1AKYA

High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
b'ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1akyA00
2GJ8A 5SZHB 3QXHA 1RKBA 3LQQA 1ZM3A 1XMJA 1G21E 2C8VA 3SYLA 1LY1A 3AP3A 5TDHA 1KSJA 1T3LA 1L7VC 2GXQA 2R8RA 3U2QA 3ZVLA 3BE4A 1JEEA 2ZE8A 4Q1DA 4QBGB 2FGKA 2GESA 1T0JB 3WP1B 2QP3A 3D3QA 4Q47A 2OLJA 2YNMA 2A5GA 3AV0B 4TTQA 2GVZC 2WMNB 1F2UA 1VCMA 2YWEA 1YZGA 2DFNA 1U90A 1US8A 2FEMA 5FPHA 3ZZTA 5HZKA 3GP8A 2FPLA 4KBFA 4LJ6A 4ZDWA 5E4FA 5FOTA 3TSOA 4Q7JB 3B1YA 2PH1A 1T9HA 4B2IA 1SKYE 1T91A 1DG3A 1P75A 2IT1A 3KKOA 4DBLC 4A8JA 3KTAA 4JBYA 4WVFA 4BEBA 3NXSA 1W2GA 4W7SA 1PLJA 2HXSA 3THYA 1P2UA 4IDHA 5B57C 5IHPA 1J70A 4CYMA 1AZTA 1NBME 2BWJA 2PZFA 1ZIPA 3NH6A 2OAQ1 3BIFA 2F43B 2IYQA 3QENA 4GL2A 1DAHA 4K81B 1DE0A 1OXVA 4IDNA 1AGRA 2N1BA 2FH5B 4Q9IA 1G3IA 1LTQA 3GLFA 2QENA 2ANBA 3U44B 4ZI3A 2WWFA 4IFEA 4ESVA 3B82A 3U3KA 1LB1B 3I8XA 1KK3A 5FTLA 1XZQA 3CX7A 2WV9A 4B73A 5EXSA 1E1QA 4NTZA 5CYOA 3REGA 4ACAA 2GEUA 2IF2A 4XWOA 2X8AA 2ZE6A 4DSTA 4GOKA 1RW4A 1DAMA 1W7AA 3B7GA 4N0EA 4DRZA 2H16A 3K70D 2QM8A 3SJBA 3TSWA 1NN3A 2ZYTX 1FZQA 1XTIA 2RGBA 4Q1CA 4F92B 4HDCA 5KNBA 1NJFA 1VYUA 2ZRNA 3Q7QA 1HY3A 1L2TA 5IK2A 4DLYA 3SU8A 4K46A 2LWIA 3BXZA 2MSCB 2ZI9A 2B7BA 4RD3A 4RD6A 2C03A 5KSOA 1VCNA 1E0SA 1W48A 2OFOA 1MO4A 1ZUNB 3ZJYA 1XXHE 3WMFA 5M04A 2HYIC 4UNRA 5DSZA 4TL9A 5E7IA 3RHFA 3FHTA 4LYAA 4EJSC 3KL4A 4L8GA 2Q0HA 3WYGA 5DGXA 4BUJA 2CLCX 5AUQA 1Q21A 1TADA 4E5UA 1NLYA 4KU4A 4AKHA 5KUTA 4C0SA 3ADBA 3BJIC 1XFAA 2ZE7A 2EWVA 2ZJAA 3QPUA 5DYGA 2PLRA 1NLFA 3SJAA 5J40A 1CULC 2HXYA 1YE8A 3A4MA 5F98A 4KXFB 2EFDB 4PFSA 2DB3A 4PC7A 3DEFA 3I61A 2D7CA 3ZGXA 1R2QA 3AQ4A 2Z0MA 3B5JA 1RFLA 4Q5IA 5AJXA 3K0CA 4NL4H 1ZNYA 3FHCB 3O47A 4CEIA 2I1VB 4RFVA 3MWJA 1W44A 4MKHA 1E1QD 2FFBA 1ZD1A 3AP2A 3BD9A 4KLNA 4GRAA 1UM8A 1LFDB 2IUTA 3VR4A 1HA3A 3OAAA 2RHMA 1E9AA 2AX4A 4A0FA 3B1XA 2F3RA 3DHWC 1NP6A 2O0HA 4D0GA 2AR7A 1AS3A 2Q9BA 5AJYA 1J8MF 4B71A 5EZ5A 1G7RA 2EU8A 2ZS7A 3C5HA 1OXUA 4IEEA 3C16C 1KZGB 1XTQA 2VHUA 5IK2D 1KI9A 2YWHA 3CWZA 4AKEA 3U5ZB 2O8FB 4PSKA 4GP7A 3KKNA 3KUDA 1NVVQ 2MMGA 1OHHA 1W4CA 1JR3E 1AS2A 1FP7A 3GLIE 1N0WA 4BWYA 5AUOB 3CIOA 3SBDA 3AVWA 2GNOA 2W6IA 4RSGA 4LC0A 1VMAA 2IWHA 5KOYA 5FI0B 4F4JA 3P1JA 4MRSA 3HU1A 4PO8A 2GXUA 3VMFA 3W6NA 2O8DB 1P61B 2GRJA 3L2OB 2DCUA 3LNCA 3R8CA 4JZKA 1WBDA 2G83A 1JXOA 1Z2CA 4MRRA 4KLZA 5FOXA 3L82B 3OE7A 2OLKA 2ZE5A 3B60A 4I1SA 1TQDA 4JVLA 2D62A 4XJXA 2XGJA 1CF4A 1HT1E 3HYTA 3M4YA 5FR1A 1KIMA 3ZS9A 1W5SA 4O2LA 3A4LA 2J0QA 1XCGB 2QT0A 4D81A 2AXPA 4B75A 1ZM7A 2FZ4A 2RB4A 2DBYA 4ARZA 2F3TA 1COWA 4BECA 1RJ9A 4OQFA 5EP4A 2G0NA 2IUUA 1PLKA 3HU3A 5JFGA 3TVDA 2QAGA 3OAAD 2WKPA 3O8BA 5K8LA 2P6UA 2GZDA 1GWNA 1KO1A 2BMJA 2H57A 2QGNA 3CRW1 2PEYA 4A6PA 4JLDA 3TUZC 1S1CA 3IILA 1JJVA 3U7FB 2ZU0C 3TR0A 4A1FA 1XMIA 1E79A 4MYUA 2W2XA 4DIEA 1HV8A 1S1MA 2ZI4A 3H1TA 3NDPA 4BQSA 1T5LA 1Z63A 1IXZA 3LWNA 2BBTA 2W0MA 2ZETA 1OHHD 5C18A 4OQNA 3C4JA 2W2VA 4QJ4A 5KU1A 4QJ5A 3X1DA 4LPSA 5TMPA 4V0LA 2RKOA 3QBTA 5FOUA 1SHKA 4HAXA 4DCTA 4JLBA 1GM5A 4F93B 2W6ID 1MO3A 4JL8A 2HCBA 4JKYA 4GNKA 1Z6GA 1UPTA 1AS0A 3PUWA 1W46A 2IXGA 3E5HA 3NG1A 2XSZD 1N5KA 2WWYA 3B9PA 2QBYA 1PUJA 1FQJA 4LJ5A 1SQ5A 2DPXA 1DS6A 3OE7D 5FPSA 4OHWA 3QBVA 1O3YA 5B64A 2D2EA 3V4FA 3QEJA 2VHCA 2RH5A 1KI6B 1G7SA 2EW1A 2OM2A 1TQ4A 4MYTA 1G5TA 3CX6A 1XU4A 3QEOA 1ZC4A 2ZS9A 3AVXA 4M9SA 4EFNA 4ZDKA 3PCRB 5AK0A 1D2EA 2A5JA 3IIJA 1H65A 1XF9A 4MYCA 3K53A 3DMNA 4CEHA 2A5YB 4AURA 2P67A 3JVUA 2DY1A 3MFYA 1COWD 2J0UB 2R2AA 4NCKA 2C78A 4OJQA 4X8HA 4Q9JA 5LPNA 2F1RA 3ECCA 1CLUA 3ASYA 5C2JB 2H17A 2AK2A 3W6OA 5FPTA 5DO9A 1D5CA 4DDVA 3OEHA 1IOZA 4HUQA 2CBZA 3TAHA 3PEVA 2GVDC 3FMFA 2QMUA 2ZRFA 3HYRA 2IW3A 4PZLA 1E99A 1R0WA 2G88A 2OFWA 2QPTA 1E79D 3ICEA 5JS7A 1GKIA 1MV5A 4FMDB 5KDLA 3D6TB 3T35A 3GLGE 3LXXA 4F7WA 2OBLA 1GKYA 4TLBA 4Q4JB 5KNCA 4RKFA 4NONA 1GNPA 3GJ8A 3FGNA 4B43A 1MH1A 2OUKA 2PT5A 5GVSA 4DC9A 3FMOB 2H8KA 4HZUA 4OQMA 4HEJA 5FL3A 1RYHA 5F2EA 3T1OA 3R9IA 3MLEA 3W3AA 4BASA 1OFUX 2BBSA 1F3OA 2J3EA 1FX0B 3C14C 4Q18A 1CU1A 5H70A 3K9LA 4NBSA 2ZRBA 4R98A 1N0VC 3QE0A 5HZHA 3QXXA 4JYCA 4RZ3A 4BFZA 4AYXA 3FOZA 3T1QA 2IS6A 1WDTA 2R6AA 5JEEA 4NZYA 3KXIA 4IFBA 2JLVA 4PPFA 3AKDA 3IGFA 5H1YA 1NBMD 1XEWY 4IW3B 4Q03A 2DWOA 1XJQA 4WBSA 1KDTA 2RGDA 4JBXA 1E2NA 4XVQA 1GUAA 5EXPA 3TK1A 3AKYA 4US1R 5LB2A 2C98A 2O8EB 4RKEA 5JI2E 1TEVA 2ZYUX 4JLKA 2ZRGA 1JEDA 3HR7A 3QG5A 1XDBA 4RVCA 1J8YF 1J99A 4DLZA 4CEJB 4AY2A 5CB6A 1E9SA 1ZNWA 2FGJA 3RC8A 2ZITA 4R2IA 5L3RA 4E07A 1US8B 2ZRKA 2VSXA 3AVYA 4U00A 1IM2A 4PZYA 3OEHD 1NMZA 1CIPA 3LBIA 1E2JA 2BMFA 4RJLA 5EE9A 4EFLA 3FKSA 2A5DA 4A92A 3GFOA 821PA 4WAUA 1Z29A 2AK3A 2AL7A 2FZLA 2OZEA 2ZTSA 3I72A 1D6JA 3KTAB 3M6AA 5FBWB 3EASA 2Q3MA 5GADl 4GZLA 1BOFA 2ZSAA 1QDEA 4HB4A 4OHXA 2ONJA 3EPKA 2EFCB 1UEIA 1RRFA 2QMOA 1FOEB 1YZKA 4AI6A 1U0JA 2R6GA 1W0JA 1OH6A 2WWGA 2CVHA 2QORA 5IF9A 2V7QD 2WSMA 3T5DA 4KSBA 2IK8A 2VF7A 1OXXK 1JR3A 1Q1ZA 4LK2A 3UATA 3GLFB 2GJSA 4ZCIA 5CK5A 3UMRA 4URYR 4CVNA 1M7BA 2WMOB 3PXGA 1GTVA 3L0SA 1KDRA 1DTSA 3OIWA 3T1VA 4WW0A 5CM8B 1Z0DA 1E2FA 1G4AE 2QMHA 3MAAC 3LV8A 3A6PC 4EUNA 4BGDA 1ODFA 4E03A 2ZVQX 4FN5A 1KYIA 1ZCAA 2CLDX 4IOKA 3BB4A 2QPOA 1K5DA 3UKDA 2A30A 4Z8XA 1KMHA 1OFTA 4LWZA 3O8DA 1ZM2A 3QJYA 2IA5A 1MO6A 1BS1A 4LSGA 3THWB 2O8BA 1XTSA 2ZRCA 1KAGA 2IYRA 3IHLA 2VP4A 2O8CA 4XD7A 1G3MA 4MQBA 2Y8EA 2FDCA 2CCGA 2W2TA 1UDXA 1OFHA 3SS8A 1Z0KA 3HWSA 4OK5A 1SGWA 2VL7A 1OLOA 2SHKA 1T3HA 421PA 3WHKA 4WXPA 4ASUA 3E70C 1CTQA 4FXPA 5JWOA 4ZIRB 3VR2A 3U6KA 5G3YA 4R2HA 1QHHB 4FINA 1XEFA 2F6RA 1ZC3A 1HT2E 4LYFA 1U94A 4MYHA 2WWIA 4PAMA 3N70A 1N3BA 2CJWB 1GZSA 3AGPA 3O8RA 4L5BA 3NKVA 4G01B 1MABB 1W0JD 3S1AA 2ZAMA 3VNVA 5EE1A 3SYNA 4RD1A 2OBNA 2PCLA 3QVUA 4M1MA 4LHYA 2OV2A 3LO5A 2VYFA 1JR3D 4U02A 2KI5A 2A9KA 4MKFA 4DWJA 1RVDA 4IVPA 3PUYA 1E2EA 5EE5B 2D06A 2CL0X 1U2RA 2YOHA 4FCWA 4XVRA 4CEIB 1P2SA 1E9FA 2JJ1A 2JJ8A 2WJGA 1JXMA 2QU8A 3B85A 1S8FA 1SHZA 4MDEA 3B78A 1U99A 3SN6A 3OESA 4I4LA 4C7OB 3UANA 5KPJA 1TQ6A 2A2ZA 3SHFA 2UVQA 4LOAA 4PO1A 4F91B 5DHFA 1XJCA 2KBEA 1F48A 2YZ2A 4C0JA 4XVUA 1NVUQ 1NKSA 3WMGA 3NEJA 1KO5A 1LF0A 5B2ZA 1NIPA 1U98A 3IKJA 2WVJA 4CRWB 1VIAA 5BXQC 2VPPA 2WWWA 4GP6A 1U8ZA 1TL7C 2CEAA 2QMEA 2PZEA 3KJHA 4JIMA 1JAIA 1K8RA 2QRZA 3LVQE 4EJSA 4ASUD 2ERYA 3QUSA 4M22A 3T1TA 2J87A 2XAUA 4PHHA 1L4UA 1OFIA 4TSFA 5BYJA 4C7OA 4Y0VA 5BN4A 2AHOA 1KNXA 4CDGA 3QPWA 3U3MA 3QIAA 4DUGD 1A5TA 3OIUA 2D7DA 2PT7A 2J41A 3K09A 2OCPA 5CLLA 2JLWA 2WM9B 3OFNA 1HE1C 1T5IA 4UNSA 4DLSA 4B48A 4MITA 1C1YA 4UXHA 2XZOA 2B7CA 1KY2A 4W5JA 3VKWA 2DWPA 3EPJA 4KVGA 1EFRA 4XOIA 1BYIA 1J7KA 1EGAA 2XTZA 1G8FA 1ZU5A 2XNDD 1P60A 1KMQA 2ZI7A 2JJ1D 1F2TA 3HU2A 1LS6A 1RJ9B 1CR1A 3QPVA 4C0LA 3VKHA 3U60B 3G0HA 5FUWA 2DWQA 1K6MA 1WA5A 2ZI3A 2ZREA 4M9XA 5TY0A 4D0LB 1IBRA 4US0R 1SZPA 1ZBDA 2UZ3A 4B76A 4BLTA 4Z1MA 2ZRHA 2X77A 5CITA 2ZJ8A 1DO0A 1ZAKA 2ZJZA 1Q1EA 3ZZUA 3SJCA 4QBHA 2P5TB 1KI7A 2QN6A 2WPDA 5BYKA 1Z22A 1E2PA 2JATA 3BFVA 1JECA 1EK0A 4QGGA 3RABA 1JB1A 1Z6XA 4TT3D 2XB2A 1G1MA 3W5JA 5G3ZA 1X6VA 1BIFA 4TTRA 1E3MA 4OI0A 3AB3A 3L8YA 4CZ2A 4AIIA 1F6BA 1IY1A 3MG9A 2ZJYA 4UNNA 1Q3HA 2BBOA 2ZI5A 2ZPTX 4B6FA 1EFUA 2QBYB 2WJVA 3MMPA 4ON9A 4HATA 3D7MA 2V1XA 4B32A 5K8UA 3ZH9B 1ZRHA 3IPYA 4W5WA 4B2LA 5H8WA 1EWRA 3MUFA 1CRPA 4TQ9A 3V4RA 2NO0A 3CRVA 5IRCD 1G8GA 1JQLB 1DEKA 4EPYA 2VF8A 4WOPA 2VP9A 3W90A 3VNUA 5TV2A 1NRJB 5DI3B 3DKVA 1ZVQA 1YZNA 1W36B 3ADKA 1YR7A 3Q5DA 4IDPA 4D26A 4DXAA 3RC3A 2J7PA 5FTJA 2EVWX 3FTQA 4JL5A 4DT1B 1HTWA 3HDTA 4NHOA 4IVRA 1G41A 1HURA 4Z1MD 1N6PA 2GETA 3BFKA 1VPLA 4HUQB 3GLHE 2HDNB 1YRBA 4KI0A 5FOWA 1KI2A 2G0TA 4AG6A 2GBLC 1L8QA 2WPDD 2G77B 4O25A 2WJJA 2QG6A 3CF0A 1NSTA 4DB2A 1TAGA 1TX4B 1Q1BA 4V0MA 2WBLC 2ZJBA 2WZQA 2Z83A 1X8JA 4P4SB 3VU9A 4UKDA 4BZPA 3U61B 4HZUB 2P6RA 3EZ6A 4L9SA 1XD2A 1ONBA 4QNRA 2IS2A 5FI1B 3CWQA 4EQ6A 1G18A 1NF3A 3K9GA 4KV9A 1TMKA 3GJ3A 3K0FB 5JJLA 2HV8A 1GL6A 3NBYC 2YVUA 3BB1A 1S4QA 3EXAA 1ZD9A 2NO6A 2XOKD 3PQCA 5CJ2A 2ZJ2A 2ZI6A 3CZQA 3U4QB 1TF7A 1QRAA 3SEAA 2RGNC 3BAFA 3SFVA 4JVSB 1KOFA 3VR6A 1DARA 1S2MA 1TNDA 4LBVA 4UQOA 4DEYA 4DIDA 4QBFA 1NN5A 3Q3JB 5GJWC 4TL7A 5JBQA 2JCSA 1L4YA 3C15C 2J7PD 1XPRA 1GFIA 1AK2A 1KJYA 1VECA 5FFMA 2VEDA 1UKEA 1Z47A 3ETLA 4G3XA 5L3QA 4QBIA 3VFDA 1XBTA 3L0IB 5K8TA 1U0HC 3LFUA 3GPLA 4DJTA 3RRYA 3UMFA 2ZR9A 2ZXUA 1NG1A 1RYFA 1RRPA 4RFSA 4Z54A 5JRZA 1II8A 1UADA 2QA5A 4Q1BA 4ZCLA 4OI4A 4C9BA 1MR3F 4BFXA 2R9VA 4Q21A 4KITB 1OV4A 1TF5A 3EIHA 1I2MA 4IRUB 5TXGA 5SZIA 5KDDA 2A78A 3ND9A 3PG5A 5J5CA 2PEZA 5EE3A 4BEJA 1AN0A 5E95A 4B33A 3Q5EA 3BRWD 3LVRE 5KNDA 1N0UA 3R8FA 1Q20A 1VIYA 3SE0A 1VG0B 1R8QA 2IC5A 3F0TA 1IXSB 3P26A 5CK4A 1KDOA 1E9CA 2CHQA 2IHYA 1A7JA 3EPLA 2ZUBA 3IEUA 2ZVPX 4BZQA 2C5LA 4JLOA 2P3SA 4IDOA 4GT1A 1G7CA 2NO1A 4QG7A 1CRQA 1OJLA 3H84A 3TUJC 3EWAA 1XTJA 2GZHA 1OB2A 4OHVA 3J81k 3IBGA 1NY5A 1A82A 1U8AA 3IBYA 1YKSA 3WY9A 5CIWA 1N6NA 2ZJ5A 1UKVY 1WQ1R 4JSYA 2J0VA 3MWLA 2BMDA 2O8BB 3ASZA 2O8CB 4M9QA 2GK7A 2CLSA 1KHTA 1WXQA 4Q19A 2ZRPA 1N5LA 4QOSA 4AYTA 3A4NA 1GNQA 1NNEA 1UKYA 2GEVA 4YLGA 2JAQA 4M21A 2VQSA 3RS3A 2Q3HA 3DVLA 1OE0A 4URXR 2J1LA 4YMSA 1UF9A 3T06B 2CK3D 4A0GA 5HPYB 4KFSA 3BH0A 1VCOA 4I81A 4M4SA 3ZLJA 1SXJB 1TTTA 1HQCA 3K0SA 1A1VA 3K0AA 2FSFA 4H1VA 4TLEA 5G41A 4KFTA 4B2PA 4I99A 2V8OA 3UG7A 3H86A 5IDVA 4YDHB 3B13B 1R0YA 3U3OA 3UK6A 4ZV4A 3DZ8A 3I32A 3S1AB 2V4ZA 2O5VA 1P9RA 2XSZA 4JLAA 3OF5A 2J45A 3IIMA 5DYIA 1YQTA 3TW8B 2ZUDA 3GJ0A 4JJZA 5FPKA 1E2HA 4MGYR 3OEED 4NYMQ 1I4LD 3GFTA 1WCV1 1F5NA 5ELXA 1B23P 4Q4AA 2UZIR 1EG7A 1Z3IX 2AWOA 1KKMA 3CF6R 4OKSA 1IN4A 1JPJA 2XTNA 4YC7A 5D3MB 1N6HA 5JSZA 4X8MA 3DPUA 3GEHA 4PXAA 1D9ZA 2FSHA 2QY9A 3ADCA 4OHZA 1SVMA 3U6BA 2YKGA 2EQBA 3QNUA 2EFHB 5FTKA 3G5UA 3VQTA 4QHYA 4DCSA 2QROA 1NVVR 5A5GA 4IKEA 2OT3B 5FUXA 4Q66C 3GFPA 3LA6A 1HYQA 2CCJA 4BFWA 4PANA 1A2KC 5BW8A 3TNFA 4IOLA 1YZQA 4AG5A 3A8TA 5KDOA 1QHGA 3LH5A 3GCGA 1T6NA 4CT4B 1SVSA 3EA5A 1UEJA 3DL0A 4B3XA 1NSFA 1FFHA 4DLRA 4GBMA 3FMIA 3LW7A 4I1VA 2IXEA 4V03A 2RGGA 1FQKA 4D82A 3ZVMA 1CR0A 4C0AC 4URWR 4QGHA 3NC1C 2BM1A 3PUXA 5EZ6B 2QE7A 1N6IA 1TEXA 3F8TA 1BKDR 4HLQB 2P5SA 5LBIA 1WP9A 1AA9A 4A9AA 1I2DA 1DVRA 5L3SB 3RLFA 1QBKC 2BIFA 4C0KA 4KYUA 4TMKA 4LV6A 2Z5FA 1VG8A 3QOFA 1NBMA 3FHOA 3QKTA 2G1JA 1IN6A 1WMSA 2GAOA 4C0BA 5J4HA 1G7TA 1IJEA 2I4IA 4A8JC 2OSBA 2V1UA 2QUZA 1PVOA 5F9FA 1K5GA 1UAAA 2F1JA 2JDIA 5FBLB 4A2WA 2HCJB 4PAOA 1E2KA 1G3UA 2BKEA 4OQLA 1KK1A 3THXA 2ECKA 3LDAA 4LYHA 5FOVA 2CHGA 3TE6A 3CONA 2VLIA 3VX4A 4EPTA 2OEPA 3NBFA 1Q57A 4YMWA 3KFVA 3QKRA 1SULA 4ZDIA 3PFIA 2A5FA 3LX5A 2QSZA 4C3ZA 4CGZA 4W5HA 5AR1A 4XIGS 1ZMXA 3EIQA 3F5FA 4CIDA 4Q02A 2Z43A 4D4JA 5DIFA 2AD5A 3LAWA 3QQ5A 2GJKA 2VSFA 3TIFA 3JZAA 1XB2A 3B9QA 3NWJA 3TSZA 3VTKA 4UNPA 4UJ5A 4QJ3A 2VH5R 2IYWA 3THOA 2PJZA 4XTRA 1G3QA 2QZ4A 5A0FA 1JR6A 2ONKA 1LS1A 4A2QA 1DAEA 2I1QA 3NC0C 1CR2A 4JLMA 4LDJA 4HUTA 1ZW6A 3ZD7A 4G5OA 4M2LA 2V7QA 3RS2A 4ZCMA 1TU4A 2P65A 1P72A 1W47A 4CT5A 2KBFA 521PA 2RGAA 2QTVB 2BCGY 1P73A 2GA8A 4M1YA 2QE7D 3NHAA 1IY0A 1Q1QA 3BB3A 4PC6A 4TMXA 3TR5A 1XXHA 2V6IA 3ZS8A 1FTSA 3CX8A 3E1SA 3QXSA 4HB2A 3SFZA 3TKLA 3GJ7A 1UBCA 1TPZA 2XJ4A 3R9XA 4P4UA 2H7VA 5CB8A 4PSAA 2IBMA 2QNRA 4BPBA 1LNZA 3TBKA 1M7GA 2NG1A 4Q1AA 5BWMA 3K70B 2FA9A 2OXCA 2FE4A 1FUUA 2BHRA 2JDID 2F43A 4Q4LA 1AQUA 1FMLA 2BKUA 1XNJA 1JALA 1G8HA 2W6JD 4P4TA 5JECA 2PMDA 5EXXA 3AGQA 4NP6A 1F2UB 1SVWA 2FSIA 5FPYA 3U44A 3T15A 4KYIB 2R6FA 3F3YA 3RSLA 1OH7A 2H1LA 4Q7LA 5J4KA 1AQYA 3WXMA 1HQYE 5CDFE 3CPJB 4JBWA 1FPMA 2KE5A 3N2IA 3RSOA 4YQFA 4AC9A 3Q8XB 1YZTA 3KFXA 3KQHA 1XX6A 3ZVNA 3FFAA 1CJMA 3VU9B 1R0ZA 3THYB 2FFHA 2PJRA 2GF9A 2V3CC 2C77A 3SI7A 2FFAA 2FX3A 3KXKA 1RPZA 2N46A 2AN9A 3KJEA 4OK3A 1G16A 4WA7A 3B6EA 3V00A 3ZQ6A 2N42A 4Q4HA 4WZBE 4D4LA 4DSNA 4PC2A 4MGZR 1W1WA 3WMEA 3QG1A 1RIFA 3JVVA 4HB3A 1M8PA 4EIWA 3P20A 2VSOA 4HAYA 5FUVA 3RS4A 3GLIA 1QZXA 5FL7A 1OSNA 1MT0A 5LB4A 4WZAE 4OQXA 3EW9A 1G5RA 2L0XA 3IUYA 1MOZA 1N5JA 4EKDA 1UDWA 3SR0A 3AM1A 3RS7A 5CLQA 3GJ5A 4JJKA 3CRQA 4UXJA 4PHTA 4BLQA 1E2LA 1G19A 1CJUC 2IYLD 2JLQA 2FNAA 4NU0A 2RAPA 4TN1A 2HEIA 2WSSA 2J0SA 4DB4A 1YHNA 1S3GA 2HYDA 3BBPA 4HAWA 3T61A 1KI8A 3KB2A 4B35A 5JHGB 2DFKB 2ZSEA 1XEWX 2GBLA 2EYQA 1X8KA 2IYSA 1DPFA 2HJVA 1RC8A 2QEQA 1Z0FA 3QKSA 2R6DA 2GHIA 4RD4A 2GTPA 2FV8A 1E2GA 3CPEA 1II8B 2HT6A 3LX8A 5CIQA 5JZVA 2PCJA 5KSZA 1Z0IA 3CZPA 1AGPA 3EWSA 4CF7A 2W58A 4X8LA 3SNHA 4U5XA 1CR4A 3IO3A 3QF4A 2NMVA 1E2QA 3PVSA 4BE7B 3EZ9A 1OB5A 1EWQA 5GJCA 2CE7A 4IOJA 2NPFA 1TUEA 2PZGA 3FFBA 1UJ2A 1EFHA 5EP3A 2ATVA 5EE0A 1A2BA 1KSFX 3KZ1E 4MGKR 4MRVA 4DUGA 2RMKA 4U7DA 1G6OA 3KQUA 3CM0A 2GXSA 1AJEA 5DLQC 3SQWA 2ZROA 4B3BA 4D6PA 4PHFA 2FPKA 3L43A 5TARA 5J4LA 2RGNA 2FF7A 2O52A 4JT4A 2C9OA 1YRAA 1T8TA 3GEIA 1W0KA 3A37A 3TW4A 5AWFC 4NYJQ 3BC1A 5FL7D 1KK2A 2XNDA 3GLFE 1JBKA 2OESA 3TUIC 4DHEA 4NPHA 4D4KA 2J59A 2O0KA 4LJYA 2ZYVX 1X8LA 4M9ZA 5DI9A 1D2MA 4L9WA 1ZUHA 1E94E 1SVIA 1WBBA 2C95A 2V9PA 1DADA 4BLSA 1MO5A 2AFHE 4ZI2A 1ZD8A 2O8DA 1DOAA 5LDDC 5JJIA 3P27A 2WSSD 5BN3A 3PV0A 4QGFA 1T4GA 2QTFA 5DE3A 5TVKA 1OYYA 3KJGA 2D74A 1BMFA 4L4UA 5FTMA 1AKYA 1N6KA 1QF9A 1S3SA 2BJVA 1U9IC 3C5CA 1E9BA 2C99A 3NVAA 4FW9A 4LBZA 4PPGA 2OCBA 3W5IA 3AVOA 3M1IA 2OHFA 1XD8A 2WICA 1W4BA 2DFLA 3DKPA 5J47A 2GCOA 3HPRA 5EQTA 3TJZA 4DLTA 1DAFA 4TT3A 1GP2A 3WHLA 3EC2A 3K0AB 3KUCA 2FPMA 3DOFA 2GDJA 4Y0AA 1S9HA 2P2LA 1E4YA 2YV5A 3LD9A 4TMVA 2JASA 2WAYA 4HB0A 2RGEA 5E3HA 1W36C 1OXSC 5C46F 4KAXA 3I3SR 2ZRLA 4C30A 3VR3A 1GDDA 1EX6A 4NYJR 4D2IA 3L0OA 1KZ7B 4JYBA 1P7CA 1YVDA 5DN6A 4A6XA 1U0LA 3GLGA 4JVMA 4EPVA 3R9WA 1N6LA 1NG9A 4W9MC 2YHSA 5EJEA 1NLZA 2IHBA 3FYHA 1VCIA 3KKQA 5L8VA 4QNMA 4ZPXA 2VHTA 1Q0UA 1W0KD 2HLDA 3IQWA 2WIAA 3IIKA 1GL7A 5E7MA 3MWKA 4JL6A 3SC3A 1EFCA 1ZU4A 1JQJC 1KKLA 2GCPA 5D3QA 2KB0A 4ARZB 2I3BA 2WJYA 4TZ6A 4DSUA 5KHOC 2JIZA 2HT1A 2CCKA 3D31A 3NH9A 4FMCF 4RZXA 5FH9A 3GQBA 3V9PA 2QAGB 4B34A 1R10A 4HLUC 3I5XA 4JMPA 1SVOA 4UNQA 4NCHA 1VKJA 1NKTA 1BMFD 1M74A 5HE9A 4DSOA 4PQFA 2ZS8A 3RWMB 1OXTA 3CH4B 2WJIA 4PQRA 1VYTA 3DDCA 3UWOA 3Q7PA 2A7QA 2LCFA 4XWKA 1SKQA 3GEEA 3TLXA 1SVKA 3B8HA 1E96A 3W8RA 4PC1A 3HP1A 2X1VA 1KI1A 1XPUA 1WB9A 3UWKA 1E0JA 4P3YA 1WRBA 2JGNA 4G1UC 2YOFA 4ABYA 2Z4RA 3AF4A 2QP9X 5JWRA 3KKPA 4KBGA 5GJVC 5E7JA 3EX7C 3NTUA 5CDFA 4EFMA 1KO7A 3DM5A 3M0EA 1SKYB 2DFTA 1G20E 1XCMA 3BH7A 5DN6D 2V54A 1LVGA 2XOKA 4O2RA 4HZIA 3AF0A 3CNNA 4FIDA 1GL9B 2BVNA 3RRMA 5JJKA 2EFGA 1ZM9A 1IAQA 1G9XA 3PR1A 3QVVA 2XITA 4ILEA 2HLDD 3CH5A 1Z0AA 4OJKA 1VYVA 4Q4JA 3REFA 3RANA 3VR5A 3PIRA 2RGCA 2JLUA 1QG2A 4ERNA 1P5ZB 2Q9AA 2XEXA 4TMZA 5JI3E 4CEHB 1WE2A 3TGPA 1OW3B 4A2PA 1YR9A 5KSPA 1N5IA 4M1OA 1VG9B 2F7SA 2JIZD 2CE2X 3RWOA 1II0A 4DDWA 3VKGA 2ODBA 1FX0A 3KKMA 1S96A 5KSYA 2X2EA 3ZIAA 5H68A 2R44A 4OL0A 1C4OA 4GOXA 2G9NA 4V02A 4QM7A 2XXAA 3EZ2A 4Q9LA 2OFXA 2F9LA 1DAKA 3EA0A 2B92A 1G8YA 2JJ2A 4Q7KA 2FFQA 1DBSA 3C8UA 5AUPB 3IO5A 4KO8A 3FPAA 4PZZA 1UFQA 3CPHA 2IEYA 3PITA 5EUQB 2D4HA 4XH9B 4V0NA 4OI1A 1GAJA 4GFDA 1GITA 4YMVA 2O8EA 2IL1A 2EYUA 4DKXA 1R5NA 2ZR0A 4NE2A 2FOLA 1ESMA 1CJTC 4ZDJA 1CBUA 1RE0A 1M7HA 1QHYA 1UBEA 4CEJA 4BFUA 2CNWA 3AUYA 3P4YA 4E09A 2ZRDA 3B1VA 3T12A 3A1SA 4JSTA 3X1ZA 1N6RA 1XXHB 1FL9A 2QRNA 4Q1FA 1ETUA 3QXCA 3E2IA 4J0QA 1R0XA 4G5SA 5FBQB 3OZXA 4F4CA 3FDIA 4Q9HA 3VX3A 5JCZA 1G64A 2XX3A 3KXLA 1XRJA 4YXWA 1E2MA 5LD2B 1NL3A 1N2CE 1F60A 2E9SA 4DLVA 1XPOA 1IQPA 2ODNA 1T3SA 2JLYA 1P6XA 4DDTA 4TYNA 5EUMA 4P0TA 4QFMA 3I92A 2RGXA 4R9UC 4K8OA 1SXJC 1ZCBA 4KHZA 3EARA 2C04A 3KX2A 3R7WA 2GEDA 4IOMA 4TYYA 1MKYA 2C9CA 2YWFA 4QKQA 1E2IA 4A82A 3AUXA 5JLJA 4IXNA 4LBWA 1OT3A 2KWIA 2ODWA 3ZIAD 1J90A 2WOJA 3MJRA 3BS4A 4Z51A 4NKRA 4UJ3A 1VDZA 4YDSA 1BYUA 2JJ2D 2HJGA 3EPHA 1HEIA 1FP6A 4NMMA 2CK3A 2ZUCA 4M1TA 2FJUA 3B2EA 4ITRC 4LHZA 5A4JA 2QPAA 1XJ0A 4LI0A 3MSXA 5AJWA 1D8TA 3K9NA 2BV3A 2JLSA 2QT1A 4GMXA 1XEXA 3PEYA 2ZRMA 4RCZA 4LHWA 2W0SA 3CKLA 5BN5A 2PLFA 4EAQA 2MMCA 3THWA 5F9HA 1M1YE 3QI2A 2IXFA 2AKAB 4Q4HB 5F3WB 1IXRC 3K1JA 3TRFA 4OYHA 4XTCS 2AXNA 1NJGA 2CNWD 3CNOA 2REOA 1M6NA 3OEEA 3GLIB 2GK6A 4B47A 5DHAA 4ZKDA 2IYYA 4ZIRA 1FNNA 1HE8B 3FWYA 721PA 4YXWD 1ZUIA 4GI7A 1QHHA 5C4GB 1ZP6A 1GRNA 4FWTA 1HH4A 2B8WA 4RD0A 2QL6A 4M1KA 3DOEA 1KMHB 2LKDA 2IYUA 3G82C 2ZU6A 2CJWA 4KFRA 3SZRA 1QVRA 3P4XA 4LHXA 1MABA 2FU5C 1T0HB 2GJ9A 3H2YA 3BERA 2Q6TA 2B8TA 3I73A 4GPTA 4RY2A 3UIEA 2IUSA 3BORA 4LHVA 2H92A 3QKSB 3SOPA 2REXB 1CJKC 1P2TA 2BOVA 3K09C 4GMDA 4BRWA 4RZUA 1Q44A 4FD2A 4C0HA 3DZDA 3QF4B 1Z5ZA 4MA4A 1NMXA 5C1BA 4PQYA 4TYPA 5FTNA 4URVR 1E4VA 4PC3A 1ESNA 2J7KA 2F9MA 2QP4A 3W34A 4IEIA 4A8JB 2YWGA 5DISB 3T5GA 2KSQA 3WNCA 3A58B 4S2EA 5EXTA 3KB1A 2H18A 1GRRA 3U7HB 3TQCA 2TMKA 1AKEA 1TQ2A 1Y3AA 1OIXA 4G5QA 4RCYA 3GD7A 3ICQB 1ZYUA 2MSEB 3W6PA 2ATXA 2YC2C 1WF3A 1CP2A 3RRNA 1E2DA 2X2FA 4KODA 4P32A 3KQNA 2F1IA 3FVQA 3AEZA 5CYPA 4EPWA 2K5UA 1YR8A 1P4SA 5GJBA 2OILA 3TAUA 4D80A 1LF5A 1X3SA 2VRWA 2XNSA 5CM9C 3A1VA 1R8SA 121PA 2AD1A 1NVWQ 2WWXA 3HPQA 1EFTA 2C9YA 2VTKA 1KO8A 3W3ZB 3EZFA 4QHSA 2AWNA 4UXIA 3QKUA 3AVQA 2NTYC 2V55B 3LLMA 4TL6A 2QGZA 3EAQA 4LUCA 2W83A 2ZSBA 1EXMA 1D9XA 3Q72A 4BFTA 4BLPA 5JWHA 4A0HA 1NN1A 2QQ0A 4XSGA 3K0EA 2D2FA 2REBA 4GDFA 3CB4A 1FNMA 5HE8A 2HUPA 3H4MA 4KSCA 2P0EA 3KQKA 3RNLA 1UKZA 1KJWA 2R65A 2Z6VA 2OO7A 1U8YA 3Q85A 5KPDA 3X1XA 4XWAA 2BCJQ 3HR8A 3RYTC 2DYKA 2GCOB 3BFXA 2QM7A 4Q1EA 2NZJA 4EJSB 4F4IA 4FCTA 4HYYA 4Z8YA 3KDSE 4BRUA 1KSGA 3PJRA 3H0KA 1QVAA 2IYVA 2LKCA 3LBHA 4KJZA 3CLVA 2ZRAA 1YR6A 2CVFA 1VHTA 2NO9A 3MGCA 5SZKB 3O8CA 4EDHA 4KVAA 4B44A 1Q12A 4WXRA 3GLHA 3LRPA 4NYMR 1SXJE 4DVGA 3SJZA 4FCVA 4LJ7A 4GZMA 3X2SA 3K70C 3CRRA 2HF9A 4NYIQ 3GLGB 1PUIA 1I4DD 1T8UA 4LJ9A 1DG1G 1GG2A 3U3JA 4BZXA 1IONA 4TZ0A 4HDQB 2ZQ5A 3PENA 3AH8A 1GIAA 1QHXA 2BEJA 4MKGA 3RS0A 3UG6A 3FB4A 3WP0A 2GILA 2VA8A 4Q7MB 1VTKA 3NBZC 5DH9A 3DO6A 3HJNA 1EX7A 4BFVA 3K8YA 621PA 3QSYA 3SQXA 1XWIA 1F2TB 2V6JA 2ZAOA 1KGDA 3CF2A 4N3NA 1OH5A 4IVQA 5EP2A 4ZO4A 3X1YA 2EFEB 1W5TA 3DM9B 4C2UA 2BEKA 2BJWA 4I1UA 1U9IA 4LJ4A 4DDUA 4QXAA 1LW7A 3AVUA 1JPNA 2ZANA 2XZPA 2ZSFA 2O0JA 4POAA 2W6JA 3TVTA 1ANKA 1GRQA 2IYXA 4HAVA 1P2VA 1RRGA 1XCPA 2R62A 1GILA 1W4RA 2F55A 1NI3A 1HUQA 1FTNA 1VG1A 4URUR 1GVNB 3PUVA 2VBCA 2X19A 4H1UA 2ZIAA 1Z28A 1CEEA 5DI3A 1ZM4A 2R6CA 4NYIR 5AJZA 3IEVA 3N2EA 1PZNA 3NHBA 1E9DA 2G1KA 3MWYW 4OI2A 1Z06A 4I1OA 3NBXX 2W00A 3RDPA 2JLRA 5EP1A 1E32A 1KK0A 4P31A 1OKKA 4F38A 3EC1A 4DT1A 1UBGA 5SZJA 1KDPA 1KY3A 1CJVC 2A3RA 3FMPB 2IWRA 3T34A 4M8NE 1G3RA 1OPXA 4LRWA 4LJ8A 3TH5A 1DAIA 4JLNA 2OAP1 2VP2A 2E87A 2VO1A 2WWHA 3I8SA 4Q01A 4M1SA 1TUIA 5FUYA 4AD8A 4MGIR 2ZYWX 1QHNA 2GAAA 2BMEA 4JS0A 4PPNA 1XTKA 4C4PA 1MRSA 2IYTA 4PHGA 3AVVA 4LCBA 1FW6A 5HKKA 4A4DA 1H8HA 2QI9C 3IDQA 3MCAA 1Z6YA 1XTRA 3QY0A 1G5PA 1IN8A 4FMDF 2VP6A 3BGWA 1MRNA 4P4SA 4S35A 4EPXA 2CL7X 3SYKA 4HLUA 3AKCA 4IXMA 4AWXA 1W2HA 1H8EA 4G5GA 2IS1A 5BQ5A 4TQAA 4HDOB 5HTKA 1CXZA 2NIPA 2YYZA 1ELOA 3GJ4A 3K0FA 4PTLA 3A1WA 3WNDA 4B74A 2ZJOA 4C0QC 2XXAB 4DLXA 5GVRA 3ZDQA 4HI0E 4N0DA 4AKGA 3AF3A 2FEOA 3U4QA 5FBRB 4B6EA 5C4MA 4OHYA 4HAZA 2RHDA 5JS8A 4LYJA 2HF8A 2E1RA 1R5OA 1E6CA 3A1TA 3FKQA 5DNYB 2GZAA 3WNBA 1E98A 2J46A 4OBEA 2CL6X 5KYKA 3WYAA 5P21A 1GNRA 2ZRJA 1B0UA 4BLOA 1W36D 1P62B 1S9DA 4LV8B 4YMUA 1GKUB 2WAXA 1IY2A 3K0CC 5AUNB 2QTHA 3OIVA 1RZ3A 1GOTA 2DHRA 1G4UR 4L16A 4N1AA 1XD2B 221PA 4LY6A 1OKKD 3PUZA 3SDZA 4E22A 4EQ6B 3L8ZA 3ZQJA 1R4AA 3VHXA 3I1FA 2JEOA 1PV4A 1LV7A 3VHLB 2ORWA 1ZIOA 3KJIA 4RD2A 4NH0A 3NIBA 2XB4A 1YU9A 2NOAA 3A36A 2PMKA 1BO6A 3AF1A 3IHWA 1N6OA 5KO2A 1QHSA 4II7A 2ASEA 3A1UA 4NDZA 5J4VA 5HKKD 1H8HD 1XD9A 2ZEJA 3CW2A 1E1RA 4BFSA 4EPRA 4QRHA 3AKEA 1P3JA 2JA1A 3Q9LA 2UKDA 5JHHB 3ZZ0A 1OIWA 5FR2A 1ZNXA 2CDNA 1Z0JA 3BWDD 4DLUA 4Q9KA 4MRPA 1E0KA 1C9KA 3R7WB 2IX3A 2Q3FA 1H8ED 4QGAA 1KJZA 4JLVA 1AM4D 3MD0A 2GKSA 3IQXA 1GSIA 5L3QB 2YOGA 1YJ5A 2WJHA 3C41J 4JLJA 3ZYCA 4AYWA 2PX0A 4US2R 4ESHA 3QF7A 4MUAA 1IHUA 4PO9A 4RFSB 1R6BX 3DMDA 4LX0A 5B30A 2JLZA 8OHMA 3TQFA 2WIBA 1X86B 2GF0A 1IJFA 1II9A 1AZSC 2G3YA 2FSGA 1KI4A 5J4YA 4QM6A 2NGRA 1XEXB 3PEWA 2OCAA 1FUKA 4DZZA 5JEDA 3ONWA 2B6HA 2IEZA 1V5WA 4D0NA 1CS4C 4HAUA 4V0ME 1Z83A 2F1HA 4LPKA 1Z2AA 2WTUA 3WBJA 2YC4C 3NDBB 5AJVB 4AK9A 2PL3A 2J5XA 3SHWA 1Z8FA 2XZLA 1PJRA 1G6HA 1NMYA 1Q22A 4BFYA 3W8NA 3CR8A 4LV5B 2QAGC 3LY5A 3VAAA 2GCNA 3UPUA 1PLLA 4A36A 3BH6A 1O87A 3BOSA 2IF0A 3FKSD 4JVNA 1DO2A 2ODEA 3CBQA 1M2OB 2QSYA 1QHIA 2O8FA 1FMJA 1OF1A 5HR5A 3B1ZA 4URZR 1SXJA 3I5YA 1S0UA 2BDTA 3SBEA 1E1RD 5ANRB 4B3DA 3ZVRA 4MKIA 1KI3A 2C2HA 2OBMA 2FG5A 4LZZA 1A4RA 1KTVA 2DR3A 4R7ZA 1J2JA 4MRNA 1Z08A 4PR0A 1KO4A 1Y63A 1ZNZA 2AFIE 4PX9A 2ORIA 4RZ2A 4WIAA 5L3VA 4D25A 1EESA 2PBRA 2FWRA 5K8IA 4AKIA 1Z6AA 1DELA 4XSHA 4NCIA 4MDFA 5KTYA 2H5EA 2WKRA 3JZMA 5FBVB 4PPQA 2D3WA 2BBWA 4TQUS 5FOSA 2G6BA 4M1WA 2XJ9A 4D4MA 1N25A 4FMBB 2CHVA 3LQRA 2OXRA 3LBNA 4ACBA 4DLWA 1R7RA 4NCNA 3X1WA 3P32A 4MUBA 3UMSA 3KQLA 1I4TD 2ORVA 4LC1A 1X1RA 3LXRA 5D3MA 1YZUA 1Z6TA 4FWIB 4YONB 3K9HA 1KAOA 5JRJA 3RRZA 1Q3TA 3CNLA 4HLDA 4TLCA 2VP5A 1G17A 6Q21A 4QL3A 4PSVA 1E9EA 5G53C 1OIVA 3PEUA 2VP0A 3ZD6A 1NIJA 4ZKEA 2JLXA 1JJ7A 3EG5A 3AP1A 4L15A 4TWZA 4XD7D 1E9RA 4JKIA 4LJAA 4IJMA 3U7EB 4HSEA 1QG4A 4P33A 4G5RA 4O3MA 5TB5A 2QAJA 4TLDA 3CR7A 1AIPA 3L0PA 5JCPA 1NY6A 4QC2A 1G291 3ND8A 3CO5A 2CMKA 4GSYA 4DCUA 2CXXA 1JAHA 4Q4AB 1P9NA 2VHJA 1D2NA 4KFUA 4IHQA 3GMTA 1YZLA 1ZINA 1SXJD 2C96A 1IN5A 4FMCB 4IDQA 5JSZB 1VHLA 2NO7A 2XTMA 3FE2A 1W49A 1SVLA 1IN7A 4Q48A 5HCNA 1NVXQ 4GOJA 1BH2A 3MRSA 2YJTD 2Q21A 3B1WA 3TMKA 2WKQA 1XMVA 3EZ7A 4M0LA 4TYWA 3RAPR 2FN4A 4V0OA 1W4AA 4CW7A 1OYWA 1XMSA 4LGMA 3U3RA 2IYZA 3GJ6A 1E69A 1XZPA 2EWWA 3I62A 2YINC 5L3SA 4X8OA 1XP8A 1KI6A 2ZSDA 4M53A 3WBKA 5IT5A 2IS4A 4JLPA 4YMTA 4TYQA 4QHTA 1UBFA 2OG2A 3NEYA 2OE2A 4B3FX 1KSHA 2ANCA 4JT2A 5LD2C 4A0RA 1NN0A 1TF2A 4KCGA 3WRXC 3GLHB 1Z07A 3N5CA 2B21A 2BC9A 5HCIA 3ADDA 3OHMA 2RCNA 2J0UA 3C7KA 5CJPA 4B3CA 2GXAA 2MSDB 5JMTA 2VIIA 3OIYA 4OK6A 2J9RA 1JNYA 4FI3C 4BLRA 2NPIA 1E0AA 1DAGA 2WOOA 4TLAA 2QQEA 4C2TA 2Q9CA 4TL8A 1X1SA 2P6NA 4WZ6A 2GJAA 3RS5A 2WHXA 4DCNA 3RVBA 3EIEA 2ZRIA 1RRCA 2GWHA 2ZR7A 3MJHA 4B3GA 1TU3A 1U81A 4R71A 5B58C 4H9GA 4DCVA 3AVPA 4TSFD 3U7GA 3WRYC 1P9WA 2BM0A 4HLCA 4TMWA 3AVTA 1ZJ6A 3AF2A 1KNQA 4O0MA 4PAQA 1V43A 1OH8A 4DEXA 3R20A 2NQ2C 4G0NA 5G40A 3THXB 2Z4SA 1G8PA 4LBYA 3VR1A 3UXMA 3GJXC 3OFND 4NCJA 3CUEF 2VHQA 3LW8A 3QKRB 1CKEA 2AKYA 1M34E 2KJQA 2ERXA 2OCYC 2PX3A 1R5BA 3IPXA 3LLUA 4TTPA 4A15A 2ZM5A 4MH0R 3I4LA 3W9YA 2NZ8A 1EFRD 1JI0A 2FMXA 4V0KA 4Q00A 3BK7A 3WYFA 3D8BA 3QXJA 4TMTA 3CRMA 5UKDA
chains in the Genus database with same CATH superfamily
4IS2A 1P31A 1MAWA 1RKBA 3K0HA 2QRHA 1ZM3A 3QXHA 3R3ZA 1Q0PA 1XMJA 1G21E 1K92A 3AR8A 2EL7A 3F6YA 3SYLA 4XFKA 1AGNA 1KSJA 1T3LA 3C87A 1K8ZB 3FCCA 2Q2VA 3BIOA 2GXQA 2PIDA 4R81A 2JRCA 5KWJA 3I9OA 4RANA 3CB2A 5EPUA 3U2QA 2LIVA 3ZVLA 1EIWA 2WSIA 3EK2A 4Q1DA 2QJOA 4OLHA 2GESA 2WTAA 5THQA 3WP1B 2QP3A 1SHLA 1LJLA 4X5OA 5JAPA 1Z7GA 3QVMA 1F2UA 4Y30A 1LU9A 3O9VA 3HRIA 4J16A 4QUIA 2FUNB 4Q16A 2FEMA 5FPHA 5HZKA 1SA0B 2P9EA 3PXXA 4KBFA 4JI0B 1AVTA 2QE6A 3OU2A 2HTEA 5E4FA 4Q7JB 5BSFA 3B1YA 3ICWA 2PH1A 3MINB 2QNIA 1L5GB 5ALEA 2XEDA 3Q3IA 2CLIB 1SKYE 3R9XB 1DG3A 3OUZA 1OI2A 2JNWA 3JQDA 3F71A 3OT1B 4WVFA 4BEBA 1PLJA 3COZA 3G5AA 3E9EA 4OO3A 4U9IS 1XN4A 3TAXA 5IHPA 2QZPA 1J7JA 3GCXA 4L78A 3JU3A 3V6MA 3WAKA 3L07A 4MVJM 1NBME 1ZIPA 1QMGA 4II3A 1UXGA 2XOXA 3BAZA 3QUBA 2YHUA 3CW9A 2FKNA 3OLYA 4RIGA 3I01M 1HNNA 4BP1A 4GL2A 2H1SA 1OXVA 4DV7B 5JZOA 5HIAA 1AGRA 3NVDA 2W8ZA 2J9FB 1G3IA 1RLUA 4QDXA 2PGDA 4CMGA 1OT5A 1PJZA 1X0XA 3BK2A 3E4CA 3ZLUA 5C52B 2I55A 1PO7A 2WWFA 3QWFA 3F7OA 4YNBA 3G89A 2C7PA 5L6LB 5T6BA 4ER6A 4UUNA 3CX7A 3PE6A 3JZFA 2IV2X 4NTZA 4P98A 5K45A 2V7TA 1EVZA 3J7TA 1PWXA 4XUEA 1RW4A 1DI0A 2BFFB 4GBED 1JIJA 3SVTA 4E1AA 3AZOA 1Z5WA 4JJEA 2H16A 3VV3A 3W5SA 3I4FA 5IAAA 4IDCA 3TSWA 2JRLA 1NN3A 2ZYTX 3G85A 5DB4A 4R2JA 3GZTB 3ND7A 3H3FA 4DAOA 4QO7A 4Q1CA 3I9V6 4HDCA 5KNBA 2ZRNA 3CS3A 3Q7QA 3ONDA 3VVLA 1HY3A 4RE6A 3WADA 5AQ1A 5B6PA 4DUGA 3UJDA 3V1MA 5AHRA 1BEEA 5FNVA 4NCAA 2MSCB 4KQCA 1DWUA 1ODLA 3DEKA 2C03A 3B2QA 1E0SA 3BBLA 1VRWA 2AEEA 2P3OA 4F6LA 2E85A 1ZZEA 1IUNA 3ZJYA 1PWEA 1E3DA 3AWDA 3CTMA 4YJHB 4UNRA 5FA6A 3SSMA 3PZRA 4AT1A 1L7RA 5FUQA 1P6QA 1WBJB 2WWRA 4ND3A 3UQYS 3WYGA 4EJSC 2HN9A 3UFBA 2CLCX 1HEYA 4LTDA 3N74A 2MWMA 4ZAFA 1NYRA 1T2NA 4KU4A 3PDWA 5EA2A 3RBXA 4D3XA 4LHEA 1RABA 5LMNB 3NP9A 3UTDA 4KR6A 2X0IA 1Y3IA 3DEJA 4L0MA 1P4HA 5GPBA 3TD2A 2ZE7A 4ZMSA 5JALA 3IOBA 1CUDA 2ZJAA 5DYGA 3A4VA 1GD1O 5J40A 1CULC 3O3MB 1W6UA 1VJCA 4R83A 4TWIA 5F4ZA 3MYRA 3BGSA 4CDRA 4L3OA 4PFSA 1PQ4A 1CJSA 4R2WA 4B79A 2DB3A 5JCOA 3ZGXA 1R2QA 2A0FA 3V5NA 4XLLA 5CT6A 3HYLA 1WKBA 3ZXXA 3VR6D 1UXOA 4H3HB 4NULA 3KV3O 1SUSA 2Z4TA 4HRXA 4RHXA 4E2FA 3FHCB 4UAVA 5A6VA 3EVTA 3MWJA 4DARA 1E1QD 3AR9A 4FCCA 2FFBA 3LFTA 1ORHA 4JC4A 4GRAA 5LZ7A 1UM8A 3W6UA 1YSCA 1YE5A 5F3DA 4K9LA 4OUDA 4X7PA 4WBXC 1GEEA 1R74A 5JVDA 1FXSA 4R16A 2F3RA 1JA1A 3PWKA 4B5KA 1K9VF 2JGRA 5AJYA 3UV6A 4B71A 1ESDA 1CF9A 3KEFA 4DFDA 5J5AA 3O8LA 3C16C 4Y2GA 2JGDB 2ZXEA 4PFJA 2WY2D 1CRZA 3TNJA 3U5ZB 2O8FB 5EL0A 2DPHA 4O8ZA 1NGSA 4NOMA 4LOLA 2MMGA 4S05A 3GLKA 2D5CA 5BW5A 4KE9A 4LMAA 5A4AA 4FM9A 2ZTMA 3ZPXA 4ZK6A 2PZAA 1VZ3A 3OHSX 3EGIA 5AUOB 5I3CA 1O0SA 1Y5LA 4PRZA 4AX4A 5KS2A 4LC0A 3TLZA 1UPXA 1VMAA 5AM2A 4O2AF 3IVAA 5FBZA 1FDWA 1VA4A 3LUGA 3W6NA 2WFLA 2O8DB 1J39A 3L2OB 2BRUA 3C6ZA 3D8HA 5T6MA 3R8CA 3M5WA 2Q1WA 2VFAA 4JZKA 5T67A 4MUGA 2B4QA 2O6LA 4MOWA 3WLAA 3OOJA 3UTCA 5HMMA 3ZV7A 2ZJFA 4JVLA 3B6IA 4HX2A 3U81A 2XGJA 1CF4A 1JTVA 2X4DA 1HT1E 2I4MA 2OL4A 3M4YA 2BJHA 1QANA 4J0FA 3PKJA 1ML4A 2XAAA 1RQ2A 1NMQA 2VJLA 1CUFA 4B75A 4GLLA 2P2SA 4BX0A 2RB4A 4LC9A 2DBYA 3GT7A 2QL9A 1COWA 1NW7A 1Q0ZA 2NSHA 1RJ9A 3STUA 1QHFA 1OV6A 3ENNA 4W1QA 5JH7B 5EP4A 3KU4A 2QQFA 3OZUA 1F0NA 3GBPA 3HZZA 4P0QB 2C5BA 3HU3A 4R51A 4X63A 1R37A 3VR4D 4BU0A 4I5IA 5KTSA 3G7SA 2Y99A 3HQ4O 2KLHA 3GROA 2QGNA 4UCQA 2K7FA 4K26A 3GRYA 1RPNA 2M9MA 5B3KA 4K2AA 3U7FB 2ZU0C 3T99A 1F9AA 4BVFA 5JXWA 4CIYA 4JBGA 2XKBA 3P2IA 1TCCA 1G21A 4BMDA 2Q5IA 2ZTHA 4BBPA 2FZ5A 2VI5A 1DBIA 3LWNA 3LP8A 3LHKA 3MWDB 4JLUA 3SVZA 1TLLA 2XF8A 2CFCA 2OVBA 4K9DA 5G0VA 4HRAA 3J80A 4A5SA 2NSDA 4QJ5A 2HMTA 4BMPB 3W4KA 4PYJA 5ERGB 4UQPA 1N2EA 2FKAA 4G4SO 4JL8A 2HCBA 1Z6GA 4YJ2B 2RK3A 4NZNA 1NW3A 1W46A 3E5HA 4GO1A 5KINB 4EHDA 3N1UA 3R3VA 4AZWA 1NQXA 2HR1A 1FQJA 2QBYA 4NESA 3WMXA 4RDIA 1SQ5A 2DPXA 3K7EA 4J7AA 3OE7D 3WFZA 2AFVA 3DVRX 1JQDA 1N2CA 1O3YA 3NLLA 1VFNA 1ZRNA 1YJ8A 2D2EA 5GP1A 3RQSA 2VHCA 4RTNA 5AKLA 1K98A 3P0EA 2HRRA 5D3ZA 3CX6A 1PN3A 2P30A 3B20A 3QEOA 4X20A 4HS9A 1OAKA 4AO8A 1KORA 3RSFA 3ZXSA 1D2EA 5K6RA 3IIJA 3Q9UA 1U63A 1XF9A 1VFPA 2VHXA 3DMNA 2VDKB 1OOEA 2A5YB 5EXEA 1QRRA 2ZFUA 2P67A 1Y5IA 2DY1A 2I2CA 3PC7A 5EPOA 4PZUA 2PKXA 2R2AA 3I1IA 4NCKA 1SEVA 3HCFA 3BMOA 1EKXA 4Q9JA 5AI5A 5H5JA 3OUUA 4F1JA 2DP4E 4OXNA 3ROZA 1L3IA 4HYTA 4UBLA 4K6FA 1O58A 3AI7A 3M82A 4MS3B 5C2JB 1C0EA 3Q2KA 4B8ZA 1E5XA 2GRUA 2QYTA 2ZWMA 4DLLA 3ZDDA 3OKAA 1I0ZA 3GWGA 2DF8A 1NW8A 3NBUA 1DJNA 1AKUA 1IOZA 3O90A 4HDAA 1CQWA 3OZCA 3QELA 4X65B 2AA3A 1MC8A 2G88A 3ET5A 2QPTA 3HDYA 4DQKA 4ZI7B 2IOFK 3C3AA 4ND8B 3Q3VA 1PTJA 2JHCA 3AXTA 3SZOA 4QE3A 2P9CA 3RREA 5BVHA 5I51A 1GKYA 4FDTA 1JEQB 1UMKA 1L7BA 3ONNA 2VUHB 4HD8A 4D9JA 3EY9A 5K0FA 1B0AA 1T1IA 2CMFA 4IJWA 2OUKA 2PX4A 2C58A 2PT5A 3K20A 1IUKA 3OJLA 4HDRB 4Q3LA 5FB3A 3S40A 3WK5A 4DNQA 5B4TA 4FR5A 4S2UA 3BPSA 1FTYA 1MFPA 3S2EA 2HFJA 4DA6A 3MLEA 2IP2A 3UOWA 4BLWA 4BASA 3IKTA 4E2XA 3AR6A 5H70A 2J3EA 2JZOA 1FX0B 2V7BA 4Q18A 4OLAA 3K9LA 3G9QA 3WLOA 2X0JA 1SHJA 1W5AA 2GLTA 3I58A 5BOSA 5HZHA 5K3FB 1TKBA 2YR0A 3CN9A 4EUHA 1CUCA 3MWEB 1TDJA 3EDCA 3QLVA 1GPWB 2QAIA 2F8TA 4QBTA 2JLVA 2WZCA 1Y42X 3CF4G 3IGFA 4HT3B 4Q03A 1ETHA 4DY4A 4RM3A 2PUFA 4JROA 4LSZA 3GCWA 3IQZA 3DEHA 2EG9A 1BD4A 1E2NA 1Z17A 4XVQA 5EXPA 3AKYA 3EQ2A 5LZ8A 4X1YB 5DMXA 1NVBA 2AE1A 1C5KA 2JCBA 2RHHA 3FMGA 4NR0A 3O91A 1B6TA 4RKEA 2G36A 2ZYUX 4LISA 5JC8A 4L8VA 1JEDA 4RIFA 2J31A 3UCFA 4UOEA 1ONPA 3OLZA 3HR7A 3NQ41 1R00A 3OX2A 3QLUA 3AI1A 1J8YF 4W7IA 1SUWA 4KFCA 1YJBA 1ZNWA 5KYYA 3RC8A 3RE1A 4X6YA 2XB8A 1ULBA 2RHLA 1DKUA 4U00A 2A5LA 3OEHD 1PS8A 1CIPA 3LWZA 5ALOA 4KR2A 1EGQA 1FFDA 2G9UA 1DPGA 4CI9A 4ZOEA 2ISQA 3K6RA 5E6SA 2EGGA 2VXYA 4TS3A 4A92A 3A9UA 4PN3A 3GFOA 5AVOA 5FHRA 4WAUA 4OQ4A 5DTQA 3I72A 4A8JB 1THTA 2OCIA 4KDEA 1D6JA 5LYJF 1JG2A 1C41A 2Q3MA 2JVJA 3VNRA 5GADl 3BX1A 7REQB 3T9FA 4BVHA 3OM0A 4U3JA 3OZ7A 3EPKA 4MUMA 1MVLA 3QYFA 4G67A 1YZKA 2GLXA 5JQGB 1DSSG 1ZD3A 4EDFA 2BDEA 3O92A 4LMPA 1Z26A 2QORA 3D2AA 2DLCX 3KU1A 4I9UA 3TGLA 1GT6A 4QUHA 4ZODA 4DIFA 1F6DA 4EBFA 3WGTA 4IO0A 1GHTA 4RXTA 4XYEA 4DQUA 3QFTA 1DKLA 1G5QA 3H87A 3PJEA 3IEXA 2YCLA 4F97A 1UZUA 1EFPA 1CUAA 1OZHA 2C0QA 2OO3A 2VK4A 3BZUA 3ASVA 3GL9A 3R6DA 3W2GA 4CVNA 2D59A 3L8HA 3ABZA 3L7JA 5HIMA 3IPAA 3ZGVA 3OIWA 4WW0A 5HBRA 1ZL0A 4XIJA 1E2FA 1N57A 2NAPA 1TCVA 2QMHA 2VDVE 1M6VA 4FGWA 1O0BA 1QRTA 2H52A 4E03A 1JZQA 1ZCAA 4XYBA 2PT6A 4FILA 1DC6A 4IOKA 2PVSA 1KMHA 5AO9A 5AQEA 1KYZA 3EVNA 1A8UA 4D56A 2IA5A 3DEAA 4PG7A 1MJNA 3WO1A 4G1VA 3HFRA 3G6WA 2XYRA 2BFCB 3EFHA 3THWB 1W5EA 1IOVA 2OK7A 2IYRA 3IOYA 5CD1A 1GTSA 4XD7A 4CFYA 2IY9A 2CXOA 3PFKA 4KE6A 4IJKA 2XR1A 1XSEA 4RLQA 3TZ6A 5IUJC 3WK4A 2FDCA 1NW6A 1PSWA 3EYWA 3F4LA 3FMVA 4TRMA 4YRDA 5LKAA 1D8AA 1OLOA 421PA 2BYTA 3WHKA 2Q0QA 3SKXA 7GPBA 4X41A 3F2IA 1CTQA 1F0YA 4JFRA 4F86A 4ZIRB 5JBIA 3VR2A 3T1YB 2XCRB 4C07A 5KREA 4OH1A 4R9RA 5CH8A 1AN9A 5IYZF 5KAPA 1YIAA 2WMDA 3KQVA 1JHMA 1JFLA 3ED1A 1FTWA 2HUNA 4GGPA 4PAMA 1JG6A 3UJBA 1KEVA 4PGAA 2I4LA 1MJGA 4EENA 4RTRA 3CUUA 2ZJ1A 4L5BA 1GCUA 3TW0A 3TDNA 1OWOA 1MABB 1RXCA 1W0JD 2DKOA 1FDIA 1YCDA 1UZNA 2RH9B 4YI3A 1OTXA 2PCLA 3AC0A 3I9KA 2I03A 4M1MA 1Z8HA 5GOTA 5JNSA 1MZPA 3WB0A 4YV2A 3L0BA 3LO5A 4Y6OA 2IYPA 1LSJA 2KI5A 2A9KA 1NVEA 4MWBA 4EFDA 3ETDA 4IVPA 2W4IA 3PUYA 4JB2A 3ZGYA 5JYDA 2D06A 1LX6A 4E21A 1X1DA 2ARKA 2W22A 1YJQA 2CMGA 5IDYA 3KEMA 2HLPA 5D84A 1P2SA 5L40A 1E9FA 3UT5A 1IQ0A 3FN4A 1WKCA 3EUFA 1JXMA 4MGEA 1FLDA 3B85A 3E8SA 2DX7A 2O2JA 1ID1A 3LZCA 3HSSA 4ICIA 1OLXB 1U2SA 3B78A 3K0KA 3R3UA 4MR9B 5FPQA 5IVIA 4ZT2A 4BN4A 5BR7A 5KPJA 2RHRA 3N0XA 2BFOA 5LZ4A 1E62A 4QD3A 1V6AA 3H5WA 4GEGA 2UVQA 4ZEWA 3AJ9A 4YPOA 5HJ7A 1YZHA 3GPDG 4OVKA 4ARSA 4UASA 1C3LA 4C0JA 2OUIA 1E1CA 1NKSA 1EH5A 2IY7A 3NTRA 3RVMA 3SHVA 3CXUA 3R5TA 3ZV4A 5B7GA 3NEJA 1J0EA 3D6JA 1U98A 3IKJA 2NT4A 5BXQC 2IEDA 5T4HA 2Y1XA 1U8ZA 1TL7C 2CEAA 3KJHA 2I33A 4QU9A 5M29A 2AC2A 2FPPA 1XRRA 4EJSA 3Q1LA 3Q10A 4BYMA 5REQB 5GZ1A 2VK8A 2H1OA 4OX9B 3H65A 1BMQA 2AX3A 1IHXA 3FHLA 2E5LB 1LI5A 3EFBA 1L4UA 3LC7O 1ECLA 3HN2A 4WXYB 5BYJA 2PWPA 4Y0VA 1PT6A 4MWDA 3ZLBA 2KM1A 4D42A 4ND7A 4C6RA 1SCJA 1Q74A 2PT7A 3RR2A 3HNOA 3IODA 5F4BA 2CNBA 4NZOA 2ECOA 3VU0A 5D7BA 3DEIA 3K09A 3LY9A 3ON5A 3AETB 1AQLA 2E5WA 2DQ4A 2I6XA 2FWIA 3IIEA 4R9SA 3OFNA 4XB2A 3VU8A 4X94A 1L7OA 4M3NA 5U1PA 3WKCA 2XQFA 1KS2A 1CUHA 2B7CA 1KY2A 3H5LA 3NAZA 4W5JA 1V1MA 4Y2YA 1U1GA 3VKWA 1AHHA 4NI5A 1ZIYA 2B2CA 3T7CA 3X1MA 2UVDA 1PYDA 1QJCA 3UJ7A 1ZK0A 3OO1A 3FWKA 4AJ4A 1CVLA 1Z2EA 1FYXA 4EW1A 5EZYA 4C78A 3RASA 1ULHA 1CY4A 4LZWA 1T5BA 4AQDA 5FA8A 1F2TA 4DQXA 4E1BA 2JIOA 1CR1A 4DF3A 4LJLA 1YK1A 1U8TA 1LCIA 3FZEA 3HLYA 1H23A 3LQKA 4O4HA 5J9FA 4US0R 5B4UA 5ELLA 4ZT6A 2BW0A 1ZBDA 2ST1A 2UZ3A 4MW9A 2YMPA 3VZPA 3IPCA 4B76A 5JS6A 2BGRA 2ZRHA 2H2FA 4MVXA 4KYTA 5TQ0B 5HVNA 4TKUB 3BWVA 2JAPA 1ZAKA 1IBMB 1Q1EA 3ZZUA 1GNVA 4IIJB 4C4TA 3M1LA 2B4YA 2FWPA 4P3XA 4TTVA 2IEAA 4EGSA 1KI7A 3LGSA 5ESDA 1E2PA 3TDKA 4C89A 4CTOA 1E5TA 1MXFA 2JATA 1JDTA 3LHSA 4HGOA 1JECA 5ALHA 5DSTA 3UB4A 4Q39A 2HL6A 1W25A 3DXYA 4GZ6A 1Z6XA 4NFYA 3LQ4A 4TT3D 5JLAA 3D1VA 3DP9A 1EUDB 2E7ZA 3W5JA 2X76A 3WSVA 1D1QA 1GR0A 2P40A 5B7NA 1A9XA 1XHFA 4TTRA 4ZVSA 1S2IA 4PAGA 4YP9A 4OI0A 3WLEA 3EGEA 3L8YA 3L6OO 3R0VA 2QJTA 3E7XA 2X0DA 1XWWA 1XKXA 1Y7HA 1XDZA 1Q3HA 5BVGB 2ZPTX 4M0CA 2NUTA 1JXAA 3RIYA 3O8QA 2NUAA 5G0WA 3HJFA 2NP7A 1D2GA 1SUIA 2EZTA 1ZVMA 1I7PA 3WICA 1ZRHA 3IPYA 1UBJS 1A97A 1W19A 3SQMA 2PZMA 4E3ZA 1UWVA 2WF5A 4R2XA 4AWBA 3CRVA 4J7UA 3H11B 3MS7A 3WGYA 4EPYA 1V3QE 4MHTA 3KWLA 2PSDA 4L5AA 4Z9BA 2HBYA 1JFSA 2QN1A 4QZVA 2VP9A 3VNUA 3E9YA 1J2YA 2OCXA 2XRMA 2QB5A 3DKVA 3ITKA 1Z4OA 1ZVQA 1G8AA 4AROA 3ADKA 3O9ZA 4OSPA 4B7XA 4BO7A 2IXBA 4L22A 4TZKA 5EWMB 4QJIA 3WJ1A 3OE1A 5DXFA 3ZDCA 3OC0A 5BV7A 3O2SB 3WYNA 1QYXA 5FTJA 2EVWX 1QP8A 2VHWA 2PSSA 4JL5A 4DMUB 3PTLA 2WWTA 3H1BA 2Q45A 4IVRA 4ZVPA 3UBMA 4HLNA 4QEZA 4CL0A 4Z1MD 5JAUA 1KE2A 5HKBA 2ZLBA 2A7XA 1K89A 3I39X 4RKRA 3U48A 1XL0A 2IGBA 3CZ4A 3W1WA 1QC5B 1O95C 2HDNB 2XMDA 2I67A 4BAUA 4ECEA 3DJYA 3EVZA 1KI2A 1Q2UA 2NU6A 3S2FA 1OLSA 2GBGA 3PRHA 4MS1A 2WPDD 2Z95A 5KJEA 5KCMA 3W4JA 1POWA 2O3TA 2QG6A 3CF0A 4MB0A 5CGZA 1TX4B 1PWZA 3ZH2A 4L74A 5DNWA 4RYDA 4V0MA 2RIRA 2ZJBA 1BH6A 1FTGA 3N76A 4MV0A 3TN7A 4C14A 5EUCA 4QVGA 2OQRA 4QEDA 3F6PA 4P4SB 1L5OA 4HADA 5D1NA 4DC0A 2P6RA 1UKBA 2QRLA 3VU1A 1W4LA 2WDZA 3EZ6A 1RXEA 2DJIA 4I6GA 4L9SA 4B4UA 4M1QA 3VR0A 2O1XA 4CF4A 2CD7A 1IPHA 1TTHA 1MIOA 2XY4A 1NF3A 3K9GA 4GW3A 4QFDA 3GJ3A 5JJLA 2GAFA 2HV8A 4RV5A 1HE4A 3NBYC 3FDXA 4LNHA 1T1EA 3M3DA 3EXAA 3IP9A 1DWPA 1T1GA 1AU9A 2NO6A 2XOKD 4MQUA 3RHZA 1CQPA 4IHJA 5HF6A 1ABBA 1HE3A 4BNUA 1TF7A 1VL0A 2H29A 3OCUA 1BRMA 2QTTA 2ZIVB 5B12A 3BAFA 1D4AA 1M1UA 3KNZA 3S44A 3ZTWA 4CQMD 2GM5A 1TM4E 2B3TA 4RY9A 1T5HX 1DARA 3ZHTA 2R4UA 4DIDA 3N8KA 3D43A 4WMLA 4B9AA 1AQNA 5I7EA 1JSXA 3C3CA 1O89A 3HBLA 4G56A 4GLJA 4TL7A 5HRAA 2IXDA 1ODCA 5JBQA 1P7WA 1L4YA 4CR7A 4CFZA 1AK2A 2M2IA 1KJYA 4P84A 2GM3A 4EGCB 1H2BA 1LVHA 4TKLA 4F9EA 4ENTA 2EL9A 4YIHA 4G3XA 4FI3F 4B4KA 4GWLA 1XBTA 5LC1A 5IX8A 4M0FA 3MELA 1U0HC 3RROA 4WESB 1Z37A 3QXGA 5GIOE 1MAUA 1JU9A 1YMVA 4S1OA 3AJEA 3QM1A 3V46A 2ZXUA 4RFSA 4Z54A 3A6EA 3VJMA 3UGQA 3IV6A 4LNAA 1R88A 1KBOA 3AEUA 1I5RA 4HL6A 2VTVA 2TMYA 3EB9A 5F77A 4BFXA 3KZNA 4KP7A 4ALNA 3EBPA 4C9BA 4OBBA 4FZJA 4JUBA 2ZB8A 4KITB 4BV2A 1SIWA 2NZYA 2PPLA 4XVCA 5KDDA 4KQEA 2CJXA 2W8BA 4RAQA 1C1XA 2MU1A 3LVFO 2PEZA 1PK8A 1YQXA 1AN0A 5E95A 4B33A 3BRWD 3DAPA 2H85A 3LVRE 1JLRA 2V58A 2D8AA 1Q20A 3SE0A 3DV2A 1RHKA 2JFFA 1GT91 3F0TA 1IXSB 4IJUA 4C7BA 3JQ7B 2HPZA 1E9CA 4AU1A 4ETMA 2IHYA 4RK1A 3GNQA 2ZUBA 3JD1A 3K5HA 2VPWA 2PRZA 2YN2A 3I4CA 5KNDH 2ZVPX 5F1PA 3K71B 2ZIXB 2ETXA 3NIFB 3PQ5A 1VCHA 4G37A 2B8EA 4TVOA 4Y2JA 4QG7A 1I10A 4QPJC 4X7RA 3TUJC 1XTJA 1T3TA 3HJRA 4KQMA 3IBGA 1PNVA 1N2JA 2D00A 3RVLA 3R41A 1B1CA 1PF7E 3RSCA 4RK0A 3W7BA 2PRKA 1Q1GA 4F4HA 4UD6A 1BX0A 5T57A 2HSDA 1ZJWA 1X94A 2JVIA 1IFXA 3O2JA 4WJZA 4EKNB 2PLWA 1UKVY 1AC5A 4EJMA 5JAIA 2R1ZA 5EJ7A 2O8BB 1VMEA 2WVHA 2ESRA 2YRFA 1O4WA 1UDCA 4ZO6A 3EC7A 4JQYA 1B00A 1AUXA 1F51E 4PYIA 3KUKA 1SFRA 2KYRA 2V0NA 2OGWA 2ACVA 3HGTA 4JP3A 2OAGA 3C2QA 5LQKA 2JAQA 3K9CA 3U7QA 2F8MA 4OGGA 5KNDD 1MCZA 1WMDA 1ZSYA 3EDYA 2CFIA 2R79A 3F6RA 4X6XA 2I65A 4ALJA 3PPYA 3ZDFA 3K5IA 4TMFA 1DL5A 2WVAA 3JQCA 3R8XA 2RGWA 4ODIA 3QMWA 3RAFC 2DETA 2H59A 4V3BA 4DLAA 3SC6A 3C5EA 4KG7A 3ZLJA 4K6MA 3A2MA 2Z8YM 4ZU6X 1EZ4A 1YTUA 2HEGA 3K0AA 3OPYI 5DASA 3KJNA 4D9MA 5F51A 1DFHA 4N4AA 4TLEA 3UN1A 3KT0A 1Q95A 3S8MA 4KFTA 3ZNPA 3DSRA 5DM0A 2JIPA 2V8OA 2XDQB 1JKJB 2WYIA 2X3UA 3I32A 1PVVA 3GEGA 3R3JA 3UUWA 1AF7A 4JLAA 4NMLA 3TW8B 3OETA 3PWTA 1KU6A 1ZWLA 3LCVB 3TM4A 5BNTA 4KNYA 3WL6A 3GJ0A 3BREA 5I7HA 4AY6A 2HPVA 1YULA 1E2HA 3HXKA 2HHHB 3ZJVA 4MGYR 4F12A 1KARA 2BTQB 1M6YA 4NYMQ 2J30A 2ZDQA 4DV3B 4D3YA 4U2FA 1D6NA 2HK6A 2YASA 4QYTA 1F5NA 1JSLA 5K7SA 4JELA 2R84A 2ICAA 2NU7A 3I53A 1EG7A 5HQ3A 1TUBB 3OJXA 2I76A 4FONA 4U7DA 3CF6R 3PI7A 2R6JA 2CDCA 2CF5A 4YRIA 5EHZA 2PFSA 3HBFA 4X8MA 1B26A 3GEHA 5JSZA 2C59A 4CDNA 2FSHA 4LGYA 4HWGA 1GZUA 4GZ5A 4XDHA 3AHHA 4DANA 2XWPA 1CZUA 1GRVA 1VJGA 3DXFA 2NVUB 1RC0A 3PC2A 1ECBA 3M6VA 2P1DA 2OK8A 3DQPA 4HDSB 2YV1A 1JH8A 3GGGA 4QQKA 4UFNA 4A8HA 4Y2PA 5LYYA 1YQUA 1NI5A 3L49A 3R23A 3LVBA 2CDAA 2OT3B 3ZOKA 4XEHA 3GFPA 2X4GA 3IP7A 2BGMA 3L46A 5JDCC 1J09A 3RRJA 4J75A 4BFWA 2IELA 2JAOA 1NF9A 1DX6A 4PANA 1A2KC 2JGAA 3KSDO 2O7QA 3TNFA 3FBWA 3V8QA 4HEA6 3IYLW 2YHAA 4QDZA 1EVQA 2PU5A 3PTAA 1UMBA 1P81A 1QHGA 2VNIA 3GCGA 1TI7A 1T6NA 1KDVA 1U2GA 2NZ2A 5F7OA 4Z4FA 2QL5A 1E4OA 3AY6A 4XWGA 3ULKA 4CT4B 4CMAA 5I45A 1SVSA 1ABFA 1AD2A 2AE2A 3L9XA 4O5AA 5LMZA 4B3XA 2X0FA 1NSFA 3IEKA 1XVAA 3FMIA 3BXOA 2IPNA 4I1VA 1JQAA 1MJFA 2IFTA 3IE0A 5KKNB 3AK4A 4D82A 1X87A 4MUJA 5JNLA 3D4PA 3UWDA 1QK5A 4URWR 1LPPA 1WVIA 4C0AC 4QPCA 4UTPA 3PUXA 5EZ6B 3ZJTA 1AZWA 1Y37A 4J1SA 1BWQA 3MOSA 4IIVA 2IDJA 2XV1A 2JC3A 1U8UA 1WP9A 4RA9B 2PRYA 3KQOA 2KX7A 1I2DA 3ZNOA 5JRDS 4UUBA 3FGOA 1DVRA 4TUYB 3KHSA 5L3SB 1RLMA 4C0KA 1OQAA 1PBTA 4BGIA 2Z5FA 1VG8A 4ZC8A 1NBWB 2ZBUA 5FRDA 3QU2A 3GELA 3ROEA 5J4HA 1WMSA 1ILEA 5AKKA 3BJRA 3GRUA 1E4EB 5HBGA 1G7TA 1IJEA 2I4IA 1PTKA 2XVXA 4O59O 1TVKB 2WM2A 3HG7A 2CV0A 1UAAA 2BGKA 2F1JA 4PNPA 5MN4A 2AI1A 4HQ6A 2JDIA 2BKAA 3K16A 3OCYA 1T9AA 3N2ZB 3SG0A 3ZZ1A 1QR6A 4A2WA 4AY3A 2NUBA 1KK1A 3THXA 3LDAA 4KREA 1SBHA 3CONA 2VLIA 4OXRA 4W1SA 3GVCA 2DR0A 3CT4A 2D2VA 4EPTA 5KYUB 5A5DA 4YMWA 4EKYA 3QKRA 1EAMA 3VPCA 5BNWA 2H3HA 3S2GA 3PFIA 3PQ3A 2QSZA 4TXNA 1TYCA 5AKZA 2QL7A 3MWFA 3Q8LA 2CC2A 5AR1A 1RMQA 1IHDA 1XQXA 1SIUA 1ZMXA 3NDRA 3F5FA 3L8MA 4XJTA 1NYTA 4JA0A 1EPUA 1PJ8A 4P4NA 4OFBA 4Q02A 3S0JA 4CIDA 2GJKA 1DB3A 2H3EA 2N0SA 2VSFA 1JH9A 4XJVA 4HGYA 5KMGA 3T3GA 3TSZA 3T3DA 4UUMA 2CFSA 1W8IA 4TTIA 4F2GA 3KOXA 4RLFA 5AW8A 4I3HA 2H54A 3A1NA 4JK3A 2J32A 4QJ3A 3RCBA 1UODA 3THOA 2PJZA 3F7TA 3PRYA 5A0FA 2Q41A 3NRCA 3WK6A 3THRA 1ZIXA 1GPYA 3O8RA 2BUCA 2ONKA 2EKZA 3KYJB 1GGVA 4A2QA 4X00A 4UHKA 3RFXA 4RPGA 3P9PA 4ZHSA 1QZTA 3NASA 4KXQA 1REQB 1JAYA 2EX1A 3A14A 1B8UA 1T0PA 1UM9A 1WMBA 2RGAA 4PZ9A 2BCGY 4Q34A 2EERA 4B6GA 1P73A 2GA8A 1PR3A 3NEAA 4M1YA 1Q1QA 3V8RA 2AMFA 4BRSA 4MPTA 1XE3A 4KZPA 3IPRA 3ZX4A 3MGGA 3RU7A 2NTVA 3ZS8A 4COKA 3M6IA 4F6RA 4ARIA 4HB2A 3BGIA 2ZWAA 2QZJA 2R7NA 2EQ5A 4M99A 1IBLB 2H51A 4FW8A 1TPZA 1ZXBA 4W8GA 1DXHA 3OQVA 1GCGA 1OC4A 3LA8A 4PSAA 2DC1A 4DMFA 3W5CA 5KSWB 5T64A 1LNZA 3WZMA 3TM5A 2RSLA 1M7GA 1XQWA 3MSCA 5JFTA 2ZBQA 3A9VA 3ZHRA 5BWMA 6CHYA 5HRUA 5IZCC 2BF4A 3PYMA 2FA9A 5CH5A 1KZHA 1I7QB 2DFPA 4JQCA 2FE4A 4UBNA 3NFRA 1Y1RA 4RXMA 3OLVA 1E60A 4JBIA 4KQWA 2Q7DA 1V8FA 3OCWA 1AQUA 1XQVA 4P4TA 3TFWA 3Q8WA 4MJLA 3AGQA 5TF4A 1F2UB 2FSIA 5HFNA 3PUJA 4ZQHA 3T15A 2R6FA 3ZHCA 4KN6A 2L42A 3RSLA 4Q7LA 1OU0A 1NVTA 2JLZA 3WXMA 3N7TA 3DZCA 3CPJB 1EE9A 4AUEA 1OZAA 5HDQA 1I1QB 4EI2A 1B6SA 3NW9A 2HQRA 3KFXA 4EJFA 1XX6A 2O19A 1PNOA 1SC4A 1F4LA 1YDHA 1YUNA 3AV3A 4L5IA 2FFHA 2GF9A 4MZDA 4WLUA 3ST7A 3JRNA 1GPUA 1RWQA 3TDMA 2FFAA 5K0JA 5C37A 1C8LA 2NO5A 1ND5A 1DJPA 2AN9A 3KJEA 1I2BA 4TV9F 2RAFA 4WA7A 4ZOBA 4AMUA 2QOEA 4PC2A 5ECDA 3WMEA 4HVLA 4M0KA 1RIFA 4C4XA 1X1QA 2YL2A 3JVVA 4HB3A 4KQXA 2QRMA 2A1TR 4HAYA 3RS4A 3ZOZA 4EUFA 1OSNA 2HMSA 2VUTA 5IABA 4WZAE 4LDPA 4UHFA 2L0XA 4EF4A 1EP3B 2Y1EA 1WUKS 3A2KA 3FAZA 2WJZB 1GARA 1NUTA 3C3JA 3KVOA 3G2LA 3FCYA 4JJKA 5DMHA 1AF4A 4PHTA 5ILGA 1H22A 2XDYA 3JALA 4AJHA 1XMQB 1G19A 1BXKA 5E1OA 1MV8A 4NU0A 3BQ9A 2HEIA 1YHNA 1O95A 4ZRDA 4HAWA 5A9RA 1RP1A 2OR3A 3A9WA 3EPRA 3KB2A 3SYMA 3VSAA 3AINA 2PH3A 3F1KA 1LBIA 4RJIA 1IMOA 1B2RA 4GMFA 2J6BA 3STXA 1VB3A 4KQ2A 4KPUB 4OREX 4BMOB 3D8UA 3D3JA 4DG5A 1RQGA 4JXKA 4GKKB 3C1UA 5JZVA 4N5IX 4OHMA 5B3JC 2CVOA 4Y2XA 1Z0IA 2YVKA 3OP1A 3QE2A 1SKAA 4P5PA 1MU0A 4X8LA 1CR4A 1B6RA 1PG5A 2B2NA 2Y2UA 4BE4A 4BE7B 1DKPA 2OFPA 1ZICA 1TUEA 1N2OA 2FPIA 3FFBA 3QRWA 2FPRA 4FFNA 2OCLA 4OHRA 4WLVA 4Z9XA 1RQ7A 5AOBA 3AUAA 1RIIA 1T5TA 1AUOA 2A0YA 3HKCB 2VAPA 3OOYA 4FYPA 4IIEA 1GPKA 4W8OA 2PGXA 2V7EA 5CDUA 1AB5A 4MAAA 1NW4A 3OH8A 1LRLA 1NT4A 4H08A 3QX7A 4OKNA 1FLAA 1V8BA 4B8YA 1MFZA 3D7LA 3LPNA 4B3BA 1V1JA 1F2VA 4RCVA 6YASA 4PHFA 1ISFA 2MINA 4LCEA 4WLEA 8MHTA 1XALA 2HO4A 1SCBA 3Q98A 4ZZ3A 5DTJA 1ZVJA 2I6UA 4UTVA 1O6ZA 2C4UA 4H7IA 2W42A 4O08A 4X7MA 3W9BA 4DUZB 1NMSA 1W0KA 2FFJA 4LWQA 3IR6A 4RY8A 2O7NA 5AWFC 3S81A 5F5LA 3BC1A 3MPUA 2P7HA 1W1IA 2IGTA 5FL7D 2IXTA 1RP7A 2H0AA 1JBKA 2OESA 4U7HA 4NZMA 1K8YB 4NPHA 2J59A 3ZY3A 4M9ZA 2ZYVX 1X8LA 2P5YA 1Q0LA 4Q93A 5DI9A 5PGMA 1PL0A 3ZEIA 1E94E 5BSUA 1W8DA 1WBBA 1MO5A 4I55A 1RHUA 4EF5A 3G2JA 2QZ9A 3NT2A 4HN2A 1OASA 5JD3A 1YE3A 2XUFA 5EMNA 3P27A 3KDAA 5BN3A 3KDPA 4QGFA 5JVDB 4NAVA 1CIVA 5DE3A 5TVKA 5TR9A 4EG0A 1WP4A 1J22A 4D74A 4AY5A 5P21A 1Y80A 1N6KA 2BJVA 1S3SA 4ZQBA 1UMCB 1U9IC 4PPGA 4ZAWA 4AO6A 4D1YA 1TAUA 1RWKA 2YJZA 2OCBA 3W0LB 4O1MA 4JD5A 4UBKA 3PX7A 1TZMA 3QMPA 3HCNA 3IVCA 4J0EA 3DKPA 3SX2A