1IIBA

Crystal structure of iibcellobiose from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
103
structure length
103
Chain Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYS
publication title The structure of an energy-coupling protein from bacteria, IIBcellobiose, reveals similarity to eukaryotic protein tyrosine phosphatases.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iibA00
2B1JA 4YRZA 3IDOA 1EWVA 5TQ0B 1LK0A 4EVQA 5GOTA 1KGSA 2E4XA 5EWLB 4XFKA 3HK2A 4RWEA 4MQFA 3HS3A 2FN9A 3EQ2A 3NBMA 1ZITA 5TQ2A 3GRCA 5KQMA 2JBAB 1YS6A 1NXXA 4G0ZA 5IUNC 2KYRA 4GPAA 1DCMA 1D1PA 3ILHA 4W5OA 5JS1A 4YLEA 4D6YA 1IIBA 4LRQA 1FQWA 3IP9A 1BDJA 4RS3A 4NICA 2FTKE 3N8IA 1KRWA 1D2AA 4Z4IA 1JL3A 5HSGA 2FW0A 3Q41A 2NUBA 3KLNA 1YTUA 3F73A 2WB4A 2RJOA 5BRJA 4KREA 2HSGA 3JS5A 4F11A 4FB4A 1DRJA 4KK3A 3M9WA 2R48A 2IOYA 4S04A 4ZMSA 4MS4A 4RSMA 4L4UA 3L49A 4EVRA 3CHYA 3T38A 1Z26A 4EVSA 3JY6A 1ZVVA 5B3JC 3CG0A 1I3CA 4LE2A 1JWLA 2JRLA 2QR3A 3HV2A 3N75A 3N53A 1KMIY 3RVLA 4YV7A 1RZRA 2FEPA 1TVMA 3MQ4A 4Z0NA 5TE9A 4LE0A 5DGCA 4YGXB 3RVRA 2O20A 3KCNA 1P6UA 1QKKA 4G97A 2PMCA 3CG4A 1DBPA 4LDZA 2ZAYA 4MLDA 2M98A 3CTPA 4PEVA 3CLKA 3Q7SA 1VLZA 3TMYA 2PUEA 2IDMA 2FQXA 3OMWA 1DJMA 5DTEA 1PHRA 4MQEB 4OATA 5EWMA 1L5ZA 2QZJA 3RVPA 3H1FA 4G86A 4ZPJA 3ROFA 1D1QA 1TM2A 4EGSA 3F7NA 1JYFA 3K4HA 5FWYB 3QEMA 3CZCA 4OBBA 4Z99A 2IPNA 4JP1A 4IMIB 2JVKA 3SAJA 1NXPA 1K68A 5ABPA 3K9CA 1LJUA 3OLVA 2GI4A 3O2QB 4TMYA 3TO5A 1YK1A 2VUIB 4TLMB 1JH9A 4LZLA 5JNRA 3KS9A 3I45A 5IULC 2GWRA 3CRNA 3O2SB 5CNKA 2Q5CA 4D74A 4EYGA 1Z16A 1MB3A 2FN8A 4EYQA 1EAYA 3IP6A 3TB6A 3F6PA 5C5CA 1GUDA 2PLNA 3CKMA 4MPTA 4MS1A 1S8NA 3BREA 3ILYA 1JF8A 4Y9TA 3JPWA 3O1HB 3KYIB 5GQSA 5KQPA 1A2OA 2PUBA 2HJ9A 2ID7A 4Z9BA 4RK4A 5EWJB 2GKGA 1CEYA 4XXHA 1ZH2A 1DZ3A 3OLYA 2QU7A 1PUXA 4YCSA 3LUCA 3LFTA 9ABPA 2TMYA 1FFWA 4IF4A 3H5TA 3EODA 4G0YA 2WY2D 4FE4A 4RKQA 5JNWA 1AB5A 1ABEA 3OQNA 5JNVA 4ZYLA 5TPZD 3MF4A 4LE1A 1ZDMA 3E61A 2JVJA 3H5LA 3LKVA 3O21A 3HJFA 1NXWA 5E3JA 2M1ZA 1M5TA 4PE5B 1BA2A 3HDVA 1ISRA 1XHFA 1NXOA 1EWTA 3Q15C 3HO1A 3UK0A 1Z12A 3TX6A 5KWSA 2FVYA 1YMUA 1CYEA 5BQ3A 4W5NA 1U04A 2L18A 3QX8A 4N47A 1JFTA 1J56A 5BR1A 3IP7A 1FFGA 3Q7TA 1ZGGA 4Q6BA 3B2NA 2B4AA 2XDYA 4JB0A 2NZUG 3N6VA 5TPWB 1A0OA 1DBQA 3I09A 3KTOA 2IYNA 1AB6A 3N0WA 4RKRA 4WXEA 5KI6A 1USKA 1EFAA 4WT7A 2MYTA 2LIVA 3OQOA 1E6MA 2JB9A 1B00A 3HUUA 5PNTA 1ZHHA 3H5OA 4LDAA 4MR8B 4QYWA 5I4CA 2FSPA 3OLXA 2QW1A 3LKBA 3BRQA 2CD7A 4NCAA 1U2QA 1WETA 1RXIA 4MR9A 4TN5A 1QO0D 1XWWA 5DCLA 3A10A 3HXMA 1YVUA 1URPA 2E4UA 4H3KB 5CNIA 4MQFB 2R47A 1ZESA 3KLOA 5TQ2B 3LUKA 8ABPA 5T7BA 3KG2A 1W9HA 2YHBA 4YS6A 1Z2EA 1CHNA 4KRFA 2L17A 4G0MA 3A0UA 1NY5A 1R8JA 5HM6A 3FFTA 1SRRA 1P8AA 4QICA 2GX6A 3JVIA 3F6CA 2W42A 4ZJPA 1P6QA 3P9YA 1C0EA 4KFCA 1VPWA 2FLKA 3OLZA 1F51E 3URMA 1JLKA 1K66A 1VRVA 3CS3A 3OMXA 4RY8A 3RVJA 1JBEA 2PUCA 1M2EA 4O5AA 3ROTA 3QLUC 3H1GA 1H9CA 4IGAA 1QP4A 2NT4A 2FKAA 4FE7A 1A04A 4MS4B 1F4VA 2WRZA 4RK1A 2FQYA 3MA0A 4Q7EA 3QLVA 3C6QA 4IRXA 2I6FA 3JVDA 3A0RB 4MS3A 1APBA 1DCFA 2JVIA 2RDMA 2PL1A 1Z18A 4KNYA 4F3TA 4N0PA 1LJLA 1GUBA 1OXBB 1YIOA 1YK0A 2PKXA 2WJWA 3QELA 5JS2A 3O2JA 5IEJA 2FLWA 4D6XA 2J48A 3H6HA 3Q7RA 2MYUA 3LMKA 5EWMB 1SXIA 1JX6A 3BBLA 3DGFC 5KC9A 1BVHA 3I42A 3QLTA 4RK0A 2A9QA 4N03A 4JOQA 4MR7A 2WMYA 3BRSA 3QEMB 4RK7A 2PJUA 2FEWB 4CBVA 1Y1LA 3HZHA 1RZRD 1D5WA 3NNSA 4B09A 1MB0A 3RH0A 5BRAA 1DP4A 4S05A 5JNUA 3EJWA 2MSLA 3HM9A 4ETNA 3OM0A 2PUDA 5KQGA 4MYRA 4EUKA 5C5EA 4YP9A 1FFSA 2CWDA 3JTEA 3OO0A 4RU1A 3C3WA 5KC8A 2FXIA 2L19A 2A9RA 2IKSA 2QSJA 3E3MA 3IPAA 4XLTA 4YR7A 4L85A 1NTRA 4W5RA 1U2PA 4RV5A 1TMYA 3L6UA 2P9HA 4HYEA 3DGEC 4QPJC 1TLFA 2PUGA 4KMRA 4Z4HA 1L5YA 4LX8A 1NATA 1DG9A 1E6LA 4MS1B 1T34A 5FWXA 2IPLA 4MRMA 3QX9A 2P4UA 3RVQA 2FMFA 5ED4A 4Z4FA 3CZ5A 2R4QA 1NXTA 5DLEA 1Z2DA 1EHCA 3SY8A 1ZH4A 3H1EA 2HQOA 1DC8A 3RVOA 3JPYA 4XASA 3GV0A 2DRIA 3SNKA 3DLHA 1Z13A 4KPYA 1Z25A 3H6GA 1ZAYA 4UHJA 1YMVA 1DC7A 4N76A 2FMHA 3OM1A 3QEKA 4PYRA 2MYNA 2E4VA 4Z4GA 4NQRA 4IMJB 2QV0A 1QP7A 1QQBA 4EYKA 1M2FA 1JYEA 4QYMA 4HNSA 1SXGA 3EULA 2ID9A 2VUHB 4JA2A 1ZN2A 3CNBA 3KJXA 2PUFA 2PUAA 5B3JA 2RJNA 3MMNA 2HPHA 4RXUA 2FMKA 1JDPA 4YO7A 1PNTA 2E4YA 3LUJA 1MVOA 1U8TA 2E4WA 3NHMA 3HUTA 3R0JA 5TQJA 4F8JA 1QQAA 4G0QA 3NHZA 5IEBA 4F06A 3UKJA 3HVRA 3D8UA 4P1ZA 2WWVD 3UUGA 4WWHA 2F8SA 5FBHA 4KV7A 5TQ0A 1DBWA 1NXSA 3C97A 5EWLA 2MYPA 2CHEA 3RQIA 2AYXA 7ABPA 3RVNA 4G0XA 1RXEA 1FSPA 2FMIA 1UDRA 2WJAA 5DKFA 4MR9B 2JBAA 2F8TA 1KRXA 2HQRA 2BGGA 1USIA 2NT3A 1XHEA 4W5TA 3QK7A 3DZDA 3FMVA 1SD5A 5IX8A 4H3HB 3FFWA 3CFYA 2LUOA 1P2FA 5HQJA 4RZSA 4M88A 1USGA 5IUJC 4RK5A 3DLBA 2HQBA 3HDGA 3HEBA 1ZY2A 1GCGA 3GBVA 3IP5A 3T8YA 1QPZA 4WZZA 1MIHA 4DN6A 4F12A 1PNRA 4RXMA 4MGEA 3SM9A 3HSYA 2VYCA 1C4WA 2ZWMA 3O74A 4H60A 3LUAA 3M9XA 3RVKA 4MLCA 3N0RA 3C3KA 4RY0A 4OLBA 4NV3A 4G0PA 4XAQA 2MSKA 3DBIA 3MM4A 3GL9A 1QP0A 4W5QA 3MYYA 3GBPA 2AYZA 1TJYA 4MS3B 3C3MA 1PEAA 3M6MD 4KVFA 2PL9A 3RVMA 4ML3A 1W25A 2QVGA 3EQZA 4YWHA 3RVSA 3I5AA 4OG2A 4DADA 4JB2A 1DRKA 3CU5A 4MQEA 1ZGZA 3KHTA 3QELB 4P98A 2N9UA 3HCWA 2JK1A 3NNDA 2VK2A 4Z4CA 1JFVA 1E2BA 4EYOA 2RGYA 3MIZA 5FWYA 3A3KA 3LUFA 1QNLA 4RY9A 3T6KA 4G0OA 3GT7A 2E4ZA 3OLWA 3EAFA 4MR7B 1RNLA 4ETMA 3LOPA 1Z15A 2LBPA 4RXTA 4O1IA 2OENG 1DCKA 3H75A 3BILA 3GA5A 2YHAA 2R25B 4O1HA 4HNQA 2PAFA 4GNRA 5IC5A 3D02A 1NXVA 4Z4EA 4KQCA 3O75A 4WXMA 1M5UA 3LTEA 5CHYA 5TPZA 2H3HA 4XARA 4WUTA 3G1WA 4IILA 3NNNA 4UHKA 5CNMA 1MAVA 3SG0A 4TLLB 3LUDA 1RPJA 3G85A 5F64A 1ABFA 5T3YA 1Z17A 3T95A 3H5IA 5FWXB 1LBHA 3S99A 4NCBA 1LBIA 4MRMB 4RK6A 3OO1A 1GCAA 4KK4A 3QLVC 5EWJA 3SQNA 3FDFA 4N0QA 4ETIA 1GLGA 3KYJB 4KQ9A 3IPCA 3VNAA 4KZKA 1JHZA 2OQRA 3O1IC 3VNBA 4OLAA 2FEKA 1JFSA 3LUHA 4E7OA 3OQMA 2JCGA 5JNSA 1QMPA 3W9SA 2GBPA 4E7PA 3EGCA 3H5VA 4PICA 4N41A 4OTZA 4EY3A 2CHFA 3O1JC 2FQWA 2NZVG 1D4ZA 1U0SY 1BAPA 1SXHA 1VKRA 3GWGA 2LP4Y 4Z9AA 2V0NA 4JASB 5KQLA 3GYBA 3Q9SA 3FGZA 3N0XA 2IPMA 5CNJA 2L2QA 5FBKA 4DQDA 2MSWA 3KKEA 3QLUA 1QO0A 4Q6WA 2H0AA 4RDCA 5IBQA 6CHYA 2PE5A 3KSMA 4MAAA 1YS7A 2X7XA 5JNTA 5TPWA 2A9OA 6ABPA 1E6KA 3TD9A 4PZ0A 1BDHA 4HNRA 5HKOA 1ISSA 2IPAB 5IUKC 1BDIA 3EDCA 1PEYA 2QXYA 1HEYA 3H5WA 2QVCA 5D2CA 4ZMRA 2LPMA 3FFXA 3LUGA 4MR8A 1JDNA 1OXKB 2A9PA 1EWKA 4JAVC
chains in the Genus database with same CATH superfamily
2KHZA 3DFZA 2RONA 4RPLA 3IV7A 1IH8A 3LPCA 3WKEA 4NBUA 2WR8A 2X8JA 5FOVA 1OX4B 4R84A 1DAGA 2ISCA 4HLDA 3PHHA 3I1JA 5D3QA 1H8EA 5JVDA 2Q4TA 3EQ2A 1NLFA 3THOA 1GDTA 1IHDA 4BNHA 3I9MA 4W6ZA 1DWQA 1Z68A 2RAPA 4H08A 4PZPA 2C82A 4QPDA 5J43A 4C06A 3BFKA 3GGJA 4AROA 5GONB 3B85A 3KOXA 3OA0A 1V9CA 3X0DA 1P77A 4HVLA 1AXEA 5EXDA 4ND4A 3P0IA 1Y3FE 1XZHA 2FXVA 4LRQA 4MQ4A 1I4EB 2VSYA 2SBTA 2J30A 2WV9A 3FNGA 3ELUA 4RS3A 4TQGA 3HA3A 1TK9A 1Q0HA 2XQKA 5FLKA 1WDLA 4TMKA 2PANA 5KOJA 1N9GB 3D64A 3VZCA 4MA0A 3G0HA 2M6RA 3DMFA 2I3DA 3HCBA 4GP6A 4ESHA 2Q5QA 1NZDA 1U1DA 2WG0A 3DAYA 3WQQA 3CVWA 5GVRA 6NULA 1UWVA 1HDYA 4OYYA 4PNPA 2PGJA 2R5FA 2ZUSA 2W2PA 3BIWA 1P3DA 5I9TA 2WC1A 5GTDA 1S02A 2GBCA 2QRVB 1WMEA 2ZYGA 5EQDA 5JFGA 1N2XA 3ZNOA 1L4HA 5TMDA 5BW5A 4HDNB 2OE2A 3LRXA 1O6ZA 2PNJA 3L8DA 4DR4B 2JK0A 1JHDA 5IK2A 1Z37A 2DKFA 3JALB 3GQBA 3WSWA 4CG3A 1KKMA 1DBPA 2GVZC 4N9WA 1FIUA 2G77B 1YI1A 1IZ9A 1IEQA 3HYCA 1XXHE 3Q7SA 1K6EA 4JC0A 2IDMA 1OYWA 2I6SA 4EBFA 2BHLA 2ZJOA 3CXUA 1A8QA 1SPXA 1P4SA 4MGIR 3NHYA 1G1AA 4IY1A 3UHOA 5IN4A 2HF8A 1FJHA 3AILA 3EGXB 3LSYA 1M3SA 3BFPA 1KK3A 2BEVB 3QVVA 1F4PA 4G86A 1V8PA 1Y5MA 3K0HA 4Y2UA 4AY3A 5CDFA 4I19A 3HNOA 1EJ0A 2Y92A 3D8BA 3A2LA 1QRSA 3BWMA 3RUHA 5L6LB 5DN6D 1NXPA 2VTVA 3M83A 2GZSA 2PZGA 4GZLA 1G8JA 4IDCA 3WL7A 1GGMA 5F2EA 1L4LA 3TNFA 2EJBA 1PT8A 2YX1A 2IWRA 1YK1A 2A1UA 1MAHA 3UKOA 4LZLA 1J42A 4B75A 2HMTA 2UUBB 5HFNA 1YF3A 1X6VA 1ZA1A 4RZQA 1UDAA 4WNAB 2BONA 5A5FA 5IT4A 1VCOA 4JP3A 4XQGA 2RBEA 1RWQA 2EBUA 1VIVA 4ND5A 5LYJF 4JYZA 2HRDA 3A4VA 3SS8A 4CTOA 1IZ8A 3HU2A 4M8IA 1ZLXA 4PZUA 4RZXA 3L8FA 1OROA 3EH2A 3SVLA 1CY8A 1PR3A 3TE7A 3U3OA 3IQEA 3PFWO 4ITRC 4JMPA 4EAAA 4Y9TA 5CA1F 1OU0A 4RADA 3N8NA 4D25A 2FF5A 4FC7A 3UT0A 2NPOA 1P5HA 3BWXA 3QRWA 4HDSA 4BUZA 4BZPA 1XMOB 4UCWA 3WFZA 5I9BA 3D59A 3IDQA 1SVNA 4OQMA 2VP0A 4WXYB 4XM1A 3R4CA 1GKUB 4PR0A 2EZ4A 1PP4A 1RE1A 1TZCA 2EOAA 3LUCA 3ZHRA 2R4TA 3DHNA 4P84A 2F59A 2OO3A 4GRIA 3CRVA 5JNWA 1OV4A 2ZIVB 2HXYA 4MUMA 2Z2XA 2A6PA 2ZBPA 3F96A 2IYFA 4I4LA 4OHMA 4DWOA 1XN4A 2IELA 3LH5A 3C16C 3GRVA 4GLOA 3Q72A 3RHZA 3SS9X 1NR7A 3T15A 1STOA 1WXEA 2W11A 3O7WA 4DF3A 1YU9A 4KNWA 4URZR 1WUKS 1VDZA 3STVA 5JAPA 3HO1A 2YW9A 1K5PA 1HF3A 2IFTA 4KLCA 1YMUA 1M2GA 2FE4A 1WTCA 5BQ3A 3HL4A 5EMNA 2PWPA 3H7AA 1N2HA 3PC7A 1Z08A 4AZ3A 3U4AA 1M10A 3D8NA 5K4AA 3UMSA 5AKGA 1BXGB 4QUEA 4QRHA 3PRKE 4XUGB 5JBQA 1HT2E 3I2FA 2NZUG 4FGJA 4JJZA 3BD7A 2XADA 3UT5B 4RKRA 2BMVA 2F3PA 1XL1A 1USKA 1JILA 5EJ8A 3ZD7A 4XDGA 4N3AA 3QMWA 4PSVA 1IG0A 4LZNA 2B5WA 2IYOA 2R8OA 3NLLA 1WUHS 3NKLA 3LT1A 1S89A 2PZAA 3WKDA 2A92A 2LV8A 2HHCA 5LQUA 1CUXA 4Z7QB 3UFBA 3JWJA 4LGMA 4A0FA 1WMBA 1C4OA 2GN9A 2EERA 5J2UF 1GAJA 2RBGA 1RP1A 2IIPA 2WINI 1A8UA 2ZSEA 2AF3C 2XDQA 4RLSA 3ZHBA 5L3ZA 5JTTA 1V1MB 5DLDA 1KYWA 2IX9A 3N76A 5B2ZA 5LBTA 4PN7A 1QFYA 2GUWA 5I48A 3KLOA 4BQEA 3P2MA 4G09A 4ZK6A 1NJ5A 1LFDB 4WFKA 1VP9A 2EIXA 3DM9B 4GHWA 5A9TA 2Y1DA 1HLGA 3OZWA 2B34A 3PQ8A 4FONA 2NU9B 1NYTA 2XVAA 5GZ6A 2ATIA 4NL4H 3IR7A 1EINA 5B6IA 4C22A 4R2KA 4GOXA 5CLIA 1C81A 1FNDA 2FZ4A 2IYSA 1SRRA 2XMQA 4X94A 3ZYZA 5A1TA 2QJOA 2Z1DA 4LYAA 3ZHTA 1ZM2A 4Y0AA 1TLLA 3GIDA 3UMJA 5KTMA 2PJZA 3UQYS 1WXHA 3AZPA 2IEZA 4QQKA 4GD3Q 4QFBA 4AW9A 5I7VA 2DLDA 5NULA 4MLPA 4DDVA 4PAMA 5AKXA 2IY7A 3A31A 1Y3DE 2BI4A 4DTCA 2WSMA 5I5GA 4MS4B 3A1EA 3VZSA 1W76A 3LVQE 4P9NA 3I2HA 4C2AA 2VAPA 4M1SA 3VSBA 4WA7A 1ZRHA 3QLVA 3VX3A 3G82C 1LD3A 3WB2A 5ESRA 1FRQA 2JGJA 3QHPA 1C9MA 1I4OA 4O3MA 4YRJA 1C3LA 1CUDA 2GF2A 1H5NA 1LF5A 2QXUA 2R79A 2HF7A 4RZUA 3A36A 3TIXB 1Q77A 2VDUE 1OXBB 3S2FA 3BCRA 1SG0A 1VG0B 3P97A 5K45A 5K3OA 4Y18A 1GLNA 4UD6A 3FSGD 2B35A 3DVQX 3O92A 3ROZA 1F4LA 2G7ZA 5HM8A 4FEGA 3BBLA 1M2VA 2HNBA 2X4GA 5HIMA 1V8BA 1KU6A 5I9IA 4AZ0A 3PE6A 3OPYA 2YYZA 4HFMA 3D3NA 2DZDA 2YNMD 3TR6A 3NWPA 3PSAA 3G5AA 1NQOA 1T1GA 4WXRA 3DC7A 1XVLA 3KQYA 4ZYVA 3TQIA 2DTDA 1Y1LA 3HJAA 3IBSA 5CBKA 1HK7A 1U8AA 1JHRA 3VC3A 5EQTA 2IZ0A 2NO4A 5LU9A 3DWFA 5DI9A 4S05A 4QL3A 4FYWA 1O57A 2O5CA 1WF6A 2P68A 3J7TA 2P40A 2ZSKA 3VR3D 3KQVA 4MVJF 4CM8A 2OV1A 3L84A 1BDBA 1UMDA 3C3WA 1KY4A 4GSYA 2EHDA 2OBMA 3EZNA 4RY2A 3IXMA 5K6AA 3R3YA 4J0HA 1XKTA 5JCOA 4MPJA 4ARCA 4X00A 2XODA 5LZ7A 1W59A 1O5IA 3MPUA 1FUEA 2YWDA 4RD0A 5SY4A 4DUZB 1EU1A 1MHPA 3R0QA 4JSRA 4ZRNA 1J21A 3VO1A 3RASA 3QX9A 4GM4A 3OX2A 5FB3A 4EJ6A 2DFLA 1SO8A 4XCVA 2RKBA 1JIKA 1M6EX 5AKIA 1HYEA 1IXZA 1OWNA 3BMNA 3CZMA 2B9VA 2BBTA 3H1EA 3A58B 4WK2B 4P7GA 5HEKA 2X19A 1FVFA 3QEJA 4YVFA 1KDPA 3O8BA 5BMVF 2C4NA 5CITA 1ESNA 4QD3A 2Q3FA 1E9BA 2EFEB 1MJ5A 1IWPB 2P1DA 2PGAA 3V42A 4BMCA 4PZAA 2QZPA 3ZU2A 5CCXA 2ECFA 5L3SB 1XE3A 2VQ6A 1YMVA 5CEFA 2F1IA 1TE2A 3FPLA 3L1JA 3MJHA 1L5LA 2ODTX 1ESCA 4KQKA 2JANA 4FMDB 3SR3A 4AUNA 3QEAZ 1D2GA 1IZYA 4JR2A 4C7VA 2W2QA 2V6GA 4YJ2F 3HB7A 3GFPA 4OMUA 3HHPA 5D1NA 5EHXA 4OP1A 1RCTE 3L1KA 4PYNA 4HNUA 3ZDCA 1R8QA 1HM5A 5CXSA 5F9MA 1OYOA 3BG5A 4GO1A 1U3CA 2MU1A 2MSNA 1EFRD 4PLGA 5HF9A 1SUCA 4MW5A 1K4YA 4HQFA 1FVXA 3NHMA 4A0QA 2TMGA 2ADMA 5E2AA 3KFLA 3JASA 1WU7A 3OJLA 2X8AA 3FNIA 4UNSA 1Y98A 2LRHA 5IEBA 4BKMA 5C1BA 5HZMA 4ZKEA 4DCCA 1ADCA 1ZNXA 3GUHA 3Q8WA 1LH0A 3AL2A 4IIVA 1QHEA 3PQ4A 1YI0A 3QWAA 4DLYA 2JW5A 2OV3A 5EFOA 4RCYA 1UPXA 3DV9A 4J91A 3LWDA 4MW0A 3TEFA 2WTAA 1TQ4A 5I9LA 2FMIA 4OIFA 5DKFA 4O2AA 2JBAA 1RR6A 1NMZA 1SVLA 2PKCA 1DT5A 5CR9A 3LY9A 3MFQA 4DLRA 2HB6A 4ZC8A 1F6DA 2JAPA 1U6KA 2OBXA 3AW9A 1LKZA 2Y0CA 3FRJA 1TW3A 3GFVA 4JB8A 4P5EA 4CKEA 3UAYA 3LLCA 1QQ5A 2D5AA 4HEA1 2Y77A 1NBAA 1V26A 3UYKA 1MEJA 3ZEIA 5C3UA 4PIVA 4ZVRA 1QB7A 1UXKA 4BLUA 1YH3A 3BZBA 4RK5A 3DLBA 4ZZ0A 2FLVA 3ASYA 3ZDQA 2ZIZA 3VU9B 4MKXA 1YZVA 3FH0A 3H3FA 1U28C 2H92A 1IY1A 3BIXA 2XYRA 5GJBA 2XZPA 4DNQA 1I7LA 1KZYC 2OAGA 3JAWB 4JFRA 4DSNA 2FZCA 2WQ6A 3V8PA 1X1AA 1SQ5A 2R66A 3JQFC 2HWKA 4OXXA 4RM2A 1BS1A 1GEEA 4WN9A 4ND1A 3QXGA 1P4GA 2G5GX 2VH5R 1XU4A 4ACAA 1CWUA 1W0KA 1Y5RA 4OLBA 2ZIFA 1QP0A 1O95D 2ZT8A 4KCGA 3WL8A 2AOTB 2IW1A 2JHCA 3MYYA 4N7MA 2O0JA 1WDKA 1WJGA 3FHJA 4G5FA 3VDQA 1PEAA 1KZ4A 1U3FA 1JDUA 1UKVY 3MNFA 5H0IA 2V98A 3UJ7A 2Q28A 2RGCA 4W7IA 3E5MA 5AVUA 2HWUA 4OFXA 1JKJB 3M1AA 4MGZR 4MQEA 1XEFA 1KI9A 16PKA 2EP8A 2QWXA 1ZMRA 3FXAA 4HP8A 5K2MA 3LVRE 4DARA 2ZQ5A 4RACA 3KOZA 5FBQB 2FAXA 1JIIA 1U8FO 3ESBA 3Q3HA 2F17A 2WUFA 5D86A 1QKIA 2YYYA 4RY9A 3BSYA 4YCBA 4AO8A 4TYYA 4J1TC 4Q9LA 5KSWB 2HCTA 3QG5A 5K6RA 1YFKA 1RJ9A 1TK2A 5BOSA 4GECA 4R81A 3DC2A 4DQUA 4U7HA 4ETMA 4FKMA 5LLSA 1R0RE 3IQDB 4PHGA 2OENG 2Q2WA 2HF9A 4KQ6A 1T0UA 3K70B 1IUKA 2IP1A 2X2FA 4BGVA 4DJTA 2R25B 2NZWA 1OLUB 1YKGA 3HC7A 5IC5A 2ECOA 1YQ9A 2J5XA 3DQZA 3GFSA 4YCMA 3NHFA 1WMAA 1TCBA 2W8ZA 2VJKA 3P9RA 3PHLA 1DC3A 3VO9A 3W5BA 4Z4EA 3PHJA 4OJNA 1Y1TA 5AHRA 2P2CA 3GX1A 4C78A 3C5HA 2JATA 3EGWA 3K9GA 1Z6GA 4D8UA 1HYGA 4DRYA 2CDCA 3H84A 5CLLA 1NJ6A 1QNFA 1C3EA 4IILA 1T43A 5CX1B 4BBJA 1BXKA 2IWHA 4X97A 3DVLA 2J0EA 1U7ZA 1YZUA 3ZY4A 1NPDA 4BDSA 1MIOA 2C7BA 2AMFA 1ZJJA 2JIQA 2PU7A 5FR2A 3UHPA 3Q3VA 2ALJA 1SR8A 2Q3DA 4LOIA 4B6GA 5CXQA 5ALPA 1I24A 1IEVA 1T3HA 3T54A 1ODFA 1SJ9A 4J8PA 3WAKA 4JA0A 2XYHA 1I1HA 1MC8A 2PPLA 1M33A 3VNAA 3O1IC 1A9QA 2H16A 4FGZA 4FT2A 4JLUA 4LGCA 3C7KA 4IXTA 2C4HA 2N47A 1XD2A 3G8BA 3OF2A 4JJAA 3ZWAA 4DILA 2GBPA 2PH1A 4I1RA 4PICA 5CDTA 3OHSX 3PYXA 5JH7B 1UKCA 2P8SA 5EMKA 3TR5A 4KLRA 4OXIA 2ORED 1V4VA 1XXHA 2R00C 1GCIA 3IMCA 4GVXA 4MRVA 3WZMA 2V0NA 4JHLA 5E1BA 1SC4A 1X1BA 4C7KA 4DW8A 4I4NA 3AP3A 1EFCA 3ZI0A 4NG4A 2QLLA 3ZHVA 2O3SA 4ZDJA 1B1AA 6CHYA 3I9NA 1C2TA 2XA9A 4W8GA 1JKMA 1X42A 4RE6A 3OF3A 2G4VA 3ICOA 4UXHA 4CF5A 1E6KA 3ROPA 2PLWA 1FU7A 2NSLA 1YA6A 2SNIE 4DIOA 1UMBB 3EDCA 5LQSA 4JP2A 4KVGA 1Y0BA 3UUWA 2BGIA 3QVLA 4HDMA 3I30X 4D26A 5JD5A 2A9PA 5BPFA 4ZU3A 4RTSA 1C3OA 1T36B 2ZSUA 4QBIA 1J99A 3E9CA 5T4HA 1T25A 2VWHA 2Y93A 4TKVB 3VXKA 1C5KA 5EWLB 5A4JA 4HNVA 3AU9A 3Q3JB 3RRMA 4E5MA 5LDHA 4KX5A 3HK2A 1D07A 4UASA 2R7KA 1PGOA 2GCEA 2RBKA 3GPIA 3E8MA 2OC9A 5KDLA 3VC2A 2D2IA 4E33A 4K6HA 1E2EA 1Y8ZA 1WMFA 2DT8A 3PR3A 4OGFA 3UCEA 2YQ4A 4JUFA 3VR5A 5BUSA 5GY7A 2BBSA 5CCDA 1BC5A 3GJ8A 1HKUA 2ECKA 1XKLA 2ZGVA 2FF7A 3P8ZA 1DCMA 1J9GA 2EFCB 3C8MA 3MK31 3VNRA 2G9RA 2YXDA 5AK3A 3TXYA 4B8YA 4C0BA 3RC8A 2BP7A 3BXHA 5EIAA 4HLQB 2CYCA 3N8IA 5DHAA 4LHYA 3T7AA 4ZZIA 4C7JA 3PJRA 3BGVA 2QAGB 3ESQA 4GT1A 2DR0A 3D8SA 2RK3A 3ETDA 3ID6C 1NFQA 5DTRA 5KSYA 3PPXA 3HV0A 2Q27A 1PGNA 2CJXA 2ZSFA 5HP4A 5IABA 2P3LA 2ZULA 5FTKA 4EHLA 4HVCA 5KYUB 2GM4A 3W8FA 1F0YA 1J7KA 1G8HA 1P5JA 4BUCA 3I4LA 3FPSA 4ZO4A 3W3ZB 4RSMA 2PUHA 1T3SA 2PTHA 2TMKA 3MYRA 1B0UA 3BTOA 3K0CC 3ANSA 1MB2A 1GU0A 1MO6A 4RD4A 4W82A 2V65A 1TUBB 4TXJA 2JAXA 4NS1A 1PWHA 2P75A 1RYMA 3S4YA 4B2PA 4BC1A 4CIBA 3RIHA 3LGAA 1V16B 4LSWA 3ZC3A 3NIWA 2I1LA 3T52A 4DBVO 1PG5A 2ODEA 3HWSA 3IPLA 4UOZA 5KDOA 4BQSA 5INTA 3GFFA 1YRQA 3TF5A 3D7RA 1Q0LA 5DTEA 4EEKA 4Z6KA 1XVAA 2HXGA 3ZWPA 3P9KA 4KGVA 1W30A 2ZR9A 1Q3HA 2VJAA 1LS6A 3SXUA 3JW8A 3TLXA 1V96A 4LPSA 1N2EA 1W0JA 1Q12A 1CHDA 2K4MA 2QW8A 5DRYA 4IKPA 4Q05A 2B7BA 3JQ7A 1RHUA 4ARAA 2WHYA 4JKIA 5ES4B 1NP7A 3L7CA 1FTYA 2FEOA 3RK1A 4D4KA 3FLBA 3FCSB 5E6UA 3NUGA 4H6XA 1YVRA 3C39A 3NM6B 5A3JA 3AEQA 4WCFA 5FUWA 1WAMA 5HOEA 1JJVA 1UZAA 4BRWA 4JJ4A 2UUPA 1V43A 2H1LA 2JGEA 1TQ6A 5IWCA 2GWRA 2ZIEA 4KNVA 1FDUA 2Q5CA 3HVJA 4F8EA 5CPBA 4DCJA 4TLEA 3AHHA 3TR0A 1PVVA 2LKCA 1EAYA 2ZG6A 4UTRA 2XR1A 4TPKA 3QW4B 5FWAA 2O2IA 2HK6A 4LWPA 3ENWA 3MWGA 4F4HA 1Y7LA 4IIFA 3WIUA 5AW1A 4C21A 3BL6A 3AR9A 3S2YA 1RXYA 5T57A 4AZSA 3HCPA 3C24A 4NECA 5GAJA 3Q6IA 5HA5A 5LA6B 1ULHA 1EUDB 1GA4A 1BKDR 3C8HA 4XJTA 3WBFA 2FW6A 3ZIUA 3ZLBA 4DCOA 2AZMA 1WPGA 2GKGA 4RKYA 3NBQA 4EG8A 3HO8A 1UPAA 1MVLA 5F7OA 1TU4A 1TA0A 3FF4A 2HJHA 4DLVA 2F4NA 1Y3HA 3GVCA 4Y1RA 1OAOC 2O2GA 4RTOA 4Y2QA 1AB5A 5DNCA 2C00A 2WT8A 1J0BA 3AY7A 1ZDMA 1HQKA 3QBEA 3SLKA 1PLJA 2PX0A 1Y7PA 3UANA 1NI3A 1EBBA 4H6WA 4JYAB 2OWEA 5H16A 1EWTA 4NYJQ 3D43A 3NDJA 5AHOA 4B1FA 1HT0A 2I2XB 2J0UB 2UZ1A 2GDJA 3CX6A 4NCHA 4W5NA 1FUYB 2A58A 2IHBA 5DMXA 4CFSA 4DGQA 2WD7B 4UVIA 1YRHA 3JYLA 3P2IA 5DZSA 3D7KA 4KBYA 4M53A 3R7LA 3RAJA 3I52A 2AE2A 3KAPA 3PG5A 4WBNF 1PLLA 1VSTA 4O4LB 1JJAA 2HHJA 4NU5A 3HXPA 4WESA 3GEIA 1AB6A 3PGJA 3PS9A 1NMXA 2C7OA 5AP9A 5C1IA 5CLJA 2FZ5A 3L05A 2XUHA 5BN3A 4WCVA 3TQRA 1B00A 4MXDA 1PDWA 2VZ9A 5TJ9A 2QVYX 3K09C 2PGDA 2Y6UA 2ZRKA 4UBOA 1U99A 4QYWA 3JQQA 1KMCA 3LY8A 5JCJA 1HLFA 2OD9A 4QO7A 5F52A 1O96A 4OHUA 2P6NA 4HAYA 5FD8A 4I3HA 3U5ZB 3EQ9A 2HIAA 1RYDA 4PX5A 3SP1A 1ZESA 1FXSA 2ODQA 2YTZA 3HABA 3N28A 4ENVA 2CFSA 3USZA 5T7BA 3C7DB 2PHZA 4HGOA 4JLSA 4O08A 3FUWA 4YS6A 4DLKA 1ONSA 1U2ZA 1KVTA 4FOPA 1LVGA 3OIFA 4LECA 3LX5A 3KFVA 5G2OA 4AIIA 3GAAA 4J2HA 4ITVA 1YBMA 3PX3A 3ROQA 4WKGA 2HEIA 3HA7A 5ITVA 1QFSA 1G9SA 1G59A 2H5EA 2F62A 4II7A 4TMZA 4HDAA 4I0WB 4KH0A 4X92A 1VPWA 1KA9H 1OXTA 3PTZA 4RYLA 5JIBA 5L4LA 4RMHA 1ZI8A 2Q2OA 3EEIA 4MI6A 2FH5B 3OLQA 4EJ0A 2OHIA 2VWPA 3BMCA 4M76B 1E7SA 5KNDH 4NE7A 3RYHB 3AVOA 1N8TA 4MVJD 4HKTA 4IWNA 4E5DA 2RG1A 1H2EA 1H9AA 1NW5A 3FWYA 5KSOA 1SKAA 3VO8A 4CMJA 1NONA 4U7PB 3VJMA 2AT1A 3I62A 4A0GA 3PGLA 2C4TA 2CE7A 2VJYA 3CMCO 4JUAA 3CLSD 5TNXA 2WU0A 1ULTA 4OMCA 3A28A 4KXXA 4PC3A 2W48A 2AJDA 2AXQA 3L0BA 2WJWA 5BSUA 3CLUC 3DV2A 1XMVA 3JD2A 3UXYA 3R44A 4FYPA 4D6XA 3K6SB 3NU1A 4JQSA 3U4GA 1DPGA 3LU1A 4HWRA 4XH9B 1R8SA 1NVVR 5CRIA 2HYDA 3P2EA 5I7WA 3DT9A 5EWMB 1JX6A 4J16C 3JSAA 2C31A 3DCNA 4D8WA 4MITA 4N82A 3BSWA 2P9BA 2B0JA 2BCJQ 2XRFA 3FZEA 1L4MA 1OI2A 2OCIA 1UM9B 2D0PB 2PPVA 3B5IA 2EU8A 4Q3NA 4AJ9A 1PFGA 4CBVA 4IDDA 4N8DA 4YDSA 5M7EA 1D5WA 1TUEA 2IGTA 2NYAA 2Q2QA 4CEIB 3FB4A 1DJOA 1JTEA 1ZGHA 1X7YA 2PO5A 2JZCA 2PY6A 2QN9A 3PQ6A 3HM9A 4BNXA 3HKDB 4MYRA 3GN1A 3DBRB 4BLWA 4X20A 4J1SA 3WO1A 1D1SA 3C4QA 4W5RA 2B3DA 2H2GA 3UO8B 3P0HA 3OPMA 5KX5A 4IW3B 1EFVB 4YUXA 2P69A 2P7IA 4EF5A 5IJZA 5HFJA 4DG9A 3B6IA 2FZKA 4WZBB 3PPYA 3FGNA 3K05A 5EZYF 1FMJA 1ZC3A 3MWYW 3FUCA 4EFKA 2OD2A 5GJWC 5KJEA 3AUSA 4EUFA 3W6PA 4DRXA 4QDTA 3GEMA 4S1PA 2EGUA 2P4UA 4NJMB 1ARZA 2J7PD 3LDAA 1RLIA 3WLOA 1JYSA 1RQPA 1CJMA 3AFNA 3BFXA 3OFNA 4N3BA 4KSBA 1K7YA 5G4LA 3W9YA 3WGOA 2QL5A 4MQ6A 5JJ5A 2XXBA 3PGMA 5DHSA 4BRZA 3IUSA 4OBWA 3AM5A 4CLDA 1L9KA 1TYCA 5ITZB 4RIHA 1L1RA 1X8XA 1YCDA 3HYRA 4TWIA 2CHUA 5K8IA 3DLHA 1Z13A 3VKGA 3RU3A 3T5AA 1EB8A 5BNWA 5CX4A 4QC2A 2XEXA 3DEIA 4UC0A 5FO0A 3ASZA 2MYNA 1T0JB 3DNPA 4G5YA 4ES6A 4MVCA 4OSEA 4B73A 5A04A 3W4JA 1RRFA 1VCHA 5C7IO 2FX3A 2ZSBA 2CMFA 4V39A 4AF8A 2C1XA 1M2FA 4QLOA 4ZOLF 5DNUA 2WYVA 1LC0A 3MQ2A 4D4LA 2GPBA 4EKYA 1O9BA 2WQ7A 4DDWA 3DOUA 1HE2A 1FX0A 1Z2PX 2SKEA 1QX4A 4Q9HA 3WNVA 1BO6A 1WEHA 3MGAA 1VKHA 3TZHA 3DTVD 1EGMB 3WK8A 2FI1A 2C3YA 1MVOA 2VTEA 2XNCA 3MWLA 3QOWA 3R0JA 4HPWA 5TQJA 4DMKA 2GZRA 4JCOA 1UXJA 1FCJA 1WWKA 4UTXA 4V0QA 3WMWA 3AY3A 2JEYA 4N3NA 5C18A 3CRRA 3KQOA 4D4GA 1EUCB 1IRIA 2L82A 3KLBA 3L8MA 4HQNA 4JJKA 2VWGA 3KUCA 4YRIA 4GWLA 1RQ2A 2G9UA 4PVDA 5IYZF 5IAJA 3OEEA 1DBWA 4ND3A 3VR5H 1FDSA 4P92A 3X1XA 1EMDA 1A9TA 1ULAA 2CHEA 4P2GA 3WK7A 1XDDA 3O5AA 3EUFA 5HRCA 2R1TA 4EPTA 3LLVA 4X6XA 5BW4A 2OPHA 5HZKA 4ZQBA 2NTVA 1US8A 2BHNA 4DG5A 1N34B 3C45A 1THZA 5AI9A 3A1FA 1SUAA 4LJRA 1ZVKA 4C0QC 1XHEA 1EDZA 2ZZKA 3OCXA 4WZBE 2Q5OA 3ZCQA 4DBLE 4A5SA 1EKXA 4F3RA 1JS1X 1U0FA 5EP4A 4CM4B 2WPDA 5IMSA 2OILA 1GPBA 1P2FA 1YBFA 1XKQA 2NXJA 2O52A 3MTEA 4RQBA 1FTGA 3TK1A 4AXBA 4BMXA 4RVUA 5LD2B 3EW7A 3AVVA 1CR6A 4MV3A 2BSQA 1XLTA 2OAQ1 3MWDB 621PA 1SBHA 1SBIA 1Z5WA 1A4UA 2DVMA 4UHDA 3QUSA 5I7OA 2X0DA 1SPBS 2JIMA 4BB5A 1PNRA 1VSQA 5F51A 3TJMA 4KP7A 3WSVA 5A0FA 4RIFA 1OLXB 2AG6A 3HWWA 1VHLA 2Z8ZA 4H60A 5CFOA 3WHIA 2ORWA 2ZSJA 3O4IA 4IUCS 3KQTA 3HXOA 1JG6A 3AF3A 2ZAOA 2GMWA 2JD2A 3OEHA 1N0UA 4W5QA 1VL8A 3K4QA 5EQFA 4R7TA 3FI0A 4EK9A 3P2JA 5AI8A 3M6MD 4BLRA 1JIVA 3RLIA 2N75A 4A8JC 3M5CA 1T5OA 3WDKA 2Z5VA 6REQB 1AO3A 2PUVA 1JB9A 2GN2A 2YFQA 4ARSA 2PXAA 2ZKLA 4D6PA 4EX6A 3BXZA 1F60A 3MMZA 5DIFA 1ZGZA 3PE4A 4HTAA 4P98A 1JEYB 3GYGA 2EX4A 3Q8XB 2AJ8A 1EPUA 1XBTA 3NNDA 4Y6OA 3UB3A 2QRNA 1M74A 1P9WA 5T4EA 3T0GA 5JS6A 2EW2A 3O8QB 2E5WA 1U2EA 3LUFA 3B1XA 4HBZA 4AJJA 4UFOA 3LT0A 4YJ3B 1I8TA 2YIVX 4FMPA 1SOWA 5LWHA 3T7SA 4P4SA 3C7TA 2GJ4A 4NARA 2IPXA 4LI3X 1NVUQ 3HP1A 3GJ7A 3OPYI 4NENA 5FA6A 2Y66A 2Q3BA 4I50B 2ATCA 1JJFA 1VKNA 2HM7A 1TT7A 1M1NB 3ZUPA 1CZRA 2AEEA 3DAGA 2O2JA 4IYJA 5LB2A 3D6JA 3TTSA 1R0XA 3VDRA 2VZ8A 4YJKA 3I0MA 3EXIA 5THQA 1I32A 2ZB2A 3IE0A 4L1KA 5FNVF 2QT9A 5LZ4A 3H2HA 4EGFA 4MW4A 4OKNA 5F64A 4DB4A 3QOXA 1WB5A 4NNJA 2VHQA 2W6JA 1EGAA 1GQQA 2ZB3A 4GLJA 2C2GA 2FG5A 3TQCA 3F0TA 4LK2A 4L0CA 3WYNA 4O4JF 3RANA 1H42A 4P80A 3KRTA 4CKXA 4KVZA 1MAWA 2QMZA 1BE1A 1SUIA 3L7OA 2AD1A 3LD9A 2HMVA 1Y7HA 1NKVA 1ZK2A 4EHKA 1SQSA 1AGXA 2JJ1A 4EZIA 3NAZA 2NVBA 4UDYX 4Z2AA 2CBZA 3H87A 2Q5EA 4RHFA 3LY5A 3BDIA 1C30B 1RI2A 1X7XB 2V7UA 3Q12A 3GFBA 1KERA 2PKWA 1M2OB 2PS9A 1Z36A 2XUJA 1LCIA 1OFUA 3HXTA 4PW0A 4IGEA 2D6FA 1NQXA 3AVYA 1SVOA 3QQPA 3GYBA 3BWCA 4P7BA 4IIUA 4KB5A 3EE6A 1B2LA 2VJOA 1CPYA 3NB0A 2QP4A 2H0AA 4KYTA 1RKQA 4W5JA 5DK6A 2VK1A 3EY9A 1P7CA 4R40A 5JXGA 3TZEA 4E70A 4X7MA 1V1RB 2C9CA 4F72A 2CC2A 4DJDC 2A9OA 1E60A 5G4KB 5FPSA 3KQMA 2VQ3A 2X9NA 4D9MA 5BVGA 9LDBA 1PFVA 2JC3A 4K81B 1U7UA 1M75A 5E8JA 3U7QB 3QVUA 3V4FA 1CEEA 1PJSA 3E2PA 3KUKA 3SZ3A 1M1YE 3O4HA 2G71A 1GA1A 4OJQA 2E48A 1SVWA 4FXOA 1A1VA 2VF5X 4B7CA 1YR8A 1O08A 4UPDA 1NBMD 5TQ0B 5SZHB 5BT8A 4U6QA 4UBIA 1KGSA 4L6CA 2DHQA 4MCAA 4EO9A 2JKVA 3H2BA 3O03A 1OZAA 3LS2A 1LXCA 3WRVA 1YIAA 3OTHA 1HRDA 4BFLA 1ZITA 1E1LA 1PJ2A 1WZIA 2FSIA 5CFRA 3HBNA 1TT5A 4O33A 3QFRA 3H9BA 2EW1A 1KO7A 1EFUA 4UCXA 1L5NA 2H51A 2AR7A 4M6WA 1BD3A 1HFKA 4JX8A 4C2UA 1RQLA 5DHTA 2GO1A 4ZANA 3U7FB 3PPVA 3VO2A 1Y3AA 2FTKE 4FR2A 1Y4SA 2GPYA 3ME5A 4XYGA 3GLKA 1E2DA 1KFBB 1W88A 4EMTA 1N7IA 3Q41A 1PV2A 2Q29A 3WHKA 5EJ6A 1P4RA 2QE6A 4S1TA 1ISMA 3VYTB 3T1YB 3Q88A 4AJNA 3WMGA 3LCJA 4NULA 1A72A 4CTKA 4O4HF 2Q07A 4I66A 3ZVKA 5DNWA 2O8CA 2DQYA 1LLQA 4TWRA 1AGYA 3RCBA 4ZI7B 1ZGCA 1NGSA 2VAXA 2JLYA 4QGBA 5D1HA 3UV7A 2I4TA 1F2VA 4EVRA 1N2CE 4W99A 1ZK4A 1RRGA 4YJDA 1GKKA 4LNUB 2Y27A 3QMVA 4HUQA 4LE2A 3HV2A 4DPMA 3K4PA 2ECPA 3GDWA 3HXQA 4CKCB 2ZIXB 4HX2A 4P6VF 5FJIA 3WYBA 2ZJBA 1Z33A 1UMCB 2C7GA 4UATA 2IS2A 2IPOA 1P74A 2E49A 2QL7A 4AMVA 4DMLA 1Z7WA 2X58A 5IJ0A 1ADFA 4I4TB 4HZUA 1TZBA 1MC5A 2ZTUA 1L4BA 1MBZA 3VOBA 5JT1A 1JEJA 4F4DA 5KU7A 2I6GA 2KLHA 1FE8A 1L5ZA 2FX2A 5DBGA 2YV2A 4CIXA 2JIZA 4ZPJA 4XKJA 3SBOA 1TM2A 3SBXA 4ENQA 1VJRA 3D6TB 1HI9A 1JYFA 2D4HA 3QEMA 1KXJA 2B0CA 4PX9A 2XUIA 2LD4A 3ONFA 3A3PA 4UJ3A 4J90A 1W48A 1M67A 4TRJA 2ZDQA 1ZOIA 4DSUA 4JL5A 2OXFA 3K8OE 4ZC1A 1CVIA 1HSZA 1RYBA 2A30A 2OZPA 5ICCA 2GI4A 4AJEA 4WLEA 1FDVA 5DBEX 4A16A 2AHOA 1C7ZA 4QQRA 4ZRMA 5IC4A 5JNRA 2CKMA 2PZFA 5FHQA 5C7LO 3CKLA 1ZMBA 4LOKA 5KWVA 3ZWYA 3E5RA 4WERA 3HKEB 2FPPA 1OU4A 2WU1A 4YJGA 1Z07A 5BXYA 1YZQA 3ENZA 4TV9A 1JWBB 2QTZA 4XRRA 3KKMA 2PA3A 4BO3A 4GRAA 3DWGA 3R7DA 2O3UA 1D0VA 2KW5A 3QOFA 3SHFA 4AICA 1YFZA 4QGAA 3U4MA 5BQPA 4WY8A 2RAFA 3ZS8A 1D9ZA 1QTRA 1WW2A 4A8TA 1WY5A 3VPAA 5KQPA 3GFGA 4CR6A 4N7RA 4IP0A 3GQVA 4W5HA 1WCXA 4Z1OA 1NVMB 4DMRA 2IBTA 4URYR 1DZ3A 2WWHA 2I4IA 4C6SA 3F74A 1K8ZB 3BD6A 4JNCA 1AZLA 2A8YA 2FFHA 3K0FB 4MSUA 2PX8A 3H2SA 4EECA 1GKLA 1PZGA 1CG6A 1G17A 2V59A 5IBCA 1DQPA 3E4DA 2ZE8A 3DE7X 5BUQA 1ABEA 3H4VA 3GLFB 1FS6A 3KYBA 3R7FA 1EVYA 3E61A 2E18A 3LKVA 2GILA 4KXVA 4LYHA 4DLZA 2V03A 1H05A 4E03A 3H4MA 5JDCA 1H5QA 1L7BA 1UEJA 2A0UA 1CFZA 4NFHA 2I2FA 3KB2A 3ZZMA 2B21A 3F5MA 5J9FA 1NU8A 2RHTA 4N5LA 3BB4A 3TX6A 4JLVA 2CV0A 2OORC 4WKBA 1IY0A 3WGKA 1VJTA 5EE3A 3ZDYB 5A7HA 1L7DA 3C1AA 4QJ5A 1UWLA 2V45A 3TRKA 2Q4RA 2XWBF 4R6WA 5TB5A 3CNNA 3HUDA 3LXRA 1UZNA 2DECA 2XDYA 2XUZA 3AQIA 3E35A 1QHFA 5HJ2A 5FTWA 4YQEA 2Z04A 2VRCA 4ITUA 1FJGB 1YAJA 3HU1A 3H8WA 5DFAA 1YA4A 3RFFA 2V8OA 2YMQA 4LNHA 5CT9A 1LBTA 4UUQA 1LEHA 3A05A 4MRAA 5L6MB 2TMDA 4JY7A 2DTXA 2G8LA 1CUIA 1FXWF 2BMWA 1AK2A 2PGXA 2YBEA 1IWBB 3K8YA 3UJ9A 3IR6A 5AESA 1LA2A 2IRWA 3L93A 4WGGA 1E2NA 1LRKA 2BEUA 1TTTA 1BWRA 3D5QA 3OX4A 3T5GA 2YHIB 4JFAA 5HXAA 3A10A 3CIOA 1LPOA 2XWPA 3EEBA 3BK2A 3CX7A 3HXLA 1W5EA 2LWIA 3NBXX 3P5SA 3R8FA 1AM4D 2VWQA 4WVFA 5K2OA 1K0FA 2QN8A 1CNMA 1WE2A 4ND7A 3UK2A 1CP3A 1L6RA 4AMGA 1ZUD1 3KZXA 1CS0A 3IP8A 5COAA 2VF2A 3O0TA 2W90A 4FFBB 4HTFA 1SZCA 2KQUA 3IAS6 3RJTA 1I01A 1C1XB 2WHPB 3VGPA 1QCDA 2CFOA 5AQEA 2PBZA 3GLQA 4QNMA 3FFTA 4BJ5A 5J1SB 2HYIC 4OX9Y 3OWHA 2JI9A 2O2XA 4DR1B 3AKYA 3JQDA 5EI5A 1J7JA 1SBQA 2WF8A 1HDCA 3GRKA 1QIEA 4LDJA 2ZCJA 2BZGA 4I1YA 3F3YA 3QKTA 3TOVA 5A9SA 4F5WA 1GD1O 1LTQA 1CZHA 1P62B 2WU3A 4HWSA 1QP4A 2FKAA 4LXUA 5T6MA 4DKXA 1KEEA 8LDHA 4RBNA 4K9SA 4Q3DA 3MA0A 3RUFA 3S8EA 2JD0A 4YV1A 4LYFA 2J9YB 2ZR8A 4IRXA 2ZJ1A 1OTXA 1P9RA 2JHPA 2FGKA 3GJQA 3N2KA 4Y6LA 2F1HA 4R83A 5AWFC 4O2BB 1U0BB 1Z0FA 4MW2A 1JW9B 3IUBA 4KW7A 1NT2A 3TSOA 3BAFA 3LBHA 5LYYA 1GPAA 1QZTA 3QV2A 4RLQA 2R1UA 4CQLA 5KVCA 3H7IA 2JEOA 3EXFB 3V46A 3FNQA 3OCJA 4WDQA 2QTGA 1N0HA 3G68A 5LJLA 3OX1A 2QN6A 2LXNA 3LZCA 4FDAA 3MS7A 4QJ4A 2HO4A 4DLNA 4B46A 3ICPA 3R3JA 2VBCA 2EJCA 4PSDA 2I2AA 3JWEA 1RBMA 1LSJA 3E81A 3KTFA 3C3AA 2OD7A 4RK0A 4OXYA 2D2EA 3KV3O 4J75A 3D7LA 1O03A 1O87A 5CU7A 5CA0F 1Y81A 3HKCB 2GUGA 3OP1A 5K1ZA 5E6RB 2AJBA 3EIFA 4RZIA 3TW4A 4REOA 4QU8A 1ZR4A 3C6YA 1OILA 3I01M 1P73A 3DFFA 4CL3A 4U9HS 4B8ZA 1LSSA 3LC7O 1RLOA 4XUCA 1HXHA 4CZ2A 3KKOA 4FYVA 3EIEA 4EDFA 1YZGA 4YP9A 1BVRA 2XUFA 4Q4HB 2Z5LA 1NU6A 3HB9A 4PAQA 1KZ6A 3OJOA 3TECE 4AI6A 4DA6A 1S3FA 4G26A 1WEKA 1U8EA 4KQ2A 3WL5A 2KPOA 4BO4A 1TMYA 2XAUA 4G4IA 1ZI6A 1YR2A 1L5GB 3QSYA 2C1EA 4QPJC 1G0OA 1R0ZA 2Z95A 1QZ3A 4Z4HA 1IN5A 3B70A 3PEEA 3ERCA 1NATA 4MNTA 4KR3A 4A2PA 5A3VA 1CUZA 1E94E 1NQWA 2QI9F 1L4FA 1OZFA 1Z6YA 1WXIA 4EJSC 3NFRA 4MQLA 2JLXA 5DK4A 1DHRA 4ME6A 3RFVA 4CLRA 1SUSA 3OI7A 5BV8A 1XROA 3TLGB 3CYFA 3KOMA 3NM4A 4Z7JA 3EEFA 3VI4B 2PRKA 1XZGA 3GV0A 1II8B 4Y2YA 3E7XA 3IQHX 1C7IA 1DC7A 1P1HA 1N8KA 1U5BB 4BXOA 2FDXA 3F7TA 4OB8A 2GN4A 1C2YA 2XGGA 4ZVTA 1EVEA 1P2GA 2H0RA 3OJCA 1KEWA 4FQ8A 4FS3A 4G36A 3DBLB 1RHJA 2DGDA 1ORHA 2WHXA 3B12A 4HAZA 5B6JA 5ICGA 5FL7D 1ZONA 2GJAA 4QYMA 3ZLUA 1G20B 3MLAA 3MJEA 4M36A 1MG5A 4EG4A 3S3TA 1ZN2A 4Y2HA 1ONBA 3KJXA 1CZOA 3CH4B 4FZ3A 1JSLA 4Q9IA 3IUYA 3ZHZA 4QEDA 4W1SA 3CBQA 2CUTA 3IOCA 3NJ4A 3BK7A 4ZK2A 1AGRA 2HPZA 1ZINA 3ADKA 3CPJB 4KJZA 5BNTA 5D3MB 2AN4A 5JC8A 2E4WA 2WIGA 3HEMA 3R5JA 5HKLA 1ZUIA 3M33A 3U49A 4BLQA 4GOKA 1RWKA 4FX5A 5ALFA 5AVOA 5NLLA 1S2IA 2ZWOA 4EW3A 4E32A 3QX7A 3T9AA 4ZOEA 5AXBA 3X1MA 3ZBTA 1X87A 4AJ1A 4LF8B 1KAMA 3V7UA 1A95A 2GPAA 3K0BA 4FJ1A 4KV7A 4TVKA 2XDWA 1E64A 1BS9A 4LBYA 1QXSA 4HDKA 3Q8MA 3MGCA 3FF1A 4RE5A 2D5BA 4F4CA 1MO3A 2JJMA 3IVMA 3LZ6A 4MMXB 5FPHA 4R51A 3F98A 4ZJYA 3AI1A 3BZWA 2QBYA 5CG1A 3T4PA 3UY4A 2CMHA 3R0VA 3EXG2 2RH5A 1W29A 4QUJA 2UXBB 3VNQA 3LK7A 3KJEA 3HKBA 4A1FA 2O2SA 4QXAA 4R0NA 2PXHA 2XSZD 3TQFA 2DETA 3A7EA 5HQJA 5M2QA 1ANKA 4X9XA 5IUJC 2J0SA 2Z3ZA 2ZI9A 3LFHA 4LSZA 3Q6NA 3B20A 2BV3A 1EFKA 5JSZB 1ZY2A 4IQ8A 4AS3A 1ES9A 3LBYA 1DOAA 2EBHX 5ILQA 3EHDA 2BFEB 4ZO8A 4C7OA 4RMGA 1RIFA 2D0DA 2YXNA 2HA3A 3DF9A 1C4WA 1UQTA 2CF5A 4IHJA 2I66A 1YL6A 3M4NA 3T5DA 1CQJA 2NZYA 5CDGA 5LXTA 3NG1A 6LDHA 2PSHA 3ZCUA 2C3PA 4CI0B 1JG1A 3EVCA 1L6IA 2XNDA 2GXQA 3DQPA 1Z35A 1GZ3A 4XAQA 1TO6A 3MRSA 1UFKA 3ST7A 1ZMXA 3QVKA 2V7PA 4I9UA 4XVRA 4LFBB 2HRBA 2HD4A 2IE8A 2YWFA 3DOEA 3WVNA 1CIVA 3LHDA 1G20E 1TB4A 4MYUA 3X1ZA 1Q0ZA 1F38A 1TPYA 2QTAA 3LYHA 1T4MA 2GASA 2O3JA 1J2JA 2VYND 1FNBA 3FYCA 3T0FA 3HY3A 4X65B 4INOA 3CZAA 1DHTA 2VN8A 3GRFA 1ZP6A 2IXAA 1Z8HA 4LYYA 4M1TA 4MKZA 2HV8A 4Q3CA 5MN5A 1PR9A 2FZWA 3H3XA 1Q1AA 3I6ZA 5DBOA 5HIJA 1NR5A 1I4DD 4UTPA 4TYNA 4OQXA 2ODAA 4D0SA 1CE8B 4PYMA 1M1YA 1VLMA 1G21E 4DSZA 3VHXA 1MGPA 4AX8A 1TX4B 3REQA 1MNQA 1GU1A 1QNLA 3BJRA 2BRUA 1IULA 2HAEA 1Q95A 3KE9A 3H17A 4PTYA 3N74A 4CM5A 3ZU4A 2K6GA 3F1KA 4RFSB 1E9VA 1G3QA 3GA0A 3CQ9A 1QLJA 5SZIA 3PC8A 4OFBA 4RYDA 2YMLA 4BFYA 2QDXA 2V55B 1KDYA 1K6XA 3U62A 2OGZA 2E89A 3R7WB 3JQCA 3JQRA 1C3XA 2VHXA 1TVKB 2LDXA 1EK1A 3Q40A 3VTKA 4CE6A 4DLWA 2QTNA 2O8FB 3LTEA 1UC9A 3UV3A 4BMZA 3V97A 2BFWA 1ZEJA 1FP4A 1CR4A 1XAHA 3OA2A 4X60A 5JYCA 1LBQA 4RA9A 4QOSA 3QI2A 3LKZA 1XQYA 3UAOA 3H1TA 3MTGA 1GGFA 1G291 4NYIR 2IYAA 2HWXA 4KK4A 3SC3A 1NZJA 3QLVC 3W6NA 1E9FA 1WM1A 4YRFA 5CK4A 1LPPA 3EIUA 3K5IA 4MCHA 2R65A 2WQZA 2CNOA 1Z5NA 1F8FA 2MJLA 1JG7A 4IWYA 4OQQA 1N2CA 2C57A 5FOSA 2IH4A 3TSWA 1JHZA 1U9YA 4LQ4A 5LB4A 3PUZA 4C3ZA 2GTPA 3LBNA 2XMCA 4KQWA 1ZD3A 1F14A 1JR4A 2AOWA 4KV9A 3G2OA 5UKDA 4F4IA 1GNLA 2VSQA 1AJEA 4TT8A 3HI4A 3OU6A 2OQVA 4AURA 1IFXA 3HL0A 3SYRA 4HGNA 3GF4A 1YHZA 2IU6A 1WA5A 4OHPA 1LS1A 1V5EA 2ZJ6A 4ZVPA 2Z5GA 3FGZA 4RC9A 1FFDA 3IKJA 1E9DA 3KKEA 4GH5A 1HDOA 4DDMA 5ILGA 1H8HA 1T2UA 3UW1A 4CG2A 1TCVA 1RM0A 1V11B 1YASA 2BKEA 2GZAA 4MW9A 3ZUGA 4EPRA 1XNGA 2LCFA 5DI3B 4ZEOA 1CU1A 2O06A 4C6TB 2MDTA 5K9ZA 1QRUA 5ECGC 2AX4A 1X0VA 2WE7A 3MJCA 1T0IA 2EFDB 3EQ7A 3CEMA 1Q1NA 3KVRA 1LDBA 2FP3A 3QU9A 3LTNC 1HEYA 2VDKB 3MWKA 3LY7A 2BISA 1KOGA 3PE3A 4EJFA 2FOLA 5K6AC 4IJWA 1EWKA 1XTZA 3ZTYA 5JCOC 3KJGA 4RA6B 4QGHA 4WRRA 2NVUA 3GRUA 3VYWA 4EVQA 1XQ6A 1RRKA 2G1PA 2E3JA 1OWOA 4XFKA 1FRVA 1OFTA 4I5DA 5DYYA 1U0RA 4TTTS 4UAJA 1G7TA 4QGFA 2NTEA 3WFIA 1T9GS 1JFFB 1K5DA 4ZODA 3MILA 2A5GA 3D0QA 4KRGA 2V5AA 1QBGA 5H4GA 2EEZA 4YA6A 5H4HA 3FPAA 2VNKA 4DXHA 1FDIA 4L75A 5B58T 1CY2A 4M99A 4NICA 4AN4A 4OLFA 2WTEA 4OYRA 4JJ6A 5KVAA 1HEIA 2JFWA 1JAYA 1CDEA 2VYVD 2ZJFA 4QAQA 5AJWA 3T5BA 3TGWA 3KLNA 2NUPB 1AE1A 1W5AA 2WB4A 5H83A 4DZRA 4ESEA 2HJWA 4BU1A 2UZ3A 2O8EB 1M9NA 2IU3A 2ZUVA 3JR3A 3TZ6A 4M7WA 4LRUA 5BN5A 5J23A 3SFVA 1UIMA 4BFTA 4RABA 1D7OA 2YZGA 4PYIA 1Z26A 4RO0A 4YIHA 1ZVVA 1QHNA 3A3NA 3DZIA 5B53A 4G9GA 1V6AA 4K1LA 1EM8B 3CPHA 4ANFA 1U2GA 3N5KA 5GP1A 3VPGA 3W5VA 4YT8A 3MWJA 4LJ4A 5DGCA 3WL6A 1IN4A 4JITA 3E05A 1QKKA 2H5LA 4PEVA 2CNDA 2M98A 3KBOA 3CLKA 4OU4A 1MRSA 1NXQA 3U48A 1YTLA 4CXMA 1AHIA 4GBED 4JEIA 2RGXA 2B69A 1CQIA 3PQFA 4PS1A 4P4NA 2V6JA 3IQZA 1MVNA 1MOSA 4TTVA 4OGGA 5JNLA 4L5YA 1TIPA 5K0TA 1GQ2A 4EFMA 1Y63A 2I8CA 4LDNA 5LCXA 1GZ4A 4HEQA 1C80A 2D0OB 3DHYA 3S29A 5CB4B 2GPWA 1CTQA 2YV4A 4AY6A 2JF0A 1WHTA 3ZQJA 3RHFA 4OK3A 4I3FA 1MU0A 1FQKA 3PUXA 1PNVA 3L6EA 4A15A 3TIVA 2VXBA 1BXZA 1SULA 1ZYUA 4I1VA 3B6KA 3SZMA 5G0VA 1AA6A 4Y1EA 2AZDA 4L95C 3UIEA 2OCBA 4B2YA 5GONF 1HPLA 1CETA 2ZEJA 1FSGA 4FEEA 1CEQA 3L82B 1EGVB 3ZE9A 4C3UA 1SA0A 2FN8A 1FC0A 1BIFA 1FQOA 1VKZA 1W1IA 2C2KA 3FHLA 3KM0A 2DB3A 3IP6A 4LJ6A 2VTBB 1R4AA 2AXPA 1K7SN 3TLZA 3VYVA 2XTMA 3D4NA 5AI0A 4QUHA 4PANA 3JPWA 4DCGA 1DARA 1GU7A 3NGXA 1DO0A 3CR8A 3DOFA 1Z4PX 3O1HB 4DLAA 1AZTA 3FN4A 5LZ9A 3TQSA 9LDTA 2PUBA 1WQ3A 4M0DA 4ZHQB 5CW2A 3K8ZA 3R3HA 2GBLA 2ZE5A 1PR4A 2PVSA 3AX6A 2H9YA 4E2WA 1WQ4A 1KMHA 1PQWA 3WYFA 3D8HA 4FE4A 4BWVA 3FOWA 4Z1MA 3LBIA 1YUMA 3WAJA 4X1IA 5H82A 5K3FA 5DNDA 4Q1BA 1GGVA 5BN4A 3ZJVA 4PE5B 2ZYSA 5C8ZA 1WZ2A 3GROA 4L27A 4K9MA 5ALGA 4P4LA 5B1IA 5FOUA 1MJHA 3VQTA 4ZYWA 4QT0A 4ILEA 4R71A 4Q4LA 1CY6A 3B51X 1E2GA 4P4TA 3ZWQA 2H4YA 2FRVA 3PNLA 4Q24A 5BR1A 5FUVA 2W6OA 3QPVA 1BEZA 1QLHA 4F46A 5KKCA 1U0TA 2K7ZA 2YHUA 4JB0A 2M2IA 4UZEA 2A7XA 3SKXA 2I80A 4IM7A 3W4KA 4UNRA 2DWUA 2DUJA 4EPYA 5LKAA 1E0AA 2BI8A 2YHSA 1F0PA 3D8RA 3FTCA 1KR5A 5EN4A 3K71B 1UT6A 1M7GA 2F48A 1TPZA 2VRNA 2J8ZA 4RL4A 3G02A 2DPMA 2EV9A 4WEQA 1JJIA 1OT3A 2X7HA 4LDAA 4UULA 1J1UA 3RABA 1V7PC 2CDNA 1BKYA 4YASA 3OLXA 1GITA 2D62A 2F43A 1NUSA 1ODKA 2RI0A 1IN7A 1QG6A 5ERYA 2P79A 5LBIA 4NCAA 1YVPA 4MR9A 2FFQA 1QO0D 2CVHA 2AN1A 1NVVQ 1PQ4A 1VRWA 2CXOA 4OV6B 4PHCA 1PZFA 1AF4A 3EFHA 4JI1B 4DA8A 3BMOA 2XA2A 5TQ2B 3B8HA 4CFYA 5A02A 8ABPA 3GJ3A 4J0GA 3WGVA 3KQLA 1OBOA 1Z2EA 2PRZA 4U8GA 2A5DA 1CHNA 3KFXA 2AW5A 1NTOA 5BWLA 3AERA 1IXKA 3IRVA 4P4GA 4OUDA 4HMQA 4N5DA 4U63A 2GBFA 5G3YA 1MLDA 5HUQA 2F1OA 1W36B 3AWDA 3IAS1 3NETA 3RC9A 3UMGA 3ZR4B 3NTUA 4EA9A 3DEFA 2QOEA 3OLZA 1F51E 4JJ8A 4D9BA 1K66A 3O26A 4QAJA 3TNYA 8OHMA 5FNZA 3F5QA 2GS9A 4HS4A 1WMSA 4Y0NA 4BQNA 1EDEA 3U3DA 5LQMA 3UNXA 1D5CA 4KR9A 3SHWA 1GG5A 2ZYWX 2H85A 1NW6A 4Q16A 2R8RA 5CIYA 1ZH6A 1EZ4A 1P17A 4HNHA 2H4ZA 4CIWA 2H18A 1FRZA 4HDQB 1LLCA 1E77A 4MWEA 4U2KA 4V0OA 4HAUA 1MTZA 1N6NA 2G72A 3ND5A 2RDMA 3UYLA 3FY4A 1UJBA 3KT0A 1NBHA 2YUIA 1B6TA 3B6JA 2JGDA 3QE3A 4N5MA 3TNDA 3GPLA 3STXA 1IQPA 2PKXA 1Z0DA 3WX0A 2O2CA 5ICSA 5BSVA 2CXRA 2QSUA 1AC5A 3WLFA 5D7NA 2IS6A 3H6HA 3UK1A 2QG6A 3GGGA 3GLHB 4XX1A 2RGGA 2ZIWB 1P4HA 3H13A 3G0GA 1Z7YA 1Y3BE 1J06A 2QLTA 3L0OA 3QLTA 5CTAA 5KAPA 2ONJA 4QPZA 2FG6C 1WL8A 5BORA 3IR5A 2ANCA 3IOMA 4B48A 2H1CA 3BL8A 3CLVA 3MCVA 5EUCA 3OSZA 1WU8A 2C83A 3SYNA 5HVNA 3VYSB 1Q0QA 2R6R1 1GGEA 1ZI9A 3O4JA 5B64A 1CR1A 5HQ3B 1E6WA 4NVRA 3FR7A 1QQ7A 3FW1A 2PSEA 3AHJA 4DR5B 1DP4A 2A1TR 1SH7A 3D3WB 1J20A 2NNWB 2PXXA 4R1NA 2PUDA 1XRRA 2JA2A 4OA8A 1P7PA 4D92A 3I39X 2RSLA 3VSEA 3LDFA 4MVJP 4I5GA 1FFSA 3OO0A 4LGYA 1KPIA 2JFUA 4P53A 4QFCA 1Q1QA 5HUJA 2BFDB 1SFRA 4RH1A 2P5SA 3T9EA 3C3DA 1SBZA 3PUJA 1Z2CA 4JJEA 1GKYA 3MMPA 4BLVA 1Z73A 4DNOA 5AVQA 5LQJA 3QBVA 2GEKA 3OX3A 4UHFA 3A1CA 3SS7X 4I8IA 5EMJA 3KR9A 3NTVA 4J4HA 1TDJA 3NH6A 2PJDA 3MJTA 4MS1B 5SZJA 1RTKA 1SEVA 4L76A 4NBKA 3S8YA 5ED4A 4EGJA 1T4CA 3VU8A 2R96A 3K96A 2NW6A 1QDUA 3VSCA 1FL9A 3GEGA 3GY0A 3QP9A 5E8RA 2JFVA 1YKSA 1CX9B 3NH9A 3GP8A 1VPVA 4PG6A 1EUYA 2DH5A 1IQRA 1YE8A 2ZI5A 4XX0B 5J2UA 2WA2A 4P7KA 3PK0A 4PGGA 3RS8A 4DR7B 2JLBA 1PK8A 3OHPA 4IDNA 3H2ZA 4KN5A 4A0SA 4MI3A 2FWAA 3WB1A 5FPPA 2HHLA 3LG2A 3QEKA 3C8UA 3O8LA 4PYRA 1N6KA 4YCJA 1WZUA 3BK1A 3GUYA 4NZZA 1WTAA 5H1YA 1RJEA 2W6PA 5EL0A 2HTFA 3KT3A 5I9MA 4B3TB 1WO8A 5JSFA 1BH2A 1Z7GA 2HCBA 3BRWD 3IBFA 4IZIA 1SBTA 2XMBA 3RS7A 1UKZA 2G0NA 1PKEA 3F6RA 4ZCTA 1QHSA 3BWYA 1FYVA 2I22A 3QHAA 5DISB 1G21A 2GRAA 4BDTA 2WM9B 4C88A 5KPDA 5H7XA 3AKEA 4RGYA 1SCNE 4G1FA 4GM1A 5F76A 2MINB 4DRZA 4WCFC 4L4XA 4AWXA 4ODIA 2ILVA 4HWPA 3HUTA 5BUZA 2IQIA 5BYBA 2PL5A 2DPLA 1Z4OA 2C5HA 4FGWA 1O8BA 3LGSA 4E0BA 2I7XA 1RPZA 2CNWD 1P5ZB 3X1DA 4F5EA 2IVZA 4W8HA 5C1PA 3HCOA 1ZU5A 1CUJA 1MABB 3SZOA 1QHXA 4E51A 3PUWA 2WWVD 3HFGA 3WI7A 3DDSA 1LLDA 1ODLA 4WWHA 1VI5A 4Q9JA 3X44A 3FCAA 1C7FA 1RRCA 3T1TA 2ASEA 3C97A 1RRMA 1THGA 3EDQA 5CVDA 3IEKA 4DLTA 4B3MB 1R5NA 1WOMA 3ASVA 3I72A 4BY9E 4PSCA 3TI9A 1WSDA 4ARZA 4LI0A 2DY0A 3E48A 1PHPA 4MYCA 4M7OA 4TL6A 5M34A 2HQRA 1VKOA 3L6CA 4FT4A 2BGGA 3RV4A 3EA4A 1F8UA 1CULC 1FQJA 2AEMA 4FHDA 1KAHA 5AH0A 5F33A 3DZDA 1N77A 5D87A 4FC6A 4JEMA 1JLSA 4IIGA 4KE9A 5ESDA 3ZX4A 2JJ2A 1DKUA 4GEKA 4RZSA 5KYWA 3A9CA 4M98A 1MF7A 4MICA 1R9JA 3ZTTA 2I99A 5EXEA 1FLDA 3CR7A 3JZDA 4GR4A 4LFAB 3HEBA 4HLUA 3AHFA 3I6MA 2ZVQX 1U63A 1EM6A 2Q6TA 2IEIA 3KU1A 4RF5A 4GPD1 3H2IA 1NWCA 2VYCA 1S3GA 2JLAA 3ZDEA 3ZGNA 1YZLA 1YSCA 4DR2B 3CX4A 4CCAA 4MLCA 1KVQA 4Y9UA 1C9NA 1DC5A 1U5CA 3E84A 4FMDF 5F78A 5REQB 3PKJA 4GBMA 3V1NA 3IKTA 5L3QA 1KNXA 5DN6A 1DBRA 2AYZA 1JBKA 2IITA 3JQPA 2XRMA 1JDZA 2FW7A 3C3MA 1QAQA 2L69A 4MZXA 1UFOA 5F7ZA 2QVGA 4D9CA 3R5XA 2AK3A 3I5AA 2YOGA 4TUYB 2GEVA 2TS1A 4BQQA 3PTAA 1Q50A 2YC2C 4YCCA 1ZJ5A 4Q47A 4WJZA 2RK4A 5C8DA 2DEUA 1RKBA 5HDQA 2XEDA 4BV3A 2QR2A 3P1JA 2QYHA 1SBCA 1NUQA 3GNSA 4BB9A 3CLHA 4OKSA 5IRCD 3GAFA 1EHYA 3I73A 2J85A 3ITNA 4C7XA 1H2HA 2X77A 1RWVA 3FPEA 3RG2A 1RC0A 3BD8A 5J2TA 3EAFA 2JAHA 3U9SA 1TU3A 4MR7B 1Z15A 4NPHA 1Q22A 2VA8A 2ZI7A 4PX3A 1EH5A 5ALDA 3JRXA 1ZD8A 5CBPB 3EF0A 4YP6A 1QIDA 1Z29A 1KJNA 3GA5A 4INPA 4MRSA 3T0IA 2HNKA 2VPQA 1SHTX 2QRQA 3CUVA 4KAFA 1ZD2P 1BX0A 1ZLYA 3DYBA 1QH8B 1W8DA 2CT8A 2I1WA 3QMPA 1JU9A 2GHRA 4LHSA 4FKZA 4QDJA 4KPUA 4REQB 4HJXA 2G9NA 5KTTA 4MVYA 5LP6A 3L7MA 3H11B 3EPJA 4FBLA 5HJ7A 3ZLJA 2VUUA 4PZZA 4XFJA 1AD2A 3W7AA 4CV3A 4E88A 3UFXB 4G8CA 2WOJA 4B81A 2D5IA 4J7CA 2IP2A 4XSGA 1C0KA 5FI3A 4IXWA 5HFAA 4DJJA 2QMEA 4NZOA 4RTJA 1IBMB 2OLEA 1QP8A 1GPKA 1U7OA 5D6NA 1NN1A 4M38A 2W6CX 2UUAB 4NCKA 2V7TA 3SZRA 3OZAA 2XCRB 3EDYA 1JE0A 4MRMB 1IK6A 2R8ZA 3RDPA 1EJ6A 1L7VC 2OL4A 3SQNA 1CRWG 4QOIA 4N0QA 4V24A 4B9AA 4EB6A 1F3OA 5JZ9A 4KQ9A 2XKBA 3GZTB 3ORFA 3Q11A 4KHPB 2PMKA 4FEAA 2OQRA 2YJTD 3NASA 3UEOA 4HWTA 2XYVA 4JEUA 3MINB 1E32A 1QMPA 3INRA 4FN5A 4ZOCA 5HK9A 1KKUA 2ZSIA 4RH0A 4CLHA 2FQWA 1OXMA 1U0SY 1HG1A 2BH9A 3M4ZA 4TMVA 1VKRA 4M0EA 2RCNA 2ZWAA 4X3PA 1CJTC 1VYUA 2ARKA 2WIBA 2XUAA 1Y8QB 4I2VA 1S8OA 4BNIA 2BCEA 2ZRMA 1A27A 3LW7A 1GYRA 2HWWA 1EA5A 2ZJ0A 3QFHA 1U1FA 3QVMA 1ISPA 4GIBA 4WJLA 4B5LA 5FKJA 2GXUA 4JLAA 3G49A 2OVBA 1QIKA 2ERXA 4RJIA 2C7QA 2V96A 7REQB 3QY9A 3A4LA 1Q57A 4AXXA 4G67A 4RPHA 2C92A 1SD2A 4K6KA 4BO7A 3MOSA 3H5WA 3MJSA 4H7KA 4MUXA 3NP9A 1G6Q1 2XYPA 2HWYA 4MR8A 4QJBA 3IIMA 4YEDA 4EQ6B 3CRMA 4JYBA 5JRDS 1RAAA 4ZV4A 5IFLA 2FPSA 4H7DA 5BNFA 1PS0A 4IXNA 4Q9NA 2YV5A 4QOJA 4F0JA 2PQ2A 5JYDA 2ODWA 3GUVA 3JARA 3LXMA 1NMQA 2I34A 2W2XA 2ZQYA 2K2QB 4RWEA 1DELA 3AEKB 3E6AA 3MG9A 3R6TA 4MQFA 1FYEA 3VM6A 1O94D 3AETA 3WRYA 4RPJA 1YS6A 4BGUA 1TIKA 1UK6A 3F90A 1SU7A 3I4FA 4HDOB 2AMVA 1JVBA 1IJEA 3BZUA 4YMSA 1WX1A 2Y1FA 4U5XA 1WBJB 3OHMA 3BF8A 2RGWA 3R9WA 4V0SA 2RJOA 1SOAA 4FFWA 1UWCA 4P34A 2EG5A 3AUKA 5DSZA 5C8YA 3RK0A 3FSGA 5EVJA 2QSYA 1WPXA 1V7ZA 2AWOA 4HUJA 3SIPA 3E15A 1WVIA 3NALA 4KE6A 4S04A 1GQRA 4ADSG 2OXIA 4EB0A 1YJCA 1M0WA 2F8LA 1IUOA 3AB7A 3AF5A 3U7IA 2Z3VA 5CVTA 5JH7F 1XNQB 1P2SA 5C5DA 3IALA 2XTZA 4A6PA 4IDGA 1GM5A 3GMTA 4G25A 2WA1A 3ANLA 3V00A 2GEBA 3C4JA 1ZOLA 2F1RA 2FEPA 2YRFA 1VM6A 1NUAA 3B1FA 4UUAA 4LE0A 1BEEA 4RKEA 3NEPX 2F55A 2AQKA 1E2JA 3E22A 3U56A 1Y89A 3UPDA 4KYIB 4D8VA 2VDWB 3P2OA 3VR3A 1UC4B 3BGWA 5T41A 4JXJA 1MZPA 2FQXA 5AXCA 5JLJA 2SHKA 3WHLA 5LSAA 5ECYA 2PX6A 2XB6A 5B6PA 1U7XA 5CFMA 4GXNA 3E70C 4RV9A 4KE7A 4P83A 3H1FA 4DLXA 4UHCA 2VNJA 1JFRA 1K8RA 1GGNA 2WUDA 1N4AA 2Q7DA 1BCSB 3KSUA 1CDZA 2E21A 1D7AA 4Z9YA 1OWPA 4D3SA 3CZCA 1AA9A 3KZNA 1SKQA 1U0HC 2O7SA 5EC8A 3VZRA 3K1YA 5B1EA 2ZXUA 4TQ9A 3T94A 2JS7A 1W35A 1QH1B 5ABPA 5CJPA 3VKWA 1DLJA 4WK4B 1L5FA 1SOVA 4YQYA 5DSTA 3DBHA 3HBFA 3N58A 4KLNA 5DP2A 3H6KA 1PIWA 4ALIA 4ZALA 4BFCA 1OH5A 1XLTC 3IEVA 1IUNA 3I45A 2HO5A 2WTMA 3MTBA 4ARIA 1E2PA 3W2FA 4Q1DA 3VJRA 3BULA 4I14A 1Z16A 3BJIC 3KWLA 1JDBB 4XZ3A 5IZCA 5JV5A 3DMYA 3OF5A 4QASA 4R8SA 3RFCA 4LY0A 1MG0A 4MVJE 3LVFO 4J76A 4ABYA 1I9GA 2BFFA 1COWD 1FOEB 3TM5A 3TTTA 5C5CA 2ZYAA 3GA7A 3M81A 4C0SA 2OG2A 2WVAA 1HT3A 3A6ZA 4PPNA 1W94A 1E3MA 1E2MA 1KETA 2WM2A 4E08A 4J4BA 3KYIB 4BHTA 4BQOA 1BD4A 1FSFA 2BTQB 1A2OA 3NWOA 4L6IA 5LQNA 1AHNA 1Z6TA 5TT1A 2O1XA 1G38A 3F67A 4BVAA 1M7HA 1Y1RA 1WHSB 1EFRA 2PN1A 4LZWA 4PZEA 4Y6PA 5KTNA 3A4NA 1CEYA 1UQUA 3OKFA 1G8MA 2CJFA 2H1FA 1PV4A 1QIIA 2NGRA 2Q41A 3NCHA 4OQ4A 4Y7CA 4ER0A 4IXDA 1VIMA 4LG1A 3CXRA 4ZVOA 4G0YA 4PG7A 1N33B 3W5CA 2Y2UA 2VJDA 2UZAA 2MR6A 2B2NA 2PEYA 3DTVB 2IU4A 3VC1A 4LE1A 4MWBA 4F85A 3RYCB 5ERGB 2GM3A 1KSFX 1U3GA 3ZK7A 5KSZA 1CYDA 3L8HA 2JGLA 4ZFNA 1P45A 4UAUA 2R6JA 1DG3A 4JIGA 2GR9A 3A26A 3NHBA 821PA 3K70C 1FUUA 1RBZA 3UK0A 3WADA 2R1VA 4CUZA 4F6LA 1DEKA 1MEOA 1UQRA 1U04A 2ZLBA 3EVAA 4KWTA 4CQMD 3F8WA 4MQMA 3RTAA 1N5JA 1YR6A 2IYRA 3DEKA 1ZSVA 2PRSA 1GSIA 1F9EA 4JR0A 1T0PA 5CUQA 4QARA 3T3MB 4EI8A 2H4WA 4RW0A 1Y48E 3I09A 3KTOA 2EF1A 4LRTB 1DC6A 1P1BA 1PR1A 1G66A 1R0YA 4AS2A 2IP4A 2BFCB 3ZIAD 1DFIA 4U6SA 4DR6B 1YQXA 1NMSA 1ZGBA 2DHCA 5IT0A 1RJWA 1JR3E 2DUUA 4XR9A 1S6YA 5DASA 1THTA 3K2BA 1LSUA 3EVEA 3I2JA 1TMKA 3NORA 4P33A 4HGPA 3SPXA 2CD7A 1PD1A 3AHIA 1AN9A 2YBDA 3B7PA 3ZI7A 2ZYIA 2V9CA 1RXIA 5HWSA 4UEJA 2Q8PA 3NAQA 3HCEA 2H1SA 1E2IA 5C0OE 2WVJA 1CJSA 4IGIA 2QGNA 4IRUB 4OREX 5IVDA 4CCYB 2FEMA 5BR4A 2YWBA 3DD5A 2ISSD 1O95A 2QTRA 3HUEA 3R1IA 4A27A 5DTJA 1EXDA 4FSHA 4QODA 1QGED 1Q1ZA 3ET5A 1P1RA 5LA6F 1TJ3A 1N57A 3ISVA 5AMXA 2D5LA 3HACA 1JN0A 2J3DA 2A84A 2O57A 4JBGA 4QOGA 3F6CA 3GMDA 4PFJA 3RTBA 5A5GA 4TMXA 4RXUA 4PF1A 1KQNA 4NLLA 1UZMA 3FUVA 4QRIA 1HTWA 2VP6A 3QLEA 1WBBA 2D59A 3CS3A 1HORA 2AMYA 3DOOA 2V8BA 4GW3A 4EABA 1D8TA 1GG2A 4YRTA 2PWAA 5IJAA 4Z5XA 1K6JA 2OGWA 3GRAA 2AJTA 2GD2A 1LW7A 2EG9A 3HN6A 2XOXA 5EIBC 1ESMA 3BDAA 2GDZA 4HY3A 4LKRA 5U4XA 1KEVA 1VYHA 2CZQA 4H0NA 4M1KA 4NI5A 3WWOA 1FPQA 4MS3A 1C1YA 3PFKA 1NQAO 4NHOA 4MHSA 1ZX1A 3IUPA 1SCUB 4J3JA 1P2UA 1JT2A 1RQGA 1U9IA 3EVGA 4GICA 3TJRA 4E21A 4BVHA 4Z4QA 1MQ9A 4M0KA 2VSNA 3HGMA 1H6CA 5K4HA 2JI4A 4LZPA 1YK0A 3D6VA 3B9RA 4JI7B 1RZ3A 2CB0A 2GJSA 4O4LF 4ON9A 4ERNA 4IIJA 4DV2B 1L4GA 3NHUA 4GPEA 1P7WA 3KUDA 3K0AA 2CWWA 2J48A 1Z63A 2VI5A 3P5BA 2Q1SA 1KBOA 3NHLA 2XD4A 4HH4A 1BVHA 1PBTA 2JIPA 4OFWA 1NP6A 3MWFA 3DLPX 4OJKA 5EMLA 1OIWA 3NJ8A 4H7IA 4IDAA 2HFKA 4JOQA 3W1EA 4B7ZA 4S0ZA 1U6JA 1ACLA 3UJ3X 3AHGA 4RK7A 4K9NA 9ATCA 1HDZA 5K3CA 1F1JA 2ZJZA 5EINA 5DOZA 3PDCA 1E3QA 4WPGA 2BGKA 5IJ9A 4MLZA 1DADA 1V1JA 2QM8A 2O0MA 4GE0A