4UHHA

Structural studies of a thermophilic esterase from thermogutta terrifontis (cacodylate complex)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
273
structure length
273
Chain Sequence
AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 107
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhhA00
1HLGA 3VJKA 3L1HA 3AIOA 1W4LA 2V9ZA 4PW0A 5LZ8A 3T4UA 1T4MA 1AQLA 5ALMA 4TGLA 1DQZA 4LYEA 1I6WA 1WHTA 3WWOA 3Q8WA 4XVCA 4IO0A 4OUKX 5AOCA 4BATA 5AH0A 4UHHA 3I6MA 2HRQA 1MNAA 4FLMA 4RE6A 2CBGA 2JEYA 4X3CA 3D7RA 4UBLA 3ESAA 4X6YA 2Y6UA 4EA6A 2ZYRA 3F98A 2XUGA 2AJBA 3STYA 3WZLA 4K2AA 5FV4A 1EDDA 5DYYA 3C6ZA 1E66A 3WMRA 3CXUA 1CUAA 1XZHA 5JZ9A 4X91A 1NU6A 1SFRA 2O2IA 1TAHA 1UOOA 5IVHA 5HQ3A 1LPNA 2DSNA 4A23A 2EEPA 2J3DA 3I2HA 1WB6A 2DCMA 1QONA 3QYJA 3N2ZB 2X5XA 4J0JA 4W1RA 2HU7A 2XI4A 4OB8A 1MAHA 4KACA 4RPCA 3ZLTA 2JGMA 4GBGA 3DOHA 3WA6A 4AN0A 3L1JA 3IULA 5AI6A 4PF1A 4X7BA 5HK8A 5KBYA 4ROTA 1WB5A 5HF9A 2AJDA 2J3QA 2VA9A 5K3FB 1IZ8A 1GPLA 3PF9A 5HF8A 3B12A 4GECA 2RI6A 2WHPA 4B84A 5K3EA 4X00A 4CIBA 2WLSA 1K6EA 1UFOA 1PJAA 3IURA 4KRYA 1F0PA 4G9GA 2OCLA 3W9BA 3QPCA 4PO3X 5C8XA 1IUNA 1KU0A 5FDFA 1EXWA 4OB6A 3WWDA 2QRUA 3DCNA 4LXHA 4GDMA 5CRIA 4G1FA 5AI4A 1VZ2A 1EDBA 3F96A 2ACKA 1SCKA 1BROA 2PU7A 5AKIA 4BDTA 2C58A 2PL5A 3C43A 3VJMA 4C4ZA 3WK8A 4MEAA 2XB6A 1EINA 4H7DA 2HDWA 3FVTA 1VE6A 3I2IA 3EQ7A 5K3AA 4U2GA 4UHDA 1R9NA 5HK9A 4G4JA 5LKRA 4ZGBA 3DL4A 2JEZA 5AM1A 1IZ7A 3QVMA 4DTCA 1CUHA 3WYDA 3EQ9A 4HVTA 1JU4A 2R11A 1DT5A 2GYUA 1AURA 3FYUA 1MTZA 1GKLA 1JT2A 4F21A 3R40A 1U65A 1JJIA 4BCCA 2OQVA 5AKYA 1ODCA 2VT7A 4N5HX 3H2KA 2WHQA 4G8BA 1MX5A 2HU8A 1VA4A 2VAXA 2ZJ7A 5AKZA 2VTVA 3MUNA 3P2MA 5EHQA 3M82A 4QLAA 4BB0A 4BP8A 4J03A 5BWCA 1YA8A 2WHRA 3DDUA 2GBGA 3R3ZA 2OCIA 1CLEA 3GFFA 1QZ3A 4FFWA 1S8OA 1R88A 4ZV7A 3PI6A 3HYSA 2GZSA 1XLVA 1XQYA 1QOZA 1ZGCA 4J7AA 3AINA 5DNWA 1XZEA 4CG3A 4EB0A 4B9EA 2HM7A 3DKRA 5E4YA 1CR6A 4G4GA 4AXBA 4X97A 5ALFA 3PF8A 3BE8A 2QKYA 2Y1KA 3UUFA 1XQXA 1ZIYA 5AKEA 5ALHA 3PUIA 1AKNA 3STVA 2VJAA 4HXGA 1Y37A 2VAVA 4G9EA 4AB1A 4DMHA 3K6KA 5AIBA 3WJ1A 4A5SA 3BJMA 5AHXA 1UK7A 3M81A 1MJ5A 4DMCA 1E89A 4MWTA 2IX9A 1QIGA 3V1LA 4DNFA 1ACLA 1A8SA 4MWSA 1FFAA 4QDUA 1MNQA 4C88A 4BYMA 4KYVA 4NMWA 3VVMA 3IIIA 1FFDA 3R3YA 1ORVA 3PDCA 4Q34A 2HA4A 3FYUB 1L7QA 4U2CA 1Z68A 5A71A 4P08A 3M3DA 2VJCA 1UKBA 3STTA 5E4JA 1R4ZA 4N5IX 4DLNA 4FTWA 4I3FA 3STUA 3CCBA 3DL7A 1QIMA 1ZD3A 2O2HA 2XQKA 1DQYA 1C4XA 3WWEA 2CUTA 1XLWA 1HKHA 2PSFA 4B0PA 5CT8A 4WJLA 4FMPA 3C8HA 5EFZA 4AN1A 3BJRA 1YA4A 1TQHA 1G42A 2X8BA 4XWGA 5ALJA 2WIFA 4Y2TA 5E4TA 2WG0A 1E8NA 4CCYB 4IQ4A 5DYTA 3O9MA 2PUHA 3NOXA 1XRQA 3WKAA 4UHEA 5K3FA 4ETWA 3WL6A 4Y9SA 1XZCA 1DWOA 1AGYA 5JANA 4LHEA 2YXPX 1WB4A 4CFSA 3C45A 4J0GA 2QS9A 3RLIA 5AKKA 4Z49A 2Q0XA 2B4KA 3FBWA 5IVIA 1QIHA 3IB3A 2WJ6A 3F8SA 4HTAA 3C6XA 3OTQA 5AK4A 1MAAA 1XRMA 4FNGA 4Q3OA 5AM3A 4QZVA 4J3JA 1USWA 1G4HA 1XKTA 2HHAA 2BUBA 5AI9A 3IBTA 5DJ5A 2W6CX 3G0BA 1ZI8A 5FPPA 4KE8A 3H2GA 3I2KA 2DR0A 4QDXA 3KSRA 4C87A 3O4JA 4OYYA 2OCGA 4OU5A 1XZIA 4X94A 3RARA 5AP9A 1DU4A 3MUOA 4BC1A 2VJDA 3QH4A 1B41A 5A2GA 5LKAA 1QO9A 5AKXA 5IVDA 2FX5A 4FKBA 4WFKA 2DHCA 1BCSA 2QUBA 2W22A 4BAUA 1H2WA 3OG9A 2H9YA 5ESRA 4YASA 4G8CA 1FFEA 5ALDA 2QVBA 4FBMA 4G4IA 1F6WA 4CI9A 3H1AA 4PQEA 4EY4A 3NWOA 1C7JA 1N5MA 2VEOA 4WCVA 4UFOA 4AO7A 4U2EA 3PFBA 3WWCA 2QT9A 2BFNA 2QJWA 1EVEA 5AM0A 4K6HA 2Z5GA 1BN7A 4Q05A 1BN6A 2ROQA 3WI7A 5ALIA 4C4XA 2ZYSA 5FOQA 1MO2A 3OURA 5D7BA 1XRRA 3TRDA 5T4FA 3IVMA 5I7UA 5EI5A 4B82A 2AJ8A 3C87A 1LBTA 4IH9A 2QM0A 4UBNA 4BVLA 4BVJA 1BU8A 3DD5A 2WQZA 4FHZA 2JGLA 4FLFA 2WKWA 4JYMA 1G5FA 5EIEA 2JGFA 4EY7A 5EGNA 1BRTA 2QZPA 3STWA 3BF8A 2B9VA 3E0XA 3H0CA 3FYTA 4KE9A 4M0MA 3HXKA 3PICA 5BWBA 1J07A 5ALWA 5BOVA 2GYWA 1Q83A 4AO6A 5AI5A 5C8VA 1UWCA 2C4HA 5EIAA 2CZQA 4G5XA 3A2MA 4Q3LA 2HADA 3H2IA 4Y2SA 1UOPA 2JBWA 1M33A 2HIHA 4B0OA 3GA7A 1IVYA 3PE6A 3U0VA 3X3HA 3ZLVA 5IH7A 1TKRA 2Z3WA 2H1IA 6YASA 1ZD4A 5CT9A 5SYNA 4PNZA 4X85A 1KEZA 3FYUC 2I03A 3KXPA 5DNUA 1AX9A 3IUMA 4H7EA 7YASA 1LNSA 4BE9A 4BAGA 4BVKA 3G9XA 1YR2A 2QUAA 4U2DA 5HF5A 4E14A 3ICVA 2WJ3A 3W05A 2WIKA 5KWIA 2FJPA 1EB9A 1QIFA 1QFMA 1W75A 2V97A 5CURA 4HZGA 3QZUA 4GI1A 2PUJA 1AUOA 2WG2A 1RP1A 1R3DA 2G5PA 3LS2A 4QLOA 3CCCA 4FOLA 3I1YA 3O0DA 3AZOA 4W1SA 3VVLA 3FAKA 2QOEA 2WU3A 2XUOA 1MT3A 4F5ZA 5ALRA 2WTNA 3H18A 4AMYA 1A88A 3R0VA 1ACJA 4E15A 4JYPA 5K3BA 5A7FA 4H7HA 4WFIA 3WKDA 5JATA 4GEGA 2J4CA 4MYDA 5CTAA 2CKMA 1F8UA 4TVKA 3WWPA 1ZGBA 2XMDA 4O08A 2OCKA 1ZOIA 3A2NA 4FNMA 2B20A 3I6ZA 4EY5A 5K3DA 2Z8ZA 4Y2XA 1A8QA 3A2LA 3HI4A 4RNCA 4G8DA 3R3XA 1MX1A 5IVKA 4F0JA 3W9UA 3HRHA 3QMVA 5HKBA 4IH4A 4X95A 4K5QA 4I4CA 1WOMA 3WL5A 3ZWQA 1P0IA 1CRLA 1DWQA 5C7YA 1TCBA 1CUEA 3E1GA 3NUZA 1AC5A 3FLEA 1CUGA 4KRXA 2HA5A 5A7GA 5H3HA 1JJFA 2G63A 1TRHA 1YB6A 4CG2A 3V48A 3HJUA 3G7NA 3LIIA 2XQGA 1LPAB 2RAUA 1ISPA 1A8UA 3QMWA 4QA9A 5JZSA 4DMFA 5CT6A 1FSSA 4YX9A 2VSQA 4KAFA 2RGUA 2XMQA 4W1PA 4LYDA 2WIDA 3I28A 1GZ7A 3FSGA 3A70A 4P92A 3A6ZA 3B3QA 5ALXA 2QMQA 4UFPA 2VT6A 5AKJA 2XQJA 3W06A 4JNCA 1EI9A 4N8SA 1CEXA 3ANTA 2PSHA 3ESDA 1CUUA 3MGAA 3UUEA 1JFRA 3BDVA 5E2IA 4B85A 4GLBA 5C8ZA 5I9IA 5EIHA 3QPDA 4H7IA 3I2JA 5ALOA 1EH5A 5FXMA 1U2EA 2IIVA 4E46A 1AZWA 1XRNA 2HFKA 2VQ6A 4K6KA 2OPHA 5JD5A 2GBFA 1TK3A 1EB8A 1GPKA 5F4ZA 1HDEA 3G9UA 5ALZA 3H19A 3HSSA 2WM2A 2PPLA 4NZZA 3C5VA 1XZMA 1BS9A 3DLTA 1CUJA 2E3JA 4FBLA 2PSDA 3T52A 1GQRA 4EBBA 1VXRA 1K63A 1LZLA 4QWWA 2YASA 2YH2A 4BZZA 1A7UA 3DOIA 3WJ2A 1IUPA 4M0FA 4KE6A 4UBMA 4AZ0A 5FP0A 3D4LA 5CH5A 1CQWA 1QIJA 1HQDA 1LPBB 5LP1A 3LLCA 2XMBA 5D3KA 4XIIA 5DTJA 2DQYA 4EHBA 4Y2QA 4N8DA 2QJRA 2WFLA 5FKJA 1CUZA 1CQZA 2OAEA 1R50A 5AKGA 3FWHA 4BP9A 1ZICA 2RONA 4RGYA 2WU4A 5ALTA 4EUSA 2OAGA 5LZ5A 1XZKA 5ALSA 5AKLA 1Q84A 2VF2A 5A6VA 3HC7A 3JWEA 1E8DA 4Y2PA 4HXEB 5AI0A 4B80A 4UBOA 4X93A 4EY6A 1PFQA 2C0QA 3V1KA 4HXFB 1BCRA 3E3AA 1XLUA 4L3WA 1CUFA 3N0TA 3H2JA 3KWJA 1GXSA 1R1DA 1LZKA 5ALUA 2GZRA 2WTMA 5BV7A 1HPLA 4BTLA 1ZI6A 3SK0A 1CVLA 4Y7DA 4AZ3A 3WKBA 1L7AA 1WPRA 3C5WP 2AJCA 4BTVA 2Y2VA 2WIJA 1R9MA 3QBJA 3K2IA 3FCYA 3W2TA 4W1QA 4AO8A 2O2GA 3I2GA 3G0GA 3S8YA 3IUNA 5AOBA 2C5FA 2JGEA 4GWLA 3DNMA 5AICA 5AJHA 5LLSA 3EBLA 3WL7A 4AMZA 4I19A 4D9JA 4M0EA 4DNQA 3QMMA 4MYSA 5ALGA 2XLBA 2O7RA 1DINA 2XUJA 2PVSA 1QE3A 3TEJA 4H18A 2P8SA 1OXMA 4HS9A 4XX1A 4OB7A 4Y2YA 1QTIA 2XUQA 4MXDA 1ODTC 1UK6A 5KREA 3ANSA 3DYIA 3FNBA 2PSEA 2C5GA 3FLBA 1VKHA 3JYHA 2XMZA 1N1MA 2ECFA 1X70A 3QITA 4PSUA 4FDMA 1QJ4A 1XRLA 1U8EA 3HEAA 2WUFA 3ESBA 1MN6A 4DNPA 1JMKC 5JASA 4X90A 2JF0A 5JAUA 1EK1A 2XMGA 1ZJ4A 4BBZA 5AOAA 4Y2UA 3H1BA 3V1MA 3HACA 3MVEA 1CV2A 4H7KA 3H04A 4LKOA 1MPXA 2CB9A 3G8YA 1CUDA 3BL8A 1E5TA 5FPQA 3V9AA 4BRZA 2WIGA 3KD2A 5K5EA 4CCYA 4HRXA 2O7VA 1JMYA 1NX9A 4PSCA 3ZI7A 5ALPA 1K4YA 4Q3KA 1EA5A 1H2XA 3FCXA 2XUPA 5LZ9A 2WFZA 3VJLA 2XUFA 1ODSA 2QTBA 2JGKA 4OPMA 2V96A 3F97A 3WK9A 2DQZA 4FWBA 1XZGA 1X2BA 1RWQA 4WY8A 2BUAA 3TGLA 2CEKA 3ED1A 5ALQA 2CJPA 1SC9A 3C6YA 5JAOA 1Y7IA 2EDCA 2ORYA 2WSLA 3C6BA 5CXUA 4QNNA 1XKLA 1C7IA 1O6GA 2OXEA 5T4EA 3F67A 3PFCA 4A16A 4ZWNA 2NW6A 1YAJA 4KAJA 2HA7A 4J0HA 3R41A 5J3JA 2WJ4A 4QDZA 2XE4A 2BGRA 3GZJA 2WG1A 4LIPD 2XUKA 1LPOA 3G0IA 3ZLUA 4UBIA 3NGMA 4YPVA 4UFNA 1YCDA 4BC0A 1XZBA 3TJMA 4ZV9A 3WK6A 2PSJA 4BRSA 2XUHA 2PBLA 1THGA 3FVRA 4H35A 3D2CA 4ZXFA 5SYMA 4B9AA 3AFIA 2XQFA 5FRDA 2OGZA 1J06A 4JEIA 1FFBA 1LPMA 2G5TA 3KOOA 1WM1A 3G9ZA 1XZJA 3SC2A 1RYYA 2BAGA 1ZD2P 1P0PA 3ESCA 4QDOA 3OPMA 4KE7A 3G0CA 1QIDA 2H7XA 4XJVA 2OGSA 3DS8A 1QFSA 4GW3A 1K5PA 4Q1VA 3U1TA 3CN9A 3BDIA 5AM2A 2RHWA 1KU6A 3RK4A 2D0DA 2ZJ6A 5DWDA 3WL8A 4L72A 1ZI9A 5JD6A 1IMJA 1UXOA 1MX9A 3GROA 2WFMA 5CW2A 2YYSA 2RHTA 1O6FA 3RM3A 3PUHA 2QR5A 5AM5A 4DSZA 1PV1A 4RE5A 2ZVDA 4QE3A 1UT6A 1E8MA 2OG1A 4HRYA 2BCEA 1K8QA 1UOQA 2OLEA 2QXUA 3JW8A 3G9TA 2DFPA 1YAHA 5AK5A 5A7HA 1CUIA 1B6GA 4C01A 3OC0A 1E3QA 4CIAA 1QLWA 2XUIA 4QWMA 4ZREA 5DTIA 5EHZA 4GHWA 4C89A 4UUQA 1LGYA 1CIJA 3DEAA 5JALA 1HL7A 2XUDA 1UK9A 1ZD5A 5EHNA 1UKCA 5LZ7A 1J2EA 1W76A 2PM8A 2PX6A 4F60A 4PV7A 4IHAA 4E11A 1XROA 5ALEA 4KAAA 2V98A 1ORWA 3LCRA 2D5LA 4H0CA 1L7RA 3HZOA 2BJHA 5HKAA 5CXXA 1XZLA 1EVQA 4N8EA 3BIXA 2XUAA 2FJ0A 2EDAA 4P9NA 4H7FA 2UZ0A 4UBJA 5HFNA 3WKCA 3RKSA 1XZDA 1QIKA 2XMRA 2ZJFA 4IH1A 4LXGA 1IUOA 4CCWA 3DYVA 1CUVA 3KWFA 4YK7A 2HFJA 4BCDA 1YASA 5AK6A 3AIKA 4J0IA 1N5RA 3OOSA 1WCYA 1D07A 1XFDA 3SWWA 3VXKA 2Z8XA 3B5EA 4H7JA 5LZ4A 2VATA 3SX4A 2JIDA 5LZ2A 4OCZA 5JARA 2ES4A 5ALYA 5EHXA 5HF6A 1LLFA 4X6XA 1BE0A 4C6HA 2HA0A 2HA6A 2XLCA 2G4LA 4Y2RA 5AKHA 4OU4A 3FSGD 4DSAA 1DWPA 5A62A 2I3DA 4U2BA 3D3NA 3AILA 3HLKA 4UHBA 4WDQA 2I3ZA 2Y2UA 1OCEA 2JGIA 1DT3A 5KWJA 3BXPA 4UHCA 2FUKA 3D0KA 2BUCA 5JIBA 5DNVA 3HABA 3AZQA 3CN7A 1VE7A 3WYNA 4X92A 3EQ8A 2HA3A 2HA2A 4C4YA 3H17A 4KEAA 1EX9A 5HZGA 4JUIA 4L0CA 4MQLA 3G0DA 1AMNA 1QIIA 4B83A 4V2IA 4ITVA 4MEBA 2AXEA 1UZAA 1BEZA 4B81A 4PSDA 1H22A 1LBSA 3L1IA 3DJYA 1UKAA 2ONCA 4EY8A 2QXTA 3I2FA 4W63A 4JH0A 5T4HA 4KR0A 3WZMA 1N8SA 1X2EA 3O4IA 4LXIA 1LPSA 1XQVA 1GGVA 1U4NA 1CUWA 1WHSA 4DYHA 2ZYIA 2K2QB 5JAPA 3D2AA 2Z3ZA 3BF7A 2GYVA 4INZA 3AJAA 1VJ5A 3LIPA 4TPKA 2H7CA 2XMSA 5D6OA 1SCQA 1VXOA 1LPPA 3IA2A 1EK2A 3IDAA 4FLEA 1VLQA 3WK4A 1T2NA 5DYWA 2ACEA 2WUDA 4S0XA 3I1IA 3OM8A 5ALVA 5AIAA 3R3WA 4OSEA 5AM4A 4GXNA 2JGJA 5ALKA 4EZIA 3W04A 2GBCA 5FUMA 1QGED 1YS2X 2J4FA 4WY5A 5AI8A 3AIMA 2DHDA 5HQ3B 5ISMA 4NVRA 3D5EA 5JAHA 5D3ZA 4DM7A 5JD4A 1BEEA 2DHEA 4BE4A 3M83A 1GPNA 2WUEA 5ALLA 3IUJA 3DKKA 1CPYA 4BAZA 5CT5A 1CUYA 1F0NA 1DX4A 4BZWA 3EIOA 1VOTA 2PU5A 1HBJA 1CFJA 3GELA 2RIPA 1FJ2A 3YASA 4AX4A 4AQDA 5CBKA 1TCAA 3VDXA 2Y6VA 5HFAA 2ZSHA 2XDWA 3DQZA 1ZIXA 4QEKA 1G66A 4NS4A 1XQWA 1TIBA 5CH3A 5I8PA 1CUSA 3STXA 1THTA 4MQMA 2X76A 4CG1A 3FOBA 3C8DA 3V1NA 3WIBA 1CUCA 3D59A 5LIPA 1VZ3A 1XZAA 4QDTA 1Y7HA 4Y2VA 1JJBA 3EF3A 5AK3A 3WK7A 4ARBA 3R3UA 1CUBA 1EDEA 1QIEA 2BGNA 5FLKA 3O4GA 3F9CA 3WK5A 1MU0A 2I78A 5IKXA 3S2ZA 1H23A 4DNOA 3BWXA 2HL6A 3E4DA 1XRPA 3QPAA 2ZYHA 5AO9A 4HAIA 1W1IA 1W6RA 4DGQA 3H2HA 4MJ3A 1GT6A 1SCIA 5JYCA 2IITA 1Q0ZA 4X6UA 3FLAA 3AZPA 2OQIA 3ILSA 1CUXA 2WFLB 3WKEA 4B7ZA 5T4BA 2BKLA 4DIUA 5YASA 4W9RA 2CMFA 1YB7A 3O95A 3LP5A 4ZI5A 3GBSA 4UBKA 3AUKA 2OGTA 4ARAA 3IUQA 4WDRA 1W52X 1JU3A 1FFCA 4UPDA 5ALNA 2R8BA 4P93A 4Y2JA 3O9VA 3R3VA 3ZPXA 5C81A 4ZRDA 4OD0A 3VISA 3QM1A 2GBIA 4L9AA 1VA5A 3Q0TA 4OYLA 2PKYX 3ZV7A 2LIPA 4H77A 1YS1X 2C7BA 4DMKA 5CMLA 3WLAA 1Q0RA 2HRRA 1QTRA 5LYYA 1P0MA 1NU8A 3KDAA 3ICWA 2C0PA 1JKMA 2WUGA 1JI3A 5JZBA 2ZSIA 3BIWA 4B6GA 1XZFA 2VJBA 2XT0A 4J0KA 1QO7A 3WQHA 4BCBA 1H2YA 3VKFA 3WA7A 4U2FA 4BDSA 4X71A 1SOMA 4WFJA 4K6GA 2WHPB 4UHFA 1TCCA 2XQIA 5CT4A 2XMCA 4J0CA 1ZJ5A 3O4HA 1WPXA 2H7YA 1UK8A 3K9BA 5JADA 1DX6A 3UMJA 4J0DA 1H2ZA 4KJXA 1GQSA 3GUUA 1J1IA 3WIOA 5HCUA 5K3CA 2AJLI 3D2BA 1OILA 1P0QA 2B61A 1DTEA 1GKKA 3G02A 4FFVA 5DLPA 2WILA 1EHYA 3C70A 2HU5A 3I6YA 5CH8A 4Q82A 1YSCA 1ETHA
chains in the Genus database with same CATH superfamily
2QYHA 3TTUA 1WVMA 1ZRMA 2F3SA 1D7AA 1W4LA 1PJSA 3CZPA 3RW9A 1BD3A 2DAPA 4I50F 2HB6A 3P26A 1CE8B 1Z5OA 2Z09A 3GEBA 4EW1A 5ALMA 3H86A 3LKZA 4O4HB 4P3OA 1E5XA 3L8EA 3QYFA 5EJEA 1P7YA 5DTQA 4UUPA 1RQGA 1WHTA 3KWMA 2DPLA 4QFBA 3RVMA 4JJ6A 5B6IA 3UWKA 4XVCA 3K1ZA 3QNWA 3M89A 4IO0A 5AOCA 3KZOA 2JAHA 5AH0A 3OC6A 4RORA 4UHHA 3TIFA 3W5CA 3G3EA 3I6MA 2HRQA 2Q5CA 4ZA2A 4RE6A 1U0HC 4LJSA 5IXYA 3PS9A 3EWSA 3V1UA 1B8UA 3TOVA 1UBJS 1WR8A 2FPSA 4TYNA 2FGJA 2D3TA 2XWJI 1A50B 2TMKA 1GTJ1 3GXOA 4GS5A 1II0A 1PK7A 1AQ6A 1RAAA 1FBNA 3U4QB 1HDOA 5T67A 5JYEA 4WLNA 3K7EA 3DBOB 4PFKA 4BJ5A 4YFYA 1DARA 2P62A 4I4NA 4DMLA 2BFCB 4EA6A 3EBOA 3F98A 1EAYA 4M1OA 4WPGA 3IDQA 4WE3A 1XTZA 1FDWA 1TADA 4EPYA 1NSTA 1LA2A 3CNLA 5DYYA 3KETA 3K32A 2AI1A 3WMRA 1RLIA 4ZU1X 3W2IA 5JZ9A 4N1AA 3GEDA 5FJJA 1Y6FA 1TAHA 1XJ0A 1PNOA 1MBZA 1DMSA 4WZAE 2IL1A 1F1BA 2R8EA 4MW9A 4XQ9A 2VPYA 3S2FA 1XTQA 2AN9A 4YMGA 2DSNA 2C2MA 2EEPA 2UVDA 2J3DA 3E6AA 2BR4A 3I2HA 2DCMA 2NXNA 4TTTS 4DC9A 1PNRA 1O5IA 3QYJA 3N2ZB 2VC2B 4TVOA 4Z9FA 3QFSA 4J0JA 4D97A 4Q9DA 1XNQB 2GPAA 4GX1A 3VZCA 3BK7A 4LZOA 2Q4OA 1V2HE 1C30B 2WTAA 1WDMA 3IE0A 1Z2NX 3WFIA 4DLNA 5DM2A 1W48A 3NHJA 1HZJA 3QXHA 4JELA 4LK2A 1SVWA 3PYMA 4OB8A 1ZN9A 3H7AA 4AVYA 1JQJC 1OI3A 2ODAA 1G8MA 4QOSA 5LMUB 4GZ5A 1PFVA 1T2VA 2E5WA 2EL9A 4PLWA 2FLKA 1M2GA 4NNPA 3P32A 2G72A 3DOHA 2JKYA 4ETMA 4AN0A 3IQHX 4R9UC 4DSNA 2MSDB 1K8XB 3VI3B 4EUHA 1A9TA 2ZR8A 3HCFA 2D5BA 2XWQA 4RS3A 4ZAZA 4CU5A 3QVLA 1H3NA 1U5BB 4X7BA 3QJGA 2HMWA 1B23P 4BO2A 5HK8A 3UFXA 4D0GA 1EWKA 5KBYA 2OCBA 2FDCA 3ABSB 1D2EA 4I4TF 1OXSC 1UKVY 2G0NA 2FSHA 3A3KA 5F51A 3VVCA 2HMUA 1G3RA 5IYZA 2WM9B 1X1QA 2GWHA 2Q9AA 1NXQA 5LQMA 1U3CA 2JJYA 3SFTA 3TQFA 3V4VB 5L7TA 4RHFA 2C8KA 4MINA 4A9AA 2AJDA 1QR6A 3PGKA 4N18A 1GRCA 2NO9A 1NVDA 5K3FB 5H83A 4FJ1A 1WHSB 3ECAA 2UXDB 4MS3A 2FR8A 2F6RA 2H4WA 3T7DA 1N7JA 3E58A 4C3ZA 3IE2A 1DDIA 4MKGA 1I9CA 3UZUA 3VPCA 1DV1A 3A9RA 3NOQA 4RF3A 3VV2A 4BJHB 4ECEA 4MCHA 2FHSA 3VPFA 1W36B 3LVQE 3HJNA 2AMYA 3HUFA 4KWTA 1EX7A 1I7DA 2FI1A 4UVEA 1WMBA 1Y4SA 2XMPA 1JA1A 4X00A 4YMTA 1VLMA 3LUAA 1GKUB 3MIZA 3N9IA 4I99A 4PLPA 5KTNA 2VHWA 2YCLA 2VSXA 2FUEA 1E9BA 1PJAA 4WKOA 2XE7A 1G38A 3LBFA 2A0UA 3ELWA 3NOVA 1UC9A 4NOKA 3QA3E 4D6PA 3N8HA 3Q3VA 4IUBS 1U2DC 2X77A 4G9GA 2OCLA 4V0NA 1C0LA 3W9BA 2H7VA 2PUBA 10MHA 1LWNA 3QOFA 3B1XA 5C8XA 2F3QA 1IUNA 1KU0A 5G1NA 2FZ5A 2GT1A 5LU9A 1IN8A 4TS4A 1EXWA 4X45A 3VHLB 1FIUA 1LSSA 2Q45A 4N7BA 1NRJB 4M8SA 1N0WA 4U3JA 2RH8A 3SYRA 3E7PA 3UAZA 4CMEA 3VU9B 2JDID 4IDBA 2C9DA 1W4ZA 4U8GA 4GDMA 4WCFA 2F00A 2K7ZA 5BNTA 3IOBA 9LDBA 5IZCC 3EHEA 2IHUA 3K1AA 3QRWA 4E5MA 1XMVA 5JQGF 3PD0A 1A2QA 2J7PD 3O92A 3E7FA 4EGSA 1HT0A 3EVTA 3CX4A 3HJAA 3QE9Y 1VZ2A 5C7OO 4RKQA 5DNEA 3Q10A 1E1YA 1WDLA 2BCGY 2RG7A 3ZE8A 4CV0A 3A9UA 4NIMA 1TKBA 2P0AA 2OC9A 5AW8A 1SCKA 1W4AA 1BROA 3EOBI 1I1HA 5I7FA 3UAGA 1GTVA 2XZDA 4G3XA 2I2FA 2C58A 1QQ6A 2QXYA 2YN4A 3BG5A 2M1XA 4LZNA 1PR3A 3C43A 4MV3A 5LBTA 3RFXA 3VJMA 4C4ZA 4YUAA 4YACA 2NZ8A 2HQ1A 3ZDDA 6REQB 4MEAA 2XXAB 2XB6A 1SZJG 2HKIA 2JGRA 4YFVA 1EINA 2R751 2H63A 4H7DA 4Y9RA 5CU7A 4Z4GA 1N2HA 4Q4HA 4REQA 4F7WA 3FVTA 1U0NA 3AF4A 1NZFA 3T5BA 3VKHA 1F2TB 1GPAA 3B3GA 4IFIA 1B74A 3C1OA 4U2GA 3CZQA 4P80A 3IT0A 3B6JA 4YLEA 1K92A 1IFXA 4XLZA 4IVQA 4YRFA 4WXPA 1OGYA 1GG8A 3DL4A 4ZGBA 1WIWA 3A6JA 1V8ZA 2JEZA 5BNZA 3SCZA 1HE4A 2O7NA 3ITEA 2B37A 2Z9BA 1JS1X 2Z8YA 4ZHSA 2LV8A 3H8JA 2GCIA 2PD6A 1VMDA 4EPVA 5A3RA 3NLLA 3AVPA 4NV3A 4UAUA 1Z0AA 1EX1A 4M9XA 4CL0A 4D80A 1DT5A 3WRXC 3FZNA 1TC2A 2C03A 2Z2IA 3FWYA 2EKBA 4PZ0A 3UGTA 3V8BA 4DWJA 4XWOA 2R6CA 4F21A 3IKJA 2OB1A 4OF4A 1OQAA 3G2HA 1SK8A 1XXHE 2F8SA 1JJIA 2V74B 1NL3A 3C24A 3CLHA 1WXWA 3FLMA 4RL6A 3GP8A 1HV8A 2QAGB 5AKYA 5SZKB 1ODCA 3EZNA 3GGDA 4RV5A 2GF0A 2GRJA 3LQKA 4MB2A 3P2JA 1KMCA 1ESZA 5I3ZA 1V7PC 2CJFA 3N6XA 4KGDA 3K0HA 3HA2A 4ZDJA 4FFBA 3JCZA 3AG6A 3PFKA 2VK4A 1P2FA 1R3UA 1UM8A 1U3TA 3R5XA 1XK7A 2JFOA 5EPEA 3EOAI 2P90A 5EHQA 3OE5A 3KL2A 4YRQA 2Q1XA 1UMDB 4IM7A 3WXBA 4J03A 2GN1A 3JQBC 1XMSA 4ZC8A 5JPIA 3WJAA 2C8LA 2HXYA 1R37A 1T5IA 1OLSA 1VHLA 2DRIA 4RH1A 2OCIA 1E3LA 4OXYA 4U8HA 4PLHA 3B1YA 3FDXA 4EMSA 3QFTA 5COQA 1TZJA 2ASVA 1K6MA 5K0EA 5I47A 2P4HX 3OE4A 4NS1A 1YDFA 4NBNA 1IZYA 1RQNA 3EFEA 3I9NA 4ZV7A 4AKTA 4C5AA 2FW8A 1TK2A 5FTKA 4X5OA 1NVUQ 1E6MA 4FIZA 4KXMA 2OO7A 4KUEA 5DGIA 3RHZA 2AGVA 2GZSA 1JIJA 1Q6ZA 1OZFA 5GGXA 2DFLA 4IJUA 1G64A 1RJGA 2YTZA 3ZIAD 3WK8A 4EB0A 3UFBA 1XZEA 1SQGA 3VTAA 3TSWA 1K08A 3A37A 4LJKA 4BMXA 2Z98A 2CNDA 2HM7A 1M75A 1KY5A 1LBEA 5L3QB 2D1TA 2ZB3A 1CR6A 1TM1E 2R79A 2RFLA 3SHQA 2GJSA 5A5EA 3B1VA 4I46A 1NI4A 3PWSA 3PT5A 3TMAA 3L0BA 1N36B 3W6OA 1HYEA 3HKCB 3PF8A 4DPMA 4GPBA 3RPEA 3LUBA 3SYKA 3EB9A 1W5SA 3TBFA 5K8CA 1DIGA 5AJYA 4FR0A 3UUFA 2VYQA 2EC5A 1E4VA 2X5NA 5GGYA 5AKEA 3PUIA 2W11A 2P2DA 2WSSD 3LVRE 3OT1B 4UAJA 4ZAYA 5KB3A 4TZ0A 1W0KD 2I4RA 2O8EB 3AETA 1K7FB 2VJAA 2Q2OA 2UUPA 1HTWA 1QH1B 4K0RA 5JCOC 2OENG 1P91A 2UYCA 2QI9C 1WV0A 4MW6A 1ZNXA 3B60A 3GY0A 1ZKMA 1J2TA 4G9EA 2KPOA 4KK4A 5JWOA 5KTKA 1NT4A 2ZRGA 3WJ1A 2JIMA 5JHGB 1WMEA 1OX4A 2G25A 5DPMA 2IDZA 4UW9A 3MGBA 1UK7A 1J2JA 6CHYA 2R68A 1WW2A 1ZS9A 1MJ5A 3GV0A 3IJEB 1EIZA 4RPLA 3TWOA 4GZMA 1Y7TA 2HNKA 4H6VA 1QIGA 3OMXA 3K0KA 1ACLA 4KXLA 4D8TA 2C29D 1HDXA 1QO0D 2D0IA 1MNQA 2W8ZA 5DHPA 2YRFA 1L7DA 4B4OA 3AHFA 3F6EX 4YCLA 1PSDA 3PTZA 1U90A 1FFDA 1BNCA 3VVMA 4ENUA 2QN6A 3TMYA 3D8RA 2QT0A 1TM7E 1HLPA 1C80A 1JSXA 1PHRA 2YQZA 3TVYA 1SXJA 1G21A 4PG7A 4V2UA 4CF3A 4EPWA 2YOHA 4JBLA 4YJFA 3C3EA 5A71A 3M3DA 3ULKA 3EW9A 5JXHA 5U9CA 2LD4A 5FBZA 1PL6A 1UKBA 1XDUA 5D00A 3ZHBA 3ZQ6A 5JC1A 2P65A 2PH3A 2NMVA 2AMFA 4F4CA 3N6VA 3JAWA 4YV2A 2JLWA 2VUSA 1DS6A 4FSDA 5K4AA 1QZUA 4A6EA 1P7CA 1FP7A 2WF6A 1XYYA 1Z2AA 3FOCA 3IRUA 3KM0A 3LCVB 1ACMA 1TQDA 2OG2A 3I83A 3Q7EA 2NN3C 4MGEA 2XB2A 2IVZA 1ZH0A 3NDIA 2OZEA 3STUA 1PQUA 4D8YA 3FBTA 3KDPA 4OGFA 5JNVA 1O9GA 2DH6A 3A28A 4KNWA 1ZD3A 1GUDA 2XQKA 3ZZ1A 4QKQA 1N4DA 4P83A 4TTQA 1N5JA 4YT5A 3FX2A 3WWEA 1LDMA 2G1PA 3RC7A 1V1MB 1VMIA 3QOWA 1YR6A 1HKHA 1MG0A 1RWOA 4LXXA 4MKXA 4UZSA 3BRWA 2IPMA 5JS1A 5BSRA 3TLBA 1IN4A 1NNEA 4WJLA 3C8HA 2CMKA 4UKDA 2RIRA 4XUCA 1AXEA 1J6UA 3VZRA 4ISCA 1N5OX 1YA4A 1Z45A 1JVSA 4N65A 4RTJA 5EP4A 4ODIA 16PKA 4WK0B 1JDSA 3AKCA 1G42A 4PY2A 3QSYA 4PIPA 3O7WA 4TMWA 3KQOA 4QYIB 1I3LA 2N0SA 4A27A 1RBZA 3OLVA 4Y2TA 4B6OA 1ZHHA 2WG0A 1OBFO 1E8NA 5ENVA 4KMMA 5SYAA 3SQLA 1F3LA 4CCYB 1FDSA 4RXMA 3NBAA 4O8ZA 5DYTA 3U4IA 3SHWA 1QX3A 1IJFA 3DDWA 3CUWA 3ACCA 1KETA 3PA6A 4UHEA 5K3FA 5P8WA 4CWAA 1TYBE 4ETWA 5AVSA 3OZWA 4O6VA 1JLKA 3QFRA 4KOEC 2C7PA 4IV5A 1AGYA 4MVJM 1UC4B 3ZE9A 4BN0A 5J2TA 2Y1FA 1WB4A 3NNDA 4C03A 4KR6A 4HAXA 3NKLA 3SFVA 5JW6A 5CB4A 4XZ3A 2ET6A 2I4NA 2ZAOA 2QS9A 5FCDA 3TQQA 3EUAA 1Y5NA 3LRPA 3MRXA 4A6XA 2PS0A 4Z49A 3T1TA 1WAMA 2BF7A 2B4KA 2Q0XA 3RRJA 4DIDA 3F3YA 3OLWA 1A2KC 2YJNA 4LHSA 4EHKA 1NBMA 5JEEA 4IHQA 4WBXC 5EQDA 2ZJ0A 4KV9A 2X4LA 4JJ7A 1Z12A 5IRCD 2C00A 3OTQA 1RZVA 3MINB 3H11A 2HZ7A 4Q18A 4YCJA 2FAXA 3SHFA 2QN3A 4OGKA 4D56A 3GO4A 1EWQA 2YV3A 4J3JA 1USWA 1G4HA 1QHFA 1F2VA 5EP1A 3PEYA 2HHAA 2QP3A 4TYQA 3OIWA 1WY7A 3OX3A 1BMFD 3IJRA 5DH9A 4ASUD 4D9HA 3U80A 3KFVA 3TDKA 1SRQA 1W5BA 5AJUA 4C4TA 2JFWA 1T6NA 2IUSA 1Z6YA 2VYVD 2JD2A 3U3DA 1X80A 3SHOA 3MYRA 3RRXA 1H66A 5FPPA 4KE8A 1IAQA 1YIOA 3CW8X 3TD2A 3ETHA 3HQ4O 1Q7TA 1W30A 1CKEA 1T24A 1V48A 1Z8FA 1JMVA 2DR0A 2H3EA 2PGIA 2UZ1A 4I1YA 4LRSB 4QDXA 4F2HA 2AZMA 3KSRA 4HEA1 3K35A 1XEXA 1Y80A 2WE8A 3O4JA 2H1RA 4BXOB 1OLOA 1QZXA 2OCGA 4KUHA 3K6RA 1FJXA 1P31A 3PJRA 3OJEA 3F46A 2D1QA 1DAGA 5T3UA 3UHOA 1E92A 1JW9B 5L3QA 3HA5A 5CVVA 4KX5A 5AXCA 2ASEA 1EA7A 5F23A 2P4UA 4B48A 3KQLA 4A10A 3M4YA 1QV6A 4D3XA 5AP9A 2BCJQ 2IYNA 3OPXA 4V0OA 4RVSA 3AVTA 2DY0A 4XCXA 5DNAA 5EQJB 1DU4A 1P1HA 4EJMA 3ZTWA 1SMKA 2A30A 3I52A 4JEMA 1I7SB 3IXQA 5TB5A 3FDIA 2O1SA 3P2KA 2OZLA 1JFVA 3K9HA 2BI7A 4LXYA 4MUIA 1B6SA 4DJEC 5IVDA 2AKAB 3R5FA 4LBZA 1LTQA 3GVPA 1LJUA 1HMPA 1X9IA 2JW5A 4WFKA 2PKXA 1BCSA 3B3FA 2B0JA 1KSFX 2QUBA 2W22A 5IXJA 4FR5A 4ZO7A 3QVUA 5DYNA 1UUFA 5I9MA 4BAUA 1Z17A 2PZKA 3I37X 4DAEA 4X7PA 2P2NA 3ZG6A 3C8MA 2I1WA 3HO6A 3JQAA 5AVJA 2QVYX 2GBLA 4PG6A 1VHQA 4YASA 1UMBB 1T2EA 4FGSA 4DWWA 2BWJA 4EEXA 1TMKA 3S1AA 4CKEA 1VE5A 3B6ZA 3NDRA 4GAEA 4B32A 4Q48A 4F4FA 3NFYA 4G4IA 5KNDD 1FVHA 2WNHA 2ZRKA 4IVPA 4RGQA 4IZOA 4YP5A 4MWDA 2VFAA 3S29A 2W2VA 2AZTA 3KT8A 2ILTA 1OHHD 3ERCA 3AF2A 1C7JA 4DV1B 3ZE2B 5F12A 5I4CA 2QAGA 1US8A 3KYCA 3GLVA 3GJ3A 2P9JA 4RIFA 4JA2A 1BYIA 2JCBA 2JIRA 4OQNA 5DB4A 2HCTA 4NHOA 4BGDA 3WWCA 1QK4A 1E5DA 1UBTS 2IEBA 2BFNA 3FPAA 4MGHA 4YH1A 1X9HA 3V2HA 3UT0A 4G67A 4QARA 2Q3DA 2Z5GA 4X7RA 2YS7A 3M7IA 2OBLA 2SHKA 3DBRA 3RSGA 2AW5A 2XBMA 4X65B 3I9V6 2O0JA 3K5IA 3W5DA 5GJWC 3RK0A 2R5WA 2ZT6A 1M0TA 5LU8A 4MI1A 2ZIFA 2HBQA 2O20A 1C9JA 4R5MA 1N7GA 4ER6A 1RLJA 1ODLA 4LOIA 4Z2AA 5FPTA 5DIFA 5F7JA 2EIXA 1AQIA 1OB5A 1DBIA 4QTZA 3OX1A 5F1PA 1RPNA 4FOSA 1Q17A 1U7ZA 2UAGA 5IMSA 1YQUA 1ZWLA 4OP2A 3IAFA 3FFAA 4CG2A 1NAHA 2QR2A 4Q1BA 4RANA 3A32A 3HKBB 4EUEA 5I7UA 4AKHA 1XT6A 2A9FA 1V9LA 1ZCZA 3IVGA 4WJZA 5JH7A 2WQ6A 3FN4A 4M1YA 3ZQ4A 1RYNA 2IOYA 4RPHA 4ATNA 4EVSA 2Z6QA 4Z4HA 3UK0A 1C2YA 3FCSB 3REQB 2WR8A 4O4JF 1LW6E 5CLJA 1J5EB 4RKFA 2GHRA 3PDIA 2ODEA 5IZCA 3OVMA 3SE7A 1I24A 4GE0A 1IBMB 4R0MA 2FE4A 1GIAA 5B4TA 3FDJA 1WVGA 1HT2E 4L4UA 1BU8A 1J0CA 2CLOB 1APBA 4FHZA 1RFLA 1NUPA 4ILKA 4NBSA 3RGGA 2PRIA 3EXFB 3L0SA 1SCUA 4IQ0A 4MI6A 5KSOA 1E1CA 2A9KA 2WJVA 2FWRA 4C08A 4DIEA 2Z8YM 2NYRA 4HXYA 3NAQA 4B1FA 3DVAA 5EGNA 3VH1A 4BZPA 1DOZA 4DM4A 1D8TA 4N3AA 4I1RA 2X14A 5PNTA 3ZCPA 3BF8A 4EYSA 2ECQA 3DDNA 1U8AA 1ES9A 2B9VA 3KFLA 4O02B 4OBEA 3QLVC 1KR5A 1R18A 3QJYA 3MA0A 2YINC 2W2QA 2V6GA 1LTKA 4DLTA 5CDTA 2FPRA 2R1ZA 2HHLA 1MFZA 4KBYA 4M0MA 3TQHA 5JFGA 5ITSA 5BNWA 5DLEA 3UXYA 4W82A 5ALWA 2VNAA 3RS2A 3IBYA 5CDUA 5KTMA 5BOVA 1X38A 3DE4X 3O8OB 4RVGA 3BE6A 1Q83A 2CJWB 5AI5A 2EJTA 1G4AE 5DBFA 4HGQA 4LJ7A 2COUA 2GOYA 2CZQA 1NJ5A 3OFSA 3ROPA 1BQ3A 3KZCA 4Z0NA 1IXRC 1TO2E 1W88A 3G8DA 3R74A 3W90A 2WD7B 5KPJA 3TGPA 2JBWA 1I3NA 4RK7A 1EZ4A 4I9UA 4TKVA 1XVVA 1YH3A 1W9MA 1RHJA 4FSXA 4MPTA 3WMXA 1L3IA 1OFVA 1QOPB 2BSXA 2ORVA 1FSFA 4CR7A 3O5AA 3DDZX 2DGDA 3DONA 2NVUA 4NICA 3ZLVA 1BD4A 2CHFA 1TC1A 2H1VA 3B89A 5CT9A 1SPXA 4DR3B 3P0RA 3UPDA 4EOGA 3NVMB 4LC9A 3TIIA 1W9HA 2D2XA 3FYUC 2AI2A 5DM70 2IPNA 2G8NA 2W6NA 4DM3A 1P4JA 3BTSA 2V9PA 4H7EA 5AOVA 3ESZA 3HCNA 5E7QA 3RU3A 1NLFA 2R3SA 4Z4CA 4PO9A 4CMGA 1SHUX 1YR2A 1UQTA 4IKOA 4IOLA 5EIWA 3RG8A 4U2DA 4EJ0A 5EVCA 2VTBA 4B4KA 3WLJA 4EW6A 4LSGA 3FNEA 5ITZB 5DWVA 4RW0A 1AKVA 1ECFA 3HKBA 1NPDA 4GF5A 1XCPA 3V6MA 2PGDA 5JI2E 2PS9A 2OCDA 4W6ZA 2DKFA 5CYPA 3ZCXA 5BV2P 4QPDA 2ZU0C 5KWIA 3RUPA 3C3CA 3OIDA 4U6QA 3SVLA 1WU7A 1P4GA 2WYOA 3EGXB 4J2OA 4L6AA 5HOQA 1JAZA 3CKYA 4HZGA 4W5JA 4GI1A 2GDJA 4IMIB 2Y77A 2CKDA 4TN5A 1AUOA 2NO1A 4AM8A 5IW8A 1CQJB 1R3DA 1FX0B 3KTOA 3U44A 2OCYC 4O1HA 3U26A 5LL6P 1KZ1A 3GBVA 4EHIA 1HOXA 1YVRA 5AESA 1LQUA 3I1YA 1N1EA 1DJQA 2D5IA 3KEFA 4WCDA 1NW3A 2NVBA 2Z5VA 1W5EA 3FJOA 1W1WA 1SC1A 2EAUA 2OBFA 3L0CA 3PNVA 4G1UC 5IBQA 2JAOA 4BFUA 3PQ4A 4DC0A 5BOSA 2BV3A 3FAKA 3AL0C 5KHAA 2QD5A 3E27A 5FI5A 3VR5H 5H0IA 2NU8A 3GLKA 3C6MA 3RBZA 2XUOA 1SG6A 3AKZA 1J56A 1NR1A 3R24A 4LOHA 3KVNA 1KQPA 4LZAA 1MGPA 2FSSA 1ACJA 3R0VA 4AMYA 1XMQB 2JLSA 1WCV1 4J16C 2J9FB 1D6SA 3RKUA 5K3BA 3FUCA 1R6UA 2OAQ1 3BMOA 3CM0A 5CLLA 4MITA 4H7HA 3WB0A 2ODQA 4GBED 4WFIA 3W2EA 2O8BA 2UV8A 1Q1BA 2O23A 1XSEA 2I6FA 2J4CA 2Q27A 4CMHA 2XCUA 3CT4A 4TVBA 2IYUA 3CGGA 4PFSA 3E7DA 1E5VA 4L1KA 3MTEA 4WH0A 3PUJA 1WKBA 3VR3A 7MDHA 4Q66C 1F7UA 4O2BA 1M6WA 3T7SA 3QEBZ 1K0UA 3WWPA 3ZI4A 7MHTA 4F1WA 4EZBA 3A2NA 3VAAA 4W4TA 3T95A 3S8MA 1U3FA 1MENA 1YDEA 3EODA 4B09A 1DXOA 1OZHA 3ZHTA 3QTLA 4L5AA 5IN4A 3AO0B 1CZRA 3OHSX 5FOTA 2JK1A 1TYDE 1L1QA 3LO5A 1SVUA 1HLFA 5L6MB 1VECA 4CEJA 2FMIA 1PK8A 3CRMA 4HDKA 5FNZA 3TI7A 4D96A 2O54A 1HYBA 1NF2A 1DTSA 2BFAA 2D4AA 2F67A 1VCMA 3WLMA 4AF7A 5I5EA 3R3XA 4GMGA 3AEKB 4OQDA 4R31A 2ENUA 2QY9A 4IXTA 4YHBA 2PS3A 4Z7JA 5IVKA 2GZAA 3A8TA 3PYXA 3RG2A 3E9MA 3M4JA 2WBLC 5C3MA 1FUKA 3K73O 4PQFA 3LYLA 3ZDBA 1AF4A 3INRA 3ZLBA 4BBAA 3FPGA 4NYJQ 2C88A 3B1WA 4DLAA 3PFIA 3QPUA 2F3RA 1JALA 1KQ3A 1KC3A 1P1KA 1S9HA 2WKPA 4UMEA 3MM4A 5FULA 5HKBA 8MHTA 2JBAB 1XEWY 1L2TA 2R6HA 3SQXA 2JD0A 3HB4X 2OFWA 3A9SA 3DTVD 3WL5A 1WZNA 3ZWQA 2CF6A 1DWQA 2ZB7A 1GCAA 1TCBA 1MB2A 3L0PA 5E95A 1G5TA 1CUEA 4I08A 4RLQA 4JUCA 3U6KA 2G07A 3N75A 3W4IA 2R2GA 1T6ZA 1NT2A 4KRXA 3BICA 5F3DA 4EI7A 5H3HA 5I01A 5ABPA 4TL7A 3KJZA 1JJFA 4FYKA 5TPWA 3VPGA 1CY0A 4X60A 1A1VA 1JEQA 1EWRA 1KDYA 3RIMA 3U6BA 2PKQO 3BXEA 5J4VA 1TRHA 2XGGA 1CY2A 3E9YA 2D7JA 3IODA 3W5UA 4NOJA 1AJEA 1T91A 3S68A 4B6JA 1IXSB 3O8RA 2DUUA 5JH7F 5H1YA 2MSLA 5KKCA 1UXIA 3LIIA 3PIIA 2HZBA 4FFOA 5CEEA 2XQGA 5J2TB 2ZM5A 4ZT3A 2VQEB 5B4UA 2GVZC 4JC5A 4QT0A 1L5LA 1ISPA 3ILYA 4B3GA 3BJEA 2R8OA 1K8RA 3JXEA 4MPDA 4QA9A 5JZSA 1D8AA 1S6YA 3LDAA 1ZM4A 3FUWA 1OLXA 5E6SA 1U2RA 4CT0A 2ZBFA 1TVEA 3PJEA 1FSSA 4OXRA 4YX9A 2VSQA 4J6EA 2RGUA 2E5FA 2YWDA 1POWA 2P1ZA 1QF7A 3OEEA 3TQSA 4LYDA 1LK7A 5GP1A 3E7XA 1DGQA 1MA0A 3IJ5A 4LHVA 2B1IA 3CR8A 3WNVA 1DO8A 1NMQA 1OXBB 1W34A 3GPDG 3MERA 4CLDA 1V1RB 3NG1A 3DEFA 3BA1A 2QMQA 3KEGA 5BN3B 3EG9A 4A2PA 5AKJA 1QZZA 3VNSA 1XUOA 2CHEA 4XPIA 1ZO8A 3FCCA 4EH1A 2NSHA 2ZIZA 1H0SA 2OXRA 3CPSA 2AOTB 1T0IA 4BN5A 2YY7A 3HXMA 5CB0A 1EI9A 5FWNA 1YL5A 1HZZC 3LV8A 4HLDA 5LMCA 3ZNQA 1YIDA 1RJWA 1SUFA 2JI7A 1KYZA 1E98A 2PSHA 4B87A 1FLAA 3MGAA 3UUEA 4U6NA 2VHJA 1OT5A 4YRSA 2WM8A 2CDRA 2QTLA 3UPTA 3E0QA 1JFRA 1J1ZA 2RK3A 1QRTA 2F8TA 3K15A 1KI4A 2I2DA 3PNKA 1IQRA 2HBRA 4GSLA 2BHLA 5C8ZA 3FCAA 2YJZA 3GLIE 1BWPA 1CIVA 4XB2A 2VHCA 5I9IA 4ZTUB 1XRSB 1O95A 3QPDA 5JMTA 3OZVA 2EJVA 3RHFA 3JATB 4LRQA 4H7IA 1V1MA 5C0OE 3C4VA 4ABYA 3LC7O 1QMPA 1FL9A 4FZ3A 5ALOA 2W2TA 5FXMA 1D4AA 3HBNA 3OZIA 1EWTA 4HMOA 3SEFA 3VR5A 2F4VB 2IIVA 2H5EA 3W6UA 2FN7A 4M9RA 4KLZA 1TAGA 3PDIB 3L3BA 4M89A 4XIYA 1RU3A 1ZEMA 4UUMA 1CRPA 1JUDA 4C0AC 4K6KA 1JVNA 4Z0PA 1HFEL 1OZAA 3TDNA 5JD5A 1PZFA 3HP1A 5THXA 3ORHA 1JHYA 2WYIA 1KZHA 4Q4JA 2CL5A 3WR5A 5I4IA 2VDMB 3KKEA 3C7DB 2IOFK 3CRQA 4QU0A 4CF5A 3O3NB 1QHXA 1A71A 2PBFA 3GGPA 3H19A 2EATA 5CM8B 1TZ2A 2HPAA 2C3MA 3HN7A 4BNYA 1HG0A 1NKSA 1IEWA 1KJQA 2ZJ2A 2PPLA 2V4ZA 2B7BA 3QEMB 1XZMA 4G01B 4NZZA 4OFZA 3PFGA 4NRDA 4OVKA 2YHSA 3F71A 3HU2A 5NLLA 1PBTA 2E3JA 3Q40A 4OSOA 1ISSA 1WZUA 2HMVA 1I10A 2FP4B 4XUDA 3UOGA 4FBLA 2IXDA 1DO2A 2AFVA 1LZLA 2F9FA 2WA1A 2Q5HA 4QWWA 5LQCA 1U3DA 2Z30A 3A3PA 1DJNA 3QKIA 1Z4KA 3PHLA 5DTRA 4ZCIA 4IDPA 4M0FA 2J87A 1Y5IA 2GCEA 4KWEA 4KE6A 2WB2A 5JE8A 4MB6A 3HB5X 4UBMA 5G1OA 5I4KA 2IUUA 1O5OA 4FT4A 1YE8A 2VO1A 5F5LA 2QSUA 1CQWA 4KVZA 4NJOA 1UXHA 3G88A 4HH4A 1E1KA 2XGSA 1HQDA 3E5NA 4EG3A 4D74A 2H2IA 3W7BA 1UDAA 5CVEA 3QENA 4REOA 4F4IA 4RPJA 2VYNA 2CLLB 3VPDA 2QPAA 5D3KA 1SD5A 4G6ZA 1AN9A 5I9LA 3OY2A 4EB6A 1T1EA 2QY6A 1VE9A 4JODA 3HBMA 4WACA 1FS6A 1KAQA 4QQRA 4ZOAA 2XDQB 2Y05A 3ITDA 4EHBA 4MUJA 3LK7A 4BNDA 2FRDC 1GNSA 3DMFA 4KIWA 2QJRA 3FTEA 4JLAA 4P4SB 3SGLA 2FPPA 2GEUA 2W58A 2W6JA 2W2OA 1G5IA 1C3JA 1A9OA 1CJUC 2O3JA 2WKQA 3IVAA 2X6QA 2C7RA 1BO6A 2MJLA 3RLFA 5AVXA 5KTPA 2YMLA 1R50A 2OPBA 1GZSA 5ENDA 4XD7D 2ID7A 4LRXA 1RLTA 2AN3A 3PHGA 4TS9A 3E3NA 3HDYA 3LX4A 4ERXA 2I6XA 4CLHA 2CGEA 1KEVA 1TD9A 2QTZA 1CEQA 5CHYA 4BP9A 1Q1AA 2CK3D 1YZQA 1ZICA 3SIPA 3ZV4A 1ZX1A 1QDLB 2WU4A 5E3HA 2QW0X 3HNPA 3PQEA 5JWHA 2O7SA 1QVVA 2FG5A 1U2GC 2Z57A 4MA5A 4M9ZA 4DA8A 1NJGA 5A5GA 1XZKA 2GPBA 3HFJA 4BLUA 2BR3A 2G0TA 1Z13A 2DQKA 4A26A 2D7DA 3P94A 1TUBA 4NE2A 1Q84A 3GBPA 2O07A 4NSNA 3UO8B 5CBPA 2IPOA 4G1BA 5K3SA 3IGFA 3OEWA 1SC3A 4QOHA 1NPTO 2BEVA 2HWXA 2JLAA 4OQFA 4I5EA 5G4LA 1CS4C 5H59A 4DR4B 1NUHA 4B80A 4UBOA 2Q29A 3DVAB 4X93A 4WXYB 1HYQA 3RWOA 2C0QA 1KJYA 1V6CA 3OQVA 5L7YA 4BB5A 4JC4A 2Y3IA 4H17A 3UW3A 2GDZA 3WISA 1B00A 5KX5A 1OIXA 2ZPAA 2DMRA 1V43A 1KI3A 3N0TA 1IRXA 4UDXX 2O1XA 4KVAA 3LWZA 4JR1A 2IV2X 2ODNA 1YBAA 3EDYA 5EZYA 3SS9X 1QSGA 3D7NA 1T9AA 4R51A 4Q9LA 3Q3IA 1GV0A 4GKBA 1ARZA 2EKDA 2GZRA 3ONNA 1JHZA 1HPLA 3QU5A 2Q7DA 3RC1A 5BV7A 2DTXA 2WT8A 3QKTA 3SK0A 3T5AA 1H8HD 2VDJA 1ONBA 4GT1A 3QFFA 2W9XA 4GMFA 1CVLA 2IFTA 3GGSA 2CE2X 2DP4E 3BIJA 3NJ8A 2E18A 1MA3A 1G20B 4Y7DA 1NASA 3C39A 4NBRA 5FTWA 3WKBA 4Q1EA 5EE0A 3DE6X 3AR6A 3OKAA 1KYXA 4R2LA 1NBWB 5EG5A 3C5WP 2AJCA 1QH9A 1UM9A 4YAFA 2WIJA 1K9SA 4DA9A 1ZCFA 1GZ4A 3COVA 2YZ2A 4WK2B 4LZZA 3VAYA 1EJ0A 3FA2A 3K2IA 4PLFA 1DUIA 2IXAA 3G2QA 2Q9BA 1RI4A 3PHJA 4W1QA 3UA4A 4B6QA 4ZI3A 4QYMA 2O2GA 5D85A 4UTZA 5JJIA 3VU8A 1PJCA 5FOWA 2QLBA 1JHXA 4TV8A 3S8YA 1JDJA 2O5EA 4JSRA 2R6FA 3TH5A 3D9QX 4X3OA 3ZVRA 3RS0A 1JX6A 5E6SB 4ZYUA 1J49A 4KKXB 4V0KA 4TSKA 1TT5A 1X74A 2C2YA 2FW1A 4BFSA 4I1PA 1KVRA 1OGJA 5LLSA 4G0MA 3WL7A 3ZBUA 3DT9A 3ZLJA 3A4LA 1WUJS 2GUWA 5CPBA 1DDGA 3SE0A 3QXCA 3SKVA 3UV7A 4AJ9A 5T57A 5KINB 2P9BA 4MYSA 2Z2KA 3COJA 4JLJA 1EBBA 3MMXA 3VYUB 2XDAA 1Q7GA 2PLFA 3D7LA 5BVGB 4HWPA 2PVSA 3TM5A 3ILVA 4EENA 1JFSA 5FBKA 3LY9A 4GPD1 5KSZA 2FR0A 4AJ4A 4CKCB 1N2CE 1EFPA 2ZSKA 2P8SA 3IP3A 3M70A 4LRWA 1F0YA 1QG2A 4Q9HA 4XX1A 2J3MA 3AY3A 1FLNA 1UJBA 1XTJA 4OB7A 4R8MA 1TLTA 2XUQA 3SLKA 1AGNA 1JE0A 1ODTC 3QKSA 4R3NA 3D4BA 1L5GB 3ANSA 1RADA 3WJ7A 1AF7A 2ZYDA 2C5GA 2DJIA 4B6SA 1JGTA 2QLTA 4EFDA 1N6LA 3FLBA 1JVBA 1DADA 3P1JA 5T41A 2GRUA 3SHVA 5EESA 3MD0A 3JVUA 2VAPA 5FFMA 3A1TA 4KR7A 3T9EA 3DEKA 2WHXA 1GARA 1V7CA 1VP3A 3MXTA 5EUMA 3FR7A 3ZHVA 1FSPA 3UV3A 4IHJA 1N1DA 1Z4QA 3ZD9A 2ECFA 3Q72A 1SZCA 3GU3A 5C7IO 1Y1LA 1QHEA 2JLBA 2TYSB 2Z6VA 4ZZ3A 4UNPA 4FDMA 3NBYC 4DOMA 4ZYTA 3KSAC 1QJ4A 1CF4A 1XRLA 1QE5A 2FWJA 1NXSA 4QTXA 4P34A 4E1VA 4TZ6A 3PV0A 2OV6A 3WGGA 4X64B 3U19A 1BH2A 2BL4A 2FGKA 5SV2A 2XXBA 4MYTA 1F48A 3ESBA 3ER9A 3CEHA 1SRRA 3JQ9C 4HLQB 3QVTA 1YK1A 2JNWA 2Y71A 4L51A 4TKUA 4HNUA 1K88A 1JMKC 3A58B 3D6UA 5JASA 1XD8A 1E2IA 2V9CA 3ICPA 2JGNA 2FG7C 1RJ9B 2NUAB 3IPLA 4U1RA 4HYQA 3HDHA 2ZRMA 3U7EB 5CCXA 4IIJA 1PJ8A 2CC2A 2IE0A 4ZRMA 4YV7A 2I4OA 4PHTA 2AEJA 4M9SA 2OP0A 1R8SA 2DB3A 3NTVA 3SX2A 3I9KA 3ZY6A 5KS2A 1ZJ4A 4AY2A 3S1LA 4XGIA 3EZYA 3RS7A 5AOAA 5MGBA 4MDFA 2V6BA 2XYHA 2Y0DA 4N3CA 4PCUA 4UM8B 4BX2A 3H1BA 4E3WA 3Q7TA 3HACA 1ICIA 1P0CA 5DGCA 5MN6A 2H48A 1ZHOA 1KOFA 4YCCA 4TXHA 1YZFA 1MEOA 1EVJA 1UJCA 2CFRA 2P4EA 1CD5A 4RS4A 4UNQA 4R9RA 1E5TA 1KZ7B 1Q6YA 1YFJA 5B55A 2O2YA 4FFRA 1FEZA 3O75A 4IDOA 5AXAA 2GKOA 1OAOC 2AR9A 4AJEA 4C5CA 1Z6AA 1Q74A 3KJFA 1NUAA 2FLVA 3AC0A 4KWHA 4QDKA 3FPSA 1JHRA 5DHRA 2CNLA 1FU8A 3PGJA 1J21A 4TQAA 5ILOA 4QUEA 1E9RA 5K5EA 4LFBB 3EXHC 5M3BA 5JCXA 2POCA 3ZVNA 4E33A 4KQFA 4YJDA 3M2PA 3CONA 1UWVA 3LPLA 4LCJA 4PSCA 4AS2A 2Q21A 5ALPA 3L77A 1DKOA 1IZ9A 1CY4A 1Y6RA 2Z4SA 4FXOA 4K05A 3S99A 2FN8A 2C3YA 1BQ4A 2BEVB 2MYNA 2X13A 4Z8YA 5BSMA 4DMMA 4YRAA 4Z9XA 5BWLA 1AA9A 1Q1GA 1KO7A 1SVMA 2J5BA 4NAHA 1FMTA 3VJLA 3MTBA 4J16A 1IY9A 3ETDA 3RK1A 3VTKA 1SGWA 1XDZA 1ODSA 1K0FA 4M7PA 1GCOA 2BGTA 3NP9A 4CL3A 2P2LA 3ELYA 1WBDA 4FWBA 2DR3A 1JFLA 1X2BA 2XCLA 2X40A 2PA0A 1IEQA 4WY8A 2VP5A 3U49A 1EE2A 1P62B 4B43A 2V7PA 3ZKWA 4ZZ1A 4IMPA 5L95A 3L0IB 4BLWA 1V5WA 1A5TA 3E2IA 3EEOA 5IAJA 3WVNA 5KQPA 1IYZA 1GNVA 1QZTA 1ABBA 2Q6OA 1OZGA 2IV3A 4QELA 4DSUA 4EKIA 2Q8NA 2A1UA 1G55A 4KL8S 2C4MA 4RETA 5CVCA 5IARA 3JWIA 2IXTA 3UKJA 1JAHA 4JL5A 3UFXB 1C7IA 1JDPA 1TA0A 1DC7A 2KS6A 3PHIA 3WOVA 1L9KA 1ZA2A 2OXEA 4OHZA 1JEDA 1COZA 4GFDA 3BWMA 3Q12A 1AVTA 4AWXA 1OLXB 4FGLA 1ZGZA 5DCUA 4F8EA 2H1OA 3UICA 4CNBA 1GGMA 4WXHA 2P3SA 1DUSA 1GZUA 2A9JA 3I9LA 1U2QA 4Y6QA 1RAHA 1M0SA 5J3JA 1YB2A 3L8FA 3SQOA 4BNXA 3ZCSA 1MB0A 721PA 4Z3KA 4QDZA 1GADO 4G36A 2R8ZA 3KXLA 3RS5A 4NTZA 1GQFA 5L53A 3GZJA 1C30A 2WG1A 1AGPA 1YO6A 1AO3A 2A88A 2PA3A 2C82A 1M6VA 1JLLA 2JGDB 4UBIA 4U63A 3R7WA 2A5FA 4Y98A 3RUIA 1QGZA 5K8VA 2GEVA 3RYCB 4Q01A 4ADSG 4DL9A 1R0XA 1RWVA 3INYA 3M0EA 4FUTA 4XFDA 2QGZA 3C74A 5FEMA 3W1WA 4BC0A 9ATCA 2H65A 1PE0A 1C9YA 1JR3E 3FMPB 3WK6A 5L40A 2GERA 3DL2A 4BRSA 2XUHA 5H9WA 2H4YA 1GPUA 4KPUA 5B3JC 2AWOA 4WLVA 5F5NA 3EXHA 4LE0A 3V8QA 2Y1DA 1XTTA 2QE7A 2G82A 1GZ5A 1M6HA 2V55B 3R0XA 3W5HA 1OJLA 5LWQA 2GN2A 1BDMA 4MRPA 4F3RA 3UMVA 3NPMA 3WMFA 3BMNA 4I1UA 1UMCA 1YVUA 3P7MA 2EP7A 1UZNA 4DLYA 2GPJA 1SXQA 1V5GA 1J06A 1Q7CA 2IWRA 1UCFA 3EPLA 3CSUA 1D03A 1KJ9A 2YFQA 3MOGA 1LPMA 2QX6A 3LUFA 4FPXA 4JKOA 3R0ZA 2PUVA 3BSSA 3LL7A 4BV3A 3K3PA 1FA9A 1JDTA 2HSDA 4P4UA 3S1AB 5H7XA 4F6LA 3LXRA 4LW8A 4RTNA 2N46A 3BHJA 3SC2A 5K51A 1ZMRA 3VGPA 2VWPA 2CLIB 3OICA 1BDBA 1I14A 4NR0A 4O4LB 2ZR7A 4LOLA 4LWZA 5EUQB 2BMAA 2Q5JA 3BS4A 4LK3A 3WB1A 4ZOQI 4QDOA 3AHEA 1AU9A 1TQ6A 5ED0A 4PCLA 3TM4A 1EHCA 1V35A 2E89A 2GF9A 1VHWA 1P39A 1MG5A 1UIRA 2VHVA 4H9GA 4U7PB 2ZCUA 5C52B 2OGSA 3F1LA 3GT4A 3BULA 1D1QA 3BDIA 1FBTA 3MSCA 4P4GA 3O4RA 1XAJA 4PZUA 5AM2A 4YIHA 3O3CA 1D4ZA 4TT3A 3A27A 4C0JA 2V1UA 5LOVF 3I9JA 2VJQA 3IO3A 4Z3DA 1GU0A 5CYGA 2W2KB 1XNHA 2I99A 4QOGA 3RVBA 3TZ6A 2MWMA 4A36A 4RF5A 1YQQA 2BMDA 4L72A 2F8LA 2DPHA 4YC7A 1HQKA 3OCYA 5C5DA 1IC6A 1JT9A 1S3FA 3LGXA 4YP9A 1UBEA 2RH5A 4QL3A 1C9MA 4KLAA 4R1UA 1DAIA 4S1WA 1NOKA 3FDZB 3P45A 2B25A 4MRMB 3CVUA 4XA8A 3KBOA 4YIKA 3DBLA 4L7QA 1QVRA 1J97A 2JAPA 2OHIA 3TR0A 3DEHA 5C5IA 4Y7CA 4OMDA 3CRRA 2YYSA 3LVFO 3REFA 5FWAA 2ZSJA 2GTHA 3PUHA 1P1CA 4LE1A 3X1WA 1OLSB 1KE2A 3S55A 1IY2A 1X92A 4QEZA 1ZXBA 4YRCA 2AEFA 3MJCA 3QX3A 4DSZA 2ZIWB 3ZK7A 3EA4A 5C8YF 2YQ4A 2FN4A 4OL0A 2P79A 1R6DA 1RPAA 3IQZA 4LVNA 1EGAA 2E4AA 1X94A 1SNYA 3HVJA 4F4DA 3WGJA 2X0EA 1RWPA 4KMRA 1QFZA 2G0AA 1P7WA 2OG1A 3PA8A 4CDNA 1XP8A 3QK7A 1T26A 4JXZA 1QRAA 1SH7A 5EIXA 3OD1A 4JENA 1UOQA 4TROA 4AROA 1VL2A 4QBHA 1PLJA 2ATCA 2JRLA 3NGXA 1ZUWA 3H5OA 4QODA 3K8YA 2PZAA 2CXRA 3QEKA 4NP6A 4EJ2A 5TJ9A 1NRWA 3A10A 3BGDA 2BKUA 3JQ6A 3DOUA 2VLBA 3UWOA 2ZBEA 4MIYA 2XAUA 5A7HA 3ZK9A 4GX5A 1V5IA 1LJLA 3L49A 3HCWA 2FKNA 5HMMA 1WQ3A 4BO8A 4C01A 4W5QA 1LX7A 2PRJA 4WQMA 4CIAA 1QLWA 3AKYA 4B8YA 5REQA 4FE4A 1EQAA 2BHNA 1SOUA 5JSYA 5KTOA 3T0FA 4RCZA 1NR5A 3TLGA 1EP3B 3TQTA 3PDUA 5HTOA 2PWYA 4ND2A 3KB2A 3OAAA 4F9GA 4IYRA 3SEQA 5BPFA 5AJTA 3LHIA 4BFVA 1Y0BA 4KGZA 4RZXA 1HL7A 3SEAA 2C95A 2FW6A 2XUDA 5JALA 2FPKA 1KEKA 5C53B 2O8EA 1XQ6A 3FRHA 2JFVA 1U9JA 3LHKA 5IT5A 1C0IA 1SVNA 1ZD5A 1PQWA 1UKCA 1J2EA 2ZRAA 3MAAC 4H08A 3DXZA 2OLJA 1VSVA 5J5CA 4YMUA 3EASA 1EXDA 2IRWA 1JR6A 1TYZA 2FWIA 2P77A 2XOEA 2KBEA 1YRWA 2A5DA 3OMWA 4YAJA 4EABA 4F60A 3R7AA 1ZN2A 2PTGA 5AFSA 4N7MA 2HX1A 1AZLA 1KI1A 2PRZA 3MWKA 4HR7A 2PE5A 1XROA 1HF3A 3B36A 1OI4A 1VGRA 1NN1A 3JQAD 3VYSB 3D6JA 1ORWA 4BLOA 4ENWA 2JKZA 4H0CA 5CNKA 5EYPA 1XHEA 2WVHA 3ROEA 4IZHA 3VDMA 1U9IA 3OA2A 3SZMA 2OQRA 2VF4X 2QRPA 3IEMA 4LRTB 1RYBA 1XZLA 4RVNA 4V0QA 2JHFA 2P7HA 3LXMA 1C81A 4JI0B 3BIXA 2LTAA 1NVTA 3TQCA 2O8DB 3FMFA 1LDYA 3E84A 3CTMA 2EFJA 2OYRA 1O03A 4KR3A 3L7NA 5B5SA 4NBUA 2FK7A 2J5XA 1NN0A 2UZ0A 3C7KA 1ZH4A 3WIUA 1R00A 2MMGA 2JCXA 4UVIA 1ZBQA 3TD6A 3GVCA 2XMRA 4FCVA 2ZYWX 4TUYB 3NHKA 4BNLA 3NTXA 1KXZA 4DQVA 5A4AA 1TW3A 5B64A 3WIDA 5B6PA 1ECJA 2H2HA 4QDJA 1A5SB 5H82A 1KGDA 1M76A 3OCCA 2OCXA 1T6XA 2N1MA 3L7LA 3OPYB 2FJUA 4UJ3A 2O4CA 4NFYA 3DYVA 2XAAA 1GYQA 1ZGHA 1CUVA 3KWFA 1NUQA 5CFNA 4C0SA 3QWBA 1X39A 3E5MA 1DAFA 3FZQA 4MIEA 5F2KA 2PX3A 2ZRNA 3TTVA 2BP7A 1LDBA 3VAZA 3FTFA 4Y1RA 4B7CA 3NO4A 4FHCA 1BKDR 1IPFA 1SA0B 2OZVA 4L3VA 5KYXB 2QYTA 1N5RA 2IIPA 3GIWA 3EVFA 1NP7A 4NPAA 3PQFA 3WLHA 5HKKD 1JI0A 1D07A 1WG8A 1XFDA 2WM3A 2Y1OA 1WX1A 3CNNA 4Q3AA 3ITNA 4OQLA 5HM8A 3C3JA 2HIAA 3SKXA 2Z8XA 3J80A 2AB0A 1FFYA 1SIWA 5G0VA 5IUNC 1KH3A 2JIDA 4QUGA 4CODB 3ICEA 2VOJA 3HVKA 1GNRA 3E61A 1T3LA 3K1YA 3B6EA 3P9KA 1UFRA 5HBRA 4Q19A 5HF6A 1J8FA 2XZTA 1RTTA 4HAOA 4RYLA 5E9AA 4EUFA 1O96B 5TVGA 3RYIA 1A9XA 2XF2A 2X15A 2VVTA 3HBAA 2HA0A 2DH5A 2HA6A 1PGPA 4NI5A 3T1VA 1IWOA 4CKBA 5IBCA 4MAMA 2XLCA 2BW0A 4R1QA 3FG9A 1GILA 1JTEA 1Y82A 3H5LA 4IIYA 5EKUA 2VDWB 3O0TA 4H59A 4DSAA 5M04A 1RRVA 3OSUA 3ZXIA 4Q12A 5BT8A 4U2BA 5F9FA 2MSEB 2FWNA 1LQ2A 3JALA 3D3NA 4PFJA 2AG8A 2R44A 3IP8A 3NTOA 4JXKA 5K2OA 3O31A 4JGIA 5BNFA 1T2FA 2GBLC 1FU7A 1Z0JA 3LH5A 4KQCA 2BMFA 2HK8A 4P2BA 1GFIA 5CX4A 5B7PA 4NENB 2AX3A 5HGXA 1DT3A 1XP5A 3QBEA 3F5MA 2WA2A 2H4HA 1A5ZA 1CZHA 2WWWA 3BD6A 5CVTA 5KTYA 4LAFA 3U1BA 1I2MA 1RWMA 1BCRB 2HQOA 3UHPA 1V45E 2J31A 3QE2A 5JG7A 4NBVA 1KF0A 4M98A 4PZCA 4WLFA 1R8XA 1GSHA 1LTHR 2BUCA 1VG8A 3G1TA 4Z9BA 5JIBA 3RSOA 2YHIB 3GDFA 2C59A 3V55A 1G0NA 4HDSA 1J1UA 1B8PA 1RAIA 2IQ5A 4CFZA 2OHJA 3SXJA 2RD2A 2H6EA 4XB6B 5DMXA 3TLZA 4F85A 1MVOA 3N1UA 4AP5A 4DCMA 5LQJA 4LSWA 3QLEA 1O95D 5H9VA 1DQRA 4Y1FA 2CBZA 1XTRA 3O2JA 1GKIA 4XR9A 5DMHA 4C4YA 5A02A 5TC4A 1TO1E 1N8KA 4AZ0B 1PAUA 4WCFB 4ZT7A 5J4LA 3NW9A 2PXXA 4L8VA 4MR9B 2AEEA 3FOEC 1SCNE 4KEAA 5HZGA 3COWA 4YXWA 4HDQB 1V6AA 1YDGA 3CH4B 4JGGA 3W3AH 1E3IA 1U7DA 4U7GA 3OE7D 5HCNA 3NXKA 4BZQA 5BVHB 3BTUA 1AMNA 4D8VA 3LBAA 5HJ5A 4QVGA 3UMBA 3CRVA 4MQUA 2NGRA 3UWDA 1IY8A 4OXQA 5E2AA 2C61A 3WOHA 2I22A 2VLIA 3G17A 4B81A 4GOJA 4PZEA 4TQ9A 3DEYX 1H22A 3JVVA 3GLIB 1IHXA 1MFPA 5CFMA 1KEWA 1CIPA 1MOSA 1KP2A 2NV6A 4G65A 1H2HA 1RWBA 4O4JB 2QXTA 4F56A 1OF1A 5DF1A 3L6BA 4LXUA 5TY0A 2P6RA 4JD5A 3W5SA 4ZO9A 5T4HA 3F74A 4HX5A 4KR0A 4U9IS 1EK5A 3WZMA 1YB5A 3VH3A 4YAOA 3WBBA 2Z04A 1V37A 4X6LA 1PS9A 2W4MA 4O0LA 3ZY2A 4X9XA 2O3QA 1WHSA 5IDYA 1JKIA 4RIEA 1T4CA 5IT9A 3ZBTA 3KR9A 1N0VC 2XV1A 2Z3ZA 3PXBA 4O0MA 4GQBA 3ZQKA 3JALB 3VHXA 4YPFA 4D8WA 3WGLA 1Q12A 1V1RA 3DWEX 2ISSD 3A9CA 3Q5DA 2VH1A 3ACBA 4ZOLF 4RV4A 3VYVA 2QD3A 3WYFA 3QG1A 4QLBA 3ZD7A 3TLYA 1EK6A 2F64A 4RD0A 1U7XA 2X5JO 3KRTA 1R4NA 2CL6X 2IA5A 3NQ41 1KOGA 1U28A 1NC1A 4UNNA 3FOAA 3VDNB 3B8EA 2EOAA 1VLQA 2PO5A 1YCHA 3HYCA 3IKVA 1EE1A 4AIIA 4BQRA 4UD2A 4JVNA 2WUDA 2WF5A 4P4LA 1Z0SA 3R3WA 5CX1A 4OSEA 1PR1A 2FPGA 2DBRA 1VIYA 2HF8A 5BQOA 6REQA 1JHOA 2PD3A 4XUGB 2ZYVX 3L82B 4O3MA 3MTIA 4PZZA 1NXOA 4LVCA 5IC6A 5HJ2A 4WBSA 2PR7A 1YA6A 4J7CA 2Q3HA 2DKOA 4DBLE 1N9ZA 4MS1A 5K2MA 4LFCB 1YQTA 1OLUA 4C2UA 2C2WA 1P1IA 2BF4A 4YV0A 2J48A 1HNNA 3HNRA 3PLAE 5LYJB 3TXXA 3K4HA 4DA4A 3KPJA 3DTVB 1DZ3A 2DHDA 3MBOA 1ML4A 4TSRA 4KPFC 1E2LA 3HJGA 2BC9A 5JAHA 1TTHA 5KSWB 2I3AA 4AIRA 4KO1S 2YC2C 3KSZO 1EUYA 3P19A 4M7RA 1JG6A 3OWXA 1S2NA 2XDQA 3KZ1E 4CJXA 1NW4A 2IIQA 3VR0A 4D99A 3RS9A 1B1AA 3WNDA 3WYGA 1I7LA 3K9GA 4ZQEA 3UANA 5JY6A 1BCSB 1I01A 2XVZA 1F12A 4HG2A 4DUGA 1NQUA 4GWGA 4WBNB 4PAWA 4E94A 1J24A 1GUYA 1QHHA 4BAZA 3PX2A 4HGZA 4YNBA 3PQ2A 2H0QA 1ZMTA 1K8ZB 3BGSA 3EIOA 1TMOA 1YFZA 5EEGA 3L7IA 4KGXA 1Y1TA 3TIGA 4YQZA 1XYGA 1PR5A 2PZBA 4EZEA 1Y48E 4V38A 4I0WB 4LRUA 1XZPA 1W581 5KWEA 2QPLA 1AN0A 3V3TA 1OI2A 4KGVA 1WKVA 2GASA 4FHGA 4NEQA 3DOCA 5HFAA 4YMVA 4FD3A 4MP3A 1ZMOA 1RYZA 2XDWA 2VDVE 3QKUA 1V7QA 1JEEA 4O29A 3VX4A 4R6XA 2IUEA 1LV8A 2X8LA 2ZIGA 1H8HA 4PYJA 4E12A 5EJ7A 2BH2A 1QQAA 3B9QA 3NZEA 4INJA 1XQWA 3Q87B 3RASA 1TIBA 3VKVA 4M87A 2QTNA 2L18A 5I8PA 1P74A 1TMYA 1THTA 2PLRA 5JJBA 4FDLA 3F6PA 3CS3A 4WL0A 1KBZA 1G8PA 1TU4A 2XE8A 3JZAA 2ZUEA 2QUIA 2FQQA 3LRTA 4P33A 4DYDA 5EKSA 1RAEA 3FOBA 3C8DA 3P96A 3PC6A 3UYKA 3WLOA 3T5PA 4ZQHA 1KY3A 3S5UA 5LIPA 2QT1A 3BAFA 3PQCA 4G5SA 2PAFA 3JQFC 4L95C 5ADUS 1PDWA 3WAJA 1S5PA 2JCVA 1Y7HA 2ZDQA 3PCRB 3B8HA 2AFIA 3CLTC 1W8IA 2O06A 3ADOA 3B5JA 3EF3A 3I3OA 4UQLA 2PANA 3A1NA 4G56A 2PJUA 2NSDA 1Z5PA 5BXQC 4RKRA 1E6UA 1PVDA 2EX1A 4L15A 4LY3A 5IJ9B 1DX9A 3JQDA 1E9CA 3MJFA 1OZ0A 2JLYA 2XCOA 1K2VN 4K8RB 1E2DA 1QIEA 2F1OA 4LCBA 5FLKA 2Q99A 1KEPA 4ZAFA 4LJLA 1YL7A 2WWVD 4AJOA 3KQSA 3O4GA 3I8XA 1BS2A 4HDMB 2FPWA 3MWJA 4Q39A 4TKZA 2PUAA 5F2EA 3QUTA 2R7KA 2WF8A 3OPNA 3S2ZA 2O2XA 2P68A 3FKJA 1QOQB 5IC5A 1L7BA 1KK1A 2JCGA 3ZY5A 1P77A 3CMMA 3ITKA 2IZOA 2ZSBA 4DNOA 4QXOA 2RC6A 3DMTA 4N5NA 3CVOA 4Q9KA 4BMDA 4EVIA 1Z2CA 3DDHA 2AMVA 4FQ7A 4CMKA 4YR7A 4Q37A 4FHEA 2HL6A 1QX4A 5TQ0A 5TJHA 1I6KA 5F2OA 1TM4E 2NVOA 2Q5OA 3NM4A 3X44A 3KE9A 2BKVA 4AYWA 3QVJA 5EHGA 2OV1A 3HBLA 2QMYA 2WWFA 4CBVA 2XRYA 4ZOEA 1FXSA 5F35A 3O84A 4GO1A 4V1CI 1PJ2A 3M9WA 2ZCJA 3CTPA 4EARA 2B82A 1BE8A 4D3ZA 2RHLA 3UJBA 1W6RA 3MWDB 5HPYB 1H3EA 3F5SA 1WP4A 4WVLA 1GG2A 3I9MA 2QM8A 3FDFA 1C3OA 3OIVA 2XBLA 3NJRA 4IFTA 4JB2A 2PUCA 2A3RA 4KHZA 4Q3EA 5DBHX 4EA8A 4IJ6A 3D31A 4I8DA 4DMRA 1SCIA 1V41E 4BU1A 2QL9A 2PUDA 2IITA 4INPA 4U39A 3AZPA 4MUFA 4O33A 2QSYA 3CHYA 4ZOBA 5D6NA 3TL3A 2BGLA 4ZGGA 3ILSA 3KYIB 2QRVB 2W8BA 3QUBA 2RBKA 2HV9A 2WFLB 5GJBA 5K0CA 2REQB 3UJNA 3DAHA 2G9ZA 4FI3F 2IHJA 2YIDA 5IAGA 2UUOA 1P7PA 1SZDA 2YFYA 2B0CA 1DBRA 5IT4A 1CQIA 3G49A 5YASA 4MIOA 5A04A 1YRBA 4R9SA 3RNOA 3W1VA 2A9PA 1R66A 4JZKA 2CMFA 4LQ4A 3VPSA 3EDRA 1PD0A 4HYEA 1WZ2A 4ETNA 4E30A 1HDGO 1M2WA 1NI4B 3HU3A 4TLBA 2CSXA 4U2KA 5JO9A 4ZI5A 2LR0A 3ZZUA 1ENPA 4F5ZA 3NXSA 5ESWA 1CCWA 3DAGA 2F8MA 1G8KA 3IUQA 4PFQA 1W52X 1W5AA 2GN4A 3LDHA 2O2CA 1DFHA 3ZD6A 1FP2A 4XWKA 3CFYA 3DM5A 2WZCA 3G0OA 1HYGA 4JC0A 1XNRB 5KQLA 1QGOA 1DC6A 1W2HA 2YJ3A 4P38A 5JDCA 4GPTA 4W99A 5C81A 1A9QA 1NMSA 1O9HA 2RJ3A 5DFAA 3VISA 2J08A 3OUUA 3QM1A 4F5EA 5KQGA 1SXJC 1NSFA 1MPTA 3TE6A 3SJAA 3RYCA 5FOUA 2EG9A 3EXG1 1N0HA 2SBTA 2YRWA 1VA5A 5A9TA 1RYDA 4JP2A 5CD1A 1NVAA 3TW0A 4ZZIA 1GRQA 1SUEA 4HKTA 1S8FA 2HD4A 1AKUA 4ONEA 3ZV7A 1PZGA 4F11A 3HUDA 3BE5A 2VS1A 4DEYA 4RMHA 3RVSA 1KTIA 1PBNA 1N8TA 1P6XA 2VDPB 4K86A 5E9WA 3RYFA 2C7BA 1J33A 3LL4A 5CMLA 3UNXA 4P3NA 1QTRA 2RHBA 3M4XA 3NCTA 1SC6A 2BIFA 2RGXA 1A8IA 1JZSA 1M2VA 1NU8A 3GMTA 3KDAA 3ICWA 2AFHE 2C0PA 4R9NA 2G9NA 1J7JA 1GNTA 3KKZA 4L02A 2V0CA 3LGSA 1ORRA 2DKNA 1IG3A 1DQSA 4YMIA 1FF9A 5MF6A 3DSRA 3KJGA 2GI4A 5FFFA 3I1JA 5BYAA 1IMOA 3LLMA 1CZKA 4QO8A 3GFBA 2G4CA 2L19A 1J8QA 1KEUA 4B4WA 4C06A 3LX6A 3KR1A 4MYHA 5JYBA 2YKGA 3KYDA 4RA9B 3UAVA 1FNDA 1G59A 4X71A 1VL6A 1D5CA 2IHNA 5AK0A 3ENWA 3O1IC 3RV4A 4G86A 4P84A 3ZZMA 2HOQA 4RL4A 4UHFA 3WL3A 3W8EA 3WHPA 2M6SA 3G5LA 4CM8A 1MJHA 2BI8A 3QIVA 5ICSA 3KIPA 4K9KA 1NG1A 4W7IA 2XQIA 4XQEA 2A8YA 1PQYA 1KSHA 1EFVB 1W0KA