3GGPA

Crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
286
Chain Sequence
KSLSMQNVLIVGVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIAKKLSYILSEDATVTDQGSVKGKLVYDLENILGKRFVGGHPIAGTEKSGVEYSLDNLYEGKKVILTPTKKTDKKRLKLVKRVWEDVGGVVEYMSPELHDYVFGVVSHLPHAVAFALVDTLIHMSTPEVDLFKYPGGGFKDFTRIAKSDPIMWRDIFLENKENVMKAIEGFEKSLNHLKELIVREAEEELVEYLKEVKIKRMEID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Aquifex aeolicus Prephenate Dehydrogenase Reveals the Mode of Tyrosine Inhibition.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords Prephenate dehydrogenase
total genus 105
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3ggpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ggpA01
1VL0A 4IZHA 1I2CA 4YQZA 1DIRA 2Y1GA 4I9UA 2C0CA 4W7HA 3MJ4A 4YR9A 1M66A 5I7SA 2NVUA 1LDBA 2WD7B 1HYEA 1ADBA 4YB8A 4Z0HO 3WIDA 3BMQB 4DC0A 1P33A 3TNLA 3ZWPA 1MXFA 3PYLA 3INRA 4RVSA 5KKAA 4BOYA 3OQBA 4R9SA 3RC7A 4E2XA 1P1FA 1EDZA 2ZTUA 2RCYA 4NJMB 1E7RA 2IDZA 4D3DA 5A5FA 5L51A 2WSBA 1QYCA 2J3HA 4CR6A 1Z7BA 3ASUA 3WFJA 3JYLA 3LT4A 4J4BA 1YJ8A 4FFPA 2HO5A 5TNXA 1QG6A 5I9LA 1BRMA 4XYBA 3D64A 3DOCA 4HFNA 5KIAA 5ENDA 3PIIA 4MKXA 1NFRA 2P4HX 5DOZA 5A9RA 4B4OA 3KYCA 1N9GB 4E5NA 4AJ1A 3I9MA 3NT4A 2XXJA 3VPHA 3BA1A 2NNLD 4A2CA 4NBUA 4XB2A 4ZA2A 3V2UA 1NXQA 1IUKA 1O6ZA 3ONEA 2D59A 5CPFA 4HX5A 3RC2A 1H6AA 3ZV3A 3AI3A 3DWFA 3OETA 2WM3A 5JLAA 3F4LA 5C7OO 3PHLA 4P8RA 4YWJA 1R4MA 2NVBA 3QLJA 3WMWA 3IP3A 2DC1A 2GN6A 2PD6A 3SXPA 4WLNA 4BNFA 1F06A 1KS9A 4TZTA 5JNLA 1X7HA 1NVGA 1K5HA 1XQ6A 1DC5A 4C7KA 4BNTA 3RVDA 4O59O 4PZCA 1GDHA 2P9GA 1JU9A 2YW9A 3LSYA 1SB9A 1T1RA 1ZBQA 1E0DA 3AUTA 3BMQA 3MOIA 1ISGA 1EUDA 3AI1A 3A28A 1KERA 3COSA 5A5EA 4D3FA 1DLJA 1DO8A 5JO9A 4AJIA 3JQAB 1EDOA 4L74A 5L45A 3V2GA 5AXDA 4MVJI 4A26A 2ZATA 1EVYA 3L4SO 4CM8A 2QRKA 3EAGA 2X0JA 3MJSA 1O89A 1MB4A 3E03A 4BO5A 5JAMA 1F12A 3DMTC 3ZNPA 3WDSA 2X1HA 1TT5B 2HCTA 3DAGA 1E6EA 1YVEI 3JQGB 2YQ5A 4J91A 4NK5A 4PLVA 4ONEA 1P77A 1GQQA 2HRZA 3OIFA 2JJYA 1DLIA 3H9GA 3ZU2A 4E21A 1PL7A 5FWNA 3S55A 3KO8A 4F3YA 2O7SA 1ENYA 1D8AA 4YRDA 3HUDA 4K28A 1IB6A 2H63A 3S2GA 1MFZA 1WMAA 1PU2A 3ASVA 2DPHA 2EWMA 4YAGA 3U5TA 4CMHA 3MTGA 4NJMA 5HS6A 2YV1A 4WOJA 2GD1O 4E31A 1SZJG 3BTSA 3K5PA 3K6JA 1NVTA 3NUGA 5ER9A 4BO7A 3HB4X 2B36A 1HE4A 5G4KB 4J1NA 2ZB7A 1ZMOA 3WNQA 3WJ7A 3F5SA 3GFBA 3TQHA 1DRWA 4ALIA 2DFVA 1B15A 2D8AA 1DC3A 2POQX 3OJFA 3EYWA 4Q3CA 5B37A 2RHCA 4RQUA 2Q4BA 3VZRA 3GGPA 2NM0A 5JCXA 5T57A 2O48X 4OQZA 3B1JA 1PSDA 5DDIP 1OI7A 2BLLA 1QMGA 3D3WA 3SJUA 4BNJA 4BNVA 3IL2A 2Y1OA 4XRGA 3WLFA 4B3IA 4KDEA 3G49A 3D3EA 4P22A 1SC6A 3DZIA 3H5NA 4JJFA 4KTTE 4FJ0A 4I8XA 3RQSA 5ENVA 3TZKA 4IQGA 3ZNNA 2VHXA 3TSCA 4E5YA 4R54A 3WFIA 4CL8A 2EP5A 2HMUA 1XDWA 2A92A 2E6UX 2NSDA 3OQ1A 2X9GA 3RASA 1LLQA 3X2EA 2O3QA 1TA4A 3TOXA 4D79A 5KVSA 2BFMA 3AK4A 1NHGA 3DHEA 4S3MA 2PTGA 3ZN2A 1DBVO 1PJ3A 2HK7A 3Q0EA 4Y9DA 1ZK2A 2A9FA 1XWFA 3SLKA 1EMDA 2X5JO 4H16A 3WTCA 4E30A 4ALKA 4IZIA 2I65A 3WICA 3GH3A 3JD3A 3BXXA 2CVOA 1YE3A 4IUYA 3ROMA 4CM4B 2X58A 1LU9A 2WYVA 4KWIA 1JN0A 3TF5A 2WJPA 3ZWVA 4J7XA 4RO0A 4BO1A 3PJFA 3QIVA 4MP6A 5FI5A 2V7PA 4O63O 1PZGA 3E18A 4IINA 5A9SA 4K6FA 5BQFA 3V1TC 4IIUA 4XZ3A 2BKAA 1DHRA 3R0IA 4LK3A 4XR4A 3FNEA 4BNMA 1ZSNA 3BMOA 1FK8A 1H2BA 2D1YA 3DB2A 1A27A 2EP7A 1HDOA 2EGGA 4QEDA 1X7GA 1OAAA 1UDCA 5C5IA 4DC1A 4KOAA 3KEOA 3SEFA 1QYVA 1A5ZA 4WLEA 4J9UE 3QHAA 4GMGA 4DREA 1QXSA 1U28A 2FMUA 3IS3A 3O4RA 1U7HA 2ZYDA 1GYRA 2JHFA 3NT2A 4L9RA 2X7HA 4YAIA 2B35A 2PK3A 1MXHA 2CF5A 2Z95A 4CMIA 4L4RA 4ALMA 3PHGA 2W2LA 5KJ1A 1XGKA 3HHPA 5ES3A 1MGOA 5G2OA 4TZKA 4MDHA 5JAIA 1ZIDA 1ZO8A 5HM8A 2D3TA 4IDBA 3LQFA 1UDBA 4CQMA 2C7GA 4CM4A 4JBIA 2VZ0A 3RFTA 3I6QA 4GI2A 2UAGA 4N5NA 4WJZA 1VLLA 4GSLA 1T1SA 3WS7A 3GR6A 2Q99A 3KB6A 5FI3A 3I1JA 2OMEA 3PJGA 2VZ9A 4XX0A 2YFHA 4NDNE 2DUUA 3CSDA 4IDDA 4L4SA 4M86A 2C5AA 3DBRA 3TOZA 1NBOA 5L53A 2CDAA 4GWKA 2Q45A 3OHSX 4WLVA 1TXGA 5F5NA 4PVDA 2RBEA 4UEOA 4FR5A 1GFSA 5KJFA 4ZHSA 2W90A 3FTNA 1BMDA 3BHJA 1R4MB 3I9LA 2DBZA 4I1IA 4WNIA 4NNJA 1W6UA 2P68A 2Q49A 4NU5A 4DA9A 2V65A 1NFFA 4DBVO 4PRKA 3R3JA 1GADO 4FFLA 3IJPA 3W4JA 1PL8A 1ZK3A 1YOVA 3SLGA 4XB1A 1N9GA 1D7OA 2BD0A 1LX6A 3PDUA 8ADHA 1SAYA 1GUFA 2X0NA 3T4XA 4JCOA 1YB1A 3PGJA 4IS3A 1Y81A 1U8FO 4NBTA 1A71A 2I6TA 1FF9A 2AEFA 3TN7A 5AVOA 3D0OA 1NASA 1WP4A 3DEYX 1LSUA 2ZCVA 4NHEA 4UVEA 1MV8A 5DULA 4CUJA 1F14A 3H2ZA 4MINA 1PWXA 1O94A 3PQFA 1RJWA 4E2WA 1H2HA 3AM4A 4ND5A 3P2OA 5JW6A 5BSFA 3WYCA 1UJMA 2J6IA 3MWDB 1UXIA 4HFMA 4R5HA 2O3RA 3UCEA 4HNHA 2Q46A 4J4HA 4R1UA 4B3HA 3FBTA 2OP0A 3FNGA 5TS3A 3JD2A 4YACA 1GTMA 3L4BC 3GFGA 3UN1A 1L7DA 4OGWA 3WB9A 4CLRA 2VZ8A 4L76A 4XQ9A 5I7EA 5KOIA 3KETA 1HTBA 3CXRA 1BSVA 1N92A 3PGXA 1U3WA 2LDBA 2VT3A 3DBHB 2NUAA 2WDZA 4KQXA 4UUNA 3WTBA 2G5CA 5T67A 4HV4A 3ZWWA 3F47A 5L7YA 3ON5A 3GNTA 3JQ7A 4BMSA 3L9XA 4Q9NA 3SVTA 4DYDA 5JMWA 3LT0A 2W4QA 4WCFB 2IZ1A 4ZRMA 5JY6A 1ADGA 1OZAA 1P1HA 3NKLA 3IDSA 2AG5A 4ZD6A 2C20A 2VNSA 2C2XA 3RD5A 3C7DB 5AQ1A 2I76A 1ISHA 1UXHA 2VWQA 3AM5A 1GUYA 1DIAA 1E3WB 2I3GA 4RZHA 1PR3A 3NEPX 4JXKA 4TQGA 2V6BA 4L73A 3QSGA 3FWZA 3I9OA 4BO9A 5L4LA 1KIFA 1VM6A 3VH2A 1IPFA 3AUAA 1UP6A 3B20A 2OP1A 3HN7A 1YRLA 3D1LA 3GNQA 1DDOA 4CUZA 4AJHA 1QLHA 4TKLA 3L0DA 4UVDA 3RWBA 1LSJA 1BDMA 2RHRA 4CMIB 3WBBA 1DFHA 2J3KA 4B4WA 4EDFA 4PIVA 3ENKA 3IQDB 4GX5A 3W6UA 4IDAA 3E5RA 3IP1A 4D42A 3K73O 2I3AA 3LVFO 4GSKA 4PZEA 3BTUA 3D4NA 4JROA 3ETGA 4XCVA 4J0FA 4QO8A 4XD2A 1ADFA 3ZNQA 3WGOA 3ZNOA 1CJCA 4JIGA 1NHWA 4UVHA 5CFZA 4YPOA 2Y0EA 1R4NA 1A7AA 4PG4A 4Z9XA 3HADA 1YH3A 4XR9A 2YUTA 1WLYA 2R6JA 4IS2A 4RF3A 3U4DA 4BNWA 1LBEA 1P0FA 4R4JA 2VUSA 4ZQHA 3IUSA 1U5CA 4ZVVA 4Q3AA 3ZGYA 3P19A 1VL8A 1X14A 1EUZA 4DPKA 3ICCA 2D2IA 2DTXA 1Z7EA 3EVTA 3LK7A 5DZSA 6LDHA 3AJRA 5L4NA 5A3JA 1H94A 4INAA 1XHLA 5KTKA 4QUKA 3OJOA 2GR9A 1LXCA 1PGQA 1PR9A 3Q6IA 1ID1A 1SB8A 3UF0A 5JO0A 3EMKA 2YV3A 4D43A 3D5QA 4S1VA 1E1KA 4OL9A 1C0PA 3ZHZA 1EK5A 2CVQA 3JD0A 3ABIA 1DFGA 1QYDA 2BELA 2Q1TA 3GMDA 3PVZA 4N54A 1K89A 4CQLB 1EE9A 1N2SA 4KP7A 4LVCA 5H83A 4AJ2A 1XYGA 3ETEA 3GNSA 1Z82A 1PL6A 4RF4A 3LC7O 4Q3DA 3WGZA 3K2EA 1MG0A 2BGMA 4JGBA 5EQFA 1LDYA 3H9QA 4LRSB 4RZIA 4CLOB 5F3RA 1ZJZA 4II2A 4KUHA 4XIYA 2D5CA 2EJVA 3NRCA 3D3WB 3E48A 2IEDA 1T2FA 4R41A 2OORA 3E5MA 3RAJA 2QZ9A 3TJRA 1R0LA 1E6UA 4PLZA 2ZB4A 2GPTA 3C3XA 3E1KA 4UEJA 3LF2A 3QJ5A 3CIFA 1I33A 3AOEA 4PFJA 2EF1A 1I2BA 1KVRA 2J3JA 1YL7A 3ZV4A 1ML3A 2J5RA 3E82A 4AICA 2QW8A 3ZU3A 1X0VA 2FR1A 4CLDA 5HBRA 4RF5A 4BGUA 5TRTA 2GN9A 2P91A 4XRRA 2YV2A 2H6EA 1MUUA 4FGWA 4WK6A 4BNIA 1XU7A 2E82A 2IXBA 4QO7A 3V1UA 2IE0A 1HWYA 1K2WA 1WAMA 2GF2A 1HSOA 5IAAA 5KJ6A 2AQKA 3DZBA 4K1LA 3VPFA 3TRIA 1QSGA 2JKVA 4W99A 3RU9A 3W8DA 1EVIA 4Q3BA 5CPBA 4DPMA 3M6IA 3CMMA 2HMWA 2ZB8A 5KWEA 5FF9A 1TT7A 1VJ1A 1Y1PA 4YJGA 1LSSA 2HMSA 2O3JA 3GMSA 1BG6A 1PJTA 3U9LA 1CQJA 1IL0A 1HEUA 3O26A 1LC3A 2OUIA 4EUHA 1R4NB 2W8ZA 1YWGO 2CFCA 1EFKA 2BI8A 3B6ZA 4LRTB 1EBFA 3AU8A 4WLOA 4E6PA 1E1MA 1JWAB 3MJTA 3TZ6A 2OGUA 4FB5A 5CG2A 4OO3A 5JFOA 1YBMA 2X5OA 4GAEA 1YQXA 5AXCA 4RGBA 4UVIA 2AE2A 4QTZA 3DBRB 3DMYA 5JXWA 4U6SA 4BIIA 2AMFA 5ILOA 3GHYA 5COBA 1NYTA 1ONPA 1O95A 2FPIA 1YGYA 1P44A 3FWNA 2HAEA 2FZWA 3DO5A 4IJUA 2Q2WA 3QY9A 1CETA 3C24A 2XAAA 1MP0A 4AJLA 5EJ2A 1P1JA 1KEPA 3ZWOA 3UOGA 3GEDA 2NVWA 4EJMA 1P31A 3F46A 4NBRA 1FDTA 1LJ8A 1E6WA 1C0IA 1U3VA 1QV7A 5GZ1A 2HU2A 3CUKA 4OQYA 3RBZA 3UAGA 1R0SA 4NBVA 4FDAA 1FXSA 1NAHA 2GGSA 4OSPA 2GZ1A 5G0SA 5BSHA 5BR7A 1PJBA 3BHMA 3PYXA 4DPLA 1EZ4A 4J1QA 1X7DA 4DIBA 2X0RA 3CH6A 3JTMA 4DQUA 5I7FA 1YS4A 1ONNA 4CLRB 4TVOA 1J0XO 1PJCA 3KXDA 1T4DA 5F1PA 1PWZA 3R3SA 1LLCA 2QYTA 4DIFA 2DQ4A 5ITWA 1XIVA 2PZJA 1LDMA 2P4QA 4ALLA 4P38A 1N1EA 4RVGA 1I0ZA 5JAQA 4NI5A 1AUPA 1DSSG 2XPCA 3KV3O 4M8SA 3PZRA 5CEFA 4BKOA 1FMCA 1H6DA 4XYLA 1J6UA 4C7JA 4W9NC 2IZZA 1A7KA 5JCJA 2NV6A 2OBYA 2W98A 4N5LA 1B26A 3C1TA 3BHIA 1PZHA 4IDFA 2VTEA 1E92A 1PJQA 4YJHB 4A10A 1X13A 3CINA 1D1SA 4RL6A 1PJSA 1YO6A 4HNGA 3ROPA 4PG8A 4B8ZA 1KC1A 5EERA 4GLOA 3U4CA 1TI7A 5U1PA 4ZICA 1LA2A 1E5LA 1ZMTA 4J49A 4NU6A 1GV0A 3AOEC 4WCFA 3BMCA 2UYYA 4NG5A 5IXYA 1SBYA 2HQ1A 1Y7TA 3DOJA 3KYDB 5KJEA 3ZH2A 1L7EA 1AXGA 3A06A 3G3EA 4EJ6A 3L07A 1ONOA 4YRAA 2DBQA 4I9NA 4ZGWA 2C29D 1E3WA 2Q1UA 3GA0A 3K31A 2DFDA 1LRKA 3H3FA 5IDQA 1ZUD1 3NTOA 3I4FA 4AJKA 2BRUA 2Y0CA 5FEUA 2Y66A 2V6FA 4DXHA 4NFYA 4NMHA 4BKUA 5CDTA 4RJTA 2JAPA 3JQ7B 2Y1DA 3G79A 2YDXA 3PQDA 4FFMA 1X1EA 2GRAA 1DOHA 2EGHA 3JSAA 5HA5A 4XQGA 3RFVA 3DBHA 3JD4A 3OMLA 5I9MA 1QRRA 3BMNB 3NX4A 5IDYA 3V8BA 3TZQA 7MDHA 1ZW1A 1DRUA 3PHJA 3H65A 3AU9A 5EQDA 3INTA 3BIOA 1Q7BA 3ANLA 1UAYA 3L6EA 3L6DA 2Z5LA 2GLXA 2CMDA 1EUCA 2X8LA 3ZHXA 5B4TA 3GPDG 1Q0LA 1DAPA 2UUPA 3PRJA 3WBFA 1SNYA 3ITDA 2NADA 1PGPA 4II3A 4D45A 1ZH8A 4NPCA 4ZQFA 1CWUA 3G0OA 3UXYA 2J8ZA 2VQ3A 4W6ZA 5HWSA 2DU8A 4CR8A 1GPJA 2R00C 2XF8A 4FC6A 3E8XA 2V6MA 2EJWA 4A0SA 4WASA 3DZFA 4DIOA 1QYWA 3W1VA 4PG6A 2NWQA 2EKQA 3L6OO 1C1DA 2I5PO 1X1TA 1SPXA 1B8UA 4D0SA 1XR3A 1Y8RA 1MG5A 4GL4A 4J7CA 1KVTA 3Q9UA 4MVJD 1KETA 1F17A 3H9EO 2DPGA 2YHIA 4OHUA 5F1OA 5BSGA 2PA3A 1O8CA 1NWCA 5CEEA 4IQ0A 3VKVA 2O2SA 3N7UA 2FRDA 3VTFA 5KNLA 3ROQA 1ADCA 4XGIA 3JQAD 4UULA 2EG9A 4H7PA 5G0VA 5BNTA 3GDFA 1QKIA 1FJHA 2B0JA 3Q11A 3DL2A 4YJFB 3FRJA 3PZBA 5KJCA 2PD4A 4LCJA 2HK8A 4WUVA 1ZCJA 3LC2O 4BNUA 2CZCA 4AJ4A 4LVUA 4JBHA 3RSHA 2OZPA 1W4ZA 1GZ3A 3AY3A 3LT1A 1HL3A 3UCXA 1V9LA 2ZCUA 5JDIA 4AJJA 3AI2A 2PH5A 1ZK0A 4OYRA 5TT1A 1JLLA 3GZNB 3OQ6A 4W9NA 4R16A 5JCJD 4G5HA 1GEGA 4ZQEA 4Z0PA 3STHA 5CDGA 3PDJA 3JQ9C 3N58A 2BGLA 3TL2A 2FZEA 3GGGA 3F6YA 4U7WA 3V5NA 3QW2A 3JQ8B 1R12A 2PD3A 1DHTA 2ZJ0A 3QWAA 2A35A 1VKNA 3WNVA 4MOWA 4MVJE 1GUZA 2PKRA 2Y99A 4N5MA 3SC4A 2C82A 2O4CA 3ZU5A 1BVUA 4U6QA 4L0QA 4BO2A 1J5PA 3ITKA 1E3JA 4FJ2A 1QORA 4Z6KA 1P3DA 4IM7A 4GX0A 3AUSA 1AXEA 3JQBA 2AEMA 4PCVA 3IC5A 2ZB3A 2ZTLA 3MJEA 4BV8A 4GVXA 1NWHA 3LYLA 2NTJA 4GMFA 1QYXA 3LC1O 4OKNA 2IODA 3INGA 3UHAA 1LEHA 2HMTA 2I99A 2P5UA 2QZZA 2C54A 2WD7A 3LLSA 2NVUB 4CMCA 1PX0A 2GZ3A 3A4VA 2X23A 5TX7A 2GCGA 2G76A 4WGGA 4HADA 1T26A 2EERA 3H6KA 3WGYA 3QQPA 3WQSB 4CPDA 4EW6A 3M1AA 1LI4A 3VOSA 2ZKLA 1TT5A 4XEHA 2TMDA 3PLNA 1NNUA 3D4PA 1X15A 3HFSA 4PLCA 4Q39A 1BXKA 1XELA 2VRCA 1BDBA 3K8ZA 5BT9A 1K0UA 1PQWA 3WXBA 3LT2A 3RJ5A 3TFQA 2HJSA 2FSVA 3OSUA 1DIBA 1E1LA 3KRTA 3OJEA 4JN6B 2ILTA 1VJ0A 4YJFA 4QFDA 3TWOA 2GDZA 2EW2A 2QYSA 3WOHA 4BNKA 4DBZA 1CYDA 5TT0A 1IHYA 2DUWA 2W2LD 3O03A 5IDWA 1UXGA 3DR3A 3WMXA 4GGOA 3ONFA 1B14A 2UV8A 4BKRA 4RCVA 4AJOA 4NFHA 5A9SB 3UH1A 3DTYA 4EYEA 3NGLA 4YRBA 2ZYGA 1UZMA 3GUYA 3UUWA 3RBXA 5AOVA 1ENOA 1I3KA 1IHXA 5IZCC 1DJNA 2GERA 4HXYA 4UUMA 3FNHA 3ONDA 4RLSA 2VUTA 5MDHA 3WGQA 1YQDA 4URFA 5K9ZA 1ISJA 5A3VA 1KEUA 1RM4A 3BZUA 4D41A 2B4TO 4LW8A 1Q7GA 4J1TA 4G65A 3I52A 4AL4A 3DXFA 4FCCA 5TLSA 2GNAA 1LNQA 2BH9A 4EEZA 3WGIA 3AFNA 2QX7A 4R51A 3BTVA 4K6CA 1UP4A 4RPJA 3PPIA 3RCBA 1MA0A 2FY8A 1LQUA 4CM8B 1NTOA 1K3TA 1MLDA 3FBGA 4W4TA 3C85A 3TPCA 4L75A 1I5RA 1Y9AA 3G17A 4CR7A 2B5VA 1HRDA 2O3UA 3V2HA 3I5MA 5JMPA 2VHWA 4R1TA 1R15A 1UAGA 4PGFA 5G0UA 1JVSA 4ZU3A 3WGGA 1V3TA 3W4IA 1VE9A 5DP1A 3MTJA 3U3XA 1U3UA 4OH1A 3ZCXA 4O6VA 1NR7A 5HRUA 2ZIZA 2VWHA 2WWRA 3HN2A 3E9MA 5K0ZA 2JFGA 3K92A 1X0XA 3ANMA 5COAA 5IXSA 3UICA 1D4FA 3TFOA 3PI7A 1WW8A 5THKA 2Q2QA 4B79A 1E3SA 5DP2A 5C3MA 4GGPA 4UEKA 2IYPA 3D4OA 9LDTA 1EQUA 4UVGA 1T24A 1XCBA 1Y5RA 4BNXA 2X0IA 2OO5A 3Q2IA 2Q4EA 4Y67A 4D3SA 4WCDA 5DCWA 4J90A 4J0EA 1R0KA 2YHIB 4DQVA 3O8QB 1AE1A 5A05A 1GYQA 3T7CA 5IZCA 3AW9A 5JYEA 1C1XA 1ZEMA 3NT5A 4WECA 5CP8A 1HETA 5LCXA 4KUGA 5L95A 3BTOA 4WLUA 5TJHA 3DC2A 1IZ0A 1HDXA 4OKIA 2JHGA 3RUEA 3ZHBA 4U8GA 1TVEA 2GO1A 1U8XX 2PZLA 3MEQA 4TRMA 1A9ZA 3E6AA 1E7WA 4JJIA 3Q3CA 4BNNA 1E3EA 2O4UX 5H82A 4MVJF 4CM9D 2WMDA 4BQRA 3KSDO 4FFOA 3P5SA 2OBNA 1KEVA 4XWYA 2UVDA 3S2EA 3C1OA 1U4SA 3HDJA 1JA9A 1OC2A 3EGOA 3EVNA 5KKCA 2F00A 3ST7A 2NLOA 4K26A 2I67A 4OMUA 1NFQA 3GY0A 4A03A 2G17A 4WEQA 3H5RA 3EY4A 3FSRA 3GVPA 2G82A 1GR0A 3OA2A 1H6CA 1VKOA 1E7QA 4YT4A 4PLGA 3TZHA 4R1SA 4TKMA 1TEHA 1FDUA 3JQAA 1BW9A 4JJGA 1A4UA 1RWBA 3PHIA 4B8WA 5TGDA 4CODB 3EW7A 5AYVA 4Z9FA 3GRPA 3OJLA 4RPKA 4HUJA 1NPTO 1VI2A 2RH8A 3NDIA 2HDHA 3DBLA 3DZJA 3KLPX 1WMBA 3VH1A 4F6CA 2B5WA 3OEWA 1NM5A 1XG5A 3UKOA 3VZQA 1R16A 2PH3A 1U4OA 3VPSA 4G81A 2NU9A 4RPLA 1PGOA 2WEKA 3L4BA 7ADHA 3RC1A 1GY8A 3RBVA 1P0CA 3PTZA 4EUEA 3WJAA 4XA8A 3GGOA 2FN7A 3GVHA 3UGKA 3JQCA 1CIVA 4DLBA 1GD1O 3NYWA 4N18A 1JVBA 4FFNA 5ICMA 5K6AA 3QWBA 4MVJH 2XXBA 4LMRA 3JQFC 3EC7A 5LC1A 3NDRA 4KUEA 1J4AA 4PLFA 1I01A 1JKFA 3CZMA 3DQPA 3KBOA 4RF2A 3ZHYA 5ITVA 1ZSVA 4X54A 2XOXA 3AUUA 2QRLA 3ETDA 4IXTA 1DB3A 1YONA 1OFGA 4IY1A 2Y1FA 3T7EA 5L4SA 2EKLA 3D5TA 2Q1WA 4PG7A 1HSZA 3QVTA 2YZ7A 1GV1A 2B4QA 1JWBB 1ZFNA 3F1KA 4DLLA 4YT8A 1YBAA 1ZSYA 4XDYA 2ZQZA 1WXDA 3ICPA 3EZLA 4FJ1A 3F4BA 4BGVA 1PZEA 2DLDA 1G6KA 4XQEA 2B37A 1M6HA 2CDBA 3DZKA 2BFPA 3CPSA 4CM1A 2AA3A 1LLDA 2EHDA 1TLTA 1MX3A 3LF1A 2IZ0A 3RIHA 1S7CA 1DAOA 1P1KA 1YDWA 3CTMA 3SX2A 2HUNA 4CV1A 5JS6A 3HDQA 1UR5A 3WG9A 2AEJA 5GY7A 5BNFA 5JDIC 3VHRA 3HSKA 1N8KA 5F21A 2PWZA 3IAHA 3KM0A 1LDGA 3DHYA 1ORRA 2D4AA 1C1XB 4U5QA 2PV7A 1EQ2A 5AXAA 3H7AA 4HKTA 4Z9YA 3GZ4A 1PS8A 1O0SA 2D5AA 4JLWA 1KVQA 4JBGA 1BWSA 2QG4A 2JCVA 2DM6A 2FR8A 3Q1LA 1IULA 1U2DA 2DTDA 2P5YA 3RUHA 2Y1EA 3KHUA 2IEBA 1P74A 3L9WA 1CDOA 1NX6A 2HLPA 4K9DA 1KBZA 4OXYA 4IXWA 3DTTA 4JK3A 4CQMD 4A73A 1YL6A 2PNFA 4E0BA 4YYZA 1YB5A 5EL0A 4KTVE 4BV9A 4ZRNA 3X2FA 2PFGA 4XIJA 1A4IA 4J3FA 4GX2A 5FYDA 4BO6A 4I08A 1NP3A 4DYVA 5IFLA 1D3AA 2EXXA 5IF3A 1IPEA 5IN5A 5T5QA 4YAKA 4PRLA 4YXFA 1V0JA 3NJ8A 4O0LA 5DN9A 1SEPA 5AXBA 1ZEJA 4YTEA 4IDGA 4JP2A 1ZZEA 2VWPA 1F8FA 2O3TA 4CQLA 2NU6A 2HKIA 2Q2VA 2EV9A 3RUDA 2Y0DA 5DT9A 4AG3A 4TVBA 2R00A 1HDCA 2C2YA 2VN8A 4E32A 2UUOA 4L8VA 4F45A 3OIGA 1ENPA 1R37A 3QVWA 3GDOA 3HE3A 3FR7A 1B7GO 1SEVA 2IXAA 1B3BA 3VAZA 2F1KA 3O38A 4CM6A 2NQ8A 3NTQA 3VH3A 3P2YA 1P1RA 4EITA 3K9QO 4XKJA 4BHTA 1YOVB 2W2KB 1XKQA 1Z6ZA 3FF4A 4A5OA 4DMLA 4NBWA 3KSZO 1HXHA 1T2CA 4Z0TA 3PQEA 1VSUA 1ZXBA 3DFZA 1PIWA 1E1NA 1IE3A 4B7XA 1V6AA 1WPQA 2X9NA 3A9WA 1NQTA 4PVCA 1Z45A 3I9NA 3ROKA 4Q3NA 1I3LA 2Y93A 4BMVA 3DBVO 2WD8A 4A27A 4AFNA 2O7QA 3GPIA 2VOEA 3DAFA 3IIEA 1CERA 4GLLA 4KDFA 1CF2O 1ISFA 4XGNA 4BMNA 1NAIA 2PLAA 1HDGO 2QQ5A 4Q3EA 3GN1A 2A94A 3PK0A 3QWHA 1WVGA 1QV6A 4XQCA 1NPYA 4BO0A 4YAJA 1QP8A 4RDIA 4BGEA 4YVFA 1Y9EA 1ULUA 5C37A 4XDZA 2X4GA 2FWMX 1T2EA 2OXIA 2BI7A 3GOHA 3VVCA 2BMAA 2I9PA 2DVMA 3OP4A 3VPXA 5IN4A 2B69A 3FPLA 2FOIA 4YCAA 2NACA 1ISMA 3EUWA 4N7RA 3OEYA 4Y98A 3IUPA 5DBIA 4MVJP 3RKRA 1XU9A 3N74A 1N5DA 1JQBA 4LMPA 4CV3A 1GAEO 3E9NA 3PLRA 4NFSA 2C59A 1W8DA 3CMCO 4O1MA 1LSOA 3FR8A 4CLHA 4IGEA 3GVIA 4YDRA 4J7UA 3KSUA 4R69A 2NU7A 4TRRA 2TMGA 2VHYA 1IZ9A 2VYND 3EDMA 4IIVA 1M67A 1HDRA 3H5AA 1H0KA 1LDEA 3GLQA 4WNCA 2NU8A 3RC9A 4H15A 3M1LA 2Q1SA 2CUKA 3HG7A 2ZJ1A 4XYMA 1WZEA 1GCUA 3CZRA 4FN4A 2GASA 4CMKA 5JBIA 3DHNA 5L7TA 3B1FA 3JQDA 3HWRA 2GZ2A 2WTBA 4IJWA 5DBGA 2X86A 5CEJA 4G2NA 1Q7CA 1I32A 5A04A 1HZJA 3AFMA 3IMFA 3JD1A 1Y8QA 1DEHA 2ET6A 5JAZA 3JQBC 3VC7A 4EZBA 1YJQA 5G0TA 5JE8A 4IBOA 2JD0A 1WDMA 2CVZA 4KMSA 5DCUA 1NQ5A 5IG2A 1BTOA 4R68A 4CJXA 5KVCA 5HTOA 4O5OA 4XYGA 4AJEA 2JD2A 1BXGA 4XJSA 3DMTA 5IJZA 4IDEA 3DAPA 3G1TA 1GEEA 1HLDA 3JYNA 4AJPA 3JCZA 3MJCA 2FSSA 2X5KO 3PEFA 3QWFA 3R1IA 3RU7A 3I4CA 4J2OA 2ZK7A 2PGJA 1ZK4A 3GG2A 3MWEB 4RVDA 3G1UA 2P9CA 1EK6A 1VSVA 3QRWA 5EPOA 1V8BA 2HRBA 4PN3A 1GCOA 1E3LA 3HNPA 5U9CA 1OBFO 1W73A 1JDJA 4R1NA 3S2IA 1W0CA 4LSWA 4FOSA 3U62A 2AG8A 4BNLA 3MZ0A 3F9IA 3A1NA 4BB6A 1WZIA 2DAPA 1FDWA 4E2ZA 1U5AA 4EJ0A 2CDCA 4UAGA 4CM7A 4P4GA 3VKUA 4DGSA 1H9AA 4Y8VA 3P7MA 3ZW9A 2YYYA 3S8MA 4ZJUA 1N7HA 5JYDA 5G0WA 5L9AA 3C7CB 4DRYA 1GL3A 3GK3A 3VDRA 4OJNA 2Y1CA 1U3TA 1CRWG 4CV2A 5IZ4A 4AJNA 3WYEA 3DZHA 3M2PA 1IY8A 2HMVA 1R66A 4ALJA 1VJTA 4XYEA 3V1YA 3JYQA 3OBBA 4ND4A 1YKFA 4MIEA 1GYPA 3KVOA 1IOLA 4Y6PA 3ADPA 1H6BA 1EFLA 3GVXA 4HBGA 1EVZA 3GHHA 3UW3A 4A7PA 2CSUA 3DONA 1JAYA 3DOOA 5I8ZA 4CLXA 2QHXA 1NPDA 3LU1A 1ZNQO 3VDQA 1V3UA 4QX6A 1UZNA 1HYGA 4YA6A 1UXKA 2GUGA 4R3NA 2O3SA 4HP8A 4I5FA 3WSVA 4PLTA 3OJ0A 1Y8QB 5G4KA 2CD9A 2JFHA 2HJRA 4U0JA 1RM5A 1EBUA 1LC0A 3PFFA 5DBFA 2QIOA 4OXKA 3JV7A 3VPGA 3GDGA 3HDYA 2CY0A 3U49A 1HDZA 4DQXA 3HQ4O 4CMBA 4JP3A 3NAQA 2VT2A 2P2SA 3RROA 4JNKA 2GSDA 1DC6A 3F3SA 5FFFA 1I36A 2O50A 5TC4A 4UUPA 2E49A 5THQA 4I5DA 3KYBA 3EK2A 4IJKA 2BF7A 2C7VA 2GYYA 1FDSA 4OM8A 3FNFA 2DKNA 4L4XA 3ENNA 1G0OA 4J43A 3O8QA 1HE2A 3OIDA 4EEXA 3I3OA 5KVVA 4M54A 2B83A 3K96A 3R6DA 4ZQBA 3LLVA 4YAEA 1Q0QA 3IOYA 4LGVA 2VTDA 4KWHA 2CF6A 4AVYA 4MP8A 1I24A 4FPXA 3LDHA 4YJDA 3WX0A 1FDVA 3RUFA 3SBOA 3IKTA 4BNHA 3AM3A 4MVJG 1VL6A 5CAEA 5J23A 4CQMB 2PGLA 3S2FA 4B3JA 4ZN6A 1NQOA 4RPGA 4NIMA 3ZV5A 4BO3A 1P1IA 1B0AA 2Z1NA 1B2LA 1DC4A 1GQ2A 2FHSA 5A03A 4WCFC 2NTNA 4DUPA 2YY7A 1NR1A 1WWKA 1AHHA 4IPTA 3C7AA 3GUCA 1R6DA 2VCYA 2AQHA 5CG1A 1KC3A 3KYCB 2EW8A 5MGBA 2C07A 3AY7A 1N7GA 2VHZA 1E7YA 2ZQYA 2JCXA 1B3RA 1LUAA 5DCYA 3KEQA 1UZLA 4WOKA 3GVCA 4GBJA 2DT5A 2FPPA 4XGKA 3WR5A 1I3MA 4E33A 1Q2XA 1C0LA 1AN9A 3RUIA 2EKPA 3RI3A 1DXYA 5B4UA 2Q3EA 4ESOA 3PP8A 4ROSA 4RVFA 3K2BA 1QR6A 1DIHA 3AY6A 2E4AA 4WPGA 1SCUA 5CDUA 1E7SA 3ZW8A 4QT0A 4QSMA 5EIOA 3JYPA 3RUCA 3QVXA 1HDYA 5B12A 3A14A 3MCVA 5EESA 4BQPA 5L3ZA 3AOGA 1Z73A 3NJ4A 4RVHA 3E9QA 5JDCA 5I8WA 4MKRA 1P45A 1XQ1A 5JC8A 3GC6A 4RVUA 2O2YA 1PJ4A 4TSKA 5TQVA 2HSDA 3NTRA 1HYHA 4ND1A 1I3NA 3JQFA 4LN1A 1HE3A 5K6AC 1A72A 5TJ9A 3GEMA 2OOSA 5BNIA 1JTVA 6ADHA 4LISA 3Q9NA 1HZZA 3PWSA 2RIRA 3H9UA 5A4DA 4FBGA 3VH4A 3U0BA 4RQTA 4W7IA 1I2ZA 4Y6SA 3LZ6A 3KLMX 1IYZA 1BXGB 5JSFA 1RYDA 1U7TA 4FQ8A 1XLTA 3QVOA 4E12A 4YT2A 5L7WA 4BB5A 4CM3A 2JCYA 5EINA 4CUKA 2ZTVA 3BAZA 4E5MA 2H1SA 3OECA 4BUCA 1RKXA 4KQWA 3WYBA 1PQUA 3ORFA 4RORA 2FP4A 3PJDA 4BO8A 1DPGA 3VZSA 4BNYA 3NDJA 3RUAA 4FGSA 5C7IO 2PGDA 1ISIA 4PG5A 4MO2A 3CKYA 2E48A 4ZQGA 1LRLA 1NQAO 3HZZA 4P4NA 4MP3A 4IDCA 3TDKA 1MC4A 3QVSA 4CMGA 3FN4A 1B16A 4Y6RA 4M55A 1LDNA 1PGNA 2AQIA 3PHHA 5H81A 2J5QA 3M2TA 3FPCA 4XJTA 3JQ9A 5C7LO 5A1TA 1BHSA 4GQAA 4ILKA 4J4TA 1LQTA 1O9BA 4QXMA 3ZZNA 3UCFA 4D0RA 3WIEA 5ILGA 1GZ4A 2JFFA 2OL4A 4NZ9A 2AXQA 2VRBA 4GWGA 3GF4A 4EI2A 1UH5A 1V35A 4NK4A 3UVEA 1RM0A 4Z3KA 1LLUA 3PWKA 3FHLA 1A9YA 5EMHA 3AWDA 5B1YA 1ULSA 4YEDA 5F1KA 5LDGA 2ZTMA 3ZU4A 3EZYA 5T6BA 2D0IA 1OOEA 3FI9A 4PLYA 3NGXA 2YHUA 4CLEA 1UXJA 1YBVA 2CNBA 3OA0A 3WLEA 1ZJYA 4M49A 1HE5A 1PS9A 3K30A 3S1LA 8LDHA 2VOJA 3WGTA 4OAQA 3OFSA 2VYNA 1I8TA 3GAFA 5T8KA 1B8VA 4J6FA 4BKPA 3F5QA 3FD8A 3HFGA 2YQ4A 3C1AA 1N1GA 5GZ6A 3C8MA 1C0KA 1P9LA 1VPDA 2WYWA 3HB5X 5GMOA 4I5EA 3WWZA 4CMEA 1I30A 5L40A 3RKUA 4YT5A 1C1DB 1O5IA 2WE8A 4YJHA 4NQZA 4TROA 2PKQO 4H3VA 1JKIA 1K6JA 1KYQA 1GZ6A 2VNAA 1WDLA 2EIHA 4I9HA 3ZWCA 2H9IA 1SOVA 1PQPA 4GKVA 1K6XA 1S6YA 5CDSA 3JYOA 4ID9A 2VRCD 4EBFA 4M89A 3CEAA 4MJLA 2J5KA 1V3VA 2BGKA 1PEDA 2A4KA 4E2YA 2PR2A 4R01A 2JAHA 4YJGB 5CHEA 2AW5A 5G4LA 4LSMA 3JQ8A 4B7UA 4EUFA 3QA9A 4HFRA 5DF1A 2V6GA 2I66A 3H2SA 4ITUA 4TRJA 3TZCA 3WQRA 4HY3A 4R9RA 1UP7A 3KUXA 1RM3A 3GN2A 2VYVA 4BS9A 2JD1A 4OOFA 3ADOA 3QE3A 2PZMA 4ALNA 1L1FA 1Z74A 4J9VA 3ZWXA 1I10A 1BXZA 2B4RO 4FW8A 1AGNA 4CMEC 4IQ8A 3PWZA 2Z1MA 3ZWYA 1UDAA 1ZK1A 2YFQA 5JY1A 1QLJA 3HJAA 4IJVA 3DDNA 5TSDA 4BGIA 5GZ3A 4PLWA 1J49A 4OIMA 3VTZA 4CMJA 2YJZA 4DTIA 3OICA 4RV9A 3QV1A 3PXXA 1HF3A 5T8KC 1T4BA 4D7AA 5JC1A 1YL5A 4PZDA 4RPHA 1EEHA 2Q50A 3GQVA 3VVBA 1OMOA 1PJLA 3BMNA 5EN4A 1AHIA 4GX1A 4FOOA 3QWIA 5ER6A 1JAXA 1RPNA 1VC2A 3BMCB 2RAFA 3Q2KA 3RFXA 5U4QA 3DBLB 1GQYA 3UFXA 4Z3DA 4J1SA 1KOLA 3MJVA 4MIOA 2DBRA 2PY6A 2X9VA 4I5GA 1K6IA 3GAZA 2AE1A 4B4UA 2Y67A 4YQYA 3ZI0A 1ZXLA 3ZWAA 2VHVA 1YQGA 3SJ7A 4TRNA 3OH8A 9LDBA 1ARZA 1B8PA 4U0KA 2GN8A 4IMPA 1YXMA 3EHEA 3WQQA 2VUUA 1NVMB 3BYZA 3PJEA 4P4LA 2UDPA 5F5LA 4D46A 4TWRA 3O9ZA 3ZV6A 1SMKA 5BSEA 2Y68A 5HS4A 2LDXA 4GPD1 1F8GA 4RDHA 4BL5A 4CV0A 1H5QA 4RLHA 4D44A 1PS0A 3FTPA 1KVUA 4E13A 4E3ZA 5IDXA 3W8FA 1BVRA 4WKGA 1PGJA 4TMFA 3U4HA 1XEAA 3SC6A 3L77A 4HWKA 1GU7A 4ND3A 2DBVO 4NH4A 1RYEA 3WWYA 3I9KA 3KOUA 1HLPA 5LDHA 1D1TA 1H9BA 1Q1NA 2JL1A 4NJOA 4ND2A 4J16A 4OOEA 2G0TA 1LTHR 2BFOA 2VWGA 3BMOB 2OFPA 1JW9B 4WE3A 1ZKMA 5ICSA 1GPDG 3QP9A 1KEWA 4NR0A 2IRWA 2WYUA 4MVJA 1KY4A 4DL9A 4FSHA 5I9NA 1E77A 3IJRA 1YB4A 3U09A 3WGHA 3ZWMA 4F6LA 4BKQA 2FPGA 4J2HA 3GEGA 4GH5A 4MKZA 1M6WA 1T25A 1M75A 3CE6A 5COQA 1U1IA 4QECA 5KVQA 1YDEA 1M2WA 4DWVA 3DZGA 3GZNA 4YBZA 5A9TA 1SO8A 1M76A 2X22A 2R2GA 3GG9A 4B4VA 4UUOA 4CLOA 4C4OA 2ZYAA 1ZVMA 4QFCA 1C14A 3TL3A 3JQGA 3ANNA 1DIGA 2OHXA 1MC5A 2DTEA 2EEZA 4M87A 2SCUA 2BHLA 3OM9A 2Y05A 3HDHA 5JDCC 4DMMA 4FIZA 3FCOA 4WEOA 4W82A 3PYMA 2PKQP 2YDYA 1Y8RB 2X6TA 3ULKA 4E5KA 2C5EA 4JX8A 3H9JA 1F0YA 4GVLA 2FR0A 3PFWO 4LCEA 1MFPA 3T4EA 4GKBA 4BO4A 3KZVA 4MIYA 1Y5MA 4WLFA 2VYVD 1CQIA 4BNZA 3H3JA 4FD3A 4BVAA 1E7MA 1XSEA 5A02A 5B4VA 1SOWA 1BGVA 1PJ2A 3RJ9A 3W4KA 4DLAA 2W2KA 1E3IA 2G1UA 5TF4A 2RH4A 4F46A 4OXNA 1KY5A 4CL3A 2HK9A 3W6ZA 1KVSA 1VRWA 3U4IA 5A06A 1Y6JA 4OSOA 4CMAA 5CDYA 3I83A 4R3WA 1ENZA 1BW9B 2E37A 3WSWA 1DFIA 3I6IA 2IYOA 3VZPA 5ADHA 5TIIA 1UUFA 1TB4A 1U9JA 1OC4A 2O23A 1DJQA 1PTJA 3D7LA 4QQRA 1HKUA 2AQ8A 3MOGA 4FFRA 4UREA 4E5PA 3H4VA 5KCZA 4JQCA 3B70A 1HT0A 3KTDA 4CM9A 4FS3A 2P9EA 2H5LA 3I9JA 1WDKA 2J3IA 1LRJA 1G0NA 2PZKA 3IKVA 4M1QA 1H93A 3OF2A 1Z75A 4MVJM 3ZDFA 4R5MA 1C3VA 4HFJA 4PLPA 2BFAA 5DOVA 2AHRA 5T64A 3F1LA 3GT0A 4FC7A 1E5QA 1T2DA 2NTVA 5DNAA 1WNTA 4KZPA 4IGFA 4CM5A 1T2AA 1U2GA 3B1KA 3I23A 5I7VA 3KYDA 1DRVA 4BNGA 3ZWNA 2QRJA 3ZWBA 1Q0HA 2WE7A 3H8VA 4DVJA 1EE2A 1CEQA 2NQTA 5JPIA 3GRKA 4IMRA 1G1AA 3PIDA 1XA0A 4PLHA 3W8EA 4EGFA 1JKJA 3NV9A 4B7CA 4E4YA 3JQ6A 1PZFA 4MPDA 3DFUA 2GN4A 3JQEA 1EVJA
chains in the Genus database with same CATH superfamily
4FCTA 4IZHA 4ZI7B 4ZO8A 1NG9A 4C06A 4YQZA 4QEZA 1DIRA 3W2FA 2Y1GA 4D92A 1I7LA 2NTYC 2IPOA 2JJ8A 1M66A 4OB6A 2NVUA 3V4VB 1NY5A 4PZLA 1T0PA 3TLZA 2WD7B 3BB3A 3UXHA 1U99A 4FKMA 4G89A 1ADBA 2RE8A 3RAEC 5BWNA 4YB8A 4MIKA 1XRSB 2IA5A 3HSYA 1O1YA 1FX0B 3CF2A 1K7YA 5LM3A 4QSHA 3PYLA 3TSYA 4TS9A 5KKAA 4B71A 2CXRA 1MB0A 3WGNA 1E9FA 1BS9A 4RIGA 2ZTUA 2RCYA 3RYHA 3BH7A 2VR1A 5C7YA 4X7RA 5L51A 2AL7A 1KZ7B 1QX4A 1QYCA 3TBHA 1KAOA 2GVDC 2GPBA 2FK8A 3WFJA 2WJIA 3JYLA 3L7JA 3M6UA 2VJQA 4FE4A 4YP0A 5FPQA 4HLQB 3OEHA 4EB3A 1UFOA 3DFIA 2O8FA 1IM8A 2XHEA 3U7GA 3RLIA 3QXSA 5TNXA 3GGDA 5I9LA 4XYBA 1QNFA 1T3GA 1GNVA 2FPWA 4D4HA 4JJKA 4L8LA 5FUWA 2O20A 5ENDA 5AR1A 3PIIA 4PGGA 4X41A 4Y6LA 4B4OA 2H2AA 3NT4A 4OMCA 2OBBA 2PMWB 4XB2A 4EL0A 1IUKA 3ONEA 1RD4A 5CPFA 2ZS7A 4HX5A 4B9AA 3N0VA 1I7QB 2IKSA 1JYFA 3SM3A 3AI3A 3ZY6A 4V1CB 2Z6QA 4N39A 2BBWA 5JLAA 1Z39A 3DXYA 2O2DA 3RSSA 2CHEA 3HI6A 1RQ7A 1HOTA 4YWJA 1UBCA 3VHLB 2AYXA 4NSNA 3F6PA 3KB2A 2Z8YA 2AMLA 1PEKE 3SXPA 1JEEA 4EHNA 1IXSB 1J70A 1V45E 2FPUA 3VR5A 3I1FA 3WMFA 4TZTA 3BRWD 4OHVA 1UANA 1NVGA 1TZMA 2FA9A 3G6WA 1A9QA 3IQXA 4G0MA 5LMCA 1E2BA 1XQ6A 5AK0A 1BMFA 2VJKA 1G16A 4PZCA 3U61B 4D0NA 3GWGA 3ZXIA 2HLDA 1UQTA 3OFKA 3NHSA 3DEKA 1ZJ6A 3CVOA 1G21E 3AUTA 3BMQA 3MOIA 5FOWA 3HB7A 1J06A 3U3KA 3GJ3A 1EG2A 4KQEA 1AMNA 1EUDA 1WUTA 5LQMA 2OKCA 5EHQA 1C9YA 3ZYCA 5LD2C 1ZQ1A 1P7YA 5HF9A 4K03A 1L5GB 4A91A 4CL0A 1PD0A 2D8MA 5IT5A 1KERA 3WY9A 1KTIA 1KFEB 1DLJA 3FPAA 3JQAB 5L45A 4LJ7A 3O3MB 4R1QA 1W0KA 3BWDD 4OLFA 4A26A 2HSZA 3NZEA 3WKDA 1FP2A 1EVYA 4JKIA 5K6TA 3QKWA 2PUBA 3FM9A 1VHTA 4Y2JA 2A6PA 1O89A 2J67A 3MJSA 4FWIB 5G41A 4A0HA 5HIKA 5JAMA 3T61A 2C61A 3IOMA 1ULZA 3BFKA 4KDRA 4RKFA 3ROTA 4DBLE 3WDSA 3DAGA 4LQLA 1FDRA 1CUHA 3VYUB 1YFLA 3JQGB 1AUXA 4PLVA 4ZO7A 1V9CA 4O5AA 5CM9C 5EHZA 1GQQA 2XUIA 3OIFA 3ANXA 3AR7A 4BUJA 4TMVA 5JUWA 2ZE6A 4OQLA 4HQNA 5CK5A 1LJLA 5JVDA 3S55A 1Y80A 2PKWA 4HN4B 2VEOA 1MZPA 4LZPA 2XGSA 3EXHC 4YRDA 1D8AA 3T1QA 4FM9A 4QPJC 2H63A 5BWCA 3R75A 3S2GA 1GNTA 2AK3A 3HNRA 3KSMA 2AJDA 5J2TA 1Y8ZA 4N48A 1PU2A 4XX1A 4UDXX 3P9SA 1RXVA 3UMRA 3SG0A 4B6OA 4EW1A 3Q8MA 3JAWB 3S28A 2C95A 3N2GB 1SXPA 2BFFA 4DLXA 2GD6A 2WIFA 1TM1E 5JD4A 3GPBA 4BO7A 3HB4X 3QLUC 1G18A 4KLNA 1HE4A 2P1ZA 5G4KB 4J1NA 1M2NA 3H11A 2J0UA 1TK9A 4B2IA 3NHLA 4ZV7A 3F5SA 5K20A 3TFWA 3GFRA 3QA3E 3TQHA 4QREA 4ALIA 4KIUA 3NYQA 5BSKA 3OJFA 3JWHA 4Q3CA 1ZMXA 2WILA 2RHCA 4URZR 1TM2A 2Q4BA 4HX9A 3GGPA 5B37A 4TYYA 2NM0A 3I45A 4RZUA 5T57A 3UJ9A 2O48X 3PA8A 1XEFA 2DY1A 4OQZA 3G5MA 4QRHA 2EKDA 3DP7A 2ODEA 3ZVLA 3EXG1 2M6LA 2UYHA 1XTPA 3BE4A 1DVRA 3E8MA 1CVLA 2J9FA 1BIFA 4TTQA 4HH3C 3G49A 1L8LA 3ZZTA 4CDNA 3NC0C 4P22A 5HKAA 2VBCA 1MAAA 2DBYA 1MJ5A 1PNTA 1U2SA 2H2FA 2IYUA 3RU3A 2WWIA 3EGXB 4FJ0A 3K8OE 4YWHA 2OPBA 4BJ5A 2PSDA 1R3DA 4M76B 3AT1A 4WESA 1T9AA 2GBCA 3ZNNA 2OV1A 3S68A 4KPFC 1X1AA 1C3JA 2VHXA 2QMZA 2WFZA 4G09A 3TSCA 4E5YA 3WFIA 4NBSA 2ZS8A 1G19A 4EHHA 3NDBB 1EG7A 2C1XA 3OQ1A 1VMIA 3RF6A 2X9GA 4P3XA 2PU5A 3PQCA 1N2CA 3OPYA 1SXHA 3FPGA 4GOXA 4D79A 1T8WA 2BFMA 2QRMA 1NHGA 3E1SA 3I05A 4DLWA 1AKEA 2G9VA 4S3MA 2A57A 4R98A 3EB9A 3KHKA 1ECFA 621PA 2HK7A 2IYEA 1RYMA 1YZQA 1OI4A 4H6VA 2IBMA 2VF4X 5M3BA 1EMDA 3HBFA 1OIWA 2ZJBA 2OHFA 3D3KA 3WTCA 1QVAA 2NN3C 2X5XA 4ALKA 4E30A 1LBQA 2F8SA 1FX1A 1OVGA 4MZDA 3WGVA 1B0UA 3BXXA 1AO3A 1E9AA 1AOXA 1F8YA 1JQLB 3OCVA 3ROMA 1UAAA 4IRXA 2CHGA 4ESHA 5EZYA 5GGXA 1D6JA 1P0MA 1Z13A 2HIMA 2WYVA 4KWIA 4UC0A 1QP4A 1NLUA 3AIOA 1QRUA 3ZWVA 5HXAA 2VAXA 1ZH4A 2XF2A 3EUAA 3FYTA 4RO0A 4MUHA 1IMJA 1IN7A 3DMNA 4ZU1X 3QIVA 2BW0A 3ZI4A 1RXWA 1Z6QA 1PUJA 4HHEA 1GAJA 2PYZA 3Q6MA 1U2QA 3E18A 1J99A 4UBOA 5C80A 1OWPA 3LZDA 4I46A 4QGFA 5BQFA 3RARA 4RTNA 3QPDA 3R0IA 4JLDA 3LFUA 1L4FA 4MRVA 5DYTA 4YMIA 2YR0A 4J1TC 1EI9A 4ZOLF 3H19A 3FNEA 4BNMA 1ZSNA 2PWYA 1H2BA 4Q1AA 3DB2A 3WQHA 4DIEA 1QF6A 2EP7A 4Q0MA 1HDOA 4QEDA 2F1JA 3HWWA 1AVTA 4JI5B 1KDRA 5F7JA 5CT6A 4BZXA 2IWHA 1Z06A 1N8NA 4CKCA 5BSMA 2JKZA 4J9UE 3STUA 1ZOLA 2P41A 3UYKA 1NW4A 5ED4A 1QXSA 2FMUA 4KDCA 3AKCA 3IS3A 5DSXA 1FY2A 3SXJA 3FZNA 4B6GA 4CDMA 4QGSA 1GYRA 2ALJA 2ZRIA 2J32A 4KB5A 2X7HA 4YAIA 3B8HA 3KZKA 1VCNA 3SAJA 3N76A 2P40A 2PK3A 2VK1A 1MXHA 2A9RA 2Y1XA 1L4NA 2REBA 4L4RA 4CMIA 5KOJA 2W2LA 1JILA 1F4PA 1AF4A 6AT1A 4LY0A 5E6SB 1W2WB 4O4HB 1RI4A 5ELLA 1MGOA 4R40A 5ES3A 5G2OA 3RC3A 3BJMA 4UE6A 1YE8A 1ZO8A 5JAIA 2G9NA 1UK9A 2XCLA 2QTGA 2KJQA 4ARBA 2CNWA 1L5QA 2ADFA 3LQFA 3WLQA 4ZJZA 1II0A 2V0GA 4CM4A 1WQ3A 4JBIA 4OI1A 1KOGA 1W2HA 3FXAA 4KXLA 3FCUB 4K3VA 1WHSA 3EDRA 2P7HA 3IAXA 1KMMA 1TQ2A 4O2BA 4DBLC 1SBZA 3NOVA 1JB1A 3O2SB 1G21A 1VE3A 1X70A 1Z0JA 3F5FA 4WUTA 3U7JA 2BKVA 4FFSA 1MO6A 1X8KA 3TOSA 3K4QA 2RHJA 3C8HA 4FILA 1VIDA 5A6VA 2WV7A 3EZXA 1D2EA 1IWPB 2HQRA 5CTAA 1GZ5A 5EE5B 1DE0A 1CQXA 4ES6A 2CCKA 3CRW1 2Q45A 4Q47A 3QPCA 4X1IA 3ZGLA 2RBEA 4YRFA 4L85A 5AW1A 3FNIA 4FR5A 3SZGA 4IKEA 1QG0A 3PNMA 5KJFA 5DN6A 3V4ZA 2QRHA 1RRFA 2W90A 1E2KA 3L1JA 1BMDA 4ZOLB 3UMMA 3I9LA 2I6FA 3DZDA 1QH0A 2QLJA 4QTUB 4RSMA 1UADA 5AVJA 3ZCPA 1DEAA 4NU5A 2Q49A 3N6RA 3L7LA 1L7MA 4P4TA 3W8NA 5K4HA 4DBVO 2PS9A 3KUKA 4PRKA 5KSZA 3R3JA 4TL9A 3VDXA 2MDTA 3RSFA 3AHEA 4B87A 4N76A 3OUZA 1ULAA 1PL8A 3LOQA 3PNVA 1ZK3A 5H3LA 4HAIA 4AMBA 5AUOB 3V4FA 7GPBA 4LDNA 3UH0A 3IH5A 4BFCA 1US8B 1WOYA 3A1CA 4GG1A 3PDUA 5KTTA 5C1PA 5LKRA 2X0NA 2QZ4A 2OCXA 4URHA 4H3KB 2YICA 4M88A 4JCOA 4X61A 4U1RA 2CBZA 2RB4A 4PC6A 1Y81A 2EL7A 2MIIA 4OQDA 2OV2A 3HZOA 2QTLA 3E9YA 4X64B 4WN9A 5A5GA 4DCSA 1EFUA 3A6JA 2AEFA 1RC1A 3GIDA 4KREA 3AEQA 1AJEA 1BH6A 1DEXA 1FMTA 4JUAA 4C3UA 2ZCVA 4UVEA 1L5LA 1VG8A 1FRVA 4C0KA 3O90A 3M89A 4IVPA 4MINA 1PWXA 1OZGA 2HNBA 3KR2A 1RJWA 4E2WA 1Z4OA 3AM4A 4ZVMA 2EARA 3DMHA 3ZDEA 5JW6A 1AMUA 1BVYF 2YWDA 4GPTA 4YRIA 4M9UA 2H18A 4MGHA 2DLNA 2V45A 4HNHA 5HBGA 1WUJS 3K70C 1V9SA 1OXXK 2BZSA 3D8SA 1JQ5A 1T9BA 1H5NA 4K40A 1AGRA 1RWPA 2DFPA 1YASA 1Z0ZA 2AN3A 4IILA 1GTMA 2UZ1A 4RZ2A 3GFGA 1S8FA 4B4KA 2V4MA 1Y4DE 4OGWA 2VZ8A 2JBAA 4BWVA 4L76A 3EPLA 3M49A 3CXRA 2OUKA 3NRJA 5TVKA 1YVDA 2LDBA 2VT3A 2IL1A 1Q6YA 2FFRA 2P1RA 2WDZA 4KQXA 1SPBS 3WTBA 4I1OA 5T67A 4FTWA 1ODSA 1RAFA 2XAUA 1XALA 4YP5A 4KLRA 4F5YA 4NCHA 3CCFA 3LDAA 5L7YA 5JRJA 3L9XA 1EK2A 3D6TB 3LQ1A 5J4VA 2M6KA 2PRJA 1UZAA 4U7TB 1GQSA 3HPQA 1QANA 2BSAA 2PSJA 2RG7A 1BYIA 2FFJA 2E5FA 3PFNA 1DBRA 3AL0C 2JIQA 3U9TA 1WCIB 2I76A 1I6KA 4OJTA 2VWQA 3OJXA 1DIAA 2OWEA 2V03A 1E3WB 2FJ0A 1RCTE 4D1YA 3PFBA 4NE7A 3ROZA 4TQGA 4CCYB 3ME5A 4L73A 4AJ9A 3FWZA 2V3CC 1E2JA 3I9OA 4O2LA 1T9ZA 1IPFA 4H18A 4NS1A 2FX2A 4QLAA 3ZJUA 1EX7A 3LHDA 2ZU0C 4XW2A 2B7BA 3PXUA 3M34A 4UVDA 2YW2A 4LI0A 4H35A 1FRNA 1LSJA 4MS1B 1FFSA 1BDMA 1G8YA 4WFKA 5FTMA 2JJQA 4EDFA 5FA5A 2G3YA 1EAMA 4IXMA 5EXDA 2PBFA 2H1WA 2Q7XA 3IQDB 3PUXA 4B40A 4B74A 1JIXA 1NLYA 3EF3A 4NENB 3W5VA 1AN0A 2WF9A 2MSWA 3GRZA 3LVFO 4PZEA 3TLEA 1H1DA 3GCWA 4QO8A 3TI7A 1MB3A 1Q77A 2YV4A 1CJCA 3TAUA 4MJXA 1T13A 1U8YA 1K9SA 2B21A 1R4NA 4MWGA 4XB6B 4B34A 2C1EA 1E64A 1GZ7A 1QCCA 2P3SA 2P2NA 2YZNA 2Q41A 3B6MA 2YUTA 3BWYA 3FCSB 5HTKA 3U4DA 4R0MA 5CR9A 1QDLB 4V2UA 4FQ5A 4QZVA 3UMSA 4FYWA 3HFRA 2OHJA 1ZP6A 3QEOA 4UU8A 1OBOA 2EZUA 1E9SA 1E96A 1RQ2A 1U5CA 3DKIA 4QYXA 1YS2X 2D2IA 1Z2OX 2Z57A 4DSZA 5ENZA 3UXEA 2P11A 2WSMA 3PXGA 5K05A 2OZLB 2W6JD 3ZQ4A 3H5WA 3PVCA 1S2OA 6LDHA 5L4NA 1H94A 1QGAA 3K4PA 1NOKA 3MB5A 3R5XA 5EI5A 4BLPA 1HG0A 1KBQA 1ORIA 1E9EA 3FSJX 4R0VA 1CX9B 1ID1A 1PHPA 2F67A 2MT9A 1TOAA 1SB8A 4Y9UA 3VTKA 1NW5A 5JZBA 3NEYA 1ZUNA 5C8ZA 4HPWA 2IP1A 4V0SA 4OL9A 1C0PA 4AUEA 4XQ0A 3V42A 2CVQA 5IMBA 4PYIA 3ABIA 3QX9A 4CQLB 1K89A 4DV0B 1CS0B 2V9ZA 1N2SA 5IEBA 1ZIYA 1FLAA 2C0QA 4BE7B 4RVOA 3PT5A 1KQOA 1JFLA 1QX3A 1NXVA 3JARB 5LFAA 3CS3A 4JX9A 4RF4A 5JSKA 3ZHOA 3K2EA 3VGJA 3DLTA 3D0KA 3I2FA 5EQFA 1HPLA 3KTAA 3AVVA 5F3RA 2A86A 1QR2A 2Q6LA 3HVIA 4HXEB 2AGVA 2GEUA 4YAUA 4Q03A 2BFCB 2QK4A 3CQ9A 3F4KA 3GCXA 2WMNB 4R41A 2OORA 1KR5A 2VDVE 2GEDA 2YJNA 3HBJA 3BKXA 3BXPA 4ZYLA 4JOBA 3TJRA 3N8IA 1E6UA 2FFQA 2K2WA 4YP9A 3UV6A 3ZTWA 4ESVA 2VAWA 2QN1A 2GPTA 2FWBA 4UEJA 1B0ZA 4ZT5A 4ZIRB 1GGVA 2G63A 4D4KA 1BEEA 4HOYA 1ZNXA 3AOEA 4PFJA 2VH2A 2VYQA 2I9KA 4GZLA 1G59A 1I2BA 2Z9BA 2VTVA 4J6EA 3RS5A 4KG7A 4CN8A 1TTTA 3SEZA 1ML3A 2DMRA 1XTKA 3P9YA 2P9FA 4RV4A 3O9MA 3URKA 4AICA 3TW6A 2XDQB 4Y7CA 2B99A 3UKDA 1NI3A 2H6EA 4GBED 1SCKA 2Y8EA 1XU7A 2AT1A 3V1UA 1PNQA 1QCYA 2WSLA 5K6RA 1ZD8A 2GF2A 4MR7B 4RA9A 4PFKA 1C7IA 4RHTA 3QBJA 2YH2A 3V00A 5IAAA 5KJ6A 3Q8KA 3B5IA 4KNVA 4HL6A 4X3CA 3OU7A 4KFTA 3TRIA 4EGJA 3AEYA 1JHXA 1SUCA 1CCWA 4W99A 1KJIA 3RU9A 3X0DA 2A58A 4B75A 5CDHA 4DPMA 1EP1B 3CMMA 2ZB8A 4EFLA 1ZXXA 5FF9A 1I7SB 3FCXA 4PY2A 3GEPA 2O3JA 2HMSA 2QG6A 3LUGA 3OCCA 3DT8A 1PJTA 1N1MA 1ZH2A 3OPYI 4RJ2A 4F71A 1CQJA 5IRCD 3A2KA 4F2DA 3I2KA 1WB9A 3G9XA 2G1KA 1R0XA 3O26A 1FLDA 4JYAB 1YWGO 1TYBE 2CFCA 4NYIR 4WACA 2VDMB 5E1MA 5FH9A 4AT1A 1IJEA 2WKSA 5IG2A 4E6PA 3OZWA 3TZ6A 2VAMA 2IHNA 2OGUA 4FB5A 2P0EA 3B48A 2HU7A 3CLHA 3TUZC 4LDJA 1J2RA 3HCCA 3VYVA 4M8NE 5AXCA 1XNGA 3EX7C 1AUVA 1ZM4A 5JI2E 4UVIA 2X9LA 1N4AA 3SSOA 4LJ8A 5FTNA 4RXTA 1OLOA 3TR5A 4BIIA 3L43A 1XRQA 3AZPA 1VB3A 5GM2A 2XUGA 3IBTA 4Q7LA 4DLTA 2D6FA 3KQYA 5FTLA 1J25A 1YAHA 1NYTA 2ZSFA 1EEXB 4KR3A 4N8DA 3B6EA 2QTRA 3FWNA 5ERYA 4IJUA 4QNRA 4L07A 3ZLVA 1CETA 3SHVA 1BVHA 2Z9CA 2QQFA 1A8PA 3P9ZA 4RIFA 1JH8A 2A9VA 3F9RA 3SF8B 3T3DA 1OY1A 4CIBA 5EJ2A 1P1JA 1ZUNB 2J6HA 1FMJA 4MV0A 2ZWIA 5IP5A 2O8DB 1YNSA 3W8RA 3TLYA 1P31A 3NNNA 1H2YA 3MTAA 5CDUA 1JEYB 1GILA 4NBRA 3ZCRA 4L9AA 5FBZA 1QV7A 4A6EA 2PM8A 3CG0A 4Z4QA 10MHA 4OQYA 1XROA 3HYRA 4EYOA 1XMSA 4FDAA 3CBGA 1E0AA 4KXUA 3O84A 2PLFA 5G0SA 5BSHA 2GILA 5A5VA 4G4SO 1P72A 3R41A 1G2IA 2OR3A 4LWQA 2VCHA 4N9QA 1T0BA 4ROTA 3OTQA 4DG8A 4C9BA 4IVNA 3BK1A 4RD6A 3ICWA 3BCHA 3N28A 2EX1A 4CLRB 4TVOA 4JB8A 3OT1A 3B3AA 4Q3LA 1PWZA 3BHNA 3ENQA 3R3SA 1SKYE 4GOLD 4R6XA 5G1OA 4OP3A 2DQ4A 1QH1A 3I76A 1WCWA 2Q8QA 1XIVA 3PNLA 4H6PA 5D6NA 5CXSA 3SI7A 5AJYA 5BW6B 5F12A 5FULA 2YOHA 1SY7A 2EAUA 4WA7A 4GEGA 2XPCA 2PLWA 2IHYA 4XYLA 4FYJA 3DVSX 4MS1A 4YFYA 3ZX5A 3FWKA 3VU0A 3Q88A 3GH1A 3EZ6A 3SSNA 4DDMA 1G8PA 1FXWA 1SVIA 2W98A 4N5LA 1B26A 1A7JA 1N5JA 3C1TA 5FA6A 4YUVA 1L5YA 3RAGA 1XVAA 2H48A 1VJ5A 1XVTA 3FDIA 4UTRA 4B3SB 4W6QA 4A10A 1FE8A 4C6RA 5CX1B 4RL6A 3T9AA 4QXAA 4OLBA 3VI3B 2V9PA 5JV5A 5F78A 4HH4A 1PJSA 1RWQA 1JXQA 4A8JC 5E9WA 2JGDB 5CFLA 2HB6A 3RW9A 4B8ZA 2R1UA 1XJ0A 3ZH9B 3DUFB 4INOA 3LVQE 4LZWA 4ZICA 1DKLA 1JDPA 5LQCA 4ZHQF 5LQKA 5AM3A 3LUDA 3EFBA 3WI7A 2LV8A 3AOEC 3SS9X 1VIMA 5FOXA 4GMHA 1Z8DA 4R1MA 5IXYA 4W5OA 4KN8A 2HSWA 3DOJA 3ZH2A 1OVMA 5JZOA 5LL6P 3A06A 4EJ6A 4MCHA 3QITA 3CA8A 3L07A 3ZHUA 2JLXA 2IS2A 4YRAA 3HKEA 3P2IA 1L4BA 1SXJD 1JTEA 2CHQA 2A33A 3PCTA 4ZGWA 3GA0A 2JRLA 2BL4A 3HJUA 2QD3A 3EIQA 5EXPA 1VSBA 4WNAB 1B2RA 3GFTA 4IHJA 1K6MA 3A8TA 3NTOA 3NXSA 4HB3A 1EFDN 2Y0CA 2BYTA 1Y5NA 1FTYA 1C2YA 3F98A 3QU2A 3KQUA 5GQSA 1XZKA 4NFYA 3R7NA 4NEHB 1H23A 2OGWA 4EVQA 4KCGA 3E15A 3CLUC 1AHNA 2MR6A 3KT8A 5J63A 3G79A 3G0BA 2YDXA 3NH9A 4TV9B 5AKEA 1JFSA 3C4VA 5LXTA 1D2GA 2G0NA 4XQGA 3I6ZA 3N2NA 3OMLA 3PQ5A 2DY0A 1QRRA 3W6OA 5IANA 1NDUA 1QPGA 2A3RA 2G5GX 4D74A 7MDHA 1BGXT 4CI9A 1DRUA 4OA8A 1X9HA 3PC2A 4IIJF 1VHQA 2WWTA 4ZARA 3DBOB 1B23P 3TPZA 4P4UA 2Z5LA 1V5WA 3OJWA 2IYVA 1VKHA 2OEPA 4OHYA 2B6NA 2CMDA 4GRAA 3N07A 3WRWA 3J80A 2AZXA 1J8MF 1DRJA 3ZHXA 2W22A 5B4TA 5BN3A 1Q0LA 3HACA 1KZGB 1UM9B 4Q93A 4Y2UA 2J3EA 1D2MA 4CF5A 3F73A 5FT9A 4DMHA 4ZVUA 3B3QA 1SNYA 1N2ZA 1XO1A 2CFIA 4II3A 1D04A 3ISTA 3MRXA 3PUJA 3CGWA 4HDKA 2GWHA 4I4TB 4IV5A 4IZOA 1QVVA 4QT4A 3TIXB 2F3RA 2R00C 2XF8A 4OQFA 4N8SA 2I22A 1U81A 4YRPA 4IJQA 3W7BA 1Y7IA 5D3MA 2NTEA 4X6YA 3AVXA 4YS6A 2Y4OA 3DZFA 3DOUA 4L4ZA 3E2MA 1QRTA 3BDIA 4GFDA 4PG6A 4QODA 2XEXA 5NULA 1KH3A 3C5CA 1B8UA 3C98A 1XR3A 4JU9A 4YP7A 4X9XA 3RU2A 4Z7NB 2NXJA 5CFMA 1KVTA 4UNSA 2R751 4GI7A 1EYZA 3TW8B 1L5HA 1KETA 1F17A 5D1NA 4CFZA 2CV1A 3LUPA 4GSYA 4OHUA 1DQZA 2PA3A 1O8CA 2XITA 3AR2A 4F5DA 1P62B 5JWHA 3GJ0A 3FOBA 4YH1A 2BMFA 2A5FA 2LGJA 4I1YA 1DKUA 3G8AA 1PT9A 1G21B 3CLVA 4RX1A 3VTFA 5KNLA 3ROQA 1ADCA 1RJ9B 1BMQA 2BLNA 3BEOA 3IEIA 5E7IA 4YK7A 1RAGA 5LA6B 5BNTA 1QKIA 1ABBA 2B0JA 4AQ7A 3Q11A 1QP7A 1V4BA 3RRJA 4AKIA 1KI8A 2Q8PA 3QPBA 4LCJA 1VOTA 1RC8A 3H0KA 4L78A 4QYTA 2QTWB 4XE5A 4DUZB 4IUDS 6GPBA 3LC2O 2A0WA 5JALA 1F2DA 5KOYA 1J0AA 2XBMA 1NMSA 4FI3F 4AJ4A 4S2EA 3W3AH 5CBPA 3L0CA 4JBHA 2OZPA 5EJ7A 5K8CA 1UC9A 2ZPUA 4BU1A 1CPYA 3PQ7A 3IMEA 1XI2A 1V9LA 3RGGA 3UO8B 3K5WA 1SGWA 3KAQA 1EFTA 4Q01A 3TB6A 2MSNA 4AD8A 3AI2A 5IBQA 3UW1A 1ZK0A 4OYRA 5TT1A 2Z5VA 4EY7A 1D4AA 2HDOA 2ZSHA 4PF1A 1EWVA 3UTCA 2KYRA 3PD7A 3WAKA 4BE9A 3GV0A 4HS4A 3VR5H 2IH4A 4G5HA 4Z0PA 4ZQEA 5CCDA 3STHA 3UWOA 5ERXA 3T12A 1YDHA 3V5NA 4B3BA 1RQGA 4UDYX 2N46A 4C4TA 1A5BB 4UTZA 4ENWA 3DE2X 2V5VA 1CTQA 3M5DA 2PKRA 4MVJE 2Y99A 4N5MA 4PYLA 3U3MA 1FMFA 3SHOA 5GIOE 5DNCA 2C82A 3X1XA 5HCNA 4CEHB 3MAGA 3ZU5A 3G8BA 2W2MA 4LC0A 1H8ED 5LB2A 2UZ4A 1NBEA 4L0QA 4L2IB 5EMMA 4B5LA 4BO2A 3ITKA 4YJ2A 4MGEA 3EODA 2C2BA 1FFXA 1ODIA 3M4YA 2WMYA 1FB5A 2OENG 4FJ2A 1QORA 4UMVA 4WZAB 4Z6KA 4JITA 5KSWB 4IM7A 4JI2B 5PGMA 2FWIA 5CITA 2AEMA 2BDEA 2Z09A 3ORHA 4PAMA 4OLJA 5JH7B 1TJNA 3MJEA 4BV8A 5BVHA 1QHIA 4P5EA 1ZCZA 4L51A 4OGKA 1F2TB 3PC3A 4KAFA 2XE7A 2PYDA 3ND6A 3ZCUA 5H8WA 2I3ZA 3DEFA 5A7GA 3GLGA 1U98A 1ZESA 1K5DA 2L2QA 2YBDA 3UHAA 1H0SA 1GQFA 3K9HA 3ER8A 1YB2A 4EKDA 1XZQA 4AF6A 1RWNA 2P5UA 5FNVB 3RRFA 3ILYA 4Y1RB 3MUOA 4Q9LA 4DXAA 1XA3A 3IE1A 4AG5A 2VDLB 2P5TB 2H5JA 1PX0A 2ZIGA 3BL6A 1D2HA 3GNLA 3KU4A 5TVGA 2G76A 3AR5A 5DLQC 1MVNA 1COZA 2EERA 2IUEA 3A6DA 3DW1X 3H6KA 3P4UA 4B0OA 3L0OA 2ATVA 3UHPA 2PMFA 1EFVA 1QFMA 1IXRC 3I8OA 3HVHA 2QJWA 1EWYA 2F9LA 3CLTD 3HU2A 1LI4A 3M1AA 5LYJB 5I7UA 2UUCB 1TT5A 1YRWA 4WXHA 1UF9A 4L02A 4XEHA 3D4PA 4DADA 1V16A 2PSHA 5EJIA 3HFSA 4JA0A 1GPBA 3UWMA 1J5XA 1U7UA 4AF8A 4LYYA 5FWYA 2EKZA 1BN6A 1MD9A 1XELA 5JU6A 2PVCA 1THZA 2YMQA 3NC1C 3I62A 2GAOA 5KPDA 3SQNA 1A88A 1TVKB 4RKEA 4MDYA 1OQAA 1K0UA 3UPUA 3HMQA 5LKAA 1E2EA 1OT3A 2FSVA 1DAEA 2VFAA 1RRMA 3A6LA 1QNLA 1LS1A 4GR5A 1P80A 3B8EA 4FHZA 3OCWA 3OJEA 3QKUA 1WXHA 1GXSB 4N7JA 1ZH0A 2GDZA 2F1RA 3BGIA 1CYDA 3DLIA 4LMBA 1IHYA 1NUPA 4U7PB 2DUWA 2Z0MA 3CZQA 5ALYA 3I0MA 4CF7A 3VSEA 5IDWA 4BQIA 4ABTA 1N2XA 2GD0A 5CB0A 1ESNA 3LPLA 4JHXA 2KLHA 4LKRA 4TXJA 2UV8A 4BKRA 5I01A 2LPMA 1R10A 1WXIA 1EX1A 1NU6A 3HKBA 1X2EA 4M9QA 4MQFA 3CN9A 1TQ6A 3W9YA 4RCVA 4RA6A 2Q2NA 2O5CA 2QDKA 4Q6BA 3K15A 1YA4A 3O9VA 3BRWA 2HA4A 4NFHA 3UH1A 3E3OA 3CVYA 2R8ZA 3OY7A 3LGAA 3GUYA 1T1IA 1W1IA 2P2LA 2V4ZA 3B6JA 3DOIA 2BAGA 1E4YA 3BH0A 4I6JA 3RBXA 5AOVA 3A1UA 3RPEA 4CF3A 1N5RA 4E3WA 2FN8A 4Y2QA 1TA0A 2P65A 1UJNA 1EESA 1DJNA 4M8LA 3HPRA 1AKTA 3UQZA 5MDHA 1CZOA 1YQDA 1POWA 3KV1A 5K9ZA 1FPMA 4TKZA 2IX3A 2B4TO 3PNOA 1E1RA 1RQPA 4G65A 2HHAA 2PMCA 4NAUA 1LNQA 5KYWB 1NV8A 2LBPA 4Y2YA 5AK6A 2L0XA 1SVSA 3I73A 3E05A 5JBQA 3WGIA 3AFNA 4PQRA 1YHZA 1YU9A 3ETJA 3BTVA 4R51A 5ALRA 4B7ZA 2PS0A 2OORC 1MA0A 1S02A 1LQUA 3OLVA 4US2R 1Y3IA 5FLXA 1UBOS 4XGQA 1MLDA 2EJCA 1OKKD 4JEHA 1D5CA 1Y9AA 2HHCA 1T35A 1XYYA 2IOFK 4CR7A 3QF7A 1L7QA 1HRDA 5DB4A 3I5MA 1GA1A 1R15A 3AIKA 2KLBA 1YS6A 4LHYA 1J8VA 1ZQ9A 5G0UA 1NT2A 4ZU3A 4OUKX 1ES9A 3C45A 4C78A 5DP1A 5DM0A 1J0EA 1AS2A 5DHPA 4OMFG 4W1PA 3SFZA 2FCAA 5B55A 3R5HA 1NR7A 2WIAA 3R2JA 1CDEA 2VWHA 2D1SA 1AQJA 2Z08A 3HN2A 5BN5A 5K0ZA 1WHTB 3L46A 2Q4DA 5EKSA 2R6R1 3UOWA 3ANMA 4KYVA 1TEXA 5COAA 4LDAA 4M7OA 2SBTA 1M2VA 4DCCA 5THKA 2LP4Y 1E3SA 3GRYA 3OTGA 5DP2A 1TNDA 3V7UA 3F3YA 5CIYA 2ZUUA 4LBZA 4IDOA 2I6XA 4TS4A 3PXDA 3AUJB 2IF0A 9LDTA 4NJEB 3ZKAA 3A4NA 4A2WA 4C5BA 3Q6NA 3FB4A 3ENVA 5EC8A 5C46F 1YR2A 2Q4EA 1ZNZA 3CJTA 3U48A 1GT91 4JLPA 1X42A 3F8WA 4D6XA 5ITZA 3MERA 3K09C 4YMUA 1RXSA 1VDZA 5HRCA 3O8QB 1NJ5A 1ZONA 4N40A 3HGTA 1GUDA 1GYQA 2I6QA 3D6VA 3QQ5A 5F7OA 2GZDA 4OXQA 3ZVMA 2A1IA 4O4IB 1C1XA 3NT5A 2ZSJA 3DMRA 4WECA 5JY6A 1FBNA 1VSQA 3F7TA 4KQIA 5HE8A 3O8DA 4X60A 3WMGA 3QMMA 2WIBA 3FKQA 4D0LB 1IZ0A 4OKIA 421PA 1F48A 1MW8X 2GXSA 2E5WA 3HCWA 4GMDA 1DKPA 1GA6A 4TRMA 1G6Q1 2FW1A 5HJ7A 2Z98A 4JJIA 1PG0A 4IVRA 3ONVA 5JJLA 1E3EA 2C5GA 5H82A 1WCXA 1XNRB 2WMDA 2GJKA 2QRQA 1E60A 5JTTA 3S2EA 1KEVA 1R5NA 2UVDA 4XWYA 4KL8S 1U4SA 1BDIA 3KJIA 1JA9A 3EVNA 1UINA 3MMSA 1OTHA 3MK31 3VU1A 3ST7A 2NLOA 4K26A 2I67A 4ZEMA 5KC8A 4NXMB 3GY0A 4RM3A 1OAKA 1YIAA 3FSRA 2HT6A 4C3OB 4R8SA 4RGVA 4PSVA 3L4JA 1P2VA 4R1PA 3IDAA 1QGOA 3W6NA 4UFPA 3VTAA 3N8KA 3FPSA 4PLGA 2QX8A 2CL5A 2WIDA 4TKMA 1TEHA 2GAFA 2PT7A 3JQAA 1BW9A 3HJNA 1OLUB 4ZT4A 1RWBA 3SXUB 3GRPA 3OJLA 4A8JB 4Y6OA 3ZE6A 4L0CA 1F6DA 5AVYA 3QPVA 1JEJA 2B2XA 1GTSA 3KLPX 4IYJA 2QY9A 1E1RD 2BC9A 3QVKA 3REFA 2QPLA 5LLTA 1NM5A 1PT8A 4KVFA 2QTHA 5HNKA 2XI4A 4PO1A 1PVVA 1VMAA 4L0MA 5BRJA 3SX0A 5ARBA 2XTZA 3II6X 2D7DA 5DHRA 5CXXA 4DCJA 1JRLA 1NIJA 2BGNA 4OQ4A 1WHTA 4AUKA 4ZO9A 2FSHA 2NOAA 3OZTA 3V8EA 3QEBZ 3ETCA 3EUFA 5G3YA 1X80A 3Q7EA 4XA8A 3WJAA 4JJ7A 1MR3F 4DLBA 5J3JA 3UGKA 3V7YA 1MDBA 1SFRA 1U1EA 1JVBA 2YJ3A 4N18A 3V7FA 1JFTA 5K6AA 3TLBA 4MVJH 2PR7A 3KAPA 4LMRA 4LG1A 2PXCA 1T0JB 1M8GA 1AB6A 5DMXA 1J4AA 3O31A 3C15C 2ABWA 4BVJA 1GHTA 2CW5A 5F77A 2D5BA 3ZE0B 3ZHYA 4DF3A 4ZK2A 5ITVA 3W3ZB 4LV8B 2N3ZA 1MOQA 1ETUA 3VI4B 4YMWA 4L5IA 4YASA 5ICGA 4JI0B 3T5BA 3SE0A 4IOKA 4U2CA 1FYXA 2IHZA 4LSZA 5L4SA 3D5TA 1TYZA 1V1RA 1KMHA 2JKYA 2R87A 3KT3A 1XCMA 1P9OA 4IDHA 4RWZA 3W5HA 3AHGA 2YZ7A 5E9JA 4IX1A 3SJAA 1V96A 1GV1A 1GAWA 2WT9A 2XVXA 4M22A 4EMSA 2G77B 1ECGA 1FJXA 1ZFNA 1EVEA 3F1KA 2MSKA 3HNOA 1QHHB 3ZLBA 3AHCA 2ZQZA 1WXDA 5DRYA 3TTYA 1LCIA 3NM5A 2AMJA 2C7PA 3F4BA 4BGVA 1PZEA 2FUG6 2JAQA 3HCPA 4CDGA 5HRAA 3RYFA 1M6HA 1VG0B 1NVXQ 2CDBA 2WF5A 3NR2A 4YROA 3KFVA 3RS3A 3U17A 5HKKA 3FWYA 1KSHA 2V8BA 4JEUA 4TZ6A 1RSZA 2P9HA 2FZKA 2JGRA 4PAOA 3IRVA 4P4SB 4AN0A 1YR9A 2IZ0A 2IS4A 3RIHA 2H11A 4MYCA 3SYKA 3FOZA 1JDUA 3FVQA 1E5VA 2XVZA 1NQWA 3AUFA 3T99A 4CV1A 1UR5A 2VKTA 1MQ8B 4YUAA 5JS6A 2BT4A 5TV2A 4C2AA 3G6KA 5GY7A 3JALB 4P9NA 5JDIC 3VHRA 1N8KA 5LXTB 3FA2A 1SVMA 3OIVA 1KZHA 2FYTA 3IT2A 1ORRA 2AD1A 2D4AA 3D6HA 4JBYA 2A5JA 3H7AA 2JLZA 3PX2A 1JIUA 3I04A 1PS8A 3BIJA 4RGQA 3WSTA 1HTTA 1KVQA 1SZPA 3C3DA 2RC6A 4G6ZA 4F9FA 1UPTA 4ODIA 4ARZB 4CG1A 4N6OA 1Z88A 3GA7A 3HZHA 3M9LA 5FLEX 3RUHA 4ZKEA 4OREX 5A6SA 2HIAA 1IN8A 2HGZA 2J07A 1DUSA 4I6GA 3UT6A 3FYUB 3MJRA 1YR7A 2ZIFA 4F91B 5DH9A 3R7WA 1NXOA 4LF5B 4KGVA 3SX4A 3T41A 4MUAA 4OXYA 2FRDC 3N2LA 3WLIA 2QUKA 2GZHA 1TA9A 1UWKA 4CQMD 5BRAA 2PNFA 1CUZA 1YRYE 1SBCA 5K0FA 3EEOA 1EXDA 5DW0A 3D6MA 3AZQA 5T41A 1VYUA 5SYMA 2WFMA 2AOUA 1NP3A 1CJBA 1T10A 1J2JA 4B6RA 2HCRA 5T5QA 2F2TA 4PRLA 4UAVA 1QVWA 4YAKA 1V16B 3G0GA 3OCJA 4BP3A 3JARA 3NJ8A 4TL7A 5EPUA 4C4SA 3HY3A 5IC4A 2PT9A 1ZEJA 4YTEA 4ZRDA 3QSYA 4MUJA 4UJ5A 2VWPA 2W6CX 3AEUB 4CQLA 4YDQA 1K7CA 4Z0NA 2HKIA 4MUFA 5AHRA 4M0PA 4ZMSA 3WIUA 5M29A 1LTQA 1V1MB 5KYUA 5AKZA 2C2MA 1HDCA 2K4MA 3IP7A 2JHAA 4PHFA 4E32A 1L8AA 3JPWA 4BTLA 2QN6A 2BZ1A 3E7PA 4LUCA 5D6OA 4F45A 4JI1B 1R37A 1RZ3A 2BY4A 2Q4TA 4FXPA 5FNVA 1BCSA 4B45A 3GT4A 1B7GO 2RGNC 3EWAA 5EEGA 1VE6A 1UKAA 3ZY2A 1RCFA 2CVPA 2GEBA 3O38A 3PLAE 2X2OA 2NQ8A 3UAYA 3ABZA 2QOEA 2ZWOA 5FJJA 5KYNA 3VH3A 2CZQA 3FMGA 4EITA 4EKEA 2X7JA 4LWPA 1D6NA 3AB7A 2WFLB 1QTRA 4JGIA 4JI6B 4BHTA 4BBJA 2W2KB 4YPVA 4AECA 1Z6ZA 4P83A 3T5GA 2QRVA 4DY6A 3FCYA 3KSZO 3LUHA 4F2HA 5E9QA 2NXNA 2QR3A 4OGFA 2NO7A 3OE7A 1K06A 1KJ8A 2JJ2A 2HMYB 3W06A 5FKJA 3T9DA 3ILSA 5A0VA