4UHHA

Structural studies of a thermophilic esterase from thermogutta terrifontis (cacodylate complex)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
273
structure length
273
Chain Sequence
b'AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Planctomycetes bacterium r1
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
total genus 107
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhhA00
3W2TA 2XUIA 2QS9A 2PKYX 5JD4A 4AZ3A 4KRXA 3EQ8A 1TCAA 3WK6A 1ACJA 5ALHA 1EK2A 5DWDA 5EIHA 5E2IA 1YA4A 1XRRA 1SCKA 3AZPA 3ICWA 3R3YA 3WIOA 5AK4A 5K3FA 2XMGA 1F0PA 3I2FA 3TRDA 2HHAA 5AKIA 2XB6A 4ROTA 3C87A 5D3ZA 3IA2A 4ARBA 4Y2JA 1MPXA 1WPRA 2OPHA 5AK5A 1IUOA 4DMHA 4PSCA 1WM1A 3I6YA 3ZPXA 5A71A 3I6ZA 1J06A 5JARA 1DX6A 2HA3A 4B9AA 1J07A 1IZ7A 3G0IA 2WM2A 2WFMA 3IVMA 3WWDA 3M83A 5C7YA 4X6UA 4H7FA 2OGZA 4LXHA 2WSLA 1EB8A 3PFBA 4C88A 1B6GA 2XMQA 2YYSA 3FYUB 5HF5A 2VAVA 4DNOA 4UBJA 5AH0A 4MEAA 1P0IA 1TKRA 2QXUA 5AKEA 5KWIA 5K3CA 3FSGD 3H2JA 3ICVA 3SK0A 4BVKA 4UFPA 1VE7A 1DWOA 4O08A 4KE8A 1NU8A 4XVCA 2LIPA 3I2KA 1CRLA 3AIMA 4CFSA 3DD5A 1ZOIA 3HXKA 5CRIA 4QLAA 4LYDA 3E0XA 3BXPA 4AX4A 4GI1A 3ESDA 3STVA 3KDAA 5CH8A 2JGEA 1YS2X 4HZGA 1DX4A 1SCQA 1LPAB 4G4GA 5HKBA 5JD6A 1CIJA 1CUEA 4TVKA 3C70A 2WKWA 3R3XA 4U2GA 4QDXA 2OQVA 1BE0A 4U2CA 1YA8A 3H2IA 5K5EA 4JNCA 2VA9A 3O0DA 1XZIA 4BAZA 3DKKA 2WIKA 2QOEA 2HIHA 5DYYA 1E8MA 4PF1A 1EA5A 4B7ZA 2HA2A 2PSJA 4ZRDA 1A88A 4OSEA 1QOZA 1K63A 3PDCA 1LPBB 3D3NA 3BDVA 1F8UA 4OPMA 2HM7A 2QKYA 2WG1A 2O2GA 2XUHA 4W1RA 1GT6A 5EHXA 1P0QA 1WB4A 1ZI9A 2XMSA 3FLAA 4KR0A 4X7BA 3WYDA 5ALLA 4RE6A 2PX6A 4U2DA 5CMLA 2C58A 1VJ5A 1XZLA 4LKOA 3WWOA 4INZA 4MXDA 5JANA 4B0OA 2B9VA 5HFAA 5HK8A 2QR5A 5LZ9A 5CT4A 4MYDA 3IULA 5AKZA 5C81A 1XZAA 1ZD4A 3IDAA 1R3DA 3WWEA 5AHXA 2XUGA 1YAHA 1H2XA 5BWBA 4YPVA 1F6WA 4Q82A 5AM0A 3D5EA 1ZI8A 1DQZA 3QMWA 3C8DA 2ZYIA 3G02A 2HA6A 3B3QA 4DMFA 1KEZA 2V9ZA 2D5LA 2CBGA 1D07A 2DHCA 2ZVDA 1C7IA 1TIBA 5E4TA 3C5WP 5C8ZA 1UXOA 2XT0A 2OCLA 5HFNA 1AURA 2ZYSA 2XUKA 4KAAA 3HACA 1CUWA 1L7AA 1AZWA 3DYVA 4X95A 3A2MA 1E3QA 5AKXA 4Q05A 4KYVA 5AKLA 4A5SA 3STWA 3DNMA 2QJWA 5ISMA 2JGMA 1R9NA 2Q0XA 2AJDA 1XRNA 1HDEA 1E66A 1KU0A 2ZJ6A 1CUIA 4BAUA 1BN7A 4BVJA 5D6OA 2C0QA 5EI5A 5HQ3B 4E11A 3C6XA 2OCIA 3DJYA 1XROA 5DTIA 3W9UA 5AM5A 4KJXA 3A70A 5LIPA 4UFOA 3N2ZB 5JD5A 4LYEA 4DYHA 2WQZA 1XKLA 2BCEA 2ZYRA 3GUUA 4H0CA 4N8DA 4XIIA 5ESRA 5DNWA 2I03A 4J0GA 5CH3A 1LGYA 5ALFA 2Z8XA 2WTMA 1MN6A 2XMZA 3H18A 2VEOA 4UFNA 4BCBA 2AJLI 4RNCA 1JT2A 1G42A 5ALMA 4Q3LA 2OGSA 1DWQA 3HZOA 4K6GA 2PPLA 1X70A 1HL7A 2VJAA 3IIIA 4BE9A 5HCUA 4LXIA 1TRHA 1W75A 2HDWA 1O6FA 2DR0A 2XQIA 1USWA 3I2IA 1XZBA 5T4FA 1QIHA 3R3UA 1H23A 3FLEA 1VZ3A 2GZRA 5ALGA 1UWCA 2CMFA 2RAUA 4YX9A 1OILA 3EQ9A 4DSAA 5KBYA 5ALDA 1PV1A 5BWCA 4KAJA 1X2BA 1XZJA 1ACLA 5ALSA 3F8SA 1U8EA 2XUOA 5LZ8A 4FBMA 3F67A 3WJ2A 1FFAA 1RP1A 2GBFA 4QDOA 1JI3A 4Q3OA 1ZJ5A 1GQSA 2CZQA 1BCSA 1FFEA 1W1IA 2OAGA 2CB9A 1QONA 1UK9A 2QJRA 1DT5A 4J0DA 4ARAA 4W63A 1YASA 3V1LA 3MGAA 2V97A 1QO7A 3GBSA 1LBTA 4N5IX 4AQDA 3WL7A 5D7BA 4H7EA 1XLWA 3WKBA 5AI9A 1WHSA 1ZI6A 2O7RA 1H2WA 2WG0A 5YASA 3QM1A 3JWEA 1QIEA 2XUPA 3GFFA 1UOOA 4A23A 1A8QA 4HAIA 2Y6VA 3WK7A 3V1MA 2XMRA 4ZV7A 4C89A 1BRTA 4WJLA 2WHPB 5IVIA 1IUPA 2WIGA 3QPAA 3T4UA 1MNQA 5BOVA 3GELA 3ILSA 5CURA 3V1NA 3JW8A 4AZ0A 4BTLA 2Y2VA 5LLSA 1JJIA 4X94A 1GGVA 3R3ZA 4DM7A 1CUCA 2OCGA 1XFDA 4P08A 3KD2A 4QLOA 1XQWA 2Z3WA 4DNFA 2I3ZA 3IB3A 2OLEA 5LP1A 3H04A 4OYYA 4L0CA 1CUSA 4S0XA 4CG3A 4BB0A 1YR2A 4Y2QA 3WK5A 1R4ZA 2VF2A 1O6GA 2G5PA 4MJ3A 3H1AA 1P0MA 4QDUA 5CTAA 1JFRA 4L9AA 4FDMA 1EINA 3B5EA 2PSHA 1R9MA 4AXBA 3BL8A 4UHFA 4F5ZA 1UFOA 3D2AA 4X6YA 1OCEA 3OTQA 3VVMA 4C6HA 2QMQA 4OUKX 1VZ2A 4FLFA 1YCDA 3A6ZA 2HRQA 5JADA 4OB6A 2YASA 3G0DA 1MAAA 4QE3A 1ORWA 4FFVA 2W6CX 1XQYA 3ZI7A 4H7JA 3O9MA 4Y2UA 3WWCA 1S8OA 1SOMA 2QUBA 4C4YA 1XZKA 4DSZA 1J2EA 4EY8A 3LP5A 1XRPA 3O4IA 3H0CA 1BEEA 1H2YA 2Z3ZA 4H7HA 3QITA 4X97A 5AK3A 5AK6A 1Q0ZA 2PUHA 4BATA 4UHBA 4FKBA 3IURA 1U4NA 3HJUA 5EHNA 1UK7A 1XRQA 4N5HX 2BUCA 5ALVA 4G9GA 2Z5GA 2XMBA 5ALJA 1DU4A 2I78A 1XKTA 4MEBA 5HKAA 4BZZA 4LHEA 1B41A 4HTAA 1MNAA 5F4ZA 1QE3A 4OU5A 4WFKA 1C4XA 1HPLA 4IQ4A 4M0EA 1YSCA 5ALRA 5HF8A 1DT3A 3D59A 4X00A 2WIDA 5KWJA 1MTZA 4HRYA 3YASA 4ETWA 3W05A 4BAGA 5LKAA 3BF7A 3H2HA 4XJVA 3KWFA 5T4EA 1CUZA 4WCVA 2XMDA 1A8SA 2CKMA 5LKRA 1G4HA 5CXUA 3G0GA 3KWJA 4AO8A 1QJ4A 3FLBA 3VDXA 2GBIA 4UBMA 4KE6A 1MX9A 1UK6A 4ZREA 2WIFA 3ESAA 1MO2A 3O9VA 3OG9A 3ZLUA 1ZICA 4CG1A 2OXEA 1W52X 4ZI5A 2ZJFA 1J1IA 1UZAA 3OM8A 5IH7A 1TK3A 5EHZA 2JBWA 1DQYA 1LPNA 2J3DA 3AJAA 2QTBA 1GKKA 1CEXA 4MYSA 3PI6A 5AI4A 5BV7A 5LYYA 3EF3A 5T4BA 4JUIA 3A2LA 5DNUA 1CFJA 1Y37A 3WK8A 4B9EA 1CR6A 3QYJA 5K3FB 5CXXA 2JGJA 3R3WA 2WLSA 2IITA 4ZXFA 2HRRA 4BC1A 2Z8ZA 5SYNA 1VE6A 5A6VA 3OURA 3QMMA 3BE8A 1WHTA 4UHDA 3S2ZA 2RONA 3AIOA 2XUAA 2BGNA 2WJ3A 2V96A 2EDCA 4DMCA 3C6ZA 4EY7A 4EUSA 1H2ZA 1CV2A 2EEPA 1ETHA 1VA5A 4H18A 4OB7A 4E46A 3WIBA 2WHQA 4PW0A 3VJMA 3A2NA 4UPDA 4F60A 1LPPA 2AJ8A 2FJPA 5A62A 1E8NA 3I2HA 3PUHA 4CIBA 3TEJA 1WCYA 2QXTA 1ZD5A 2PVSA 4QDZA 2GYWA 4GHWA 3I1YA 4HXEB 4I4CA 3N0TA 4DNPA 3FWHA 4K6KA 3FVRA 2B4KA 1QIKA 4IH4A 2CEKA 3CN9A 4MWTA 4Q34A 3RARA 2XDWA 2BUBA 1CUUA 5EHQA 4QA9A 4BP9A 2PSEA 2VJBA 4QWMA 1YAJA 4BDTA 1W6RA 1CUJA 1UOQA 3ZLVA 3G9XA 5AI5A 4X92A 5ALTA 1ISPA 4GEGA 2XUDA 5FUMA 4RGYA 1QFSA 2R11A 4KEAA 2WU4A 2GBCA 4DLNA 1QGED 1EVEA 2PUJA 4IO0A 1CUGA 3AFIA 2C0PA 1XZHA 2OCKA 5JZBA 1T4MA 4ITVA 4ZV9A 2E3JA 3MUNA 4HXGA 1XZMA 4MWSA 1MT3A 5AI0A 4EB0A 2J3QA 4B84A 2DQYA 1YB6A 5DYWA 3WK9A 1CUDA 3B12A 4N8EA 5AKJA 4IH9A 3UUEA 2BGRA 4G8BA 5CT8A 4CI9A 3VJLA 1P0PA 5CH5A 2WFZA 3H19A 1XLUA 2RHWA 5JIBA 3EQ7A 5AJHA 5JAPA 2PM8A 3ZWQA 3L1HA 3OC0A 2OAEA 1FJ2A 3I2GA 1EI9A 2QZPA 2RI6A 4YASA 4F21A 2WUGA 1LLFA 4H7IA 5H3HA 5A7HA 2HA4A 3D2BA 3WK4A 1EDBA 3G7NA 4H7DA 4WY8A 2ACEA 4Y2VA 1DWPA 2WIJA 5AIBA 4Z49A 4B80A 4Y7DA 1QFMA 4GXNA 1JKMA 1SCIA 2CJPA 4EY6A 2HU7A 3H2KA 4EBBA 4AN0A 3LCRA 3FYTA 4W1SA 2WG2A 3PFCA 3RKSA 2AJBA 2XUFA 1BS9A 3E3AA 4FNMA 2XUJA 2VAXA 5FLKA 4DNQA 1XZCA 2R8BA 5AKKA 2C5FA 2JGKA 5FRDA 3K6KA 2G5TA 2Y2UA 3AZQA 3WA7A 1UK8A 3CCBA 4PNZA 2XQGA 2WFLA 2XLCA 1UKBA 1XZFA 2WHRA 2VATA 3WI7A 5ALOA 1VXRA 1YB7A 2C7BA 3WMRA 3WKAA 4B6GA 5IVDA 2HFKA 5HZGA 1EDEA 1JU3A 4XWGA 3IUNA 1W76A 5DTJA 1PJAA 2NW6A 3SX4A 4BCCA 1M33A 1AQLA 1EK1A 3I1IA 3H2GA 3RK4A 5ALZA 3FYUA 2FX5A 5AKHA 1CUXA 1XLVA 2WJ4A 5JALA 4DIUA 5JAHA 1EDDA 2OG1A 5AI6A 3LIIA 3DLTA 4B85A 4J0CA 3QMVA 3U0VA 5HF6A 5HF9A 4UBOA 5SYMA 4G8CA 3VVLA 2G63A 3I2JA 4Y2RA 2DQZA 4X71A 3G8YA 1SC9A 4G4IA 1TQHA 4V2IA 5IVHA 3FAKA 4JH0A 1CVLA 3GA7A 3ANSA 1AMNA 3KXPA 1CQZA 3AUKA 4Y2XA 3PF8A 2XQFA 4B82A 1Q0RA 5CBKA 4B81A 5ALWA 1LPSA 2GYVA 1GPKA 3AINA 4RE5A 2PSDA 3AILA 3C45A 3C5VA 5DNVA 3ZV7A 1QLWA 3F9CA 4U2BA 1HLGA 3FCXA 1BEZA 1HBJA 3DQZA 2WUFA 5AOCA 5AO9A 3DEAA 3KSRA 2XQJA 4W1PA 5T4HA 3E1GA 4X3CA 1AGYA 1LNSA 1EX9A 3STYA 4DGQA 1IUNA 3FSGA 4X6XA 4WFIA 4FHZA 2JIDA 1EH5A 1QIIA 3RLIA 4UBNA 4GDMA 4BCDA 1RWQA 1SFRA 4QNNA 1X2EA 4L72A 1AC5A 1DTEA 4Y2PA 1ZGBA 1TCBA 3DKRA 1QTIA 1THTA 5FV4A 5I7UA 2H1IA 3H17A 4GBGA 3G9TA 2VSQA 4TPKA 3C43A 4H7KA 3WWPA 2JGFA 4UBIA 4ZWNA 3NUZA 2RGUA 2X5XA 3DDUA 3DOHA 3GZJA 2XI4A 4Q3KA 3VXKA 3G9ZA 1CLEA 3FOBA 3QPCA 3WKEA 1JMYA 5CW2A 5ALIA 1XZEA 5ALNA 1XZDA 4Y2SA 1NX9A 2OGTA 1GPLA 4OU4A 1FSSA 4HXFB 2CUTA 2H9YA 2O2IA 3W06A 1LBSA 1OXMA 2K2QB 5AM1A 2ZSHA 2RHTA 2WU3A 3QZUA 5HQ3A 2XQKA 2ROQA 1U65A 2WFLB 1K8QA 3FYUC 4NS4A 4EZIA 2PBLA 4X91A 4BDSA 2UZ0A 1G66A 2DFPA 2ZSIA 4MQMA 1WPXA 4C4XA 3LIPA 4F0JA 3UUFA 3CCCA 1ODCA 1BN6A 4JYPA 5C8VA 2G4LA 3Q8WA 3MVEA 5JASA 2WJ6A 3JYHA 1AX9A 5K3EA 3DL7A 1VA4A 3CXUA 2WTNA 1U2EA 3R41A 1RYYA 3SC2A 2YH2A 4WDRA 4E15A 4NMWA 2WHPA 3BIWA 4J0HA 4C01A 1QIGA 2RIPA 3D2CA 1UKCA 1WB5A 3TGLA 3HC7A 3PF9A 4M0FA 2OQIA 2HA0A 3SWWA 4J3JA 2Y6UA 4AB1A 3WYNA 5ALUA 3CN7A 1BU8A 5ALPA 3MUOA 5JAOA 5JYCA 1QZ3A 4H35A 1Q83A 3M81A 3ED1A 4BE4A 1K4YA 5AKGA 5ALEA 4J0IA 1TAHA 4U2FA 4YK7A 2XLBA 4NZZA 3BIXA 1L7RA 2ZJ7A 4I3FA 5AOAA 5EFZA 5FOQA 5AP9A 3W04A 1R50A 4A16A 2BUAA 1MU0A 4GECA 1QTRA 3D4LA 4C4ZA 5IKXA 3AIKA 3IUQA 3BF8A 2JEZA 3I28A 1FFDA 1ZGCA 2AJCA 1YS1X 4J7AA 2WUEA 3HLKA 2IIVA 1CUHA 4GW3A 2O2HA 3G0CA 1T2NA 5ALQA 4FTWA 4WY5A 2QT9A 4H77A 1MAHA 3R3VA 4B0PA 2EDAA 5AICA 3W9BA 1CQWA 7YASA 4KE9A 4Y9SA 3QVMA 2BKLA 4PO3X 4OCZA 2W22A 4UUQA 4BP8A 4PV7A 1MX5A 1UKAA 2ZYHA 3HEAA 4JEIA 1CUAA 4FOLA 2C5GA 3VJKA 3EBLA 1UOPA 4DMKA 4WDQA 1L7QA 5CT9A 2ACKA 3WL8A 1JJFA 3IUJA 3V9AA 5FPPA 4P92A 4DTCA 5A7GA 3NWOA 4FNGA 3FBWA 3F97A 2GBGA 1VXOA 2PU7A 3NGMA 4AN1A 5LZ2A 2WILA 5E4YA 1R1DA 2FJ0A 1MJ5A 2I3DA 3FNBA 2J4FA 5KREA 3RM3A 3HSSA 1ZIXA 2HU8A 1EVQA 3F98A 4P9NA 4KAFA 1ZIYA 5I8PA 2VTVA 3P2MA 2HU5A 2XMCA 2ECFA 5A2GA 4BTVA 1IVYA 5LZ7A 4EA6A 4QWWA 4AO6A 1CUVA 1FFBA 4FFWA 3M3DA 3R40A 1THGA 4QDTA 4Y2YA 5ALKA 3STTA 4JYMA 5J3JA 2B20A 4X93A 5ALXA 1EHYA 1HQDA 1EXWA 3K2IA 3C8HA 1KU6A 4BC0A 1QIJA 4UHCA 3WL6A 2XUQA 3GROA 1E5TA 1GPNA 5K3DA 3V48A 5AIAA 4X85A 4CCWA 1LZKA 1VOTA 4AO7A 5IVKA 1GZ7A 5DLPA 3ESBA 1VLQA 5AM2A 4UBLA 5AOBA 1BCRA 4J0JA 3E4DA 4QEKA 3X3HA 4K5QA 2H7YA 3BWXA 4MQLA 2GZSA 1JMKC 3ANTA 2BJHA 2PU5A 2ES4A 3BDIA 4IH1A 1N5MA 4PSDA 4OYLA 3PICA 4ZGBA 4PQEA 4EHBA 1EB9A 1LZLA 1GXSA 3HABA 2VJDA 5D3KA 3ESCA 3UMJA 4BRSA 4D9JA 2XE4A 4CCYA 3I6MA 5C8XA 3O4GA 3TJMA 5K3BA 1AUOA 4HRXA 2C4HA 1K5PA 1XQVA 1MX1A 2V98A 3T52A 3DL4A 3AZOA 4GLBA 3G9UA 2YXPX 5CT5A 1QO9A 5EIEA 2X8BA 6YASA 2DHEA 1IMJA 3WKCA 2GYUA 4PSUA 3FCYA 5FPQA 1JU4A 5CT6A 1Y7HA 2QM0A 2VT6A 4E14A 3O4JA 1XZGA 5FDFA 2DCMA 5K3AA 1W4LA 1HKHA 3BJMA 2ORYA 3LLCA 2H7CA 2PSFA 1IZ8A 1Q84A 5AM4A 3HYSA 1N5RA 3D0KA 3D7RA 1CPYA 3IUMA 1QIMA 2IX9A 3DYIA 2JGLA 3PUIA 4FBLA 3FVTA 1NU6A 1VKHA 1ODSA 1K6EA 2QVBA 4NVRA 5FKJA 3OOSA 3QPDA 4HS9A 3DOIA 4C87A 2HA7A 2DHDA 4G1FA 4L3WA 1H22A 5E4JA 4OB8A 3S8YA 4XX1A 3IBTA 3DS8A 1XQXA 5FXMA 4IHAA 3V1KA 3DCNA 4BVLA 2HL6A 1CUBA 1AKNA 3WZMA 3PE6A 1R88A 5AKYA 4UBKA 4CG2A 2Y1KA 4Q1VA 4G8DA 2BFNA 5JATA 4U2EA 4BRZA 3L1JA 1ZJ4A 2VJCA 4FLMA 1LPMA 1E8DA 3F96A 4LIPD 4W9RA 3O4HA 4BBZA 2JEYA 4M0MA 4QZVA 3C6BA 1E89A 3LS2A 2QRUA 3WZLA 1N1MA 2JF0A 4RPCA 5LZ5A 3WQHA 3M82A 5A7FA 3U1TA 5AM3A 2VQ6A 3ZLTA 4B83A 2VT7A 3WA6A 4AMZA 4EY5A 1ZD3A 3QH4A 4Y2TA 3VKFA 2O7VA 4HVTA 1ZD2P 4J03A 5HK9A 4KRYA 1Z68A 5LZ4A 4WFJA 1WOMA 2HA5A 3WL5A 3HI4A 5JZSA 4G9EA 2BAGA 4X90A 3L1IA 1QIFA 3WJ1A 4K2AA 1FFCA 3WLAA 1PFQA 1XRMA 3BJRA 4FWBA 3Q0TA 1WB6A 4BZWA 3STXA 5JAUA 5DJ5A 4BYMA 1G5FA 1CUFA 2H7XA 2D0DA 1GQRA 1Y7IA 4K6HA 2B61A 4EY4A 4AMYA 3NOXA 2QUAA 4FLEA 2P8SA 4KACA 3R0VA 2X76A 3OPMA 2HADA 3VISA 1BROA 2J4CA 1JJBA 3O95A 3EIOA 4LXGA 4I19A 4FMPA 5EIAA 1QIDA 3STUA 3HRHA 4GWLA 1A8UA 1I6WA 5FP0A 2AXEA 1XRLA 1F0NA 1CUYA 5AI8A 2WUDA 2FUKA 1C7JA 5JZ9A 2HFJA 2JGIA 1GKLA 1UT6A 4G4JA 1A7UA 4J0KA 3WKDA 5ALYA 3H1BA 3QBJA 4UHEA 1ORVA 5I9IA 4TGLA 4KE7A 5DYTA 3K9BA 4P93A 4CIAA 2PL5A 4UHHA 3C6YA 3G0BA 4G5XA 4N8SA 5EGNA 2ONCA 3KOOA 1ODTC 1LPOA 1TCCA 1DINA 4CCYB 4OD0A 2DSNA 4W1QA 1N8SA
chains in the Genus database with same CATH superfamily
2IS4A 1Z2PX 2QS9A 2I2CA 1H1LA 1E1CA 4DMLA 5F7XA 2PKYX 3PB3A 1JEDA 3AEUB 3QU5A 3QVKA 4KRXA 3TOZA 1TCAA 4PXAA 5JD4A 3WTCA 1ACJA 1K3FA 1K6JA 1RCUA 1WX1A 1G7SA 2OV2A 5K01A 5L40A 1ULZA 2EC5A 1TTPB 1EK2A 5LOVB 4OQNA 3NZEA 3WX0A 3GBPA 2XNJA 4V38A 4GRIA 5EIHA 3HCBA 3UAGA 1NJ8A 4ZCIA 3TLYA 3DE5X 3HUFA 3NOQA 1VP3A 4PZ0A 3TD9A 1XRRA 3W8RA 1I1QB 2PRZA 3A6DA 5DK4A 3GNQA 3AOEC 1UMDB 2F43B 3AZPA 3MOGA 4MRMA 3SZOA 3T34A 3WY9A 3DHNA 3TPZA 2OCYC 1KIAA 4L15A 2LCQA 1XTIA 5B58T 4E33A 4XQ0A 3R3YA 3UCEA 3WFZA 1ZM7A 1QV7A 4HK4A 1JG6A 4L5BA 4XEUA 2AI3A 4OJQA 4C04A 2FOXA 4KB5A 5P21A 2O3UA 2ZBGA 4JHXA 1E4VA 2Q28A 3N2KA 2JFUA 2QMEA 4ZVKA 1V5EA 3TZBA 1GZ3A 5D5HA 4PTZA 2HHAA 2NTYC 3CX3A 3L4BC 1C9NA 2V3VA 3RYCA 1XTJA 3VNRA 4EHIA 3L7YA 4W5NA 1Z6YA 5D3ZA 3WSWA 4EHKA 2MSKA 4ZT4A 4FWIB 3L0PA 4AZ3B 4EB3A 2HQRA 5J2UB 3TDNA 1FY2A 3WBJA 5IU6A 1UZNA 2BTQA 3BIFA 1PG0A 1CY4A 7GPBA 1NXQA 5CG1A 4OGFA 3SQDA 1YZKA 1GO2A 3RKRA 1J0AA 2YFHA 4D9EA 5KQLA 2EZ9A 3UT5B 4PSCA 1LDEA 3GLTA 2EG5A 4HFJA 1WDMA 1MCZA 4CUKA 3FPLA 4JHLA 2C0CA 1FIUA 3KYJB 4K1XA 3VYSB 3JD1A 2WTUA 2BELA 3I6ZA 5E0KB 1J06A 3WNVA 1P73A 1POWA 1UBCA 2WVGA 1UP6A 5CA0B 5TMPA 2C5HA 3BAFA 3BG5A 1J07A 3BILA 3ESZA 5BURA 3TG2A 3I42A 3RIGA 4L5CA 1RIFA 5GAJA 1XGKA 1WXDA 2WM2A 3QFHA 4IIFA 1ADJA 4MLCA 1ZN9A 4UD2A 3SYNA 3TI7A 4RVDA 1V5GA 3V4SA 3L7LA 1NBMA 3D1VA 5C7YA 4QTZA 4X6UA 4ND8A 2KM1A 4DCUA 1LUAA 5CFPA 3DZ8A 2RGDA 2MMGA 5IDQA 2COUA 4HN2A 4MGKR 4IWNA 1POXA 4F2WA 5JJCA 3M9WA 1SU8A 2XDAA 1EP2B 2ZKIA 2P2NA 2JLUA 2P91A 3L7CA 1FRFS 3PFBA 1TUEA 2FFAA 1WETA 1JVSA 1EVJA 3I8OA 4J2OA 3I83A 3R75A 4GMXA 2YIVX 1PW7A 1WULS 1SRQA 2YYSA 5FL7A 3FYUB 5AXBA 1KQ3A 1NIPA 1FE8A 1WMSA 1Y4SA 4G0QA 1OLOA 2DUMA 2HDHA 1PJ2A 3H5LA 3K0SA 4Q4HA 1WVMA 2XZPA 3E8XA 1U5AA 4YRTA 3B9BA 2CLLB 1U1EA 2WOJA 1GQYA 4GYWA 3WDLA 1ABBA 5AH0A 3T7CA 4MEAA 1M6WA 5B57C 4EK9A 5IT0A 3CRQA 5FWDA 1TKRA 3F6EX 2X0FA 4F7WA 3KT0A 4P33A 4ZO6A 2CHGA 1GADO 2H3EA 3E9EA 2HPZA 5K3CA 3RBXA 3V4VB 5KWIA 1C30B 1DAOA 2YQZA 3QWIA 4W82A 5SY4A 3EIXA 5T64A 2EYQA 3HA7A 2EJWA 3GNSA 4CMKA 5L8VA 3V1UA 4KR2A 3BREA 1KMNA 1VE7A 4E51A 4YRAA 2BGMA 3GFOA 2BN4A 3DZKA 3GOHA 1WLYA 2ZB3A 4QX6A 3E58A 1WVGA 3K70B 2FFJA 3D3QA 2G71A 3KHKA 4OSOA 4PAOA 3AIMA 3LHDA 4KUHA 4RSGA 2QPLA 2XIQA 5DPMA 4BB9A 2WD9A 4XD7A 3ZJUA 5LYJA 1IEWA 3GYBA 1KHHA 4IWYA 1SURA 1FXWA 2EFDB 3CUWA 1VIVA 3KQHA 1KJQA 3ZY6A 3I5YA 4JLUA 5JNWA 2Q1YA 2FZVA 2OZLA 2P9BA 3OICA 4NMXB 4QOSA 3RIHA 4BNIA 1RC0A 2PJUA 2PRJA 5KOHA 2AE2A 2OBMA 3GRAA 1Q1NA 1SZDA 1WEHA 2C3OA 1DLJA 3KDAA 1SD1A 1PFUA 2AEEA 4TRMA 4HZGA 4AJKA 1Z0FA 4N3GA 2FQYA 2OHIA 4NV0A 4HEJA 4L51A 1DX4A 3SQMA 1AGRA 1J8DA 1LPAB 5BSUA 9LDTA 1ES9A 3HDYA 4M88A 4E7OA 3P0HA 5JD6A 1CIJA 3NYRA 2E5FA 1BHSA 4V0SA 5BSVA 3MAAC 3OQMA 2BFFA 2R48A 4B44A 2WKWA 3GLGE 4F3RA 1NPYA 4U2GA 2LE0A 4F3CA 4FYKA 4QQ8A 4DV6B 3W5IA 4FFNA 2YVKA 3Q3HA 3BD7A 4KZKA 4OAOA 5KHOC 1FNBA 3GN2A 1JSRA 5E3HA 4U2CA 3K09C 3GCGA 3SLGA 4W5JA 3SU8A 3H2IA 3F4BA 1JILA 1YDWA 4F6CA 4OX9Y 4I50B 1XTTA 3E7XA 3OUZA 1ZWLA 3P45A 3PGXA 3QKWA 3HFSA 4OI1A 16PKA 1DKMA 4CXMA 4CM3A 1XWFA 4IVRA 3W5VA 2OD2A 1MIOA 1HYGA 2OWEA 3CVJA 4FINA 3IRUA 4K46A 3SEAA 1OUMA 1PL8A 2WIKA 3CCFA 3ETGA 3KNZA 4WCFC 2QOEA 3IVRA 4YUXA 3ADOA 2FH5B 4MO2A 1EUYA 5DYYA 1T29A 5IC5A 1F9AA 4K6CA 1YS9A 5C1IA 4NOJA 4RANA 4EQ6A 3NHRA 4H1WA 2HA2A 3QXGA 2CXPA 2VDNB 4YJ3F 3HE3A 3ODPA 4WX2B 5DM70 3BXEA 3U9TA 4XVUA 1XNQB 3LP6A 1A88A 4WUVA 3A1UA 1PJLA 1ZK0A 2CCKA 4N3BA 3K0CA 1OD6A 4RQAA 3I09A 4PAWA 3MQFA 3V8EA 2WBLC 2H1CA 3T54A 2VVTA 1IXYA 3HS3A 4W7SA 2QKYA 4AUMA 1Z62A 5B55A 1XWWA 1HLDA 1ZESA 4UDXX 2VDUE 4IMRA 1G6OA 2C5BA 5EHXA 4FUQA 5THKA 1AXGA 5M3BA 5K4HA 1B73A 1GNPA 4EJMA 1P9RA 3LOUA 3LK6A 4CKWB 4FMCF 3VSBA 1GKIA 1WB4A 2H9AA 1WKBA 2L19A 4DA4A 4K03A 4QEDA 3B70A 3LUGA 4Q48A 4X7BA 3CZPA 4YV1A 4MCJA 2PWZA 2OY0A 2X9NA 2PX6A 1KY2A 1DUSA 1P3JA 3CJTA 1BW9A 3O91A 2ZBDA 3T5PA 4MW1A 5CMLA 1PT6A 2ZS9A 4ZQHA 4LKOA 4DA8A 4H15A 1Y5MA 3UJ9A 5C5CA 4RDCA 4DBVO 1SVIA 3HYTA 3EFOB 3UV7A 4ESEA 5JDIC 1PJ8A 2B9VA 2XNCA 5JANA 3GJQA 4Y1RA 4I50F 5B7GA 3RFUA 1MAUA 1T2EA 3DOJA 3G23A 1H2BA 3D8NA 3M33A 2G72A 2RGCA 3LYLA 4WA8A 2AK2A 2O2XA 3DEIA 2HY7A 5D84A 2LV8A 1ZD4A 1Z5GA 3IDAA 5EXXA 5IUNC 1R3DA 3WWEA 5FQOA 3JARA 3CLUC 1T8YA 1GAWA 2ZSUA 3SKYA 1FTWA 1H2XA 2Z4TA 2ZUCA 4TN1A 4ARSA 1UBGA 3PHJA 4TTVA 3DV0B 4GG1A 6AT1A 3FI0A 2ODPA 2DCUA 4YPVA 1Z28A 1QC5B 2E49A 3O2SB 4UUMA 2AT1A 3H5TA 4AIRA 1JN0A 4R1UA 1VPEA 2IZ1A 1P3DA 2JW5A 4OMFG 3DVRX 5DLEA 2UYCA 1KMHA 4R84A 3RADC 3AL0C 2JGAA 2ZUVA 2VO1A 4S2EA 4LE2A 3TLGA 1BMDA 4ZHQA 4P0QB 1CHDA 2CMDA 3DFIA 4UDOA 4KIJA 4ZHQB 2R8PA 4WVFA 3B7GA 1ISJA 2D5LA 1EAYA 5J2UF 1D07A 4TLBA 1L4MA 5H4HA 4O1IA 3C5WP 3EIQA 2XT0A 1KI7A 3N2GA 4YP6A 1WXWA 4YUZA 1AURA 4WACA 4PNHA 4KV9A 4WNYA 2JLXA 2FK7A 3DMGA 2NXWA 2JVKA 5TNXA 3VC3A 2HF2A 2VZ9A 4UTVA 4KYVA 4IAOA 2FP4A 2HXGA 5I9LA 2Y99A 1GUZA 2IPLA 1NG1A 4KPUA 4YAGA 2XB2A 2HHCA 5DNAA 4HAVA 3STWA 1ABFA 3SJAA 1MXFA 4DADA 521PA 1EDZA 1IOVA 2OO3A 1JG3A 3BMOB 1KOJA 1MGPA 1S2MA 1N9GB 2JGMA 3GPBA 4WESB 5AHOA 4EARA 3PHHA 2RHHA 1NQUA 5DI3A 1GLNA 4L78A 1RE1A 721PA 3ICEA 4NYIQ 4LA4A 1TECE 5DI3B 1B14A 1PLKA 3OUTA 4QQKA 1E66A 2CHVA 2JLRA 4QXQA 1DHTA 5IH3A 2PXHA 4ZRNA 4URVR 2ZXEA 4LBWA 3NRJA 1HL3A 4BVJA 1L3IA 4AU1A 2HT6A 1QZTA 3N8IA 4GYJA 5EI5A 2CHFA 2B7LA 3QTBA 4RF3A 4RKRA 1A77A 3UK6A 4Z1MA 4E11A 2NO1A 3AONB 1YJ5A 1G5TA 3K2BA 2C1EA 1OA1A 3F3YA 4Y0VA 3TW4A 1TKBA 5DTIA 2XZDA 2X8WA 5KTKA 2W4QA 4AC9A 6REQB 2P7IA 5AM5A 1YDFA 3LRPA 1XEXA 1O96B 2WM3A 3W5SA 1JQBA 1E2DA 4JC4A 3TFWA 3TL2A 1DCMA 1M8JA 3LAWA 4D81A 2HQBA 3HCDA 3GJTA 2DVMA 2TECE 2BE9A 3K0CC 3R0QA 4N3AA 1HEIA 4N8DA 3VUFA 3G1UA 1Z8HA 1I80A 3JQEA 4V3CA 1V11B 2G1JA 5TMEA 1NN5A 4LE0A 3JVUA 2WAYA 4LECA 4P34A 1OZ0A 2I03A 1NBHA 1RE0A 2O0KA 2V8BA 5CVJA 3ZVNA 4N41A 1XTBA 1LGYA 3T1YB 5BWOA 1P45A 2Z8XA 4LC0A 3W3AD 2XGGA 2IUEA 3QLVA 1YMQA 3HZHA 2HEIA 5FOVA 1OY1A 1NLUA 5F1YA 3TSWA 2ZYVX 3AUTA 2Z5VA 1GCIA 1QVAA 3RH0A 4UFNA 3IPYA 1Q2UA 4BCBA 1XL1A 1U0GA 1OYWA 1E20A 3ONFA 1WTCA 4JBXA 4KQFA 4XH9B 1N8TA 1JTFA 4OQXA 1RHUA 4FZVA 5A3QA 2EZUA 3TR0A 3T3PB 2HK8A 2HO5A 1R6AA 4FGJA 4O4LF 1V8OA 1C9MA 1MJNA 2CN1A 3ZWXA 5JH7A 1QQAA 2R6DA 5DO9A 3VZRA 3PNSA 4G4SO 4EG6A 4BE9A 4JVMA 1Y4UA 4LQLA 4MIOA 2QW8A 1IG3A 3ZHYA 4IICA 2PMDA 2WF5A 2IHJA 1LBHA 2FYTA 2HCRA 3H65A 1RHQA 3TUIC 1W5TA 2QR3A 5C5IA 3Q4GA 4M8KA 4IDHA 5I9NA 2P78A 2X4GA 1KDRA 3RROA 1K7XB 5FNVA 2OBLA 2BP7B 1QJCA 2DR3A 3RBVA 4E31A 2E5LB 1SJ9A 4DQUA 4M22A 1USWA 3I2IA 1Q21A 1XZBA 3K35A 5B1SA 5IASA 5TPWB 3IJ5A 4IJWA 4WCFA 1LSOA 1C0KA 1C8BA 2IP2A 3FLEA 3F7TA 4G36A 3O8OB 1OI3A 3RSCA 2YDYA 3S7TA 2IOQA 3OH8A 3RR2A 3ZWNA 1UKEA 4KTVE 4NNPA 4YX9A 1A0OA 3MMNA 4B7UA 2AOXA 4ZYZA 3E03A 4J90A 3JZDA 4NJOA 2OZKA 2P9QA 3SNHA 3EQ9A 1OLUA 4EP1A 3QXSA 1E1RA 4KQ2A 1BFKA 5KBYA 5ALDA 1RRGA 3NUQA 2OK7A 3GA0A 4J43A 1KXZA 1SU6A 4TS1A 4KAJA 5HBGA 3RRBA 5BWCA 4US1R 4U39A 2B0JA 3R8CA 1ACLA 1NY6A 1YBFA 2ZWOA 3A25A 3F8SA 1CY7A 1U8EA 4FBMA 4Z3DA 3C3MA 3LVBA 1VCIA 3U4IA 3MNFA 2BY4A 3PT9A 1YRHA 3WJ2A 3ELBA 2Q6TA 4Q3OA 1D5CA 1DBRA 2I34A 5BV2P 2IS1A 1EFRA 1GQSA 2CZQA 4G5OA 1BCSA 4P83A 1E59A 3FROA 4RIFA 2WM9B 1NFRA 3GHHA 1YRYE 3S6JA 1ZAYA 2YWGA 1K7EB 1U2PA 1JAHA 1E3WB 3QVUA 3PUKA 5LP6B 2SECE 1P1KA 3DUFA 2A5DA 3I72A 5KZMB 5EYPB 4MKZA 5B1IA 1LFAA 2JCBA 2QJRA 3T4XA 1KFCB 5JI2E 2IUYA 5D2CA 4JLVA 1S1MA 1XAIA 2ZTHA 4IDFA 2QWXA 1YASA 5NLLA 1NVMB 2FZ4A 1P8AA 3V97A 3D8HA 1CB0A 3ACBA 2O2EA 3T5AA 3GQVA 1RYEA 2CJFA 1W36C 3AO0B 1G7TA 1M1ZA 4LJKA 4UHKA 2FHSA 4FMBB 2V97A 3SD7A 2HMYB 4GX5A 3ZXUB 2A1UB 5DBIA 4DBLE 1XPRA 2XWBF 4HB0A 1DAIA 3SBEA 3ZHXA 3Q9UA 1XJ5A 4PGHA 1TYCA 3WKBA 2ZIXA 4U6SA 3RVQA 4DXAA 3D31A 1WHSA 3QP9A 1V6CA 3O7MA 4DIBA 3KVOA 3KKKA 1J2RA 1KF0A 4IVQA 4Z9FA 3FFWA 3UGKA 2L69A 3KYIB 2KJQA 2X1LA 4CEJA 2IHVA 2YIMA 3MD0A 4RABA 4QJ3A 5B36A 1VYVA 2NUAA 4RPKA 4DMUB 1K8XB 3JWEA 3MT0A 2ZZMA 7MHTA 4RYLA 4A6PA 2BISA 1HE8B 3C3DA 1QIEA 4KVGA 2YWJA 1PL6A 4J07A 2HWKA 4G65A 1NPDA 2W2TA 3A2KA 2D4HA 3U80A 1M5UA 2GI4A 2JFXA 4HAIA 4B4WA 4KP7A 3W1WA 2IH2A 2YOGA 1T4CB 1ZN2A 1KZHA 1I0IA 1PBTA 2FI1A 2H4HA 4IJUA 3B9QA 4JJFA 3OZCA 4DPMA 1TEVA 3DQPA 4MR8B 3FR8A 1GGNA 4CR6A 5JUWA 3SDZA 4NDZA 2CNLA 2XJ4A 1MO3A 3CNEA 3Q3VA 4KSCA 4ZV7A 4B4KA 2PFSA 3RTEA 1PR4A 1RLIA 2NP7A 3KLNA 5TC4A 2GUWA 3WC4A 4WJLA 3R5KA 5IVIA 2O57A 1RYDA 3QPAA 1A96A 1KJJA 4P84A 4PPNA 1RIIA 4CFYA 2DHRA 4RJ2A 4DCMA 3ILSA 4PO1A 1SHLA 3L8DA 3KVRA 1GGJA 5DK6A 3HYNA 3V1NA 3MTDA 3AF3A 4W8GA 3FPGA 5EJIA 4BTLA 3I45A 3PR1A 5JXGA 1OFGA 2WA2A 1ML3A 1U90A 2ECQA 1Z2OX 4X94A 4YPOA 4XVQA 2P6NA 5D1NA 2AG8A 1JXOA 1L5YA 2X4LA 3BC1A 5C1DA 5LMCA 1E2LA 3UB4A 1GTJ1 1VL5A 4C5BA 1T2VA 3BH6A 2FXVA 4UCXA 4RHXA 4S1VA 5JMOA 4EFLA 1Q6YA 1J9GA 1ELOA 2AX4A 3AUJB 5K2OA 3WTBA 3U81A 5JECA 1D4FA 2QTMA 4OYYA 4L0CA 4QQNA 2VYQA 1G8GA 3A11A 4O4HA 3BCUA 2JI9A 3KALA 1ZZEA 2W2MA 3VR4A 1QAMA 4BB0A 5KSZA 1X8KA 2JAQA 3EWNA 3G89A 4J3FA 1R4ZA 1V7ZA 5DTRA 5BUSA 3PDUA 5I6DA 4XR9A 1ZINA 2WE8A 2GASA 1Y7PA 3ZJ5A 2G5PA 2I22A 3ZY5A 2RGEA 2V6FA 3AIIA 4F3NA 4MVJP 4ZJZA 4IV5A 3RRYA 3H1AA 2VPWA 4U6QA 1U3FA 4DV1B 4MWCA 4JKIA 2ZIZA 4PBTA 2RE8A 1KP3A 4R1QA 3U7GA 1H4VB 2W7TA 4U7FA 4JSYA 3B13B 1JFRA 3OX1A 3SHVA 3UAYA 1IAQA 4L76A 1QVWA 4C0AC 3C3CA 2D6FA 1EINA 3LDHA 3LHSA 4JASB 2OQRA 1F14A 5JNVA 2A0YA 1VP9A 1EK5A 3C4QA 2PMWB 3L4KA 1M2OA 3CZQA 1RCTE 1CJUC 2RSLA 3AP3A 1WBBA 3BH7A 4MV7A 1INLA 3UHFA 3CE9A 4UEQA 4CWAA 4UHFA 3ZYCA 3SS9X 3IIKA 2PKEA 4X6YA 3OTQA 3RS7A 2VJYA 4CNQA 4GI5A 4DRZA 3AVOA 4QFDA 1NWCA 4OUKX 1VZ2A 1OKKD 2VHCA 5BUZA 2DP4E 3I92A 2Q9CA 2XY4A 4P1ZA 4A03A 1Z22A 4XX0A 3L2OB 2QX7A 3LDGA 4TYMA 4Q9HA 5TS2A 4OTZA 1LF0A 2HHLA 2JFWA 3SXPA 5TQ0A 1UBLS 2H6EA 2BT4A 1CJBA 3HDTA 2JH3A 3JVEA 4H0NA 3R7AA 1UFRA 1TVKA 5E7JA 4RQTA 1Y33E 3DJFA 3MHTA 1VYUA 2M9MA 3MT8A 1NTRA 2JB9A 3QLJA 1JS1X 4MUNA 1I4OA 4MYTA 4XOUA 5I9TA 4BFLA 3COWA 1CDZA 2O3TA 3EG9B 4ZGGA 3HBAA 4H3HB 1M2VA 4F85A 1ADBA 1Z6QA 1KR5A 4TLMB 4HF7A 3T12A 1HQYE 3T8YA 4BHTA 4L75A 4Y2UA 3UN1A 5BYBA 4I81A 2QTNA 5EJ2A 1Z3CA 1H1DA 1RYMA 4PR0A 3LBFA 2Y3IA 1U3VA 1PU2A 1YKFA 3L06A 2QSUA 2BFBB 2C92A 1T1EA 1Z5PA 2C9BA 1N7HA 2QE7A 4DCOA 4EY8A 1XRPA 2PG3A 4HI0E 1T8UA 5HQTA 1HDYA 4DV7B 3O4IA 4YIKA 3GLFE 3O75A 3WBFA 3IKTA 5CAEB 1AXRA 1SHTX 1Z29A 1FL9A 1L4NA 3LCVB 4H7HA 4ACBA 4OGWA 1U3GA 1PE0A 3KFXA 3JQCA 2CBXA 4GX1A 4M1SA 1OZGA 4DLTA 5JY6A 1COWA 1FP4B 1K9VF 5AK6A 1ZM9A 1E2PA 3DZDA 4BATA 2D2VA 1F1JA 1AQ6A 3E9YA 1FQWA 3NTQA 1U1GA 4Y6OA 1RXVA 2YYAA 3SZ3A 3UV6A 3C3EA 1GU0A 4I2NA 4MV3A 1U63A 1MC5A 1U4NA 2VUSA 1TCVA 3HJUA 4M8LA 4YFVA 4ZOEA 5EHNA 3VO8A 3IBYA 4BIMA 1B8PA 1UK7A 4KDCA 2PMBA 4N40A 3IP1A 3UFBA 1DC8A 4N5HX 2QTGA 4NYIR 3VR6A 5K0TA 3ZOZA 4G9GA 4UU8A 3IT2A 2XMBA 3DGEC 3PPYA 5HKAA 2J0SA 1JLHA 3NONA 1GIAA 2I1QA 1TVEA 3A4NA 3GPDG 4YCMA 2CSXA 4KXNA 3UIEA 4HTAA 1P8JA 3WHPA 2O07A 3HDVA 2ZS7A 3VNBA 5AW8A 5CK4A 3L8YA 2G6TA 3CTMA 3HNPA 5IDWA 1RWVA 4M0EA 3VOAA 5J63A 4OHWA 1CJKC 2B7CA 2FK8A 2IGBA 2O05A 2QUKA 2REXB 3EOAI 4NWIA 5FJJA 5BSMA 2PZLA 2VP4A 3D59A 1ZMRA 4DCGA 4A4DA 1X8LA 4DWWA 1C80A 4ETWA 1V26A 5JNSA 2JA1A 2JEOA 3W05A 5LKAA 4UU7A 4LF9B 3H2HA 3UAWA 4BX0A 1Z45A 4FUTA 1M5TA 3GFGA 2X0NA 3RHFA 5SV2A 3RWOA 3CEPB 4EMBA 3LWZA 2LZ0A 3PNLA 2UZIR 2BFWA 3AWDA 4BX2A 4YAUA 1NBOA 3ZHZA 2C8VA 3CX6A 1AGPA 3TQQA 3G0GA 3O93A 3NALA 4AAYA 2ZIXB 4YI5A 1MP0A 3CLSC 3F0TA 3DMFA 5KNBH 1XJWA 1VJCA 4GPZA 3NGLA 1QJ4A 2R7LA 1R0LA 3ADKA 4GYKA 2CUKA 1G19A 4HBGA 3VDXA 4TYQA 5LQKA 4K81B 2O5RA 2XH8A 2ASEA 4TS3A 5HRCA 4MB2A 2NAFA 3BSFA 3E9DA 2IYLD 2GJ4A 3PT5A 5FBVB 1RADA 4ZK6A 1UK6A 1NFFA 1TT5A 1UEXC 5JU6A 5A9SA 3WV4A 2JIMA 3A1EA 1H4QA 4LV5B 4B5LA 4RYDA 1MQ9A 4C3ZA 1Z73A 1UH5A 3O9VA 1M10A 3EGDB 3WGZA 3MGKA 3OG9A 1E3MA 3ZLUA 3EVEA 4LJYA 3KQTA 3VMMA 2DLNA 4X1KA 1OBCA 3MIZA 4OIFA 4CG1A 1CY0A 5FB3A 2ZJFA 5JJBA 4M7WA 4ZT2A 1VM6A 1JKJB 3OQHA 1F4VA 2YQ4A 2O3QA 1NBIA 4I8IA 1RHJA 1QQTA 1F0KA 3OM8A 4CV1A 1J2JA 1J1ZA 4XWWA 4K9LA 3GEDA 2C2WA 2X5JO 3WYCA 5C53B 4X41A 2FKNA 4ZHSA 1LPNA 4JBYA 5E3JA 1JFVA 5C46F 3VOSA 5M2QA 2E4UA 2W6NA 5U4XA 2CDRA 4NMMA 3NHKA 1H5QA 1EP1B 1OXUA 2ONKA 2NX2A 1YBHA 2PL1A 3DKIA 3PI6A 4N7BA 4XI9A 2CY0A 1G6HA 3G9QA 4NPCA 1E7YA 3S0JA 5F3WB 4DWVA 4FSXA 1T0HB 1ZZGA 2B34A 1E2MA 2CNWA 3II6X 3Q98A 5T4BA 5DCLA 2OOSA 2QQFA 1D0SA 1MFPA 1QXSA 1S8NA 3EA0A 3M2TA 4IJ5A 4EGSA 5CFZA 2ZI5A 1U2DC 3WK8A 1ZXBA 1QB8A 2MMCA 3LBAA 3PG5A 1L5NA 2C00A 4DIKA 5CXXA 2FY8A 1QH1B 2HPHA 1UANA 5SZJA 4EUFA 4XASA 2YR0A 2XMPA 1V25A 2CLKB 4B6OA 2IITA 5T8KC 5KNCD 3CKKA 4ZXFA 1TK9A 2XR1A 1H85A 3RU3A 2NYAA 3E9RA 3BHIA 1DFHA 1BMTA 4BC1A 2O6HA 1BHO1 1C4KA 2PBRA 2PKXA 4OF4A 4WKCA 4AZWA 4R31A 4IG9A 2P3QA 3EAGA 2D2IA 4RK1A 3WFIA 2C2HA 3QMMA 4MPDA 3PE4A 4PICA 4TT3D 5K45A 1NOIA 2DM6A 1YI1A 5LMUB 2GTPA 2HSJA 5DNCA 3O90A 3IEVA 2D1FA 1O9BA 4UHDA 5EOVA 1EEXB 4H60A 3RG8A 1B26A 2FMKA 5IFKA 4DJTA 1ZJJA 2B2CA 5EZSA 1AUXA 1QH9A 4Y9DA 2LBPA 3VPSA 1F2UA 1O4WA 1WIWA 2I4LA 1TVCA 2NSDA 4H0FA 4I1IA 4UE3S 5FV7A 3T4PA 4I14A 4RTJA 5FWYB 3FFXA 4DMCA 1Z8DA 3C6ZA 4ABTA 1QZUA 4KQJA 1MZPA 2YMQA 1H05A 2J30A 3DOFA 4B74A 4D0LB 4DB2A 3I76A 5CBPA 3VU3A 1H2ZA 3TECE 4CEIA 3SLRA 8MHTA 5BMVB 1QFYA 2DUJA 2HRBA 3GUZA 3OM0A 5ESXA 1PR5A 1ETHA 3L8ZA 4GL4A 4H18A 1EJ6A 2HMVA 3N1UA 3C85A 1N7JA 2E6KA 3R09A 1C3JA 1CDEA 2Z0MA 1OHHD 4JOSA 3R9IA 4KMOA 5JXJA 4E5KA 2H0AA 1P4JA 4LYJA 4NBTA 5TQ0B 4F60A 1SQGA 2H9IA 5BPFA 2DT8A 1FLAA 2IP1A 4XCXA 4MS1B 1SQ5A 4CIBA 5JY1A 4E07A 2QXTA 2PVSA 3UA4A 4J7CA 4QPDA 6ADHA 3DM5A 4HXEB 3IOMA 4FFSA 1M2VB 3FDJA 4C6SA 1BNCA 2CFCA 2ZVJA 3CS3A 5E7MA 4DNPA 1JSLA 5E6SA 2V5AA 1QHIA 4G8JA 1BGWA 4IIVA 4H17A 1EDOA 5HSGA 2B4KA 5DOVA 4AJ1A 1R16A 1OAOC 1JTVA 4PRYA 3GLUA 5ITSA 1X13A 1IZZA 3D64A 4MWTA 1AZSC 1JHOA 2A5FA 2P68A 3CH6A 3ZWCA 5JS7A 1AF7A 4B71A 2XDWA 5ARDA 1Z25A 3IMGA 3NEJA 5CLJA 3Q10A 1CEQA 1RZ3A 1CUUA 2O8VA 2Z2IA 3JQ7A 5EHQA 3PEWA 2J8ZA 3VR0A 2PSEA 4QWMA 1MA3A 2BFMA 3T3HA 3ADDA 2ZWVA 3QVSA 4B2YA 3FZYA 4L16A 4PAGA 4FGSA 1ZR2A 1O5TA 2OUKA 2W6PA 5GONA 3G9XA 5KUTA 1XK7A 5JRJA 4QPPA 1EMDA 2XUDA 5FUMA 3SF8A 5LDGA 3KOZA 2Y1GA 2H7VA 3WICA 5KQGA 4OLBA 4P4SA 4B47A 4M0UA 5INTA 5KKAA 3GEBA 3UMFA 2C9OA 1PR0A 4KN9S 3L7MA 2XOXA 4ER5A 2UUAB 4BN5A 4N7MA 2FN3A 3WLHA 2HIAA 1H8HA 5CYFA 5BUQA 4FJ1A 2PUGA 2J0UA 1JR6A 1MT0A 1Z74A 2ZRFA 1Y48E 3OT1B 1F3LA 4G0OA 4ZV9A 4Z1OA 1I0LA 2XCTB 4H3VA 4I4TF 2KBEA 2YW2A 4N5NA 1VHDA 1DAFA 4UUNA 4MWSA 2C84A 3RAEC 3RASA 4B84A 2VBGA 1C8LA 2BGUA 3GJ4A 3VR3D 2C8KA 4LY0A 2PRIA 4OMUA 2R66A 1Z7EA 3EUAA 4Z4HA 4NCKA 2XAUA 3JTEA 5TDHA 2DPGA 3RS8A 4R71A 1CUDA 2ICAA 3N8HA 3Q7TA 5F1PA 2PMCA 4FEAA 3FAZA 3ZBQA 5F76A 4LOAA 4UVDA 5KYTA 5KMGA 2J9GA 4N8EA 3O4RA 3UUEA 2NSHA 3CLUD 2J7KA 2WAXA 4A2CA 2X23A 1W34A 4Q66C 4JJZA 5DXFA 4TYNA 3HXOA 5LBIA 3VJLA 1EBUA 1JPUA 1JRLA 3I0MA 4BMPB 1XVLA 4HWGA 2CFTA 2W8BB 3MS4A 1WSWA 2X1MA 2J6HA 1G291 1G1AA 1CERA 1XLUA 1U4OA 2RHWA 5DX1A 3EQ7A 2ZZNA 1PNRA 3DMRA 3W3AH 5EWMB 1C9DB 1R6XA 1GPH1 2AC7A 1JH9A 1NMXA 1UBUS 3AK4A 3L1HA 4WSOA 1U3TA 4XGIA 2J0VA 4R2LA 2VRWA 3RT9A 2PUVA 3OWHA 4FDUA 4G2TA 4MV8A 4I6GA 4WV3A 3LRXA 4O8ZA 4WBSA 4MAMA 4JCCA 3QVGA 1YS7A 4HQLA 1EI9A 3OP4A 2GCEA 1FFWA 3KLOA 1BG6A 4PYOA 3R7WA 2C7PA 2PIDA 2QZPA 5KYVA 2ETXA 2RI6A 3GRKA 5LCXA 1MMFB 4F21A 5LWHA 3L92A 1O8BA 3IVXA 1LLFA 4H1UA 4H7IA 4PFSA 3EVAA 3D2BA 4PZYA 3WK4A 3G7NA 2IIPA 1OC4A 5A4MS 3ESRA 4PGMA 1CRZA 1BRMA 2F9MA 3DFKA 2B4RO 4IIHA 2WIJA 2BF4A 1JEQA 4L4ZA 2E4XA 4F6LA 2ZETA 4N0MA 2NZVG 1JKJA 3QYPA 1EVIA 1N2CE 2WV9A 4KKVA 1LEHA 3FHOA 3RRZA 1SVLA 4UPVA 3GLIE 4Y7DA 1ZVJA 3RUAA 3PDJA 4GXNA 1YVPA 1J8FA 2OSBA 4R40A 1WCWA 4GKAA 1N3IA 1UJ2A 4ENTA 3IQHX 1BXRA 4OK6A 1RJWA 2HU7A 4UNSA 1PFYA 1VPVA 2OBYA 3UK1A 2VNHA 4OXNA 4PONA 3PIIA 2JH9A 5FNVF 4D3FA 4EBBA 1M0WA 4HFNA 3OWXA 3MYRA 1SC4A 1VGRA 3UW3A 5EXTA 5BNZA 3UHOA 1TOAA 4GR5A 5LQCA 2IBTA 2G4VA 5CJ2A 4RHCA 1QK5A 3N59A 4J1QA 4E5MA 2DPYA 4WECA 2PD6A 3M1IA 1IHPA 2I4NA 3CLRC 4DWOA 5C8YA 4O4IA 3I6BA 2P90A 4YMHA 2HWUA 4CVNA 1BIFA 1AKWA 3OKPA 2JGKA 1WB9A 2AQHA 4CV0A 1TCUA 4JV5B 1YQ9A 2Y2UA 2BDUA 4WOCA 3UMCA 5FH9A 3ULKA 2Q2OA 2W93A 4NENB 1UK8A 4MW9A 4U0KA 4P81A 1TM3E 1QOQB 1N6HA 1FZQA 3QVXA 5BNFA 1EE2A 4P3PA 4MVCA 1IZ0A 2BSXA 1WY5A 2XLCA 2PZKA 2EGGA 1BDBA 4QHTA 4XUCA 1RXIA 2W0SA 5EVJA 3SOZA 2VATA 1GHTA 1TM1E 3CM0A 3U48A 5L45A 3EX7C 3ETLA 4PGFA 4Q4HB 2YIDA 2QX4A 2D5BA 3MJRA 3HSKA 3K4HA 3LCJA 4HADA 3W79A 3OQVA 2IU6A 4E32A 1XR3A 3WMRA 3WKAA 1ZUNB 5LBTA 1QVRA 3WMGA 3EGWA 4M1QA 5IVDA 4B6GA 4C30A 4LRYA 4JYCA 1EDEA 1ZOLA 5LIRA 2B4TO 2XWQA 4Y6RA 3RUHA 4D5EA 5CDHA 2AMLA 4Y9RA 1AS3A 4ZODA 3PRHA 1R9JA 4PHCA 5IX8A 3L9XA 3SX4A 1M33A 3BFPA 3AI3A 3HZZA 4R3UC 3H2GA 4RK5A 1D0VA 4EG0A 1JIKA 1B8OA 3N3AC 3OZRA 2HCTA 4K7JA 3ZBTA 1XAGA 2CHQA 3LUJA 1CUXA 2NO5A 4W8OA 1KMHB 1TD9A 4GPEA 1XLVA 2WJ4A 5JALA 2OKCA 4TT8A 3DLPX 4HLCA 5B5SA 3BWMA 2OG1A 5EQFA 4X1YA 3VYRB 5K8JB 2YX1A 4DRXA 3TRFA 1V9LA 4M7OA 3L84A 2CCGA 2VWHA 4KMMA 1B2RA 4XYLA 5CFOA 1TPYA 4IW3B 1M74A 3QWAA 1GQOA 1FU8A 1JV2B 2R86A 4OQQA 3EH2A 3MWDA 4QYXA 2P65A 1TJ4A 2GCNA 1IBMB 5KSYA 4LSWA 1IL0A 3MWDB 4C3UA 2Y1CA 1V1MA 2VT2A 4NCIA 3KPWA 2D5IA 3G8YA 3PLNA 5LWQA 4JP5A 1D5WA 1GVNB 1DCKA 5IVHA 1F9EA 1O77A 4N0PA 1FDSA 2VDWA 3KAJA 1GTL1 2CFOA 4MTLA 3D1LA 3PEYA 3FAKA 3OJLA 1YQDA 4LPKA 1PJCA 4C6RA 4F3KA 1RBYA 1CVLA 1Z0KA 3D7MA 5B3LA 2JG3A 1G55A 3E23A 1O0CA 4WZZA 4XGNA 1YT5A 4COKA 4D4MA 1GPDG 1NR1A 3KXPA 4A82A 2Q8PA 2VBFA 3QEAZ 1GV1A 1ESNA 1JIVA 4WGFA 3RS9A 3OKAA 2NPIA 3LQ1A 3P52A 4I99A 4JXKA 5EIBD 3SC6A 3SYLA 4COOA 4D57A 3B9PA 2QW0X 3KXLA 2FEXA 1Q0RA 4PN3A 3FRIA 3QEMA 3GT0A 5IUKC 3T1OA 3UJNA 1Z34A 4KFSA 3D4IA 4XGRA 1T9AA 1N92A 3MLEA 5TE9A 5TXGA 5HUQA 2C83A 1X7XA 1XEXB 1DVRA 1LPSA 2KE5A 1CR1A 2ZDHA 3JCZA 4FGLA 4Z9AA 1X86B 2UVDA 1UWLA 4X1OA 1SKYB 3RFTA 3RSZA 4HNHA 1E5QA 3DXFA 1I3NA 2B2NA 1TT7A 1KMQA 2DJ5A 4ZN6A 1X1AA 3PA6A 5JHHB 1HE1C 3PPVA 2OV6A 5JSHA 6NULA 4TQUS 3C45A 4UE6A 4BNUA 3C5VA 1ZMXA 3K1AB 2HF8A 3DKVA 3R3JA 1CZRA 1TRKA 4LBZA 4UMDA 4AG6A 5DTQA 4ER7A 3QBTA 5KPDA 3N0XA 3ZV7A 5IWAB 2P3OA 5J4VA 3PE3A 4DPKA 4UXIA 4V3BA 4L8FA 2GLXA 5FJIA 3TNYA 3VSCA 5G1NA 3OX3A 3SZUA 5A5DA 4U2BA 1SCUB 2Y1EA 4YP0A 3EZ2A 1A8PA 3PC6A 1EXVA 1MA0A 3FCXA 3P4UA 4H27A 2RKBA 1CD5A 3TRKA 1V9SA 2X13A 4H6XA 2WUFA 4R8SA 5AOCA 5BR7A 2GBPA 2AOVA 2GHTA 3DEAA 4HLUA 4LRTB 5J5VA 3WE7A 5ARBA 5A0VA 3TW0A 4W1PA 1FOEB 4GOLD 1PZFA 2YS7A 3DBHB 3QX7A 5T4HA 4FD3A 1T26A 5BQFA 5JCPA 4MPJA 3GPCA 4I0WB 4BFVA 1SVKA 4UASA 3RANA 4CLRA 2PD4A 2AC2A 3F8WA 3JWPA 3RYIB 2QX9A 2A8YA 4KQXA 2VP3A 4TV9B 2PIAA 4FFOA 2R8ZA 1SCDA 4GMDA 3RYIA 3VV3A 5FWNA 2GFQA 2NU7B 1OOEA 4ZYLA 5EA2A 3X1YA 3MFQA 2XXBA 1G5RA 1YXMA 2X5NA 3B82A 5HBRA 3RGGA 5AVXA 1FUIA 1X77A 1EBFA 4WFIA 4X62B 3S2EA 3I4CA 4PO9A 5TMBA 1FNSA 5DIFA 1QKJA 1E0DA 4ZP1A 1W46A 2ZI9A 5TLSA 4JBNA 3PR3A 1GA1A 4R98A 2RGNC 1PJRA 4PLPA 1RWQA 4BV3A 4TKVA 3RHSA 5IHPA 1JLSA 1NOKA 4LRUA 1IQPA 2M6LA 1X2EA 3WDKA 1AC5A 1LSUA 2C57A 4KNVA 3H3XA 1N25A 2N1BA 2QK4A 1ZGBA 4IIGA 4Y2PA 5T3YA 2A78A 3IEKA 5SZKB 1TCBA 4KI0A 2CC2A 4RZHA 5HMLA 4BV8A 4GIBA 3BMOA 4DCSA 3T1HB 1QTIA 1THTA 5FV4A 2BEVA 1LLDA 5C31A 5FD8A 1ZJWA 2V7TA 5BMOA 1DI0A 2VAPA 4IDCA 5ERYA 3B53X 3JTMA 2R8YA 2JGDB 1ZNWA 5FTWA 3UJ8A 1CW2B 3ECCA 1GR1A 1P39A 3G6WA 2RGWA 1DQNA 2IEIA 3ZZNA 1N77A 1HFWA 3WWPA 2I8CA 2ID4A 1U28C 2JGFA 5IANA 2C97A 3O73A 5DGHA 4ACAA 4JXXA 1N2CB 1HDOA 1BMFD 2CVFA 3N3BC 1T1GA 4II2A 1JZSA 2AXPA 4TVSA 3DAFA 3D6TB 3I32A 2C4UA 1AE1A 1RQXA 2R6HA 2RGAA 3REFA 1FU7A 3GIDA 2DH5A 1KE2A 2Q2WA 3RU7A 4U3JB 4CR7A 3QWBA 4KC0A 2CL5A 4U00A 4BZXA 4OO3A 4F9EA 1QPBA 4BO7A 1L0BA 2NSJA 2J45A 2Q3HA 3G9ZA 1IHDA 4OXQA 3FOBA 4Y1GA 2VNIA 1VHLA 3LC7O 4DLPA 3IOEA 1YC2A 1QG6A 1PSZA 2ZJ1A 5ALNA 1XZDA 1JA0A 4AT1A 3FZQA 3NH6A 5CNKA 1DJLA 1NHWA 1P2BA 1WDLA 3J81k 1GNRA 2M2IA 3PGKA 4Z9BA 1KK1A 1ZYUA 2JIZA 3H6GA 4QNMA 4QREA 5AJZA 3H16A 3LXMA 3SYKA 3G2KA 4L74A 2EKZA 3VH4A 2VPYA 3MTAA 5BWLA 2VCHA 3OEEA 3F7NA 1IN7A 4UNNA 5K6RA 2DU8A 1V8PA 3IVCA 4JELA 1HDXA 1E9RA 2R84A 4CM9D 3FPAA 2G77B 5AM1A 5LA6A 2OM2A 2ZSFA 4YCJA 5KAPA 1W85B 1ISSA 5HQ3A 3OHPA 1NAHA 1OH5A 3URKA 2UYOA 3IAXA 3NHWA 4Z0NA 2D0PB 3TOVA 1I2BA 2WFLB 3FYUC 1MC1A 1B0ZA 1EGAA 4X91A 2VAWA 7REQA 2UZ0A 4J1SA 2SCUB 3KE9A 3EXAA 4YECA 4OLAA 2DFPA 3QUCA 3AEKB 3VKUA 4R6WA 2JJYA 1VCNA 2YRFA 2ZSIA 4XEHA 1M34E 5BRJA 2NG1A 4QUAA 4HLDA 1SKAA 3ZBUA 4YP5A 4F86A 1XL0A 3L8GA 1U7OA 3FYHA 3ASZA 2B94A 5TQ2A 5H1YA 2FNAA 3ICPA 4C4XA 1SXQA 4AS3A 1E64A 2NNLD 2WTEA 2VHTA 5D01A 5L3SA 2P9YA 4EB6B 5ENDA 4ZJYA 1WCIA 1XKXA 5JYBA 3G2PA 3PUYA 4V1CI 4MKXA 3IDFA 1V1JA 1VIAA 3EG5A 3ROZA 4AJ4A 1LSJA 2QL6A 1GV0A 2WSIA 3BERA 1GN9A 1VL2A 3JQAA 4L5IA 4YAKA 5KNBD 2RDMA 1N1DA 2XSZA 2ZRPA 3VAZA 4CQNA 3DL7A 2BOVA 1CIPA 1VA4A 1QH8B 4DABA 1E9BA 1NKTA 3DE1X 4ZAGA 5BSKA 1TX4B 3DZJA 3T7SA 2WTNA 3DE6X 4OBEA 4YHHB 4JZYA 1TA4A 1DBQA 3AF0A 2XT9A 2PY6A 4MUYA 4LW8A 1WUYA 1SXPA 3EARA 4V0NA 4YRRA 3NIBA 3AWIA 4WDRA 5EG5A 1U8UA 2AI1A 3PXAA 3AERA 2ZTMA 2YY6A 3UBTA 1PFKA 4F46A 2CNKA 4NYMR 1U81A 4HQ0A 4OQEA 5B1HA 2DFVA 5K8VA 1G20E 3CB4A 3JRNA 2G09A 2OORC 4ZCPA 4N18A 1BCSB 1VG1A 3THYA 2A92A 1OYVA 1SVNA 1XMJA 3HDQA 5EHGA 1ZN7A 4OHMA 2ZRMA 5ES4B 1OREA 5K0ZA 1PRYA 1PTKA 3T1VA 5JAMA 3FSRA 1QIGA 1YDMA 1Z5UA 4BO5A 8AT1A 3R1IA 3RAPR 3LC0A 1WB5A 3HC7A 3V4FA 3I3SR 4UNQA 3PF9A 1MD9A 1YQGA 2EJCA 5FTMA 4BVBA 1GZ4A 2DRIA 3HKCB 4X3PA 4E03A 5A1TA 5AUPB 5J47A 1A4IA 2HBRA 3NVKI 4BNTA 1PVDA 1FNCA 2D2XA 2IVFA 1JIIA 3DA8A 1GA6A 5C5DA 121PA 3AHHA 4WZBB 3WYNA 2DECA 5ALUA 4GD3Q 3CN7A 1NF2A 1J99A 2ZRQA 1GCGA 4CQMB 4XLZA 2WSSD 4YJGA 1K3UB 4JC8A 3NBZC 2XWJI 1PS0A 4YGYA 4EB6A 1DJPA 1R5JA 3HN2A 2P4EA 5JYCA 3EQ2A 3EBPA 1GL9B 3DNFA 5D5QA 2HF7A 1IONA 3M81A 1Y1SA 2FB9A 4MYHA 2JVIA 4BO0A 5COQA 4R9SA 4UEOA 4BE4A 5AKGA 5ALEA 5JMTA 4BO2A 1PO7A 2LPMA 3IKJA 3QTTA 3R0ZA 3TAXA 1MABB 2HRDA 1W2HA 1K08A 3K73O 2GCGA 1QRAA 4JOQA 1DKRA 5BSEA 2RGXA 4TLAA 1ZH4A 4RNDB 5J2TA 3X1DA 1A9XA 1MO6A 2EHDA 3UJPA 4D9MA 2Q4TA 3D8TA 2X1HA 3I5MA 5LB2A 6LDHA 5I51A 3QW4B 1DS6A 4V0ME 3W04A 3TSZA 1FW6A 4NU6A 1N6IA 4WWHA 4MWOA 2MU1A 4FN4A 5JRDS 4D8VA 1R50A 4FSHA 2BUAA 4B09A 1GL6A 1Z5ZA 1SVSA 4RM2A 3RSQA 1N5KA 3KSDO 1YB5A 3WSTA 2R96A 2DSTA 3ZZUA 1JLKA 3CZ9A 4EZEA 3PFIA 4KXQA 2F4VB 1WZCA 2FPGB 4BLWA 3AEXA 2YZ7A 3IUQA 4W9NA 3ZV6A 1XMQB 3E53A 3RWBA 2IPMA 1USVA 1Y6QA 2G82A 2H8GA 3OE5A 3K5IA 1LTQA 2YN4A 4M1TA 1C7EA 5DCYA 5L3QB 3SCZA 2YVUA 1I14A 1ZGCA 5HG0A 1U0EA 4GGPA 4HJXA 5H82A 1N33B 5LQRA 1U7UA 2WUEA 4PVDA 4YDSA 5C3UA 4DDHA 2A3RA 3HLKA 5PNTA 1X38A 3ZDCA 4HHEA 4HQKA 4Z7JA 1I1HA 3RSHA 2GZHA 4IO1A 5KNLA 2CJWA 1VGVA 4EMUA 4YRDA 1P5JA 2EWVA 3C7CB 5HUHA 3LMKA 2IYRA 2IHZA 5ALQA 1IM2A 5HRAA 2DTDA 4YMSA 1TYDE 2IXFA 1HFEL 3N75A 4H77A 4LDNA 1GG2A 1U28A 2XA9A 1B43A 3FFBA 1SH7A 2HRCA 4Q6WA 3DXYA 3FPJA 4BFTA 4CJXA 3L0CA 2Z09A 4OFWA 5BUCA 5KJFA 4KE9A 4Y9SA 4DQLA 1L7XA 1JR2A 3JALB 3QJGA 4I3HA 4LFBB 4FS8A 4WGGA 2AZDA 3RVJA 1R66A 3C74A 4KLCA 1ZD9A 3TSOA 4I3GA 5LUAA 1RWBA 3HGMA 2Q3BA 4ANFA 4MYRA 2YFYA 1VLVA 3PR2B 1Y6JA 1E6MA 4NE9A 5BQXA 4RIEA 3KKPA 3KIPA 1QRSA 4Z4GA 5CPFA 2O8NA 4D99A 4DMRA 1XN1A 2RHJA 1XDZA 3BA6A 4MH0R 1PVOA 1K88A 1J21A 4C7KA 4MV1A 1UKAA 1SUWA 2BKEA 3FDZA 4UTZA 1FTYA 3O8QB 3NTUA 3CH5A 4CCSA 1SQ6A 4FOLA 3WQRA 4CIXA 4HQNA 3PHBE 1UOPA 2WK1A 1FRZA 1UBOS 4OJMX 4DMKA 1C3OA 1R4MB 1NGSA 3EEFA 5LR6A 4KNWA 3H83A 3TTVA 3V4OA 1YULA 4DOMA 3UJ3X 2ACKA 3WL8A 2VSNA 4QL3A 3T7KA 3OA0A 2GLTA 3V9AA 3NOVA 2FFHA 3QU7A 4DTCA 3NT4A 4CM1A 1QDLB 3NWOA 5EEGA 3N2KB 1OLSA 3PQ4A 4L8YA 3N86A 4TMZA 1VLHA 2J3HA 1WW8A 1RI5A 2Q5FA 3P9SA 4GFDA 4PC2A 2UXBB 2SHKA 1G38A 1DC7A 3T9AA 1N1EA 2BHLA 2EX1A 2L0XA 1P9LA 4AYWA 2CLSA 3H1PA 4RIGA 3ZU5A 3NGMA 1AGNA 1IVSA 2WILA 1KARA 4ZI7B 3DVAA 2JFOA 2QG4A 3DL0A 4IDQA 2DWUA 1R1DA 1RQGA 4HATA 2ABWA 5MN6A 1V95A 2JLQA 4UZEA 1NC1A 4CKEA 5C52B 2J4FA 3PC4A 1PKEA 1UP7A 2VNJA 3RM3A 1JT9A 3EXEA 3K0EA 3SHOA 3ROFA 1GGFA 1YIAA 1Y1QA 1EVQA 4D6XA 2ZTUA 1GGKA 3MRSA 4P9NA 4QYTA 3IOCA 5I8PA 2VJMA 4EJSB 1F51E 2I4MA 2I6TA 2VTVA 4OI4A 5TQ2B 1XBTA 3RT7A 1E6EA 4BPRA 3P9NA 2IYFA 2HU5A 2VJMB 1Y8QB 1IWOA 4OLJA 2PGLA 3JQ8A 4LWZA 3W8FA 4BTVA 4TMWA 4BO3A 3BRSA 4AN4A 4F2HA 3I6QA 5I9SA 2HMAA 3QHAA 5A5GA 1NUSA 4DNXA 5K05A 4FMDB 3AHGA 3VRHA 1CUVA 1W8IA 1ZJZA 2G08A 4BX8A 1T9ZA 3GEMA 4PG8A 3OZXA 1N57A 3N28A 1XF9A 2IY8A 2Q1WA 4NJMA 1I32A 2C77A 3L8CA 5F9HA 3A1DA 3KETA 4YQFA 3LDFA 3M3DA 3R40A 4NE7A 1THGA 1TLTA 4CTKA 1Z08A 3ZIAA 3C15C 1QE5A 1U3UA 2P9ZA 4QDTA 2GCPA 5EAIA 3HB1A 2J9YB 1JGTA 4TWAA 5AJTA 1QP7A 4NX2A 2GA8A 2Q5EA 2Q0QA 5AXCA 4DA7A 4RS3A 5DE3A 1PEYA 2B20A 4HY3A 3NAZA 4HDCA 1HQDA 4LWQA 2OXIA 4C4OA 2F4NA 3FE2A 4I9HA 2PXXA 5DHRA 3HUTA 2I67A 3MCUA 1CZLA 3C8HA 4IGIA 3HJGA 3E9MA 4HVLA 1XSEA 2WA1A 4UHCA 1T8PA 5L95A 4NH0A 1JEEA 3A9WA 1E5TA 1GPNA 3NBAA 3O8LA 4NBNA 5AIAA 4OHUA 2J0QA 5K3SA 1I7SB 2GHQA 2VWGA 3RNLA 2YBDA 4CCWA 2WFAA 3ESXA 2Q3MA 2ZRGA 3KCQA 5I7WA 1JF8A 4NAHA 1YQWA 1GNSA 4WLFA 5DU2A 3TJRA 3MS2A 2NO4A 1G20B 5KVVA 1NSYA 3Q3GE 1ZM3A 5B2EA 1SHKA 3NEYA 2O6LA 2Y0CA 4G56A 3ESBA 3IHLA 1Q3TA 3QVJA 1RD4A 4LX8A 5BSTA 3BTSA 3ZEAA 4D1YA 4DM4A 4YMWA 1J97A 2O0JA 3D6HA 1NDQA 2Y9MB 5AM2A 2AFHA 1QK4A 4W5RA 1IN6A 4RJLA 2YWBA 1J2YA 4X84A 2QRJA 3FKSD 3RBAA 3ZK9A 3QXXA 3K5WA 4CU5A 1L4LA 2JVJA 3I58A 4WQMA 2RAPA 3E4DA 1T3TA 3TH5A 5LJIA 1XOIA 4QEKA 3KT8A 1CSEE 2VG8A 8GPBA 4MJLA 4K5QA 4RVHA 2M98A 3OBBA 2D8MA 3GFTA 2I2DA 1GTZA 2GD0A 2I7XA 3JZFA 4PLHA 2GZSA 5EWJA 4M0CA 1MABA 5CHYA 4ZVRA 5HOEA 3BIOA 4MI9A 4YWHA 2FSVA 3QLUC 2X41A 3T5GA 1H0RA 4WBXC 1EUDA 3WXBA 3VZPA 2ZM6B 3OM1A 4PSDA 5LQUA 2XRZA 1YONA 3O83A 4PQEA 1EE9A 2IS6A 5DHPA 1JR3D 2VCYA 2UZ4A 1H1TA 5HQJA 4JMPA 2VJDA 3N07A 4M54A 4Q4AA 1AZTA 3WBKA 2O5VA 2WYIA 2XE4A 3K31A 4GGMX 2PYIA 4PLVA 2GQ0A 3H3JA 4C7BA 2W2LA 3EWSA 1M34B 1DJMA 1XTVA 1NRIA 2BEJA 5IKMA 3DZCA 5JJ5A 4ZEOA 4MITA 3BXGA 3LBHA 3OD1A 1S3GA 2YVAA 4PU0A 2C4HA 3IDQA 5TGZA 1XQVA 2QYSA 4GMFA 3RS2A 1I3MA 1XPUA 2RFLA 4ZCMA 4CL2A 3T35A 3AI7A 4H08A 1E9AA 4UEJA 3AKDA 4RJTA 5TMDA 4RSRA 3NHBA 4LRQA 4MUBA 2AD1A 4KSYA 4KQHA 1N0VC 3FUWA 2XWSA 3A0RB 1IMJA 1LJ8A 1YZTA 5TR9A 1ZD1A 1PF7E 2B3DA 2R2GA 5LDHA 4G0NA 3NM6B 3TX2A 2OENG 4IMPA 5FR2A 4EUEA 2XOKD 2D7DA 1TZKA 3HNRA 4DVGA 2B92A 1SMKA 3IMKA 5ICFA 1G2QA 3K3PA 1FVFA 1Z0SA 5EUCA 3R74A 5KTRA 3ORRA 4WH0A 2OD9A 2VPPA 3B2NA 4XYGA 5LXTA 3SHFA 1R18A 4YP7A 3ZQUA 2UYHA 1KJZA 1PKXA 5AM4A 1XQ9A 3D0KA 3D7RA 2BFOA 1EUCA 3HUUA 5C1PA 3EDMA 1UPFA 4EGQA 1ECFA 1KO5A 3OPVA 2ZSDA 4IR7A 5LM3A 1FX0B 3FVTA 4AD8A 1VKHA 1YCHA 1UZMA 3O94A 3W6UA 2C5AA 4BRUA 2D0OB 3HYRA 1FLDA 3L5OA 1UDBA 2I2WA 3K0FB 3P19A 4HS9A 1Z5NA 1EFPB 2F8SA 3FPEA 1V5IA 1FQOA 4PZAA 5AT1A 4Q9JA 1PQPA 1ZN8A 1C1XB 1AKYA 1HDGO 4WXYB 4CPDA 2FPPB 3FMFA 3G0OA 4X44A 1KQNA 3NTLA 1SELA 3ZH2A 3L0BA 3SP1A 3CVXA 5LNK1 2WSMA 1R0RE 3EVFA 2P5SA 4OB8A 2FPMA 1QCDA 3SS7X 3S8YA 2PUCA 1HG0A 3DS8A 3ZTYA 3KQQA 1L7OA 2RHDA 4KIUA 2VYFA 5BVGA 5CBPB 2FSSA 1JEYB 2OO7A 2P6MA 1JDZA 3EQZA 4TL7A 5H02A 1E2HA 4OGKA 3RUDA 4HEA6 1O57A 3F6RA 4OAPA 1QC5A 1JPNA 3D3WA 3LE8A 2FEMA 4PTLA 2CV0A 4WBNB 1XJ0A 1KGSA 1MR3F 3C7KA 4D92A 2VHQA 1SOVA 1QGZA 3GLFA 2R8EA 1C7QA 2AOUB 3L6RA 1M76A 3DBLA 3FD8A 1UBJS 3ZHQA 2JIBA 2VEDA 3HFJA 3PA8A 1XXHA 4Q1VA 4G8DA 5CIYA 5HFJA 5EZ5A 1EEHA 2Y1FA 2CFSA 4LYHA 1SHZA 2Q6LA 1PK8A 4FQ7A 4HSGA 5BNTA 3QXJA 4BRZA 1RRCA 4WK0B 4KH0A 3N2GB 1DBPA 1NMEA 4QICA 4F8YA 1ZJ4A 2DT5A 4B2IA 4LNUB 5KNDA 4I5DA 1D1PA 4RF5A 4EVSA 2PUBA 2AUMA 3D02A 3I01M 3TDMA 3SS8A 3TBKA 5A02A 2B21A 2F59A 3MWGA 4INPA 4QFCA 2WNIA 1U0TA 2C03A 4NEHB 4WN9B 3CVUA 4LIPD 3BD8A 2QP9X 3JPWA 4W9RA 4L9WA 4BBZA 2G9VA 4WN9A 4M0MA 2YHIA 1R4NB 4Q0MA 3HVIA 3ZZMA 1W4ZA 3B60A 3IS3A 1QLHA 3LS2A 3LY8A 4QJ5A 2A33A 2BZ0A 4PCVA 1N1MA 2AV6A 4DARA 3X2FA 1V16B 1MUUA 1YZYA 3GJYA 4PZUA 1P9OA 4E7PA 4PZ9A 4AZVA 2IYWA 4YV7A 2V5VA 4M38A 3CR7A 3KTAA 5LZ5A 3VNQA 2X4DA 3WQHA 5KX5F 4CODB 4GZ6A 4FHDA 1TIKA 2O06A 3NBMA 4RK4A 1RI4A 1SNYA 3F2IA 4AW9A 3ZHCA 3IHKA 1SULA 4LQCA 1KJYA 4NBLA 4CMJA 2O8CA 1R3UA 2ZWPA 3D4PA 1XZQA 1HYHA 3T9CA 5B7PA 3WA6A 2OCXA 2REOA 3DZGA 3FNEA 4DAEA 1FNMA 4DEYA 2O8CB 3CGWA 4RWEA 2HJ9A 3I3OA 3LL7A 2JJ2D 2VPZA 2AQ8A 1RPAA 2OC4A 2VXBA 1ORHA 2J7PD 2HMTA 2AXQA 2H1WA 4JX9A 4N7RA 1W1UA 2V9CA 5AVJA 3BJZA 5FA6A 1P1CA 4IBOA 3UC5A 2XXAA 3FTEA 5LN1A 1E9FA 2WWIA 1E96A 5DVZA 1QBKC 1CJSA 1OFIA 4HVTA 1JLLB 1HH4A 3C7TA 3AL2A 1PJ4A 3GVHA 2E4VA 3L04A 2PS1A 1E7RA 1Z68A 3LNCA 4KRYA 4PO8A 4QULA 3LXXA 2GFIA 3ENZA 3FYCA 3NBQA 4OUDB 1KERA 1NNI1 2HGSA 4Z6KA 2A9OA 3E7PA 4LJAA 1KS2A 3B1XA 3QENA 3CC8A 4EAQA 2QN3A 3AMVA 2G70A 4ENWA 3SY8A 3TJZA 4Y1FA 5GZ6A 1G3UA 5DM4A 4X90A 3L1IA 5KSPA 2V0GA 3WJ1A 4KIFA 4IGAA 3JATA 3OFND 5CDFE 4NPHA 1L9KA 3GUYA 4JJ8A 1P2TA 1W2GA 3K5HA 5I01A 2BYTA 4C7OA 1FFCA 1XD8A 1PFQA 3GNTA 3N5KA 2AB0A 4A26A 6REQA 3IP7A 3Q0TA 1W9MA 5LA6B 3PGJA 1VJ0A 4D7AA 3AF4A 2BKUA 1E9SA 3B52X 2WWGA 2G9ZA 3PZRA 3GVXA 3NFRA 4QFMA 1ND5A 1P1RA 4UXJA 4B6QA 4KI7A 5BW8A 1DLIA 4Q4JB 1XE3A 1CUFA 1WR8A 2DUWA 4JP1A 3DEJA 3UOGA 4S1WA 4B3HA 1EUDB 5JCOC 1TAGA 2WTAA 2SCUA 1WZEA 3MAGA 7AT1A 5EIFA 4K6HA 1UPCA 5JDCA 1J5XA 5EJFA 2B61A 1PGPA 2IKQA 2W2NA 3H9UA 1IRIA 3MSCA 3H1GA 4PYIA 3TNFA 1U8XX 3WLKX 5HX7A 2QUAA 4J76A 1JEOA 1ZRMA 4MICA 5JYEA 2FZLA 1Y8QA 1P77A 3ETHA 4KACA 3WYBA 4EZBA 3NTRA 2IUUA 4QVIA 4IZIA 3BGOS 4L3VA 4RV5A 3I9FA 1A72A 2ZB4A 1PJZA 4ZU1X 3VISA 3ET4A 1M1NB 2E4WA 4GM0A 3TNLA 4ALIA 2GN9A 1NVUQ 3PGA1 3U7RA 2IZ7A 1OXVA 4MPTA 1VSUA 4RQBA 4OKNA 3DTYA 1R64A 1BVHA 1QZXA 3F49S 4QGHA 4YREA 3STUA 4YAIA 3V2GA 4JDPA 1W19A 1YWGO 3KYDB 4HSEA 2C82A 1GTG1 2AXEA 4L7VA 1RJGA 3IO3A 1IAVA 3ABSB 1XRLA 4KQ9A 2CXUA 4Q1FA 3ITNA 1F0NA 2V7XA 1X1RA 2WF7A 2WHEA 1YVUA 4R5MA 1M2FA 5JQGF 2FUKA 3MXTA 2FEPA 2ZJ3A 3RIYA 2ZSBA 5HJEA 1L4HA 4HGPA 3K9FC 2FFBA 4W7IA 3B2EA 3T7IA 5JZ9A 1A7AA 1U8AA 4FI3C 4BQQA 2Y67A 2NPOA 1X19A 1A7UA 1A9ZA 1PBNA 4J0KA 1DMSA 4PZEA 4TUYF 4W99A 4E5UA 1R6UA 4UU0A 5JVDF 4ZVUA 2Y71A 4BNZA 1BDIA 2EARA 1JQJC 1IIBA 3GRPA 1YACA 1RI2A <