1IIBA

Crystal structure of iibcellobiose from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYS
publication title The structure of an energy-coupling protein from bacteria, IIBcellobiose, reveals similarity to eukaryotic protein tyrosine phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 35
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iibA00
1FFSA 4YWHA 4W5NA 3ROFA 3E3MA 1GCGA 2PUEA 3A3KA 3RVPA 4PZ0A 3IDOA 3I09A 4N76A 4RWEA 5FBHA 3H1FA 4D74A 1U8TA 4MRMB 4Z4HA 5CNIA 4D6XA 1L5YA 2VYCA 4EUKA 1QO0A 3K9CA 1SXGA 1FQWA 1BDIA 3T8YA 4LRQA 4G0XA 4MLDA 5GQSA 3N0WA 3H5WA 1K66A 3MF4A 3HV2A 1RXEA 3FDFA 4MS3A 5IEJA 1USKA 3K4HA 2VUIB 1QKKA 4KK4A 4ETMA 1GUDA 1SRRA 2NT3A 2L17A 3CRNA 2QV0A 1NXTA 3H5OA 4JA2A 4RXUA 1L5ZA 4XARA 1JLKA 4YLEA 2PUCA 5IUKC 2NZVG 4Q6WA 3LUDA 4MLCA 2MSLA 3CZCA 4ZYLA 4G0ZA 2PUBA 3QLVC 3LUKA 2FXIA 3Q7SA 3NHMA 1DG9A 1QQAA 1USGA 4PEVA 5E3JA 1FSPA 4WXMA 5TPZD 3SM9A 2HQBA 4PICA 3OMWA 1BDJA 2F8SA 1DCFA 3TB6A 4ZJPA 9ABPA 1JYFA 3I5AA 4GPAA 1ISRA 1Y1LA 4LDZA 2A9OA 2L2QA 4JB0A 4ETNA 2R25B 2PUDA 4Z4FA 2HSGA 5FWYA 1AB6A 3MQ4A 2QVCA 1BVHA 3GRCA 2BGGA 3C6QA 2GKGA 1YK1A 4NCAA 3F6CA 4N47A 3M6MD 3UK0A 3KSMA 4WXEA 1EWKA 4DQDA 5JS1A 5BR1A 3SNKA 3LTEA 3R0JA 2QXYA 4TLLB 1JX6A 5JS2A 1NXWA 1IIBA 2MYPA 4O1HA 5EWLB 4EVRA 4EVSA 4KQ9A 3CS3A 4JB2A 3DZDA 5T3YA 4RZSA 1JBEA 3O74A 5IUJC 3DLHA 3KYIB 1MB3A 3RQIA 3TMYA 2TMYA 1YTUA 5IC5A 2HQRA 1KGSA 3KHTA 5JNVA 4HNQA 5ED4A 2RJOA 3FGZA 3Q9SA 2IPMA 1URPA 3TO5A 2LIVA 1P8AA 2WY2D 1M5TA 3OLXA 3M9XA 2FLKA 2FQYA 1YMVA 4KVFA 5JNRA 4PE5B 3JVIA 3S99A 1GUBA 2IKSA 4RXMA 5KQGA 3GBVA 3O75A 3TD9A 4MPTA 3OQNA 2PUAA 1M2FA 4DADA 3O1IC 4MS1B 1RPJA 3UKJA 4Q6BA 3EAFA 3LUAA 4OG2A 3D02A 1LBHA 4MR9B 3KS9A 1JFVA 3OO0A 3SY8A 1E2BA 3CNBA 1RXIA 3HCWA 1ZDMA 2RGYA 1WETA 3T38A 3N8IA 5CNJA 1PEYA 5C5EA 3A0UA 4MR8A 2HJ9A 2LUOA 4QYWA 3P9YA 3H6HA 3GT7A 1U2QA 2J48A 3BRSA 3CFYA 4YS6A 5EWMB 1H9CA 3O21A 3QEMA 5EWJB 4ZMRA 2JBAB 1PHRA 1USIA 5IEBA 1TVMA 3JTEA 5DTEA 7ABPA 1FFWA 3HO1A 2JVKA 3G85A 2I6FA 2KYRA 4P98A 1YS7A 3H5VA 4MQFB 1QPZA 4F11A 3QK7A 3HK2A 2GX6A 1BDHA 2JVIA 1VRVA 1R8JA 3OLWA 3EGCA 2FN9A 2OENG 3H1EA 3RVKA 4MR8B 2WB4A 3CU5A 2MYNA 1QQBA 2CHFA 4G0YA 6CHYA 4LE1A 2ZAYA 1TMYA 3HJFA 4RK0A 3QEKA 2QVGA 3UUGA 1JH9A 3OM0A 4KREA 5TQ0B 4MS4A 5IX8A 3BILA 4MQEA 2FEKA 2MYTA 1DBWA 2WMYA 3KG2A 2B4AA 4YGXB 3F6PA 2IPAB 1EAYA 1T34A 2FTKE 8ABPA 1D4ZA 4XFKA 5KQMA 1ZHHA 5CNMA 2PUFA 4RV5A 5FBKA 3RH0A 3IP6A 2E4ZA 3I42A 3QLUC 3DLBA 5TQ2A 1K68A 1JFTA 1ZGGA 3RVLA 3RVSA 4KPYA 2A9PA 4IF4A 1NY5A 4ZPJA 3OQMA 4Z4CA 2O20A 3SG0A 1XHFA 1DCMA 4XLTA 3B2NA 4M88A 1D1QA 3KLOA 3KYJB 4LZLA 4MQEB 1PEAA 3HZHA 3RVQA 4QYMA 3FMVA 4G97A 1ZVVA 1A2OA 2R47A 4MS3B 3HDVA 1E6KA 2QW1A 4IGAA 4LE2A 1ZH2A 3OQOA 2IDMA 3MM4A 1OXBB 3QLVA 1C0EA 4OBBA 4XAQA 4WWHA 1Z13A 2ZWMA 1A04A 2AYXA 2FW0A 5HQJA 3LUGA 5BRAA 3HDGA 4UHJA 4HYEA 1NXPA 1Z18A 2H0AA 2E4VA 2VK2A 1EFAA 5KQLA 4EYKA 3OO1A 1Z17A 1KMIY 2MSKA 5B3JC 4G0QA 4EYOA 3BRQA 1NTRA 4WT7A 1ABEA 3SAJA 4B09A 5DCLA 3O1JC 1U0SY 5F64A 4KK3A 1A0OA 2WJAA 3JS5A 1OXKB 1PNRA 5ABPA 1QO0D 1QP7A 2JCGA 3LFTA 3CTPA 4D6YA 2QSJA 1MB0A 1TLFA 3QLTA 4KFCA 5FWYB 3A10A 4Z99A 2YHAA 2PMCA 1D1PA 5B3JA 3CG4A 4OLBA 5BQ3A 4Z0NA 2P9HA 4LE0A 5PNTA 5CNKA 4S05A 2R48A 1CYEA 3CLKA 1XHEA 1DC7A 3DBIA 5TPWA 4RSMA 6ABPA 2PL9A 4KNYA 1DBPA 2PUGA 3F73A 1VPWA 5FWXA 3SQNA 1Z2EA 3LMKA 3CG0A 3C3MA 4KMRA 2FQWA 3QELA 1YS6A 1GLGA 1DRJA 3HSYA 3C3KA 3IPCA 4YP9A 4MR7A 2P4UA 3C3WA 1B00A 3RVJA 2PL1A 3OLZA 4EYGA 1AB5A 2PJUA 1GCAA 1SXIA 1Z16A 3DGEC 4H60A 1S8NA 3T6KA 4MGEA 2JB9A 1DJMA 4EYQA 2NT4A 4YR7A 1RZRA 1PUXA 5C5CA 2FKAA 2H3HA 1E6LA 1W25A 3OLVA 4QPJC 1TJYA 3CKMA 1YMUA 4Z9BA 1CHNA 4Q7EA 2AYZA 4WZZA 4LX8A 4OTZA 4RK6A 2QZJA 3M9WA 4TN5A 3URMA 4ZMSA 5JNTA 3VNAA 1EWTA 4JASB 4N41A 3HUUA 4YV7A 1KRWA 3N0XA 1JFSA 2Q5CA 2R4QA 2FQXA 1M2EA 2E4XA 1HEYA 5HM6A 4QICA 4RK4A 4ETIA 2ID9A 1DC8A 3GBPA 2JVJA 1ZN2A 3KLNA 2X7XA 4H3HB 2M98A 4LDAA 2HPHA 3Q7TA 1SD5A 1J56A 1LK0A 5CHYA 3HUTA 1Z2DA 1CEYA 2VUHB 3NNSA 5TE9A 1JYEA 2ID7A 3MMNA 4MRMA 2FMIA 3FFTA 4RXTA 3L49A 1ZESA 3HXMA 1EHCA 4JAVC 2MYUA 2JRLA 3MIZA 1F4VA 3QEMB 4GNRA 3JY6A 2GWRA 2W42A 4PYRA 1MIHA 4UHKA 3LUFA 5JNWA 1NXVA 2FMFA 3JVDA 4S04A 3ILHA 1QNLA 5HKOA 4DN6A 4RK1A 4KQCA 1YIOA 2IYNA 2LP4Y 4RS3A 3A0RB 5T7BA 1JL3A 1ZH4A 2WRZA 2B1JA 1LJUA 3RVMA 3LUJA 4XXHA 3Q41A 3D8UA 3JPWA 4FE4A 4O1IA 2XDYA 2FN8A 1DP4A 1RZRD 1MVOA 3KJXA 4HNSA 1BA2A 2PLNA 4JP1A 2PE5A 4RDCA 4P1ZA 1Z15A 3N75A 2NZUG 2IPLA 2WWVD 1JDNA 3MA0A 1D5WA 3O2QB 3O2SB 4IRXA 4MS4B 3NBMA 3T95A 2CWDA 3EQZA 3G1WA 3F7NA 4Z4GA 4MYRA 2L19A 1U04A 2FEPA 3BBLA 3LKVA 3Q15C 2GI4A 4G86A 3W9SA 4N0QA 5IULC 1APBA 1NXOA 1KRXA 3H5LA 1DZ3A 4NCBA 4N0PA 4F3TA 3QLUA 1YVUA 3MYYA 2OQRA 4IMIB 4L4UA 5JNUA 2E4YA 3Q7RA 2LPMA 4EGSA 4YO7A 3EJWA 3FFXA 5TQ2B 4MAAA 3H5TA 2A9QA 2V0NA 1ZGZA 3OM1A 3FFWA 1U2PA 1Z12A 4FB4A 5EWLA 1ABFA 2IOYA 4NQRA 1RNLA 5DGCA 5JNSA 3CHYA 1JHZA 2FLWA 4O5AA 1PNTA 1TM2A 2CD7A 1P6UA 4KV7A 4ML3A 5KQPA 4OLAA 4NV3A 3RVOA 4OATA 1NXXA 3GL9A 2PKXA 1DRKA 4RK5A 4RU1A 4FE7A 3O2JA 4EY3A 1Z26A 3QX8A 4XASA 3L6UA 1P2FA 2FMHA 2QR3A 4KRFA 3JPYA 4RKQA 4RY0A 1D2AA 2CHEA 3IPAA 4G0OA 3H5IA 3BREA 4TMYA 1ISSA 1ZITA 2LBPA 3H1GA 2N9UA 1EWVA 2DRIA 1F51E 1QP0A 4Y9TA 5DKFA 4MS1A 1YK0A 4NICA 4RY8A 3N6VA 3RVNA 1FFGA 3KKEA 3VNBA 2F8TA 1LBIA 2GBPA 4MR9A 3EDCA 1LJLA 3H75A 3GWGA 2A9RA 1NATA 3ILYA 3LUCA 3OMXA 3QX9A 1Z25A 5I4CA 3NHZA 1DCKA 2HQOA 2FVYA 4W5TA 5GOTA 3IP5A 5HSGA 3E61A 3KTOA 2L18A 2FEWB 4W5RA 1XWWA 1BAPA 4H3KB 4Z9AA 2PAFA 4L85A 4E7OA 1I3CA 2RDMA 4KZKA 5EWMA 4N03A 4RK7A 4YCSA 4WUTA 4G0PA 3DGFC 5TPWB 5EWJA 3NNDA 2JBAA 1NXSA 4HNRA 3GV0A 5KC9A 4RY9A 1VKRA 5FWXB 1W9HA 4F06A 3H6GA 1E6MA 3QELB 3LUHA 3OLYA 4Z4EA 2WJWA 4MR7B 4E7PA 2JK1A 5BRJA 3ROTA 1JWLA 1MAVA 4MQFA 1SXHA 5D2CA 1ZY2A 3GA5A 2YHBA 1ZAYA 4F12A 4G0MA 3TX6A 3I45A 5TQJA 5IUNC 2FSPA 3NNNA 5KI6A 4W5QA 4Z4IA 5DLEA 1QMPA 3IP7A 2M1ZA 2RJNA 1JF8A 4IILA 5KC8A 3EODA 1P6QA 5TPZA 1DBQA 1UDRA 3N53A 4CBVA 3HEBA 3LOPA 4F8JA 3EQ2A 3O1HB 5KWSA 3KCNA 1VLZA 1QP4A 1M5UA 1C4WA 5TQ0A 3CZ5A 3HVRA 3C97A 4IMJB 2FMKA 4RKRA 3IP9A 3HS3A 4JOQA 3N0RA 4W5OA 3EULA 2MSWA 3GYBA 2IPNA 2E4WA 2QU7A 3LKBA 5IBQA 4TLMB 3HM9A 4EVQA 2NUBA 1JDPA 4YRZA 2E4UA 3RVRA
chains in the Genus database with same CATH superfamily
1FFSA 4Y1FA 5IAJA 1N7IA 2J6IA 5DWQA 1C8LA 1DFHA 1GCGA 1QRDA 3LF1A 4BNYA 3Q40A 5AW7A 2ZXUA 4LNHA 4Q3CA 4AKIA 2B4QA 2BKEA 2RMKA 4IDBA 1XJCA 4MRMB 4DREA 4Z4HA 4ABTA 3DHWC 5D3ZA 1ACLA 5ALIA 5T4EA 2YNMC 1ABBA 2L0XA 1GU7A 4PGGA 2AZMA 1NYLA 2OV1A 4XPIA 5FLEX 1ZRNA 1AS0A 5K0EA 5EMMA 1YULA 2IZ6A 2KBFA 2OO5A 4IQFA 4IMRA 3LCCA 2ZKIA 4DQUA 5JYDA 1R5BA 5LNK6 5MN4A 3CXRA 4CMIB 2BC9A 4U3JB 4EHAA 1U81A 4C1NA 3ASZA 3CRNA 2QV0A 4R05A 2HF9A 1GILA 2QN6A 2VP5A 4P2BA 1N2SA 1IIRA 2AHRA 2PFGA 2GEJA 3FZGA 4MVJH 3THOA 1U94A 2MSLA 3K6SB 1DGQA 3H83A 1NVWQ 1WLYA 3FZEA 3G8AA 2DHEA 1ZMTA 4HC4A 2A59A 3JXEA 3BEDA 3E9ZA 1ESCA 2JH8A 4MDHA 3X1YA 2GJ8A 3A27A 1LDEA 4Z0HO 1EK1A 1USGA 2B8NA 1N6LA 5EJMA 5D00A 5IBCA 3ZZ0A 4YB8A 4PC2A 5TPZD 2O8CB 3NM4A 3QBTA 4TROA 1G59A 3ZIAD 3WNZA 1V3TA 1SCJA 1W52X 2ODTX 4G1FA 4MW7A 1THTA 1K1EA 3FG9A 4WCFC 2VK1A 1JYFA 4O1MA 4M0CA 5A4FS 4OX9Y 4BFYA 2P91A 1VFNA 4FB5A 4WXYB 3ZDZB 3QW4B 4A36A 2EWMA 2I29A 5TB5A 1Q3HA 1H8EA 2L82A 1UP6A 3OWXA 2P2YA 1DRWA 1GL6A 2V6FA 3DD1A 5EPUA 4KR3A 4UUNA 3UWDA 3PX7A 4MDEA 4H6WA 1BXRA 4CDNA 1N2IA 3AVTA 4YT5A 5B4VA 2AN9A 2OD7A 5FLXA 2F64A 2BFCA 1YZVA 1CBUA 1CS0A 5FD8A 4CDMA 4ZDKA 3K94A 3WZMA 3AHDA 3L8DA 3RF7A 2O2ZA 1OV4A 4WCFA 2NUPB 4IO0A 1G8KA 1OD6A 5AQEA 3GT0A 5UKDA 4X20A 5AOCA 4QDJA 2XXJA 2XTNA 2ADFA 4U2FA 3PE3A 2AX4A 2PM8A 4QXAA 3C4QA 1XG5A 3DXFA 4EGQA 2QS9A 3CS3A 4LC1A 5T3YA 4JBGA 1WXXA 1X1EA 3KJZA 3E9NA 5IYZB 2DX7A 3HMKA 3ZCQA 2G71A 4LV6A 4JX8A 4KXNA 3AXSA 4P7GA 4YFYA 4FI3C 2WVAA 4IGKA 3A3PA 5DYYA 5B1IA 1AQIA 2Z83A 3ZZNA 4F60A 5AVTA 2FWNA 2RJOA 5IU6A 1G38A 2RK6A 2WQ6A 2NU6B 4MOWA 4C3OB 1L7QA 4HUTA 2XJ4A 5FF9A 3GI1A 2KX7A 3ZCSA 1B14A 1QFJA 4N5NA 1M5TA 4P5PA 5M7EA 3B3AA 5JNRA 1U8EA 4PE5B 2HGZA 4Z7QB 4MAFA 4W7SA 1XCLA 1C4KA 4QUJA 3ZWYA 2OXRA 4DADA 4ZV4A 3AERA 3O1IC 4FFNA 1EQUA 3IS3A 5K2MA 1BIFA 3LUAA 3LLCA 1B3RA 2X5KO 1N6KA 2GHQA 3UWKA 1X7YB 4TYNA 2C3MA 2C9ZA 3AFIA 4FMCB 3OUUA 4GNKA 5J2TB 1RCFA 1Y7LA 5AW9A 1C7ZA 2GCOB 3H1TA 3EXFB 1P73A 1O8CA 2GO7A 1SQSA 2EXXA 2XB9A 4WACA 3W78A 5JSQA 2YV5A 2HB6A 3R9WA 2ZBFA 5CIQA 5DW0A 1N4AA 4ARVA 1N9GA 4ZO4A 1FFAA 1I4WA 2UZ3A 3TOXA 5B2EA 2GLTA 4BNNA 1NM5A 2R84A 2XY4A 3D0OA 2BGLA 5EWJB 1NNI1 2I1QA 4RZ2A 1XRJA 3LJKA 4HWGA 4Q9KA 1MR3F 2B61A 1PTJC 1ZNWA 1G19A 2X0IA 1UQRA 1L7EA 1FUIA 4HH3C 4BP9A 3W3AH 4EA9A 4L8YA 3FTCA 4TM8A 1N78A 4GICA 4ZI7B 2KJQA 4JIMA 4JBNA 1PBTA 5EZYB 1I6LA 3LX8A 4MQFB 2I1LA 1QCZA 3QK7A 4DR5B 1A8PA 1NQXA 1QFZA 4DB2A 1FW6A 2IK8A 1IBSA 3EIOA 1DTWA 2E1RA 5BPHA 4MR8B 3UT5A 3V2HA 1E66A 2QBYB 3R7LA 4BBZA 1PRYA 1U9IC 3DJYA 4UQOA 2QN7A 1TYZA 1AK9A 4YHHB 1R0WA 3TFOA 3SHWA 3ZWQA 3QEKA 1FLNA 2BJHA 2A14A 3DB1A 3NDRA 4ZVTA 1U2RA 3LQQA 4P9NA 2EQBA 4KQGA 4DGSA 4F72A 5AVZA 4DR1B 2E5LB 2ZS8A 3ITDA 1O77A 2VWHA 4ALMA 4CV3A 3BDAA 2IUTA 1U99A 3JV7A 2BGIA 1R0ZA 1DSSG 1DBWA 3HRKA 3WGYA 3NVDA 1SC3A 2B5OA 5FCDA 5BSKA 4IRMA 2K4MA 4KPGA 3VHXB 1GWNA 1R6UA 3HO8A 4B3IA 5BWCA 1O3YA 1U5AA 2FZGA 2WAAA 2P2SA 5IM4F 2Q1UA 4AFNA 2YJ3A 4BO8A 2QTMA 3AOGA 5TLSA 2CXQA 4FYIA 1VJGA 4UBMA 1YB2A 1UMBB 1QG4A 2ZJFA 1JFTA 4ZZ2A 3K70D 2C4KA 3JZAA 3E22A 1QH9A 3KR9A 1L8QA 3EPKA 2JGAA 3ZDEA 1QVRA 1RWPA 3IMFA 3PCXA 4NABA 5G4LA 2C7RA 1XXLA 3JALA 4M88A 4NENA 1KWKA 4LF4B 1TMKA 3O9ZA 3ILSA 4RHTA 4Q9JA 3D8HA 2OFPA 2IYOA 4QYMA 3CUUA 3FMVA 3FSRA 4UXHA 2G82A 5FKJA 3U17A 1H6CA 1PJTA 2VTDA 3BMQB 1H2HA 2JA1A 3EWIA 2GAIA 3KKMA 4DVGA 4EFLA 5AHXA 5KZMB 3OQOA 5CFPA 1SG9A 3Q0EA 1SXJA 3RV3A 4XAQA 4I55F 4ARZA 5DI9A 2BFAA 4PIVA 5KDDA 2FFRA 4Q9AA 1ZRHA 3K1AA 3OSUA 2ZVPX 9LDBA 3FNQA 1ZICA 4OUDA 4PAWA 1WM1A 5EI5A 3WNVA 2R5FA 3ZLUA 1WB6A 3Q12A 2AK2A 4KCGA 3C6YA 1PE0A 3TN7A 3RS5A 1ABEA 5KKCA 3EX7C 2Z2IA 1WS6A 5I7AA 1NFFA 4PWYA 1GPAA 4XLZA 1RC8A 2DZDA 3CNOA 2I2DA 2Z5LA 4WL0A 4O4LF 4M8SA 5DGDA 5DNAA 5ABPA 2F4VB 1QO0D 2H2FA 4AZ0B 4D99A 4RSRA 5J4LA 3KQLA 1XNHA 1H23A 1LNSA 1RVDA 2QSJA 1OBOA 2B6NA 3P5BA 3UXYA 1CUFA 3B36A 3DHYA 3QLTA 3PR3A 4KSBA 3PNYA 3K0FA 3LBFA 2I3ZA 3O90A 5DDIP 1KYYA 3OEED 3KKQA 1OHHD 2O3RA 2QYOA 4IZHA 4L6AA 3IUPA 3P9ZA 4N49A 4RZ3A 5T3UA 3SWWA 4S05A 3EGXA 1HZZA 1M2GA 3CLKA 3NIGB 4OJQA 4YDRA 5EKSA 4Q4JB 1MN6A 5H80A 2VHXA 4M2LA 4R2LA 1WPXA 3PHGA 5FWXA 2XE4A 1W2HA 2EKPA 3CG0A 2P7IA 2FQWA 4INPA 3RRZA 5L4LA 2CZCA 2EZ8A 4YACA 5BV2P 4HWTA 1AHPA 2BMEA 2G9UA 2PL1A 5E38A 1S5PA 3HWX1 4X62B 3C6BA 4ZVQA 4IX1A 3T6KA 3N7UA 4RTSA 2VO1A 4HSGA 4WFIA 2JB9A 1DJMA 5C18A 1L6RA 5CH3A 2C96A 1G1MA 3AHJA 1N5RA 2J32A 2VJBA 3EIWA 4NYJQ 5AM5A 1E6LA 4ZCQA 1BD3A 1BHQ1 5LZ8A 3WV5A 1WCIB 3MGGA 1UBUS 3ZNQA 4I99A 4Q7EA 3GX1A 1WDTA 1CDOA 1TJNA 2CFOA 1Y4UA 4OTZA 2V7PA 1SVKA 4LSGA 1PLLA 2FW8A 2H7YA 3O4IA 5FV7A 1EFVA 3UHJA 1UKBA 3UMGA 4NBWA 1YQTA 3UMCA 3PA6A 4F8YA 1EX1A 1L5HB 4RSHA 1ND6A 3H8JA 2A35A 2XYGA 3BYZA 4BKOA 1V45E 4KQKA 5TC4A 1D9XA 3BOSA 4NCKA 4YXWD 3PLNA 3NTVA 5FOTA 1W75A 1XIVA 3D7RA 4F3RA 1KAQA 4IF6A 1XZIA 5DISB 4D25A 2AYYA 4CW7A 2NSJA 2NSLA 3LGAA 4O8ZA 3WAKA 3ENKA 1UXHA 3L49A 1EHCA 1I7NA 2EJUA 2HMAA 3AFNA 3CKKA 5FIUA 4UDYX 4BRZA 3PFIA 3OLCX 1S96A 4ZAZA 2I54A 2ZJOA 1V48A 3J7TA 5G2OA 5ALYA 5C8YF 3BF8A 2ACEA 5FTKA 5JNWA 2WWWA 1T8UA 1O4VA 4NE9A 5BMVB 1S3GA 1EBBA 3U39A 3UM9A 4ER0A 4ZOCA 1LSUA 3KQQA 3COYA 4HNAA 4DA0A 5K3EA 2FPMA 3RYTC 3TZKA 2XOEA 3WOVA 5FYDA 1G8SA 4K9MA 4HGYA 1M83A 2HRCA 2X4GA 4CF3A 4KQ1A 3VX3A 4GX5A 2TS1A 1CCWA 2H8GA 4E4YA 2ZAGA 4K6FA 5TJ9A 4TTIA 4C0BA 4AN4A 3MAJA 4WOJA 3GLIE 4U0JA 5B7PA 1YONA 4HGRA 2GGSA 4QJ3A 1SQ0A 4LC9A 3SSOA 3AEKB 1MVOA 4PLPA 4YJGA 2G36A 5AKIA 2IYLD 2R8XA 3CLRC 5EJ8A 1XRMA 2PE5A 2ZVDA 4KSCA 4Q3KA 1Y5IA 4DDVA 3UJNA 5DM1A 1I01A 2XVZA 1RMYA 2BTOA 4GKAA 1IEVA 1F20A 4YYEA 1INLA 1SC1A 3FPFA 4J43A 4O2AA 3UW3A 4B6EA 1SAYA 2GI4A 2EQAA 1LC3A 2ZI5A 3KJIA 4BEJA 2YRXA 3L1IA 3N76A 4K1XA 1QFYA 5FOVA 1RLJA 5JR3A 4U7DA 2G04A 5BMVF 1KIAA 2W6JD 5E2IA 1YOBA 1X1SA 3PEUA 4BFCA 1Q0RA 3OQ1A 3RUIA 5K3BA 2EGHA 3M1IA 1TIKA 1VE9A 2G88A 3SFVA 1K9VF 3W5UA 4WBXC 4JZKA 4E6EA 4YRKA 4PCUA 3I5MA 1KK0A 4FHDA 4I50F 2ONKA 3VXKA 3LT0A 4LTDA 3OCCA 3BHIA 2EDCA 1RQLA 1MX9A 3F2IA 3OCJA 4WGFA 4YP0A 1JEQB 3QHPA 5CFMA 1X1BA 3K72B 5ECGC 5JASA 4C0KA 1NRXA 3CRZA 2ZI3A 3FSJX 3AV3A 2DM6A 3PVZA 4X1IB 4JI6B 3KB1A 4ZGWA 5JSYA 4EY3A 4W5HA 2GZHA 5JSHA 1GFIA 3TSYA 1XDUA 3PWSA 4MUYA 1L4NA 4EFNA 5I7EA 4RKQA 1CLUA 3DDUA 4MROA 1XRNA 1FW8A 3IPAA 3QVUA 4G0OA 2VJAA 4I9FA 4WZAB 4UU0A 2CVZA 3RTCA 3KKPA 4R9VA 2Z5FA 5EGSA 5KX5B 4F8EA 1WUJS 5IMBA 3JVVA 4YCJA 4PFQA 3KBOA 4DIUA 3AEZA 4X41A 1LSOA 1T2DA 3HCCA 3KM0A 4IUBS 3RVNA 1Z4NA 1GZ6A 4C2BA 2AA3A 2QN3A 3GJTA 5JS7A 1MQSA 5JNSA 4KO3S 4K5QA 4YTEA 1EUDB 1CF2O 2E21A 4X9XA 2PCLA 3USES 4OU5A 1NBWB 4Q4LA 1A69A 2H1SA 2JJ8A 2ZIGA 5C52B 1M1YB 3RKSA 1CC1S 1R6AA 1WY7A 4MKIA 1JFFA 4W1PA 1KEPA 1N5OX 2L18A 3DOIA 4PO1A 4RHYA 1BAPA 2GYVA 5FNVB 4L85A 1PFGA 2PR7A 1YKSA 4P93A 3LPNA 3FPCA 2RHLA 3D4BA 4FGZA 3UCFA 5KTSA 2OAGA 1JEYB 1WTCA 2BLNA 2QNBA 3GV0A 4KW7A 4TZKA 4WY5A 1G291 1QTNA 5I9NA 1YI1A 2B82A 3UHOA 1W9HA 1FJ2A 1KZHA 1SM4A 5IWCA 3AGPA 1T1GA 2B8JA 2DUUA 2NX2A 3MEQA 3WS7A 4UMVA 4CCYA 2RSLA 3IXQA 2BEWA 4QAJA 4UBOA 2G9ZA 1VLHA 3OFKA 4RX1A 5IVPA 3EF3A 3GG9A 3DPSA 4WK4B 4ZDJA 1V7CA 4UVIA 5E1DA 2WWIA 3HUEA 2NV6A 5E6RB 4YRSA 5L51A 5JTUA 1I4OA 2OO3A 2HQ1A 3NNNA 1IN6A 4YXFA 2WMOB 1PQPA 2IYUA 1GP2A 2P2ZA 3SVZA 2Y1EA 2IVZA 3IV6A 2JL1A 2HK9A 1HETA 3E7XA 3R23A 4GLBA 2V5UA 1Y1SA 2W2NA 2WYOA 4FDAA 1UDRA 4RA6B 2IEDA 4XWTA 4EQ6B 3CUSA 5ESXA 4FDMA 3CR7A 3ELDA 2WLTA 4FYWA 4KIGA 5DX1A 3G6KA 2PNJA 4R01A 5KOJA 3RK1A 3KCNA 1NVBA 1VLZA 1YOVA 3M9LA 3O03A 4BX3A 5BV0A 1I2DA 1RQPA 3ZD6A 3B3FA 4ZIRA 2CSUA 2GA8A 5B2ZA 4E30A 4UTPA 5HIKA 3BX1A 5DCUA 1KVSA 3ZY5A 1AQJA 4XUEA 1TGYA 2OG1A 1E1CA 1Y3IA 3GARA 3DA8A 4IIJF 4FFBA 4O2BB 4TV9F 4B45A 3DE6X 3WSVA 4NG4A 3MCVA 1S2IA 3H2KA 4A6PA 3HI4A 1PR1A 1JDPA 4XB1A 3JARA 3AM1A 1OI4A 1W88B 5ARBA 3M6AA 3OQJA 1FS5A 2QGZA 4J7UA 4JUIA 1RPZA 2VCEA 2FRDA 2PBLA 3HCBA 3IJEB 1JLRA 3WBBA 1EDBA 1W0JD 1E0DA 3E3MA 4KYIB 2O59A 1XLUA 4B7XA 2JGLA 3U7IA 4RIEA 3BD8A 3OT1A 3V48A 4O3FA 1CV2A 3H9EO 4M49A 1I1OA 2O1SA 6GPBA 2BGRA 2HREA 3U4QA 2DJ5A 3G2IA 3PWTA 3IAAA 1QHHA 1AJEA 4RF3A 3PNOA 5D6NA 3O3OB 1USKA 5AXBA 2WF9A 4P80A 2V6IA 4LDQA 3SIRA 2DPHA 2ERYA 4G41A 2VOJA 4EUEA 1NMZA 5GPBA 4HDAA 3U19A 4X45A 1L5ZA 4K3VA 4X7MA 4C7OB 3L40A 4XQCA 4INOA 5CG2A 5DI3A 3RSZA 5AI4A 1CTQA 1P2DA 4NMMA 4YRAA 1NVKA 1POXA 3MJ4A 4FEYA 2VNKA 4I19A 4CKBA 5ISMA 4NJEB 3ZD9A 2YV1A 3OKAA 1X1CA 2C4UA 4IYJA 4EO7A 2FFHA 3TZCA 5L6MB 1TQ2A 2FUKA 2P1ZA 1MO4A 4PPQA 5TIIA 1V6AA 4KWCA 1B7GO 2V7QA 2NXEA 4EUNA 5IASA 1OV6A 3KR1A 1I13A 2FOLA 4Q82A 3I5AA 1PKEA 2FPPB 2YJZA 3KQMA 4GPAA 4GXNA 2X42A 3RTDA 4AO6A 3CR8A 3JQAA 4CQJA 3UBTA 2ZVJA 3D9QX 2EFEB 4IFIA 3ZI4A 2HSGA 3OT4A 3ZV3A 3V8PA 4XCXA 5EMKA 5F52A 4PHCA 1XPOA 3TQRA 3I32A 4X6UA 3EDOA 3HVHA 4AY5A 1OREA 2HV8A 4DQDA 4NF2A 4B87A 4H0NA 2I78A 5HS6A 3IELA 3KZKA 3OA0A 3LTEA 4J0QA 3PPYA 4AAYA 3EISA 4BNUA 3PXEA 5A71A 2IZ1A 4RTPA 1ORIA 4TYWA 1SD1A 2C9OA 1QUEA 2W58A 2WTEA 3TNLA 2ZWAA 4ERXA 2H08A 5JAUA 3BMNA 5IUJC 1T4GA 4U2BA 1BH6A 4EIWA 3HV0A 3R4VA 4OSEA 4KUGA 3DO5A 3SF8B 1TF2A 4O2RA 3UYLA 3HNOA 5DPMA 3A6JA 3WQQA 3ZCTA 3M33A 4Q05A 1TYBE 2R00A 3D1VA 4LK2A 1ORHA 4WLUA 2QN8A 2ZB4A 4BO2A 4I6EA 5ADWA 4HXFB 1G3QA 4WD3A 3SI7A 2MCFA 3C6MA 2HF8A 4W8HA 2GK7A 3MB8A 4LCEA 1NBHA 4P92A 3QUTA 2XRZA 1GOTA 1Q19A 3NRBA 5AVOA 4MPTA 1FLDA 1L8OA 5KTYA 4UUOA 4K86A 1W48A 2NQ8A 5I48A 3VHLB 1V39A 1PG2A 2MIIA 3QPDA 1N8KA 2WEKA 3I9FA 3ZD7A 3EAFA 5BO5A 5JI2E 5CVCA 1HORA 1Y3AA 5BR8B 3TW0A 2G0NA 1PQYA 1EFPA 4PZZA 1RJEA 3SVLA 1L7AA 4EG5A 3W90A 1TZMA 1QZXA 1V16A 2ZWVA 2YIMA 2BGGA 2WINI 4NY1A 4PYOA 1GYPA 1P4GA 2NZ2A 4EVIA 1M1ZA 1VB5A 1RAFA 4BNWA 3H6HA 4OEHA 2D6FA 2GHTA 4KQJA 4B44A 3FHTA 5CCBA 2BBSA 2VJPA 3KOXA 1BX1A 1K4MA 3E03A 5EWMB 1NQ5A 3IUYA 3T5DA 2OOKA 4JJEA 2HBRA 4ZO6A 5ERXA 3GJ7A 3L7JA 1XDDA 4KIFA 4X1KB 3AO0B 1QP8A 1Q1NA 3N1UA 5BQFA 5CEEA 4TS4A 1JP7A 2W8BB 5J9FA 1OLXB 2VQSA 3DXXA 2ZLBA 1YJCA 4FGLA 3M83A 3CMCO 5LWQA 2APJA 3QPWA 3STHA 2HH9A 1OXSC 2Q6IA 4CT0A 2WOOA 1A1SA 1R8JA 2AJLI 4D9JA 1KDYA 2KI5A 4YJFB 2O7QA 4GZ5A 4DCTA 1H4SA 3A6EA 5DHPA 4KYTA 2CHFA 2M6SA 4YRDA 3ZDCA 4BP1A 4G4IA 4CNBA 3RKUA 3P0IA 4JHXA 1KIMA 1O2DA 2BLLA 3ODPA 1ZUNB 2XUQA 1ONSA 4RK0A 1OYWA 3TSWA 4C05A 3OZ7A 2YQ4A 2CK3D 2HZBA 4EEKA 3P4XA 1EE9A 1OC4A 2MMCA 1YSCA 5BNFA 1LDYA 4BZQA 4AB1A 2WHPA 3E0XA 1PNVA 3A4MA 5KSOA 2C94A 4C0SA 1ZKMA 2OLJA 3AUFA 3L04A 4HLQB 1Z7GA 2MINB 4ZVNA 2NUAB 1OHHA 3LCJA 4P4SA 3LG2A 3QXJA 1I2BA 3GRPA 5HIIA 5M3BA 3RUCA 4RV5A 1M34E 2Y1CA 3TKAA 1IY1A 3INYA 4DEYA 3FTPA 4HVCA 4J91A 5ILGA 3T3DA 1GRQA 2PQ2A 1ZW1A 2DQ4A 3VZPA 5IM4A 5CMLA 2FW1A 5EHZA 3C6ZA 4F38A 2I2BA 3QUQA 2RJ3A 4RGBA 3SBXA 4A92A 1Z33A 1D1QA 5EQDA 2JGIA 3I4CA 1GGNA 1PEDA 1PEAA 2HIGA 4HAZA 2PXXA 3HZHA 4PTLA 4Q1AA 2FN3A 5BRNA 3T1HB 3DV0A 4CV0A 5IJ0B 2JIPA 4Z8YA 5KJCA 2QMYA 3GLFE 1B6TA 2A7XA 3R3YA 2XADA 1U8YA 2YIJA 4Q9NA 5KDLA 3R7WB 4IJWA 4C5CA 3H04A 4NPAA 1IYZA 3I2YX 4TVOA 3AESB 1HLFA 2ILTA 1F2TB 1ECGA 1HYBA 2EX1A 3LY9A 4JENA 4WWHA 3RS9A 4Y8VA 1P2VA 1YDMA 4N9QA 1BE6A 1GUAA 1E8MA 2AJBA 2FPGA 3II6X 4KIWA 4YAJA 5LYYA 4Y1GA 4JKIA 4QWMA 3U3DA 4EJ2A 1S3FA 1NW5A 3C43A 4I55A 2OHGA 1CUXA 3PD0A 1SNYA 5F2OA 3VYSB 4KDFA 4PGAA 1U28C 3GLSA 2QT1A 4NR0A 1ETUA 1S02A 1A5BB 4CM8B 1E7WA 2A0UA 4M1QA 4ZCTA 2J5BA 5CD1A 2W93A 4HWOA 4RVGA 5AVRA 2H2HA 3H3FA 3CTPA 4TSFA 1BGWA 4O4LA 2Z9CA 1WNTA 2Y68A 2XUJA 4H18A 3UFXA 3CR3C 5H4HA 1G21B 1SBQA 2C7GA 3FNGA 1DHTA 1KJJA 3W4IA 1ZZGA 4O4IB 4NP6A 1WE2A 1XMXA 5CT8A 4ERNA 3PS9A 3QYAA 3MRTA 4C0JA 3OHPA 5LKAA 3EZXA 2D7CA 4ZFNA 4EI7A 3PR1A 1A9OA 3AY7A 1U2SA 5AJHA 4M86A 1T8TA 2P68A 2PVPA 2DWOA 1N3IA 2JLQA 1B15A 3B9BA 4X3CA 4D42A 2ACVA 1BU5A 2PQ0A 5A4MS 3AJDA 4O2LA 4POAA 2QZZA 3PDIA 5CBPB 1MENA 4YMLA 5EN4A 5JUWA 1EZ1A 3P2IA 4JL6A 3U44A 1TZ2A 1X8XA 4MB0A 1UDWA 3WB2A 5AESA 3DMGA 1EK0A 4NOLA 1EJ6A 2Q9BA 1VTKA 3HE3A 2M6LA 3KX2A 4B74A 3KUCA 5LXTF 4F71A 2BM0A 2WTXA 5CITA 3M6UA 3UUEA 1FFXA 4OHWA 3WBFA 1Z7YA 3HFRA 4J1SA 2P40A 5BSWA 2IF0A 3ADCA 2ZBVA 4DLRA 4Q12A 3P9CA 4JQZA 4LXXA 4JR1A 5KREA 1WQ3A 3NM5A 1GJRA 5IDXA 2Q2OA 3A04A 2YMMA 1KEUA 3CPJB 4UHCA 5DTMA 4CZ2A 1WOMA 3HJCA 3W5VA 4QGHA 3CN7A 4R2JA 2R4QA 4N9WA 1M2EA 2E4XA 3EZ9A 3O4RA 3MJSA 5L9AA 1C4XA 3CURA 2K87A 4E4TA 2I7CA 2VWQA 2OC4A 2W6JA 4JCOA 4X44A 1UM9B 1GCIA 4DIEA 5CT5A 4DA8A 5MGNA 2BCEA 1QS0A 2VUHB 2V7EA 3CZPA 4MGIR 3FLEA 2FEAA 3MMNA 3W8EA 4NBSA 1Z8NA 2FLVA 4EG0A 1C1XB 4C88A 3AKDA 3PNQA 3EA5A 4IWYA 4K28A 2DXIA 3H42B 4LXYA 1C7EA 5KNBD 1C7JA 2VRNA 5AFSA 2VHEA 4QTZA 4BQQA 4D82A 3MCZA 3OQNA 2GNAA 5EZ6B 1IQ0A 3NC0C 4U5XA 3V32A 1GU0A 3ZVNA 1SUSA 3B6MA 5C8YA 3DTVB 2XUDA 2NAFA 1YIOA 3JQFC 3OU6A 3M4ZA 3F9RA 3KVNA 2NNLD 5SZHB 2IYNA 1VPLA 1RXUA 1NR5A 3ZJ4A 2UKDA 3D8TA 2GVNA 4AJ2A 2BPOA 3TLJA 2IHTA 1G60A 3G5MA 3K9QO 3KWFA 2BCGY 5GONB 4RV4A 4OHZA 2ENWA 2DH6A 5ICEA 5KTRA 3O95A 1DP4A 3V8RA 3MTDA 4J1TC 1VIYA 5LD2B 2HSZA 2Q9UA 1R5NA 3RYFA 4BVJA 1JBKA 1UJCA 2I2XB 4RHEA 3ZVLA 4CM9D 3MTIA 3FIUA 1TMOA 1ZUD1 4I6GA 4L5AA 1S2OA 1U5BB 3NHSA 4MS4B 4J0DA 3G8CA 4TSKA 4D9GA 1TTPB 1CXZA 4GZ6A 2JKVA 1IBLB 1AZSC 2C61A 2R6FA 3IHTA 1APBA 4ENRA 1WUTA 3PDUA 4RA9A 4ND8A 1TC2A 1XDWA 2FW7A 2QR2A 3BHMA 3NT5A 4TSRA 4DV5B 1X2EA 4WCDA 5FOWA 3N58A 1NFQA 1LY1A 1TCCA 4KN9S 4W1QA 1U7OA 3EJWA 3GNQA 4OU4A 4RBNA 1SHTX 4IDPA 2F9LA 3R2JA 1JVBA 2C1ZA 1QF9A 2A9QA 2D2FA 2ZYAA 1SK8A 4FSDA 5ELLA 5BMVA 1UBLS 1YASA 2NU9B 1I1NA 4JB8A 1M2VB 2WIDA 2OMKA 3PPWA 3ZU6A 3G9TA 3PNLA 1OWPA 4HWPA 5HZHA 1KR2A 2QL5A 2R7NA 4FGJA 5H83A 3CEJA 5CUQA 4US1R 3IMKA 1KXJA 2J3LA 2PKXA 3ZNPA 4I50A 3ROQA 1X1QA 1IN5A 3L06A 4OQYA 4GOOD 4PLGA 3TPZA 4BLPA 1L9KA 2PX8A 3NAQA 3H7AA 3AKZA 5CM9C 4HY3A 1MEEA 1PL8A 2WF8A 3I05A 2F48A 3VPCA 2Y92A 4LMRA 4ZDIA 3L77A 3DQQA 4R2MA 4EF6A 2R7MA 3GGCA 3DAHA 4OK3A 4C5BA 2BSXA 3VC7A 3HXPA 2OY0A 2VDJA 3I6MA 2WNIA 1OX4A 1YO6A 1QP0A 1DMSA 3ZW9A 2DPXA 1WG8A 4L9RA 5DMHA 1IQRA 2BGJA 4MICA 1FXSA 1NBIA 1SC4A 1F8UA 3BMCA 4EY5A 4QHYA 3CE9A 2UYCA 4UAJA 2AI1A 1FUYB 3IESA 2R5NA 1NATA 3OX1A 1NVMB 3ORHA 3H2YA 4DJ5X 1JTFA 3WKEA 3T1YB 3I53A 4WFKA 2JFWA 3SIPA 3KFVA 4WOKA 1VSBA 1CR0A 1ZH0A 3BRCA 4Y9DA 1W0JA 3V8EA 1YBHA 3N2IA 4PWZA 1SVNA 4WW0A 5JXIA 1LF0A 3IQXA 2ZYDA 1MEJA 2BEVA 4PZEA 1XWWA 1MORA 1VCHA 2QP9X 2QU8A 3P5SA 3FTQA 3B1WA 1BKYA 3QNMA 4JQCA 2RDMA 4KXYA 1P0CA 4QDKA 2VDRB 4RK7A 1IG3A 1Q7CA 4QM6A 2I2CA 1VE7A 4MV8A 4UCXA 4RHUA 1W35A 1NSYA 1Y81A 2QI9F 4LRXA 3K5IA 1U0FA 4U7WA 2I7XA 4V0NA 5AJTA 1KU6A 3GJ4A 4QODA 3VPDA 3H8WA 1DTSA 2JAQA 4XDHA 2X0EA 2OYRA 5BRJA 3LHKA 1UMCB 1ZAYA 1F9AA 1A5AB 5JAQA 2IHZA 1U7WA 1Z5OA 1FDIA 1HY3A 5T6MA 4FGSA 5TEVA 3GNTA 3ZX4A 4XLLA 3UAWA 4ZQEA 3VU9A 1LPBB 2DYKA 2WFAA 2V8OA 3AEQA 4QBTA 1J07A 3QX7A 2W2LA 4MWOA 1S2DA 1A2KC 2RJNA 2YHIA 1E4VA 4U7GA 2XWPA 4R1MA 5DGXA 4BMSA 5CLIA 1V6SA 1AK2A 4CKWA 1P5FA 2HEIA 3ZH2A 2SBTA 2XWSA 3GFVA 2SKEA 3EXEA 3KOOA 5EUBA 5IAKA 5I51A 1IFXA 1XZNA 1QCCA 2O06A 2G40A 3DEKA 3LCRA 3LLMA 1AX9A 1M7BA 2ZRCA 1JALA 5IMSA 2AWNA 3ICWA 2X6RA 2C2WA 3JWHA 3BZWA 4FCTA 1GUFA 1M6VB 2A30A 2PEYA 3ZE6A 4OKSA 3ZXUB 5IVDA 3EY4A 3OJLA 1P5RA 4RQTA 4QJ5A 4E15A 2QU7A 1B8VA 4BFSA 5EPOA 1JDSA 2VWGA 3WFJA 3K53A 1GR0A 6REQA 2ZJ4A 2WQ7A 4UNRA 5EAIA 1CJTC 1GUZA 3EVFA 3U16A 1IY2A 4IIJA 2R6HA 4Q7KA 3DLTA 5IN5A 4ZI2A 4PTZA 5BP7A 1W76A 1JI0A 1UPFA 2HZ7A 3NHRA 4DUPA 3PTAA 1XKXA 2LW7A 2I62A 1LRLA 1YJ8A 4HS4A 3QTTA 5LWHA 4ESVA 3GAMA 5AW8A 1DIRA 5I7UA 1XA4A 3ND7A 4MEJA 3DE4X 3JD4A 3WMEA 4BDTA 1CDZA 2O05A 1D8TA 4F5EA 5CA1F 1AQNA 3R8XA 4V0OA 3BKXA 3EQ8A 2XLCA 3MTBA 3N39C 5YASA 4N6OA 4OSPA 3GLRA 4K81B 3LV8A 2EFJA 5E6UB 1ZSNA 2FPOA 2VUIB 4WKNA 2ZRAA 2B20A 3AUYA 3H6KA 5DHSA 2QM7A 1HK7A 1MT0A 1ODKA 1XYYA 2NT3A 3AMVA 2FFQA 3BF7A 3LHDA 4MW0A 1E79D 4XQGA 4XIFA 5FWDA 2NZ8A 3B12A 4K87A 1P45A 3R5FA 1N5LA 1CUBA 1XSEA 2FXIA 2QPLA 1Q0ZA 3NUGA 5FI3A 1FDTA 4F2GA 3KZVA 3X1JA 1EP1B 4S3MA 2ZB8A 5JZSA 1I8TA 3LVFO 4KHPB 3PF8A 3WL4A 2GCPA 3QMMA 3PZBA 4BASA 2OM6A 2P1DA 5DBGA 3CUYA 1PW5A 1UEJA 2PUHA 2ZIUB 4OGGA 1BWSA 4P08A 5ENVA 1PU2A 1ZXBA 4XEUA 1RAEA 2UZ1B 1DX6A 2RHTA 3CZ4A 2DBQA 3SC2B 4CRWB 1O6BA 4D45A 4IIEA 2O14A 1D6MA 2OHIA 3S28A 1D6SA 5KSWB 3OEYA 4FR5A 3RUFA 4R0VA 4ZT5A 3T35A 1W5AA 4G5RA 5LQMA 1B6SA 4PX9A 3BIWA 4NMWA 3T7JA 3T94A 2IITA 3AHGA 5EUQB 5JBIA 1CY2A 2QYHA 4GD3Q 1R9MA 1JNYA 5A5EA 4EPTA 1ESDA 2QTCA 4PVCA 1EWKA 1J99A 4K6CA 3GFFA 1WXWA 1A97A 2BVNA 1Q91A 5GIOE 1V1MA 2BDUA 2ZSAA 2B4TO 1AS3A 2DE0X 3IILA 4M1YA 4QIHA 5K3FA 3VI3B 3BGIA 2P6OA 1FDOA 4O1HA 5CG1A 1ZM4A 3KSRA 3FYTA 3DWGA 5HPYB 2D1SA 3SHFA 1CKEA 1K7FB 1MB3A 1PZXA 3IUBA 2AUMA 3VV3A 3K5HA 3L1KA 5BQOA 4KUHA 3UYKA 1B8OA 3FCAA 1CZNA 1KGSA 1RPTA 2CNWA 1NJSA 4RZQA 1KJZA 1UT5A 3GRKA 1HKUA 1DQYA 3DFUA 3EA0A 1WL8A 5LQCA 4NTZA 1BOFA 3G8YA 3ZQ4A 5FBVB 5GJCA 4MI6A 3PK0A 4WGGA 1T8PA 3IB3A 5IZCA 4KVFA 5ALJA 3PU6A 4Q4AB 2CK3A 3A4NA 2IKSA 3Q3JB 4HS9A 4MA4A 1JJIA 2ZATA 1KR5A 2JASA 5DF1A 1N33B 2IQIA 3NAMA 2LE0A 1W4ZA 4ZHQF 3P0HA 1MO6A 4C4TA 5IBRA 4LGYA 2FX5A 3OZIA 4AF6A 1VMDA 3HR4A 3R24A 4LBWA 1JFVA 2OORC 4BGVA 4BO1A 3HB5X 3ZWNA 4C78A 5JJKA 4A8JB 3IKTA 3NGXA 4LZAA 3U0VA 1A4UA 3RD5A 1DX4A 3Q8XB 1PEYA 4E12A 3TRHA 1F2DA 3KE8A 3DF9A 2P69A 3HJUA 3HVJA 3COZA 5CH5A 1HOXA 3BD7A 3CFYA 3KD3A 2FDXA 4NOKA 1V1RA 4CM4A 4AJ1A 4BEBA 4M54A 4FFVA 4HNGA 3OM8A 3HUFA 5I5GA 5K8LA 4YJDA 5IT0A 3OC6A 3T12A 2GEFA 2PPLA 1USIA 2V7XA 5I9SA 3DS8A 3RREA 3SYKA 5HKKA 2OORA 3GJXC 4P0TA 4DQLA 3BWBA 3G85A 3ISJA 2QX6A 3PJGA 2KYRA 3BB1A 3B5JA 3D6AA 5CM8B 5FT9A 3U4MA 1JDJA 5AIBA 5LDGA 4RQBA 4FONA 5EJ9A 3ZQKA 4PRLA 1DINA 3VAZA 3CW9A 2DOKA 2W2PA 2WLSA 5CRIA 4E5SA 1ISMA 3PWZA 5ALOA 3SE0A 5K0TA 1L5LA 4G25A 1AGNA 2ALJA 3RNOA 5FBQB 1G5PA 3G8BA 3R3SA 4AWAA 4E13A 2A5LA 1GPJA 1BNCA 1Z6ZA 5FPHA 2WT4A 2E6UX 3S44A 2ZAYA 3RU2A 1XZPA 4QECA 3INTA 4E5VA 2M1XA 2O4CA 2Z2KA 4HBGA 4KPFC 1XZMA 4B4KA 3LX6A 3HWRA 3J80A 1W44A 4MGYR 1YGPA 1YQGA 1XXHB 2AC7A 1JPJA 2Q8NA 1J06A 3AUSA 3SJZA 2Z6UA 1YJQA 2QVLA 4FTWA 3VSEA 4D4JA 3B20A 3H1BA 4HAIA 5EJ5A 3DSRA 5BN4B 2QUIA 1F4PA 2J31A 3RO7A 2EVWX 4HPXB 2IZ7A 2IYRA 1GT91 3KZCA 2E4ZA 4U2KA 1GL3A 1G17A 1XK7A 3EXHB 4UHFA 3KL2A 1TD9A 3AM4A 4MRAA 4KPYA 4LXUA 1LBEA 3PF9A 2IFTA 1PDVA 4HGQA 3TXXA 3JWIA 1RACA 1GDDA 3PHJA 5KYVA 3ZVRA 4HQNA 1EFRD 2ZIXA 1EJ0A 2XITA 5F3RA 5C46F 3AR9A 3SX4A 3VBEA 1JPUA 5EQFA 3UJHA 3GVIA 4DCSA 1XLTC 3FMIA 4RLQA 5K3AA 4MZDA 2Y0EA 3JYNA 2MWMA 4LE2A 4TVKA 2C84A 4ZP1A 3BL6A 4Z6KA 4L0DA 1IAQA 2DAPA 2IP1A 5FJJA 2Z8XA 4CFSA 1BC5A 1T9KA 2RGCA 4UCFA 3V1UA 5FWNA 1Y1KE 3FRHA 4RADA 4IZ6A 4QL3A 4DBVO 3K6JA 1Z17A 2Y1OA 4HFMA 4JDPA 4L51A 4Y9UA 3T9AA 4E31A 4DA6A 4JC5A 4RPJA 1WB9A 4O4JB 1E7YA 4B09A 4DR2B 3O7MA 3ABOB 3K35A 2WU3A 5F64A 4E3ZA 4KAXA 4EENA 1UXOA 2BD0A 4DCMA 4YASA 2EC5A 2ZB3A 1Z5PA 1PNRA 1B76A 1G7RA 4GM0A 4EL0A 1HT2E 1C30A 2JCGA 1PT9A 3Q5EA 5F7JA 1KQNA 3KJEA 3DM5A 3GRYA 4G5FA 1TLFA 2QQ5A 4D4KA 4QG3A 1DIAA 2CFCA 3D5TA 5BV7A 5FWYB 4Q3AA 1LSJA 2KLHA 2Z2YA 4Q1CA 1FS6A 5BQ3A 3IHKA 4LE0A 1B2LA 4HNVA 2C5EA 2R48A 3UGJA 3OZEA 9LDTA 1T9HA 4EG3A 1C50A 3ZY6A 2W43A 1CR4A 1SKYB 3I9JA 4WESA 5KNBA 5JAMA 4K1LA 5T4BA 1SC6A 3FDZA 3FETA 1Z2EA 2IEIA 2VRBA 3BWEA 3CLUD 4K03A 1S8FA 2ZEJA 4NULA 1CUGA 4RO0A 3NKLA 1DRJA 4KRYA 3GOQA 1G2PA 3REOA 2OCBA 3E15A 3F8TA 4EA8A 5K6AC 4JUBA 5B6PA 3IQFA 5BSMA 2DFNA 3KNZA 1YB6A 2GPBA 4UM9D 3TUZC 4JQYA 3ZWVA 5CFZA 3H4VA 4YRMA 2NT4A 4FN4A 1FPQA 1TK2A 5C5CA 4EPVA 3MJRA 3AKCA 2JIDA 1FRFS 1FYEA 3QG1A 2BFBA 1AGYA 2ECPA 2WUWE 4MI3A 5SY4A 3LCUA 4RUKA 1PZEA 1AUOA 2X8JA 1XZAA 3H2JA 4CM9A 5LXTA 2HV9A 5K20A 2V6JA 5D5QA 1L4FA 3SJAA 1NI4A 1T0JB 1F17A 1JLLA 2HA0A 2XVAA 4RK6A 3TBKA 3OHMA 2IY7A 4AC9A 4ND2A 2RC6A 1B3BA 4IEIA 3ZNOA 3DLCA 3I30X 4MXDA 1N0VC 3EG9B 1HM5A 1JFSA 3GRUA 3G17A 3KOWA 3EZ6A 1GSIA 3GFBA 5ER9A 2IH5A 2YXEA 4EABA 4K6GA 2QL6A 4F7WA 1GFWA 4V3BA 2JVJA 3HSKA 2FW6A 2I4LA 2D0DA 2JD2A 1U8ZA 2FWAA 2XMQA 3M4XA 4KL8S 1ZBQA 4N1AA 1F5NA 1A9PA 2Y0PA 3H2ZA 3JWJA 1T8YA 2BR5A 4BO9A 4IHAA 4RHXA 3CBGA 1HFJA 1NZFA 2GEUA 2NW6A 2XT0A 3HWWA 3R5KA 4M9XA 5EE1A 4ZXFA 5M04A 1CDEA 2AF4C 2VT3A 4NMHA 4OP1A 5HG0A 5AW5A 4ONEA 3BQNB 4TYMA 4KMMA 2NPIA 1I4EB 2K7ZA 3A36A 5IKOA 1M34A 1OLSB 2DWQA 8ATCA 1XDZA 4S04A 4OH1A 3UMRA 3TUJC 1ZJ6A 1I2AA 4Z7NB 3TKYA 3KPJA 1TCAA 4CKEA 2JI9A 1L7VC 3B1JA 3PYXA 1L7OA 1AKQA 3QFCA 4HAXA 1PFYA 4R3NA 4H77A 2V7VA 3DZHA 1HO3A 3MHTA 2HCBA 3RC8A 4QUHA 1NW8A 3Q41A 4TXHA 3TTYA 1A7UA 1NU6A 3IPYA 4P84A 1WSAA 3AZQA 4G67A 5BNIA 4PG7A 3N7AA 3OP4A 4OD0A 3KSAC 2QSYA 3H99A 3B6JA 4TYYA 4M55A 1K6IA 4RDCA 3TTVA 2Q28A 4MUJA 2EP5A 3OF3A 3UICA 1WVGA 3TJMA 1T13A 1WMFA 4ZT3A 5JCZA 5ALEA 5KNBH 1TJ5A 2L19A 5C3UA 3T4UA 2C4HA 3CINA 3GT3A 3MGCA 1PVVA 2GCIA 1NL3A 2H18A 2OHHA 1G20B 1SRQA 2CBGA 2VG8A 3ESCA 3GVCA 1QB8A 2G09A 3H5LA 3COJA 4AUEA 4ARIA 2O3QA 3RSCA 4U63A 3A8TA 4D56A 1F0PA 1P1CA 4A0SA 4B6JA 5TMBA 2IY9A 4E14A 2O2JA 4L4UA 4IV5A 4JLVA 3F9IA 4PHTA 2DLCX 3HB4X 2AN5A 4A1OA 1P33A 3N74A 1RQGA 1P72A 2ZQZA 3I1IA 2J08A 3CLTC 4TTQA 5IYZF 5JFGA 2C29D 1KSFX 3PD1A 4L2IB 1Z22A 5FV4A 2UZ0A 4KXWA 4Y2XA 2EBHX 1EGAA 2SCUA 3ZBPA 4MGKR 3L7BA 2FF7A 4TZ6A 4K2AA 3FAZA 4ML3A 1CVRA 3O26A 1U1CA 4LYYA 3WLJA 1REQB 1V5GA 2F59A 5SYAA 4TXNA 3U7FB 2ASVA 2A4MA 1GN9A 3SDBA 3VYUB 5TMEA 4V39A 4UNNA 1E9RA 2FJPA 4I9NA 3LBNA 1XTVA 4KRFA 2QXTA 3DBRB 2JFYA 5HRCA 4LISA 3OC0A 2PUTA 1W93A 3TNDA 3TPFA 3TWOA 1ZC3A 3H5IA 2I8AA 3PHBE 1OT5A 3D4IA 4TTAA 4X1YA 1MG0A 4K05A 5IAEA 2VBFA 1ZR4A 4ZYXA 5CFRA 4KG7A 3BAFA 2Z04A 3OZVA 1ZLXA 2QRVA 4B6PA 4IOKA 5J2TF 3N6VA 5TY0A 1WR8A 1FFGA 3PPXA 1HZJA 3MJFA 4O6VA 1WXDA 5CLFA 4QXMA 3ILYA 3KEGA 1HG1A 3NJ4A 4IHJB 5ALPA 1Z25A 5I4CA 2OLEA 2YJGA 3QPUA 1DCKA 3FCCA 4I2NA 4WVLA 3AHIA 2HIHA 4MWCA 4O25A 3KOYA 1W1IA 4BNKA 4DKXA 5I7FA 1P19A 1X92A 2GFHA 4D43A 4XSGA 2IS6A 1MB4A 2DUJA 3OIVA 4ITRC 3ZJUA 4ZC1A 1WUIS 3KKZA 2HKIA 3BHNA 3USCS 1KFKB 2WUGA 1BXGB 4QU9A 4C6TB 4XGRA 1Y1QA 1NPYA 1LLFA 2GRJA 2VHYA 5A3RA 3ST7A 5CAEB 1VL2A 2W2MA 1NXSA 2QLMA 4II7A 2D7DA 4N48A 4ZI7F 4OP3A 1ENZA 2Q8PA 4TGLA 1GGJA 4HJRA 4OHRA 3QELB 3D2AA 2RHDA 3FBGA 4XX0A 3IA7A 4EA6A 1QGYA 1UPBA 1GNPA 4ZOLB 3I34X 1RI2A 4MR7B 2R44A 5EJ6A 3GEBA 1NSTA 2OILA 3FDXA 5IUNC 5ADHA 3I45A 5TQJA 1GZHB 2FB9A 4HEQA 3ZG6A 1G6Q1 1QOZA 1RBQA 1TZCA 4PQGA 4KHZA 2FSPA 4YUVA 4ZZ3A 1L1EA 4LGCA 1QTQA 5AM4A 3LRXA 4P3KA 4R71A 4OJYA 4UC0A 3HB1A 2YASA 2C9YA 3S2FA 1U9ZA 4N5LA 1XZCA 4QPNA 2OD2A 4CM7A 3GDHA 4QGGA 1HE4A 1RT9A 3U7QB 4QU0A 4KFUA 2X0RA 3BKWA 4QELA 1TEZA 3M70A 4CEIB 3H05A 1P1FA 1WQ4A 2GM3A 1ZX1A 2GTIA 4ND7A 2B1GA 2BFDB 4XYLA 5L6LB 1RXWA 3I04A 4OL0A 3RGWS 5K8CA 1OT3A 4B76A 3S27A 2VZLA 1D6NA 1LGYA 3LSYA 3VR1A 4PBRA 1Z0UA 2ORED 1RWXA 3OIYA 4TLMB 3RYHB 4GSYA 4UARA 4N0EA 4DNXA 1F2UA 3TPCA 4MW4A 3QVMA 3KEQA 2VPZA 6PFKA 4UD6A 1YS4A 4BAZA 1HMPA 3C8ZA 1BN6A 2ASEA 1J0XO 1OFTA 1UDXA 4DLUA 2PH1A 3WL8A 3ZTTA 2X23A 4FW8A 5BYKA 2C00A 2XOKA 1DDGA 2Q1SA 2J3QA 3ZHTA 4F9GA 3VTFA 5LMUB 1T5IA 3FOBA 4X84A 3W8NA 2NIPA 1RYNA 3QVGA 3WA6A 3BD9A 1JQJC 2EYUA 3OICA 3PNSA 1GITA 4LRQA 4IIBA 2DUNA 1ULHA 2ZI7A 3VKFA 5CA1A 1F12A 1IY8A 3EEQA 5AVUA 1TM5E 2OEPA 1UBNA 2GARA 3OEHD 4PAGA 3RVBA 1CNMA 1W4BA 2F8MA 3WQHA 3F90A 4KK4A 1SU4A 2YR0A 4JZYA 4QFMA 2CNNA 1B93A 1G3RA 4KO1S 1J2RA 1BW9A 3NBFA 1YC5A 2C99A 2PUBA 1E5XA 2XB4A 1JZQA 3X1WA 1Y4ZA 3K0AA 1N34B 4AYWA 1UMDA 2J6HA 1YR9A 1V5WA 2GM9A 3Q72A 1CETA 4N0DA 1KI6A 1OROA 2JCSA 2VHTA 3T4PA 3TCKA 3UK6A 5DFAA 1OXTA 1KVQA 2FVXA 2W7TA 5J5CA 3SM9A 4RVSA 4RAOA 3TKLA 2GBFA 4LBVA 1ZYUA 2JNWA 3PRJA 2WIAA 2POCA 5IKXA 1HL3A 4BPBA 3WLNA 2VDQB 1GNSA 1HGXA 1AHNA 3HYSA 2O3JA 1GZUA 1J00A 2FGJA 2WD7A 5C32A 3KCQA 3R0IA 4ETNA 2R25B 1XJQA 1GG2A 2CUZA 2PSFA 4MW6A 3T99A 2PSEA 4FYHA 1EFLA 3RJZA 1AKMA 4Z9XA 1JXQA 3EFEA 2XOXA 3L9WA 3RI3A 5AKZA 3RHZA 3PDJA 3PLRA 1A76A 2FA9A 4JV5B 1XTZA 1R12A 1WZUA 2GN4A 2REQB 3MG9A 5JISA 4D8XA 3V8QA 2R1UA 3G13A 4EECA 4LPSA 2RE8A 1S2NA 2WSYB 3MWEB 1LTQA 5JS2A 3L4JA 3JQCA 1T15A 5AI0A 4YAGA 4WZAE 4BL5A 1O4WA 5FORA 1J49A 3E0QA 3IUEA 4G37A 4R8RA 3WYGA 3JQGA 3IKLA 5JIBA 4ME6A 3AF3A 1CF4A 3P97A 2ET6A 5TV2A 2D0OB 2XKBA 2GFQA 1WULS 4OBWA 3ASUA 3PFNA 3B3JA 2IPMA 2YXBA 4UKDA 5IZ4A 1XEWX 3JQBC 3L6BA 2WFZA 4ND3A 5D87A 2NPFA 4BO5A 4FDUA 3CRVA 3U40A 1MKYA 5A4AA 1ZEJA 4Z2YA 5B7NA 2ZZMA 2FQYA 3GRZA 1UP7A 1M1YE 5I9MA 2IV3A 2QNIA 3TD9A 1XRQA 2ERCA 2ZRDA 3UOWA 2VXCA 1KRHA 3H16A 1TEHA 3UB4A 3G68A 1FQOA 1GA4A 4L6IA 4ZK6A 1FSGA 1MDFA 1J8DA 2GNPA 5A5DA 2FRVA 4I5GA 4QOIA 1WDWB 3DVAA 2XYVA 3FPAA 4ZHQA 3WAGA 1V11A 3LXRA 4DVJA 5BORA 5JJCA 3TSZA 5BOSA 2HRDA 1AXGA 2GEDA 4KWHA 5TR9A 4BXOA 4PONA 4H7IA 4L4RA 3N8IA 4FFMA 4IJUA 4IJ5A 4G0NA 3F4BA 1NQTA 1PLKA 5CB4F 1WKBA 4OLBA 1IWBB 3TJRA 3ZBTA 3G5UA 2ZU0C 5G02A 1Q1BA 3W0LB 4H6PA 1U2QA 5CCEA 3WYCA 4Q3BA 2J48A 2QE7A 4YS6A 1IEQA 5BYAA 1KYTA 3S70A 3FCXA 1JIKA 1EFRA 3O21A 3GRAA 4AKSA 2GRAA 2WYWA 1JT9A 1P2BA 1ZVJA 3PITA 3C3EA 4Q7MB 3R9KA 4ENQA 4HVLA 2FRXA 3UB3A 1LVGA 2GD1O 3ECAA 4RESA 3KZOA 5DTEA 1SHJA 1V9LA 3C5CA 1X1RA 1RWMA 3QUBA 1YS7A 4QNNA 4HQ6A 3TXAA 4JQSA 5G0TA 1PSWA 3ZJVA 1AT1A 2R3SA 4C4OA 1R4AA 2ODQA 2X3YA 1BDHA 4H0CA 4EY7A 1E60A 3BXEA 3H11A 3OIWA 3OE7D 3Q2IA 1U3CA 1TKCA 4S1OA 5FB3A 2O54A 1F14A 2VTVA 3ZK8A 4KBGA 1MFPA 3R3WA 2GEVA 4JEUA 3FM9A 4RIFA 4CLHA 4DUGD 1P75A 3G59A 3IMCA 3UMSA 3AM3A 4IS2A 1U8UA 2G9RA 4G5YA 2AW3A 5D5PA 3FPJA 2JHFA 5DYGA 3U80A 5B1EA 1ZGJA 3JASB 2GN1A 4QO7A 1RKBA 1EB8A 4WY2A 5AKYA 1BCSA 1HKHA 2VSFA 1DJPA 4REMA 5FR2A 4CIYA 3V8MA 4KREA 4TLEA 3EC7A 1UOEA 3G0DA 4CQLA 3PFCA 4B82A 3FF4A 4OP2A 2I6TA 1LRJA 4GXRA 3NWBA 1C7RA 4H1TA 1Z2OX 1Q0QA 2G63A 3PXDA 4LY3A 3PUWA 3F3YA 4LHWA 1DTWB 4E0BA 1YQXA 2IHNA 2ZSJA 3UT5B 3I42A 3NASA 4UZSA 3EXAA 4IUYA 2E82A 5JATA 3ITEA 3C3AA 1ATIA 3UKOA 3GLGB 3AHEA 4MMZB 3WLMA 3CRW1 5A06A 1JECA 2FWMX 2FG7C 4EKIA 5LDDC 1WZNA 3RFVA 3IOCA 2ANBA 1OC2A 1Z6GA 1EDDA 1IJFA 1J8VA 3RLIA 7AT1A 4CEHA 2BMFA 3TTUA 1KYZA 3RSLA 5EMNA 1IBRA 1FVFA 1JPNA 1GA6A 1WU8A 2Z9DA 2JCBA 1G63A 1E2IA 1Q6ZA 1QVVA 1ZA2A 4EB8A 1HTTA 1GFSA 2JFFA 1KKMA 3D6VA 3GIDA 1KSHA 4XW2A 1O95A 2QW1A 4WTOA 2IDMA 1T5LA 3GJ3A 3FUCA 4G8CA 1GTMA 1PJZA 1QX4A 3OMLA 4OBBA 1CY1A 4TXLA 5CR9A 5KX5F 4IDHA 2J67A 1OAKA 2EZUA 5A6SA 3L7DA 5ALSA 1TM1E 4D46A 3QOFA 1L8AA 5JLJA 4RD1A 5DZSA 4DJEC 1YGYA 3BFJA 2XNDD 4FEEA 3N2KB 4DPKA 1AS2A 3JD3A 3U31A 1KEKA 2JJMA 4DMCA 2FZWA 1JHPA 2CXTA 3OQIA 3RARA 4C08A 4AG5A 2WIKA 2YS7A 3TLMA 4Y9RA 4NHEA 2O8DB 3ZWDA 2QJTA 3QEAZ 1OXKB 2XXAB 3LK7A 3T1OA 5T67A 3OESA 4EHIA 5JPDA 3OOEA 3GDFA 2D8MA 4DT1A 2YBEA 1NMQA 2VCYA 3DEAA 3MELA 4TRNA 1MB0A 5FNVF 3ZU3A 4LFBB 3OY7A 5JRJA 4C01A 2HM7A 2CNOA 2XYRA 3CJRA 1SXJB 2GAJA 5ETJA 5H4GA 5CFNA 2R5WA 3VSAA 3WLPA 3FVQA 4ARZB 2BE7A 3KPYA 5CEFA 2RBGA 3LQYA 1SU7A 5EY5B 4EJSC 3WYNA 3EUEA 2PCJA 1ZGAA 2WF5A 3GEDA 4XM1A 2LZ0A 1NT2A 2ZE6A 3V9AA 4ARUA 3SQNA 3DAYA 4BNFA 3GG2A 5A5FA 8LDHA 2PGIA 3F4LA 4AJLA 1TKRA 3C48A 5FBKA 2CLOB 4Z1MA 5DASA 3P52A 4QOSA 1B00A 3DOFA 1CE8A 4OIFA 2OWEA 3L8CA 2OFFA 1PT7A 3EZYA 3A32A 1TJ3A 5K6RA 3KK0A 1M5RA 3VVCA 5FI1B 4AO7A 5GJWC 1KI9A 3VYTB 2VPIA 2DTXA 1F6DA 1TXGA 5JC1A 2OB2A 4HUQB 4NU0A 4XCVA 1QFSA 4U1RA 3FN4A 4GO1A 5D51S 2H1FA 4Q4HB 3ZUPA 5IEJA 2B2NA 1QQ5A 4KXFB 2F1JA 2OXIA 2BMJA 1WO8A 1B74A 4IDGA 1QQTA 1H8HD 1R9JA 2I87A 3QXHA 5E7JA 5HFAA 5KYXB 3ONDA 2J9FA 3UJCA 5JJBA 1C1YA 1XRPA 5DLDA 3SIXA 2Y9MB 8GPBA 2HF7A 1XT6A 2VKTA 3IIEA 1YB4A 3MRXA 3DUWA 2XD4A 4GFDA 3MTQA 4O2BF 5JNTA 3I83A 5CFOA 1C7QA 2HMWA 3JAKB 3PEFA 4HQFA 1AY0A 3MGKA 5GM2A 3WWYA 2D5IA 1OF1A 1FLVA 2GAAA 3BCUA 3COPA 3FTEA 4LDRA 1C0LA 1KRWA 1T6XA 1R3DA 1TVEA 2NV0A 4JEIA 4OKNA 1Z29A 5BT8A 5F3WB 1OLUB 3DR3A 3GBPA 4QM7A 4LYHA 2RGEA 1K2WA 3S2IA 4AJKA 1DHRA 3AJ8A 3BTUA 1GEGA 3Q7TA 1SD5A 1Q1EA 4IDAA 1AOXA 1CQWA 2RGNC 4C6HA 3N70A 4XDYA 1NBME 1I7QB 2F00A 4MRMA 3O8RA 1ODCA 2JGKA 3BCSA 4EP1A 3EZLA 3HJBA 4KQWA 4JAVC 1GPH1 4RFLA 1E2JA 1QE0A 2IGTA 3I2KA 3TIVA 3OTQA 4GWLA 4ND1A 3UAOA 2W42A 4BLTA 5GVSA 1Z47A 5JCOC 3PE4A 1NF3A 4MVXA 7REQB 3K6RA 1VP9A 1PS8A 1Y1RA 1UK9A 5JO9A 4U3JA 3HJAA 4K9OA 1E32A 2XRYA 4XUCA 5LBTA 2KE5A 5CXQA 1HX7A 1FFEA 2O8EB 3GJRA 5A5VA 1LKZA 4MV7A 4R5HA 3R3XA 4CVNA 2C8KA 1KVTA 1LBQA 2NZYA 5BN3B 3VNSA 1U8CB 5EQTA 3GPLA 2YVUA 1KYIA 2CXHA 2I2FA 1SUDA 1Z6YA 2AFVA 1P60A 4W7HA 4AKEA 5JXWA 4B6QA 2O8CA 5K01A 4IIVA 2Y1XA 4IDCA 1DQPA 4ZT6A 1Y48E 1XPJA 3ZE7A 4P1ZA 3WGLA 1HNXB 4Z5XA 5DNCA 2JHAA 1ZI6A 1JDBB 1W6RA 3OIFA 3VU3A 1RRFA 1WKCA 3NBMA 4NYMR 1DJNA 2GHIA 5EIHA 4RJIA 4HNAB 3KE9A 2PBFA 3BBLA 3JATB 4FW9A 2COKA 4RZUA 3VSDA 5JJLA 3BMXA 1ZJ4A 3DONA 1ZIXA 1UZUA 3H4IA 4JP3A 3HPRA 5AXDA 4D9HA 4QYSA 1P4RA 4ZVUA 2WB2A 4FFOA 3O82A 2FUEA 2JFVA 3M8KA 2BKLA 4DCUA 4E09A 3QPCA 5JNUA 2LPMA 1S7GA 1GDHA 1U0EA 3C98A 4Y0VA 3ZBUA 3RAGA 1PR3A 2LDXA 3SLKA 1GGMA 1F3OA 3H5TA 4GYJA 4TWAA 2NUPA 4OGLA 3SHVA 3N59A 3FFWA 4GKKB 4Y3UA 3I9NA 4AK9A 2FMXA 2O8BB 2KBEA 2E5FA 1I1QB 2AOUB 1RNLA 5K3OA 3HCEA 3U5TA 1TADA 5LP6C 2VK8A 1KWGA 1TVKB 4JYAB 2CD7A 3IIJA 1O6FA 4M6WB 4UEKA 4GOJA 5IYZA 4I08A 1NHGA 4A9AA 3IEMA 2OBFA 4NPHA 2PLAA 2PXHA 2WJYA 2HN9A 3EDQA 3PI7A 1WCWA 3E1SA 4JVNA 4O2AB 4RK5A 3T3EA 4F5ZA 5L7WA 2FSSA 1Z26A 5H16A 2NU6A 5JADA 3ID6C 1KDZA 3LRPA 1P2FA 1VHJA 3DYIA 4C7KA 2C59A 3CPHA 1W5FA 3JPYA 3OVMA 4P33A 1K5DA 2EBWA 4PLTA 4RY0A 2QSUA 4UASA 5ESWA 6LDHA 5LUBA 1GARA 2G5TA 3ABQB 3ZHCA 3R7SA 4D44A 2OCGA 3WWOA 1EEXB 3ZLVA 3THYB 5FFNA 2I7DA 4EW1A 5ADVA 1R4MA 1G21E 3L4SO 3NBYC 2Y0DA 1PFWA 3L8YA 1ISHA 1X7YA 3UGQA 4HVTA 2E3JA 3CJTA 2LKDA 4K9DA 1XP5A 5J2TA 1W94A 2H0RA 1RI1A 2GCOA 3G9XA 1JMYA 3EXFA 3QKRB 4J8PA 5DBOA 5B7GA 1CR1A 1JHVA 3GXBA 4GLFA 4GW3A 3PZRA 1J09A 3VDMA 5HKBA 3ACCA 3H5RA 4FYXA 4URHA 4YX9A 2O5VA 1EX9A 4H4EA 4MVWA 4RJKA 1RE0A 2BE9A 4KFSA 4B35A 2E1PA 3K0HA 3W2TA 3ZV6A 1ZOSA 6NULA 5ULLA 2W6NA 5DSZA 2XCTB 1A2QA 1ECCA 1SQ6A 5BW6B 1E8DA 2EJTA 2XIQA 3FI0A 4G5SA 5EWJA 5FL7D 5B1DA 5TVGA 3F98A 1ELOA 1UWKA 1L1FA 4A7PA 3UV6A 5CT6A 3OX4A 1UFVA 2WPNA 3Q10A 1QHSA 2X77A 3OEHA 3UHPA 5JH7B 3T7KA 3EIUA 4BC1A 4ZI7A 4X8LA 4G6ZA 4LMBA 2ODBA 3WIOA 1FYWA 5BSFA 1GLNA 1JGTA 3COVA 4M7WA 1YVRA 1RHKA 2YHBA 4MQFA 4MRRA 4XM0A 4G0MA 4HAWA 2C2OA 3BGOS 4IAOA 4HRAA 4Z7JA 1I1HA 1YBFA 5DV9A 3AJRA 2ZJ0A 3HY6A 4P8RA 3KLBA 3B48A 5DXJA 5A5GA 1LK5A 1UT6A 4HB2A 5K8UA 3L6OO 3IOMA 5I4BA 5L40A 2QBYA 4BVHA 2C5SA 1Z4JA 5EVJA 1CZOA 1HRKA 2AOTB 3PJFA 4FINA 1DBQA 4G9EA 2B69A 2C5BA 2EQ5A 2H11A 1G1AA 3SXJA 3TX2A 3HEBA 1DXOA 3D3JA 3EMKA 3O1HB 1A9ZA 2PS3A 4HOYA 4BUCA 4AMYA 3GUVA 3UGTA 4WLFA 3C97A 3S2UA 4IGEA 2WJPA 1NJ6A 2QY6A 3FJYA 1UBEA 4LI3X 3MD0A 2R1ZA 5KOIA 3JU3A 3N0RA 3ASVA 2E48A 2I1WA 3C7CB 2FN7A 1SIUA 2CDBA 3OD1A 3PI6A 4ZVRA 2JLCA 2D2EA 2PMBA 4KQEA 3UWSA 3ETJA 3VHXA 5ARCA 1GIAA 1AXEA 2LR0A 1EE2A 2NUBA 2PRIA 1A27A 2FEMA 2ZXFA 5F5NA 1KJ8A 1QORA 1PJSA 1OILA 2LWIA 1R1DA 3BMOB 3PC4A 2GF0A 4S1PA 3SR0A 1K8ZB 1CB0A 5CB8A 1KHTA 1CU1A 1KE2A 3G5TA 4PV7A 3G9ZA 1UMBA 2H48A 3A3KA 4PZ0A 1SK9A 3LO8A 2GLXA 1FSFA 2OOSA 2R4TA 3GJ5A 4H7FA 1U8TA 4JELA 5CNIA 2YOFA 5KCMA 4EKEA 4YBRA 4D9EA 1G18A 2VYCA 1WNFA 1LDGA 2NO1A 2ZIWB 4PU0A 3AI3A 3V2UA 4YUZA 1PV4A 3PC8C 1RD4A 3V7WA 3GGSA 4OB8A 3WTBA 1GZDA 5DLYA 3DTYA 3BMQA 3TQHA 5EJ4A 4JBHA 4FFBB 2WFMA 4R1PA 1NV8A 1L1QA 3CT4A 3VAYA 3GFSA 4JA2A 1D04A 5KOYA 5G0SA 4D0SA 4XWOA 1KMMA 3AF0A 2WAMA 4OPMA 2VTEA 3ELUA 3H2SA 4MLCA 4PQRA 1N3BA 5L8VA 4LRUA 3GLHB 2NYRA 4L73A 5AK6A 1GYQA 2OV6A 2IX9A 1H2XA 1DG9A 3NHMA 821PA 2E5WA 1LNZA 2QYSA 3SZGA 3QVKA 1KF0A 1NPDA 3RHTA 3HG7A 4H2DA 2B6HA 3LYHA 1MNQA 2BAGA 4I1IA 1OA0A 2HA7A 2Y93A 3WRXA 1XEFA 3D6FA 4AZ0A 4GMXA 4DV0B 4TT8A 2WUDA 4A3SA 3QKIA 2VF8A 1TYEB 3KB6A 1Z4KA 1WQ1R 3ROKA 3D7KA 3AU8A 5GGXA 3U3ZA 4X97A 4BLRA 3T3GA 2WHQA 4O4IF 1A9SA 4ENUA 2VNIA 4RJJA 5FTWA 3GRCA 3LW7A 3DNFA 4IJ6A 1R0KA 3FIJA 4WAUA 3T7EA 2F1OA 3ORRA 4JWTA 3SEAA 2R7KA 3DZ8A 2HY7A 2G1UA 2PLWA 1KJNA 3F6CA 1XOIA 3GQBB 2POQX 3S2YA 4QC2A 4CE6A 3B7PA 3BK2A 2X7JA 3F4KA 4Q4JA 4RCYA 1EFDN 1L9XA 4LN1A 2UV8A 1M33A 1NLFA 5JZVA 3VSBA 3IIIA 2WIFA 1HA3A 1M2NA 1OPRA 2QRQA 3E7FA 4PYNA 2BFEB 1LI7A 1MJHA 2H5EA 3ED5A 4KQ9A 1DJLA 1VBMA 1K5PA 2VF4X 1Y8ZA 1G66A 1P4SA 3MS4A 3QF4B 2WVJA 3PEEA 1OWLA 4LXHA 4YQZA 3G5LA 1XTTA 1V8DA 3OQ6A 3OE7A 4HGNA 1DBSA 1RP7A 3KEMA 2HQRA 4MB6A 1MC8A 1TFUA 1NOKA 3FH0A 1YDGA 1G0OA 1ZZEA 2G76A 2J6CA 3TVTA 3VISA 3KTDA 1E64A 1N6OA 1UFOA 4PPGA 1WF3A 1HNNA 4NAUA 4NYIR 1WCIA 3JVIA 4BKUA 1E2DA 1RYDA 1U3DA 1YZKA 1UIRA 3GCDA 4NNJA 1W0CA 3PC6A 2H65A 2D13A 4BC0A 4EBFA 4I1RA 1DG3A 3FHLA 5CDGA 2EHDA 1A9YA 4FX5A 2PANA 3OUZA 4Y2JA 2PT5A 4B40A 4ZAXA 1VMAA 1L5HA 5T6BA 2J4FA 1NN5A 3PUIA 2YHUA 1KYXA 1ZISA 3ACDA 4YCCA 1E2BA 5IP5A 4GI3A 3IAM1 5AYVA 5HK8A 1X1AA 5F33A 1WETA 1X14A 1G9SA 2O8NA 4ENSA 3R09A 3NJRA 1EFTA 3VKGA 1VJTA 4QYWA 2HJ9A 4AWBA 3DE7X 3TIFA 4RACA 1M3SA 2IBSA 2AN3A 4X54A 2HJHA 4M99A 3QVJA 1Z4OA 4UBIA 1Q3TA 2EWVA 1VHQA 1E1DA 4M0FA 3BRSA 3AUXA 1Y8CA 2AZDA 2QB5A 3QBVA 1ZUWA 2R6R1 3VC3A 5C7YA 2F3SA 1TK3A 2QRHA 4OFXA 2IX3A 3K15A 1P0QA 1YCFA 4LCJA 1D2CA 3IPXA 5H82A 4FYYA 4LG1A 4NCHA 5GMOA 3KPWA 1UPAA 2VQ6A 2VSYA 3S5UA 5C5IA 3I2IA 3ZN2A 5GONF 2JVIA 1KS2A 2P2LA 5BW8A 1EWRA 3DNMA 2IXEA 1MFZA 3H1EA 2CYCA 1J9EA 4BJ5A 3K70B 1EGMB 1OGYA 5JMWA 1C9MA 3NWEA 1W4RA 2JGEA 2PX0A 3REFA 1H2AS 3JQRA 3NHFA 4OHCA 1DELA 3RSSA 1Q14A 4A82A 3AEKA 6CHYA 5IK2D 1V37A 4NOMA 1IN4A 3W6PA 3HJFA 1NRJB 1M8KA 4U7HA 4ZOBA 2Z1DA 4BDSA 4A15A 5FLKA 1GTVA 2CD9A 1BHO1 5PGMA 3RS7A 4AM8A 1JDVA 2HCRA 5AVKA 2WILA 4HEHA 4DJFC 5JT1A 3DBLB 1VLMA 2MYTA 3S2ZA 4BKRA 2X9NA 2P9BA 1HNWB 1VLJA 1FZQA 3KG2A 2RHGB 3IT3A 2FTKE 3N8HA 1P1JA 4K9LA 3H9UA 3FUTA 4GVPA 1YHNA 1NWCA 4NL4H 3I4LA 3FWPA 3VR5D 5ITZB 4Q15A 3PJRA 4UM7A 2OM2A 3ICCA 5EA2A 1ZHOA 4YWJA 3HFSA 5BW4A 1NZJA 3N9IA 3W79A 4BWGA 4Z4CA 5JJIA 1ATZA 1YCDA 4X66B 1M6HA 1FF9A 2CMKA 4HQOA 2ORIA 4TPKA 4MW1A 5DSXA 5HOQA 2AMJA 3C2QA 2Q7OE 1OQAA 1VG8A 1MV8A 1JEQA 3P2JA 4NCJA 5CT4A 5T8KC 5FPPA 3ELWA 3RVQA 2H4FA 2WM3A 4G97A 3LYLA 4MS3B 3HDVA 1E6KA 4JQOA 2UYQA 2UYYA 3DTVD 1FNCA 4NEQA 3QLVA 3WRYC 1XELA 2VNJA 2YFHA 3M6XA 2FETA 3L7CA 1A04A 2FW0A 3HR8A 4WZAA 3VSCA 2REXB 3HDGA 1WVMA 1N6IA 2WG2A 2XEDA 2EWWA 3CF6R 4UATA 4EYKA 5KX5A 2OBNA 3DEIA 3ZOKA 3O4GA 4EYOA 1BN7A 5T41A 1DEXA 2X0FA 3OFSA 2W6OA 1SPBS 2A3NA 3TBHA 4C89A 1U7DA 1EB9A 3VJRA 1RJDA 4JT8A 2XKKA 1II8B 4JLDA 3WRYA 4GEGA 1E9BA 1QANA 2CVFA 3DOHA 1N5KA 4BE4A 2QUJA 4ED9A 2IWHA 1OAOA 1CQPA 3E9RA 3FVRA 3ZDBA 2VJKA 3EZNA 4JLKA 4E2WA 1E9DA 1RXYA 3CH5A 3P26A 3SDSA 2BSAA 4FWBA 3UV3A 4F45A 3E35A 1K27A 3R77A 3F7OA 5FNVA 2C98A 3LY5A 2P4SA 4Q39A 4PZYA 4MYHA 2RGRA 1EFKA 1JEYA 3ADPA 3O83A 4I4TB 3GCWA 5A02A 1Z2PX 1VPWA 5AI8A 3LMKA 5FO0A 3HY3A 4YN3A 5IVIA 1JXAA 4NK4A 4HLUC 3HSYA 1I24A 1Z6QA 3EGEA 3M6WA 3PHIA 1X7ZB 4KUEA 3RVJA 2CY0A 4B3FX 2Q6TA 1QYRA 2WSLA 3JYOA 4FR0A 4RJLA 3L9XA 3PDCA 1FP1D 3OQBA 5F77A