1AKYA

High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE
publication title High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1akyA00
4PC2A 1PJRA 1ZCBA 2DY1A 2JLUA 2ZJOA 2IBMA 2QGZA 4PSVA 4QKQA 4G1UC 2O8FA 3ZGXA 2CNWA 2YWGA 4RD4A 2FFQA 2P6NA 1DG3A 3K9GA 2BMDA 2P5SA 1W4AA 2QMOA 1IXRC 4RZUA 4KBFA 4AKEA 2N1BA 1GRQA 2PZFA 1N5JA 3RSOA 1L8QA 1Z0JA 3UG7A 4ZIRB 5KNCA 3D3QA 1E2GA 4P4UA 5EE9A 3THWA 4MYCA 2NO0A 1NVVQ 1YZKA 2AK2A 3WRYC 4OI0A 5KDLA 4BLSA 3BE4A 3MMPA 4QG7A 3I61A 1JR3A 2NGRA 3ONWA 2A5DA 1AN0A 4ERNA 2GZHA 3NG1A 1HTWA 1P9WA 1RRFA 1D2NA 1L2TA 2KWIA 1DE0A 3TJZA 3EPLA 3I1FA 2WOJA 2WKRA 4TSFA 4M1WA 1U9IC 1W5SA 5E7MA 3WBJA 1TEXA 1K8RA 4M9SA 2O8CA 4KBGA 4HLQB 1EG7A 1U9IA 5AK0A 3VHLB 4M8NE 3I62A 2NQ2C 3CWQA 4DSUA 1G4UR 2ZUBA 5FOUA 3R7WA 2HT1A 1X86B 1X1SA 4Q9JA 4RSGA 1P73A 2XEXA 3UKDA 2GZAA 2ZU6A 4BFWA 2PZGA 2WZQA 3NKVA 1VKJA 4BECA 1VCMA 3H0KA 4GOXA 4BEJA 1RRCA 3T5DA 3AB3A 1XTSA 4DT1A 5FR2A 5FI1B 1Z06A 5HPYB 1E69A 3E5HA 1HT2E 2NO9A 2OUKA 4AKHA 3GLGA 1RC8A 2D74A 2VSOA 3C5CA 1JQLB 1W0JD 2HV8A 1MOZA 1RVDA 1US8A 1Z2AA 2QP9X 2ODNA 4QHYA 5DO9A 4ZDWA 3SS8A 4C7OA 2VQSA 3TKLA 2F3RA 4M1OA 4RD2A 3KUDA 4NYMR 1S3GA 4QRHA 3SHWA 4CDGA 3AV0B 2IHBA 2O8FB 4PPNA 2RGBA 2GCPA 3OIWA 1T5LA 1JEEA 4M1SA 5FUVA 1E9BA 2IYTA 1TU3A 4OK3A 4DWJA 4RD6A 3W8RA 1KI6B 1IBRA 4Q1AA 4A1FA 3A58B 5AJXA 4KFSA 3QJYA 5JWHA 2XTZA 1T0JB 3PEUA 2BBOA 3I8XA 4KHZA 4OHWA 1A7JA 3TQFA 1UDWA 4PHGA 2PCJA 3E2IA 3NBZC 2QY9A 4HUTA 2VH5R 2CCKA 4WZ6A 3GLFB 2Z4SA 1KK1A 3CW2A 3EZFA 2ORIA 1XF9A 4Q4JB 4MGIR 3W5IA 2LKDA 2H8KA 5EP4A 1KKMA 4LRWA 4UXIA 3WMFA 2ASEA 1XJQA 3MSXA 1XP8A 2WWFA 4OHXA 4OQNA 2GXUA 3WYFA 4C0HA 2R44A 5C4GB 3B9QA 2RGXA 3RS7A 5BWMA 3FKSD 2WJIA 1NIJA 1NIPA 2F9LA 1NL3A 3R7WB 1ZU5A 4B3GA 3RS2A 1IXZA 2AHOA 3CLVA 1JALA 1W5TA 3ZIAD 3ZS9A 2QMEA 2AL7A 3UG6A 4KODA 3D6TB 4PQYA 4TQ9A 3AF0A 3B1YA 5L3VA 3CRMA 4U7DA 5EXTA 2JIZD 1OFHA 4DDUA 3AF3A 1J70A 4QNRA 4OK5A 4B47A 4YMWA 1M1YE 4N3NA 4C2TA 4C3ZA 4O2LA 3T61A 3TAUA 4RD1A 1Z28A 3DKPA 3NBYC 1G5PA 4XSHA 2QROA 4E03A 1VYUA 2RCNA 5CJ2A 1COWA 4NP6A 5CB8A 2G6BA 3U7GA 4LJ9A 2IXGA 2AK3A 3GLHA 2FSGA 3EZ6A 1OJLA 2XZOA 1E2MA 4ESVA 2DWQA 3TVTA 3RRNA 4FXPA 3NC1C 3W6NA 4NU0A 2EU8A 5JEEA 5BQ5A 4PPFA 1E99A 1E2DA 2ECKA 1QVRA 4GOJA 4A92A 1TUIA 1KNXA 1NBMD 1NKTA 4KU4A 4F7WA 1OXSC 5L3SB 3OESA 4JBXA 4DKXA 2A5YB 2OHFA 1GITA 4TTRA 4PANA 1IQPA 1Z6XA 3VKGA 1XEXA 2EQBA 2BMJA 1NVUQ 3FYHA 1G64A 3I92A 2ZSEA 1JR3E 5EE5B 5C1BA 1DPFA 3VR4A 2JGNA 1BOFA 3NXSA 2SHKA 3THYB 3IO5A 4TQUS 3O8RA 2O0HA 2X19A 1T4GA 5FUYA 2VHQA 3L43A 1DBSA 3IEUA 2Q21A 5AUOB 1T6NA 3NWJA 4Q19A 3FFBA 4JZKA 1EGAA 4FD2A 5FOXA 4TZ0A 1HURA 5GVRA 2YWEA 1FFHA 3BK7A 1AS3A 3EIEA 1N6PA 1J90A 1DAMA 4PAMA 1MRNA 3K0EA 2WAYA 4PO1A 1GAJA 2WKPA 4GZMA 1E79A 2O8DA 2R6AA 2ZJAA 3DOFA 3SR0A 4YQFA 1X8JA 3U5ZB 2W2TA 3U4QB 4JLPA 4B35A 4ZKEA 4NDZA 1GTVA 1GG2A 2GJAA 1E3MA 1G3RA 4QM6A 3RLFA 1M7BA 5KSPA 4F4JA 3MGCA 2BCJQ 4LYFA 3TMKA 5FL3A 3GJ5A 1KSFX 3CM0A 3THOA 5P21A 4JBYA 5HE8A 1VHTA 3CNLA 4TQAA 5DIFA 4HLCA 4YXWD 4TYYA 1M6NA 3GEEA 4LYHA 4OK6A 2D7CA 3C7KA 1HH4A 1AS0A 2EW1A 5HKKD 4MUAA 2C99A 3AEZA 3GFTA 3K9HA 3M1IA 4A0GA 3THXA 4EDHA 2FGJA 2ONJA 1X8LA 2WKQA 3VMFA 1W49A 2ZYVX 4JL6A 4TMXA 3OE7A 1OB5A 4QJ4A 1KI1A 1SVSA 3UWKA 2H17A 3R20A 3KX2A 4DDWA 1GRNA 1XEXB 2V6JA 3EAQA 4LC1A 4CW7A 2H16A 3GFOA 1P7CA 2J0UA 4ZV4A 3U7HB 1KAGA 4HB4A 1N6IA 1KJWA 5FPKA 2FDCA 2Q6TA 1GDDA 1CP2A 4IDNA 4BLOA 5KTYA 4BZXA 1MO3A 1F3OA 2WWHA 2XOKA 4ASUA 2JJ2A 2UZ3A 4OQFA 3QKRB 3LY5A 1WE2A 4JVMA 1U99A 1F6BA 4A0RA 1QDEA 4LJ7A 2ODBA 3L82B 1TEVA 4A82A 3QY0A 2VSXA 2AN9A 2ANBA 5HTKA 5LDDC 1KI4A 3HYRA 3CX6A 5DN6D 2GRJA 1VHLA 3LA6A 3F0TA 5KSZA 2ZRNA 4FIDA 4Q1CA 3QSYA 5KPDA 2PZEA 1KO4A 2ZSFA 3MJHA 4RY2A 2IS4A 2QBYA 5AJVB 4EPXA 4LJ5A 4D4LA 2WTUA 2J0SA 2PX3A 5FBWB 1KZ7B 4CVNA 2VA8A 1QHYA 1ZINA 1KY2A 4XVQA 2P6RA 2IX3A 3CF2A 4JYCA 5HR5A 2CXXA 1ZUIA 1G6OA 2P65A 3ADDA 2HJGA 4M53A 4A0FA 5AUPB 3KJGA 4IDOA 1XX6A 1JECA 3K70D 1XWIA 1NY6A 1TF5A 2HF8A 1GKUB 221PA 4LJYA 1RFLA 5FBRB 1D9ZA 4ZO4A 3QI2A 1H8HA 4C0SA 4LBWA 3ZJYA 5L3RA 2IL1A 3A6PC 3KQLA 4QBIA 1LS6A 3PUXA 1YZQA 5FI0B 2EFHB 4EUNA 3THXB 2P5TB 3CPHA 1N5IA 2Q9AA 3QXCA 2XSZD 4OL0A 5JLJA 3K0AB 2FE4A 2DFTA 1XD9A 3DMNA 2IWHA 3ZS8A 2XTNA 1OF1A 5BN5A 3W3AA 3CNOA 4YMVA 3OEEA 4O2RA 2EFDB 2GEUA 2R6CA 3IBGA 4I81A 1G9XA 2Q0HA 2DWPA 2V4ZA 1ZD8A 1KMHA 2IWRA 1GL7A 2JJ1A 4JS0A 1YJ5A 4RD0A 3OFNA 3HU1A 4DLUA 4YMUA 4R2IA 2R62A 3A37A 2OG2A 1CJKC 3AVUA 3I3SR 2J1LA 1ZU4A 3AP2A 4B3BA 1U81A 3FTQA 2GILA 5B57C 1F48A 2Z4RA 4GNKA 1GM5A 1GOTA 1YRAA 1Z22A 3C5HA 4Y0AA 3EZ9A 2NMVA 4PQRA 4B76A 3DL0A 2QBYB 3H84A 1TL7C 2ZI4A 4ARZA 4PTLA 1OE0A 5L3QA 4KXFB 1N6OA 1YR7A 2ZJZA 4QBGB 4DLZA 1KSHA 2F55A 1B0UA 1N0WA 2QTHA 2VPPA 3K9NA 1U0HC 2D62A 2FSFA 3QBTA 3QG1A 4UJ5A 2F6RA 1E2LA 1N3BA 5DI9A 3KQHA 1AKEA 4XSGA 5JI3E 5JI2E 4Q21A 1FQJA 2BM1A 4LZZA 3NDPA 4IKEA 3U2QA 5JBQA 2OFOA 1CEEA 1BYUA 2FFAA 2RGCA 4R2HA 4HATA 4CEHA 3L8ZA 2Z43A 3AVTA 2AD5A 5JJKA 5J47A 3P26A 1J8YF 5GJBA 3KFXA 621PA 3FMFA 4B3CA 3CRW1 3QOFA 3SE0A 1C4OA 2XGJA 2GJSA 3EWSA 1UKYA 2GCNA 3L0OA 4PQFA 2CK3D 5H8WA 4ILEA 3WP0A 2AWOA 1SKQA 2EYUA 3BS4A 4F4CA 2ZYUX 1F2TA 3DMDA 1S1CA 3SOPA 3GD7A 4NL4H 4HUQB 2ZRMA 5FOTA 4XWOA 6Q21A 2JLYA 2IA5A 5FTJA 2ZRBA 5M04A 2ZRFA 4IW3B 1OPXA 2YOGA 1X6VA 4D26A 4PO9A 2DPXA 2CLDX 2ZEJA 1CR1A 1RZ3A 4RJLA 4OHZA 4Z1MD 1ZBDA 2DHRA 3KKPA 3B2EA 4IJMA 5JWRA 2YINC 2IEZA 3TBKA 4P4TA 2GXAA 3CUEF 3QBVA 2VP4A 3U3JA 3CBQA 2BWJA 2HDNB 4Q4HB 5FFMA 2ZXUA 3LH5A 1KMHB 2OBMA 5JZVA 3CR8A 1HE8B 2J7PD 1KJZA 2GVZC 1Q1EA 2X1VA 5JCPA 1E1RD 2GNOA 3FKQA 2O8EB 121PA 2D2FA 1Z8FA 2GWHA 3LNCA 1SQ5A 3NBXX 4LWZA 1DARA 1GKYA 4B71A 2GBLC 3G82C 1AGRA 1Q1ZA 3SJBA 3AP1A 3TQCA 1B23P 2WPDA 4KITB 1H8ED 1JAHA 2CEAA 1KK0A 3R8FA 3IKJA 1E2NA 1SXJB 2XJ4A 2I3BA 4JLKA 4BFVA 1E32A 4LHYA 4F92B 2GXQA 3MCAA 5CJPA 1GVNB 2VBCA 3DHWC 4D82A 4QOSA 5FBQB 4ACBA 4TYNA 3EZ2A 4WW0A 3BRWD 2GETA 2AXNA 1P3JA 3NDBB 1DAIA 2I1VB 2V6IA 3PQCA 5KHOC 1XPOA 5J4VA 1GFIA 1GL9B 2FU5C 2K5UA 3X1DA 4JJKA 2XAUA 4LI0A 4D4MA 3AVOA 1NSTA 1Q21A 5DI3B 2FSIA 1JXOA 4CEHB 5KSYA 2GA8A 2GEDA 1EK0A 5C18A 4I1UA 3UWOA 4RFVA 4DLVA 1VCOA 2FJUA 1I4DD 1ZM2A 1E9AA 2QP4A 4KYUA 2V7QA 3EA0A 5EE1A 1ZUNB 4B3XA 3LFUA 3KKQA 3L0IB 3AKEA 5JMTA 1PZNA 1RRGA 2YOHA 1IXSB 4IFEA 4TMVA 2FX3A 4XJXA 1LNZA 2OM2A 5CYPA 4EAQA 5IK2A 2Q9CA 3N2EA 2FEMA 3VAAA 5FBLB 1OFUX 3IUYA 1OSNA 2OBNA 2PCLA 2QT0A 3W3ZB 2JLVA 2XXAA 5D3MA 3T5GA 2QG6A 1XCGB 4V02A 3EWAA 4PHHA 4IVQA 1NF3A 4V0KA 2MMGA 3CRVA 3GMTA 3ZD6A 4H1VA 4NYIR 3TR5A 3RHFA 1KK3A 4B74A 4NE2A 1TQ2A 3AVWA 1C1YA 4B2PA 5LD2C 4AIIA 2V3CC 4G5SA 2IYXA 3P27A 1VCIA 3RS3A 5JS7A 2OCPA 3SYKA 3V00A 1SXJE 4K81B 1U8AA 2ZRCA 1G8YA 4KAXA 4URYR 1X8KA 2QEQA 4JMPA 4A15A 1N6KA 1FX0A 1KAOA 4LK2A 4M1YA 3WRXC 3FHCB 4YMTA 2W6ID 1TX4B 2GVDC 2HXSA 2OE2A 1BIFA 1XTKA 3U6BA 4B44A 1A1VA 1BMFA 5AUNB 1P6XA 1YZUA 4MKIA 3ZVRA 3VHXA 1YZTA 3HPQA 3WNCA 4ZIRA 1RYFA 3V4RA 1M7GA 2V1XA 2QM8A 4HDOB 1T91A 1E9FA 1MH1A 1KO8A 2QPAA 1NSFA 3KB1A 4D80A 3R8CA 2KB0A 3MLEA 1XNJA 1E9RA 3DOEA 3QXXA 4PR0A 1UPTA 4M22A 1E2IA 3CNNA 2WSSA 2NTYC 1S8FA 2X2EA 4OI2A 1QVAA 4TTQA 4W7SA 2FPMA 4RKFA 1E2KA 1LVGA 3ZD7A 2KSQA 1UBEA 1N0UA 2IEYA 2QNRA 1MKYA 3VR1A 2ZRKA 4DSOA 3JZMA 4US1R 4TL9A 3BJIC 4CYMA 2KI5A 3F8TA 5FL7A 1NLYA 1JAIA 2B6HA 3GQBA 4JVLA 2QUZA 4POAA 3S1AB 1N25A 4V0NA 4DUGD 4G01B 2IYRA 2IYUA 3WXMA 4G5OA 5D3MB 4MRSA 4Q02A 3LVRE 5EUQB 3ZZ0A 5EZ5A 4CT5A 4S2EA 1WXQA 2ZJ2A 4DBLC 1A4RA 3GJ3A 1EWQA 2OLKA 3DVLA 4FMCB 1JBKA 1VIYA 3RC8A 4EFNA 3WBKA 3TAHA 2ZJ5A 3N5CA 2ZRLA 2OEPA 2OESA 2CJWB 3SZRA 3A4LA 4WIAA 1W0KD 4YMSA 5LD2B 4DB2A 1IY2A 1IAQA 4BFTA 1T9HA 5FPHA 1LF0A 3X1YA 1FL9A 4NH0A 3BGWA 4GMXA 2BMFA 4NCHA 2WJJA 4BE7B 1G8GA 4Q18A 4RFSA 4XOIA 1FX0B 4JLNA 5FH9A 2X8AA 3FOZA 1VYTA 3H2YA 3CB4A 4KFTA 2G88A 4KVGA 2IF2A 4MRRA 4TLEA 5B2ZA 2LWIA 1Q22A 1SVOA 3O47A 4OI4A 1KI6A 3CZQA 4PZYA 1UADA 2XNDD 2YC4C 3J81k 4X8HA 4JLJA 2ZS7A 1Q1QA 3VQTA 4ZDJA 3LXXA 1JPJA 3GJ8A 4NYJR 2QTVB 2OCBA 1XCMA 2ZVPX 4PC6A 1FQKA 3VNVA 2FFBA 5JS8A 2C98A 4NHOA 1MV5A 1ANKA 1IM2A 2O0KA 3GLFA 3C15C 3NH9A 4A2WA 4JL8A 1OIWA 3U7FB 4Q4JA 2HF9A 2ZI6A 3W5JA 2NPIA 5AUQA 2A7QA 4GZLA 2NZJA 3VKWA 1GNQA 1U0JA 4Q9KA 2IYZA 2R65A 4DIDA 2FV8A 3K1JA 3KXLA 2UVQA 2RGDA 4TSFD 1M2OB 3DKVA 5EXSA 1W46A 1CULC 3FWYA 1KTVA 1WMSA 3LBHA 2O8BB 4HI0E 3WP1B 2JASA 2OFWA 1NN0A 4C0JA 4HLUC 1EFRA 1AZSC 1R10A 3BH6A 2JDID 3K0CC 4IHQA 4P0TA 3O8CA 4HLUA 1QZXA 2RGEA 3SN6A 4A2QA 1U90A 2ZIAA 3MAAC 1G5RA 3K0CA 2ZJYA 2ZRDA 3ADKA 5AJYA 5CLLA 4CEIB 1N2CE 1TQ6A 3MD0A 3TUJC 4QJ3A 2ONKA 3B6EA 2E9SA 5GJCA 4AYTA 4HB2A 4URWR 5CM9C 2H1LA 3IIMA 2CHVA 1HQYE 1YZLA 4M9XA 3F5FA 3AF4A 2W6JD 1G7SA 4LX0A 4XIGS 1MRSA 1FNMA 2HT6A 1XXHB 4RFSB 1ZVQA 3NVAA 1P72A 2ZI7A 4XD7A 4OHYA 1KO7A 3LLUA 5JFGA 3MRSA 4G5GA 2FF7A 3C41J 2WICA 4NCJA 2YOFA 1E6CA 3EG5A 4NCIA 5L3SA 1XEWY 1U2RA 2C9YA 3QEOA 4OJKA 1OKKD 2NOAA 1AIPA 1G21E 2OBLA 1Z3IX 4DCUA 3SQWA 2RHDA 4MUBA 1W0JA 4P31A 2PBRA 3BXZA 3RS4A 5JJIA 5JSZA 2QRNA 4RZXA 5CM8B 3X1XA 4A8JB 4EPVA 4JLVA 1E2PA 3AF1A 1Y3AA 4IEIA 1E0KA 3THYA 4X8MA 1ZW6A 4C2UA 1I4LD 4W5WA 3CR7A 4BZQA 1S9HA 2HEIA 1ZM7A 3U6KA 1VG9B 4MRVA 5BYJA 1R0ZA 3AVPA 4A4DA 4EPYA 2Y8EA 1Z6YA 3BERA 3OIYA 4LV6A 3U7EB 3MUFA 3C16C 4L16A 4LCBA 3OAAD 4Q1EA 4DVGA 1XMSA 5EZ6B 3TW4A 4W5HA 2CCGA 2QA5A 2YKGA 2R6GA 4BUJA 1U94A 4ABYA 3TUIC 1OH7A 5EXPA 2P6UA 4ZI2A 3O8BA 3AH8A 5LB2A 1IN4A 2REBA 5ANRB 1IN5A 3T1VA 3U4QA 4Q4LA 1Q20A 3LX5A 4OBEA 4FWTA 2YVUA 1NVVR 4KV9A 4L8GA 2C78A 1LFDB 1NG9A 4Y0VA 5IHPA 1J7KA 2C5LA 1NLZA 3PJRA 2YWFA 4PC3A 3W6PA 4BZPA 1S0UA 2C2HA 4LJ8A 1T0HB 4IXMA 3SJCA 2QTFA 2ZE7A 1P2VA 2PX0A 1BYIA 4UJ3A 4GL2A 3ASYA 3FKSA 4U02A 1XJ0A 1XXHE 4ON9A 2J45A 3HWSA 2ZROA 4K46A 4WZBE 2H57A 2FPLA 2XX3A 4WOPA 3KB2A 5HCIA 2AFIE 4TN1A 5TY0A 5EP3A 1KDTA 5SZIA 2AFHE 2C04A 5H70A 3FE2A 2BC9A 4WXPA 2JJ8A 2ZS8A 2TMKA 4AG6A 3SDZA 3ZIAA 4ZDIA 4G0NA 2RGNC 2VYFA 4QFMA 2DWOA 5CIWA 2A5JA 1S9DA 2DFLA 2JIZA 2RGNA 2ZR9A 4OKSA 3GLFE 3A8TA 2ATXA 1KDPA 4BLTA 3AKCA 4B73A 3L0PA 3L2OB 1VMAA 2JA1A 5SZKB 3U44B 4GFDA 5JSZB 3K0SA 1VTKA 3KL4A 1SVMA 1K6MA 4CEJB 3DZ8A 5AWFC 4URUR 1XZQA 2J9RA 4DEXA 4ZCLA 1T3HA 3Q8XB 3QKRA 5CIQA 1TPZA 4EQ6A 3RDPA 3VTKA 2HYIC 3MWJA 5KSOA 2FGKA 1W2GA 3CIOA 3QENA 3CX7A 2ZITA 2D2EA 3VU9B 5DNYB 3FDIA 1EFHA 1NBMA 1AA9A 2BV3A 2QM7A 4B2LA 2QSYA 4CT4B 4DDVA 4JLOA 5ELXA 4Q4AA 1G41A 3NC0C 4LBVA 1YHNA 4Z8XA 4ESHA 1KJYA 1BO6A 2ZSDA 1G3UA 1OXTA 3LV8A 2BVNA 4Q66C 2PJZA 1DTSA 5EUMA 1W4BA 2UKDA 1LF5A 4IDPA 2VHUA 2IUTA 1CS4C 1GKIA 2FA9A 4X8LA 3KQUA 1OHHD 4MRPA 3HR8A 1Q0UA 3VR6A 4Z54A 3AM1A 1XBTA 3B1XA 4LSGA 1Z0AA 2DBYA 1CR0A 3Q72A 3ETLA 3OF5A 4LBYA 1E1QD 4G3XA 1W36D 2OZEA 4I99A 5CYOA 1CRPA 1HYQA 1DAGA 4PHTA 2H18A 4LV5B 4L15A 1E2EA 3PUYA 1FMLA 3T1TA 2IHYA 3LVQE 3EX7C 3BFKA 1VDZA 5TDHA 4UNPA 1Z6AA 1J99A 1TF2A 4GT1A 2QQ0A 1VPLA 3RVBA 2VP2A 2ZUCA 4NCNA 4JLBA 4LDJA 2GESA 3NEJA 1XPUA 3GPLA 3K0AA 3QXHA 5IRCD 2WM9B 1NG1A 1DOAA 1XJCA 4AG5A 3KUCA 4LHWA 3H86A 1XD2B 5FTMA 4PHFA 3ZVMA 4LHVA 3QG5A 2GKSA 4YXWA 2G0TA 1L7VC 3WNDA 1E2HA 1TF7A 2IYYA 1RKBA 1CIPA 3UANA 1ZJ6A 1CF4A 2EFCB 4EQ6B 5HKKA 1DS6A 3R9IA 2ZU0C 4B48A 2J5XA 1Z63A 3QKTA 3LRPA 4LJAA 1OV4A 4Q9LA 5B30A 5EE3A 2V54A 3EASA 4DRZA 5J4LA 4D25A 1WCV1 3IDQA 4Q4AB 1UEIA 1QG4A 4Q01A 2ERYA 2IW3A 4A2PA 3KQKA 1CTQA 2RGGA 2EYQA 4PSAA 4IOJA 2FWRA 1K5GA 2PH1A 3QXSA 3ZZUA 1S2MA 4IVPA 2E87A 3CONA 3I73A 4DCSA 1SVIA 4C4PA 4KCGA 1YR6A 3PVSA 2G9NA 1OLOA 4E07A 4M0LA 1XU4A 2XZPA 1XTQA 1FW6A 1KDRA 2YC2C 1EWRA 3A1UA 1NMYA 2MSDB 1G5TA 4MKFA 4MITA 1E98A 4XH9B 1CJMA 2IT1A 1BKDR 2GAOA 5E95A 3U3OA 2VLIA 4LBZA 4HAZA 2IYWA 4KYIB 2PEZA 3QNUA 5DN6A 5UKDA 2HXYA 4YDSA 3QVUA 4TTPA 2H5EA 4KJZA 2OT3B 3LW7A 1CR4A 2WSMA 1AQYA 3GEHA 4P33A 3M6AA 2ZM5A 2ERXA 4QBHA 3O8DA 3BFVA 3NH6A 3ND9A 2J7KA 1Q44A 4R98A 4DCNA 1W47A 4B33A 3FMIA 3H1TA 2W0MA 3BFXA 4DSNA 4HUQA 3FHTA 3KQNA 3K70C 1RPZA 3HU2A 1JXMA 3IHWA 5CLQA 1R5NA 3OEED 3QKSB 4JLAA 4O25A 1X1RA 3CZPA 3TSWA 4K8OA 2BEJA 4HAXA 2NG1A 2W00A 2V55B 2WIBA 4BFXA 5EQTA 4JKIA 4II7A 4GI7A 5C4MA 3ZYCA 2J0QA 4CGZA 4HB3A 4PC7A 4Q4HA 2BJVA 4FW9A 1DAHA 4J0QA 1NBME 3K0FB 3AUYA 4WZAE 1KI9A 1AKYA 1HQCA 2WJYA 4Q03A 3SBEA 2O8EA 4BRWA 1QHIA 3QF7A 3QF4A 1R7RA 2QT1A 1TADA 2ZAMA 2XSZA 4IDHA 4HZUB 3IBYA 4B34A 4YONB 1SXJC 2FOLA 2NPFA 3ZQ6A 4WVFA 3KXKA 3RNLA 1YVDA 2ZRAA 4PSKA 3LXRA 1SXJA 4WAUA 2CE2X 4Q9IA 2Z5FA 4FMCF 2ZI5A 3SQXA 2BCGY 3D31A 1IN8A 1D2MA 3CWZA 3A1VA 3FMPB 1YU9A 5D3QA 4TT3A 3EA5A 1NRJB 4OQLA 3HJNA 5LBIA 1NN1A 4BLQA 4DXAA 2ZJBA 4TL6A 2PJRA 3U60B 1GIAA 4I4LA 4UKDA 3PFIA 2IXEA 3FB4A 1XEFA 2VF8A 4NMMA 1NN5A 5DI3A 4DLXA 3SHFA 1R0WA 1ESMA 1P9RA 4RD3A 3SI7A 2RMKA 4JSTA 1O3YA 3UMSA 1GUAA 3Q3JB 4US2R 3ICQB 3TVDA 2B8TA 4EPWA 4QL3A 5L8VA 2ZPTX 1MO5A 2HCJB 3P4YA 3OEHA 3EARA 3BORA 1FP6A 1G16A 1DVRA 1M8PA 1GNPA 4FWIB 4YLGA 2VP9A 3T35A 3W34A 3JVVA 4CZ2A 4IOLA 2QE7D 3REGA 4MA4A 4TZ6A 1TQ4A 1XMJA 1ZM4A 2RAPA 2YHSA 1PLKA 4EKDA 5IT5A 4Q1DA 3EPJA 2ZRHA 3K70B 2NZ8A 3NHBA 4GDFA 3HP1A 4ZI3A 1ZNZA 1R2QA 2YJTD 1DAFA 2IYVA 4LJ6A 1G7RA 4KI0A 2V1UA 1RW4A 8OHMA 3GJ4A 1AJEA 4C0KA 4RCYA 1CJVC 2G1KA 3QF4B 4TL7A 3VFDA 1T8TA 2GCOA 2PLFA 1WBBA 2N42A 1HT1E 4Q48A 2DCUA 3P32A 4U00A 2J59A 3X1WA 4Z1MA 3TUZC 1F2UB 2JLQA 2XTMA 1CJTC 3IIJA 4TYWA 2C8VA 2REOA 3EPHA 3VX4A 2G83A 1YKSA 3CH5A 4Q5IA 5LB4A 1IHUA 2ZSBA 5J5CA 4PZZA 4MDFA 1AQUA 2J7PA 2JLRA 5JCZA 1ZMXA 2PT5A 1ZNYA 4NTZA 1DG1G 1E1RA 4PX9A 2JLZA 2IYQA 4DJTA 3K9LA 1U98A 4D0GA 1NMXA 5AJZA 2CVFA 1XPRA 1D8TA 2CL7X 3RYTC 1P5ZB 4WA7A 1IONA 2E1RA 3NIBA 1R8QA 3L8YA 2OSBA 5KOYA 1KDOA 1J2JA 1II9A 1XRJA 3KTAA 5H68A 2DFKB 3TNFA 1IY1A 5JHGB 4A6XA 1II8A 1RIFA 3SYNA 1ZD1A 2CDNA 3ZDQA 4ZDKA 2B8WA 2C03A 4Q9HA 3R9WA 3S1AA 2Q3HA 3I32A 2GTPA 2V8OA 4M21A 1WB9A 4N0DA 3D7MA 3LX8A 1TTTA 2WBLC 2A78A 3W8NA 1UEJA 2XJ9A 3OHMA 2J3EA 4NONA 4PPQA 2B21A 5DH9A 5FPSA 3RWMB 1W2HA 4US0R 5J4YA 4M4SA 1QF9A 3W90A 1ZP6A 2WIAA 1N6RA 1EX7A 3EW9A 1CBUA 1R0XA 1XMVA 1G4AE 2Z83A 4AYXA 2C96A 3ZQJA 3I5YA 2OCAA 2CJWA 1FMJA 3V4FA 4BGDA 3LO5A 4PO8A 2ZYWX 1QRAA 1UBFA 1R6BX 3KKOA 4G5QA 2GCOB 4HAVA 4Z51A 4LUCA 4HAUA 1GRRA 4QBFA 2NO1A 1LTQA 1XDBA 3AKDA 3PUZA 3FVQA 3QE0A 3SC3A 2MSEB 2ZETA 4BFZA 1UM8A 3BC1A 4JT4A 4KSBA 3PR1A 3RRMA 3BB1A 1HEIA 3PEVA 2PLRA 3CO5A 2IS6A 3QIAA 3IPXA 1AK2A 1OIXA 4BFYA 1SVLA 2IUSA 3UXMA 3FMOB 4HAWA 4MKGA 2OAP1 1KK2A 821PA 1QG2A 1PUJA 2G1JA 1G17A 4UNRA 4QGHA 4LGMA 4KFUA 1GNRA 4D4KA 2KBFA 4B6FA 1YZNA 2H7VA 2FPKA 1SVKA 4TMTA 3KJIA 4HDQB 4E09A 1I2DA 4HDCA 3LQQA 1NY5A 1G3IA 3B5JA 4BPBA 2PMKA 2W6IA 2ZAOA 2JLWA 3VR3A 1V43A 2AR7A 1F60A 2R9VA 3KTAB 4JIMA 4Z8YA 5KO2A 1KI8A 2YZ2A 4JJZA 3QKUA 5HCNA 1KZGB 2O8BA 4JVSB 2W83A 4RCZA 3VNUA 1II8B 2CVHA 4MGKR 1NI3A 4IOKA 4LHZA 3W9YA 3PEYA 1VECA 4FMBB 1FP7A 4EJSB 4AI6A 5C46F 2QP3A 5CITA 2O0JA 2FN4A 4NCKA 4D6PA 3DDCA 4CEIA 4FI3C 1YZGA 4L9SA 1ZC3A 5JHHB 4E5UA 3UMRA 4KSCA 2VEDA 1CJUC 1N5KA 1L4UA 3A1WA 1ZNXA 3KKNA 4NYMQ 5BN4A 2VL7A 3P20A 1G8HA 4GRAA 2HLDD 3PITA 5JJLA 4V0LA 2PEYA 3PIRA 2BMEA 2CNWD 1E9CA 2XITA 3NEYA 4IVRA 5BW8A 1XXHA 4TMKA 2ZE6A 3KJEA 4DUGA 1VG0B 3LDAA 4RKEA 2ZJ8A 4QJ5A 1ZUHA 1Q3HA 4A36A 1JQJC 4UXJA 4C30A 2WJHA 4M1TA 2HYDA 2P0EA 1BH2A 4PC1A 2G3YA 5FOVA 4XWKA 4AY2A 3TH5A 2LCFA 3EIHA 1LW7A 2WMOB 3IQWA 3R9XA 3Q7PA 1N6NA 5F9HA 1IJEA 1GSIA 3RC3A 3FGNA 1E0JA 2ZE5A 2IS2A 1U0LA 4A8JC 2OXRA 2UZIR 3PUWA 3B9PA 4V0MA 4QGAA 1OXUA 2ZTSA 1W0KA 421PA 4A8JA 2CL0X 1OFIA 4RVCA 1JR3D 1TMKA 1W4RA 4URZR 1E96A 4IOMA 3CH4B 5EJEA 2WJVA 1D9XA 1XTRA 2FZ4A 3Q85A 4IEEA 3TE6A 2VHJA 4AURA 2D06A 4MDEA 2A9KA 2F9MA 1ZIPA 3NHAA 2A3RA 4UNNA 1HY3A 4MKHA 2XNDA 1SGWA 1EFRD 5TB5A 4OQMA 5DISB 1KSGA 2VSFA 3ADCA 3PV0A 1UKZA 2G77B 2AX4A 2NIPA 4WXRA 5GVSA 1JNYA 3KDSE 3PG5A 4KFRA 1TUEA 2DFNA 5K8IA 1YR9A 2B7CA 1R5OA 4ZCIA 4Q1FA 4L5BA 2CE7A 5KU1A 3MJRA 1E2QA 1VCNA 4EPRA 2JLXA 4V0OA 5DGXA 2ZANA 1GWNA 5CK4A 4A6PA 4LOAA 1P60A 4PAQA 4DLYA 2ZE8A 4MGYR 3MG9A 1SZPA 4IFBA 2VHCA 3PENA 3VR5A 1N5LA 1KO1A 1KSJA 2JDIA 4TLAA 3N2IA 4MGZR 4XD7D 4AD8A 3CRRA 5JRZA 3ZZTA 3BBPA 5EE0A 2RB4A 1DAEA 1R0YA 2BBSA 1KOFA 1EFUA 2ZI9A 3HU3A 4GMDA 5G3YA 3QXJA 5J4KA 1G18A 2D4HA 2AWNA 2R6DA 4EIWA 3RS0A 1XB2A 1TNDA 4DSTA 4P4SB 5E4FA 1E2FA 3SFVA 4XVUA 1OT3A 4HAYA 1Z83A 2J87A 4U5XA 4M1KA 2J0VA 3B1WA 3IPYA 3K09C 4D2IA 2F43B 3UATA 3U44A 4JT2A 3M0EA 4DDTA 2FSHA 3MFYA 1KY3A 3K09A 3DPUA 1Z6TA 4CEJA 1CRQA 2WOOA 2WWXA 2W6JA 3B8HA 1U8YA 3B1VA 5EXXA 3PXGA 4DEYA 2ZS9A 2O5VA 4XTRA 1XZPA 1D2EA 5HZKA 2EFEB 5FPYA 3VU9A 5HE9A 5FBVB 1WF3A 1ZCAA 4BFUA 1TU4A 2GF0A 4L9WA 1OH5A 2BJWA 4X8OA 1XTIA 1OKKA 1ONBA 4N1AA 1KI2A 2G0NA 3CPJB 4AK9A 3THWB 2YV5A 1NP6A 3WYGA 3T12A 4M9QA 3DEFA 4PZLA 4LHXA 4B75A 3DM5A 4I1SA 2QAJA 3SU8A 3WMEA 2Q3FA 2JCSA 3AVQA 4F4IA 4DB4A 3ND8A 1P2SA 4URXR 3DZDA 1IOZA 3BH7A 2VP6A 2EVWX 3I8SA 1KIMA 2OV2A 3OAAA 4W5JA 2O8CB 5TMPA 4UNQA 4R71A 1E9EA 1COWD 4QGGA 1S1MA 3EXAA 2F1JA 2OCYC 2ZRGA 1MT0A 4A9AA 2ORWA 4V03A 2OLJA 1Z29A 3LW8A 4LY6A 5B58C 2XNSA 5KNDA 3JVUA 1D5CA 2FZLA 4OJQA 5KDDA 1G7CA 2CL6X 3QVVA 1ZRHA 3IHLA 3RANA 2KJQA 2OO7A 2W2XA 3QUSA 3EC1A 2WHXA 4HSEA 2ZRIA 4KO8A 4TYQA 4DT1B 3U3RA 2ZUDA 2N46A 5CB6A 4R7ZA 1Z6GA 1T3SA 2IC5A 3I72A 2L0XA 2Z0MA 3TIFA 5F2EA 4V0ME 5BYKA 3GLGB 3I5XA 1VG8A 1JJ7A 1US8B 2QPTA 4JL5A 4C7OB 4CIDA 5EP2A 3X2SA 5DE3A 3T1QA 1XD2A 3B78A 3C14C 1OH8A 2VO1A 3KFVA 3A1SA 1KYIA 4JLDA 1I2MA 3IGFA 5A4JA 4B2IA 5FOSA 3KZ1E 4DIEA 3GJ0A 3BIFA 2WWGA 4Q7JB 3BOSA 1UF9A 4MYTA 4JLMA 2PL3A 1UBGA 4H9GA 1E94E 1EFTA 4FMDB 1QHXA 3RRYA 4TYPA 3UPUA 3A4MA 3B82A 1ZC4A 1G19A 1UBCA 3P4XA 5J40A 1NJFA 1AM4D 2QAGC 1GZSA 2ODWA 1E79D 1AZTA 3HPRA 5E7JA 2OFXA 4P32A 1Z0IA 3PUVA 1P4SA 5G40A 2QAGA 1KI7A 3DM9B 3Q5DA 4DC9A 3BWDD 4I1VA 4MYUA 4D0LB 1RJ9A 4LPSA 1SHKA 3GJXC 1ZAKA 3QPVA 5IDVA 5K8LA 1DAKA 2CBZA 5H1YA 2EFGA 2GF9A 3BH0A 2IYLD 4UQOA 5KPJA 3ADBA 4QC2A 4JKYA 3AGPA 2VP0A 3FFAA 4M1MA 5FPTA 3RSLA 3MWLA 1LS1A 4KVAA 4G5RA 3LAWA 1AS2A 3ZVLA 2DB3A 1SULA 1JR6A 4A0HA 3GLIA 4O3MA 1ETUA 3CPEA 1O87A 3BB3A 1LV7A 1R5BA 2FMXA 1YQTA 721PA 2REXB 1VG1A 3HR7A 3GLGE 2MSCB 2ZRJA 1KO5A 1OHHA 4MRNA 4HZIA 4FCTA 1Q57A 3OE7D 2C95A 5DHAA 4ZCMA 3TK1A 1W36C 3RWOA 4DLSA 1HE1C 1ZM9A 2RKOA 3MWYW 2GZDA 3SNHA 1E1QA 1KNQA 1IY0A 5IF9A 4GOKA 2HCBA 3QKSA 3RRZA 1UFQA 1EX6A 2ZYTX 5DHFA 1CU1A 3QPUA 2XOKD 3GLHB 3FPAA 4ASUD 4XTCS 4URVR 2JJ2D 4Q47A 1MO4A 5TV2A 2A2ZA 1VIAA 4O0MA 2CHGA 2EWVA 1JPNA 4NPHA 2WAXA 1W7AA 1ZD9A 3K0FA 5GADl 1J8MF 1NMZA 2J41A 3C4JA 2CLSA 5FR1A 1RE0A 3OIVA 2J46A 1VYVA 2QGNA 2I4IA 4HZUA 2C9OA 2F1HA 2BBTA 1Q12A 4BWYA 1MR3F 4NZYA 3IO3A 5AR1A 2ORVA 4EFMA 5KDOA 2QMHA 4TLCA 4DCVA 2QORA 1D6JA 3GJ6A 3HYTA 3WY9A 3ZVNA 4ACAA 2GJ9A 4FINA 2QAGB 1CR2A 4LV8B 4JBWA 4IDQA 3RS5A 1K5DA 1NN3A 1RJ9B 2RGAA 2LKCA 3N70A 2WMNB 1YRBA 1PV4A 1QHNA 3G5UA 2MMCA 1OH6A 4HYYA 1N6LA 4BLRA 5JEDA 1G3QA 2XB2A 3CKLA 2F1IA 3VR2A 3LBIA 2IYSA 1G6HA 1YR8A 2BKEA 1ZM3A 2W58A 2A5GA 1FTSA 3BAFA 2PMDA 3WHKA 2BEKA 3I4LA 3B13B 2AKAB 3LD9A 3A4NA 5DSZA 4ITRC 1H8HD 1JJVA 1PLJA 3AF2A 2GJKA 4BEBA 1XEWX 2O8DB 1JI0A 3GLIB 4TLBA 5DYIA 1OIVA 1Q1BA 5SZHB 1ZYUA 2F7SA 1WDTA 2NO7A 2ZVQX 3SJAA 5EP1A 3F3YA 1Z2CA 2QQEA 5SZJA 3AGQA 2IXFA 5FUXA 3RABA 2BHRA 2Z6VA 4AKIA 1SVWA 2QI9C 3K53A 2D3WA 2B92A 3CF6R 3GLHE 3D8BA 1W36B 1Y63A 3VKHA 2AKYA 2ATVA 3B1ZA 1DO2A 3B60A 1XFAA 2ZR0A 3GP8A 1DEKA 2GAAA 1Z5ZA 2JJ1D 3AVVA 2Q3MA 3OFND 2X2FA 5K8TA 3EIQA 2GEVA 5FTNA 1SKYB 1GL6A 4PPGA 4JYBA 4QHTA 1KKLA 4LC0A 4B43A 2X77A 3Q9LA 5LPNA 1S96A 3CRQA 4AKGA 4UXHA 3SFZA 4TL8A 1SXJD 2AXPA 2J0UB 1FZQA 3E1SA 5K8UA 1ODFA 2FFHA 2VRWA 4FN5A 4LYAA 4XVRA 1F2UA 1MO6A 1P2TA 4Q7MB 4TT3D 1WRBA 2QZ4A 2P2LA 1KGDA 2B7BA 4Q00A 1NJGA 1Z0KA 3LWNA 3Q7QA 1FUKA 3QPWA 3DO6A 2GHIA 5BXQC 3ICEA 1FNNA 2IUUA 3HDTA 1EFCA 1KMQA 4XWAA 1QHHA 3VX3A 4C0BA 1CKEA 4M9ZA 4WBSA 3GLIE 1PUIA 4GBMA 2O52A 3OZXA 3U3KA 5TXGA 4B32A 2YYZA 4I1OA 3LLMA 1P2UA 4QXAA 2OILA 3FHOA 4PAOA 5FUWA 4DCTA 3OEHD 3TRFA 1RYHA 4D81A 3T06B 4JVNA 1XTJA 3AQ4A 3WNBA 2W2VA 1OB2A 2CLCX 1W4CA 5JWOA 4B3DA 2BM0A 1OW3B 1E0AA 2JATA 1DELA 4C0AC 1WBDA 1TAGA 1ZNWA 4TMWA 1OYWA 2QSZA 3U3MA 4C0LA 3IQXA 1NVWQ 1NLFA 3CX8A 4NYIQ 2JAQA 1JEDA 5C2JB 1G7TA 4HEJA 2FG5A 2PT7A 2WJGA 3TSOA 2VTKA 3AKYA 4BRUA 4D4JA 1G291 4RZ2A 1HV8A 1WQ1R 2D7DA 1SKYE 1M7HA 2VIIA 3SBDA 1TQDA 1FPMA 2KBEA 2P67A 5GJVC 1ZIOA 1Z47A 1PVOA 5CDFA 3LQRA 1A2KC 1E9SA 2CK3A 3WMGA 1JB1A 4TMZA 4DLWA 4PFSA 3AUXA 4ZPXA 1Z07A 5HZHA 2WWWA 1S3SA 2BOVA 1G20E 4KLZA 4TWZA 2QL6A 1E4VA 5BN3A 2ZR7A 1YE8A 3NBFA 2WPDD 2QE7A 1NKSA 1WP9A 2P3SA 1E0SA 1FUUA 3K8YA 1QHGA 4GSYA 2CMKA 5DLQC 4QM7A 5A0FA 2KE5A 1OFTA 4NBSA 5G53C 4BLPA 1P62B 3PCRB 1LY1A 1A2BA 1EXMA 3QQ5A 1DO0A 1E2JA 4OQXA 4B6EA 2BIFA 1UDXA 2EWWA 2R8RA 1G3MA 1W48A 2JEOA 1QHHB 3IIKA 3ZH9B 1Z0DA 3KXIA 1I4TD 4Q7KA 5F9FA 4FCWA 1T5IA 2F1RA 2GBLA 2R2AA 3JZAA 1P75A 3KJHA 3U61B 4LJ4A 1G8PA 1H8EA 3LBNA 4BQSA 1ELOA 2V7QD 4GP6A 4ARZB 5L3QB 4C9BA 5KUTA 2GK7A 4M2LA 3OIUA 2R6FA 5CK5A 1SHZA 5G3ZA 1IN7A 1M74A 1RRPA 4RZ3A 4MH0R 1F5NA 5E7IA 3TSZA 5AJWA 2V9PA 4GPTA 1XMIA 5JECA 2QN6A 4H1UA 4BFSA 5IK2D 5G41A 1FOEB 3A1TA 2GK6A 2XB4A 3GJ7A 1PLLA 4EJSC 1DADA 2BBWA 3P1JA 2F3TA 2IS1A 1UAAA 2WV9A 1S4QA 2ZREA 4EJSA 1W44A 4DHEA 1Q3TA 4HB0A 4PXAA 4N0EA 1UJ2A 4CF7A 3BB4A 1IN6A 1G1MA 3ASZA 1QHSA 2QENA 3UMFA 1OXVA 1W1WA 1M34E 3GEIA 4IXNA 4ZKDA 4Q7LA 5FTLA 3EPKA 1EESA 5TVKA 3TLXA 5J4HA 1F2TB 3C8UA 1N6HA 4BASA 1GP2A 3L0SA 5KYKA 2FNAA 2HUPA 2JLSA 3PEWA 2RHMA 4YC7A 5F98A 3A36A 3IILA 5FTKA 1V5WA 1T8UA 2WVJA 3TW8B 3IEVA 2I1QA 1C9KA 5B64A 2HJVA 4NYJQ 2QPOA 4LYJA 3EZ7A 3GCGA 1QBKC 4DZZA 1N0VC 3Q5EA 1E9DA 1L4YA 4E22A 2WWYA 1BMFD 1E4YA 2WWIA 4OYHA 4AYWA 2BKUA 1II0A 2DYKA 2GDJA 3ECCA 1OYYA 2ANCA 4Q1BA 2A5FA 2QMUA 1GILA 3T1OA 3UK6A 1MABA 2VF7A 4KLNA 2NO6A 4P3YA 2ZSAA 2OXCA 4OHVA 3SJZA 4DLRA 521PA 1A82A 4B3FX 4OI1A 5GJWC 3WHLA 4GP7A 1ESNA 2A30A 2WSSD 4LPKA 4L4UA 4F38A 4QNMA 3B85A 1R8SA 3RAPR 1HUQA 1G8FA 2AD1A 2ODEA 4D0NA 3AVYA 2W0SA 1IJFA 2IK8A 4QHSA 1NVXQ 1P61B 4HLDA 1XCPA 5E3HA 3B7GA 4S35A 4W9MC 3G0HA 2H92A 4F93B 1XD8A 3SEAA 2FEOA 3V9PA 3H4MA 4AC9A 4C0QC 5FL7D 2YNMA 1R4AA 4CRWB 2IF0A 1P9NA 4QGFA 1OXXK 2RH5A 2ZRPA 5KNBA 3E70C 3TR0A 1UKEA 3UIEA 3TGPA 3SYLA 3NTUA 2DR3A 5DYGA 3QEJA 4EPTA 1HA3A 3WYAA 2QU8A 4MYHA 5CDFE 3AP3A 3MWKA 1A5TA 2FH5B 4FMDF 4AWXA 5F3WB 5TARA 4JSYA 1CXZA 5A5GA 3W6OA 3REFA 2QRZA 1U8ZA 1UKVY 4EFLA 3ZLJA 4UNSA 2Q9BA 4TLDA 1Z0FA 1KHTA 5JRJA 2VP5A 3KKMA 4IRUB 2C77A 3BD9A 5FOWA 4DLTA 1BS1A 1WA5A 2CCJA 4YDHB 1X3SA 1NNEA 4FCVA 2GJ8A 4MQBA 2XXAB 1H65A 3T15A 3AVXA 3EC2A 1AGPA 2ZQ5A 4NKRA 3X1ZA 1T3LA 2VHTA 3CF0A 4P4SA 2ZI3A 4R9UC 3M4YA 1FTNA 2CHQA 2C9CA 2XZLA 2YWHA 3GFPA 3T34A 2HLDA 2OAQ1 2GXSA 1KI3A 4F91B 2BDTA 1MABB 2F43A 1Z08A 1CLUA 1LB1B
chains in the Genus database with same CATH superfamily
3R41A 3I9LA 2JLUA 1BCSB 1Z8HA 4MLZA 2Y93A 2IBMA 2QGZA 2QRJA 4PSVA 3ZGXA 3U4MA 3A1FA 3CLUD 3V46A 5T8KC 3ZY4A 3C1TA 2P6NA 1P91A 4C6TA 1V39A 4QAQA 2HB6A 1NTRA 1IXRC 1C4WA 3G8AA 4KBFA 4PNEA 2N1BA 2FAXA 1GRQA 3ZW7A 5AW7A 1EPUA 2YIJA 1N5JA 8LDHA 1XU7A 1L8QA 1QIDA 1Z0JA 3QVJA 3TZ6A 3G9TA 2K7FA 3QLEA 5AMXA 3UG7A 1ZSVA 4IG4A 4DDKA 5CVVA 2BFMA 1E2GA 4KQWA 1XLTA 4F5YA 2IQ5A 3JQBA 3KT3A 3FI0A 3GEPA 2PN1A 3CR3C 1Q77A 4O63O 1JHAA 3TQHA 4D99A 1K5PA 1VLLA 1WU7A 2WU8A 1V8BA 4AN1A 1NVVQ 3GRKA 3AESA 3L7YA 1LXCA 4RF4A 3PTLA 1WHTB 4BLSA 3I61A 1B73A 2J33A 2IEIA 2C5SA 2Q5IA 2WMDA 2X9GA 2AEMA 2AI1A 3UAGA 3PDWA 1FC0A 2NLOA 1P9WA 4YGXB 5DM0A 4ZZ2A 5BT9A 3C3KA 3SX0A 4E0BA 1JR4A 1DE0A 1ITZA 1Y9DA 5CCDA 2ZTUA 4AWBA 2WKRA 3PHCA 1E6WA 2HA7A 1MOQA 2TMGA 1DXOA 2VXBA 4QAJA 1TC2A 1NRWA 4AX4A 5AK0A 1JKMA 3ZGLA 3CVWA 1ZGJA 1R37A 3TNJA 4BNFA 3Q6NA 4G0QA 5FOUA 3R7WA 2HT1A 4EUHA 4YUZA 4WXYB 4X7RA 4Q9JA 1P73A 4BDTA 1IRXA 4J94A 2GZAA 1PK7A 1RC1A 4BFWA 3CEPB 3PUIA 2MYUA 5BWBA 3QJGA 3WKCA 1VCMA 2EHJA 1M9NA 2M1XA 3OTWA 4GZ6A 3T5DA 4EG1A 5JT1A 4OHMA 4DJJA 2Q5LA 1GNSA 3F90A 1PUXA 1XK6A 4IUCS 5IZCC 5L40A 5LM3A 3SQDA 2IVFA 3WAGA 3E5HA 2NO9A 3ZE7A 4RTOA 2R60A 5DBIA 3AHGA 4AKHA 1C0PA 3GLGA 1WKCA 3C5CA 4CLHA 1JQLB 1W0JD 3VR2A 5DO9A 4QHYA 3HWX1 2A86A 2QP9X 2ODNA 3OVMA 3PWTA 3SS8A 4N9WA 1KOLA 3TTVA 3W2EA 5BVHB 1BGXT 4H3KB 3FOFC 1FFXA 2F3RA 3DNMA 4EY7A 3M89A 4RD2A 2DR2A 3ZWWA 2H2DA 3MB5A 3HHEA 2AYXA 4P3KA 2E48A 3E9YA 4O2BA 5AHRA 3OJXA 1DLIA 2HBQA 2GCPA 2ZWAA 2L19A 4KMRA 2ZB7A 4QVKA 4OK3A 3GVCA 2W6QA 1HE2A 2YMLA 3VPXA 3WDMA 5FAKA 1TAUA 3W8RA 2XUAA 2Q1TA 1UT6A 4DWWA 1KI6B 4Q1AA 5TJHA 3JWHA 2B4TO 2E6KA 5EMMA 3ACCA 4A1FA 5B7PA 3SDSA 4HVLA 5AJXA 5JWHA 4CQLA 3VNAA 1J09A 4KR7A 2QJTA 2BBOA 2HIAA 3NW9A 1JTEA 3PEUA 3PKZA 4ZVNA 1L5GB 5LUAA 2X8JA 3I34X 4PHGA 1T36B 3E2IA 4HUTA 5L6MB 1I2AA 3DBIA 3GLFB 1Y6ZA 1RAHA 3L04A 3D5EA 3VKVA 2OBFA 3EZFA 2D2VA 3DHEA 4LE0A 3F97A 4R0VA 3T0GA 4CU5A 2H8KA 3O6VA 3TCXB 5KWJA 5T41A 1KKMA 3L6CA 4QU5A 4UXIA 1KAQA 5KMGB 2GA9A 4PE5B 1L7BA 2QR3A 4KGZA 4OFXA 4LSZA 1JR2A 5GM1A 3HKDB 4C0HA 4N5IX 1EVKA 2GLTA 1AZLA 5CLHA 4MR8A 5LVAA 3G9QA 4E94A 3T9AA 1ZCJA 3WIDA 1DKNA 2D13A 2W2MA 1WJGA 3LDHA 4POOA 4PZPA 4UM8B 3WL4A 2GKOA 1ISRA 3L6BA 2PSHA 4WXEA 4JLUA 1RACA 4FFPA 4WINA 3WLMA 3DKIA 2XT9A 2UVDA 4EYOA 4M88A 3UH1A 2CT8A 4KRYA 3ZIAD 1C0EA 4MIOA 1U3FA 2YV1A 1MFPA 1N2SA 1PZMA 2YV4A 1IY9A 2C88A 2Q6OA 3KUXA 3HXLA 4KODA 4TQ9A 5I9MA 5CDTA 4OAOA 3B1YA 3CRMA 3SLRA 1OFHA 1VP3A 4C08A 1YD7A 1FDUA 4LNUA 4M54A 4B47A 4GR9A 1NE7A 4N3NA 3HK2A 1W88B 2E5WA 3T61A 4E5PA 3DKPA 3SM3A 3KLMX 3ZV4A 2WG0A 5KKAA 4A0QA 3DULA 3N7UA 4NP6A 1JV2B 1B0AA 4A73A 2ORED 1W52X 1YDFA 2AK3A 4IEFB 1G8JA 2QVBA 4LJ9A 1ZJWA 1JEYB 3KYCA 1D6SA 2XZOA 1P5RA 4ESVA 2DWQA 3TVTA 3RRNA 4J4BA 1LX7A 3WZMA 3ZXIA 1I3CA 4BXOB 4EHLA 3ZWAA 3QX7A 2VBIA 2QPLA 4OF4A 4QPPA 3FGZA 2EIXA 4PPFA 2ECKA 1BS2A 3NM6B 3V1KA 4KQCA 3Q6MA 2PSJA 1KNXA 1NBMD 1NKTA 2XA2A 1BXGA 3Q9UA 1OXSC 5BT8A 2J8ZA 3OESA 4JFAA 5AKEA 3RHTA 1MENA 1UPAA 4LZPA 5BRNA 1XTUA 1YRYE 1U8EA 3PZRA 3PYLA 5BSEA 1UJ4A 2AEFA 2Z30A 3JRXA 3U7QA 1ORDA 1G64A 2AT1A 1NOIA 1YL5A 3GT7A 3ONEA 1NT4A 3GRAA 1Q7BA 5KYYB 3VR4A 2FRVA 1L5YA 1MPXA 2PZ8A 4IZOA 4HFRA 1YUMA 3W8EA 3MGGA 3LGAA 4L74A 2JCXA 3GUHA 4LWOA 4TQUS 1TDJA 4OOFA 5C1IA 6REQB 1KHHA 1P7ZA 1T4GA 3Q10A 2FSUA 3VV3A 4D9IA 2VHQA 4KQ2A 2BFAA 5GONF 4N47A 2B30A 1GGNA 1RP1A 3NWJA 4Q19A 4ZICA 1U2DC 4XPIB 4FD2A 3UBMA 4GKKB 2F62A 5GVRA 3HN2A 3UJCA 1RWQA 4Q12A 4S12A 1FFHA 2I4LA 1AS3A 3EIEA 4YJ2B 4D3FA 3LTEA 3NUGA 1FXSA 1HF3A 1DAMA 4WJLA 4E12A 4LEIA 3HM9A 3UO8B 1DOZA 1IZYA 3KHUA 4M7PA 3HA2A 3I6QA 4RDIA 3VR5H 4GZMA 3H1FA 3F8SA 2DBQA 1CY8A 2R6AA 2ZJAA 3PYMA 3SR0A 4BJ5A 4MROA 2PGJA 2BFCA 2W2TA 5IVHA 3QE9Y 1PSZA 5BRAA 5FWXA 4ZKEA 3EZYA 4N03A 1Q11A 1GTVA 5DCLA 3K2QA 1IBMB 3ZDBA 1AKNA 4O2AB 5I7UA 3KVYA 3HR4A 3NBKA 5JS2A 1WSWA 4QM6A 1QFMA 3CIFA 5DXFA 2G40A 5KSPA 3MGCA 4Z99A 3I2HA 4BPRA 4NS1A 1B76A 3TMKA 2QRVB 3ZWNA 3GJ5A 4EY3A 3IV9A 1EDOA 1NXWA 2G25A 3F6YA 1VBNA 3E3NA 4H6XA 2Y0EA 3H7IA 1OX4B 2PY6A 3NANA 2W2KA 1RKXA 2QWXA 4R8VA 3UC9A 1EU1A 5A3JA 4IJUA 4KGXA 4TQAA 3VJMA 4TYYA 4H08A 3GEEA 4OK6A 4P80A 4D9NA 4DMKA 2D7CA 2CVOA 4MWOA 3HQ4O 1PFQA 4OBBA 1HH4A 2EW1A 1UQTA 3DEAA 4U1RA 3H3XA 3PQEA 2M1ZA 3GFTA 1DXQA 3ELYA 3THXA 2BEWB 4HOYA 2OVBA 1RAIA 2YZNA 3EGWA 5F4ZA 3SS9X 3U1BA 3RR2A 1K7CA 2ZYVX 3GFQA 1FE8A 5KOHA 4BJ3A 5EIOA 4AJ1A 3EXIB 4QJ4A 2RAFA 5GOZA 2IRWA 3FZNA 2IPOA 1CQZA 1N7HA 4CW7A 4LC1A 2FX2A 4OGKA 2H16A 3GFOA 3KR2A 1VSVA 5FA6A 2J3JA 4A7PA 2IBSA 1NJSA 1F1JA 1F4LA 1KAGA 1N6IA 4ZOCA 3HVJA 2F9FA 1GDDA 2IXAA 4GRIA 4IDNA 4OHKA 3IMCA 5A9TA 4BZXA 1MO3A 4CCYB 3O2QB 1QS0B 2ZUWA 1EZZA 1P17A 4H7IA 3S2GA 2UZ3A 4WGGA 2RKWA 5HWSA 1E7YA 4AZWA 4EHHA 3LPNA 4BYGA 3EVGA 3QSGA 1T5HX 4KK4A 1AZWA 2OMKA 2P9JA 3N28A 2BLLA 1BHQ1 1Z4LA 4J7CA 3A32A 5DNUA 2DFDA 3IAM6 4IIBA 3AL3A 4MR7A 4A82A 3FCYA 2VSXA 3SZUA 2ANBA 3WGQA 3EISA 3LVFO 3LPCA 3AMVA 3N2ZB 2BSAA 5LDDC 3IESA 2AC2A 4HUJA 4KQJA 2JFBA 2YW2A 2C2OA 1MX5A 3F0TA 3I0NA 4N9QA 5GP1A 2O7RA 4XFKA 2ZRNA 2EZTA 1Y6RA 5AM3A 3AUKA 2E18A 2Z57A 2QRMA 3MJHA 4O4JB 4BKPA 4EEXA 1JUDA 3D3NA 3GGOA 2GD0A 3IPAA 3ROGA 1D2AA 4KR6A 1QC5B 2PX3A 4I9FA 4ZZ0A 1QHYA 2FTKE 1CE8B 3HCWA 1ZXXA 5FHRA 4F2DA 5F7JA 4FNAA 3VUEA 2CSUA 2CXXA 3RJTA 3DOJA 4YV0A 1UK8A 2HJGA 2WUWE 4M53A 4EB8A 5AUPB 1U0RA 3KJGA 3GVPA 1JECA 1AV6A 1VJ5A 2QN9A 4QA9A 3VXKA 4QOIA 4LJYA 1GKUB 5FBRB 3CE9A 1MP0A 5AP9A 1MDFA 5CYGA 4I55B 1JQEA 3K8OE 3QI2A 4XLZA 5CHEA 3ZDRA 3DL7A 4UHBA 4LBWA 4C0SA 3TF5A 5L3RA 4CR6A 2RFLA 4RO0A 4JUBA 4RTJA 3DWGA 5DN9A 3V3KA 3OPNA 4CG0A 4K5QA 9LDBA 1CEYA 4UEWA 3RSQA 2PS9A 3UENA 4CLDA 2Q9AA 4O4HB 1AG9A 4HPJB 3MJSA 3A28A 5L6LB 4BNYA 3K0AB 2O2YA 3SF8A 3D5QA 1SAYA 3F47A 5FUQA 3T5CA 2H1FA 1ZD2P 1W0CA 4CIBA 5JAHA 1J42A 2X6QA 1JSRA 1FRNA 3JY6A 2ODAA 3ZV5A 3CNOA 5K0GA 1ODLA 2JKZA 4P2BA 1PNTA 1JIQA 1C3LA 1V5EA 3MCWA 4WEOA 1ZXBA 1A7AA 2GEUA 2R6CA 1FSFA 2X8LA 1DEOA 4HDKA 4QSHA 2IWRA 3RIMA 1ZD8A 2JCBA 1JT9A 4JHXA 2C2WA 1NHWA 3IEXA 2ECQA 3VYWA 3VZRA 3UGJA 1H5QA 4EB3A 5HNKA 5JAUA 1Y9JA 3HU1A 3ZBTA 3RBVA 3KC2A 5GTDA 5LQRA 2NAPA 3QVKA 2J1LA 1SH7A 1FXWF 4OP1A 2XNKA 4B3BA 1I4WA 1QQ6A 3FTQA 3LKZA 2GILA 2G9ZA 4UOEA 1XCJA 5E8RA 1ZH0A 2Q3LA 3AUJB 2Q5OA 3EZ9A 4PQRA 2FK7A 4A6EA 1V71A 1SXGA 2VJCA 3DBHA 3DL0A 1UH5A 2PQ2A 3RROA 3H84A 3VC3A 1XYVA 2C1EA 1U3TA 3N6XA 1N6OA 2ZJZA 5JJCA 4YAWA 1B0UA 3PFCA 1U4OA 3FYUC 4PIPA 1U0HC 3QBTA 4OBWA 3T5AA 1C29B 4YAJA 2QD3A 1PK8A 5BO5A 4A26A 4Q3LA 4IKEA 3TG8A 3S2SA 1UDBA 2A9QA 2B34A 2OFOA 5JSKA 5JBQA 2N47A 1YGPA 2FFAA 1QIKA 2CL5A 1BA3A 3DWIA 4A23A 3T7SA 1YKGA 3BK2A 3L8ZA 1VE3A 3MRVA 1P2GA 1CY4A 1GJRA 1SUSA 2IPAB 2PZMA 4ZAWA 5J47A 5GJBA 2H59A 3N05A 2SKCA 4YMLA 1C4OA 1PNOA 4X7PA 4GPD1 3EWSA 1U0TA 4Y1FA 5GV7A 1QO9A 5TVGA 2CK3D 2ZJ1A 5FWYA 4KIUA 1ECGA 2IPLA 1TM7E 2EYUA 2Q29A 5GZ6A 1CJCA 4LNHA 4X20A 4YHBA 5TF4A 5CVTA 1EFPA 2Q5JA 2H2GA 3QVXA 4KWIA 4MW2A 4F4CA 3TIIA 1SUDA 1G4HA 1PZGA 1S1CA 3IMEA 2Q2OA 1K8ZB 1O95A 1PFVA 3GD7A 4GPBA 4NNJA 6Q21A 2EF0A 2VUSA 1SCIA 2MYNA 3BJRA 5CW1A 3R3ZA 3ZVKA 4ZOBA 2N1MA 5D1HA 2YOGA 3KOYA 2CLDX 2I8LA 5IABA 5JU6A 4RJLA 4OHOA 2RE8A 3BRCA 1FJGB 1YJ8A 1Y5NA 3ETEA 3B2EA 3IQFA 1SQ6A 3LJKA 3VMMA 1EFLA 1SHLA 2GXAA 5ADVA 3OZWA 3NTXA 4CTMA 2HDNB 1K9SA 4Q4HB 3GH3A 3P5BA 1GLNA 3IR5A 1QCZA 2JGDA 4KUHA 4KYTA 5IXYA 2HC9A 1K0UA 3CR8A 5B37A 6ADHA 1DZ3A 1KJZA 1DUVG 3SLGA 3ENQA 2I34A 2WZDA 1E1RD 3C6YA 121PA 4P9NA 2B25A 1CS0A 3LNCA 2VOJA 3GFRA 4OSPA 3CUKA 1DV1A 1E8MA 1QZUA 1WW8A 3ASVA 4GKBA 4RDCA 3G2PA 4HJRA 4WWHA 1H1DA 1YL7A 3JARB 1K6JA 1UODA 2ZYGA 1STOA 3AEUB 1JYEA 5JATA 4WLUA 2AR0A 4GOND 4QOEA 4JLKA 4IHAA 3WYNA 2JA2A 2YCBA 4TV8A 1E32A 4IGEA 4BFVA 4MP8A 5BNTA 2VBCA 5AT1A 4XGQA 1LDYA 3WLRA 4TYNA 2HFJA 5AVXA 5C8DA 1Y33E 2JRCA 3EZ2A 5EAIA 3EXFB 1LW6E 1DC3A 1Y7TA 2SKDA 4FFWA 1C1DB 4M1ZA 1LLQA 4QLOA 2PQMA 4B3MB 3A6DA 3PQCA 4FNGA 1E9VA 1FP4A 2O4UX 4MV7A 1JB9A 3UAZA 1MVNA 1TJNA 3WV4A 1GFIA 3PWZA 4KDRA 1GTG1 1GL9B 1NXQA 1UINA 3E9MA 4RHTA 3PDHA 4LI0A 1EP2B 4Y1EA 3T99A 3AVOA 1F0NA 4YGYA 1NVBA 4BCCA 3H4IA 2NUTB 3W2TA 3EXG1 5EZQA 4CEHB 1X1QA 3DD1A 3OWHA 2BI4A 2FMHA 4KQEA 2C4VA 3UK7A 4S05A 5F9MA 1E3WB 4RFVA 2AUMA 4DLVA 1RBZA 3NHSA 3I6MA 1YASA 1E9AA 2P9QA 2Q4BA 1LQUA 2BH9A 2QP4A 3ESBA 4QOFA 2V7QA 2ZK7A 3EA0A 4RMIA 4W1QA 5EE1A 3UAVA 3WVNA 4B3XA 4F3NA 5IKEA 1V16A 3L0IB 4J1TA 5C52B 1RWPA 4QSMA 2HY7A 4F3YA 2YXEA 4H0FA 4L75A 2YBDA 2AW3A 3DXXA 3COVA 2IYPA 3PJFA 1PK9A 3PK0A 1IXSB 2I55A 3OX1A 4TMVA 4XJXA 4AP9A 3EUFA 1TZ2A 3PQ4A 1HFWA 5CYPA 4EAQA 4FNMA 4UTVA 2QRHA 3VAAA 5FBLB 3OC0A 3TGWA 3IUYA 2GEJA 5ITVA 4D7AA 2QT0A 4ARUA 4NCBA 1GPYA 3ZEIA 4BMXA 4DE5A 2XXAA 1CUEA 1XCGB 4V02A 4PZ9A 3RT9A 4PHHA 1VLZA 4IVQA 4YRFA 3SMQA 2Q4EA 5K8JB 2A9OA 2V98A 1A72A 3IP9A 4NYIR 1YFZA 3FNRA 4MQEB 3E9EA 5DU2A 3ZD6A 1N9GB 1ISMA 4NV0A 5DWQA 5ECYA 4AJ9A 1HQKA 3AVWA 4AIIA 3P27A 4HYQA 2ZBFA 1P7YA 2V59A 5JS7A 4S04A 3T3NA 4E4RA 3B6MA 3NAGA 1CG6A 4X95A 2AW5A 1TGVA 2C9BA 4K81B 1U8AA 4BNDA 3VC2A 2AG8A 1C9YA 2COUA 3SYRA 5A1JA 1FX0A 1E1NA 4HD8A 2ECOA 2LRHA 4B46A 4GXQA 1TX4B 3PSAA 2DRIA 4NFSA 2D1QA 2GVDC 3NDJA 4KNVA 1YA8A 1XTKA 3H9QA 4B44A 1J1IA 2YHIB 3CG4A 3HSYA 2A58A 4M37A 1A1VA 1BMFA 1QFSA 3ZGVA 4EYKA 2B4QA 3VHXA 5EWMB 1GCIA 1ACJA 2PUJA 3WNCA 2FEAA 3D54D 2F00A 1E4OA 5JFOA 2QM8A 1F51E 5FHQA 4F3RA 1L4HA 2HMAA 2WAOA 3PC6A 4YRQA 1TIKA 2WQZA 4JOSA 5G2OA 1XVVA 5FLXA 1PG5A 3ENNA 3R8CA 2PXXA 4L50A 2XEDA 4Q3CA 2GN0A 2X42A 3DOEA 1Z5NA 3QXXA 3GDHA 3DMYA 1EWKA 5EXEA 1UP7A 3I04M 2X2EA 4RIFA 3AFIA 4QLAA 4W7SA 4UPVA 4R9RA 4RKFA 1M2OA 4U6NA 2C2YA 1TCCA 3FSGA 5EQDA 1SBCA 3SHOA 4DANA 2E49A 4G5HA 2BP7A 3LUHA 1J9ZA 2QNRA 4Y18A 1ISGA 5I9IA 1MKYA 3FGPA 3OQHA 3QLVA 2CV1A 3R6WA 2Y6UA 4US1R 5FULA 5IEBA 1E3LA 4B9EA 2DBVO 2KI5A 1ADCA 3F8TA 5FL7A 1NLYA 4D0SA 4POAA 3MTQA 4JN6B 1XMOB 3E35A 2C2ZA 4V0NA 5JDCA 1V7QA 2A92A 4S0ZA 6AT1A 1MHTA 2IYRA 3NALA 2ZT6A 3H11A 1Q0LA 1PT9A 1JYFA 1MIOA 4Q02A 5CMLA 2I2XB 1MX9A 3EDCA 1ODTC 3K6KA 3RYHB 3ZZ0A 2QJWA 1J23A 1WXQA 3JD4A 4OUDA 3GJ3A 4RMGA 4YJ2F 3TE7A 1JPUA 2OLKA 3DVLA 4FMCB 3UB4A 1JBKA 3BD6A 1YS4A 2EJBA 1NW5A 1G38A 5AI4A 3C3JA 1ABFA 3LP8A 2WSIA 3RTDA 1M8KA 3NS7A 4UMFA 3FG9A 2OEPA 2OESA 3SZRA 2ZQZA 1EQUA 1CUFA 4YMSA 1R8JA 4YRPA 1X7YA 4YT5A 3PC3A 5FPHA 2PSDA 1ZMOA 4UZSA 1FL9A 1FU4A 2WD7B 1TRHA 1X2BA 4O2AF 4DMFA 4C04A 3S8YA 4Q18A 5B7NA 5FH9A 5AVOA 3KAQA 1PW7A 2FR8A 2JHFA 1VYTA 3VH1A 3JQ6A 1JL3A 1N8NA 5BV8A 3E82A 4G8CA 4WESA 5B2ZA 1U28C 2IF2A 2VZ8A 4KVGA 4MRRA 4CKYA 2WQ7A 2GPSA 1Q22A 1SVOA 2VJYA 3WQHA 1D6MA 1P1CA 4PZYA 3TXAA 1UADA 3BSFA 1LI7A 3DMHA 3FF1A 2ZS7A 4ZDJA 2CMFA 1JPJA 1Y4ZA 3DEZA 4NABA 4MLDA 3OCUA 2OCBA 2Q2VA 3QELA 3TZQA 1GO2A 2WNHA 3ESCA 3ND6A 5HBRA 4EATA 2FFBA 1Z26A 2IUEA 2I2DA 3IOEA 1IM2A 4WN3A 3C15C 1X7ZB 3WWYA 3DE4X 5DHQA 4Q4JA 3CLUC 1DX9A 5IM5A 3U3DA 2ZI6A 3IDAA 3KD2A 2DERA 1P0QA 1NGSA 4H60A 3VKWA 4HS9A 3DO8A 1S01A 3JQEA 4CM6A 2X9LA 4U7PB 2WKWA 1IUKA 3U13A 1L7QA 2BH2A 1UKAA 4R69A 1BKYA 2H2FA 5EXSA 1P5HA 1F7UA 3COZA 5ABPA 3AG5A 2O2JA 1PWHA 1PG0A 3RRFA 1YHZA 2C0QA 5G41A 2O8BB 3WP1B 2OFWA 1NN0A 3CUUA 3ESXA 1YC2A 4NOMA 3EVFA 4DM3A 1ZS9A 2X5OA 3KP1A 4Z9YA 2Q7OE 3K0CC 4P0TA 1X92A 5I9LA 5LA6A 3QFSA 3H87A 4A2QA 3RSFA 2QXTA 4G1VA 1D3AA 1VB3A 2C84A 1FU8A 4EA7A 2DU8A 2QUAA 4CMIA 3U1TA 3C8HA 2HSWA 4C4YA 2CD7A 3FNQA 3JATB 5AJYA 3TO5A 2WKSA 5CLLA 1NXXA 1OC4A 5LCXA 3UK0A 3MD0A 1VL2A 5JAOA 3VZBA 5H9VA 1QOPB 4G86A 5KYGA 3EFOB 4X64B 2VF4X 3RJ5A 5TQ0B 2Y77A 3T7IA 1QZ3A 4AYTA 1AKVA 1YI0A 2V7UA 1E1KA 3PEEA 1I13A 4HB2A 3I01A 4J2TA 5KOJA 5CM9C 3K6JA 4O4JF 3IIMA 4M60A 2MJLA 2WE8A 4M9XA 5MN4A 3P0HA 2YASA 2QMQA 4QBKA 3T3EA 3A3PA 2BFBA 2YTZA 2AHRA 1OZFA 3JPYA 1G7SA 5FYDA 1B14A 5JQGB 1HL3A 2VNHA 3SLKA 3WB2A 3NVAA 3WR5A 4OBXA 4XD7A 3V2HA 3ZI4A 13PKA 4QGBA 2XBLA 4MQ6A 5FNVB 3IVGA 3UJAA 1D7AA 1BE6A 1JZSA 2FF7A 2HMUA 3L6RA 4QEZA 4WFQA 3C41J 5KKCA 3HXOA 2A35A 1E6CA 3KJNA 2AXEA 2AFHB 1XEWY 4F97A 2HCTA 1XMXA 4RS4A 3GRZA 2NOAA 4XYBA 4EI7A 1YRWA 2OBLA 3GVXA 4N5MA 3W0LB 3INRA 1ZIYA 2EGHA 4I55F 4PGGA 2RHDA 2V5VA 5AKKA 1NFRA 2PUTA 2Z1DA 4KN5A 5HMMA 1KVRA 1ND6A 2HJSA 1U2GA 2AG1A 2XV1A 4KR0A 5AKLA 2QRNA 5CM8B 4HPWA 3ZXYA 4A2CA 4AZ3B 4DQDA 5E6SB 3G2OA 1E2PA 3DMGA 3LIIA 4ZVKA 5KHAA 1IXYA 4I4NA 2DMRA 3THYA 1L7RA 2D0DA 3BJMA 4O4HF 3OM9A 3LE8A 3N3BC 1P74A 3NGLA 4QOGA 1ZM7A 4ZCRA 3IA2A 5B1SA 3HCBA 4I1IA 5BYJA 1BGVA 4EPYA 2HRRA 3SC2A 3BERA 3WYBA 3GRYA 1MCZA 3AI2A 3RUCA 2H7YA 1XMSA 1Q6ZA 2O23A 2Y0CA 3JV7A 5TPWA 4HF7A 1RXWA 2OOSA 2ZAGA 1Z62A 3UCXA 4DRYA 3CG0A 3ZDZB 4BUJA 4F7DA 3GG9A 2ENWA 1W581 3IRVA 2GMWA 1QKKA 4ZI2A 3O8BA 3AH8A 4DR4B 3ZY2A 5K05A 1VC2A 3T1VA 2X1LA 2WUVA 3F5MA 3I58A 4UBMA 4FWTA 4Y6PA 3WK4A 4KV9A 3HFJA 1P39A 4L8GA 2H4JA 1NG9A 4XUDA 1C5KA 1NUSA 2X76A 1J7KA 3WSVA 1WZIA 1ZD5A 1L9KA 2VZLA 4PC3A 3W6PA 3RGWS 2C2HA 3AB7A 4I4CA 2IOFA 3HDGA 2ZE7A 3VA7A 2PX0A 4UJ3A 4W6ZA 5AICA 3ASYA 2G67A 1EE2A 4TSKA 2JB9A 4U02A 3YASA 5CA0F 3MM4A 2J45A 3HWSA 2FETA 3AY6A 2NP6A 3OPXA 2PIDA 1ZI9A 3AETA 3R6TA 1REQA 4NZPA 2FPLA 1HDXA 2I6XA 3KB2A 1V0JA 2ZUSA 4WZBE 5ALMA 5ALVA 4DMCA 5TY0A 2XCIA 2BFWA 3JVEA 4O02B 1ZD4A 5KVAA 2C57A 1XEAA 3IODA 4LY9A 5H70A 2PV7A 4WXPA 1K4YA 1KJQA 2CLEB 2JJ8A 4HADA 4FT4A 2BISA 3BXGA 4HDNB 4MVJH 3RVPA 5I9BA 4DS3A 1SIOA 3N2YA 4X1IB 4DV4B 3OTIA 3EBOA 4LF9B 1B2LA 2DTDA 4LFAB 3E7PA 3TW0A 2Y1KA 3ILXA 3A8TA 1KDPA 4MI3A 1Z5UA 3AKCA 4QPDA 4JEIA 3TIGA 1HDIA 1VMAA 4QYIA 2OA0A 1AGNA 4CL0A 1CSEE 1N2ZA 3N86A 4GFDA 5ALOA 4FSDA 3LRTA 3GFVA 1SVMA 3AEXA 5C8XA 4P5PA 4ZVQA 2HNBA 5AWFC 3ITDA 4L4XA 1VFPA 3HYLA 3KAPA 4S3MA 3ZCTA 4C76A 1E2BA 4GYKA 4HH4A 2QLFA 2PGLA 2WR8A 2P9TA 1CY1A 3MWJA 2JFFA 3QFFA 5KSOA 4ZALA 1W2GA 4I36A 2ZITA 5DNYB 1HGXA 3CUYA 4ALLA 3D02A 3FDIA 1EFHA 2AOTB 2Y1WA 3FDFA 4LMRA 3ETDA 4W8GA 1IDN1 2QTMA 2WF8A 2YWBA 4TTTS 5ELXA 3ZY5A 3EXHC 1G41A 3ID6C 1T24A 1OWPA 2JAUA 3MCZA 1EDEA 1YHNA 1LDMA 4Z8XA 3DE3X 3BKWA 2C8LA 5K3FB 4CMKA 1FB5A 1XQYA 4RZSA 1Q0TA 5CTJA 5EUMA 1DTSA 2POQX 1ADJA 1JLHA 5ALJA 3G2MA 1LF5A 2VBFA 3SX2A 2VHUA 4IHJA 1CS4C 2FA9A 3DVQX 4X8LA 5LOVA 2W37A 1VXOA 1LPMA 4EHNA 3VSAA 3VR6A 1HXHA 2J9YB 2B2CA 3B1XA 2WJPA 3HNOA 5F35A 3P2OA 1CR0A 1X1CA 2XDYA 3L0ZA 3ETLA 2FZKA 4G36A 3F4LA 4KAFA 1RYEA 3JRNA 4JBNA 3AIMA 2G28A 1HYQA 1R6DA 2AJLI 2OZVA 2LPMA 1F9EA 3D59A 4HCJA 2YVQA 3PUYA 3O9VA 2Y1EA 2ZT5A 3CMCO 3M6MD 5DT9A 1EBBA 5HMLA 3CNQS 3DKKA 4Q3DA 3TECE 1IBLB 2IHYA 3LVQE 3EQ6A 3NYQA 4NE7A 2JFQA 5TDHA 4BTEA 4BX2A 4UNPA 4G37A 3UQYS 1PHRA 1J99A 4GT1A 4RGBA 4E3ZA 2KLHA 1W35A 1VPLA 4LX8A 2QRUA 2JW5A 2VP2A 3WNZA 1IOVA 3LDFA 1KWKA 1P80A 1VPEA 3ZN2A 3M4XA 2VPXA 2V7XA 3NEJA 4WK6A 2WHRA 4WNIA 5AK6A 3NAMA 3QXHA 5IRCD 1ZZEA 1HMPA 4XB6B 3TKAA 3RADC 1Q0SA 3TZCA 1FMFA 1I6KA 1TYAE 1TKBA 3H86A 4G8JA 5FTMA 4PHFA 1M2KA 2WU3A 5B3LA 4NXMB 3DZGA 4UEQA 5HK8A 3KO8A 1SCUB 3QG5A 4A5OA 1N92A 3ANTA 2VXYA 2I76A 1L7VC 3C3YA 1TF7A 1X1BA 2BTQA 4WFJA 4YJ3F 4YEDA 1UBKS 2ZTLA 2VK8A 1N2IA 2B8JA 4NK5A 1A9XA 5I3ZA 1DS6A 2V7EA 3GIDA 3PE6A 3PPIA 3QE4A 2P4QA 3LRPA 2WIJA 2WY2D 2O3JA 1A8IA 3DW3X 3TBFA 1LWOA 4UM5A 4D25A 1RBQA 3SG0A 1LBTA 3ZHBA 4WZAB 4EK9A 1WCV1 3IDQA 3OQ1A 4Q4AB 2ZSIA 4CKEB 5LNK6 1QR2A 2CHFA 2D3TA 2JIBA 2IW3A 3HI4A 3OKFA 3QTTA 3ZBQA 1CTQA 2A1UA 4MPJA 5T6BA 4A2PA 4PSAA 3A1DA 4OU4A 3EMKA 2BDEA 1U2TA 1XKQA 2GHTA 3CVJA 1P0FA 1NW6A 4FNOA 5CD1A 1X13A 2VRCD 2ZKIA 3DF9A 4UVIA 1SVIA 4OLJA 4PTZA 1IYZA 5JXGA 4LN1A 2Z9CA 3LC1O 4M7OA 1VRVA 4E07A 5J1SB 4MYDA 3DMRA 1LTHR 2YC2C 2XMZA 1BMTA 2JD2A 4FOOA 3RNOA 4EJ0A 5JNWA 3ESYA 5CDGA 5IT9A 4IYJA 3D7KA 4PYNA 1G5TA 3K8ZA 3Q7EA 4XUGB 3T1TA 1IVYA 1K92A 5D1NA 2VLIA 3RF6A 4K9DA 5JY1A 3LI2A 3INTA 4YRRA 5DN6A 4YDSA 1FEZA 3L79A 1HYBA 2H5EA 3VVCA 4DSAA 1QQ7A 4JA2A 1CR4A 4U3JA 3SSAA 1U3UA 3GEHA 1N2JA 2LP4Y 2X0FA 3F96A 4MUKA 1PEDA 3BFVA 3NH6A 3ND9A 1ZOPA 2PKCA 5B36A 5KYNA 4IMJB 4R98A 3V34A 3DQPA 3ZWBA 1JIVA 1L5LA 4D9BA 4OEHA 4HUQA 5D51S 3DVAA 2XMGA 4FDAA 1SK9A 2BM8A 1Z6ZA 5H59A 1AUOA 4JI8B 3VDQA 4FUTA 1VHWA 2XB6A 1JXMA 4R2XA 5IH3A 3UCFA 3OEED 5J2TF 1NJ1A 3QKSB 3RFXA 1CFJA 5HJ7A 3DZHA 3WHPA 1POXA 1RADA 2PVPA 5CBPA 2XE6A 4M83A 4RABA 3KKZA 4GU5A 4GI7A 2WIFA 3DCJA 3P19A 4HB3A 1K0FA 1X0XA 2BJVA 4EG3A 2PKRA 3DA8A 3MIIA 3AUYA 2JFHA 2NZWA 1KI9A 1HQCA 1YR2A 2O8EA 4HGOA 3ELUA 4IAOA 1QHIA 4ESEA 3QF7A 4TWIA 1VGRA 4EYEA 2QT1A 2XSZA 1LDGA 2ID7A 5LU8A 1NBIA 4B34A 2E2WA 1KQGA 3HADA 5FB3A 2NPFA 3KXKA 2F3SA 3LC0A 1E5TA 2F17A 4PSKA 4Q7EA 5HQTA 1MJGM 5C1PA 2UYYA 1SXJA 3LXRA 3DKRA 4Q9IA 4AF7A 4PG7A 3OQMA 3L40A 1JSCA 4FMCF 3MGKA 1B3BA 4UFPA 3OQPA 1ZKDA 3R5HA 2ERCA 1J07A 4J0GA 5A03A 1DBQA 1RWWA 1D2MA 3BDIA 1ICIA 1TZMA 4B40A 2DQYA 4IJ6A 3FMPB 1L7XA 2QRKA 5D3QA 3EA5A 1NRJB 3QI7A 5ESWA 2IDJA 1TTPB 3AUFA 3N8KA 5B6IA 1V3QE 3V5NA 5JCOA 4DXAA 4BRSA 5F21A 4HTFA 2ZJ4A 3ZXSA 3IAFA 2OM6A 3DDHA 3L18A 3PFIA 4NMMA 1NN5A 3FPSA 2PD4A 5CLGA 3T9BA 1R0WA 4ARIA 2NWQA 1Z33A 3OF2A 5ENDA 4IIJF 3KCNA 2Z5VA 2Y4OA 4JSTA 5AXCA 1YZYA 2J3DA 4FHDA 1PZXA 1YOVA 3HRKA 3TVDA 4D9HA 2HCJB 2I33A 2WD9A 2PANA 3OEHA 1OY1A 1DVRA 1Z18A 4OXXA 2V6GA 4D6XA 2BEVB 4C4RA 4R8MA 3W34A 3JVVA 4UTZA 4H35A 4W9NA 2QE7D 1W59A 1HRKA 3BSWA 3PWKA 3REGA 1DJNA 2HCFA 4WERA 3S29A 5KYXA 4EHFA 4EENA 2EJCA 3PE4A 4NBKA 2UYCA 4LA4A 1PLKA 2PMFA 1DQRA 1Y8RA 4Q1DA 5J5AA 5HYVA 2A5LA 3UPTA 2BSQA 2YXBA 4NECA 4HTAA 1ZVJA 2NXNA 3HV0A 1TK3A 1RLMA 3WNQA 4B7AA 4KOAA 4NCXA 5LL6P 1G7RA 3DL2A 4J9UE 4KI0A 2HK8A 1DC8A 4Z9AA 3ZTWA 1AUPA 4BQEA 3D4NA 4H4EA 2R2GA 4BO6A 3JQGB 1RW4A 3Q9SA 4E31A 4NEQA 2BUCA 3GLQA 4KVFA 4IXTA 3IMFA 5KCMA 4EW2A 3K1TA 2BF7A 3HL4A 5C1BA 5EIEA 1M10A 1WBBA 2PLFA 1CLEA 3FCCA 4QQRA 2N42A 3JAKA 1HT1E 4PLCA 4KE8A 5GWXA 5I7VA 1ORWA 2H9AA 5EIBD 3LLCA 1WKBA 4B3SB 1I33A 4Z1MA 4KWCA 4EKEA 1F2UB 2A14A 3IIJA 1CJTC 3R5KA 1QLWA 1JKJA 2HOQA 5CRIA 3EPHA 5B6JA 1L5WA 1T5OA 2G83A 3UB2A 3MBOA 2H51A 4AN0A 3CH5A 2UYGA 4ND7A 3SKYA 3MCTA 4PZZA 3KM0A 4MDFA 1AQUA 1KPGA 2H63A 3HEBA 4J75A 2BR5A 3WLOA 4CJXA 2IOHA 5TPZA 3Q3EA 5JANA 3DLHA 5JQGF 4DJTA