3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pantothenate kinase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
1D6JA 3BERA 2QORA 5TB5A 3QIAA 3RYTC 4P32A 4LJ5A 3CRRA 2BEKA 1U8AA 2BBOA 1NF3A 2ZRBA 2OLJA 2GEDA 5BN3A 3T5DA 1TMKA 2IK8A 3GJ8A 3AVYA 1G6OA 5JI3E 4PAMA 2QRNA 1JB1A 5TARA 1FL9A 3WYAA 3MLEA 3FPAA 5H1YA 4B71A 5EE9A 2VP0A 1OXVA 2VH5R 5BQ5A 3RLFA 4RCZA 4MYUA 2HYDA 2J7PA 4AKGA 2QT0A 3TRFA 3VR4A 3OAAD 3C4JA 1XCPA 5CK4A 2WMNB 3D6TB 4HB4A 3LD9A 1N0UA 4MUAA 3SDZA 4B2PA 2HCBA 4IOMA 2KJQA 3Q7PA 3CRVA 1EG7A 3MMPA 1XXHA 3AF3A 1IN4A 1ZNWA 3EAQA 3EA0A 1XD9A 1KOFA 1R2QA 3K0CC 4LK2A 4W5WA 4NCIA 5EE0A 2PMDA 2IEYA 3R8CA 1HQYE 3SU8A 2QGZA 1OV4A 2C77A 2RGDA 1VHTA 2ZI6A 5FOWA 4EFLA 2F9LA 2WJGA 1DO0A 1R5NA 1VDZA 2CCGA 3K0EA 2C9CA 1OKKD 4WW0A 4ZCIA 1N6KA 1XTRA 2G1JA 2IYSA 5FTJA 3PEYA 1YE8A 4RZUA 4UNRA 1KI6A 1NBME 1EFRA 3VMFA 4BPBA 2YWHA 1F60A 2QZ4A 4JVMA 1N5JA 1G21E 1EFHA 4MUBA 2C99A 2QPAA 4Q9HA 2F43B 2FF7A 3K9NA 3QY0A 1EWQA 4Q4LA 4PPFA 5JCZA 1QHHB 1E2IA 4P4SB 1U90A 3Q8XB 3B8HA 1N3BA 2RHDA 2ZTSA 2VLIA 4ZI2A 1KDTA 4LYFA 2QA5A 5KPJA 3AKYA 2XSZA 3RNLA 2VQSA 2OUKA 2ZE5A 5AUOB 4QKQA 1SXJC 1QHYA 4FINA 4NKRA 1KTVA 2ZS8A 1LB1B 1QDEA 1VKJA 1ZM4A 4IDPA 1GG2A 2ZU0C 4NU0A 3DMDA 4O0MA 3RAPR 3ADKA 3UPUA 1IN5A 5H70A 3SR0A 1H65A 3K09A 4KFUA 2WIBA 1RFLA 3ZJYA 4DLYA 1DO2A 2BM0A 3MWYW 3KUCA 1JAHA 2IYUA 2D2EA 3UG7A 4OHXA 1OIWA 5KHOC 1Z0FA 1WQ1R 1Z6YA 1CR2A 2ZR0A 3NH6A 1G7RA 4LBWA 4NONA 4TT3A 4EKDA 4NBSA 3DOFA 4NE2A 2FSHA 1PLKA 4Q19A 1J2JA 4RFSB 3GLIE 4D26A 5SZHB 1RPZA 1GSIA 1WMSA 4B48A 3QKSB 4RZXA 1SVWA 3RANA 3IHWA 4JZKA 5GJBA 2P67A 4JL5A 1LY1A 2ZYUX 1ZD1A 4PPGA 2IWHA 2NO1A 2X2EA 3DO6A 2OT3B 4PQFA 1ZIPA 3I8XA 1YRAA 1QHNA 3BRWD 4XSGA 4HB0A 4JLVA 3I1FA 1TTTA 2Q3FA 1OHHA 4LC0A 1SXJE 1E2FA 1ZM7A 4M9QA 4IDOA 2WJYA 2QU8A 1BKDR 1SHKA 2KSQA 2XNSA 3LW7A 4FCWA 3T61A 1DADA 3AUYA 4L5BA 3F3YA 2RGAA 2C9YA 2PX0A 2R2AA 3CO5A 1S96A 2YYZA 3W5IA 2WSSA 3SN6A 4PZZA 5CB6A 2CK3A 3QF7A 4M1MA 3TNFA 3QJYA 4PFSA 1UKVY 3DZDA 3TE6A 5B58C 1BOFA 3K0FB 1PUIA 3B1VA 3GCGA 1FFHA 4DCTA 3BAFA 5FOXA 1AKYA 5CIWA 5G40A 1YQTA 1I2MA 4LHXA 5IF9A 1RE0A 4OQLA 2Q0HA 1WB9A 5L3SA 4BZQA 2REOA 3FFBA 4TMTA 3HPRA 5FPKA 5JLJA 4BQSA 4GSYA 1JQJC 4BZXA 3C41J 1N6LA 2Z6VA 2PH1A 3MJRA 1M7HA 2ZS9A 1Z2CA 2O8EB 4P4UA 3TW4A 2OLKA 1ZP6A 1PLJA 2QP9X 2RCNA 1FX0A 2YWEA 1AZTA 5TXGA 3R7WA 4Q7KA 5CK5A 1W5SA 2ZRDA 4G1UC 3NXSA 2ZYVX 4NYJR 4TYYA 1JEEA 1G291 2ODNA 4DDUA 5TDHA 2RGGA 2FNAA 4PTLA 4DXAA 4JSTA 2GILA 5AR1A 2ZI4A 5EJEA 1YR7A 1XBTA 4OL0A 2WVJA 5SZJA 2I4IA 4ZDKA 3ZS8A 1I4TD 5B57C 3TSWA 1LW7A 1OXTA 1VIAA 2VEDA 1R6BX 4D25A 3B13B 4DDVA 4QGGA 3LBHA 2H17A 4FXPA 1XX6A 1GL9B 4M21A 4C0KA 1W48A 1XJ0A 4WXPA 2FMXA 3C7KA 3NVAA 1XRJA 2C04A 4O3MA 1U0HC 3AP2A 4IDNA 4C3ZA 1ZUIA 1DAMA 3RWMB 1QG2A 1C9KA 2O0HA 1E9EA 5FR2A 4OK6A 3W8RA 2XITA 2G0TA 4US0R 4LBVA 3WRYC 1E2HA 1VCMA 1M34E 4JT4A 1BH2A 221PA 1E79D 3BS4A 5L3QB 3S1AB 5HTKA 3TQFA 5C4GB 3SQXA 3EG5A 1ZCBA 1IN6A 3O8BA 2ZRFA 1VTKA 4IHQA 4PZYA 5EUQB 3HPQA 1WBBA 4UQOA 4XD7A 1Z6XA 2DB3A 4G01B 4TLDA 1JJVA 2VPPA 3CX7A 3PUYA 4EQ6B 1UBCA 4MH0R 1JQLB 1YZKA 1T5IA 1FMLA 4ILEA 4EIWA 3DDCA 2DCUA 5EUMA 5KSPA 1DVRA 2KWIA 2WWYA 3PUXA 3FKSA 1R7RA 2WWIA 3HDTA 4FCTA 3NG1A 4E22A 1Q22A 1FW6A 3DM9B 1KSFX 3VNVA 2WWFA 2G9NA 3C14C 2W58A 2HDNB 1P73A 2CLSA 4YC7A 1ZAKA 4C30A 1E6CA 3VKWA 4RD4A 4HUQB 2H1LA 5JJKA 1Y3AA 1HT1E 5JSZA 4UXJA 1H8ED 3EWSA 3OZXA 3HP1A 3M0EA 4JBXA 1UADA 2MSEB 2ODBA 2CVFA 5AJWA 5BWMA 3GJ4A 1G7CA 4OK3A 4CEJA 2XXAA 2SHKA 3MWJA 1XD2A 2JIZD 3MJHA 3QF4B 4EPTA 2CE7A 4JIMA 1G9XA 2J59A 3EPHA 2N1BA 3PEUA 2ATXA 4WZAE 4M8NE 5FOSA 3SFVA 3QENA 3X1XA 2GEVA 1W46A 3CF6R 2W6JA 4DDWA 5F9FA 4M1TA 1COWD 2E1RA 4HAVA 2B7BA 3OEHA 1MO3A 1K8RA 2WHXA 2CL7X 4M4SA 5GVSA 1ZC4A 4QHSA 3K9LA 1IY0A 2FSFA 4WA7A 4LJ8A 2WPDA 2IYWA 4NL4H 4DSOA 1T6NA 3WMEA 3Q9LA 3GLGB 1OFTA 1EGAA 4TMVA 3U3KA 1RC8A 1HV8A 2XZOA 4BRWA 4Z51A 1EWRA 4E03A 4PAQA 5D3QA 4A8JA 4URVR 4Q1DA 5D3MA 2BCGY 3DHWC 3QPWA 4XSHA 2O0KA 3OEED 4D80A 5AJXA 5JHHB 2VIIA 4NCJA 4NH0A 3K9HA 3QPUA 4MGZR 3B5JA 1GKYA 4BLRA 5JWHA 3SYNA 3VR3A 1P9RA 2QY9A 3DPUA 4RD1A 4I1SA 4C0LA 5J4LA 2XB4A 4NYMR 2QI9C 3BORA 4GFDA 4JS0A 2IEZA 2DY1A 4TSFD 1W0JD 4UNQA 3U3MA 1Q20A 2FPKA 2L0XA 3Q72A 3LY5A 4D81A 3U6BA 2JLXA 2WAYA 4HLUA 1E4VA 2FFAA 3LDAA 5FBLB 1XMSA 5FOTA 3REGA 4B6FA 3IEVA 3V9PA 1AS3A 2J45A 1G20E 4GP7A 4WBSA 1FZQA 1KI2A 4QM7A 2A5YB 2FH5B 3VNUA 3ZZUA 4WZBE 1WDTA 5F9HA 3CRMA 1RIFA 5FOUA 4KJZA 4ARZB 4AKHA 2XJ9A 3I32A 1NLFA 1M2OB 1Z8FA 3PJRA 3LBIA 2WSMA 3IIJA 4BFWA 1UBFA 2FG5A 2OHFA 3V4RA 4QG7A 2P6NA 4LJYA 4PO1A 3OIWA 1S0UA 4TL9A 3TSZA 5FTLA 1IXSB 3U7GA 4I4LA 2JLRA 4F4IA 3M6AA 2JJ8A 1QHSA 1W47A 2IC5A 2ZRHA 3I72A 4V0MA 3BC1A 1MRSA 2YZ2A 2WJVA 4Q4JA 5GJCA 3A1VA 3GJ6A 5C46F 1NIJA 4F91B 5TVKA 3GMTA 1OB5A 1HE8B 2WAXA 2PEZA 4TLAA 5DNYB 2ZI7A 3ZVRA 3AVUA 1GOTA 4C2TA 1JR3E 3THYA 3EPKA 2XOKA 1VCOA 3ND9A 1GITA 2O8CA 3BGWA 4AI6A 1KYIA 4TTPA 3J81k 4HLQB 2YOFA 4B2IA 3AKDA 1EESA 5AK0A 3U6KA 5JFGA 1E0KA 4DLWA 2ZAMA 1KO4A 3ASYA 3LA6A 1CULC 3A4MA 1TQ2A 1QZXA 4BWYA 4HDOB 2LWIA 1T5LA 4TZ6A 1KO7A 5CJPA 2ZVQX 1T0HB 1XZQA 4W7SA 4TL8A 3TH5A 2NQ2C 3NBFA 4L16A 8OHMA 2C03A 3FMFA 1R0YA 5JI2E 3NBXX 1DPFA 2ZUCA 3GP8A 1UKYA 3V00A 3ZGXA 1P2VA 2FGJA 2FE4A 2ZI9A 3THXA 3FB4A 2A9KA 1U9IC 4BFVA 4Q4HA 1J8MF 3W6OA 2FEOA 1O87A 5JS7A 3IPXA 1ZC3A 4B44A 3CUEF 2DFTA 3DMNA 2JAQA 4LPSA 4LV6A 2A5DA 3KX2A 1KJYA 3IEUA 3PIRA 3QBVA 3DEFA 5DN6A 5HKKD 5FBVB 3I5XA 2YNMA 2W2TA 3G5UA 2TMKA 4EJSB 2QT1A 5K8UA 3TR5A 1QBKC 1X6VA 2F3RA 3TSOA 3GJ7A 1IBRA 3L82B 4PC1A 1U98A 1YZTA 4Q4AA 4WOPA 1YHNA 2BBWA 2ZJ5A 4X8LA 4XVUA 3PEWA 3AP3A 2GJAA 3L0OA 1KGDA 2EQBA 3NHBA 2V54A 1Z29A 2WOOA 4ACAA 1CJUC 3BK7A 2ANBA 3B1WA 2F1HA 5DI3A 4B3FX 3OIUA 2JA1A 1X8JA 5EQTA 1ESMA 3QEJA 1OYWA 3NDPA 1HEIA 2NZ8A 3T1TA 3GFPA 4IW3B 4RD2A 4MKFA 1DELA 4C7OB 2R6DA 4A0HA 2AXNA 3BXZA 3I92A 2GCOA 3BFVA 2HCJB 2QE7A 4TQ9A 3DKVA 5CLQA 2ZJYA 4TQAA 1G18A 3WYGA 2MSDB 4JLMA 2AFIE 2CL0X 2IW3A 4IRUB 3U60B 2ATVA 4DSTA 3EX7C 3IGFA 2V6IA 3KQKA 2H57A 3OE7D 3UIEA 1I4LD 2AKYA 1BYIA 2P6UA 3T34A 1NVXQ 2DFLA 4QNMA 1G6HA 4ZIRB 4TMKA 4KO8A 2ANCA 2OCPA 1G4AE 3GLGE 1E1RD 4NCHA 2CJWB 4UJ3A 4V02A 3AVVA 2ZR9A 3NC0C 1VCNA 4AY2A 2V7QA 4B6EA 4DT1B 2CXXA 1F2UA 3AH8A 1N6PA 3LXXA 2J0VA 1W5TA 4B43A 3VHLB 3L0IB 2EFHB 1NBMA 5KDDA 2E9SA 4HB3A 4Q21A 2JLVA 1YU9A 3HU1A 2A5GA 2O8DA 3MUFA 4DHEA 4HEJA 1Z07A 1ZYUA 3PITA 5HR5A 4R71A 2PZGA 1W0KD 5L8VA 4OBEA 2ZR7A 1N6IA 1E2KA 1AM4D 3H86A 1JJ7A 2EFDB 3U4QB 4RSGA 2WWXA 3TBKA 2IYZA 4LZZA 3SBDA 1XJCA 1E0AA 4V0LA 2FGKA 2BCJQ 2ZRIA 4F7WA 4YLGA 3L8YA 3NIBA 1TNDA 4EDHA 2GKSA 1LVGA 2JJ2D 4URZR 3THWB 3BB4A 4M9XA 2G3YA 2GWHA 3WMFA 2CMKA 1SGWA 2NMVA 1MABB 2JDID 3K0CA 3LVRE 3CIOA 4TMZA 2X2FA 4PSAA 5GADl 1W1WA 4OYHA 3VU9A 1R10A 3KJEA 2G1KA 2Z0MA 1RYFA 1J70A 2WMOB 3AVXA 1ZU4A 4HATA 3WMGA 5JRZA 4NHOA 4KSBA 3PEVA 1P7CA 2DWPA 2OE2A 1F2TA 2W6ID 2IS2A 2VRWA 4TYQA 1OLOA 5EE1A 2FFBA 1E1QA 5M04A 1QHXA 4Q1EA 3VR2A 3WBKA 3GLIA 4FCVA 2BKUA 3R8FA 3N2EA 4QGHA 3TW8B 4GP6A 4KSCA 3T15A 1E2LA 2YINC 3D3QA 3RHFA 3AF2A 4NYJQ 4EJSC 4DIEA 3I5YA 2XZLA 1OIVA 2XEXA 2ZI5A 1ZD8A 2ZROA 4I1UA 1KAGA 3TR0A 1DOAA 1ZIOA 3PFIA 1TUIA 3QNUA 4I99A 1A2BA 1WCV1 4MKIA 1Q1EA 5FPYA 1CP2A 2EW1A 3MFYA 1W36D 1KI4A 5KDOA 4BFUA 2IL1A 2P3SA 3VR5A 1H8HA 5J5CA 1SXJA 2JATA 2V8OA 3W90A 1W36B 3T06B 2NGRA 4ZDIA 1E98A 2G83A 3MCAA 4V0OA 1JALA 3O8RA 2F9MA 1G8HA 2ZE6A 4A2QA 4EPYA 4RKEA 2OCAA 4YQFA 3WP1B 4A6PA 4KLZA 1II0A 2J7PD 4EPWA 5KSZA 2F7SA 1U99A 2BIFA 2QMOA 2QPOA 1UAAA 3H84A 1D8TA 1GNRA 1JPJA 2IA5A 3IUYA 5DYIA 2UVQA 1ZUNB 1II9A 2R6CA 3BH7A 4NCNA 3CPEA 5A5GA 2ZRLA 2HJGA 1NN0A 1A82A 1D9ZA 1GZSA 2FOLA 2AR7A 4LJ4A 2O8FA 2YV5A 2QQ0A 3KKNA 3GLHB 1Y63A 3AF0A 3TKLA 2AD5A 4M2LA 2Q9AA 2ZUBA 2QEQA 3K1JA 2WTUA 4D82A 3LWNA 2QMUA 1KDPA 2EFEB 1CU1A 1EFRD 2ZRMA 4KVGA 1SZPA 2RB4A 2QN6A 1X1SA 4LBYA 1S3SA 4OI1A 5AJVB 3RSLA 4OI0A 5HZKA 4UXHA 4BE7B 4GOKA 2QBYB 1XNJA 4A15A 1GDDA 4P4TA 3FYHA 3K70D 1Q21A 3MG9A 1M8PA 3CPHA 4C0BA 2FDCA 5EXPA 2BOVA 4TYNA 2FWRA 2RH5A 1VYVA 4N0DA 4D4MA 3GFTA 4KODA 3PQCA 3LFUA 1XZPA 4TTRA 3GLFB 3NWJA 3MRSA 4AIIA 5A0FA 2CHGA 4JLNA 1KY2A 1LTQA 3MSXA 3TQCA 2AK2A 2F3TA 2H92A 5LDDC 4XJXA 2FN4A 4EPXA 3I62A 3UMSA 2DWQA 2OM2A 3A1WA 4YXWA 1E2DA 3QXSA 1IM2A 2FPLA 2IXFA 2PJZA 4MRNA 1ZINA 1OE0A 1Z0KA 1NJGA 4MRPA 4UNNA 3U3RA 2GNOA 4ZKEA 4YONB 2ZE7A 1NLZA 1ZRHA 1W2HA 4LDJA 5DHAA 4HAYA 1K5GA 3NBYC 4PC6A 4RFVA 4TT3D 2KI5A 4KI0A 1JEDA 1QG4A 1XMVA 5DISB 4DLVA 2IWRA 2C96A 3QPVA 4OHYA 2ERXA 2ORWA 4MA4A 2R44A 1Z83A 2JGNA 4XWAA 1KK2A 2J0SA 1LF5A 2WBLC 2A3RA 2FSGA 4IDQA 4OHZA 3R9IA 2BDTA 4RD6A 5DSZA 3TJZA 5BN4A 5KUTA 2F43A 3SEAA 2Z5FA 1LS6A 3A4LA 1QHHA 3AGPA 4J0QA 1CRQA 1WP9A 4QJ5A 5GVRA 5DE3A 4KV9A 4P4SA 4UNSA 4D0GA 4C0AC 3LLMA 1N2CE 1OHHD 1KNXA 2QNRA 1FNNA 2R9VA 3PUZA 4OI2A 3L43A 1OYYA 4PPNA 4Q5IA 2N42A 4D0NA 5CITA 4PANA 3T1QA 4DIDA 2NG1A 1W36C 2GXUA 3CW2A 1RYHA 3TAUA 2ZSBA 2WSSD 4QC2A 1YR9A 3AP1A 4NYMQ 5SZKB 5EP4A 2CK3D 1TL7C 2NO9A 1XEFA 4Q1FA 3VHXA 4PO8A 2J1LA 4JKIA 4JJKA 4XH9B 4NDZA 3ICEA 1KI1A 3JVUA 5CM8B 2RHMA 1KSHA 4PR0A 4X8OA 4YMSA 1P62B 3QE0A 2GJ8A 4YDSA 1DARA 2AX4A 3ASZA 2BMFA 2J7KA 3EPLA 3BFXA 5FL7A 2R62A 1LS1A 4RJLA 2W00A 3BB3A 3KFVA 2CCJA 2ZJBA 3QKSA 5B2ZA 3EXAA 4K46A 4QGAA 1Z0DA 4TN1A 5G3ZA 1HH4A 5TY0A 1MOZA 1FP7A 2GAOA 2J87A 1NMYA 2REBA 1GRQA 1HTWA 1ODFA 4X8HA 1XTIA 2XNDA 3VX4A 1IOZA 4DDTA 2F1RA 3ECCA 1F5NA 1MO5A 4PHHA 4URUR 3ZS9A 1JR6A 2D2FA 2ZYTX 5C1BA 4L9SA 4KBGA 5DGXA 1YZQA 3QKUA 2QTFA 2GRJA 1AIPA 1KIMA 3AGQA 4NPHA 2G0NA 3L0PA 4CT5A 5JBQA 2D3WA 2EVWX 2OSBA 2IHYA 1SKQA 3GFOA 2ZRPA 3LXRA 1EXMA 4ZV4A 2WJIA 3Q7QA 1G16A 2VP5A 1FUKA 1GVNB 2PMKA 3GEEA 5BYKA 2BHRA 2GJSA 2HT6A 3A4NA 1OFHA 3LVQE 1KY3A 1QHGA 2F6RA 2BJVA 2R65A 3QKRA 3QXXA 2AWOA 1E9SA 1X3SA 4M1WA 5P21A 1DS6A 1XJQA 4LY6A 5LB2A 4DCNA 4LPKA 2MMCA 4JYBA 4XWKA 2WKRA 1AS0A 4PSVA 2AHOA 1VG9B 1TEXA 4XVQA 1Q44A 1P2SA 3RRNA 3GLHE 4O2LA 4TMXA 4F92B 4Q00A 4B3DA 2G6BA 4QBFA 1DAEA 1U94A 4LHWA 1TX4B 1D2MA 3F0TA 1UDXA 2RGBA 2O8EA 3ZIAA 3GQBA 2R6AA 2ZU6A 5EXTA 1NP6A 5KU1A 1IN7A 1ZMXA 1DG1G 4XD7D 4BECA 3UXMA 2YWFA 1TQ6A 2O52A 2V1XA 5FUYA 5FTMA 4PC7A 2HF9A 1YJ5A 2LKDA 4BFYA 3QXHA 3WHLA 1G3IA 3UMRA 1TAGA 4JLDA 1JXMA 1MKYA 3UWKA 3KJGA 4WVFA 2O8BB 3FTQA 4HYYA 1T4GA 3FKSD 3O47A 5JHGB 3RRYA 1BMFA 1RRGA 1UF9A 1XPUA 3T5GA 5E7JA 2OFOA 3SHFA 3RWOA 5AJZA 1NKSA 1N0WA 3FHCB 4G0NA 1AGRA 4RCYA 3SYLA 4OJQA 2HEIA 3GJ3A 1JR3A 2PT7A 2ZEJA 3KJHA 1DTSA 4QFMA 3FMIA 3JZAA 4DZZA 2BMDA 4FW9A 3GLFE 5JCPA 2W2XA 3BD9A 3KJIA 1F48A 1JXOA 5FPTA 4DLTA 3GEIA 4UKDA 4H1UA 4CEJB 2GF9A 2DHRA 4O25A 3GJ0A 2FSIA 4B74A 4Q9IA 3CR7A 1GP2A 3IPYA 3X1DA 2ZJAA 1N5IA 2Q9BA 2ZSDA 5L3QA 3ADBA 5EP1A 3AVTA 2WWWA 1E99A 2OBLA 1A1VA 3L0SA 2GXAA 2W6JD 4F4JA 4A4DA 2YWGA 4XOIA 1G17A 4OJKA 3OEHD 1OXXK 4A1FA 5EP3A 3CNOA 4IVRA 1E2NA 3E1SA 821PA 5L3VA 4CEHB 1P3JA 1G5PA 3LX5A 2WIAA 1HE1C 4BFSA 4PZLA 1HA3A 1MV5A 3EZ7A 3SI7A 1C1YA 2WPDD 3U44B 3U5ZB 4GRAA 3CWZA 2ODWA 1OJLA 5H8WA 2ZI3A 3IDQA 1XB2A 3FMPB 1U81A 2ZSAA 1IONA 1VECA 1P9WA 3IILA 4LC1A 1KI8A 4GI7A 1HQCA 1WXQA 3RABA 2BWJA 4AWXA 3A8TA 1GAJA 3ZVMA 2YJTD 2OZEA 4QJ4A 2YKGA 3A6PC 4NP6A 1OFUX 3ZVNA 2OBMA 1MRNA 4HSEA 4KFRA 1R4AA 3JZMA 4C2UA 2V1UA 2Q21A 2VTKA 4IOKA 2BEJA 5FFMA 1YZLA 2XTMA 3QQ5A 3IKJA 4M9ZA 3AVPA 1GUAA 5LPNA 4V0KA 2CHVA 2YC4C 2IT1A 4PHTA 2RGCA 1T8TA 3ZYCA 1G19A 1WE2A 2ZXUA 2XB2A 1X86B 3FE2A 3KKOA 4B34A 3IIMA 1GM5A 4JLKA 1CIPA 2WKQA 5FI1B 2IYVA 3M1IA 1CR0A 1LF0A 2OG2A 3FKQA 4ASUA 4A0GA 1G1MA 4BEBA 1HT2E 1GILA 1U9IA 1B23P 5ANRB 4GZLA 3VTKA 1KMHA 1VMAA 5UKDA 1M1YE 5CIQA 2F55A 3F5FA 1G3UA 1P2UA 4W5JA 2FFHA 2BKEA 2Q3MA 2VP9A 2DFNA 1WF3A 3GLGA 3ADDA 4HB2A 2RGEA 5E3HA 2J0UB 5AWFC 1GKUB 2CE2X 2CNWA 3E2IA 1GRNA 3RS0A 4DLXA 1GRRA 1UBGA 2QAGB 3IQWA 2H7VA 2F1IA 1US8B 4R7ZA 5CM9C 3B9PA 2VF7A 4ACBA 1NVVR 3QG1A 4JJZA 3P26A 3PUVA 2G77B 4Q4JB 4B47A 4TLCA 1EX7A 5H68A 5JECA 2A5FA 4DKXA 1KK3A 3QVUA 2BVNA 4JBWA 5J47A 2AN9A 1N6HA 2C2HA 3CNLA 2XOKD 3OFNA 5JWOA 5KYKA 3AEZA 3THYB 3Q85A 4NCKA 3LQQA 2ZS7A 4QOSA 4AYXA 3P4XA 4NYIR 3NEYA 1VG0B 1GKIA 2P0EA 2Q3HA 4ERNA 1P5ZB 5K8TA 1FTNA 1PLLA 4LJ6A 1IQPA 1SHZA 2IS6A 2B92A 4CW7A 3RVBA 3WYFA 3RRZA 1G5TA 3X1ZA 1W49A 1G3QA 4CEIB 3VKHA 1HURA 4PAOA 3HYRA 2FU5C 1RRCA 2X77A 1S2MA 3W3AA 2JJ1A 4Z1MA 4CDGA 1S1MA 4PSKA 1RJ9B 4ARZA 2MSCB 2YC2C 4IXNA 1M7BA 1Q0UA 4MDEA 2QSZA 4E09A 4I1VA 2CHQA 1E9AA 1S9HA 2DR3A 1A2KC 1RW4A 3EZ9A 3N2IA 2QTVB 4LJ9A 4FMBB 1VPLA 3NBZC 4W5HA 2ORVA 2NPIA 4DLZA 3NEJA 4BFXA 1CF4A 5DIFA 4QBHA 1LFDB 1FTSA 4HAWA 5DN6D 4JLJA 2GZAA 3BH6A 1E9DA 1UKEA 4ZI3A 1R8SA 5E7MA 1G8GA 3NTUA 5LD2B 4B3BA 1U8ZA 3PENA 1P6XA 4QHYA 5CLLA 2RGNC 3K0AB 1QRAA 4POAA 2XTZA 3MGCA 4Q4AB 3ETLA 2FV8A 3U3OA 4A36A 3KUDA 2EWWA 3B7GA 4ZPXA 4DUGA 3CBQA 2X1VA 2V55B 3B60A 3EA5A 4TYWA 1XF9A 4KHZA 4MQBA 3ICQB 5AUQA 4PQYA 3AB3A 3HWSA 5DI3B 4MDFA 4WAUA 4Q1BA 4QNRA 4AD8A 4TTQA 3SFZA 1NN5A 2H8KA 2AL7A 2F1JA 2XJ4A 1G5RA 1AK2A 2FFQA 1QHIA 2QM7A 3B1YA 3C15C 5BYJA 3A37A 5FI0B 2GCPA 5FPHA 4IEIA 3W5JA 721PA 1R5BA 2WJHA 2A30A 1CJKC 3U7EB 3SYKA 2O0JA 1NKTA 2QP3A 2B21A 1XD8A 3R20A 1OH6A 2XX3A 3WNDA 4P31A 1NVUQ 5B30A 3LH5A 4LJAA 3B85A 2NO6A 1SVSA 1YZNA 2CLDX 1P4SA 4KVAA 2GBLC 4Y0AA 3U7FB 1T9HA 3HR8A 2FEMA 3WNCA 1TADA 3IQXA 2WZQA 1XPRA 3GEHA 1PV4A 3HR7A 4BFTA 5EXXA 3C5HA 1EFTA 3BE4A 1DEKA 2HUPA 2V7QD 4ZDJA 1ZNYA 5DLQC 6Q21A 2WWGA 5IK2A 3RSOA 3RC3A 2GCNA 3SE0A 2QP4A 1ZNXA 2H16A 1XEXB 1EFCA 2QAGC 1NBMD 3C16C 3KTAB 121PA 4IVPA 4M9SA 2QM8A 1Q3HA 2R6GA 3CWQA 3EW9A 3B2EA 3KL4A 4MKHA 4LYAA 4GZMA 2OFXA 3JVVA 4GPTA 4K81B 2CBZA 4A92A 1VCIA 1NIPA 3DM5A 1E0JA 1P61B 2R6FA 2V6JA 2GTPA 3X1WA 1YR6A 4PX9A 2Y8EA 2D4HA 3VKGA 3LV8A 3H0KA 4K8OA 2QROA 3KDSE 3X2SA 2QL6A 2Z4SA 1NL3A 4C7OA 3TAHA 3CONA 1S3GA 2PEYA 3T12A 1TU3A 2WJJA 4JT2A 1OW3B 1Z63A 4BFZA 1O3YA 1T3LA 2RGXA 4B3XA 2P5TB 1GNQA 2OILA 3MD0A 3W3ZB 1AZSC 1KO5A 3IO3A 4UNPA 2QUZA 3AV0B 2PCLA 3I4LA 4QL3A 1DG3A 1S9DA 3AKCA 3BOSA 5J4YA 1S8FA 2GEUA 1E3MA 3VFDA 5FOVA 2OEPA 4B33A 3O8DA 3PG5A 4KLNA 4ZIRA 1CJVC 2HLDA 1KO1A 3CRQA 1L4YA 2CJWA 5EE3A 3WBJA 1E1RA 2XGJA 4IDHA 4QXAA 2P2LA 4Q02A 4BGDA 1F2TB 4OQNA 1E9RA 4DT1A 1YZUA 1CXZA 1E1QD 4G3XA 4RD3A 1J8YF 2ORIA 1KSJA 3DZ8A 4Q47A 2J0QA 3PVSA 4JVLA 1SULA 3HJNA 4JSYA 1KI9A 1DAIA 2YHSA 2VHQA 3TVTA 3EZ6A 1Z06A 2ZRNA 4LOAA 1ANKA 2KBEA 5GJWC 5LD2C 1II8A 4I81A 3RC8A 1L2TA 2IS1A 4DB2A 2FZLA 4DBLC 2BJWA 2W0MA 2Z4RA 5JZVA 2JLUA 4HZUB 4DSNA 1EFUA 1P2TA 2A2ZA 3R9XA 1W0KA 1CS4C 4ZO4A 4F4CA 4FMCB 3C8UA 1XU4A 1H8HD 3PCRB 1SXJD 3U4QA 4QBGB 4M1OA 3NC1C 1DAFA 2QAJA 2Q9CA 1ZNZA 5CDFE 3QKTA 4LX0A 1OH8A 4KYIB 4L4UA 3THWA 1UFQA 3KQLA 1E2JA 5EXSA 2LKCA 1AN0A 2HV8A 3EIHA 4Q48A 2IYYA 2OXRA 1MABA 1D9XA 4RZ3A 1XEWX 3CH4B 3LO5A 3CKLA 2OXCA 3UATA 1VG8A 4DSUA 3W8NA 2CL6X 2ZANA 1JBKA 1GIAA 2REXB 3OIYA 1KMQA 4G5OA 2BBTA 4PPQA 5EE5B 1G3RA 1NSTA 4ABYA 1OFIA 1FQKA 3BB1A 1RRFA 1RVDA 4X8MA 5C2JB 1IJEA 1FPMA 2ODEA 1ESNA 1Z28A 3NDBB 4ESHA 2AWNA 5JEDA 1Z0JA 3CNNA 4B35A 4XTRA 3H1TA 3SOPA 4A2PA 2ZRAA 3SJZA 1GFIA 3WP0A 2B7CA 3QG5A 1XXHB 4YMVA 1Z6TA 5FBRB 1OPXA 1NJFA 2OAP1 4DCUA 1P75A 3LBNA 1NI3A 1XPOA 2OFWA 4RVCA 1NNEA 1YKSA 4TYPA 1UJ2A 3TUZC 1W4RA 4OHVA 4BLQA 1A5TA 4YMUA 2GK7A 1E9BA 5HE9A 1G64A 4O2RA 2FX3A 2EYQA 1Q1QA 2GHIA 5AUPB 2GZHA 1TF7A 1KI6B 4LRWA 4Q7LA 1YVDA 2ZREA 1Q57A 4EFMA 1FQJA 4TLEA 1DAGA 2IUSA 3K8YA 4PHGA 1IAQA 4ZCMA 3A1SA 1GWNA 4BLSA 4AKEA 1AGPA 4MRVA 4TQUS 1KSGA 5HCNA 4HDQB 4YXWD 4GNKA 2CLCX 2EWVA 1XFAA 4FMDB 3RS7A 1X1RA 4Q01A 1KO8A 2B6HA 2XSZD 4C4PA 3K70B 4B75A 1CRPA 1BYUA 5HPYB 3NHAA 2ONJA 1XTJA 2HJVA 3GLHA 3MAAC 4GOJA 1SKYB 1UDWA 4OQFA 4E07A 4EUNA 3K0SA 3M4YA 2I3BA 5CB8A 4F38A 2QQEA 4LUCA 1V5WA 4CT4B 4U5XA 4JL8A 2VSFA 1CJMA 3OAAA 4GOXA 3SHWA 4MYCA 4AYWA 4FWIB 4HLCA 5FTNA 4JKYA 3AQ4A 4ZDWA 2DWOA 4HI0E 1NMXA 4BASA 5CYPA 5KDLA 2WV9A 5EP2A 4HDCA 2ZRCA 1RZ3A 1GL6A 3IO5A 4URXR 3BH0A 5KNDA 4M1KA 1SVOA 2VA8A 2YOHA 5KTYA 1Z0AA 3TK1A 2V3CC 4JMPA 2QBYA 4DWJA 2UKDA 5FUWA 4HAUA 4II7A 4MITA 2D7CA 3B78A 4LJ7A 1OKKA 5KOYA 1AA9A 2GA8A 2HXYA 2XTNA 3CX8A 4WZ6A 4JYCA 1FMJA 1KDRA 3PR1A 4WXRA 1VG1A 4C0SA 1HYQA 2MMGA 1E2PA 4AKIA 3FMOB 3ZVLA 2PBRA 3GLFA 1N6OA 4Q7MB 2BV3A 3T1VA 2WWHA 4LCBA 5J40A 3EASA 4P3YA 4QJ3A 1UM8A 1NN3A 1ZM2A 5AJYA 3DOEA 3KQNA 5JJLA 3KXKA 4LHVA 1J90A 1AKEA 3P1JA 3BIFA 3WXMA 3HYTA 3UANA 1ELOA 2A7QA 4JL6A 2IYRA 4G5GA 4GMXA 2ZJ2A 4S2EA 4M53A 1UEJA 3H4MA 1G4UR 4PHFA 4R9UC 5G3YA 4YDHB 4YMTA 4G5RA 5FL7D 2QPTA 1Z6GA 2NOAA 1ZD9A 4XWOA 1XTQA 4BUJA 2DBYA 2JLZA 4Z8XA 4FWTA 1OXUA 1SVKA 3GD7A 1R0XA 3ZQJA 1EK0A 5B64A 4LGMA 2KB0A 3QUSA 2ERYA 4DEXA 2IX3A 3MWLA 4U7DA 3AF1A 1IXRC 3ONWA 1KK1A 3LAWA 521PA 2XNDD 1TF2A 1XDBA 1Z22A 1CKEA 5L3SB 1QVRA 1P72A 2H5EA 1ONBA 4B2LA 4LYHA 4RFSA 3WRXC 4RY2A 1E2QA 4Q18A 4DJTA 2GJKA 4BLTA 1F3OA 3PXGA 1G7TA 1NVVQ 1V43A 2GJ9A 2W2VA 2UZIR 2PCJA 3D31A 4HLDA 4BEJA 2ZJZA 4ON9A 1FX0B 3ZD6A 1N5KA 3R7WB 5KNBA 5DO9A 3EC2A 1A4RA 1OH7A 1AS2A 2GXQA 1XMJA 2D7DA 4B3CA 2OO7A 4QBIA 3OESA 1BIFA 3LNCA 5DHFA 3T35A 2YOGA 4CRWB 4NYIQ 1CLUA 2ZQ5A 2C5LA 3IIKA 2NO0A 2WICA 5F2EA 2RAPA 4RD0A 2ZJOA 3QKRB 4FIDA 4YMWA 3W34A 1I2DA 1M6NA 4DEYA 3D8BA 2AD1A 3SNHA 2B8WA 3FFAA 3U3JA 4DC9A 2I1VB 1Z2AA 1ZW6A 1G8FA 5SZIA 2GF0A 1ETUA 5FPSA 4OI4A 1JAIA 3K70C 2IXEA 2QRZA 1G3MA 4AC9A 3RRMA 5DYGA 3RS3A 1UEIA 3CX6A 3ZDQA 4DCSA 4A82A 1NSFA 3K0FA 3ZIAD 4LHZA 4R98A 3E70C 2AKAB 2VHCA 2FA9A 1JI0A 2OCYC 3OF5A 1OB2A 4TL6A 1LV7A 3FWYA 5BW8A 1KKLA 1U2RA 1XXHE 2NZJA 3K09C 4LWZA 4DVGA 2PLFA 1NLYA 2JCSA 3UMFA 4CGZA 4Y0VA 1Q12A 2IYQA 3BWDD 1R0ZA 4OQXA 4JBYA 3SS8A 4A0RA 3P27A 1P9NA 4Q1CA 1BMFD 3TLXA 1NN1A 2ZIAA 1ZVQA 2ZSFA 4OKSA 4XVRA 5E4FA 3BBPA 1PUJA 4U00A 2ZPTX 5C18A 3CM0A 5CJ2A 1VYTA 3VR1A 621PA 1JR3D 2VHJA 4RZ2A 4P0TA 3CR8A 1GTVA 5K8LA 1IHUA 1DE0A 2IBMA 2V9PA 2Z83A 5FL3A 2J5XA 2HYIC 2ZITA 2JLWA 1W2GA 1Z6AA 1E9CA 1N6NA 1CR1A 1M7GA 1KJZA 4ZCLA 1FNMA 1S4QA 2DPXA 2ZETA 2J46A 4LSGA 5F98A 1SKYE 2D06A 5JSZB 2HF8A 4B32A 4P33A 5AUNB 1X8KA 3RS2A 3THOA 5HZHA 4CZ2A 1NVWQ 2OV2A 3QI2A 4XIGS 4DLRA 4GMDA 1MT0A 3N5CA 4TWZA 3DL0A 2XXAB 5DI9A 3SJCA 3UWOA 2IXGA 5EZ6B 3WNBA 4JLPA 1XD2B 5IDVA 3RS4A 5J4KA 5L3RA 2GVDC 1ZBDA 2GK6A 4L15A 2QTHA 3S1AA 1E79A 3T1OA 3ZZ0A 4DB4A 2ECKA 2BMJA 2O8BA 3EZ2A 5FUVA 4KBFA 4HUTA 4D0LB 3P20A 1Z3IX 3Q3JB 5K8IA 3RDPA 1E2MA 1SVLA 4H9GA 2IF0A 3CZPA 2IHBA 3PUWA 4GL2A 1R0WA 4GDFA 4D4KA 4B3GA 3TUJC 4US2R 1T0JB 3CRW1 4DCVA 3E5HA 4EQ6A 4Q66C 2WOJA 1T3HA 4LBZA 4M1YA 1BO6A 4EFNA 1G8YA 1D2NA 2PZFA 3FDIA 1PJRA 2EFGA 2ONKA 1XCGB 3EWAA 2VSXA 5KPDA 3B9QA 3RS5A 1N25A 2V4ZA 3X1YA 4HZIA 5FUXA 1W4CA 1BS1A 4CIDA 4FD2A 1XEWY 2BMEA 3KKPA 4A8JB 4M1SA 3FGNA 4A2WA 2LCFA 1XTKA 2AXPA 4LV5B 5D3MB 2JASA 4HUQA 3GPLA 3U7HB 5BXQC 3U61B 4F93B 4L9WA 4LV8B 3AUXA 5E7IA 3VQTA 4D4LA 5KSYA 3ZD7A 1H8EA 1R8QA 4ASUD 5JJIA 1Q3TA 4H1VA 5E95A 5FH9A 1J7KA 1YRBA 3QXCA 2WKPA 4DRZA 2IF2A 1B0UA 4CEHA 2FZ4A 2GDJA 2P65A 3QF4A 1KMHB 5G41A 3W6PA 4MRRA 3IHLA 3I61A 4AURA 2JIZA 1XTSA 4OHWA 2RKOA 1KI7A 1IJFA 3AM1A 3U44A 1SVIA 1KZ7B 3DKPA 4IFEA 2BBSA 2JLSA 1Q1ZA 5J4VA 3V4FA 3TGPA 2CNWD 2IS4A 4PXAA 4TLBA 1MH1A 2RGNA 3KKQA 1COWA 1WRBA 4LI0A 2PT5A 4PC2A 2EYUA 2PL3A 3SC3A 3EC1A 1E69A 1CJTC 2VYFA 3SBEA 4WIAA 4NZYA 3QVVA 1RRPA 4Q9KA 4DLUA 2EU8A 4BZPA 2C98A 3KB2A 3KQHA 4B76A 3EARA 1AQYA 1JPNA 3WY9A 3FVQA 1TEVA 3OFND 1NMZA 4A6XA 1FP6A 1D5CA 3P32A 1E96A 5FTKA 2OESA 2A5JA 3CB4A 4AK9A 2RMKA 2VL7A 4EAQA 4MRSA 4M0LA 4L8GA 3VX3A 4D2IA 2IYLD 1TPZA 4KFTA 1QF9A 2HT1A 2NO7A 4Z54A 4XTCS 1HUQA 3OEEA 1AQUA 1E2GA 2VP4A 3CPJB 4I1OA 4E5UA 4FMCF 3I73A 2VHUA 1TQ4A 2PX3A 2VBCA 3PV0A 1GL7A 1FUUA 3TUIC 4Z1MD 2C95A 2JJ1D 3UG6A 5JRJA 2G88A 4M22A 3ND8A 1Z5ZA 4C0JA 2O8CB 1ZU5A 4TSFA 2GBLA 1W0JA 3SQWA 3A36A 4JVSB 2YVUA 2ZRGA 2R8RA 4LYJA 2ZJ8A 2J41A 1VYUA 3QEOA 4R2IA 2CDNA 2WM9B 2GETA 2CEAA 1EX6A 1E9FA 1NY5A 5C4MA 4AYTA 2J0UA 3I3SR 2KBFA 3N70A 3WHKA 1WBDA 3TIFA 2GXSA 3REFA 3SZRA 1ZCAA 5JEEA 1DAHA 1TQDA 2C78A 2QAGA 1US8A 5BN5A 4MYHA 4R2HA 2PJRA 1L4UA 4C0QC 1Q1BA 3OHMA 5A4JA 3QBTA 2AFHE 1XP8A 3IBYA 3THXB 3LX8A 5HE8A 2JLQA 1G8PA 4TZ0A 3B82A 4Q4HB 3HU3A 1OF1A 3F8TA 3CZQA 3KZ1E 1OH5A 2AK3A 4D6PA 1XWIA 2VF8A 3I8SA 4KYUA 4DUGD 2W0SA 2BM1A 2GESA 3KQUA 1E2EA 1OT3A 2GVZC 1IY1A 1LNZA 2ZYWX 5IHPA 1U8YA 2XZPA 1IXZA 4URYR 3IBGA 2P5SA 4TL7A 4Q1AA 4MGYR 4C9BA 2O5VA 2FJUA 3ADCA 1K6MA 4IEEA 2IYTA 2X19A 3ZZTA 4ITRC 4KITB 1UBEA 2IUTA 3UKDA 5CDFA 3R9WA 3NH9A 4CEIA 4GT1A 1JECA 4A8JC 1RKBA 3B1XA 5ELXA 1C4OA 1VIYA 1KZGB 1RJ9A 2IYXA 1U0JA 1N6RA 4N0EA 3B6EA 3VAAA 2Z43A 4V03A 2ZM5A 2B8TA 2OBNA 5J4HA 4MGKR 5KNCA 4NTZA 1KI3A 4G5QA 4HAZA 3SJBA 3EPJA 5LB4A 4KAXA 4OK5A 4C0HA 2QE7D 2ZVPX 3LQRA 4HLUC 2GCOB 4FMDF 1CTQA 1CBUA 4Q03A 5TV2A 1ZM9A 1P60A 4MYTA 4JVNA 1E32A 1NRJB 4UJ5A 4MKGA 2ZRJA 3FHTA 2EFCB 3AVOA 5IK2D 1FOEB 4KCGA 1UKZA 4GBMA 3K53A 3K0AA 4PO9A 4LHYA 4U02A 3ZH9B 4QHTA 4ESVA 1DBSA 3DVLA 4CF7A 4FI3C 3TVDA 3LRPA 3AVWA 2OCBA 1VHLA 4OQMA 4CYMA 4W9MC 1R5OA 1TUEA 4JLOA 4BLPA 1CR4A 2NPFA 1E4YA 4B73A 4AG5A 1J99A 1G41A 5HKKA 4V0NA 4D4JA 4EJSA 1KDOA 1MO6A 3BJIC 3ZQ6A 1TF5A 1NG1A 2C9OA 2CVHA 5FBQB 4AG6A 2HXSA 3OIVA 5KSOA 1ZM3A 3GJ5A 1YR8A 1F2UB 1IY2A 5FR1A 4ZKDA 1JNYA 3Q5EA 1YZGA 2Q6TA 2OAQ1 2X8AA 4Q9LA 2BC9A 2PZEA 4US1R 3W9YA 5IRCD 3AKEA 3FOZA 3GJXC 4DLSA 1PVOA 1NY6A 2O8DB 1W4AA 4IOLA 1E0SA 1MR3F 1Z47A 3LW8A 1WA5A 1T8UA 1KJWA 3EIEA 3FHOA 3AF4A 5JMTA 2D74A 3UK6A 5CYOA 3KB1A 4Q7JB 3C5CA 1KAOA 4IJMA 1W7AA 4A0FA 3BFKA 2VHTA 2GZDA 421PA 3U2QA 4EPRA 1KKMA 3A1TA 1Z0IA 3P4YA 2HLDD 1XCMA 2QMEA 3B1ZA 2CCKA 3A58B 4Q9JA 1NG9A 5LBIA 3H2YA 1DAKA 3AVQA 3W6NA 2P6RA 3Q5DA 1IN8A 1OSNA 1KK0A 2DFKB 1I4DD 5DH9A 1KHTA 2PLRA 2XAUA 1MO4A 2JLYA 3OE7A 1XEXA 3LLUA 4QGFA 3KTAA 4KU4A 1W4BA 2VSOA 4UXIA 3VU9B 1TU4A 3HU2A 2KE5A 1K5DA 1PZNA 3G0HA 3VR6A 1II8B 4CVNA 2UZ3A 3L8ZA 1OIXA 1CEEA 2FPMA 1N0VC 2DYKA 3D7MA 5TMPA 4HAXA 2QG6A 3SJAA 4V0ME 1N5LA 2J3EA 3GLIB 5EZ5A 4MGIR 5HCIA 3TMKA 2ZE8A 4PQRA 2QENA 3O8CA 1Z08A 4URWR 4EPVA 3EIQA 2D62A 4N3NA 3ZLJA 4KFSA 5KO2A 2VO1A 2VP2A 4IKEA 2ASEA 4JLBA 4PC3A 4TMWA 2VP6A 4QM6A 4BRUA 2W83A 2ZRKA 2ZSEA 3CF2A 1SQ5A 1S1CA 1QVAA 4JLAA 3QOFA 2JEOA 1D2EA 4BLOA 5JWRA 2ZAOA 1OXSC 1X8LA 3QSYA 1KNQA 2IUUA 1G7SA 1AJEA 4IFBA 1SXJB 3KXIA 4FN5A 4IVQA 1HY3A 3G82C 1W44A 4NMMA 3A1UA 1U0LA 1T3SA 1T91A 3L2OB 2I1QA 3KFXA 3NKVA 2JJ2A 1M74A 1GNPA 2E87A 4IXMA 2GAAA 4G5SA 4Z8YA 3KXLA 2JDIA 2QGNA 5IT5A 1ZJ6A 5G53C 4N1AA 3K9GA 1L8QA 3QXJA 5JS8A 2C8VA 2QSYA 5FBWB 3MWKA 2ZUDA 4QRHA 4A9AA 3CH5A 3KKMA 5F3WB 1L7VC 2O8FB 4HZUA 1SVMA 1XMIA 4RKFA 2W6IA 2NTYC 1A7JA 3CLVA 2NIPA 1E94E 4KXFB 1F6BA 1ZUHA 2QMHA 2K5UA 4S35A 1UPTA 3EZFA 4IOJA 2J9RA 2A78A 3CF0A 2H18A 5GJVC 2N46A
chains in the Genus database with same CATH superfamily
5DWQA 1NRXA 2HSGA 2MYPA 3PWKA 1T6BY 1Q84A 3A9WA 4LJ5A 2X76A 4F8JA 2BBOA 1B3RA 3DBRA 4AMYA 5L3VA 1LI5A 1NF3A 1VE6A 2R1VB 4OMFG 4UVIA 1V41E 3T9BA 3W8FA 5BN3A 3G2IA 4HTFA 3UOGA 2DWCA 4X20A 4X7PA 2O1XA 2WUFA 4NH4A 2Q5JA 1G6OA 3GA7A 5B1SA 4DMMA 2AN1A 1QTQA 1WXGA 1CUGA 1FFWA 1KVTA 3OU2A 4ND7A 3U7QB 3CCCA 4FE4A 3V2UA 2YDXA 3HU5A 3WFIA 3QBDA 1K4KA 3QLUA 4HH3C 4B71A 3GZNB 4UEWA 2PQ6A 3DD5A 3S0JA 4RNDB 1N57A 3I58A 4MYUA 5I5EA 4BN0A 1NQXA 3LPMA 2BGWA 3EVFA 1PAUA 1QOZA 1CY7A 5EKDA 2LNDA 1SBYA 4OQDA 3OAAD 2N75A 5CK4A 4EYSA 3L7OA 1XZEA 2BI8A 4MV5A 1FMFA 4HB4A 4RV4A 2AUNA 3EPPA 3LD9A 4CF3A 3SDZA 4B2PA 4XWTA 3MNFA 2AEFA 1KERA 2YJ6A 5F21A 2TMYA 2OWDA 3CRVA 3HYCA 3O1IC 1L5GB 2HCRA 2HFKA 3V1NA 1GG8A 1IN4A 1CZKA 1T10A 1UK7A 4DWVA 4LK2A 1XD9A 3PPIA 2Q28A 3G2JA 4E5SA 5CEJA 2XRZA 2PKQP 1R8YA 4MW1A 3R8CA 3LWDA 5FAXA 3O4RA 9MHTA 5JYBA 1PQWA 1I4WA 1RJWA 2QGZA 1OV4A 4L4XA 4R1QA 1PV1A 1LPAB 4U0KA 5FOWA 2F9LA 2HRCA 1YS9A 3WWCA 3A6JA 5ES4B 1R5NA 1VDZA 3FGOA 4UHFA 2OGWA 4IH4A 3FMGA 4MQ4A 1XTRA 2G1JA 2IYSA 2OWEA 3GHHA 4GXNA 4RZUA 1LBQA 5FTJA 5JCOA 1KI6A 4D3DA 4AF7A 3L6RA 1JIVA 2XCUA 3MJEA 1J23A 4FE3A 2FFJA 3KZOA 4FCCA 4W99A 3VMFA 2XYPA 2YWHA 5K5EA 1G21E 1LVUA 4D9JA 5CJJA 4CMHA 4Q9HA 4P4NA 4CR6A 5J2TB 2Y0EA 3TBHA 2FF7A 3NXKA 3QY0A 4FS8A 4MB0A 4QDUA 1QHHB 2B6NA 2WF8A 1JH8A 1MDBA 2ZUTA 1RBQA 1AD2A 4P4SB 2IYOA 2ZWVA 4RQTA 1X1DA 2WNSA 2VOJA 3FTDA 2P79A 1RYBA 3Q8XB 1ZMTA 3VBCA 5C35A 2VLIA 3E9RA 1QRDA 2B98A 1KDTA 2FN8A 4GAEA 1XLTC 4LYFA 4RMNA 1UBTS 2XMSA 5KPJA 1CV2A 2D13A 5FNZA 1TJNA 5AW9A 4LGYA 4DY6A 2H85A 1FTYA 1X74A 1CDZA 2OUKA 3GJYA 4NKRA 5DGCA 1KTVA 2CC2A 2ZS8A 1FFBA 4BBZA 3EQZA 4IDPA 1GG2A 1CPYA 4NU0A 4XQEA 2XD4A 1DUVG 5JE8A 3ADKA 2A9VA 3DF7A 3M9WA 5H70A 2ZB3A 4KFUA 4BP3A 1OZGA 5FWDA 3VSEA 3ZJYA 4P2GA 5DLYA 3WLNA 2GSDA 1O96B 3NV9A 1GCOA 2BM0A 3G49A 1JAHA 5CXSA 1TZCA 4ZPJA 1NNSA 1SUDA 3AY3A 3KOZA 3UG7A 2PTGA 2X15A 1BNCA 1OIWA 1NVFA 1ZI8A 3VXKA 2DPMA 3BMQA 4BQFA 4RTKA 5GY7A 3IESA 2PFSA 4H7HA 4OJNA 2FPOA 3T3HA 3NNNA 5EXEA 3AZOA 2PKWA 4JOSA 1KQ3A 3KTOA 3WISA 2OVFA 3MC1A 4LBWA 3T4EA 4A7PA 4CTMA 5DW3A 5EXDA 4NE2A 5ESDA 1J2JA 4M9UA 5EVCA 4NE9A 3U49A 3N87A 4ZOEA 5KNBD 3IHWA 2P67A 3G79A 1LY1A 1PT5A 2ZYUX 4JL5A 1ZD1A 2FLWA 2HQRA 4PPGA 4ZU1X 2CVQA 3DW3X 3GT0A 1ORDA 3SQMA 4A8HA 4TWJA 1AQNA 1B8NA 3OPXA 3RADC 1GLNA 2Q7OE 3DPSA 4EO4A 1M2NA 1ZIPA 3P2JA 3I8XA 3HK2A 1YRAA 1QHNA 4BWVA 4I0WB 1Y6ZA 3KEFA 2IDJA 5G1PA 3KPVA 2AMLA 2BSXA 3L79A 1YS2X 2GOYA 2ZSJA 3O7MA 1VPTA 4IHJB 4LC0A 4S12A 3TQOA 3WK5A 1E2FA 4M9QA 4YDQA 1NSYA 4YHBA 4H77A 1BKDR 1SHKA 3LW7A 1XDSA 5TT0A 1DADA 2W48A 3D81A 4X6UA 2J09A 3CO5A 1Q7BA 4IMJB 4DY4A 5H83A 4PZZA 3BSSA 4ED9A 3WYDA 4RA6B 1AY0A 3QF7A 4U9HS 1IHOA 1KORA 2P27A 4QEDA 4PS0A 4QUBA 3AKZA 4JI8B 3QJYA 1G42A 1MC4A 3H2BA 4PFSA 1BCRA 4GRIA 2E85A 4ILKA 4LOIA 4BBPA 4KQFA 1L3CA 2RHCA 5IAJA 1FFHA 5LQJA 1SKAA 3BAFA 1H05A 4JJ8A 1ADJA 5KVAA 2P2DA 5CIWA 1FUYB 5G40A 3OA2A 1V6CA 3LGAA 5AHOA 3TPZA 4HNSA 3ICCA 3R0JA 3SKXA 3W8EA 1JDBB 4BZQA 3FFBA 1C9NA 1Q77A 2XYGA 5JLJA 4DPLA 3O3CA 2VRCA 2P9FA 3N53A 2PH1A 3PNYA 2P7HA 4FB5A 1EDZA 3ZWYA 4U9UA 2NPOA 4DV1B 2OLKA 4FK8A 1ZP6A 4M46A 5LZ2A 2QP9X 1TK3A 2IPXA 2RCNA 5B6JA 4WVLA 1W5SA 2ZRDA 3IQHX 1CC1S 2ZYVX 3OECA 1JEEA 2QRVA 3PQ7A 1KZ9A 1G291 1P0FA 3WGUA 2G5GX 3QUBA 2I6UA 4JAVC 5T4HA 5HF5A 3F98A 4CTNA 1JQEA 3M83A 3OC0A 3PGMA 1OC4A 4DXAA 2JIPA 3HR4A 5J2UA 1OWMA 3OLZA 5AR1A 2QTCA 4O6VA 1NWCA 5ALTA 4YIKA 1YR7A 3Q9NA 4W1SA 5B12A 3N3AC 3ZCQA 3I64A 2P8JA 1OXTA 2X5NA 2VEDA 3BL5A 4CR8A 4D25A 2C4TA 1EP2B 3GGSA 4Y2PA 1Y5NA 3O9VA 4JR1A 5EZYB 2BTQB 4ZOCA 2FOIA 1GL9B 4BKPA 2QD1A 1PZXA 3N7TA 5KCMA 1W48A 1AGNA 1XJ0A 1FEZA 2ZAIA 3E9EA 3FCSB 3LLCA 1QK4A 2FMXA 3ZGVA 1K06A 2GAFA 2EEPA 5FWAA 2FHSA 1C8BA 4HX5A 3RJTA 5DYYA 2GPNA 4LG1A 5CUQA 2XUJA 1N34B 1D04A 1MX1A 3KOWA 4UPDA 3ESYA 3VSBA 1O5IA 1OTXA 1Q1AA 1NBEA 2UUOA 1SBNE 4NNOA 4CBVA 5DLPA 2XITA 4JVOA 2G0TA 4PXYA 4KPGA 4LBVA 1E2HA 1VCMA 1M34E 2AJTA 1XTPA 4CFZA 2FQYA 3BS4A 1P74A 3GRZA 1YGYA 3SSAA 3V80A 2H63A 4CUJA 3LZ6A 2PR7A 1SD1A 2V3VA 3EF3A 1N2EA 3O91A 3ONFA 1ZCBA 4E7OA 3OY2A 3D7RA 2R6ZA 4D42A 3GBSA 1O95A 1VTKA 5JNWA 1C3OA 4G36A 1TIPA 4DUZB 3RTGA 1JJIA 1UMBA 3VYSB 3CZ9A 3LC7O 4G01B 1ZHOA 3FIUA 2HDHA 4MGEA 4RE5A 3PUYA 3MTIA 4RIEA 3GGCA 1JQLB 1YZKA 4GLFA 3JQ9A 1FMLA 2HU2A 3NIDB 4MUEA 3R3HA 1ZOPA 4YUZA 4ND1A 4EIWA 2JI8A 4JXJA 5JTUA 2ID8A 2PRKA 4R1MA 3BKWA 3PUXA 2HL6A 1F1JA 2HRZA 2WWIA 4YMIA 3EEIA 3NG1A 2SBTA 1FDIA 1Q22A 3AR8A 5AHRA 3DM9B 1FW6A 1KSFX 3EGDA 2G9NA 3VNVA 4MXDA 1RWBA 4V24A 1V11B 1T0IA 1ZAKA 1YTLA 1LV8A 1DNPA 3VKWA 4GMGA 1BHQ1 1BDMA 3AZQA 1HT1E 1FXSA 1SIBE 2QVCA 5BURA 1G8KA 3DQZA 2NACA 2XYHA 4TUYA 1ADBA 5KMGB 4JBXA 1CNEA 1UADA 2MSEB 2ODBA 2WQ7A 3GJ4A 1G7CA 2Q99A 3NBQA 1EFPB 1NR1A 4F7DA 2F1OA 3ENZA 3M4ZA 4RULA 1KE2A 1HFJA 2BHNA 1YRHA 1Z26A 3KVNA 3NHJA 4E3WA 1ZR2A 3CUSA 3G2LA 1JDUA 2JIZD 1SAYA 3ZHBA 1G9XA 2VZ9A 4NFSA 4BKUA 1SC1A 1HDRA 2QY6A 5MF6A 4M8NE 1NV8A 2XDQB 1GQ2A 4JIGA 2XQJA 3QENA 4R0MA 2GEVA 3N74A 2G17A 3AONB 4J7CA 3CF6R 4DDWA 1WEHA 4M1TA 2GCEA 2A35A 3C4VA 1SHUX 1LDYA 4WFIA 3OEHA 1QGUB 5CTAA 4CKZA 3CEHA 4PSUA 1YQUA 5H4HA 1YCHA 4HGRA 2FPIA 3CZAA 3MAJA 3VO8A 4E33A 4BXOA 3ZHQA 4NXMB 3OZWA 4IQ4A 3CVVA 1NJ6A 2ZWOA 4QDTA 4WA7A 3ZE2B 4ZTUB 1TJ5A 1X0XA 1A8HA 2WPDA 3OKAA 4BLUA 1N5MA 3INRA 1BROA 4FE7A 3WMEA 3ZD8A 4WMLA 1KBOA 3MZ0A 3M89A 5SICE 1JJFA 3VAZA 4ALKA 4NR0A 3I52A 5IJAA 2V7BA 2D5LA 3U17A 4TMVA 4NI5A 3GX1A 1ULAA 3U3KA 3QVGA 5J63A 4TS1A 1HV8A 3WTBA 4RTJA 4IDGA 4AWBA 2BFCA 4LYDA 4Z51A 1EWRA 2C1EA 4IPTA 4PAQA 4TS4A 5B5SA 3GAAA 1MFPA 2G5TA 2AOVA 1Q0RA 2FF5A 3D8NA 3DHWC 5EIBC 2D5BA 2O0KA 2PX5A 1U6JA 1LLDA 3OEED 5ED4A 2YN2A 4LE1A 2RKWA 2VIIA 3DEYX 4NCJA 4NH0A 4BLRA 1LQTA 5KNLA 5JRJA 2GYWA 1U1IA 1OAKA 1OBVA 1OR8A 3G2NA 4G0QA 4KLAA 3VGPA 3KJFA 3JV7A 4HD8A 1DDOA 1HWYA 4C0LA 3ZHXA 2QI9C 3ER6A 4JHXA 4M89A 2EFYA 1N8NA 4L4ZA 3E9DA 2IEZA 5EOVA 4TSFD 3UAOA 5LMUB 3V6MA 3U3MA 3M49A 3U56A 3IP6A 3DLAA 4NABA 3IKLA 1QIGA 5EJ2A 5E2IA 4O1IA 5FBLB 2DMRA 2BF4A 4OJTA 1S89A 2Y27A 3A9SA 1SM4A 3ORFA 5FLKA 4I9NA 4B4KA 1JKFA 1JKJB 4Y6QA 1TDJA 1AS3A 1OA1A 3OM9A 4RQUA 1G20E 1SG0A 4XM2A 2NYAA 1V9CA 2A86A 5K03A 2HIAA 1KOJA 2B0CA 2H4ZA 3I1JA 4R7TA 5IEJA 1QWOA 1CUIA 1U0GA 4JXZA 3QGMA 4Z7NB 1RIFA 1KU6A 3HKCA 4K9SA 4KJZA 1V8ZA 3O31A 3Q7RA 4YP0A 3VKFA 4HMQA 3PJRA 1SCJA 2I99A 4F2HA 5JDIA 3LA8A 3LBIA 4QPNA 1OWLA 5ICEA 2XCTB 1JR4A 3LKVA 1XCOA 1UBFA 2M1ZA 2Q45A 4EEZA 3BTVA 1NZJA 2GEKA 3AERA 4MPTA 1LJ8A 1W1UA 4R3WA 3MMZA 3RVMA 5ARCA 2P4EA 1KHHA 1ZHFA 2G4LA 5I6DA 3BWEA 1WW8A 3U7GA 1MQSA 2YJ5A 3HVUA 1SOAA 4V0MA 4UZSA 3A6FA 3FYTA 1AHNA 5EJ7A 1MRSA 3AX6A 1AO0A 5IASA 3L4JA 3BTUA 1FDOA 2IRWA 4MVXA 4Q4JA 5THKA 3V8BA 4IIUA 2FVYA 4I66A 2EF1A 3IHTA 5TVKA 1OB5A 1TO1E 2PEZA 3KVRA 5DNYB 1GUYA 3ZVRA 3DULA 5DLEA 3BF8A 4C2TA 1JPUA 2DSTA 4OGKA 5T41A 2XOKA 1VCOA 1NUUA 3ND9A 3G0DA 4EO9A 3WV4A 1SIOA 4I9UA 3T4UA 4IV5A 4XB2A 4QVKA 3LU1A 2QD5A 3BUSA 2VNIA 4MHTA 2YOFA 4Z0HO 2FN9A 4UUPA 1Q0SA 1Z0ZA 2G1PA 3LYUA 2OCDA 3R3UA 4MVJH 5CVTA 1J25A 4NU5A 5ENZA 1TQ2A 1CQPA 4AN4A 4OHFA 3QTBA 1P8JA 3M2TA 1TQHA 2G9UA 2LWIA 2NU7A 1F8FA 1V6SA 2ZVQX 3KV1A 5KINB 4W7SA 3M6XA 4KWHA 1KVUA 1RI4A 1H3NA 2NQ2C 3PX7A 2W6CX 3L1KA 5FP0A 4YWJA 5K05A 4WHMA 3H9UA 4L08A 4QTTB 3MEQA 3TCKA 1H2WA 1R0YA 2VTVA 1DPFA 3ZGLA 4Y2YA 5K6TA 3W5SA 3L02A 2O2EA 2JZOA 3DOHA 2BW0A 4QLAA 3THXA 2FE4A 3KYDA 4CLXA 3D6AA 3FB4A 1GPYA 3WGVA 4BFVA 1J8MF 1UODA 5HZGA 3TIXB 4AJ2A 1O87A 2R68A 2B9EA 2Z9BA 3SS7X 3IPXA 4MZDA 2XTJA 3I45A 5JASA 1BQ4A 2Q0QA 4LV6A 2AH5A 5JAOA 3DC7A 1L3IA 5DN6A 3RUDA 3FRJA 1QFJA 1N7HA 2YNMA 3I5XA 3DLHA 3T38A 1QGZA 1SFRA 3PT5A 2VDRB 3I0ZA 4X24A 2F3RA 1RLUA 1YB4A 4KO4S 1Z2EA 4RLQA 5MGBA 1FZTA 3KZVA 3VO2A 1ZN2A 5EIOA 1YRYE 1YZTA 2GSWA 4Q4AA 4M83A 1ODJA 3MINA 3EF1A 4IFIA 1F0NA 1JS1X 5IVPA 3PC6A 3IQDB 5CR9A 5L6MB 3I04M 4X97A 3OTQA 3OIGA 4YK7A 3DR5A 3I6QA 3D1VA 1QUEA 4FFWA 3V1UA 4ACAA 1VIDA 3BK7A 2WEKA 2ANBA 2J33A 5TQ0A 3SJ7A 4HNHA 2JA1A 4JITA 3UN1A 1X8JA 1XTUA 1ESMA 2JGEA 1JG6A 1TPYA 3OPMA 4HOYA 2CBGA 3DDSA 3TI7A 4IW3B 4U6NA 1JU4A 1AQLA 5F4BA 2AXNA 4A0HA 2AFRA 3I92A 3VDNB 3ILYA 3ZNQA 3BG5A 2QN8A 4RU1A 2HCJB 3K8OE 1A8UA 5LYJA 1GD1O 4Z6KA 1G18A 1XVUA 3S2ZA 3M1LA 1FTWA 1ZVJA 2MSDB 5LZ7A 3KIPA 5BSKA 2A3NA 3U60B 4DSTA 4D56A 5AK4A 2SKDA 3DEAA 1U0NA 1YR3A 3I9MA 4MR8A 1RXVA 3KQKA 2H57A 1MZVA 2OYSA 1I4LD 3O4HA 1X13A 2IEIA 2V7PA 4L7VA 3ZDDA 1NVXQ 1XTVA 1YJ8A 2P6OA 2XQVA 4QNMA 5I7RA 1G6HA 1H22A 2O6LA 4G5YA 2C5AA 3OMWA 2ANCA 2OCPA 3G0OA 1J0DA 4GD3Q 4J94A 4K9MA 4NCHA 1O6ZA 4V02A 5A7HA 2JFFA 3ECSA 3D4NA 4GI3A 2V9CA 2EZ4A 2WW8A 1VCNA 3F74A 3NC0C 3R6LA 2V7QA 4J3FA 3PNPA 3W4IA 5CA1A 4AY2A 2UXCB 5DASA 3J7AC 1RQLA 1NT4A 2I2FA 4DT1B 5KI6A 3AESB 2X14A 2Y2UA 4FDMA 3BXHA 4BO6A 3UXEA 3VHLB 4CIVA 2EFHB 5KDDA 3I42A 5CT9A 4HB3A 5I9TA 2JLVA 1YU9A 1G21A 1Z2PX 2VK1A 1XQWA 5FYDA 2O8DA 2FR8C 3P0IA 5H4GA 4UE2A 4YV0A 1XXLA 3PITA 4S1VA 3O75A 3A25A 5GOTA 1PR3A 3V4OA 1W0KD 2CVZA 3G6WA 2HK7A 3R9XB 5IX8A 1V8DA 3SSOA 1HE4A 5AKEA 1ETHA 1FA9A 1JJ7A 2EFDB 5HYVA 2C5GA 4PW0A 2IYZA 3GVPA 1TA9A 2ZZNA 3EW7A 1E0AA 2WK1A 1DJNA 4UBMA 5A3RA 2FGKA 4CV3A 2YV2A 3Q8LA 4F7WA 1E1KA 2DUNA 1O6BA 1MG0A 5FCDA 2YVKA 3X43A 3NIBA 3HYNA 4AM8A 1UBOS 4DYHA 4EDHA 4KH1A 4BV3A 3BB4A 4YFVA 4C0WA 5KVVA 2DWUA 2IEBA 4ZOLA 1LGYA 4OU4A 2P9YA 1VBMA 4MO2A 3FBTA 4QGSA 5ALMA 3KKEA 5JD5A 4RMIA 1ILWA 3A6HA 3S40A 2C97A 3H9QA 3MSCA 3OURA 4PSAA 4N0MA 1AG9A 4NG5A 1R10A 4BATA 3WS7A 1CNMA 1ZISA 2G5CA 3USCS 1D6MA 3ZHSA 5AJUA 4ZFNA 4CM9A 4JI4B 4HATA 1SQ0A 3UFBA 5JRZA 4CG2A 3EUFA 2PKQO 3PEVA 2O7QA 5DK4A 1ST3A 1N7JA 1C2TA 1F2TA 5FWYB 4J43A 3V2GA 4EHLA 2W6ID 1GDTA 4EY6A 4MKXA 1JHQA 2DE0X 3DCJA 1VLLA 3ETDA 1OLOA 2NUPA 2H4HA 4PSDA 3O4VA 4LXIA 1G8JA 5K09A 3NKLA 3D6UA 4QGHA 2HNKA 3L1JA 4II3A 3D6NB 2AHRA 1Q16A 1E2LA 2YINC 2XE7A 3QWFA 5F9HA 2XZLA 4N40A 4O4HA 3VPFA 4PYRA 1ZD8A 1N4AA 3A2LA 3OFVA 2BKVA 4I1UA 3RKSA 4EABA 2NZVG 3TR0A 4D46A 5KQRA 4EF4A 3VM6A 1TECE 2X6RA 4I99A 1XLTA 3QNUA 5DCYA 4EGQA 5FWXB 4LNAA 3LFHA 4MROA 3K6SA 3TIFA 1CP2A 1U7DA 3O6VA 1PX2A 5KDOA 4WKPA 2P3SA 4YN3A 3T3GA 3WDSA 4BO9A 2JATA 1RZVA 1RVV1 4PEVA 4LJRA 1E98A 3SEFA 3R77A 2WTAA 3ED1A 3L7MA 1JALA 3DTVA 1K4YA 1SUSA 3NETA 1VHJA 3A4VA 4I36A 3SQDA 4C0XA 4A2QA 4EPYA 4WK2B 3CUYA 3ZLVA 2P5UA 3RTCA 2LTAA 1I3NA 4Q15A 1II0A 1VL8A 2GHQA 3A11A 4P5PA 3HXOA 2F7SA 1U99A 1H2YA 3QVXA 1D8TA 5AVJA 1CZNA 4LRSB 5AI8A 3KYCB 1JPJA 1AH2A 3IUYA 2V96A 5DYIA 1NUQA 3VPGA 2NWQA 1W29A 5JIBA 1T0BA 4GKBA 4R5HA 4Z4FA 2ZRLA 1Y9JA 5KQPA 1UAYA 1ZI9A 2FOLA 1D9ZA 1JU3A 2VDWA 1A9ZA 3OOSA 5ALWA 3WKEA 4CF5A 3K0HA 5C5DA 1YACA 2DM6A 2QQ0A 5TGTA 1Y63A 3ZHYA 2AD5A 3BICA 2Z5VA 2QEQA 4RZQA 1XF1A 1L7NA 1RM3A 1PZEA 1DJOA 4N3BA 5D3KA 1SUEA 3FGPA 3RE1A 4HNTA 1EI9A 1K8XB 5DP1A 3R0VA 2ACKA 3SKYA 2A59A 1ORIA 2E4ZA 3DSRA 4FT2A 3SXUA 3G7NA 4DS3A 2ZRMA 3VKVA 1SZPA 2C2ZA 2RB4A 3KZKA 1QF7A 4I4TA 3KLMX 1X1SA 3M7IA 4I9GA 2OOSA 4P5EA 2ZK7A 5AJVB 4JUIA 2ACVA 5LWHA 3M6MD 4M76B 2NU6A 3RSLA 4UXHA 3LOUA 3UQZA 1HDCA 2I4RA 2HGSA 3IBCA 4XIFA 4HS4A 4IIJA 4FC6A 1B43A 1VE3A 3KEOA 3P7MA 4MAFA 3O3OB 4PCLA 1XRRA 2C8KA 1N1GA 3QZUA 4DMFA 1Q21A 3C98A 4Y8VA 2GLTA 1MX9A 4EYGA 2BOVA 4TYNA 1J9GA 2FWRA 3IXMA 2PSDA 1FNCA 3SD7A 5GMOA 1D8AA 5LN1A 4GWKA 3H97A 6NULA 1NQAO 3SBOA 1RTKA 1S2NA 4TKVA 1JNXX 5L51A 4TTRA 1L4HA 1RPAA 2JFYA 4G1FA 3RRXA 4AIIA 4XCXA 1NXQA 1KY2A 1MNQA 3QPAA 4ZVVA 2NLOA 3H3XA 4N03A 3PRHA 4XJXA 4J0KA 5LDDC 5JNTA 2DWQA 4IS3A 1E2DA 1USGA 1YDFA 3BTOA 1Q5PA 4B3RB 5G0WA 1PWXA 2GRAA 2M6RA 1YKFA 4HGPA 2B20A 2I65A 4LQLA 4FMPA 4UNNA 3KOXA 4WKNA 2ZE7A 2I5PO 1EUDA 3VC1A 3ZWOA 3MBIA 5DHAA 1Y48E 4WN9A 4G41A 1NGSA 3ZOZA 1UFKA 4HEQA 3GNTA 4ZCSA 4KI0A 1K97A 1ODSA 4AL4A 4V0QA 3BJMA 5LZ9A 1WDMA 1YSCA 1ZBQA 1XE3A 3J81A 4MA4A 2BMAA 2R44A 3BSYA 1UPXA 3TMYA 2FUKA 1F14A 1GZ6A 2JNWA 3Q9SA 5HM8A 5JMWA 2WBLC 2A3RA 1R8XA 4MMYB 4GBED 2HQBA 4PGMA 5BN4A 1V45E 3PI7A 2VK4A 4FPXA 2QB5A 4W4TA 5DM1A 3A4LA 2CDAA 1EVLA 3JYOA 4LOJA 3VPXA 5BY2A 2WUEA 2CDCA 1CZOA 2RAVA 3C87A 3H9BA 3PSAA 4MV7A 2O0MA 3V4PB 3HKDA 2PSJA 4OB6A 4FLMA 3WE7A 3QHAA 1R15A 4BU1A 4V3BA 3IQEA 2QL7A 2RCYA 4ND5A 1J8VA 1RQGA 1HQKA 2IZOA 2NVOA 1E7YA 1YI8A 2QNRA 3L43A 4OI2A 1U4OA 1DC8A 2B1QA 2C83A 4LXGA 1XWFA 3FIJA 4OL9A 4PANA 3T1QA 3CW2A 1G1AA 3WTCA 1VFNA 3TAUA 2PWAA 2CLFB 3PGVA 1YR9A 4FDVA 1R6XA 5SZKB 1WX1A 1GFSA 2W90A 3QE3A 1FDRA 5EP4A 4DNXA 3HBMA 3AW8A 3DCYA 4YA6A 1XEFA 1ID1A 5HCUA 1RYMA 4DM3A 1OX6A 2J1LA 5DGHA 4UMDA 3N05A 4RV5A 1J07A 1E6WA 4WLEA 3HBAA 2WKSA 3G7SA 5AI9A 1KI1A 3JVUA 3GZTB 1CIJA 4F3RA 4JEIA 1EGVB 2J32A 4YMSA 3RYFA 4R1LA 1VKZA 4YDSA 3ISVA 5JY6A 4A91A 2Z2YA 3O74A 2H00A 4KZKA 3R7SA 1WXWA 2BMFA 3LY8A 3EJ6A 5DXJA 3DGEC 3RM3A 1IDOA 5FL7A 3ULKA 1LS1A 1N0IA 1NRWA 4QYWA 4RUKA 5CH8A 2IW1A 2VRCD 5BSGA 2X0RA 1NJ1A 1BVUA 1JEQA 2PRJA 4I8XA 2NXWA 4RJLA 4A5SA 4B7ZA 4D98A 1M1YB 4YJDA 3LQ2A 3T54A 2SKCA 3NTVA 2R96A 3LY9A 4C87A 2DBRA 2DJIA 1WKVA 1T5TA 4QGAA 3RYIB 2B2XA 5G1OA 1EAMA 1JYFA 1HH4A 5TY0A 1RJDA 3IT1A 1OILA 4UAVA 1TXGA 2J87A 2QRLA 4CU5A 5K0CA 1OYVA 2REBA 1PWYE 2NO4A 3OU7A 3WO1A 4YYEA 1XTIA 4X94A 1L5OA 1MO5A 3EXFA 2VDLB 3ZS9A 5JARA 1JR6A 3K2BA 4RK1A 4BJ5A 1QV7A 5DGXA 1YZQA 1XOIA 2FPPB 3QKUA 2QTFA 5EIFA 5BNZA 1U7TA 1XYGA 2QTRA 1Z16A 4OUDA 1AIPA 1KIMA 3GIWA 3M6VA 4WI1A 3ETCA 3AGQA 1FCJA 1VZ3A 4C29A 2CXUA 3L0PA 4CT5A 4A10A 5JBQA 2YIJA 4B8ZA 1DIBA 2FWJA 1SKQA 4RJJA 4KQHA 2HQ1A 2P2YA 2ZRPA 3LXRA 5F52A 5TR9A 3ZWXA 2OFFA 4YRZA 3Q7QA 2JRCA 1FUKA 3L7LA 3GVHA 2DEUA 2VBFA 1K89A 2GJSA 1RLJA 3A4NA 3TRKA 4U7WA 1QHGA 1SCUA 3SHQA 2OV1A 3QXXA 1YJXA 1X3SA 2QM3A 4XW2A 3MIIA 5LB2A 2JGAA 3G5MA 2GYYA 4LPKA 1QIMA 2O48X 2Q3BA 4Y1GA 4Z86A 1AS0A 2YWXA 5ALRA 1X92A 1G20A 3TTVA 1VG9B 2XT0A 3VUFA 1J2EA 1DWPA 1GDHA 3CR3C 3GLHE 3GNSA 1NQUA 4ZCPA 3RRNA 4IUBS 4Q00A 1Q11A 1JH9A 4CHTA 3ISJA 4OXIA 5A1JA 3HNPA 1GZHB 3F0TA 1QXSA 2CT8A 4AWAA 1FDSA 1O95D 3KWFA 4WBNA 4RDCA 2VAMA 3NM5A 1W88B 1Q95A 2FSSA 5AKLA 2RFLA 3P9KA 5BW6B 1NXXA 5C3UA 1GGVA 3UXMA 7YASA 2O52A 1KPHA 4MYRA 4CLRB 5U9CA 4GVXA 5EIAA 4OV6B 1A8IA 3S1SA 1VGQA 1I33A 2DZDA 2LKDA 2WJ4A 3DBOB 4N5NA 3WHLA 2OAGA 2PUJA 5K0FA 2VXOA 2I4TA 2O8BB 3RVNA 1UMCB 2ISSD 2WD7B 3FTQA 4HAOA 4MS3A 1WWKA 5F1KA 1T9DA 3O47A 1KQFA 3RRYA 1XR3A 2Y76A 3LUFA 2EJUA 1HL3A 4H4EA 7REQA 1H1TA 1R6DA 5JV5A 4BNNA 3ZE1B 4RW0A 3MT7A 4GL4A 2D2VA 1R4NA 3L9XA 1IMOA 5AJZA 2CF6A 1N0WA 4ZAWA 1R0LA 4RCYA 2PUWA 4OJQA 3WIUA 3GJ3A 4PR3A 1EXVA 5JH7F 5GZ6A 2WM3A 3O1LA 3WLIA 1L9KA 2BMDA 3STXA 3DBLB 4AMUA 3ETEA 4YP6A 4D8XA 1XMQB 2VUTA 3SIWA 4AZSA 2YHIA 1B76A 1F48A 3ZJTA 5FPTA 4DLTA 3EY4A 3HJRA 2AZXA 1RWVA 1NHWA 4H1UA 2IEDA 5JAPA 4WLFA 3WFJA 2G09A 3GJ0A 2FSIA 2P68A 1BDBA 4Q9IA 3X1DA 1CSEE 1L4GA 2H2FA 5HNKA 4X41A 2Q9BA 4TRJA 5L3QA 5EP1A 3I53A 5KTNA 4EHIA 1CUDA 3RROA 2OBLA 5LOVA 2GTHA 4B5LA 1A95A 4MS4A 4F4JA 2C0CA 2R6JA 3P9SA 2IOFA 3M5PA 1G17A 1XZLA 4OJKA 1ZRNA 3OEHD 4R8VA 3U13A 3SVTA 3LOQA 3WGZA 2C88A 3LX5A 1Q74A 2WIAA 1K68A 3N6XA 1IEQA 4PZLA 5IABA 1KRWA 3W1VA 1C1YA 1SCBA 1H2BA 2WPDD 1W4LA 3JTMA 4IUDS 5CA0F 1QP4A 5A4DA 5IS2A 1Y80A 1GTJ1 2H06A 2RHOA 4JV5B 1TLFA 1OJLA 4AJPA 3RFCA 1XB2A 3O9ZA 3IILA 5C32A 1CERA 1P9WA 4ZXPA 3CYFA 2AC2A 1RHRA 1T1IA 4WEOA 1OZAA 3HTXA 1A50B 1B74A 2XUQA 3IUPA 3R0QA 3RABA 5CHEA 4EA7A 5CB0A 1AMNA 1CFJA 3JZIA 2QTZA 4H1TA 3ND7A 4UNIA 2JI4A 5EPOA 3M4JA 1GFWA 2BELA 2PS1A 2YJTD 2OZEA 2YRWA 4OLHA 4NP6A 1PR1A 1NULA 3ZH2A 1M0SA 1MRNA 3ZWBA 5CAEA 3K73O 1R4AA 1QH8A 3FD8A 4H27A 5HRUA 2NV6A 3UK0A 3VZRA 4Z9YA 1YZLA 2XTMA 1DIOB 3KVYA 1JYSA 3QQ5A 3TR6A 3WMWA 2XCQA 3VU3A 1DKRA 3MLAA 2XR1A 3MJSA 2EKPA 4PLGA 5G0TA 5CFLA 1BGVA 4RPGA 3GUUA 3EDQA 4M55A 1DKUA 1JAZA 1M1XB 1U2SA 4ZYVA 4YCLA 1ZUWA 1T2VA 4Z0TA 2ZXUA 1X86B 1MV8A 3F6CA 1KMCA 4CN9A 2B7LA 3HO1A 1F1BA 2H1HA 2IYVA 2Y3IA 2YZNA 5AXAA 3PQEA 3QU9A 2F67A 5DRYA 1RMYA 4DMHA 1GTSA 3NMUF 1MEJA 1IZ9A 3DOOA 1G1MA 4BEBA 1REQA 2V7UA 1HT2E 2DBQA 3E5MA 1UM9B 5DDIP 1B23P 2WD8A 5ANRB 5KC8A 2XQKA 4F56A 1Y5IA 5CIQA 2F55A 1SVNA 3BVPA 3AI1A 4RIIA 3PHGA 5LQKA 3QPBA 2E4XA 4L02A 2PXHA 3RHSA 3ZE0B 4W5JA 2ATIA 1UWVA 1JW9B 1XROA 4U4AA 4KGXA 4YRJA 3K9BA 2D5CA 1UP6A 2VP9A 2DFNA 5IC5A 3T5BA 4D3FA 5A6VA 1WF3A 4JODA 2WG2A 3ADDA 3F2IA 5HIMA 1CE8B 2Q4BA 3B53X 2P9CA 3I12A 2EP8A 3RS0A 4DLXA 4HX9A 1GRRA 5DEIA 2QAGB 3IQWA 4RKWA 4DSAA 5F78A 1N2SA 3B9PA 4XASA 1OLXB 4PYLA 2AW3A 3U1VA 3CGGA 3K9QO 1JA9A 1E7MA 1PE0A 3PUVA 1H93A 3FPLA 2A5FA 4LF9B 3QVUA 4JJGA 1X9HA 3R3YA 1ISPA 1BXGA 1N2GA 1QFMA 3HA3A 2D5AA 2C2HA 1JILA 3JQEA 2XOKD 5KX5F 2QD2A 3S7ZA 1C1XB 5K51A 5IN4A 3I34X 3N28A 3PF9A 3GGJA 1YJQA 4PCUA 1HL7A 5KYKA 3VKGA 2R1TB 3EXIB 3OJFA 1Z25A 4AYXA 2QR5A 4ER0A 5KQLA 1AKTA 1VG0B 1GKIA 2Q3HA 3BILA 4JX8A 4UHHA 1IC6A 2FG7C 1P5ZB 1FTNA 1I01A 1ZKMA 5EFOA 1CHNA 1LBSA 4O2AB 3GVXA 4IGEA 2ALJA 4XIYA 1EWVA 1LI7A 4Y9RA 5E1MA 1FFXB 5BNIA 1DAPA 1WJGA 3WYFA 2EKQA 1BE0A 2OCXA 4F0JA 3IMEA 4ESEA 4ALLA 1W49A 2ZUFA 3JWGA 1DMSA 4EBFA 4RACA 4PAOA 4GGPA 4KE7A 5KCZA 5K0TA 2QRMA 3D64A 4ZMRA 2NXJA 2H48A 3L07A 3B9BA 3QMWA 1ND5A 4N39A 1YL5A 1GPBA 3M3DA 4LWOA 3WL6A 2YC2C 2IU3A 1M7BA 3RF6A 5KNCD 1Y5RA 4GLLA 2DR3A 4MVJM 5LCXA 1PJQA 1BS2A 3BCUA 1RW4A 4IG9A 1X87A 1SIUA 4AJKA 3PSHA 3NV7A 3NBZC 4W5HA 5LZ8A 3IDAA 3DDOA 4KMRA 1RWKA 2FMFA 4ZAXA 1F2DA 5K3DA 4QBHA 4GZ6A 2JCXA 4DJDC 1AHHA 2XB9A 3FRIA 4UEQA 4F5WA 5DN6D 3LYHA 4TKLA 2GZAA 2BFDB 2R1ZA 3ABZA 1E9DA 3GUYA 4KP7A 2GPSA 2YNMD 4KMSA 8AT1A 3WA7A 3N07A 5CX1B 1M6WA 4PG6A 1O0BA 4TTIA 1K6JA 3NTUA 3ENKA 1M54A 2D0IA 3H7IA 2Y1CA 1DRJA 3O4JA 5AMXA 4KX3A 1P6XA 2FR8A 2X42A 4MUYA 2FWMX 3IAUA 1ESEA 5CLLA 3WLFA 4Z3KA 1GZVA 4BNHA 1TAQA 3VYVA 5C1PA 1AKRA 2XTZA 2Y92A 2GM9A 3RVLA 4BMVA 4U39A 3ETLA 4JB3A 4F5DA 4A36A 1HDIA 1B6GA 2EWWA 3CBQA 5ALUA 4EUHA 5KAPA 2V55B 2OXIA 3X1MA 4RF4A 3G8CA 1XF9A 1CY1A 4KHZA 2HZ7A 5ESRA 2VDOB 1D4OA 4NBVA 3AB3A 1BMQA 3PKIA 5AUQA 4MDFA 1XN4A 3PDWA 3RAFC 2ZT6A 2HPHA 2Y6VA 4KWTA 1PEKE 4FQ8A 4Q1BA 3NKFA 2HO4A 3HE3A 2IOFK 2E37A 2MYNA 4NESA