1AKYA

High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1akyA00
1W2GA 2B21A 3QIAA 4C0JA 4EQ6A 3ZVNA 4KI0A 1UEJA 2FH5B 4M9SA 5ANRB 1JR6A 1Q1QA 5HZHA 2ZI5A 1MT0A 3A6PC 4Z54A 2IXGA 1R10A 2OFOA 2GKSA 2V7QD 1HE8B 4GL2A 2RCNA 1CTQA 2RGNA 1UADA 1XXHB 3KJGA 4ASUD 1ZW6A 1EFRD 1XCMA 1EWQA 1LTQA 1VHTA 3HJNA 4QNMA 4V0MA 2GCOB 2WWHA 3SJBA 4E07A 3QY0A 2XTZA 4ZIRA 1Q20A 3OIYA 4Q47A 4RKFA 4Q9JA 4DSOA 3D31A 1GUAA 2ATXA 4B3BA 4EUNA 3BK7A 3BB4A 3W6OA 2OBNA 2JLYA 1M7HA 1ZM7A 1ZM3A 1FUKA 1JR3E 1RRGA 2CE2X 4GPTA 1UF9A 2G83A 1A5TA 2BMDA 2IF2A 4KFUA 4P0TA 4EJSB 2F6RA 2OO7A 2C9YA 3CRMA 3NDPA 3BWDD 1G3QA 1NJGA 1OKKA 1TUEA 2KE5A 3LFUA 4WZ6A 3RSOA 1QG4A 2BCGY 3BBPA 2CCKA 4L9SA 3U4QB 2J5XA 1ANKA 1GTVA 4QC2A 2OXRA 5FPSA 4C9BA 2HJGA 2Z4SA 1F3OA 2PT7A 4XH9B 2I4IA 3SJCA 5K8TA 2JCSA 5D3MB 4S35A 2JDIA 4NYMR 1Z28A 1HTWA 1X1RA 4PR0A 5K8LA 3RABA 1QVRA 1GRNA 2AL7A 2ZYWX 4QHYA 2VRWA 2H7VA 1G4UR 2WJHA 4I1UA 2PEZA 2WJYA 2FPKA 3KDSE 2XXAA 3NH6A 2W6JA 4MUBA 2PCLA 1OW3B 2YWGA 4BASA 1ZC4A 4BZPA 3SYNA 5EE5B 3W9YA 4PX9A 5DISB 2G6BA 4QJ4A 1KHTA 2ODWA 3I72A 3LVQE 1ZM9A 4RZXA 2NIPA 5A5GA 1W44A 1E3MA 4LHYA 2R6AA 3AF3A 2VO1A 4F7WA 4UNNA 3I62A 3A58B 5DNYB 4PHTA 5EZ6B 1BH2A 4B33A 2QMHA 4Z8YA 1FMLA 4NDZA 5CJ2A 4DC9A 1XEXB 2VL7A 2WKQA 4AC9A 1I2DA 4OJQA 1O87A 1G3RA 2A5GA 3OIWA 5H1YA 1U9IC 3CF2A 3DDCA 4L16A 4F38A 4PO1A 2QQ0A 4NYJQ 2ZSBA 3D6TB 1IN7A 2GBLC 1UM8A 2PT5A 3I5XA 1CR1A 2FSGA 1IQPA 2OSBA 3TR0A 2QT1A 3DKPA 2ZRFA 2CMKA 5J5CA 2SHKA 4WW0A 4A6PA 1SHKA 4PC1A 4TLBA 4EFLA 2ZJ5A 2C78A 3HR8A 3AKYA 2OEPA 3CKLA 4QGFA 4BRUA 1E1QD 3EZ2A 2QORA 4EPYA 2I3BA 2ZANA 1ZBDA 4N3NA 4MRPA 6Q21A 4LPKA 4DEYA 2KI5A 4CT5A 4B6FA 2FFBA 3KB1A 3EPLA 4ERNA 1S0UA 1E79D 3MLEA 2QP3A 2R8RA 3B5JA 4R98A 2Q3HA 3BH6A 4LHXA 5AUNB 5C46F 2IYUA 5JEEA 3GEHA 5CIWA 3D8BA 1XX6A 1YZLA 3T1OA 2DB3A 1PLJA 4KITB 2Q3MA 1KJYA 2R65A 4US2R 5FR1A 3VNUA 3AUYA 2MSDB 5DE3A 3K0CC 3QG1A 2J45A 4NKRA 1G5RA 1OXTA 3ZIAD 1KI2A 1YRAA 2QE7D 4DSUA 1OYYA 3EWAA 1GRRA 5AR1A 3CPJB 1KDTA 5FBVB 4LJ4A 3CRW1 1T0JB 2F7SA 1CR0A 1JBKA 3H84A 1WQ1R 4JLPA 4KFTA 1E9AA 2GWHA 3SJZA 1F2UB 1AQYA 5B57C 1UFQA 4POAA 4Q7MB 2CXXA 2CHGA 2AXPA 1VTKA 4BLQA 2FSHA 3SJAA 1KKLA 4Q1CA 3BB3A 2FGKA 4CGZA 1N5IA 3P4XA 2QQEA 1G3UA 4B6EA 3IDQA 5M04A 2AKYA 4DLSA 2BWJA 2YC2C 3BFXA 3FMIA 4WOPA 5C1BA 1IN4A 1H8ED 1RRCA 4CEIB 1QVAA 4TYPA 4XVRA 5DI3B 2CCJA 2XNDD 4PO9A 4XOIA 4AI6A 3GLHB 4TLAA 5CIQA 4P4SA 1R4AA 5E7MA 4C30A 4US0R 1T91A 3LRPA 3TIFA 1ONBA 1P7CA 3I32A 3Q3JB 2CJWB 1GNQA 1RJ9A 4M1WA 1DARA 2W58A 4Q00A 4TYQA 2FWRA 2ZREA 1OXVA 1Z07A 2V6IA 3VKGA 2EFEB 4TYWA 2QEQA 4RFSB 3HDTA 1IN5A 3TRFA 5KTYA 3I73A 3K9GA 1RE0A 1K5DA 1OLOA 4IFEA 2G77B 4LYHA 1KI9A 3QEOA 3QKRB 4D4KA 1N6PA 1NLYA 2NZJA 4V0ME 3RWMB 1YVDA 3IHLA 1IXZA 1BYIA 1E2FA 1M7BA 1SVSA 2ZJZA 2IHYA 3PUZA 2ZRKA 3NC0C 4KODA 3BE4A 4HZIA 2BJVA 2MMCA 3VR5A 1VG1A 5LDDC 1P2UA 3IEUA 2XJ4A 3N2EA 3NTUA 4FMBB 4A8JB 4CDGA 5KYKA 1QHHB 4LK2A 4DDVA 2OG2A 5TXGA 1UDWA 2A2ZA 1G8FA 5EXSA 1DAIA 1TUIA 4IVRA 3MWJA 2GXQA 1U8AA 1E6CA 1VKJA 4HAWA 3PEVA 3TBKA 1T8TA 4TQAA 2ORWA 5DO9A 3ZVRA 5JJKA 2ORVA 4NYMQ 1AM4D 3LQQA 2GF9A 5CDFA 3CONA 4HLDA 2P2LA 4G5OA 3IPXA 2EFGA 3RS2A 3GJ5A 3L0OA 2Z83A 4M53A 4TYYA 4D26A 3A1UA 1PZNA 4DZZA 2WIBA 2ZSFA 5CB6A 1W4BA 4Q1BA 1NN5A 4NPHA 4OQXA 2ZVPX 4PAOA 4GZLA 1OXUA 3L82B 4PHGA 3C41J 4PZYA 3TQFA 3OEED 2VPPA 4FCTA 4PANA 1F2TA 2CL7X 2DBYA 5KUTA 3NH9A 3GLIA 3ZQ6A 1S3SA 1Z3IX 4YQFA 2Q0HA 1E2KA 3B6EA 2QBYB 1JQJC 2DWPA 4LBYA 3LLUA 4RJLA 2Y8EA 1T0HB 1G6OA 1T3SA 3GJXC 4CEJB 2AWNA 4TQ9A 1KKMA 3VAAA 3KJHA 1M2OB 4V0KA 3LW7A 1MO5A 2XAUA 1YZQA 4M1SA 4MGYR 2EFDB 2MSCB 4GMXA 2FV8A 4MKIA 1UBGA 4LV8B 3TSOA 3ADBA 1XCGB 1CU1A 2C96A 3DL0A 3L0PA 2BKEA 1MO6A 2F3TA 4CYMA 4TWZA 1KY3A 1XMVA 4DJTA 4EIWA 1OH5A 4A0RA 1YR6A 1DTSA 3LO5A 2ONKA 2VF8A 3KKNA 3IO5A 3VFDA 4AKEA 3QQ5A 3EPJA 1S2MA 2ZJYA 4B43A 4G5SA 5EZ5A 3HU2A 1AS2A 2X2FA 3RRMA 1A4RA 5FPKA 4RY2A 1NG1A 3NBFA 3SBDA 2QMOA 2VYFA 1WRBA 4LHZA 2BBSA 1Y63A 1HT2E 1M8PA 2WOOA 1DAMA 1MO3A 1XF9A 3I92A 3U7GA 1H8HA 3NG1A 5FBLB 1FP6A 3L8ZA 1DBSA 2OT3B 5FL3A 1WF3A 2GAAA 1AZSC 5FTJA 4A2PA 3RDPA 4TYNA 4NU0A 4O3MA 1ZUNB 5H70A 4HZUA 4GI7A 2A5YB 1S9HA 3EZ7A 3Q7PA 1JJ7A 1DS6A 4BFSA 4YMVA 3T1TA 3H0KA 5UKDA 1W4CA 4RD3A 1EWRA 1U94A 1NVUQ 1W46A 5DSZA 1G7TA 3AP1A 4BFVA 1NVVR 1R0XA 3FHCB 1ZUHA 2ZRLA 4ITRC 3U60B 5E3HA 5E4FA 2HXYA 4X8MA 4B2IA 3UMFA 3X1ZA 5HCNA 3A1VA 4B76A 2Q9BA 1OB5A 4BLSA 3LBIA 1NY5A 1DADA 1P9RA 2DWQA 3MJHA 1JEEA 2W00A 4IFBA 3MAAC 3IEVA 1E0SA 1QHXA 5FTKA 1J8MF 2WWWA 3MJRA 2P6UA 2YWEA 4TT3D 1OFHA 2O8EB 1KI6A 5SZJA 4FWTA 1QG2A 3UG7A 2D3WA 4JLBA 4J0QA 1U2RA 3WMGA 3ZZ0A 4GOJA 3ZVLA 3K8YA 4B3DA 3CX6A 5JWHA 1GDDA 1KDRA 1LS1A 2BM1A 3CH4B 2J1LA 4NE2A 1N6IA 4BPBA 2IS4A 4JBWA 2F43A 1XDBA 3CNOA 1A82A 2YHSA 4G5GA 3CR7A 4WAUA 4RZUA 3KQKA 1E2JA 4Q1AA 1N5LA 4KYUA 5DN6A 1OIVA 1HURA 1SGWA 3W6PA 3T15A 1P2SA 3KTAA 3TAUA 3EZ6A 2J41A 4BWYA 5FTLA 3R20A 3U61B 1RRPA 1NRJB 1R0WA 1Z06A 3AQ4A 3CO5A 3K09C 3OAAA 1NLZA 1DO2A 4NTZA 4AK9A 2RGXA 3CF6R 5JFGA 3QG5A 2WV9A 2GF0A 1E96A 1XD9A 5TB5A 3R7WA 4LCBA 4MDEA 2QSYA 3KXIA 2QI9C 2RHDA 2XB4A 5BN3A 3SN6A 1BYUA 1RYHA 1Z2AA 2WSSD 4V0NA 2N42A 2O8FB 1NY6A 3K1JA 5FI1B 4P31A 2J59A 4DIEA 3FYHA 1RVDA 4LRWA 1CS4C 1TU3A 1J90A 2IBMA 4B47A 1HE1C 1SKYE 1AA9A 4S2EA 1GKUB 1KMQA 4PQYA 3W8RA 1R5NA 1E2HA 5FOTA 4CT4B 3GLGA 5CDFE 1XTJA 3K0EA 4M21A 2WKPA 4LY6A 2FEMA 4ZCIA 4LJYA 3KB2A 4O2RA 3SDZA 3T61A 3A36A 5D3MA 1OV4A 2BKUA 3W3ZB 1JEDA 1T3LA 2R2AA 5J40A 4EDHA 1SXJD 1UDXA 5E95A 1JR3A 2ZYUX 1M1YE 1Q0UA 3TVDA 4OJKA 2C9OA 4U02A 5A4JA 3P4YA 2JAQA 1IN6A 2GRJA 1UJ2A 1VIAA 1KNXA 3T12A 1E99A 3A4LA 1KO7A 3CX7A 4IDOA 4PFSA 3GLIE 4FCVA 4DLYA 1GKIA 1X8LA 1E9CA 3S1AA 4B44A 4WXRA 1G4AE 1G19A 4HDQB 4EPTA 1GP2A 1OXSC 1I4LD 2V7QA 3EW9A 1GAJA 3MMPA 1VYUA 4LJ8A 5JHHB 2H5EA 1MKYA 2VP0A 3NHAA 2AFHE 1YZTA 4P32A 5CB8A 1D2EA 1BS1A 2QPOA 4LUCA 2OAP1 4LBWA 1OE0A 2P6RA 4JMPA 4NZYA 2XZOA 1JXMA 3LBNA 2R6DA 3BJIC 2JJ2D 3LDAA 3OIVA 3U3KA 2Z0MA 1M6NA 4C2TA 4M1MA 1H8HD 5JZVA 2VHCA 5JJIA 1P75A 2IWHA 1TEXA 4JVSB 3WNCA 2OM2A 1D8TA 2ZE8A 1KK3A 4DIDA 2O8CA 1WP9A 1NVWQ 2QAJA 4NCNA 2FDCA 4XTCS 2VHJA 2IC5A 2EVWX 3QF7A 4KFSA 4XVQA 1K8RA 2FMXA 1SVOA 3KJEA 2ATVA 4D0GA 3AVXA 4YONB 2FEOA 1AN0A 5JI3E 1TF7A 4PC2A 2VSFA 1E2QA 3ZVMA 3AKCA 3EARA 3L2OB 4M1TA 2AHOA 2GZHA 4XSHA 2EQBA 421PA 5BWMA 2YVUA 2JLUA 1DEKA 1E2LA 3QENA 5EE0A 3UWKA 1P60A 2P0EA 4BFWA 5JEDA 1OF1A 3G82C 2I1QA 1QZXA 5JWOA 4MYUA 4CIDA 3P1JA 1FOEB 3NEJA 3PIRA 4UNQA 1CJTC 1PVOA 1NF3A 2P3SA 2ZXUA 4ZKDA 5IF9A 3GEEA 3UMRA 1E9FA 4ARZB 5AUPB 3KFVA 1NVVQ 1R0ZA 1S1CA 2BBOA 3PVSA 1CJKC 4GFDA 2NO6A 1ZNWA 2WWIA 3UATA 1ESNA 4OQMA 1E2EA 1D2MA 2PZFA 2VHQA 1D6JA 1QHIA 3Q8XB 4HDOB 2FU5C 1TPZA 1YKSA 1L4YA 4DDWA 4U5XA 1XNJA 2J87A 3T5DA 1KJWA 5JBQA 4A36A 5EXXA 2VLIA 1VG0B 4Q4HA 4E5UA 2HLDD 2FPMA 5AJXA 5DN6D 1WBBA 2IUSA 5DI9A 2QMEA 1KMHB 3PXGA 4URUR 2PEYA 4TZ0A 4M0LA 2GTPA 4EJSC 2BMEA 3AV0B 2G0TA 1SULA 3LWNA 2X19A 1XD2A 4TQUS 4C7OB 1SVMA 5FBRB 3L0IB 3WNDA 3LAWA 1NKTA 4TMZA 2ZI4A 2BM0A 3QVUA 1S1MA 3K9NA 3T1QA 2FA9A 2ONJA 4Q48A 4KAXA 4ZDWA 2ZI6A 1VIYA 2V1XA 4B48A 1ZCAA 2O0KA 3NBXX 4IEEA 4H1VA 4A15A 3TNFA 3GLHA 3EIQA 1J99A 4W5JA 4D82A 5BQ5A 3CNLA 4KSBA 1U9IA 3DM5A 1R6BX 1E1QA 4I99A 2REXB 1ZYUA 4OK6A 2CDNA 4MYTA 4M9ZA 3UMSA 1KO5A 2GBLA 3BD9A 3V00A 2W6ID 3VKWA 4BZXA 1V5WA 4QGHA 4XVUA 4TMKA 1E79A 3QVVA 3RS3A 4C0SA 1SHZA 3DMNA 4EPWA 2IL1A 3QNUA 3SE0A 3R9WA 1J70A 1ZJ6A 2VTKA 4IDNA 4BE7B 5GJCA 1AS3A 5FR2A 1KIMA 4MRSA 2CK3D 2FNAA 4DVGA 3F5FA 1CLUA 2QA5A 3AF1A 5JRZA 5BN4A 4JVLA 5LD2B 1ZP6A 2QRZA 1D9ZA 2EFHB 2BBTA 4IOKA 3ZIAA 4M1OA 2QE7A 1RIFA 1G3MA 1G7SA 5C2JB 1NLFA 5KSOA 1FQJA 2IEZA 2VP6A 3DZDA 5AJZA 3ASZA 1DPFA 2NO7A 3C15C 4DSNA 2BCJQ 1II8B 1Z0DA 2FGJA 2QAGB 3F0TA 3K9LA 3RC3A 3T5GA 2V4ZA 4C0LA 3GLGE 2GJKA 1FNMA 2R44A 3EZFA 5IT5A 1KOFA 2DWOA 4YDHB 2C5LA 1CJVC 1XEWX 3K0CA 4WIAA 2JLRA 3HU1A 2GEUA 2GVZC 2ZUCA 4Q9HA 1KI1A 1VYVA 1H8EA 1YJ5A 1CF4A 4ABYA 1Z0AA 1P3JA 4KV9A 3U6BA 2CLSA 2XNDA 1F6BA 1N6LA 4L4UA 2RGEA 1E9RA 4NYIQ 5JSZA 3DKVA 1VG8A 4M4SA 5HCIA 3R8CA 2FOLA 3AKDA 4XJXA 2O8DB 1HA3A 3CLVA 3EA5A 1E1RA 5CM8B 4B3XA 2BDTA 5KHOC 1EFHA 2ZAOA 1W36C 2ZR9A 5F3WB 3TJZA 5JRJA 1OSNA 2VA8A 3PR1A 3A4NA 5KOYA 4R71A 5J4HA 3K0AB 1CEEA 4IOLA 2FZ4A 4LDJA 4CRWB 1GRQA 2WJGA 4LHVA 4OHZA 2DY1A 3AVWA 3B1YA 5FFMA 2FN4A 5L8VA 4PPNA 4WA7A 4OK3A 2BIFA 3AEZA 4A9AA 4A2QA 2Z4RA 2IX3A 4H1UA 1NSFA 2EU8A 3PV0A 2IT1A 1YR9A 2IYSA 1SKQA 3I8XA 4IHQA 4KLZA 1XTKA 3WYFA 3QEJA 3A1WA 2RB4A 2ZUBA 3PEUA 3LXRA 4C0QC 3AVOA 4XD7D 1N5KA 1UKZA 1EFTA 4M9XA 4E09A 2HT1A 2KJQA 1E9DA 1KSJA 5EUQB 3J81k 1T5IA 2GETA 3CF0A 1NJFA 1RFLA 2LKCA 5FOUA 1MR3F 1OFTA 3BORA 3KFXA 5HR5A 3FB4A 4HLQB 2ZETA 4IJMA 5TMPA 3U44A 3BC1A 3BRWD 2ZQ5A 5DHFA 2FFQA 4DDUA 4NONA 2C95A 2CE7A 4ZI3A 2KBEA 4I81A 2QTVB 4AY2A 1XCPA 3AVTA 3D3QA 1W4AA 4Q18A 1AGRA 4I1VA 2RH5A 1J2JA 2C8VA 3RANA 3OEEA 4QL3A 1QHYA 4DCSA 4NP6A 4OHYA 3IKJA 4WZAE 5LBIA 4C0KA 4OK5A 1A2KC 5L3VA 3NBZC 3EA0A 4GDFA 1GVNB 2WVJA 1OJLA 4FMCF 1TTTA 1NN0A 3OFND 4HUQB 5L3SB 1BOFA 1XZQA 4BECA 3FPAA 3FMPB 1GL9B 4TSFD 1C1YA 1CR2A 4PQFA 4W9MC 1KTVA 1MABA 1T9HA 1GITA 3GCGA 1FW6A 3ZS8A 1E94E 2GAOA 5CK5A 4BLRA 4DSTA 2OV2A 1F5NA 4I1OA 1WB9A 3MGCA 1YR8A 2OUKA 1VMAA 5FOVA 3QPVA 1Z2CA 2QNRA 1W0JA 4F91B 1JXOA 2A3RA 4V03A 4A8JC 4KXFB 2JLWA 5KDLA 1W36B 1P2VA 5JS7A 4ZCLA 4OI1A 3CH5A 3NC1C 4QBFA 1KI7A 1R7RA 4BLOA 3IIJA 4MGKR 4Q1DA 1GKYA 1X3SA 4JKIA 4P33A 3ZS9A 1CULC 1ZIPA 3K53A 3UPUA 2CLCX 1RPZA 2CBZA 3QJYA 2ZAMA 4D2IA 4GBMA 2YINC 4N1AA 3RRZA 1X8KA 1UBCA 1Z47A 4Q4JB 2YYZA 3KJIA 2JJ1D 2C99A 3C4JA 4JT2A 3AF4A 3SNHA 3THYA 2XGJA 2IW3A 1J8YF 5DHAA 4B74A 3GLHE 3QKSB 2GNOA 1N3BA 1HY3A 1E4YA 2VBCA 3TMKA 3PFIA 3HR7A 1OT3A 4AKHA 1U99A 3LA6A 1XPRA 1ODFA 3VTKA 4OQLA 1D5CA 1Z83A 3QXXA 3AVUA 3VU9B 1IY0A 1NG9A 1N6NA 3N5CA 4Z1MA 4Q4AB 1HQYE 1G8PA 4PC6A 4RFVA 1Z29A 4HATA 3QKTA 4OHVA 1P62B 1ZNZA 5EXTA 4C0BA 2Q3FA 4HI0E 3U3OA 5KU1A 2GVDC 1Q21A 2ANBA 3SHFA 3U6KA 3X1XA 2F9LA 1E32A 2RKOA 4B2PA 2HCBA 1UKYA 4BQSA 1ELOA 4P4UA 2IK8A 3PUVA 4PPQA 3WP0A 2OILA 3AM1A 3MRSA 3IILA 1E1RD 4PSKA 1FX0B 1LFDB 3I3SR 3IPYA 2WWGA 4B3CA 1NN1A 2ASEA 4PPGA 2VHUA 4JLMA 2EYUA 4OHXA 4CF7A 3MWKA 1DAEA 4DLTA 1G64A 1KYIA 4TT3A 4G5QA 3LD9A 2DYKA 5TY0A 4QKQA 4NH0A 1P6XA 1EGAA 2HDNB 3FKQA 2ZTSA 3CW2A 3TR5A 4D25A 3AP2A 1U8ZA 3KUCA 3NKVA 1E2PA 1DVRA 2ZROA 4MRRA 1LB1B 1OPXA 1RKBA 3B9PA 3QOFA 4Y0AA 2A5JA 3KKMA 2ORIA 3AGPA 4II7A 4P3YA 1E98A 2NGRA 5FH9A 1XU4A 1WCV1 3GFTA 1MH1A 621PA 3SBEA 4Q66C 5GADl 4UNRA 2J0VA 5TVKA 3K0SA 3B1XA 2JASA 4I1SA 1US8A 3BIFA 3M0EA 4OQNA 4Q9IA 2A30A 4HLUC 4JIMA 2ZJOA 2CLDX 5HKKA 4ZDKA 3ADKA 2REBA 4TTRA 2IWRA 5G3ZA 4BFYA 4BGDA 4TMWA 3EASA 4EQ6B 3PCRB 1YZKA 2UZIR 3QSYA 4JZKA 3V4FA 2YWHA 5FUXA 2OCPA 3ICEA 2WSSA 3FDIA 1P73A 2VH5R 1TAGA 5SZIA 1KSHA 4KVGA 4HLCA 4W5WA 2P5TB 1WDTA 2RGAA 3SFVA 3WNBA 5G53C 2D7DA 3GJ8A 3K09A 4QBHA 2GXSA 4FINA 4RCYA 5IK2A 1Z6AA 1KI4A 2IYWA 4ZIRB 3EX7C 3GLFA 4JT4A 1HYQA 5HE8A 3AB3A 5B58C 2R6CA 3PUXA 3MG9A 1YQTA 3IHWA 521PA 1ZRHA 1UKEA 1Z8FA 3WYAA 3MWYW 2F1HA 2WM9B 4LJ9A 4OKSA 5K8IA 1N0WA 1OH7A 1JAIA 4HSEA 2O8BA 2AN9A 3LH5A 1W0JD 2O5VA 2P6NA 1SXJA 2QGZA 1DAGA 3CRQA 3NIBA 4AIIA 3LX8A 5JMTA 2H17A 4DUGD 1ZINA 5L3QA 5CYPA 4AURA 1U0JA 3K0FA 1M74A 1E2GA 3IQXA 1Q1EA 4E03A 2FFHA 1E0JA 4B35A 1JJVA 5GJVC 1E2IA 4N0EA 4D4LA 3QUSA 4BFTA 1R5BA 3W34A 1W2HA 4LI0A 3THWA 1OYWA 3IGFA 2KSQA 2VP2A 5AUOB 3ZDQA 2AWOA 3B60A 1YZGA 1G291 4NCJA 1KDPA 2ZI9A 4AYTA 4DT1A 2JJ2A 5KNDA 1FMJA 5SZHB 3IIKA 1LV7A 2J0UA 2XXAB 2R9VA 1KMHA 2XEXA 4XIGS 3L0SA 3THXA 4DLUA 4QGGA 1KSGA 3OE7A 4D0NA 2FZLA 1XP8A 2OBMA 1KO8A 1IHUA 2ZRJA 3ZD7A 4Z1MD 5FBWB 4F4JA 4LJ6A 1DE0A 4CEHA 1Q22A 1OFIA 3PUYA 3QF4A 3M4YA 2ZE6A 4NMMA 4GP7A 1N0UA 3CWQA 4RZ2A 1KK1A 1E69A 2QP9X 4TMTA 4QGAA 2D4HA 3HPQA 2XB2A 3CWZA 1EFCA 3BFKA 1Z0JA 2ZRHA 4W7SA 5FUVA 1VPLA 2ERXA 5AJWA 5TV2A 3WMEA 2X2EA 2RGGA 3VMFA 1B23P 1UBFA 3CR8A 1KJZA 3C7KA 3QBVA 4JL8A 3OIUA 3NDBB 1ETUA 1N6KA 3R9XA 2AK3A 3KZ1E 3I5YA 4FW9A 1G8YA 1AK2A 1CRQA 3NVAA 3QXSA 4GSYA 1XTIA 3AH8A 3T35A 5E7JA 3G5UA 5CITA 5KDDA 3KQUA 4F92B 3LLMA 2EFCB 2NG1A 4PAMA 2QENA 4IW3B 4TL6A 2D62A 2ZSDA 3ZZTA 4A0GA 1XMIA 2W2XA 2X8AA 1WE2A 721PA 2QRNA 4G3XA 2WMNB 2HLDA 2ODBA 2OBLA 2YOFA 1SVLA 4TTPA 3PUWA 4MQBA 5IDVA 2WZQA 4L8GA 5K8UA 4UXJA 1Z5ZA 4QXAA 2BMFA 1RZ3A 4MDFA 1YHNA 1XXHA 2H18A 5FTMA 5HKKD 1X6VA 2ZEJA 4HB2A 1OH6A 3WXMA 1Q12A 4FMCB 1G7CA 2GCOA 3WRXC 4D6PA 1KY2A 4XWOA 2FE4A 1DOAA 4FWIB 3AP3A 4QRHA 1LF5A 2BOVA 2XX3A 1BMFA 3B2EA 4KCGA 4JLOA 4XWAA 5FUYA 5SZKB 1U8YA 5EP4A 1S3GA 5FI0B 4EJSA 4URWR 3WP1B 1HV8A 2FX3A 4MA4A 4YDSA 5J47A 5IK2D 2AKAB 4ESHA 1TX4B 2QN6A 3ICQB 2UVQA 4DLWA 4JBXA 3SQWA 2QUZA 821PA 1Z22A 3A37A 3CRRA 3I1FA 3U4QA 3X1WA 4NCIA 4R9UC 3SEAA 3BERA 2W6IA 4LYAA 1KZ7B 2J46A 3M1IA 1D2NA 3AF0A 2CVFA 2DFKB 4P4SB 2IYTA 3RNLA 4DBLC 2ZRMA 2CNWD 3A1SA 3DVLA 1RJ9B 3TGPA 3NBYC 3LBHA 4WBSA 2PX0A 1P61B 2CK3A 2GJ9A 2ZS7A 4EFMA 1Z08A 2Q9AA 3N2IA 5FOSA 1JECA 2MSEB 1R0YA 2XSZD 3KL4A 3VKHA 1P9NA 4Q7KA 2YKGA 1L7VC 1FTSA 4FXPA 2F1RA 1C4OA 4NHOA 2G1KA 4R7ZA 3U3MA 3GLFE 1Q3HA 4HB0A 1GZSA 1WMSA 2N1BA 1SZPA 4EKDA 1A2BA 3CZQA 3W5JA 4F93B 2PLRA 1E9SA 3Q7QA 5CK4A 5DLQC 1IAQA 2VQSA 4JL6A 5D3QA 5DH9A 3W8NA 2NO1A 1GOTA 2REOA 5G41A 1DO0A 2IYVA 2P5SA 1XEFA 1ZD1A 5BW8A 4JLJA 3RRYA 1QDEA 1IONA 5KNCA 4M2LA 3OE7D 1SXJE 4ZO4A 4ZI2A 1SKYB 2X1VA 1VG9B 5KNBA 1XEXA 1Z0KA 3N70A 4JJZA 1UKVY 4PSAA 3RWOA 2JA1A 3I61A 1EESA 1R2QA 5EE1A 2QP4A 1XPOA 4R2HA 4PQRA 1TF2A 3TAHA 3WBKA 2ZI7A 2HV8A 3B1VA 3KKOA 4A2WA 4RD4A 3DOEA 1ESMA 5AJVB 2VIIA 1WXQA 2C04A 2WJVA 3K9HA 2ZYVX 1HEIA 3HYTA 5J4KA 3MCAA 2WIAA 2B8TA 5EE3A 1L8QA 3K70C 4A6XA 1D9XA 4JS0A 4JKYA 1F2TB 2G9NA 4NBSA 2QSZA 4RZ3A 2ZSAA 4W5HA 3GLIB 5AJYA 3FHTA 1T4GA 1N2CE 5LD2C 4PPFA 2DFTA 1U0LA 3PJRA 3FGNA 2RHMA 4Q02A 2JLQA 4V02A 1MRNA 1R8QA 2WOJA 1KSFX 3ZZUA 3PEWA 3EAQA 2MMGA 1TMKA 1K6MA 2QAGC 1VCIA 3AUXA 4XD7A 1BO6A 2YJTD 5G3YA 3X1YA 2WBLC 3HPRA 3H4MA 3WRYC 5KPJA 4LSGA 5EUMA 4RCZA 4V0OA 1G1MA 4ZV4A 3BXZA 2HJVA 5DYGA 3OEHD 4ACAA 4HB4A 2R6GA 4WZBE 3Q9LA 4BUJA 4HDCA 1O3YA 2EYQA 3H86A 3AVQA 3ONWA 1F2UA 3RC8A 4RSGA 2QGNA 2QT0A 1MOZA 4NYJR 3AKEA 4TMXA 2QU8A 3LV8A 5JI2E 4FN5A 5GJWC 4LZZA 1BMFD 1OHHD 1G16A 4CVNA 3QI2A 2RGBA 5JECA 2E9SA 4L9WA 3A1TA 3OFNA 2ANCA 5BYJA 4CEIA 4GMDA 4IKEA 4HAXA 4D80A 5DI3A 4KBGA 4TSFA 1Z6TA 2GILA 1NBMD 4RD6A 2PZGA 3GP8A 5JWRA 4DEXA 5KO2A 2A5DA 4JLAA 4JLNA 2CJWA 4HZUB 2ZE5A 3ECCA 4UXHA 4WXPA 1DG3A 4PAQA 2F55A 1W0KD 3C16C 4MUAA 1B0UA 4OI2A 4QHSA 4RFSA 2OHFA 2V6JA 2XJ9A 4TL9A 3QE0A 1GSIA 1XXHE 1EXMA 1S8FA 3QKRA 1FUUA 1KI3A 4ZDJA 3RLFA 4F4CA 2ODNA 2FSFA 2FFAA 2Z5FA 1GM5A 3K70B 2BHRA 1XTRA 3KXKA 4GNKA 3UXMA 3WHKA 4GP6A 2DCUA 2IXFA 3BH7A 4IVQA 4IXNA 2K5UA 1JQLB 1YR7A 2JJ1A 1E9EA 1KO1A 3DPUA 4A8JA 3B13B 1M34E 1PJRA 1KI6B 3LXXA 5CLLA 1QHHA 2O0HA 2GJAA 2C98A 1WBDA 1AQUA 4MKFA 2OESA 2IYXA 3X1DA 2B7CA 4G5RA 2ECKA 1FQKA 3OHMA 1KK2A 5HZKA 1U81A 1CP2A 1XMJA 4DCNA 2F43B 1AJEA 1UAAA 1IJEA 2A5FA 1P72A 3HU3A 5FPYA 4Q9LA 5J4YA 1ZMXA 2OLJA 3VR2A 1W48A 2B7BA 4PHFA 3HWSA 1OH8A 2GK7A 3EC1A 2R6FA 3CIOA 2B6HA 3M6AA 3OESA 4KSCA 1P4SA 2LWIA 2VP5A 4MH0R 4L5BA 3RS0A 2JLVA 1KI8A 3EC2A 3KTAB 1I2MA 1KAGA 3EPKA 1KDOA 4G0NA 5P21A 4ACBA 4B34A 3FTQA 3TK1A 5FTNA 4DCUA 3IO3A 4Q7LA 3GEIA 1II0A 2VF7A 1DAFA 3B7GA 4DCTA 2J9RA 1G8HA 3GFOA 1ZU4A 3R7WB 2YWFA 2BJWA 2E87A 4IDPA 2QBYA 4UJ5A 2WKRA 2ZR0A 2ZR7A 3FKSA 4O0MA 2ZJAA 4M22A 2Q6TA 2J0QA 2ZRBA 3CBQA 4YMUA 3VHXA 3B82A 3GJ0A 3B1ZA 4LX0A 3FOZA 4CEJA 3D7MA 4PZZA 2H57A 4QJ5A 4ON9A 2CEAA 5E7IA 3SU8A 1R8SA 2W0MA 1FPMA 3H2YA 4RD2A 4XTRA 2HUPA 1Z6YA 3UG6A 4BRWA 2HYDA 3P32A 1F48A 4QFMA 1N0VC 1QF9A 2D2FA 1FZQA 3LX5A 5HPYB 1W36D 4C4PA 1DAKA 1Q44A 2PL3A 4HUTA 1WA5A 4I4LA 3FFBA 3GLGB 3U7FB 1TEVA 5EJEA 4L15A 1RW4A 2WSMA 1PUIA 5J4VA 1TL7C 4OBEA 2D7CA 3RS5A 2YOGA 4TN1A 2GEVA 2XOKD 1E2DA 1JALA 3SI7A 2ZRCA 5H68A 3EZ9A 2PCJA 2PLFA 1GNPA 3LNCA 4R2IA 3VX3A 4TLDA 2HEIA 1XWIA 1AZTA 4U7DA 2AX4A 2WWFA 5KSPA 4IRUB 3L43A 4FCWA 3S1AB 4B3GA 1LY1A 1XFAA 2I1VB 2ZJ2A 4Q19A 4YMWA 2YV5A 4JL5A 1TF5A 3DMDA 1YE8A 3BS4A 4PSVA 2IUTA 2ZRNA 1YZNA 2Q21A 3ZYCA 2GEDA 1QHGA 1SVIA 1GILA 4HLUA 4JYCA 4PXAA 221PA 2QM8A 4A0HA 4JVMA 2YZ2A 2EWWA 3DM9B 1PLKA 2XNSA 1AGPA 2OLKA 2GZAA 2J7KA 2XTMA 3B78A 1CRPA 1X1SA 4Q1EA 4Q7JB 4RVCA 4QM6A 3UANA 2C03A 1AKYA 2BBWA 2QZ4A 4TLCA 4UXIA 2O8CB 2VP4A 1AS0A 4LJ5A 1VHLA 2OFWA 1XBTA 4YMSA 3C5HA 3KKQA 2RAPA 1I4TD 4X8HA 3GMTA 2R62A 1DAHA 5H8WA 4XSGA 1N5JA 2OZEA 3IBYA 1MO4A 4DUGA 2O8EA 5FPHA 3U5ZB 3SS8A 2LKDA 3ZQJA 5BN5A 2IYRA 1L2TA 1ZM4A 4DLVA 4LJAA 4DHEA 1QHSA 1JAHA 2ZRPA 3ND9A 2BMJA 4LGMA 4A82A 1E9BA 1NMXA 2GJSA 4ZCMA 1JPJA 3BFVA 2VEDA 3EIEA 1ZVQA 1KZGB 2JEOA 2V3CC 2WPDD 1NNEA 1EX7A 1NP6A 1IXRC 4Q03A 2PZEA 5A0FA 5FL7A 5CYOA 2AXNA 4DXAA 5G40A 3VR6A 4EPVA 5TARA 2RGNC 3AGQA 4MKHA 2RGDA 4TTQA 3BAFA 4LOAA 4ESVA 2OFXA 4PTLA 1JI0A 2F1JA 4HAUA 2GZDA 5JCPA 3W5IA 2Z43A 2H16A 4EFNA 5FOXA 4Q4HB 4D0LB 3TLXA 2JATA 1XZPA 3KUDA 1L4UA 4D81A 3SQXA 2KWIA 1JNYA 4TL8A 3EWSA 3RS4A 4KYIB 3QBTA 5AK0A 1G6HA 1XTQA 2WTUA 4LV5B 2O8FA 3MFYA 2IF0A 1E0KA 3H1TA 3RRNA 5IHPA 4DKXA 1XD2B 1W49A 3P20A 2A7QA 3GJ4A 1GIAA 4OHWA 1EFUA 2AK2A 3VNVA 2HT6A 4A0FA 3FKSD 4UNPA 4X8OA 2IS1A 4MKGA 1OFUX 2W2VA 4QM7A 2EW1A 4HAYA 4PHHA 1GWNA 2D74A 1LF0A 3R9IA 4EPXA 2PMKA 3LW8A 4B73A 2P65A 1OKKD 2QPAA 1XB2A 3O8DA 3GFPA 1PUJA 4LV6A 4NL4H 3TVTA 4P4TA 1XMSA 4X8LA 1SVWA 3DOFA 3E1SA 5L3RA 4AG5A 1ZD8A 3ND8A 1LW7A 3KKPA 3IUYA 4PC3A 1LS6A 1ZU5A 3ZH9B 1NKSA 3PEYA 3NHBA 5HTKA 5DIFA 2FPLA 2PH1A 3GQBA 2ZE7A 3TH5A 1AIPA 2QTHA 5LB4A 4AYWA 1Z0IA 3FMFA 2ZRIA 2BV3A 2LCFA 2JDID 1RC8A 2NO0A 1G3IA 2NO9A 4FI3C 2BEJA 4BLPA 1G17A 5AWFC 3KX2A 4MYHA 4BLTA 2JIZA 2ZI3A 1LNZA 3ZJYA 5FPTA 3C14C 4TL7A 4C2UA 2PJRA 5LB2A 4WVFA 4US1R 1XTSA 5EP3A 1E4VA 1N6RA 4AKIA 2DFNA 2W6JD 5GJBA 4JSTA 3JVUA 2CL6X 5KSZA 2YOHA 1CJMA 1C9KA 3KQLA 3SHWA 4B71A 3T06B 4Q21A 1GL6A 1NI3A 4CZ2A 4Q4LA 4IVPA 1XPUA 4RD1A 4ZDIA 3RSLA 4FMDF 4HAZA 1OB2A 2V9PA 2XITA 3F8TA 1OIXA 1CIPA 1TQ2A 3BGWA 3QKUA 5C18A 4Q9KA 4Q01A 3CRVA 3SR0A 2PMDA 3VQTA 1GFIA 1ZUIA 5JSZB 4YMTA 4IEIA 4PC7A 3SC3A 3WMFA 2HF8A 2NQ2C 2AD1A 2CNWA 2O52A 2ZIAA 3SOPA 4DCVA 1HT1E 1J7KA 1G21E 1JB1A 4AG6A 4O2LA 2ZITA 1P5ZB 1RYFA 5B2ZA 2H1LA 4JVNA 2CHQA 3B9QA 5KDOA 3I8SA 2XSZA 3KQHA 2ODEA 4QNRA 3WYGA 2IS6A 4YXWA 3AF2A 4ARZA 3TUZC 4GOKA 1T6NA 2V8OA 1DG1G 2KBFA 1W7AA 4UQOA 3AVVA 1SQ5A 2IXEA 2P67A 1U0HC 2QM7A 3T1VA 3VR4A 2AFIE 1W4RA 1HH4A 4K46A 1JPNA 4QBGB 3UK6A 2GDJA 4IOMA 4KU4A 4M9QA 1Y3AA 4IDHA 5FL7D 4DB4A 4MGIR 5HE9A 1YU9A 1YZUA 4DRZA 1ZM2A 1S96A 2J7PA 4QJ3A 3G0HA 3L8YA 3A4MA 2ZYTX 1G20E 1H65A 2NZ8A 4Z51A 2CCGA 3GJ6A 2W83A 1Z6XA 2QMUA 5GVSA 1SVKA 3TUJC 4C7OA 3RYTC 4U00A 3QXJA 1NVXQ 1TADA 3F3YA 1BIFA 3FHOA 2WMOB 4FIDA 2NPIA 3U44B 4KBFA 1K5GA 1FTNA 1W1WA 3QPWA 5EP1A 1ZNYA 2IS2A 3P27A 4AD8A 2YNMA 1S4QA 2UZ3A 1CJUC 3O8BA 3O8CA 1E2MA 1TU4A 3U2QA 2JLZA 5F98A 3O8RA 2WWXA 4QHTA 4BFUA 4B32A 1QBKC 2JLXA 2ZUDA 1ZIOA 3QXHA 5EXPA 1PLLA 2NOAA 3HP1A 3Q85A 2WWYA 4OYHA 1W47A 1G18A 5CJPA 1W5TA 5BXQC 4DLRA 1AKEA 1N25A 2GXUA 2WJIA 4FD2A 2QROA 3Q5EA 3TKLA 3ZLJA 1X8JA 4D4JA 3CUEF 3IIMA 3TSWA 2ZJBA 1Z63A 2NMVA 1MABB 5DYIA 4D4MA 4F4IA 2ZS9A 4PZLA 4LBVA 3Q72A 3UWOA 4B2LA 2J0SA 4KVAA 1NIJA 2GHIA 2ZM5A 3HYRA 2D2EA 4C0AC 4M1YA 2WICA 5IRCD 4JBYA 4MYCA 3CX8A 3IQWA 1XJCA 1IY1A 1FL9A 4OQFA 4PO8A 4GOXA 5JHGB 1Z0FA 5EE9A 2HYIC 4Q1FA 4LJ7A 1KO4A 2XTNA 3V9PA 2L0XA 4G1UC 2PJZA 2C77A 2ZRDA 3W90A 2OCYC 3X2SA 1N6HA 2FSIA 5CM9C 2GXAA 1G41A 1UEIA 3OEHA 4CW7A 2IYYA 4Q5IA 2O0JA 2VP9A 3QPUA 2JIZD 4LC0A 2GCPA 1NL3A 1II8A 2QAGA 2VSOA 3TW4A 2F9MA 2ZPTX 3THYB 3RAPR 5GVRA 3O47A 3B8HA 5C4GB 3DO6A 4M8NE 1CR4A 3BB1A 3FE2A 1OHHA 3AVPA 1CBUA 5C4MA 3C5CA 3W6NA 2BC9A 2EWVA 1T8UA 3WY9A 1ZAKA 2YC4C 3DZ8A 4A92A 2X77A 1XJ0A 1T5LA 3U3JA 3B1WA 3PQCA 3KXLA 3SZRA 3MD0A 4Y0VA 4B75A 3Q5DA 1BKDR 1NBMA 2WAXA 3LVRE 2QL6A 5FBQB 3E5HA 3EPHA 1TNDA 2O8DA 1G9XA 4IOJA 1HQCA 1TQDA 2GK6A 4RD0A 1RRFA 4LYJA 2G1JA 4BEBA 4DLXA 3GPLA 1W0KA 3ADDA 5EQTA 5B30A 1MRSA 3UIEA 3K0AA 1PV4A 1UPTA 5B64A 1IBRA 3PITA 4N0DA 1T3HA 3CPEA 1NSTA 4AYXA 3U7HB 4JYBA 3E70C 1VCOA 1W5SA 5LPNA 1ZCBA 1SXJC 4UKDA 2QY9A 2KB0A 2W0SA 1X86B 121PA 2BVNA 2VHTA 4QOSA 1E0AA 2IEYA 3EG5A 2IA5A 3ASYA 3NXSA 1EX6A 1Q1BA 4UJ3A 4JJKA 2OAQ1 1TQ4A 5EP2A 1U98A 4HB3A 4KO8A 1U90A 4K8OA 4JLVA 4M1KA 4YXWD 4C3ZA 2TMKA 8OHMA 3VR1A 4HEJA 2V54A 4URYR 5AUQA 2G88A 2RMKA 2Z6VA 3FMOB 2GA8A 4TZ6A 1E2NA 2QG6A 4EPRA 3I4LA 3THOA 1Q1ZA 1I4DD 4URZR 2G3YA 3B85A 2AD5A 2C2HA 3GD7A 4XWKA 2OE2A 4AWXA 4ZPXA 2OCBA 1VECA 2XZPA 1COWA 1F60A 4V0LA 2DFLA 3IBGA 2CVHA 4YC7A 1DELA 4OI0A 2IUUA 2H92A 1XJQA 2OXCA 2J7PD 2FF7A 4AKGA 3AVYA 3V4RA 2H8KA 1FFHA 3T34A 2QPTA 1VYTA 3LY5A 1US8B 4NYIR 3PENA 2DHRA 4YLGA 3FVQA 2IYZA 3C8UA 4MRVA 2NPFA 3SYLA 1XEWY 5J4LA 4ASUA 4DLZA 1EFRA 2JLSA 3EXAA 3GJ3A 3GJ7A 3MUFA 2GCNA 1IJFA 1P9WA 1KAOA 1ZD9A 1YRBA 3ZGXA 3RHFA 5FUWA 4JSYA 3EIHA 4HUQA 5L3SA 2ZJ8A 5TDHA 4BZQA 5F9HA 4E22A 1S9DA 2PX3A 2C9CA 2JGNA 3MSXA 2A9KA 3SFZA 5DGXA 4TLEA 3FWYA 2FJUA 5F2EA 2VSXA 4KHZA 3TSZA 3UKDA 1IXSB 5FOWA 1II9A 3GLFB 1FNNA 1A7JA 4EAQA 4BFXA 2HF9A 1XRJA 3DEFA 4MRNA 4ZKEA 1Z6GA 3OF5A 2PBRA 4JLKA 4A4DA 4C0HA 3ETLA 4ILEA 4K81B 4UNSA 1NIPA 2OCAA 3K70D 2FG5A 2G0NA 2O8BB 1HUQA 2IHBA 3JVVA 4NCKA 3U7EB 2GESA 2XOKA 1EK0A 1OXXK 1SXJB 2GJ8A 4A1FA 5KSYA 5F9FA 2A78A 2CL0X 2NTYC 2ZVQX 4Q4JA 3RS7A 1VCNA 3OZXA 4LC1A 2B92A 4GRAA 2F3RA 5L3QB 1ZNXA 2HXSA 1G8GA 3E2IA 3QKSA 3K0FB 5KPDA 1IM2A 3TE6A 1GG2A 2QTFA 2W2TA 2D06A 4KFRA 1IOZA 3KQNA 2XZLA 2ZS8A 1Q57A 4LWZA 3VR3A 5ELXA 1IN8A 1QHNA 3JZAA 3VU9A 4BEJA 3THWB 1A1VA 3SYKA 3TUIC 5JCZA 4Q4AA 1G5PA 2CHVA 1KNQA 2UKDA 4FMDB 3JZMA 4HAVA 1GNRA 1N6OA 2J3EA 3CPHA 2ZSEA 4O25A 4JLDA 1TQ6A 4DT1B 2DR3A 2HCJB 3CB4A 2J0UB 5CLQA 3REGA 3THXB 3MWLA 1ZC3A 4MITA 1NMYA 1P2TA 3P26A 3LQRA 4LBZA 3NWJA 3OAAD 4KJZA 3WHLA 3QXCA 2WJJA 3A8TA 3VX4A 1LVGA 4CEHB 1FX0A 4IDQA 2B8WA 3CNNA 5JLJA 2F1IA 1XD8A 1IY2A 3QF4B 4URXR 2IYQA 4G01B 2N46A 2ZU6A 4HYYA 3TW8B 3CM0A 3VHLB 3BH0A 4LPSA 4H9GA 3RVBA 4DWJA 1CXZA 2ZRGA 4MGZR 2ERYA 1M7GA 4OI4A 3PG5A 4TMVA 3REFA 2ZU0C 2ZRAA 1R5OA 1KGDA 2AR7A 4QBIA 4BFZA 1KK0A 2RGCA 4B3FX 3U3RA 1G7RA 1GL7A 1MV5A 1VDZA 2V55B 2WHXA 3WBJA 1FP7A 4NCHA 5BYKA 2DPXA 1NMZA 3NEYA 1CKEA 4GT1A 4LHWA 4URVR 2WPDA 4RKEA 2WAYA 3TQCA 1NBME 3ZD6A 3W3AA 4DB2A 1QRAA 4OL0A 4LYFA 2IYLD 4Z8XA 4KLNA 1EG7A 1OIWA 1Q3TA 4DDTA 1UBEA 2Q9CA 5JS8A 3R8FA 3FFAA 2V1UA 4IXMA 1JR3D 5JJLA 3CZPA 1G5TA 1VCMA 3BOSA 4GZMA 2BEKA 2E1RA 1COWD 2JJ8A 3DHWC 3ADCA 1V43A 4QG7A 1NN3A
chains in the Genus database with same CATH superfamily
2EJUA 2FX2A 1HZZC 1KC3A 4IHJB 4GPAA 1TIKA 3EUFA 4IO1A 2WAAA 3UK7A 2WV7A 3LUGA 1JR6A 4JROA 1BVYF 2ZI5A 1MT0A 1L5WA 3RSFA 1EXWA 2QX4A 3P19A 4A23A 4ZEWA 1IQRA 3N0TA 2OFOA 3LIIA 2GKSA 2V7QD 2O05A 5HIMA 4KQEA 1HE8B 2Q3LA 1EEXB 4YRQA 2UVDA 1OBHA 4HV4A 4GL2A 3KJGA 5BWNA 4EY4A 1ZW6A 4WY8A 1ISIA 1VHTA 1Y5RA 2WR8A 5KAPA 4QNMA 7ABPA 4JYPA 5JJCA 1YOVA 2O4CA 3G88A 4L5CA 2IYPA 2WSBA 4E07A 2JA2A 4ZIRA 1Q20A 1T8WA 3ZE6A 5D5QA 1N3IA 3RVRA 3BB4A 1D2HA 3OPQA 3W6OA 2JLYA 2HK8A 2PBZA 3PDWA 3F7OA 1XU7A 1VOTA 4K6GA 2X3UA 4FPXA 2IF2A 2BMDA 4FE7A 4GPTA 4KFUA 4NABA 1G60A 4TZKA 3RUDA 3TX6A 4E0BA 2OP0A 1E1KA 2PQ0A 5DCUA 2RFLA 2BZGA 3CRMA 5ADWA 3H5RA 3NUZA 1IATA 4EKEA 3NDPA 2UVPA 4UC0A 1NJGA 4WZ6A 3ZHRA 2KE5A 1SUAA 3NWOA 4UM5A 5D2CA 1WTCA 3B52X 1M9NA 1W6RA 1XQWA 2EKBA 2UZ1B 2BCGY 1C0LA 1UM9A 2OC4A 3OZGA 4RIFA 4CDRA 2CCKA 3OPYB 3GCZA 3D1VA 2B94A 1UR5A 3EY9A 3PL1A 2OXRA 2X5KO 5CVVA 5C1DA 5C52B 2WHPA 1VI2A 1F3OA 2EKPA 2PU5A 1WZIA 4QEDA 1UUFA 2MINB 4BTLA 1ENZA 1INLA 3L7IA 5K8TA 2E2WA 3NYWA 5D3MB 4HDKB 4KWCA 4O8ZA 2PY6A 4MJXA 5LU8A 3S5UA 3SPXA 1IOLA 5KYYB 4KRGA 2YQZA 4R9NA 1HR0B 4H0NA 4OP1A 1BFDA 3UK0A 5LM3A 1QK4A 1QVRA 4JQSA 4ZHQA 2ZOSA 5FNVA 1SUWA 3TZHA 3MTBA 4DIBA 3DUFA 4GECA 2Y1LA 2R8BA 4EO9A 5IJ0A 2C92A 1TO6A 4N01A 4OMUA 2ZUFA 1OTYA 5HF6A 4OQDA 5AW8A 5AM5A 5AVRA 1LBTA 4B3HA 4H7PA 3NR2A 4MUBA 2W6JA 1FNCA 4OXYA 3F9CA 1OW3B 5DMHA 4G86A 3KCNA 4BASA 10MHA 4GG1A 5DM1A 5EE5B 1RXIA 2C4MA 3O9VA 2PS1A 3PCTA 4QDKA 3CRNA 4TUYB 4D74A 4KREA 5K6TA 2I22A 3T52A 2G6BA 5CPBA 5C8YF 1X19A 3HP4A 1KHTA 4Q05A 5MN4A 3LVQE 3MMZA 1J9GA 1V8FA 1ZM9A 1XQ1A 1J39A 2NIPA 3KUUA 4FXOA 1J7JA 4OAOA 4ZEOA 1T8PA 5JSUA 2IEGA 4HH4A 1E6WA 5DNYB 4O2BF 5AKYA 5EZ6B 4B33A 3GHYA 1IWOA 4Z8YA 3NVMB 3E4DA 4HDMA 1IQUA 1NOIA 1VDMA 2POQX 1XWFA 3G2QA 3QTLA 1A4XA 3DYVA 1PK7A 1XIVA 1G3RA 2A5GA 5H1YA 3VPSA 3K1AA 1RXCA 1OXBB 2BAGA 2V5UA 3HY3A 2XOXA 5F2NA 4NYJQ 1IFXA 1TVEA 2D2IA 3NTRA 2WYVA 4YLYA 2YASA 1V11B 5HWSA 2GBLC 3DSRA 4J8PA 3ETJA 4ITVA 5HCUA 4K2HA 4F3KA 2FSGA 2NU6A 1AHNA 2D1QA 5JO0A 4PYRA 4I4TF 1I7PA 2VF2A 2R8YA 2WFZA 4N9QA 4WW0A 1SHKA 1C3VA 5GWXA 3WGOA 3K1YA 2VPYA 3ZWYA 4AJPA 1BA2A 1L8XA 1AQ6A 1ZLXA 3KEOA 3C5EA 3EUAA 3GXBA 5KX5A 3C1UA 3WMXA 2IOFA 2FK8A 4P08A 5KMGA 2QORA 5CD1A 2PKYX 4W82A 4NECA 2FWAA 1HZJA 4N3NA 3DVRX 6Q21A 3EF1A 5YASA 1RJEA 1AB6A 2KI5A 4CT5A 4B6FA 4N8DA 5ED4A 4WCVA 2FFBA 3IQFA 1QIMA 4Z86A 4F9EA 1PT7A 3M70A 4L28A 2VJMB 4U6NA 5CBPB 1M8JA 4NHEA 2XHEA 3EGVA 4R98A 3WNQA 4AY6A 2OAGA 5DM2A 1PBNA 3ZCQA 4FBMA 4ER3A 3HBLA 1CR6A 5CIWA 3D8BA 3F9IA 5JNSA 1GGEA 2ADMA 1XCOA 2HQOA 4M87A 3F2IA 4U2GA 4GQAA 2DB3A 2Q3MA 4Q82A 5MHTA 1H4SA 4US2R 3RODA 2AI2A 3D7RA 4S1TA 4PY2A 3AUYA 4ZV9A 3COJA 2DR2A 1RS0A 3NT2A 5JAMA 4ARCA 2IDJA 4G07A 4MQEB 3C6MA 2OKCA 2SCUA 3CSUA 1EQAA 3F47A 3QG1A 4H59A 3ZIAD 4D44A 5IJZA 3AU9A 2QE7D 1YMUA 1ZVMA 3AUJB 3B51X 4XYGA 4MV8A 3UCXA 4ZYTA 1T5SA 3K4QA 3VR5H 2W2KA 1CR0A 1JBKA 2F7SA 2NZVG 4IKOA 4IMRA 1U7UA 1U1FA 3SJZA 4M1ZA 1F2UB 1RE1A 4WCDA 4YO7A 2WTMA 4POAA 3NRCA 4Q7MB 2CXXA 1UC4B 3FKJA 4UDXX 3KQWA 2Z8YA 4I1PA 1F8GA 2FSHA 4YJDA 1KKLA 1M6VA 5FT9A 4BLQA 4E32A 5C5IA 1JIKA 2IXAA 4P3XA 1F8YA 3P4XA 5DCYA 3IP3A 3V7FA 2OP1A 3WSTA 4CR7A 3AHFA 3C3KA 5EQFA 1USKA 2AOWA 1E62A 2WYUA 2QXYA 1IHDA 3D6HA 3D3KA 4TYPA 3TLCA 4KGDA 3WO1A 4KDEA 5AI6A 4XOIA 2ZCUA 2OECA 3FDZA 3ND5A 3O84A 2PR2A 1JH8A 5CIQA 4Y9TA 2FOXA 4FEYA 4D3DA 2G08A 3LRPA 2O7VA 3AHDA 1JG2A 3I32A 3MT8A 5EIHA 1E61A 1XA0A 4KQ6A 1DARA 2W58A 2Z3VA 2H00A 3E9QA 3IRVA 2XMZA 4Q00A 4X63A 2D5BA 4H18A 1TAQA 2IV3A 2EBHX 3E1GA 1OLUB 2V6IA 4JUDX 2EFEB 4TYWA 4QQNA 2I0FA 3BMNB 5EJ5A 1WXHA 4QQRA 4RFSB 1SHJA 1YE3A 4WBNA 4G25A 1NM5C 1G63A 1VJGA 2B7LA 4IFEA 5CU7A 1GUZA 3QEOA 4RMNA 4ZGGA 4H4CA 1T36B 1N6PA 1NLYA 5BRAA 1YI0A 4TPKA 1E2FA 1SVSA 2ES4A 3NC0C 5ECDA 3BE4A 3AJ9A 3FCOA 1FYEA 3O1LA 3OFJA 4D3XA 2JS7A 3WRVA 4ZXPA 3GBPA 1DUSA 1XALA 1MTZA 2MMCA 3VR5A 2V7TA 3WFIA 2WJAA 1B1AA 2I54A 5BRJA 5LDDC 5TGTA 2YZNA 3MTDA 1P2UA 3IEUA 4FFSA 4EYQA 4CDGA 3VOBA 3WLOA 1UFKA 1YNSA 4OG2A 3Q7TA 3LU1A 1G8FA 1R12A 2W6PA 3A4TA 2VBGA 3PUJA 4HQNA 3TLYA 2HPZA 4IVRA 3OZDA 1MXHA 5HOQA 4L0DA 4RA9B 4HAWA 2ORWA 3TZLA 1B42A 4I6EA 1T1RA 1AM4D 4NYMQ 3LQQA 2GF9A 4RORA 3CONA 2P2LA 4G5OA 4QEKA 5KS2A 2G04A 3RS2A 4AF6A 2YXPX 3GJ5A 4EB3A 1TYBE 4D79A 4M53A 2DLDA 3L6BA 3RUHA 1MB9A 1UBTS 3GNQA 4F11A 3CLSD 1W4BA 2YIVX 4NPHA 1M1YA 2OOKA 1LDYA 2ZVPX 1H6AA 1O0BA 2WNHA 1XRSB 3ILHA 4PZYA 3ESDA 4KXNA 1WMFA 2Y77A 4JWKA 3THSA 2WF7A 1NNUA 3G2KA 4IBOA 1UPUA 1XF1A 2VPPA 3LYHA 2QLBA 2CL7X 2I6SA 5CT5A 4BOYA 1Z62A 5CRIA 4PZDA 1S3SA 1Z3IX 2G67A 2Q0HA 4JQZA 4J0GA 2VUTA 1L7XA 4JYZA 3BXEA 3I5MA 2OMEA 2WZDA 3QEMB 2DWPA 2IX9A 1RLJA 4LBYA 4O02B 2QKYA 4EY7A 3UQYS 4OGWA 4RJLA 1F1JA 2AFHA 1T0HB 1G6OA 2RH4A 3BMOA 3RKRA 1T3SA 3BCSA 2X2OA 3GJXC 5J2UA 4CEJB 4BMOB 1KKMA 3P9KA 2A0FA 4IG4A 3IAM1 3CVJA 2D1SA 2H1FA 2VWPA 3BWVA 4BJ1A 3O2QB 3G2OA 3LW7A 5TS2A 4EGCB 1YZQA 4IIVA 1YR3A 4DLBA 1F4LA 2G28A 4HGRA 1XRLA 2PPVA 4FHFA 3P0IA 5K0TA 3ADBA 3NYRA 1XYGA 4X3PA 4WH0A 3P9PA 4MB2A 1N2BA 2TMYA 3AUFA 4W5QA 3T1YB 3G0IA 3L0PA 2BKEA 1WW3A 4O6VA 3ETGA 2XMGA 3GGCA 1J8DA 1YR6A 3L7JA 2ZB4A 4MULA 4RF3A 4U3JA 2ONKA 3K9WA 4GLBA 4U7JA 3RCBA 3KKNA 2IEBA 3IO5A 3KT3A 4RTKA 3DE0X 5EGSA 2JI7A 3V8NA 2A5LA 3X1MA 1AS2A 2QT9A 2VPTA 4KDCA 4G0WA 3RRMA 3FCCA 5KOHB 4RTMA 3GFFA 3ZI7A 4C07A 3KEFA 1GD1O 5FPKA 1WY5A 2Q7OE 5CDTA 2WB4A 1VJ5A 3P97A 2OM6A 3SBDA 1IUNA 4LNUB 1JXAA 4WKCA 2O2YA 3D4PA 4QVIA 1KFKB 2ZIEA 1E20A 1W8DA 1AMOA 2XUKA 1MO3A 1SCIA 1XF9A 2AUNA 4O5OA 5F73A 4ZCPA 4EVIA 3U7GA 1EFAA 3L8ZA 4BBZA 1DBSA 1LK0A 1YZHA 2OT3B 1WF3A 2COEA 3QOYA 5FD8A 4R0VA 1AZSC 4R1MA 3O4VA 2BGIA 4A2PA 4A7PA 1LUAA 4RACA 4NU0A 4EGQA 2GO1A 3MHPA 4O3MA 4HZUA 1U0NA 3L92A 4HWPA 4OBBA 4XQCA 4HADA 4IXTA 1GR0A 2RAVA 5EJFA 5UKDA 1W4CA 3QLEA 4RD3A 3CZRA 3UOAB 3HO1A 3K05A 2AFIB 1WNFA 3IVXA 3BN3A 4BFVA 1EZZA 1BVRA 1NVVR 3FHCB 2B4QA 1QFYA 4AY4A 5GV7A 2IY9A 3KKKA 4NE9A 2VCHA 3C2QA 5AM0A 5IAEA 3TSAA 3LBIA 1Z2PX 1KU0A 1NY5A 1DADA 2KX7A 2QDXA 3F1KA 1JEEA 3MJHA 4HN4B 4IFBA 1BHO1 3VJKA 3PXCX 1OC4A 5FTKA 4RAOA 5K8CA 1Y7IA 1J8MF 4FILA 2WWWA 1Y5MA 3BXFA 3MCZA 2M9MA 3KOXA 1UEXC 1X0VA 2FG6C 5B4TA 4K03A 1QU2A 2P6UA 1MVLA 4V1CB 1U6IA 2BGTA 3NVKI 1L7RA 3GA5A 1R37A 2YQ5A 2D3WA 5FWXB 4J0QA 5LKRA 3WMGA 1LRKA 3AR9A 3UMCA 1QQ7A 3C8DA 4D8VA 3OCVA 1B0PA 4AZSA 4JB0A 1ECBA 2BM1A 4BAUA 1YAJA 3MAJA 3I6ZA 3ONNA 5C8YB 1JAZA 1N6IA 1H42A 5C0OE 1KGSA 4JBWA 3KZCA 4LE0A 4F5EA 5FWDA 4G84A 1M67A 4GF5A 3KSMA 3ZHQA 1HDXA 4TZTA 4IMJB 4FDLA 4O2BB 2ILTA 2BKXA 3KQKA 1TW2A 7MDHA 3KU4A 4CMJA 2ZB3A 4I9NA 2WE7A 4G0PA 2ZJ6A 4FE3A 3T6KA 3CLUD 1P2SA 5HG0A 1LQ2A 1W4LA 3QUCA 3T15A 3E8MA 3R20A 4BWYA 3A2KA 1RRPA 1JG4A 3ZGZA 4ONEA 5FI3A 4J16A 3NDIA 1NLZA 4WA8A 1RTTA 1ZEMA 1DJPA 1DO2A 1K6XA 2DJ5A 4FLMA 5CGQB 3ZUGA 3ZY4A 3KBOA 2GD0A 5F76A 1AT1A 2O57A 4GI1A 1R00A 3F73A 1RWNA 5TB5A 3R7WA 2CHEA 3UUEA 4LCBA 4Q39A 1Q0TA 4MDEA 3A6JA 4I4TB 1Y1RA 3QUBA 4ZMSA 3FOEC 1BYUA 4BWVA 4DTIA 4NXMB 3SSAA 3E48A 4Y2XA 1EDDA 3HV0A 2HO5A 4UZSA 5F21A 5C1OA 1EP9A 2PYIA 3UAVA 4QFCA 3RPEA 5B4VA 1CS4C 1Y98A 2FVXA 1EK5A 4QSMA 1JMVA 1FW8A 2NAPA 3O83A 4IV5A 5KJFA 3JYQA 4TRMA 1I7QB 1HE1C 4Q6WA 1WUTA 3CU5A 1IPEA 1V1RA 4S24A 3V1YA 1PT9A 3MOGA 4MI1A 4UMEA 1R5NA 1Z4KA 1Z4PX 3G6WA 5IC4A 4GR9A 4NBRA 5FOTA 2X22A 1ISSA 2PKQO 1AA6A 5CDFE 3DMFA 4UTVA 8ATCA 4ERXA 4BLWA 2FEMA 3NHFA 5DLYA 1KHHA 3NOQA 4LJYA 2EG9A 2Z1MA 3GWZA 5IARA 4O2RA 3V2UA 3A36A 5D3MA 2BKUA 4HDKA 1JEDA 3TEMA 2BFFA 1K97A 4MR8A 5A4IS 2ZYUX 1Q6YA 2QTMA 3G8DA 5A4JA 4OFWA 2Q3BA 1M2JA 2A1UA 1IN6A 1UJ2A 3WWDA 1KNXA 4BO6A 3T12A 4LE2A 2E48A 3NHUA 4N5LA 3RLIA 1DLIA 2AMFA 2OWEA 3CX7A 3BT7A 4IDOA 4EYGA 3GLIE 4QDJA 3O7MA 4FCVA 1HDRA 1RZVA 1X8LA 2O2CA 2JH8A 4WXRA 3BMQB 4ZAWA 5DP2A 3UMVA 3Q6MA 2JBAB 4ZO7A 1G19A 4B3RB 4KQ2A 1GP2A 1OXSC 1I4LD 2WFMA 3MMPA 1GAJA 3WA6A 5JHHB 1P0PA 1QCZA 2H5EA 4MO9A 1MKYA 4CHGA 1GG9A 2ZYAA 1WP4A 3NHAA 3C7TA 3AOGA 3HJAA 4LUCA 4BQOA 2VDUE 2BZSA 2P6RA 3TTXA 1NVKA 3GU3A 3PC7A 1ZK3A 1LJUA 4NZYA 4HNTA 2XZOA 1MZPA 4JCOA 2AXQA 1HZZA 2Z0MA 4P82A 1GAXA 4KR9A 5T4FA 1WHTB 5BUQA 5EESA 3CEAA 1TYAE 3LQ4A 1MA0A 3H4VA 2L17A 4LJLA 2GRUA 1I3NA 3G17A 3SE7A 5CMLA 2FN7A 2OM2A 4R84A 1VA5A 2VJQA 3IX7A 5DRYA 3M1LA 3OA2A 3O8LA 4BTEA 2O8CA 3HKCA 4RDHA 2FDCA 1L5QA 1X7XA 1Y89A 2R6R1 4MQ5A 2JZCA 1ZQ1A 1SQ0A 3HSSA 3WDKA 3I0MA 4KFSA 4BKOA 5C7LO 4IPTA 4K8RB 3TQSA 1D4OA 1SVOA 5KTNA 2ATVA 3PC2A 3AVXA 4YRJA 1XTUA 1NASA 3N58A 2VSFA 3AKCA 4YY3B 3MJSA 4AWAA 2IH2A 3VH2A 2GZHA 1WUHS 3AEUA 2EQBA 3Q41A 421PA 1TOAA 2YVUA 4L4RA 4LA4A 3FJOA 1DEKA 3L7NA 5BWMA 1E2LA 1NGSA 3O90A 2X0JA 3E58A 1SU6A 2CJFA 3DT8A 1JN0A 1JLSA 4CM8B 2WHQA 3IEXA 3G82C 1QZXA 2F55A 3LCUA 2HF2A 4NZOA 1FOEB 3H83A 5IN5A 5DNAA 2GZSA 1PVOA 1NF3A 4F96A 2P3SA 2ZXUA 2YJGA 1IN1A 5IF9A 2I5PO 1UDBA 2BGRA 3WGHA 4ARZB 5AUPB 4K40A 4BB0A 2AR9A 2NO6A 1ZNWA 4L51A 3HKEA 3B3GA 3E27A 2CB0A 2CNNA 2JGDA 2XW6A 3ND6A 1MVOA 1QHIA 3HB1A 4HDOB 1RPJA 2FU5C 4NENB 1TPZA 1YKSA 3BVPA 1ICEA 4FBGA 4U5XA 2BGNA 3QY9A 4YRRA 4Z9YA 4CCYA 2J87A 3T5DA 4W5RA 4OBWA 3N0VA 5EMHA 4CGYA 2PIAA 4JX9A 4L07A 2B8EA 4LE1A 5LZ5A 4TQGA 4E5UA 5JD6A 2IKSA 1UXHA 2V7EA 5JYCA 1Y0BA 2QMEA 5T67A 6CHYA 3TTSA 3BRWA 1BE0A 4QUBA 2QYOA 5FPQA 5KCMA 4D9GA 4G2NA 1AURA 1NWHA 3JWPA 1Y8ZA 1XD2A 4Y2UA 3SSOA 1SIUA 1RKVA 2YJNA 1RFGE 3F1LA 1ZMBA 2VYQA 2VK8A 2FQYA 1R6UA 5C8XA 2JL1A 5AH0A 3W9SA 3EJ6A 2EGGA 3PYLA 3UYLA 2FA9A 2J31A 2G82A 1RM3A 3QVWA 5DNCA 4KGZA 2VT2A 4HRYA 5LLDA 2ZI6A 1ZN8A 2UYHA 2FSUA 4B48A 3NJ4A 4Z4IA 2HL6A 2O0KA 3RGGA 4FT2A 4A15A 3DJYA 3KZXA 1ABBA 5EIXA 1XVAA 1DHTA 4GI5A 4DL9A 1J99A 3E22B 1JZTA 3USZA 3JTEA 1U8FO 3ESCA 1ILEA 1HDOA 3FDXA 2R48A 3GGOA 2H0RA 4P84A 4GEKA 3WL6A 1R6BX 2I4TA 4YROA 2H08A 3ZWQA 1K63A 2ET6A 4L5IA 3PQ4A 4RAQA 3G6KA 4MYTA 4RCYA 3F3SA 4M9ZA 2GBLA 3A3PA 3BD9A 1X9HA 1DWQA 3NHPA 1MG0A 3RTBA 1V5WA 2JGIA 1IWBB 3T95A 4AKTA 3QVVA 3RS3A 4M89A 4C0SA 1SHZA 3DMNA 3ZWXA 1UPXA 3VSDA 5HRUA 4IDNA 3V8QA 1AS3A 2XUAA 1IIBA 3VI3B 1K86A 2QW1A 1BXZA 2ILVA 3IUQA 1Q83A 5DOVA 1CLUA 3U81A 1UBOS 4JVLA 4EABA 4DHWA 1EWKA 1ZXXA 1T0BA 3CYFA 2OD2A 1YRHA 2GTIA 3NGLA 4MCHA 5DWDA 1OYOA 1O6BA 5FWYA 4C14A 2FRVA 1LI7A 1R9GA 3WKAA 4B6RA 5K6AA 2HHLA 1G3MA 2AX3A 4FQ7A 3RYFA 3TLJA 1X7WB 1NLFA 1O97D 2VSNA 1FQJA 2IEZA 2XDQB 2YVQA 3OKAA 1XLWA 3LYAA 1C8VB 1K8QA 5HF8A 3RSCA 1DZ3A 1UAGA 4WKGA 5G0SA 2QAGB 4PXYA 1WOMA 1OLXA 4KE7A 1C7IA 2XUFA 2YVKA 2V4ZA 4CM5A 2AR0A 1AU9A 2R44A 4LOKA 4MVJH 2BLLA 2DWOA 4JODA 3D6JA 4ENWA 3FLAA 3GIWA 3V4ZA 1FFYA 1C81A 3OJOA 3QVMA 5GZ3A 1XEWX 2IODA 3D64A 3R3UA 3QVJA 3D2LA 1AQJA 2ZUCA 1IEXA 1KI1A 1H8EA 3K8OE 1U1IA 3G59A 4XIIA 5DV9A 2WMYA 2X9GA 2XNDA 2P6OA 3KQPA 4EY5A 1M34B 3G0OA 1H5QA 4OVKA 3QOXA 4H0FA 3LWBA 4BQIA 3V3KA 1C2TA 3DC7A 1PV1A 2FOLA 4QPJC 4XJXA 1NDQA 3MQ4A 3GFQA 1JHPA 1NW5A 3HKDA 3WIBA 2C4KA 2O0LA 2G6TA 1EFHA 1YS9A 2WAMA 1N2HA 2VYCA 2O3SA 3D8SA 1QKKA 4J0FA 2VXCA 4GLLA 2HREA 2QGFA 2VNJA 3GD5A 4N5DA 2QY6A 3E23A 3K0AB 3L6RA 5KOYA 1F14A 3WJ1A 1A8SA 3K4HA 4IXDA 4QDTA 4RMIA 1CEEA 5HK9A 1VHWA 1YE5A 4WXEA 2Q5EA 2QTLA 3L5KA 3TRDA 3B1YA 5FFMA 4C05A 1NVTA 2LBPA 5AK6A 4MPDA 4WA7A 5DXFA 4BO8A 4DMHA 1KZ6A 3V4OA 3EWIA 1AMUA 3AEKB 2H1SA 3WK7A 4A2QA 1CUJA 4TTJA 1AK9A 4XLZA 2EU8A 3PV0A 3OC6A 2I6UA 4M7WA 3ORHA 3T7EA 2PSJA 4NAHA 5DTIA 4WFQA 3I8XA 4CG2A 1QIEA 4BNDB 4HQ0A 5HS4A 1NM5A 4CR8A 1IK6A 2RB4A 4MVJA 4DZRA 4P4NA 5JXHA 3HCNA 5ALZA 5AXCA 4RY0A 2MIIA 2PUWA 2PFKA 4HX9A 4QYXA 2HT1A 1ORRA 2KJQA 2W8ZA 2ZYIA 3AR4A 3DFZA 2C82A 5EUQB 3U9TA 4HRVA 2PUJA 2XT6A 3CF0A 3ABIA 2P5YA 4Q37A 3QYJA 4EI8A 1MR3F 3VOTA 2CEKA 3OQIB 2O5EA 2KQUA 3VPAA 1PEKE 4IJMA 4ML3A 4F7DA 3BC1A 4R1NA 3BRWD 2YHUA 2ZQ5A 4QAQA 4F6CA 1XNQB 5ALEA 1V45E 2FJ0A 3HFJA 5A3SA 1IZZA 1XCPA 3DE4X 3GJTA 3NWBA 4UHCA 1W4AA 4PZUA 2VJDA 5AVUA 2NZ2A 1AGRA 1L4GA 4KE6A 5L4NA 4Y6GB 4BO7A 1DC5A 2C8VA 3OEEA 1UJ6A 4F56A 5JZBA 2FPGB 3H8SA 2QR3A 5AK4A 3KJQA 2DY0A 3V55A 1TYEB 4O2AA 3NBZC 3EA0A 2WVJA 3ENWA 1VGVA 4FMCF 5I7SA 3G2JA 4BECA 4B7UA 3FPAA 1YCGA 3GGDA 5HF5A 2MWMA 3FMPB 4ZEMA 3VTAA 3G1UA 3HXQA 1CR2A 4FJ0A 4PQFA 3UYKA 3D7SA 2FXIA 3FYCA 2VYVA 1MABA 3LFHA 4AZ3A 1D2AA 2O7QA 1NX6A 1E94E 5CK5A 5GPBA 3WGLA 5A3JA 3MGCA 4QICA 1M1ZA 1KETA 3ZHYA 1NQXA 3SX2A 2QNRA 3STWA 1GYPA 2LDXA 4ND6A 3E35A 3ZOKA 1G9SA 3R6TA 3D8TA 4KXFB 2JLWA 4ZCSA 2QRGA 3RT7A 1HL3A 3MWGA 4X20B 5ADHA 3RVQA 3KQMA 1U0SY 1R7RA 3F7NA 3UUGA 3KSUA 4J9VA 5IHXA 1S5PA 3ROKA 3BICA 4WDQA 1YC2A 3WDLA 1X3SA 4ZZ0A 3IQEA 3ZS9A 1A71A 1DQSA 1ZIPA 4GOMD 1XAHA 1RPZA 2CBZA 4HZGA 6REQA 4D2IA 5AKJA 3I9V1 1EE1A 3JALB 5JISA 3I0NA 3HSKA 3M6MD 5LYJA 1B6RA 4JQYA 1CVLA 2YYZA 3JZIA 3KJIA 5CTAA 2C99A 3FFWA 5IUKC 3AF4A 2Q4OA 2B78A 4XDZA 2XGJA 4R1UA 3ESZA 4JOCA 5JS1A 1NDHA 2ZVJA 3QKSB 1N3BA 2FPRA 3WMWA 4FYIA 2J9FA 2GS9A 4R5MA 1OT3A 1SCKA 2P11A 5TGDA 2BMAA 3RV3A 4RSHA 3L0YA 2GF2A 4EATA 1UMKA 3LA6A 3TG2A 2YFYA 3DEKA 4FOLA 3VTKA 3MS4A 3SQNA 1RHMA 4YB8A 1LLQA 1PR2A 1UQTA 1IY0A 3BHIA 4UOQA 2B9EA 3N5CA 1NG9A 4Q4AB 3OO0A 1HQYE 1X9IA 4RFVA 4HJRA 3ZN2A 4IVNA 5BSVA 2AZTA 1Z73A 3ZZMA 4DKJA 4D43A 2PLNA 3U3OA 3OF2A 5KU1A 1NNI1 2WDPA 3PNYA 1V39A 1X1BA 3I2HA 4NJEA 2IKQA 4V38A 4Y7DA 4F97A 1TPYA 5LNK1 3CTMA 3U6KA 3X1XA 2F9LA 4UBJA 3D3NA 4RDIA 1KJ8A 4G85A 3ZV7A 1BDIA 2P6MA 2VZ8A 2IV7A 3PUVA 3AM1A 1WR8A 3N05A 2RGUA 3PSHA 2GM4A 2QTBA 4PSKA 5HRCA 3NX4A 4UU1A 2C9BA 4B3CA 1AMNA 4LTNA 3PVCA 2IFTA 1D04A 2ZIFA 3KZNA 3TCKA 3LSYA 4OHXA 3TE7A 4YUVA 3KT6A 4UASA 1EWTA 2WVHA 1YWGO 1E6LA 1DCKA 4M0DA 3ZCSA 1TECE 2DYKA 3L8GA 4PFJA 3U17A 4KLRA 5K0EA 3C45A 1ZH8A 1H6DA 1RLUA 1SZDA 2Q1YA 1EP2B 2MYPA 1PD0A 4C4AA 2OCIA 3NKVA 3IYLW 1ZHFA 2JFBA 3DMYA 1SIWA 3Q7EA 1DVRA 2AQKA 3M9WA 3NORA 1EUQA 3M5PA 1V1MB 4C20A 1OPXA 1MB3A 2V59A 4CIAA 4Y0AA 3KKMA 2G9VA 2WINI 3AGPA 1QAQA 3NOVA 1YMVA 3WWZA 3KEGA 2NGRA 1NONA 2ID9A 4DBZA 1I3CA 1UMBB 4FHCA 1QOPB 5AKLA 3JU3A 4TV8A 3TBHA 4R2XA 3BF8A 621PA 4TKUA 4CU5A 5L51A 2GHTA 3K16A 2EJBA 2B82A 2LV8A 2HJRA 2P1ZA 2VPWA 2J0VA 3FWNA 3KLBA 4BKPA 1TO1E 4ZJZA 1M1NB 3CH7A 4G67A 4XGRA 3K8QA 3TLZA 4RQAA 5KVVA 3A14A 3WTCA 2C2BA 4B7XA 1VM6A 5BV7A 1U9JA 3IQIX 3M0EA 4OQNA 4X90A 3GAMA 5F5XA 4Q9IA 4Y6OA 4YT8A 2A30A 3RSQA 5BQ3A 1Y33E 2C5GA 4BZWA 4R8MA 2XB9A 5AJUA 2IWRA 4BGDA 1YGYA 4TMWA 3P7MA 1NNLA 3EASA 2W8BA 2Z1NA 5TQ0B 4YCMA 9ABPA 2G76A 3H5OA 3ZTWA 3V4FA 2OYRA 3KAKA 1CUBA 2P9QA 3KTDA 2MYNA 3UKOA 3LKBA 3LHDA 2ZTUA 2WSSA 3FDIA 1P73A 1Z2EA 3NWPA 1POXA 3A9TA 3SZGA 4W5WA 1WDTA 1QIKA 4MROA 5DBHX 4EWLA 1W59A 1QCDA 3DFKA 3HCDA 5LBTA 2VAMA 2IEDA 3MLAA 3HC7A 5D00A 4YEDA 5EWJB 3GLFA 2BEWB 3DWGA 4H6XA 3BGSA 1U7TA 4XQGA 4NFSA 3DCNA 4U0JA 1YQTA 4QASA 1FYFA 521PA 4DA9A 3G8AA 1IDN1 1FFGA 3SXPA 1Z8FA 3WYAA 3E9ZA 2IPAB 5CUQA 4LJ9A 4CLEA 5K8IA 1TRKA 1WVMA 4IH4A 4KDRA 3MWEB 1SBHA 3EZXA 1V5EA 3FLBA 4QECA 4LOJA 3W5CA 4NU8X 5I51A 3A11A 1SXJA 4NMHA 4R4JA 1U2GC 5BUZA 4N4AA 3ZC3A 1MPXA 2XVYA 3GUUA 4P3PA 3GVPA 4Q24A 4XR4A 4DV1B 1JFSA 4MMXB 5EIBC 1FFEA 3A1NA 3PK0A 2VTVA 5JMTA 3O1JC 3QRWA 4D8UA 4OGKA 4LFBB 2UU9B 3QLUC 4B79A 1U9YA 4CCSA 4MHTA 1UODA 2MTBA 4OUDA 5ALKA 2HSGA 2ISQA 1Q1EA 1J22A 1AUOA 1E0JA 2CDBA 5C32A 5I9NA 4XASA 1JDZA 3CJRA 2BFWA 3FZEA 1L4KA 2EQ5A 2Z04A 4D4LA 4KPYA 3T5TA 3A9SA 1C1XB 4BIMA 3KOYA 1JDBB 2Q3JA 3JZDA 4WOKA 1R5BA 4YFVA 1PBTA 1JPUA 1F8FA 3GMIA 4M0MA 2E4WA 4ND2A 2WG2A 1YVPA 5IVHA 3FNRA 1MAUA 1F0KA 4NCJA 1G291 2ZI9A 2NU7A 3NJRA 1Q16A 2Y1XA 2F9FA 2JJ2A 2YICA 4FBLA 4RDCA 4XM0A 3P0RA 1FMJA 3X3HA 3VR6D 1K3UB 1N2CA 3PXAA 2XXAB 5JAHA 3UT6A 5E1OA 2WQ7A 3E7FA 3OE7A 2XWBF 4AB1A 4UFNA 5FHQA 4F4DA 1XP8A 3RSHA 5SYMA 3D5EA 1OFUA 3V9AA 3EF0A 1I7NA 1MAVA 5IF3A 3VAZA 1Z33A 2Z57A 4D42A 4P6VF 1OFIA 1Q1GA 3KG2A 1PJLA 2DPGA 2Q9UA 2RH9B 5A03A 4I8XA 4WCFA 2Y1KA 4PICA 4LAFA 4G6ZA 1BWQA 1I1HA 2AQHA 2NXEA 1KH1A 1N0UA 3ES9A 3DT6A 5BNFA 3CWQA 5J5AA 5A02A 2OSVA 3ETHA 4RZ2A 2G80A 3FSGA 3DPSA 2PL1A 2PSHA 1VE6A 4QGAA 5LL6P 3OT1A 4RIIA 1BQ3A 3GB9A 4QYWA 4M8LA 4DCCA 4MCJA 4WFKA 2PXXA 4W7SA 3TPZA 4PGFA 5TV2A 5KWEA 1V16A 2HIGA 2GZ1A 1YBHA 3WGVA 5BY2A 1UBFA 2GM9A 5EKTA 1TZCA 4XGNA 1A7AA 1KJZA 4Q9AA 2B4RO 1B1CA 4HDSB 4LWPA 4YDRA 1ETUA 1A96A 3R9XA 4R1QA 3UKDA 2Q46A 3MUEA 1QTIA 4Z3OA 1AK2A 1CRQA 3CF4A 3QEKA 5THXA 2NUTA 3NAMA 3O5AA 4FX5A 5E7JA 5JCJA 5KDDA 2W2MA 2WYHA 1STOA 1W1UA 2HDHA 4MICA 1P5FA 1ADCA 3S7TA 4TL6A 4MUYA 2OYSA 2ZSDA 4PZ9A 4A0GA 3D6VA 2GPNA 2PVSA 1JSCA 3CT6A 2H31A 1O0SA 1DJNA 2X8AA 3GFBA 3LMKA 4ZQEA 3GWGA 4YS6A 5BWLA 2QRNA 3SC2A 3RTAA 1EX9A 1P7YA 1CY6A 2WMNB 3L1JA 2OBLA 4KIUA 1SVLA 4C0WA 2GGSA 3PUWA 4MQBA 3STXA 4AJOA 2NUAA 2BUAA 5K8UA 1YUNA 4MPJA 3UNXA 1X7WA 4I6GA 1RC0A 3SY8A 4MDFA 1YHNA 3F8SA 1XXHA 4MDHA 1GZ5A 3WLMA 5FTMA 2LCQA 2PRKA 1GG5A 3EBLA 4KE9A 4K9QA 4FMCB 1TC1A 3QMVA 3E7XA 3WRXC 3FCXA 4H2DA 5A9SA 1MPTA 3NYIA 4PWYA 4FWIB 2VDOB 2XX3A 3K20A 2YJ3A 3H1GA 4KCGA 4ODIA 3NCTA 4BJ5A 1IIRA 4AZWA 4NBWA 5SZKB 3T7JA 4MV4A 5JVDA 1EKXA 1PZGA 1I3MA 3JAWB 1B3BA 3UJAA 4C4XA 2C7PA 3P0JA 1ZH4A 4URWR 2A57A 1M34A 1QO0D 1HV8A 2FX3A 2QTTA 4YDSA 4B7ZA 3N74A 2Q6LA 4NFYA 1O94C 2AMYA 3HRKA 2QN6A 1QYDA 3A3YA 3ITKA 3OECA 4RVSA 2GUGA 1U04A 4H35A 3G8CA 3HBFA 3SQWA 1A9ZA 5BMVA 821PA 4C76A 1WNTA 2H7CA 4F2HA 1CQPA 1JUDA 1NJ1A 3JASB 1WB4A 1GNSA 4R9UC 2PH3A 3SEAA 4MGEA 2HB6A 4QYSA 3V2HA 2J46A 3M1IA 4YK7A 3LLSA 5EG5A 1UINA 2CVFA 3B89A 1SMKA 4P8RA 2I7CA 3HSYA 5DPMA 3RNLA 3ZHVA 1VSUA 4DBLC 5KREA 4D8XA 1FRVA 3E9DA 1RJFA 4WNAB 4G4JA 2WWRA 2C2GA 1R4NA 1TVKA 2QYTA 4QXPA 3WGTA 1KR2A 1PK8A 1PYGA 2CK3A 2GJ9A 2VNAA 1UC9A 3MJEA 1MMFB 2ZS7A 4G5HA 2A9RA 1Z08A 2BTQB 5K05A 2XCSB 4EM6A 1JECA 4ZVUA 2VT7A 1JIUA 8GPBA 4X1KB 3VKHA 3BQNB 3FCSB 2FEWB 4UMVA 3E81A 4GPZA 1NVFA 3RHTA 4F6LA 2NYUA 3NCHA 4PXSA 4WN9A 4NHOA 2R00C 1UDCA 2DHEA 1GZSA 3VR4D 2BH2A 4EKDA 1A2BA 1Y1QA 2AGVA 2DOKA 2W6MA 1E9SA 2XEDA 3EDYA 2AE1A 3Q7QA 4KO1S 4UAUA 1TCBA 1HT3A 4ZC8A 2VQSA 3DLIA 3IE0A 1A5SB 5D3QA 1XZFA 2FWNA 1ODLA 4RSRA 5G41A 2P8SA 3VC2A 3WGYA 1W85B 1VP9A 2IYVA 2HDOA 2XMBA 2CUKA 2XA2A 1A69A 3KZVA 3MN1A 4H08A 4OPMA