3GGPA

Crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
286
Chain Sequence
KSLSMQNVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKRFVGGHPIAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKENVMKAIEGFEKSLNHLKELIVREAEEELVEYLKEVKIKRMEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Prephenate dehydrogenase
publication title The Crystal Structure of Aquifex aeolicus Prephenate Dehydrogenase Reveals the Mode of Tyrosine Inhibition.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 105
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3ggpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ggpA01
1Q0LA 3PYXA 1R37A 1FXSA 2R00A 1GL3A 1DB3A 1V3UA 2HMUA 4KOAA 4YJFA 4HADA 4BO7A 4P4GA 4U6SA 2YFHA 1U7HA 2JD2A 2I99A 3WMXA 5CFZA 4TRJA 1SCUA 1OC2A 1PS0A 4QFDA 3JQAB 4DWVA 3AY7A 3NAQA 4J1TA 1GYRA 4HXYA 1NHWA 3L07A 4ND3A 4PG8A 4CLRA 1QLJA 3NTOA 1W73A 2P2SA 1I3NA 4ZVVA 1YE3A 1GUZA 1O6ZA 1KS9A 4NZ9A 4L8VA 1PZGA 2Q1TA 3H5RA 3HN7A 1EVYA 5L4NA 4C7KA 1ZIDA 1EQUA 2DBVO 3JQGA 2OBYA 4CM5A 5K0ZA 1X0VA 3ONDA 3E9QA 2LDBA 1MXHA 3D4OA 1EK6A 3LK7A 3H9QA 3DHEA 4ZN6A 3GHYA 4XJTA 5FWNA 2J8ZA 2DTDA 3K96A 5U1PA 3CZRA 3WICA 3AW9A 4CQLA 4ILKA 4FW8A 4NU6A 4ONEA 1YQDA 4TRMA 1A7KA 1TB4A 4EJ6A 4WNIA 1CQJA 1E7MA 4PVDA 4QX6A 1X1EA 3QVSA 4IJWA 1ZKMA 3NKLA 3QVWA 1ISFA 1LSSA 3I6QA 4I5GA 5A9TA 4DXHA 5C37A 3Q3CA 5KNLA 4IQ0A 4MVJI 5A02A 2J3JA 3KSDO 4PN3A 5EJ2A 1ISMA 3JD2A 1YL5A 4KZPA 4ND5A 1LLQA 1XG5A 5I8WA 1X14A 4TRRA 2A9FA 3WWZA 4W4TA 4CUKA 1VC2A 4CUJA 4CQMB 5H83A 1WAMA 3W4IA 1VL8A 4FFRA 2X0JA 1LDBA 3HFGA 1WMBA 3FCOA 1LSUA 1O95A 5JC1A 3P5SA 3JTMA 2RHCA 4FJ1A 5A9RA 3ZW8A 1SOWA 1EE2A 4U0KA 5J23A 4WECA 1P44A 4ALNA 1X1TA 3MWDB 1LDGA 4DIBA 3MJEA 1HDGO 4D7AA 1UDBA 1ZK1A 4AJ1A 2X6TA 4IY1A 4PIVA 2P91A 1E3LA 2I3AA 4GAEA 1DAPA 4NBRA 4Z0PA 1E5QA 4N5NA 2I5PO 2VOJA 1XELA 1QYVA 2PWZA 3NT4A 4L9RA 2FN7A 3N58A 4DMLA 2GRAA 9LDBA 4EW6A 5ADHA 3KHUA 3DMTC 4FFPA 1TA4A 3S2EA 2OZPA 2I3GA 4R9SA 1IB6A 5G0WA 3ROMA 3WR5A 4D42A 2X9VA 4E31A 1NWCA 4XX0A 1UP7A 3HB4X 2ZJ1A 3ZWNA 3H3FA 1N9GB 3KOUA 3QW2A 1KYQA 2CY0A 2VN8A 4FS3A 5F5NA 1U8XX 1VI2A 3BHMA 3D3WB 4M49A 4W7HA 1OOEA 4YT5A 1G1AA 4LRTB 2GZ2A 2Y0CA 3E1KA 1ISJA 2NTVA 3I9OA 4GMGA 4PCVA 4R1NA 2GYYA 1IZ9A 4RF4A 2V6MA 3KBOA 3JCZA 5JYDA 2E4AA 4HBGA 2WJPA 2FPGA 1ZSVA 2A35A 2IEDA 4CMIB 1HE2A 5IFLA 1PGQA 1JVBA 2NM0A 3QE3A 3P2YA 3PFWO 1ISGA 2NADA 1BRMA 4TWRA 4CMKA 3GZ4A 2PK3A 5EIOA 4AFNA 1GADO 2EJWA 3WFJA 4TROA 1DXYA 4M87A 2OP1A 1YKFA 2GUGA 5EESA 4J90A 3MJCA 4WGGA 3RUIA 4YQZA 3BTSA 4GLLA 5CPFA 4LVCA 1QSGA 5KCZA 2Y68A 1YRLA 4J4HA 4LSWA 2CNBA 4B4UA 1Y9EA 1U3WA 5FF9A 2CMDA 5F3RA 4EZBA 1I3MA 1WDMA 2BGKA 4DQXA 3WSVA 5BNIA 1XHLA 1U1IA 2E37A 2FZEA 4JIGA 5GZ1A 5G0UA 2EG9A 1QV6A 2R2GA 3D5QA 4YB8A 1C3VA 1ZK2A 4FB5A 5F1KA 1NXQA 2DBQA 1YB4A 4D43A 3NTQA 1EFKA 3GUYA 4LCEA 4ZQGA 1LNQA 4CM3A 5K6AC 1DFGA 1YDEA 1M66A 1KVSA 1PX0A 1GQ2A 1RYDA 1T25A 1ZBQA 3GZNA 4GGPA 4IUYA 3GK3A 5IJZA 4RF3A 5TT0A 5COBA 5EQFA 2P4HX 5BNTA 3GG9A 3UXYA 1H2HA 3OHSX 1MB4A 1TT5A 3OF2A 3T4XA 4BO5A 1P1KA 3QP9A 4KUEA 2ZYGA 4PRKA 1Q1NA 3E8XA 4B7XA 1U5AA 1ZFNA 1LC0A 3EUWA 4QXMA 2ZB4A 1PJ4A 1YBAA 2AEMA 5I8ZA 2V7PA 1Y6JA 4MP3A 2BI7A 3F1LA 4WK6A 1R4NA 5IZCC 3HDYA 2A94A 4H3VA 1Y8QB 2HLPA 4PG5A 2HRZA 1U2DA 3AK4A 3H5NA 1UXKA 2JAPA 2TMGA 4YR9A 1EUCA 5KJ1A 4I08A 4BNKA 1BDBA 1JKJA 3AOEA 3PTZA 1GU7A 1U3VA 3UAGA 4L4SA 4Q3CA 4QSMA 4CM4B 5JS6A 3FSRA 3ETEA 2O3UA 2UAGA 5TSDA 3FRJA 2AXQA 4L74A 4U6QA 1DOHA 3X2FA 2C82A 5C7IO 5JDIC 1EK5A 4GLOA 1VSVA 4OKNA 1SPXA 3VDQA 3FNHA 2QIOA 3ROQA 5JPIA 2VYVA 4YRAA 1EDOA 1T2EA 3BTUA 4RGBA 1WMAA 4IMRA 2ZYAA 3S8MA 1TT7A 2ZK7A 2IXBA 3WTBA 4CV1A 4CMCA 2ZIZA 2QYSA 2VYND 3H3JA 1IOLA 3L4SO 4R69A 5KJEA 2DT5A 1GTMA 4L4XA 4NJMB 1E92A 4RL6A 1WVGA 2CF5A 4L0QA 4UEKA 4E21A 3TZKA 4HV4A 2PNFA 5KOIA 3D4NA 1PQPA 4PVCA 4B3HA 2Y93A 1LUAA 1NPDA 1QXSA 4ZA2A 3O8QA 5DULA 2VT3A 2OOSA 1KVQA 1OI7A 1PJBA 4N18A 5DBFA 4DMMA 2X1HA 1H6CA 3FHLA 1EVJA 1DIAA 2HO5A 1DIHA 3D3EA 1KEUA 1HTBA 1VSUA 4XGIA 5F5LA 3TZ6A 5BQFA 1ONOA 4WCFB 1WDLA 5COAA 4OSPA 4XQGA 4F45A 1SEVA 1Z7BA 3CMMA 2OHXA 3GT0A 4UVDA 3CXRA 3JQ7B 4GWGA 1HYEA 3AM3A 2DBZA 4YJFB 2I6TA 4KTTE 2VWQA 4L73A 3ZH2A 4DBVO 4DUPA 4NJOA 2E49A 8ADHA 5JAZA 4ALIA 3C7CB 4ZHSA 1XCBA 4XKJA 4G65A 3LC1O 3DB2A 5A04A 1Z6ZA 4J91A 1KY5A 3D4PA 1JWAB 3CIFA 1JKFA 1T2CA 2QG4A 4WE3A 3GGOA 3S2FA 4EJMA 1K6IA 1I33A 2HK8A 2VRCD 2SCUA 3CH6A 3SLKA 1I36A 3AFNA 5H81A 4BMNA 4NBTA 4E3ZA 2GN4A 1HZJA 4I9NA 4GL4A 1HKUA 1IL0A 2WYWA 2YHIB 3BTOA 3Q6IA 4NMHA 5KWEA 5KTKA 3IOYA 3JD1A 4YJGA 1EUZA 2ET6A 1Q7GA 2B5VA 2J5QA 2NTNA 3OJ0A 1PJQA 3JQGB 3FPCA 3OIFA 1HDCA 1N7HA 2BLLA 4L76A 1GYQA 4B3JA 1XU9A 3JQAA 2EKPA 4CR8A 3AM5A 1ZK0A 4WLFA 4E13A 1LLCA 1GCOA 4RORA 4J7UA 3INGA 1SNYA 3HNPA 4EGFA 1TLTA 5IDXA 4WLUA 2ZCUA 1GZ6A 1P1FA 2WD8A 3DBVO 5G0VA 1QR6A 3WQRA 1OBFO 2X0RA 3AWDA 1DDOA 1P3DA 1VLLA 3I3OA 4BNMA 1LDNA 2YW9A 3E82A 1R4MA 3OEWA 4MPDA 4CQLB 4BO2A 3F3SA 3QVTA 4XZ3A 4CM1A 4ZQFA 4I5DA 2GLXA 3GEMA 2NWQA 5JO9A 4JQCA 5B12A 5L9AA 2BI8A 4M54A 2QRJA 4IDAA 4XIJA 3B1JA 4II3A 5L3ZA 1JA9A 3K5PA 2HJRA 1TI7A 3DAPA 1ZZEA 2NACA 2DUUA 1ISHA 1ZNQO 4DIFA 2PD3A 3RUEA 5K9ZA 1Y9AA 3NDJA 4XCVA 5TLSA 1NP3A 1EBFA 3MJ4A 4EJ0A 1PGOA 1U4OA 2DM6A 1UDAA 1DO8A 2Q2VA 1T24A 3F4LA 3U49A 1HYHA 4PRLA 3R3JA 1B8PA 3F1KA 4KMSA 4IIUA 4J3FA 5T57A 5L45A 1NWHA 2ZCVA 3BMQB 4YT4A 1YH3A 2X23A 2BRUA 4K6FA 4NU5A 1HL3A 3TOZA 4A03A 4Y67A 5ITVA 3A1NA 1BMDA 3TDKA 4W7IA 4JROA 2NQTA 3D5TA 3NDRA 5CP8A 3INTA 1WNTA 3LYLA 4J4BA 3BTVA 4BNLA 2DLDA 2PD6A 1GEGA 4EEZA 2DC1A 4CQMA 3MOIA 5JFOA 1DBVO 1A72A 1U3UA 4QT0A 3WWYA 2PKRA 3WGHA 4BNGA 4BS9A 3QVOA 1LDMA 4JJFA 5I7SA 2X4GA 4XRRA 4TZTA 4KWHA 2WDZA 3ZCXA 5DN9A 3I9JA 3ONEA 2UV8A 4C7JA 1ZH8A 3GN1A 4J9VA 2VWHA 3MJVA 3P19A 4JP2A 3TOXA 2ILTA 2OP0A 3OJFA 4WEOA 1HDYA 2VCYA 1B14A 3RROA 3ST7A 2O48X 4JK3A 5G4LA 5CPBA 4YAIA 3GHHA 1CETA 1QP8A 2FR1A 4RDHA 1LXCA 4CV2A 2X22A 1YONA 2UUOA 2Y99A 3Q11A 1MG0A 4HP8A 2H9IA 2RAFA 5B37A 2IZ1A 4W9NC 1FJHA 3RFVA 1K3TA 5TX7A 1N9GA 4B8ZA 1MFPA 1NVGA 3VH4A 3KTDA 2VWPA 4FFNA 4PLZA 4WLVA 4E5PA 3HWRA 4L75A 1PTJA 2Q45A 4PG7A 3H2SA 4CLDA 1MFZA 3PIIA 4NPCA 2NVWA 3JSAA 1LRLA 1G6KA 2J5KA 3DZKA 4J7CA 1BTOA 2HUNA 1B7GO 4CMIA 4A73A 3O03A 2HQ1A 4CR6A 5FYDA 3GVHA 4NBVA 3PQDA 1E1NA 5DZSA 2FHSA 2FRDA 2CVQA 2B4TO 1R6DA 3DO5A 3VKUA 1GUFA 4MKZA 1HSZA 1LQTA 4XB2A 2QZ9A 3ZWCA 1TEHA 1IULA 5IDWA 1LRJA 4LISA 1I01A 2HCTA 1FDWA 3TN7A 3WJ7A 5L7YA 5C3MA 1F17A 2R00C 4O0LA 4D79A 1I5RA 4BNXA 4PLPA 7MDHA 2Z1NA 2IYOA 3RBVA 4YQYA 4B4WA 1EQ2A 1LDEA 4XRGA 4UUMA 2POQX 1B0AA 4D3SA 2O7SA 1KVRA 3M6IA 2EEZA 3JD3A 3WIEA 1PZHA 4ND4A 1GUYA 3QRWA 1RKXA 3F6YA 2P9CA 2V6GA 2C20A 4GWKA 5CEEA 3DQPA 3PJEA 3GN2A 2VYVD 3Q0EA 2QQ5A 3AY3A 4Z0HO 3RVDA 1JAXA 4TQGA 3V2HA 4EUEA 2GO1A 1NNUA 1ZSYA 4E2ZA 3LF2A 3DAFA 3SEFA 4BNIA 1N2SA 1LSOA 3GMDA 1M6WA 4BNFA 2IZ0A 4BGUA 1E3WB 3DFZA 3LU1A 4B4VA 1Y8QA 2VT2A 2Z95A 1Z74A 2PD4A 5CDTA 3L4BC 3CZMA 3ZHXA 2NU7A 1WW8A 3VPGA 1Q7CA 5TIIA 4W99A 1O8CA 1PL8A 2C5AA 4H15A 4YAJA 2O2SA 1P45A 2EF1A 3RAJA 5L7WA 1YJQA 3SVTA 4M89A 4CM4A 1UDCA 1GDHA 5JMWA 2C54A 3ENNA 4B8WA 2HDHA 2WM3A 3ZWAA 3KYDB 5BSHA 3QWFA 4D41A 3GPIA 2P9GA 1WDKA 2Q3EA 4LGVA 4B3IA 1EFLA 3H6KA 3O8QB 4TVBA 3FI9A 3BHJA 1G0OA 1IZ0A 3G79A 4D0SA 4AG3A 1NYTA 2F1KA 5A4DA 4O1MA 1PQWA 1S6YA 2O4UX 4XYGA 1T2AA 2ZTLA 5CG2A 3ENKA 3ZGYA 3AUSA 3AU8A 4YPOA 4RV9A 1PR9A 4NJMA 3DZJA 4WLEA 3EC7A 5U4QA 3CUKA 1U7TA 2VNSA 4WCDA 3VKVA 4BO3A 3MJTA 1YB1A 2O4CA 3I23A 1YO6A 3AY6A 3GFBA 4RQTA 5G2OA 4OQZA 1V35A 3I9LA 3G1UA 4GX0A 3NRCA 1BHSA 4RVGA 1SO8A 3VH2A 3OP4A 4PLFA 4NBWA 3K31A 4MJLA 4BNYA 4WCFA 5F21A 1E1LA 1CDOA 3WXBA 3PRJA 3P7MA 3DDNA 3L6EA 4YRBA 3ETDA 1DIGA 4J4TA 4XDZA 3JQ7A 1YJ8A 2J6IA 4BV8A 5A5EA 1F8GA 2VZ0A 4MVJH 5C5IA 1E3IA 3RUCA 3QWBA 2JCYA 4YJGB 1K6JA 2DPHA 1ZSNA 1ENZA 4PLCA 1UXHA 4RZIA 3WTCA 3CINA 3ZNPA 1A9ZA 4E2XA 3PDJA 2ZTMA 5EERA 1HEUA 2C2YA 4J1SA 3ONFA 4PFJA 4FPXA 1GYPA 1E3JA 4IDBA 2D4AA 4GX5A 1UH5A 2IODA 4HWKA 3IDSA 4AJHA 1LJ8A 4AJLA 4R5HA 3ZI0A 1T2DA 2HMWA 5F1OA 5HS6A 3JQBA 3WQSB 4NI5A 1A7AA 3QIVA 3PI7A 4FJ0A 1R4MB 4UVGA 5CG1A 3Q2IA 2YHIA 2PY6A 3LLSA 5JY6A 4YTEA 2G17A 2O50A 4MVJA 3GR6A 3NT5A 3RCBA 3UHAA 3WGTA 4Z6KA 1ZJYA 2DQ4A 4NG5A 3F9IA 1PWXA 2D5CA 1LI4A 3ITKA 2CD9A 4C4OA 1E1KA 4MVJP 4AJIA 2EHDA 4R68A 5JSFA 2EP7A 4RZHA 4XA8A 2HMTA 4MP6A 4PLGA 3DHNA 3OJOA 5JCJA 4G2NA 4P8RA 3IUPA 1E3EA 3EMKA 3GLQA 4BO9A 2P68A 2W98A 3TJRA 1K6XA 4KUHA 2JAHA 5DDIP 4AVYA 1C1DB 2HU2A 3F4BA 1H2BA 5EMHA 1U3TA 2VQ3A 4JBHA 1UXJA 3LT1A 1LLUA 1DLJA 1A5ZA 1M76A 2VTDA 3MOGA 4TKMA 2GSDA 1DJQA 1MUUA 2AE1A 2WMDA 2YYYA 3KYBA 5L53A 1T2FA 1I2ZA 1N1GA 3DHYA 2VTEA 3O38A 3ON5A 1E0DA 4WEQA 3GMSA 5DP1A 2QW8A 4YJHB 2CVOA 4O59O 3EW7A 4QO8A 2NU9A 1YQXA 3EDMA 4BNHA 4DREA 3HHPA 4ND1A 2OORA 3ASVA 2GGSA 4HX5A 1UP6A 4R01A 1C14A 3BMQA 3GQVA 4D3FA 5HTOA 1I10A 3G1TA 3MZ0A 2BELA 1YWGO 2P4QA 3PIDA 3EVNA 3IKVA 2IDZA 3KETA 1ADCA 3FTNA 3V5NA 4HFRA 2FPPA 3OIGA 3UGKA 5DBGA 3GFGA 3AOEC 3GNTA 4OL9A 3I4CA 2GN8A 3KZVA 1ZCJA 2DVMA 2RCYA 4JJIA 4N5MA 4Y9DA 5G0SA 1NAIA 2OGUA 4MIOA 1HWYA 2G76A 4YXFA 3PLNA 1I8TA 3L0DA 5GZ3A 3EZLA 1N8KA 3OECA 3EGOA 4XD2A 3TQHA 1AHHA 3RASA 4IDGA 3AM4A 2PV7A 4CMJA 3AUTA 3V1UA 2PZJA 3FBGA 3UF0A 3EZYA 5A3VA 1SZJG 4MKXA 4Y8VA 1ZXLA 3HUDA 1WLYA 3KEOA 1F06A 1NFQA 2DBRA 3M2TA 3U4IA 1DRUA 5IG2A 3JQ6A 4RLSA 1C1XB 2EP5A 3K73O 4ITUA 4FOOA 4PLYA 4DVJA 2AQKA 4F46A 3G3EA 2HRBA 1VL0A 3K92A 3OEYA 3WSWA 3BMOB 4M86A 2ZB8A 3WDSA 2GDZA 4H7PA 4KUGA 1H9AA 2NSDA 1XGKA 1N92A 1QG6A 3A06A 2NQ8A 4ZRMA 1JQBA 1ZO8A 3MWEB 5KVCA 4CV0A 4GX2A 4PG4A 5JY1A 4BB5A 3E5MA 1XSEA 4K1LA 5ITWA 1OFGA 3H9GA 3I5MA 3PHHA 3GAFA 1BDMA 1GZ3A 1RM0A 5JNLA 4W82A 4YDRA 2R6JA 5B4TA 2AG8A 3LZ6A 3WIDA 3I4FA 2NVUB 1RM4A 1LTHR 2PFGA 2C2XA 5A9SB 1KEPA 5JW6A 3VZQA 5G0TA 3U3XA 1ML3A 1KVUA 4LRSB 2P9EA 3NUGA 4WASA 2PH3A 1VL6A 3PDUA 4FC7A 4OO3A 3WGGA 2C7VA 4EYEA 3UUWA 4BKPA 3ZV4A 3ZWVA 1NR1A 1SBYA 1YDWA 4NR0A 3W6ZA 3DOOA 4EDFA 1QYDA 5EQDA 4R3WA 4D46A 1ZUD1 3TSCA 4DPMA 1MG5A 4NK4A 3OJLA 4O63O 2H5LA 3FD8A 2EKLA 1DHRA 4CMGA 2BGLA 4UUNA 3C24A 4M1QA 1P1JA 1Y1PA 2FP4A 1B3RA 3SJ7A 3AI3A 2V6BA 3O9ZA 4ZQHA 3W4KA 1JKIA 3RU7A 5IXSA 3RUAA 1LX6A 4E32A 3GDGA 3PJGA 4I9HA 3ZV3A 2BFMA 3LF1A 1FDSA 3U5TA 2EIHA 3DTTA 6LDHA 1J4AA 1DC3A 4GKBA 1H93A 4AJNA 1P1HA 2GCGA 3PEFA 4HFNA 3S2GA 1E7YA 3OSUA 3GY0A 3VH1A 2BFOA 2RH8A 1DEHA 1EVZA 2GNAA 5TT1A 3X2EA 4JJGA 2YHUA 3GF4A 4Z3KA 1B26A 5FFFA 1HLDA 4CM9D 4UREA 1E3WA 5MDHA 3NJ8A 1NM5A 1KBZA 2OBNA 4II2A 4AJJA 3BXXA 3KLMX 4GQAA 3OICA 4NFSA 4K26A 3KSZO 4YT8A 1O9BA 1D4FA 1YB5A 3WB9A 4ROSA 5KJFA 1KY4A 3IL2A 4YT2A 2VHWA 2Y05A 2NU6A 4MIYA 1MGOA 2WD7A 1P31A 1ISIA 1U5CA 3RWBA 1HZZA 1PSDA 1VJ0A 2EERA 3I52A 4MDHA 3KYDA 5L7TA 2VZ8A 2VUUA 4O5OA 5EINA 1ULSA 1C0LA 3IP1A 4PLHA 3VC7A 5I7VA 3TRIA 3HDJA 4S3MA 3BA1A 2X0NA 4ZU3A 2H63A 3DOJA 1WP4A 2JHGA 3JQ8A 2RBEA 2CF6A 3GA0A 2A92A 3RUHA 1E7RA 3NV9A 1PL6A 4J2OA 5LDGA 2DKNA 3TF5A 2VHZA 3CPSA 1I2BA 3H5AA 3K2BA 3L9WA 1D1SA 3SC6A 1B15A 3QWHA 1AXGA 1HLPA 2C07A 3VTFA 4EITA 2PZKA 3NDIA 4R1UA 5GY7A 1M67A 1E5LA 4R5MA 5A03A 4MVJD 4EI2A 2DAPA 5T67A 5L95A 3CTMA 3V1YA 1Y8RB 1A4UA 4HNGA 3RJ5A 2W4QA 2RH4A 4JXKA 1G0NA 4NFYA 1H6BA 1IHXA 1RM3A 2FZWA 4J0EA 4OAQA 3WG9A 2EW2A 1E7QA 4XQ9A 4XYMA 1XA0A 2W2KB 5AQ1A 3COSA 3PWKA 1CERA 2ZB3A 3DL2A 2QRLA 1PIWA 1PS9A 1P33A 4QFCA 1SB9A 4LVUA 3VZPA 3BMNA 2AE2A 5DCYA 2W2LA 2H1SA 4O6VA 1IHYA 4DL9A 4FR5A 3ZU2A 3BZUA 3JQFA 5JDCA 4RPHA 3QWAA 4NH4A 2AW5A 2O23A 3LQFA 1A9YA 2E48A 4MVJF 1BG6A 1SAYA 4IDDA 3ZWOA 3JQDA 3WX0A 2B69A 4IDFA 3R3SA 2E6UX 3VVBA 3HDHA 1ZK4A 4E5MA 4EUHA 4N54A 2ZTVA 1VPDA 3PHLA 3U0BA 4TRNA 4YAGA 1C0PA 2HMVA 3FNGA 3ZNOA 3CKYA 5DOZA 3PWSA 3DEYX 2QX7A 4A0SA 2G82A 3ZWWA 4YAKA 4GGOA 2Y1GA 1HDOA 3PQEA 2NNLD 1N7GA 3ZDFA 3UKOA 2CZCA 4OM8A 3BMCB 3F46A 3H9EO 4WOKA 3GG2A 1GEEA 5COQA 2O3TA 1BXKA 4RVUA 2JFHA 2OUIA 4BGIA 5CDYA 4EEXA 2HAEA 3VPFA 3H65A 3R1IA 4Z3DA 5I7FA 2C0CA 3BYZA 5DP2A 1C1DA 5JDIA 1CYDA 5JXWA 4J7XA 4CLEA 5ILOA 4YRDA 4PLTA 3DBHA 5A05A 1ZEJA 1V0JA 5IN5A 1JVSA 4R41A 1I0ZA 3GC6A 5DT9A 1GQYA 3W8EA 3GRPA 1NX6A 2OO5A 4IS2A 2D59A 2JD0A 3PYLA 4L4RA 2OXIA 4OIMA 2CFCA 4Z9FA 2YFQA 5T5QA 3IC5A 3U4HA 5AYVA 3MTJA 2I9PA 2NVBA 1Y7TA 2Y1FA 4E5KA 1DFIA 5TNXA 4INAA 4JGBA 1YL6A 1HDZA 2B5WA 4PG6A 4RO0A 4YJHA 1RPNA 3F5SA 1V6AA 1YBMA 1X0XA 1L7EA 1ZXBA 3T7CA 1UJMA 3GVXA 2Y1DA 4ALMA 3ADPA 4PLVA 3ZV5A 1YOVA 2X9GA 5AOVA 4BNZA 2G0TA 3VHRA 3C1AA 1XR3A 3U9LA 3IJPA 3RBXA 1Y81A 4IINA 4AJ4A 4GX1A 3PHIA 4XYEA 1Q0HA 3B1FA 3JQEA 1IY8A 1R12A 4RLHA 4CM6A 1DHTA 3AI1A 4DLLA 5FI3A 1XQ6A 1CQIA 1F12A 2WSBA 3ZV6A 1PJTA 1SC6A 3CMCO 2GZ1A 3ZZNA 4BNNA 4JX8A 2DTEA 4OXYA 1XIVA 4E30A 4RF5A 4MIEA 1UXGA 4IIVA 4IGFA 4A5OA 1O94A 1KIFA 4I5EA 4FOSA 5BSFA 1B2LA 2WYVA 4YEDA 3TFOA 2VRBA 4Q3DA 1WZEA 3QY9A 1PJ3A 3N74A 4E12A 1E7SA 1K89A 1D7OA 2AEJA 3K8ZA 1MP0A 1NPYA 3DAGA 1YBVA 3I6IA 4RPKA 3JYLA 4WUVA 5GMOA 2O3SA 2IEBA 1KOLA 3ULKA 4BO0A 1C1XA 3F47A 5ER6A 3RSHA 2X5KO 1YS4A 3KVOA 1Z7EA 3NEPX 3KB6A 6ADHA 3E9NA 4QEDA 2AG5A 3BMOA 3HE3A 1JAYA 2P5UA 1LC3A 3EYWA 4QO7A 3O4RA 4OGWA 1P74A 2HKIA 5TGDA 1VKNA 4YJDA 2ZYDA 4CJXA 4LK3A 2RIRA 2H6EA 2G1UA 4PZEA 3ADOA 3JD0A 4CODB 4WCFC 2FR0A 4NBUA 4E5NA 2NVUA 4E33A 5A9SA 3ZWBA 1U9JA 3C1TA 4BO8A 2WWRA 1R0SA 2C29D 5T6BA 4CL8A 1EMDA 4B7CA 4DC1A 3HZZA 4WJZA 4FBGA 3HADA 2GF2A 3SC4A 4FIZA 3WNQA 4XJSA 1TVEA 2XPCA 1EBUA 2RHRA 3KSUA 1GAEO 3BIOA 3IUSA 1ORRA 3TL3A 4U0JA 2X8LA 1SMKA 5HS4A 1IPFA 4BV9A 1I2CA 3JQBC 4IM7A 5ES3A 4WPGA 5EN4A 2Q4BA 2LDXA 4FFMA 1YGYA 1UAGA 3IIEA 4UAGA 3RU9A 3V8BA 4Z9XA 1E3SA 4CR7A 3FNEA 1H9BA 4OMUA 1B8UA 1UZLA 5HRUA 3PPIA 3QQPA 1N1EA 4DIOA 1XKQA 5GZ6A 2PA3A 1I24A 3CEAA 4I9UA 4A26A 1QLHA 1U2GA 3OJEA 5I9NA 2YQ4A 3DZBA 3JV7A 3H8VA 1O5IA 2GR9A 3LT4A 1U28A 3D0OA 5DBIA 1MV8A 1MLDA 2UUPA 4JBIA 4CMEA 3HJAA 1NASA 3GDFA 3DC2A 2WD7B 1MC4A 2CDAA 4CM8B 3C3XA 5T8KA 4CUZA 3UFXA 3AFMA 5BSEA 3FN4A 1VM6A 1YQGA 3L77A 3ROKA 4BKUA 2PKQO 1DJNA 2ZQZA 1T4BA 2Q4EA 1V3VA 2JHFA 2J3HA 5HWSA 3VOSA 1L7DA 5A06A 2Q1SA 5TC4A 5G4KA 4J43A 3RD5A 2Y66A 4FQ8A 4NQZA 3JQ8B 4IBOA 2BFPA 1RJWA 5F1PA 3RFXA 3ROPA 2GPTA 1JW9B 2ZJ0A 3K6JA 1HDXA 5FEUA 3GNSA 5KVSA 4BO6A 4RDIA 3TWOA 5JMPA 4LMRA 3BHIA 1Z73A 3OQ1A 4HUJA 5L4LA 1CJCA 3PYMA 4YCAA 3PJFA 2WE8A 1AN9A 4Q3AA 3KO8A 1EE9A 3DONA 1E6UA 1Q7BA 1T1RA 4ZQBA 3TZCA 4DTIA 2NV6A 1GQQA 5DF1A 1FDTA 1LLDA 4J16A 3U62A 4EUFA 1D1TA 3MEQA 3JQAD 5TRTA 1OMOA 2Y67A 5KVQA 4DRYA 3JQ9A 4UVHA 4E0BA 2HK9A 2W8ZA 2X0IA 2B4QA 3DZHA 4D3DA 1W8DA 2ZKLA 2NU8A 4B4OA 3GGGA 3NTRA 1V3TA 4OSOA 2O7QA 4OQYA 2YUTA 3ZWPA 4OJNA 2WEKA 1Y5MA 1F14A 2QRKA 5JAQA 1UAYA 2C7GA 2YQ5A 3F5QA 3GH3A 1DC5A 2HJSA 4JLWA 2V6FA 3BMNB 4J2HA 3U09A 2JFFA 5DCWA 3MJSA 3WGOA 3NT2A 1Y8RA 3FBTA 3INRA 3OQ6A 1HE3A 2X86A 1HE4A 1J49A 1BXGA 3QJ5A 3PHGA 2VYNA 2YDXA 5KJ6A 1QMGA 1NPTO 2Q1UA 1Z82A 2W2KA 3OFSA 2VHYA 3E6AA 4J1QA 1FK8A 4OXKA 1YL7A 4MVJE 4RVDA 4A7PA 4JCOA 4F3YA 1VKOA 4GVLA 3DOCA 1IUKA 4HKTA 3OA2A 5B1YA 1LSJA 1UXIA 1D8AA 2UDPA 1T1SA 2WE7A 4XEHA 4RVSA 3E48A 2YV3A 3KYCA 4A27A 3D64A 3IP3A 2IE0A 5I9LA 4FC6A 1B16A 3NYWA 1PGPA 1RWBA 4RPGA 3U4CA 4CQMD 2FPIA 3RC2A 1EZ4A 2AEFA 4XQEA 4YACA 2AQHA 1MX3A 1PZEA 5EL0A 3DBHB 4J49A 4Q39A 1DFHA 5A1TA 3Q9UA 4KWIA 1M2WA 2XOXA 3L4BA 4XIYA 4YA6A 3W4JA 3BMCA 1VJ1A 2VRCA 3ABIA 4PZDA 4BNTA 3IQDB 5JO0A 2B35A 5THQA 3VPHA 3W8FA 5IN4A 3A28A 3DBLB 4IXTA 4BO4A 2JJYA 3TFQA 1ONPA 4IQ8A 1BW9A 3AU9A 3V1TC 5H82A 4DPKA 2DTXA 4BGVA 4QQRA 3R0IA 4GSLA 1WWKA 3JYPA 3ICPA 1PZFA 2UVDA 3GVPA 3ICCA 4D0RA 2NUAA 5KKCA 2VUTA 1YOVB 1K2WA 5TJ9A 4BNWA 3EK2A 1R0LA 4R16A 5DCUA 4FCCA 3WMWA 1EEHA 1PR3A 3HG7A 2Q2QA 2O3RA 1VE9A 2E82A 4N7RA 5FI5A 3H4VA 5AXAA 1CWUA 3RI3A 2EJVA 2F00A 3W1VA 1ZMTA 1DC6A 1PU2A 1NVMB 1UR5A 3LSYA 3WFIA 4CPDA 3OBBA 3WOHA 3E03A 5BR7A 5KVVA 4WNCA 1X7GA 3I9KA 2PZMA 2PR2A 1SOVA 4ZJUA 3PFFA 1NQTA 3ZNQA 2JCXA 2Q49A 2XF8A 1T4DA 3V2GA 3ZU5A 4A2CA 2Q46A 4BMSA 4AJOA 1IYZA 2OL4A 4YYZA 4Y98A 4DYDA 1OC4A 2EW8A 2VNAA 2BD0A 3FPLA 4BNVA 1JWBB 5ILGA 2JD1A 2UYYA 4LMPA 4LCJA 3W6UA 5L4SA 3IS3A 2BH9A 3H9UA 4NK5A 1R66A 3T7EA 3CSDA 2FY8A 5IDYA 4OKIA 5TQVA 3VPSA 3C7DB 3I9MA 5L51A 3B1KA 1FMCA 3FF4A 3UOGA 3DTYA 1P77A 3Q1LA 1DRVA 2PZLA 3RC9A 1DRWA 4BNUA 3DFUA 4S1VA 1CRWG 2FMUA 1JDJA 3LVFO 4HFMA 3VZRA 3C85A 2Y0DA 2ZQYA 2BMAA 4BO1A 3WGZA 1AUPA 4BKOA 3ZHBA 4RVFA 1HYGA 2DPGA 3W8DA 5BSGA 1ZK3A 4DBZA 4TKLA 3Q2KA 4BB6A 2O2YA 4JBGA 4R51A 1Q0QA 3K9QO 5B4VA 1UUFA 4GMFA 1I30A 4W6ZA 1X13A 1K5HA 3IAHA 4GBJA 1J0XO 4BKRA 3PLRA 3RQSA 3NX4A 1W4ZA 2BFAA 1IPEA 1ZJZA 4CL3A 4D45A 1I32A 3LLVA 2YV1A 5BNFA 3ZU4A 3OETA 3MTGA 3E5RA 4TSKA 4BUCA 2C5EA 2HK7A 4QTZA 2JL1A 3AI2A 3WYEA 2Q50A 3NJ4A 5JBIA 5AXBA 4YAEA 1LBEA 2AHRA 1EDZA 4J0FA 3WGQA 3FR8A 1KC3A 4RVHA 2J3IA 1YVEI 3RC1A 4RPJA 4H16A 4Y6SA 4KDFA 4ZD6A 5AXCA 5KKAA 3JQFC 5JDCC 4ZGWA 3D1LA 1XDWA 2IZZA 4RF2A 5C7LO 1Z45A 3L6OO 3SLGA 4R1TA 2AQ8A 3IMFA 2VOEA 4I5FA 5AXDA 3TNLA 2GN6A 1S7CA 2X9NA 3H2ZA 4B79A 3S2IA 1GZ4A 3UCXA 4IDEA 3SJUA 1B8VA 3PJDA 3L6DA 2IRWA 3QV1A 2GASA 3JYOA 4KQWA 1E6WA 3C7AA 3HB5X 2X7HA 4P4LA 3SXPA 1PJSA 4Z9YA 5ER9A 1GR0A 1ZMOA 4MVJM 1U4SA 3KM0A 1A71A 1PL7A 1QYWA 1H6AA 3TL2A 1R15A 1PJLA 4CLHA 5DNAA 4DPLA 4CM7A 2I66A 2PTGA 4ZQEA 3PZBA 5G4KB 4AJKA 2O3JA 3LDHA 5CEFA 3H9JA 3HSKA 3WBBA 3LT2A 1PGJA 4KQXA 4FGWA 1M6HA 2B0JA 4IJKA 5B4UA 4R54A 4MOWA 2PGLA 3AJRA 2GZ3A 2PGDA 3EY4A 2Q2WA 3FTPA 4CM8A 2BGMA 3DMTA 4Z0TA 3GVIA 4OOEA 5A3JA 4MVJG 4CLOB 2QHXA 2A4KA 3ZWXA 1PS8A 2D8AA 4UUOA 5HA5A 3VZSA 2GD1O 4OH1A 5U9CA 4G5HA 4B7UA 3FWZA 1P0FA 3ASUA 1GPJA 3RBZA 4BMVA 1HE5A 1PGNA 3WJAA 3QSGA 4E2YA 1KVTA 5JYEA 2CVZA 3WBFA 1ENOA 1O89A 1NFFA 2I65A 4TZKA 4YBZA 5JAIA 3PHJA 2PGJA 2I67A 1V9LA 3T4EA 3HN2A 3WLFA 4NNJA 4U5QA 4UUPA 1PWZA 1PQUA 1KC1A 4UVEA 1H94A 1Q2XA 3DBRB 3WLEA 2GERA 3ANNA 5I9MA 4KDEA 1NHGA 3M2PA 5JAMA 4X54A 4ALLA 3KV3O 3WYBA 3BAZA 1ENPA 4KP7A 4BOYA 1HXHA 1DIBA 4IMPA 4AJEA 4D44A 1V8BA 3DXFA 1Y5RA 1BXGB 3HDQA 1RYEA 2V65A 4ZRNA 3RUDA 1M75A 3D7LA 3G0OA 1AGNA 4BQRA 1HSOA 1PEDA 3VH3A 1WPQA 4NIMA 5JCJD 1SEPA 3GEDA 3ZWMA 4GH5A 2VUSA 3OQBA 1QRRA 5ICSA 4E4YA 3KEQA 4IDCA 1BVUA 3I1JA 2FWMX 3WS7A 4DC0A 4ALJA 5K6AA 1LU9A 3QVXA 2C59A 1DPGA 3DZIA 1GV0A 1ZW1A 1C0KA 4DLAA 2Z1MA 1JN0A 3A14A 5LDHA 2JKVA 4MP8A 4CLRB 1KEVA 2IXAA 3K2EA 2OFPA 3GPDG 3OA0A 4Q3NA 1ADFA 3A9WA 1ADGA 5L40A 1X15A 2VHXA 2WTBA 3H7AA 1HF3A 2EKQA 3U4DA 3KYCB 3M1LA 1PJCA 1QORA 5AVOA 1I3LA 2EGGA 5JCXA 1AE1A 3GOHA 3GDOA 4P38A 2XAAA 2P5YA 3KXDA 4MKRA 3QHAA 1HETA 4RCVA 2G5CA 5IZCA 1J5PA 4M8SA 5ENVA 1ID1A 3Q9NA 4K9DA 1GY8A 5JE8A 4J1NA 5CDUA 2J3KA 3LC2O 3DZFA 5ENDA 5CDSA 3LT0A 3UCEA 5IF3A 1FDVA 1LDYA 4K28A 3GNQA 4XWYA 1DIRA 1NQAO 1OAAA 4URFA 3DWFA 1GFSA 4LN1A 4WLNA 1NAHA 4CMBA 4R3NA 3I83A 4QUKA 2HSDA 1BW9B 1AXEA 2CSUA 2Y0EA 4XB1A 1ADBA 3RC7A 3RIHA 4ESOA 5ICMA 4LW8A 5KIAA 3OMLA 4WLOA 3TZHA 3PGJA 1NFRA 2YV2A 2J5RA 4IS3A 2B83A 1P9LA 1LRKA 2DFDA 1QYXA 3PWZA 3RKRA 1QYCA 1UP4A 1BXZA 2PKQP 1KETA 3FR7A 3V2UA 1IE3A 1X7DA 2BHLA 1NQOA 4Y6RA 1UZNA 4AL4A 1AHIA 3K30A 2NTJA 3KUXA 3AOGA 1QKIA 4ALKA 3ITDA 9LDTA 2AA3A 3R6DA 4IZIA 3O26A 5CAEA 2FR8A 3OH8A 3DBLA 1B3BA 2X5OA 1BSVA 2HMSA 4AJ2A 3WGIA 1E1MA 4FGSA 3VTZA 3STHA 1P1RA 3GAZA 4UVIA 1YXMA 5A5FA 4XYLA 4DQVA 3FWNA 1ONNA 5TF4A 2FSVA 3ZW9A 1GD1O 4U7WA 1VRWA 2Y1EA 4G81A 3RUFA 3UH1A 5TS3A 1F8FA 4WOJA 3UN1A 3PP8A 4E2WA 1JTVA 1C0IA 4IGEA 2BKAA 1XU7A 1WXDA 3JD4A 4Q3BA 4BNJA 4CMEC 4ZICA 5IXYA 4XQCA 1P1IA 4Q3EA 2B36A 1WZIA 3TPCA 4KTVE 1F0YA 5T8KC 1KERA 3UW3A 1DAOA 4IXWA 2JFGA 4JNKA 2YJZA 4Q9NA 3RKUA 4LSMA 4DGSA 2ZB7A 4FDAA 4BKQA 4HNHA 5KJCA 4YWJA 2EXXA 3S55A 2EGHA 1BVRA 4WKGA 4OOFA 4XGNA 4YVFA 4IZHA 4DQUA 2D1YA 2D3TA 4JP3A 1L1FA 5CDGA 4FFOA 3PK0A 1HDRA 3OIDA 4HY3A 4RJTA 1CF2O 2CUKA 3VDRA 4CMAA 1XEAA 2DUWA 4I8XA 5HM8A 1E7WA 3JYNA 3PZRA 4CV3A 3JQCA 1I3KA 1BWSA 4XR4A 2VZ9A 3SBOA 1HT0A 4AJPA 4E6PA 4DLBA 1H5QA 4BGEA 1O0SA 4IJUA 1K0UA 4TVOA 5CHEA 3D3WA 1GPDG 1Z75A 4PLWA 4XYBA 4DA9A 3NGXA 3JQ9C 4MO2A 3ANLA 3ZHYA 1SB8A 1W6UA 1QV7A 4OYRA 1XQ1A 3EAGA 2Q1WA 1XYGA 3DMYA 4QECA 5I7EA 2QZZA 4GI2A 4I1IA 4R1SA 1DSSG 3CE6A 3G17A 2X58A 2ZATA 3E18A 3GVCA 4HFJA 4XR9A 5LC1A 3ZN2A 4FD3A 2VWGA 2Z5LA 1RM5A 3IJRA 1E77A 3GZNB 4R4JA 1EUDA 2XXJA 2TMDA 1HRDA 3L9XA 4UEOA 4F6CA 1T26A 3WQQA 1TT5B 4CMHA 1LQUA 3ZWYA 1J6UA 4GPD1 3VVCA 4BIIA 5MGBA 2YY7A 3MCVA 4UULA 3PQFA 4Y6PA 3C8MA 3UICA 5T64A 4GSKA 3GEGA 1DC4A 1LEHA 1R4NB 1JLLA 3DR3A 4NFHA 5EPOA 2OMEA 4ND2A 3ZNNA 4OXNA 1MA0A 4FJ2A 3ANMA 4GKVA 4R9RA 2CDBA 2FOIA 4A10A 3KRTA 1OZAA 5DOVA 5IZ4A 4ID9A 1KEWA 1ARZA 3M1AA 4NDNE 4PGFA 1X7HA 3QA9A 1TXGA 1FF9A 5JLAA 2GN9A 3IKTA 4RPLA 1ZVMA 2BF7A 4PZCA 2PH5A 3GUCA 3ORFA 3SX2A 2JCVA 1UZMA 2I76A 1H6DA 1NQ5A 2EWMA 2D5AA 3QLJA 4IJVA 1PJ2A 2DFVA 4FSHA 2VHVA 3UVEA 1EVIA 3PVZA 4IPTA 2YDYA 4IQGA 5JC8A 4XGKA 2Q99A 3RFTA 1ULUA 5IAAA 1XLTA 1H0KA 1BGVA 3VPXA 1R0KA 4BL5A 3A4VA 3S1LA 4DYVA 3P2OA 1DLIA 2O3QA 4P4NA 1MC5A 3EVTA 1E6EA 1NR7A 1ZEMA 2Y1OA 2B4RO 3DZGA 4U8GA 1NVTA 4EBFA 3ETGA 2FSSA 2YZ7A 2AMFA 4AICA 3E9MA 3OM9A 1D3AA 3B70A 4N5LA 1JU9A 3B20A 3LC7O 1A4IA 3FNFA 4MINA 4NHEA 2NLOA 3RJ9A 1XWFA 1NBOA 1ENYA 1GV1A 4CLOA 4UEJA 5LCXA 3UCFA 4F6LA 4FFLA 2D2IA 3HFSA 4W9NA 2XXBA 4BHTA 3AUUA 4E5YA 2B37A 3WYCA 3QWIA 3G49A 3WGYA 2CDCA 2W2LD 2W90A 4CLXA 4J6FA 4K6CA 1R16A 2D0IA 3VAZA 2QYTA 2X5JO 5TJHA 1VJTA 1NTOA 2Y1CA 3B6ZA 3ZU3A 2ZTUA 1A27A 1CIVA 3GGPA 1LA2A 4J9UE 3PXXA 3HQ4O 4JN6B 2PLAA 3C1OA 1U8FO 4CM9A 3AUAA 1W0CA 4GVXA 4BQPA 5IDQA 5C7OO 3N7UA 1MXFA 4XDYA 3PGXA 3GRKA 4FN4A 5THKA 1FDUA 4RQUA 3NGLA 3DBRA 4OHUA 3TZQA 3WNVA 3ZHZA 4M55A 1N5DA 4TMFA 3KLPX 8LDHA 7ADHA 4P22A 2DU8A 1CEQA 3EHEA 2IYPA 2WYUA 3I9NA 5HBRA 4BVAA 2EV9A 1P0CA 5BT9A 5CEJA 1GCUA 3JYQA 2AQIA
chains in the Genus database with same CATH superfamily
1Q0LA 4IIJF 1E9AA 1JP7A 1Z4MA 1FXSA 1Y8AA 3NKFA 2R00A 1GL3A 1PEAA 2GPAA 2VJKA 2XITA 2XWPA 3NQ41 4LTMA 3ZD7A 4KOAA 5H3CA 4HADA 1E2IA 4LKRA 2A0XA 4GPBA 1SVSA 3EIQA 4IGAA 2YKGA 3WMXA 1QE5A 3FPHA 3JWHA 4PN7A 1SCUA 121PA 2FWPA 2X3YA 3A36A 5BXYA 2ZUBA 1F9EA 5DMXA 3JQAB 4BU0A 4ZV4A 1YZ3A 3WNCA 1KU0A 2DR2A 4DWVA 3KTOA 4G1FA 1FUEA 4J1TA 5C8XA 4HXYA 1TLLA 3LMKA 2H4WA 2YINC 4KLRA 2YTZA 4FNGA 3AQIA 1PLJA 2V3WA 4G8DA 5B2EA 3OURA 1QLJA 1I3NA 3FYSA 3D2BA 1QIEA 1G2OA 1GRQA 1IOWA 1T9GR 3COPA 3H16A 3IVXA 3LP5A 5TGZA 1EUYA 5IWAB 1GCIA 1XCLA 1KQPA 1D2MA 2IKQA 1KJWA 1TKBA 2Q1TA 3JATB 4C0SA 4CKBB 1AURA 1N0WA 1FQJA 3U0VA 4E5SA 2IU3A 2VG8A 1BGWA 3ZLJA 1XNRB 3R3ZA 1ZIDA 4LDAA 1EQUA 3ISVA 2I4NA 2HIMA 3JQGA 4WAUA 3TIXB 1H5UA 4CM5A 1Q7RA 2VJYA 4FU0A 1YU9A 4FSXA 4JC8A 5FCDA 5F9HA 4HX9A 1A9SA 1LY1A 1GIAA 1YDHA 1RYNA 4ETNA 1ECFA 2UYCA 3O9VA 3L8MA 3U7QA 2MSNA 3AZOA 3ECSA 3DE0X 4A8HA 2PRSA 3ZEIA 4ZN6A 4HAXA 1AH2A 1XT6A 5FEMA 4EY5A 5FWNA 3IAXA 2DTDA 5U1PA 1LVUA 1ZOOA 2FMKA 3GJ8A 1RIIA 3AW9A 1CJVC 3YASA 2Z83A 4HQNA 3UV3A 2O2HA 4LYEA 3UWOA 4ONEA 4F5EA 1A7KA 4OP1A 4JR0A 1SXQA 2IIQA 1NF3A 3T3OA 1ZPDA 3W5JA 3QVSA 1JQLB 4EYKA 1KMMA 2G67A 6YASA 1NG9A 5L8VA 3U3OA 2CYBA 1CE8B 4I5GA 5JZOA 3TDMA 4JUAA 4K87A 4MVJI 5AFSA 4HPXB 4D92A 2QE7D 5ALWA 5EJ2A 1JEQA 4KZPA 1M2NA 1JR3D 2MSDB 1XOIA 2KYRA 1XG5A 5I8WA 1VLMA 1GR1A 3CPEA 4Q37A 1EZZA 3B12A 3N3BC 5BVHA 4LOJA 4CG2A 3KJZA 1KI8A 3BE4A 4FM9A 1SD2A 4TYYA 5JPDA 3SR4A 1CF9A 1VL8A 2X0JA 2QM3A 1ZCAA 3ORYA 4QEKA 1WMBA 3FPJA 4Z4HA 2CXNA 2E4VA 3MAAC 4W8OA 2C1XA 3JTMA 4FJ1A 1UPCA 3V6LA 2HF9A 4WFJA 1EE2A 1JE0A 4Q1FA 1L5KA 2IEYA 3WHLA 1IIBA 1X1TA 1UQUA 3MWDB 4G36A 4ALNA 2C8JA 1EFAA 2PQMA 4HN2A 4ZK2A 521PA 1IXZA 1ZWKA 4M22A 1KA9H 1T8YA 3KUUA 4QDXA 5E9WA 2R8YA 5FH9A 2QM8A 3FJYA 3V33A 4B81A 4OFWA 2V7EA 1UDBA 3IDOA 1WSAA 2FDXA 2X6TA 3HA7A 4G09A 4IY1A 4K9NA 4EAQA 4ZHQF 2P91A 3OZDA 4PC6A 4Z0PA 3H2GA 4NBRA 2XCOA 4KBYA 1PK7A 1ZINA 1EFRD 4LHSA 3EEBA 3N58A 2FKAA 1EIWA 2ZI7A 1Y4ZA 1TA4A 5CMLA 5DEIA 3A31A 3VAAA 1FEZA 2I3GA 3D6HA 4M8NE 3SKYA 3G0CA 1AGYA 3EE6A 2X9VA 4AKSA 4C0LA 2P78A 4RVOA 4XX0A 4D42A 3HB4X 2QRUA 1EVQA 1TYZA 3TKLA 1M1NB 2VN8A 2GPYA 4FS3A 4JHLA 4DARA 1U8XX 2ZRNA 3FDIA 4LC0A 4EBBA 5C1OA 1BWRA 2WYIA 1M5TA 1T0PA 5KTMA 3FH0A 3HVJA 4X8LA 1J39A 2XA1A 1GAWA 2Y0CA 1N36B 1ISJA 2VDOB 3GPCA 1LB1B 4KPUA 4X41A 3SNKA 3DT6A 2RGBA 4AZVA 4BX2A 3IMKA 2WJPA 2PUEA 2FPGA 1BE1A 4QJ3A 3QEKA 3D02A 5FBWB 2ZRBA 2F3RA 1P17A 1VI5A 1OXVA 2NM0A 2WJGA 4CMKA 1BRMA 3GZ4A 3Q7PA 1GADO 4BNDB 4TMKA 3BCHA 3H18A 4OPMA 4TROA 1ODCA 1YAHA 2G8NA 2GUGA 4ZAXA 4J90A 3WY9A 4WGGA 3W9YA 4GE3A 2I78A 2J4CA 3T9CA 2GYVA 1TVMA 3ZBUA 3VNUA 2Y68A 3ZQUA 1Z7YA 4LSWA 2R44A 3BIJA 2CMDA 1US8B 2VI5A 4NYJR 3ROZA 1XYYA 2PX0A 5TPWB 3BC1A 3D6TB 3O2JA 3WSVA 3ANXA 1C9KA 1YS6A 4EGJA 5GZ1A 3N1UA 5G0UA 3COVA 4XVRA 4O1HA 4YB8A 1C3VA 4DNQA 2DLNA 1WD7A 4MYRA 4K2HA 5AW3A 2XODA 4TTSA 3NTQA 3GUYA 3LUAA 4LCEA 3CG4A 3DO8A 4O2BB 1H2ZA 4HEQA 4L08A 3UXEA 4ARUA 5K6AC 3EDOA 1T25A 1GQ2A 1KO8A 4YALA 3GZNA 5BQPA 1XB2A 2VDUE 2PUVA 4OK5A 2GVDC 5EQFA 4GOND 4DLSA 2C31A 2O8DB 1JHVA 3DP7A 1E94E 3KELA 2AF4C 4PQYA 2AJTA 2QI9F 3IUMA 3OHSX 1MB4A 1GAJA 2OAP1 2CWWA 3OE5A 4BO5A 3PKZA 3F73A 5EZ5A 4LZZA 4KSBA 1VG9B 3E8XA 4N0PA 2CNWA 3H86A 4EOGA 1LC0A 2VHCA 2VT7A 3EXEA 3F9RA 3MILA 4IF4A 4MS3A 1C30B 1OFUX 2ZB4A 4GZ6A 5H0IA 5I8ZA 4FQ7A 2TRSB 3TTUA 2EWWA 3T3HA 3K72B 4EG8A 2BI7A 4WK6A 3TH5A 2OLEA 1QK3A 1Y8QB 3FAZA 2OSVA 1DEKA 3GI1A 1GKUB 1D2NA 2CL6X 2QVZX 4E7OA 5JH7A 3IJEB 1BU8A 5B1DA 1IWBB 4OMCA 1EUCA 5BP7A 4BE7B 1BDBA 5UKDA 2AHOA 1GU7A 1KR5A 4Z1MA 4OHKA 4I5IA 2HB6A 2QMEA 1IH8A 4YR7A 2W93A 2FF7A 5LU8A 3UT5A 3S1AA 3CA8A 1UPAA 3RTDA 5JS6A 3CPHA 4ZGGA 3RRFA 2UAGA 1UMDA 3FRJA 4UHFA 4U6QA 1C3XA 3NDBB 1XMIA 2OM2A 4D26A 4EKNB 2Q5EA 1SPXA 2QUHA 2Z2JA 3UK7A 5IF9A 3A1TA 4PNZA 1KE1A 4YMLA 3TLBA 3DDSA 4O4IB 4QBIA 3LUBA 3EGXA 4G4GA 4L8WB 1EDOA 2I7DA 5IC5A 2HJGA 3E2PA 2QPTA 1XA3A 3QBJA 3GPBA 1NUAA 1E60A 1H2XA 2VXOA 1DOZA 1GOTA 3FHJA 2C97A 5HR5A 1SG6A 2KM1A 3KKLA 3VAYA 3CLSC 1Z33A 4ZT3A 4RD0A 2TSYB 5FWXA 4EW3A 4RL6A 2CF5A 2DE0X 2EWVA 1EK1A 4HV4A 1QG2A 5KOIA 2GK3A 3HHEA 4B3HA 4JQOA 4CU5A 3MC1A 5HM6A 2BGIA 2WIJA 3O8QA 3ELYA 16PKA 3ET4A 4G86A 1KVQA 2HSEA 2XMGA 3KJNA 4PCUA 3HMQA 3UB2A 3WRXC 1L5HA 1W44A 2X1HA 1T35A 1H6CA 3O84A 4P2BA 1NJFA 1AQUA 1DIAA 3JAWA 3D3EA 3P52A 5SZKB 3SJBA 4BQOA 4MUGA 1DO2A 3NHAA 4ZYYA 2ZVQX 4UBLA 4C4TA 1QC5B 2VLIA 4B6FA 1KSJA 3I9V6 1ONOA 4FOPA 4L8LA 2G9NA 3S2ZA 4OSPA 3ZDXB 2Q4DA 4F45A 1J0DA 4RESA 5LQCA 1KI6B 1FUKA 3CXRA 4CKEB 3ANSA 1SD5A 1HYEA 1ORDA 2F3TA 4F3TA 3IJ5A 2I6TA 4KTTE 3ZH2A 4L9SA 4DBVO 4B46A 4DCNA 3AJ8A 3TW8A 3N05A 3H0KA 2VJOA 4U5XA 3CR7A 2E49A 8ADHA 3PHBE 3HCWA 4HB0A 4YIKA 1NXSA 2BCJQ 4G65A 1QH0A 1QFZA 3ABRB 5K7SA 3KVYA 1EINA 3DB2A 1EJ6A 2HHLA 4IO1A 1KY5A 4MQBA 1JWAB 2OB1A 4QKQA 1H22A 3CIFA 3E4CA 3F74A 1GGHA 1EB8A 5NULA 2XI4A 1I33A 3LD9A 5FBKA 3EWIA 2VRCD 2IH5A 3GMIA 3SLKA 2OGTA 1I36A 3AFNA 4JLSA 5EOVA 4NBTA 2GN4A 3AUYA 1U0RA 4Y0NA 3EXG1 3LPLA 4YRRA 1HG1A 1SCKA 2M2IA 2OCKA 4Y2UA 1P81A 1Q11A 2HLHA 3LVBA 4KPEC 3THYB 1L8LA 1VLZA 3BTOA 5AVKA 1Z3CA 3Q6IA 5KWEA 5CFOA 1XZAA 2QMHA 3QEOA 4LJYA 4YJGA 1EUZA 2ET6A 2J5QA 5K0GA 5DH9A 4CEIA 1AUXA 2VQSA 3FPCA 2NZ2A 3RSOA 3T54A 2RHWA 1GYQA 1U8UA 3O3OB 4MQ6A 2J6HA 3TQRA 3C97A 3AM5A 2ODAA 1RXCA 1COZA 4E13A 1GCOA 4CKCB 3AX6A 3INGA 3E84A 1OYWA 1XAHA 2AYZA 3R24A 4IIBA 1NC1A 3QX8A 1QHIA 4DBLC 5B7QA 1P1FA 1ZS9A 2WD8A 3LWDA 1D8TA 1QR6A 3C70A 3IHLA 3IT3A 5K3FB 1H05A 1L6RA 1OBFO 2X0RA 3ETJA 4GXTA 2X5NA 2IX3A 1U7PA 5D1NA 3VI3B 3IXQA 1R4MA 1UKVY 4MPDA 3OC6A 5AVJA 4ZVMA 2IWRA 4CQLB 3AB7A 3F3SA 3QVTA 4JOSA 4XZ3A 4LXIA 4CM1A 3GLIE 3C5EA 1NDQA 2CXSA 4JQCA 1T43A 3I42A 5IC6A 1IN7A 1X80A 1PFUA 3TNDA 4GECA 2WD9A 2PUWA 3RNOA 4AN0A 1O4VA 4DSZA 5IVIA 1SC9A 3IMEA 3VOAA 1B0PA 1V2GA 1MEEA 5AI5A 4DS3A 1X1RA 3UMYA 3RUEA 1P6QA 1Y9AA 3W8RA 3PA6A 1GU0A 3DGEC 2X8AA 3G8DA 2WJIA 4G1EB 4F9EA 5DI3A 3A1FA 3IV7A 4WVLA 3F4LA 2ODWA 1HYHA 1K8RA 1EXNA 2ZVJA 3R3JA 2NU9B 3ROEA 1AT1A 3F1KA 4IH1A 5T57A 4L5YA 2Q28A 4PYLA 1K3FA 1NWHA 2R66A 1EM8B 2PYDA 3M4ZA 3PB3A 1JHYA 2IHBA 3WLPA 3OIYA 4K6FA 1RJ9B 4C6SA 2C04A 3MT0A 1L4YA 5F98A 2JC3A 3QVUA 1JT2A 2FPPB 3M6WA 1Z62A 1MQSA 3D5TA 4WINA 3WWOA 1N5IA 4B0OA 3BOSA 3I61A 4FGJA 1PT5A 4J4BA 2FZVA 3NIBA 4MGYR 4V39A 2PCJA 5TPZA 4BNLA 3AI7A 4YRCA 3UPUA 2JHCA 4BKMA 4B80A 4CQMA 3MOIA 2WU4A 4Q4AB 3BDIA 3UAOA 4FYJA 3VX4A 4ZALA 1U94A 1DKPA 3KE8A 1ZD3A 1O7JA 2F1RA 4LRUA 3SJAA 2ZFUA 3WWYA 2QKYA 2A5GA 2H4FA 4HBZA 4W1SA 4BS9A 1XMVA 2E9SA 5I7SA 4DCTA 4ND6A 2ZJZA 4MV1A 1T9KA 2X4GA 4QZVA 3KQNA 1ORVA 1DI0A 2AZDA 2FEMA 4RJ2A 3GROA 4M6WB 4AM8A 2XVZA 3MJDA 3EX7C 3L46A 1B2RA 1Q21A 3FJ1A 2W6CX 5DJ5A 3RIXA 3OKCA 1TQHA 2RGAA 4X1IB 3NXSA 3CM0A 2QMUA 3LECA 4N0EA 4X7PA 2CFTA 1ESDA 4TV9F 5JZMA 1SCNE 3RROA 1QQ7A 4HNAB 2AFIE 3Q0TA 4XPZA 3TW4A 2LZ0A 1QHYA 2FR1A 4C4YA 3SX4A 3DMNA 3DPUA 5FNZA 5LZ7A 1TADA 4H0CA 4NCKA 5ALQA 2RAFA 2YWHA 4QOEA 3TS1A 1KOGA 1YBFA 1XRQA 3RFVA 3L05A 1S01A 4A6XA 5TX7A 3UJ7A 1N9GA 2VTVA 4B3GA 1PUIA 2WYHA 3WK9A 1RNLA 4JLOA 3LUFA 4GG1A 3ZHQA 1X92A 4DZZA 4CLDA 4IRUB 5J63A 3PEYA 4K88A 1DOAA 1QHFA 3VHXB 1IMOA 4L6IA 3JSAA 4E94A 1LRLA 3EIUA 4O2RA 1G3RA 3DZKA 5CB6A 3M6XA 4LDQA 2VP0A 3NBAA 4CMIA 1PI3A 1R6XA 2Q0XA 3O03A 3LUGA 3RYFA 4CR6A 1NLFA 4NBVA 4ND8B 4AULA 2ACEA 5BUQA 4FXPA 5J47A 5KQSA 1HT3A 2VAPA 1WIWA 2WNSA 4HYEA 5DZSA 2C61A 4W5NA 2ZWIA 3TJMA 1NP7A 4BVLA 1HFWA 3ETCA 3W90A 2CB0A 2BSQA 2JA2A 3DO5A 3MWEA 3T7KA 3VKUA 2OV4A 4TKUA 1YOBA 3RNLA 2IZ7A 3VSDA 3PFHA 2DYKA 4TS4A 2P5TB 2OESA 4Z51A 2WDPA 2ZI5A 1Q20A 1TFRA 2YZGA 3LDAA 3E9EA 5BV1A 4DCCA 2O0MA 1V71A 5L7YA 4E3WA 3HGMA 1F17A 1GHTA 2WZQA 1F48A 4I8DA 4F1JA 3RRJA 1RTTA 2HJHA 2QYHA 3K1JA 4Y0AA 5FA5A 5JEDA 1HK7A 2A14A 5HNKA 3KFLA 3R8XA 4B4WA 1PR0A 4XRGA 1TTPB 2IYRA 4AIRA 1N0IA 1EHIA 5AWFC 3TE6A 4I0WB 1B0AA 4MHTA 2O7SA 2J3QA 2DQZA 2D6FA 2EEZA 2JGAA 3GBSA 4D25A 3CW8X 4ND4A 3RSLA 4BRZA 3QRWA 2E5LB 1Z18A 4RY9A 1G5FA 1FA9A 2GAOA 4RQBA 1KQ3A 3DQPA 2AN5A 4MO9A 2E7ZA 1IPHA 4X7RA 4NYIR 3RVDA 2Q4OA 1OH6A 3DOFA 4FMBB 4G6ZA 3ORQA 4E2ZA 2CL0X 4XWOA 3JAMA 3Q87B 3MGAA 3SK0A 1UJNA 2BVNA 3GMDA 3BIWA 3DKPA 2LIPA 4EQ6B 3IE2A 4G67A 4BGUA 4TTPA 3UT0A 2VZEA 3LU1A 4MS1B 4LNUA 5FLKA 2I0FA 1GRVA 4LX0A 4B4VA 5DW3A 3SM9A 1KU6A 3SQOA 3OF5A 3C48A 1FDOA 2VT2A 4XIGS 1OTHA 2BUAA 2FW7A 4EENA 2GEFA 1WS6A 5CB0A 3WJ2A 1PJRA 4P34A 3AQ4A 2D1SA 3B6MA 1N6PA 1WW8A 1TQ6A 3VPGA 3TSAA 1PL8A 2MYNA 1FP1D 3L6BA 3CNBA 3OZTA 2HC9A 4H15A 1GNPA 2O2SA 1YZLA 1ETHA 1WQ3A 4OB6A 3BL5A 4HLQB 2AUMA 5EP1A 3LWZA 4D81A 5KYUB 4IDOA 2NU6B 3EZNA 1YJQA 3SVTA 2VNHA 4CM4A 1KPGA 1NKVA 4I6JA 3WP0A 5HSGA 1UJCA 3CNLA 3GOQA 3KXIA 3RTEA 2WM3A 3KYDB 1QUFA 4D41A 3KNZA 3ZG6A 4B3IA 3WB0A 3LHIA 3WWPA 1MPTA 3K0AB 4EL0A 1VMKA 1E9BA 1VJDA 1W88B 3BFXA 3VPCA 1QIFA 3BGIA 4TMZA 3C3MA 1SKBA 2F1KA 2VF4X 3HCRA 3LQ4A 5LMCA 2J9ZB 4U2EA 3ZZ0A 2VK1A 1CY4A 1TYCA 2WZDA 3QUTA 2P2LA 3K53A 3LX6A 4N8DA 5CG2A 5AVSA 2WJVA 2ZIUB 1W49A 3E5NA 4PSAA 2GSWA 2HA6A 1O95C 5HW0A 4O4HA 3DYIA 4WLEA 5E4FA 4TTIA 3EC7A 3AHDA 2IIVA 4GEGA 4HX2A 4U6NA 2XDQA 1MOPA 4LECA 1YR9A 1WULS 1Z5WA 2PANA 5E4JA 5T4EA 1KJQA 2VNSA 2RHJA 3KU1A 3VKVA 4BO3A 2GOYA 2C99A 3P8ZA 4NX2A 3GFBA 1GZ7A 4RQTA 1N34B 1U0OC 4O2AB 3HNOA 3K05A 1FSGA 1V35A 5KINB 1OQAA 5ICFA 2I1WA 3P27A 1SO8A 4IICA 5B57C 3OP4A 5F7ZA 4OI0A 3FETA 3VO9A 1OIXA 3KKNA 1E1LA 1CDOA 3MHPA 3CUVA 3PRJA 4X6UA 3BM5A 4JQYA 3O1JC 3DDNA 3RODA 4EVSA 2ZLBA 1SXJA 1WXWA 3TZLA 3JQ7A 2YXBA 5FNVF 3HY3A 1O0CA 4AZSA 1E3IA 2A0WA 3RUCA 3DLIA 1ZGGA 2R8PA 2H1HA 4F4CA 1ENZA 2YWBA 1UXHA 3N75A 1DRJA 1M7GA 2R6R1 3QEMA 4PLCA 5FOVA 1HO3A 3CINA 3RSSA 1E2MA 3WWEA 4E2XA 2VAMA 4IRMA 4KYIB 2ZTMA 4O29A 1HEUA 2GILA 3ASZA 3LO8A 4HMPA 3UYLA 1XMJA 1RDFA 1GG2A 2HPHA 2QTVA 3ONFA 2X2FA 2BBSA 1E3JA 3ISTA 2F1JA 2BFFA 4GX5A 1UH5A 1RZRD 4HWKA 4GNKA 3IDSA 4AJLA 4WKPA 1VL2A 3HRIA 3R7FA 2LKCA 4JODA 3P96A 1T2DA 2IXFA 2YWCA 4HH3C 3TR5A 3U56A 5F1OA 5HS6A 3JQBA 4UTOA 1PO7A 1A7AA 4FJ0A 3PI7A 1Z5GA 1FFXB 5A1JA 1JALA 3EIXA 1DZ3A 3Q2IA 3GQBA 5JY6A 1P0PA 3CLSD 2N1MA 4US0R 3TL6A 1HA3A 4D8TA 2O7RA 1N4DA 1FXWA 3HKEB 3UHAA 2DQ4A 1R4AA 3T5CA 2YYSA 4RYDA 3M9WA 4HWRA 4ZWNA 1M6VB 4D9BA 5BMVB 3NW9A 1J0AA 3C4VA 4GMDA 2CK3D 1AX9A 3E3NA 2CD9A 3KQLA 4AJIA 1O5TA 3I1IA 4R68A 1B1CA 2YASA 3QPAA 3PUJA 1O8BA 2EP7A 4XA8A 5JSFA 2HMTA 2XHZA 4BFCA 3JAKB 2IF2A 5DYWA 1SXIA 4RSGA 4L50A 5A7GA 1E3EA 5EIBC 1XYVA 2XUZA 2P68A 1Z0AA 3TJRA 1NW8A 5E8RA 2ISCA 4BATA 4BUJA 3LNCA 3GLIB 4AVYA 2H59A 4UW9A 4ZI7A 4H3KB 1EA5A 1W1UA 3QKIA 1R0XA 4EI8A 2DCMA 1U3TA 4RYLA 3A9RA 3NBYC 1QFXA 4AJ9A 5HZGA 1UXJA 3NYRA 1DLJA 1M76A 5DGDA 2VTDA 4Q1EA 1DJQA 1MUUA 1YB7A 3OCWA 1MC8A 3VV3A 2D5LA 4EB6A 1I2ZA 1ODLA 2P3SA 2VTEA 2O57A 2QK4A 2RMKA 6NULA 2B7BA 3P0EA 3WL4A 4DADA 3EPKA 4JA2A 5CXXA 4KFTA 4ZOQI 1EP9A 3VO2A 2JAXA 2C9YA 2FHPA 4YJHB 3ZZMA 1Y3CE 1N2OA 4N0DA 2CXHA 1WZ2A 3F3KA 5DHAA 3FZQA 4QO8A 4BNHA 2XUDA 2A9JA 4ND1A 3U26A 4V2UA 3WGVA 1OBHA 4ZOEA 3VUEA 1UP6A 1G9TA 1MHTA 3B5JA 3GQVA 4GWLA 4POAA 2HQRA 2IKSA 1QTRA 3EF3A 4RTNA 4MDYA 3G1TA 2C3UA 3LPAA 4M9UA 3IKVA 2IDZA 3KETA 3FTNA 1P6XA 5T3YA 2WQ7A 1D2RA 4PX5A 1R0YA 1T5BA 3EQ7A 3OLYA 4CIVA 2CHGA 4B7ZA 2WP8J 2WJ6A 1ZDMA 4JJIA 4Y9DA 3N3AC 3ZVRA 2AG0A 2VHQA 2G76A 4KE7A 4MCAA 4N7JA 4FFBA 5IBRA 4YV1A 4YXFA 4HRXA 4RJLA 2H0QA 3EZ9A 4QUIA 5GZ3A 3OLVA 1JXOA 1P75A 3SYMA 1R18A 4ZJPA 1VLVA 3VXKA 4F2PA 1OH7A 2O59A 1IMJA 1M0TA 1G6HA 4RFSB 1CD5A 3KK0A 3OLZA 4Q9IA 4EY4A 1UPFA 1MX9A 3UPTA 5LD2B 2V1UA 3BQ9A 4X6YA 3EZYA 3T41A 2X41A 4EKYA 3VR2D 4H1HA 4UQOA 1MJHA 3B85A 1CHDA 3RF7A 3MLAA 1KDVA 1NY5A 3HCEA 1PWYE 2JGRA 1WV0A 2FWJA 3DVAB 1H69A 3LDFA 1Q0RA 3M2TA 2RGRA 2ZRIA 3JQ6A 1OASA 3O3MB 1ZH2A 3EXG2 4RLSA 1OLUA 2MINA 2VHEA 3BZBA 3EXHA 3TCNA 1E2BA 2AFIB 4ITUA 4MICA 4WBNB 3VSCA 2J7PD 2HH9A 2AQKA 2WIDA 1W1IA 1ZH0A 1C3LA 1NE7A 2A1UA 2HRBA 2PLNA 4M0UA 5LP6F 3WIVA 3WSWA 1VFNA 4M83A 3ZQ4A 1GRRA 4QWWA 2Z58A 1N92A 1QG6A 3A06A 4L3OA 4MITA 4ZRMA 4G24A 1UKCA 1RKBA 4HZUA 1OHHA 2LNDA 1ULAA 1FSSA 3FPFA 4H08A 4PHCA 3ZKAA 4EX7A 4I50A 4K1LA 4WT7A 1RHUA 2XVXA 1EDDA 1KP2A 1OGYA 2Z2IA 4J75A 3IB3A 1CS0A 3L7YA 3T5DA 4BGDA 2YN4A 3I28A 3GAFA 5B1IA 5KMGB 1IBRA 4NLLA 1GZ3A 3OBIA 3R0ZA 1NP6A 4LCBA 1QNFA 1R6AA 4EW2A 2AWOA 2QV7A 2R6JA 4BX3A 1A8UA 1WVMA 1RM4A 4ATNA 4KC0A 4EECA 1G2QA 5B30A 2IPLA 1E9SA 2GKSA 4B6PA 1JMYA 3U3XA 1ML3A 1P4RA 2WW8A 3AERA 1R5OA 2ORED 4GVPA 2P9EA 3NUGA 1CULC 4HGNA 5CDFA 1VL6A 3C1UA 3WWDA 3PDUA 1DTWB 3PD1A 3WGGA 2HCFA 4FYKA 3V9PA 4EYEA 3H99A 1UFOA 5LQNA 2EFYA 3ZWVA 3W6ZA 1UM8A 3DOOA 2JZCA 1ESNA 3OLCX 2HZBA 2P90A 1P2DA 4D46A 3BXEA 4FVTA 2IY7A 1MG5A 1ZRSA 4O63O 5BN3B 3H4TA 4XUDA 2ES4A 1E61A 4R8MA 1GNRA 3PV0A 3QOFA 4RADA 1E1RD 3C24A 1PNVA 4DLWA 2J07A 2RBGA 3VKWA 2SKCA 1A2QA 4GRDA 5EMNA 3AI3A 5AHOA 1GTSA 1ZD4A 2X3FA 3CKKA 4RBNA 2B4YA 1QCDA 4ZQHA 1F2UA 3HUFA 4S04A 2PXAA 1QO9A 4N4AA 4Y6GB 1ISPA 1F60A 1LX6A 1OT3A 1KH3A 1VIMA 2H2HA 2WZCA 3GDGA 3ABZA 3BCSA 3KT8A 3GLTA 1E9VA 1USGA 3DLTA 1QHXA 4MUIA 4BLTA 2O5CA 4MW7A 1GL6A 1QDUA 2XNCA 3ETNA 1FDSA 1XJQA 4WK4B 4PC3A 2EIHA 6LDHA 1J4AA 1NA5A 1VIAA 1DC3A 4GKBA 2ERXA 1J9ZA 4G8JA 4RVNA 2OCPA 3EF1A 4XXHA 1GSHA 1GGVA 4RJKA 1RJGA 3LG2A 3VR3D 3S2GA 2O8BB 3TZBA 3DJFA 3GX1A 2HO4A 1W36B 4X3CA 1EVZA 5EE1A 1X7ZA 1J70A 1U8CB 3A1EA 5HPYB 5GGXA 3RH0A 2JDID 2XRFA 1GQOA 3HJCA 1O9HA 3VZDA 5JSQA 5FFFA 2VDLB 4LJKA 4CNBA 3K9CA 4ZGBA 5MDHA 1PK9A 4F8JA 3GFSA 4ZT5A 1NDHA 2WM9B 2I34A 3L7DA 3PQ2A 4LX8A 4R2WA 5GOZA 3OESA 2DQSA 3V4LA 3KLMX 3PNMA 5FWYB 4AJJA 3JWGA 2W43A 2ZUVA 3BKXA 4GHWA 3SYLA 3RS8A 1YJCA 2FMFA 2W83A 2WFZA 2XVAA 3OZFA 1JVNA 1YB5A 2GB4A 4MUMA 3WB9A 2G5GX 5KJFA 3IL2A 2NXCA 4ZJYA 1QBGA 3RK0A 4EHNA 4MIYA 3EFHA 3QPDA 1MGOA 1SHKA 4YT2A 1TKRA 4G1UC 4X6XA 2WWVD 1ISIA 3RWBA 5FKJA 3O95A 1OE0A 4TWAA 5AKYA 2OAGA 3I52A 3V7UA 4QOIA 4TTVA 5HEKA 3H05A 3RPEA 3WC4A 2VZ8A 2M6KA 1ULSA 1QCCA 2KS6A 2BRUC 4HTFA 2G4VA 1UOQA 2ZU6A 3TRIA 1KFKB 3QLVA 4M53A 4S3MA 5EUQB 3UNXA 2W42A 5TF0A 3U44A 1XXHA 1NOJA 4AB1A 3HJFA 2ZUUA 3PE4A 3RTAA 2J9GA 3TQIA 1ZD8A 3R5JA 4FDVA 4A8JB 2WIFA 2CF6A 3GA0A 2Q6KA 1GU1A 2DG2A 2BEWB 5BWLA 1KP3A 4J2OA 2CUZA 1SCQA 2FNAA 5KDLA 2DKNA 5LDGA 1YFJA 5M2QA 2VHZA 3FOZA 4KQKA 5JUWA 3K2BA 4DR3B 4BN0A 4X5OA 3HA3A 3A4YA 1H1LB 3VTFA 1KJJA 5LDDC 4BVHA 3AV3A 2JF0A 4IHQA 2P65A 1EJ0A 3EXIB 4L85A 3H97A 1CEYA 2UVPB 1FNMA 3DR5A 3CO5A 5GY7A 3IE0A 1B23P 1E5LA 1W2GA 3CCBA 3DXXA 1FOEB 1ZESA 2ZYSA 5IASA 5TQ2A 3ZJTA 3ABQB 2GBFA 4KX5A 4ZZ0A 1DJLA 2YHSA 3FNBA 3K1YA 4RK4A 1A4UA 3OPMA 1NXWA 2VDWA 1PW5A 2VDPB 5EYPB 1XTBA 4OAQA 1IZ7A 3RHSA 4C0HA 3Q3EA 3QJGA 1MO6A 2QX8A 3KQOA 3KTAA 4GYYA 1N9KA 2GD2A 4C0XA 1N2BA 4XYMA 5I4KA 3G9UA 5AQ1A 3COSA 3PWKA 4K6OA 3RYHB 3TLEA 2QRLA 2VAWA 3K0HA 1IIRA 4JLAA 4TLCA 4OJKA 1T3ZA 4HH1A 4FFWA 1FTQA 1SB9A 3B1YA 1J7JA 1YCHA 3BXZA 3BMNA 3EB9A 3IH5A 4KH1A 3GD5A 2J6CA 2AE2A 5E38A 4IIJA 1WNFA 5DCYA 4L4YA 3EASA 1AKEA 3LUKA 3G5MA 3H2YA 3BZUA 3ZU2A 4RPHA 4L72A 1F1JA 2O23A 3P2KA 2R4TA 4AZWA 2E48A 2L19A 1BG6A 2O06A 4X1YA 3TM5A 4CTOA 3WX0A 3KWFA 3RYIA 4IDFA 3R3SA 4NCBA 4N48A 2E6UX 3VVBA 2PQ6A 3LGSA 4EUHA 1X87A 2YFYA 3EGCA 4EK9A 2ZTVA 1E1CA 2ZSKA 3LQQA 4WIAA 2FZGA 4TRNA 2YBEA 1RFGE 5JQGB 3FNGA 4QOHA 4X64B 1NKSA 2BEVA 5DX0A 1ZMRA 3I5XA 3UG6A 3PWSA 1ZN2A 3DTNA 5I45A 1N3YA 4UBNA 1SXPA 1L4KA 1O95D 3O93A 3RK1A 4FMPA 1L5GB 1L3CA 1HDOA 2FWAA 1CUUA 2G08A 3JR7A 1OBVA 1TMYA 3DUFA 4XWAA 3X1XA 4A16A 5TEVA 5FDFA 3ZDFA 2O8CB 4HGZA 1ZIYA 2WBLC 1V48A 3BS4A 4G8CA 4LF6B 4NOJA 5COQA 2O3TA 3SHQA 1BXKA 1M6NA 1GG5A 1U0NA 2OXRA 4RMHA 1JIVA 2PMDA 1B1AA 1C4WA 3G7SA 4OXRA 2AG1A 4L6CA 5BN5B 3V80A 2C83A 5C9ZA 1TDJA 4EATA 1EESA 4LF8B 3UWSA 1H2AS 3GFPA 1R5JA 3H65A 3IXMA 4UZFA 3S40A 3R1IA 5I7FA 5LXTF 3FYTA 1R7RA 3SC3A 1HY3A 3WNBA 2YC2C 4ANFA 5DP2A 4W8HA 5BVGB 3SFVA 4U39A 5JDIA 5JXWA 5D5HA 1UC8A 4WNAA 2P77A 4WXRA 2H65A 4JNCA 5IN5A 4ARSA 3MW8A 5DT9A 5KSYA 2DH5A 4NZNA 1P5HA 3W8EA 3GRPA 2OO5A 4IS2A 3UGTA 1HRKA 4AKHA 4RABA 2BE9A 1D4AA 3SC2A 3O4VA 5J3JA 4HS4A 4HL6A 2CFCA 2QRZA 2C5SA 3D1JA 3IC5A 4XH9B 5T7BA 5FTJA 4KO3S 3PF9A 2I9PA 9ATCA 1TPZA 3ESBA 3DLBA 1LW6E 3I04A 2HUPA 5TNXA 4INAA 2DWPA 1YL6A 1HDZA 4EO4A 4XFDA 3OPVA 3F5SA 5FTKA 3D6FA 1E2LA 4A0GA 2DHEA 1P73A 3W5CA 2VQFB 4DIDA 1ZXBA 2FSGA 2IYVA 4N3AA 4ZZ2A 3B8HA 4H7FA 4P7GA 1ZH4A 2WFAA 4XJXA 3ZV5A 4GMXA 5AOVA 4L27A 4U7DA 1WXHA 5C51B 2WQZA 4LKOA 5LXTB 4WXPA 4ZVKA 1MW8X 3IP7A 3R9WA 1C1HA 2GZDA 2MIIA 1V3QE 4JYCA 1UINA 4L3WA 4UPDA 2K7FA 1CFJA 4EEKA 1WCWA 1L7MA 2PEZA 3TNJA 1CUVA 4KHZA 1MB2A 4NZOA 4RA6B 1Y7IA 4OUDA 4IOKA 13PKA 3RK4A 4JCCA 2F2TA 4G37A 1UAAA 1KOFA 2DP4E 4JWKA 3A04A 1I7QB 4ODIA 4BCDA 1W35A 5FI3A 1JIUA 4I1RA 5G40A 1F12A 3L02A 4OI1A 3KWMA 1II9A 2BEUA 4IZOA 4JP5A 4PAQA 5AI9A 2DTEA 5FL7D 3UXHA 1KZYC 4ZHQA 3I62A 4RF5A 4IGFA 4DT1B 2FQQA 4TMXA 4IGIA 4KQ6A 2JJ8A 3AG5A 3N7AA 3VSAA 2BGTA 2QE7A 4FOSA 5LMNB 1JR3A 4P54A 3O8CA 2VS1A 2VRBA 1ZOPA 3RIMA 3TFOA 5LL6P 1WZEA 3QY9A 5ARDA 5EZYB 4E12A 1E7SA 1EPUA 1K89A 2J0EA 1WKBA 4K9OA 1JH9A 2GD6A 4JEIA 3I6IA 1NPYA 2O1WA 4MGIR 3DFIA 2NYRA 1M34B 2AOXA 3SQWA 4GP9A 4RWZA 4BO0A 2RGGA 1C1XA 4D74A 5I9SA 1LPMA 4DV1B 5ER6A 3K0CA 1QDLB 1BYIA 3KVOA 1Z7EA 3IV6A 1U2TA 3NEPX 5AOCA 1QOQB 1VYUA 2BBOA 3KB6A 5K6RA 3L79A 4O3MA 3AEQB 4MW2A 6ADHA 3RAEC 3BMOA 3OZSA 3HKBB 4K6GA 1JAYA 2QQGA 4QO7A 5J1TB 1CU1A 1NZDA 1PQ4A 1T2UA 4EPYA 1XMPA 5E6SA 2Y92A 3M7IA 2H11A 4ITVA 5I47A 3IP5A 1TJ5A 2JH9A 4NULA 2HKIA 2B6NA 1II8A 4RVCA 4CEJB 1DDIA 1QOZA 5TGDA 3BDAA 3D8SA 4YJDA 3T7AA 1Z0SA 2WPDD 3FCEA 2RIRA 1Y5NA 1EFRA 1XD2B 4FKBA 4Y2XA 1Z8NA 3WLRA 3DFKA 5JNUA 3AFIA 3KKOA 4OQPA 3GJ5A 4HEA1 5G53C 4RKWA 3RJZA 3UJCA 5CNJA 1TLFA 3ZWBA 4MRVA 2C9ZA 1VQ1A 2C29D 3H13A 5BORA 1CDEA 2N1BA 3CB2A 3TNYA 3VBCA 4DIMA 5AKGA 4BV2A 1EMDA 4ZZIA 2QRVB 4DC1A 1UK9A 1CHNA 3D4IA 3HADA 1SUSA 2GF2A 2HBQA 3H5WA 3IDFA 3N2GA 4INZA 4MUFA 4FIZA 3JZMA 4Q4HA 1ZL2A 5FUWA 1I7SB 4XJSA 5BMOA 1FVHA 2V7WA 4IIDA 2VBFA 1N77A 2I1VB 3KSUA 4ICIA 3QVGA 4E03A 1QPBA 3K5WA 5LZ5A 2OFWA 2OOKA 2O8FB 3IUSA 1ORRA 4HQKA 1JU3A 4RE6A 4HO1X 2L82A 3QKWA 4U0JA 2R6ZA 2UYQA 4ZYUA 7REQB 3NGMA 3FWPA 5HS4A 1W8IA 4BV9A 4X24A 1P5ZB 3RYCB 2YWDA 1AKTA 2CE7A 2JI8A 5I4CA 4HDQB 3QEBZ 4QOSA 2YICA 1D1PA 1ZJWA 1SBZA 4R9UC 3H0CA 3IIEA 4NE9A 1XEWX 1CUZA 3H2HA 2GPSA 4A1FA 4RC9A 1H9BA 4OMUA 4I9GA 1B8UA 2C42A 2H17A 2OCBA 2MT9A 4H1VA 1W5BA 2ATIA 3EA4A 1VG1A 4M1ZA 4CTKA 3QQPA 5HRUA 4RZSA 2R68A 1JQAA 4Q18A 4BMOB 2PA3A 5CA1A 4A26A 3G9ZA 3OJEA 4PANA 3K70B 1RLIA 5FPYA 4GPAA 3BJRA 3C45A 1Z12A 3R5SA 3R40A 1T1EA 2GR9A 1W5TA 4QFBA 1PZXA 2AZMA 1MLDA 2VC2B 5DBIA 2ATEA 2WUDA 4Q5IA 3DFFA 3HJAA 3GDFA 4KLAA 4L5IA 1DP4A 2WD7B 4OHBA 2C77A 4TXJA 2CDAA 1M1YA 1O2DA 2PJDA 5ARBA 3H6HA 5ALVA 3HXKA 4N9QA 5ECDA 1VKHA 4P4SB 1MH1A 1TF5A 1LJUA 1T8SA 3LBNA 1R0CA 3MJRA 3L77A 4LGYA 5LBTA 4GRAA 3KG2A 2FMTA 3G23A 1DJNA 2HWXA 1ICEA 4JH0A 2PRIA 3HC7A 5I7UA 3HU2A 1FFAA 3TO5A 1JHUA 1JJ7A 1R2QA 3VBEA 3I8OA 5E9AA 1N1MA 3ISJA 1L7DA 5F2OA 3ADBA 1BE0A 3KCNA 5CLGA 2Q1SA 4HPJB 4QPZA 5C8YB 3WJ1A 3E15A 1OVMA 3CLKA 3P0RA 4IIEA 1DBIA 3V42A 2G40A 3JQ8B 3PX3A 4IBOA 1TIKA 2AFVA 1I6LA 3VGJA 2HNAA 2CHQA 3RFXA 1ZRMA 3FHTA 2GPTA 2VDNB 3EGDB 5LYJB 3GNSA 3JVVA 4RZQA 4BO6A 2ZUFA 2V9CA 2X13A 3PGMA 2XKJE 3IP8A 3SIXA 3TWOA 1XMOB 3E58A 1FFYA 4CI0B 2JFBA 4MWZA 4HUJA 1W59A 3PYMA 3PJFA 1ADJA 2QTGA 2Q27A 1BKYA 2OECA 1XTZA 4GBGA 2QAIA 4G0PA 4K05A 3DONA 5K8JB 2O8EA 1U11A 4ZQBA 2VF7A 2NV6A 1GQQA 3IT2A