4UHHA

Structural studies of a thermophilic esterase from thermogutta terrifontis (cacodylate complex)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
273
structure length
273
Chain Sequence
AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
molecule tags Hydrolase
total genus 107
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhhA00
4X6YA 3WA7A 2QZPA 2C4HA 3VVMA 1TAHA 1QFMA 4CCYB 3K9BA 3ILSA 3A70A 2ZYSA 3EIOA 3FLEA 3HLKA 5ALZA 3WK4A 3V1KA 1GKKA 5CTAA 2Z8ZA 3DCNA 3BDVA 4BYMA 3R3WA 1E3QA 1QE3A 5K3CA 2ES4A 5LZ7A 2XQGA 1VLQA 4AO8A 3MUOA 2HRQA 2XQFA 5FPQA 3D0KA 5C8XA 2DCMA 2H1IA 4MYDA 3I2IA 5DNUA 5DNWA 5JZSA 1QO9A 3BXPA 2WJ4A 4OB8A 4JYPA 2O2GA 4DMKA 3I2JA 4DMFA 1AMNA 2PL5A 2D5LA 5JD6A 2WQZA 4UHFA 4AN1A 1VA4A 5A71A 5E4TA 4BRSA 5E4YA 1L7AA 1CUVA 1XZMA 3WK8A 3DDUA 2XUAA 4QA9A 2I3ZA 3F98A 3FOBA 1QGED 3G7NA 4C6HA 3OURA 3H18A 2WHPA 3E1GA 5JD4A 3WZLA 3PDCA 4BRZA 2PM8A 4FTWA 3S2ZA 1R88A 4UFPA 1EDEA 2VAVA 3PICA 5EIAA 2YH2A 4CCYA 1XZGA 3P2MA 1TCAA 5ALPA 3EQ8A 1XZFA 1XZAA 2CJPA 5ALMA 4K6HA 1GGVA 1QLWA 1QIEA 4X7BA 1THGA 3FVRA 1QIHA 4X91A 4MWSA 1EINA 4QZVA 3ANTA 5AKIA 3H1AA 3QPCA 5SYNA 1QIJA 3O4JA 4A5SA 5JALA 3HYSA 5HQ3A 1OILA 3HZOA 3L1IA 4BAZA 1CRLA 5C81A 2B4KA 3G0IA 1R9NA 4EY4A 1UWCA 1N8SA 3PF9A 1EXWA 1YB6A 3A2NA 2E3JA 4BAGA 3GZJA 1ZD4A 5T4HA 2JIDA 4OYLA 1XQVA 2OLEA 2BGNA 4PNZA 3W05A 1HL7A 2HDWA 1P0QA 1YA8A 1P0PA 3N2ZB 5CBKA 3H1BA 5ISMA 1K4YA 2CMFA 5AICA 2GBCA 3WIBA 5KWJA 2XB6A 3FNBA 1JU3A 1CUGA 4OD0A 4AO7A 4BVKA 4C4XA 2XUDA 1ODCA 4MQLA 2Y6UA 4C4ZA 3JWEA 3C5WP 4RE6A 4HAIA 2JGFA 4CI9A 1XRPA 3ICVA 2PSDA 4KAAA 3FSGD 3K2IA 5T4BA 5A6VA 5EI5A 2PU7A 1PV1A 2HA5A 1AURA 3BE8A 3KXPA 4MJ3A 2JEZA 2H7XA 2XQKA 2PUHA 5CXUA 1XQWA 3HI4A 2DHCA 4Y2PA 1BS9A 3O95A 2HA7A 5J3JA 3C6XA 4XIIA 3KWJA 3A2MA 2WU3A 4E46A 5FXMA 3S8YA 1VE6A 1VE7A 3AFIA 2XUJA 4PSCA 2X8BA 4HVTA 2OQIA 4Q82A 2ZJ6A 4EBBA 1CIJA 2QVBA 4K2AA 2XUFA 1XRLA 3D4LA 1TCBA 3VXKA 2WG1A 3QBJA 4EB0A 2XUHA 1CUJA 1CUSA 3M83A 5AOAA 4W9RA 2PVSA 2XQIA 5T4FA 2PSHA 4PW0A 5LKAA 4DMHA 3GELA 2AJLI 5FKJA 1XZCA 4G4JA 3GFFA 4E14A 3WZMA 3GA7A 4CG2A 2WFLB 1VA5A 1UK6A 5EGNA 1BU8A 4GI1A 4N5HX 4HXEB 2WIFA 5C7YA 2GYWA 4KJXA 4BCDA 4AO6A 4KAJA 1XZKA 3DS8A 4Q3KA 3HXKA 3DNMA 2V97A 4ETWA 1KU6A 3C6ZA 1HQDA 4INZA 5YASA 3B3QA 3AZQA 5CW2A 5FPPA 2JGJA 3V1NA 4LHEA 3IULA 2XDWA 3D2AA 1ETHA 1CV2A 5K3DA 1EVEA 2OGTA 3WA6A 3G0DA 2XMRA 1W4LA 1VXOA 3R41A 4FBMA 5JZ9A 4H0CA 1ZD2P 2C58A 3FWHA 1JJIA 2DHEA 5AO9A 3R3YA 5KBYA 4HRYA 1LGYA 4PO3X 4KACA 2HA4A 1AX9A 3DYVA 4BCBA 4BE4A 1MPXA 2XMGA 3VKFA 3L1JA 1AKNA 5ALKA 1GXSA 3EQ9A 2XT0A 4G8BA 4X93A 4TVKA 4LIPD 1GPNA 2ROQA 3HRHA 1ZGCA 3F9CA 2CUTA 5AM1A 5EHXA 2HA0A 2XUGA 4KYVA 1EH5A 1EI9A 2WFLA 2OXEA 4N8SA 4W63A 1VXRA 3UUFA 2OCGA 2WLSA 2QOEA 1JMKC 1MN6A 4F60A 4QDZA 4HTAA 1G66A 4L0CA 4B81A 5FV4A 2XUPA 3VJKA 3FCYA 2DQYA 2OCLA 3AZOA 3STUA 1MX5A 1LZKA 3H2JA 1ISPA 3QMWA 5AK4A 4X90A 3YASA 3LCRA 4GWLA 3VVLA 3G9XA 1BE0A 4Y7DA 1P0IA 5AOBA 1EX9A 1W76A 4MXDA 4XX1A 4E15A 2JGIA 1AQLA 1W6RA 1R4ZA 2CBGA 1UXOA 1THTA 2O2IA 1HDEA 5AIBA 5AKKA 3DJYA 4W1QA 1BRTA 4L72A 5HZGA 3WL6A 4EY7A 4P92A 3ZWQA 4XVCA 3G9ZA 5AIAA 4OB7A 1WPRA 2XMDA 1HLGA 1GZ7A 3PUIA 2QXTA 5ALNA 1USWA 1QO7A 3ESAA 2OAEA 1B41A 4MYSA 1UKBA 3WIOA 3F67A 2JGKA 5ESRA 1EK2A 5AM4A 4EY5A 2FX5A 4H7FA 3QH4A 3FCXA 5AM3A 3C43A 1BCRA 5A7HA 4KEAA 4I19A 1IZ7A 4HRXA 4GHWA 4ZXFA 2WM2A 5AM2A 3GBSA 3A2LA 3X3HA 3WKAA 2JGMA 1QONA 1YSCA 1SOMA 1Q0ZA 4Z49A 2XMQA 3WWCA 3IUMA 2RI6A 3QYJA 4WFKA 3CCBA 3H2IA 1CUAA 1JJBA 3D5EA 2PX6A 1XROA 5JARA 1NU8A 2AJDA 5JYCA 1YS2X 5ALTA 4BZZA 2OCKA 4B0PA 4X00A 2B61A 5EFZA 4DNQA 3C8DA 5JANA 3WJ2A 1H2YA 1QIIA 3DQZA 2OCIA 4UBKA 4EY8A 4NVRA 3HC7A 4OUKX 4C89A 3MGAA 1A8SA 2X5XA 1XLWA 1ZI8A 4GEGA 4LXHA 3BIXA 1FFAA 4G5XA 3R3ZA 5DYWA 2FUKA 2QUAA 4UPDA 4BDTA 1QIDA 2XQJA 4FWBA 1JMYA 3FYUC 1M33A 1DWOA 3ZI7A 4KRXA 4H7DA 1O6FA 3V9AA 4OCZA 1E8NA 3IVMA 1ZIYA 1MT3A 5HQ3B 4AB1A 1R3DA 3I2GA 1XRRA 2VJAA 5ALXA 3ANSA 4QNNA 1PFQA 1UOQA 5DNVA 4FFWA 5BV7A 3R3XA 2CZQA 3CCCA 4IO0A 1A8UA 1ZICA 5KWIA 2IIVA 4OU5A 1ZI9A 3M81A 4UHEA 1X70A 3WKDA 3QITA 4B80A 1S8OA 3L1HA 4AMZA 1CUBA 2WHRA 1Y7HA 3OTQA 5ALUA 3WL5A 4CCWA 2HA2A 4QDTA 2HRRA 1DT5A 1XRMA 1DQYA 5ALSA 3FYUB 5HF8A 3C6BA 1E8MA 1F6WA 3PE6A 4B7ZA 1XZIA 2QS9A 1Z68A 4BB0A 4KRYA 3RKSA 5HKAA 5LZ2A 3DKRA 1F0NA 3EBLA 3Q8WA 1K63A 1YAJA 3W04A 4K6KA 1CUHA 4U2FA 1LPAB 3C70A 1FFDA 3STXA 2VT7A 5AKZA 3FYTA 5ALQA 4YX9A 1J2EA 4X92A 2JF0A 2P8SA 1T2NA 2Y2UA 1G42A 2G5PA 3WL7A 3R40A 2W22A 1KU0A 3I1YA 2QTBA 4YASA 1CFJA 5ALIA 4F0JA 3NWOA 3D7RA 3N0TA 1LPPA 2V98A 4Y2VA 4ZV9A 3DL7A 2PU5A 1XKLA 2QKYA 4RPCA 4LXGA 3V1LA 1UKCA 3DLTA 1CQWA 2RHTA 5ALGA 1QTIA 1DX6A 4MEAA 4ROTA 2O2HA 4B0OA 4UHDA 5LP1A 4Y9SA 2DSNA 4WDQA 4BVJA 5BWCA 2VATA 4Y2UA 1ZD3A 4J0KA 5AKLA 5H3HA 1OCEA 2GYVA 3WL8A 4C88A 1ORVA 3NGMA 3BIWA 2C5GA 1A88A 3QMMA 3C45A 4G9EA 3O4GA 4C01A 2RGUA 1J1IA 2IITA 3HEAA 3FYUA 4J0IA 1XQXA 2K2QB 1CUUA 2AJ8A 2I3DA 5CH8A 5ALRA 5ALVA 1BEZA 4X94A 1CUZA 1WOMA 3NUZA 1DWPA 1CUDA 2VJBA 3G0GA 2HFJA 3WLAA 2B9VA 2ZYIA 1FFCA 3EQ7A 3QPDA 4E11A 2VJDA 4U2DA 4QDXA 3E4DA 3FAKA 5K5EA 1J06A 4K6GA 2NW6A 5DTIA 3DOIA 3H0CA 5T4EA 3UMJA 3U1TA 2Z3ZA 4ZREA 5JZBA 1A8QA 4B83A 3QM1A 3ED1A 2I78A 4ARBA 2W6CX 4X97A 3KOOA 1L7QA 3CN7A 4RGYA 5K3AA 2EDAA 4OB6A 5ALLA 3O9MA 3W2TA 4HS9A 2JBWA 1H2XA 7YASA 2JEYA 3O4IA 5AK6A 4B9AA 5AKJA 3IDAA 2RHWA 1AGYA 3JYHA 4QLAA 1IVYA 5AKHA 1YAHA 3OM8A 1BCSA 1EDDA 1AC5A 4FNGA 4U2BA 4K5QA 4I3FA 5JASA 1CUCA 3MUNA 3WWPA 4OSEA 1TRHA 3NOXA 1EDBA 3F96A 4G4GA 3I6MA 2QJWA 5AH0A 5FUMA 2BCEA 4GDMA 1UOOA 2BKLA 4JEIA 3ZLUA 2RAUA 5AI8A 2PBLA 5DLPA 6YASA 2C0QA 4UHCA 5CT6A 5JD5A 2AJCA 3H17A 3I1IA 4N5IX 2G5TA 1ZD5A 5LLSA 2CKMA 4JUIA 3BDIA 4CG3A 1ACJA 2Y1KA 2HL6A 1EB9A 1QZ3A 3IUQA 2Z3WA 4G1FA 1GQRA 5DYYA 3VJMA 4PQEA 3O4HA 1MX9A 4WJLA 5AKXA 1AUOA 1AZWA 3B12A 3BJMA 2WJ3A 4Y2TA 3STVA 3BWXA 4LYEA 2OPHA 1XQYA 5A62A 1EVQA 1H23A 2OAGA 5FLKA 4A16A 5E2IA 1C7IA 2WILA 1XZJA 4M0FA 5LZ5A 2QR5A 3G8YA 1UKAA 2DHDA 3WKEA 5IH7A 3DD5A 4FBLA 5AK3A 2YYSA 3VDXA 3G9TA 3WWOA 5D6OA 4WCVA 1ZJ5A 2OGZA 2WTMA 3D3NA 3LS2A 3AINA 3AJAA 2ZJFA 1N1MA 1CVLA 4BP9A 1X2BA 4IH9A 3FLBA 3H2HA 2BJHA 3WWEA 4C4YA 5FOQA 2HM7A 2GBGA 4CG1A 1CEXA 5AP9A 3WK5A 1OXMA 4O08A 3KDAA 5JATA 3LIIA 5EIEA 5AI0A 1ODSA 1LPOA 1H2ZA 2ONCA 5AI9A 2G63A 4BTVA 5JADA 4LKOA 4JYMA 4IH4A 4Y2SA 4DNFA 4FNMA 4UUQA 2ZSIA 4PSUA 3AIKA 4FMPA 2V9ZA 4I4CA 3LP5A 4G4IA 1JFRA 1W1IA 5HF5A 3ESBA 5D3KA 4Y2QA 4BC1A 2LIPA 2XMSA 4FKBA 1GPKA 5AOCA 1XZDA 2H7CA 2QJRA 1XKTA 1YA4A 3IA2A 4UBLA 4U2CA 4JNCA 4UBOA 4AZ3A 3ZV7A 1ZJ4A 4FLEA 2VSQA 3ZLVA 1YS1X 5HFNA 1ACLA 2WIGA 1RP1A 1LPBB 5FP0A 4RNCA 1GKLA 1MTZA 2VTVA 3BF8A 1WM1A 3D2BA 4DNPA 5AHXA 4PSDA 2WU4A 4FLMA 3HACA 1JJFA 4N8DA 2XUIA 3OPMA 5CURA 2XUKA 4DNOA 1TKRA 2PSFA 1XZEA 4ARAA 3IUNA 1L7RA 3WMRA 5I8PA 2WIJA 2Z8XA 3PI6A 5D3ZA 4BE9A 2ZYHA 4HXFB 4ITVA 5DTJA 4X3CA 3D2CA 1CPYA 5HK8A 2HA6A 4L9AA 2WJ6A 4CFSA 1VKHA 1RWQA 3FBWA 3TRDA 5ALEA 1YB7A 1YASA 1LNSA 1UK8A 3KD2A 4H7IA 5HCUA 4H7HA 5F4ZA 2AJBA 3V48A 2BAGA 3OC0A 4UBMA 1UK7A 3H04A 4Y2JA 3AUKA 4DLNA 1XLVA 1B6GA 1DX4A 5LZ4A 3TJMA 1EA5A 3AIOA 3W9BA 4KE8A 2XMBA 3VISA 3RARA 2HA3A 3O0DA 4EY6A 3DKKA 1U8EA 3QVMA 3ESCA 1XFDA 4ZWNA 4EHBA 5AKYA 2V96A 4KE6A 1N5RA 4XJVA 1GPLA 2EEPA 4XWGA 2ZSHA 2VJCA 1Y7IA 4J0DA 3W06A 3WK6A 4B84A 1F8UA 3OOSA 5LZ8A 4J0CA 3WJ1A 3JW8A 4DM7A 5ALFA 1BROA 1UOPA 4YK7A 2PSEA 4WFIA 2HADA 2RIPA 4QE3A 1GQSA 1XRQA 2QM0A 1WHSA 5C8ZA 4NS4A 1G5FA 2O7RA 1VJ5A 2D0DA 3C8HA 2IX9A 4IH1A 4FOLA 1BN7A 3SC2A 5C8VA 1ODTC 4H18A 1TIBA 1Q83A 3ZPXA 4BVLA 3E3AA 1QFSA 5EHZA 1ZIXA 3WYNA 1Q84A 1R50A 4G8CA 2VQ6A 1PJAA 3A6ZA 1LPSA 3ESDA 3I2HA 3IUJA 3I2FA 4AQDA 1WCYA 1W52X 4L3WA 4JH0A 1IUNA 4AZ0A 2QT9A 4U2GA 1EK1A 3TEJA 4H7EA 1QJ4A 1WB6A 3H2KA 1K8QA 1XZBA 1I6WA 1HKHA 2PSJA 3IIIA 1VZ2A 4G8DA 2B20A 4J03A 4DYHA 5K3BA 4W1SA 5K3FB 5AKGA 1TQHA 4H77A 1EB8A 2DQZA 2R11A 2XE4A 3IB3A 1MAAA 5HK9A 5AM0A 3SWWA 3WYDA 4LXIA 2ECFA 4C87A 2WUFA 3RM3A 1LPMA 4RE5A 2C0PA 1VZ3A 1E66A 2GZSA 4CIBA 3G0CA 5A7GA 4OPMA 3DOHA 1CUEA 5AI5A 4WDRA 5LZ9A 5I9IA 2ZJ7A 4Q1VA 3WQHA 4V2IA 1CLEA 2QXUA 2G4LA 1CQZA 2OG1A 3DL4A 4GBGA 5CRIA 1TCCA 4OU4A 1DT3A 1ZOIA 3WKCA 4GW3A 4AN0A 4G9GA 2ACKA 3WK9A 5EHNA 2RONA 5CT9A 5LKRA 2ORYA 3R3VA 3PFCA 4B6GA 5DJ5A 5HF6A 4KE7A 4Q3LA 2J3DA 2JGEA 2WSLA 3RLIA 5IKXA 3R3UA 5AI4A 2WUDA 1ZI6A 3F8SA 5AM5A 1W75A 3WKBA 1P0MA 2WUEA 4B82A 1CUIA 1G4HA 4DSAA 1XRNA 3M82A 2WUGA 1IMJA 2Q0XA 1R9MA 2BFNA 4IQ4A 2WHQA 1T4MA 1JU4A 1WB4A 2O7VA 1H22A 2VF2A 3OG9A 1UZAA 1YR2A 2ACEA 3H19A 1CUFA 2FJ0A 4Y2RA 5ALWA 5K3FA 4ZI5A 2FJPA 1QIKA 3T52A 4U2EA 3GROA 2DR0A 4QWMA 4F5ZA 5CT5A 4AXBA 1TK3A 5IVHA 4X95A 1D07A 2XI4A 2DFPA 5ALOA 4B9EA 1HBJA 4M0EA 1WPXA 2HU8A 3I2KA 3LIPA 3TGLA 5A7FA 5A2GA 1N5MA 3H2GA 2PUJA 3STWA 4BTLA 3KSRA 2BUCA 3WI7A 2HU7A 3RK4A 3F97A 3K6KA 3STTA 2XLCA 2HIHA 3W9UA 4W1RA 4BP8A 1UT6A 1U4NA 2PKYX 4TGLA 4BZWA 4H7KA 4PV7A 1MNQA 1ORWA 2GZRA 3V1MA 1E89A 4NZZA 4S0XA 4DGQA 1F0PA 4KR0A 1DTEA 4B85A 4DIUA 2QMQA 2BUBA 1MJ5A 5JAHA 5E4JA 4J3JA 4QLOA 1E5TA 1MX1A 3HJUA 3STYA 3BL8A 3FSGA 3UUEA 1WHTA 1E8DA 1U2EA 4D9JA 1SCKA 1H2WA 3SK0A 3G9UA 2OGSA 3WWDA 2QUBA 2HU5A 2XMCA 4QWWA 5FRDA 4Y2XA 5JIBA 1SC9A 5HKBA 3U0VA 5ALDA 1BN6A 4LYDA 4GXNA 1DU4A 4Q05A 4QDUA 3I6ZA 4A23A 1IUPA 4UBNA 3ICWA 1JT2A 4WY5A 3DEAA 5ALHA 4X85A 1XLUA 1RYYA 3QMVA 1SCQA 2YASA 3MVEA 2WFMA 4EA6A 3Q0TA 2JGLA 1SCIA 4J0JA 2UZ0A 3IBTA 3C87A 5JAOA 1QIMA 1DWQA 1Y37A 2C7BA 1DQZA 2PPLA 3QZUA 1CUYA 2VEOA 3HABA 1IZ8A 5AJHA 1A7UA 5DWDA 1IUOA 4AX4A 4UHHA 1QIFA 2ZVDA 3AZPA 4EZIA 1JI3A 5AKEA 5JAUA 2QRUA 4M0MA 3DYIA 4Q3OA 1VOTA 3M3DA 4BDSA 5BOVA 3CN9A 2CB9A 4BCCA 3I6YA 4P08A 1QOZA 2VAXA 1JKMA 1J07A 3EF3A 1WB5A 1U65A 4BAUA 4TPKA 1NX9A 4H35A 4IHAA 5I7UA 4WY8A 4GLBA 2GYUA 4N8EA 4BC0A 1XZLA 1O6GA 2WKWA 4UFOA 5IVDA 4MQMA 2WTNA 1R1DA 5ALYA 5CT8A 1MO2A 4UFNA 1FFBA 4FDMA 3VJLA 2VT6A 2Z5GA 1QIGA 4DSZA 4J0GA 1MU0A 3WK7A 5FDFA 2AXEA 2J4CA 4GECA 4ZV7A 3FVTA 5DYTA 5D7BA 5LYYA 1MNAA 4Y2YA 1BEEA 2Y6VA 2GBFA 4J0HA 1KEZA 4P93A 3HSSA 1CR6A 4ZRDA 4QDOA 2HHAA 2Y2VA 1FSSA 4QEKA 1MAHA 3R0VA 4OYYA 4YPVA 3AILA 2ZYRA 2H7YA 1Q0RA 2WFZA 5HF9A 4EUSA 1UK9A 4X6UA 4BATA 2GBIA 4KAFA 2R8BA 5SYMA 5IVIA 1SFRA 2EDCA 3E0XA 2X76A 3SX4A 3CXUA 1FJ2A 2XMZA 4HZGA 3BJRA 1NU6A 2XLBA 4MWTA 1LBSA 5CH5A 1YCDA 3ZLTA 3BF7A 2VA9A 3C6YA 3KWFA 4F21A 4CIAA 4KE9A 3D59A 2C5FA 1UFOA 2BGRA 3FLAA 5CMLA 3I28A 1QTRA 4X71A 3IURA 5LIPA 4UHBA 4FLFA 3C5VA 3PUHA 5IVKA 2BUAA 3PFBA 5K3EA 1LLFA 4Q34A 4W1PA 1DINA 5HFAA 1FFEA 1CUWA 3B5EA 3GUUA 3G0BA 4AMYA 3PF8A 1LZLA 5AI6A 5ALJA 4FFVA 5CH3A 5KREA 4J7AA 4DTCA 1LPNA 2XUOA 4H7JA 4UBJA 4DMCA 2I03A 2J4FA 4MEBA 5EIHA 3LLCA 4PF1A 2WIKA 5EHQA 5CXXA 5CT4A 1K5PA 3O9VA 2XUQA 4ZGBA 3QPAA 1GT6A 1C4XA 4UBIA 1ZGBA 3T4UA 2YXPX 3AIMA 4NMWA 1K6EA 1LBTA 1EHYA 2OQVA 1HPLA 2CEKA 2HFKA 4P9NA 4X6XA 4BBZA 2J3QA 4HXGA 2WG0A 2H9YA 4FHZA 1XZHA 1CUXA 4WFJA 2WG2A 2WIDA 5BWBA 2WHPB 3G02A 5AK5A 1X2EA 1C7JA 5JAPA
chains in the Genus database with same CATH superfamily
3RU9A 1MC5A 3LPNA 3ENNA 3TXXA 2B30A 4WNIA 4N47A 2C4HA 4MCJA 3DDSA 3PDWA 1JR4A 3DOEA 2ZT6A 3TN7A 2XOXA 2HCJB 1NMYA 4ZC1A 1N32B 5IDVA 5IW8A 4A73A 1KEEB 1D5WA 1RWNA 3ILSA 4JYCA 4DM3A 2GXUA 4NL4H 4DY4A 1TFRA 4RTPA 4HX9A 5GMOA 3B1VA 2G25A 3HLKA 2KPOA 3NM5A 4HEA1 2GLXA 4KXFB 1L5HA 3U4HA 3W3AD 4AF6A 3TB4A 1YFJA 1GKKA 1H05A 1PQUA 2YRXA 2Z8ZA 1PGNA 3O1IC 4QUIA 5D3MB 1QH8A 1WMDA 1V3TA 3LQRA 4WI1A 2O8BA 2GTIA 3QVSA 5FJJA 2YMQA 2ES4A 2YBEA 2I1WA 5EJMA 1USVA 2QRGA 1B73A 1EX6A 2XQGA 4OEHA 4OAQA 1VBKA 4TZTA 3K32A 1SCAA 2H3HA 4RHFA 1FE8A 1KJQA 3MT7A 1Y0BA 5B3LA 1Q21A 4K28A 3T0FA 2IE0A 2DCMA 2MCFA 1WVMA 4CLEA 2DFTA 4RIHA 1DLIA 4IUYA 4MYDA 1UZNA 4PLPA 4NR0A 3T5DA 1WABA 5F5XA 3ZBTA 3IKTA 3N87A 3I37X 3HBLA 3OC6A 1Z5PA 3A05A 1VHJA 4XD2A 2RGWA 1XCMA 5DNUA 4R9RA 2NU7A 4OB8A 3CR8A 1ZH2A 1K8YB 4DB4A 4MGEA 1MOSA 4H31A 4NCNA 3K1TA 4QAJA 4R1LA 3U1BA 5K2OA 1BXRB 1WV0A 2W00A 3L05A 4ZARA 3ONNA 3JALB 3SY8A 1TQ2A 1ZUHA 3I2JA 1QLHA 4MVXA 2ISCA 5BW6B 4DMFA 4G1CA 4IZOA 4EHAA 3KOUA 4YVFA 2NVOA 4BO8A 5JVDF 5JD6A 1OH8A 3TEMA 3ULKA 4AN1A 1G3RA 4GBJA 3GJ3A 1P8JA 4ZO6A 1F4LA 5HFJA 4BMXA 2Y0PA 3I6QA 1U3DA 5E4TA 3RYHB 2FPUA 3RU2A 1XX6A 1NOIA 4TSKA 1XL0A 3B51X 3QPUA 2OV6A 3AEKA 4HEJA 4O4JA 4AK9A 3KHSA 3V2UA 4LDQA 5K0SA 1HRDA 1YRYE 2P9QA 2ZWPA 3B70A 2IZ7A 1QLJA 4QUAA 1DEHA 5DP1A 1PU2A 2QTRA 3UW3A 4DIKA 3T3HA 2UYYA 1DJPA 1Z34A 3JQ6A 3VC3A 1TXGA 3DZHA 3CB4A 3S2YA 4HYEA 4QA9A 4BO7A 1JTEA 2EX4A 2GVZC 2FW6A 3TQOA 1BXGA 4BRUA 1Z37A 3DKVA 3AR6A 4HN2A 4HAYA 1C50A 4FGWA 2VK1A 3BA1A 4XFJA 3ZWCA 1AGXA 1Z56C 2GPYA 3PTLA 5I7HA 5BSGA 2PUDA 1D4ZA 1ODIA 4PC3A 3SC3A 2D0IA 3LRPA 4L8LA 1RAGA 2W6OA 3D7KA 4YT2A 1A9PA 3S2ZA 4CF7A 1R88A 4OQPA 5AJTA 3T1OA 4HY3A 3GCDA 1EDEA 3PICA 2Y71A 2KSQA 3A04A 2Z83A 3GJTA 4P35A 4KTVE 3PQCA 3VNSA 2JEOA 2Q3BA 2A5JA 3VAYA 4CCYA 3VO9A 1X86B 2FUEA 4QTUB 4RJIA 2FLKA 2Z6UA 1JNXX 2VC2B 4B6PA 2A4KA 1GWNA 2EF0A 2X0JA 3HB7A 3K4PA 1YQWA 2QNRA 3P2MA 3KVOA 3P5SA 1X7HA 1PAUA 1KKMA 4R1MA 2N75A 4RPJA 1ULZA 1DJOA 2VHCA 4OSPA 1KE1A 3U17A 4MPTA 1XZFA 1XZAA 1OJ7A 3F7MA 4C4AA 1WXXA 1N5JA 4HGZA 5HS6A 3S0JA 3VPAA 3QVJA 3FZEA 4K6HA 3V2HA 4Q4DA 3WLHA 2VF7A 3OECA 4XM1A 1Y3FE 2O57A 2R85A 2R4UA 1FPMA 3QE3A 4KQXA 8LDHA 1AXRA 2FZ4A 2IBMA 5JQGB 2I2BA 3IS3A 4L85A 3PR1A 4WZBB 3UBTA 4IDAA 1UMBA 3AR2A 4S24A 4MW7A 5EJ9A 3J7AC 2P9YA 1EINA 4MWSA 4Q4CA 5AHKA 2H5EA 2Z8YA 5AKIA 5KNCD 1JIIA 4BLPA 4BZXA 3QPCA 3TUZC 4R2IA 2BMDA 1V5EA 4E3ZA 1C0IA 4XCVA 1K3UB 1SU7A 1UBOS 3IVGA 3QK7A 3OFKA 1OJLA 1ECFA 1QIJA 4KN8A 4HSEA 4DUPA 1E6LA 3CB2A 4B5LA 3GFVA 1F1JA 1P1HA 4KUEA 4JK3A 2ZUFA 5K2MA 4I99A 2DFDA 4FPXA 3QKRB 1Q1NA 2R00C 2O2DA 3CX8A 3QIVA 3C3KA 3NHZA 3OD5A 4X45A 5C81A 4CM4A 1TO2E 4OJKA 4QYMA 4CHGA 2B4KA 3GRFA 4PXYA 4CNQA 1OWMA 4QBFA 1VGQA 2ZB8A 2YZ2A 3GMIA 2R1UA 3L82B 4H27A 3AUTA 4ZAZA 1X1CA 3NYRA 3FTDA 4C0AC 1EXWA 3LT0A 1KSFX 1VL6A 1YB6A 2F3RA 4PR0A 1XB2A 1C30B 1Z0FA 2WWRA 3DZDA 1CZKA 1XVAA 2IC5A 2D2VA 4MUAA 4OHPA 2C2OA 2W42A 2NAPA 2YOGA 2VYCA 5A6SB 2NUBA 3L43A 4IFTA 1P1KA 1N2JA 3S7ZA 4TKVA 2FOXA 4WKNA 2I33A 3ISJA 2PS3A 2X1LA 4MKXA 3UYKA 2CHUA 4CI0B 4D4LA 1NJ6A 1P0QA 1YA8A 2CHEA 2V7EA 2WD9A 3M9LA 4M53A 2VUTA 4RY9A 4C0QC 4F86A 4FHFA 2QIPA 3KCNA 4XGIA 4A0RA 4DR5B 4ZOQI 3U16A 4IFIA 4BIIA 1HT1E 1BA2A 2YMMA 1KOFA 3MOIA 2C2XA 4JI3B 2W98A 1H0KA 3LCJA 5JDCC 1UCFA 5JEEA 2X5NA 3BWYA 2PFSA 4QM6A 4JASB 3IH5A 1S6YA 1Z06A 2CLDX 3JVIA 5ILQA 3WX0A 5F33A 5DGCA 2CLOB 4AO7A 2Y67A 5A4DA 1W4AA 2YWRA 3SPXA 2IOHA 4DDUA 3KK0A 3TDNA 1W9HA 5AXDA 4MQLA 3EARA 3LX8A 3T95A 2QQFA 1C8VB 3HCEA 4IMJB 1XMIA 4OIFA 4ZI2A 2AQHA 2B98A 2YWEA 1GSAA 4PZZA 4RXTA 4XJTA 3UG7A 2JGFA 1CZLA 2HNBA 3ZYCA 4HBZA 1H2EA 2WP0A 3GAZA 3CR7A 3CZCA 1BXZA 1I5EA 3KE9A 3L49A 4C0XA 5K9ZA 5KDOA 3DFFA 5A6VA 2WLTA 3OKPA 1ZGZA 3A25A 4BFYA 5EI5A 2WU8A 5EXXA 4DCSA 1T0UA 4M3NA 1PV1A 2FSIA 2ZB3A 3D7LA 2HA5A 1AURA 3DL0A 4RMHA 3WAKA 3AUUA 2UAGA 4MJ3A 5DT2A 1NJ8A 1NVBA 3N6RA 4ZOLA 4FFSA 1K9VF 2H7XA 1F8YA 1ANKA 1NDUA 3R1IA 4LJ8A 4RQBA 4V0QA 4TYPA 5IBRA 5CXUA 5KYWB 2DHCA 4AJOA 4BECA 3HGQA 4JSTA 3RVMA 4YLYA 4LRSB 4ENRA 3HO6A 3EVBA 4V0MA 3NGXA 1TYZA 3C6XA 3L7YA 4NK4A 4XIIA 1KDYA 5E3HA 3LHDA 2IH5A 2WVHA 1J8MF 2W5UA 2WU3A 3Q72A 2VHTA 3P0RA 5JCPA 3HA5A 3JV7A 4MQBA 1OLXA 2BT4A 3RRJA 5HZHA 5JT1A 1Y98A 1I9CA 4CEIA 1Q1QA 3FCEA 1M2KA 1WKVA 2GD2A 2ZDQA 1YQUA 2YWHA 3IPLA 2W6QA 3DB2A 1MQ9A 4O3FA 3AFIA 3NKVA 4TUYF 2AQKA 4C3OB 2ZCJA 3KJQA 4ZHQF 1GLNA 2QE7D 3UKJA 1ZHOA 1HH4A 4I55B 1CEEA 1ZCZA 1G8PA 4LZWA 3HJFA 1NTOA 3FZGA 1K92A 4YJKA 1R12A 4J75A 2W70A 2ALJA 4Q82A 2QBYB 4C0LA 3T1YB 1H1LA 2O0HA 3VYSB 4WNAB 4EBBA 2QJTA 3D6MA 4AU1A 2JJ8A 4FEYA 3JQDA 4HP8A 1J0CA 2XDQB 4KZPA 1SK8A 3E8XA 4LOHA 4QOEA 4W82A 3LZCA 4K2AA 5JI3E 2VYVA 2AFIB 2GFHA 2UYGA 2XDAA 3LDHA 2PE5A 3U60B 3F78A 3UXMA 1OC4A 4TS3A 2G28A 1DAHA 4KQ2A 1LSOA 3FE2A 2BSQA 3B2NA 5T4FA 1B8OA 4W9RA 1MKYA 4GEKA 4IVQA 4R3NA 3KLBA 4DN6A 1XP5A 2ZIWB 3OHPA 2BZSA 3NX4A 5F9MA 5EJ7A 1LCIA 4UE2A 3JYQA 1VE5A 3MT9A 3OM0A 1Q95A 1XGKA 2AJLI 2VDPB 4UNSA 2IYRA 4Q4JA 5CDFE 1XMSA 4UOQA 5A02A 3GF4A 4PZ9A 3PHLA 3FG9A 2IXEA 4KK4A 1B1CA 2J9ZB 4P83A 1Z22A 4PNPA 1Y8QB 2QE7A 1SQSA 3GA7A 5LOVA 1W30A 2GSDA 3USCS 2C2GA 2WFLB 3EH2A 2ZM6B 4A15A 4FR5A 4XDYA 1YF3A 2FSPA 5WRFA 3USES 3KQYA 3C1TA 3SKYA 5JH7A 3MRVA 2VRBA 2H8GA 4WKBA 3VHXB 1AM4D 4N5HX 4YMTA 3ZZ0A 2GDZA 2WYWA 4R9SA 1TJPB 1XCOA 3FZYA 4AO6A 3QVTA 4XPZA 4BFXA 1XZKA 2ZJ2A 3RRBA 4MWZA 2H54A 1D6NA 3FGNA 3LPMA 4HZIA 3M8KA 4YQZA 4RO0A 4E2WA 1NV9A 4LQCA 1DPGA 1PWHA 2CMGA 1ORTA 5DHSA 4TL6A 4CUJA 2WTUA 4XIFA 3ZJUA 1NQWA 4MKGA 4ZKEA 4TL7A 3ND9A 1P9RA 1L5RA 1Z25A 2WMYA 1T9GS 3HKDB 1I8TA 4P7BA 3ISTA 2C4MA 1SQ0A 2Z0MA 5DHPA 3RS3A 3PPXA 2PX4A 4YRTA 4BGUA 1NE2A 3B3QA 2DM6A 3GLVA 3JQ8B 1UZUA 4ZCMA 2BRUA 2RGYA 2ZSBA 3CLTD 3CUTA 3FFBA 3IFSA 5CW2A 2SBTA 4MUMA 4CDGA 4D97A 1V5GA 3T7JA 4ZODA 4PAMA 4RVFA 1ABEA 4EGQA 3E3LA 1JEEA 2BKAA 1E32A 2J6IA 4KX5A 4WUTA 4Z99A 5J2TB 2IBSA 1YKGA 1V37A 1E0AA 1QHIA 1NUAA 1MC4A 2AOTA 2EFCB 3MWEA 3O8DA 4YIKA 3RRNA 2HKIA 5K3DA 2D5CA 2N1BA 1SOVA 2Q5IA 1E3MA 1TJNA 1E9FA 2VTKA 1FNCA 4DEVA 4M54A 2XCRB 5HMLA 1M2VB 1W85A 2VRCD 3CINA 2Z1MA 1GY8A 3G0DA 4D96A 3NC4A 3SAJA 4ENUA 2QP4A 5CBPB 2IY7A 1YCHA 4BQOA 1Q0HA 5CDSA 3UUWA 4LF9B 1E6MA 3U19A 4I4NA 2X58A 1VXOA 1PV4A 1C1DB 2X9NA 4LHWA 4ZT4A 1V5WA 1W2HA 3ONFA 5JZ9A 3I32A 4ES6A 3IUBA 3DDHA 1TMYA 3U39A 1H3EA 1GFWA 2WA1A 3AW8A 4I1IA 1NMEA 2GLTA 1XTBA 1UC8A 1ODKA 4K88A 3IEXA 4MB0A 4LJLA 1D9ZA 3R3YA 1YH3A 2O2JA 3A58B 2J6BA 3ABZA 3Q85A 4JAVC 1SR8A 2YINC 2AUMA 2PJRA 3BSFA 4KACA 5TY0A 2HA4A 3E22A 4M8NE 1TCVA 1AT1A 4QOFA 2PUAA 1CYDA 1ISIA 1M5UA 1EGAA 2QYTA 2MJLA 2VBIA 3F0TA 2YBDA 3PIDA 3W5DA 4BE4A 3DVAB 2XR1A 3O3NB 1NJ2A 2QX4A 4Y6PA 5EWJB 2AN5A 5JQWA 3VKFA 2VT2A 4E5DA 4FE7A 3JAWB 4MULA 3N8IA 3T3PB 3P5BA 5ALKA 4KL8S 1GXSA 2X8WA 3E84A 3ET4A 4W7HA 4CM5A 1JA0A 3I61A 2VRCA 1A27A 2A5LA 5BSWA 1L8OA 3EQ9A 4G8BA 4QFDA 4F5YA 1D4AA 5GIOE 3Q8LA 3P4YA 4TVKA 1KI4A 1V1RA 1HV8A 1ZDMA 1WUTA 3E9QA 3QG1A 1DOZA 3O1HB 1GUDA 4HQLA 1LKZA 3CZ5A 3BTOA 4AP5A 2ANBA 2H51A 5IJAA 4IS2A 1P1RA 3ZHYA 3M6MD 5E8JA 3MBIA 4WXMA 3I6BA 3UA3A 1XR3A 2LDBA 1K6MA 2F6RA 3CYFA 1EH5A 1E58A 3IXLA 1I2DA 4N8SA 3EZNA 3FH0A 2IOFK 3OPYI 4W63A 4A8HA 4C04A 4DLBA 1E5LA 1M8GA 1N6NA 3HKEA 4L16A 4BO1A 5BUCA 3LQFA 1G5IA 4RESA 2COUA 3SZGA 2OCGA 2UZ4A 1WG8A 1JMKC 2NV6A 2YWJA 4XLTA 4F60A 4QDZA 1USGA 4GX5A 4DF3A 4JHXA 4HN9A 1QYVA 3BD8A 3MJEA 2WJJA 3NHAA 4A8JB 2BHNA 1W35A 1EA7A 2QM8A 3AF4A 3EGEA 4DLYA 4OQ4A 2P9ZA 4WJZA 3VJKA 4CR6A 5K0LA 1QP7A 1UBLS 1XTKA 5IT9A 1N5OX 5H9VA 2Z6AA 2OCLA 3NTLA 5DYNA 5EZ6B 2EGHA 2QTMA 3IDZA 2X7JA 4C7XA 1FFYA 1GADO 3NVDA 1RQXA 2A86A 4ALJA 3NBAA 3QMWA 2R6DA 5AK4A 5FWXB 1FXWA 1OA1A 4X90A 5LLDA 1CZUA 1MAUA 1TC1A 3I5MA 4FXPA 3YASA 4QBTA 5C5DA 2PL3A 1HNWB 4O5OA 3ORYA 2X5KO 4GWLA 4WT7A 2Q0HA 2C5BA 3I9LA 3VVLA 1AS2A 3FDXA 4D8YA 3L7IA 5B58C 1P0IA 3PRYA 4JVMA 1W76A 4XYLA 2YWBA 3H9QA 5JXGA 1LWOA 4I1OA 1G8GA 1OYOA 4CXMA 1AO3A 4L4ZA 3IUSA 1LS1A 1UBNA 2MINA 1G1AA 4KWEA 3SU8A 2DXIA 2CLHB 5IWCA 1GAXA 5L7TA 4TQAA 3HXQA 1A9QA 1UXOA 2GHRA 3RIXA 1EUQA 1MX3A 1THTA 4YGXB 1Y89A 1V7QA 2NM0A 2O2IA 3VPBA 1NVTA 1XDZA 3EDRA 3W4IA 1KH1A 5KOHB 4YI5A 4ND3A 1XAIA 4LZZA 4OL0A 3V97A 1KAQA 4LX8A 3DJYA 1BKYA 3GJRA 4IDHA 3JD3A 3SF0A 4UVGA 1T0BA 1YB5A 3RO7A 1Z18A 3SYTA 4EY7A 5K0BA 3ZWQA 4XVCA 1HG0A 4HQKA 2XCIA 5DNAA 3ZIAD 5KMGA 1NVVQ 3TBFA 2TECE 1R4MA 2VNKA 1TMKA 4OLJA 5AIAA 4OB7A 4PLFA 2X2OA 2EARA 2XKKA 4WN3A 3LW7A 1JWLA 1JG7A 1NYTA 4MGKR 2DFKB 3DE4X 3UK6A 1SRQA 4I46A 5ALNA 1B23P 4MVJF 3PA8A 1USWA 1QO7A 4Q4HA 5HGXA 1OFHA 2GJAA 3VR4H 1KFBB 2O8BB 3VSEA 3FNIA 1G3QA 1G2IA 1K98A 2N3ZA 3FCSB 4MYSA 3AGPA 4J3NA 4B3CA 4CTJA 1HM5A 2PRJA 5F51A 3UXEA 4GMDA 1SHUX 1QYXA 4Z51A 2GTHA 1Z0IA 2O2YA 2R1TB 4EMBA 1OWNA 4EUHA 1HEIA 4EY5A 3CG0A 1Q17A 4ZFNA 1TT7A 1DTWA 3FCUB 1PL8A 4OHMA 4E2YA 4H7FA 1KETA 4MVJE 3INNA 3QH4A 5EIBD 4ZQCB 1MVLA 1YHZA 3FBTA 2O1SA 1KP3A 2M1ZA 3W5JA 2DPLA 3I3OA 2IYPA 3FI0A 1FNMA 4HRXA 5ELMA 4TMVA 4ZXFA 2ZRAA 3HA2A 3I8OA 1FSFA 2P2SA 4PRZA 3ZVRA 2WYIA 2WD8A 4UTVA 1AMUA 4B8WA 1H4VB 4DWOA 5FTNA 3D7MA 1E2DA 2ZJYA 1SK9A 3VJRA 1FMJA 2GR9A 4GSYA 1QONA 5BQFA 2V0NA 4BFZA 1NSYA 1U7ZA 3CIOA 1SOMA 2A7XA 3A0UA 1K7CA 3KTAB 4LJYA 4N82A 4NYMQ 4TLBA 1Q0ZA 1Y4UA 1I33A 4CJXA 1QHFA 1RT9A 3JASB 5IAKA 3RSGA 5I7EA 2BEUB 3WRXA 1FRQA 1YE5A 3QSGA 2H4FA 4DC9A 3DG9A 4KUGA 1YL6A 4IDPA 3Q7SA 3EN0A 3QYJA 3F7NA 3DAYA 4YAKA 4YRMA 2X0DA 5KYXA 5BUZA 4W5OA 3H2IA 3TCKA 2AG8A 1URPA 2IHKA 4GRIA 3CPHA 3PG5A 3ZLJA 2YJ4A 3KVYA 2OC4A 1MOPA 3D5EA 1YOBA 4KXWA 3OEHA 4Z4CA 2GEKA 4EP1A 2F62A 2QMOA 3FSJX 5HCNA 3PFHA 1VHLA 3KKPA 5B4VA 4MV8A 4RY2A 3SJ7A 1GPUA 4TV8B 2AJDA 5IKEA 2VR1A 5JYCA 3HXMA 1M6HA 2IZ6A 3KPJA 4MPJA 3VV3A 4GNRA 3WOHA 4B47A 3KKZA 2JHPA 3NB0A 3OZWA 4K9OA 5KCMA 1N7IA 5TE9A 3WBBA 3D5TA 1U2ZA 3MCVA 5BSFA 1HYEA 3O2QB 3K72B 1Z7YA 4B0PA 2YC2C 5G40A 3GLRA 4ZEXA 1R00A 3DNFA 1DP4A 1NF8A 4UUNA 4X00A 4MW1A 1R10A 5EFZA 1FDRA 1KMHB 2BFOA 2I4RA 3AKEA 1KYVA 1OFIA 5JANA 4QT4A 1OX4A 3QLUA 1T4CB 4IWXA 4JZKA 3FFTA 2VP9A 5FV7A 2F59A 2HJRA 3AH8A 4B8YA 4CODB 1QIIA 4HQRA 1KWKA 4MHSA 4MV5A 2OCIA 3AEQB 1EK5A 4EF5A 4EY8A 2BFBB 4L5JA 1H85A 1NSTA 3MGAA 3N53A 1X77A 1XLWA 4E94A 1NSFA 2X23A 1QHHA 1ZI8A 1GGEA 1KVQA 3C8ZA 1UPUA 4PU0A 1WKCA 1QRRA 3GPIA 3IESA 5CK4A 1QANA 3NDRA 5LCXA 4NX2A 1TZJA 4GG1A 4A27A 2GA8A 1RJ9A 1CF4A 2XTZA 1A8PA 2HRZA 1Z4QA 2NTVA 2ZI4A 3BXHA 1KI8A 4G5XA 2D2EA 3BMNB 5J4LA 1A3CA 2C03A 10MHA 3IOCA 3OZBA 1BHQ1 3Q7TA 5FPKA 1QQ5A 3HN6A 5C53B 2QUAA 3ENZA 3GA0A 1FK8A 3AL0C 3B9BA 1K08A 2VCEA 3IQFA 3PWZA 2B25A 4QDKA 5FOTA 1X14A 1HYBA 2QX9A 1EUDA 1RI2A 2X4GA 2XQJA 4RQAA 1JMYA 3ZOZA 3DKPA 4EG4A 2IX3A 2PBRA 1KVSA 1DWOA 1XA4A 2Q1SA 1KO8A 3IO5A 2ZSKA 1S1MA 3KVNA 4X8OA 3RVRA 3MWGA 1S3FA 5EMNA 3ZI7A 4YXWD 4TMZA 2VLIA 3CJTA 4RPHA 1SVUA 5EWLB 4RVCA 2BM8A 3GXOA 4HVAA 4PGGA 1V2HE 2ZB2A 5F2OA 4MVJG 5IHXA 2X7XA 4MZXA 3N2YA 1L7MA 1PVDA 5BVGB 5EKDA 3OPQA 4JLBA 3OQMA 4Q4AA 3W78A 2W2VA 4YV2A 4AB1A 2GI4A 2QTFA 1JR3E 3HKCB 3KEMA 5D01A 3RUEA 3O3OB 2CSXA 4BEVA 2BEKA 4UE3S 3WBJA 2DTDA 2VJAA 1IBSA 5K01A 2OO5A 1UAGA 3A3KA 4DEYA 3BFXA 4BLSA 1GPH1 4XTRA 2WM3A 1Q0SA 1OBCA 3FOEC 1P74A 4YT4A 2I5PO 1SCNE 3E9EA 3PXEA 5DNDA 1SXPA 4TVSA 2P5TB 2PGXA 2CZQA 4CM7A 4TV9B 4IO0A 5GONA 1U7TA 4CL8A 1SWVA 2ZRIA 3CSUA 4RA9B 3VKHA 3FY4A 1UEIA 1LU9A 5TQJA 4QUBA 3M81A 1X8KA 5H16A 5HUJA 3CIFA 3I4LA 4OX9Y 4YA6A 3T06B 1U2DA 1PK7A 2GETA 1NDHA 3M2PA 3L8ZA 3R5FA 1QJCA 1S8OA 2LBPA 2DQ4A 1U9IA 3L1HA 3OLCX 4M37A 4AAYA 2FKNA 2XDYA 4NU5A 5ALUA 3FR7A 4I50B 2PH5A 1ISRA 2GPJA 5FUWA 3EZ9A 1AUVA 2PWPA 4CYMA 4JBIA 1LVGA 2TYSB 1I80A 3C7DB 3CO0S 4H3VA 5J2TF 4N7RA 4RQUA 4YECA 4D80A 1KJYA 5ALSA 5EUBA 5HF8A 4EGFA 2GHTA 4I4TF 5ITWA 1E8MA 3DZFA 4WSOA 3PE6A 2RGDA 2GFQA 2YHUA 3F4BA 1XZIA 3GFGA 2WM9B 2XYHA 3KFLA 1SBHA 3RKSA 3WMWA 5LZ2A 4OGFA 5DX0A 3FNEA 3CEPB 2JCBA 4KMOA 3EBLA 1SBTA 2FPRA 3L93A 3Q8WA 4Q18A 5HILA 3GLGE 1SY7A 1NQTA 4XIGS 3W04A 4NC9A 1ZA1A 2JCGA 2PH3A 1A5TA 4XVQA 4EKIA 1F1BA 1LPAB 4OMCA 4XUEA 3C70A 3AXSA 4RJ2A 1SEVA 1J90A 2E0IA 4H3KB 4UCFA 2O1XA 2X6TA 3TMYA 4DV6B 4MRSA 3PLAE 3WY9A 1QU2A 4JCCA 1QFYA 3FYTA 2GK3A 3MIIA 1KAEA 3T3NA 1NF9A 2ADMA 5IZCC 1L5QA 4X92A 4F7WA 2C4VA 2GKGA 4HNHA 4G1VA 1D1PA 1J09A 1MO5A 1SXGA 1O9BA 2WZCA 4WRRA 4YP0A 2B7CA 4C7OA 1YCGA 5G0VA 3COJA 1VPWA 3H2YA 4MIKA 2A1UA 3B60A 2G5PA 4DARA 3PE4A 221PA 3TQHA 2W22A 4R1SA 4BNIA 4ZYVA 1VE3A 2QTBA 3KS9A 1CS0B 2CF5A 5ALIA 5IRCD 1BDIA 2QMEA 2YMLA 3V3TA 4MSUA 7MHTA 1KYWA 1AKVA 1WMBA 1M2HA 4OLFA 4HV4A 4AS3A 2V6JA 2RC5A 5F3WB 3DL7A 1T6ZA 3H5WA 1TYEB 2EATA 1U3UA 3F2VA 3H3JA 4PNEA 3IVAA 1SCDA 4RPCA 4EYKA 5TF4A 3U5ZB 1IXKA 1GCIA 3FNHA 1UKCA 4I14A 3TLXA 1D0IA 1TMOA 3VKVA 3ID6C 1WMEA 2BRUC 3ETDA 2B36A 2HB6A 1FMCA 1CQWA 1WOYA 1JEYB 5TGZA 1UF9A 3WO0A 4NAVA 4LF8B 1N6PA 1OWPA 2YIVX 3NKFA 5BWLA 4DV1B 3MCZA 1DX6A 3LUFA 3O3CA 3N74A 1AUQA 2UKDA 2W2MA 4N01A 2JLXA 2R0QC 1J7JA 3BREA 2IWRA 4B0OA 4QDJA 5JSHA 3I1JA 4IOLA 3IAM6 4IXWA 4HH0A 4ZCRA 1P4AA 3WQRA 3TM5A 1PK8A 3LT1A 4PVCA 3H5RA 4WDQA 4O1MA 5DYGA 3TIGA 5E9QA 2C4KA 3VO1A 4ZVQA 1E9SA 2VATA 4ZKDA 3IAXA 5FO0A 1UWKA 1L4MA 1YS9A 3EGXA 1BC5A 1JDJA 3IEUA 3LA8A 4J0KA 4UZEA 3WHPA 1PNTA 1DQNA 4OQDA 4IBOA 3PVZA 4ZCIA 3U49A 2ZWVA 1GU7A 5F5NA 5IT0A 2OHOA 4WTOA 1ORVA 3TPFA 1JEDA 5LOVB 2Z1DA 1PDOA 4REQB 2X0EA 1NV8A 5BN3A 2X7HA 5JJ5A 2EG9A 3NGMA 2HR1A 1ZD1A 3A1TA 3BIWA 3WDMA 3L0IB 2XAUA 4K0RA 1XU4A 4TVBA 3QMMA 3SFZA 4C14A 4G9EA 3FHCB 4GQBA 3HQ4O 1G4AE 1U28A 3B6IA 1LJLA 3EGVA 1T1IA 5TJ9A 1E9AA 1J1IA 1KR5A 3OZTA 4BP1A 1YXMA 1QQ7A 2HH9A 4D0LB 1KYTA 3PNVA 3FYUA 2C84A 1XCPA 4LSZA 1NKTA 1XQXA 5FTKA 2J46A 1CRWG 1OXSC 2OLKA 2P6UA 3IOYA 4DT1B 5HX7A 1UADA 2JZOA 2F4VB 1X7WB 4A3SA 2K2QB 2AJ8A 2RJNA 3KZVA 4ZYYA 4Z1MD 1U7DA 5ALRA 2C2KA 1JBKA 3WJAA 2QSJA 5CA0A 4F2WA 4C2UA 2EXXA 5IULC 1WOMA 3GBPA 2BMWA 1F7UA 1CUDA 1E62A 2A8YA 1JG4A 2JIZD 4DLRA 4Q66C 3JAMA 1QGOA 4FFOA 4EL5A 4BLQA 3ELWA 4EM6A 1QV9A 4X41A 2XQVA 2H4JA 3V4VB 2G5GX 3DAHA 3OX1A 4DILA 2HMUA 4AC9A 4X3OA 4FEGA 1PHRA 2NWQA 2WT8A 4PLYA 4XW2A 3WLMA 4JVSB 3A3YA 6ADHA 3GHYA 5HEKA 4FFDA 1WTCA 2FSVA 2R7NA 1X80A 4YDSA 3FAKA 2V6FA 1KVUA 1IZZA 1J06A 4GI7A 4XDZA 2PR7A 2AOTB 3H8VA 3HL4A 3MWEB 1AQUA 4NTZA 2M6SA 2NX2A 4DQKA 5DTIA 1RQPA 3NOVA 3DOIA 3QNWA 1RYFA 4J1QA 3RTAA 2IYQA 1KGDA 1YQQA 3LKBA 5FULA 1W85B 5U1PA 5K8IA 4N7MA 4IF4A 2EP5A 2HSJA 2WTAA 4ZREA 4YT5A 3T5GA 3OY7A 4Q93A 5FLYA 4ALMA 5CG2A 5DHTA 1A97A 5KQGA 1P81A 4B83A 3HM9A 4F96A 3DF9A 2XIJA 4HGRA 3EDMA 4LGMA 1HZZA 1LRJA 2CJXA 4RIIA 4Z1MA 4DIOA 5M3BA 1AA6A 4G6ZA 2G06A 1YZVA 4OQFA 2YZNA 3A26A 4ZEWA 3MERA 1XTVA 2V55B 4TMXA 5K99A 3R0ZA 3SSOA 2GJ8A 3KOOA 1L7QA 1V71A 2FX2A 4RGYA 1ZCAA 2EDAA 1R0WA 3VPXA 3AM3A 4EVRA 2C9DA 4AKGA 3OQIB 5FADA 2BTEA 4OK3A 1A9TA 2Y92A 2DTEA 3DDWA 1HI9A 4G0XA 4GR5A 4HNQA 3PUXA 1O95C 3U7IA 4DMLA 4B4DA 5KYVA 1RHRA 2JBWA 5B6PA 1JYFA 2ZR8A 4FONA 2UDPA 3M33A 3WNCA 1KEVA 4ZO7A 5A1TA 3R7WB 2I2CA 2NXNA 3IDAA 5AKJA 1OAOA 3DV0A 2PT6A 1V9LA 2RHWA 2YWFA 4Z9AA 4QQRA 1P62B 2XCLA 3FDZA 3N2LA 3Q3EA 4HDCA 3JYHA 4D56A 5DLEA 3N7AA 3EEYA 3NRBA 4KPGA 2X0FA 4CL3A 2I8CA 4Z7NB 2X0KA 1LF5A 2BFCA 4NJOA 5SZKB 1Y6RA 3A9VA 1P31A 2PKEA 2V4MA 3FMVA 3GCXA 1WBJB 3DT9A 2O7SA 1V1RB 3HDVA 1UJNA 4FNGA 1GAQA 2AYXA 3RTGA 3NG1A 4JT2A 3BMQA 3HCCA 4I3FA 1X74A 4UNQA 3E53A 2ET6A 1A71A 3PFGA 4R2XA 2PH7A 4YRBA 1VIMA 3IBGA 1C1XB 2WY2D 4JOQA 5DM1A 1TF5A 4LZAA 4AJ2A 4BFCA 5D84A 4O4JF 1N1EA 1YBAA 5DW3A 1QX3A 1X8XA 3RRZA 1J20A 1H6DA 3GRKA 1X9GA 4ETMA 5JU6A 5TQ0B 2IIBA 4PZUA 3N1UA 3O1JC 5BRJA 4JLDA 3KQPA 5L8VA 3F96A 3TW4A 3WMEA 3A6PC 3WTBA 4X1KB 1AD2A 3I9V6 4RVUA 2QTGA 4NPAA 3K8QA 3F3SA 3P0HA 2QJWA 4V0OA 5AH0A 1ZVJA 3ZVNA 4CLXA 4BFTA 1Y34E 5B6IA 1RE0A 1QHSA 4OM8A 4OP2A 3V4OA 2W37A 2EJCA 2QTWB 3WYGA 1TKAA 1DJLA 2CUNA 2OXRA 5CR9A 3UT5A 1VHTA 3DZIA 4Q9LA 4B73A 2O59A 4PX3A 1OVMA 4LEIA 5DGHA 2ETXA 5TV2A 3WAJA 1CDDA 1CR4A 1QKJA 1RI1A 2VAMA 4HI0E 4RANA 2JCXA 2C0QA 5EJIA 5F2KA 6YASA 3ZKWB 1K97A 5SV2A 2ESRA 2VZ0A 3VU9A 4CM8A 4BLTA 4B3TB 2L18A 3B7PA 2ZROA 1EE9A 1ICIA 1W0KD 2G5TA 3T3MB 2NTYC 1A7AA 1ESMA 1E7YA 2ISSD 3T9CA 1HOTA 4JUIA 1Y5NA 4RKQA 1CJMA 1IM2A 4M2LA 4GMHA 2JHAA 2QV0A 3AONB 5GINE 1QZ3A 3TINA 1B8PA 3PJFA 2IEGA 3QF4A 4FM9A 1IB0A 1YO6A 3II6X 1SKQA 2Z3WA 3JWIA 5KQLA 2YRFA 4A0FA 3C2QA 4DY6A 4PQEA 5C8YA 3T3DA 3EFOA 2PT9A 1X42A 1NI3A 2VJPA 1V95A 1L8XA 2R25B 3SDSA 1F12A 4TL9A 4WXHA 4RFSB 1JDZA 5TEVA 1V3VA 3U48A 3BGVA 2QMZA 2NLOA 1IIBA 1MO6A 2CSUA 3B12A 3HNRA 1HE4A 4PLZA 1GYQA 3AESA 4DV5B 1CULC 1QGUA 2C7VA 2F43A 2WJ3A 3HPQA 3MT8A 4MYTA 1H5UA 2L69A 4ER7A 3NDBB 1AVTA 2ZU6A 1SRRA 3WRXC 3UVEA 1ZA2A 4N48A 3EEIA 2ZIVB 2J0UB 4EYEA 3PRJA 4ZVNA 1TM2A 4YO7A 1SQGA 2P4UA 1I51A 4AKEA 5LSAA 5HE9A 3BIJA 1W0KA 4B71A 2NP7A 1JALA 2OAGA 3AF5A 1G6KA 2XE7A 3FRJA 3OKAA 3AJEA 2FE4A 3Q0EA 2RHGB 4COKA 5KTRA 1HT0A 5HWSA 3EDYA 5FR1A 5LZ5A 2ZRQA 2QR5A 4RPIA 3L92A 3BK1A 2R6ZA 2ZVQX 4QNRA 2ZUTA 2DHDA 3G88A 3PNLA 4AMUA 2F1JA 3TFOA 5HIJA 4PNHA 1N0WA 3EPJA 1G8HA 3CMCO 3DD5A 3EG9B 3T1QA 3NYIA 3AEXA 2GZHA 2QN3A 4Q01A 2ODAA 3L0DA 3FDJA 2Y66A 2IXDA 1PWZA 3DLAA 4BWVA 2MMGA 3WWOA 4MUNA 1OI3A 1O9GA 4KNWA 4XGQA 4F46A 3D3NA 3WLFA 3LS2A 4LVOA 2IWHA 4ESEA 1JWBB 2WZQA 3AINA 1TAQA 2ZJFA 1M67A 1D7AA 4RF2A 2J5BA 3TRJA 4YV0A 2QX8A 3GT4A 1DTWB 4OXIA 1X39A 1Y3AA 2VJLA 1L4LA 1LLCA 3PC3A 3QLUC 3Q6MA 2BJHA 3H2BA 2D8AA 4M7OA 5FOQA 1SAYA 4RSRA 4CG1A 2P1DA 3AEUA 1PQ4A 1ZR2A 2AH5A 3R3SA 4MO9A 3NH9A 2BPOA 1H3FA 3WYFA 3G82C 4UARA 4UCWA 4NQRA 3HBAA 4IKEA 4GI3A 4XARA 4O08A 1ZZEA 2R4QA 3G1WA 4EHJA 3KDAA 5D1HA 3I9OA 3U7JA 1IBRA 4MCIA 1FVXA 3NIFB 4BQSA 5F9HA 2EL7A 3S68A 1JFFB 4I8DA 1AUPA 1FB5A 1TT5B 1P4SA 1V5IA 2CJWB 3ZGXA 2ZI5A 4HT3B 2PWAA 2GPBA 1H2ZA 1XQ9A 4G85A 5IUJC 2BGMA 2CT8A 2GCPA 4H60A 4A6PA 3JYOA 1E64A 2BBSA 2YFKA 3UAZA 2O6LA 1YVPA 5LQRA 4HNAB 4E09A 2HZBA 2VSOA 3T5TA 1IBCA 3FAZA 3TXYA 4AJLA 1W19A 5A3QA 3A6LA 4ZTBA 5JADA 4TSFD 1UDXA 2WWWA 2D7CA 2LW7A 4LKOA 1VL8A 2IV7A 1IK6A 1FTGA 4JB0A 4JSRA 4DNFA 3VBCA 4LJ4A 4MTCA 4V0LA 3VDMA 2ZJ0A 3EC1A 4FMPA 3AM5A 1NBEA 3T7SA 1DC3A 3X2SA 3GJ6A 3ZUGA 2JFGA 2BEVA 2W6PA 5B4UA 4OGLA 3VR5H 1S7GA 3RAPR 3MJHA 5KWEA 3HE3A 1CLUA 1N1GA 3D43A 2WA2A 4FZ3A 4KX3A 4UVDA 4AM8A 4TXNA 3CLUD 3IMCA 4J9VA 1C3JA 4NPHA 1RWKA 1QK3A 3ONDA 3RODA 3PD0A 4EA9A 2EKLA 3CA8A 1U99A 3FFAA 3TOSA 4CIWA 1CU1A 3D5QA 3W7BA 2O8NA 3P9ZA 2X14A 4ZOLF 2GO1A 2LIPA 3GC6A 4FKBA 1Z33A 4HTFB 9LDTA 4CR8A 1GPKA 4OQZA 4HQ0A 1E9CA 3C39A 4GX0A 5AOCA 2V7TA 2QVCA 4PZPA 5C32A 1XMJA 3JPWA 4BUJA 5IU6A 4DFDA 1ZHFA 5AVRA 3TCNA 2XCTB 5KI6A 2NUAA 3P8ZA 1QP8A 2QJRA 3ND5A 3I52A 4J2TA 4B3BA 2ID7A 4J7CA 4REOA 3ZWMA 2KE5A 4KYUA 1XJ0A 3VYRB 4WCFA 4D74A 4DR7B 1GEEA 1I3NA 4FMCF 1NVEA 3BJZA 4G5RA 4DAEA 3KQNA 4DEXA 3BZUA 2RBEA 2VSQA 3ZNOA 2BBWA 4K9KA 1ACLA 4I1PA 4QXRA 4A8PA 3JVDA 2D3TA 1YRQA 2RH5A 1N3IA 1Z7BA 2VTVA 4V0ME 4D9CA 2FHSA 4MDYA 5B3KA 3U56A 2GXQA 4O4LA 4R8RA 1WHSB 3HU2A 5EMLA 3THOA 4EA7A 4F92B 3EZFA 1QRAA 1RQGA 1OT3A 1WM1A 2ZULA 3D2BA 4MV1A 3UMVA 4DNPA 2CYAA 2JCVA 1PZHA 2CUZA 3N8NA 2X1VA 4ASUD 4J1TC 5FQOA 4Q7QA 3TYXA 1W36D 3CKKA 4BVLA 2PSFA 3QWHA 2R84A 4R8LA 4YRJA 1DAGA 2JA1A 5KU7A 1Z62A 1GCGA 1GDHA 3TSZA 1L7RA 3LO5A 2WIJA 4MRMB 5JNSA 1M5TA 2CLSA 4KGXA 1JFLA 2H07A 1UPXA 1NLMA 2H59A 2VSYA 4CQMB 2ZFUA 2PGOA 2P65A 3IB6A 1ZJJA 2ZYHA 4ITVA 4BE9A 4TRRA 4C05A 5KTMA 4X3CA 1JZTA 5C0OE 2AGVA 4PZYA 5HK8A 4DANA 5CM9C 4QFMA 4FGLA 5IAEA 2ZSJA 2GMWA 2ZYDA 2B5WA 1QYDA 4Q47A 5THXA 4K9RA 4ND7A 5JS1A 1YQEA 1F06A 3QX7A 5BSMA 3FBWA 3RADC 4EMUA 3BRQA 3ZLBA 5IP5A 1C7RA 1F8FA 1LNSA 5ER9A 3I92A 4NBRA 5LOVF 2P1RA 3HV2A 3QP9A 4D3SA 2V5UA 3LGXA 2NTNA 1LH0A 3HN2A 5HCUA 4H7HA 2C61A 3BD9A 2WU0A 4OJYA 3Q0IA 2XWPA 3U7GA 1V35A 4X20A 2DPHA 4IRMA 2BAGA 2QGFA 3L4EA 2P79A 3DT8A 4JR0A 3GEBA 1T36A 4YY3B 2PA3A 4RK0A 5BMVB 1NVKA 3H04A 4DLNA 1XLVA 4BBJA 4NFYA 1JB9A 3TJMA 4U9UA 1VJCA 2KMLA 2OCDA 1V96A 3BX1A 1XDUA 1MF7A 2W0SA 4AJ1A 4Z7JA 5GZ1A 2QNBA 3KOMA 3N8KA 4CKBB 3RARA 1D09A 2M6LA 3H75A 3O0DA 1PJ2A 3PX2A 2DBZA 3OCVA 2BHSA 3QI2A 2FJUA 4W4TA 2GVNA 1QXSA 3S7TA 5AKYA 3NNNA 2I4OA 4LOIA 2ZM5A 4KE6A 3RUFA 3QX9A 5A4MS 2QN9A 2EAUA 4WJKB 2DZDA 2G09A 2BF7A 1QB7A 1LJ8A 4OMDA 2ZSHA 4TMKA 2VJCA 5CFMA 2A35A 3W06A 1G8YA 3EVCA 3Q15C 4HX5A 3WK6A 2Y1EA 3T38A 1HLPA 4MWBA 1JQ5A 3KYBA 1SBNE 3OA2A 4X63A 4B84A 2YS6A 3KB8A 1SVOA 1W96A 3L01A 3OOSA 2NUTA 3VKWA 2JD0A 4GPIB 4QRIA 1BH6A 4IDGA 4TXMA 3SICE 3X1WA 4F3YA 3LX6A 1Q20A 1HFJA 4JJGA 4CUZA 1GRRA 4UULA 1EFUA 4RGBA 3N28A 2FPPA 1J7KA 3A28A 4TMTA 2HADA 3OICA 3UYLA 4RYDA 2RIPA 4CBVA 1T29A 3S2UA 4XVUA 2Q9CA 6GPBA 2AI1A 2RCYA 4IV0A 2JIOA 1H8HD 1NUHA 5C8ZA 1MP0A 1GCUA 1G5FA 4QFCA 3JZIA 3ZE1B 5IJ9B 2UUOA 3AFMA 5EZQA 3RSHA 3HV0A 4P54A 3HLTA 2OWDA 4IOMA 5B57C 3RANA 1GZ6A 1NVWQ 4OGGA 4OL9A 1BN7A 1C3XA 1NUQA 2EJWA 3F6CA 3I64A 3NYQA 1RZRA 3LUHA 3LY9A 1U28C 5CAEA 3K3PA 1L7OA 3ZDEA 4FFBB 5ITZB 5IAAA 3WGTA 3JQFA 3OETA 3K31A 2VP0A 4ND4A 1QH0A 3D3WB 3RFCA 3RVLA 2IXBA 4X84A 1T15A 3T99A 3KXDA 4D9HA 1RM0A 3ACDA 1U0EA 4L7QA 4NH0A 3VC7A 3FPLA 3LM8A 3RJZA 2FX3A 1KAMA 2J09A 3KZNA 4QULA 3SNHA 1CR1A 4Z4EA 2GO7A 2D2XA 1O96B 3PEUA 2GK7A 1GPDG 4LAFA 1PJAA 2QW8A 2B0CA 1QNFA 3A6ZA 2VZ8A 3SLGA 1RWWA 1IEVA 2J87A 3RH0A 3VH1A 4ZHQA 4YRPA 2INGX 4K9PA 4U7JA 3U6KA 3IUJA 2JKYA 4PINA 4B79A 2FRDA 1H8HA 1IG0A 3Q9NA 2BMFA 5GOZA 1JXOA 4J3FA 4GPEA 1DIHA 1XNQB 3FGOA 1NR7A 4PSAA 2O19A 4JROA 1IUNA 3E8MA 5C9ZA 1NJGA 3L06A 2QT9A 2GPAA 3TEJA 3W5HA 4N18A 2I6QA 1ID8A 5HYVA 3H2KA 2IFTA 4K9LA 1QF6A 1CNFA 2JI4A 1HKHA 2PSJA 2VWGA 3IIIA 4NU6A 5LYJB 1OWLA 5DHRA 2QF7A 4HJXA 3P9IA 2OO3A 5IN4A 2EZTA 3D4OA 4G8DA 5IDQA 2GCNA 3T7AA 3K53A 2XYRA 2PGNA 2IUUA 3HJBA 1RW4A 1RTKA 2BW0A 5K3FB 2AVDA 4ILKA 2JZNA 3CPJB 2YW9A 5LLTA 2I67A 1XK6A 1OB5A 3D4BA 5J59A 8ATCA 1HZZC 2DQZA 5IJWA 2R11A 2TMDA 1UAYA 2I6UA 3FA2A 5DKFA 3P52A 1IJFA 1MAAA 1YUBA 3BXEA 2BFPA 3I83A 3UMMA 4YACA 5TR9A 3B52X 1FXWF 2P2YA 2QNIA 1L7VC 3C7KA 2B5VA 3K0EA 4DIBA 5J9FA 4DCGA 1LPMA 1CRQA 1RLTA 5CCEA 5I9NA 5HKKA 4RA6B 3A9UA 1MOQA 2G3YA 2IEDA 2Y0DA 1IN4A 1JHDA 3EVNA 3FPBA 3K0BA 4B4OA 2JFHA 3DO5A 1W4RA 2AF4C 2V3VA 2E6KA 3HY3A 2HEIA 2PL1A 1E66A 3IC5A 3KLPX 3L7JA 4QU5A 5LQUA 3FZNA 4ZAFA 4YRRA 1OAOC 1I7NA 1U31A 3NHMA 2BR3A 2VTDA 3G0CA 3GQVA 4HH1A 3JQ9A 3TLYA 3KQSA 5EINA 1L4BA 3WADA 1CUEA 2EKQA 4HQNA 5FL7D 2XPCA 4YP1A 3RBAA 4JGBA 2GQ0A 5LZ9A 3GEEA 5JD3A 2ZJ7A 1G3IA 4MRPA 3WQHA 1Z5NA 2A0YA 3D54D 3JWHA 1TZKA 4LJKA 1CJCA 1B3BA 1TCCA 3FSRA 1SG6A 3LKVA 2AG5A 4Q03A 3SXJA 1ZOIA 3VDQA 4WY2A 5KOJB 4GW3A 3LYAA 4BEWA 1UXKA 2AR9A 1O97D 1FY2A 5D51S 1M6WA 2JGAA 4B1FA 4P3NA 1O5OA 1ZC3A 3EJWA 2WMDA 5L4LA 3ZHXA 5C1DA 1NX6A 4XQCA 1KZ4A 2P7HA 3PFCA 3K09C 1UJMA 2JFUA 1E7WA 5DJ5A 4KE7A 4PC7A 4RZIA 4GXQA 5IX8A 2D3WA 2G7MC 1M54A 5L9AA 1RXUA 1U04A 3BWCA 2WSLA 4KQ9A 4QYTA 4I1VA 1YR1A 3RLIA 3R3UA 3VZSA 5AI4A 4EH1A 3O7MA 4EDFA 1VIYA 2G4CA 2FWMX 4PEVA 4CKYA 3CR3C 2BBTA 1Z4IA 2XGOA 1JHOA 1TGYA 3FPHA 2ZAOA 2BVNA 2V5VA 3CX3A 3P96A 1ICEA 3PZRA 5K3SA 3TWOA 1KZYC 4PZAA 4YAOA 2ATIA 4OO3A 4MO2A 1I2ZA 4FKMA 2WUEA 3FVVA 3PCXA 3L46A 1CUIA 1AK9A 1G4HA 1KI3A 2H08A 4L4SA 3NM4A 1RHJA 1E3TA 2D7JA 2KLBA 5I9MA 4AICA 3HI6A 4DSAA 5KWVA 3WZ2A 4EI9A 1LXCA 4CKXA 1F0KA 1IMJA 1T0PA 2ZITA 1YRAA 5BSRA 4FBGA 1YOVB 1NATA 4E88A 3GUYA 4TWAA 1DSSG 1GZ4A 1XEXB 3ORFA 4KQWA 2R47A 4IQ4A 3ZWNA 1GOTA 2KM1A 4GI2A 4XQ0A 4KBYA 3AVXA 2YZGA 1FU8A 1RC8A 1Z2DA 4GP6A 4G2TA 3ND6A 3KUUA 2MT9A 4LPSA 3ELYA 3LI2A 3FDZB 1KDPA 3CQ9A 2OGWA 1SURA 2RGXA 3RGWS 4BO9A 4TYMA 4LK2A 2A9QA 3IOBA 4QJBA 1XD2A 3VR2D 2QG6A 4BV8A 1P5FA 4ZMBA 2ZBVA 3HVRA 2OBNA 5ADHA 1S3IA 4LJ9A 4ZI5A 2FJPA 4X7MA 4G5OA 1G6Q1 2VHWA 3TLGA 4CQLA 3WGKA 1RE1A 1L3CA 4BO5A 3U5TA 1US8B 3GROA 3QWFA 5IZ4A 3OEED 3K6SB 4RZQA 4N9WA 5G0SA 5AVSA 1Y4DE 5K0GA 2GKOA 1KO1A 3W4JA 4RKFA 4QQKA 1D07A 3A4VA 1MEEA 3HPRA 3RQSA 3TGWA 4CT0A 2GF2A 4CG0A 4ZDIA 2VNHA 4M0EA 4PWYA 4RF5A 1H4QA 4FYKA 2FQWA 4FUQA 4BNTA 5IANA 1XPUA 2NVUA 5L3SA 1W2WB 1GUYA 1VDZA 4M1MA 3OPVA 3LIPA 4OXXA 4F9GA 1K4MA 2W6MA 3OCZA 5A7FA 1DKQA 2V7GA 2IK8A 3DMNA 4NJMB 2A9JA 1KMQA 4TKMA 3GRRA 1HE5A 3E2PA 1U5AA 3D3KA 2WPNA 2PO5A 2VDVE 1IXRC 3BXXA 5GGYA 4RSGA 1VSTA 4P38A 3STWA 3TR6A 3EPKA 3FUVA 2VDRB 3GYBA 3F8WA 5IKMA 3A7DA 3HA3A 1SUWA 5LN1A 4RW0A 2OTCA 3DWFA 1CJSA 3G89A 2FE1A 4N5LA 4NIMA 1ECBA 4RL6A 3U3ZA 4OQYA 2HU7A 1IU9A 1Z6GA 1NRJB 2W6ID 1K68A 2WIAA 1S2MA 3PQ6A 1LTQA 2DECA 3F97A 3PNQA 5I7VA 3DEIA 2XLCA 3OJWA 1J2YA 2JBHA 3W9UA 5I7SA 2CL6X 4FGSA 9ATCA 4IX9A 4LJ6A 1U2GC 2ZWOA 1BS1A 2ZKLA 1NQOA 2YJZA 2BY4A 4TWJA 4EHDA 1YA6A 4NYJR 1ZGAA 1COZA 4K3VA 5ICFA 2JW5A 1K0UA 1U81A 1WUHS 3I6IA 1BSVA 1U5CA 2FFBA 3AVTA 4J4TA 4MS3B 1KDZA 4YBRA 4JIMA 5C8YB 2VDNB 4BZWA 3AHGA 2O5RA 4H7KA 1LVUA 1NBIA 4Y1FA 2PZBA 2QD3A 2OM2A 1OXVA 1WQ1R 2X1HA 3LOUA 2IH4A 2V7QD 3EQ6A 1RADA 1G21A 1O6CA 2AXNA 3I76A 4I6EA 1D2EA 4M8IA 3VYUB 1BDBA 3AETB 1E89A 3W6UA 1EVKA 2N47A 1CEQA 1GGMA 1NJ5A 4S0XA 4XIYA 1UBUS 3SEZA 1NXXA 1F0PA 5EP1A 5CVJA 4K6OA 1GSHA 4JC8A 4E7OA 1OXXK 1USIA 3FCOA 2LCIA 1O08A 4XA8A 3CVXA 2CC2A 5IK2D 4FSXA 4DA6A 4EYGA 5IEJA 1OSNA 1UBJS 3PD1A 5DK4A 3WGUA 3S6JA 2ISQA 3B20A 2BUBA 3CISA 1IK4A 1XBTA 3WGVA 4LI0A 2REXB 3LDAA 2PZKA 1V4NA 4F2DA 5JAHA 1XP8A 1DG9A 4KIGA 5E4JA 1X9HA 5L6LB 3NTUA 2BGLA 2UUPA 2CWDA 3FHJA 3EHDA 3SFTA 1YL5A 4M9SA 1Y6JA 3F3KA 4PQRA 4QOHA 4J3JA 3H5VA 3VM6A 4G84A 2ACWA 4PRYA 1JUDA 1MX1A 2F00A 4UHJA 2OHJA 5K8JB 1H2AS 2QTCA 1JLKA 4EG5A 3LVRE 3ZJ5A 4ZI3A 3BL8A 2VA8A 4YCCA 2XWQA 4OHOA 1RKUA 4IM7A 4P3YA 2V7QA 1CHNA 1E8DA 4OMFG 4PLVA 4A7PA 2XRFA 4O2AA 4D9JA 1AB5A 1VPEA 3NUGA 4YXFA 2GJKA 5H70A 4HQ6A 1CNMA 1D1QA 3ME5A 3I9FA 2FUCA 3M6LA 1B7GO 3WB9A 1OLUB 4K9QA 3L8FA 3EA5A 1S8NA 4NK5A 1GNTA 3PL1A 4TLDA 4CL2A 5IT4A 1RFLA 1M34B 1NMZA 1TM7E 2HU5A 4WCFC 5GONF 4QWWA 4ZEOA 3ZGLA 4A5OA 3O8RA 4GKJB 5IK2A 3TD2A 4Q02A 3RQIA 4D79A 2WR8A 2NXJA 5B36A 3OE5A 3P71T 2X4DA 3UFXA 3TG8A 3EPRA 1ESCA 3EGDA 1IVNA 4UASA 4D44A 3L07A 1BN6A 5SICE 1N6OA 2OEPA 5L95A 2AUNA 5LB4A 4KQFA 2PWYA 1U5BB 2ZTVA 1W47A 3LBAA 4XR9A 1IG3A 4I3GA 4HUQB 1X1RA 3UJPA 4A23A 1C41A 3NCTA 4W9NA 4ZRNA 2ECQA 2YY5A 3ETGA 3D9QX 3WLLA 1Q1GA 1TJ4A 1NURA 1SVIA 2ZTLA 3LUJA 4R9UC 3KQQA 1U0GA 1HYQA 3UCEA 2IUEA 2BDUA 4CKCB 3IDQA 1KJ9A 1SKYB 3KFXA 2HU2A 1F48A 2V7BA 4HYYA 4J91A 3EX7C 5C51B 3PL5A 3K0AA 4WESA 4DBLE 2ZJBA 4P0PB 5JSZA 1XO1A 3QUQA 1DXHA 2PJZA 2PXAA 3QW4B 1II8A 4RS3A 5HP4A 4HEA6 4DDWA 4F9FA 2OD2A 4BXOA 2QK4A 1Z5UA 3FWNA 3HJNA 5CITA 1VPDA 3QFCA 1II0A 1ZITA 2KJQA 4TWRA 3SR0A 5F98A 2WFMA 3NT5A 3NONA 2F3UA 4CTNA 1L9XA 1TAUA 4GL4A 5DXJA 3BVPA 1F2DA 1UZLA 4AIIA 2GN6A 3LX5A 4E7PA 3C87A 1T3SA 2X40A 3MD9A 4E31A 3X43A 1XHFA 3NHYA 1WQ3A 3N6XA 3IQZA 2OCAA 1DWQA 3GXBA 5D00A 2YVKA 2OV3A 4MQ6A 3OLYA 2EEZA 1XQ6A 2PPLA 3TLCA 2VDKB 3SR4A 3TD9A 4D0GA 2DETA 2X5JO 4Y0NA 1CUYA 2GN8A 3W8DA 1YJBA 3KWLA 3DBVO 3GLIB 3NTQA 3HABA 2NUAB 5F1PA 3AY3A 1ZUNB 3KSBC 4PIVA 2Q7XA 3BTSA 3ZHVA 2JLCA 5CFQA 2AI2A 4HDMB 4WCFB 5FWYA 5KOIA 1KR2A 2AE1A 2FHPA 4BIMA 4GC5A 3NIGB 1HSZA 4EZIA 4N3CA 2QRUA 2H2AA 4P32A 1T0IA 2FPXA 4A2CA 1ZNZA 3CGWA 2OB1A 2QAIA 4FDTA 1JSCA 3FYHA 4N03A 5DZSA 3WIDA 4EJFA 1P45A 4PG7A 5H3LA 4CEJB 3A9RA 4J2OA 5BOVA 1RJWA 4HDRA 3WFZA 2HGZA 1IQPA 4OOFA 3TSYA 3W9BA 2UYCA 3HNOA 4I4LA 4JR2A 4P08A 5FHQA 3F9IA 1PGPA 1QOZA 1TW2A 2GN0A 2VDMB 3DM5A 1JEQB 3LLVA 1JKMA 4KPUA 2YDYA 3L7BA 4NH4A 5KSZA 1J07A 1JEAA 1W4BA 3QEOA 4BO2A 1QCZA 1DC6A 1WF6A 1WB5A 2C1XA 4NCBA 1AZSC 4BFWA 4B4KA 4DHWA 1OXKB 4CGZA 5JDIC 3V8BA 4TPKA 1BHSA 1QG0A 4H3HB 5I7UA 3I9KA 1TA0A 3TZBA 4QXMA 4WLEA 1N3LA 1RXSA 2R1VB 2YR0A 3ZBUA 5TMDA 1I3KA 1TO6A 1ZW1A 4MQFB 5BXQC 2AKEA 2R4TA 3IP1A 1VCMA 2RJ3A 1XZLA 4PX2A 4UFOA 3IVCA 4DR2B 4K46A 3WGYA 1U4OA 4G8JA 4JODA 2XNHA 1ZSYA 3B3FA 3GJ0A 2WTNA 4X64B 1R1DA 2OZVA 2Q3EA 1MO2A 3BM5A 2ZR7A 4PS1A 5EJ6A 2J48A 3Q98A 4DRXA 4U3JA 1GPBA 3PYXA 2Z5GA 3OHMA 3W5CA 1FTNA 1YTUA 2B4AA 4DSZA 2UZAA 4F12A 1XSEA 3DBHB 4X20B 3IO3A 4LGYA 3WK7A 3ZCPA 3HJTA 3A6FA 5FDFA 3G7SA 4IJKA 5IPFA 1U0LA 4O4HA 2PO7A 1JPUA 4WXPA 3GOQA 3MZ0A 3H9UA 4NOKA 3RSQA 1Z0JA 2DKNA 3GEIA 3KSZO 4OMUA 4BNMA 4R6XA 1C4WA 1YFKA 2P9FA 3INGA 3UMCA 2NG1A 3KSDO 4G07A 2CXNA 2FEAA 1IDN1 3V32A 2FKAA 4FWIB 4Y1GA 4YMGA 1J25A 2Y6VA 1F7VA 1KI6B 2QU8A 3I42A 4KIFA 4P93A 3WB2A 2PUBA 1U8UA 4G36A 5CA0F 5IHPA 1GARA 3RHFA 5CA1B 2P0AA 4URUR 3QBDA 3AB3A 3MOGA 4I1UA 4Y98A 4S05A 2Y2VA 4B3SB 3L0CA 5H3CA 4YQEA 4QEKA 2YTZA 2ZRCA 1MB4A 1MAHA 2LKCA 3D7NA 3P9NA 4LOJA 4TLMB 2JLZA 1D7OA 1CY0A 1TFUA 1Y5MA 3AILA 1O94D 2ZYRA 2FRDC 3H1GA 4KSBA 1NIPA 4X1OA 3RKUA 3WLNA 5KNLA 1E3WA 1P2FA 4PHTA 3SEAA 3ZY5A 2NO9A 4KAFA 3L6EA 2UYOA 4INJA 2E2WA 1O87A 2EZ8A 3U9LA 2HXYA 3CWCA 2Q6KA 2EDCA 2ERCA 5I01A 2YYYA 1NBMA 3V9PA 1V8BA 1FJ2A 3I72A 1X7YA 1UBFA 4OA5A 5KHLB 3H05A 1UANA 2YRWA 4JUBA 2J59A 3LK7A 3I04A 3ROEA 2XLBA 3Q3HA 1O58A 4NMXB 4DJAA 1E1KA 4UOZA 1NR1A 2FPPB 4JJFA 1FFXA 4MWTA 1LBSA 3H84A 2HQRA 3L6RA 3ZLTA 2BFEA 2PX8A 3SYRA 3BF7A 5CNIA 3RSZA 3KJXA 4FIDA 5LBIA 1BTOA 1FF9A 4DNXA 2R5FA 5L53A 2VA9A 3DFMA 3C6YA 2ZIZA 3GDFA 1K66A 5CK5A 1QQ6A 3E35A 3PP8A 1F2TB 1PT5A 3QG5A 4X54A 4WZBE 1P75A 4ZQIA 3V00A 3NASA 5HM6A 5LD2B 4D9FA 4ZPXA 3WFJA 2J9GA 2Q3CA 3D59A 2BGRA 1XVUA 2WJIA 3DEJA 5IDYA 3EY9A 3SMQA 4ETNA 3ESRA 3FGPA 5GP1A 1BYIA 1P2GA 5ICCA 4K9SA 1P77A 2CXSA 4M88A 4YUVA 1BGXT 1O94A 1FCJA 1GL9B 1RBZA 5HBRA 3S2GA 1E6CA 2ZSAA 1NUUA 3PQDA 3PUHA 4MP3A 2JI7A 3H4TA 4E2XA 1NJSA 2PZMA 5BNWA 5GADl 1ZUD1 2DHQA 4G86A 1RYBA 2VHVA 4F5WA 2HHCA 4LC1A 3VR0A 1QDEA 5FI0B 1AKWA 3FPAA 4PC2A 5HBGA 1T5IA 2LCFA 5JCZA 5K3EA 3BZWA 4ABYA 2RFLA 4RU1A 4Q34A 1WL8A 2UUAB 4W1PA 2CK3D 4UM9D 1DINA 1QH1B 4LUCA 3MB8A 1PCXA 2Q7OE 1LK7A 1TQ4A 1SA0A 2P27A 2PGAA 2YVUA 1PW5A 3KAKA 4M7WA 3MK31 2CN1A 3GLHE 4M9RA 4RD3A 4ZVLA 4EUKA 9ABPA 3GH1A 3LWBA 4YEDA 2XNDA 2W2NA 1DC5A 4P2GA 4NQZA 5J40A 3SBXA 3CT6A 3PQ8A 4FFMA 3BBPA 3OPYB 4O6VA 1T5DX 4HZUA 4RVSA 3PF8A 2AS0A 1OZAA 2WICA 1DZIA 1PJQA 1VL0A 5DWQA 4BWFB 5ALJA 4PE5