1AKYA

High-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase (phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1akyA00
4TSFA 2GEDA 4KLZA 2WAYA 3KQUA 3ZLJA 2ZAMA 5F9FA 1ESMA 1XB2A 3DKVA 1VMAA 4AYTA 4TLCA 4DCNA 4IOKA 2FPLA 2V8OA 1SVLA 3GD7A 3L0PA 4LY6A 5FL7A 4G5OA 2YOGA 1JR3A 3QG1A 4MRSA 4XH9B 4Q7KA 4TLDA 4N0EA 5GJWC 1NKTA 1XZQA 1FFHA 1NMYA 3EIQA 2XZLA 4PO8A 1G8HA 3UKDA 2DCUA 2IS6A 2ZTSA 1DAFA 4CEHA 2XB4A 2Z0MA 3EASA 1DG1G 4RZ3A 1KO4A 4DXAA 1E9RA 1CS4C 2H16A 4HAZA 4QKQA 1DS6A 1EWQA 1J2JA 1IXZA 2GJSA 3PUVA 4HSEA 4RZUA 4B48A 1UJ2A 4D6PA 2GEVA 1G18A 4QM7A 3W3ZB 1QG2A 1TUEA 1Z6TA 3P26A 4Q03A 4TLEA 4OI2A 1KO8A 3NC1C 1AQYA 2QT1A 4AKIA 4HLDA 3CLVA 4OHYA 3SE0A 4S35A 4JVSB 1MRSA 3WMEA 1Z63A 1JQJC 4QGHA 5EXSA 2WZQA 2JDIA 1D8TA 1P75A 3AVQA 5BW8A 4BZPA 3VKWA 2N42A 1KOFA 4P4SA 1WDTA 2JAQA 2CCKA 5DN6A 3C41J 4IXNA 2WIAA 1WQ1R 1QDEA 3AF2A 5ELXA 4JJZA 4Q4JA 2R2AA 1MT0A 1F3OA 4D26A 4ZPXA 2FE4A 3IPYA 2XTZA 5KOYA 3U60B 3BAFA 5AUOB 1UEJA 3T12A 4LWZA 3ZDQA 1NVWQ 4HDOB 1UEIA 4ARZB 3KDSE 5LD2B 3HYRA 4LUCA 1OE0A 4LV5B 1KDRA 3VX3A 4EIWA 1UBGA 1Y3AA 3B13B 3KUDA 3D8BA 2OBMA 3A1WA 3IPXA 1P73A 3CRVA 2O8EA 2KSQA 1II8B 2WMNB 1E79D 4Q4LA 4R98A 2HF9A 1YR6A 2FU5C 4D81A 3B2EA 2YZ2A 2ZR0A 2H57A 4ZI3A 1JXMA 1C1YA 4M0LA 2OESA 4C3ZA 2W2XA 3BOSA 3GEIA 1DAIA 1GG2A 1HV8A 3OAAA 3AVXA 1Z47A 3QXJA 1QVAA 2VTKA 1DAKA 4KFRA 4JLPA 1R7RA 3PUXA 4OK5A 2OBLA 3SHFA 5LB4A 5BYKA 2AFHE 2BMJA 3I4LA 2GXAA 4RD1A 3WNDA 3P20A 2CK3D 4WZ6A 3OHMA 5BN5A 2ODBA 4LYFA 2GDJA 1UKEA 2EYUA 3BS4A 2HF8A 5AUQA 1U0JA 4C30A 4Q1AA 4LJYA 3P32A 1CEEA 1IOZA 4OL0A 3U3JA 1YR9A 2Z6VA 1NG9A 2B6HA 3VKGA 1G9XA 2W6JD 1P5ZB 1ZD8A 1ZM9A 4LBZA 4KITB 1CF4A 5JJKA 3QUSA 5LBIA 2AR7A 2RGGA 4NL4H 5CDFA 2AWNA 2WOOA 1SZPA 4BWYA 3IQXA 4CEHB 3AVTA 1P72A 4YLGA 4TYYA 3OEED 4A92A 4FMCF 1NVUQ 3VAAA 3U3RA 1NN5A 3ZQ6A 2YVUA 2NPIA 3AF4A 2MSCB 3ADDA 3ZZ0A 3ONWA 2GXSA 1P2TA 2QI9C 1YZQA 4M1KA 1AKYA 3GEHA 4GDFA 1N6NA 2EFEB 1F2TA 4PPGA 2F1RA 2KBEA 4RVCA 4RD4A 5FH9A 5AJYA 1W36D 4PHHA 1CR1A 1ZNZA 3BXZA 3UIEA 3KKPA 2VIIA 4DC9A 4PXAA 4TQAA 3TW4A 3F3YA 1IY2A 1N0WA 2H1LA 4FMDF 2XZOA 1ELOA 2V54A 3AKDA 3FTQA 2IS2A 2O8FA 2IT1A 2EW1A 1H8ED 4QBHA 5KNCA 4M9XA 2OXRA 2GCOA 3PEYA 1BYUA 1YQTA 1ZW6A 2QM7A 3FGNA 4QJ4A 1G4UR 2BBOA 3DZ8A 4WZAE 4EFLA 3KJIA 5FBRB 2RGEA 1MRNA 1N0UA 1P9NA 3O47A 1RIFA 1DBSA 4Q21A 3T1VA 2EWWA 3U7EB 4G5GA 2RMKA 3OIUA 2CHQA 2BDTA 1NG1A 5L3RA 4R71A 3O8RA 3THYB 3CNNA 3T35A 1GNRA 3NHBA 4BLRA 2ZR9A 3T5GA 2B8WA 3SJAA 4IVQA 3W5IA 2XJ4A 1VYVA 4GP7A 4TSFD 4CGZA 2W0SA 5BN3A 1N6OA 3M1IA 1S2MA 2IYYA 4FI3C 3KXLA 5EUQB 5KU1A 2PEZA 3IKJA 3HR8A 1CLUA 3MCAA 3EZ6A 1CJTC 4OI0A 2W83A 4E22A 1GKUB 3DPUA 3I32A 2QTFA 4BZXA 1EK0A 1W46A 1YKSA 5M04A 3T06B 1SXJB 2J0VA 4RKFA 5JRJA 1NLYA 4ZCIA 4PR0A 1LB1B 3W6PA 1J90A 1OH7A 3AM1A 3U7FB 1PLKA 1WE2A 5C4MA 3TGPA 1JBKA 4HATA 1ODFA 4MRRA 3BC1A 4KFSA 3QVUA 2F1JA 2IXFA 4MA4A 4B76A 4PPNA 4KVAA 2CLSA 1YRBA 2FPMA 4BFTA 4Q00A 1IJEA 3ZIAD 5K8TA 1RVDA 2ONKA 5H70A 1XTKA 1OIWA 2NO7A 2C9YA 3WBJA 1MH1A 1M34E 4QBFA 2WWFA 1KK0A 4X8HA 1W2GA 1ZUNB 2QPTA 2DPXA 3AB3A 4ZV4A 1OXUA 3GJ4A 4IFEA 1FTNA 3QIAA 4QHTA 1OT3A 3KXKA 4JYCA 4EQ6B 3UG6A 3BE4A 3QNUA 4RD0A 3RLFA 4F7WA 5FUXA 2OSBA 5TXGA 4JYBA 4PZYA 1Z22A 4D82A 1HE8B 3QKSA 3BB3A 4DT1A 1G7CA 5H68A 2HEIA 2UZIR 1FNNA 5FOTA 3NWJA 1DAMA 1GIAA 4QG7A 2GRJA 5FUVA 5SZKB 4RJLA 1NLZA 1Z06A 5CLQA 4TL8A 3VTKA 1PLLA 4TMZA 2O8EB 1GKIA 3FOZA 5JWOA 3ECCA 5J4HA 1Z08A 1S1MA 3BFXA 2AKYA 3NH9A 2I1QA 2C2HA 2IF2A 2D62A 2VRWA 4MYCA 4HB0A 3ASYA 4XWAA 5TARA 3R8CA 4OQXA 2FGKA 1NIJA 3EPLA 4OHVA 3T34A 2X8AA 4HZUA 2O5VA 3KX2A 2ZRBA 2ZS8A 2QRZA 5D3MB 4UXIA 4RFVA 2RB4A 3Q9LA 5HR5A 3D7MA 1K5DA 1P9WA 1DEKA 4ON9A 4M9QA 1G5TA 1XEXB 4FIDA 4PSAA 2FV8A 3TUJC 2CCGA 3EC1A 2BIFA 1XMVA 4C0KA 4V0ME 3BH0A 4FWIB 1W0JA 4EPVA 4WXRA 5KYKA 3I72A 1M74A 2FZ4A 2OV2A 2WKRA 2XTMA 4W5WA 4YONB 2IC5A 1GILA 2R6FA 4ZKDA 1EX6A 1VDZA 1YZKA 4PO9A 4BRWA 4M53A 1Z0IA 2WOJA 2WWGA 5E7MA 1UPTA 3PFIA 5L3VA 2YHSA 4M2LA 3A4MA 1YZLA 3IBGA 3B6EA 3RANA 3O8DA 1IN8A 4QNMA 1IJFA 2VBCA 3LO5A 1KI8A 3L82B 4A36A 1KJWA 3BERA 1FTSA 3AEZA 4X8OA 5E7JA 4A0HA 2W2VA 4IW3B 3MUFA 3K0SA 1W7AA 2I3BA 3NDPA 4HI0E 4G5RA 1GRQA 2NIPA 2BMDA 4XIGS 4NDZA 5IDVA 5C18A 1JI0A 1E9BA 2BOVA 4DCSA 1JEEA 4BLPA 2VO1A 2FEOA 2ZI3A 1GM5A 5DI3B 4HEJA 1KO5A 4FWTA 4ZDJA 2F43B 1WRBA 4JBYA 4UJ5A 5KPDA 3WHLA 3MGCA 3GLIB 2FA9A 2HXSA 1AGRA 5FL3A 2G1JA 5J40A 1S3SA 521PA 2J1LA 1OB2A 3LBIA 5BN4A 5JWRA 1Q44A 2WMOB 2OAP1 2ZYTX 2GF9A 3ZZTA 1KK3A 3TSWA 4Q4AA 3I61A 3UMSA 3OE7A 5L3QA 1RW4A 2G0TA 4GSYA 3TR5A 5HE8A 3LH5A 2XGJA 1DOAA 1Q21A 2EFDB 2W00A 3QKRA 4HAUA 3I62A 3VFDA 1JPJA 4B3BA 1ZNWA 1IXSB 4GRAA 1AN0A 1EXMA 1A82A 1II8A 1X8KA 721PA 4ZI2A 1E32A 5FBLB 4NU0A 3TH5A 4A15A 4M9ZA 1A2BA 3D3QA 4IKEA 3L0SA 4S2EA 4QOSA 4XWOA 4OKSA 1LY1A 1MO3A 2ZYVX 4CYMA 3ZJYA 4U5XA 4DB4A 1XEXA 2O8CA 2QAGA 3THOA 3A1TA 4LYHA 2ZRCA 2FSFA 2FFHA 1KO7A 4NCHA 1VCOA 1I4LD 3WRXC 5J47A 2F43A 2RHDA 4UQOA 1GNQA 1BS1A 1U99A 2FSGA 1VIYA 4DLSA 2G9NA 4JMPA 1I2MA 4Z54A 4QBIA 3D6TB 4HDCA 4W5HA 3UMFA 1HT1E 2KJQA 4Q7MB 2A30A 3QKTA 1PV4A 2GBLC 1S9DA 4W9MC 2VP0A 4XSGA 2WM9B 3SYNA 2XNSA 1DADA 3QPVA 2GCPA 1S9HA 1XTRA 3LXXA 1ZC3A 4P33A 2FH5B 3EZ7A 3WRYC 1E79A 2VHTA 2WJJA 2VP6A 3DOFA 5FPSA 3GJXC 2D4HA 1KI4A 4HUQB 4DDTA 1XD8A 1T6NA 1X1RA 4KV9A 4QFMA 4TMWA 1Z0AA 1E2PA 3OZXA 2BBTA 2YYZA 2CL7X 2CDNA 3U44A 4PPFA 5FUWA 1KSGA 1GWNA 1OH5A 1YE8A 1YR8A 1TAGA 1LF0A 2LKCA 2YOFA 4V03A 5JI3E 3FDIA 1ZD9A 4AI6A 4HB2A 4TTRA 4GI7A 2AX4A 4BFWA 5KNDA 3RAPR 5EP4A 2GEUA 2X77A 4JBXA 3PG5A 4NKRA 4AC9A 1Q3HA 1R8SA 5G40A 5G41A 2OO7A 3X1YA 5CJPA 3U3KA 2OCPA 1DELA 2IEYA 2NO6A 3MD0A 5FI1B 3NHAA 5SZJA 3RWOA 1KO1A 2V7QA 4XOIA 4K46A 3U61B 1AM4D 1EX7A 4N3NA 4OQLA 1KI3A 1HEIA 1NMZA 4PC3A 1UBEA 3KUCA 1L4YA 3A1SA 2VQSA 3PUWA 1K5GA 4NHOA 2WVJA 3CIOA 3SBEA 3SQXA 4WA7A 4FMBB 4X8LA 2D3WA 3B60A 1N3BA 2DFNA 4U7DA 3NBZC 1NVXQ 2JASA 3BB4A 3VR5A 2H92A 3CRQA 4GOKA 4F4CA 2GK6A 1R5NA 2WWYA 3SR0A 4M1SA 1T0HB 4GNKA 1FP7A 2CNWA 1W4CA 2C96A 3C5CA 3I1FA 3N2EA 4OI1A 2R8RA 5KDLA 1G3IA 1NMXA 4ZO4A 3TQCA 2ZEJA 1SHZA 4PX9A 3PEWA 4C4PA 3K0AB 1U9IA 4DLYA 5FPHA 3NG1A 5L3QB 1JR3E 5BYJA 4DLVA 4YMUA 4KCGA 1E0AA 4J0QA 4KBGA 2QPAA 3P4XA 4ESHA 4PC1A 4F38A 4DB2A 1RRGA 1F2TB 2KWIA 3OEEA 3EXAA 3A1UA 4PFSA 1G3MA 2V7QD 3IIMA 3V9PA 4CVNA 2FPKA 2ZRIA 3BJIC 2PJZA 2ZS7A 2CE7A 2QAGB 2JLWA 4YMWA 2R65A 3RC8A 3SU8A 1UAAA 3PIRA 4YDSA 2ZI7A 5JHHB 3TJZA 3GJ7A 2P6NA 2CXXA 3FHOA 4OJKA 1Z6GA 2Z5FA 4LGMA 3B1XA 2NGRA 2OT3B 4RSGA 5FTKA 4IDOA 2EFGA 3PXGA 5KSPA 3MJRA 2ZI5A 3OIWA 1XXHA 3NBFA 1G5RA 1V43A 1E9EA 3KQNA 1NLFA 3HR7A 3U2QA 4NYMR 1ONBA 3LNCA 4GP6A 1FP6A 2Z83A 2RGDA 4DSNA 4CEJB 3Q5EA 1M7HA 2P6RA 2MMCA 1GZSA 2YINC 5JFGA 2JLSA 1LV7A 2ZSBA 1R0WA 3KQKA 3W3AA 4LJ9A 1N2CE 2GJAA 3PV0A 4LDJA 3WHKA 1N0VC 2CVFA 2PT7A 2JLXA 1XD2A 3ADKA 3OEHD 4WIAA 4HUTA 3THWB 2GKSA 4Y0VA 4YDHB 4MUAA 2WAXA 1XDBA 4KXFB 1OH8A 1VYUA 3B1WA 1SVMA 4RKEA 2IWRA 1AS2A 1ZM3A 1WXQA 3TSOA 1JNYA 2X2FA 1FW6A 3CX8A 2V1UA 2JATA 2ATXA 2QORA 4EJSB 2A78A 4QGAA 4LI0A 1XTSA 3ZZUA 4KHZA 2P6UA 2J3EA 5B30A 2O0JA 3K0FB 1Z28A 3B1ZA 4RD2A 4G3XA 4HAXA 5DO9A 2ONJA 3G0HA 1QHHB 4V0MA 2W58A 4XTRA 3R9IA 4URUR 2GTPA 5AR1A 1KK2A 4TLBA 3KKOA 3FMFA 5DYIA 1TX4B 1Z6XA 2IYVA 4OQNA 1G21E 5DIFA 3TUZC 4BFYA 3C4JA 5JWHA 2NQ2C 3K70D 2L0XA 1XD9A 3FMIA 1P9RA 3L8YA 1HYQA 3MMPA 4PSKA 2GWHA 3FYHA 4RFSA 3R9XA 3FB4A 1A1VA 5KSYA 3IO3A 4IXMA 4EPTA 3AVOA 1IHUA 3LDAA 4LHVA 1G8PA 2R6DA 2WSSD 5TVKA 3AP2A 5UKDA 1N5JA 4A9AA 3GJ6A 2HYDA 4FCWA 1MR3F 1N6PA 3F5FA 4D0LB 5E3HA 3Q3JB 4P0TA 3K70C 2PZEA 5G3ZA 4DT1B 2B21A 1SULA 4DSOA 2FZLA 4DUGD 1QHNA 2QM8A 3ZGXA 5TB5A 3C7KA 3FWYA 1Q20A 3TVDA 5JS8A 3K70B 1HURA 1E94E 1T5IA 2XITA 4Q9HA 5J4VA 5FTLA 3X1XA 1BMFA 3BORA 1RYFA 2I1VB 2ZE5A 4OHWA 1Z2AA 1W44A 4YC7A 4TYPA 2GNOA 3HU3A 4I1UA 3GLGB 4L4UA 4TYWA 4JL6A 4O25A 2ODNA 5FOUA 3TAUA 1QRAA 1W0JD 4IDQA 4JLOA 4ASUA 3Q8XB 3B78A 4IOJA 3MAAC 4MRVA 4XWKA 1FUKA 1ZINA 3WXMA 1U81A 4KI0A 3L43A 3H1TA 3QF4A 2IEZA 3SN6A 4MGYR 2QTHA 1L7VC 2XXAA 2AD5A 4QM6A 3PVSA 2NMVA 1E2JA 2RH5A 2HCJB 1E2LA 1T4GA 4F4JA 4ZCMA 1ZVQA 3T61A 2O8BA 1GDDA 1E9AA 2F3RA 5EP3A 1UKYA 3U44B 2QUZA 4DSTA 1H8EA 1TPZA 1ESNA 2QTVB 2PH1A 4BASA 3R8FA 2O52A 5FPKA 4WOPA 1SVOA 4AYXA 1E0KA 1AJEA 2ODWA 4Q19A 4Q7JB 2O8BB 3I8SA 1XP8A 3SC3A 1OPXA 1DAHA 2X19A 2GHIA 2VP9A 2ANBA 2IW3A 1P62B 1FNMA 3AKYA 3LVQE 1C4OA 2WJHA 3GEEA 2FWRA 4DDVA 2RHMA 3GLFE 2ECKA 2G1KA 1OXTA 1EFUA 2CHGA 3AP3A 5JJLA 2GJ8A 1OH6A 4ASUD 3ZD7A 4Q48A 1K6MA 1GL7A 4MKHA 3BH7A 1CJKC 2RGXA 1G8YA 2BKUA 4BLTA 1XXHB 4ZDKA 4HLUA 4JVNA 3WYGA 4DIEA 2A5YB 3QG5A 1E2MA 3A4NA 4IJMA 4M9SA 3K8YA 3FKSA 4LC1A 2IXGA 2CBZA 4P3YA 5AJVB 1MOZA 2QT0A 2ZJAA 4Q4HA 2BBSA 2QNRA 3N5CA 2V9PA 4NE2A 3CF6R 4GMXA 2BBWA 2XSZD 4EUNA 3BFKA 3AQ4A 2H8KA 1T5LA 4HLQB 1S96A 3OESA 3AGPA 1XD2B 2DFTA 4TMTA 2WJGA 4HUQA 4NMMA 3ADCA 3VHLB 1XTJA 2VSFA 1ETUA 3KQLA 3X1WA 4TYQA 3QKSB 2ZRJA 3QXSA 4G1UC 3EIEA 1E96A 3Q7QA 1VG0B 1YRAA 3NKVA 3WNBA 2BVNA 3IBYA 3UANA 2QE7D 3AUXA 1IAQA 3B1YA 1OXVA 1XJQA 3P4YA 5JZVA 2A7QA 5K8UA 5HE9A 3THXA 1N5KA 5JMTA 5LB2A 4V0NA 1U9IC 3UG7A 3EX7C 1QG4A 2KBFA 2OUKA 1T91A 3KKMA 2V55B 4II7A 1DG3A 3IUYA 1GAJA 4GFDA 3K53A 1VG9B 2WV9A 4BFVA 1T9HA 2NO1A 2KI5A 1JEDA 2QQEA 4TMKA 3CRMA 2O0KA 3A8TA 5EP2A 2GXQA 3Q85A 4Q4JB 2H18A 3KTAB 3VNVA 2F9MA 3TRFA 4V0KA 3UATA 4TWZA 2C9CA 5E7IA 3QSYA 2KB0A 4Z1MA 1E2DA 1GL9B 1SVIA 5GJCA 2FFAA 1KI9A 3SJBA 5DYGA 5CIWA 3THWA 1NSTA 2SHKA 3SFZA 3IILA 1CR4A 4PHTA 4Q47A 3TE6A 5FOSA 4F4IA 2XB2A 2EYQA 4ZIRB 4DBLC 2HCBA 2MSDB 1N6KA 5G3YA 2FX3A 4EPWA 2GA8A 1M8PA 1YZTA 2QG6A 1OV4A 4WXPA 2VEDA 3GLIA 4Q18A 1KY2A 3QXHA 4OK3A 1HH4A 1NIPA 1OHHD 5EZ6B 2WWIA 4ZCLA 2IL1A 3UK6A 4JVMA 1OSNA 3K1JA 4PAQA 1KI6A 3SYLA 3WMFA 1L8QA 3CUEF 3H0KA 2QP9X 4L15A 2JA1A 1E1RA 1JJVA 5EP1A 3KB1A 4NYJQ 3RC3A 1RPZA 4DCUA 4AIIA 3B82A 2WIBA 2AXPA 2F7SA 1GRNA 2RGAA 2ZU0C 4GPTA 1OFHA 2WHXA 2GF0A 4A1FA 2XX3A 4MGIR 1UFQA 2VP4A 2ZRFA 3FHTA 2Q9BA 4RCZA 3VR3A 1OIXA 4XVRA 1G17A 1HA3A 4RY2A 3RS7A 1ZAKA 2PJRA 2WWHA 1IQPA 1KNXA 4L5BA 3RSOA 2NG1A 1KI7A 1Z83A 2BCJQ 1XJCA 2PMKA 4GZLA 4LPSA 4A82A 4BEBA 4YQFA 2XZPA 2OBNA 3LRPA 4I1VA 4LZZA 1N6LA 2R62A 4Y0AA 2J45A 1R6BX 1D2EA 1N6HA 1FZQA 2DR3A 4LJAA 4NTZA 4JT4A 2OEPA 1KMHA 4FN5A 4NYIR 2NO9A 4FINA 5K8LA 1VPLA 2A5DA 5C1BA 2W6JA 4YMTA 4TTPA 3SI7A 4L9SA 1JAHA 4V02A 5CM8B 2PMDA 2W0MA 2WJIA 2WBLC 3AVPA 1SVWA 4NH0A 2ERXA 3IHWA 3R7WA 1IN7A 1T8UA 5L3SA 5CLLA 4TMXA 4HAVA 5F2EA 1LTQA 4P4UA 2BJVA 3WP0A 5BWMA 3RSLA 3THXB 4E03A 1E0SA 2C04A 1DE0A 4EFNA 5HZKA 1OXXK 4DLZA 2VLIA 3SEAA 4CT4B 4IOMA 1JR6A 2E1RA 3SZRA 1PVOA 3RYTC 1DARA 2AK2A 4UXJA 3KFVA 2QGZA 1CIPA 2OHFA 1CRPA 2OZEA 2O0HA 2AKAB 2G88A 4IEEA 3LWNA 3QPWA 3AVWA 2H7VA 1KAOA 3IIKA 3RHFA 1Z0KA 4DCTA 3TBKA 1XRJA 4JLVA 2EVWX 4JLBA 1X6VA 3CZPA 1N5LA 3CNOA 3KFXA 2JJ1A 3H4MA 3TIFA 4JKYA 1G291 2PZGA 5E95A 1ZNXA 3UPUA 2PEYA 1U8AA 1G6HA 1D6JA 3TVTA 1DPFA 3CRW1 1VG8A 3DEFA 2A3RA 3EARA 3FHCB 4MKIA 2Q3HA 1EG7A 1GOTA 4C0LA 5KDOA 2F9LA 5H8WA 2FDCA 4UNSA 1X1SA 4A0RA 3E2IA 5EXPA 2F6RA 2QGNA 3MWJA 4B3XA 3LQRA 1E3MA 4LJ6A 2VP2A 4JJKA 1NF3A 2ZSDA 5JEEA 3CWZA 3SBDA 4QNRA 3B9PA 4M1MA 4MDEA 5AUPB 3CR7A 1WBDA 3H86A 4JZKA 1YZGA 4B3DA 2R9VA 3I3SR 3TQFA 4C0AC 1JPNA 5EE9A 1XWIA 2ZVPX 1Z2CA 2REOA 3CKLA 3H84A 4JVLA 3QY0A 4D4KA 4OQMA 2JLUA 3B5JA 3FKSD 4B32A 1W4RA 4Q01A 2Z4SA 1KTVA 2ZRAA 3BIFA 5FFMA 3W90A 2ZE6A 4BECA 5IT5A 2PLRA 2QP4A 2ORWA 2WPDA 1SXJA 1SKYB 2XAUA 4B34A 5KSZA 1WMSA 4A2QA 4PHFA 1UF9A 3K0CC 3OEHA 2IYZA 3L2OB 2WSSA 1VCMA 2A5JA 3LLUA 3CB4A 3ND9A 1M2OB 2LWIA 2ZAOA 3QF4B 5DISB 1SKYE 4D25A 1OYWA 2V4ZA 2ZRKA 5SZHB 2I4IA 2RGNC 5FOWA 3M0EA 1R8QA 1NJFA 2FSIA 4H1UA 3NIBA 4IVPA 2XOKA 5SZIA 1P7CA 4KO8A 1ZIPA 3CPJB 4YMVA 3I5XA 4OJQA 3KL4A 3K0CA 2V1XA 1PUIA 3KKQA 1PJRA 1G7TA 5B58C 1Z8FA 1TMKA 2J0UA 1SXJC 3B9QA 4JL5A 4W5JA 3EZFA 3NC0C 4ZDWA 4O2RA 3GJ0A 1TU4A 5FL7D 4LJ4A 4PSVA 2ZQ5A 4A8JA 1ZU5A 3DM5A 3GJ5A 2RGNA 4HZUB 4EKDA 1F2UA 2QMEA 4US0R 2WTUA 4RZXA 1ANKA 4CDGA 1ZUHA 2AWOA 2YJTD 4M21A 4G0NA 4DWJA 1HUQA 2Y8EA 1A4RA 2MSEB 1RRPA 4CEIB 1CULC 1QHSA 5KHOC 2ZUBA 2J59A 2HJGA 1EGAA 1KY3A 3PEVA 3AF3A 4KSBA 3FE2A 4R7ZA 2PBRA 3OAAD 2FG5A 3TKLA 2VSXA 3C15C 4O2LA 1FX0B 4C0SA 1TNDA 2JJ8A 3PUYA 3LW7A 4K81B 2ZVQX 1WF3A 2OILA 4OYHA 4WAUA 4C2TA 5C4GB 1GNPA 2OFOA 3IEVA 1SVKA 2D06A 1G16A 4B74A 1TUIA 4MUBA 1E4VA 1TQ2A 2ZITA 3LQQA 4HDQB 4LOAA 3PENA 3QQ5A 3OFND 2J7PD 2QMHA 1CJVC 1RYHA 3B85A 4M1WA 2C98A 1RFLA 1KNQA 3PCRB 4JLKA 3IEUA 4KFTA 5EE5B 3CR8A 2PLFA 3FPAA 1G7SA 4LHYA 4LCBA 1KDPA 3HPQA 2ZYWX 3RRNA 4FW9A 3EWSA 1N25A 3GLGE 1QVRA 2REBA 5TV2A 1XJ0A 4B6EA 1KJYA 1AA9A 1D2MA 2GZDA 5KSOA 1UBFA 3BGWA 4XVQA 3R7WB 1S8FA 4PQFA 3QBTA 1A5TA 5HCNA 1DAEA 4ILEA 4DEXA 1E69A 3P1JA 1JXOA 2ZJ5A 2QROA 4A6PA 1RJ9A 1TTTA 4NCJA 3OIVA 4GL2A 1NBME 4B71A 1IN5A 4CF7A 4L9WA 3C5HA 1T3LA 4CT5A 3Q72A 4GZMA 1KKMA 2ZR7A 4LBVA 4ZKEA 2PCJA 4P4TA 1P60A 4KSCA 5CM9C 1LS6A 621PA 2HXYA 2R6CA 4HLCA 4KYUA 3BRWD 1VTKA 3CF2A 3PQCA 3QBVA 4V0OA 5EE3A 5FTJA 3X1ZA 2QEQA 2V6IA 3KJEA 3CM0A 4IOLA 5CITA 4R2IA 2A2ZA 5LD2C 2WPDD 1BKDR 4YXWA 3UMRA 2F55A 4ABYA 1DVRA 1XU4A 1Z29A 2QA5A 4P31A 4H1VA 2HT1A 1E1RD 4UXHA 5J4KA 1NKSA 3BWDD 3AVUA 1TEXA 4EJSC 4M22A 3ETLA 4B2PA 1F60A 4A4DA 2XNDD 4B47A 1F2UB 4GBMA 2P2LA 1WA5A 1XFAA 2JLYA 1E2HA 4LV6A 4LJ5A 2IWHA 4NONA 3AP1A 5EZ5A 1JR3D 3U6BA 4D2IA 1S3GA 2ZIAA 3NVAA 2C03A 1ZCBA 1P6XA 1G1MA 3QF7A 2G3YA 2GBLA 4JKIA 4QJ5A 4R9UC 2HYIC 1OYYA 1CXZA 5AJWA 1ZYUA 1T8TA 1S0UA 3F8TA 4FXPA 2O8FB 2ZI9A 421PA 2YWHA 1TU3A 1XCPA 3GJ3A 4MRNA 2ZXUA 1E6CA 1W2HA 2BEJA 2G6BA 4IDNA 3GMTA 2OG2A 4XD7A 4F93B 5JBQA 2C99A 4AK9A 1HQYE 4PANA 2A9KA 2IK8A 2GVDC 1Z5ZA 3U7GA 3FFBA 1AKEA 1XZPA 3TNFA 2QN6A 4DRZA 2O8CB 4OHXA 4WZBE 5J4LA 4QHSA 1IY0A 4G5SA 2AN9A 4BE7B 1G64A 2ZYUX 5JRZA 5GJBA 1F6BA 1SKQA 4EQ6A 3LAWA 4ZIRA 1FMJA 2XOKD 1G3UA 1LF5A 2FSHA 3G5UA 5B2ZA 2RGBA 3U5ZB 1VHTA 4Q9KA 1HY3A 5GVRA 3A36A 4HYYA 3RS2A 3E5HA 1E99A 4N1AA 1BYIA 3CPHA 1I2DA 1Z0JA 2VHCA 2OCBA 4NCIA 3M6AA 4AY2A 1VYTA 2ZJBA 3FVQA 4U00A 1FMLA 1N5IA 3LX5A 3MG9A 1RRCA 4DLTA 2FJUA 2VPPA 1E2IA 1H8HD 4LBYA 1IY1A 1QBKC 1W4AA 4D4JA 3PJRA 1R0YA 2RCNA 1CKEA 1RC8A 1XBTA 1SGWA 2VF7A 3Q7PA 4B43A 4B3FX 5FPYA 1GUAA 1LNZA 1U2RA 1HTWA 2GZAA 3ND8A 2PX0A 1ZM7A 5FBWB 1E98A 4RD6A 4FMDB 1EFTA 4UNQA 1M7GA 5DSZA 3X2SA 3VKHA 5D3MA 4ERNA 5EXTA 2GAAA 2ZSAA 2NZ8A 3AGQA 4DJTA 2QBYB 3M4YA 2DB3A 5DHFA 1YR7A 3X1DA 2V6JA 4KLNA 3REGA 3RNLA 4BGDA 4B35A 4KFUA 1G8FA 1SXJD 3RRMA 5FBQB 1II0A 2WSMA 4MKGA 2CK3A 4MYHA 3A1VA 2H5EA 2D7CA 3QOFA 1VG1A 5F98A 3SS8A 1HE1C 2CHVA 2ZUDA 3FMPB 1XCMA 1UM8A 4Q9JA 3VR1A 1NN1A 1T0JB 3ICEA 1CU1A 4IDPA 1NNEA 1G3RA 1WP9A 1GP2A 2HJVA 3K9NA 4JBWA 3KJHA 3VHXA 3NEYA 4TLAA 3ZQJA 3CNLA 4QJ3A 1TQDA 2OLJA 1Q1EA 1E9SA 1W36C 4D0GA 4EPRA 2GESA 1VKJA 3CW2A 2CJWA 1VECA 1QF9A 3MJHA 1TQ4A 3EC2A 2HLDD 3H2YA 4QC2A 5IK2A 1UADA 3QI2A 5IK2D 4FCTA 1L4UA 1Y63A 3J81k 3GLIE 2D7DA 1AIPA 2TMKA 2GXUA 1WBBA 3I73A 3LV8A 1E2EA 1ZU4A 2VHUA 3NH6A 1US8B 2F1IA 2OCAA 1WB9A 1WCV1 2H17A 2BKEA 4ITRC 4Q1BA 3AVVA 4TZ6A 1KJZA 2ZRMA 1OF1A 4BZQA 1QHIA 4EJSA 4KVGA 1E9FA 1E1QD 1NVVQ 2OE2A 1JALA 2X1VA 4IVRA 4TTQA 2OLKA 3K9GA 3PEUA 3UWKA 2GZHA 4PZLA 5HPYB 5DH9A 2XSZA 2CMKA 3JVVA 3EPKA 3SNHA 5DGXA 4AG5A 3U3OA 4B3GA 5KUTA 1UDXA 3R9WA 4URVR 1UDWA 4G01B 2P65A 1KGDA 3BH6A 1VCIA 3DVLA 2QU8A 2R6GA 4URWR 1TADA 3W8NA 2BWJA 4IFBA 1GKYA 3UXMA 4M8NE 3NDBB 1O3YA 4HB4A 2RKOA 4PPQA 1QHXA 4C0BA 1ZUIA 2ZRGA 2AHOA 4NCKA 1KDTA 1IXRC 2LCFA 1Q12A 4R2HA 4L8GA 1R5BA 1I4DD 4URXR 3WY9A 2XXAB 2IUUA 4NYJR 4TL7A 1CRQA 2O8DB 4XJXA 3WBKA 4DHEA 2J87A 1KYIA 2GJKA 5FUYA 3EPHA 5GVSA 1I4TD 2ORVA 4MQBA 4BLSA 3EPJA 3K09A 1SVSA 5D3QA 1QHHA 3MWKA 1O87A 4A8JB 3RABA 2GAOA 3KB2A 2ZJYA 3ZVNA 3N2IA 1AS0A 4TQUS 2J0UB 2Q9AA 2ASEA 4DLUA 4AYWA 1CJUC 2IYQA 2EQBA 3DMNA 3GJ8A 1R0XA 3CF0A 1FQJA 3CWQA 3GLHA 2GCOB 3ZVRA 4BFXA 5JEDA 1QZXA 1D5CA 1KAGA 2OFWA 5FR2A 1OFIA 1OXSC 5TDHA 2FEMA 1B23P 5JJIA 1F5NA 121PA 2VSOA 2WKQA 3GP8A 1KIMA 1XX6A 2DWPA 3ASZA 4DLRA 5EJEA 1EFCA 3WMGA 1W36B 4C2UA 1P3JA 3PR1A 2QRNA 4MYTA 2R6AA 1GRRA 4HAYA 4URYR 2F3TA 1KMQA 2ZRPA 3T1QA 4XVUA 1YHNA 1FX0A 2Q6TA 4MH0R 5AUNB 5DNYB 1Q22A 5IHPA 3K0AA 4IRUB 4Q4AB 3AF1A 4BQSA 1CR0A 3NEJA 1P2SA 2ZI6A 4TQ9A 1ZRHA 2ZJOA 2G0NA 1KK1A 1IM2A 1L2TA 1W48A 4Q7LA 1XMIA 3BBPA 4PAOA 1DAGA 4BFUA 1RRFA 1QHGA 1NP6A 2J7PA 3HDTA 2C9OA 4A8JC 1W0KA 4PHGA 4EPYA 5L3SB 3NXSA 4UKDA 3W5JA 1CR2A 1GVNB 3LBNA 1CJMA 2HUPA 5P21A 4OI4A 4CIDA 2WJYA 5JI2E 3GLFA 5F3WB 4LPKA 2CLCX 1MO4A 3DOEA 3VR6A 2HV8A 3MWYW 2QMUA 2HDNB 4AD8A 1E0JA 4PTLA 5LDDC 4LYJA 2FN4A 1N6IA 8OHMA 2IHYA 1GITA 1IONA 1A7JA 4NBSA 3SHWA 5JHGB 2PX3A 2A5GA 2P3SA 2QBYA 3HYTA 4LJ8A 1W49A 2AXNA 4Q1EA 5BQ5A 1XPOA 1KSHA 2DFKB 1W4BA 1W47A 2NO0A 4GOXA 2QQ0A 1XEWX 2ZANA 4A2PA 4C9BA 1KDOA 3TW8B 2Q3FA 4XSHA 3V4RA 2C95A 4B75A 5JCZA 1JECA 5J5CA 4JIMA 4AKGA 5TMPA 4G5QA 4DSUA 2J46A 3RS3A 4LYAA 1R4AA 4EFMA 3KZ1E 2C8VA 1OKKA 4MKFA 4JSTA 3KTAA 2D2FA 3SJZA 5C46F 2KE5A 1BMFD 2IX3A 2YV5A 1TF7A 3A4LA 4JLDA 1U98A 3C8UA 4V0LA 3WP1B 5KNBA 2JIZD 4PZZA 4C7OB 5JS7A 1W1WA 2ORIA 4MITA 4AKHA 3HP1A 4QXAA 3CO5A 3S1AB 3BD9A 4HAWA 2JGNA 3E70C 3LX8A 2W2TA 3TSZA 4M1OA 4DUGA 3GLFB 3K0EA 1PLJA 3LW8A 3GCGA 4CEIA 2HT6A 2ODEA 4OQFA 2JJ2D 2XEXA 4D4MA 1QHYA 3DKPA 2BV3A 2EWVA 4D80A 1PUJA 5EQTA 3HU2A 3W34A 4AWXA 4D4LA 5K8IA 4URZR 2PL3A 2WKPA 1F48A 3IIJA 1GFIA 3SQWA 5AWFC 1R2QA 2C5LA 2R44A 2YC2C 1X86B 4NYIQ 2OM2A 5EE0A 1S4QA 3VU9B 3ZS9A 1EFRD 1NRJB 1TQ6A 4Q9IA 4E09A 4B2LA 2Q9CA 4US2R 4LJ7A 2QSYA 4P4SB 4Z8XA 1P2VA 1G7RA 1EWRA 3QVVA 1OKKD 1OW3B 4WW0A 2UZ3A 5TY0A 5H1YA 1CBUA 1G41A 2K5UA 1ZC4A 5A5GA 3AV0B 2VA8A 3QPUA 4KYIB 4Q1FA 3ZD6A 3T5DA 3W9YA 5HKKD 3EG5A 1G6OA 3EA0A 5JLJA 5FOVA 3LLMA 3A37A 3DHWC 4KU4A 2OFXA 4QHYA 3RS5A 3MWLA 2ZSEA 3TR0A 3VQTA 1Z6YA 4KAXA 4U02A 1ZBDA 4JT2A 4I99A 4Q66C 3D31A 2GK7A 1HT2E 4MRPA 2CLDX 3W8RA 2FOLA 4QRHA 1RZ3A 2IBMA 3LY5A 1Q57A 2CJWB 4BLQA 1TL7C 2WWWA 1KI6B 1XF9A 2YOHA 4TN1A 1ZCAA 4B44A 2VF8A 3L8ZA 2A5FA 3F0TA 3QKRB 4UNRA 5KO2A 1VIAA 1KKLA 1FOEB 3QXXA 1TF2A 2B7CA 1COWD 1Q0UA 4LHWA 2BCGY 1J8MF 2OAQ1 1M1YE 2VH5R 2ZJZA 2NOAA 3TK1A 4TL6A 4D0NA 1BIFA 3CBQA 1U8YA 1BO6A 1MABA 4I4LA 1R10A 3EA5A 4EDHA 3Q5DA 4W7SA 4ESVA 2ZE8A 4PQYA 2N1BA 821PA 1OJLA 3HWSA 1G20E 4Q9LA 2QENA 1JB1A 1JJ7A 3L0IB 5DI9A 1FPMA 4E07A 5IRCD 2ZPTX 2DYKA 5E4FA 4JLMA 5KTYA 2FGJA 4FCVA 5FR1A 2ERYA 3VNUA 3U4QB 2BM1A 4P32A 2EFHB 4Q5IA 4WVFA 3WYFA 2O8DA 1YJ5A 4BFSA 4DVGA 2GCNA 4F91B 1IN4A 1D2NA 5CJ2A 5JSZA 3E1SA 4B3CA 3AVYA 3ZVLA 3QJYA 3B7GA 5HKKA 2IYRA 4KBFA 3EZ2A 1TF5A 1KI1A 5DN6D 3V00A 1E2GA 3WNCA 1YU9A 3I92A 4N0DA 2AD1A 4I81A 4QBGB 4DZZA 5HZHA 2J0QA 1M6NA 1RKBA 1J8YF 1E2NA 5FPTA 1AK2A 3RWMB 2YWGA 1M7BA 1D9ZA 4LHZA 4OHZA 3TUIC 4AG6A 4DLXA 4K8OA 4CW7A 2WJVA 5C2JB 5FTNA 1MO5A 3MRSA 4JSYA 3RRYA 5CK4A 2IXEA 2EU8A 4MGKR 3DO6A 2ZJ8A 1AGPA 4O3MA 5B64A 4DDWA 1AQUA 1Q1ZA 2CNWD 4NPHA 3GPLA 3C16C 5CYOA 1AZSC 1U90A 5J4YA 2P67A 2CCJA 3KJGA 4DCVA 2CE2X 4POAA 2AK3A 4F92B 4MDFA 3VR4A 3DZDA 3C14C 3GLGA 4CRWB 1VCNA 3GFPA 1Z6AA 5CB8A 1S1CA 1ZM4A 2BMEA 1MO6A 3AKEA 1N6RA 3RDPA 1BOFA 4I1OA 1Q1BA 4B6FA 3N70A 2ZRNA 2F1HA 1IN6A 2JIZA 2B8TA 3THYA 1Z0DA 4FMCB 5ANRB 2CEAA 4KODA 1NJGA 2VHQA 4EPXA 5FTMA 5LPNA 3OF5A 2QAJA 1SHKA 1NBMA 4A0GA 1H8HA 3IQWA 5EE1A 1NBMD 3MSXA 2GETA 2NZJA 3PUZA 1NL3A 4LHXA 4A2WA 4TZ0A 2W6ID 4C0JA 2C78A 2GJ9A 4H9GA 3S1AA 3CONA 1II9A 2VL7A 2Z43A 3QENA 4LSGA 4NP6A 4Z1MD 1KMHB 1ZNYA 3OIYA 3RS0A 3IHLA 1J70A 2UVQA 4IHQA 1KZ7B 3OE7D 4BEJA 5B57C 5FBVB 2DBYA 1GL6A 1SXJE 4US1R 4B33A 3KXIA 2IYWA 4Z51A 1PZNA 3K9HA 4NZYA 5A0FA 2FMXA 2D2EA 2OCYC 1XCGB 1FQKA 1J7KA 221PA 2GVZC 4JL8A 3I8XA 4LBWA 4LX0A 5BXQC 2IYSA 4Q02A 2JDID 2BJWA 3GLHB 3L0OA 4Q4HB 3IO5A 1BH2A 2PZFA 2YNMA 2CVHA 3T1OA 4OK6A 1FL9A 2HLDA 2QY9A 3A58B 5CB6A 1G8GA 3RS4A 4RCYA 3QE0A 4QGGA 1Q1QA 1U94A 1YZUA 2BEKA 5JCPA 3G82C 3U7HB 4B2IA 1UBCA 3SJCA 3QXCA 2J0SA 4AKEA 3T15A 4TT3D 3ZVMA 3EWAA 3JZAA 2AFIE 2IUSA 2ZUCA 1CTQA 1GTVA 2JLRA 4GMDA 3KQHA 4ACBA 2Q0HA 1NY6A 2J5XA 4CZ2A 4A6XA 2Q3MA 3HJNA 1US8A 4DEYA 3WYAA 1J99A 4ZDIA 1ZIOA 1EESA 3LD9A 1NVVR 4RZ2A 2JJ2A 2RAPA 3GQBA 4PC7A 1VHLA 3V4FA 2LKDA 4B73A 2NTYC 4GT1A 5FOXA 4AURA 2BC9A 4JLAA 1SQ5A 1AS3A 3ICQB 2XTNA 1W5SA 3BFVA 3DDCA 3FKQA 4DKXA 3U3MA 5HCIA 4PC6A 4TL9A 1G5PA 1E9DA 4EAQA 2ZRHA 2BMFA 2FNAA 1G3QA 4GOJA 5L8VA 4PO1A 1XNJA 3IDQA 1Q3TA 3A6PC 1XEWY 1E1QA 4DDUA 1V5WA 3CZQA 3OFNA 3K9LA 2QSZA 1KZGB 1ZD1A 5IF9A 1T3HA 2J41A 4ACAA 1LVGA 3REFA 3BK7A 5JECA 5AJXA 1OFUX 4LK2A 1NN0A 5GJVC 4L16A 2P0EA 1RJ9B 5G53C 1P2UA 3T1TA 2VYFA 2REXB 1K8RA 3LBHA 1XPRA 1NY5A 2PT5A 3R20A 3TMKA 5CYPA 4UJ3A 2PCLA 3LXRA 2ZE7A 5KDDA 1ZM2A 3EIHA 3NTUA 3QEOA 2RGCA 2MMGA 1UKVY 2UKDA 4UNNA 2Z4RA 4RFSB 1B0UA 2N46A 4JS0A 1OHHA 4QL3A 2IS1A 5GADl 1A2KC 4FD2A 1U0LA 1OIVA 4A0FA 1EFHA 2IS4A 3IGFA 2YWEA 2E87A 3FMOB 4Q1CA 2Q21A 2W6IA 3CH5A 3HU1A 2QL6A 2ZRDA 4MGZR 4OBEA 1NN3A 3ADBA 1R5OA 1XTQA 2NPFA 5AJZA 2D74A 5JSZB 1KSJA 1OB5A 4C0QC 5CDFE 4PQRA 2JJ1D 3NBYC 1JQLB 5DHAA 3ZS8A 1E4YA 2OXCA 1NI3A 3GFOA 2P5TB 3DM9B 2EFCB 1MV5A 2G77B 4LV8B 2DFLA 5CK5A 1XPUA 3CRRA 1MKYA 3K09C 2QZ4A 3ZYCA 1FUUA 1MABB 2DHRA 4BPBA 2YC4C 2JLZA 2B92A 1H65A 1LFDB 2BHRA 2P5SA 2ZI4A 3DL0A 3CH4B 3MFYA 3B1VA 1W0KD 2QMOA 3B8HA 3RVBA 1X8LA 3VX4A 4IEIA 5KPJA 3JZMA 4YXWD 1LW7A 1KI2A 3HPRA 5CIQA 2AL7A 5AK0A 1P4SA 2FFQA 2IF0A 1W5TA 2ZJ2A 4LRWA 1EFRA 1KSFX 4X8MA 3O8CA 1DO2A 1TEVA 2ZS9A 1XXHE 4MYUA 3W6OA 4YMSA 1DO0A 1AZTA 4PC2A 1CP2A 3P27A 4TT3A 4DIDA 2DWQA 2ZSFA 4KJZA 5DE3A 3GFTA 2QE7A 1R0ZA 3ZIAA 5F9HA 4CEJA 4ARZA 3TLXA 3QEJA 4IDHA 4BFZA 2ZETA 2B7BA 1G4AE 2QAGC 2IYTA 4LC0A 1LS1A 3UWOA 1UKZA 4HLUC 3LVRE 2JCSA 2J7KA 1P61B 4Q1DA 3EAQA 4XTCS 2WICA 2IYXA 3SDZA 1YZNA 3NBXX 2CL0X 1XMSA 5FI0B 3VMFA 3JVUA 2DWOA 1RE0A 2IYLD 1XMJA 1XTIA 2X2EA 2C77A 4TMVA 1Z07A 1ZJ6A 3AF0A 4DLWA 2ZREA 1U8ZA 1ZP6A 3RRZA 2QP3A 4TYNA 1E2KA 1OFTA 4M1YA 3ZH9B 4NCNA 1IBRA 2VHJA 5DLQC 1D9XA 6Q21A 1G19A 4BUJA 1Z0FA 3DMDA 1C9KA 4PAMA 1OLOA 3AUYA 4M4SA 5EUMA 3QKUA 5A4JA 3SFVA 4E5UA 1E2FA 5HTKA 1JAIA 1DTSA 2DY1A 3MLEA 2ZU6A 4QGFA 1XEFA 3EW9A 2ANCA 4I1SA 3W6NA 5EXXA 2VP5A 1KHTA 2V3CC 3CX6A 1T3SA 2IYUA 2QPOA 4BLOA 3O8BA 2ZM5A 2XNDA 1ZMXA 1U0HC 1NSFA 2FFBA 2ZROA 1Z3IX 2BM0A 4WBSA 3AH8A 2JEOA 3CPEA 2E9SA 3GLHE 3TAHA 4JLNA 5DI3A 4C7OA 3LFUA 3AKCA 3EZ9A 2ATVA 2ZRLA 3VR2A 3U4QA 1HQCA 3PITA 3U6KA 4M1TA 2JLQA 2G83A 2GILA 3LA6A 3SOPA 1YVDA 4O0MA 2CL6X 1COWA 1E9CA 2XJ9A 3K0FA 2WWXA 3SYKA 3FFAA 3CX7A 4RD3A 3VU9A 4Z8YA 4HZIA 2YKGA 4BRUA 2JLVA 1X3SA 2IUTA 2IHBA 3BB1A 3KKNA 1E2QA 4UNPA 4XD7D 1X8JA 2IA5A 2FF7A 4HB3A 4JLJA 4NYMQ 4C0HA 2YWFA 1GSIA 3I5YA 2J9RA
chains in the Genus database with same CATH superfamily
5DIZA 1O9HA 1ZICA 4KLZA 2M1XA 2WAYA 4KXYA 4YJ3A 1RWMA 4Q37A 4P54A 3B1KA 3KQUA 3ZLJA 4CQLB 1VL8A 5F9FA 3QJ5A 3KQTA 4NWIA 1J5XA 1LC3A 1VMAA 2XQIA 3DKVA 3COZA 4TLCA 4YYEA 4IOKA 3OZAA 4QUKA 3GD7A 3ZHOA 4DCNA 4LY6A 4ALKA 5JU6A 1WXFA 3AI1A 1KWGA 5BURA 3QG1A 3KT6A 1ZGBA 4XH9B 2PVCA 4TLDA 3CGWA 1NBHA 1JEJA 2KX7A 5EFZA 4Q3DA 2FPRA 4UQLA 3OQNA 2ZTSA 4PRYA 4CEHA 2XB4A 2Z0MA 3EASA 3UEOA 1SXQA 1R3UA 1YQWA 2A3NA 1N4AA 3ED5A 4I50F 4RZ3A 4BMCA 4CMIB 4JHLA 4KB5A 2JIMA 3NVKI 2H16A 5E0OA 4CPDA 2RARA 4PHCA 2FSPA 3KWMA 1UBNA 4XX0A 5WRFA 1TQHA 3R75A 5B5SA 3AG6A 5EJ7A 1EWQA 3NBUA 3A4YA 4HH1A 3AL2A 4HSEA 3UV7A 2GO7A 2RI0A 1U80A 1E18A 1VL2A 5J1SB 1RLUA 2OKGA 1ZVVA 3R6TA 1FRQA 4D6PA 1YRHA 1WMBA 2HW8A 1E8NA 1G18A 1NJ6A 2PZJA 4ZWNA 3VOSA 3W3ZB 2YUTA 1Z6TA 3P26A 2PSSA 4TLEA 4EY4A 3EYAA 2DJ5A 5L4NA 1MTZA 1KO8A 5IANA 4FYMA 1BG6A 9LDBA 1XJWA 1YI1A 1HRKA 4MRMA 3GCXA 5KVQA 3W3AD 3ZV4A 3G9UA 4YRZA 1TIBA 4H3VA 4BN0A 5JTUA 4HLDA 3CLVA 2OYRA 4OHYA 5THQA 3SE0A 3AI3A 4JVSB 4S35A 2W4IA 3NZEA 1Z63A 1QTNA 1EINA 3L4JA 1D8TA 2PFKA 4ZCSA 5GIOE 5FEUA 2FR8A 5KVAA 1S2NA 1KOFA 4R0NA 1NQOA 1CPYA 2JAQA 1W4ZA 4QPZA 3UA3A 2H7YA 3C41J 4IXNA 2AJLI 1STOA 3F5DA 3ESAA 5ELXA 3LXMA 3LCVB 1DIRA 4P2BA 5IM4A 1D04A 1MT0A 3H83A 4D26A 2WK1A 2RAFA 2FE4A 3JWPA 4A91A 1WPGA 2FY8A 2VXBA 3B6KA 3ER9A 2IE8A 5AUOB 2OZLB 4O4IB 3NX4A 3MMSA 5TQ2B 4WKPA 3C48A 4DREA 3MQ2A 1N34B 1GPLA 4ARZB 1JQ5A 3AHJA 1DJLA 3KDSE 5EIOA 4BZZA 4AXXA 1UODA 3N8IA 3HVUA 4L0QA 5FKJA 4F1KA 3IEXA 1FDWA 3VX3A 4RPGA 1Y3AA 3W7VA 3B13B 2OBMA 2QN9A 4UBIA 2ZUEA 2TMDA 1ZNQO 4WBNA 4RTPA 2C94A 6LDHA 4ZVOA 3I76A 3A1CA 3S27A 4CKYA 4PLHA 2O8EA 1LWNA 1K6JA 1II8B 5F1YA 2FUKA 2B1JA 2XVYA 4Q4LA 4R98A 5IUJC 4I55F 3Q9UA 2QZSA 3B2EA 3K2BA 1G0NA 1T9GS 2OSVA 2H57A 2XYHA 2YZ2A 3FWNA 1T6BY 4PFJA 3OICA 5EWLB 1JXMA 2FXVA 4FQ8A 2JZOA 2A1UB 4RDHA 4C3ZA 1U0SY 3I37X 3PRJA 3A9TA 4JGIA 2EKPA 4JT8A 3QXJA 1K9SA 3LIIA 2P2CA 3R2JA 1DAKA 1FRNA 3PUXA 3G1WA 4OK5A 4V2UA 4EHFA 5MN6A 3I1IA 5DX8A 3PX7A 4RD1A 1KEUA 3BWYA 4TV9F 3WNDA 4CM1A 5IS2A 1FFYA 1LRJA 3AHFA 3RVJA 5BN5A 4COOA 2ODBA 2V7UA 4KE9A 6CHYA 1AKNA 1UKEA 2EYUA 2GDJA 3BS4A 3R3XA 5IG2A 4K9DA 3UJAA 4LZPA 1DWQA 2LDXA 4EY8A 1NRWA 1L8XA 3ES9A 1NG9A 2B6HA 2YRWA 4FONA 3ZLVA 3A6JA 1QE5A 1USIA 2B4AA 1H3FA 2P9BA 1VLVA 1CF4A 1E5DA 2XV1A 3GJYA 1UBLS 3QUSA 4NJMB 1E66A 5LBIA 5C8DA 1TFRA 1Z75A 2NTVA 4BWYA 4TM7A 5HEKA 4DL9A 5DNEA 1N57A 1P72A 4YLGA 3F5SA 1J9GA 2Q1TA 3OEED 4JVOA 3TQIA 2EX4A 4IQFA 4A92A 4EARA 5FWXB 2PS1A 3PHJA 1DC6A 3B9RA 1NN5A 3K6SB 5EWJA 4HRYA 4XDZA 1GZVA 3PGXA 3PQ3A 4PXYA 1AQNA 1JEAA 3BSSA 1WUKS 3N2ZB 3ZZ0A 1NULA 4U2BA 4EFDA 1LH0A 1P2TA 2VWHA 1YZQA 4C6TB 4KR7A 2WWTA 1N0HA 3GEHA 1WPRA 4OQYA 4QPJC 3TZBA 2HHCA 3IVGA 2C9DA 4RD4A 3HVKA 4RVCA 3EEBA 4Y2VA 1HDOA 3C1UA 5REQA 1W36D 4XJTA 2CZQA 4HGQA 2D1QA 3CVXA 1XDSA 2E21A 1ULAA 3OPYI 4Y6QA 3KKPA 2VIIA 2C3MA 3OURA 4PXAA 3R6DA 4CKWB 2PH3A 4NFSA 4G65A 5LQJA 2H1LA 3R7AA 2V54A 2P4SA 2AF3C 2G7ZA 3TRHA 4DANA 1LQ2A 4JXKA 5A5DA 4M9XA 2OXRA 1YZFA 2OGUA 1GCIA 4EMTA 5AVYA 4E08A 3QHQA 2NN3C 3DZFA 2QM7A 4KRGA 5LVAA 3C97A 4QRIA 3GGSA 4YP0A 3DZ8A 5CM2Z 4R1LA 1A04A 4Q34A 3GDWA 2RGEA 3KZKA 1QH1A 1P18A 3JW8A 3MSCA 2FZVA 3IDAA 1ESEA 5LCXA 2O6HA 4L9AA 3EAFA 3FJ1A 3T1VA 3VDXA 1PS9A 5ALNA 4DKJA 2G4CA 4G5GA 2RMKA 3OIUA 3RJ5A 3ZWMA 4E30A 1PSZA 4WECA 2ID9A 1SBCA 3THYB 3L7CA 3CNNA 5E8JA 2VPWA 3NHBA 2UZAA 1JQBA 1FJXA 3SJAA 3W5IA 2XJ4A 1VYVA 1W0CA 1J23A 4JROA 4FZVA 3W5AA 2IW1A 4RHXA 3INYA 1TT7A 4TTIA 2YY7A 1S2MA 1GA1A 3LT0A 3M1IA 3QLVA 3IKJA 4LISA 1ZK4A 2BZSA 2X23A 4B6SA 2HWKA 4JJ8A 3TF5A 5BW5A 5CYGA 4HYEA 5MFZA 3WAGA 4K86A 5DGIA 3DPUA 1EXNA 5AHKA 3GFQA 5CJJA 1RU3A 4BZXA 4QO8A 3GRVA 3HU5A 3HC7A 3T4EA 4LDNA 3QFFA 1UKBA 1DQYA 4OREX 1E1YA 3WGZA 1KOGA 1A4XA 4WLOA 4UOZA 1WXEA 3NTVA 4GWGA 1DC7A 3H16A 2I2AA 1JIVA 1J90A 1TGYA 1V1JA 3K2EA 3L6UA 3RF6A 2VTBB 3U7FB 1GLNA 4ZTUB 2QUBA 5CT6A 4K26A 1JBKA 2C58A 1ODFA 4HATA 4Z7JA 5L7WA 1U7OA 5A9RA 4D8XA 1NBAA 3IQHX 4OOFA 3HV0A 4JCCA 5EESA 2BGKA 2IXFA 2P62A 3E7FA 4PPNA 1ZJJA 3P9IA 3L01A 2ZYAA 1QCZA 4KVAA 1XZ8A 4CGYA 5ALWA 4OMFG 1EIWA 1TVMA 2NNWB 3RWBA 3ZIAD 2FWIA 1TM1E 1CY6A 4C4OA 5EMHA 4LE0A 3SHVA 5H70A 5AHOA 3BCSA 4F21A 1JSLA 5ITWA 1M34E 4EI8A 2GN0A 1FVHA 2I7XA 2WWFA 1SD1A 3HBMA 3QMWA 4B45A 5BY2A 5C80A 5K8VA 1W2GA 3RG8A 3PWSA 3JWEA 3FWHA 4PBSA 4ZV4A 1OXUA 5JISA 3TFWA 1FTNA 4ONEA 4A0SA 2JAUA 5A7GA 4RK5A 4D5GA 3BG5A 3QNUA 4J0FA 2BPOA 3OFVA 1ML4A 3G59A 4UTZA 4M1EA 2Q1SA 3I5AA 4PZYA 1HTBA 1Z22A 2D8AA 5JVDF 5JYBA 1DXYA 4H6PA 1BJRE 2EEZA 1KMNA 4HX9A 3TLJA 4YUZA 5H68A 5LDGA 2UZIR 4RAQA 3NWJA 1GIAA 2HGZA 3P9RA 5BW6B 5JVDA 3LX4A 3ET5A 1L5QA 1RYZA 1EFAA 4FX2A 2C3OA 1WZCA 3F46A 1J2RA 3NBQA 3KTFA 3FPJA 1XRNA 3BD6A 1PLLA 3OLYA 4TMZA 1BFDA 2IU3A 1A50B 1K7EB 1RWKA 3ECCA 2ZYRA 4L22A 5J4HA 4KNYA 1SELA 3QVOA 3WWPA 1TT5A 4X94A 3IAM1 4BNMA 3BFXA 2AKYA 4M6WA 3ZHRA 2E49A 4WRRA 4N41A 3RJTA 2ZJ0A 1NQTA 4NX2A 1UMCA 2J3IA 3P2JA 4HB0A 4HYTA 4P6VF 5D86A 3DZHA 5TARA 2XE4A 1VE1A 4EQ6B 2PE5A 2FUG1 3GV0A 3ZI4A 5LQMA 2FWBA 4OHVA 4P5PA 2WU3A 4HZUA 3T34A 3ZNNA 1WCWA 2QR3A 5FJJA 4LSZA 1SXHA 1XQYA 3IJEB 4IZHA 4YROA 3O2NA 4UXIA 5CNJA 1OAOA 3F1LA 3NAMA 3VOAA 4K6FA 1QP8A 4EGFA 2YHIA 2XWSA 3HSKA 5FA8A 3UMCA 2DY0A 3EVNA 4ON9A 3KTDA 1BHSA 3D0OA 4RPKA 4FIDA 3BIJA 5BSRA 3WB0A 4YRIA 2R86A 3FLMA 4KQIA 2CCGA 4YRCA 1YS6A 3IL2A 3W1VA 1XF1A 2XOEA 4OYYA 4C0KA 2PWZA 4V0ME 1EHIA 1R66A 3GFSA 3LVBA 1ZQ9A 3T5BA 2VT2A 1GADO 3I72A 5DP2A 4C6SA 5AXCA 1M74A 4TTTS 2XCOA 1ZOLA 3L6RA 1GZHB 2GGSA 2D5LA 4W5WA 5EERA 4C2BA 3CVVA 2IC5A 4MYSA 3WYBA 3L7MA 4DF3A 4CFZA 1CEYA 4YQZA 4N7RA 1VJDA 2WHQA 1SCNE 4RIHA 1GNVA 1VDZA 4WXEA 4OJTA 4BRWA 4C29A 4M53A 1Z0IA 3BHMA 4REOA 3HBNA 1PJZA 2H4JA 4X93A 2CKMA 1UPTA 1R15A 1M2KA 3ABQB 3PFIA 3RFTA 1HNZB 2BSQA 3ZNQA 3KE8A 3A4MA 3NGMA 4B3JA 4R8LA 3IBGA 2WIJA 1X0VA 3I4CA 4DMCA 1D7OA 5IJAA 1JWAB 1M33A 3FNGA 5IDWA 3L82B 2X0NA 1KJWA 4ER7A 1ZK2A 4A36A 3R0QA 1FTSA 1MHPA 4MZDA 4X8OA 1SBNE 2NADA 5JANA 1B2RA 3MW8A 4UHBA 3K0SA 1ORHA 1T3ZA 5GTDA 4N40A 4HC4A 3S28A 2YFHA 3KJZA 2JGIA 2FLKA 2OMEA 1YDHA 4H16A 3H3FA 1GDHA 3SZLA 2G8LA 2XB9A 5HYVA 4F4DA 1Y4ZA 4XIGS 4WL0A 3VI3B 3MJDA 1OI7A 4G41A 1ZHHA 5C18A 1CQJB 1MC4A 1E9BA 2BOVA 3UGKA 2L2QA 4AJPA 2FEOA 1G38A 4C6RA 3DTVD 4WH0A 1GM5A 3M7IA 4FE4A 4IUBS 1P7PA 3ZE7A 1YB6A 3CH6A 5JQWA 4NY1A 1E6MA 1GTG1 3TOCA 4F6CA 4ZDJA 2B2CA 4NFYA 4UJ5A 5DDIP 5C32A 3M81A 3N8KA 2RDMA 5FRDA 3WHLA 2PWAA 3P97A 5AW4A 3GLIB 2HXSA 1U9CA 2G1JA 2JHGA 521PA 1Q77A 1O6ZA 3LBIA 1XKQA 4Y9DA 5BN4A 1Q44A 3QA9A 5C53B 5EPUA 2OAP1 2B94A 3LWZA 4JP1A 3QW2A 4TWAA 2HKIA 1NFQA 4ENRA 5KEIA 1U2EA 4PN3A 1RW4A 2XB6A 2BEUA 1Y7IA 1E7RA 1K06A 2NUPA 2XGJA 1Q21A 4XOUA 3K4HA 3UK2A 1JPJA 2VNIA 4B3BA 5AQEA 5ECWA 5JH7F 1E5VA 5H3HA 1NVBA 3GGGA 3LA8A 4NXNB 3W8DA 4NBNA 1ZVJA 3FTPA 1A2BA 2I4MA 3D3QA 4UDOA 1EA7A 3L0SA 2QZPA 2P2GA 3SAJA 4QOSA 4OKSA 4I5EA 1KS2A 1YVUA 2ZYVX 4QQFA 3W2GA 4CE6A 5M7EA 2V65A 1TM7E 3KLOA 4Y2QA 1NW8A 3F6RA 5HOQA 4WFQA 1VE3A 2H1FA 1K08A 2HN9A 1GRVA 4TXLA 2IH5A 2C5AA 3HNPA 4OFXA 4RESA 1WV1A 1KR5A 3I1JA 1D4ZA 3HB4X 4OHUA 1EBFA 2VI5A 4NCHA 4J07A 1I4LD 5J47A 2HWWA 4UQOA 4MR9A 1O03A 3UJNA 4ZQHA 3VNSA 4RDCA 4X97A 3BILA 4DNQA 4Q7MB 4CCAA 4P38A 3EGOA 1K97A 3VOTA 4W9MC 1QP7A 1J2EA 3IXQA 2J3MA 2WM9B 4K6HA 2XNSA 3EVFA 3UWSA 1DADA 4TV9B 2GCPA 3CG4A 3LXXA 5BWNA 2FH5B 1DRJA 1B15A 1FP4A 4WHMA 3T5MA 1LU9A 1QGUA 2VHTA 2WJJA 5FPSA 4ZVTA 1QWOA 1KI4A 4U7TB 3G13A 2O06A 2H52A 4PG8A 4OX9Y 1AOXA 2GYUA 1CY8A 2JIBA 2JFBA 3O8QB 3OZXA 4UFNA 1J20A 1GKLA 1YDGA 4ALMA 5FUWA 1MP0A 4QE3A 4CMGA 1NXVA 2A4KA 1U6JA 4QTTB 2BFOA 1BFUA 5MDHA 3RODA 1TAGA 1LF0A 2LKCA 3IOYA 4KP7A 3VC7A 3K7EA 5CBPB 4RVOA 1RQXA 1TTPB 2HF2A 2VAWA 4HB2A 2INGX 3GU3A 4GI7A 3KQMA 4QULA 4BFWA 4C6TA 1WZNA 4R8KA 1OX4B 3KWFA 1PU2A 3EGCA 3MB5A 4ZQBA 4JBXA 3E9ZA 2H54A 3DQQA 3X1YA 1T9KA 4MAAA 5CJPA 3T3NA 2H31A 3LOPA 4INOA 3MD0A 2NO6A 5FI1B 5HIJA 4DBLE 1KO1A 4K9NA 2HFKA 3B8EA 5EZQA 2CLLB 4PC3A 3O4IA 1DRWA 1KJIA 2WVGA 3A1SA 1EVYA 1QFMA 3PUWA 2QU7A 2WVJA 2MINA 3CIOA 5HJ7A 1MEJA 4FMBB 1D2CA 1DUIA 2JIDA 2QVGA 1NW3A 1O6FA 2VDVE 3H3XA 3JQGB 2M32A 4ISBA 4DMMA 5IWAB 2W11A 4U7DA 2C7BA 2DQZA 3BB4A 3JV7A 3C1TA 4JY7A 4MGHA 4YS6A 3VR5A 2GEFA 1CUGA 2YIVX 1IG3A 4TTJA 2H2HA 3OMXA 2X1MA 2X76A 3G7NA 4OLAA 1H2FA 3LKDA 4YAWA 4HVCA 5DBGA 2B69A 3EGXB 3FF4A 1MOQA 3UA4A 3JAMA 2IVZA 3N2EA 1CNFA 1WP4A 1SKMA 4CT0A 3AM4A 5ICMA 1L4NA 2XT9A 1SHZA 1HF3A 2VT3A 1RYMA 2VK1A 1JFFB 2IHZA 4DTIA 2A1UA 4KO1S 3NVMB 1U9IA 3PFFA 3D2CA 2Q46A 4IR7A 5AO9A 3DFMA 5L3QB 1UDRA 1Y48E 3C3DA 2RC5A 1Y8AA 2C82A 3CMCO 5BYJA 1USUA 4MVJD 3UUEA 4DRYA 4KCGA 1L5HB 4J0QA 4KBGA 3CW8X 4PC1A 1UWCA 5HJ5A 4LJLA 3H7IA 3GRUA 1XZCA 1PKEA 2DWUA 2P27A 2ZUTA 5JR3A 2FG6C 4KPYA 1HXHA 3E9EA 1EJ6A 3BF8A 3IALA 1ZIXA 3BJIC 5A3QA 1ZHOA 1K66A 1I9CA 2PBFA 5ES3A 3UAGA 4CR8A 4JP3A 2BR4A 5I8WA 2JLWA 3V8EA 3RC8A 1ICEA 1JJBA 1UZNA 2CF6A 3PIRA 2ZI7A 4BB9A 5AFSA 3TJZA 5HGXA 3GJ7A 1Q5PA 4II2A 4AY6A 2ZT7A 5DYNA 1I32A 2SKDA 2WF8A 5LMUB 4YJ2F 4CLOB 1XDDA 3AY0A 1ESZA 4ZT2A 5FTKA 4F2HA 1QK3A 1A8HA 5T3YA 3SVLA 4OFBA 5KSPA 2QB5A 1FDUA 1HDCA 2ZI5A 3NBFA 5ALMA 3IKMB 3GRPA 4UHDA 4HEA1 3ZWKA 4MV6A 4PRKA 4OMCA 3SMVA 1H5QA 5T57A 4GP6A 1FP6A 3OFSA 3UUGA 4O4LA 1FNSA 3Q5EA 1X80A 1SIUA 3E5MA 2I91A 1GZSA 2ZYIA 2TSYB 4PGHA 3F7NA 2O7VA 4LNUA 1R0WA 2XYVA 3W3AA 4LJ9A 1E59A 1GPWB 4LDJA 3PV0A 1N0VC 3RK4A 2ZBGA 1ULSA 4P3PA 1NQVA 2RHGB 5CFOA 2JLXA 1F51E 3FYDA 4Y0VA 3FJYA 4OFZA 3SE7A 5FA5A 1XDBA 4NEQA 2QVBA 2XMBA 4O1IA 4DMLA 3V8VA 4RZQA 3GFRA 4KHPB 3VPFA 1KPGA 3BMCB 4MPPA 5E6UB 1SOVA 5ALFA 2XLCA 2ID4A 4M38A 1WXIA 1JNYA 2X2FA 3TSOA 5B6JA 4J7CA 4PYMA 4Y6SA 5HFNA 4EJSB 5B7PA 2I78A 5JSZB 2UUAB 4LI0A 3I0NA 1T5DX 1DBWA 3O1LA 4G9EA 3GB9A 2P6UA 3ZZUA 2O0JA 1KEPA 4ZHQB 3UF0A 1J42A 3JAKB 3A6ZA 1D6NA 1Z28A 3B1ZA 4G3XA 4Q3AA 4RD2A 5ERYA 5EHXA 1FFBA 1CB7A 1QHHB 4XTRA 3L92A 3RHTA 2ZSKA 4M9UA 3ZWBA 3IUBA 2ZWPA 2XRMA 2DSTA 3D6AA 2WF5A 4EA9A 1VLMA 5DYIA 5U1PA 1G2OA 4OHKA 3M8KA 4TUYA 1NUPA 4GM4A 3UJCA 3TKAA 1PTJC 1C4KA 3RFVA 4AN1A 2ZG6A 1EFVA 2YUIA 3IUPA 4RF4A 4XXHA 1FRZA 3MJVA 5EL0A 3L8YA 1O95C 5IAAA 2PO7A 2GWHA 3GFBA 4PSKA 5HDQA 3FB4A 3CRZA 3PNBA 3ILYA 1A1VA 5A0TA 5B3JC 2O4CA 3IO3A 4IXMA 3ZHZA 4EPTA 4Q0MA 4NE9A 4TVKA 2WIDA 3LDAA 4F3YA 2E5LB 1Y0BA 3WYCA 2DSNA 4CG3A 4UMDA 3A3OA 4RV5A 1T2UA 3KP1A 1BCSB 3AP2A 4Y2GA 2UVDA 5UKDA 1EUCB 3LCCA 3AUKA 2R4UA 3GLVA 4JJFA 5G0VA 3N8NA 7ADHA 2BFEB 2HQSA 2QTWB 2HYDA 4FCWA 3EIFA 4GMKA 1GPH1 1MR3F 1QB8A 4F8JA 2XYQA 1N6PA 2LZ0A 3C3CA 3HSYA 3IIEA 3Q3JB 4MVJH 4XGRA 5E3HA 1QX4A 3ZCPA 4INJA 2NP7A 1VI2A 5G3ZA 3NYWA 4LXGA 4DT1B 3D4BA 1C30B 1E3LA 4D96A 2FZLA 1P1BA 4C4SA 3I9V1 4HN2A 2QM8A 1MJGM 3WTBA 3RUIA 5DNCA 1XLWA 3AQIA 1NNSA 3TZKA 4BNGA 1PTJA 1Q20A 4X71A 1T2CA 1WKVA 1YR2A 5JS8A 5J3JA 1V26A 3KD3A 2PN1A 3CEMA 1YE3A 5FTLA 5K0CA 2CVOA 1NJ2A 1Y9EA 3OZCA 3QUBA 4N8SA 1Z2AA 4YO8A 2A92A 3TM4A 4W4TA 4YC7A 3U0BA 4TUYB 2XZDA 3K8QA 1JU3A 2GNOA 1LI4A 2DTXA 3I0ZA 4UVGA 4L4UA 4N7MA 3L8FA 4JL6A 3VAZA 3VKVA 1QRAA 1OYVA 1W0JD 2AFRA 3EH1A 4IDQA 2IBSA 1JXQA 3MAAC 1RM4A 3BIOA 4L3VA 1X2BA 1AKMA 3TQRA 4CTMA 4F3TA 1L4FA 3GPBA 3EEQA 1ZINA 5J2UF 1QP0A 4W63A 5JSFA 4KI0A 4QIHA 2RGWA 3IULA 4IDFA 5EJFA 4D42A 1RJFA 3QF4A 2IEZA 1A9TA 2VCEA 1ENZA 2ZJ4A 4HNRA 1TU0A 3E05A 2RGUA 1PD1A 4FUQA 3SEQA 1QJCA 4BCCA 2NMVA 2RH5A 2HCJB 1D1PA 4F4JA 4AAYA 3S2GA 4ZCMA 1UH5A 1CJSA 2E48A 1H66A 3KJQA 4NZOA 2YJ3A 4AMBA 1XA0A 3L7DA 1VZ3A 2XCQA 3GA7A 1XLVA 2QBYA 4FB5A 1B1CA 5CDTA 5JXIA 1YFKA 2GM9A 4LXHA 2P1DA 2PH1A 1ESNA 3AL3A 4BASA 3R0JA 1V9SA 2EQAA 4OHMA 4CMEC 2BTEA 4H27A 1SVOA 2JRLA 4HJRA 2GCEA 4RGQA 3SSOA 1V6SA 2ODWA 1SUBA 3FBWA 4Q19A 3N2YA 5CXSA 3NNDA 3NTLA 4AN0A 1RHMA 2O8BB 4JBIA 3VSBA 3HCRA 2EKQA 1YC5A 5K8JB 3HJAA 1P62B 1SCUB 4EWLA 4C5BA 3LVQE 3EMVA 3MLBA 2V5VA 4DDVA 1Z4IA 4I4NA 4C5AA 2XWPA 4N3BA 1OXTA 2RJ3A 1EFUA 4IWYA 1NGSA 4XRRA 2Z98A 2Q45A 4YLYA 5DFAA 3WGQA 5K3AA 1ML3A 5IKMA 4N01A 1REQB 1M6VB 2BKUA 1N36B 4MUMA 4JVNA 3WYGA 5IVKA 4DIEA 1T6YA 1E2MA 3A4NA 1BCRA 1BKSB 3O8LA 4IJMA 1MJHA 4Y30A 2OL4A 3ZV3A 4MEBA 4DIBA 1ISHA 4H08A 3OF3A 4LC1A 3W3AH 2QT0A 3KOUA 1Q1NA 2ZJAA 2B0JA 4KJXA 1GA4A 3FYUB 4M0KA 1DKNA 1YTUA 2B2NA 2QNRA 1PIWA 4IVNA 4G4SP 2W4MA 2YJ6A 5ALKA 1HBJA 5CDSA 2C2GA 3E48A 3F5MA 1K89A 5FXMA 4DC1A 1MH9A 1IC6A 4EUNA 4ZT7A 3WK6A 2HPZA 4U63A 4B6RA 2ZVDA 3ZQKA 1S96A 3OESA 3AGPA 1GYRA 1OLXA 1VQ1A 2G4VA 3HY3A 4JFRA 4ME6A 1GXSA 3GH1A 3GWZA 1JN0A 1KQ3A 3QPBA 1P31A 1P6QA 1WXWA 2OHJA 4HUQA 1AGNA 3ADCA 4JC0A 3PUKA 3H8WA 1LW6E 1XTJA 2DUJA 2G72A 2OC4A 1BN6A 1I7NA 4NLLA 1ZGJA 2P11A 4XIYA 3X1WA 4F84A 4YCSA 3WGJA 2F4NA 1KH3A 3FG9A 1TK3A 3U7IA 1BFKA 2V5AA 2ZRJA 3CX4A 1SU7A 4PGAA 3UT0A 4BV3A 4G1UC 1E96A 2PNJA 3LZDA 2J3KA 4P7JA 5BSMA 5CFLA 4QYTA 2XNJA 2NTJA 2CMDA 4RORA 3UANA 1CVLA 4M55A 4F5DA 3D8HA 5J23A 1G21B 4WE3A 2M6LA 4Y2UA 5JAOA 3ICOA 5JZVA 2XKJE 1Y42X 1U3TA 2A7QA 2KW5A 2PSFA 3GPCA 4CM7A 3THXA 1N5KA 4RGYA 4ZC1A 1KAQA 1OWPA 1MW9X 1L7XA 5EVJA 1EGHA 4RTLA 3EX7C 1F7VA 3OQPA 4ENVA 3KKMA 3IUYA 2PLAA 1GAJA 4MI1A 2HC9A 3L7YA 1F3LA 2QQEA 3CRMA 2O0KA 3I5UA 4Y9RA 2XBLA 2RH9B 3MA0A 1RBMA 3Q85A 4Q4JB 2EERA 3BQMB 5AKHA 4V2IA 2NUTA 3O31A 1MRZA 3KTAB 2F9MA 4QQKA 4KIUA 1U3CA 4WEQA 1KE2A 5JBIA 3EN0A 2C3YA 2J3QA 2HMUA 1GAQA 3G0BA 4JP8A 4RS3A 3CEAA 4MCJA 3MBOA 1E2DA 2VHXA 3HA2A 3LQFA 1TKRA 4Q6WA 5ALHA 1LDNA 1NQAO 2FFAA 2O14A 4G86A 9ABPA 2O1SA 4P3NA 5DYGA 5CIWA 4DARA 4HP8A 4IS3A 3V1TC 3R9XB 5IC5A 1F9AA 1CR4A 1MF7A 3AWIA 4IBOA 5B4TA 4F4IA 1ID1A 1DTWB 2EYQA 4BNWA 3ICCA 2J6CA 3IP1A 2UUOA 3EULA 4ZVLA 4BMSA 4Z9BA 2HCBA 3IMCA 3WIOA 5BV2P 4Q93A 5G3YA 2FSVC 2FX3A 2GA8A 2HOQA 3ICVA 4MZXA 3ZGYA 1OV4A 2HZBA 4J1QA 4I2NA 1UPCA 2QVZX 5AESA 5BOSB 4EYSA 3EWIA 1HH4A 3VUFA 3UQYS 3LUGA 4GE3A 1KH1A 3M49A 1I24A 1OSNA 1SBYA 3K1JA 4KQMA 4EG7A 5IM4F 3OQMA 1KI6A 2PVSA 4XGKA 2VRNA 3SYLA 3WMFA 3ZKAA 3CUEF 1RC0A 4D3YA 2PZAA 3H0KA 3L77A 4L15A 4JV5B 4JN6B 1E1RA 3RE1A 1NFFA 2PRZA 3U13A 2FMFA 2QQFA 1VRVA 3KB1A 4NYJQ 3Q8WA 4U2FA 3UV6A 3JAKA 5BN5B 3MINB 1L0BA 4DBLC 2Q5EA 3NJ8A 2WIBA 4XGQA 1QGDA 2Q2VA 2PXHA 2F7SA 3P0IA 2I54A 4GPTA 5MN5A 2WHXA 4E5YA 1Y1SA 1R0SA 2NXEA 3F2IA 2Q1XA 4EHHA 1UFQA 2ZRFA 3L8HA 1JJAA 4MQFA 2WFZA 1IDOA 1GGMA 2AC7A 2IP2A 3RS7A 1JHZA 1ZAKA 2PX4A 3F7MA 2JLCA 3KYIB 3DZKA 5IBCA 5LXTA 3OY7A 3L7OA 1QMPA 2XGMA 1Z83A 2BCJQ 1XJCA 4DNXA 3TE7A 4A8HA 2XZPA 2OBNA 1HFEL 3LRPA 4LZZA 2ODPA 1UT8A 4KPFC 2R62A 3ILVA 4Y0AA 2J45A 4UEQA 4WK4B 4AQ7A 2O23A 1NXXA 1R6BX 2V98A 3FFTA 1PN3A 1RMQA 1AO3A 4MUKA 4NTZA 1Z26A 4OF4A 5JXHA 2NUPB 1NXOA 1KZYC 3DLHA 4AECA 4FINA 4QAJA 1UC9A 2ON6A 2VKQA 3VM6A 4TTPA 4R1TA 1NHGA 3R1IA 4L9SA 4AZSA 4PTYA 1XMQB 5CM8B 2W0MA 3WFIA 1SVWA 2ZIFA 4L2IA 4W8GA 1CVRA 1E3IA 1OBOA 5L3SA 5ILOA 3K5PA 4TMXA 5JAMA 5JZOA 4OLHA 2YMPA 5G0UA 1SIWA 1A5BB 2BJVA 5COQA 2ERCA 3TL3A 1W4LA 3IQFA 4PG7A 2YZKA 2Z8XA 1DE0A 5K2MA 1NXSA 4MUJA 4GM1A 2RBGA 3KT8A 1UMDB 2E1RA 1PVOA 3VKUA 4CKCA 2AW5A 2JNWA 4BBAA 4DBVO 1ISFA 1KEEB 1CIPA 3DDSA 1ORWA 3NJRA 1CRPA 2W2KB 4MVCA 1SU4A 4PZ9A 3QPWA 3BRWA 3H05A 3AHCA 1XA3A 4IDAA 2EVWX 2QR2A 3VSDA 2AX3A 3KPVA 3CZPA 1WETA 3NP9A 1N5LA 3HKBA 1VE7A 3W5SA 2O6LA 3VSCA 5SY6A 3TIFA 1FP2A 1NQUA 2H6EA 3L84A 4UOQA 4F2WA 3N8GA 2P9TA 1Q0HA 1TQ8A 5M2QA 1D6JA 3TVTA 3CRW1 2QY6A 4E5KA 4YR7A 3MELA 1GYPA 3SR3A 1EG7A 2Q5HA 2YRXA 4FDLA 3GAAA 1W75A 4LYGA 3H04A 4MK4A 3UXHA 4MV3A 5EI5A 2F6RA 1PFVA 3MWJA 3A9VA 4DE5A 3UHPA 4LJ6A 3PQEA 1RSZA 1KTIA 1AY0A 3I0MA 5HRAA 1NF3A 3A10A 2JAXA 4OXNA 2Q3CA 4QEKA 3B9PA 2O1EA 1RWBA 3B9BA 4I7EA 1BJTA 3DP9A 3FNHA 4HH0A 1XVIA 1ODKA 1TYAE 1YZGA 1JG4A 1IIBA 4E1VA 3I34X 1U0NA 3GPDG 4ZVQA 2P8JA 1OWLA 3D64A 1XWIA 2ZVPX 1PS0A 5ALYA 3MCTA 2REOA 3H84A 4JVLA 4DIMA 2ZIZA 3QY0A 4OQMA 2JLUA 5C1IA 1G55A 4B32A 2XTJA 1BZYA 3ANXA 1Q7RA 4MWEA 5FFMA 1Z37A 2C8KA 2AG1A 2GZ3A 2ZE6A 4JWKA 4RQUA 1S6YA 3O75A 5KTOA 2ORWA 3IP6A 2UUCB 2GM4A 1ISMA 2HMVA 4B34A 5KSZA 4AX8A 4A2QA 4PHFA 2PSEA 4WN3A 5ADUS 3TB4A 2IYZA 3HL0A 1SCJA 2NV2B 2OO3A 1QYWA 1SOWA 1G98A 1U65A 2G5TA 1RE1A 2ZAOA 3OJ0A 1E62A 2CN1A 2V7PA 3QF4B 1OYWA 3OUUA 2WMYA 4NPAA 1Q92A 2V58A 2I4IA 1GAWA 3R09A 4MAMA 4OYRA 2Z3ZA 3UN1A 3ZG6A 4AO7A 4RHTA 4ZXPA 4H1UA 4HGPA 3NIBA 3U49A 3LLSA 2XOKA 3NRJA 3D7NA 2JW5A 4KLAA 5SZIA 5C8YB 3CPJB 1EX9A 4YMVA 3SQLA 1ORTA 1W35A 2PG3A 4N48A 3UJBA 1PUIA 3KKQA 4WLVA 2FW0A 1GU7A 3FTFA 1G7TA 4OGLA 4U7JA 2CXRA 2GZ2A 3R6GA 1X74A 2N3ZA 3GLUA 4MR8B 1W30A 3OQOA 3EZFA 3BMNA 3AJ9A 4INZA 1RYNA 4JB8A 3ENWA 4KV7A 5FL7D 2NUAB 2W5UA 2YMMA 1FMFA 2ZQ5A 4KN5A 1DDGA 2VCHA 1TYEB 4US0R 3FZNA 2XCRB 1XZGA 3I04A 1ANKA 1BDBA 3WIEA 5KYTA 4G0NA 2OZVA 3EVEA 2QTZA 4QFDA 1A4RA 2PT6A 4RV9A 2MSEB 1PJTA 4TXNA 3BMNB 3A6LA 3GROA 4KPEC 2VNHA 1Z4OA 4F97A 3NHJA 5D5PA 3O94A 1D1QA 2WLTA 3WGOA 3VA7A 2A6PA 1P19A 2AA3A 2Q5CA 4WCDA 1PK9A 3FE2A 4R7ZA 3OAAD 3ZTTA 4BMOB 1EP9A 2VSXA 4XIJA 3I9V6 4OA8A 5CU7A 4WCFC 1TNDA 3R5TA 3DCNA 1ZW1A 2PYIA 3EF3A 2IDKA 5DV9A 1UXJA 5C4GB 3FSRA 1G6Q1 3TSCA 3KIPA 3UB3A 1G16A 1ATIA 1DKLA 3AJAA 1P33A 3UJDA 5K0BA 3KSMA 3M9LA 1E4VA 1TQ2A 2C5GA 3GZNB 3I4FA 2Y6UA 4XGIA 4WNAB 4ZCQA 1RR6A 1PEKE 4KNVA 2FPGA 2JZNA 3PENA 3QQ5A 2AQ8A 3KQPA 1CJVC 2YWRA 3WLFA 3MNFA 2E7ZA 1OROA 2C98A 2TS1A 1GTJ1 4FU0A 4JLKA 4M1WA 4YRMA 2PGAA 3RIXA 2VNKA 1P0IA 2B83A 1J0XO 3TOZA 4LCBA 1NJSA 2DLNA 3HYSA 3ORYA 2P9YA 3CE9A 2ZYWX 3RRNA 3BWXA 3QU9A 1SUAA 1LBHA 1YS7A 2ARKA 3NI2A 1UPXA 3UT5B 4EJ6A 1O95D 4QEDA 4RPLA 4M1QA 3RU3A 1HX7A 3WLTA 3GLGE 2P9CA 4AN4A 2REBA 1JYFA 1AKTA 1XYGA 4LVNA 2Z6QA 1BSVA 4ZCRA 2C4KA 1LSOA 1P7WA 1J06A 1T9DA 1ZIYA 4BFTA 4D8UA 5JDIA 2KLBA 4O33A 2QN7A 1UBFA 3M5DA 3H18A 3BGWA 3ZBTA 3EEYA 4PQFA 5CBPA 2EZ4A 5CCEA 1YVRA 1JLLA 1DAEA 2EV9A 3VISA 5TR9A 4A6PA 3AM5A 3ZWWA 3ABOB 4OHRA 1RZRD 1OZ0A 1DTEA 5A62A 4GL2A 1FDVA 4B71A 2J9FA 4BO3A 4GZMA 2V97A 1SCQA 1YDEA 3C8HA 3DW1X 3M70A 5F12A 5EMJA 4ZKEA 4BVHA 4ER5A 3FIUA 3ZCUA 1LS6A 1JKJA 2HXYA 3QU7A 4R2JA 3A2MA 4BYGA 3RHSA 4DUZB 4BO9A 1ZISA 4I46A 3BRWD 3CF2A 4EFLA 3PQCA 3NUQA 2O8CA 2QEQA 1QOPB <