3GGPA

Crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
286
Chain Sequence
KSLSMQNVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKRFVGGHPIAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKENVMKAIEGFEKSLNHLKELIVREAEEELVEYLKEVKIKRMEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydrogenase
publication title The Crystal Structure of Aquifex aeolicus Prephenate Dehydrogenase Reveals the Mode of Tyrosine Inhibition.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 105
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3ggpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ggpA01
2O50A 3QVSA 3UCFA 2WD8A 3TZQA 4JX8A 5KJ1A 3RKUA 3FWNA 4UUPA 4BV9A 3UH1A 3FRJA 1OMOA 1KC1A 3OP4A 4UUMA 1E1NA 1HE2A 4RF2A 2V6GA 4PZEA 3ETGA 1IPEA 1FXSA 2HMWA 4WLOA 4HV4A 4PG7A 2O3SA 1UAYA 3PHIA 4WASA 1PS9A 1FDUA 1V8BA 4GMGA 4E3ZA 4YJHA 1JKIA 2LDBA 3SX2A 3ORFA 1QV7A 2X5OA 3K92A 3I4CA 1ULSA 5ITWA 2AEFA 2SCUA 5CHEA 2NU9A 1GYRA 5FEUA 3DHEA 3PYLA 4M87A 4DMMA 3W1VA 1OI7A 1XHLA 2Y99A 3I6QA 5G4KB 5JO9A 4AJLA 2IEBA 1JAXA 4IQ0A 4ZQGA 1XKQA 3B1FA 3EHEA 4P4NA 2C7VA 2V7PA 1G0OA 3T7EA 1JKJA 2JCXA 5EQFA 3QLJA 3ZWVA 2PZKA 3JYLA 1LRLA 4BNWA 3C8MA 3DR3A 3UCEA 1EZ4A 1LJ8A 1LLQA 3PRJA 3QHAA 1PX0A 2G76A 1DC3A 1T2DA 1N1EA 1QV6A 1YL6A 3HHPA 3QVOA 4J9VA 1KERA 2HU2A 2DBVO 1PQUA 1MV8A 3DBRB 1QMGA 2C54A 4L74A 5T57A 1AN9A 2CZCA 2JAPA 4ZA2A 4YTEA 2DBZA 3PQFA 1F06A 5JCXA 1TA4A 2W8ZA 1SCUA 2X0NA 3IP3A 3R6DA 4I5EA 3VPHA 1WDKA 5IZ4A 3D4OA 1SC6A 1PWZA 2QW8A 1ZMTA 4D43A 1I32A 1EVYA 1HDXA 2GRAA 2OP0A 3BTSA 2VTDA 3C24A 4BO1A 3RFTA 4FB5A 1KOLA 3PLNA 1DIGA 2HRZA 1DEHA 1UH5A 1B16A 2AG5A 3DMTC 4PLPA 4EEXA 1WVGA 3GMSA 2PKRA 1PR3A 3OH8A 5BNFA 4E31A 1Q7BA 2BHLA 2W90A 1PR9A 3PGJA 1U8XX 3PFFA 4QSMA 1EVJA 1RPNA 5U4QA 1BSVA 1R15A 4ALLA 2DBQA 2IZ0A 1L7DA 1MFZA 3F4BA 3O9ZA 4MP8A 2PV7A 1C1XA 1C0PA 3PPIA 3OIFA 4RLHA 2D5AA 3OM9A 3W8DA 5T8KA 1T2EA 3GVHA 1NPDA 4PLGA 1HLPA 5C3MA 1RM3A 2JD0A 4CMJA 1ZK4A 1PGPA 4D0SA 3M2TA 3ZWWA 3WOHA 2O2YA 4EJ0A 3GHYA 5A06A 5I7EA 3MTGA 3NGXA 1U4OA 1HZJA 3DBHA 2IZ1A 4BNUA 1HE3A 1E7YA 3RUEA 3UKOA 2VRCD 3H8VA 1K89A 1N7HA 1P3DA 4I9HA 2QRJA 4Q3NA 3EW7A 5KJFA 2YV1A 2PZMA 1U3TA 4R41A 1E7RA 3DTYA 5KWEA 1E3WA 2PH5A 4FFLA 3V1UA 2Y68A 3CSDA 3H4VA 3SC6A 5T6BA 2R00C 4Y9DA 1DO8A 3D4PA 3KBOA 2O3UA 5DP2A 1AHHA 3DZGA 4XQ9A 3E03A 3F5QA 4CQMA 4E5YA 2GASA 3WDSA 4R51A 1TT5B 4W9NC 3PTZA 3SVTA 3PJGA 3BMOA 3HB5X 1KBZA 4FJ2A 1OC4A 3W4JA 4DQUA 3DAFA 2DKNA 4N54A 1E7SA 4IGFA 3QWAA 2D5CA 3GGOA 3GEGA 4DXHA 2GN4A 3JTMA 5EPOA 1GU7A 2C5EA 2G5CA 1E7QA 1UR5A 1I2CA 2IYPA 1H2BA 4GGPA 4RQUA 4EGFA 1WW8A 4LMRA 2OBNA 2FY8A 1HXHA 5HTOA 3I9MA 3PWKA 1NWHA 3QVTA 3ADPA 3B6ZA 2EW8A 5TGDA 1DLIA 3GZ4A 1U3UA 3VPGA 3G3EA 1HL3A 4II3A 4OYRA 2HK8A 4QO8A 5JYDA 1HE4A 2V6BA 3V1TC 4BB5A 3DC2A 4RVDA 4YAEA 1ZSYA 1HWYA 2C0CA 4GSKA 1NR7A 1W4ZA 1UZMA 1I8TA 4UVDA 1O94A 3WB9A 3INRA 4RLSA 3GK3A 1E3LA 3WG9A 2NTNA 1X0XA 3FTNA 1E0DA 3IJPA 4BO5A 3DTTA 3VKUA 2P9CA 3FWZA 4E21A 2VHXA 3RUCA 3L9XA 2VYVA 4IY1A 1JAYA 3X2EA 1B15A 1YONA 3IP1A 4WJZA 3TOXA 5KJ6A 1PS8A 4D0RA 4BNVA 3D1LA 4BNYA 3ZN2A 3VPXA 1CQJA 1GQQA 4QT0A 4WEQA 1YOVA 2VZ0A 1DXYA 3FNHA 4B79A 1CWUA 2P4QA 4J16A 4MJLA 3SXPA 2ZATA 1OC2A 3E5RA 1I10A 2VWPA 1KY4A 4Z9YA 3ZWOA 1DHRA 2YZ7A 3OJFA 2O48X 2HLPA 1M6HA 2WEKA 2YY7A 3OQ1A 3DDNA 4ZQBA 1T1SA 2AHRA 4Z9FA 4CM8B 2RCYA 3OJ0A 3ZGYA 1ISMA 4W6ZA 1GZ6A 4DUPA 1C1DA 4Q3BA 4ZD6A 1Z45A 3IDSA 4CR7A 1BGVA 3H5RA 1O89A 4IZHA 4BO0A 5IDWA 4Y98A 5B12A 3NGLA 3OEYA 4YJFB 4FQ8A 4TKMA 3C7DB 5TIIA 4BNZA 4CM4B 2W98A 4BMVA 1V0JA 2O3RA 1NQAO 3EMKA 2E48A 2B4TO 4IIUA 4KOAA 4PLVA 3GPDG 4CUZA 3IJRA 2F1KA 4RPJA 4HWKA 2YHUA 5DP1A 2A35A 3UHAA 2JJYA 2VWGA 3NDIA 1KIFA 1PWXA 4GX0A 1UDAA 4W7HA 4LISA 1X7HA 4OQZA 5HM8A 9LDTA 1KC3A 1KY5A 1YB1A 4LGVA 4XR9A 3E82A 2JL1A 1VSUA 3GGGA 1DC4A 2WSBA 1DIAA 2G0TA 4M8SA 4AG3A 4CMEC 5CP8A 1VL8A 1SMKA 3ROPA 1GV1A 5COBA 3PEFA 3NEPX 5DULA 3VH4A 4MIOA 1NM5A 4II2A 5H81A 1BXZA 1E3IA 1LSUA 4PCVA 1YL5A 3GC6A 4I1IA 2BF7A 5B37A 4R3WA 1GEGA 3UW3A 4IDGA 4AJ1A 2WD7A 5IDXA 1HDZA 4RPHA 1P1FA 4ND3A 5LCXA 1U7HA 3CE6A 3A28A 4E2ZA 1E7MA 3KYBA 4CV2A 3JQAA 6LDHA 3P2YA 3AM3A 4BUCA 4FIZA 1EVZA 4HXYA 3JQEA 5JNLA 1RKXA 2VYND 3EDMA 4IJWA 3ZNPA 5FFFA 1ZNQO 4FBGA 1D3AA 1X13A 4FJ0A 3ZWCA 4HP8A 4A0SA 3ZWXA 2PFGA 5F5LA 5BSHA 2VUSA 4WPGA 4D45A 1HDYA 3HSKA 4E5PA 3MJVA 4OAQA 3WNQA 2RH8A 1QYXA 3GAZA 1E6EA 3HN7A 4XB2A 1RM0A 3K73O 4AICA 4R1UA 5IZCA 4AL4A 4YJGA 3WFJA 3H9JA 1Y8RA 2PD3A 3PJDA 4M54A 4YAKA 1XSEA 4J43A 3JQ7A 2UYYA 2EV9A 4K1LA 1DIBA 4DYDA 1HTBA 4CLEA 2Q2WA 1RM4A 3AI2A 4TZKA 1PJQA 3S2FA 1GADO 2VZ8A 1P0CA 1W8DA 3GUYA 4I8XA 4ZU3A 2I76A 5I9MA 3JQ6A 2WWRA 3AFNA 2QYSA 1YWGO 5L53A 3VH2A 2O7QA 5TX7A 4FFOA 3NYWA 2C2YA 1DC6A 1T2CA 3QIVA 3OA2A 4L4RA 1CJCA 1PJLA 4XD2A 5JDIA 3VZQA 1QG6A 1LC3A 3D64A 1H9AA 3PVZA 4OL9A 3ENNA 2C82A 4KP7A 2Z1NA 2WYUA 2GGSA 3DONA 1P44A 1YDEA 4J0EA 3RUDA 3UCXA 4GVXA 2A4KA 2JHFA 3PJEA 3PQDA 4GGOA 4LSWA 4HX5A 4MVJP 4B4OA 4YJDA 4RORA 3PHJA 1T25A 4CODB 4U8GA 4DC1A 2H1SA 3GR6A 4EJ6A 1NYTA 3H3JA 3ON5A 3ROMA 4DGSA 3W8EA 3RU9A 1YB5A 1TLTA 1F17A 3PZRA 2B69A 3I9LA 2YDXA 3KETA 3JQBA 2X0IA 4OKNA 2BELA 1NP3A 3MTJA 4JK3A 3RJ5A 4RDHA 1IL0A 3VH3A 3DZKA 4LRTB 1PL7A 4IBOA 3P5SA 3DZHA 1B8VA 3LT1A 3TNLA 1F8GA 5G4KA 3NX4A 1E3WB 1KEPA 5L4SA 1R66A 2B4RO 4AVYA 5A9SB 2HCTA 5DOVA 4XYMA 4IZIA 3JCZA 2FR8A 3OIGA 4BNFA 4ZQFA 2PK3A 1B8PA 3RBZA 4BO6A 1PEDA 2D3TA 3RBXA 1VRWA 1G6KA 1I01A 2WTBA 4GI2A 3KRTA 1VJ1A 3H5NA 3GG9A 2YHIB 2Y1GA 3DEYX 4EW6A 4J91A 4WLFA 3DBRA 4QFDA 3FPCA 3DL2A 3RIHA 2NVBA 1CETA 2J5RA 4AJ4A 2HKIA 4JQCA 2NU7A 1CERA 4ZQHA 3LLSA 3KXDA 3UAGA 4U5QA 4FFNA 1NWCA 4RZIA 5AXAA 4XR4A 4IXWA 2B83A 1A7AA 1DFHA 1Y6JA 3ASVA 3DFUA 4TZTA 2V65A 2GNAA 1Q7GA 2O23A 1PQPA 5CDUA 2DVMA 3WGGA 1TEHA 3EVTA 1LLUA 5A03A 4BKOA 4NBRA 5DCWA 2FSSA 1J5PA 5CPBA 4NPCA 2JHGA 4J90A 3DBVO 4HNGA 4RPGA 4I5FA 1UZLA 3PDUA 4HFRA 5IXSA 3AK4A 1ULUA 3ANMA 1BRMA 1I0ZA 1PQWA 1YBVA 3AUTA 4YAGA 4FW8A 3ZH2A 4IIVA 5FYDA 4B7CA 2C20A 4JJFA 5ES3A 2I3AA 4KTTE 3PYMA 4EZBA 5EINA 4MKZA 3ZW8A 5A5FA 3RC1A 1GUYA 2BH9A 5BQFA 2VHVA 5JAMA 1GCUA 4KWHA 3HQ4O 2BFMA 2OZPA 1ZK2A 1H94A 4AJKA 2B36A 4YR9A 3S2IA 1C1DB 3LC2O 4L76A 3JYOA 5JAIA 2ZKLA 3H2ZA 1YBMA 2UV8A 1FJHA 1QRRA 2ZJ1A 4ND4A 1V3TA 5T64A 3LK7A 5F1KA 2ZYAA 4RGBA 4RDIA 4IM7A 2Q2QA 5LC1A 3NKLA 2WJPA 1NNUA 4MVJE 5IN5A 3D5TA 1TT5A 1LXCA 1JWBB 4XIYA 2J6IA 4D3DA 2AW5A 5T8KC 5A3VA 5BSFA 1ZBQA 1UXJA 5EJ2A 2PD6A 4I9NA 1G0NA 1ZVMA 1LDGA 2PZJA 2CF6A 2C29D 3AM4A 2DU8A 1CDOA 1YKFA 1MC4A 4LSMA 1O9BA 5DDIP 4CLHA 4RF3A 1V3UA 1JN0A 4KWIA 3KLPX 5ICSA 2VWQA 2VHYA 4CQMD 3E18A 5ILOA 1MG5A 1YB4A 5BNIA 5EIOA 1H6CA 5A5EA 5KKAA 1E7WA 4AJEA 1YJ8A 5KIAA 2G82A 2PGJA 2BFPA 5IDQA 2X7HA 4IMPA 4B8ZA 2WD7B 1LDBA 1LSSA 4Q3CA 4NK4A 3AY3A 4GX1A 3SLGA 4UAGA 2G1UA 4BGEA 5COQA 1EDOA 3BHMA 3DMYA 5AXBA 1BMDA 2H63A 5GZ1A 3UOGA 3H6KA 3FF4A 2JAHA 2HMUA 1LLDA 4WE3A 1Y9AA 3TFQA 3UGKA 4RPKA 5L3ZA 1U2GA 4IMRA 3SC4A 3KZVA 4E32A 4A2CA 4W99A 1XLTA 2PY6A 4A73A 4DC0A 3S1LA 1B8UA 2DUUA 3E8XA 1LSOA 3EGOA 3RC9A 3K31A 4IQGA 2IZZA 3C7CB 3G79A 1XQ1A 3ASUA 4AJOA 3EY4A 3GHHA 2ZTLA 5KVVA 5KNLA 3NV9A 1YXMA 4OM8A 4LVCA 3AOEA 3AU9A 4YJGB 5JXWA 4D7AA 1BHSA 1Y8RB 1Z6ZA 2VYVD 3V2GA 2G17A 3PQEA 4J2OA 3GNSA 3HJAA 2AA3A 3R0IA 1YQDA 5A9TA 5FI3A 2VT3A 4S1VA 4J7XA 1PJ4A 4Q3AA 2ZQYA 4TSKA 4E2YA 1Z75A 5ER9A 1WXDA 4A10A 4UEKA 3BXXA 5JCJA 3DXFA 4ZHSA 4OOEA 4E4YA 3E48A 4YJFA 3ANLA 4CV3A 3C1OA 4B3IA 5TNXA 4CM4A 3RBVA 3KB6A 2FOIA 4IUYA 4OSPA 2HMSA 4YB8A 4JP3A 4OXKA 2EG9A 5LDGA 3WGOA 3JQFA 3OQBA 4H3VA 2NACA 1PIWA 5AXDA 3HN2A 2DQ4A 1IZ9A 2E82A 3I9JA 1IHYA 2PKQP 3EZYA 5THQA 2OO5A 3ZV5A 4ALMA 1FDSA 1F12A 1U5CA 3EUWA 1LLCA 3FNEA 2EXXA 5DN9A 1KVUA 4YCAA 5IF3A 1LDYA 1QSGA 4CPDA 1GEEA 3WXBA 3P19A 3IS3A 3SJUA 3GH3A 4EEZA 1M67A 4NJMB 1LDEA 1FF9A 3GNQA 5DOZA 2YV3A 2BFAA 2DT5A 2CNBA 4Y6SA 1R12A 4D44A 1N2SA 2HAEA 3U5TA 2A92A 4Z3KA 3Q6IA 1HYEA 5L40A 4BNIA 3COSA 5A05A 4DPMA 3PI7A 4Z3DA 3ICCA 4E2WA 1H9BA 2NQ8A 3RC2A 1O0SA 3JD0A 4XJTA 1UXGA 4Q9NA 4M1QA 3DOOA 2BFOA 1RJWA 4CUJA 1G1AA 1QYVA 3GF4A 4HUJA 5TLSA 3NTOA 3WGZA 1DBVO 1M66A 4DMLA 3WGIA 2YFHA 3FSRA 3M6IA 1EQ2A 4ZICA 1X14A 2QQ5A 3BYZA 4Q3EA 4IS2A 4F3YA 4JP2A 2X0RA 4B7UA 4RV9A 3ZWPA 1WLYA 2CUKA 4KZPA 4QECA 4TRMA 4XJSA 3C1TA 4PVCA 1R0LA 2D8AA 4MVJF 2HSDA 3IL2A 2GZ2A 4TWRA 4UUOA 4L9RA 2AQHA 3JQAD 1Y5MA 4GL4A 4ILKA 3K2BA 1YS4A 3E9NA 2VHWA 4O63O 5CAEA 4N5LA 3LQFA 9LDBA 4N7RA 1DJNA 4M49A 4A27A 3O4RA 3LSYA 4HNHA 2YFQA 4CL3A 2EEZA 1GY8A 5T5QA 5I8ZA 1GAEO 5DCUA 3ZHYA 3MJ4A 1IB6A 1DIHA 3GY0A 3V2HA 2H6EA 1NQOA 3H5AA 4BO3A 4P4GA 4CM3A 1LU9A 4J1NA 2Y0CA 3NJ8A 5JPIA 4FOOA 1TB4A 3IIEA 4NFSA 1HF3A 2BRUA 1QKIA 4PLZA 1WAMA 2FRDA 4CV1A 2ZIZA 5L7TA 4XDZA 4DYVA 4KDFA 4FFPA 4NG5A 4RZHA 3WGTA 3A14A 4GAEA 2H5LA 4P38A 3L0DA 4BKPA 5I8WA 3GFGA 5C7IO 1GPJA 1SAYA 5HRUA 3NAQA 4KMSA 1H93A 5G0VA 2DAPA 2OORA 1LEHA 4CM1A 2NQTA 4RF4A 4PN3A 5IZCC 4KQWA 3TL3A 4BO4A 1ORRA 3PP8A 4FGSA 4GH5A 3SEFA 1J4AA 1J6UA 4YPOA 2CVZA 3OECA 2Q2VA 5ENDA 1ZIDA 5TJ9A 5L4NA 2XXJA 1PGNA 2YUTA 3B1KA 2AE2A 2EP7A 1D1TA 1IULA 5KOIA 2B35A 4WKGA 3VZRA 3HDHA 2X9GA 3AUAA 4E6PA 3KTDA 4F6LA 4OH1A 3UXYA 1HDOA 3AI3A 5ICMA 5A9SA 3L4BA 2AEMA 1XIVA 2E37A 1T1RA 4N5NA 5TS3A 4BGIA 2X9NA 4K9DA 2A9FA 3TN7A 2ZB3A 3GNTA 3IQDB 3BIOA 4IJUA 3AU8A 1JW9B 4XYBA 1P77A 4AJ2A 2FMUA 1X0VA 3CIFA 3DAGA 2QG4A 4LMPA 3ITDA 2YHIA 1GUFA 3VHRA 1YQGA 1PGQA 2PZLA 3BZUA 3RASA 2ZB7A 4F6CA 3NT5A 3K96A 3EVNA 2OOSA 2FZWA 2XPCA 2OHXA 2HK7A 1JTVA 4FCCA 4PLFA 2XOXA 3A9WA 4PG8A 4QO7A 4Z0PA 3MOGA 4BNHA 2I66A 4QXMA 3ZWNA 3UVEA 3T4EA 4BKUA 3TRIA 1ISJA 3TZCA 3JQBC 4BNGA 1PS0A 3QQPA 1GUZA 3ZW9A 4NR0A 2X23A 3DZBA 4TKLA 5IFLA 4N5MA 3H9GA 5F5NA 2YV2A 3D3WA 3LT2A 3DBLB 3QWIA 3FTPA 5DCYA 2E49A 2QYTA 5I9LA 1IY8A 4FFRA 2PTGA 3S2EA 4BGUA 3TZHA 3TJRA 1BDBA 4CV0A 2B37A 3MJCA 2ZTMA 3QJ5A 4J4TA 1QYDA 2DFVA 2P2SA 2FZEA 2I9PA 1UZNA 4DLAA 2VZ9A 2WDZA 4RVGA 3QSGA 3QE3A 3PGXA 4LK3A 3WYEA 2CY0A 1SOWA 1IPFA 1DDOA 1ZJYA 3GDGA 4OGWA 3W6UA 1DOHA 4L0QA 3OFSA 2Y1FA 1BG6A 4E12A 3PLRA 3K8ZA 4X54A 4CLRA 1ZSNA 1U2DA 2C7GA 5TJHA 3H9EO 1VM6A 1MA0A 3M1LA 1DSSG 3WYCA 2POQX 3BHIA 4JGBA 3GEDA 4M55A 3BTOA 3IMFA 1OOEA 1ADGA 3STHA 4IXTA 4C7KA 1XEAA 2X8LA 3CUKA 3DOCA 3R3JA 1K0UA 1BVUA 2GPTA 4QFCA 2P4HX 1YGYA 1HKUA 1OBFO 4R16A 1LC0A 4NNJA 3VC7A 3VVBA 1RWBA 1NVGA 2Q50A 2PGLA 4LVUA 3LC1O 2PR2A 5AXCA 1SB8A 3ABIA 4IJVA 3ITKA 3SJ7A 4DQVA 3FNFA 2UUPA 1C0LA 4PVDA 3Q2IA 1SPXA 1E77A 3H65A 4IGEA 3L9WA 4WCFB 1A7KA 2YQ4A 2C59A 1UDBA 3EK2A 4IDAA 2F00A 3ONFA 2GF2A 4KTVE 4L75A 5L7YA 5IXYA 3L6EA 1I5RA 3WQQA 1J49A 4I5GA 1F0YA 4XB1A 1A71A 1EK5A 4MVJM 5JLAA 5B4TA 1AGNA 1N5DA 4A26A 3K30A 1VJTA 3PWSA 2IXBA 4GBJA 4F45A 5HS6A 5CDTA 5EERA 5A3JA 2BD0A 4UREA 3OETA 5MDHA 2PWZA 1X15A 2PNFA 1UXKA 2WMDA 3DFZA 1K6XA 3GVPA 1MLDA 2IDZA 5DZSA 3WQRA 3I5MA 4NIMA 4DPLA 1P1IA 1IHXA 3EZLA 1E6WA 1TXGA 4R1NA 4UEOA 3KSUA 3IC5A 3JQCA 3VPSA 5KKCA 5U9CA 2EIHA 1VKOA 2O2SA 4DIFA 5JAQA 4WEOA 4KUHA 2QIOA 1HDGO 2EKLA 4Z0HO 4BO8A 1E1LA 4RF5A 3FD8A 3GVIA 3WSVA 1A4IA 4BQPA 5JSFA 3WLEA 4B3HA 3KVOA 4MO2A 2FN7A 2TMGA 4AJJA 3OIDA 4UVEA 5JC1A 3OF2A 3TZKA 1FDWA 1P74A 1Q0HA 2NLOA 4BMSA 4CUKA 1GYPA 2IODA 3GQVA 1WNTA 3IOYA 3B1JA 3CTMA 4JJIA 4MVJA 1LNQA 4CMHA 5K6AC 2VCYA 2JFFA 4YRDA 2ZQZA 3I6IA 1KS9A 1EUCA 4MDHA 3JQGB 1ZEMA 1MXHA 3GAFA 1NHGA 4YRBA 1CQIA 1OAAA 5DT9A 1LX6A 1B7GO 3JQ9A 4CMKA 2GYYA 4RQTA 4YWJA 4EUFA 3CMCO 3ZNOA 2AMFA 3MZ0A 1H6AA 1XCBA 1HDCA 1WDLA 5JAZA 4OSOA 3RUAA 5I7VA 1T4DA 5JCJD 5L95A 5L9AA 1I3KA 1IYZA 4R1SA 2EERA 4PIVA 4MP3A 3QVXA 3ZHXA 1IE3A 2CDBA 3G0OA 1TVEA 4RVFA 1S7CA 1Y8QA 4NJMA 4RVUA 3ZV4A 5CDYA 1VC2A 1UXIA 3I1JA 2RHRA 4YDRA 3KV3O 3ETDA 4ROSA 1ADFA 2QRLA 3AOEC 1I24A 1T4BA 4TRJA 1HYHA 3DHNA 3T4XA 3UICA 1ENPA 3FCOA 3MJEA 3CXRA 3K5PA 3TFOA 2GUGA 4W9NA 1C0KA 2BGLA 2A94A 1NHWA 1VE9A 3VZSA 3C1AA 3I9NA 1B3RA 1PJ2A 1P0FA 1A4UA 4MKXA 4PLWA 4INAA 1NPTO 5THKA 4YYZA 3O38A 1I3LA 3G1UA 1LRKA 1DLJA 4R5MA 4GLLA 5C37A 2GO1A 4ID9A 1YL7A 3FN4A 2Q3EA 3JQFC 4XGKA 4BGVA 1SO8A 2I5PO 2O7SA 1EFKA 1QXSA 2YYYA 3I52A 3V1YA 4DIOA 1GTMA 4AJPA 4DWVA 1UP6A 2EKPA 3PHGA 3W6ZA 4C7JA 2DPGA 2ZCUA 3E6AA 5L7WA 2GLXA 3PFWO 3ZV3A 3AI1A 4S3MA 2E4AA 3BAZA 4R5HA 1ZXLA 3PK0A 4OKIA 1PSDA 1L7EA 4XYEA 2W4QA 4Z0TA 2Z95A 4QX6A 1VI2A 2OUIA 2PD4A 2B5VA 5B4VA 5CFZA 2BI7A 5TT0A 1ZKMA 1NFRA 4CQLB 3ZU3A 3UFXA 1AUPA 3WBBA 2DPHA 1HLDA 1DB3A 2X58A 4B8WA 1JVSA 3F9IA 4RVHA 3KYCB 2Z1MA 2VNAA 1WP4A 1U5AA 3TWOA 3E5MA 4OJNA 1K6JA 4E5MA 1N1GA 4BNLA 3GT0A 1MC5A 1ZMOA 2DC1A 2PH3A 4MIEA 4YT5A 5CG2A 3FBGA 2HRBA 1JU9A 4PLCA 4B4WA 4FSHA 1FMCA 2VUTA 3U4CA 5JY1A 3D3WB 5C7LO 5TSDA 1EE9A 3EYWA 3N7UA 1ISIA 1ZW1A 2VHZA 3D5QA 4BNJA 5F1OA 3WQSB 3VDQA 1D7OA 4B3JA 1GZ4A 3HNPA 4NU5A 3I23A 3CPSA 2Y05A 3AFMA 4J1SA 4FOSA 3WJ7A 1GDHA 2D59A 1ZH8A 2QZZA 1TT7A 1RM5A 2NWQA 3ADOA 4ZJUA 5JFOA 3GGPA 2Y66A 2DTEA 4PRKA 3W4KA 5FWNA 2X6TA 4H7PA 1NQTA 2FPGA 1F14A 3PHLA 3NTRA 4CLRB 2H9IA 3MJTA 3D4NA 3G17A 4FS3A 5U1PA 1DPGA 1E3JA 2Y1EA 3BMNA 3ZDFA 2X86A 2NVUB 1M76A 1GCOA 2EF1A 3L4SO 1I2ZA 1E6UA 4TROA 3ONEA 5B1YA 4MKRA 3F4LA 4JCOA 3AJRA 5KVCA 1XG5A 3NDRA 4ALJA 1PJBA 3HADA 4H16A 2ZJ0A 4QEDA 4CMEA 1WWKA 1N9GB 4A7PA 5G0SA 3RUIA 2Q1UA 2CMDA 1QP8A 1M2WA 2J3IA 4U6SA 2JFHA 1XWFA 1ADBA 2RBEA 4TVBA 4IINA 1S6YA 1HSZA 1SZJG 3CZMA 2WM3A 4O0LA 3U3XA 5I7FA 4Q39A 3GOHA 4FJ1A 1WPQA 3OMLA 1CIVA 1JA9A 4YAJA 3INGA 4WLNA 2Q1WA 4RO0A 1VLLA 4FC7A 2B0JA 2Y0DA 4CM7A 1K5HA 4YT2A 2ZB4A 3BA1A 4P22A 4XRGA 1LDNA 1UXHA 2C2XA 4P8RA 4J9UE 1SBYA 4BQRA 1DFGA 3I4FA 4GSLA 4HADA 3U9LA 1E3EA 4FGWA 3B20A 3RD5A 4J4BA 2DTXA 3RFXA 5IG2A 4DREA 1ENOA 5FF9A 4K28A 4NK5A 3GZNB 4J1QA 2OBYA 4KQXA 2AQ8A 5JMWA 2CF5A 4YACA 2QZ9A 1I3NA 1ZFNA 3L6OO 2Q45A 2VT2A 3LT0A 1AHIA 3OSUA 3WBFA 2ZYDA 1ID1A 3WWZA 1NASA 4M89A 4PLYA 3DBLA 3N74A 4MVJH 2DLDA 1ARZA 1U7TA 3NT4A 2GZ1A 5DBFA 4BO7A 3QW2A 4IDDA 4NU6A 3L4BC 2AE1A 2VYNA 3ST7A 2O3JA 4E30A 3U62A 8LDHA 3OJOA 3RAJA 4AFNA 2JCVA 3CMMA 4NBVA 4BKQA 1KVSA 3L77A 1Q2XA 4QTZA 5H82A 3GRPA 5TT1A 2ZYGA 4EBFA 4NZ9A 4PZDA 4BL5A 3JV7A 4ZGWA 2Q46A 4G5HA 2BKAA 5HBRA 1OFGA 1QYWA 3WNVA 2GCGA 3LDHA 3ROKA 2GN6A 2BI8A 4ND1A 3AY7A 3D7LA 3OJEA 4L8VA 1LQTA 1QORA 1YRLA 2VQ3A 3PHHA 1ZK1A 2GN9A 3PIIA 1L1FA 4DTIA 2YW9A 4HFMA 1A9ZA 4URFA 1AXEA 4XWYA 5FI5A 4QUKA 4FD3A 4O6VA 1N8KA 4RPLA 2Q1SA 2J8ZA 3LZ6A 4FPXA 4XRRA 3ICPA 5AVOA 3UF0A 7ADHA 3RUFA 1H6DA 4CM9A 2PGDA 1D4FA 1EE2A 1D8AA 4QQRA 5COAA 1NVTA 1A72A 3TQHA 1RYDA 4R54A 3H7AA 4LRSB 3AY6A 5GMOA 3I3OA 1LQUA 1Y1PA 1T2AA 3K6JA 4BO9A 1BVRA 4HFNA 3B70A 3WGHA 4YQZA 1NR1A 2EWMA 3MWDB 3PYXA 1I2BA 1PZFA 3RWBA 4K6FA 1U8FO 2Q49A 4J2HA 4MVJI 3IUPA 4WCFA 4EUHA 3TDKA 4XQGA 5ITVA 3TF5A 1DRUA 1VKNA 1PJCA 4FFMA 3H9QA 3C7AA 4GWKA 1Y8QB 3O03A 5JO0A 3WGQA 4BVAA 1RYEA 3TSCA 3VOSA 1M75A 1DC5A 3WFIA 1EUDA 3ZV6A 2Y0EA 3R1IA 5TF4A 3GDOA 1YO6A 1Z74A 4FN4A 2FR0A 2NV6A 1DAOA 4IDFA 2BGMA 2BMAA 2NTJA 3AUSA 4JJGA 3U4DA 3E9QA 4ESOA 2W2KB 1Z7EA 1AXGA 1P1KA 4CMGA 4BKRA 1I36A 4EJMA 4R01A 4KUGA 2FSVA 1GZ3A 5JC8A 1SB9A 3GFBA 4DRYA 1ENZA 4TMFA 3C3XA 2HJSA 1VL6A 2J3KA 2P5UA 3OHSX 2HQ1A 3NJ4A 3RU7A 3D3EA 4XGIA 3GMDA 3KSDO 3HWRA 5AQ1A 3HB4X 1ZK0A 5CEEA 4PFJA 4DBVO 3KEOA 4MP6A 5GZ3A 3S2GA 3FPLA 3DQPA 2J3HA 1ONPA 3A06A 1NAHA 3RUHA 2EHDA 2Q1TA 5F1PA 2CDAA 4FR5A 4WCDA 4I5DA 3ZWBA 1IOLA 1KEUA 2D1YA 3ENKA 3EAGA 1U1IA 1T24A 3BHJA 3CKYA 2GN8A 2AG8A 3BMCA 3GG2A 1BW9B 5I7SA 1DRVA 1P1HA 2C07A 5EESA 3IKVA 5BR7A 4J6FA 1Q7CA 5CEFA 2C5AA 4HY3A 4DPKA 3M2PA 3F46A 5DF1A 2ZK7A 5K9ZA 2HDHA 3AM5A 4YT4A 2HMTA 1UAGA 1JLLA 2VTEA 1X1TA 3TL2A 3AUUA 1EVIA 3F47A 2R6JA 1ZZEA 1GPDG 1YVEI 1HRDA 1ISHA 3JQGA 5K0ZA 4OXYA 3HG7A 4JIGA 1B26A 2J3JA 3GVXA 4YQYA 1IUKA 3W8FA 4BS9A 4D46A 1KETA 3LF2A 1BXGA 3JQ8B 4GKVA 4WK6A 1ONOA 3NT2A 3GDFA 4UULA 4O5OA 1Y5RA 2VUUA 2IEDA 2NU6A 4PGFA 2FPPA 4MVJD 4NQZA 1QYCA 4XA8A 1C3VA 3EC7A 3KSZO 2D4AA 4AJHA 1R0KA 3ZNQA 3DHYA 1EEHA 2DTDA 2VOEA 2ZCVA 1LDMA 4YRAA 4E5KA 1GL3A 4M86A 1NBOA 1LRJA 3O8QB 3F1LA 4R3NA 4GQAA 4GX5A 4WNCA 1IZ0A 3BMNB 4J49A 2CSUA 1LA2A 1U28A 5JY6A 1XYGA 4L4SA 4IDEA 2O4UX 1CEQA 2UDPA 3NRCA 1H2HA 4Y67A 3P2OA 1PZHA 3VTZA 4Y6RA 3JYNA 3ZZNA 4BHTA 4OQYA 2RIRA 4B4VA 5JDCA 4JBGA 3MWEB 1PJTA 1D1SA 4PG4A 3DZIA 4JBHA 3HDYA 3JQ9C 4E2XA 4D41A 1Z7BA 1ZSVA 4JBIA 4UVIA 2EGHA 5JDIC 4IJKA 1NTOA 2X4GA 1BTOA 3BTUA 3VZPA 4EITA 2PA3A 4XYGA 2OGUA 3FI9A 4YVFA 4CM5A 4P4LA 6ADHA 1EBUA 4JROA 5DNAA 4NI5A 3QRWA 1ENYA 4J1TA 4IS3A 1V3VA 4CLXA 4CQLA 3E1KA 1ZUD1 4G81A 3WGYA 3I9KA 2P91A 1GYQA 4OIMA 1GV0A 4XQEA 1Y7TA 1X1EA 3KYCA 3KYDB 1R4MA 1R37A 3I9OA 3L6DA 1XELA 3X2FA 5L45A 3Q0EA 3ZWYA 4NFHA 1NAIA 2NTVA 3BMQB 4TRRA 4GVLA 3ZU2A 4CMCA 3RCBA 3WIDA 1NPYA 2CVQA 3RROA 1Q0QA 5KCZA 2GR9A 2FR1A 4FDAA 4Q3DA 5TQVA 1CF2O 1E3SA 3V2UA 4YA6A 1P31A 4NJOA 3DOJA 3LT4A 4NFYA 4CL8A 1NVMB 4RVSA 4CMAA 2O3QA 4E5NA 2IYOA 2EJWA 1U9JA 4BV8A 4K6CA 2D0IA 1CYDA 3O26A 1A27A 4BB6A 2W2LA 1O6ZA 2CD9A 1WMBA 5IAAA 4MVJG 2NVWA 3PIDA 5ILGA 1T2FA 4GX2A 4N18A 3QY9A 3OQ6A 5A04A 4PLHA 2BGKA 3CINA 2OP1A 2X22A 3F6YA 5BT9A 7MDHA 1M6WA 1VSVA 1FK8A 3WYBA 3ZNNA 2NVUA 2P68A 4LCEA 3HZZA 2EJVA 2P9EA 2GSDA 3Q2KA 3WWYA 4AJIA 5B4UA 3DAPA 3WIEA 4JLWA 2XXBA 1GD1O 3PDJA 4CMIB 4XZ3A 1N9GA 4PZCA 5C5IA 4WLEA 3KEQA 3VKVA 5JE8A 2XAAA 4I08A 4YXFA 5GZ6A 3ZHZA 1DHTA 1UP4A 3VPFA 1LI4A 1B2LA 4RJTA 1K2WA 3QVWA 5MGBA 2NADA 1PJ3A 4R1TA 1A5ZA 5G0WA 1ZCJA 5A9RA 4DA9A 3HDJA 4E13A 1NX6A 4J3FA 2E6UX 4IQ8A 1ADCA 1HYGA 1EK6A 3RI3A 3GRKA 3ZWMA 3JD4A 1XGKA 2X5JO 1FDVA 3GEMA 5JW6A 4J7CA 2Y1CA 3U49A 3ZCXA 1HDRA 4DLBA 2Q4BA 1E1MA 1GQYA 3FR7A 1ML3A 3GZNA 2VOJA 1YJQA 3QWHA 2WYWA 4HKTA 3OBBA 3E9MA 3TZ6A 3P7MA 5ADHA 5TC4A 1EDZA 1BDMA 4LN1A 2NM0A 3INTA 5DBIA 3RKRA 1X7DA 2X0JA 4NH4A 1NQ5A 3Q3CA 3ZU4A 1C0IA 5H83A 4U6QA 1QLJA 5LDHA 1MB4A 1E5LA 2PKQO 3DZJA 3OA0A 3VAZA 1PJSA 2RH4A 1NFQA 4GWGA 1XU9A 4C4OA 1PU2A 1KYQA 1P45A 1T26A 4CLOA 4YJHB 4R9RA 4MOWA 1R16A 2JCYA 3WLFA 1EUZA 3JSAA 3JYQA 4BMNA 4AJNA 4NDNE 5L51A 1HETA 4JNKA 3DMTA 2GERA 5EN4A 5CDSA 2I99A 3LU1A 3N58A 2Y93A 3QWBA 2JD2A 5EL0A 1XR3A 3T7CA 3BMCB 4PG6A 4R68A 3ZHBA 1H5QA 5J23A 4ZRMA 4RCVA 4XGNA 2IE0A 3RFVA 1CRWG 1VPDA 1Y9EA 3FHLA 1MGOA 4K26A 5G0TA 3TPCA 1MXFA 3ETEA 2QRKA 1ZXBA 1N92A 1F8FA 1SOVA 4MIYA 4B4UA 3ROQA 5A02A 1PGOA 5CDGA 2J5QA 4R9SA 5IDYA 5KTKA 4A5OA 3GLQA 1P9LA 3IUSA 4EUEA 3RC7A 1V9LA 4U0KA 4W4TA 1P33A 2DBRA 2UAGA 1JQBA 4WOJA 4ZQEA 3QV1A 3DO5A 4D42A 2UUOA 4WLVA 1O8CA 1BXGB 2CVOA 1UJMA 1P1JA 3S55A 3KLMX 3KUXA 1ZEJA 2NNLD 4NBUA 1ISGA 4B7XA 4TQGA 1B3BA 3JD1A 5BSGA 2WYVA 2B5WA 2BLLA 2ZTUA 3HE3A 4CM9D 3KOUA 1SEVA 4DLLA 4CR6A 2I65A 3M1AA 1SEPA 1R4NA 1UP7A 2J5KA 1KVTA 5HA5A 3FR8A 2O3TA 2OL4A 5I9NA 2R00A 1C14A 4CJXA 3IKTA 4XCVA 1LTHR 4Y6PA 4BNNA 4A03A 1U3WA 4DBZA 4CMBA 2IXAA 2D2IA 4GLOA 3RVDA 1DJQA 4BNKA 1O95A 2JFGA 3F5SA 2V6MA 3CEAA 1NFFA 1YDWA 3OJLA 4D3FA 4NBWA 1C1XB 2RHCA 4ONEA 3WJAA 1EBFA 2CDCA 1K6IA 2W2KA 4ND5A 5KJEA 3S8MA 3U4HA 1JVBA 1MUUA 4XQCA 2VRCA 5AOVA 4Z9XA 4KDEA 2XF8A 4J0FA 3V5NA 2Z5LA 2X1HA 1KEWA 4NBTA 2EGGA 1H6BA 5G0UA 2YDYA 3C85A 4WGGA 3H2SA 4XDYA 3FNGA 3GA0A 1HE5A 4YAIA 4ZVVA 4PRLA 1VJ0A 3DBHB 3RJ9A 2X5KO 4GKBA 4PG5A 3RQSA 3F1KA 3G49A 3ZU5A 4ALIA 4BOYA 2HO5A 2QHXA 5ENVA 3HDQA 2GDZA 2V6FA 3H3FA 2AQIA 3ZI0A 1PL8A 2GZ3A 2FWMX 2GD1O 4WCFC 3WX0A 5BNTA 3GUCA 3HFSA 1BW9A 2DFDA 1Q0LA 4ZRNA 4IPTA 3VVCA 1I3MA 2R2GA 1U3VA 2OXIA 4CR8A 3WSWA 4CQMB 1R4MB 2RAFA 3WS7A 2DM6A 2HMVA 3LC7O 3PXXA 4UVHA 1JDJA 3LVFO 3UUWA 1ZO8A 3D0OA 3WTBA 1P1RA 3BMOB 4UVGA 5ER6A 4O59O 3NUGA 2AEJA 3TOZA 4I9UA 3KM0A 1EQUA 3BTVA 4XEHA 4U0JA 3ZWAA 1TI7A 2JD1A 2AQKA 1E1KA 3AWDA 4E0BA 1K3TA 1LSJA 2NU8A 3H9UA 1HSOA 3JQ8A 4XKJA 3CH6A 3PWZA 1A9YA 1KVRA 1KVQA 3SLKA 1GQ2A 2Q4EA 3GPIA 5GY7A 1QR6A 4BNMA 3QWFA 1ZJZA 3F3SA 3Q9UA 4D3SA 4G2NA 4UEJA 4TVOA 5IJZA 1EMDA 1J0XO 1XDWA 4ALNA 4DL9A 4W7IA 1PZEA 4OMUA 4EYEA 3O8QA 1B14A 3ULKA 1MP0A 4UUNA 3GN1A 3UN1A 3JD3A 5C7OO 1Z82A 5EMHA 2VN8A 5KVQA 3MOIA 1E92A 5L4LA 1H0KA 1YH3A 2AXQA 2I3GA 4E33A 4XIJA 1YOVB 2I6TA 3G1TA 1DRWA 4WUVA 3HUDA 4EI2A 4IDBA 3GVCA 1V6AA 4R69A 4WECA 5G2OA 3NTQA 3ONDA 2JKVA 5F21A 1MX3A 2PLAA 2UVDA 1JWAB 1E5QA 1XQ6A 4HBGA 4FC6A 2TMDA 3SBOA 3WICA 1BXKA 1U4SA 4HFJA 5CPFA 3LLVA 5T67A 3I83A 1WMAA 3Q1LA 1GR0A 5AYVA 1Y81A 4GPD1 4TRNA 1PGJA 1FDTA 3VDRA 3VH1A 4NHEA 2HK9A 3LF1A 1PZGA 1VL0A 3DB2A 4J7UA 2EP5A 4D79A 4DVJA 4L73A 4EDFA 3A4VA 2Y1OA 5IN4A 4CLDA 1DIRA 1YQXA 3K9QO 4YBZA 2WE8A 4J4HA 3KYDA 4DIBA 3PJFA 4OHUA 3JYPA 3MJSA 4NMHA 2HUNA 4U7WA 3BMQA 1SNYA 3KO8A 4WOKA 1WDMA 5G4LA 2IRWA 4ALKA 3RSHA 1N7GA 8ADHA 5JS6A 4YEDA 1YBAA 4KUEA 1W0CA 3ANNA 4ZN6A 5BSEA 1JKFA 1ZK3A 2NUAA 2Q99A 2FPIA 2QX7A 4MPDA 5JDCC 4XYLA 1UUFA 2FP4A 4ND2A 3L07A 3KHUA 4BNTA 3QP9A 5KJCA 1GFSA 3AOGA 3VTFA 4CLOB 4R4JA 5HS4A 2ILTA 1O5IA 2YQ5A 3DZFA 4BNXA 2LDXA 4G65A 4LW8A 3GN2A 4LCJA 1BWSA 1ONNA 2B4QA 5K6AA 3OICA 3W4IA 2ZTVA 3WR5A 1OZAA 3WMXA 4OXNA 4RL6A 4BO2A 1XA0A 2OFPA 5EQDA 4Z6KA 4PLTA 1I33A 2P5YA 3JQAB 3U0BA 1EFLA 3MEQA 1HZZA 1R6DA 1W73A 5DBGA 3U09A 1DAPA 2HJRA 2NSDA 3JD2A 3IAHA 1AE1A 3A1NA 1DFIA 4OOFA 2DUWA 3Q9NA 4WNIA 3NDJA 3Q11A 1UDCA 1HT0A 4O1MA 1MFPA 2VWHA 2O4CA 2OMEA 2VNSA 2W2LD 3U4IA 1MG0A 4F46A 1X7GA 1ISFA 1NXQA 1QLHA 4CMIA 2X9VA 1WZEA 4XX0A 2ET6A 5CG1A 4H15A 5JMPA 2EW2A 4IDCA 2VRBA 3WMWA 2I67A 3JQDA 1LBEA 2ZB8A 1YE3A 4DQXA 4L4XA 1WZIA 3FBTA 2YJZA 4CM6A 3JQ7B 4CM8A 2P9GA 1Q1NA 5CEJA 1XU7A 1V35A 2Y67A 1HEUA 3LYLA 3V8BA 3MCVA 4W82A 1PTJA 1I30A 2Y1DA 1KEVA 3PZBA 5A1TA 3HFGA 5HWSA 2FHSA 4MINA 1W6UA 1LUAA 3K2EA 3R3SA 2EKQA 4OO3A 4WLUA 1R4NB 2WE7A 5A4DA 4Y8VA 3OEWA 4JXKA 1B0AA 4YT8A 3QA9A 5JYEA 1PL6A 5KVSA 1Z73A 4GMFA 4JN6B 3AW9A 3CZRA 2CFCA 4ITUA 5F3RA 5JBIA 4BIIA 1R0SA 5TRTA 3WTCA 3DWFA
chains in the Genus database with same CATH superfamily
3QMMA 1IHUA 1RMTA 1UPXA 2ZUCA 2WD8A 3DXYA 1J00A 4IFBA 5TY0A 4DDHA 1U8EA 3B85A 4PQRA 3DD5A 3RVKA 3RKUA 3OM8A 4IX1A 4BV9A 3UH1A 1ZGBA 2BHNA 1UWVA 5AW9A 1E1NA 1VLVA 4RF2A 4N8EA 4PZEA 1FL9A 4O4LB 1RPJA 3C5CA 5LLSA 5LXTF 4BGDA 1FXUA 1SIOA 4OAPA 1L7NA 1NUUA 1Q2UA 4PG7A 4DLWA 3FHJA 5K09A 4G8BA 3PHIA 4PX3A 1UDWA 1RQXA 3KR9A 4QDJA 4WASA 2C2GA 3SS9X 5LLDA 2WHXA 2G0AA 2LGJA 1I13A 2N9UA 1R6XA 4GU5A 4M2LA 2GHTA 4YJHA 1CY4A 4PIPA 1JKIA 2AXPA 2LDBA 4L85A 2V0GA 3DLPX 3HBAA 4TYWA 3K92A 2PUEA 1RJDA 4Q7QA 2O7NA 1YZQA 4C01A 2E89A 2Z04A 3IUYA 2PL1A 3JSXA 1GYRA 3DSRA 5CYPA 2I34A 3QUBA 5LYYA 2JRLA 5EKUA 4DMMA 1OI7A 1XHLA 3I6QA 3V4SA 2DWCA 2QVCA 3BK2A 3QLUA 4BLQA 4ZZ1A 5CNJA 2NV0A 2WF9A 4ZQGA 5KC8A 1GO2A 3E9ZA 1JKJA 1TKCA 4K9QA 5D7NA 3LNCA 4DNOA 3KWFA 3AC0A 2VYCA 3JYLA 5GINE 4AROA 2JA2A 2XDWA 1LLQA 3TQTA 5DI9A 1E2QA 5T4BA 1KEEA 4NPAA 4UOEA 3TSAA 5JT1A 1DC3A 3WZLA 3MSXA 1JR6A 2HT6A 3HUEA 1A50B 5HJ2A 3RV4A 3QVOA 4IWXA 4J9VA 4D0GA 2V8OA 4C2AA 1IXZA 1OGYA 2DBVO 1MV8A 3FVWA 1FA9A 4LI0A 3RSOA 1Z07A 2ODPA 4L74A 1F38A 1EIZA 3KKOA 4ZA2A 1K4YA 2ZFUA 1IHPA 2Q5OA 3GCWA 2WWWA 3DPIA 2OUKA 4Y0AA 1Y8AA 1RHMA 1SCUA 3IP3A 4O4IF 5L6LB 2FRXA 3JARB 1NDHA 4M22A 1WDKA 2QD4A 2XX3A 2ZAOA 1SC6A 4LVOA 1O6CA 3QUTA 3R4CA 2H2GA 1ZMTA 2B82A 4D43A 4F2PA 4ZDKA 2KLHA 1ORHA 1HRKA 5CXUA 1YZVA 1XPOA 1WPRA 4XWGA 1M6VB 3Q0TA 4KVAA 1MN6A 4MCIA 4XAQA 4Y9RA 2RGBA 4BO1A 2WSLA 4MR9A 3PLNA 4IVPA 1KOLA 3IVGA 1Y1RA 5SZKB 1KJ8A 2H7VA 3O0DA 5FORA 2EFDB 5EQTA 1Z0FA 2OKCA 1WVGA 3OH8A 1EGMB 4C05A 4RUKA 2BHLA 2GAOA 2IPAB 3PFFA 4HH3C 4K2HA 5TQ0B 2ONCA 2I3ZA 3M9XA 3RDPA 3N8DA 1BSVA 1R15A 3CRRA 3SG0A 1NF2A 2EEPA 1BWQA 1FUKA 2IZ0A 1L7DA 2P27A 2C9ZA 4JKIA 3WADA 1ZUWA 5DMHA 3PPIA 3OIFA 4E7PA 3OEHD 2C1EA 1DJMA 1XROA 3OM9A 3PGVA 4Q3OA 1NUQA 2BDEA 5AM5A 1R10A 3AYXB 3GVHA 3UMGA 1HLPA 1XDBA 5CK4A 3THWA 5EWMB 1DJPA 1R6AA 5IM5A 2JD0A 4CMJA 1Z12A 3A1TA 1SXIA 3WOHA 3C8UA 5AHOA 5I7EA 3IOCA 4IV5A 1CJMA 4L3OA 4D9HA 1T9CA 5LMZA 5TE9A 3NGXA 1VPVA 1O95D 3OMWA 4ETMA 1YJBA 1JQLB 3JVEA 2QAGA 4BNUA 3ESAA 5DHSA 2IUTA 4EPXA 5E2BA 1UMBA 3ZTWA 4ZEXA 2CZGA 3DLTA 1KP2A 4MS4B 4D96A 4DMCA 3DCYA 1N7HA 4IKEA 4I9HA 2AF3C 3IELA 4H17A 4NV0A 2RJNA 5I48A 3EW7A 5KJFA 4J0HA 1W96A 1E5DA 4BTEA 4ZCMA 1E7RA 4W5TA 3DTYA 4TV9A 5M04A 3G2OA 1BCRB 1J1IA 1OAOC 1YRQA 3G8AA 3ZC3A 3H4VA 2HPHA 3AEXA 5T6BA 1DO8A 5LYJA 4ZCPA 4IUDS 1F2DA 1W46A 1LPNA 2GYVA 2YJ5A 2HBYA 2CJWA 2WVHA 3BJRA 1IHOA 1WP9A 2VJOA 3EAQA 1UFQA 1C7ZA 3H0CA 4R51A 4L4UA 1FRFS 3O90A 3I72A 3PTZA 3EEFA 3NP7A 4R8RA 4F72A 1SXPA 2AFHE 3WGNA 4DVGA 3HB5X 2CHUA 4FI3C 2XZPA 1YV9A 4HD8A 4LV8B 1VJGA 3UB2A 1RRKA 3LE8A 3AF6A 3DAFA 2DKNA 3FUTA 1E7SA 4N54A 1NVVR 3AEQA 2D5CA 2QX6A 3GGOA 3BPSA 3V9PA 4DXHA 3FH0A 5EPOA 1M2FA 3BRWD 4H7EA 4NMLA 2N0SA 4YRTA 1JSCA 2FPIB 2QGNA 3LY5A 2FY8A 1HXHA 3HFRA 4H18A 1KRHA 1MVLA 2BT4A 4LJ9A 3WL5A 1EBBA 1EDEA 3PE4A 4CIWA 2DEUA 3P20A 2B94A 3VSCA 4JLBA 1AUOA 1EWVA 1P4HA 3ZI7A 1C2TA 1U3UA 3D3KA 5I4CA 3THYB 4H77A 2HIGA 1IM5A 4OUKX 4IDPA 2G83A 3CVVA 3HRIA 5DKFA 2ATIA 5A7HA 2Q8NA 3ML1A 1VPWA 1QH8B 1ZCZA 1HWYA 4RFSB 2JIOA 1TAQA 4Q9HA 1I8TA 3TPZA 3VFDA 2NG1A 1YZTA 4UVDA 1O94A 5DTEA 3TMYA 5K8VA 1QDUA 1U4NA 2P9ZA 4RD1A 3NHZA 4W5OA 3MG9A 1N0WA 2WF5A 3QVMA 3WA7A 1Y4DE 4MQFA 3O21A 1XDSA 4E21A 4PTLA 2DJ5A 3X1YA 4JASB 1I1NA 2Q29A 4IY1A 1JAYA 2R8BA 4LDAA 3X2EA 2XOKD 4HVTA 4EUKA 4BNVA 2QPOA 4BNYA 1BN7A 2ETXA 4ZALA 4A91A 5BW4A 4QT0A 2JVIA 3UJ3X 5FR1A 2UZ1B 2VZ0A 1JQEA 1Q12A 3RC8A 2Q1XA 5F64A 5B55A 2P4QA 1ATZA 4Q4JB 5F4ZA 4KJXA 5C1PA 4WKOA 5CT5A 3SXPA 1GRCA 2IU3A 2ZJ2A 3E5RA 2XTNA 1I10A 1R5BA 2LP4Y 3GLTA 3O73A 4TKVB 4ZPXA 2I8LA 3BMXA 5EWJA 4Z9YA 4ZHQA 3IP9A 1AZSC 2YZ7A 3OJFA 4Z7JA 5KYNA 1U63A 1KK3A 5KX5F 2PL9A 3LCJA 2XMDA 1EI9A 4GMXA 1USGA 2XZOA 1SVIA 3DXZA 1L4GA 1GZ6A 4DUPA 3NBKA 4KVGA 1C1DA 4HS4A 4B6JA 2X8JB 4MHTA 3IDSA 1J8YF 1D9XA 2I6FA 3UH0A 3VYWA 1CDDA 5C51B 1RQGA 2FPKA 3NIDB 3RT7A 2D5IA 2N75A 3T7IA 3F5DA 4WWHA 3QV2A 4NZZA 2P4EA 4ENPA 1Y3DE 3T5AA 5ALZA 4R2WA 2BV3A 1TUBA 2XB6A 3CZPA 4K81B 4RJIA 2W98A 3DEFA 1V0JA 1XV5A 2O3RA 3EMKA 4IIUA 5FTKA 1MRZA 4OJYA 3ZDYB 2IYZA 2OSBA 3DVLA 3QF4B 1Q21A 2F1KA 4B33A 4HRVA 4CUZA 2R4TA 2YHUA 5KYGA 1QHGA 3GJ5A 3CH7A 1HX7A 2EARA 3N2NA 5I9BA 1S3GA 1IG0A 1V71A 2RHJA 1YOBA 5CNMA 4ZO7A 3ZTYA 4E11A 5LZ9A 1PWXA 4FGUA 3V3TA 2BGWA 1CK4A 4LYAA 4L07A 1X7HA 1XRJA 4OQZA 1XEXB 2B1JA 3IKLA 9LDTA 5HM8A 1CR4A 2FOXA 1IU9A 4I3FA 5ECGC 4X1IA 4Y1RA 4XR9A 1IY2A 3E82A 4JR2A 1U1GA 2WSBA 4EHBA 1DIAA 4G63A 4EATA 2G0TA 3FKSA 4AG3A 1BHJA 2C03A 2KI5A 5ANRB 2K7FA 1XXHB 1BS2A 2HC9A 5C1IA 1KI3A 1XTBA 4FXOA 4GBMA 2GWRA 3A9UA 4HPJB 4KQHA 4AUEA 4PCVA 3GC6A 3CNNA 3HLYA 2BF7A 4KYIB 1FLAA 4HNAA 3BREA 2JCSA 2Z3WA 4R3WA 1UEJA 5EP1A 4AJ1A 4DBLC 2AOTB 1UKVY 2WD7A 5EPEA 4RPHA 4P31A 5LCXA 1YR7A 2DKFA 1E9BA 2FN9A 1RHUA 2I2XB 4CKWA 1WXXA 1OQAA 4HJXA 3GFRA 6LDHA 4TTSA 2GD6A 3AM3A 4Z5XA 4X8HA 4GEKA 2V7TA 4OQMA 4WINA 5LXTA 2XQJA 3IP5A 1QAOA 3AXTA 1M2GA 2XUPA 4IJWA 5E9JA 5AICA 3C48A 4FBGA 4DIKA 3QVLA 1OBOA 5HUHA 2BP7A 1HK7A 4FJ0A 1JKJB 3GD5A 3HXLA 5I5EA 3OTOB 2CHEA 2FOLA 3GYGA 3ND5A 2VHEA 2ZR8A 4OQEA 4XUGB 5DLQC 1VPTA 2B2CA 1RYHA 2VUSA 3EH1A 4WPGA 1YFZA 3HSKA 4MLPA 1ZAYA 4OAQA 3QVUA 4GI1A 5FBZA 1BCSA 1N32B 4CW7A 1UBKS 3R5XA 3THSA 1E6EA 1OB2A 5LWHA 2G07A 3OFJA 2AMYA 4R1UA 2JIBA 2X4IA 3DW3X 3FNBA 1NZFA 5FV7A 4BIMA 4Q4LA 4M0LA 1Y5LA 1Y8RA 4Y2TA 2HU8A 3DUFA 1EFVA 3K7EA 3AH8A 3KB8A 2R1VA 4JQSA 4HSGA 5DEIA 4CIXA 2EV9A 5A4FS 1DIBA 1OYWA 3HUFA 1Z34A 4YNBA 3VR5A 3N6RA 2NSLA 4AX8A 1I2AA 1Y3CE 4EG5A 1CV2A 2QSJA 3E9EA 3BGIA 3LHFA 1CUDA 1PJQA 2GK7A 3GEIA 3BSSA 3LL4A 3IP8A 1XTZA 1GUBA 2VZ8A 5DU2A 13PKA 1W8DA 3GUYA 3I1FA 4ITRC 4QREA 4BFTA 2IUFA 3IP7A 4OHVA 4YUXA 4MR9B 1GTJ1 1ZLXA 2QYSA 3BWBA 4QG7A 1DAFA 3L8FA 3NB0A 4RKYA 5TX7A 3GLHA 5CX4A 4QHSA 4M1EA 2AOUB 1HZZC 4YJ3B 5DT2A 3OZDA 3HL4A 2WIBA 4HGQA 4HWSA 4E1VA 5K8LA 2EFEB 3VZQA 5JDIA 4J94A 1LC3A 2XNCA 3D64A 1ODFA 1JJFA 2CN1A 4GG1A 5EP4A 4O4IA 3L8MA 3ENNA 3KJXA 5LVAA 3RSQA 3Q12A 4DA7A 4KP7A 2IWHA 3RRJA 4TXNA 4NPHA 2GGSA 3DONA 4NCIA 3V8PA 1G5IA 1GSIA 2BY4A 4XFJA 2O0MA 2A4KA 1RWNA 2JHFA 2X1VA 4GGOA 4DWWA 4HX5A 4MVJP 2F9MA 3HKCB 3C5WP 4X5OA 2YWFA 2B78A 4U8GA 4HDCA 4Q1FA 3H3JA 3O8OB 4D9JA 2MSWA 4IWYA 1YB5A 4RSMA 2H00A 3GLFE 2B69A 2YWCA 3KEGA 1M2VA 4JBXA 3GAAA 1ZESA 3ESDA 3MTJA 2CHVA 1Z2DA 4H6XA 4K9KA 4OYLA 5AK6A 3N8IA 1BWPA 3OY7A 2QU7A 4IBOA 4KVFA 5BWOA 1L5OA 4G07A 5EMKA 3PJRA 5G4KA 3VTAA 3U5ZB 4XUDA 3DP9A 4TV9B 2ANCA 3USES 5ALXA 5L4SA 2B4RO 4Z54A 5A9SB 1YQWA 2FNAA 2XT0A 4BAZA 4Q02A 3RPEA 5LD2B 3FUCA 1F48A 3KCNA 3JY6A 2JS7A 2XLCA 3OIVA 4RYLA 5DN6A 4CG3A 2CCKA 3IDFA 4EG0A 2YN4A 1B8PA 5BW5A 1Z62A 4R7ZA 4FEEA 4BO6A 1J20A 2FEXA 2IFTA 3AHCA 1II8A 4OHRA 1G291 4TVSA 4DCGA 3FFAA 1I01A 1VJ1A 7MHTA 4J8PA 2YHIB 2Y1GA 4PSVA 2WVGA 1E9RA 1L5GB 3OPYA 1DJOA 2P7IA 2Q3HA 3DEYX 3PITA 4XDGA 1IVNA 5D7BA 4J91A 2HBRA 4WLFA 3R7NA 4HN2A 5HZKA 1KY2A 1YZNA 3LQRA 4ZO8A 6CHYA 1ZGHA 4ZJYA 1TF7A 1H3NA 1CETA 5JD3A 2J7KA 3AY0A 3VR3A 3HZRA 4Q1EA 3ER6A 4JQCA 1ISPA 1PFQA 2EBHX 3JR3A 3OTWA 1VIVA 2FTKE 2PN1A 4LC1A 4U5QA 1UPFA 1ZM4A 1NWCA 5LM3A 2X8AA 4RZIA 5AKIA 4XR4A 5AXAA 5CVEA 5B2EA 1TKAA 2ZYUX 3Q0IA 2XMCA 1YHZA 1MIHA 3L18A 5KTNA 1Y6JA 3QX8A 2PANA 1W0KD 2V65A 2GNAA 2D3WA 2HJGA 1Y5IA 4YXWD 4YO8A 4TUYF 1Q7GA 1FMFA 1E2FA 2Q8PA 1GUDA 4R0VA 2DVMA 2XVYA 5KUTA 1JHYA 4LZWA 3SKYA 4PX9A 4MVXA 2I55A 2VK4A 2Z8XA 3O2SB 5A03A 2HW8A 4X6XA 1IJKA 4TKZA 3NANA 2IL1A 2NXWA 3E7XA 4NPCA 2CLEB 2JHGA 4HDMB 2BM9A 1YUBA 4HFRA 4TL7A 3PNKA 5ESXA 4EB6B 1YBVA 2R6DA 3B2QA 2HSEA 1KI8A 4KO2S 4YRGA 5AR1A 2E4XA 3HU1A 5IT9A 4FDMA 5LA6F 1FP4A 4WZ6A 2KE5A 2C20A 2GXQA 1UBTS 2BFCB 4JJFA 4BX0A 1PDVA 3PUVA 1SURA 5ES3A 2IPNA 5EINA 4A2WA 4X1OA 1CFZA 5A5FA 3TSZA 1F51E 1J1UA 1K8RA 3WLQA 4EVRA 1ZNYA 2ETVA 2KMLA 1O9HA 1Z5WA 3QFRA 5EWJB 5BQFA 5K8IA 2VHVA 5JAMA 3CVUA 1UPTA 4ER6A 3PT9A 1MO3A 3QKIA 2OZPA 1A9SA 3BK1A 3O91A 2GA8A 2N42A 4NEQA 1JIIA 1H94A 4AJKA 2ASEA 4S1WA 1C1DB 4U7FA 3KKNA 3T9DA 1RWQA 3R7AA 3WLMA 1DTWB 3THRA 1I2DA 5JAIA 3T5DA 1V48A 3WNDA 3MW8A 1Z2AA 4Q19A 4BMXA 4HSEA 2B9EA 3M49A 5T64A 1N0UA 4UFOA 5I7HA 5F1KA 4RGBA 2FEWB 4GOOD 2Q2QA 1HQKA 2O2DA 5LC1A 1FUIA 3ABSB 3COWA 4JMPA 4AY4A 4CEHB 3MCZA 1BMFD 3ZU6A 3OU7A 2YXNA 1OHHD 2E3JA 3MBKA 4BX8A 5KX5A 4CEJA 3G2IA 4RVNA 1LK0A 4N6OA 5LP6C 1GM5A 3WNCA 1QHNA 2AN3A 4PSUA 3N86A 2Q5JA 4R1PA 1RYYA 4ZYUA 4D3DA 2AZMA 3EZNA 3KZNA 3RIYA 2PUAA 3N3AC 4B3GA 1UXJA 2VHQA 2PD6A 4I9NA 5JSZB 5DWVA 4R8VA 1N2CE 2PZJA 2C29D 3AM4A 1XTQA 5FNVB 4H7IA 5DDIP 2BUBA 3Q87B 1POWA 4RF3A 4TPKA 4R84A 4F9FA 1JN0A 2V7UA 4CQMD 1OFVA 2WABA 3E18A 5ILOA 3ADBA 1CBUA 1R0YA 5JNRA 1WXHA 3AUXA 1X8LA 5A5EA 2HHJA 1ZD4A 4D2IA 1YJ8A 4HNAB 1HT2E 4JLKA 2ZDGA 5K6TA 2PGJA 3VU0A 4XLZA 1OBHA 5CTJA 3J80A 2CHFA 4B8ZA 1MKYA 2WD7B 1IC6A 1LSSA 3MK31 3MYYA 4QNMA 5DTQA 4G5OA 3NGMA 4ZCTA 3ET5A 2XJ9A 3G2LA 4F4DA 2WU8A 5COQA 3AKYA 2F3QA 4PN7A 1CP3A 1P9WA 1JE1A 3DMYA 3ZCRA 4UBJA 5FWXB 1WBBA 1BMDA 2ZU0C 5EJ5A 2ZZNA 5ERXA 4CIDA 4JVMA 4RESA 5AUQA 4YV7A 3H6KA 3FF4A 4GKKB 5FPSA 3O0TA 4EDHA 4EY8A 2C00A 5L3ZA 3AHDA 5JARA 4IDHA 3SC4A 3KKLA 4E32A 3NCTA 3SBXA 3UIEA 4DC0A 1NQVA 4UHFA 3TUJC 1U04A 2IZZA 4NYJR 1YA8A 4RY0A 1UPAA 1U0NA 1L4UA 3IERA 1XQ1A 5E7IA 5KNLA 3EY4A 3GHHA 2ZTLA 2WQ6A 3DKVA 3IEKA 1A1VA 1YXMA 2Z5FA 1QO9A 4LVCA 1UK6A 4X3CA 2EZTA 3U9SA 4D7AA 1Q7TA 2GPBA 1PVDA 1Y8RB 1CX9B 2ORVA 4R0MA 4CIYA 4J2OA 3N39C 3GNSA 1WUYA 1CB7A 2W6NA 4Y30A 3R0IA 4IIXA 5TVKA 2E7ZA 2GQ0A 2VUIB 5FI3A 4RZ3A 4J0DA 4J7XA 2XCQA 1F1BA 3VR4A 3QXCA 1YVUA 4TSKA 1KZHA 3WRYC 1FU7A 1V4NA 1CUXA 1GU0A 1W44A 3B2NA 2ZSUA 2PLRA 3UWOA 1BDIA 1MJGA 3BXXA 4YJFA 1XZ8A 4CV3A 2AFHA 2GILA 4MUJA 4YCMA 5TNXA 3IKJA 3RBVA 3KB6A 4KKVA 2HTFA 4IUYA 4O4JF 5J2TF 5DGDA 2XT6A 4OXKA 2QN8A 2Y9MB 3DDCA 3JQFA 3FYUB 4DR3B 5AXDA 4JNCA 4P54A 1UBFA 4EY7A 4EWLA 3L8ZA 4MCAA 3I9JA 5K3AA 4ALMA 3EZYA 1P60A 5THQA 3SZMA 1U0TA 3ZV5A 2H1VA 3AR6A 3V3KA 5J47A 3FNEA 1FSGA 1JEQA 3UG6A 4CN8A 1A9XA 4UPVA 1ZMRA 3FX2A 4D8VA 421PA 3I73A 4YCAA 4EHDA 4MWCA 2R96A 3CZAA 4JYCA 3FB1A 1RU3A 4MEBA 5CVJA 1GFIA 4J16C 3IS3A 1IZYA 2DE0X 2GPSA 3GH3A 3V8NA 2YVUA 4NJMB 2Q3LA 3P9NA 3GNQA 5BW6B 4XCQA 4LWPA 3M4NA 2BFFB 4Y6SA 2M6KA 4JWTA 1N2SA 1D04A 3RRFA 4QLAA 1CUHA 1F4VA 2QTMA 3SHOA 2VNJA 3CZ5A 2ERXA 4BNIA 4FILA 1JS1X 3P0JA 4NP6A 2QZ4A 5A05A 5F2NA 3B78A 1UL1X 3L1KA 2VPWA 5BSUA 3PI7A 5EFZA 1VCMA 1PT8A 3AJEA 1CQWA 2FCRA 3P96A 2O5VA 3JD0A 5H70A 1GG2A 1XCOA 1Z6GA 4BLSA 3DGFC 1RJWA 2BBSA 2JVJA 1QYVA 3EW9A 4DLZA 5A4MS 3NTOA 2AL7A 1BDHA 3A3OA 9GPBA 2XZTA 2B2XA 3M6IA 3RO7A 1M6NA 5JAOA 5KNCD 2WKRA 1MZPA 2QT1A 4Q7JB 2QQ5A 2IZ7A 2OSVA 2PQ0A 4IS2A 4F3RA 3VJRA 4QXQA 4DR6B 3QKUA 2IXDA 2CUKA 4KZPA 4QECA 8LDHA 2D1TA 1K6EA 2QL5A 1OSNA 3BK7A 3C1TA 4PVCA 1R0LA 2YV4A 5HKKD 1M2KA 2V6JA 5TQ2B 3MSCA 2PX3A 3GELA 3A8TA 5BNWA 3ZGXA 1W0JA 3BIXA 2BM1A 4KQ2A 4FFBB 4MGZR 4L9RA 5GONF 3HGTA 2ZUWA 1ZVKA 4DR2B 2I2CA 5EUMA 3CFYA 3E9NA 1ZRSA 4L3VA 3SSAA 5FWYA 2HSGA 5JJIA 5JFGA 3JAKB 1NQUA 1X7ZA 2O0LA 3EPRA 3PCXA 4AZ3B 3M0EA 3G7NA 4LOIA 4N5LA 1UEIA 1BDJA 2WSSD 3MTAA 1U0BB 3LQFA 4OXXA 2GTPA 4LJYA 5ALJA 3BFKA 3O4RA 1U0EA 3FOBA 2P41A 1XE3A 4XDHA 4CNQA 4OH7A 4MHOA 3HJFA 5I8ZA 2D2XA 4FCVA 3ZPXA 4LQCA 2R44A 3MJ4A 3OPNA 3GY0A 3V2HA 4TQUS 2H6EA 1GFWA 2NZ8A 4NATA 1HYQA 2PX0A 4IXNA 1LU9A 2VH1A 3OPYI 4M9RA 4P4GA 1XK6A 1AS2A 2I78A 5FX2A 1BKDR 4DV3B 2PX5A 2Y77A 1XZJA 1ISSA 2R8ZA 4C6TA 1OREA 4GOND 3HXQA 2BRUA 2BN4A 1WAMA 3HBJA 4OXQA 1GZHB 2FQQA 4KDFA 4FFPA 3PQ4A 4NG5A 1FLNA 5HCIA 3U4AA 4CETA 3PTAA 1TAUA 4BB0A 4D9KA 5CDFE 1LVUA 2A3RA 2D5BA 4HZGA 3E8MA 5I8WA 4RV4A 4PNPA 1JALA 2EU8A 1UJCA 4KVZA 4JP1A 1N6NA 2Q4DA 3KJIA 2B0CA 1GPJA 2J3MA 2WPDA 5IBRA 4QG3A 2EX1A 2PEZA 4A8PA 3MUEA 3V4FA 2QRUA 2V7EA 2OBFA 4KAFA 1JF8A 4TUYA 4FHZA 2YJ6A 4NZNA 3QE4A 3KUUA 4PN3A 5IZCC 2CWWA 2VPYA 4Q1BA 4X6UA 2FPGB 3IODA 1DOZA 4Q4AB 4B7AA 4FHGA 5CJPA 4C3UA 3BRSA 1U2QA 3IKMB 2CHQA 4R2KA 3MGCA 4M0DA 2ZRHA 3QMVA 3U9TA 5HRAA 1KK0A 2W9XA 1G9SA 4LBWA 1NURA 1KQNA 3VNBA 2XXJA 3RYHB 1PGNA 2MSCB 4GZMA 5KOIA 5LA6A 3GP8A 1PW5A 5MGNA 2W2NA 3KTDA 1V2HE 1P3JA 2DHRA 3CW9A 2R7AA 3GFSA 4OH1A 1ZICA 4UQPA 3E7FA 4TSFD 2ATVA 2P2DA 3ZKAA 3PPYA 1OLUB 1SUIA 5AJHA 4RD4A 2V5UA 2A9FA 2AKYA 5E1BA 3IQDB 2BGRA 2VRNA 3D1VA 3I6MA 3UT6A 5KX5B 4BUJA 3F4KA 2WD9A 2LE0A 5JH7A 4AJ2A 3H1BA 2IF2A 3I2YX 4IXDA 2FMUA 4QVGA 1W36C 2GCNA 1NN1A 3UK6A 5AVWA 5KZMB 2QG4A 4LMPA 4OHOA 3ZVNA 1PGQA 1ZHHA 1MB3A 2E1PA 3RASA 4BC1A 2ZB7A 3I04M 3ZIAD 1XO1A 1AUXA 2PXHA 2F43A 3MAGA 3DLHA 3IJ5A 4KO3S 2D5LA 2OOSA 1QKKA 4WX2B 2GBFA 2XPCA 3OZVA 4FCCA 1JTVA 3H84A 1C8BA 2YFKA 1ML4A 4UTOA 1RS0A 4QPJC 1W1UA 1Z29A 3GIWA 3OJXA 4X9XA 3MOGA 4QGGA 4W1PA 3E3LA 4ZVPA 3SAJA 1O0CA 1VFPA 1KMQA 1Z13A 3L43A 3T8YA 1DKLA 3TRIA 2DFKB 1ISJA 1Z4MA 3DGEC 1CUVA 3E23A 3LBHA 1VBKA 1AHNA 3NASA 4DCPA 3PFBA 5CJ2A 1GUZA 3ZEIA 1YB6A 1LV7A 3DZBA 3B6JA 1PFKA 1P4GA 5BR1A 2F8SA 4ZANA 3VR4H 5H0IA 1UBGA 2YV2A 2HSZA 1AG9A 3IJEB 3LT2A 4LVNA 4LSZA 3HO6A 5FNVF 5F3DA 4AIIA 5LZ5A 2PMDA 4I8IA 4E4YA 3GT3A 5HJ5A 2B3DA 2MYUA 1IY8A 1E6LA 1QCYA 4N40A 3K0CC 3VSAA 4G0VA 4FFRA 4I7EA 3S2EA 3TZHA 5IKMA 2JI6A 3FWYA 2ZJ5A 5FOUA 4CV0A 1VXRA 4JJKA 4PQEA 2ZTMA 3QUAA 4IHAA 4H1TA 5F7JA 5BR4A 4UMFA 4QULA 2DFVA 3W7BA 5AKGA 1ZRMA 4D4GA 2VQFB 4NYIQ 1GTZA 2JGLA 4ED9A 4NMXB 1W75A 3F5FA 2MSEB 3H5TA 2WDZA 3MYRA 3TUIC 3PGXA 6GPBA 1K98A 2II6A 3SYRA 1IPFA 1DDOA 2VF8A 4OGWA 5FQNA 8OHMA 1PZXA 4L0QA 3F8SA 1CUZA 1FP1D 2VCEA 3OFSA 3VDMA 1FU4A 1LWOA 1BG6A 2ISSD 2ZRCA 4US0R 1KE1A 4ZYYA 5GIPE 2C7GA 2OB1A 2R87A 2B20A 4HDRA 2WBLC 1E64A 2ESRA 3Q40A 4CTOA 4XXHA 1DSSG 3JR7A 1WXIA 5BQXA 2HTEA 3K2IA 4H0CA 5DRYA 4NESA 4RTNA 4MW6A 3K1ZA 1E5TA 3AQ4A 3GEDA 1PUJA 4WJKB 4MQ5A 2MCFA 3BTOA 3OT5A 1BJTA 3U3DA 3ZS8A 1MAWA 1YI1A 4C7KA 5HM6A 3CUKA 3HYNA 2H54A 3REQB 1XVAA 3R3JA 1K0UA 1XJWA 2RGNA 1BVUA 1U7DA 3EDOA 2XQIA 4TLEA 1B0ZA 1HKUA 1HEIA 2NIPA 2AFHB 4NZPA 3CWCA 5CNKA 2X40A 4NNJA 3TEJA 3IMGA 3LP8A 1E9FA 1QOZA 2J5XA 4JI3B 3Q1KA 4U63A 3RU3A 1Q0UA 1SZDA 1NVGA 4CRWB 3EXEB 3LC1O 4ZJPA 4O8ZA 1KJJA 2ZU6A 1ULHA 2YINC 2VDQB 2BHTA 4UPEA 3ABIA 4EPWA 1ZL2A 4IJVA 4JXZA 2GLUA 3ITKA 5B64A 4TYYA 1KO7A 4DQVA 1PVOA 1JEQB 4LDNA 4ENWA 5CTAA 5A5DA 4ZPJA 5BMVF 4JCCA 1UIRA 2EF0A 3Q2IA 4PVDA 2AN1A 4QLOA 1C1YA 2MMCA 5JAPA 2W6JD 1E77A 1YTLA 2IQ5A 4IGEA 5ALIA 2J0EA 4G56A 1A7KA 3OY2A 4E94A 1AZWA 3BZBA 1GAQA 1TQHA 1FFXA 4OFZA 4DARA 3HR8A 3TRKA 1W8IA 4EAAA 4IDAA 3NXSA 1ZAKA 1MAUA 4O4JA 5J2TA 5P8WA 3BWEA 3P9CA 2UKDA 1J49A 1KIMA 2CW5A 2F1IA 2J5BA 4XB1A 1A71A 3B8EA 1J06A 1AJEA 2R8YA 4MVJM 4MPJA 3DF7A 3HU5A 1G2PA 3K9HA 4M21A 5D6NA 5JLAA 5B4TA 3O8RA 3V4OA 5DTIA 3PFHA 3ZK7A 3LUHA 4BEJA 3K30A 5T4HA 3V8QA 5EXDA 2BEWB 2DH6A 2IXBA 1A9QA 3D31A 1X1AA 5GTDA 2CLCX 3BB4A 3QOFA 4LJ7A 4YLEA 1E8DA 1V5EA 5JQGF 1ZJ4A 2Q6TA 2REXB 5MDHA 3PQCA 1K8ZB 2PCJA 2AI2A 1NYQA 1UXKA 1DUIA 2VQDA 1YTUA 1FMTA 3TEMA 4E5SA 1PFGA 3O92A 3I5MA 4L5IA 1XOIA 4EPVA 3OZWA 4IYRA 1OPRA 3IRVA 1P1IA 4UFNA 3EFHA 5AHWA 2JIPA 2RHGB 1PF7E 4UEOA 1E66A 2RK4A 2ZJOA 2Z8YA 3LHIA 5CHYA 3S29A 3VPSA 4DQ0A 4PXYA 4QBKA 2Q7DA 1D4AA 2BEUB 1TTPB 2OCPA 3HLKA 3LRTA 4IW3B 3BFJA 4S05A 3M6UA 4M46A 1RWKA 1TA0A 3M5PA 3SSMA 3ZG6A 3X1ZA 4JL5A 7AT1A 3FSJX 4OP1A 5JAQA 4DIFA 1UZUA 3HK2A 2PXXA 1E1LA 4BO8A 4EKGA 1KI6B 4RF5A 3AF3A 4LYJA 5JSFA 5JNTA 2GHIA 4KLRA 4HVLA 5JWRA 5BVGB 2PKXA 1IK4A 2XYGA 3V8MA 4AJJA 3TCNA 4NNPA 2YV5A 4IVRA 4GPZA 4ZTZB 1FDWA 2NLOA 3QEMA 4D4MA 2JDID 1JTEA 3GQVA 3H6GA 1VKZA 3T95A 1AKRA 3AIMA 4UPDA 3QE0A 4DY4A 2XUIA 3SGLA 4YP7A 5HF5A 5K6AC 1PRYA 2QXTA 3CJRA 4KQGA 4X84A 5GONA 4W5QA 3JTEA 4GYWA 3BE4A 3I5YA 5DHFA 4OLBA 1G8FA 1CLUA 1ZEMA 3GJQA 4QJ5A 2VP9A 4FE3A 4YRBA 1GZ7A 1NHGA 4ZARA 3LQ2A 4X1YA 2NSYA 3H19A 3IEIA 3PHCA 1N2CA 2GYYA 2ONZA 3A6JA 2DUMA 4KIUA 5JJLA 4C04A 3ESQA 3WB0A 3OT1B 2P3SA 3MZ0A 3N07A 1XCBA 3PX2A 2ZBVA 4KQ1A 4NAHA 5KEIA 1P0PA 1U2GC 1FDIA 1WDLA 1YRWA 1P2DA 4V0QA 2OHFA 3DMNA 1PR5A 4OXRA 4C0HA 5I7VA 1I3KA 1QHSA 1ZOIA 3QE2A 5H3LA 5JALA 5KOHB 2YNMD 3L7YA 4PIVA 4MP3A 3HP4A 3QPCA 3QVXA 4X91A 1IE3A 3E15A 3NVKI 3H2KA 2YX1A 4YH1A 2VPPA 4N3NA 5JS2A 3WLAA 4RSRA 2MYNA 2O06A 4FE4A 1VC2A 8ABPA 4WA8A 4KE6A 2FLWA 3DCNA 5HX7A 4A6DA 3KV3O 3ETDA 2HWYA 3KD3A 1ADFA 2QRLA 4K8OA 5C3UA 1I24A 1T4BA 1P6QA 3N8NA 1HYHA 1BXRB 4F12A 1ENPA 4ZIRA 4NYMR 3NOOA 4K88A 4W9NA 3VAAA 2EVWX 2X3UA 2BGLA 1GFZA 1TTQB 3JALA 4PSKA 1X8XA 4QXRA 1W85A 3I9NA 4I6JA 3OE7A 4Q48A 1A4UA 2V5AA 2PCLA 4H60A 3B8HA 4G36A 4V2IA 3UBMA 4C7VA 5LA6B 4YYZA 5KO2A 4KLZA 4PPQA 3A3PA 3UQZA 3F9RA 4GLLA 2C3MA 1MENA 2FFAA 4PHTA 1QZ3A 2JLBA 5C8VA 1H2XA 3KKPA 3MJHA 2VXCA 4MYHA 1TIPA 2PWBA 2UYOA 3FN4A 3R3VA 4QEZA 1K3UB 2I5PO 1EFKA 1T2NA 3I52A 5EE3A 3V1YA 1N5JA 4FGKA 4DIOA 2O8FB 1GTMA 4AJPA 4DWVA 4GC5A 2BISA 2EKPA 4LBZA 2ZCUA 4R1QA 1FVOA 1W52X 4G1VA 1G7TA 3QBDA 4RNCA 3QG5A 3TLKA 5L7WA 2J41A 2VA9A 3KZOA 5IWAB 2UXCB 3C3AA 4K9NA 2CNOA 3G5MA 2MT9A 2I1LA 3F6BX 3RTGA 4LZNA 3SCZA 3V8EA 3WKAA 3BH0A 1Y34E 4HC4A 5HQ3A 2BR4A 2XB2A 1VL5A 2PD4A 4TWAA 4EZBA 3TK1A 5TT0A 3CNEA 1ZKMA 4JC5A 4BEVA 5LQRA 3ZU3A 5ED4A 1AUPA 1Q92A 4E1BA 3BX1A 1HLDA 1DB3A 1CEXA 1I4DD 1NLMA 2M2IA 2X58A 2XGGA 3DFKA 4FMPA 4HVCA 4XW2A 1HDIA 2JGJA 3O8LA 5IVPA 2DX7A 2Z1MA 4PCLA 3JASB 2K2QB 2VNIA 4E5MA 4RXMA 3VR6D 3CUYA 1Y37A 3GT0A 3FVQA 2FQ1A 1Y9JA 3LHKA 2PH3A 4YT5A 4C14A 2QLTA 1VYHA 4GNRA 2HRBA 4KXVA 5CG2A 2P2YA 3KS9A 2NP7A 2WUFA 4FSHA 1JGTA 3U4CA 2VUTA 1ZZGA 3ROZA 1XTSA 3AEKA 3WIUA 4W5NA 1K7EB 5K03A 4CKZA 3N7UA 1H2AS 3PL1A 1IOZA 4M0MA 3UMMA 2VHZA 1SQ5A 4U02A 1U8TA 3H2JA 4AURA 5K0JA 2H4JA 4N47A 1FEZA 5JTTA 2W71A 3WRXA 4BB9A 1FBNA 1H8HD 1U8CB 2QRNA 5DJ5A 5FNZA 3PNQA 4MR7A 3HA3A 2J87A 2P2NA 3CPSA 3DS8A 4ZVUA 3GFPA 4TVKA 3HVJA 4FZJA 4G1EB 4J1SA 2EJCA 2ZP1A 3OFKA 4TMKA 1PKXA 2EFJA 3LG2A 1AURA 2GN2A 1TT7A 3DAOA 4M98A 3VNAA 3GLFB 1WO8A 3MTEA 4PCAA 3ELYA 3WIOA 1U0OC 3QXJA 4HNSA 1PQ4A 2Y66A 2FWBA 2DTEA 3SS8A 1IXSB 1YIOA 3D54D 3USZA 2WQ7A 1DEKA 2FX3A 2ZRAA 4S2UA 4F4HA 3OIWA 2E5LB 3PHLA 3NTRA 1LBTA 3NBMA 4CF6A 4HDRB 3T5TA 3R2JA 1JL3A 1Z4JA 3Q3HA 5ALHA 1E3JA 2Y1EA 2X86A 1IDOA 5C7YA 3F6SA 1SUWA 2A86A 3L4SO 1I2ZA 3I92A 4NBLA 3TLXA 1XTTA 3PR3A 3ONEA 4L7QA 1S2OA 5FBHA 1NSTA 4FOLA 3AJRA 4FVTA 3SKVA 5KVCA 2OENG 3FWHA 4QJBA 4ZOAA 1V8OA 2A0KA 2IOQA 1A9OA 1W94A 3HADA 4HDKA 1OF1A 1XZEA 1UBUS 2QTAA 4JLPA 3PEEA 5EHGA 1Z2OX 1UBEA 10MHA 1VMDA 1KP9A 3RUIA 1JDBB 2DFLA 3HTXA 2J3IA 5K0LA 1N0IA 1XWFA 3EN0A 2XVZA 5HDBB 3Q7SA 1PQYA 1Y6QA 4ROTA 4W5HA 4O0LA 4IQFA 3U7QA 4A5SA 1MJHA 5J9FA 2QLNA 4H4CA 1PE0A 2WR8A 1HTWA 2WV7A 3GOHA 2ZULA 3TTSA 3O2JA 1WPQA 1CIVA 1TM1E 3AZOA 5DO9A 5IH3A 4B43A 3INGA 2Q1WA 3LIIA 4FC7A 2B0JA 3R20A 1WXQA 2PZ8A 2FFJA 3LKVA 2V74B 4YT2A 3IQIX 3OD5A 3GV0A 1ZN8A 1UXHA 4P8RA 4KQ6A 4J9UE 1NNSA 5KVAA 3CLUD 3B20A 1CJBA 1M8JA 1I7NA 3WLJA 3RFXA 5FF9A 4NAVA 4J1QA 4KQIA 4AY6A 2AQ8A 4LCBA 4WN9A 1TQ6A 1L5HA 2GETA 4N03A 4CZ2A 4YLYA 6AT1A 4LE1A 3V7YA 2VT2A 3EA5A 1JNXX 3D3NA 3I2HA 3OSUA 3C8ZA 4EB3A 4WD3A 2DHDA 5BMVA 2DETA 3P9PA 5CDFA 4RZSA 3C14C 1TTTA 4MRPA 1A5SB 4QTTB 3LUPA 3ZXSA 2YWXA 3CXUA 4AO7A 4B6PA 4BO7A 3QW2A 1P81A 2XGOA 2DERA 2JGDB 2VHCA 2WJ6A 4TQAA 1G8GA 4E30A 3FBWA 3KTOA 2WG0A 3OJOA 4C76A 2VXYA 3UJ7A 2O6LA 1CY6A 4UHBA 1TLLA 3L77A 3DDSA 2QI9C 2NUPB 3C2QA 4MQUA 1Z4KA 3KAJA 2H1WA 4QTZA 2NPIA 5H82A 3TBKA 1UMCA 3HUUA 4B3CA 4YX9A 5DCLA 3STXA 4BL5A 5JASA 2F3TA 2XUZA 3NALA 1NG9A 4G5HA 2QJRA 1O94D 1WX1A 1OBVA 1PBTA 2AI1A 2ONKA 4FINA 5E6RA 3MQFA 2WF8A 3EZGA 3LDHA 5JQGA 1LNZA