3E7PA

Crystal structure of of putative methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
253
structure length
253
Chain Sequence
b'NTILGFDVNLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title CRYSTAL STRUCTURE OF of putative methyltransferase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
molecule tags Transferase
total genus 89
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e7pA00
1JSZA 2YQZA 1TW2A 1P91A 3V8VA 3B89A 2FHPA 3GXOA 3NVMB 3R0QA 4AZVA 2HNKA 3VC2A 4YUWA 5EHIA 3DOUA 5CCXA 4YUVA 1IXKA 5E1OA 3K6RA 4QQKA 1SG9A 3KPWA 5EC8A 2FK8A 2EFJA 2IPXA 1FP1D 3HVKA 2OYRA 4AZTA 1KYWA 3MB5A 5KYGA 3C3PA 3KKZA 3FRHA 1KR5A 3NWBA 4PYJA 5DXAA 3HEMA 3EGVA 3KU1A 5EZSA 3OZSA 2B9EA 4QVKA 5EIWA 1KIAA 3OFKA 4YMGA 3UJ8A 2V7EA 3DXYA 3OU6A 5LQCA 3M70A 5T6BA 4OBWA 3UZUA 4PWYA 1M0EA 3E8SA 5FWDA 4BY9E 2ZULA 5K05A 3EGEA 1G55A 4FT2A 5IKMA 3TMAA 3CBGA 3LKDA 2GS9A 1SUIA 4DKJA 2C7PA 4RVDA 3UJBA 2O07A 4QTTB 4BP1A 1VPTA 5E9QA 2G1PA 4GEKA 4RVFA 2QRVA 3R9XB 1JTEA 3OCJA 4DM3A 1QAOA 3G5TA 3LSTA 5EVJA 3BXOA 1DL5A 2G8NA 2PSSA 3FPGA 5M5BA 1VQ1A 2LD4A 1NW6A 4DZRA 1JSXA 5HILA 5GWXA 4HH4A 4MHTA 2Z6UA 4PYMA 3KHKA 3SSNA 1NW7A 4YMHA 1DUSA 1X19A 2P35A 3MTEA 1BC5A 2ZTHA 3UJCA 3BZBA 5EEGA 3QOXA 1L9KA 3KPVA 2QM3A 5D1HA 1Q0TA 3T0IA 3MCZA 3OU2A 5K0GA 3GU3A 4OX9Y 2ORED 2QY6A 3GGDA 4DF3A 2EJUA 3EVBA 2O0LA 3M4XA 1XCLA 4QPNA 3OE5A 4BLVA 5T64A 3G8AA 3ER9A 2UYHA 1VE3A 5DTMA 4MWZA 2CWWA 3NMUF 1RJGA 4KRGA 2NNWB 2I6GA 3R3HA 1ZGJA 4V0QA 2XBMA 4KDRA 2AS0A 2NXNA 4ATNA 4R05A 2XYRA 3P71T 3I58A 5C1IA 3LBYA 3G8BA 2IBSA 3UJ7A 5GIPE 3KPUA 5F2NA 4E33A 5EG5A 2ZSUA 3G89A 5P8WA 4EQZA 2I9KA 3A7DA 3CC8A 3KR2A 2ZFUA 4RVGA 5B1SA 5BP7A 1WS6A 4X61A 2ESRA 3LDUA 3TQSA 1D2GA 3BWCA 2NYUA 1N2XA 3EVZA 2P8JA 3OU7A 4P7KA 1QYRA 5K0LA 4C07A 5FQOA 4C4AA 3C6MA 3P2IA 4E70A 2H1RA 5HIJA 4FT4A 2R3SA 4JXJA 2YVLA 3HVIA 4CKBA 4E31A 1XXLA 3D2LA 2GAFA 3ELDA 4V0RA 2C7RA 1XDUA 1B42A 2I62A 5FTWA 4PGGA 3KQWA 5K03A 4RTSA 2FCAA 2XYVA 3NWEA 4QQNA 5K0BA 2I7CA 5DXJA 2Z6QA 4RVHA 3HTXA 2IH2A 2YUIA 3MGGA 5DRTA 1Z3CA 3FUUA 5KS2A 3PB3A 1UFKA 2PT6A 3UJDA 3UA3A 4PYIA 2PXXA 3UJAA 2QE6A 2ADMA 4XUCA 1RJFA 1WG8A 2Y1WA 3EMBA 3E05A 3IEIA 2Y1XA 4CKCA 4QPPA 3FUWA 3S68A 4DMGA 3P97A 5MHTA 5CM2Z 1JQDA 3GRVA 2HTEA 1G60A 4RYLA 3A27A 5T67A 3AXSA 3KPYA 3M6UA 2AN4A 4FGZA 5C9ZA 5K0JA 2YXEA 5HIKA 5E1BA 3LKZA 2AOUA 4E30A 1QAQA 2FPOA 1P1BA 2OKCA 2ZBQA 3TM5A 3JWIA 4PIPA 4HTFA 1VL5A 4WVLA 1YB2A 3AY0A 1KYZA 1I1NA 3EGIA 3LGAA 1RJEA 5LQJA 3FTEA 1O9HA 2OZVA 3VC1A 4RTRA 5DLYA 3EVEA 5FWAA 1VLMA 2GPYA 3LDFA 3M6WA 3ERCA 1YFJA 5DSXA 4F86A 4GOLD 3BWBA 4GOOD 4C08A 1X1BA 2YXDA 3BKWA 2IH4A 3DH0A 3FYCA 2P7IA 4PCAA 1TW3A 3LCVB 3DXZA 3SVZA 5K0EA 5LQRA 4GF5A 5EGSA 5DTRA 4F84A 3AWIA 2CMGA 3ID6C 2IP2A 3E7PA 2YTZA 2R6ZA 5H02A 3PLAE 2ERCA 2NXCA 3UA4A 1N7IA 1F3LA 3DLIA 5E2AA 5IH3A 4A6DA 4DCGA 2O06A 1H1DA 4YUZA 4AUKA 2OO3A 1YF3A 5FQNA 3DP7A 2P41A 5GOZA 5CVVA 2NXJA 3GO4A 3NJRA 1XVAA 2P3QA 3CJTA 4IV8A 2QRVB 2PT9A 3P9CA 5HIMA 3SSMA 2PWYA 1FP2A 1NV8A 2VDWA 1SUSA 2PKWA 3PS9A 1R8YA 2UYCA 3KQMA 3KR0A 5EOVA 4LWOA 3B5IA 3UJ6A 2EG5A 3CJRA 3BWYA 3PFHA 3P9KA 1RI5A 1VBFA 2AOVA 2OXTA 4CTJA 5JUWA 1N7JA 1VIDA 5EMLA 3THRA 3GJYA 2ZWAA 5KQSA 5BXYA 5F2KA 1IM8A 3OZTA 4FS8A 3QOWA 5BW4A 3R6TA 1ZQ9A 2XVMA 3PTAA 1OR8A 1IY9A 2OPBA 2B2CA 2GLUA 3JWGA 4DA4A 4XCXA 5LQNA 3EVGA 4ZTBA 3FRIA 2B78A 3BUSA 3EVCA 2DPMA 3MERA 3P8ZA 2GA9A 5EHGA 1BOOA 2WA1A 3EEYA 3A4TA 3BWMA 3TKAA 3EVFA 5GP1A 3HVJA 5FUBA 2VS1A 4HGZA 3LHDA 5EQJB 4G56A 1R6AA 3GCZA 3IHTA 3LECA 2G72A 4C03A 1KPHA 1FJXA 1EJ0A 1AF7A 1X1DA 2Q41A 3NW9A 3VYWA 1EG2A 4KWCA 3DLCA 3G2QA 3PVCA 4LECA 5E9WA 2O05A 4YV2A 3TM4A 2BM9A 1NW8A 4PIMA 4QVGA 5CIYA 3CCFA 4Y30A 2IBTA 4XUEA 3GIWA 5DM1A 5E1MA 5EIFA 1QZZA 4IWNA 5K0NA 3FPJA 4A6EA 2V74B 1NW3A 3GRYA 3HA5A 4KVZA 5DPMA 3AXTA 4QDJA 3P9NA 1XTPA 4EK9A 3R24A 1PRYA 4L7VA 2FYTA 4R8RA 1WXWA 3UBTA 5FHRA 3HVHA 4MQ4A 4PYNA 5CVJA 4ER5A 1KHHA 3P9IA 3KQOA 4U7TB 5GM2A 2PXAA 1BHJA 3EPPA 1EAMA 3GRZA 3B7PA 4GQBA 4BLWA 1I4WA 4LG1A 2NXEA 4PGHA 3M6XA 4RTKA 3DXXA 3LX6A 4E2XA 4GUAA 3HP7A 1HNNA 2PY6A 4F85A 3O31A 4POOA 2OB1A 1KP9A 2JJQA 3DTNA 1UIRA 5K09A 2VP3A 4FSXA 4X1OA 2BH2A 3KQYA 2AOUB 2XVAA 3FPEA 1T43A 2AOTB 3MTIA 3PX2A 4PYKA 4UOEA 5LQKA 2OY0A 5ICFA 3O7WA 4PONA 1WXXA 3I53A 4HTFB 3ELWA 4P58A 3SSOA 1SKMA 1M6YA 1D2CA 2UYQA 2PWPA 1AV6A 4CXMA 2IIPA 2P3LA 3EMDA 3KR9A 5EZQA 4C04A 5LSAA 4M37A 3P2KA 2P7HA 3I9FA 3ER8A 1JG4A 5CVUA 1ORIA 3FZGA 3WSTA 1L1EA 3DR5A 3B3GA 5E8JA 3TKYA 3HCFA 3NDJA 2FRXA 1O54A 4FZVA 4FP9A 2JG3A 1QANA 2BR3A 3FTDA 2NP6A 2AOTA 4PYQA 4C06A 5DM0A 4C05A 2AVNA 3QV2A 2ZIGA 2O57A 1UWVA 3CVOA 5LQUA 4PNEA 5EKUA 3IYLW 5CD1A 3CGGA 3E23A 2ZVJA 4O29A 4QTUB 2YXLA 4AX8A 3F4KA 2WA2A 5EMMA 4E2ZA 2PX5A 1O9GA 5C0OE 3H2BA 3A25A 3KQSA 4E32A 3P2EA 5E8RA 3SMQA 3JWJA 5FA5A 3X0DA 1FPQA 3C0KA 1NE2A 2E5WA 3FYDA 5ERGB 4EKIA 4GC9A 2VDUE 2EJTA 4RTMA 3GRUA 5EKXA 5LR6A 3KQPA 4ER3A 1TPYA 3ORHA 5CVDA 1XDSA 3KQTA 5DTQA 1P1CA 3SM3A 5LQAA 5DT2A 5HEKA 4X60A 1AQJA 4K6MA 5K0CA 2JHPA 2P1DA 1NV9A 1JTFA 3MQ2A 2AR0A 5ICEA 2XYQA 5E1DA 4R6WA 1ZHFA 4OA5A 2K4MA 2ZWVA 2OB2A 1L3BA 2AN5A 3FTCA 4P7GA 3C3YA 3V97A 3M6VA 5FHQA 2HMYB 3OZRA 4X41A 4CWAA 1RI1A 3G2PA 5HOQA 5GINE 2ZZKA 1MJFA 5FA8A 5HFJA 2CKDA 3T7TA 1G8SA 3OE4A 4DCMA 1U2ZA 3G2OA 3HCEA 4RX1A 1ZG3A 4RV9A 1G38A 2B25A 4WXHA 4ISCA 3A7EA 2DULA 4OBXA 4EVIA 3ANXA 4RTPA 1RI4A 2PXCA 3RIEA 1Y8CA 1RJDA 4KW7A 2BZGA 5DRYA 2EX4A 2VZ9A 3FUVA 5HIIA 4AZSA 3BGDA 4CKEA 2ZZMA 2HWKA 3MCTA 4M38A 4BLUA 3THSA 4E2WA 3HCCA 2CMHA 4PCLA 1G8AA 3KQQA 5EMKA 4ER7A 3CJQA 3BKXA 3T7SA 3NTVA 4KDCA 4R8SA 3GNLA 3Q7EA 1YUBA 2IGTA 1AQIA 2Z6AA 3RW9A 3DMFA 4B17A 5DX0A 3ME5A 7MHTA 1YZ3A 3A26A 3FPHA 3DULA 3B3JA 3KPJA 2IFTA 4LWPA 4BP3A 3EVDA 3KQVA 5U4XA 1YFLA 1EJ6A 1EIZA 4ER6A 2PBFA 2PX8A 5CCBA 3PFGA 4KIFA 3SGLA 3HA3A 2AOWA 2ZIFA 4RWZA 5DX1A 2AN3A 4PYOA 4RTLA 3L8DA 2ZBRA 3SXJA 1V39A 2C7OA 1VP9A 4GOMD 2GB4A 4HG2A 3SX0A 2BR4A 2PJDA 2KW5A 1R74A 5FULA 5DSTA 5FADA 8MHTA 1NBIA 3HCAA 1MHTA 4AZWA 1KXZA 4M36A 1I9GA 4P7FA 5G02A 4OQDA 1F38A 4MIKA 4U7PB 5ICGA 1G6Q1 4EMSA 5F2OA 5DM4A 2ZCJA 3K0BA 4YUYA 3LCUA 4MTLA 3G7UA 2HV9A 4ER0A 3LCCA 2ZW9A 3RODA 4XUDA 2JH9A 4KIGA 2P40A 3HM2A 3TLJA 5K01A 3TOSA 3OFJA 2ONYA 1NT2A 5BW5A 2AOXA 1R00A 2ONZA 1WY7A 2N47A 2PX4A 3I64A 2PLWA 3LPMA 4RSRA 1JG1A 1RI3A 5D1NA 3C6KA 3SR4A 1ZGAA 3DMHA 4FSDA 5JR3A 3BT7A 1D2HA 4RTQA 1R18A 5DM2A 4IV0A 2ZLBA 4P7JA 2ZBPA 2PGXA 4PINA 3HCBA 3AJDA 4YV1A 3GWZA 3DMGA 2A14A 4PYLA 1JG3A 3FUXA 4Z2YA 1XDZA 3I5UA 3HNRA 1NKVA 5E2BA 2BM8A 2JH8A 5GM1A 3EEOA 3NDIA 1L3IA 1VP3A 3LBFA 2JHAA 4IKPA 3LDGA 3LL7A 4HGYA 3TFWA 1QAMA 2AZTA 2HR1A 2CL5A 2P3OA 2QYOA 4X63A 2BR5A 1NW5A 4R6XA 5HZMA 1JG2A 2F8LA 1XJ5A 4GOND 4HC4A 2IH5A 2ZZNA 3GRRA 3PX3A 2UYOA 4OA8A 3KR1A 1NBHA 5EEHA 3IV6A 1PJZA 5FCDA 4H0NA 2YR0A 5EMJA 1RI2A 3B3FA 3FPFA 3UFBA 1SQFA 3HCDA 3G2MA 3VSEA 5KVAA 3ELUA 4HSGA 1R8XA 2H11A 3PT9A 2GH1A 5CVEA 2AVDA 1X1CA 4RTJA 2OBFA 3MHTA 3G88A 2JHCA 2VDVE 2C7QA 4QDKA 3FTFA 4NECA 3TR6A 1KPGA 1JQ3A 4CTKA 1JQEA 3M33A 3CKKA 3GDHA 9MHTA 1P39A 3DUWA 1HMYA 2PX2A 3TRKA 5K0FA 1YZHA 2IDJA 3ELYA 2YX1A 2FK7A 4YUXA 5DWQA 3NVKI 4OQEA 3TPZA 1BKYA 4HRAA 4GBED 1ORHA 4EKGA 1Q0SA 3T7RA 3OPNA 4FR0A 2WK1A 3Q87B 1SVUA 2PV0A 2G71A 4M7RA 3G5LA 3HA7A 1XCJA 4RTNA 5CUQA 4Y2HA 3UJ9A 5KQRA 2PVCA 10MHA 1L3CA 3U81A 3FUTA 3EVAA 1M6EX 1EQAA 5EPEA 1WZNA 3BGIA 1X1AA 1FBNA 4E2YA 2UZ4A 5ICCA 3REOA 1JR4A 1ZKDA 5E9JA 4GC5A 3UWPA 4DQ0A 2B3TA 3MAGA 4YV0A 3BGVA 2G70A 1SQGA 2NP7A 5GIOE 2ZIEA 2H00A 3O4FA 5K8VA 1INLA 5DX8A 2IDKA 1KPIA 1DCTA 4RTOA 3JWHA
chains in the Genus database with same CATH superfamily
4WADA 3N9IA 1QK3A 1Y3AA 2HNKA 3CH6A 5DYIA 4IGFA 5EZYA 5FFMA 3I01A 3TB4A 3RYCA 2KB0A 4MYTA 5CCXA 3ZK9A 4WOPA 2VQ3A 2WKSA 1NJ8A 2B4QA 1EPUA 1SQ5A 2OEPA 4KUHA 3KPWA 3I2KA 4RELA 2EFJA 3SZMA 1YOVA 2R5NA 2C77A 5T5QA 3I8SA 4NBTA 1U28A 4NAVA 4BMNA 3DO5A 3LQYA 4A26A 2V5UA 3JYHA 1BWRA 3KKZA 1G2OA 1IH8A 4HQ6A 4KXUA 3PGA1 5DW3A 2IJGX 4X54A 3RYTC 1RRMA 1GNVA 5THQA 3S5UA 1KYTA 1BDJA 1LF0A 1QWOA 1P9NA 2B9EA 3FCSB 2V1UA 4HXYA 1ICIA 1VJ1A 4EITA 1I3KA 1OXMA 2FPSA 3M70A 2DVMA 2HJGA 4IIBA 4TWRA 3JATA 4U7HA 1A5ZA 4LA4A 3KU4A 1I2MA 2BMWA 5DN6A 2IUTA 3CBGA 4IO0A 3W1VA 2W8BB 1CUUA 5ED0A 2BT4A 3ABRB 4YYEA 1NFRA 4P86A 3ROKA 5I9NA 3KAKA 4I08A 3OT1A 1JNYA 1QHFA 3WNCA 5HKAA 3RT9A 2ORYA 1SUEA 4I1OA 1EVQA 3AHFA 2XGGA 4G26A 4MGYR 1Y8AA 3PRHA 1T13A 3EXHC 1IHYA 4OLHA 2XKBA 5HF5A 1XMPA 5AW2A 3K1JA 3Q6NA 4GOXA 1H05A 5D01A 4DJTA 3KXPA 1DJNA 1NBME 2LD4A 3MOSA 3T7KA 3TAXA 2A0XA 1EM8A 2FPGB 2R7AA 3H1TA 4DZRA 4HYTA 3SHFA 2DR2A 1K0FA 4PPNA 5BV0A 2XX3A 1RBMA 4LJAA 4LY0A 5EFOA 2IIVA 4MRRA 4PANA 1FTYA 1JAYA 3TQQA 2QZZA 1KRWA 3LX5A 3OTQA 1U8FO 3JAMA 3ANTA 3WIVA 5IUJC 1QFYA 3UB4A 4BWYA 2HRDA 2D7DA 1GQFA 3U13A 5KVCA 2XRYA 4NXNB 4HDNB 4ARIA 2REOA 3KOYA 5JI3E 3ER9A 5M34A 4EJSB 3IQFA 3NRCA 1NBEA 1XALA 1RJGA 2Z8XA 3GPBA 1AXGA 2OD2A 2P0AA 4TM8A 1O7JA 3QI2A 4I1UA 4JWTA 4OHZA 3IE2A 3OWOA 3QQPA 4LY6A 3OBIA 4KWTA 5EIAA 4J29A 5BN3A 4BRWA 3AW9A 3G8BA 3LUKA 4B82A 3PJFA 1U80A 1ZOOA 5DZSA 2GRUA 1T4GA 2O48X 1JKXA 1NNSA 3GEPA 2X5OA 1PJLA 4MQMA 5ECGC 5FOXA 5JH7B 4QFDA 1RYBA 1FFXA 1MRSA 1WS6A 1T1IA 2D5AA 3LDUA 3MJSA 5FH9A 5LUAA 2I55A 1PKXA 2WKWA 2N46A 3WB1A 3KAPA 1SXPA 4C07A 1RQPA 4E5DA 3BL8A 5BSTA 3R8CA 3KZVA 3PC8A 3QYPA 4K26A 4TX1A 4RGQA 3SPXA 4HNUA 1SXQA 2NPOA 1HRKA 1O6GA 3PKIA 3U80A 5AYVA 3NBKA 3ZW7A 5JXGA 3PHHA 5LIPA 3KQWA 2L0XA 2QK4A 3PXEA 1LBIA 2XB9A 5LBIA 2EC5A 1HNXB 1PT7A 1SVMA 1LEHA 1FBTA 1R6UA 1KSJA 3CUVA 4Y6OA 5JMPA 1HEIA 2OZKA 4M1TA 4P0QB 2DCMA 1Y3IA 1PX2A 1XU7A 1RJFA 2BEVB 1PG5A 4FS3A 4M9RA 5KVVA 2Y1XA 3MYYA 4QUKA 4JI7B 4UBIA 1AUPA 5FOUA 4CM8B 2C0CA 3FFAA 4AN1A 2AKAB 1LDMA 2C99A 2JGKA 3A27A 4PQGA 1H1TA 1HQYE 1VBKA 5BWBA 1LPNA 3NWOA 1VCMA 4XRRA 5KTRA 1Q0RA 2Q2WA 3P7MA 2OYSA 3SNKA 4MUAA 2FPOA 3BQ9A 1Z6ZA 3KD3A 4G1UC 4BL5A 1YRQA 4XZ3A 5GGXA 3SQWA 1YO6A 2IUSA 3UAGA 3V32A 5CT9A 3H9JA 821PA 2BEVA 3DCJA 3C3JA 1XMVA 1PO7A 1SG6A 3S7TA 3RVMA 4DCUA 2O6HA 3FN4A 4X0EA 3TI9A 2CDNA 1A50B 1OPXA 5CJPA 2PQ6A 4UVIA 5LXTF 3D43A 2ZUDA 3UK0A 1M2OB 3UICA 4ZOQI 1YI1A 3IAS1 5G53C 3X1WA 4WBNB 1I3OA 4NU5A 5EYPB 4K03A 1ST2A 3ZNNA 4BX8A 1W7AA 2CNNA 3OM9A 3NFYA 1PT8A 2W4MA 1LFDB 1U8UA 2QLLA 4PM4A 2YTZA 1G4UR 1QG6A 1UODA 2WG2A 2QORA 1H1DA 3PFFA 5BUZA 1DO8A 2JVJA 3AOGA 2PSFA 3SSMA 4GL2A 5TSDA 3A1NA 5AJYA 1M2OA 1EFDN 1JEOA 3DGFC 3IQZA 4WCVA 1JDZA 1B74A 2Z6VA 4QPZA 2XDAA 4G4GA 1YAJA 3AFNA 4EW1A 5KYKA 3VTZA 1RS0A 1Q3HA 2BV3A 3QU5A 4CTJA 2YYAA 2YN0A 4JVNA 2A0YA 4F11A 1VL8A 3U6BA 3AY6A 3LOUA 4FR2A 7YASA 1USKA 5KQSA 2IYXA 1GPDG 3FPAA 2VF8A 3PJGA 4LRWA 3TQFA 1AG9A 3H1AA 1E60A 4MRAA 5LWHA 3P4UA 4YQEA 4YS6A 2YJNA 2B2CA 3V9PA 1Z5PA 5A3QA 1I3LA 2PT7A 1DJOA 1Y1PA 2DFTA 2DUWA 3BULA 3IVMA 3M7IA 3NHAA 3U7IA 5IX8A 3CTMA 2APJA 3L18A 2IK8A 1U2TA 2ACKA 3A4TA 3HN7A 4N12A 4R9NA 3CVVA 1Y80A 1IY1A 4IJWA 1A1VA 3K70B 2EARA 2PD4A 4CIDA 3IHTA 2XGMA 3G8CA 4FHCA 4G09A 1EJ0A 1AF7A 1L4EA 5H3HA 4EEZA 1D7OA 1QGED 5A3VA 1N6HA 2VK1A 1KMHA 2BMAA 1JKIA 4YV2A 3SG0A 5CIYA 5B3KA 4UOZA 2XMQA 4UHDA 1S8FA 4UVDA 3ZW8A 4AJEA 2UUBB 4K6OA 1WTCA 5EJ9A 1K97A 1LBSA 2PLAA 1WJGA 2QAGC 2WU1A 3AR9A 2N9UA 3NETA 5FYDA 4Z54A 3ZI4A 1N5DA 1GTJ1 1Y5NA 2R00A 2ZI6A 2YXPX 1DUIA 2CXXA 3HA5A 4MUIA 1A0OA 4TUYF 4CIYA 3CUKA 5LXTA 4BVAA 1YMQA 3V1UA 4D46A 2HHCA 3D7KA 4OQQA 2WKPA 2JIDA 2FPKA 5BNTA 4Y9UA 1EG7A 1ML4A 1RT9A 1YRWA 1FRVA 2V7WA 1QB8A 2V4UA 1EAMA 4XIIA 1PTKA 2XWSA 2M98A 3OQ1A 1I4EB 4F72A 4JP8A 3I5XA 3GZTB 3NAZA 1JDTA 3CRQA 3EXEA 5JD5A 4RZUA 3JQ6A 4JIGA 1KDZA 4H7FA 1NUAA 3LBNA 1LC0A 3LCMA 2CXQA 1J49A 5A5GA 1XJWA 4INZA 3VH3A 3WX0A 3RRYA 1LPPA 3ZXIA 4RHCA 4KH1A 2VF5X 3WGOA 4ZQCB 1V8PA 1N92A 1MHPA 1T9KA 3DAPA 4QBHA 3TIIA 4TL8A 4YRGA 5EJ5A 4FFWA 2IUYA 3O7WA 3Q41A 1WXXA 2CFIA 3NOOA 4AKHA 4P58A 5HKBA 1GU0A 3AB7A 1ZK0A 4NQZA 1U3UA 2IIPA 5I9LA 4NR0A 2X4GA 3H6KA 4ID3A 1G3UA 1PZHA 4KL8S 5COQA 5E9AA 4MP3A 2XEDA 4ZU6X 1O58A 1E6UA 3IBSA 2EEZA 1YUMA 1L1EA 2QOEA 3PE4A 5EWLA 2I3GA 4AF7A 3ZVKA 1HUQA 2I6FA 3IT1A 1EWQA 1HKUA 3H2IA 4OFZA 4CT4B 4QG3A 3OAAD 5LWQA 3ZU3A 1J2RA 2WQZA 4WQMA 5ALIA 4AIRA 2BWJA 1Z9BA 5D6OA 3S81A 1USVA 5CXUA 1SXJE 3U3OA 3IKTA 1E2FA 3KLOA 1GGEA 4QYTA 1WLSA 3CYFA 4QARA 1TQHA 1JE1A 3BWDD 4BMVA 3Q7RA 1NFFA 3W2EA 4V3CA 2VXOA 1GPKA 2FAXA 3OWXA 1F2TA 1T0BA 5E8RA 2EZTA 3EZ9A 1C7RA 3QYFA 4NPCA 1UJCA 5AKKA 2I91A 2Y4NA 4JQSA 1YS1X 1NE2A 1RXYA 3IJPA 1XP8A 1QRRA 1ZOPA 1IEXA 3GRUA 1PQPA 3ABQB 1ULSA 4J1NA 5CVDA 1XDSA 2F55A 1SQ0A 4PFJA 4RGYA 3RTGA 3VPBA 3VU9B 1ENYA 3OD1A 4GMXA 5BYBA 3VNAA 1P9OA 3EPJA 1JTFA 3H6HA 2YZKA 5KYUA 4Q4JA 2BRUA 2IEAA 5EP4A 1FFHA 5SY6A 3MB8A 4Z1MA 2JS7A 4DLZA 2CUKA 3LV8A 4JKOA 3T5DA 1BA3A 4OSEA 5CLGA 1T6XA 2X1MA 5FHQA 3PQ6A 1NAHA 2GTHA 5JPIA 1KJ9A 2FX3A 2HB6A 4CWAA 4EX7A 3GLIE 3NS7A 5ILGA 1JIKA 5AI5A 4QNNA 2XUIA 2CKDA 1P5HA 1M2JA 2E4XA 2VPZA 3C7AA 4HAOA 5JC8A 3LAWA 1LV7A 1QS0A 5JZ9A 2YWXA 3MBIA 3UJHA 4WXRA 5AR1A 3ZD7A 3U7FB 5JATA 1RI4A 2J3EA 1TGVA 3CPEA 3EIOA 3NEPX 4CM9D 1W6RA 2J0UB 3ZZ1A 1Q74A 3D3NA 2Z5VA 3L0BA 3QLUC 2VLIA 5AJWA 5AVZA 4D6YA 5DRYA 2VZ9A 3LPCA 2IC5A 2HWKA 1JMVA 3D1VA 3AEKA 1T36B 2H07A 2FEAA 3A32A 3BRQA 4RGBA 3USZA 3CLSD 2ZIWB 5EMKA 4XFJA 2VCHA 3SEZA 2J9FA 1E99A 3PZRA 2HGSA 2YY6A 4LBVA 5AW0A 2PUAA 3R1IA 5F9HA 2I33A 4FYJA 2VSXA 3K53A 1EK2A 3WS7A 3PDJA 2R5FA 2GAOA 1FUKA 3EQZA 1LA2A 1FUYB 2J0UA 1RWOA 2JBHA 2KLBA 1W75A 4GM0A 4M54A 4M7WA 4P4SB 4RIEA 3W0LB 3GA0A 3WGYA 4A0QA 4ER6A 3ZD8A 4CLOA 3NALA 4HDRA 3HLTA 3K8ZA 2JGMA 4G4SP 4INPA 4FM9A 2CB0A 3PRJA 5CJ2A 2PV7A 2VBFA 2GM4A 3IP3A 1YL6A 2YIDA 1VA4A 4YJFB 3RYIB 4D3FA 5JW6A 5DM70 3TNJA 5IHPA 4J49A 3WKEA 1R74A 3E3OA 3M49A 3HJNA 4DJEC 1ZVKA 4WMLA 1G20A 1M2VB 5IEJA 1ACMA 3KE9A 4P4SA 4RPHA 3L6EA 5L53A 3CZ5A 1JA1A 3KVYA 5DLQC 4WK0B 3ZN2A 3MJHA 1Y1SA 2CDAA 3CKLA 3LVBA 5KKAA 5TXGA 2CVFA 4BNJA 4CDRA 4YXFA 4EO7A 3UWKA 2QN1A 5TPWB 4O3MA 1DJMA 3AM4A 2GNOA 4L50A 1IBCA 3K30A 3FOBA 4BNZA 4YJFA 4TMVA 3Q2KA 3COWA 3IDSA 3IPAA 2P40A 1GWNA 3B7GA 3H17A 4MW2A 1SUWA 2IY9A 1R00A 3F3YA 2VLBA 4MINA 3URMA 5I8WA 2A84A 1QQ6A 1ZNQO 1KEKA 1I94B 2XHZA 1A4XA 3MLAA 4C2AA 1D2HA 2ZLBA 1UBGA 3QNUA 2WIDA 4KQFA 2V3WA 1JUDA 1UR5A 2WT4A 4V39A 1MOQA 2VP4A 3VKUA 4H16A 1XDZA 4MS1A 2XUGA 4H3VA 4Z4HA 1PUJA 3MOGA 3C16C 4CW7A 4IG4A 5KWVA 3LL7A 1J56A 3IQXA 1QBGA 2NTEA 1JG2A 4UMVA 1J2UA 2YN4A 4FCVA 3RIMA 3VUEA 2ZUEA 3EVTA 1D4AA 5BY2A 1DMRA 4NEGA 2NADA 3OOHA 4PN7A 1KS2A 5EEHA 2GTIA 3GVIA 3PT5A 4ZA2A 1XQ1A 5JSUA 4U0JA 1XI2A 1M75A 4WECA 4IIFA 1GAQA 2YWJA 3K1AB 1RLMA 5JECA 2ZDGA 4IDQA 1WOMA 3SQMA 1A69A 4EGQA 3BTSA 2J09A 1W6UA 1G8JA 1GTG1 3M4ZA 2IYSA 2GXUA 1H8HA 3B12A 4L9SA 2BLNA 1N2JA 3CEHA 3I6MA 1JZTA 3O9ZA 3AETA 3HHEA 2VK8A 2PX2A 2POCA 3Q12A 4PSDA 2IDJA 4JU9A 4DJDC 1V95A 2J3KA 3U7HB 4IHQA 4MI3A 2XOKA 1YA6A 1NPYA 3T7RA 3O1JC 1J2TA 1B00A 4QDZA 3O26A 2N3ZA 2PUJA 2X8WA 3T1OA 3TSAA 2WWXA 3OQIB 4YV7A 3ZK8A 4YIHA 2NSJA 3D6UA 4HNVA 4RMNA 3SJBA 3A3PA 2YCLA 3TQRA 2YRXA 5I7VA 3Q8KA 3L7YA 3EH2A 5JV5A 1UBRS 1T2CA 2Q9CA 3PVZA 1GNSA 3G0DA 1AQUA 4UU7A 1TVCA 1C30A 3UMGA 1JHQA 2GO1A 4DDHA 4R2MA 1U3CA 3QLJA 2PFKA 1A8IA 1ZIPA 4D74A 3MWJA 4LKRA 3N74A 3LFUA 1CS4C 4HXFB 4YALA 3SXPA 1KNXA 3WK8A 4D6XA 4QKQA 1WPGA 1OJLA 2IA5A 1J0BA 4AU1A 4BEWA 5JDIC 4RTOA 2KS6A 1HG0A 3LZ6A 4TS1A 4TSKA 2JEZA 3V8VA 2R7LA 5K0TA 4KJZA 1E2BA 2CCKA 2BMFA 4PHTA 3V3TA 3ZZUA 3H2HA 4TS9A 4X44A 3PG5A 3VA7A 1CQXA 4QQKA 2ZS7A 4OI1A 3MB5A 1HORA 5F78A 3CR3C 3KLBA 1J1UA 1FRFS 2XTZA 2L18A 1ZVJA 2YUTA 1E1MA 5A4KA 1AD2A 3GPIA 1ECGA 2C96A 1E3JA 2VJCA 5L7WA 2KX7A 4ENRA 2B8JA 2XWPA 3AFGA 4IW3B 2DHDA 4ML3A 3WLKX 5DK6A 4AWBA 1SPBS 2EP8A 2CNWD 5CFZA 4URXR 2R9VA 4S1VA 3EGEA 3TGLA 2QJTA 1ZZEA 1WQ1R 3CKYA 3SKXA 1PL7A 2J9ZB 4RVDA 3BD8A 3QPWA 4FBGA 4OCZA 1VPTA 2JCBA 1O95A 5FPHA 3VZPA 3TVDA 5DGCA 2VG8A 3IAUA 2NGRA 5DYNA 2ZAMA 1KMCA 1H4VB 3I6BA 3VJLA 2YINC 3WB9A 2P2YA 1U7HA 1EDOA 2V6GA 3DFIA 2A57A 2PKQP 3KTDA 2E1PA 2XKAA 2JEYA 2YNMD 4LJLA 5ERXA 4ZYZA 4BJ3A 1U0RA 2O7RA 5I9IA 1TEHA 2BSQA 4HH4A 1N6LA 1JA0A 1ETHA 2ASEA 4HN2A 3H9BA 3NH9A 4RDIA 4RSHA 2K2QB 4HEA1 1FFEA 2FFBA 2R1UA 4IFEA 4WGGA 1FTQA 3H5TA 2NQ8A 4KC0A 4R5HA 1RBZA 1CY2A 1YQXA 2AQKA 3MXTA 4JFRA 2PMWB 2R6JA 5EJ7A 1E92A 1TYDE 2EJUA 4GFDA 4QSHA 3C1AA 1BTOA 4L75A 4W8GA 1NMEA 1JIQA 1Z83A 4X1YB 4RVCA 3M1LA 1HLDA 4RYDA 2X5KO 5FL7A 4AY4A 4EARA 8GPBA 1ZRMA 1JLLB 1RAHA 1XWFA 3DEZA 4CLEA 3EHEA 4JVOA 1WNFA 4YCNA 1GGFA 2XBMA 4KTTE 3CPHA 1FVOA 1PLLA 4OHVA 3P71T 3I58A 4FQ8A 3MTDA 4AF6A 4DXHA 1X74A 2WWHA 3EGDB 2J0SA 3DFMA 5EG5A 2NTJA 1VPLA 2R8RA 4GM4A 1Y1QA 2CLCX 4MPRA 1FRNA 3D4BA 4TQUS 1E3DA 4QPCA 3TD6A 4ZZ0A 5BSKA 3QKSB 6NULA 3T5PA 2ZRAA 3P9PA 5J2TF 1C1HA 5G1NA 4X1YA 3Q5DA 1MGPA 1JSLA 2QE7D 3AKDA 1QYRA 3BFXA 2CBZA 3OKAA 1AUQA 3WDLA 4DZTA 2ZXFA 1XPRA 1JLLA 3FG9A 3R3JA 1AGYA 3C3WA 5HIJA 1QGDA 4V2UA 4H17A 1QIJA 3BIXA 4L8WB 5C1BA 3RBAA 4RKEA 2BD0A 2ST1A 1EQUA 4B84A 1H4SA 4N48A 3M5PA 4UEKA 5FTWA 5CFNA 4PGGA 2ZTUA 3O6VA 1PTJC 4UARA 3SYNA 4XWYA 3R7WB 3QKIA 1QX3A 4MLCA 2H5LA 3DMRA 5DXJA 3RFFA 3W7BA 4AG6A 2QRKA 4KQGA 5H83A 1XKXA 3NO4A 5HQTA 3FUUA 2YHBA 1VCNA 5DHPA 3UJAA 5C5EA 3D0KA 2ADMA 1WG8A 1TAHA 4CLRB 1QR6A 1R8SA 1Z17A 3AR8A 4K28A 1SO8A 4W9NC 3AHJA 3ET4A 1A7JA 1B8OA 4FX5A 4ISBA 4MW4A 1B6SA 2C2YA 2Y0PA 1YDMA 3KT6A 3AEXA 3JQGB 3MF4A 3OQPA 3VKWA 5A1JA 4OFBA 4LNHA 5JNWA 3DBLA 3ILVA 4GNKA 3KKEA 4E5PA 2DPHA 2KHZA 2Z95A 3U0BA 1K7FB 2B5OA 2E3JA 4Q9AA 5KTYA 1JHMA 1QAQA 3K9WA 3UXYA 4PIPA 2ZRKA 2W2VA 1G5IA 1TQDA 2OHXA 3D0OA 3ZD9A 1P2VA 2O3RA 2DH6A 5IAJA 4YHHB 3GFBA 4EFKA 2C2MA 4BC0A 1T9GR 4IZOA 3K71B 1POWA 5IS2A 4HQKA 3FYUB 4B45A 4HEA6 3TWOA 3Q72A 3QVMA 3C7CB 1X1BA 1Z7BA 4A3SA 1SBTA 3EXHA 3I8XA 1J9EA 3DKVA 1OBVA 1BXGB 4I7EA 5G3YA 4ERXA 3HKEB 5EGSA 1LBQA 1RLJA 2R6DA 1SG0A 3AWIA 4FSHA 1EUCA 3WJ2A 1YS2X 4JX8A 2HN9A 4YXWA 1PDVA 2F67A 4HOYA 3JR7A 5CT5A 3Q6MA 3INYA 1PJQA 4DCGA 4PN3A 4TKZA 4Y2UA 3BHMA 3RRJA 1YHNA 3ELBA 4YCBA 1QO0D 1TADA 2AZMA 3AEUB 3HWWA 2OQIA 2AIRA 5KTSA 3FYUA 4ZC8A 1Z07A 2WEKA 4DDUA 2PWYA 2HKIA 2R1VB 3IMCA 3QY9A 4ENWA 3S7ZA 4HLCA 5J2TA 1D8AA 3KUXA 3RFVA 1YDEA 5IBRA 4D56A 2I2BA 2RHGB 3LU1A 1X6VA 2OILA 2ZYVX 2IGBA 3FYTA 4J16C 3H84A 1K86A 5EESA 3I2YX 1UMDB 4EKNB 5JAUA 3D64A 5TQ2B 2OHVA 1G66A 1GT6A 1G5QA 5C3UA 3D02A 1DRUA 3A3YA 2XKKA 2Y66A 3SJZA 4RQUA 2YL2A 3NANA 1FDTA 5EPOA 1YKFA 1WXQA 3L40A 2FEMA 2ZSHA 4WUTA 4BJ1A 3L7OA 2XE4A 2BISA 3NRBA 5KYWB 2OPBA 4WLUA 1JLRA 2QAIA 4DA4A 3EVGA 1PL8A 4N54A 1JFFA 1YZYA 2AE2A 1N6OA 2XMPA 4I4IA 1L7BA 3HB4X 2FFAA 3SZRA 2BE7A 4R1QA 5JOQA 4Q1FA 4KGDA 2Y9PB 3L0OA 2WG0A 4U0KA 4Q7QA 3JTEA 3T0FA 3OO0A 3DQZA 3FETA 3IAM1 2CNLA 3UPTA 1OX4B 5KHOC 2GSDA 1GYRA 3KB6A 1KJZA 2XB6A 4EEKA 4LFBB 3CW2A 1CJCA 1XGKA 2FQWA 5SYAA 1C3OB 1Q7RA 2RHDA 5DH9A 3K8OE 4Y30A 3VR2D 1GU1A 3KVOA 5E1MA 1NXXA 3UBMA 4A6EA 3CFYA 4B7CA 1XCOA 2AUNA 2H57A 4Y8VA 1PYGA 2NWQA 2QN6A 2DR3A 4M1ZA 3RRXA 1FDUA 1WZIA 3IERA 4M0DA 3QVGA 2ZJ3A 5C7YA 3ZV5A 4UUMA 4WOCA 2JIQA 2P9YA 3RT1A 4BB5A 5AVRA 3RADC 1WO8A 1EE9A 5TR9A 3PXUA 1QPBA 4ER5A 3A4YA 4BLRA 4DR1B 3HKCA 4YRFA 1LPMA 2XADA 4YP0A 4HNGA 2VP9A 4OGGA 3LZCA 4NZZA 3M3PA 3KZNA 1I4WA 3VOBA 3IFSA 3S55A 1LI4A 1T2NA 2G0TA 1N77A 1THZA 3LX6A 2I7TA 2QR2A 2OSVA 4IMRA 4N7BA 3WFZA 1XJQA 3REFA 4RQTA 1CNMA 5AKYA 3RABA 5F9MA 1HO3A 4D99A 1E6CA 3EXFA 1CZUA 3COYA 3RC7A 1T4CA 3V4SA 2RGWA 1KP9A 1LVHA 2XQFA 5KDLA 4EA7A 1W88B 4BAUA 4UFNA 2CHFA 3CUWA 4DS3A 2FN7A 1IVSA 4DMCA 1ISFA 3D4PA 1XD2B 1I32A 1P61B 4C04A 3IBGA 5JQGF 2P5TB 3CV3A 1B41A 4FEGA 2QTFA 5K1ZA 5AJTA 3ZX5A 4H1WA 3BRCA 1ORIA 1NUQA 2B82A 2AXNA 4JJGA 3TVTA 3MC1A 4B4KA 3KJGA 4L51A 5KVSA 3O2SB 1P2FA 4BX2A 5IYZF 1GN8A 1BFDA 4FYXA 5ELMA 4J91A 4PYQA 5FWXA 3STYA 4C05A 4LC0A 4C7MA 1VKHA 2A9KA 2GESA 4UEWA 3QF4A 1BVYF 3T52A 2ZB2A 4JI3B 2ZI9A 1D6SA 1B0UA 3E23A 3JASA 1EGQA 4I2VA 3R7AA 3V48A 2Y76A 4AX8A 3F4KA 5IVPA 4MW1A 1G4AE 2FW7A 4GX1A 2XKJE 2GOYA 5LZ2A 3EEIA 3WFJA 5AI8A 4LDQA 2JHFA 4LDJA 4PHHA 4E32A 3P2EA 2XPCA 3IAM6 2P11A 2ILVA 1M10A 5TLSA 1X3LA 2DUUA 2B1QA 4LZLA 1KC1A 1NXTA 2QD3A 3WGGA 5A2GA 1T3TA 3Q15C 5CLFA 5F4ZA 1D6NA 2A1UA 3BE4A 4S1NA 3ORHA 3ADKA 1QB7A 1P1HA 5D3MA 4TTIA 5DT2A 3BA6A 3WO1A 2E2WA 1JHUA 3BCUA 3ND5A 5K0CA 1BU8A 4HKTA 2PR2A 3JVEA 5I7UA 1MLDA 4HWKA 3QMVA 1GQYA 4OEHA 4M60A 3SKYA 1BJTA 5INTA 4HRXA 4ZCRA 1W47A 3LJKA 3B38A 3G8DA 3OHPA 4A7PA 4DR7B 4DILA 5JQWA 1W36C 5KNBD 4BFCA 1TU3A 4QECA 2EEPA 2QNIA 4YVFA 2A59A 4JI2B 3ISJA 3ZBTA 3D0QA 3OE4A 1JEYB 1RCFA 3I09A 3FRJA 3LFTA 3SQNA 1DQPA 1W5SA 1ZG3A 1K7YA 3BIWA 4RTPA 2DULA 3DKRA 4QT0A 4D02A 3PKZA 2G1KA 2YIJA 2Z2JA 3P19A 4LXGA 1HC7A 2ZU6A 1QIDA 3VR5H 5FX2A 5CPBA 4QQRA 2I9PA 2RI6A 4BMXA 4GR9A 2H1IA 1W0KD 5FOVA 4O2AF 3STTA 3W5VA 1MIOB 3E0XA 4AMGA 3HP4A 1H9BA 2AG0A 1FDRA 2IT1A 1VGRA 1HDZA 3H0CA 4IIVA 3E70C 3DE4X 3PC2A 3GJQA 5AW3A 5JQGA 5KKCA 1TO6A 1LBTA 3KK0A 2BMJA 1I7QB 1DBSA 3AVPA 5FI5A 3HABA 5IK2A 2J7PA 2YMLA 1MB9A 1YZQA 4CTMA 1BJKA 2BGRA 1Y5IA 4MIOA 5JCJA 2HEIA 4O0LA 1SEPA 1VYVA 3KQVA 1P7VA 1MC4A 1TMYA 2F1HA 2PYIA 3NBQA 5A1TA 5IYZA 2F6RA 2G9NA 3F96A 1FP6A 1P2UA 5DX1A 4CF6A 1XEWX 1CVIA 2WYOA 1G21B 2PKXA 5IEBA 2WP8J 4LHZA 3GRFA 4I66A 2OVBA 1XRLA 3WLAA 1X1RA 5FOQA 4EO9A 4GKJB 1BVHA 1UWKA 4RJLA 3FZYA 4UPDA 4RE6A 5D00A 1VIVA 4DW8A 2RG7A 1QQ7A 4JU8A 1DLJA 4DNXA 2EU8A 4TMYA 4PF1A 1S4MA 1D1QA 1ZPDA 3M83A 4DV5B 1W5EA 4PICA 3K7EA 3KVVA 3C24A 1KO5A 1VE1A 5F73A 2AFVA 4KH0A 1QXSA 2W98A 1H2FA 4WKPA 4DYVA 4ZCIA 1ZU4A 1G6Q1 5F2OA 4RA9B 4LXQA 3R9XA 2X0KA 2B0JA 4WD3A 3SC3A 4F8JA 4BKMA 5FBVB 1G21A 2V6BA 2HZ7A 5HFAA 3W9SA 1X7YB 3PK0A 4IS3A 1NOJA 1YKGA 4D9EA 2QVLA 3H97A 2ZUWA 4KO3S 1XXHB 3D8RA 2WU3A 1HMPA 2F62A 3FGPA 3GY0A 1Z7YA 3L6UA 1H8EA 4LDAA 3SICE 3VR5A 4MR8B 3OICA 1Y3BE 5FO0A 5HGJA 5JMTA 2G07A 4WK4B 1JQJC 2GZRA 1YMUA 2XI4A 3FSRA 3OX1A 4QEZA 5EFZA 5A2QA 1N2ZA 2JA1A 3AJDA 1DKNA 3HCBA 4Y0AA 4RA9A 2VC2B 2VSNA 3EC7A 4K8OA 4ZEVA 1OXUA 4KE7A 1GVHA 3B2EA 3C3KA 1X7YA 3KYIB 2EHJA 2J0EA 4HDCA 3GLFB 3D2AA 4FGLA 1XHLA 5CX1A 2QYOA 1JP7A 1Q0UA 4K9SA 1SC9A 2NPFA 1CLUA 4IS2A 2O0KA 1CY7A 1UBLS 1H6AA 3EPRA 3K9BA 4HO1X 3TRHA 2ZITA 4PZEA 4O2AA 5BYJA 3MELA 3X1ZA 2AFIA 4MR8A 4CN9A 3G9UA 2Y3IA 4BO9A 1N6PA 5AH0A 4M4SA 2VHCA 4AN0A 1YE8A 4L95C 4UEOA 2YR0A 2V54A 3I04M 2Z8ZA 4G36A 4NOMA 2P6NA 5FBKA 2J4DA 1NR5A 1SQFA 1YC2A 2VHYA 5ARBA 2UZ1A 3FIJA 2QP4A 4JB0A 1C1YA 3AJAA 3CUSA 3MNFA 1EJ2A 2IY8A 3TQIA 3BF8A 3EBOA 4QDKA 2X2EA 1EHIA 3F8WA 3FTQA 1ZNXA 3ORFA 5BNWA 5H9VA 4PSAA 5AJHA 1Y6QA 3CH4B 1QGUB 1VI2A 1X87A 5DOZA 5I9BA 1F2VA 3E5RA 3SF8B 4W9MC 2IZ5A 2R68A 4BQQA 5T3UA 2QZPA 2UXBB 3MS7A 2PRKA 3KYDA 3C74A 3CX7A 2JAWA 3N0RA 3OJLA 2HMSA 1UJ4A 1US8A 2X1HA 2VZLA 4M98A 4LXTA 4S2UA 4TZTA 4FHDA 4RD2A 4BMOB 2ENUA 1MB3A 3L8CA 3JALA 1QIGA 2ZUBA 1B26A 3WWPA 5KSOA 5K6RA 3RUIA 4FGKA 4M9QA 2VRWA 4YLGA 3AOEC 1JXQA 1U3DA 4JOQA 2JK0A 2IVFA 1VL2A 3U81A 5KWIA 3BGIA 2BELA 4ZZIA 2L17A 4OGKA 3CQ9A 3PUYA 3IMKA 2Q5HA 3UWPA 4ASUA 1NVEA 3W05A 1UBEA 4EGFA 1N8KA 5FI3A 3W78A 1I3NA 3HVUA 1WF3A 3JQEA 3ZK7A 1L5MA 1Q11A 2EKLA 3O4FA 1HDEA 3TL3A 1EGMB 2I8LA 4QICA 1PLKA 5IVIA 2D06A 3PEVA 1M0TA 2FHPA 3I9JA 1KQPA 3LLVA 1OWPA 1JN0A 1YQUA 2NV0A 3VISA 5AHKA 5KPDA 1KP2A 3IAFA 5E1OA 3GZNB 3IOEA 5BVGB 1DAOA 1GKYA 1W8DA 2WJHA 4LV5B 2OYRA 5BNZA 3QX7A 5IJZA 3PQ8A 2C8JA 3G0CA 3KSRA 3O93A 5AKZA 3NDBB 3I34X 5KYGA 2CVPA 4AZ0A 1A8PA 1W85B 2XCLA 4H9GA 1C2YA 2BZSA 3TL6A 5TVGA 5LZ4A 1MABA 5HYVA 1YB6A 3LK7A 1ELOA 4A2QA 4OHBA 1NI4A 4JSTA 1OXTA 4MKZA 1MTOA 2TECE 2XCRB 1ADFA 1RMTA 4HQFA 3EZ2A 3ONFA 1FPMA 2ZULA 2HSJA 3OX2A 1JIIA 2A9FA 2WHPB 1EQ2A 2COUA 3TPFA 2X77A 5BVGA 1I6KA 1EFCA 1BSVA 1C7EA 1WB6A 1O94C 1Z4OA 2FXVA 2JI4A 3UJBA 3VU1A 4YCCA 1GGVA 3ER6A 1ECFA 3DYBA 4JB8A 2P5UA 2QRVA 1QE5A 2X3FA 4NV0A 4QT4A 2PDAA 1UKZA 1EUDA 1V1JA 1BN7A 3LSTA 4KZKA 4MW7A 4UQOA 4V1CI 4YQZA 2HRRA 3PNMA 1IZ0A 2I6UA 3K0KA 2ISCA 3WI7A 3J81k 1M6VA 4MQ6A 5EJ8A 3AYZB 5F35A 1M67A 2QIOA 1WW3A 4JJIA 1JHPA 1NW7A 1UBKS 2A0WA 2Q49A 4K3UA 4ZYUA 1QHXA 4NCBA 2GQ0A 3LUHA 5KU7A 2P35A 4DC0A 4CGYA 3BGOS 3CT4A 2YV3A 4Z86A 3LWDA 4G5GA 4BQSA 1DTWB 3T0IA 4FW8A 2JARA 4Z8XA 4Q02A 1SRRA 1HK7A 3QVXA 3T4EA 4K2AA 2UV8A 3L1UA 3SK0A 3TLMA 2FR1A 1S1CA 3AFMA 4TMZA 5DTMA 6AT1A 3W6NA 4MUKA 1FLVA 1A5TA 4OOFA 2A4KA 1PI3A 1BNCA 1ZW6A 3ND6A 2CXPA 4V0QA 5TVKA 1QP8A 3KHSA 3RWOA 1QYCA 1KKUA 2A9QA 4GBGA 2RK6A 5ALEA 1RZ3A 1YZFA 3UG6A 1F4VA 3KYJB 3HUTA 1UPCA 2ZBEA 1WW2A 3IO3A 3LLUA 5GIPE 4DV2B 1N32B 5AD1A 3USCS 5HE9A 3FVQA 2GM9A 1X8LA 5BP7A 4TT3A 1SU7A 1WRBA 3HDYA 3BWCA 2XQJA 2JFVA 2NYUA 4GS5A 4MS3B 3JVUA 4O0MA 4H7IA 4D41A 5T8KA 3DT8A 2V6JA 3SBDA 1CT9A 4NSNA 5JVDA 1E6WA 3PQ2A 3SS9X 1GO2A 3AVTA 4BV8A 3D7RA 1E5QA 1G16A 4GSYA 4J07A 5E4YA 2YQ5A 4CKBA 1XNRB 3IOCA 1G3QA 3A1TA 5DNUA 3KSDO 3SLGA 4EG1A 1G0NA 4Z3KA 5LNK1 4JOBA 1A82A 4QQNA 4PAQA 3RUEA 3TW4A 1QRUA 1U0BB 1N2GA 4B7ZA 3G0OA 4HJXA 3LQRA 1KZGB 5CHYA 3AVXA 4PG5A 2GHTA 4BQPA 4JMLA 3PHBE 4P3KA 4MS3A 2CT8A 1VE9A 4UXHA 2OZLB 1LQTA 1HSOA 1C8BA 1CULC 1Z74A 1V45E 1SOVA 2W2MA 4XUCA 5ALHA 4CKCA 2IYNA 1NHGA 1S3IA 1NRXA 1K7CA 2W6CX 4GM1A 1E7RA 4Q05A 4L78A 4J1SA 4DLPA 2GN8A 3P97A 4LRUA 3IIEA 4OH1A 4EVQA 2UUOA 5K9ZA 3BVPA 1K2VN 5F5NA 4YMVA 1BE1A 4ZIRA 1DJQA 4I19A 4WA8A 3PNKA 3K0SA 3P9SA 3AUXA 3VYRB 3ZLJA 1BH2A 3BAZA 2XOXA 2KJQA 2NO9A 3BCRA 4TMXA 5JC1A 4WVLA 4MKGA 4P3XA 4TLMB 5ADVA 3AY0A 2F1JA 3K0FA 4L08A 4XD7D 3FTEA 2OZLA 1G4HA 1PNOA 1GDDA 4KQEA 4RTRA 2Q1YA 4J3JA 3C5HA 1PEDA 3CLTD 2ZWMA 2BEKA 3DL4A 4D9BA 2B4KA 3OY2A 1ZJZA 4TLCA 2CFOA 1RR6A 3HJRA 3W04A 1KAMA 1TW3A 2XUZA 3DXZA 5PNTA 3VNSA 4N18A 4XVUA 1Y6FA 3B9QA 3IA2A 1A72A 1UBJS 4C3ZA 3VAAA 2VHZA 3F3MA 2IP2A 1Q50A 2R6ZA 3BJZA 3REGA 2Z8YA 3ESCA 4DQVA 3PWSA 2QTZA 4JVLA 4U7FA 1FA9A 5GOZA 1J8MF 1OAOC 3PL5A 5KX5B 1NP7A 1XCMA 3ZNOA 1L8XA 1ZBQA 3GLHB 3VNQA 2HYDA 1R6BX 2LW7A 4B3XA 3ZHRA 3D81A 1TUIA 3EF0A 2V4ZA 4WZAA 5KJFA 1CY4A 1HE3A 2HA4A 1NF2A 3CLUD 5AK5A 3R9KA 1HOTA 2JFBA 4F2PA 5CNMA 1KF0A 3LHSA 2XVXA 4NYJQ 3F6SA 4RF4A 4XLZA 2BW0A 1A77A 1AN0A 4GAEA 5ALFA 4BQIA 4MV6A 4EKDA 5CVTA 2XBUA 5I47A 3BS4A 3CJRA 4R9UC 1GUYA 2WW8A 2ZJBA 1LWNA 2FJPA 2KWIA 3PEEA 2C61A 1MNAA 1N7JA 4EJ0A 2CXOA 3HFRA 3HU3A 1IAQA 4HXEB 3SJ7A 4TYMA 4A73A 2AF4C 2ZWAA 5DN9A 1M7HA 3H9QA 3NT2A 3ZWMA 4QYIA 1KY4A 2J46A 2O1SA 2Y0CA 1DXYA 3ZWOA 1D8TA 2JGAA 4MV1A 4XCXA 1TO1E 3M9XA 5FYQA 1GILA 3DMYA 1ZJ5A 3BUSA 4QWMA 4P3PA 1HEYA 4YRKA 2GN4A 2O8CA 4IJKA 2ZJZA 5C8YA 3O84A 3UJNA 1SXJC 4HJRA 1CNEA 1LXCA 4HMPA 3I9NA 4J0QA 4BKQA 3L0CA 3CA8A 3QITA 4PSKA 1GPMA 1F0NA 2YN2A 3PRYA 2OCBA 3VR1A 1E2KA 1TTHA 1FJXA 3A6LA 4IJVA 3VHLB 3ST7A 3DLCA 1TO2E 4ZTZB 4MQFB 3RWBA 3WJ1A 4GYWA 1VXRA 1W94A 2C2WA 2QG6A 5KTKA 2IBTA 3SOZA 3R7FA 4IWNA 3IPLA 5ELLA 4RL4A 5EP3A 4C7JA 2MINA 1ISJA 4JP2A 4XH9B 4F4UA 1S7CA 1ICEA 4I4TF 4TRNA 5DPMA 3AXTA 2JKVA 5FEUA 1IJBA 1J42A 1XTPA 4NH0A 4E13A 2X0JA 4UNRA 2ECOA 4EZIA 5L4LA 3UBTA 1Z12A 2PU7A 5LN1A 5HG0A 4CCSA 2HSGA 3PHCA 3EQ6A 3L7KA 3P0HA 5MN4A 4GH5A 3UHJA 4PZUA 3P9IA 1Z0AA 1SVIA 2GYVA 3LC1O 1KJWA 1QONA 2Y93A 2CXUA 1PT5A 3CX8A 3O7MA 4G0YA 4IDCA 4JOCA 4MQFA 4QREA 3V33A 4DLYA 3NUZA 1E20A 2P4QA 3E3MA 4LG1A 1XZBA 1HDCA 1SH7A 4AYTA 3E9YA 3EZNA 4YRJA 5AVOA 1EI9A 2B5VA 3S70A 3L77A 1OI4A 1D9XA 4FBMA 4BNKA 2HMTA 4LYFA 5KSPA 4H0CA 1HNNA 2C98A 2HMAA 5K20A 3TF5A 4IGIA 1BDIA 1NYRA 1K7SN 2G9ZA 3IP1A 3QG5A 4Z9FA 3R76A 4BN4A 1JDBC 1ZR2A 3QX3A 3MIZA 1JDPA 3NTRA 3ZCRA 1VBMA 2W4IA 4V0SA 1XF1A 1FRZA 4I3GA 5AJZA 5JJKA 3ZCSA 2IHZA 3K5PA 3ELWA 1E5XA 2Q0SA 2BEWB 4ZQFA 5A62A 2XUJA 3OKCA 2W83A 3NIWA 4F8YA 3F71A 5AOBA 3LO8A 1IZ9A 1XZAA 1PR3A 2RH4A 2YRWA 3EIHA 4Q3LA 1EVEA 2D1FA 4ZEWA 3V9AA 4JVSB 1QGOA 3JZFA 1OKKD 4WJLA 4F9GA 5CPFA 3RGWS 4C2TA 1GG8A 3LC7O 5TF0A 1G6KA 2DJ5A 4DNOA 2VJQA 1II8B 2RGGA 4BNWA 2JG3A 2FA9A 1QCYA 3QIAA 4EI8A 4J16A 1E2EA 3K0HA 3S1AB 4K1XA 4FWBA 5JAQA 2Z3VA 3BXHA 1IIBA 1QDEA 2J87A 2MYPA 3ZIAD 2JFWA 3FHJA 4O29A 1SCDA 5KAPA 3EG9B 5G1PA 1R5JA 3Q1KA 1J22A 3NUGA 4B6FA 4OYHA 3ZXYA 5SZHB 5IT5A 3QUTA 5L3SB 3BQMB 4YMUA 2VNKA 2HOQA 2G4VA 5C7IO 4PXYA 4DA6A 4U63A 3SR3A 4NONA 1NONA 3JQAD 1RHJA 1VL1A 4JC0A 4P1ZA 3JAKB 1GFIA 4XSHA 4XX1A 4YWHA 4L8YA 2VCEA 3DOJA 4IICA 2VBGA 1GA1A 2OMEA 3LY9A 4HLNA 4WKGA 5EXSA 3H5IA 1XRMA 2P2SA 5CDTA 5L7TA 4H4CA 2OE2A 3OLQA 3DHWC 1L7DA 2D2FA 4ZDJA 1NV9A 3CZCA 1P33A 4RJ2A 2MMCA 2WYWA 4QPJC 3LUJA 1SD2A 5JALA 1JBEA 3L1VA 3UYKA 4JYAB 4G0MA 2W2XA 3FTCA 2OB2A 3JXEA 5LJLA 4KGVA 3NRJA 1E96A 5AM1A 1EUQA 2FEXA 3KSUA 4YLYA 5JTTA 1XZQA 3G2PA 1MENA 5TMEA 4BC1A 1FTWA 4RO0A 4D81A 4L1KA 3STHA 1AHPA 3TFOA 5MN5A 3SE0A 3HO1A 1ZJWA 3PWKA 3VPFA 1G38A 2B25A 5AVUA 4KITB 1KDRA 1QG4A 1T1JA 3A7EA 4MVJH 1P81A 3KKMA 4KNYA 1DIOB 2O3TA 1KZ1A 2GARA 2VHWA 2AGVA 1CUJA 4U8HA 1NVAA 4KPYA 1QHNA 3PEFA 3CNHA 1W9MA 3AKEA 3VR6H 2XTJA 4Z0NA 2JF0A 3ZLBA 2J4CA 3ND7A 4DBLE 2PFSA 4XIGS 4ER7A 4ZOEA 1YA4A 1CP2A 3GNLA 4BNVA 2O8FA 1TAGA 5KNCA 2IS2A 3N6VA 1IN7A 2AWOA 2W6ZA 1X14A 1M72A 2QVYX 3DULA 2Q45A 3PI6A 4WASA 1VPVA 2H1FA 3OCCA 3VKVA 1UXKA 4MKFA 1MQ8B 3H3XA 3NBUA 1Z5VA 3L5KA 4K9MA 1WQ4A 2QGNA 1E1RA 3PFGA 3BL5A 1G2QA 1P17A 3SC2A 1YSCA 2JI6A 2P3SA 2Q1XA 3DOCA 5BORA 1MNQA 5FPQA 1SC6A 4UE6A 1L5SA 5K8LA 2HJSA 4RS3A 5F7OA 1IQ0A 3UY4A 1TU0A 5FFNA 1DKQA 5C8VA 1VE5A 2WJVA 3TZHA 5JY1A 3F6BX 4TL9A 2RSLA 2X22A 4AURA 3IXMA 4B34A 3DZKA 3F98A 5JCXA 1XA0A 3TTYA 3FGOA 5DKFA 1PAUA 3L07A 1MOPA 5JNTA 1RXCA 2LKDA 5JSYA 1DEKA 3AJ8A 4R3UC 5EXTA 3TE7A 5K5EA 1CFJA 2ICAA 4P8RA 3RIHA 4BU1A 1Q6YA 2QT1A 3S0JA 4ER0A 5JROA 3F73A 4G01B 3QKUA 4L0MA 1FL9A 1BROA 3K0CC 4ZT2A 3DWEX 1V26A 1J23A 4OXIA 3UHFA 3H9GA 3UNXA 1PR4A 2XNCA 5BW5A 4RSRA 1EA7A 2QRUA 2UZAA 4N7JA 4S1OA 1A2BA 4KQ1A 3QPDA 2WWGA 1GPWB 1RWWA 1SCUA 3BOSA 3CSUA 1CZNA 3LT1A 3TTUA 1YE5A 2W2PA 1FVXA 5CCEA 5CTJA 3FOCA 3TLXA 1HOXA 4NZ9A 2PZMA 1M5RA 3OZFA 1Z4JA 1FDWA 2M1XA 1XAJA 1LPAB 4K05A 1OB5A 4IHJB 4OJNA 3IVXA 4S0XA 3TZBA 1NBAA 2C03A 3MMZA 2UVPB 2P2DA 2JFUA 4DR5B 3JY6A 4NNJA 3PNQA 3OESA 1XJ5A 4D45A 2ZZNA 1TJ5A 1X39A 3PUVA 1QE3A 3R09A 1IPEA 3MWYW 2JCGA 2XNJA 1D3AA 4E0BA 2I0FA 2DSTA 4H0NA 2XDQA 4C0LA 1R0CA 3NFRA 1IQRA 2GVNA 1Z38A 5FIUA 3UK7A 1MEJA 5F21A 1N2BA 3QSYA 3ELUA 2GPTA 2YVAA 2WQ6A 3Q2IA 3NNDA 4PY2A 4FWTA 4P35A 1OJ7A 2P0YA 1L5LA 3RSOA 2VDVE 5CDFE 2M2IA 1CDDA 1K1EA 3RHFA 3OLXA 2OXFA 1ZN9A 1LS6A 3OT5A 2O4UX 1FSZA 2GEUA 1KFEB 4ZVRA 1SC1A 2PJUA 4EBBA 3QK7A 1DBPA 2IUFA 4GI3A 1R0KA 5HMMA 2VIIA 1V3UA 5GONB 1G9XA 1U7WA 4WK6A 1ORHA 3CLSC 5KQMA 4ZOBA 2ISQA 3GLUA 2HC9A 4MQEB 4WDRA 4WKCA 4K2HA 2G17A 4CIAA 1KFJB 4O33A 1M1NB 1PE0A 4BJHB 4EG0A 1JWAB 3NC4A 4WFIA 3VZCA 1IYZA 4CF7A 5ITZB 2C58A 2O19A 1L3CA 1QZXA 3FIUA 4MAAA 5FUVA 1J7KA 3IEUA 4BDTA 4JLAA 1OZFA 3GLGB 5ICCA 1E2NA 4DQ0A 3K92A 1C9KA 2H4WA 1E2HA 2HIAA 2VYVA 2YH2A 3OJXA 1H22A 4UULA 1O57A 4XVQA 2WOOA 4Q21A 1OWLA 4EUNA 1EWKA 1F5SA 2CLEB 3PNPA 2OZEA 4PHCA 4BUJA 4N3GA 1Q12A 1R4NB 4MQEA 3BXFA 4QULA 4XFKA 3UWSA 1OLXA 1T0UA 1I24A 2OO7A 2VSOA 2YQZA 4X00A 5EAIA 4C0HA 1PGJA 3N53A 5CA1F 4MB0A 1UBOS 4P5EA 4X8MA 4KRFA 5IH7A 4NZNA 1WW8A 1ZMTA 2Q5LA 3DBIA 3RTDA 3PCXA 1JDUA 1JXMA 1WCIA 1B3BA 2TMDA 1ZU5A 1Z56C 4DSTA 3H5VA 4Q1CA 2IPXA 1FP1D 1KO4A 1CEXA 1YK1A 4N7RA 4QDXA 1ZBDA 2G7MC 2XQVA 3C3PA 3QLVA 4P93A 2AI1A 4Q00A 4XGNA 4YGXB 3RQSA 5A03A 4ZP1A 4IFBA 1Q7GA 4FFNA 3TIXB 1SA0B 1R4NA 5L4NA 3VMFA 3GAZA 4NC9A 1VM6A 5KNDA 3D2CA 5TF4A 3BXGA 3TZEA 1XG5A 3WRYC 5M04A 3TMAA 3PE6A 1AU9A 4ZVOA 3LY8A 4NU0A 2WAOA 4NK5A 5HMLA 2QTVB 2RGXA 3BMNB 3MTJA 3BWXA 3PQEA 3NP9A 4P54A 4IRXA 4TGLA 1CJVC 5DHQA 1KKLA 2HSWA 1A2OA 2Q0QA 2V7VA 3GIDA 5TPZD 1ZUNB 4KI0A 3OCJA 4NWIA 2GKGA 2AR9A 2BKAA 3HNPA 2C7VA 1GN9A 4FB4A 2XXBA 1SA0A 3IUNA 4X1KB 4I9NA 2Z30A 3JW8A 4LOAA 4WY8A 1YE3A 4Q3BA 3WL8A 5C5CA 1NW6A 2OHHA 5LOVF 1I6WA 4EB6A 2PS3A 4IOJA 7ADHA 4GP7A 1DOHA 4ZQBA 1XLTC 3TUJC 5ED4A 4M0EA 2QTVA 2XRFA 3R7BA 1L7OA 3ZH2A 4BB6A 2EFDB 1GGHA 2RHMA 4NCNA 3BREA 1IFXA 3D5EA 1BHQ1 2FRDC 4D25A 1VYUA 4NBSA 4F4CA 4OX9Y 1VSUA 3EVBA 3FPBA 2O0LA 4BZZA 4RE5A 1X7XB 2YWCA 2ZOSA 4KQHA 1SKYE 5CCDA 5CDUA 1IBLB 1QDUA 3ZOZA 1EX7A 3ES9A 3KFXA 1CWUA 3IDAA 3TAHA 3HY3A 4RIIA 4KRYA 3ZLVA 4I4CA 1BHSA 1JI3A 4D8TA 2D5BA 3RJZA 1LD3A 4B80A 1F2UB 3FPKA 1V9CA 1V8BA 3ENKA 2XYRA 4D82A 2C00A 4XYLA 5LDDC 2EGUA 2UYGA 4NCAA 2G5CA 4G86A 3UVEA 2AX4A 3F97A 3FW1A 4DV1B 2ZSUA 1JH9A 3U3XA 5CA1A 2VRBA 4URHA 3CC8A 4FEAA 4JCCA 4JC4A 1TDJA 1QZ3A 2AFHE 4CQLA 1X7XA 3IOMA 4B3DA 4F3TA 4PPFA 1U7PA 1WWKA 1IXZA 4ZXFA 1NRWA 3P52A 2Q50A 4G67A 1OU0A 2YASA 3WLTA 4H7DA 4YRAA 2BI8A 3R7DA 3BMCB 3NAQA 1ZK1A 3PLRA 1YBVA 3VVMA 4E31A 1B73A 2AK2A 5CB0A 4MVJM 2JGIA 5JBQA 4RTSA 1CW2B 5JT1A 1E0SA 3KTAA 5P21A 2FCAA 4AN4A 1DAFA 2R66A 1Q1AA 1DRKA 3WMEA 3TVYA 1AVTA 1PK8A 2Z5LA 3U6KA 1ULAA 3IUQA 3PB3A 5CYGA 1I4LD 5IULC 3FWHA 3H4MA 4HAIA 1BMFD 2H4JA 5K8IA 1AQ6A 3MHPA 1PEYA 2R6HA 3AP2A 1QV9A 2XNDD 5DHAA 1OH6A 1MTZA 3DMTC 3SNHA 3G1WA 4OBEA 2PIDA 5FUXA 2E4YA 2YHUA 4QL3A 5TGDA 2GN6A 1BQEA 4D26A 1H2WA 1Z8HA 2XOEA 4XM2A 3FWZA 3DBVO 1MO2A 2CHQA 2WAMA 2X19A 2P9FA 3HKDB 3L6CA 4RC9A 4UVHA 5G4KA 3WK4A 3H3JA 1OH8A 3T9AA 3TK1A 2C9ZA 2ZSKA 3WWDA 4CF4A 1JH8A 4EWLA 5C32A 3I5AA 2Z3WA 3FI9A 2ZBQA 3ZIDA 2D0PB 2W58A 1WV1A 4HXGA 4M9ZA 1OXKB 1D5CA 1N5KA 4FNOA 4DN6A 3INRA 2FTKE 2IYTA 1KYZA 3KOMA 4CMGA 4X95A 3EZYA 2M32A 4IUYA 3GMTA 1Y63A 3IVCA 2EL7A 2WC1A 4RXMA 1Q84A 4KXNA 4O08A 1DVRA 1E8MA 1LK7A 3BX1A 2IHYA 3DP9A 3KJFA 4F86A 2ZRFA 4MV5A 4MGIR 4P80A 3AHDA 1V6CA 3RS7A 1XDBA 1XA4A 3QMPA 1PUIA 2RGBA 3F5FA 4L4UA 4FNAA 1WSDA 3SWWA 3KC2A 5LQRA 5F3RA 2O8VA 1ML3A 5D5QA 1HM5A 1XOIA 2QUHA 1JVSA 1NKTA 1MORA 3O3NB 1O4VA 5JRZA 1Z0DA 1NL3A 5H02A 1RDFA 3ZWCA 2VAWA 1B6RA 3WGQA 3L84A 2EJWA 1GQRA 3ICPA 2OO3A 1X13A 2BIFA 1E4OA 1SB9A 1N8SA 3WYDA 1XDWA 1Z36A 1PT6A 4W5RA 2QDXA 3KEMA 1YR3A 3GBPA 5G0VA 3HFSA 4Q15A 5HKLA 1U7ZA 3HC7A 5BR4A 2RBEA 2HXGA 2RB4A 3ZE9A 3WDSA 3VR3A 4B4VA 3Q8LA 2BHSA 5J63A 2EFGA 5EXPA 4M1EA 4I1RA 4WCFB 4UNPA 5CT6A 1VHQA 2A67A 3ITKA 3VPXA 1D0SA 1S9DA 1KEWA 5HUHA 1SWWA 4I6JA 4BGDA 4NBLA 2AG8A 2VAVA 1FEZA 1ZXBA 4EAAA 5BV7A 4GWLA 3TI7A 1R9GA 3E35A 4FMCB 1EJBA 3TSWA 4TTRA 5I3CA 5EIHA 3BHJA 5GMOA 4NJMB 1I7LA 2C94A 5EHGA 5JAIA 2GA9A 2AYYA 3V4OA 1OZ0A 4NVRA 1DDGA 1JQBA 2NACA 3E4DA 4WCFA 1M83A 2J41A 1I0LA 3OQJA 5TY0A 1G5HA 2W2TA 1NPTO 1SBYA 2AC2A 2H52A 2ZPUA 3TQHA 4EHHA 2DERA 1YTUA 1P4GA 3T99A 4FMDF 3WIUA 3PFNA 4ESEA 3MLBA 5C8XA 3BK1A 3GA7A 3CZPA 3PQ5A 4L5JA 2Z83A 1RLUA 2I5PO 2D1RA 1B1CA 4XR9A 1RWXA 2EOAA 1L7MA 1QZZA 1RWPA 3DL7A 1BOFA 1MAUA 3EBPA 3HBJA 2E6KA 1U6JA 1RM3A 1I36A 3GMSA 4I9HA 4DRXA 1OREA 3MD0A 1CERA 1DBVO 2OECA 2OV6A 4QASA 4FJ1A 4HTAA 1V37A 4A0SA 3NGMA 3HU2A 2PGJA 3K6KA 1YRHA 1J0AA 1YJ5A 2GCEA 3O8LA 4MQ4A 5TC4A 1K9SA 1XTBA 3A11A 1HDXA 4KO4S 4GDFA 1E1QA 5DNWA 3E27A 2C92A 2IHKA 3PGXA 3ZH9B 8LDHA 1YH3A 4PLCA 2Y6VA 3BD9A 1OH7A 4K1LA 3OLZA 4R2WA 1ZCFA 2C4TA 1UK8A 4RTKA 1DIBA 1EX1A 1TCAA 3BGWA 4LOJA 1UZMA 3ZYCA 5AW4A 1J9GA 2FN3A 2ZGVA 3FKJA 3OIYA 1SULA 2IYFA 2HRBA 3A9VA 5K0ZA 4LXHA 1N2CE 1TECE 1I4OA 3FYHA 3H16A 1U0LA 3I1IA 3LT5A 4XUGB 1I30A 2V96A 4BYMA 2AOUB 3E8XA 3MJDA 1T43A 4FMPA 2P2GA 4XKJA 1QU3A 3PITA 2O8BA 2OY0A 1QBKC 1GZ7A 2NLOA 4Q93A 3I53A 2GK6A 4OHRA 3RJ5A 4D9FA 4D5GA 2QQEA 1GZ5A 4KFUA 4PZYA 4NYMQ 1OA0A 1WMBA 3CM0A 1XVLA 4OQFA 3QEMA 4EHFA 1OYYA 1ZC4A 1NOIA 1ORRA 3B6JA 3AGPA 1ULBA 3Q8WA 2ZUFA 1ZQ1A 2WVJA 3PQFA 1VMKA 1U8TA 2Y67A 1FZTA 1QRDA 1A9XB 1FCJA 2MSWA 1T6ZA 4OK3A 1N4AA 3FZQA 1EX6A 3EPKA 9LDBA 1NDUA 2WWFA 4KGZA 2CBXA 3VOSA 5AVSA 3P4YA 1A8HA 3RSCA 4CM4A 1T15A 3IV7A 4LMPA 1WETA 2ZVJA 2JFOA 4FFPA 1J8DA 2RONA 1H6BA 3MFYA 4WKBA 5JDCC 3AX6A 4LF6B 4QGFA 4E2ZA 3T12A 3ZV6A 2SCUB 2C5HA 2Q6KA 5T7BA 2OQ2A 1IRXA 1NJGA 4G1VA 4DXDA 4AMYA 4TXNA 1RWQA 4JLMA 5KOHB 4BO2A 2AX3A 5DO9A 5BV2P 4BKOA 2R8ZA 3MJFA 1C0LA 4EA9A 1IVYA 5DLDA 1J00A 1HDYA 5IARA 4RORA 2I2CA 4YJDA 3RUHA 1P7ZA 1RQXA 3SBXA 3BFKA 4X1IA 4CODB 5I7EA 2JK1A 4CKZA 1PVVA 1K98A 4RNDB 5E4FA 1SKQA 1YZKA 2Q1TA 1OI3A 4WFKA 3CB2A 3SLKA 4WZZA 3AIOA 1ZI6A 3ESYA 4Q9IA 3BIJA 3G2LA 3FDXA 4GZLA 2CYCA 2E9SA 1CYEA 5JFTA 4EB3A 4DCMA 13PKA 4IVRA 2VUSA 2FMXA 3FHOA 4JCOA 1Q1QA 1UXJA 3KUDA 4KE8A 5A71A 6LDHA 3HCOA 2PX0A 3JQDA 4JDPA 4N0EA 1AM4D 3OBBA 4ZGWA 4HDSB 1JV2B 2JIBA 1W73A 1Z22A 3QE4A 2BVNA 3A6PC 2HCFA 2WT9A 2IHVA 2E37A 1Z35A 3KEGA 4HX2A 2NU9B 4WV3A 3STUA 1WCWA 4LF9B 3RVQA 1QOQB 5KU1A 4JQYA 1DT5A 4EFDA 2RGRA 1ESDA 1R50A 4BVHA 5JNSA 1LVUA 5CK5A 3VHXB 1U0FA 4YR7A 3WV4A 1ECPA 2FF7A 2JLCA 4QBFA 5UKDA 2W37A 3HDVA 3ETNA 4R8SA 3TRJA 2B2NA 3D3WB 3U3RA 4DR3B 1FXSA 2CZQA 2NTVA 3BDIA 3NI2A 7MHTA 1U90A 1OFVA 1YB1A 3R75A 5C8ZA 1RRPA 3GT7A 4UNQA 5IHXA 1DEHA 4CL3A 4KQMA 2BOVA 4MYHA 4U9IS 5K3AA 5A5DA 1IUKA 3INTA 5KDDA 1Z2CA 1KRXA 1G19A 3AI7A 5DNAA 5I7OA 3GPDG 3WJ7A 5HPYB 4HZIA 4OAOA 2HT1A 1YI8A 1P1RA 4BIMA 3K5HA 3KOOA 4PYOA 5A9TA 4Y2GA 1P0QA 2Q1WA 3SEQA 1ZSVA 3H2YA 3A28A 2JD0A 2GEFA 5T3YA 2A5DA 1PZMA 2A7XA 2BR4A 1L7RA 5AVJA 5K3CA 1MH1A 5D3ZA 5FOTA 4FYVA 3RIYA 4B6RA 4G5FA 4JBLA 4C6SA 4HUQA 2W2QA 4M8SA 5BV8A 2D54A 4HV4A 2YZNA 1L1RA 3RVNA 2GYUA 4P38A 1K4YA 3LUCA 2FLWA 2VJOA 3TG8A 1GAXA 5H0IA 4G1MB 3DW3X 3AQ4A 4LFCB 4A82A 4GMKA 5C8YF 2HO5A 2NXWA 3TMKA 4Z4IA 3H4IA 4YJ3B 4S1TA 4EMTA 3G7UA 2QRMA 1XZJA 2HDNB 3ND9A 5KNLA 1XRRA 2FB9A 2I6TA 2ZE7A 4JEUA 1C0EA 3MXOA 4ZT3A 4ZREA 5FRDA 3CH7A 5KYVA 3W90A 2WJWA 4ALLA 3C6KA 1YJQA 2OGZA 3DMHA 4HYYA 4RS4A 2J5KA 4XQEA 4F45A 5B12A 3V8BA 4DG8A 3B3QA 3DQQA 3PIDA 5JAZA 5ER9A 5BO5A 2PVPA 3U09A 5HRCA 2AFRA 2VI5A 5BQXA 5JO0A 3WBBA 2IEGA 1O4WA 4IY1A 4PX5A 3LBFA 3FCYA 1T0JB 4OHPA 4RHFA 3W9YA 4BWFB 4B7AA 4BMSA 1YB5A 2HCJB 4RLQA 2YDXA 3HU1A 4AXBA 5EQTA 4B0OA 5IDXA 5E7IA 5IJ0A 3OY7A 2XY4A 3TN7A 2IH5A 4I55F 3C2QA 4ND8B 2CE2X 4ZCSA 1U2DA 4NL4H 3DB1A 1XPOA 2GF0A 2QS9A 2WUFA 1ND5A 4QUJA 4EPWA 4F3RA 1OPRA 4XARA 1M6NA 1PVDA 3OM8A 3OOYA 1X92A 5J40A 4LFAB 4Z1MD 1AKYA 4RXUA 2QXYA 4IH1A 3UF0A 1R8XA 2H11A 1E2QA 1NJ5A 2CLLB 3OOSA 4KVAA 2C5FA 4WN9A 1CF2O 1R0ZA 1WL8A 4GE3A 1LQUA 5C18A 4PSUA 2GBIA 5ALGA 1WY5A 2HIHA 1TKAA 4F9TA 1P39A 3AH8A 1VI5A 3UAVA 2CEKA 3F6PA 2IXDA 5K0FA 1ZIXA 3T95A 4D79A 1T1RA 4RL6A 4KQ6A 5ALTA 4AJIA 1H2HA 5I4BA 1PHRA 1LJLA 1RQGA 1EINA 1QCCA 3AC0A 4PLFA 4GYYA 2V3CC 2G28A 1QTQA 4GX2A 2CXTA 2OHIA 1H3EA 1ZUHA 3FLMA 3TJRA 4FN5A 3I1FA 3OEEA 3A10A 3K0EA 3TD2A 4CG2A 1PUXA 4UZFA 2HV8A 2QTRA 2AEJA 3ZHQA 2QL7A 2I65A 1GXSA 4CKEB 1EZ1A 3MAGA 3HI4A 4MQLA 2Z6AA 4FPXA 4L6IA 1EHCA 3ZPXA 1DFGA 2H4FA 3O9MA 1C3XA 3HBNA 1AF4A 3G8YA 4QEKA 1RJ9B 1INLA 2J1LA 3MINA 4O5OA 1KSHA 2WILA 1BXRB 2IYLD 4XTRA 4D9HA 1SHTX 3HDQA 3FWYA 3QGMA 4L6CA 1U6KA 4RW0A 3VC2A 1EVIA 1E2IA 1IOZA 3PFWO 2DLDA 3JD4A 3T3NA 4G0UA 1WP4A 1ZD9A 4TWBA 2HRQA 5ESWA 4YRBA 1LX6A 4WNAB 1SBNE 2PZGA 4UEQA 4A8PA 1KI3A 4WIAA 1QQAA 2ECFA 3FWPA 3KU1A 3ZCUA 4Z2AA 1OFIA 3HPRA 2NUTA 4PO3X 3M4JA 4KIWA 5JZMA 3GHHA 3MN1A 3D8UA 3OU6A 4II7A 1JG6A 4OJMX 4GE0A 4UUAA 2LDBA 5T6BA 4HLUA 1QKJA 2OD9A 4N03A 4ZAWA 1HURA 4DIUA 1M0EA 5K05A 1QU2A 4H1VA 4GR4A 4AKSA 3AT1A 3U56A 3ZGNA 3HZZA 3KSBC 3MJRA 3AV0B 1MX9A 3DDHA 1H0HA 4TV9B 1UWCA 4KR3A 3OHMA 3ODGA 3HEAA 3H5WA 3Q7SA 3W79A 5EVJA 2NYRA 2JJ8A 3CNQS 4QHTA 2WYIA 3TSZA 4AJ4A 4G5OA 1IUOA 1F51E 3HXLA 3FPGA 3M1AA 1UZLA 3SHOA 2IPOA 1U7DA 1XROA 1TYCA 1JSXA 2OKGA 2YDYA 4RHXA 1ZEJA 4L57A 4YACA 5L3QA 3V8NA 5A4JA 4QFBA 1Q92A 2QPLA 2OCAA 1MOSA 1OTYA 1T9DA 2ZPAA 2AE1A 3E0QA 3QU7A 2G63A 3QKWA 3QOXA 3TSOA 1CX9B 1KQGA 1UPXA 1XN4A 5EE0A 4B32A 4MRNA 1N2SA 4RCZA 4JBGA 1VJCA 4NTZA 2E5LB 3UK2A 4KR2A 4D92A 1GPYA 1SIWA 3O03A 5FT9A 2WD7A 1VMEA 1HR0B 1MV5A 2FWBA 4KLZA 2RH9B 3BXEA 1YJBA 1AGNA 2OCPA 1IC6A 3FFWA 5AKGA 1JAXA 2WRZA 1UADA 3VZBA 3M2PA 3B6EA 1UP7A 3JPWA 3R3HA 2OV4A 5U1PA 1ZGJA 4J6FA 3MGKA 3PGMA 2XE6A 4GVPA 1H8HD 3BF7A 4L5BA 4QGAA 5TE9A 5C1IA 4CPDA 3SXUA 2BGWA 2X4IA 4PRYA 4MVJI 5JVDF 2LR0A 5KOYA 2BKEA 2G77B 1L5NA 5P8WA 1GSHA 2O2YA 2AN1A 5TIIA 4BBZA 1PK9A 1HTBA 1KDPA 4Z0TA 1JRLA 2VOEA 3REQA 4X61A 1YVDA 2IBMA 1PSDA 3A9UA 3H1EA 3RYHB 3WLLA 2XOKD 4DIFA 1VKNA 1A7KA 2Y1LA 3W6OA 2XF8A 5ALXA 1YBFA 5HRUA 3RS0A 3EX7C 2ZT7A 1VLQA 3HK2A 3CX6A 2LKCA 1OF1A 4FNGA 4EKEA 1U31A 1GQSA 2IWRA 5BR7A 4BBAA 2MHCA 3QWFA 4N9QA 3D2LA 2Q5QA 3H2ZA 1UEJA 2BGUA 1W0JA 1Z25A 2H2AA 3SX4A 3ZWAA 1Z6QA 4YAGA 2PLNA 4EJFA 4E88A 2ZB8A 1JW9B 2W48A 4MUFA 4LDNA 4M87A 1PGQA 2EWWA 4YCMA 1TM4E 2GBCA 2QZ9A 4IP0A 3KOUA 5FLYA 4EOGA 1Y7LA 3X2FA 5AWFC 2CY0A 3GT0A 4NRDA 4XWTA 2JDIA 2QJOA 2JVIA 2QRLA 1C80A 1K3TA 2FP4A 3ORSA 3WLNA 2IITA 5IBCA 1CRZA 1C9JA 4IJUA 5HCNA 2WICA 2AI2A 3KJQA 3L7NA 5DN6D 1OCEA 1MJGM 2PMCA 2XAAA 3KB1A 4H1TA 3ZE2B 2JAPA 3QA3E 2G25A 4KB5A 4TWJA 4PPYA 4YUAA 2QAGB 3LBAA 1WCYA 1SNYA 2OA0A 2X9VA 3PV0A 1TQ2A 1C7FA 1P1BA 1Q21A 3TM5A 2SKDA 2JGDB 3PFBA 3UENA 1B8NA 1YB2A 3WRYA 3N07A 4E5SA 1GSAA 1I1NA 4BO7A 3SYKA 2JCVA 2I4TA 4Y2VA 1RLIA 3S2GA 3E3LA 4M1WA 1U9JA 3IKMB 1IZ8A 1QOZA 1NXQA 2WM9B 3L7CA 5H3CA 1NJ6A 3LD9A 4F91B 4GBJA 4PZLA 2RIRA 4U1RA 4BQFA 4DHWA 2V1XA 2HLDA 3BB4A 3BKWA 3K3PA 2QN8A 1EHYA 1OIWA 2OV1A 1R27A 5K0EA 1R0RE 3GFSA 1O95D 4LJSA 4NABA 4P81A 1E32A 4ZVQA 3ID6C 3STWA 1QHSA 4N01A 4G1CA 2BHLA 4KIJA 4RKWA 1AK1A 2YVKA 4S1WA 5KBYA 3PHLA 5IXSA 1CY0A 1XLTA 2AZDA 2C9OA 2VPIA 1F3LA 3AIMA