4UHHA

Structural studies of a thermophilic esterase from thermogutta terrifontis (cacodylate complex)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
273
structure length
273
Chain Sequence
AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ESTERASE
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
total genus 107
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhhA00
2XUQA 4J0IA 5AI4A 5AO9A 5HF9A 4JYPA 1CEXA 1VA4A 1AKNA 3WYNA 5I8PA 1K4YA 3VJLA 3YASA 1E66A 1I6WA 1WHTA 3BXPA 4DLNA 4H7JA 3M82A 3STUA 5DWDA 5DJ5A 4MEAA 2QKYA 1VKHA 3H19A 4N5HX 4U2GA 2XMSA 1KEZA 5EIHA 1MX5A 3WL5A 1ISPA 3WKEA 1D07A 2XLCA 2OPHA 3G7NA 4Q3OA 5J3JA 1CRLA 1DWQA 4I4CA 1CUIA 4AQDA 1HDEA 4HXEB 3A2MA 5AI5A 4Z49A 1IUOA 1W4LA 1BCSA 1N8SA 4GW3A 4QDUA 3WMRA 5FDFA 2G5TA 2PUHA 4AO6A 1ZGBA 1NU6A 4G9GA 5FOQA 5HCUA 5DNUA 3LIPA 1JFRA 1H2ZA 3STTA 5HKBA 2OCGA 4P08A 3I2KA 5CRIA 2IITA 5A71A 2QTBA 4KAFA 5AP9A 3U1TA 1QONA 1HPLA 2QM0A 5ALVA 5LYYA 2XMRA 2J4CA 3WQHA 5JIBA 1JMYA 2GZRA 3MVEA 3STXA 3PDCA 3W06A 4IH9A 3WIBA 5HQ3A 2RHTA 5ALGA 1UKBA 4EHBA 1A8UA 3LP5A 2B4KA 5AICA 1IUNA 4BVLA 3C5WP 4UBLA 1X2EA 2BKLA 3IULA 2ROQA 6YASA 1EB8A 4Y2UA 1UXOA 2HFKA 4JEIA 5AKIA 2HRRA 1CUVA 4I3FA 1U4NA 1P0PA 2QS9A 3PF8A 4RE5A 2GYUA 4B84A 3GELA 4KJXA 4E15A 2UZ0A 4BTLA 4Y2QA 4ZGBA 1XZEA 1QGED 5CMLA 3WWCA 5C8XA 4Y2TA 4AB1A 1VZ2A 5ALHA 3AILA 2BAGA 5IVKA 4UHCA 4C4ZA 2PKYX 2YASA 2G63A 3G0IA 3G8YA 3OC0A 4CCWA 1Q84A 3VVLA 1A88A 3S2ZA 4FDMA 2BUAA 2YH2A 2WIFA 4BZZA 1CUZA 3BDVA 2WFZA 5AIBA 1O6FA 4ZRDA 4G5XA 1Z68A 3DOHA 1ZD4A 1MU0A 2Y1KA 3KSRA 1RP1A 1BROA 2H9YA 2V96A 4HRXA 3QMVA 5D3ZA 2JF0A 3R0VA 3DEAA 1QTIA 2GYWA 2XUPA 4QE3A 1DQYA 1JKMA 5AM1A 2ZJFA 4Q1VA 2YYSA 3G9ZA 4H7IA 2C58A 4UBOA 3MGAA 2XQKA 1ZOIA 2ACKA 3ED1A 3R3YA 1CQWA 3R3XA 4BAZA 4P9NA 1VE7A 1UOPA 4AX4A 3HSSA 4CI9A 4G1FA 3WK7A 4X97A 2CUTA 3FYUC 3B3QA 1J1IA 3HACA 2DQYA 5AKGA 3D2CA 3R3VA 1CIJA 4U2DA 1LPMA 3KOOA 5FP0A 1TIBA 1SFRA 1A7UA 4B85A 5FXMA 5DYWA 5C8VA 2QT9A 2AJBA 3G9TA 3FAKA 2R11A 5AK4A 4WJLA 3UMJA 1TKRA 1GQRA 4OB7A 4H7FA 4RPCA 4GHWA 4KEAA 4QDZA 4FLEA 3RARA 4EY7A 4W63A 1AUOA 3IDAA 3F96A 4OD0A 3MUOA 3ICVA 3DOIA 1R4ZA 3G0DA 1VOTA 4PO3X 3L1IA 4DYHA 3ZPXA 1DX6A 1XQXA 2HADA 5I7UA 1ZJ5A 3WKAA 1X2BA 4Q3LA 3G9UA 1XQVA 4H35A 3CXUA 4B6GA 4RNCA 4J0CA 1XKLA 3A6ZA 4MQLA 5IVHA 1ORVA 2QZPA 5JD6A 2HM7A 1QIFA 1CUBA 4DMFA 2VF2A 1BS9A 4L72A 1GKKA 1XQYA 2Q0XA 2FX5A 1X70A 4J0HA 5AK5A 2OCKA 5AKJA 1AURA 4IO0A 1XRQA 2XE4A 1T2NA 1TCCA 3PFCA 2V98A 3O4GA 4BC0A 5HFAA 1XLVA 2VEOA 4C01A 3I6MA 1F6WA 4AN1A 4V2IA 1N1MA 1YB6A 5AK3A 1QIDA 1P0IA 2H7CA 3C6YA 2HA6A 2WG0A 4DM7A 3KWJA 2XUDA 1LPPA 2ZYHA 1Q83A 4YPVA 4UBIA 3GROA 3WL6A 4X3CA 5F4ZA 3HLKA 2G5PA 3M3DA 1CUFA 2HU8A 1P0MA 1DTEA 1CFJA 1PFQA 5A7GA 3WK5A 4DNFA 2PVSA 3D4LA 3G9XA 1M33A 3K6KA 2Z8XA 3QBJA 5E4YA 2WHRA 2WFLA 4UPDA 1OILA 4JH0A 2VT6A 4ARBA 3I2GA 4EA6A 1T4MA 4UFNA 4HXGA 3S8YA 4GDMA 5A7HA 2CBGA 1EDBA 3DLTA 3ANTA 3H1AA 4BRSA 2WUFA 2ACEA 4GBGA 4NMWA 1AMNA 2AJ8A 4Y9SA 3VKFA 1SCIA 4FLFA 5AM2A 1CUHA 5CXXA 3H2HA 4CG3A 1ACLA 4AXBA 1E8MA 2PSHA 4WDQA 4UUQA 3VVMA 3FLBA 1CPYA 2OQIA 2WILA 3FSGD 4DSAA 3LS2A 4YX9A 1KU6A 1ZJ4A 1K8QA 3H04A 2PSFA 2J4FA 3WWPA 2DCMA 1HBJA 2VATA 5HKAA 5JATA 2WTNA 1K6EA 1XRNA 1ZI6A 3SC2A 3O4IA 4DGQA 5ALNA 3D7RA 1WHSA 3OG9A 2HA7A 4BP9A 1XZLA 4N8EA 1WOMA 2XLBA 4B81A 3H2IA 1JI3A 4ZWNA 5T4EA 3R3ZA 3W2TA 5LZ4A 3L1HA 3FCXA 5A7FA 4W1SA 3WWDA 3GA7A 3B5EA 4DIUA 5AM0A 3DQZA 4H7KA 3EIOA 2JGLA 5ALKA 4OU5A 2RAUA 2VA9A 5FV4A 3A70A 5AOAA 1QIKA 1CUWA 3G0CA 4HS9A 5EHXA 3OOSA 4M0MA 5JALA 2W6CX 2ZYIA 3QZUA 4PSDA 2Y2UA 4DMCA 3FVTA 1DQZA 4LIPD 1TK3A 1UZAA 1QIMA 1FFCA 4QWMA 2GYVA 1LPAB 4MJ3A 1EDDA 1YCDA 3F97A 2HL6A 3C8HA 3FNBA 4C89A 2JEYA 4QA9A 1JJIA 2O2HA 4ZV7A 4BATA 3B12A 2C0QA 4C87A 4Y2YA 1K63A 4IHAA 4LHEA 2OGSA 1J07A 3DD5A 2WIJA 3FYUA 3C8DA 3ANSA 5AKXA 2DQZA 4FNGA 4OU4A 1QFMA 4UBKA 3O9VA 3H2JA 3F67A 2WIDA 3O4HA 1SC9A 1XZJA 4Y2XA 5AI6A 5E4JA 1YAHA 3A2LA 4PSUA 5ALEA 1CUYA 5AM3A 2P8SA 3G0GA 2DR0A 1FJ2A 4AMYA 4INZA 1TRHA 1C7JA 1Q0RA 1S8OA 3PFBA 5HFNA 4CIBA 5LZ8A 1AQLA 4G4IA 2QXUA 4Q34A 5JAHA 4L9AA 1QO9A 2GBCA 4X85A 4G4JA 4FHZA 4FNMA 2XMQA 2PSEA 4BDSA 1YA8A 1G42A 4X90A 5LZ2A 1W76A 4XWGA 3Q8WA 4ITVA 2OCIA 4MEBA 2Y6VA 2Z5GA 1MX1A 2DSNA 4CCYA 4WY5A 3WYDA 3F98A 4LYEA 1LNSA 3I6ZA 3H2GA 4TGLA 5AIAA 3VDXA 5A6VA 1YA4A 4U2FA 4FLMA 4KRYA 1XZHA 5T4BA 2J3QA 1UKAA 4NS4A 4XVCA 3O95A 4B0PA 2C5FA 1GXSA 3I2HA 5K3FA 3O4JA 5T4HA 1YR2A 2AJCA 3BDIA 1QJ4A 1KU0A 1H22A 2VAVA 3OM8A 4U2EA 3CN9A 4N5IX 1MTZA 5LP1A 2HFJA 1QFSA 1UK8A 3PI6A 1LGYA 5IKXA 1WPXA 2X5XA 5ALIA 3NWOA 4M0EA 3IIIA 4PNZA 4FBLA 3DYVA 3H0CA 1CUJA 1MO2A 1L7RA 3R40A 1BN7A 5DNWA 2WHPA 1AGYA 1EX9A 4BAGA 3WWOA 5ALOA 2BUCA 5KBYA 2JIDA 3SK0A 1N5RA 5CT4A 5IVIA 1BRTA 5FRDA 1CQZA 2HRQA 3QH4A 2OQVA 2WJ4A 2XUIA 3HJUA 2XUFA 1W1IA 3WA7A 1IVYA 1XZFA 1GT6A 5JZBA 4FMPA 5LLSA 5K3EA 2PSDA 5JAOA 4BCDA 3C6ZA 2PM8A 4UBMA 3V9AA 1F0NA 3AZPA 4BZWA 2ZJ7A 1BU8A 2WIKA 4XIIA 5HF8A 4F60A 1A8QA 2XUAA 5LZ7A 2OGTA 3KWFA 3R3UA 1CUGA 2E3JA 5CBKA 4PW0A 1BEEA 4X92A 3VJKA 3LCRA 1LPNA 4B80A 1EK1A 2XQJA 1MPXA 4BBZA 4IQ4A 3E4DA 2XMDA 1SCKA 2O7RA 2HA5A 1WB4A 1Q0ZA 2FJ0A 5AKEA 5K3BA 3DL4A 3I1YA 1TCBA 2GZSA 4BCCA 2GBIA 1VXRA 1XRLA 3JWEA 1A8SA 5CH3A 1VZ3A 4LKOA 2H7XA 1QIIA 5JZSA 3WA6A 1H2WA 2VJAA 3IUNA 3V1MA 5K5EA 3F9CA 4ZI5A 3TJMA 4MXDA 4H7EA 2JGKA 2VJBA 4PQEA 2WM2A 3AJAA 4NZZA 3AIKA 3WKCA 3M83A 3WKDA 4H0CA 1ZI8A 2WQZA 3ZLTA 4B9EA 1QTRA 3C87A 3D5EA 3QM1A 1MNAA 3RKSA 1JU4A 1HQDA 4K6KA 3JW8A 5D3KA 2CKMA 5AKKA 3LLCA 2QOEA 1PJAA 2K2QB 2OCLA 3BJMA 3HZOA 3K9BA 1CUAA 4C4YA 5CT8A 4J0JA 3IUJA 4HTAA 1JJFA 1VJ5A 2HA3A 2XUJA 3I2FA 4L0CA 3VISA 1WB6A 3ZLVA 5HZGA 2B20A 2XQGA 3AZOA 1JT2A 1UK7A 4CCYB 4W1PA 4HAIA 4BYMA 1XZGA 4KACA 5A62A 3FBWA 3G02A 2ES4A 4AO7A 5EIAA 3C6XA 2V97A 3PUHA 1WPRA 2JGEA 3WIOA 3IB3A 5AKYA 5CXUA 3OURA 4J7AA 2QUBA 5LKAA 3QPAA 4X6XA 1W6RA 1XLWA 5K3FB 1R9NA 2CB9A 1XROA 5JD4A 5FPPA 5ISMA 5LZ9A 1U8EA 4JUIA 4L3WA 1MAHA 2I3ZA 4UBJA 3V1NA 2I78A 1ZICA 2QJWA 3H1BA 4K5QA 1BCRA 5BOVA 1HLGA 4IH1A 1W52X 3PICA 3FOBA 2ZJ6A 5HF6A 4AO8A 2ZSHA 4JYMA 5AOCA 5KREA 4ARAA 5HQ3B 1DWPA 1CV2A 5A2GA 1EXWA 5ALSA 1GPKA 3C70A 1JU3A 2VQ6A 5CH8A 5EGNA 4EY8A 3W04A 1PV1A 3C43A 1XQWA 2PU5A 1FFBA 5AM4A 1C4XA 4K6HA 3STWA 3HC7A 1CR6A 5FPQA 4BVJA 4H7DA 3U0VA 2WG1A 3STYA 3R3WA 4DTCA 1QIEA 4B9AA 1LPBB 4Y2JA 1LBTA 3AIOA 1XZAA 3BE8A 4AZ3A 4AN0A 2RGUA 1QIJA 2PL5A 2WIGA 1EK2A 2QRUA 2PPLA 2PU7A 2VJDA 5AH0A 3O9MA 2VSQA 3ESBA 3O0DA 5ALTA 4P93A 2YXPX 4QDXA 2O2GA 3WLAA 3V1KA 2H1IA 4KRXA 1THTA 1EDEA 3WL8A 4OYYA 5AJHA 4FFVA 4BCBA 2BGRA 5AKLA 3EQ7A 1E8DA 2PX6A 4KAAA 4FTWA 4X95A 3WWEA 1U2EA 2LIPA 2Z3WA 3E3AA 2OXEA 3VJMA 2ZVDA 3KD2A 2XUKA 2PSJA 4Y2SA 3C5VA 3FLAA 5JASA 4HRYA 3ESDA 5FKJA 2HIHA 1H2YA 1GPNA 5ALWA 3DJYA 1GQSA 3V48A 1J2EA 5JZ9A 1EA5A 3ZLUA 2IIVA 1CUDA 5CT5A 4RE6A 5FUMA 1E8NA 2XMZA 2WTMA 4W1RA 4OPMA 4UHDA 5AI9A 3WJ2A 4HVTA 2XUHA 3T4UA 3T52A 1OCEA 4LXGA 3HYSA 1HL7A 3HABA 4BC1A 1GZ7A 4X7BA 2GBFA 1YSCA 4W9RA 3D0KA 4N8DA 2I03A 4G8CA 2OLEA 1CUXA 4DNOA 5HK8A 1JMKC 4KAJA 1ZIYA 1FFDA 2XB6A 5D6OA 1YB7A 1USWA 2QMQA 4EB0A 5JANA 2QVBA 5HF5A 1YS1X 4GWLA 2JGIA 3CN7A 1THGA 2O2IA 4GEGA 3L1JA 4EZIA 3HEAA 3A2NA 3ESAA 4BE4A 4WDRA 5AI0A 4FFWA 2ZYSA 1B6GA 3H18A 4A5SA 3BJRA 3DCNA 5AHXA 3ILSA 2PBLA 4E11A 1LZLA 2BJHA 3AIMA 3EF3A 1YS2X 1CUCA 1C7IA 2BGNA 2D5LA 1YAJA 2DHCA 3GZJA 5BV7A 1XRRA 3X3HA 1UKCA 3BIWA 2O7VA 5AK6A 2WUEA 3BF8A 2OAGA 4CIAA 1IMJA 1DINA 5CH5A 1UK6A 4HZGA 1O6GA 4EY4A 3E0XA 3DYIA 5EFZA 5JAPA 4UBNA 2EDCA 1F8UA 1WM1A 4G4GA 5CT6A 4MYSA 3EBLA 4MWTA 1J06A 5C81A 4KE7A 1G5FA 5JADA 4UFOA 5AM5A 4HXFB 4PF1A 1ZIXA 1MJ5A 2WFLB 1CVLA 5LKRA 1XZCA 2JGMA 3R41A 4Q3KA 2XT0A 1EB9A 4EY6A 4Q05A 4X00A 1IZ7A 2XMGA 4WFKA 1XZKA 4WFIA 3QITA 4ZV9A 1FFEA 2C0PA 4QEKA 3PE6A 2B9VA 1ETHA 1MN6A 4IH4A 3C6BA 3M81A 3QPCA 4F0JA 1UFOA 4BDTA 5ALMA 1TAHA 2RONA 1GKLA 2HU5A 2CMFA 1QIHA 5KWJA 4C4XA 4YK7A 4DMKA 2V9ZA 3ESCA 4J0KA 1LLFA 1G4HA 4X6YA 4BE9A 2Y2VA 5YASA 1FSSA 4OYLA 1UT6A 5JARA 3HXKA 5AKHA 2HA0A 3DNMA 2DHEA 4UHHA 4QDOA 4KE9A 3ZV7A 3KDAA 3FVRA 7YASA 1FFAA 4B7ZA 1E3QA 1SOMA 4A23A 4EBBA 3ICWA 5ALRA 3QYJA 5KWIA 4ZREA 3ZWQA 1NU8A 3G0BA 2BFNA 4K6GA 4DNPA 1WB5A 2EDAA 1XFDA 4F5ZA 4H77A 4UHFA 1UK9A 2WU3A 1E5TA 3FYTA 1EH5A 1ZD5A 3IUMA 4GLBA 2BUBA 1EHYA 1UOOA 3HRHA 1ZD3A 3AINA 2B61A 1YASA 3UUEA 4C6HA 4LXIA 1IUPA 3WK8A 5CTAA 4ROTA 2CEKA 4W1QA 3W9UA 2VJCA 1P0QA 1DX4A 3LIIA 2W22A 4X71A 1UOQA 1L7QA 1R3DA 2PUJA 5DLPA 2VAXA 3STVA 4F21A 5CT9A 2HA4A 2ORYA 3WK9A 4DSZA 4KYVA 3TGLA 3WI7A 2QJRA 1N5MA 2RHWA 4A16A 5SYMA 1CLEA 5JAUA 3FWHA 4CFSA 4G8DA 1L7AA 3VXKA 4D9JA 2EEPA 2XMBA 4CG1A 2XI4A 3IURA 3NUZA 3UUFA 3QVMA 1AC5A 2ZSIA 3FYUB 2Z3ZA 2CJPA 4GXNA 1CUEA 2AJDA 4TPKA 4J3JA 1MT3A 1XZIA 5ALDA 3WJ1A 4Y2VA 5H3HA 4MWSA 2WHQA 4N8SA 2X76A 4UHBA 1ORWA 2WLSA 5SYNA 5ALJA 4J0DA 3E1GA 2DHDA 2H7YA 2RIPA 1XZBA 4UFPA 4KE6A 4FOLA 5K3DA 2QXTA 2ZYRA 3AFIA 4NVRA 1BEZA 5T4FA 2OAEA 4H18A 5EHQA 3NOXA 2WFMA 1XRPA 5E2IA 1GGVA 5DYTA 3W9BA 4QLOA 2DFPA 2OGZA 2Z8ZA 1CUUA 1QIGA 1NX9A 4X94A 5EI5A 3RK4A 4OB8A 2HA2A 1EVQA 1R9MA 3SX4A 3IBTA 5BWBA 2VTVA 1H23A 5ALFA 5K3CA 2JEZA 2JGJA 4QZVA 4OB6A 5BWCA 2JGFA 1ODTC 1QO7A 5K3AA 4B83A 3GBSA 2HU7A 4LXHA 3FSGA 2GBGA 5ALLA 4PSCA 1LZKA 1BN6A 3D2AA 1XZMA 3RM3A 1RYYA 1VXOA 2HDWA 3H17A 2VT7A 4C88A 3KXPA 4O08A 4BVKA 5DTIA 1HKHA 1ZGCA 4BB0A 3QMMA 5AI8A 4QDTA 2J3DA 4Y2RA 4I19A 2NW6A 4AZ0A 1MNQA 3BL8A 3OTQA 2WHPB 2BCEA 3PF9A 3RLIA 1IZ8A 1JJBA 2XUOA 3DKKA 1QZ3A 4WFJA 1EINA 5LIPA 3QMWA 4AMZA 2C4HA 3JYHA 4DMHA 2WG2A 5EHZA 1TCAA 1K5PA 5EIEA 2HHAA 1XLUA 1QLWA 3WK4A 4FKBA 5EHNA 2R8BA 1VLQA 3FCYA 4DNQA 4EY5A 3TEJA 3BWXA 3EQ9A 1EVEA 5DYYA 5D7BA 5CW2A 5ALZA 2WUDA 3N0TA 3DDUA 3OPMA 4X93A 4BAUA 1XRMA 1ACJA 4QWWA 4U2CA 1EI9A 4G8BA 2AJLI 5ALXA 3D3NA 3ZI7A 2Y6UA 3MUNA 4K2AA 5HK9A 3DS8A 4JNCA 2WJ6A 1VE6A 3BF7A 4FBMA 4OSEA 1H2XA 1DT3A 3WK6A 1GPLA 4OCZA 3SWWA 4MQMA 4B82A 1MAAA 1E89A 5ALQA 3I28A 4E14A 4Y7DA 4UHEA 3CCCA 4G9EA 4TVKA 5FLKA 2JBWA 4QLAA 2WJ3A 2QUAA 1Y7HA 4OUKX 2RI6A 2ECFA 2OG1A 3TRDA 5AKZA 4S0XA 3NGMA 4GI1A 4CG2A 3C45A 1QE3A 5I9IA 1LBSA 2WUGA 1CUSA 3DL7A 3IVMA 4BP8A 2G4LA 4P92A 4XX1A 3QPDA 1R88A 3D2BA 1G66A 3D59A 4WCVA 1RWQA 5C7YA 4X6UA 3WL7A 5C8ZA 5LZ5A 3V1LA 5ALYA 2I3DA 5AOBA 2XQIA 4QNNA 5ESRA 5JD5A 4BRZA 4J03A 1MX9A 4LYDA 3I2JA 2XMCA 2FJPA 1R1DA 1ODCA 3WZMA 1B41A 2D0DA 2QR5A 2X8BA 4FWBA 4B0OA 5ALPA 1TQHA 1F0PA 1DU4A 1U65A 2WU4A 4U2BA 1UWCA 1Y7IA 3WZLA 2FUKA 3IA2A 2XDWA 4WY8A 3I1IA 3I2IA 3P2MA 4GECA 5CURA 3EQ8A 4XJVA 5IH7A 2ONCA 3W05A 3IUQA 1OXMA 4YASA 1VA5A 3AZQA 1R50A 1Y37A 1ZI9A 5IVDA 1BE0A 1LPSA 1ZD2P 2WKWA 4M0FA 1WCYA 2CZQA 4RGYA 4EUSA 3PUIA 4BTVA 2C5GA 3WKBA 3Q0TA 1W75A 4Y2PA 4PV7A 3FLEA 2XQFA 5ALUA 2IX9A 4KE8A 2C7BA 5DNVA 1ODSA 1QOZA 5JYCA 1AZWA 2XUGA 3CCBA 1SCQA 1DT5A 3BIXA 5DTJA 4Q82A 3F8SA 2WSLA 3GUUA 1DWOA 3I6YA 3K2IA 4ETWA 3DKRA 3GFFA 4E46A 1AX9A 1XZDA 4KR0A 4MYDA 4H7HA 1LPOA 5E4TA 3HI4A 4ZXFA 4J0GA 3H2KA 1XKTA 3N2ZB 2AXEA 4X91A 3AUKA
chains in the Genus database with same CATH superfamily
1L1RA 2QY9A 4J0IA 1UKEA 3X0DA 4LV6A 3TDKA 3EVAA 2R8PA 2XHEA 5BVHB 2P2NA 1JQEA 4LHXA 3VU0A 5KAPA 4OQNA 4TM7A 2YV5A 5AO9A 4CMIA 3QEBZ 4O1HA 3UFXB 3FIJA 2ODWA 2ZJ8A 4XZ3A 3IP3A 1Y0BA 1YV9A 4PN3A 1ZK1A 1AKNA 1BZYA 1XU7A 4PGHA 4WUVA 4W9NC 5ELMA 3RVRA 4XPZA 3I3OA 4Y6PA 3V6MA 4CQMA 1A50B 1I9GA 2RGCA 2PWZA 2FUEA 4LMPA 1N2XA 3WO1A 4DUZB 3U6KA 2FE1A 3WISA 2IIQA 5JXHA 4QUEA 3PENA 4H7JA 3QX3A 4BNTA 3M82A 1U6IA 3DQPA 3JRWA 3M6UA 5HDQA 5C46F 5K4HA 2X5NA 3FPAA 5DJ5A 3KQYA 3JSXA 3CZPA 2UYCA 1W1WA 3MUEA 3Q0EA 1HYHA 1K4MA 4HDNB 3SE0A 3AI1A 3H19A 4GI3A 4DWVA 4EHDA 1E9DA 1EX1A 2ZJBA 4JKIA 4N5HX 1W36B 3DZDA 2HSGA 2Q8NA 2CLEB 1O2DA 2HWXA 1KEZA 1MJNA 4UKDA 4I3HA 5EIHA 3LT2A 2VDQB 5A0TA 1DPFA 2W2QA 3WL5A 1P1HA 4BIIA 4F84A 3HN2A 4TTRA 4ES6A 1PD0A 4IRXA 1F3LA 2B9EA 1F51E 3HFGA 2HK7A 2XLCA 3G7NA 3IHLA 3PBKA 1DB3A 1JPVA 1SXJC 3H3XA 3LHFA 3L77A 4TXMA 1S7GA 4NU0A 3PXAA 1LJLA 4F45A 3L1VA 4DV6B 2AA3A 5CEJA 1BKDR 1EJ0A 5D1HA 3SLGA 4IFEA 5ITVA 5KQPA 2P65A 3H5VA 3K9HA 3BMNA 1ZA2A 3A2MA 4HXEB 5L3SB 4CMKA 1NQ5A 3U3XA 2XXAA 1QP4A 1EFHA 2Y4NA 4KDEA 4Z9BA 4F8JA 2EKLA 3TVDA 3S1LA 2NUAA 4G0MA 1TTPB 1FFGA 1ONPA 1BCSA 4DE5A 4CQNA 1N8SA 1HRDA 4AMUA 1GSIA 1OX6A 3HB0A 4O3MA 3HL4A 3CX4A 2ZAMA 3TQSA 2IXTA 3FZNA 1A8IA 4M1KA 1NBHA 1NU6A 2XOEA 5FL7A 3E7WA 3BQNB 1DKQA 1IXYA 1CU1A 1KOFA 3PA8A 4C2AA 4AP6A 4ZAYA 4A2QA 3DV9A 1KAEA 3DE4X 4XEHA 4Y0AA 2A84A 2OCBA 2IS1A 4Q4DA 2DT5A 5JSHA 4G09A 3O4FA 1ZMRA 1W73A 1QPBA 3ORYA 1BWPA 3VJRA 4ZPJA 2BY4A 2MR6A 1GO2A 4LI3X 2OCGA 2GPJA 3RRXA 5EJ7A 1JWBB 1LDGA 3E8MA 4M7OA 5IDQA 1W85B 1SUBA 4E31A 3OHSX 2IHKA 5TPZA 3UAOA 2AZDA 4R69A 1UT5A 2YFKA 4L7VA 5A5DA 3QQ5A 2PYZA 4UVDA 4JYCA 2Y71A 3KWLA 2E4WA 2IITA 1Y3DE 3EIXA 1DBSA 1REQB 4F11A 3CG0A 3QX8A 2Q5IA 2NZ8A 4KAFA 5AP9A 2B7BA 1DJOA 1HPLA 4TV8B 2AC4A 1JEDA 1WUYA 3PR2B 4ZCLA 2H63A 2QM0A 2Q46A 1TUBB 1WKCA 3U3KA 4AU1A 2B69A 5CA1A 3KNZA 5HIAA 4LNUA 2YIMA 4M8NE 3WQHA 4G0UA 5DGIA 3QY9A 2HCFA 2C04A 1RCTE 2PHZA 2I2DA 1A7JA 4HQNA 2VRWA 1UZMA 2O07A 4JT9A 1HYGA 3C1AA 3KVOA 1Q7BA 1ZR4A 5LP6A 1H66A 1P60A 1Z25A 1N92A 2X0IA 1Z47A 3ILHA 2ZE6A 4FFNA 1YRWA 5DX1A 3HUDA 1OGJA 4NYJR 2IDKA 2W2XA 3ZE2B 4DSTA 3AFNA 1CQIA 3A6JA 3DGEC 3F90A 2O8NA 3ZE8A 4IVPA 1PZNA 4EY3A 5HQ3A 4X1YA 1I94B 3HKDB 3U5ZB 5AUQA 3MELA 1EZ1A 4ENVA 2PZGA 1T2UA 1A8UA 2HQRA 4RZSA 2ONYA 1T2CA 2F4VB 4C06A 1PEAA 2CDNA 4EUEA 1A5AB 1I8TA 1PGOA 4BVLA 1E63A 4O4JF 1X2EA 1VLLA 4TRRA 4N49A 3IQWA 1O7JA 3A6DA 3MJTA 6YASA 4C4TA 3LUHA 1EB8A 4YQYA 2QGZA 3UC5A 1S3FA 3QBTA 4AICA 2E4ZA 5CEFA 2ZU0C 4ESVA 3OWHA 2ZR8A 2I4IA 2EJBA 1WV0A 4I6EA 5BRAA 2XOKA 3WL3A 3JV7A 5C7IO 5BR1A 4OQZA 4Y6GB 3RLFA 2HBYA 1N8NA 3U0BA 3ZIUA 5C52B 2IUTA 4EI2A 2BTOA 1Y33E 1XHEA 4RE5A 2GYUA 3VSAA 1K5HA 2BKXA 4QM7A 2I7VA 3GELA 721PA 2DPYA 2IZ6A 1JA9A 1YVDA 4KJXA 1H9BA 5JS2A 3OEHD 2UZ0A 3BA1A 4JB0A 5FF9A 4E15A 3ZKWB 1GA4A 3DMTA 4ZGBA 3BD7A 1PQYA 3PPWA 1QGED 1HT3A 3ZWYA 2IWRA 4IIEA 4ALNA 3IERA 4QDJA 5FFFA 4EELA 5B5SA 2F9FA 2ZRGA 3L8GA 3NB0A 3VKWA 3VVBA 3WWCA 3HYCA 1A9PA 2M6RA 4QVKA 5F7JA 1CVRA 2PD6A 3B6KA 4RPKA 1Z22A 4CFYA 1NYTA 2J0UB 1GSAA 2A5JA 4PRKA 4WBNA 5CFMA 3C8ZA 4OLFA 3KS9A 1SOUA 2OCAA 1M6VA 2VYCA 5DO9A 4GC5A 3IILA 4BRUA 2R7MA 1P3JA 3AYXB 2X86A 4GVLA 4BBJA 4BMVA 2D1YA 3ZCSA 1M67A 2YASA 4DXHA 3AKEA 4C4RA 4ER6A 4BV3A 3OC0A 4PPYA 2VK8A 1JPJA 5ABPA 2D1SA 2FSSA 3EDRA 1A88A 4ZO4A 2DH6A 3ABZA 3S2ZA 2WIFA 1UF9A 4M98A 3KRTA 4C3OB 2WFZA 4K8OA 4OAOA 5K0BA 3CPSA 1CRZA 3TMAA 4LDRA 3G2IA 4P4UA 4QRIA 4HR7A 4R1MA 1XX6A 2PS3A 4IDAA 3QBEA 1L8OA 2ZBVA 3NFRA 3RYHA 3HK2A 3WMXA 3OLZA 3H9EO 2VHWA 3AUXA 3WRVA 5JCZA 2IE0A 2QHXA 1V8DA 2H9YA 2JHCA 2QUJA 2V96A 2PZAA 1HZJA 3UHJA 5AVQA 2DEUA 1TADA 3RK0A 5CB0A 3IDOA 2AFIB 1YZKA 2JF0A 1AS0A 2F43B 2PA3A 2Y92A 3CVYA 4GO1A 2C2MA 4QRDA 2GARA 1NP7A 1AE1A 3CY6A 4TYQA 2QRGA 5AM1A 4J4BA 3K0SA 1L5WA 2OSVA 2EKPA 3Q3HA 2PIDA 2OBMA 1VJCA 2EKQA 3DTVD 5JTTA 5GONF 4NZ9A 3Q8MA 2VS1A 3R0ZA 3Q1LA 2IWHA 3SIPA 2QX9A 4HBGA 2O5CA 5HBRA 1USUA 3QW4B 1MENA 4FYIA 1U0LA 3UJ7A 1LI5A 3FTDA 2WVHA 3T95A 4QQFA 2Q3LA 1MB4A 2V4ZA 3LK6A 3ONWA 1U9ZA 3R3YA 3DKPA 4OBEA 4MQEB 4WNCA 4ZKDA 3TB4A 4P9NA 3E9MA 5IXJA 4EKNB 9LDTA 3MJSA 2FPPB 3RS2A 2AOXA 1M1NB 1QVZA 1NYQA 3JRXA 1GFZA 4JB2A 4LS3A 1FXSA 3K0FA 4JBLA 2Q6VA 2RSLA 3IMFA 3EDQA 2AG8A 4TLAA 3WYEA 3ZHTA 3RC8A 1G0NA 4G1EB 1P29A 2DQYA 3ZHOA 4LDJA 3F5SA 4YJ3B 2DUJA 3K31A 3TMYA 1EJ6A 1K7XB 3LA8A 5KOIA 1DARA 3QV2A 2MSEB 4QUDA 4Z9YA 4C07A 5SYAA 2PS9A 3GOQA 4W6QA 3TW4A 1YC2A 1YIOA 3FOCA 1GN9A 3AG6A 4J4TA 4QGHA 4P4GA 5FXMA 4PR3A 3MJDA 2PLFA 2SCUA 3CW2A 5DNAA 5C8VA 3RUIA 1RE0A 4JEMA 3DTVB 3B20A 2JGDB 3CF2A 3G9TA 3OD1A 3PTZA 1NXQA 4C5BA 4EPXA 4OQ4A 4ZV4A 1V9CA 1QH9A 4YWJA 4HS4A 3ND8A 1JDZA 2RH9B 3HDTA 3JQ8B 4WJLA 2AVDA 2Z95A 1GQRA 1QYCA 1DRVA 3I4CA 4RPCA 4RVSA 2CLFB 5MFPA 1SHLA 1XD9A 3ET5A 4FLEA 4ARSA 5F1OA 4YQFA 1G59A 4EY7A 4HEJA 4JYBA 3PIIA 5TLSA 3W8DA 2WZQA 4RELA 1WRBA 1KZ9A 5JWRA 2ST1A 2VDRB 3FTNA 3AVVA 4ZVTA 3PQ5A 5AT1A 1KSGA 1WLYA 1UBLS 4TTIA 4JX8A 4KWCA 4PO3X 4XGKA 3O1LA 1YJ8A 2JIQA 3M6WA 3NONA 5AESA 1GCUA 2HLDA 1LNZA 2VJMB 4O4HB 5EP1A 1HSZA 1RACA 3VYUB 3U19A 3SFVA 1K5DA 3BRSA 3W1WA 2QTTA 4BWYA 2WJAA 4ASUD 3IE2A 3ZCPA 2FETA 2KHZA 3EF1A 3GBVA 3EZ6A 3DLIA 2H59A 2X2OA 3G9UA 4DR7B 1QZUA 3E53A 5CA0A 3IDFA 4JI5B 5J2TA 1XQVA 4H35A 4OHMA 2I1LA 3CXUA 4RJKA 3WGTA 4G07A 2D8MA 4LZWA 3GRCA 4KJZA 4NMHA 3FCCA 2XIQA 4QJIA 5I9TA 4MGIR 1RQRA 1KPGA 3V4OA 2VQEB 4JI4B 3WGGA 1ETUA 2BE9A 2WSYB 3NV7A 1VP9A 5JD6A 1QIFA 4LJYA 2Q1TA 4CIWA 3OFSA 1E2UA 4DWOA 2XSZD 3A3NA 1GKKA 1YQDA 2B1QA 5LSAA 2GTIA 3D3JA 2KYRA 2YMPA 2BEKA 2IKQA 5JLAA 1CKEA 1F4PA 1X70A 4Z99A 4AZSA 1SVWA 3CQ9A 4J0HA 3V4SA 1ODJA 2F90A 4EX6A 4HXYA 3NEAA 4EAQA 4MVJP 5DIFA 1ZRNA 4J2HA 4GEKA 4G0YA 2OV8A 5JJLA 1RJGA 3BEDA 2NXJA 5CIQA 4UU8A 3L04A 5FNVA 4L74A 3V8BA 4RFLA 4DN6A 3ZJ5A 4ED9A 3IEKA 4TN1A 3R5SA 4FW9A 4W9NA 4BC0A 1Z73A 1N7IA 1YJBA 3C3YA 1M76A 4M6WA 1Z9BA 1Z26A 2UKDA 1T3GA 1NMYA 3EGCA 2VEOA 3RWMB 4JL6A 4C01A 4MV3A 4EVQA 1PWHA 2G67A 2B3DA 2V6FA 4U7DA 3I6MA 1HL3A 4NYMQ 3BL5A 2YY7A 2YYYA 3EIWA 2WWGA 3QOYA 4V2IA 5F9MA 5BV0A 5KB3A 3TRKA 3QYAA 1XPJA 3NKLA 1PNTA 1PR0A 5SZKB 1SQGA 1QVWA 1E2KA 1B00A 1KI4A 1GL7A 1KIMA 1ND6A 1O96A 1UXKA 2VBFA 2WG0A 4KWHA 1BH6A 2O8EB 2H31A 1OX5A 5INTA 3IKTA 1M3SA 1ZBDA 1QH8B 3DEJA 1PT9A 4HATA 2ZS7A 7ADHA 1LPPA 4CMJA 3TZHA 3D7MA 2QUZA 3K6SA 1QHFA 2AOTA 2F1IA 2R1ZA 1NPTO 3NTRA 4GM0A 4OJQA 4RS4A 1IH8A 4C4PA 4EF4A 5D8DA 3EK2A 1FNCA 4WD3A 1D09A 2HIGA 2J0EA 2JNWA 2UZ3A 5THXA 5ESDA 3QE3A 3ZUPA 1J24A 3I52A 2BKEA 5K3OA 5BY2A 3C39A 1NSYA 2Q3CA 3OT1B 3TVYA 2FSUA 1XSEA 3D6AA 5EE9A 3UK7A 5DN6A 5DP1A 1YQXA 4A03A 2EHDA 3FNEA 4K6FA 3ZQ4A 1K6JA 1JWLA 1N2BA 3A4YA 2QJTA 3COPA 3LUCA 1A04A 3OPVA 2L82A 5DGDA 4RPJA 5HXAA 5KSWB 2O3RA 1PS0A 4KV9A 4N41A 1Y1QA 3PZBA 621PA 3JRNA 2VJLA 1MD9A 2ZSAA 4I55A 4MGYR 4WKCA 5A7GA 5IKMA 2ZQZA 1Z2EA 2ODTX 1PVDA 1LTKA 3Q12A 3T94A 3V4LA 1YB1A 4I50A 2Q2WA 4MLPA 1ISHA 1L3CA 4HNQA 3JQGB 2E21A 1N4AA 3FFBA 1OILA 4JH0A 1W5TA 2IYUA 5KOHB 4PFQA 4WSOA 3SBEA 3CLTD 3IP7A 1I3CA 1TJPB 3PHCA 3JXEA 3LGAA 4Y2GA 4HFRA 4B76A 2GNOA 4NE9A 3S8YA 1OYOA 5KX5A 3PSAA 1SCBA 2WPNA 3HU1A 2EF0A 4DA8A 1LLDA 3SOPA 3QSGA 2VQFB 3Q72A 2VUHB 1IE3A 1BGWA 2CJWB 1O89A 1HRKA 4R2JA 1NDQA 4LJ7A 1DO2A 2W98A 1T9CA 4PBSA 1THZA 4E3WA 2ZULA 4J6EA 1I7QB 4NMWA 3ZU6A 5AJYA 4JC0A 4ZCIA 2V3CC 1I01A 2RGWA 4IG9A 4TL8A 4LEIA 2PL1A 4PO9A 3K16A 3V2GA 5JJKA 3ETJA 1FVXA 1V1JA 3MEQA 3WGLA 1P2GA 4KO2S 2ZUDA 4UJ5A 4O2BB 4IRMA 5DI3B 1GUYA 3WS7A 5CBPA 1EBUA 3K32A 1P75A 3DC7A 4M9QA 3NBYC 1BS1A 1ACLA 4P7KA 1GRCA 1E2FA 1NLMA 4AXBA 5CM8B 3P5BA 3OZTA 5FI1B 3RGWS 5CGQB 5FR1A 4C22A 3OMLA 4DXDA 4UUQA 1J4AA 3WDMA 1E61A 3EUFA 2J6CA 3EPRA 3ND5A 2AOWA 3PHJA 4KQIA 4C3UA 3LDGA 4XCXA 2WILA 2FGJA 4QFCA 4HDOB 1WZ2A 4CI0B 4DDMA 4PSKA 2IOYA 2JARA 3VSDA 3LC1O 3QTLA 4ZI7A 2IIPA 2NO6A 4Q4HA 3L0IB 3EVEA 3V8QA 1YDGA 2OB2A 3IE1A 5E8RA 5EYPB 3HUEA 5M29A 1GNRA 3IKLA 4M36A 4DBLC 1ZNYA 4JI8B 1B8OA 1D3AA 2JZCA 1GARA 3GV0A 3WBFA 5CLLA 4TV8F 4AG5A 4BUZA 4FGLA 3X1YA 4W7IA 4PRYA 1X1CA 3BWYA 2P5UA 3KELA 4POOA 4Z1OA 2QRVA 3DOUA 2WTNA 1K6EA 2OZLB 3OLQA 3LPAA 4FUQA 5FWNA 4HH1A 1ZI6A 2AR9A 4QJ3A 3M1YA 4QQRA 2L69A 4FMCB 3U3RA 3LF1A 3LYAA 2UXDB 1V5GA 1EE2A 3KT6A 2NUPB 2CKDA 3OG9A 5DBEX 5IFKA 4OL0A 2VDPB 5K6TA 4KFRA 3ZHCA 4MIOA 2QN2A 2WNIA 3KT8A 4JSYA 4N6NA 4D0GA 5IJ9A 1EVJA 3DB1A 1WOMA 2QLJA 1L7MA 2QLNA 3KQMA 5F2KA 1V3UA 1A27A 3MWLA 3E5RA 1F8XA 2X9NA 1SVUA 1SUCA 2XLBA 1IN7A 3TR0A 4AY4A 4H60A 4B81A 2I6SA 4DCJA 2XNCA 5BSGA 4KITB 5T4EA 2G82A 1X80A 2QRZA 2ZI7A 3FN4A 3WHLA 2BH2A 4PTYA 2ESRA 5AVUA 4H3HB 1HNZB 2XTZA 2DWQA 2NVOA 3BHJA 1M1YB 1Z06A 3BZWA 2C9YA 1VL5A 1P1RA 3FPBA 3L4SO 1O77A 4L5BA 3L1HA 3FCXA 4TKVB 1KHHA 4B3JA 1KERA 2WMOB 3D3WB 4BWFB 1KFEB 4Q7KA 1OJ7A 2V5VA 4OHVA 4BGUA 1QS0B 3P2OA 3LQQA 4I14A 3M6LA 1TA0A 4BLRA 2R60A 4XA8A 1SB9A 2E4YA 5AM0A 3DQZA 3IP5A 4H7KA 4R05A 3PL1A 4JI6B 1N2CA 1YZGA 2JGLA 4MVJA 2IOQA 3OLYA 4MUAA 4UTXA 2RAUA 3CSSA 4AZ0B 1O4WA 4BFUA 5KSZA 4DAOA 2WQ6A 1VSVA 2OZEA 1ZK0A 1M0EA 1P1KA 3B6JA 1E9RA 4ZTBA 1H4QA 3MBOA 1VBFA 2OD7A 1JR3D 2A9JA 4FIZA 3AUTA 1CUWA 3E27A 3QU5A 4OHZA 3G7SA 4LZOA 4ND8A 4NEHB 1IRIA 1MO3A 4NG4A 3O38A 3CWZA 4BNWA 5KUTA 5C32A 5L45A 1JI0A 2R7KA 1QP7A 2EFGA 4P32A 4PINA 2XHZA 1JR6A 1F2TA 3L8DA 2XTNA 1JG4A 2PV0A 2R8XA 5EZYF 1JEQB 3KCNA 2DXIA 4RHYA 4PSDA 3T9DA 1V1MB 3DL2A 1TB4A 1UCFA 3K0CA 2JCYA 2DY0A 3EEFA 1RQXA 3IJEB 3KQSA 3NWBA 1OB5A 1TK3A 4HWKA 1GTSA 2I54A 3CS3A 1NQUA 4JLMA 3SXPA 5TT1A 3LFHA 4HLQB 4RDCA 2ZG6A 1FFCA 4QWMA 3DVLA 1AZLA 3EVGA 1H1TA 2AFIE 4MJ3A 4U7PB 1GYRA 1F20A 3PL5A 4HMOA 4ZAFA 2G9ZA 5FQNA 5FJIA 5PGMA 5FLYA 1U0EA 5TRTA 3N07A 4FU0A 2C92A 4LF4B 1J0CA 1YCDA 1XHLA 4NOJA 5KYXA 2HL6A 2ZJ5A 3FTPA 4F8EA 2O54A 3NT4A 4NCAA 1PK9A 2JEYA 4WERA 1V8BA 2J33A 4Z9AA 3ZLJA 1FJGB 1DKLA 2CFOA 4NJMA 4TKZA 1P9WA 1Z4PX 2VP3A 5JJIA 1Y8QB 3PC6A 2OGSA 1N6PA 1TM7E 1XJCA 3HLYA 3PXXA 1VJRA 2BZGA 1QU2A 2P90A 2GBPA 3ISJA 4ZCMA 4BMOB 2VAWA 3LXUX 3BWDD 1X1SA 5KHLB 1HNXB 4H1VA 1JL3A 1X7ZA 2I6TA 2DQZA 4OU4A 2JFFA 4FFBA 2J41A 4KBGA 1RQPA 1D7AA 1ZMOA 4BY9E 1OXBB 3T4PA 3O9VA 2QX4A 5LWQA 1II9A 4Q3BA 5I6DA 1U0HC 3H2JA 4RETA 1JJAA 3OIYA 1HDYA 2OXCA 2WIDA 3KR1A 1SC9A 1XZJA 3AQIA 1TQ8A 2AOUB 4QNMA 4Y2XA 4MUXA 5AI6A 3QLEA 3AUFA 3S44A 5GADl 2VYND 1YAHA 1DJPA 4RA9B 1BWQA 4ZO9A 3FBTA 3KQUA 1FJ2A 3ANMA 5IYZB 4UCWA 3RCBA 1KR5A 1BA3A 5KTOA 4TYWA 3ST7A 4INZA 5I5GA 2LR0A 4MPDA 3HBJA 1TRHA 1Q0SA 2AN4A 1IEXA 1X3LA 3DHVA 3HV0A 3QFFA 4TWIA 4Q24A 3V4PB 1NRIA 3M34A 3ZDEA 4CIBA 5K01A 1S2DA 2QXUA 3NDRA 4N03A 3AL0C 4QKQA 1ZLYA 3L02A 1FDTA 2A1TR 4EJFA 2CY0A 5I4KA 2CNDA 3WLNA 1AO0A 4JXKA 4ZVVA 1P4RA 4D4JA 5K9ZA 4KC0A 4WNIA 3GEPA 5JNRA 3KCQA 4YJ3F 5LU8A 10MHA 3PFWO 2PE5A 1NULA 3L7YA 4F3TA 2FP4A 3UYKA 3U61B 4YRPA 5DK6A 3QKWA 1RC1A 2J5BA 1BHO1 3RTGA 3G2PA 4JJEA 1T5HX 4FNMA 4F5DA 2XJ9A 3T4EA 1HR0B 4K9PA 4MMXB 4Z4FA 4ZPXA 5ESXA 1UKYA 3TUJC 4DEYA 1MEEA 4ND3A 1G42A 1DSSG 2VNJA 3GCGA 3PD1A 4J7XA 4L28A 4PIMA 3FNGA 4X1KB 4P3OA 5J9FA 3SGLA 1FQJA 3GLGE 3L0CA 1NKVA 3T34A 4G5GA 1H69A 4UASA 4DLPA 1XNQB 1ZIPA 4ZYUA 4DMGA 3DMFA 4IZOA 4EITA 4EVRA 2Z5GA 2BTQB 4NBLA 4HTFA 1Y89A 2BHRA 1P3DA 3SFTA 3WYDA 1Z6AA 4YUWA 1PSZA 4RFSB 5KYNA 2UDPA 3A3KA 4P5DA 5H68A 3H2GA 4WADA 2QR2A 1RIIA 1ECLA 2ZKLA 1XDWA 4TGLA 2H1RA 5AIAA 3VDXA 5A6VA 3PYXA 4MW0A 4REMA 4G0VA 4BLOA 4PICA 1CETA 3HGQA 3L6OO 4FLMA 2WUWE 4OFWA 3CLRD 3OTIA 4U9UA 3W2EA 5CLJA 1RZRA 1KZGB 4KRYA 2NOAA 3FH0A 3NNDA 4MTCA 1JJ7A 1XKQA 3JWJA 4J0FA 4NS4A 4O4HF 2VSOA 4B0PA 1YCFA 1GXSA 1HF3A 1P74A 1L5FA 2PX2A 3AR5A 4H59A 1C1XB 1KDYA 1JNXX 3HU3A 1I6LA 3GLFA 3F6SA 1J2YA 4IMRA 2IV7A 2AJCA 2OZVA 3B6MA 5FWAA 1P4AA 1W4RA 4D6PA 4WZBA 3SC4A 2CE7A 2ORVA 2YYAA 4XXHA 5DF1A 3EFEA 1S2NA 3CN9A 4R2LA 1ISRA 1GG8A 4Q12A 4IM7A 1YI1A 5KYWB 4C7BA 5LP1A 2HFJA 3TH5A 1UZLA 1S3GA 2X9LA 2CC2A 3PI6A 3DFFA 4GYWA 1RMQA 5FD8A 2P2GA 2PMKA 2BFFB 2V9CA 3K20A 1TM3E 3GWZA 2ZRPA 3KOUA 1YBAA 3ODPA 5ALIA 4D41A 4DVGA 4NQZA 3VO8A 4B6FA 2ZT7A 3ASVA 1TXGA 2PXCA 5BMVA 5IEBA 1WHSB 3DWGA 1OKKD 1U3VA 2VIIA 1DG3A 5KMGA 3A26A 4QOJA 4ANFA 5K6AC 4TKLA 4DMMA 4FW8A 3UW3A 5K03A 3ULKA 4MS4A 4WNYA 2V1XA 3R40A 3CH4B 1QO0D 1ZDMA 2YJ3A 3QP9A 3HSKA 3HR8A 4R3UC 2JLWA 2O06A 1LH0A 3WYAA 4C0LA 4QFMA 4CR7A 3WWOA 3M5WA 4JY7A 4XIYA 3GRYA 2JIDA 3OCYA 5G3YA 3V33A 4G5HA 1RM3A 1FFSA 5ED0A 3A1CA 3BSYA 3QH4A 2WJ4A 5AVVA 2ZBPA 4Q5IA 4CLOB 1KVUA 4KRFA 1GU7A 2JFYA 3RF6A 1H2EA 2BEJA 1XZFA 2O0JA 4WCFB 1L5HA 1HFWA 3EZ7A 5IASA 1UM9A 3RAGA 1CBUA 1Z13A 3EWIA 4HDAA 5TMEA 2Q4RA 4B17A 4B3SB 2NPFA 1LKZA 2OZPA 3S1AA 5HR5A 1KJZA 3V2IA 5K3EA 4U5XA 4CL0A 2YJ5A 3MMNA 1W8DA 5JAOA 3ZWKA 3LO5A 3VC2A 4QFBA 3MERA 4WNAB 2EJTA 2HWKA 4UBMA 2WYHA 4ZT7A 1MJHA 3FDZB 5C7OO 4OL9A 3VX3A 1DDOA 2RKBA 3AZPA 4BZWA 2XAUA 1VIVA 3GBPA 1E5QA 5GVSA 1CFZA 1J8DA 1HE2A 2VDLB 3ASUA 3GGPA 2GEBA 4UCXA 5EQFA 3W7VA 4UOQA 3R3UA 2WIAA 2Q4DA 3D4BA 1KIAA 1KZ4A 1Z88A 2JKVA 2E3JA 5MN5A 4FGJA 1CS4C 2ZBQA 2I1WA 2QB5A 4GOXA 5I01A 4X92A 4BQQA 1WDLA 4X5OA 3WNQA 4ENWA 5LJIA 2HF7A 4L8GA 4Z4CA 1U7PA 1G3MA 1LPNA 3FKSD 4MB0A 4YDHB 3OHMA 4DJDC 4D96A 1XHFA 3B82A 4IW3B 1NJFA 4NPHA 4EA9A 1MPXA 1OXTA 3WDLA 4BBZA 3ZWVA 3JWGA 2BISA 3OTGA 2CLLB 5DLYA 2GT1A 1GFWA 2A1UA 2GSDA 2JCVA 3H2SA 4G0WA 1J39A 3V7FA 4IDEA 3DL4A 2PX0A 3BIJA 3I1YA 5L3QA 4IQ8A 4P3KA 4EK9A 521PA 2Z2IA 1DVRA 2WV9A 1MVOA 3BZBA 4Q7QA 4EJ2A 3QBVA 3GEEA 3JWEA 1A77A 1X1TA 3NDIA 4FD3A 1IY2A 4WGGA 4NEGA 2Q6OA 1X42A 4V0NA 5TMPA 1CF4A 1EDZA 3ELUA 5CH3A 2GXAA 2TSYB 4JMLA 3AUSA 1X87A 2RB4A 3O8QB 5JZSA 2VO1A 2YZ2A 2QN7A 2ZRIA 4JT8A 1QCDA 3DV0B 1H2WA 4FX5A 4MR8A 3RIHA 2IBMA 1RWVA 2PRKA 1JTVA 5K5EA 1MEOA 4D45A 2ODBA 1FQKA 1U0BB 3UANA 2N42A 5CIWA 5GMOA 3F6CA 4XX0B 4ZI5A 1E5XA 4CMAA 5JZVA 4O2BF 3O7MA 4O02B 3L0OA 3TJMA 4F4FA 5CCDA 2YXNA 5L51A 3EW7A 3ODGA 2W48A 4MRSA 3IE0A 2UVPB 3LLUA 1G5PA 3TFQA 3C4JA 2QD1A 3CKMA 1ID8A 1D0SA 4PBRA 1C9DB 4PQEA 3V8EA 3AJAA 3FYDA 1TC1A 2OAP1 1OJLA 3C3XA 1FTGA 4QXAA 5IWAB 3EQZA 3IRUA 4ETNA 1QYDA 5FI0B 4HK4A 1H5NA 4DLBA 1ISIA 1YI0A 2B7LA 3I09A 3LOUA 1MC8A 4A7PA 4UEJA 2GN0A 4B9EA 2Y1OA 3OQOA 3DW1X 1M2GA 4OMUA 2D59A 2ZCJA 5CK4A 5DHSA 3W5SA 2RIRA 2W42A 5HWSA 3RKSA 1UBUS 2FW1A 3HQ4O 3K35A 1OI3A 3KLMX 3S2YA 3JW8A 4JJFA 3ECCA 3LVRE 4E09A 2QOEA 3OKFA 2K2QB 3BJMA 2OCLA 3HY6A 3K9BA 4FMCF 4HYYA 4REQA 3Q7EA 4U7WA 3ZQKA 4C4YA 4CMBA 3N05A 5B57C 3DUFB 5JVDA 1ZKMA 1N9KA 2JZNA 3IUJA 4J0JA 4DUPA 3DPSA 4ZIRB 1AOXA 3T1QA 4EFMA 1M1YE 1I4EB 5KKNB 1NZJA 3PHHA 5ANRB 5TQVA 4QXPA 3ZYZA 1QPZA 4QVIA 3OZXA 2C78A 3Q3IA 2FJUA 4NDZA 1STOA 2I2FA 2MSNA 1KI9A 4GWGA 1DXYA 3ZE9A 4F1WA 5C53B 4XGIA 3OWXA 3CYFA 1KXJA 3AZOA 4PX9A 1U0SY 1ZOLA 1KF0A 1LFAA 3WB9A 2CYAA 1R6TA 4RY9A 4RIHA 2Q3HA 3KUDA 3E35A 3EGWA 3UPTA 2ZAOA 2WM8A 5KNDD 3ZZUA 3SIWA 4Y0NA 4HO1X 3VQTA 3OLCX 1SBIA 5A62A 1GKIA 1ZMBA 3WLJA 1L8LA 2AL7A 2ES4A 4PCAA 3VKGA 1VLMA 3B85A 2AQIA 5CXUA 4Y6RA 3KJZA 3LY8A 1HE5A 4KFTA 2XW6A 3DZIA 1IB0A 2TMYA 3L0PA 3FTCA 4J7AA 3C1TA 3N74A 4PU0A 5MN6A 2QUBA 3MNFA 4I8XA 2HLHA 5LKAA 2WR8A 1XLWA 5E6SA 2O3UA 2CB9A 2V7TA 1XROA 4L4ZA 1FCJA 3FF1A 4N0MA 3WB0A 2PFKA 1EGQA 4IJUA 3T12A 1KKMA 4B7UA 1U8EA 1ZJ6A 2BH9A 2ON6A 1R6DA 4FSXA 2F1RA 3PWKA 1NQVA 3UBMA 1GUZA 1C3JA 2GCPA 2FQYA 1JTEA 2I78A 2QTVB 5TQ0A 2QJWA 1W44A 3RYFB 5IF9A 2A7XA 4QUBA 4DC0A 3V00A 2PWPA 1BCRA 4Q18A 4UUPA 1Z6QA 4IH1A 3NBAA 3VV2A 1ISSA 2PYDA 4ARVA 4JDPA 1VJTA 1YL7A 2H54A 3AHCA 3DMGA 2QRNA 1X7WB 3RS8A 2ZB7A 3RH0A 4P3YA 4PZZA 5HYVA 1NVEA 2QVCA 3C85A 3KYCB 2A78A 3NZEA 4RJJA 1EP2B 5DCLA 1JDBB 1ZY2A 3PR3A 4BPBA 3UJ8A 1ZL0A 5IM4A 2FXVA 3AHFA 3H16A 3JQAD 1U2ZA 4WK4B 3C3MA 4Y9UA 2O2CA 4B6RA 4TXHA 4G5OA 2H2WA 1J20A 1O0SA 1PWYE 2R85A 3VSEA 4DAEA 5KCMA 5AOCA 3UCFA 4E5YA 5J4HA 4URHA 5KREA 3PQ6A 4B3RB 4ARAA 4R71A 4Q47A 4RESA 4RIEA 1IG0A 3OPYB 4TRJA 1DWPA 3FMPB 5JYBA 4BVHA 3VPHA 1A8HA 1HDIA 1B42A 4EBFA 2AC7A 1GPKA 2WZBA 3C70A 1Z82A 3L0YA 1R4AA 1OFGA 1RD4A 4MS3B 3ROZA 2VQ6A 1R6XA 5EGNA 1MGPA 1R4MA 2TMKA 5EFOA 4TQUS 3ZD6A 2GETA 4EA8A 3ZXSA 3LTNC 3U44B 1YB2A 5JWHA 3W04A 2Y3IA 3TI7A 1MVNA 2J32A 1KP2A 2VQDA 3C43A 1QX4A 1XQWA 2EWVA 3N8IA 4K87A 4M86A 5AJXA 1G19A 4QUHA 1AA6A 1EZZA 1WMBA 1QE5A 2LDBA 2Z5FA 3OIGA 1QQ7A 1IY0A 5GJBA 4TROA 2WTUA 1C4XA 2IYSA 3CBQA 3IAXA 3K73O 2XH8A 3W8FA 1OTYA 1S96A 2HW8A 4GIBA 3PGVA 5IJXA 2Q9UA 3LUPA 1NVTA 3MWDA 1KOJA 4GPTA 4BVJA 2IHBA 2EFCB 1PK7A 9ATCA 3GFQA 2WB2A 2G1KA 4HB4A 3WRXC 4DA9A 4YVFA 4ZC8A 2WG1A 3OQHA 4TXJA 3UMMA 3JQAB 4K1LA 3STYA 1RBZA 3C24A 4MAFA 1GU0A 4GGPA 4WPGA 3OEYA 1JR2A 4JGGA 3K70C 1J33A 1V6CA 2Z58A 4JLSA 1H0HA 3TBFA 1T13A 2IXBA 1NWCA 2E4UA 3QWAA 1JLKA 2O4UX 3AIOA 4MA4A 4TKUA 5IYZF 3B3JA 3PQ2A 3O8LA 2YJGA 3HB5X 2CYBA 1A9YA 3LG2A 4IXTA 5B3AA 2ZE8A 3BKWA 4HWGA 4B2LA 4HPXB 2JD0A 3X1DA 1HM5A 4AN0A 2OCYC 4DQVA 1V41E 5A4AA 2WIGA 4B34A 1ZP6A 5K0ZA 2WSSA 4RIGA 1I2ZA 5BSTA 5FR2A 1RKQA 2H9AA 1C29B 2GXSA 3SKYA 4CN8A 5AH0A 3W4KA 3E4CA 3O9MA 1MDBA 3EARA 4LRQA 4Q4AA 4KOEC 1Q7TA 1QAQA 4G63A 3O0DA 3ZGVA 5ALTA 3UCEA 1FPQA 8LDHA 4BKOA 2YXPX 1T1GA 1ZH8A 2IEIA 2LBPA 1H2BA 2H1WA 2O2GA 2PT5A 3VR4A 4PLFA 3V1KA 3RC9A 2HCJB 3GHHA 2H1HA 3BXFA 3ZI4A 1THTA 3CW8X 2EQ5A 2WOJA 2QX7A 2XJ4A 2JD1A 5DLQC 3IMCA 3JARA 5KWEA 5IW8A 3TZCA 3AEYA 4LZAA 1S2OA 2JBAB 1PZFA 3HNRA 2RKOA 4A6DA 5E6UB 1CF2O 1LB1B 1IDN1 2VC2B 1AH2A 1E98A 1TJ5A 4Z7JA 1FYWA 4ZVRA 5JV5A 5IAJA 2Z1NA 4GKAA 1UIRA 2FXIA 4HAYA 4RL4A 2AI3A 4OI4A 1BKSB 3GARA 5B1HA 2OV6A 1T15A 3PC8C 2BGRA 3MJ4A 2G6BA 1R0YA 3AM4A 3PKJA 2UXBB 2QE7A 2QF7A 1JHAA 1UJNA 3EQ7A 2YS7A 1E8DA 2XTMA 2PX6A 5K0CA 1O0CA 4CM4A 4KAAA 4Z0TA 1SHUX 4MWCA 3GGJA 2IXDA 2GASA 1PW7A 3EAGA 3EGDA 1MMFB 4X3PA 2Z3WA 1JTFA 3CLUD 3T3EA 3V8NA 5BVGB 3ZVMA 3G6KA 3U4IA 4TN5A 3ZW8A 1JWAB 4D9FA 2O59A 4BU1A 2YS6A 2JLSA 1ZXLA 1MA3A 3NEYA 3CNHA 2XUKA 2JVJA 3LGXA 1NP6A 2R00C 5C4GB 1TE2A 1BHJA 1G5QA 1Z2CA 4PEVA 4V0LA 3CGGA 4Y2SA 3ASZA 4C6TA 4CT0A 3MQ4A 3PDIA 1PD1A 2XEXA 2ZW9A 4XOIA 4I5EA 2CHEA 4QXQA 4QUKA 2D1FA 2ZKIA 3FG9A 5EMLA 4L9RA 4HNAA 4OATA 3V1YA 1ZVKA 3THYA 1QMPA 5KYKA 2H1VA 1QH1B 1KVQA 5K99A 4OQFA 2ZT6A 3VNVA 3M7IA 5FBQB 1JVNA 1MP0A 2A30A 3F4BA 1H2YA 1VMIA 2P9GA 1PN3A 4OJYA 2PUEA 3KXDA 3AM5A 2AEMA 5ALWA 2RK3A 3DJYA 3OZRA 2N0SA 3DE5X 3V48A 2WYWA 3N8HA 3MTJA 4AIIA 1U9YA 3LBHA 1LBIA 3EBOA 1JDNA 3KTOA 3KVYA 3OCXA 1AHPA 2QAJA 4LTMA 1KRWA 4WWHA 1HT0A 4JOQA 1FP4A 3VHLB 2OYCA 1E8NA 1X0XA 2YUIA 3F74A 3C16C 2XMZA 2GDJA 5KCZA 1L8XA 3MG9A 1P18A 4W1RA 4AD8A 1GQ2A 1CJUC 1DKMA 4V24A 2OESA 1Y82A 5LQMA 4RLSA 3P97A 1NXXA 4M1QA 3QFCA 3VR5D 3IPCA 2QP9X 4ZN6A 2LKCA 1E3IA 1QHSA 3HFSA 1XP8A 3DZ8A 2XUHA 4M0KA 3UT6A 2EGGA 3GJYA 3PQEA 4GPEA 4MPPA 4II7A 3JAWA 3MTAA 4YQEA 6LDHA 4DR2B 1COWA 4Q02A 2I0FA 1ZM9A 3RVLA 1HL7A 3W5CA 2VBGA 3HABA 3SJCA 1GZ7A 2GXUA 1PNQA 2LCIA 2WWXA 3KEFA 4Q00A 1IHUA 2GBFA 4RTLA 3ETNA 2C2KA 3EGIA 4ZHQA 3TKAA 3GD7A 1EUCA 2HAEA 3LYUA 1K92A 1SIBE 1JPUA 5G0SA 4G8CA 1QCZA 2FY8A 2WJZB 3FNFA 3LQ4A 4PFJA 4QYIB 1P72A 4WLVA 3TE6A 5IJWA 1DOZA 3KJNA 2GVDC 3DE3X 3RAFC 3INNA 1QB8A 3VPAA 1TW3A 3HU5A 1NOKA 1M34B 3D6UA 3IQXA 1Z2DA 2GLUA 4XLTA 1EXMA 4MKXA 1ZIYA 4AJJA 1B76A 1KGSA 4A0HA 4KXLA 4EENA 4XOUA 2D2IA 2XYRA 1NJ1A 1YB7A 2FUCA 3KUUA 4GP6A 4U7TB 1JHMA 2QI9C 4JBYA 1DKUA 1MJFA 1VGVA 2NZUG 3T7SA 4LFAB 1NHGA 4YIHA 7REQA 3NHSA 1G8JA 1U7DA 2RI1A 3NATA 2QVBA 8OHMA 3I4LA 3GVPA 4KAXA 4BFCA 1E5LA 4AECA 1BFDA 1DS6A 4N3GA 4CG0A 1QC5B 1VG0B 3SYLA 2XF2A 4EFNA 5B58T 2YFQA 1PWXA 1OAAA 4FGWA 3ZHXA 3K4PA 3N2GA 1GNLA 1JQKA 4JKOA 1BWSA 4KO1S 3LTEA 2O2IA 4N40A 4OI0A 3L8FA 1U8FO 2XYVA 2IEYA 3DEYX 2CV0A 4IYJA 3L1JA 1RKVA 4EZIA 1E1QA 1X7YB 5FWDA 1RXCA 16PKA 3TPCA 2OL4A 4FFWA 2ZYSA 1B6GA 2VPIA 4RZ3A 4C9BA 1TKCA 2VF8A 3M2TA 3BD9A 3PJEA 2PBLA 4E11A 4IFTA 1VB5A 3C3BA 4Q7JB 5IHXA 3KQNA 1LZLA 3FIUA 1QQBA 3EF3A 1YS2X 5DBGA 4IQFA 4MGZR 2WWTA 3HVUA 2AMYA 3NO4A 1GLVA 5EJMA 4ZI3A 1FRZA 2ZXEA 1X7HA 3CCFA 4GF5A 4PY2A 1PFWA 3MSCA 4QU5A 2D5LA 3GFRA 3RIGA 4EUNA 4KMOA 5JBIA 4D0NA 4LC1A 3GZJA 1ABFA 3L6RA 4YUVA 5TGDA 1C3XA 1YQEA 2E1RA 1II8A 1U28A 5FYQA 1Y6FA 3BIWA 1V11A 2J7PD 3P2EA 4AROA 1N8KA 2WM3A 4EH1A 1CY8A 1EVIA 4WLUA 1ULSA 4HAXA 2WUEA 3ZY5A 5K0TA 2OAGA 4P0QB 1IN6A 2H65A 4FEGA 5EJ2A 3K9GA 5B2FA 3FGPA 4J1NA 4YY3B 4UOEA 2FRVA 2XB8A 4H08A 1EFPB 5BXYA 1GIAA 4C05A 1L4BA 3E0XA 3Q7RA 4PRZA 2VDJA 4QODA 1CS0B 4KB5A 4YDQA 4XE5A 2WWYA 5CIYA 3U2QA 1ZSNA 2G3YA 3TCXB 3VAZA 1WM1A 3IBGA 4H15A 5FWXB 2GD2A 2I3BA 4XGNA 2IHNA 4HEQA 4N1AA 4X60A 2D5AA 3F3YA 3GH3A 1AHIA 1RBYA 3H42B 4HLCA 2EFEB 4LDAA 4MB6A 2NXNA 3LI2A 4MI6A 5IDVA 1TT5A 2A1TS 1R6AA 4L5JA 4BTEA 1YR1A 5AJUA 4R1LA 3KTAB 4W99A 3GUYA 5E9QA 3UMRA 1A9OA 3WMGA 1YD7A 2ZYDA 4WZ6A 3KSZO 5F7OA 4MWTA 1ONBA 4UD6A 3SN6A 1J06A 3NRJA 3JQQA 4EKGA 5BSEA 3THXB 4OFXA 5HFJA 4YMGA 4OQXA 2HT1A 3T1OA 2GJSA 5JADA 2VHUA 1G8HA 2D5BA 1NBMD 1WW8A 4LPSA 1C9KA 1W6UA 5JPCA 4HXFB 2CLHB 3TF5A 1ZIXA 4GM4A 1IBMB 2QT0A 3NWJA 4RK5A 2X42A 1WQ3A 2WFLB 4M1YA 2V55B 4M76B 4UUOA 4ERNA 1CVLA 1EFVB 5CLIA 2QVLA 2IXEA 3IX7A 5CNJA 5JNLA 2JRCA 2YJ6A 3LT0A 1RAGA 3BREA 1Q14A 2NTJA 4HDSA 3QKTA 3N53A 3RSZA 4RF2A 4BBPA 1H5QA 1ZJYA 4X00A 1IZ7A 1TM5E 2DPHA 2XMGA 3D5QA 4GOLD 1ZR2A 4WFIA 4O4LA 4EO7A 2H51A 1I14A 2JVKA 3GCDA 3GIWA 1VRVA 3PNPA 1Q0HA 1FFEA 1F7UA 2B98A 3M3HA 1RKBA 3AETA 5D7NA 4WK0B 3PE6A 1M8JA 3LKDA 4H7PA 1CCWA 1ETHA 1SPBS 1UPXA 1C7ZA 1MQSA 2R96A 3L0SA 4ZO8A 2WY2D 4YRBA 4BMZA 3VA7A 2DFNA 3GGCA 2BDUA 1Z7EA 3M81A 2QTGA 5F21A 2HJVA 4XLLA 4BQSA 2W9XA 4RY2A 3VAYA 4BDTA 5MF6A 1UZNA 1YU9A 1P39A 2DPGA 1RPNA 3G17A 4MOWA 1K4KA 4XQEA 5L95A 2Q62A 4FM9A 1NMXA 3P27A 1AB6A 1VJ0A 2CMFA 2FFBA 3NVDA 1SXGA 2O1EA 2VSYA 4IIVA 1I9CA 2GKOA 5CHEA 4YK7A 1ONNA 2FQWA 5H83A 3ESCA 3PNLA 3RT9A 5JQGB 1W34A 3OX4A 3T5TA 3FZEA 3NIFB 5ENZA 1Z18A 4X6YA 2FHSA 4EEKA 3HP1A 3WGUA 2W6PA 5YASA 1RI4A 1AA9A 4MWGA 1A9TA 2NVUB 1E3LA 1V9LA 4CLHA 1AUXA 5TARA 3H87A 5LLDA 1N34B 1PNRA 4NESA 3A06A 5M3BA 1G5HA 1WY5A 5HE9A 4C20A 1O97C 4BOYA 4Z2AA 5CVTA 3TM4A 2VR1A 5L40A 3DNMA 5DDIP 2DHEA 4UHHA 4QDOA 1GZVA 4ND4A 3ZV7A 5LQNA 5TV2A 5IBQA 3CF6R 2XCUA 5KNLA 1KI1A 1U8CB 2FTKE 4OHRA 2F00A 2CMDA 2VG8A 2IYZA 4RBNA 3LU1A 1Q1EA 3EMBA 3SC2B 4DR5B 2ZB2A 1KH3A 4DRZA 3TCNA 3HB1A 2FYTA 3ABOB 3KJIA 4TL7A 3QYJA 2JJQA 2G36A 2LUOA 2OBLA 4MAAA 3C5EA 4JVMA 2PTGA 4BO0A 2NU6B 5F35A 1Z34A 1NU8A 2OWDA 4DLZA 3NHUA 3DTYA 4R31A 1O8CA 3GLUA 5HA5A 4L85A 4NBVA 1JIJA 1XFAA 3WRXA 4YCDA 4EUKA 1SUEA 2QAIA 3IP1A 1Y42X 4PE5B 2BP7B 2EDAA 3VR6H 3L43A 2G9NA 4BVGA 2QDXA 4CETA 1G6HA 3S2EA 3I5MA 1TM4E 2Q3FA 3CT6A 5EEHA 2FFAA 2I29A 2CNBA 1IRXA 1N7HA 4JHXA 5C18A 4KREA 4H77A 1O9GA 1I0IA 4R51A 5JJBA 2R1TB 1SG9A 4F06A 3NUGA 4JN6B 2WU3A 3MINA 2E49A 1QANA 3PEWA 1E5TA 3ZJTA 1G6KA 3QVWA 4IDPA 1VHJA 1C1DA 3RKUA 1IVNA 1Z0ZA 3CH5A 1L7XA 2Q9BA 3GFOA 4WI1A 4F6RA 1LQ2A 1ZD5A 4JUBA 4BV9A 5IT5A 1MW8X 3R3SA 4TSFA 4DJFC 2C7GA 3SF0A 8AT1A 1Z2PX 2YV2A 5JAMA 1MAUA 3SBOA 2QSZA 1TFUA 1U5BA 2QW1A 3ROEA 2P41A 2PGIA 1ZD3A 3NG1A 3DR3A 4HDRA 1E6LA 3R1IA 3UATA 3E05A 3HUFA 4GSKA 1ZK3A 3AINA 4JIMA 1SCUB 2B61A 1FRNA 2MINB 1GL3A 2MT9A 4LQCA 5D3MB 4I08A 1T36A 4MNTA 1BMFA 2QIOA 1T6NA 1PWZA 4GMKA 3V32A 1GEGA 4U2BA 4C6HA 2I87A 2NZJA 2QPOA 1PUIA 1O58A 2B37A 5A02A 3QFHA 5CTAA 4ROTA 3NTVA 4MYRA 3JD0A 2ZJ0A 5U9CA 1PL6A 2ERCA 2P2SA 4LCEA 5TS2A 4UM5A 3EC7A 3OECA 4TLMB 5A3QA 4BL5A 5IK2D 2O19A 1N7JA 3FZGA 5ES4B 4U8HA 3MWKA 3M1LA 2HHHB 3DT6A 3MFYA 4P33A 4PYMA 3CRMA 2ZWIA 1OI7A 4LAFA 5FCDA 5CG1A 5KOYA 1TEZA 3PC8A 3OUZA 3PU6A 2YFHA 2P4EA 1D2EA 2GD0A 2PUJA 5SZHB 3MWFA 3Q3EA 2PUTA 2YWRA 3MB5A 4IV5A 1Z7GA 4UC0A 3AGQA 3RAEC 5DZSA 4IZ6A 3BMOA 2GH1A 2IGTA 3K5PA 4HNHA 2DUMA 4NX2A 2NAFA 5CT9A 3IC5A 2HA4A 3ZWOA 1T3HA 2GCOA 4GR5A 5C3MA 2XB9A 4NBSA 2DSTA 2OFPA 4HUQA 3TGLA 3O21A 2XNKA 1D8AA 2JANA 3BS4A 2FPSA 1CK4A 1WZNA 1XOIA 2VUSA 1FFXA 1F0KA 5JPDA 3FWHA 1QGAA 4MW4A 5DVZA 4E3ZA 4DV2B 4PYKA 3ZE6A 1Y7PA 4DY6A 4CFSA 2FWNA 1Q12A 1WR8A 3HZZA 4AT1A 5SICE 1GHTA 3K0AB 2I2AA 3E3OA 3JYNA 1EIZA 1Z7BA 2JJ2A 2NACA 3IA7A 3KOXA 3AF4A 3HR7A 1USKA 5H4GA 4DGSA 2RHMA 1ZVJA 2FPIA 3T1HB 2BZ1A 1RXIA 2QN9A 2GA9A 3ONEA 3IURA 1JAXA 3G49A 1MRNA 4DDHA 2VJPA 3Q6IA 5K8UA 1L8QA 1QAOA 1SUPA 1MV5A 4JVOA 1Q7CA 1XEXB 2RK4A 3HXLA 4MV6A 5DT9A 5L7WA 2ZWAA 3FWNA 1IHYA 2XCOA 3D3EA 4AKIA 4WKGA 4QSHA 4OLJA 4QRHA 4TPKA 3C3KA 4CGYA 1NOIA 1ECGA 1TUGA 2WHEA 4TXLA 3ZHVA 3RFCA 3DEHA 4M9RA 3NPMA 4B3IA 2GPTA 2YZ7A 4Y2VA 3FUUA 4IUCS 4AM8A 2OM2A 2WHQA 3W79A 4GL2A 4N4AA 1V1RA 3A7EA 2HREA 2CHFA 1X3SA 4LWPA 4P80A 4RPIA 3JR7A 2Z8YA 3HO8A 1SEPA 5CYFA 4MYCA 1HYQA 5TQJA 1QK3A 3L4BC 4QQKA 3E1GA 3I5XA 5AJVB 1PW5A 2DHDA 2X19A 4RCVA 4MRMA 2LDXA 4DQLA 2RIPA 1XZBA 5DFAA 5AK0A 1DI0A 1T4CA 2DBYA 2I6FA 1XCBA 4X1IB 4NVRA 3L0BA 3FUWA 3S27A 4TWJA 1Y4ZA 4GGOA 2YW9A 1BYIA 5E0OA 3ZE7A 1BEZA 5T4FA 2CZCA 1S0UA 4QJ4A 4AY2A 2ZCVA 3SS9X 5GONA 1VM6A 2H1SA 2BGTA 4QUJA 1SUAA 3PT9A 1XRPA 2EARA 1JDUA 2A67A 2YQZA 4L6AA 5L3ZA 4C1NA 2BBTA 4E7OA 4J76A 3SDSA 1UP6A 1J42A 3L6UA 5LL6P 3HZRA 1ZUHA 5CAEA 1YUBA 5I7FA 4NAUA 5C3UA 2OGZA 3RJTA 2Z8ZA 5C5EA 4MUBA 5KDLA 1YB5A 5AVSA 4G85A 1CUUA 2QVYX 2BWJA 1W49A 1ZS9A 4NCNA 1M34E 3LLSA 4X54A 5HZMA 2PPVA 4X94A 1NY6A 2RI0A 4OB8A 3DBLA 5E6RA 1OXSC 3DFMA 4U6QA 5DOZA 5EIBC 5TQ2B 3VZQA 2LP4Y 4RKWA 5A9SB 1R9MA 1IXZA 2FWBA 3NAGA 1XKXA 5EPOA 3DHWC 3VO2A 4XTCS 3GNSA 5JI3E 3SX4A 2Y4OA 5JSFA 2ZVPX 3K15A 1U0NA 1XZNA 5BRJA 1RYBA 2R5NA 5CX1A 2FZ5A 4FB4A 2J9YB 1U81A 2W4IA 2FSIA 3N0RA 4QPDA 1L7VC 4HGYA 4UAVA 3Q5DA 1GNSA 1IQUA 1UJCA 4GL4A 2FN4A 1GL6A 5K3CA 5LNK1 3Q0IA 3W3AH 1XD2B 1AUQA 2JGJA 3NM5A 1BU5A 4BHTA 2VPPA 3D1VA 4A3SA 3UVEA 1HETA 3P9QA 1KJYA 1MG5A 5BWCA 2JGFA 1ODTC 4RGQA 4B83A 3R6DA 1UBJS 1G16A 4KPUA 3G89A 2Q5QA 4F9EA 4KV7A 1XVUA 5BRNA 1PEKE 2IZ5A 2EG5A 2NLOA 2OP0A 3NS7A 1BN6A 3D2AA 5DGXA 2OPBA 4B3HA 1E7MA 2P2CA 1RYMA 2NPOA 1JEAA 4Z3OA 1U7TA 1VXOA 2REQA 1Z4KA 4E33A 3CB4A 3H13A 3U4GA 4WN9A 1AM4D 4M49A 1XL0A 2EW8A 1GYPA 2ONZA 3U4QA 1U02A 1XA4A 2FOLA 2XWQA 4XJSA 4EPYA 2D1QA 1OX4A 5H5JA 3ILYA 3JQBA 2ZIGA 4NMLA 1XK6A 2IF0A 4DB4A 2F1KA 2PQ6A 2FKNA 1TCUA 2J3DA 3CX8A 4Y2RA 5BN4A 3IEMA 3KJEA 1MNQA 3BL8A 4A82A 3ZHQA 1I2CA 3B7GA 3S2FA 2IODA 5F98A 3A7DA 2VRCD 2WHPB 5AVTA 2BCEA 3FTFA 1QHHB 2ZTMA 4ERXA 2REBA 4CQJA 4DUGD 2XNDD 1E77A 5C4IA 3QVSA 4FJ0A 1JJBA 3DKKA 3DFUA 1KKLA 1YKSA 1W4AA 1PK8A 1DRUA 1OFHA 2DFLA 2G9UA 3BFXA 3NBKA 3S2GA 4BO4A 4AMZA 2C4HA 4MQFA 5IF3A 3BH7A 1SHTX 2B6HA 3R0JA 1EM8A 3RT1A 2WG2A 4TT3A 5ADUS 1T3LA 1G5IA 2EC5A 4HNGA 1C30B 4A0FA 4URXR 1ILWA 1XLUA 2E18A 2HHAA 3FKJA 3JAKA 4N3BA 3V4ZA 4FKBA 2ZSBA 3WK4A 5EHNA 5BXQC 4AURA 1IWBB 2GAIA 2MHCA 3ADKA 3L79A 3FFXA 3R7BA 4AIRA 4TS1A 2FMTA 3BXZA 1G8YA 1HORA 1YOBA 3SD7A 1XMOB 1S01A 3FCYA 4Y6SA 4C7XA 2EWWA 2PLRA 2QTHA 3FJ1A 4DNQA 1N0UA 2QXYA 1G5RA 4WOPA 3QWBA 4GZMA 1EDOA 2OVBA 3VKUA 3T1YB 4PXYA 421PA 3EQ9A 1DIGA 1NVXQ 1EVEA 3E18A 3PVSA 4Q93A 4WT7A 3EZ9A 5C8DA 2JIOA 5ALZA 3LM8A 3N0TA 3UB2A 1WV1A 5GIOE 1K7YA 4BAUA 3PIRA 3R2JA 4CTJA 2D3WA 5JRZA 2AD1A 3SFZA 3OU7A 2Z6AA 1HTBA 2HQSA 3IT1A 1UC5B 3G6WA 3D6NB 1IBCA 4RVHA 3QUQA 4AF7A 3LMKA 4OA5A 2WT9A 1EKXA 1C7EA 2VP5A 1UPAA 4ITRC 4KPFC 1K6XA 2PY6A 3ZXYA 4YUYA 4QWWA 3DFKA 4I1PA 1Z4JA 4U2CA 5I9LA 3WGHA 2GVZC 4KH1A 3LV8A 3PQDA 4G8BA 2AJLI 4EHIA 1CYEA 3ZI7A 3BAZA 4UDNA 4H1WA 3MWEB 5HK9A 5JFTA 1FIUA 1YIDA 4G3XA 3UB3A 5BVHA 2C9DA 3OZAA 2F7SA 1QVVA 3PEFA 4WVLA 1PT6A 1UKZA 4JNCA 2WJ6A 1GPUA 3BF7A 3UFXA 4EW6A 4LW8A 1H2XA 1IK4A 2DAPA 2BDEA 3OFVA 2HUPA 2OVFA 3VR0A 3WK6A 4R9NA 1TF5A 3RC3A 2PZEA 4B3TB 4EW1A 2EBHX 4GOKA 3R7DA 1UR5A 2FE4A 3PNMA 1DQSA 1V6SA 4MIKA 5DTEA 2EBWA 1GPLA 2QAGC 1RQLA 1WCWA 1Z4MA 2Q99A 2R1VA 1L5VA 2R8EA 4DR6B 1P33A 3LD9A 3GAAA 1TUEA 3KBOA 1L5RA 1K8XB 4HGZA 5EERA 4AF6A 3I28A 3WNDA 3MMSA 4Y1FA 2WTAA 1EFDN 4Y9DA 4CYMA 4Z1MA 1KFJB 3ZJYA 1OIVA 1VI6A 1XJWA 3CZQA 4TVKA 1WP9A 4UNPA 5DNDA 4Y1RA 2IYFA 4PZUA 1I5EA 2JBWA 3ACBA 2ZVQX 1QHIA 3GMIA 3X1JA 2ZBDA 3JVVA 4NE2A 1UDXA 3KLBA 3PQCA 1CD5A 2JG3A 4OUKX 2RI6A 2RJNA 2VEDA 4IKPA 2VQSA 4QXOA 3F1KA 1U80A 3BRWD 5JQGF 1OFUA 3UKOA 1I3NA 3SC3A 2HCBA 1Y1TA 4L8LA 4Q1EA 2WM9B 4CG2A 4DG9A 1PGQA 2RMKA 5IT4A 2FPMA 1QE3A 2X2EA 4J0QA 1E1KA 1DUIA 2P2LA 3BB4A 3BQMB 3NIBA 3UTDA 2A9RA 3RVSA 1RDFA 3TN7A 3DPUA 4LJ8A 1P1IA 1UP7A 3G2JA 3F46A 5CJJA 4D26A 1RHMA 2AIRA 2KB0A 2R6R1 3DL7A 3EGXB 4CKYA 3IO5A 1KS9A 1SBYA 3LCMA 4CKZA 2P27A 4HJRA 4TL9A 1PFGA 3GN2A 1RHQA 2WDZA 1RPJA 4HN2A 4KLRA 5C8YA 3HB7A 4EG4A 5HM6A 4JP5A 1AJEA 3GRPA 4M89A 1G66A 3LF2A 4WCVA 3UGTA 1SVSA 1NE7A 4H1UA 2X0KA 1J1ZA 1TYBE 2CVOA 5C7YA 1WOYA 1D2AA 4XVHA 1NUQA 2H92A 2I55A 4LZZA 2D4AA 5K4AA 5F77A 1SG0A 1JHOA 1UJ2A 3WL7A 4DCUA 5K0FA 1XDGA 2QLBA 4G1UC 4H31A 3H9GA 5GJWC 3ZW9A 9GPBA 1NW7A 5I3ZA 1EQ2A 5C9ZA 2I3DA 4OFBA 2RGNC 4GM1A 3IBYA 3BH6A 3E58A 2DE0X 4LBVA 4Y6OA 5ESRA 2EBUA 5B3JC 5JD5A 5JMOA 5JEEA 2W6IA 4PAOA 2HKIA 3SLKA 1REQA 1Y4AE 2ZB3A 3AEQB 5BN5A 4TS3A 4CBVA 1ODCA 1Z7YA 3WZMA 1B41A 2QR5A 2ZM6B 3EDMA 1V4VA 3U7FB 1SKBA 3KG2A 3KZ1E 5BYAA 1YRLA 1X14A 5ALPA 3BYZA 3WADA 5U4XA 1TUBA 1XJ5A 3TJRA 4XWWA 4PWYA 4RHXA 4LVOA 5LQSA 5J2UA 1ZO8A 1OLXA 4J6FA 3A2KA 4BQOA 1KMNA 5JCXA 3CMCO 3GMSA 2OFFA 1FBTA 1VPLA 3FVQA 1RJDA 4R2IA 4NTZA 2WKPA 1UWCA 2QTLA 4NICA 1KOLA 2VZ9A 1PV4A 1OFIA 2KI5A 2QL5A 6GPBA 1PJ8A 3UZUA 2ZRDA 1DFHA 3WZLA 4BNYA 4JJKA 1JFFA 3F4KA 3CA8A 5COBA 3CNBA 4PCUA 1V3TA 4WY8A 2ZYAA 1UINA 4QYTA 1LFDB 2YKGA 4R01A 3R5HA 1Z8HA 5CURA 3EQ8A 4XJVA 3K1ZA 2CLSA 4K1XA 3U37A 1OXMA 3OOYA 1F2DA 3OZCA 1OLUA 4MCAA 1JRLA 3R74A 4CEJB 2ONJA 3A9WA 1VA5A 4ZAGA 3ROXA 3J7AC 2NZXA 1SY7A 2C5LA 2R2AA 3CNLA 1L1FA 1XZ8A 1QVAA 5K0JA 5IVDA 4D57A 1LPSA 2EBFX 1D2HA 5CPBA 4OIFA 5HQJA 4FD2A 3UO8B 1J1UA 2WKWA 3HY3A 3L6CA 9MHTA 4ODIA 1L6IA 4OUDB 3I8SA 3W34A 4JOBA 3E2PA 3KQTA 1WW3A 3B7WA 4LOKA 1WL8A 1WCYA 1R6BX 2CZQA 2WD8A 3MQFA 3FWYA 2RAPA 4OXKA 3VM6A 1JXOA 4A0SA 4PLHA 3HYRA 1MQAA 3VBCA 3DT9A 2XWPA 3BWVA 2ABWA 3JWIA 2NU8B 3D8SA 4IDOA 4JI1B 1RJ9B 3DAOA 1IQPA 3EVNA 3J81k 2RHGB 2HJWA 2IX9A 5IX8A 5LIRA 4LTNA 4CM9A 2CJYA