1IIBA

Crystal structure of iibcellobiose from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYS
publication title The structure of an energy-coupling protein from bacteria, IIBcellobiose, reveals similarity to eukaryotic protein tyrosine phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 35
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iibA00
4KK3A 2MSKA 4WT7A 1ZN2A 1Y1LA 3TX6A 4DQDA 3MM4A 2WJAA 5FWXB 4N41A 1JBEA 2PAFA 4LE0A 1SXHA 3TMYA 3GYBA 1EWVA 2IOYA 4MS3A 4ZPJA 5GQSA 2E4XA 1QP7A 5HQJA 5DCLA 3KKEA 4YP9A 4ZYLA 2J48A 3LUJA 5TPWB 1QP0A 1D4ZA 2HJ9A 1ISSA 4RK1A 1LJUA 3Q41A 5FBHA 2NT3A 1CHNA 4D74A 3UUGA 1LJLA 1E6KA 1RZRA 2FEWB 5EWJA 3Q7TA 2MYPA 4KK4A 4RV5A 2N9UA 1PNTA 3JVIA 3OLWA 1LK0A 4MR7A 4IGAA 3SAJA 5KC8A 3F6CA 3EULA 3O75A 3T6KA 4ZMRA 1DBPA 1Z2DA 2NUBA 3OMXA 3HO1A 3CG4A 1DC7A 3G85A 3O2SB 3QEKA 3GBVA 4MYRA 3HS3A 5IUKC 4Z4HA 4KNYA 5FWYA 3JTEA 1DJMA 2FMHA 5B3JA 4DADA 3HV2A 1QMPA 1BVHA 2FVYA 2A9OA 1ZY2A 1JDPA 1QQAA 3SM9A 1Z16A 4QYMA 2FEPA 3CZCA 1MVOA 2FW0A 2FN8A 3OLZA 4S05A 3DLBA 1Z26A 1JFVA 1BDHA 4MQFB 3C3WA 1NXXA 2PUCA 1QO0D 3A10A 5EWLA 3RVMA 2NZVG 3H5IA 1TLFA 3LKBA 4EYOA 2BGGA 3FMVA 5KQLA 1NXSA 4MLCA 3Q15C 1DC8A 3VNAA 4ZJPA 3SQNA 1JF8A 1U0SY 4NCAA 1JFSA 5TQ2B 3OM0A 3FFXA 3CFYA 3OQMA 2FQXA 1D5WA 3GV0A 4Q6BA 4N76A 4F3TA 3OO1A 5IULC 3A0RB 4TLMB 1QQBA 1JL3A 3LTEA 3QEMB 5TQ0B 4HNSA 2M1ZA 5HKOA 4IRXA 5HM6A 5PNTA 4F11A 3IPAA 3H5WA 1LBHA 4NQRA 5TPZA 1VRVA 1LBIA 3HM9A 3N0RA 2FQYA 2QXYA 2FMFA 1VLZA 3GL9A 3D8UA 4P1ZA 1K66A 5JNTA 2I6FA 2L17A 1ABEA 3IP9A 1EFAA 3EGCA 5C5CA 2E4ZA 1J56A 3M9XA 1K68A 3RVNA 4NICA 3OLXA 4OATA 2WY2D 3OM1A 5BR1A 1YMVA 3I45A 5TQJA 2QVCA 2LPMA 2WB4A 4MRMA 3UKJA 3MA0A 4MS1B 2RDMA 4P98A 2QW1A 2GX6A 3O74A 4HYEA 1ZESA 3ILHA 4MR9A 1PEYA 1JWLA 3R0JA 4LE2A 4G86A 4WUTA 5C5EA 2HQBA 3G1WA 3I42A 3IP6A 2FQWA 3F6PA 2B1JA 1GLGA 3LUFA 4ETNA 3BREA 4LZLA 4EVSA 5F64A 3HUTA 4OLAA 3H6GA 2JCGA 1ISRA 3C3MA 1RZRD 4Z4EA 2KYRA 1M5TA 1ZDMA 2FXIA 4RXTA 2IPMA 3GT7A 4OBBA 3F7NA 4ETMA 4M88A 3EJWA 2E4YA 3EODA 2W42A 5GOTA 4H3HB 3M9WA 1S8NA 2JBAA 2PLNA 3RVPA 2JVIA 4N0PA 4O5AA 1JFTA 3C97A 1D1QA 2YHBA 3URMA 8ABPA 3A0UA 3C3KA 3OLYA 4JB0A 4O1IA 4EYGA 4RK5A 1NXPA 5EWMB 4YS6A 5DLEA 1I3CA 3KTOA 2FN9A 4PYRA 3N0XA 5CHYA 2M98A 3T95A 1FQWA 3NHMA 3RVQA 1XWWA 1YMUA 3BRQA 3Q7SA 5IUJC 3H1GA 2PUGA 3HDVA 1WETA 4PICA 4W5RA 3HZHA 4ZMSA 1R8JA 4Z99A 2F8TA 2AYZA 3FFWA 4GPAA 2MYUA 4MR8B 2F8SA 1CYEA 5DKFA 1EWKA 3E3MA 3OO0A 4KRFA 1KMIY 1TMYA 4OTZA 4MQEA 2B4AA 3NNNA 4NV3A 4Z4FA 4HNRA 3K9CA 3KSMA 3BBLA 4JOQA 4W5QA 1ZAYA 2RJOA 2PUFA 1DBQA 2PMCA 3MF4A 4GNRA 4QICA 1YK1A 1ZVVA 1U2PA 1P6QA 2Q5CA 4KQ9A 1USIA 5IUNC 1E6MA 3OQOA 4N0QA 1U8TA 1CEYA 2PL1A 1YVUA 2E4VA 3H1FA 4W5OA 3IP7A 1YK0A 3DBIA 4EYKA 2PL9A 1L5ZA 3H5VA 4PZ0A 3H5OA 3JPYA 1HEYA 1XHFA 2A9RA 2R25B 5TPZD 4YR7A 1APBA 1QNLA 2HQRA 2L2QA 3O21A 2QU7A 4EVRA 3MMNA 3L49A 2ZAYA 4KV7A 4KQCA 1SXGA 3CHYA 6CHYA 3W9SA 4MR7B 2PJUA 2HQOA 3LUCA 2H0AA 5JNRA 1QPZA 3H1EA 4UHKA 3LUDA 2WMYA 1BDJA 3CU5A 3DLHA 2A9QA 1F4VA 1Z12A 2V0NA 1QP4A 4F8JA 1BDIA 1NXWA 1ZH4A 4Z9AA 5JNVA 1MB0A 3NNDA 5T7BA 1EAYA 3O1JC 3KLOA 1USGA 5FWYB 2P4UA 3K4HA 2PE5A 1PEAA 2QR3A 3QX9A 1TVMA 3JPWA 4L4UA 3M6MD 1PHRA 1ZGZA 4S04A 4RWEA 3MQ4A 3SY8A 4RKRA 2A9PA 3B2NA 4G97A 4IMJB 4L85A 4UHJA 1Z18A 4RXUA 3LOPA 1ZH2A 3OLVA 2AYXA 2L19A 2MSLA 5EWLB 1Z15A 5ABPA 4RDCA 1Z2EA 3NBMA 2DRIA 2L18A 3QELA 4Q7EA 3UK0A 2QZJA 4KMRA 3QK7A 1OXBB 4RS3A 2FMIA 4G0QA 1Z25A 5CNKA 5KWSA 1YIOA 1Z13A 3FDFA 3CLKA 3LKVA 3EAFA 3ILYA 3DGFC 1JLKA 1GUDA 2JVJA 3N6VA 4JB2A 1C4WA 2H3HA 1TJYA 4Z9BA 2HPHA 3A3KA 3T38A 4KPYA 4KVFA 3Q9SA 1M5UA 4YGXB 5I4CA 6ABPA 3CS3A 1NXOA 3N0WA 1DRJA 3NNSA 4MS4A 1UDRA 4WXEA 4RK4A 2GI4A 3O2QB 5IEBA 3N53A 1JYFA 4FE4A 1U2QA 5IX8A 1ZITA 7ABPA 1QKKA 3P9YA 3TD9A 1C0EA 3BILA 4E7OA 5ED4A 3OQNA 3HXMA 3RVJA 2HSGA 4MPTA 4N03A 1L5YA 1DCKA 5HSGA 3CTPA 4HNQA 5IBQA 3GBPA 3H6HA 4XASA 2ID7A 2VUHB 1T34A 1MB3A 4YWHA 4FE7A 2CHFA 3JVDA 4LDZA 5FWXA 2LP4Y 3RVOA 4Z4GA 1AB6A 2ID9A 3IPCA 3GWGA 4MRMB 4RK7A 3QLVC 4YO7A 3HVRA 1GCGA 1YTUA 3QLVA 4TMYA 1GCAA 2CWDA 5KQGA 4MR9B 4OLBA 3CNBA 2E4UA 5E3JA 4YCSA 5TPWA 5JNWA 4LDAA 3FFTA 4ML3A 3HUUA 1VKRA 2ZWMA 2VUIB 1E6LA 2GKGA 3L6UA 3O1HB 2FKAA 4H3KB 4RK6A 1FSPA 3LUKA 4YV7A 5IEJA 4B09A 1W9HA 2JK1A 1DZ3A 4LX8A 4KREA 3DGEC 5JNSA 3KLNA 2JRLA 3QLTA 3DZDA 3CRNA 2RGYA 4EGSA 3N75A 2JBAB 3IDOA 4JASB 1GUBA 3CKMA 2PUBA 3NHZA 3HK2A 3RVSA 3TB6A 2VYCA 3H5TA 2GWRA 2VK2A 4MAAA 3EDCA 3KG2A 2FEKA 9ABPA 4IILA 4MS3B 4WXMA 2IDMA 4YLEA 2X7XA 4Z4IA 5JNUA 1IIBA 2PKXA 5T3YA 1RPJA 2IPNA 3H75A 2GBPA 3TO5A 3KYJB 1DCMA 1KRWA 1NY5A 1NATA 3FGZA 3KS9A 4O1HA 2PUAA 1E2BA 2E4WA 1Z17A 5DTEA 4FB4A 4MQFA 2IPLA 1NXTA 3RVKA 3OMWA 3T8YA 2LBPA 1OXKB 5KI6A 2P9HA 2JB9A 5EWJB 1M2EA 2XDYA 5CNJA 4F06A 5KC9A 1P2FA 4MQEB 1KGSA 3JY6A 4RKQA 5TQ2A 1F51E 1ZHHA 3HCWA 1W25A 3ROFA 2FLWA 4IF4A 3D02A 4XAQA 4Z4CA 1M2FA 4PEVA 5B3JC 3F73A 2OQRA 1PUXA 1U04A 1D1PA 1P8AA 2TMYA 4CBVA 3QEMA 1TM2A 4WWHA 2MSWA 5TQ0A 1ZGGA 5BRJA 1RNLA 3GA5A 2LUOA 4EY3A 1XHEA 1A0OA 4G0XA 2WRZA 1NTRA 4MLDA 4JP1A 3SG0A 2MYNA 2FSPA 3BRSA 4W5NA 5BQ3A 1ABFA 1MIHA 2R48A 4DN6A 3LUGA 2QV0A 3Q7RA 4PE5B 4RY9A 3S99A 1MAVA 1SXIA 2FLKA 3RVRA 4G0PA 4H60A 3GRCA 1KRXA 4TN5A 2NZUG 1PNRA 4G0YA 2WWVD 3IP5A 1SD5A 4KZKA 4RK0A 2O20A 1D2AA 3N8IA 4IMIB 4N47A 3RVLA 3KHTA 1BAPA 4D6YA 1VPWA 2WJWA 5IC5A 1JX6A 3MIZA 4RXMA 3C6QA 3I5AA 2R47A 5KQPA 4YRZA 4MS1A 3KJXA 1H9CA 1EWTA 3EQZA 2JVKA 4E7PA 1JDNA 3HEBA 1B00A 3HSYA 3O2JA 5CNIA 4RY8A 1RXEA 4EYQA 1AB5A 1P6UA 4Y9TA 4XARA 2RJNA 4XXHA 1DRKA 2QSJA 4RSMA 2FTKE 4LE1A 1QO0A 3H5LA 5BRAA 4F12A 3RQIA 4Q6WA 2FMKA 4QPJC 1DCFA 4G0ZA 4ETIA 4G0OA 4WZZA 3VNBA 3CZ5A 3JS5A 4MGEA 4RY0A 1YS7A 3O1IC 3LUHA 3QELB 3EQ2A 5CNMA 4JAVC 2CD7A 4OG2A 3ROTA 1FFWA 4EVQA 1DG9A 3E61A 4TLLB 5TE9A 3I09A 4JA2A 3KYIB 4G0MA 4W5TA 1SRRA 1A2OA 2R4QA 3LUAA 5JS1A 1JH9A 5EWMA 1A04A 1FFGA 4LRQA 2PUEA 5JS2A 3MYYA 5DGCA 2OENG 4EUKA 2CHEA 5D2CA 2QVGA 1DP4A 2LIVA 3QX8A 1RXIA 3LMKA 4RU1A 3LFTA 4Z0NA 3RH0A 3KCNA 4MS4B 4D6XA 4RZSA 2IYNA 2MYTA 2YHAA 1URPA 1NXVA 1JYEA 3QLUC 3SNKA 2NT4A 1JHZA 1BA2A 3QLUA 5FBKA 4KFCA 1FFSA 3CG0A 4MR8A 2IPAB 4XLTA 1EHCA 4XFKA 3HJFA 1DBWA 2PUDA 1USKA 1YS6A 2IKSA 4NCBA 3HDGA 5KQMA 4QYWA
chains in the Genus database with same CATH superfamily
3FVWA 4PSDA 1HFKA 2JIPA 3DEAA 3PHJA 4F3CA 1KZ1A 2ZBUA 2D0IA 3URKA 1Y6JA 1V1RB 1KYXA 2HO5A 2IUEA 4K28A 3GYBA 4A4DA 1SHUX 2IBTA 1EWVA 2WF8A 3PGXA 1AT1A 2OBMA 4W1RA 2OD7A 1CIJA 2HCJB 5IYZA 5KPJA 4BMOB 2J9ZB 4A16A 1F4PA 3MB8A 3ZWMA 4QECA 3LUJA 2QP4A 3N2NA 3M5DA 2G06A 4GAEA 4I8DA 3N6RA 4ZVTA 2HJ9A 3VHQA 1ISSA 4WLFA 4N5IX 4G0NA 3JD1A 3VSEA 4D74A 2P3SA 2DC1A 3AJAA 3QQPA 3I9MA 3WLHA 3PFHA 5KMGA 3G9TA 4I50F 3VVMA 4F86A 4CETA 2B1RA 2JFBA 4LEIA 3B20A 3RC7A 5CFNA 3GJ8A 4QUDA 2HLPA 3TR0A 1LLCA 1CJBA 1X19A 3E9YA 4V0MA 3V2UA 5CXQA 4HRXA 4NJEA 4K6FA 2FW8A 5LYJF 1I6MA 3F5SA 3DDUA 5LIPA 2JD0A 4TRNA 5LQKA 2G1AA 5INTA 3TTSA 3ZXIA 3H9JA 4BE9A 1L7NA 1MMFB 2F9MA 4GPTA 4JJ7A 3CW2A 3IJ5A 4TVOA 2I67A 1N6OA 1IG3A 3GVHA 5C3UA 1M5RA 3S2ZA 1GAWA 2JJ2D 5ILQA 3D8RA 1GZ4A 2IXAA 3INRA 5B3JA 3WLPA 3NPAA 4NZ9A 2PH5A 4UAGA 5H83A 4NZMA 2PQ0A 4MEAA 3D1JA 4O4LF 4CEIB 1EHYA 4DABA 2XQIA 2MDTA 5AOVA 2HI0A 4FYXA 1E3JA 2JGEA 4YACA 4A2CA 4FFNA 1TU3A 2O0LA 2FW0A 3FCOA 5JS6A 2CXHA 4ARZA 2J6HA 1Z35A 2GO7A 2XUPA 1NLMA 3SIWA 4YMGA 3RODA 1N36B 1CFJA 4PN3A 3SEZA 3ENQA 4RM3A 3GAMA 3COPA 1OH5A 1Z7EA 1KH1A 3KR1A 3TW8A 1U8EA 1I51A 4M1TA 1DC8A 4RF4A 2C4MA 3DVLA 3HA7A 4TT3D 4HDRB 4ZYVA 4HQ0A 3OT1A 1JFSA 1SUWA 3UC9A 4M9CA 4ENVA 4JGBA 5H3HA 3FWPA 1CE8A 1DAEA 4IP0A 1U0HC 4MCIA 3KKZA 3EIQA 5HJEA 1L5WA 1A9XA 3QEMB 3N8HA 4YALA 5ARCA 2M1ZA 3L7YA 1KQNA 5HKOA 1DIAA 3NB0A 2EW1A 4RWZA 5E4JA 4WDRA 5EIOA 4MNTA 3UGTA 3JQAA 3ZZTA 1RHUA 1ZRMA 4C6RA 1REQA 2WTEA 2H5LA 3EXFA 4FDUA 4M9XA 3EFEA 2FP4B 4EA8A 2NV2B 1AJEA 3PQ5A 3OEWA 3SBEA 1FSFA 2R8EA 2Y1XA 4RHEA 1WEHA 4YP7A 3KYCA 1TQ8A 1VLZA 2B5WA 2PT6A 5ISMA 1OGJA 5HE9A 4N5DA 4OHWA 4AN0A 1MTOA 1EFAA 2VYFA 2DUJA 4UNPA 1KSFX 1IM2A 4WTOA 1JG6A 1Y6RA 2CJWA 4OB8A 1IHUA 2IHNA 2JAPA 4O2BB 2QYHA 4LRUA 5H8WA 1H5QA 1RLTA 2OUIA 3BMNB 2XB6A 1F2UA 4X6UA 1PQWA 5C5IA 2IGTA 3ETEA 4OJQA 1FTWA 1L4NA 1Y34E 4KQ1A 5FEMA 3AJEA 3TN7A 4DRXB 5CMLA 4UOQA 3FPGA 2UUAB 1SQ6A 1JIXA 2VJMA 3DMDA 2PWYA 4ZD6A 1A5BB 3WP1B 1XLUA 1N2ZA 4DXDA 4OKIA 1RP1A 4NDAA 1TCVA 3U80A 4OLAA 3CJQA 1LV8A 4XM1A 2JFVA 4DLBA 3C3MA 4U7JA 4XVUA 1FB5A 3K6KA 2B4TO 1RZRD 3MG9A 1JLLA 1LQ2A 1NQAO 1YSCA 2WIKA 2IL1A 3BCSA 1U8CB 5ALQA 3YASA 4U7GA 3MTIA 1HFWA 2O7SA 4TS3A 4BAZA 5CYFA 2NXJA 2EOAA 3M9WA 3NV7A 3DMGA 1AKNA 3CVXA 3OFSA 1KJJA 1YCFA 3I8XA 2QL6A 4UFPA 3C97A 1E92A 1D1QA 3AKCA 3B7WA 3IELA 3DV2A 3GRFA 1AQ6A 2ZUFA 3DW1X 5BUZA 1NXPA 4QGGA 5AUOB 3I6QA 4OH1A 4OUDB 3ROEA 4JVOA 4RVDA 4V39A 3OC6A 3ZDQA 1FDWA 3MBIA 3QSYA 2VUTA 1QUEA 5D3MA 2QGNA 3VJKA 2QQ0A 5EINA 5D87A 3RBVA 1FP6A 4WE3A 2C4KA 2WHXA 3R23A 3VOBA 3HZHA 4HWSA 2NOAA 2R2AA 3MJHA 1QRUA 1DAHA 2WJ3A 2XHEA 4P4UA 1DHTA 1E6WA 1TLTA 4PZZA 4BFCA 2F8TA 2ZRJA 5JAHA 1QVVA 4IMRA 3LOUA 2YWBA 1EWKA 1MIOB 2GEJA 1Q91A 3HNPA 3OO0A 2B25A 4IIUA 1M9NA 4BB6A 4BFWA 4AROA 4Z4FA 3BE4A 3SHFA 1KK2A 2VJKA 4IVNA 1VYVA 1LLUA 2IZ0A 3MF4A 3GZNA 2Q3DA 3Q3VA 4M7OA 3FGPA 3PWTA 4JUAA 2ZB2A 3OZFA 4O25A 5L3RA 3ZX4A 3B2EA 4HDSA 4RVUA 4BFVA 4YV2A 4PSAA 5A9RA 2I78A 2D1QA 3MSCA 5F3RA 1XO1A 1ZM4A 5F2EA 1CEYA 1NNLA 1ZD3A 3LE8A 4MYDA 4LJRA 1OSNA 2NNLD 4N3NA 3A7EA 2GBIA 1KQOA 1M6VB 6NULA 2GKSA 4RHCA 4B17A 2NTVA 4HGYA 2K5UA 1DTSA 2XWJI 1C80A 1FSGA 2K4MA 3OOHA 5GJCA 2QLTA 1H6CA 1PGPA 4MVJP 2AMFA 1OLUB 4QUKA 4OM8A 1JJ7A 2E87A 4WK6A 1SXGA 4ME6A 4MHSA 2YUTA 1XBTA 4BN0A 2FR0A 2JLXA 2QIPA 4UHKA 4EZIA 2Z43A 3QYFA 4WINA 2XA1A 1EJ0A 1PU2A 5AUNB 1GUYA 2PKQP 1T9KA 2PMFA 4LTNA 4Q00A 2B82A 1M34E 4RD2A 2WUDA 1E59A 3MBKA 4RA9A 4ZXFA 4D9BA 1QP4A 1I4DD 5JNVA 3H9QA 4JB3A 3DZKA 2HL6A 4JN6B 4P3NA 3B1WA 5IKXA 5C7OO 1KS2A 1N2HA 3UIEA 4B33A 1GL7A 1I4TD 2WWHA 2YNMD 2CXOA 4FJ1A 3RAGA 3AR6A 5F1OA 4JEHA 1RWBA 5C31A 1P5FA 4BEBA 5BMVA 5JTUA 4R9UC 3WXBA 3DVAB 1VFNA 1QR2A 2G1JA 5ICEA 4F5WA 2XVAA 3QPUA 3WGVA 3SYLA 4D98A 4I4IA 4QBGB 1Z18A 1G8MA 2VWQA 3EVDA 3F7TA 1L1RA 1XTSA 1Q2UA 2VQDA 1UBTS 2GFHA 2JGJA 2NU8B 3GA7A 1WLSA 4KMSA 1ZN9A 1DWOA 2P2YA 3PA6A 3AI1A 1G8PA 2OD2A 1JFFB 5D5HA 5AKKA 1XMSA 3KKMA 3F9RA 5DDIP 4B3FX 1T4GA 4B7XA 5CNKA 3DHYA 3FDFA 1NPDA 4BCDA 3A6PC 1ISFA 3BTUA 1Q5PA 3C7CB 2A1TR 4KACA 1NL3A 1XA4A 2JVJA 4IG9A 1GCOA 1F8FA 1D6SA 2XOEA 2R1VA 2YY7A 4Z9BA 1ULZA 2OCPA 2OXEA 3H3FA 1WCYA 4M3NA 5DN9A 4DA7A 3QENA 3VGJA 1QE0A 2QRLA 2AN1A 1INLA 4IDNA 4JJKA 2PUJA 1N0WA 1XDWA 3ZV7A 1UJCA 2CFRA 2G5GX 1RRPA 3TRFA 2GFQA 1RWQA 3D3JA 4EG3A 5ED4A 3KQUA 3C8MA 3H86A 3ZHYA 5JVDA 3I2KA 2CZCA 1WHSA 3BTSA 4HNQA 4ALMA 2CLIB 1C9JA 3DZGA 4FCTA 4W5HA 3DUFB 5EXXA 1WZNA 1X8JA 2QD4A 3IDSA 2D1RA 2W6PA 2ZUSA 1QYCA 1EQ2A 1T1SA 2A33A 2LP4Y 3K9WA 3RABA 4EF5A 2C1ZA 1Z5NA 4DM7A 3FRJA 5A0FA 4B6RA 3H0EA 4QDOA 1T9BA 4TKMA 2X5XA 2FG5A 4HGZA 3V8NA 3GEPA 5L8VA 4P4GA 3ZHOA 4TMYA 1K88A 4LMPA 1KI2A 1ECJA 2HJVA 5A62A 4M0PA 4OQFA 3R9IA 1M2GA 1TKBA 1VHJA 4RD3A 1LFDB 3WNVA 4P7FA 3LVRE 4HMQA 4X1IA 1NE7A 3LWBA 4LHXA 3TSOA 3OM9A 4IIBA 3NRJA 1K7SN 3UT5B 4D41A 2QQ5A 4LWQA 1W9HA 2JK1A 3PUZA 1CQIB 2ZI9A 1VCNA 3TVTA 3HO6A 1A5TA 1JU3A 3VFDA 1B73A 1NVWQ 3QWAA 1K98A 1NRIA 5JSYA 4Z0TA 2B35A 1R2QA 2JFWA 1GG5A 3TEFA 3NHZA 3KU4A 3AEUB 2EKZA 4C4AA 3HZZA 2Z4SA 1P0IA 5JO9A 3P94A 3SJZA 1XJQA 3UHPA 1ODLA 2JIZD 3AEYA 3W8EA 3CNQS 4G1MB 2B8WA 2QVLA 4N0MA 1MQSA 1LD3A 2JAHA 3AZPA 4BB5A 2LTAA 1EK6A 1CY2A 4RHYA 4OVKA 4I2NA 5JNUA 3OY7A 1KVSA 4Z4IA 3D8NA 4JT8A 4RTLA 2ZTSA 4MVJI 2GBPA 1ZNXA 3QIAA 2H4YA 4KFSA 2UYHA 2A4KA 4I5EA 3TZKA 5H68A 2XD9A 1F0PA 4FHCA 1P4GA 4CNBA 2JGAA 4DNFA 1EFCA 3ROZA 2VHJA 2N42A 3L07A 4DBLE 4NBWA 3Q3IA 2W9XA 5BYAA 5IDQA 4YAKA 3ETNA 1TFRA 1FYWA 1QAOA 2BKVA 3L1UA 3Q3HA 3OPVA 1WV1A 4JJEA 4F06A 2G83A 3LG2A 4ITUA 4V0RA 1MJHA 4V3BA 3LQQA 1L5SA 3KVNA 2DF8A 4RBNA 1P3Y1 4ZHQA 1W5SA 1NJ1A 3I2YX 4XVHA 1OX6A 5A7HA 1Q0QA 3F71A 5CEFA 1W0CA 3CVVA 3IKTA 4XB2A 2AJCA 1ZICA 3RYHA 1XSEA 2B94A 3I9OA 3M6AA 2QYOA 2LCFA 5DI3B 2YC2C 4EHBA 2H31A 3LBIA 2IS6A 1XHEA 3MQFA 4OSEA 3S29A 1VLVA 2JIMA 2HLHA 3A9RA 4I1VA 2FX3A 3PEVA 4MLDA 4BVEA 1DDIA 2QAGC 3GBSA 5C8YA 5BSVA 4CM9A 4C06A 1SRQA 3I6MA 2I4IA 3AF2A 1QIKA 3H9BA 3HP7A 4L4SA 2DUNA 2R48A 2FWBA 1IZ7A 1AV6A 1VECA 1EK1A 2DPGA 4HLCA 3S99A 4Z6KA 3CNNA 3A9SA 2OV3A 2Y1DA 4L07A 1JR2A 1O9GA 2OCIA 3VH3A 2KHZA 1W47A 3BIOA 3PQ4A 5BPFA 3IP5A 3ESQA 2AQHA 3OF3A 2XOKD 1N3YA 4MCHA 4KZKA 5IT5A 3S6JA 2HMUA 5AVJA 1PWZA 2XCSB 2OMEA 3HBNA 2NX2A 1A8HA 1J07A 1UM9B 3PUXA 3RVLA 3WGQA 5F9FA 4IAOA 3IQGX 4MW4A 4ROSA 5KWVA 2PQ2A 3FDXA 4TTQA 2PWZA 1ZR4A 4B4WA 2YY6A 3GLGA 4KQEA 1XZHA 3Q3GE 1ILWA 1UH5A 2QLNA 3SXJA 3R3JA 2WLTA 2BI4A 2Y9PB 1HLGA 3RTGA 4FR5A 4N3GA 1B00A 1GNSA 4L0CA 3S3TA 4UVGA 2HY7A 2A14A 4CL3A 2PYIA 2ZS9A 2X8WA 4JHLA 2WYHA 3T3DA 1QGED 2Q5EA 3LLMA 3TXXA 1CC1S 4UKDA 1P6UA 1EM6A 2IEGA 4NX2A 3U62A 5FNVF 1QQ7A 2NTNA 5MN4A 4KR7A 3NHLA 4OX9Y 3ILSA 4B75A 2AJBA 4GVXA 4WCFC 1GFZA 3WFIA 5JCPA 1B8NA 1G1AA 3BB1A 4WCFA 2EHDA 1MJGM 1I8TA 3U9LA 2QKYA 4HFMA 4D4IA 1ESDA 1T35A 3T3IA 3PWKA 3Q6MA 1JZQA 4UXIA 5B64A 1H05A 4Y2QA 5JCJA 3RU9A 3NO4A 3SEAA 1Q0TA 1SVWA 2L82A 4WESA 3MJVA 2XTMA 2VSYA 5FRDA 3W8NA 3NBXX 2ODAA 4ER3A 4GD3Q 3ZDAA 1E3SA 2QW0X 3LUAA 2X5JO 3IVGA 4CG1A 4ZYWA 2OGSA 4Q37A 1XIVA 3ZQUA 3OOEA 5JSZA 1FUYB 3QP9A 3FPFA 4F4UA 5K0ZA 2CHEA 5D2CA 2VCEA 3TKAA 4B87A 4HB3A 1UODA 1P17A 1RMYA 2H54A 3B89A 1RQGA 2C8JA 4KIFA 3U7QB 4D3SA 4F6CA 3OF5A 1C41A 1P3DA 2ENWA 2RKBA 4MR8A 4OJYA 5G0VA 4XFKA 4UDOA 2PFGA 3HJFA 2ADOA 4FFBA 3DXXA 4YT4A 4MW6A 3W9UA 2RHHA 3VRHA 5EP1A 1ATZA 2H29A 2QLMA 4C2TA 1SOMA 4A10A 5KYVA 2CLSA 4XOUA 3ZJYA 3LX4A 4CKEA 4DIOA 1N8NA 3CF4G 4O8CA 4X92A 1D4FA 4AB1A 1DIRA 2BFDB 2RGWA 2Y68A 2BMEA 3E7FA 3E1SA 5HDQA 2QD1A 5CVEA 2QQEA 2V58A 2ZWPA 5B58T 4YFVA 2VVTA 1I0LA 1XZKA 1RWWA 1O6GA 1Q7EA 3EIOA 3PGKA 4KUEA 2QG6A 2XGSA 3SIXA 1OKKA 3KBOA 5F2KA 1EUZA 1KFBB 4KUHA 4MWCA 2ZUTA 1XEXB 1KC3A 3MCTA 1D4ZA 1RJ9B 2BCJQ 3BKWA 4RK1A 1DBIA 1PFUA 4QLOA 4OGKA 1Z2PX 2XB8A 3PGJA 4CT4B 5JW6A 3EQ8A 1AKRA 4YX9A 2H7XA 4LXGA 2MMGA 4X8HA 1G42A 1EG2A 1RFGE 4BRSA 4J0CA 5DYGA 2Q1TA 3P4UA 2WTMA 1CRWG 4J0DA 3QWFA 2BZ0A 3D3QA 3D81A 2PFSA 3WGGA 2V59A 4EARA 4MW0A 3V1YA 4CL0A 7REQA 3PTAA 3AJDA 3ZDCA 1DV1A 3R5XA 1KL7A 3TQQA 3ON5A 4CIVA 2PZGA 1WDLA 3IJEB 2X6RA 1Q3TA 2QIOA 1HQKA 4JP8A 5CT9A 4BBPA 4RACA 5KTNA 1JQAA 1PNVA 1E3LA 2I3AA 4C14A 3H8SA 3M89A 1C9EA 1C9KA 3T7JA 3ZQJA 4CMKA 3D8SA 4DDTA 3HKBB 4DR5B 1D2MA 3QOYA 4X63A 4QUGA 4MRVA 1XX6A 5JSQA 1UBUS 5TEWA 1E9DA 2XAAA 3PNKA 3CZCA 5K3SA 1BU8A 4XOIA 3PV0A 2AOTB 3F9IA 5CLLA 4MW5A 4D3XA 4DA9A 2B2XA 3P2OA 2WYOA 5CDSA 3C3PA 2PUCA 1A1SA 1BWRA 2Y93A 1P5JA 4L5BA 1ZEJA 4I2VA 2BFBA 1SBTA 3DEZA 3LKBA 2ZSFA 4UU0A 1XFDA 5DTRA 3TNJA 3S81A 2BGGA 2D7JA 3LX6A 5IM4F 2R5WA 3WJ7A 3CH5A 2O3QA 1O95D 1U0SY 2CNWD 4Q7MB 4NCAA 2FPPB 1S1MA 3A3PA 4NYJR 4M0FA 4UARA 1RTKA 1PWYE 1KZHA 4C03A 3R3SA 1WQ1R 3UWMA 4KN9S 4LY0A 4B44A 1SA0B 3GLUA 5AVZA 2P1DA 1UFVA 5L3QB 4JNKA 3PB3A 1PW7A 2NXEA 4PGMA 3AVYA 5KQSA 2NZYA 2QLBA 3L7JA 3Q2IA 4NCNA 1QHFA 1Y3HA 1CHDA 4Y6RA 2H1RA 4ZV9A 4UPEA 5IN4A 4LRTB 3ZE8A 5AYVA 3ER9A 1U0TA 3D5TA 2GZHA 2QR2A 4YCJA 5EIXA 3EC2A 1SVKA 3ETHA 3HM9A 3SMVA 1U3VA 2QEQA 3H84A 3TLYA 3MD0A 4FN4A 2Q3EA 3STUA 2WFLB 2XUOA 2ZJ0A 4GF5A 4WZAE 3U4AA 4D8YA 4OIFA 2L17A 2ON6A 3IDQA 2DEUA 1YHZA 1A5SB 3II6X 1R8SA 4J0FA 4OI1A 2O5EA 2O1WA 4MWBA 1XL0A 1D2EA 5KBYA 3TLJA 2F3QA 3T5GA 1NBME 4R3NA 3TVYA 2WY2D 3HYLA 5EG5A 5TT1A 1XVAA 5CX1A 4HB4A 2Q9AA 2WMDA 1Y9AA 2D74A 3VZPA 3ABQB 1KMQA 2PSFA 1Q44A 2QRZA 1T1GA 2WB4A 5I7RA 3IJRA 4OLFA 5AKZA 5JV5A 4UM5A 2PS3A 1SKUA 4PG6A 3EFBA 5LZ2A 5I7HA 1XYYA 5B4UA 1IB6A 2CMKA 3QVUA 4MW9A 1OWOA 4MI9A 4WK0B 4AWBA 2RGBA 1KI6A 4XDGA 1Q0PA 4J4BA 3QV1A 4YMUA 5E1DA 1TA9A 1LV7A 1CRZA 2FWPA 3T7DA 4CDGA 4W9MC 4LWZA 3A04A 3OH8A 4YJHB 4K3VA 2GB4A 1A4UA 3JZFA 4TV9A 2QDXA 2FRXA 2R6DA 4LY6A 4BXOB 4NFHA 1ZM2A 1A8PA 4HPJB 3SP1A 2WM8A 4RXTA 5GINE 1GTSA 5EAIA 3HDHA 2YXNA 3S1AA 3CNHA 3OUTA 4LF4B 3KLPX 3VJLA 2ANCA 2ZANA 2J4DA 2P6RA 3GT4A 4GBJA 3E9ZA 1JQJC 2IW3A 2GESA 3ELYA 1PV2A 3C3KA 3NHYA 1NDQA 2D1FA 4NECA 5EXSA 3MUEA 3HDTA 4UVHA 4IJMA 4MVJF 4YS6A 4NH0A 2PK3A 2Y1LA 4FVTA 5CHEA 1RWKA 2C3YA 2HJGA 5DNYB 3GCZA 3KT0A 1IEVA 1CBUA 1SY7A 2O6HA 1E8NA 3LHSA 1YL7A 4JUDX 1N32B 3Q7SA 2DP4E 3WLSA 1U0GA 3NHBA 1ZA2A 3MRTA 1P8JA 3N3AC 5HA5A 2F3TA 4NXNB 4KH1A 1P3JA 1R8JA 5HOQA 1WVGA 4Q02A 5BR4A 5LLSA 5JCOC 1X7XB 2O5RA 3QBTA 4JSYA 4W1QA 1E69A 5JCOA 5BQ5A 4JL5A 4RO0A 1JXOA 4JGGA 4U7HA 4YECA 3DE6X 5F5NA 1GPJA 3AOGA 5DJ5A 3EVBA 5K99A 1JAIA 1XAJA 3QWIA 1KI7A 2AV6A 1SOVA 3N74A 1H9BA 1EUQA 2ECFA 4P58A 4Z3KA 4PHFA 3VPSA 1CX9B 3DBRB 3K0EA 2I62A 2OVBA 5F52A 5BRNA 5A6SB 4FFPA 3SC4A 1PJBA 5E3IA 2BGLA 2ZXFA 2LKCA 1H1DA 2HA3A 1OB2A 1CB0A 2ZBFA 3X2SA 3SEQA 1PJ4A 3GLHB 4FC6A 2WG2A 4HK4A 3WIEA 2VHQA 3PJEA 3I4LA 4QREA 3LUBA 3QMWA 3K20A 1L7PA 2B36A 4MLPA 3U0VA 5JXGA 4OAQA 4JBXA 5K3DA 1L5ZA 5E6RA 1HDXA 1MRSA 5CD1A 1PG0A 1YS4A 2R25B 4LJ9A 1APBA 3WKAA 4YDSA 1WB6A 2ZTVA 3ELBA 3U5ZB 1WD5A 4J6FA 4KODA 1W76A 3L49A 4TYYA 3RIEA 2D00A 3WGTA 5DTMA 2DJ5A 3VXKA 3OJXA 3RV4A 3JYPA 3S2FA 5CT4A 5EFOA 4B9EA 5JNRA 1VXRA 5FUYA 1ACLA 1BDJA 3CU5A 3L9XA 1FL9A 2G7MC 4ZARA 3WHPA 3D6HA 3DBVO 3HU3A 4PGFA 4NZOA 2B37A 3I9V6 4PTYA 2DFTA 2BBWA 1VP9A 5KAPA 1ONNA 4X60A 3N2GA 4C5CA 5J2TA 4K0KB 1YZQA 4UU1A 1G4AE 3KLOA 1Y4SA 3THYB 4DCTA 4YXFA 1EVKA 1SCKA 1MDFA 3LQ4A 1ZM9A 3CR7A 1FA9A 3QVLA 4K6OA 1IJKA 4LA4A 4XVCA 1DJNA 4CIWA 1I7SB 1HORA 1GTVA 2P3OA 1KYYA 2WZQA 2PYDA 2ZULA 1IDOA 4QRDA 3ZH2A 2AOWA 3N6XA 4HEHA 4YP0A 3GJ4A 1GJRA 1Y89A 4UJ5A 4BMSA 4EEXA 3G5UA 1A8IA 4KO1S 3G13A 2MSLA 3JW8A 2WZDA 3S40A 1UJ2A 5AM3A 1Z2EA 3VUEA 5EIAA 3KB6A 3ZI7A 1EZZA 1T3TA 4TZTA 2KPOA 3BWYA 3ULKA 3WZ2A 4BIIA 4UTRA 5G0UA 3PCRB 4BLWA 4EM6A 2AG0A 3R75A 4IDFA 2CY0A 3QXGA 4DS3A 2RONA 2FZWA 4E33A 1EGHA 1OI7A 1ZQ9A 3GMSA 2QZZA 3NASA 1JBQA 4RVNA 2CDBA 3HBLA 5EXEA 3AUJB 4HLQB 3W79A 1UQTA 3H5RA 4KMOA 4WBNF 2CT8A 1QH1A 5KKAA 5DBGA 4EHIA 4KVFA 3KUKA 5JANA 1NIPA 4JDUA 3OP1A 1DO0A 1F14A 2XQFA 4NZNA 3KSBC 4D9GA 4HI0E 1AO3A 4CKCB 2ZI4A 1NQOA 2C5GA 2B7CA 3ID6C 4DNXA 1U2QA 3PC8C 3AILA 2VRWA 1MGOA 4PBTA 3PC8A 2M6SA 1LXCA 3D3WB 3E6AA 1C4OA 1CVRA 2NPOA 4K2HA 4RY2A 2X7HA 3K9FC 2JLUA 1ZMOA 5E9WA 2C4NA 2OYRA 1XDZA 4X85A 3KEMA 4DTIA 1AQLA 2FX5A 2NZ8A 1NQVA 1M1YB 1EFHA 3FJYA 1NZDA 3MOGA 3IT1A 2ZBRA 4HXFB 1XQ9A 5HFNA 4KYIB 4F5EA 5AQ1A 4Z4GA 4OHRA 1AB6A 5DPMA 3TPZA 1K4KA 1PSDA 1Q14A 5KSOA 4WY5A 1GZHB 4GE3A 3ZCTA 4LY3A 3VO2A 3ZVKA 2YHIA 2H51A 1ODIA 1P2GA 2C2BA 4WZBA 3E5NA 4P83A 4FZVA 4ZANA 2EATA 4XDYA 5FR1A 1G8AA 1M54A 2DPYA 1SB9A 3OJOA 3KJIA 1D04A 3BZWA 4EJSB 1RBZA 4S2EA 2WU0A 1KSGA 1TJ3A 4K6CA 4NU6A 3RSHA 1AF7A 3PFWO 3HDQA 1DZ3A 4C7MA 1P1BA 4IZHA 3JRWA 4K88A 1X1SA 4JL6A 2JEZA 2FPLA 4ZQFA 1S3IA 1PFQA 4X20B 3D0QA 1G59A 2SKEA 2IF0A 4FKMA 3VH2A 5E3HA 4IFEA 1OH7A 1TECE 1ZSYA 4QAQA 2CHUA 1NW7A 2PQ6A 2JFYA 4CUJA 3FUXA 3UHJA 3MB5A 5IXSA 1YUMA 3EDCA 1QHYA 3MAAC 3WIOA 2WDZA 3MT0A 3H2SA 4R2XA 4TV8B 1ECCA 4IKEA 4PHCA 5T3UA 5A1TA 2X7XA 1RCTE 3D7RA 4D2IA 5J3JA 5TARA 1ZCJA 3PGMA 1NY5A 3PHLA 1O6CA 4XIYA 3IAFA 4ICIA 1M8JA 1GPUA 1I14A 1GNVA 5F7ZA 4EJ6A 3R6DA 4KFRA 2IY7A 4QO8A 3W8RA 2AN5A 2PN1A 4X66B 1LW7A 4JI4B 4MUEA 1PD0A 3BWDD 4F2PA 5HJ7A 5LLTA 4GX5A 4D80A 3HKDA 621PA 3PQ6A 5LN1A 5J4HA 4DR6B 3M33A 1W9MA 3QE2A 4MQMA 3MRVA 4OFWA 4MQEB 4UCWA 3QXJA 2QENA 1DWPA 4N65A 2VSOA 3WJ2A 5CG1A 1NUSA 5CH5A 3HCWA 2ZJ3A 3NRCA 2AOUA 2VK8A 1PFVA 2IYPA 2WR8A 5JMPA 3SJBA 4DR3B 3A4IA 1PJAA 4ZA2A 5AW0A 2H9YA 3W8DA 1ZCAA 3H16A 1EXDA 1T4BA 2H2IA 4P86A 2AZTA 1G21E 1HQYE 1LTKA 1RXWA 1G20E 3TAXA 3TLXA 4ZGBA 3D59A 3OIDA 1HE3A 1T5HX 2QROA 4UDNA 4ZU1X 2XZLA 2ZZNA 4UZFA 3EXG2 5AW3A 2JAXA 1NTRA 1ZIOA 1J0XO 4B3JA 5JAPA 2AKEA 1PVDA 1KO5A 1E5TA 3G02A 4MB0A 3UAWA 3WLKX 1W2HA 2LNDA 1O89A 3HJCA 1DTEA 2N0SA 3ITNA 4N7JA 4A1FA 1E1DA 3PD7A 3SZGA 1MENA 3LPMA 4O4JF 2VP4A 2ZBQA 4QUJA 1E2HA 2HHJA 2WWFA 4GVLA 5CYPA 4K1XA 4Q3LA 2WWVD 4MV8A 4UHEA 2NUAB 3LCJA 3K8ZA 2ZT6A 1DEAA 1SXJC 4JLVA 4AXBA 1Q2XA 1SXJA 3O2NA 1ISMA 3SPXA 3N8IA 2QE7D 3RQSA 2BI7A 4PYOA 1BO6A 1EFKA 4TWJA 4IJWA 4UM9B 3HRKA 4Q18A 2R11A 3AHFA 5EQFA 2XMBA 3TZBA 1BH2A 2XJ9A 3PJDA 2KB0A 3LL7A 4FBMA 5J4VA 1YMQA 3SE0A 3M2TA 3OM8A 4QQRA 5FH9A 1LX6A 1QTQA 1E64A 1POXA 2OOSA 4ZCQA 3G9UA 4NOJA 2NO5A 3IHTA 4DUGA 2BR4A 4OX9B 2P75A 3G3EA 1ZPDA 4TLBA 1E2QA 2O8CB 4UTZA 5DI9A 2CD9A 3HI6A 3ZLTA 4AVYA 3E18A 3L0BA 4DKJA 2AK3A 5I48A 1QO0A 2GDJA 3JARA 4UPVA 4WN9A 3OPYB 1CDEA 4P35A 5DBHX 3GELA 4Q0MA 5I45A 2GAIA 4ZZ3A 3F1KA 2H17A 1OA1A 1C81A 1UBGA 3NAZA 3BMXA 3RANA 4RTOA 3WWCA 3OZTA 3QELB 3WS7A 1SCUA 4EKNB 4ERXA 1KYWA 4BV8A 1NVEA 3NBFA 1O7JA 1E79A 1FRZA 1Q74A 3FMOB 1V8OA 4Q3DA 5EE5B 1UP6A 3G2MA 1SRRA 3U4GA 4QOFA 2QB5A 4QDJA 3RAJA 5BWNA 1RD4A 5HK8A 4JU9A 2P0EA 2D1YA 2H11A 4RX1A 3MJFA 5DASA 3ORFA 3PFNA 1PNQA 2W6IA 4C3UA 2WPDA 2FWJA 1L5RA 1LWNA 5G0WA 3DL4A 4WPGA 2OR3A 3B3FA 5FLEX 5EVCA 3QXHA 3L4SO 4IIXA 3FOEC 4X61A 5GV7A 3R8FA 3ZW7A 1WMEA 4HAXA 4RU1A 1B1AA 1U5BB 2JFUA 3DFIA 2QP3A 1Z62A 1XN1A 5CYOA 4RGBA 5CPFA 1EYZA 4EDHA 1EXVA 1OGYA 4EG1A 4MCAA 3KHSA 1WMAA 4EPYA 5FBKA 4FFWA 3TWOA 5HYVA 1R5BA 3IIKA 4OYLA 3EEOA 3G17A 4R9SA 4U7WA 2VJOA 2AJ8A 1ZFNA 3OEYA 3KEGA 1USKA 5AKGA 5LVAA 4Q4HB 3HDGA 3CY6A 4GOXA 3WMGA 3OFKA 3VGPA 4FMDB 3QKUA 1XR3A 5ALVA 2OCKA 3GN1A 4QG7A 4N41A 1UEIA 3T3EA 4RZHA 2IP2A 4LQDA 3TL2A 3LCUA 2OCLA 2W4IA 2XBUA 1EDDA 4L5IA 1CUEA 1CDOA 1OFUA 4BO3A 2DGDA 4DLVA 4MVJE 3OCWA 3VU9A 5JBQA 3ISJA 4LDNA 4OHCA 1IBCA 4LNHA 3SQXA 3T54A 4RADA 4JVLA 3ZNPA 3DF9A 4PYMA 4RCVA 3THRA 3WA6A 2FOXA 3M0EA 1CHNA 4FCWA 1YZTA 3DO8A 3ZQKA 5HQ3A 2V0GA 2BFEA 5EWJA 1JVSA 5ARDA 4KK4A 2EQAA 2ISSD 1T5IA 2O0HA 2QM8A 4N6OA 4BMXA 3KOZA 2V3WA 3VHRA 3ZLUA 1F8GA 1KRHA 3R9WA 2OORC 2J46A 4DF3A 1QIEA 2OORA 3HO1A 1HL7A 1Z2DA 3AV0B 2H7YA 3PXBA 3ZD6A 1MPTA 1P2BA 4LPSA 2HWYA 3P0EA 4KN5A 4BBZA 3LDGA 3TZLA 3GD5A 2XUFA 3E82A 1JKFA 4K03A 2PG3A 3U37A 4EDFA 1ZLYA 3G2KA 4G0VA 1HDEA 1XZDA 2SBTA 4FQ8A 2ZB8A 3BSFA 1P62B 4HTFB 1UAGA 2EZTA 3CQ9A 1BXGA 4RV4A 1OX4B 3MPUA 2CUZA 4DT1A 5K0GA 2XMCA 3KWMA 3NIWA 4ZAVA 3DMTA 1H8HA 5F2OA 2EIXA 3UJ3X 3DA8A 3CPSA 3DKVA 2JAUA 3IQZA 5C81A 2ZIXB 1DG3A 3PC4A 5ALTA 4MYHA 4PX5A 3VH1A 4N4AA 2WIBA 1Y1SA 3WNDA 5LUAA 3ZV5A 1I0ZA 2GA8A 1N78A 1ZMXA 1PR3A 1X7HA 2IVFA 1DXQA 2E1RA 4GX0A 4BNDB 2UZ1B 4U2GA 3F6RA 1NYLA 3JXEA 5AI6A 3EGWA 1K4YA 1QJCA 5CDFE 5FIUA 1YT5A 3OQMA 1PZFA 2AC2A 1XXLA 5JBIA 1SWVA 1DNPA 4ILKA 3LOQA 2NV0A 5CH3A 5DTIA 1FNCA 1KAMA 3A6ZA 1PRYA 4EKDA 3PCTA 5C2JB 1ZWKA 3BIWA 3V46A 4CN9A 3LY5A 3D8BA 4N39A 1UKCA 4N8SA 2MSDB 1I5RA 4P5DA 2YV5A 1EESA 3K92A 4HRVA 1SH7A 3R3VA 2IYOA 5BSMA 3WYBA 5ALWA 4BLPA 1XPOA 2IE8A 1OXSC 5P8WA 4RKYA 3O1LA 3O4JA 1DJPA 3SS8A 2YASA 3D7NA 4TMZA 2EKPA 4M55A 4Q16A 3QV2A 4B3IA 4TKLA 3JTMA 1J2RA 3VR6D 2H3EA 2CLDX 5LOVA 3RS0A 2X9VA 4L4XA 1B3BA 3P9QA 4YUAA 5KYUB 3IP9A 3MUNA 3EGCA 1BYUA 3VJRA 3HXLA 4Q01A 3I6ZA 3AFOA 3LPLA 3GLRA 4UXHA 3ZYZA 5CA1B 4TT3A 4Q82A 3OM1A 1E2MA 2BTEA 3IODA 1WUIS 4UATA 4P31A 2QVCA 3T3OA 2GEVA 3IXLA 5B4TA 3TSZA 2HCFA 5SICE 1V1MB 3I04M 2Z2ZA 3LLUA 2WHPA 3TNDA 1Q16A 2XA9A 4QJBA 2YQ5A 4LJ7A 3RSSA 1L7EA 1DG1G 2G5CA 4RLFA 5ICFA 1XF9A 1KVQA 2R1TA 3W9YA 3WL5A 2NUPA 2P11A 4ZI7F 2F1IA 2XIJA 4W7SA 2FQWA 4BZWA 1EIZA 1CKEA 1UBCA 3GRAA 3G2PA 3NHAA 5ANRB 4F4DA 4V1CB 1ABBA 3CEMA 3AUXA 3OTIA 1M33A 4L7QA 3EXEB 3AHHA 4CMJA 3TI9A 4EBFA 4NNJA 3W3AD 2C3UA 1ZJ6A 2KYRA 4GI3A 3GCXA 1L9KA 1BOOA 1Z6GA 2BJVA 3KB2A 1S9DA 3F6EX 4NG4A 2P5TB 4N7RA 2CW5A 2G70A 1I1HA 3GUCA 4L08A 4PTZA 1ZAKA 3U4IA 5AK6A 3LT1A 4BB9A 2Q3MA 5JVDB 5EIWA 3O8QA 2JBAA 3R5FA 4G1VA 2DH5A 3GRVA 4KZPA 2JVIA 1T9GS 1EB8A 2P9EA 2NU9A 3M5CA 3KHKA 3O47A 4MO9A 3URMA 2VAWA 3V7YA 4EUSA 3RS5A 3UFXB 8ABPA 2I9KA 5CTJA 3RAPR 1WZCA 3TOVA 2CXSA 1NFRA 4QO7A 4D0SA 5AXCA 1Z0AA 1SVMA 4C08A 4FZRA 3U1BA 1XL1A 2Z1NA 1K7EB 3N59A 3AQ4A 3QKIA 3BJEA 3SVTA 4P7JA 3U60B 3H1GA 1PWXA 2Q0HA 1B0ZA 1UPFA 2HSDA 4G5SA 1BIFA 1DDOA 3HKCB 4C4RA 3C0KA 1RLIA 2D0OB 2DSTA 4DM3A 4BJ3A 5D00A 2CJXA 2HMSA 3CYFA 3IT0A 3PKIA 2VRCD 3WBKA 2BZ1A 2Q5LA 4R9RA 2FE4A 2F3SA 4AF8A 2VDKB 4UDYX 1E1RD 1KMIY 2F9FA 1B8PA 1WL8A 4LJ8A 4LYFA 4O63O 5FWDA 4AQ7A 4PFSA 1W0JA 1DT3A 4TKZA 3BDAA 1E1NA 1ZAYA 3RKSA 1WRBA 4AJOA 3VAAA 1P0FA 4DIBA 1NBHA 2UYQA 3FTCA 4U2BA 1PV4A 1ADFA 3FYCA 1RSZA 1CY8A 1EGVB 2QG9A 3RARA 3HA2A 1USIA 4QYSA 2WFZA 4JEUA 1COWD 2TECE 3C8DA 2VHWA 3VVLA 3ZU2A 5AM0A 5J2UA 5KZMB 2QT9A 4MUHA 5TF4A 4ZO9A 5HCIA 3K16A 1GQ2A 3L0SA 1THGA 1V2HE 4D8TA 2WIJA 3PYLA 1DT5A 4XB1A 2GOYA 2D13A 3EUWA 3H5OA 4PZ0A 1HEYA 4QQFA 5DYIA 1DGQA 5DNWA 4Y6GB 1LK5A 1IBMB 1U28C 3O21A 3QFSA 2XXBA 1U28A 3A9WA 3MLEA 3WGJA 2CV2A 5F12A 5KU7A 1G7CA 1I0IA 3FROA 4HHEA 4RVOA 4ED9A 4QULA 1ZSVA 4M9QA 4N8EA 3K5HA 2APJA 3ZK8A 1LK7A 2PJUA 4QDTA 3VYTB 3LUCA 3ABSB 3AXSA 3U6BA 2WU8A 4ZDIA 1LA2A 3CE6A 2POQX 1JLMA 3IB3A 2RGNC 2QMHA 1WQ3A 2JIOA 2RGNA 4HQ6A 1J1ZA 3GDFA 4DWOA 3TD6A 1ZD4A 2OWEA 4YYEA 2XT0A 4PC6A 4RYDA 1A4RA 3TQTA 4HVCA 2Z6UA 1MEOA 1E96A 5EFZA 2ZUUA 4XGNA 4JI5B 4F71A 2J09A 3GLTA 3B6EA 1RQ7A 1RXUA 3T0FA 3GX1A 1C1YA 3EVTA 1J8QA 1TQDA 4HNGA 1PHRA 1ZD5A 3LQ1A 3QHAA 4G01B 4BAGA 5A2GA 4JROA 5FUWA 4BUCA 5FUQA 5JASA 1PR0A 3VDQA 4OGLA 3FOAA 2ZKIA 3R09A 2L42A 3D8HA 1Y6ZA 2QAGB 2IUYA 1GUZA 5E6SA 2P9ZA 4H08A 1ZU4A 2Q4TA 3OLQA 5C37A 1R12A 5THKA 3Q8WA 4LOJA 4HMPA 1T0HB 3TLGB 2GXAA 1WU7A 4BQPA 3ZJVA 4F84A 3N86A 3LDUA 3UK0A 2QZJA 4J0HA 3L1HA 2VT3A 4Z7QB 4GX1A 4A6EA 4XPIB 1T0UA 3THWA 1YIOA 1KI9A 2RI6A 4UE3S 3HI4A 1GTJ1 3DPUA 1ZJYA 3CX7A 4RW0A 2JBWA 2QSUA 3IOBA 1G3IA 2NSDA 5LZ8A 3FR8A 2YWEA 2R2GA 4GWLA 4XQ9A 5SV2A 4MA4A 4L8GA 1IN6A 3ZI0A 3DE4X 4B5KA 4I3GA 3UPTA 5KCMA 2W37A 1NXOA 3D4PA 4MS4A 1MA3A 4C04A 4IDDA 3NUZA 5THXA 2W2TA 5CLQA 1JYFA 5C7LO 1QH8B 4BWGA 9ATCA 2WKSA 4BKQA 2B7BA 1PUJA 3AKYA 1L7RA 2GD1O 3BCHA 3PR2B 7ABPA 4G85A 5IAOA 3E3OA 4MEJA 3OQNA 3C70A 4YJ2B 5HSGA 2I4NA 1OLXB 4R51A 1ZIDA 3H6HA 3CKYA 4F2DA 4BMNA 3EF3A 1JG4A 1WF3A 4LDZA 4ZEOA 4YCCA 1HWYA 4Y6PA 3WB2A 3Q9NA 4M0UA 2V4MA 3VR4D 2OQ2A 4HLUC 4KQXA 1D8AA 3HA5A 4H59A 4HX2A 4MGIR 5LZ9A 3AYXB 1JHRA 1OZHA 2GA9A 2OD9A 4HUQB 1FP4B 2ZE6A 4GR5A 1JFRA 2NTYC 1SUFA 2CWDA 3R8CA 1OWPA 5CVDA 5JZOA 1T9DA 1XP8A 5IS2A 1WMDA 4MP3A 2RKWA 1Z8HA 3OI7A 4H6PA 2V7XA 5DYWA 5B2EA 1YU6A 1LB1B 2G1UA 4K81B 5LYYA 2VUIB 4K9SA 2CJFA 3O1HB 3B1FA 4ER6A 2SKDA 3ZD7A 4CL2A 1U2RA 2O2ZA 3H9UA 3O3MB 1L4HA 4UE6A 3V6MA 1FQOA 1LX7A 4QGHA 3ZDBA 2Y2VA 3WLTA 2P2CA 4LJ6A 4F9EA 3L4JA 2HA6A 3KLNA 3HXOA 1K3TA 1XLVA 1ZNQO 3AI3A 4D4KA 5KSYA 4ZALA 2O48X 4PC7A 5DBIA 1QXSA 3O9MA 4FFBB 4L75A 2A67A 5JWHA 3VNRA 3D4NA 2C4UA 4O4HF 1XRPA 2AZDA 2EHJA 4BGVA 1HE8B 1WO8A 3TB6A 3A4YA 4DBVO 2VYCA 2VK2A 1SCDA 3UMYA 2BM9A 2FEKA 2B7LA 2IXTA 4XPZA 5EXDA 2GEUA 2XKBA 1ZM3A 1U8UA 1GY8A 3RYTC 3QEAZ 1DUVG 4S0ZA 2J3DA 2BEWB 4I9GA 4L4ZA 4Q3NA 4O1HA 4EHLA 1JEOA 2NQ8A 2M6KA 3SCZA 3DTVD 1GEEA 1A5ZA 2ZRLA 1GN8A 2HUNA 4U2DA 1RJWA 4MQFA 1HMYA 2CJYA 1M83A 1JB1A 3UUEA 2VHVA 3O8DA 1GXSA 3K1AA 5A5GA 2F4VB 1IL0A 2XDYA 4BE7B 3K09C 2ZYVX 4FE3A 4JSRA 3TTUA 4F92B 1QTRA 3K09A 3WICA 1KGSA 3I6IA 5LB2A 2Q2VA 4M2LA 1B8OA 4U2FA 1EFVB 1CDDA 2PGOA 4OK5A 4G4IA 1WUTA 1I5EA 3AFMA 3KSZO 1E5DA 4KYUA 2FFAA 4LVUA 3WMXA 2XYGA 4EO7A 5CITA 1IVYA 4B48A 1FRFS 2MINB 1HSZA 2ZBDA 4D4HA 4LI0A 2QX8A 3P97A 1K3UB 1R27A 3OUUA 1ISPA 3SF8A 4C9BA 1NBMD 1U04A 4MWGA 3TFQA 4BN4A 4RTRA 3HB7A 2NZWA 2ZJYA 1BHO1 2ZCUA 2JI7A 1DRUA 1VJCA 3I32A 1HLPA 3DBHB 3NGXA 3KYDB 5HG0A 1Y6FA 1NTOA 4PRKA 4PRLA 1XDDA 3COYA 3U39A 3JQQA 4DYDA 1MIHA 2E3JA 1EMDA 1U3FA 1A9RA 1V8PA 4G8DA 4ZAGA 1WLYA 3AQIA 4E3WA 3EXAA 1QQ6A 2GAFA 3PWZA 3BGVA 2A3RA 3PQ3A 1OB5A 3EY9A 1FU7A 4EPRA 3DMPA 1YI8A 1AV7A 3FLEA 4LI3X 4PAQA 4EKGA 2H00A 2HSEA 3CF0A 1NVVQ 2J7PA 2AFIA 1CZNA 3D2AA 3AKZA 1BZYA 4YCMA 3PGLA 5IBCA 3SBXA 3GUHA 2WVHA 2OGUA 1QVZA 3HFRA 5CFOA 1JHVA 2IEZA 4X1YA 1M72A 2XYVA 5BYJA 4YT5A 2VDVE 4H3VA 2HRBA 1UKYA 4UC0A 4BP1A 1V4BA 1OVGA 1U6IA 2OCYC 4ALIA 4BCBA 5HBGA 3L02A 1L6IA 1PJTA 4GP6A 5IW8A 4TTIA 4Y9TA 5BO5A 1SBZA 1UBFA 4RIHA 1KY3A 1UJ6A 3NIGB 3UJ9A 1OI3A 1OPXA 2GZSA 2FTKE 2N47A 5C53B 2CLOB 1JQDA 2BEUB 3V8QA 2QX7A 4V02A 4KGXA 1QZTA 2Q1XA 3A25A 1DEXA 3M83A 4S1PA 1PR6A 4X7RA 2WU3A 1UWKA 1LWOA 1O97C 4NEQA 5CNMA 2FUEA 3T7SA 1OREA 1CZKA 3OPXA 4BNVA 3SHVA 4ZI3A 5IWAB 3NLLA 1L5VA 3M7IA 1YZUA 2YZMA 1N57A 3MWFA 4S24A 4JODA 1FF9A 4QBIA 3IVAA 2KJQA 2Y4OA 5HILA 2DCUA 4KN8A 3M4YA 4KB5A 3DLAA 2JBHA 4GMKA 4QL3A 4NS4A 4AZ0A 1BG6A 1YGYA 3G6KA 3KXLA 2H1CA 5IK2D 1C5KA 4OKSA 5G3ZA 3DE0X 1JDVA 3QA3E 2QY9A 3SX4A 5ADWA 3LFTA 5ARBA 3M6LA 2AI2A 1QYXA 4XZ3A 4MWDA 4I5IA 1VHTA 2A9KA 4JVNA 1YBAA 2NT4A 3FDZB 1KO7A 3VR5A 4ND8B 4ZU6X 4DWJA 4KFCA 1BWSA 3E4CA 1ORRA 2NVBA 3PFFA 4HWTA 4MPJA 4NL4H 1N8KA 4RUKA 5ER6A 3KQYA 1E7YA 4MW2A 1IOLA 4J0QA 3U26A 3B51X 4ZIRB 3E8MA 3D3KA 1C9MA 2PIAA 1Q0HA 2GEDA 3NVAA 1J2UA 4RV9A 5FWXB 3TIFA 2IYTA 1NR5A 3RVDA 5KOYA 1TU4A 3ANYB 4JV5B 2VHYA 2AWOA 1FMLA 1WB9A 1P7PA 4MDYA 3V4FA 4D6PA 4HF7A 5AVTA 5C8DA 1KJ8A 1NZFA 2FPMA 3BFPA 4XLLA 1KAEA 1RQRA 2EEZA 4TMTA 1AK2A 1W96A 5EP3A 4EHDA 4YP9A 4ZYLA 1YZHA 2FPIB 5FA6A 4HN2A 3RE1A 3LQRA 2XCQA 3K71B 3VZCA 1SVSA 5LIRA 4I9UA 4WLEA 4QHYA 3ZWCA 1VG0B 4ZCMA 2I2FA 3KFXA 3U7EB 3LGXA 3DLCA 1E6KA 3Q98A 1ND6A 1EUDB 5GV8A 3U3JA 1XEWX 2QAIA 3BGWA 1GAEO 4LHSA 3WC4A 4MZXA 4OSOA 3UC5A 1THTA 5AVVA 2QT1A 4YCLA 1KPHA 3ZVNA 4FQ5A 1JTVA 2C82A 4HZGA 4O4IA 1CZLA 4Z86A 2B9VA 3V4ZA 3ET4A 4TXMA 1T2DA 5I6DA 2H65A 3ETGA 1K0UA 1Z2OX 3R5SA 3UQZA 4B3BA 4CQLB 3LCRA 4RHFA 2VH5R 4Y2SA 1PJLA 1YI1A 2QRHA 4FFMA 4NBVA 4PRYA 5A9SA 3IQDB 4J0GA 4O0LA 1I01A 1JQKA 3OAAD 1WM1A 2PGAA 3PNQA 3JQ9C 3F2IA 4A0FA 1NJ6A 5G4KB 3JQ9A 4G5XA 3IULA 2ZIAA 4G1FA 3FVRA 1NI4A 4JLBA 5FFMA 5FA5A 2BFFB 4C4XA 1R6AA 4MICA 4B2PA 4D9MA 4E5UA 3RF7A 1GAJA 3H2KA 5E6RB 1KJYA 4JUFA 2C2XA 2OXCA 4P3KA 1I3MA 1TQ6A 1VIMA 3CLTC 3HFGA 1S0UA 3N76A 3WDMA 2ZOSA 1FYXA 1MOZA 3M4NA 2OK8A 1SKYB 4IX1A 4DREA 1GAXA 3H11B 1LDEA 4QUEA 1ZI6A 1GWNA 4CF5A 3T12A 3RJ5A 1UK7A 3V3TA 4L73A 2IELA 3WGMA 2C7RA 3BRCA 1OJ7A 4KAFA 1JF8A 1FTYA 4F97A 1DC6A 2DULA 4ZFNA 2R8RA 1YDMA 2B83A 1QX3A 5ALKA 4DSTA 1W1IA 5FJIA 4P3XA 3C3XA 4IDHA 1ZVKA 3ZWDA 4DSZA 4FGKA 2DMRA 1KO1A 3BXZA 4UCXA 4JOBA 4ND5A 3RRMA 4CMIA 3N2GB 1JMVA 1M34B 2LE0A 3F9CA 3RTCA 4AXXA 5AVWA 4WW0A 5JPIA 1N7GA 1W7AA 2CNLA 4ND1A 1XP5A 3VC3A 3HVIA 1BJTA 3STHA 2RAUA 5LMUB 3W2EA 1NDHA 3DWFA 4JB8A 3WMRA 4R7TA 4J0JA 1SZCA 3LRXA 1KJZA 2Z5VA 4M9RA 1ML4A 3BMOA 3FI0A 1AHIA 2PCLA 3STYA 3G82C 2A1IA 2CLMB 3IMKA 3LGAA 1U9JA 4Q4JA 2O5VA 4EA9A 5LDHA 5IT0A 4FOLA 4MV1A 4U5QA 1JKIA 2CDCA 3E05A 5J9FA 5A04A 2VT2A 1N34B 4PC1A 3IKMB 1MX5A 1M0WA 4MV5A 4B6EA 1RYMA 1O95A 2A78A 1VMEA 2CNWA 1G38A 5A4DA 5TQJA 2CHVA 3QVGB 4I5DA 1QCZA 2GCIA 4KU4A 4WXYB 5DLYA 4CGZA 2CF6A 1BHQ1 4JUCA 3TDNA 2G77B 2C5SA 4IRMA 2J3QA 3HR7A 3V8PA 1GKIA 3KOXA 3ZU6A 3HHPA 3M3PA 5HTOA 4BKMA 4WUTA 1OU4A 3NTUA 4GI2A 3LUFA 5AVQA 2G0AA 4ETNA 1FVOA 1IAQA 1UXGA 2B3TA 4LZLA 5F64A 2RBGA 3OTWA 1D07A 1M6YA 1QYWA 3T7IA 1Z4NA 2Z9DA 3C45A 3L7KA 5L40A 5L4LA 4AC9A 2DG2A 3RS8A 3I6BA 4ETMA 5DYTA 3JALA 4M88A 3RNOA 1N92A 2PZFA 2E4YA 3BTOA 4N9WA 4WKBA 4H3HB 4PCVA 3VO9A 2P9YA 2WVGA 2X8AA 3NATA 3DO5A 3QZUA 4REMA 5KJFA 5KTYA 4Z4QA 2ZCVA 3BHNA 4M1EA 3CURA 1GZ3A 2C4HA 4O5AA 5KTPA 1GNRA 4R1LA 4QZVA 1NJ5A 3UG6A 5KVCA 1ELOA 1BXRA 1LRJA 4P8RA 2LZ0A 2ZJ6A 5C51B 4ZTZB 2JFZA 1CUAA 4FOSA 2Q5IA 1KI3A 1TKCA 3ZCPA 4U02A 3QMPA 2QMUA 2YHIB 5EJGA 4KGVA 2ZI3A 2WHRA 4FCCA 4QPCA 3T4EA 5ICCA 3JR3A 3VO8A 1UT6A 4KTTE 4BQIA 4KXLA 3NTLA 2C3OA 4QG3A 2M9MA 5B7PA 1JEEA 3K30A 2FQ1A 3CMMA 1NLYA 2MYUA 3GAAA 4JLOA 2Q46A 3M3DA 3QTTA 2MWMA 3E9MA 3O3OB 2D6FA 5G40A 1SCBA 1C3JA 4EI7A 3JAKB 4E2WA 4AULA 1M7HA 2IBSA 4YJ3B 4CV0A 3C5VA 1F1JA 1BC5A 2HV8A 2PZAA 4R54A 4D46A 4MB6A 1NJFA 2V4ZA 2ZU0C 5B2FA 3U7IA 1FX1A 2QY6A 2ZATA 1IZ0A 1GPBA 3NBAA 2GZDA 3D6MA 2ID4A 4IJUA 4P5EA 4B7ZA 5LQMA 3B5IA 1OGIA 2NP6A 3V2IA 2VDUE 5KTSA 5BQOA 1MJFA 2QUIA 3TOZA 4BMCA 1N5LA 3LHKA 3IP7A 4UZSA 2WJHA 1IXRC 4E5YA 1PNOA 2P65A 3RS4A 2F1OA 1C1HA 4L9AA 1MABA 2QU7A 2JAOA 3N70A 3AVQA 3LC1O 3NORA 2IH2A 3CHYA 3U1TA 1XN4A 2P6PA 1YZLA 2L0XA 5DVZA 1JEYB 1ADCA 1GPH1 3X2EA 1PBNA 5MN6A 5FQOA 3OOWA 3L4KA 5BSRA 4XCQA 1V16B 3AI7A 3NM4A 4I50B 4HXGA 4DRYA 2ZRDA 3WLFA 4EMBA 1K1EA 3HY4A 4ODIA 5BSEA 4TZ0A 1NJGA 4NOKA 2RGEA 4U2KA 5C46F 3QHPA 4GWKA 1EQAA 3GLFA 3BZUA 3RRBA 5T7BA 1GQOA 1Q7GA 3C15C 5LYJB 1XRMA 3ACBA 3K7EA 4FDMA 1I24A 3BORA 2C42A 3C5EA 2CVPA 4QGAA 4W9RA 2PE5A 1L7DA 1RAEA 1ZOIA 2C8VA 2A2ZA 13PKA 1ULSA 2ORIA 3OWHA 4I55A 4QDZA 4GZLA 1ODFA 2A57A 3EIWA 2JEOA 1DJLA 4RWEA 4H9GA 4WGFA 4D9FA 4O4LB 4IJVA 4IV0A 3T9CA 4IIHA 4K9QA 1T36B 1O96B 3HE3A 4OQPA 2A92A 3P19A 1DLJA 2QLJA 3DZFA 2Q4DA 4IGIA 4LCEA 3H2JA 5G0TA 1AGYA 1PYOA 3MWEB 3C16C 4DJ5X 5KS2A 1ZR2A 4Q7EA 4NENA 1AHPA 1YS2X 4YUZA 3UT6A 4FYHA 4XWGA 4Z1MA 2HRZA 3L84A 4ND2A 1XHLA 3RYFB 2ILVA 4EG8A 5JYBA 4YJFA 5L3SB 3PUKA 4XUCA 1GSAA 2RH9B 4EA6A 2ZRAA 3FPJA 4LNUB 1E7WA 1J42A 5ALDA 2QZPA 3TBHA 4C0JA 2H3HA 2IH5A 1BJKA 4IDBA 1O57A 3IERA 1OYOA 3CCFA 3PPYA 4D43A 1Z6YA 3R4CA 4EX6A 2EG9A 1TUBB 3N7AA 1YD7A 2D5IA 4JOCA 4KQKA 4F04A 3ANMA 2PEZA 1QG0A 4C2UA 5DISB 3AJ9A 5IEBA 3SLRA 2CHGA 1Z8NA 4MVJD 2GI4A 4WOBA 3ST7A 5HXAA 5K3FB 1A7AA 4TM7A 5G1NA 2C7BA 3FWZA 2Z8YA 1ZOPA 2ZYSA 3BHJA 3C6KA 2XMRA 3EIEA 1PWEA 5AKEA 4DCVA 1QKKA 2BE9A 4P82A 3BF7A 5CA0F 3EVAA 5DGIA 4BX0A 4LFCB 3E2PA 1BMTA 3NIBA 3OE4A 2ISQA 2OZLB 3RJZA 1GPNA 3G0BA 4JD5A 5EUBA 3AIIA 1FVXA 3PC2A 5CDGA 5I4KA 1P1RA 2XW6A 3FUVA 3GZ4A 4L15A 4TS4A 5L3ZA 4E1AA 4QYXA 721PA 4AKIA 3HACA 3Q72A 5H5JA 5K8JB 3DPSA 3B3AA 1JBKA 5KTMA 4MB2A 2GTIA 4JWTA 1RC1A 4TKUA 3UAYA 3DNMA 3KWLA 1IQRA 4CG3A 4BFTA 1AC5A 1BX1A 5DHQA 4N0DA 5TQVA 5M34A 3B38A 1JWBB 3ACDA 4OLBA 3U3MA 4YCSA 4H15A 5IVHA 1EM8B 4CMCA 4L2IA 2P6OA 4D99A 2AKAB 3NGLA 1TJ5A 1B15A 1Z83A 3O91A 3SXPA 5IVDA 3L6UA 1FSPA 3PEEA 1WUJS 1YDFA 3M5PA 1UKVY 3MUOA 1JS1X 2TS1A 4PWZA 3ZHUA 4D8UA 4E07A 2YHUA 2DETA 4IIJA 2IV7A 3RROA 1BFUA 3E4DA 4HEJA 5TLSA 2I2XB 7GPBA 2DHEA 5KHLB 4TKVA 4IUDS 2HN9A 2JRLA 3K9LA 3LRPA 4KIWA 3FNRA 2LCQA 3VTKA 3EPJA 4IQ4A 4MJ3A 1X2BA 1XT6A 2DTEA 1JHPA 1RE0A 3NHJA 3KUUA 5CGQB 4Y2JA 1UPTA 1MC5A 1GTL1 2E6UX 2J8ZA 1YJQA 1RKUA 1OPRA 3N7UA 2HHCA 5I5GA 3AF0A 5L9AA 4NHEA 2HFJA 4B45A 3EC7A 4YLEA 3FJ1A 2HSWA 4PHGA 2GN8A 1SUSA 4BFLA 1CNEA 3AHDA 3HJAA 3VU9B 4LYGA 1AE1A 3HVUA 3ICWA 4B8WA 3EIFA 4OQMA 4PHHA 4KPUA 2YIDA 5LD2C 3DXYA 5JH7A 2YFHA 2H59A 4RL4A 5TS2A 3N05A 3I2HA 2XDQB 2YHSA 4R1OA 2BFEB 4EG5A 4PLHA 1NQUA 5EWJB 2IUSA 1UJMA 2ZUCA 1NNSA 2VG8A 5FHRA 2PXHA 1A9QA 1IOWA 1P2FA 5DX0A 2YXLA 3SZOA 5KX5F 1ZK4A 3EZFA 5TQ2A 1ONPA 3FCXA 3P2EA 3ZC3A 2FLWA 3F8SA 3P9RA 5JHGB 2VHTA 1TEHA 4BUJA 1X7YA 4HMOA 3BEOA 1X77A 3K72B 2BCEA 3HWRA 3PQEA 2IHUA 3JASB 5CDTA 4RHUA 1T8UA 1IG0A 3NBKA 3IOEA 4RD6A 1X9IA 1CY0A 3OE7D 4L9RA 3HWWA 2R85A 4XGIA 3D6UA 1F20A 2BFCB 4G81A 4IEFB 4KUGA 3SG0A 1MEEA 1XV5A 2FSPA 1BXGB 3SF0A 2OQIA 1HT0A 3IUYA 3KD3A 5J5VA 4EF6A 5BVHA 2GN4A 5LU8A 4FXOA 4PE5B 2H0QA 2AB0A 3KO8A 3OT5A 1JTFA 1KOGA 3GRCA 2YDYA 3FYHA 1ZGAA 2NZUG 4FJ0A 3FOZA 3DMHA 1PNRA 1V8BA 4G0YA 4HDAA 1Q0ZA 1IB0A 3A05A 1VE6A 4Y2TA 4YK7A 3RUCA 2GYWA 1XF1A 3DNFA 2ZWAA 3L1IA 4MULA 5FI0B 3ITEA 3TQIA 5A6VA 2B3DA 2QTMA 2XGOA 3MVEA 5D3QA 5AM4A 4RXMA 3UKDA 1S3SA 1ZOSA 2JCVA 3M8KA 4BTEA 3LP8A 1A8UA 1Z4KA 3TLZA 1GIAA 1I5OA 1N2BA 4W4TA 4B6QA 4QBHA 4E5PA 3FCCA 1TO2E 2Y8EA 4WN3A 3LDAA 1NKTA 3HSYA 2XTZA 2ZJ7A 4AS2A 5IF9A 1CY1A 3CPEA 4PO3X 4RY8A 1UIRA 3REQB 4DR7B 1ZU5A 3AIOA 5LP6F 4IOJA 1B6GA 2AEEA 4MQLA 4AG5A 3DTVB 3ONEA 3AF4A 1Y8QA 1YDGA 3IR5A 1DRKA 1JMKC 1P75A 1T9GR 4AP6A 2WW8A 3MWLA 3OKCA 4KE9A 5B4VA 3EPHA 1SG9A 1XTZA 2JPDA 1LY1A 1KBZA 1QR6A 3AP3A 3H5LA 3LP6A 4HTAA 3T06B 3VNSA 3B52X 4Q6WA 3UK2A 3AC0A 3LBYA 4CUKA 2GEFA 4MGEA 4P53A 4B3GA 3O1IC 2Q2QA 2C2OA 2AJTA 2Q4OA 1DTWA 2ZB4A 4P34A 5EE9A 3ZY3A 4E2FA 3QITA 1KY2A 4P38A 2PBRA 3FMPB 4WZAB 1DRVA 2TMKA 2VPWA 3DEFA 4G0MA 3UW3A 1CS0B 4OF4A 4ZK6A 3KNZA 4R41A 4X24A 3GPCA 2EU8A 1UOEA 2KX7A 1OQAA 3UMGA 4AUMA 4AG6A 4DIDA 3LK7A 1YWGO 1I30A 3PG5A 2I4RA 2OHHA 2YFQA 4JJIA 4FWBA 2N1MA 3FRIA 4AFNA 1STOA 5JQGF 1AGXA 1JKJA 1OHHD 1AOXA 1RRKA 4IG4A 3UJ6A 1JQEA 1IVSA 2WJIA 2IHYA 4FOPA 1IN5A 4MVCA 2LGJA 3U1VA 2R1TB 4D6XA 4UOZA 2O8DA 3FPSA 4J76A 1X74A 5GZ3A 1NXVA 1JYEA 1O8BA 2J3JA 1U2EA 3Q12A 5DHSA 4BJHB 3L6EA 2Y99A 4UMEA 5EZYF 1GA6A 1F2TA 1Q92A 2BUBA 2X6TA 4EOGA 2P4QA 1DBWA 3LW8A 5T57A 2PRYA 4DMHA 2DAPA 1LPOA 1I2MA 4W1SA 2R60A 3TJRA 4ZXPA 1M2NA 2H1HA 5IAJA 3IURA 4GH5A 2X8JB 2J3MA 5L95A 1EFDN 2Y27A 2PAFA 3JQ8B 4IGFA 4MUJA 4OFBA 4YROA 5ALGA 4XI9A 1QZXA 3WBBA 1UADA 1U9YA 2IOYA 3CT4A 2V74B 3I2IA 3OE1A 4DA8A 3HTXA 1P2VA 3NRBA 5ICSA 3C7AA 1QP7A 1XQ1A 2JK0A 4GLFA 1TVCA 1GTRA 4D9JA 1Y3AA 1ZOLA 3HBMA 4HWPA 2NN3C 4X44A 5CFLA 3T1HB 2ZZMA 2FPXA 5H16A 1HYHA 2A7XA 4PWYA 3RREA 1E94E 3GQBA 2Q6IA 4JOSA 3C85A 4ZOLF 3UZUA 4D42A 4EEKA 5FBHA 2P2GA 3F7OA 3CZ9A 4GXNA 4B0PA 3PEYA 4TSKA 4G07A 4EI2A 3OFND 3R7WB 1IE3A 5CXSA 3JWHA 5IVKA 1C29B 4YJGB 3Q11A 2AR7A 4WX2B 4HDCA 4QOJA 2BTQB 5DHRA 3ZY4A 3HLYA 3RKRA 5KC8A 1JHMA 3AF1A 4FSHA 4NFSA 3T6KA 3SSOA 3X43A 4HATA 1EWRA 5FL3A 4CVNA 5BNWA 1FCJA 4HWRA 3JD4A 1S2IA 4XSVA 2ODEA 1BRMA 1E9RA 1L5HB 1EE1A 5AOCA 1X7DA 3PHGA 3HS3A 3AVPA 1THZA 3G8CA 1C3XA 1XK7A 4LYYA 3D6VA 3QVWA 4GUDA 1MHTA 3LX8A 1QMPA 4WXRA 1HYGA 4B6PA 1FE8A 2A9OA 4LOIA 1C3EA 1JDPA 1WMFA 4RJLA 4KWIA 2IDZA 3EVZA 4F8YA 3TG2A 3WHLA 3WAJA 2OG2A 4FP9A 1A77A 4Q1FA 4Y2YA 1HNWB 1F4LA 3A6KA 4LZJA 3RWBA 1IZYA 1Z38A 3VPAA 4MWOA 1PR4A 2IWRA 4E5KA 4P4TA 4INAA 3S5UA 3KJGA 3ORQA 3QU2A 4CXMA 3O31A 5TVGA 1T5TA 3C4VA 1NHGA 1EFLA 2BFNA 2O2HA 4J94A 3FPCA 2DJIA 3COVA 3FMVA 3C74A 3MYRA 1P2TA 4WNYA 2UZAA 4DDKA 3WGHA 4PC3A 2FZGA 4P7GA 1GPWB 4XR4A 5JZVA 3UGQA 5FYDA 3B3QA 2BFMA 3C41J 2NV6A 5E6UA 3KJEA 3EHDA 2Y0PA 2WJYA 4LVNA 3AT1A 2XCRB 5BT8A 1NU8A 3UTDA 1E2LA 2AUTA 5G53C 4RTMA 4JBLA 2GLTA 2OBNA 2I1VB 2VYNA 3B1VA 3V2GA 3NHPA 4MP6A 1BKDR 2ZBGA 4R69A 1VL6A 4C7VA 1HPLA 2CV0A 4FIZA 3RF6A 1QPGA 1YXMA 1OIXA 1TTHA 1UOOA 4HRYA 4MJXA 3ABZA 4OJTA 3W5JA 3G5TA 5JECA 4EEZA 4YDQA 1J5XA 2O06A 1R4MA 1KJQA 4LHWA 4MROA 1U8YA 4EHJA 2XNDD 4BNTA 1TVKA 1Z68A 2QTWB 1B6RA 3F5QA 4MKRA 1ZJZA 2FUNB 4V0OA 5EJIA 2PT7A 1JR3E 4R4JA 5E0KB 3BJIC 1C1DA 3MSXA 4NQZA 3PEFA 1DX6A 3B13B 2WYIA 4YIKA 5SY4A 2QMQA 2WD9A 1K8RA 5E4TA 5GP1A 5GZ1A 3BPSA 4X1KA 5HZGA 5JFTA 5FUXA 3RHFA 3V1LA 4YN3A 2CNDA 4W7IA 3ZCUA 1WZEA 4BLRA 4CN8A 5BR1A 4DHEA 1NMYA 2V45A 3I01A 4EX7A 4GXTA 1XGKA 1ZUD1 3QUBA 4XUEA 2ARKA 3WKBA 2QZSA 4CM7A 3W4JA 1D3AA 1IN7A 3WOHA 5AIAA 2OFPA 2DUUA 2CL6X 3BFVA 4R84A 1GN9A 1HA3A 2HQBA 3IP6A 3PR3A 4FJ2A 4L22A 3ANXA 1YZYA 4YWJA 2YR0A 4CFYA 4FHDA 1EXMA 1YRLA 1Z0FA 2CYAA 3HUTA 3V1NA 4PZ9A 4B3DA 2JCGA 2A0WA 4B4DA 5HZKA 4QM7A 3HKEA 1YNOA 1U0OC 3HY6A 2GN2A 5TV2A 4AL4A 2FN3A 4IR7A 5NULA 1KR2A 3HXPA 2RBEA 4IX9A 4G84A 4YV0A 5BWBA 5FNVB 4JUBA 1TKRA 5BSHA 3ZS9A 1NX6A 4OHKA 3CUYA 4KXXA 4YRJA 4TYQA 3N2KA 3DT8A 1E3MA 4H3SA 1M1XB 2XQVA 4PLCA 4F6RA 2HV9A 1XTIA 4X71A 2GBCA 2F3UA 3JSXA 4URVR 4ESVA 3LCCA 5DIFA 2C95A 2BEVA 1JVBA 3RHZA 4I1UA 1U8AA 4EYGA 1JAXA 4NYMR 1SKBA 1MZPA 3M6WA 2ZRCA 2DFKB 3VZBA 2O2IA 1MC8A 1UP4A 5JJCA 3HYRA 4BC0A 3AVTA 5UKDA 2Y71A 2QUHA 1M6HA 1UBMS 3OA2A 3RRNA 2HDWA 2QRVA 4ARAA 5JXWA 1UBNA 3TCNA 1SBCA 5T6MA 2V0CA 4RQBA 2XMPA 1G8HA 5E2AA 1TRKA 4HNAB 3QEOA 1K8YB 1E9AA 2JARA 4BNYA 4U63A 2CXTA 4W6ZA 1Z5UA 1L7MA 1WWKA 3CSDA 2NVUB 1NG1A 1RM5A 1TMYA 1QHSA 1CUFA 2BKXA 2W98A 4OQQA 4U2CA 3FMIA 2ECKA 4Y1FA 2AXNA 4KLCA 2P67A 1JKXA 2P3LA 4XGRA 1V6SA 4JOQA 5CLGA 4C7OA 1WF6A 1G3QA 4LK2A 1JUDA 3VR5H 4PG4A 2FW7A 4MPRA 2QU8A 1TU0A 1UMBA 1R8XA 1SHLA 1NMEA 2IYWA 3LT0A 4RH0A 4X7BA 5KPDA 2UXDB 5AUPB 1HK7A 3CEJA 1XD8A 3OQOA 2J9RA 3BWMA 3WK7A 4CGYA 4F8EA 2WP8J 3SKXA 5I9LA 3RTAA 1WXWA 2OGZA 1S8FA 2E4VA 3K2IA 1I6WA 1UOPA 2YXPX 4EB0A 1MR3F 3DBIA 4FLEA 5DHUA 1WXXA 2G0NA 4E1VA 2O54A 3DR5A 4FINA 2XXAB 3EQ7A 1A7JA 1EFTA 3KR0A 4ILEA 2XT6A 4KI7A 5HGJA 3WYDA 2CV1A 1DKMA 1VFPA 1ZQ1A 3QX7A 4LS3A 4TTSA 3OPNA 4J91A 5IVPA 3IL2A 2O3JA 1C0IA 3P9XA 1R0SA 4YAWA 3OU7A 3KQOA 3V8VA 1YJCA 2AEJA 2HQOA 4YASA 1AH2A 3GDHA 1ZP6A 3LUDA 4IH4A 1UFQA 2ZR8A 1HYEA 1PQ4A 3HP4A 3OURA 1IHPA 1N2EA 1XTPA 3MRSA 1WIWA 1EP9A 1LU9A 4ZVSA 5AESA 1WKBA 1U99A 2WJJA 1B2RA 4Q66C 3OQJA 4IO0A 3ENWA 2JGDB 1C7QA 2O0JA 4GZ5A 3IEIA 4C5AA 4R40A 3HQ4O 1CERA 5B1DA 4LCBA 3SF8B 2P69A 3GIWA 3WYAA 1VIVA 3FUUA 5MGNA 5DNAA 2ATCA 2ERYA 1P0QA 4A73A 3QVSA 3P27A 4RKFA 2VEOA 3HU5A 4TRMA 4TXHA 4F7WA 1IAVA 1G21B 4XD7D 1KZ6A 1TCUA 1G20B 2J33A 4HG2A 4F3NA 2WF9A 1VBFA 3NT4A 2NSHA 2Z3VA 4G67A 1P1CA 4IMJB 5F3WB 1VA4A 4PQEA 1WP4A 4ZT7A 1BW9A 3DCNA 3GVXA 1VHLA 1IY9A 3LBAA 3MWDB 3OIUA 4A15A 3FSGD 3V1UA 5EWLB 2AYXA 1E2FA 1SCIA 4OHVA 2Y3IA 3WB0A 4RIGA 3BFJA 1UK8A 4KR0A 4LFBB 2O3SA 2IOFA 1RJGA 1W2WB 1BOFA 5ILOA 4KMRA 3BIFA 4PINA