3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
molecule keywords Pantothenate kinase
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
2CJWA 4A92A 4B2IA 1YZNA 4TMXA 5EJEA 1KJZA 1XZQA 1XCMA 2IL1A 2ZE5A 2J0SA 4Q4JA 1WB9A 2Z83A 3VTKA 4LV6A 2O8CB 5TVKA 3EC2A 3NHAA 2H1LA 4LUCA 1VHTA 2XNDD 1OH8A 3CLVA 1KO4A 2QE7A 1OE0A 3ZIAA 1G8FA 2N1BA 1OFHA 5BN3A 5JHHB 2V54A 4LJ8A 1KGDA 2L0XA 2D7DA 2VL7A 3DPUA 5JEEA 3VKHA 1E0KA 1G8GA 1W48A 4Q66C 1J90A 3PEVA 4LRWA 4B76A 4CIDA 3T1OA 1W4RA 3BS4A 2CLSA 3OZXA 5JMTA 1ZUIA 1J2JA 2D3WA 3GJ6A 4Q1EA 1KI4A 4JJZA 4R9UC 3U3JA 4O25A 2VP2A 5EZ6B 3TMKA 1ZIOA 4RFVA 2JJ1A 2XTMA 2JLVA 1XJQA 2P2LA 3K09A 5IK2A 1U99A 3NIBA 3E70C 4WZAE 1AA9A 5CIQA 5TXGA 4DDUA 1FW6A 5JBQA 4DLSA 1OKKD 2ASEA 2QY9A 3REFA 1XTRA 1OT3A 2DY1A 2MMGA 2Z5FA 4IVQA 4M1WA 3VU9B 1E2FA 1S4QA 1VYVA 1S1MA 3K0FB 5E7IA 1RYHA 2VHJA 3UMFA 1A1VA 2ZM5A 5JJLA 1W49A 4DT1B 2A7QA 4IDPA 2UZ3A 2OSBA 3L0OA 1MO5A 1DAEA 1EX6A 1PLKA 1L4UA 3LFUA 2E1RA 3VNVA 2VO1A 1EG7A 4L4UA 5FL3A 3QJYA 4RD4A 1F60A 1T3SA 1J99A 2NO6A 3CX6A 4Z1MD 3P27A 2WAYA 3K09C 1E9DA 1M6NA 2ORVA 2PLFA 4M9ZA 3H4MA 2WWYA 5LDDC 4IFBA 4XJXA 4X8OA 3RS2A 5J4VA 5JWHA 4ZIRA 1D6JA 1JAHA 4QL3A 5L3SA 3KL4A 3I5XA 3PR1A 1F48A 1XRJA 1VHLA 4TQUS 4TYPA 1NRJB 1IN5A 5LB2A 1IY1A 4DLZA 2B8TA 3KKNA 4JBXA 5FBRB 1Z0DA 2UKDA 1QHSA 1XPUA 4Q18A 3B85A 4Q9KA 4MRPA 2CJWB 2DWPA 2PZFA 1MO4A 4FW9A 1SZPA 3X2SA 2CHVA 1E1RD 1NI3A 1UBCA 2OXRA 3O47A 3QBVA 1DAKA 4MRRA 4N3NA 3HU3A 1G6OA 1G7CA 2QTHA 1XD8A 2ZPTX 2ZS8A 1CULC 1N6HA 4DC9A 1KI2A 1TUIA 2ATXA 3KTAA 1D8TA 2DFLA 3LA6A 3SFZA 4M1TA 1Z0KA 5AJVB 2WSSA 3PCRB 1XTIA 3GJ5A 3K9GA 3P32A 2CDNA 3AM1A 3OESA 1KK2A 3UIEA 2G88A 1VG9B 4B34A 4D25A 4TL9A 2XGJA 2EQBA 5F2EA 2J59A 4B3BA 1II8B 2SHKA 4Q48A 2AR7A 4MGKR 3DMDA 1CP2A 2R6DA 2CNWD 3KFXA 4II7A 1Z6TA 4KO8A 4B32A 4ZKEA 1FP7A 1SXJA 3CR8A 4HZUB 4A0GA 2P3SA 1R2QA 3AH8A 3FMPB 1RKBA 2KI5A 1KSJA 1FUKA 3PUZA 1F5NA 1LF5A 2CLCX 3R7WB 3ZZUA 1XTSA 2ZRBA 2GAAA 4FI3C 3Q3JB 4DEXA 1ZVQA 2WSSD 3OIWA 5FR2A 3K0FA 3OF5A 4A0RA 2OCPA 4M0LA 1SVLA 2ZI9A 1HA3A 4PPFA 3QF4A 3RAPR 3T35A 2CK3D 2GAOA 1ZC3A 1KMHA 4Z8YA 1WXQA 4LHYA 4AKGA 2QGZA 2V9PA 1E1RA 1NY6A 3BH0A 2F1HA 3CRRA 4IVPA 3HP1A 4JLNA 2ZJBA 3A6PC 2ZE6A 3TE6A 2VA8A 1YQTA 3QI2A 2MSDB 1VIAA 1MO6A 4KLNA 4LJ7A 1J70A 1O3YA 4JL8A 4TMWA 2QSZA 3ZD7A 4GBMA 4POAA 4OK5A 3RS7A 3NBFA 1CJUC 3W6OA 2GJKA 2HT6A 4LI0A 3L0IB 1JJVA 1KKMA 1M7GA 1BMFA 1XMJA 2NPIA 1ZINA 2B6HA 4OQFA 3R7WA 3ZVMA 2P6RA 1U2RA 4QM6A 4V0NA 1YR8A 4YMWA 5BN4A 1BYIA 4A0FA 1P9RA 2WOOA 2VIIA 4HLUC 5DGXA 1KK3A 2EWWA 5HKKA 3DOEA 2R44A 4G5RA 2IYLD 3KXIA 4NYJR 5DYGA 1PLJA 1E0SA 1JQLB 1LS6A 2FJUA 5DNYB 3WRXC 2GZAA 4PFSA 5J4YA 4G5SA 2V55B 4DZZA 5KDOA 2QBYA 3LD9A 4D80A 4GNKA 1XDBA 3ADBA 3BORA 2ZJ2A 2ZRHA 1BKDR 3ZS9A 3C14C 3U5ZB 2BBSA 4HZIA 3GJXC 1D5CA 4UNPA 2ZAMA 1PZNA 1LS1A 3OHMA 2DFKB 1CR4A 2QQEA 2F1JA 2W0SA 1N3BA 1QHNA 4KODA 1NJGA 2XZLA 1F6BA 2W6JA 2YWFA 2ZRAA 2WV9A 3RSLA 2JJ1D 2F1IA 4A2PA 3PENA 3B82A 5H8WA 3K0AB 3BC1A 1ZD1A 5KSPA 5KDLA 5IDVA 2FWRA 1Z0FA 2HF8A 2YV5A 3EZ6A 1QDEA 3QY0A 4HAYA 1N5LA 1ZW6A 2GDJA 5EUMA 4DSTA 1XTJA 3PUYA 3SFVA 2FDCA 1ZIPA 2WJVA 1KDPA 2DFTA 3B7GA 4QBHA 1SVMA 1WMSA 5FI1B 2A5JA 1ZNZA 521PA 5IRCD 3GLFA 1RC8A 2CE2X 2R2AA 5JEDA 2IUSA 4IOJA 2CL6X 2VP0A 3K9HA 2IUUA 2VYFA 3IO5A 5HZKA 3UANA 5HKKD 3WMEA 4OQXA 1I2MA 2ODBA 3SHWA 5J4HA 3QBTA 2WTUA 3BFVA 2H92A 4Q5IA 2FX3A 4Q47A 2QP9X 1IOZA 1CEEA 2GILA 4JVMA 4DDVA 1AK2A 1Y63A 1VCNA 4TTQA 3ICQB 3VX4A 2JAQA 1YZGA 4MA4A 1GNRA 1OYWA 2IYRA 2RCNA 3ZGXA 3ZLJA 1IJEA 2IYSA 3HYRA 4PHFA 1CRPA 1RFLA 1IAQA 1U9IA 2O0KA 3LRPA 1NIJA 1SVOA 2AK2A 3RLFA 1FX0B 4CVNA 2BV3A 4V0MA 1OH7A 3C15C 5L8VA 4ESHA 3I62A 3GLHB 4GL2A 2F9MA 1N0VC 2FGKA 4AYWA 1G19A 1ZU4A 1N5IA 2B92A 2C04A 2ZYUX 1BO6A 2F43B 3T1TA 4QNMA 1G16A 3T12A 4V0OA 1U81A 1KJWA 3B1YA 3CH4B 1YVDA 2XTZA 2IHYA 2OCBA 4GMDA 2QTVB 2WWHA 3AVYA 3BGWA 1GRNA 5TARA 3RS5A 1BH2A 2QEQA 1CJMA 4V02A 1HE8B 3PUVA 2PCLA 4LHVA 3AVUA 5JJIA 3THYA 2J41A 3X1ZA 3LV8A 4XTCS 2QM8A 4B3GA 2FSIA 2ZJAA 3CB4A 4AK9A 2RH5A 4HLQB 5TY0A 3RABA 4UNRA 4CEJB 3H84A 3NEYA 3T15A 2RGBA 4FMDF 4Q1AA 4C0KA 2EYUA 4ZI3A 2V8OA 2IXGA 2BBWA 2IS6A 2PX0A 5FBQB 4EAQA 4GDFA 3N2EA 3FWYA 2RGEA 2F43A 4BLSA 1NNEA 3LBHA 1XPRA 3QSYA 2PLRA 1US8B 2CK3A 2I1VB 4KJZA 5KU1A 2J46A 3GLFB 2RGXA 4DHEA 2AWNA 2UZIR 3EA5A 4NCJA 3CF6R 5G53C 2OAP1 1N6RA 1NG1A 1DO2A 3TSOA 3CPEA 4UXIA 4GP7A 4KSBA 3WNBA 3U6KA 2OLKA 4E5UA 5B57C 3CKLA 1HTWA 4UXHA 1IQPA 5LD2C 1VG1A 1IN6A 1D2NA 1N6NA 4I1VA 4F4IA 4M22A 3BWDD 4EPWA 4MDFA 3C4JA 4JLPA 1E6CA 2HV8A 1LF0A 1P9WA 4TSFA 2REOA 1P2UA 4RD1A 1I4LD 3LX5A 3SYNA 4I1SA 4MH0R 4DCUA 4ZDKA 4NYMR 1L8QA 3ADKA 1KDOA 3AVOA 5EE0A 4B3DA 4B47A 4AY2A 2XNDA 2YOGA 2HJGA 1X86B 3IQWA 2XZOA 1WA5A 2P6NA 1ANKA 4XIGS 5DH9A 2ECKA 3KZ1E 1H8ED 3M0EA 3RVBA 1HQYE 1OFIA 3A1TA 4A8JC 4NYIQ 3PEWA 1E9EA 2QZ4A 3KJGA 3A8TA 4TLDA 5J4LA 3EWSA 1TU3A 2FH5B 5C1BA 1YR9A 3LQQA 1KAGA 3S1AB 5L3QA 1G7TA 2PT5A 2ZIAA 1A5TA 1MV5A 4OI2A 1GM5A 5JHGB 1YJ5A 3EPHA 4QG7A 5DLQC 821PA 1IJFA 2ZRPA 4H1UA 1R7RA 2HLDA 1QHHA 4QRHA 3SBDA 2DWQA 4YMSA 1FP6A 4KFTA 1OXUA 3AF2A 5C4GB 3SN6A 3LDAA 3T5GA 3VFDA 1FNNA 4A82A 1U8AA 3WBKA 4OKSA 2YC4C 4B6EA 4W9MC 1V5WA 2YC2C 1VDZA 3CWZA 1MABB 1KO1A 4GT1A 3CUEF 5CJPA 3W3AA 4TMZA 4M9SA 4JZKA 5HZHA 4A6XA 3DKPA 2C9YA 4D0NA 4L8GA 2EWVA 2ZI6A 4DDWA 4KYUA 4TTPA 2FGJA 1OSNA 1XD9A 1K6MA 3RS3A 1P4SA 4TYYA 4RZ2A 1RYFA 4Z1MA 4JVNA 1M7HA 1GKUB 2GXQA 2ZVQX 4WIAA 4M1OA 1OXVA 3LNCA 4BFUA 4US1R 2JLUA 4O3MA 3OEHD 1CTQA 4P4SB 1U8ZA 4C7OA 3IPYA 4AKEA 5DISB 1RRGA 4BEBA 4PC3A 5CM9C 1UF9A 1CKEA 1M1YE 4UXJA 3Q5DA 3A1UA 2OBMA 4BQSA 1PUJA 3VNUA 2OFWA 4BFZA 4ABYA 4XTRA 2GCNA 2ZRMA 3V4FA 1X8KA 1E79D 3QKRA 3I92A 1Q22A 2V7QA 2C2HA 1NLYA 2NZ8A 4H1VA 4PAMA 4RZ3A 2AHOA 3UWOA 1P60A 1C9KA 2GEVA 4DDTA 3LAWA 5AK0A 1AZTA 3FYHA 2MMCA 4PXAA 2HCJB 3O8BA 5M04A 3QEJA 5TV2A 4G0NA 3U7GA 1S8FA 3P20A 1KOFA 3BRWD 1IBRA 4IRUB 4DCTA 1G3QA 1ZUHA 3AUYA 2RGCA 5FUVA 5AUOB 3OEED 1SXJC 2A3RA 3DO6A 2VF8A 5A5GA 1WP9A 2WKQA 1LTQA 1G5TA 3THWB 1EX7A 4LBZA 1G64A 4NYMQ 4RVCA 1W0KD 4P0TA 2JDIA 3IBGA 2QORA 4KBFA 3AV0B 1YU9A 2OHFA 3LLMA 4QGGA 2A5FA 1K5DA 2OXCA 3IQXA 1G3IA 1E3MA 2EYQA 4C2TA 2DFNA 2KWIA 4H9GA 1DAHA 1JBKA 3LW8A 3EIQA 3IIMA 3OIUA 5LPNA 3U60B 5GJBA 1AGPA 1N6OA 4G5OA 4IEIA 1KI1A 2J5XA 4AYXA 721PA 1OH5A 3VMFA 3PEUA 2XSZA 5AJWA 1S96A 4PANA 2XOKD 4TLAA 2ZRJA 1K5GA 4PQRA 4EDHA 2O8FA 2BWJA 2R6GA 2FU5C 4EQ6B 4FIDA 4XVUA 4HLCA 1E2MA 3EARA 5J5CA 2JEOA 3FHOA 3KDSE 1KSGA 5GJCA 2WWIA 4PQFA 3U3MA 2V6JA 3RRZA 3TW4A 3WHLA 5JRZA 2CEAA 3GJ3A 3KKQA 3PFIA 3TNFA 2EU8A 3TSZA 3ZYCA 1WBBA 3C8UA 5HR5A 2WMOB 3KKOA 3WP1B 3THXB 2CNWA 3R20A 3JZMA 4LC0A 4NE2A 4PHTA 3TSWA 2ZRCA 3OIYA 5IF9A 1RJ9A 2QNRA 2V6IA 1BIFA 1JPJA 2H57A 1SHZA 3RRNA 5BYJA 5DHFA 1T0HB 3SS8A 4DSOA 4EFLA 1FTNA 1KI6A 5FBVB 3ETLA 3A37A 3U4QB 1KO5A 2D2EA 4HYYA 5KDDA 1ZRHA 1Q57A 4CW7A 2ZSFA 2WJIA 2ZXUA 3I32A 3QKTA 1P73A 2X19A 1FFHA 3F8TA 2HCBA 4JKYA 1OFTA 5FOTA 1KNQA 1YKSA 2A5DA 2A30A 2IYWA 1SQ5A 4MUAA 4LJAA 1AIPA 3M6AA 3IILA 4AD8A 3A1VA 5HPYB 3ADDA 1A7JA 2D4HA 2XOKA 2ZI4A 1OYYA 3AKCA 3CRVA 4IXMA 4TYNA 3U44B 2O0JA 4Q1BA 4ZO4A 4S2EA 1IY2A 1R10A 4IKEA 3BB4A 1I4TD 4MGYR 4RFSA 4A9AA 1E1QD 1KJYA 1ZM2A 3C7KA 4LDJA 2QTFA 4IHQA 4I1UA 1JNYA 2VH5R 3B1XA 4LWZA 1N5JA 1XD2A 2BHRA 2C9CA 2XX3A 4CEIA 1CLUA 4HB4A 1A4RA 3A4LA 4GPTA 3I4LA 2F6RA 3T06B 4F4CA 1Z2AA 2FPLA 4J0QA 1R5BA 2FV8A 2ODEA 2Z43A 3SOPA 2PJRA 3RC3A 3SJBA 4TYQA 4Z8XA 221PA 3WHKA 5JSZA 1KMHB 5LD2B 1NJFA 2EFEB 2Z0MA 3VHXA 4HDQB 4B71A 3DVLA 3O8RA 4D6PA 3TLXA 4DLTA 2Q3HA 4GOKA 2AL7A 5CDFA 1XXHA 2G9NA 2PZEA 4M4SA 4WZ6A 1Q3TA 1KK1A 3NBXX 1T8TA 4PHHA 4ESVA 3LX8A 1J7KA 3WXMA 3RC8A 4URVR 1ZD8A 2RHDA 4MYHA 4WAUA 5IK2D 1EESA 3B78A 2JASA 5CLLA 1TEXA 1R8QA 3CPJB 3I8XA 3L82B 5DHAA 4MRNA 2OCYC 1N6PA 1YZTA 4DRZA 1RW4A 4Q7LA 1JR3A 2YOHA 5L3VA 3WRYC 5CK5A 3EC1A 1XEWX 4OJKA 3W5JA 3FE2A 2BM1A 2ZRKA 4C30A 1X1SA 1ETUA 1Z6AA 3IIKA 1UKZA 4YDSA 3B13B 3BIFA 3W34A 1E2KA 4KLZA 1PV4A 2ZS7A 1KZGB 3EIHA 1R0XA 4JKIA 1YRBA 4LBVA 3BH7A 1J8MF 2V3CC 2OFXA 1W4BA 2ZAOA 2DR3A 3BK7A 4WW0A 1YZLA 4D4MA 2QAGC 5EE3A 2NQ2C 1DPFA 4MUBA 1Z2CA 4TZ6A 3J81k 5CK4A 1XCPA 4PO1A 4LK2A 3KQKA 5DYIA 5F3WB 4TN1A 3U44A 1KZ7B 3WNCA 2ZJ5A 1EK0A 1OXXK 2FSHA 1T5IA 3K0AA 2QGNA 2BVNA 2IYQA 3LBIA 2RHMA 2PEYA 4OQNA 5FTNA 2VHCA 5EP4A 3PXGA 3KB1A 1EFRD 4L5BA 1AQUA 4IDHA 3TVDA 4ZKDA 2K5UA 1BOFA 1CF4A 2ZTSA 4V03A 2X2EA 2ZI5A 4IDQA 1TX4B 4RZXA 2QAGA 5D3MA 5CB8A 1XFAA 4JT2A 1S9DA 3QXHA 1YHNA 3FTQA 4DIDA 2OV2A 2XXAB 2NIPA 3QKSB 2PEZA 4BECA 1FQJA 4ZCIA 4N0DA 1UADA 3WY9A 2QRNA 2KBFA 4BLTA 3BB3A 1OXTA 2MSCB 1E2PA 1FOEB 4BLRA 3B5JA 1XZPA 4A8JA 1Z47A 1TMKA 1DAFA 4A4DA 4ZV4A 5KUTA 1KDTA 2IC5A 2P65A 4URWR 1RRCA 4BLQA 1L2TA 1DOAA 1W0JD 1HV8A 2QENA 3B1WA 5HCNA 4C0BA 2AN9A 1VCOA 3ZJYA 3MUFA 3CF0A 2O8DA 3CIOA 4JLVA 1B0UA 1G20E 4Q7KA 2IYYA 3TBKA 1G4UR 1HY3A 1E94E 1Z83A 1JR6A 2QMUA 2XNSA 3LO5A 2QAGB 4ARZB 621PA 2ZI3A 4XWKA 2WJYA 2AXNA 4TTRA 2GWHA 4ZDJA 4CEIB 4L16A 2BMFA 3FMIA 4JLJA 4OJQA 2XZPA 1OH6A 1NIPA 4OHYA 1A2KC 4P33A 4YMVA 5B64A 2GF9A 4LHXA 1OFUX 4IOMA 3GPLA 2IS4A 1EWQA 3AVVA 2JJ2D 1XF9A 3AKDA 4TLEA 2FEMA 1NKSA 3RANA 2AFHE 3FFBA 2A2ZA 2KE5A 1YR7A 1W44A 3VKWA 3FKSD 2GJAA 4HB2A 1TQ4A 5FOXA 3DOFA 2HUPA 2IF2A 5F9HA 4JLKA 1TAGA 4DLXA 1II8A 3HDTA 3VQTA 5JCZA 1JB1A 3DEFA 4D2IA 1IN7A 4A1FA 1FPMA 3B1VA 2EFHB 4B33A 3KJEA 3A1WA 4R2IA 2WVJA 5EP2A 3I1FA 2WMNB 5ELXA 1G8PA 1E99A 3ZIAD 3KKMA 3PQCA 5SZKB 1E2NA 3KUCA 4Q01A 5DN6A 3L2OB 5DI9A 1XNJA 2ZUDA 2F1RA 1NMZA 4LZZA 1MT0A 2WBLC 3FMOB 2D06A 3P4YA 1X8JA 2VP6A 4BZPA 4IVRA 4BZXA 1B23P 1T4GA 1XMSA 3EZFA 2HXYA 2VSFA 1GZSA 4D4JA 3RWOA 1RE0A 2DWOA 4ACAA 2NTYC 1XEXB 4L15A 2J0VA 3LVRE 1KK0A 1ZNXA 4DLWA 2XAUA 2H8KA 4MKGA 4YXWA 1W4CA 3LQRA 1T3HA 4MYUA 1TQDA 1XMIA 4MYCA 1OJLA 1WRBA 1W36D 4GSYA 1H8HD 4HUQB 2WWXA 2BM0A 1ELOA 1GL6A 4RD2A 4B35A 1XCGB 3B2EA 3K53A 4KSCA 5E4FA 5FPSA 1P72A 5AUNB 5KHOC 1E2GA 4YC7A 2GJSA 2JCSA 4NCHA 2GCOA 4A0HA 3JVUA 4E22A 1KI6B 1JEDA 2FF7A 3E5HA 2F9LA 4C7OB 3U4QA 2ZJYA 5EXTA 4LCBA 2JLXA 4U7DA 1FQKA 1CJTC 1T0JB 4KI0A 3W8NA 4OK3A 2N42A 1EFCA 3T1VA 3OFND 4PTLA 1AKEA 3EZ7A 3D31A 2GBLA 4JYCA 1VG8A 3SEAA 3IUYA 5JECA 1N6KA 1W2GA 5KPDA 2VP9A 2O0HA 4KVGA 1E98A 4LGMA 4LJYA 1M8PA 2C95A 4FN5A 4Q7MB 3CBQA 3NBZC 1DTSA 2QG6A 5LBIA 3UMRA 2EFGA 4MYTA 3KQNA 1SGWA 2FEOA 3P1JA 2ZU0C 5A0FA 1ESNA 3K0SA 1JXMA 5UKDA 3SBEA 4DIEA 4Z54A 1HQCA 2ONJA 4A2WA 2BJWA 1AZSC 3B60A 3CONA 4JLOA 1NP6A 1DG3A 1DBSA 3R9IA 1ZM4A 2W2TA 3AB3A 2F7SA 4JJKA 2R62A 4XH9B 2J0UB 1XB2A 1G21E 1MH1A 4DLRA 4G1UC 2PT7A 2JLRA 1HT2E 3U3OA 2FFBA 1NMYA 1F2UA 1Z8FA 4PC1A 3MCAA 4KYIB 2OO7A 2ZETA 2QQ0A 3EXAA 2NO0A 5P21A 1P3JA 4OBEA 4NMMA 4NU0A 2XXAA 1IY0A 3FPAA 5IHPA 4B3XA 2QL6A 2JLZA 1N0WA 5AWFC 1DAIA 2JLYA 2FN4A 4DT1A 4Q9LA 1DADA 3KB2A 1H65A 2FE4A 1QBKC 2C98A 2IW3A 2OZEA 1X1RA 3RS0A 1XJ0A 4AURA 5FR1A 5FOVA 5FPHA 2Q3FA 1NSTA 2ZJOA 3GLIE 1ZD9A 3AKEA 1E1QA 3CH5A 2PH1A 3QOFA 5BQ5A 4B3FX 4EJSA 1UEJA 1QHXA 5H70A 3BXZA 2BOVA 2C77A 1GOTA 4GP6A 1P5ZB 2J7KA 3C16C 2WZQA 4TT3A 3E2IA 3ZZTA 1RIFA 1OIXA 2NG1A 5HTKA 4C0SA 1P2TA 1SXJB 2XTNA 3E1SA 4HZUA 4LBWA 3PITA 1ZMXA 4PC6A 1KAOA 2O5VA 1HEIA 2W2XA 5FTLA 2ZRDA 1NVVQ 5TMPA 4V0KA 4U5XA 1E4VA 5FOSA 2GVDC 2B8WA 1KYIA 2DPXA 4TWZA 1E9RA 1G8HA 2IYUA 1H8EA 3QXJA 3ASYA 1E2DA 5A4JA 1GRRA 1X3SA 1R5NA 2WWFA 3PUWA 5FUYA 3SYLA 3UK6A 4AIIA 5C46F 4HSEA 4ZI2A 2QPOA 4QHTA 4EQ6A 1DE0A 3KTAB 3V9PA 3AF3A 2CHQA 4JL5A 1VMAA 2VP5A 4Q4HB 3FHTA 2BBOA 4OI0A 3CW2A 4MGIR 2GBLC 1XD2B 3EAQA 5JFGA 1TF5A 2UVQA 2QPTA 2Q3MA 1NVVR 1AQYA 1DS6A 4B44A 3AKYA 3MG9A 2FZLA 4C4PA 3EG5A 3QPWA 2R6FA 2NMVA 3NVAA 3W90A 4F4JA 5D3QA 2FZ4A 4KITB 1W47A 2OE2A 3N2IA 2O8CA 2BBTA 2FG5A 4I99A 4Y0VA 4CT5A 5KO2A 1XEXA 2Z4RA 1GKIA 4KV9A 5BYKA 1UBGA 4ASUD 1KDRA 2YKGA 1NF3A 4QBIA 2DYKA 5CYPA 5FL7D 3PVSA 2WHXA 1I4DD 3QF4B 4HUTA 5BN5A 2EFCB 3I3SR 3QNUA 3EX7C 3BB1A 4TLCA 2CE7A 1S2MA 1N5KA 4MRVA 2RGNC 3C5HA 2PX3A 3ZD6A 1NBMA 3AVPA 5FOWA 4I81A 5FPKA 2QROA 1MRNA 3BJIC 4ZDIA 3R8FA 3TK1A 3W8RA 2A5YB 4HLDA 1Z0AA 3GLGE 3M1IA 2X2FA 1GIAA 2BJVA 2OCAA 4UNSA 3L8ZA 1CU1A 1KI3A 3MRSA 5FOUA 4QNRA 3K0EA 1XXHE 3QVVA 2DBYA 4R71A 4GZMA 3WYAA 4GZLA 3N70A 4IJMA 2HEIA 4NDZA 4BLPA 3AF1A 1GAJA 3ASZA 4L9SA 1DARA 2JLQA 3H1TA 1YZQA 2VRWA 5CIWA 2XEXA 1KO8A 1Q21A 2JATA 4QOSA 4Q21A 4C0HA 3FDIA 3CRMA 5GVSA 5KNCA 4PSAA 2WIAA 4B43A 1VTKA 4TL8A 2P5SA 3Q85A 4NHOA 1Q0UA 2VPPA 1N6IA 1S3SA 3F3YA 4C0AC 1E79A 3DZDA 5AJXA 5FBLB 2IA5A 1UM8A 1TL7C 1XU4A 2BIFA 1G7SA 4XOIA 4LY6A 1XXHB 3CX7A 4JS0A 4JT4A 4BPBA 1NSFA 2G83A 4MQBA 1OHHD 2CLDX 4GOJA 1A82A 2HF9A 3AF4A 2YYZA 2WWWA 1QVAA 3VX3A 1U0HC 1P61B 5CLQA 3Q7PA 5KSOA 1CR1A 3N5CA 2IBMA 4W7SA 2WKRA 4KFRA 2AWOA 2BKEA 4XSGA 1LW7A 3MWYW 4O0MA 4CYMA 3KQLA 2GCOB 3IBYA 1UDWA 3NHBA 1OB2A 2QP4A 1F2UB 4OHWA 1JJ7A 1C4OA 2WICA 1KI7A 3QXXA 4Q4JB 4TMVA 5CITA 4MDEA 1MKYA 1NVWQ 1GDDA 5KNDA 3D7MA 1KI9A 2OFOA 2ZQ5A 4K81B 4LJ5A 3KQUA 2C99A 1Y3AA 5GJWC 1E2QA 2RKOA 2G0NA 2OM2A 1OF1A 1QG2A 4GOXA 4AKHA 1E9CA 2FPMA 3UATA 1Q1BA 2IHBA 3WMGA 1QF9A 4NCKA 4CF7A 4P3YA 3L0PA 4UNNA 2G77B 2ERYA 1HT1E 4FWTA 4JLMA 4GI7A 5AUQA 4UNQA 1Z29A 5L3SB 2FFQA 2Q21A 3EW9A 4CDGA 2ZUCA 3GFOA 3BFXA 3CO5A 1BYUA 1NVUQ 4QGHA 1VCMA 2FMXA 2P67A 2VP4A 4M21A 1G291 1VIYA 2ZR0A 4EPRA 4A15A 2BCJQ 1OXSC 3VR1A 2ZRIA 4URZR 2QBYB 1C1YA 3RRYA 3Q9LA 4OI4A 2JDID 1W0KA 5K8TA 1P2SA 4KHZA 3UWKA 4NTZA 2GTPA 3K70C 4Q9JA 3TVTA 1M7BA 4QJ3A 4KBGA 5KTYA 2IEZA 5EZ5A 4RY2A 1GNQA 2ZYTX 1GILA 4EPYA 4M1MA 2ZR9A 2VHTA 1RZ3A 2C8VA 3BBPA 2O8FB 4C0JA 2W6IA 3U3RA 3VR5A 3SDZA 4ITRC 1UKVY 4LJ6A 2OESA 3TH5A 2PCJA 4GRAA 3U7FB 3KXKA 3HR7A 2AFIE 1OLOA 2FPKA 4C0LA 1Z3IX 3HWSA 2GEDA 3EZ9A 2GHIA 3CRQA 1XEFA 3A4NA 4WZBE 3MAAC 4MKIA 1LY1A 2DHRA 4B2LA 5KSYA 1FTSA 4PQYA 4NPHA 3FOZA 1F2TA 1KIMA 1Q20A 2CVFA 1XTKA 3VR4A 1VKJA 2JLWA 3SJCA 4F92B 2AD1A 4JLDA 3EA0A 2BEKA 3X1YA 2YWHA 1W5SA 3TKLA 4D82A 4HUQA 2EW1A 3SC3A 2FNAA 2IK8A 1AN0A 4FD2A 3MWJA 3NWJA 4HATA 3BOSA 3LVQE 1KMQA 2GZHA 4EJSB 1LVGA 2QI9C 5CYOA 4XD7A 2Y8EA 2R8RA 4DVGA 3TRFA 3D3QA 2FFHA 2XB4A 3M4YA 3AUXA 3LWNA 2FOLA 1S3GA 2MSEB 2Q9AA 2IF0A 1KY2A 4BFWA 2J7PD 4BFVA 4DCVA 4IFEA 3QVUA 4KU4A 3H86A 1SKYE 2B7BA 4BASA 1UAAA 2GJ9A 5JZVA 2A9KA 3NEJA 1DAMA 2GK6A 3QPVA 1U9IC 2QMEA 1KY3A 3PIRA 4CEHB 4HDCA 2GRJA 2IUTA 2OEPA 2I4IA 2GZDA 3IIJA 4DWJA 2LWIA 1G8YA 2X77A 3AQ4A 3EASA 4N1AA 4TQ9A 4Q4AB 1SHKA 4CZ2A 4AI6A 3ZVLA 4KAXA 3V4RA 1IM2A 1HUQA 2G1KA 4HI0E 4AG5A 3GP8A 2ZUBA 2CXXA 4HAVA 3CNNA 1X6VA 1Z5ZA 1RRPA 1W1WA 4QM7A 1QHIA 2QP3A 2W6ID 4D0GA 1RPZA 5BW8A 3RSOA 3PG5A 4MKFA 1L7VC 1D9XA 1UDXA 5LB4A 3MLEA 2GEUA 2ZJZA 3VR2A 3BH6A 2YOFA 4D0LB 3TAUA 2J0UA 4OHVA 5EE5B 5F9FA 4DLVA 1QZXA 1AKYA 5ANRB 4ERNA 1GTVA 3U7HB 3MFYA 4D81A 1NKTA 4YDHB 3AF0A 2P0EA 1RVDA 2WJGA 2X1VA 4NBSA 3RHFA 1NG9A 1GITA 2NPFA 3U61B 1ZAKA 5TB5A 4QJ4A 1E9FA 3QUSA 1OHHA 3DM9B 2R6CA 3ICEA 1V43A 2GXUA 3L0SA 1E0JA 2GXAA 4NCIA 1MO3A 4FXPA 2B7CA 1G18A 4RKEA 1Q3HA 2V1UA 4O2LA 2ANCA 4XWAA 2Q9BA 1COWA 3AP2A 2HXSA 4E09A 1LV7A 1SVKA 1S1CA 3FHCB 3LY5A 3QENA 3DDCA 2VHUA 4PR0A 4V0ME 3TUIC 4BFYA 1R0WA 3EPJA 5DE3A 1KHTA 2REXB 3THYB 2YZ2A 2WPDD 1DO0A 2GF0A 1H8HA 5CB6A 4AC9A 5DI3B 4DSUA 2AK3A 3MMPA 4HDOB 4PZLA 4P31A 4BUJA 3A1SA 1G4AE 3HJNA 1OB5A 5SZJA 1JQJC 1VECA 4Y0AA 5SZHB 1S9HA 3W6PA 1AS2A 2C96A 2XJ9A 2FSFA 121PA 2AKAB 3I5YA 1DVRA 2YJTD 3FFAA 3NDPA 2QT0A 3FB4A 4BLOA 5CDFE 1E9AA 4B48A 3QF7A 2IX3A 5H68A 3TUZC 1AS0A 3D8BA 4URYR 1II0A 4TMTA 4A36A 4NZYA 2YWEA 4PC2A 2F3TA 2NO7A 4P4SA 2EVWX 5EUQB 3GD7A 2QAJA 3P26A 4EKDA 1E2IA 2G3YA 2PMKA 4R7ZA 4TL6A 3AVTA 1FNMA 3PUXA 4HAZA 1VYTA 2ZANA 4LHZA 3RDPA 4JVSB 4C3ZA 1GNPA 4E07A 3FKQA 5C18A 3K9NA 1T8UA 5C4MA 1ZJ6A 5KSZA 1UEIA 4O2RA 4YONB 1CS4C 2ZE7A 4DCNA 5IT5A 3RWMB 1GSIA 1U0JA 5E7MA 4DLUA 2QRZA 5DIFA 2E9SA 3EZ2A 2VEDA 2IYTA 2LKCA 3MJRA 3QIAA 1ZM7A 1NLFA 2RGAA 5J40A 4EJSC 3CZPA 2JA1A 1J8YF 4PX9A 1QG4A 3G82C 3TR0A 5KNBA 5EXSA 4QBFA 4G3XA 4A2QA 3SJZA 1FMLA 1G1MA 4Q00A 2ZSEA 1FUUA 2ZS9A 4YLGA 4IEEA 3P4XA 3GLGA 2IYVA 4PPQA 2WAXA 2QU8A 3NC1C 4BFTA 3QXCA 3LXXA 3UMSA 2NOAA 1D2EA 3EIEA 4WVFA 2GETA 1GWNA 4PO8A 1T91A 1CBUA 1U94A 3I73A 1LB1B 2ZRNA 3S1AA 2H16A 4X8MA 3I72A 1WF3A 4UKDA 1JPNA 3BD9A 3GQBA 1D9ZA 1YZUA 4ZDWA 1E9BA 1UPTA 1XX6A 1M34E 1W5TA 1WCV1 2FA9A 2OAQ1 2BKUA 3ADCA 4B75A 1WBDA 3AVQA 5FFMA 1GRQA 5JCPA 4D4LA 4LYAA 3KFVA 1IXSB 1CJKC 1W0JA 1WQ1R 3MWLA 2ZI7A 2OT3B 4QJ5A 4EUNA 5BXQC 2AKYA 1KKLA 5DSZA 3IGFA 3BFKA 3GLHE 1CR0A 4NYIR 2PMDA 3GFTA 4NCNA 3IEUA 4W5HA 1U90A 2BC9A 1DAGA 2YNMA 3V00A 4IOLA 4JLBA 4QGAA 1GL9B 4F93B 4I1OA 2HDNB 4KVAA 2G6BA 1SKQA 1YE8A 4HAXA 4CGZA 4QGFA 4ON9A 1Z07A 4RSGA 1WE2A 3B9QA 1HE1C 5FL7A 3SZRA 5KYKA 1XEWY 1ZC4A 4OI1A 4ASUA 1SULA 4LOAA 1SVIA 2GA8A 4GFDA 3THWA 3MWKA 4PZZA 1ZCAA 2KSQA 1XWIA 2PZGA 3IO3A 2J1LA 4W5JA 1SXJE 2ONKA 4BGDA 3TAHA 2J7PA 1XPOA 2Q6TA 1GUAA 3DM5A 5FH9A 4DB2A 3W6NA 1W4AA 4QFMA 3CZQA 1WDTA 2JJ8A 3VR3A 1JXOA 3BE4A 4Q4AA 1LFDB 1AGRA 1RJ9B 1ZP6A 2F3RA 1F2TB 1G3RA 1GG2A 3LH5A 4CEJA 4PZYA 3MD0A 3WNDA 5EQTA 1IXZA 4RFSB 3NXSA 5E3HA 2GK7A 3IDQA 2B21A 3U7EB 1CXZA 1Z08A 5DI3A 3AVWA 1QVRA 4M1KA 5AR1A 5JI2E 2D74A 4HB0A 3K9LA 1P2VA 3U6BA 4B6FA 1YR6A 4QBGB 4D4KA 1US8A 1T6NA 3CF2A 3OEEA 4FCTA 1AS3A 2RAPA 4FWIB 4DLYA 4TSFD 3RYTC 4Z51A 2WJHA 1CRQA 3A4MA 1DELA 1VG0B 4LJ9A 3T61A 1FMJA 1EFHA 2Z4SA 1EFRA 4FINA 3GEHA 2H5EA 1UKEA 5FTJA 1G5RA 2YHSA 1KO7A 4RD3A 3GMTA 4KXFB 1Z06A 1COWD 4R98A 2YWGA 1ZM3A 4DBLC 2C9OA 3W9YA 4RD0A 4C9BA 2ZSAA 3NH6A 4NKRA 2ZRGA 1VYUA 1LNZA 2W00A 3GJ4A 3LW7A 3CR7A 3SYKA 2ZRLA 3ONWA 3K1JA 3O8DA 1W36B 3GJ0A 4G5QA 1EGAA 3CPHA 5JRJA 5TDHA 1XP8A 5D3MB 3AP1A 1TTTA 1ZNWA 2JLSA 4JIMA 4B74A 1NN0A 4FMCB 1XJCA 4W5WA 1TU4A 5JWOA 2RGNA 2KB0A 1W46A 3CNLA 2ZSDA 4RCZA 4DCSA 1YRAA 1QHHB 4X8LA 2RB4A 5JWRA 2BDTA 2A5GA 1VCIA 1G41A 4F7WA 2O52A 2R65A 2HJVA 1P9NA 4RZUA 4F38A 4LBYA 2JIZD 3ZQ6A 4AKIA 4JSYA 1JR3E 4HLUA 4OK6A 1L4YA 1ZUNB 3KUDA 5AUPB 1KSFX 1G3UA 3FGNA 1EWRA 4IDNA 1CIPA 2W58A 2V4ZA 4AWXA 1PJRA 1Q1EA 3QQ5A 3DHWC 1Q1QA 3VKGA 1NBME 1OIWA 4M9XA 1R0YA 1Z6YA 3HU2A 1GVNB 3WYGA 1T5LA 3DL0A 3WMFA 3NKVA 5JI3E 3R9WA 4B73A 3HYTA 4E03A 2DB3A 3AP3A 2ZREA 3HPQA 5GJVC 1N2CE 3K8YA 2VBCA 4LYJA 3MJHA 1CJVC 3T1QA 5K8LA 1W7AA 2BMJA 1FX0A 2Z6VA 4K8OA 4RCYA 4BRWA 2ORIA 3VHLB 2IXFA 2Q9CA 1II9A 3NH9A 3EPLA 1PVOA 2R6AA 4WOPA 3Q8XB 2OLJA 3DKVA 3F0TA 5L3QB 1R0ZA 4OQLA 2OILA 2ZEJA 4HEJA 4LPKA 1P6XA 5G3ZA 3BAFA 3BERA 3LBNA 2RGGA 2OBNA 3MGCA 4HAWA 2IXEA 3QKRB 3Q5EA 1S0UA 3OFNA 4FMDB 1ZM9A 2H18A 2ANBA 2I3BA 1KI8A 2RMKA 2WWGA 4MITA 3ZZ0A 2WM9B 3NTUA 2VSXA 2CCJA 1JI0A 4I4LA 1OKKA 1O87A 2QMOA 4Q9HA 3THXA 1HURA 5HE8A 3X1WA 3Q7QA 1JR3D 2PL3A 2BMEA 2H17A 2VTKA 4DB4A 1GL7A 4DEYA 4IXNA 1KTVA 3TQFA 1QHYA 5K8UA 3K0CC 3CWQA 2ZYWX 4Q1DA 5G3YA 1GFIA 3QKUA 2W83A 4LYHA 1AM4D 2D62A 3DMNA 3NDBB 1TPZA 1UBEA 4US2R 3GJ8A 3GCGA 4NP6A 1T3LA 1IN8A 2ZJ8A 3SI7A 3K70D 4WXRA 5JS8A 3KX2A 1ONBA 4Q03A 4JBYA 1AJEA 1TF7A 3GLHA 4EFMA 2BCGY 1ZU5A 4FCWA 4QKQA 1KNXA 2W0MA 1JECA 4HAUA 2AXPA 3OE7A 4OQMA 4P4TA 5FBWB 1FZQA 2XITA 3SHFA 4BEJA 3PEYA 4PHGA 4EPVA 2QMHA 4BRUA 3QG1A 1Q1ZA 4DJTA 1X8LA 1IXRC 5CM8B 3TIFA 2P6UA 1NN1A 2QT1A 3C41J 1GP2A 3OE7D 3GLIA 3MSXA 3JVVA 2GKSA 2QM7A 4KCGA 5EP1A 2ODNA 1MR3F 4JBWA 5FPTA 4URXR 3GLGB 3QG5A 1SVWA 4RD6A 3LXRA 5AJYA 3TGPA 4F91B 1OIVA 1R4AA 4WXPA 3TQCA 3G0HA 3H2YA 3W3ZB 1E32A 3HR8A 3U3KA 1OPXA 3WBJA 1NMXA 1KSHA 2BMDA 4LSGA 4TLBA 4DUGD 3X1DA 4A8JB 1ZCBA 2ERXA 3SQWA 1EFUA 2NZJA 3UPUA 2QSYA 1JAIA 2IT1A 3SU8A 2CCKA 5F98A 2VSOA 1W2HA 1JEEA 2FSGA 4BFSA 1E2JA 4P4UA 1TQ6A 1UKYA 2ZITA 1HYQA 2NO9A 2F55A 4PAQA 3IHWA 4M8NE 2WOJA 2QN6A 1K8RA 3THOA 3WP0A 1SXJD 4IOKA 2WJJA 3NC0C 1G5PA 1VPLA 3GJ7A 2NO1A 3OAAD 2CBZA 4U02A 1QHGA 3NBYC 3VR6A 4P32A 1ODFA 1ZBDA 4G5GA 2ZROA 2KJQA 2HT1A 3QEOA 2W2VA 1TNDA 3UKDA 4EFNA 1P7CA 2ZE8A 2IWHA 3FKSA 2I1QA 1BS1A 2CVHA 3T5DA 4IDOA 3B1ZA 4JYBA 2VHQA 3ZVNA 1D2MA 3C5CA 4OYHA 3EWAA 421PA 4D26A 3JZAA 1G3MA 2JGNA 4DKXA 5B30A 3L8YA 4TMKA 1E9SA 3GFPA 5J47A 2GESA 2HLDD 3K0CA 4KFSA 4LPSA 4PAOA 4DXAA 1U8YA 2ATVA 2IYXA 2PJZA 4K46A 3OEHA 1R5OA 3ZQJA 4Q9IA 2QUZA 2J3EA 3RNLA 3AGQA 4M53A 4G01B 4Q02A 3GLIB 1G9XA 2JIZA 4URUR 5G41A 8OHMA 3B8HA 2C03A 5FUXA 4ZCLA 3H0KA 5B2ZA 1E69A 1F3OA 2QA5A 3IHLA 4QHSA 2AD5A 3GEIA 5HCIA 2LCFA 5G40A 4XD7D 3UXMA 3TR5A 1E4YA 1NBMD 5JS7A 4V0LA 2WIBA 1BMFD 2IS1A 2EFDB 3L43A 4JMPA 4MGZR 5BWMA 4M1YA 2OG2A 3X1XA 4Q1FA 4TQAA 1XBTA 3D6TB 4QXAA 4PPNA 2O8EB 4NYJQ 5JJKA 4XWOA 2WKPA 2NGRA 3ND8A 4QC2A 2X8AA 3EPKA 5E7JA 4EPXA 1TEVA 2WSMA 3FMFA 2XB2A 1U0LA 3RS4A 2RGDA 1Q12A 5EE1A 2ZYVX 3RRMA 4EIWA 2WPDA 2XJ4A 2CMKA 2ZSBA 1MRSA 1N0UA 1OW3B 4FMBB 3GLFE 3I8SA 4AYTA 2V7QD 2DCUA 2V1XA 1TQ2A 2ORWA 3CM0A 2ZVPX 4PO9A 5GVRA 3R8CA 2PBRA 1IN4A 3SE0A 4NONA 3TW8B 4PSVA 1TUEA 2HYDA 4UJ3A 5KOYA 3ZDQA 2LKDA 4US0R 4LV8B 3B9PA 4YMTA 2ODWA 3A36A 3PV0A 1GKYA 5JSZB 5C2JB 4Q4LA 2O8BA 4TL7A 4BWYA 2O8EA 4C2UA 2N46A 2OUKA 4B2PA 2GVZC 4JSTA 1A2BA 3HU1A 2CL0X 2J0QA 2OBLA 1UJ2A 1CR2A 1YZKA 4LV5B 5FTMA 2H7VA 4HB3A 4JL6A 4LC1A 2YVUA 4OL0A 1G7RA 2R9VA 4S35A 3FVQA 4M2LA 3W5IA 1FL9A 3A58B 1NL3A 2HYIC 5HE9A 3WYFA 3SJAA 2CHGA 1P62B 4C0QC 4WBSA 4AG6A 4YMUA 2J45A 1DEKA 3VAAA 4PPGA 4YQFA 3I61A 2CCGA 4B3CA 4TYWA 3KKPA 3VU9A 5EE9A 1M74A 3TUJC 2VLIA 2VF7A 4DUGA 4GMXA 4PSKA 4TT3D 1XMVA 1E2HA 2AX4A 2GJ8A 1Z0IA 4UQOA 1RRFA 2VQSA 4A6PA 4YXWD 3PJRA 1EFTA 2D7CA 1N6LA 1T9HA 3NG1A 1Z0JA 4U00A 2YINC 3OIVA 5E95A 1U98A 3ZH9B 5K8IA 1PUIA 5JLJA 3ND9A 3R9XA 1OV4A 4JLAA 3T34A 5H1YA 3IEVA 4Q4HA 3O8CA 1E2LA 2J87A 4ZCMA 1R6BX 1SKYB 4ARZA 4OHZA 3KXLA 1R8SA 5DN6D 2IWRA 1Z6GA 1SVSA 3KJIA 1EXMA 4Q7JB 4BFXA 3QE0A 5DO9A 1NN5A 5B58C 2IS2A 1G6HA 4PC7A 1E2EA 3KJHA 3Q72A 1UFQA 4UJ5A 4NH0A 3LLUA 4XSHA 4LYFA 5FI0B 3CNOA 3IPXA 4OHXA 3SNHA 4BZQA 2A78A 4LJ4A 3TJZA 1IONA 5SZIA 1I2DA 3CRW1 4CEHA 4XVRA 4L9WA 4ZPXA 3AEZA 6Q21A 1ESMA 5EP3A 1M2OB 5CJ2A 3ZVRA 3QKSA 3GEEA 3KQHA 3AVXA 3QPUA 2O8BB 4CRWB 1UBFA 1Z28A 5AJZA 3ECCA 1N25A 5EXXA 3REGA 4X8HA 4FCVA 1HH4A 2JJ2A 4CT4B 3K70B 3DZ8A 2C5LA 1P75A 3CX8A 4Q19A 4ZIRB 2KBEA 1JALA 4N0EA 1ZYUA 4LHWA 5FTKA 2O8DB 1QRAA 1Z22A 4ILEA 5KPJA 1PLLA 2ZU6A 4DSNA 1TF2A 1XTQA 1Q44A 1Z63A 2BEJA 2ZR7A 3AGPA 4FMCF 4JVLA 3OAAA 4TZ0A 4NL4H 2C78A 4RJLA 3SR0A 3UG7A 4ACBA 1MABA 2QE7D 5FPYA 2GNOA 1NY5A 1NLZA 4EPTA 3UG6A 1NVXQ 1MOZA 2Q0HA 4RKFA 5J4KA 2CL7X 3U2QA 4LX0A 1NN3A 2G0TA 4MRSA 4Q1CA 3QXSA 1DG1G 2IEYA 4IW3B 5GADl 2W6JD 1Z6XA 2QPAA 4WA7A 1E0AA 2GXSA 3HPRA 2G1JA 1W36C 1IHUA 2P5TB 2ZRFA 4R2HA 4XVQA 2D2FA 2J9RA 5FUWA 4M1SA 4KFUA 3G5UA 2XSZD 3ZS8A 3F5FA 2GCPA 2E87A 5EXPA 1G17A 3IKJA 2REBA 2IYZA 2FFAA 3SQXA 2TMKA 1ZNYA 3B6EA 5L3RA 4QHYA 4M9QA 1E96A 4BE7B 1TADA 4MKHA
chains in the Genus database with same CATH superfamily
1DNPA 2FN3A 3OZIA 3K1ZA 4H6WA 3ENNA 3ZWVA 5BUSA 3SQNA 2WD9A 2E4XA 4ARIA 1PEYA 1ZLYA 5FI3A 1ORWA 1XCMA 2IL1A 3LI2A 4MUGA 2J0SA 1JEAA 1C81A 1OXKB 1QR6A 3G02A 1VA5A 3A9TA 4LV6A 1NX6A 4BJ1A 2P2YA 3ZWMA 3RUCA 3V2GA 1ABBA 3SXJA 1VMEA 1G66A 1IBLB 1DEHA 1VHTA 4E6PA 1SRRA 2RI0A 1KO4A 5I47A 1OE0A 1UJ6A 1DEXA 2YZKA 2ZZKA 2AMFA 2FZEA 1MPTA 4LJ8A 1J23A 2D7DA 2VL7A 4K6HA 2H07A 4JWKA 1E0KA 4O3FA 1G8GA 5KJEA 1V1RB 3AG6A 1J90A 3PC8A 3PEVA 4JEMA 4B76A 4X20B 1W4RA 3HJBA 1DC8A 3BS4A 4F4FA 1VE1A 3HDQA 2XNCA 1J2JA 1XZFA 1YJCA 3AR2A 4GZ6A 1I3OA 4R9UC 2RH4A 1ZIOA 2IYFA 3TNJA 3U3JA 3WQHA 5AI4A 1I6KA 3D59A 4LZPA 2ISQA 1MG5A 2GZ2A 2IPXA 3AEKA 3EFHA 1AKNA 1EU1A 1OC2A 1BW9A 3QFSA 3RS9A 2HX1A 4I55A 4NV3A 4Z0NA 2WT9A 3N2GB 2IEIA 2LD4A 4X63A 3ZEIA 1FW6A 3MRVA 3WIBA 1YQ9A 4DLSA 5JBNA 4RIIA 2QY9A 3SZUA 5KNBA 1OT3A 5A5VA 3JQAB 2MMGA 4IVQA 3VU9B 4RC9A 1UFRA 1PNQA 3EISA 3K0FB 3PQ2A 2VHJA 4L8LA 3D8UA 5CPBA 5FWYB 3UMFA 1W49A 4FLFA 4DT1B 3E7DA 1QAOA 4IDPA 2UZ3A 5JYDA 1URPA 2P9YA 3TLBA 1AK9A 4U2FA 2EP5A 1DAEA 2CNBA 1MMFB 3L9WA 2P4HX 4MAFA 1EX6A 1TDJA 1YGPA 3LFUA 3ZE2B 3OQOA 2E1RA 2CV2A 4LGCA 4N3AA 2B1RA 2C9MA 1OAAA 4RD4A 3U56A 1F60A 3PDHA 4F3YA 3JQ7B 2IPMA 1J99A 2NO6A 4YQYA 3VKVA 4Z1MD 3P27A 2C2MA 3FCAA 4FFMA 1CFJA 1YFZA 2F48A 1W52X 3BTOA 4FSDA 4K7JA 2HRDA 4GF5A 2H65A 2GBFA 3L7DA 4PLTA 1DTWA 1DDIA 4QO8A 1D6JA 4PLWA 1A2OA 4YRAA 5L9AA 3KHKA 3V48A 1XRJA 4QQKA 1RYNA 5CYGA 1Z17A 3G6WA 5LB2A 1IY1A 1SCBA 5FBKA 3TLEA 2UKDA 2SKEA 4DY4A 2LDBA 2E4ZA 1BVYF 3GA0A 3AXSA 2WABA 4MRPA 3F2VA 3K96A 5ALWA 1FB5A 1SZPA 2PMWB 4L3WA 4UDOA 3KKEA 4MK4A 3NBUA 3NORA 3EH1A 1DAKA 1X1EA 1T0UA 2BZSA 3PVCA 4RJKA 2HWKA 3KU4A 1APBA 1RM0A 2X9LA 1XD8A 4ZK6A 1U3GA 1X9HA 2NVUA 4PO3X 1O95D 2MT9A 1N6HA 4XRGA 2CXTA 1KI2A 5TPZD 1TUIA 4QD3A 3QLUC 1RAIA 1PU2A 2R47A 2WD8A 4M1TA 3AFHA 5CYFA 5FJJA 1W581 2GVNA 3UV6A 5KJCA 2WSSA 2PPVA 4GLOA 4QPNA 4HWOA 3K9GA 1R0CA 4NR0A 3UIEA 1L7NA 1ILEA 1MC5A 5J5AA 3TW6A 4FFWA 5C7YA 1JLSA 2FKNA 4LOKA 3T3MB 1FIUA 3JWHA 1PQYA 2J59A 4H0CA 1T25A 1II8B 2HCFA 2XHZA 2CZQA 3GRAA 3HV0A 2IDKA 3OU7A 4QLOA 4ER6A 5KX5F 4MGKR 1FPQA 2AR9A 2CW5A 2Y1FA 3R0IA 2BEUB 3KFXA 4X97A 3R24A 5E4JA 4F5DA 3R3XA 4FGSA 3UFXA 1E8DA 3DLCA 4U6NA 3LT2A 4ZKEA 1FP7A 4EI7A 3CR8A 4G9BA 2P3SA 5IFLA 1Q19A 1FUKA 4RL6A 1F5NA 3R7WB 2CLCX 1CD5A 4F2DA 3I9NA 2ZRBA 3WKDA 4YI5A 4DEXA 4ZFNA 3VUFA 3OIWA 2ZJ4A 3DCNA 2P9GA 4D42A 4M0LA 3ZKWB 1EK5A 3WVNA 1VL6A 2JKVA 2CK3D 3U39A 2XLBA 2G9ZA 1WHSB 3V33A 4QEZA 1ZC3A 5JSZB 4FFSA 4OV6B 1WXQA 4D8XA 3P94A 2H6EA 2QGZA 4I5GA 4HG2A 1NY6A 2D5AA 4IVPA 1QORA 3CRRA 1ISHA 5AKXA 5A9TA 5KIAA 2ZTHA 1E1MA 3RPEA 1MAWA 4JVOA 4FEGA 1XALA 4EKEA 2MSDB 1C9EA 2Q27A 2AQHA 2YHAA 3GRKA 3H5TA 1ML4A 2G82A 3VUEA 1DMRA 3QOYA 1CZUA 1PWZA 4TMWA 4GBMA 4IUYA 5ALSA 1L4LA 3L6RA 5LM3A 1R6XA 4F3RA 1GPAA 3C8MA 3G9ZA 3IYLW 3NHZA 3NKLA 3SIRA 1IHYA 3F1KA 3OEWA 4CM4A 1T1RA 3NTRA 2R0QC 5EMJA 3R7WA 1BMFA 2NPIA 4OQFA 2B6HA 5FULA 2P6RA 1YWGO 4KX3A 1SRQA 4QM6A 3E4CA 3ZQKA 2VJDA 1HYEA 1LPOA 4QODA 4WEQA 5IT9A 5KNDD 1B1AA 2JFWA 1I3KA 1P9RA 2ZFUA 3CEHA 1NUSA 3KTDA 4L75A 4ZVRA 3UHFA 4W5NA 4F9TA 4OD0A 1KK3A 1ZGHA 2R8EA 5HKKA 2PGLA 3DOEA 5CAEB 2Y1CA 4EY7A 3KAQA 4G5RA 4FUQA 3KXIA 3AHGA 1PLJA 4ZJZA 1DFHA 1KVSA 5B2FA 3G2IA 3R6TA 1J5XA 3HUDA 1BA3A 3WRXC 2J85A 3GAZA 4G5SA 4G36A 2V55B 2EW2A 1ETHA 2IEGA 2NT3A 1PGQA 4DR5B 1BKDR 3ZS9A 2A0KA 3PNPA 3K1TA 3U5ZB 1MG0A 3ECSA 3GJXC 3K30A 3L4BC 1PZNA 8MHTA 2C3MA 1C9YA 2DFKB 5K4HA 2QQEA 4UAJA 4X93A 4AUKA 1PR2A 3RSSA 4X44A 3SX2A 1NJGA 3WGYA 5GIOE 3BCRA 1F6BA 3R5FA 3I34X 4ZRDA 3W9BA 3RSLA 1Y8QB 2F1IA 4H31A 4UUQA 3D1LA 1N1MA 1PQ4A 3GRVA 3CKYA 1R9JA 4R2WA 3T7DA 3ZE9A 5H8WA 5KNCD 3IESA 1ZD1A 5KDLA 5IDVA 4XDHA 2FWRA 1SIUA 3QY0A 4HAYA 4JR0A 5ABPA 5JD4A 5EUMA 3MJTA 2H5JA 2KX7A 1KDPA 4EBBA 5KAPA 1Y34E 4G8BA 1M8FA 3TZBA 4Z4QA 1SVMA 1WMSA 1X3LA 2A5JA 2IZ0A 4TT8A 3VNAA 1GZ3A 5IULC 1E1CA 3TE7A 1RC8A 2AYYA 5JEDA 3I9JA 2PRIA 3W8FA 1X7HA 4UBKA 5KC8A 2CL6X 2IUUA 2YUIA 4DY6A 2VYFA 3QX8A 3IO5A 1GCAA 4ITVA 5DHSA 3UANA 4KWCA 3WFZA 2FEKA 2WT8A 1DRVA 4PBSA 3W5HA 1P2FA 2IODA 4Z0HO 5HKKD 5L4NA 4BJ6A 4HPWA 5LDGA 2H4JA 1W87A 3BD6A 1XRLA 2WUGA 3ZWDA 3FH0A 1KJJA 1ZD2P 3RWBA 2CFOA 2WTUA 1UPXA 4XPZA 3HRKA 4DLLA 2PSJA 1YOVA 3S1LA 4R3WA 1G55A 3N6RA 4PPYA 4DDVA 5ITZB 1X7XA 1JIUA 4EO7A 5B6IA 1DEAA 3AI2A 3AV3A 3QV2A 2QV0A 3QVJA 3GNSA 3ZLJA 2IYSA 3PPIA 2C0CA 2EOAA 3F4BA 5CXSA 1CRPA 3FROA 1PG2A 1IAQA 1U5BB 3BULA 6ADHA 1U9IA 2G5GX 3FETA 5MFPA 3LL4A 4GGPA 1ECCA 5TX7A 3VZBA 3NANA 2HWUA 4RV5A 2OZPA 3ZWOA 3P2JA 4CVNA 2EWMA 3MHTA 1OROA 5L8VA 2COKA 2QN1A 3ROFA 4QYIA 3I62A 3F7OA 4GL2A 1N0VC 1G19A 2ZYUX 2C04A 1BHO1 4QDUA 4DPMA 5KTKA 1CC1S 4A6EA 4V0OA 5ECYA 1U81A 3AUUA 4GLFA 3H05A 3Q3GE 4K8RB 3DVAA 1YVDA 1REQB 3ZU2A 1T3ZA 1SKBA 3I05A 1IOLA 1T24A 4B0OA 1NVKA 5ISMA 3U0BA 1QZUA 5TARA 2YY5A 1DDOA 1EFVA 5H16A 2OV8A 4JJ6A 1WPXA 1UWVA 1HE8B 2O57A 4MVJM 3PUVA 2NVBA 4EJ6A 4CDMA 4FYXA 3FUWA 4I4TB 4KQ2A 4YCLA 3PXUA 2E18A 2A59A 4JASB 2MR6A 4FHDA 2FSIA 1X87A 2ZJAA 5I6DA 4AK9A 1SO8A 2BFCA 2RH5A 4HLQB 2O2EA 5TY0A 1JILA 3H84A 2C3PA 3EHDA 3NEYA 4FMDF 4JUBA 3AU8A 1ZQ9A 4MYDA 1IE3A 2C5BA 3CVJA 5E6RB 4CQMA 1DTWB 1IMOA 4R31A 5FBQB 3RHTA 3QVTA 2J30A 1Q0QA 3FD8A 4LOJA 4OGGA 3QSYA 1US8B 4KJZA 4DPLA 2ZYDA 5ELMA 4HQ6A 3PXBA 4M54A 2AWNA 1NFFA 1V11A 5M3BA 1TZBA 3QEBZ 4EFKA 3FCSB 4JI7B 1YRYE 4NCJA 3CF6R 5FF9A 4J0HA 1N5DA 4QOJA 3CPEA 5ADVA 3T1HB 1A8SA 2W2KA 3WNBA 4E5PA 5J2TB 4K9NA 2VRBA 5EFOA 4UXHA 1VG1A 1N6NA 4FOLA 1KWGA 2JGAA 4B9EA 4F4IA 2Q99A 4M22A 4ZMBA 3BWDD 4OX9Y 4IS2A 4L0MA 3EVDA 4H77A 2RK6A 4JLPA 1E6CA 3QM1A 2VPTA 5AD1A 1CSEE 3SYNA 4BX2A 4DCUA 1ONSA 1YR1A 3KHUA 1IWOA 2XZTA 4EZIA 4FKBA 2CKDA 3E1KA 3AVOA 1KDOA 1GZVA 4XM2A 1NRXA 3GH1A 3OTOB 2YOGA 4ABTA 2HJGA 1X86B 3AL2A 3LHFA 1AN9A 2PKWA 2IE0A 1ND5A 4MW1A 3U4MA 1N5MA 2BUAA 1L7EA 2P6NA 1ANKA 4XIGS 1T6YA 2ECKA 2H3EA 3K2EA 1ZX1A 3GUUA 3M0EA 4JZYA 5DH9A 1HQYE 3MWEA 3Q3HA 4A8JC 3GR6A 3LDGA 2GO7A 4H7DA 1E9EA 2AI3A 2OQIA 3IQDB 4W99A 2HXGA 2Z98A 3A8TA 5KHAA 2BRUC 5GTDA 4B83A 3QU2A 4M0EA 2ZIUB 3HR4A 2JCGA 4I66A 4YFVA 5ALVA 2VAPA 3QV1A 3RLIA 3UJ6A 1YR9A 1KAGA 2JBAA 3S1AB 1K06A 4MR9A 4N8SA 4ZVTA 3BRCA 3D6VA 2V7BA 2VYNA 2O3SA 3COJA 4C5AA 5IXJA 4AM8A 5LWQA 1YB2A 4XASA 2O3QA 5JHGB 2VYCA 1IJFA 1C7EA 2LNDA 2ZRPA 1NXVA 4QRHA 2SBTA 1Z3CA 4J9VA 5IKXA 2DWQA 3CEMA 1GQFA 2J4DA 4RESA 3T5GA 5AI6A 4LF4B 5KCZA 2OG1A 1RI3A 4XYGA 2JH9A 1VDZA 1PFKA 2QJTA 1QK3A 3CUEF 3KLOA 4ZMRA 2O3UA 5B7QA 1J7JA 2EQAA 2QHXA 3O83A 1HK7A 5E2IA 4JZKA 1H0HA 4A6XA 4K2HA 3R8XA 3ZJ5A 4JC5A 5GY7A 3VC2A 4D0NA 3CLUC 5CA1B 1M1NA 1YA4A 1F8UA 2AOUA 2Q7XA 3NIFB 2HF2A 2FGJA 5HK8A 5L4LA 1JIQA 1OSNA 1MAVA 3VNRA 4B6OA 1FNSA 3CCFA 3IE1A 1KMIY 3GZTB 5TPWA 4K05A 4OLFA 3PUIA 2COEA 1M7HA 4CMEA 1MVNA 2BT4A 1FDOA 4ROSA 5ED0A 4YREA 3TECE 2GXQA 3PXDA 2ZVQX 3GFGA 1XKXA 4M1OA 5EHNA 4BKOA 2BFFA 3LNCA 5HIJA 4G1FA 2JLUA 1UBOS 5A3RA 2P1DA 3KVRA 1RQXA 3S29A 3SEFA 5BQFA 1MQ8B 4XDZA 1C0IA 2LTAA 1QQTA 4P3PA 1EZ1A 4TTAA 2HR1A 5CM9C 3PKIA 4M8KA 4UXJA 1GPDG 2WU3A 4CJXA 1PUJA 2XUOA 4K9LA 2AG5A 1Y8RB 2CY0A 3I9V6 4XTRA 1B2RA 2GUGA 1N36B 1FLVA 3H11A 1ADYA 1YDEA 4PVCA 4KMRA 5C7LO 16PKA 2GMWA 3I92A 2RH8A 2NZ8A 4X20A 4Y1FA 2OZVA 3UCEA 3ZV4A 1V9LA 2BHSA 1P60A 3AWDA 1TLLA 1GKKA 4IV8A 4JB0A 3WB9A 4P5DA 5M04A 3O8BA 1CLEA 1XLWA 5BN4B 1JP7A 2VUTA 3U7GA 1I3MA 4BQNA 3BRWD 5HQTA 1IBRA 1G2QA 3FRJA 4FKZA 1DRJA 1V2HE 1ZUHA 5T67A 3G6KA 4XW2A 2VJLA 4B81A 2IKQA 2VF8A 2R5WA 4WLFA 4Z7QB 4HQ0A 1ZIXA 1G5TA 4LGVA 1ZKMA 2JK0A 4RVCA 1TUGA 1Q83A 2JDIA 3GDHA 3IJ5A 4D4KA 4F71A 1RXVA 4U7PB 1F8FA 2QORA 4X71A 1Y4SA 3BCHA 5IJXA 4GHWA 2WJAA 2NN3C 4QGGA 2A5FA 4NV1A 3U62A 1K5DA 3IQXA 3IDSA 2R96A 3IBTA 4AQ7A 2HGSA 3VYRB 2E82A 5BUQA 2XDYA 4LF7B 1DAHA 1QLWA 4OJYA 3IIMA 2C7BA 4IQ8A 1YOBA 1N6OA 4AYXA 1NXPA 3EMDA 3OKAA 2J5XA 2Y68A 3DEKA 2BLLA 3H5OA 5F3DA 3VMFA 3AY6A 3PEUA 4ZAGA 721PA 2IHJA 2O2HA 2PXXA 2WU8A 5CBKA 3X0DA 1QHFA 3FPEA 5FYDA 2O7NA 4HZGA 3RAGA 1Z4PX 4OXQA 3RVNA 5BMOA 2HTFA 2XOKD 2IZOA 4K6KA 2C5GA 3VNQA 2WRZA 4CV2A 5DXJA 4EDHA 4EHFA 2POCA 3EIUA 5AM5A 3N7TA 1ZGGA 1KJNA 2FU5C 3OJLA 4MVYA 4WL0A 3ZI0A 4EQ6B 4FIDA 1E2MA 5CB0A 2BFEA 2H54A 5G1NA 4KN6A 3AETB 2P4UA 2PIDA 3SM9A 1HEYA 3EBLA 2P4QA 1SC3A 3RUDA 2WWIA 3K9CA 4PQFA 5D00A 3TW4A 5JRZA 3CY6A 5SY6A 3ZHYA 2IP2A 2NUAA 3TNFA 4FNGA 5K0CA 2XF2A 1UM9A 4D9GA 3JS5A 3KKOA 4F60A 3JQCA 3BCUA 4K28A 3WP1B 1T0IA 1SKAA 4HNQA 1D6SA 2HIMA 2ZK7A 5HQ3B 3SJ7A 3KJFA 4OM7A 2QNRA 3OVMA 4GICA 4B31A 1X1AA 3DDSA 1N2CA 1NXTA 3DMGA 5FBVB 3A37A 1KO5A 5MN5A 3AG5A 1EDDA 2PV0A 5KDDA 1AA6A 1R74A 3KWFA 3GFQA 3NCHA 4TS9A 2RK4A 1QYVA 3NWOA 1NJ8A 2ZXUA 3I32A 3F90A 1C41A 1D5WA 2HCBA 2RBKA 3HLKA 4EHAA 3U16A 1KNQA 2A5DA 2WYWA 3E15A 3IPLA 4Y3UA 4C87A 5TPWB 5A0TA 2IYWA 1SQ5A 2C4TA 4MUAA 3B70A 2ATCA 4HAIA 4MA0A 5TMBA 4DXDA 5BR1A 3M6AA 1L7XA 5IAAA 2X7HA 4AD8A 1FFYA 5DOZA 2A94A 3QVLA 4BRSA 2XOKA 3O4GA 4IXMA 1OYYA 3AKCA 3FFTA 4Q93A 4YPOA 4TYNA 2ATIA 4ZO4A 4L6IA 1R10A 4MGYR 3BB4A 1O94C 4O63O 3TO5A 4A9AA 1XV5A 1E1QD 2HLNA 3C7KA 3L46A 4IHQA 4OQDA 1VKOA 4P84A 4LWZA 4EP1A 5K0FA 1CHNA 2RDMA 1R27A 1WMBA 2HMSA 1IQUA 1XD2A 3DAGA 4R2XA 5E1MA 5C31A 1OTXA 2C9CA 1EUQA 5F51A 3REQB 4Z4FA 4HB4A 4ARCA 1C9NA 2ON6A 4B4DA 2WDPA 2VTDA 1LNSA 4A26A 4DDHA 2F62A 2DG2A 1GTSA 5H9VA 4PQGA 1JHYA 1M1YB 2FPLA 3DCJA 2Q6IA 2FV8A 2ODEA 2Z43A 4AY3A 1OQAA 4ZCTA 1VBFA 4IDBA 3LPCA 4G4SP 3P5SA 3I5AA 4QXPA 1GCOA 4ALKA 3CN9A 2HSEA 3EVZA 221PA 4Z8XA 2C9BA 4BJ3A 1E18A 2Q3EA 4CM8B 3CVVA 4GKAA 3COWA 1NJFA 2EFEB 3P0JA 1AUOA 1Z4LA 4QVIA 2DRIA 3FVWA 2RI1A 3FKJA 4B71A 4MW0A 1R4NA 1Z7EA 3L07A 3JW8A 5BPHA 3TLXA 2Q3HA 2QUJA 3USZA 1PFUA 2BF4A 3LUCA 5CXXA 2DPGA 1SC4A 4BKQA 2WMYA 5FA6A 2BGKA 1PZGA 2D8MA 3SF8B 1T8TA 1CUZA 1WSWA 4ESVA 3Q1KA 3RFVA 3H2JA 1QOZA 1ZD8A 2ISSD 2XCTB 5CDYA 5ESXA 3PUJA 1U5CA 1UT5A 2AOXA 2G9RA 1UDRA 2YV1A 3VSBA 1MQSA 2FSSA 2AJ8A 2JASA 3MJVA 1R8QA 4FSXA 3F78A 4MR9B 4F12A 3GGOA 1N1DA 2ZJ6A 4MRNA 4HYEA 1FFAA 1TW2A 2UZ4A 1JR3A 1I3CA 1KVQA 3KHTA 5CGQB 2WYUA 1QTIA 2F1KA 1XRNA 2CZCA 1M83A 3D4NA 3FZYA 3L8CA 3OFJA 4G07A 4JX8A 4R54A 1FNBA 3W2GA 4OJKA 4BMCA 2PBLA 4EA8A 1YH3A 3PDIA 1UKZA 2E49A 1TECE 2HQBA 3B13B 5EC8A 2PQMA 2FSVA 4KLZA 3B6ZA 3ZY3A 3G8DA 2ZT8A 1E5XA 2VWGA 3B5EA 2QK4A 3BH7A 3QUTA 2V3CC 1G21A 3HEAA 3M5DA 3HY3A 3P9RA 2WF6A 1V8PA 4PNEA 5JMOA 3BK7A 4GGMX 1BWQA 1YZLA 1T8SA 2YHIB 5EE3A 1DPFA 2DQ4A 1O6GA 1EFDN 4MUBA 2CHFA 2L69A 2QX4A 3CEPB 1JAYA 4ND5A 1MDBA 3KQKA 4REQA 2Y1KA 2VQFB 4L73A 2AOVA 4RNCA 2W98A 1KWKA 4EYOA 2BFFB 4E12A 1HX7A 1QTRA 4M83A 1GGEA 5IEBA 2JLAA 1J9ZA 2BVNA 4YRLA 1EVQA 3LBIA 1TEHA 1Z33A 1E77A 1Y1SA 2RHMA 3PDIB 4IQFA 3T3NA 3TD9A 2ZUEA 1AQUA 1BFKA 1NV9A 4IDHA 1ESEA 2K5UA 4HMPA 1BOFA 5A3JA 1W5EA 5AW3A 2Q6VA 1MW8X 5E6RA 1TX4B 3PQ5A 4J2TA 1NXWA 2QAGA 3QP9A 3A3PA 3CE6A 2PUHA 5FLKA 4DMUB 3NYIA 2GD0A 4GMGA 3UQYS 1PHRA 4EK9A 1RHRA 2PBFA 3QKSB 2GS9A 2H85A 3EQZA 1P29A 3NM4A 1MAHA 4QDXA 3O9MA 1C7IA 5K0NA 1J1UA 1I7QB 3EY9A 1FOEB 4HGOA 3B5JA 4M8SA 1XZPA 4EUSA 2C4KA 1TMKA 4DV6B 1LK7A 1QP4A 5KVVA 3C43A 1LBHA 2GPTA 2QTGA 2UYQA 5A4IS 2IC5A 2XKKA 2OV3A 3GLUA 2AF4C 4URWR 5DRYA 5BSTA 1RRCA 3JATA 4BLQA 5HCNA 2QENA 2VKTA 4JCCA 1UUFA 4LYEA 4Z4IA 2QD4A 1F14A 1Y4DE 1ZL2A 1EB9A 2AN9A 5AVQA 1JHXA 3NHMA 5K05A 3MUFA 3MW8A 2O8DA 5LL6P 3CIOA 4QOHA 4ND3A 1JEYB 3T7EA 4EG4A 1U0NA 1HY3A 3AEKB 3DT6A 3EBPA 4TWRA 2XNSA 4V2IA 2XB8A 2QAGB 5DXAA 3F96A 4ARZB 2PSDA 621PA 4JV5B 1H1LA 4FR2A 2AXNA 3ROGA 3WAKA 4JLJA 5I7OA 1FXWA 4B79A 2EKZA 1NIPA 4ZHQA 1L8AA 2F1OA 3HKDA 3O4VA 2CFCA 3PX2A 4G56A 3B3AA 4IOMA 4NDNE 3BICA 5CX4A 4A16A 2I54A 1XNQB 3GGCA 3AJDA 4RPKA 3N0TA 3RANA 2ETXA 2QVLA 5EYPB 2A2ZA 3JD2A 1W44A 2YNMC 3FKSD 2GJAA 3EZXA 5CPFA 4AP9A 3KBOA 5FOXA 3ZGYA 4OJNA 2CNNA 1SXIA 2HUPA 4WCFA 2IF2A 4CLOB 5F9HA 4BQQA 3NHJA 5K3OA 2JC3A 4DLXA 2ZPAA 3IODA 2HHCA 1ESCA 2TMGA 4DJ5X 4F6CA 4CODB 1R37A 3EPRA 3MBOA 1RYZA 4CL0A 4D2IA 1M2KA 4IHJB 3B1VA 5TLSA 1H6BA 1TW3A 5BWLA 4H35A 2CV1A 2P90A 2I62A 4JMLA 3N8DA 2WVJA 3PHJA 1NUUA 3I1FA 3QTLA 3MT9A 2ILTA 3EXIA 1E99A 3ZIAD 3VSAA 4BUCA 1V35A 3KUCA 4H08A 2IEAA 4H4CA 2FW1A 4KKVA 5DT9A 3VDXA 2WILA 1MT0A 2D06A 1X8JA 2JGLA 3IT2A 3KE9A 3MSCA 4ROTA 4ZQFA 5EWJB 3ECAA 1ECJA 2C4HA 3QLVA 1XZHA 3UMMA 2QLJA 3MHPA 5B3AA 2O6HA 2XYHA 1GQRA 4F5YA 2QD2A 4D4JA 1A5BB 1CDDA 1GZSA 4ZOLA 4HEA6 5CT6A 4BAUA 3NP9A 4C76A 3JD1A 3RU3A 1ZJJA 4ACAA 4YCNA 1XEXB 2J0VA 3LVRE 3STWA 1CUEA 4GPZA 4MYRA 1O54A 2FMIA 4KO1S 4MKGA 1P81A 1FLDA 1W4CA 3LQRA 3T7SA 1QTQA 4XGIA 2I4RA 1LRLA 4MYCA 2OA0A 3W1WA 5J2UB 2WWXA 5TQ2A 2YHIA 5KTRA 1GL6A 2PE5A 3OM0A 4RENA 1WB4A 3K53A 4M1ZA 4DIMA 1SUPA 1Z5UA 5E4FA 4E11A 5FPSA 1DUSA 3EVCA 1EXWA 3UO8B 5KHOC 3DUWA 5DBFA 2EBHX 2GJSA 4J4HA 2P9ZA 5T4BA 4NCHA 5IABA 2ZJ0A 4QDTA 5T6BA 4UARA 4U8HA 4C7OB 3CIFA 3U4QA 1PGNA 2EKPA 1AY0A 4BLUA 1GG8A 4U7DA 5DF1A 4YWHA 5EIXA 1L7OA 1FQKA 2OCGA 3DBIA 3IMCA 3JQFA 3W8NA 2A1UA 4G89A 4OK3A 4XA8A 3SKXA 2WJ4A 1ZH0A 5GWXA 3NHKA 3T1VA 3C5VA 1ADJA 1DTEA 4PZEA 2BZ0A 2YTZA 2B5WA 5DTEA 2PUEA 3D31A 1QIGA 3DUFA 5I7SA 2BI8A 1EJ2A 1JXQA 1XKLA 2CFSA 1HF3A 3LF2A 4K6OA 5JECA 1J1ZA 2DQYA 4ZANA 2YASA 2EIHA 4HX5A 4DJEC 5B36A 4LGMA 2AQKA 2J09A 1UOPA 1D4OA 2H2FA 2XYPA 3PTLA 4JROA 2R2GA 1U7WA 1BQ3A 3NBZC 1B74A 4MEJA 6PFKA 5K9ZA 3KQNA 2NUTB 3BRSA 3EEYA 2QM3A 3AZQA 3IR7A 2IXBA 4I2NA 4X7RA 5A0FA 5F5XA 3IOBA 3TTXA 4DYHA 5UKDA 3SR4A 1HDEA 1GT91 5JZOA 3QLEA 4HDKA 1PJZA 4JLOA 1AKRA 1EJ0A 3JWJA 5K09A 1DG3A 2JD1A 1P91A 2CLEB 4MWEA 3DW1X 4NDAA 3WWCA 3STHA 2F7SA 1X1TA 4FWBA 2R62A 2YY7A 4HGQA 2W9XA 3ISVA 4TWAA 3STVA 1NW6A 4BNVA 4DLRA 3R6WA 4E5DA 1T9KA 4H16A 1P2DA 2YY6A 1SEPA 3U3OA 5JRDS 3PC4A 4KWTA 2XIJA 3HKDB 3FLMA 3WQBA 1XZLA 3TZEA 1K4KA 1YRLA 4GSKA 5JTTA 2Z9CA 4P38A 1P3JA 2N3ZA 5DTRA 3TLKA 3CTPA 1X70A 2JLZA 1DKUA 1UBUS 2K2QB 3TEJA 3DL2A 4C7XA 3AI7A 4YRIA 1Y6FA 1QPZA 1XDDA 1CUBA 2B9VA 4HWRA 3AR3A 1QDUA 1T6XA 3ACBA 4MV3A 5I7UA 3Q8LA 2EJWA 1TYBE 4CCWA 1UMBB 1BD4A 1X1RA 3Q9NA 5AHKA 5H83A 3RS0A 2B1QA 1G5HA 4AURA 5FR1A 3A06A 1JKMA 3KWJA 4DUZB 1UC9A 4EGAA 4WZBA 1GR1A 4L72A 1E1QA 5BQ5A 1KU6A 3QOFA 4EJSA 5LP6A 3COZA 3EGVA 1BW9B 5DHQA 5F23A 4ZV7A 1EDBA 2C77A 5CEEA 4HXGA 1T1SA 1P5ZB 3C16C 2WZQA 4DDKA 3O92A 2C0QA 5BY2A 1ZVVA 5F7XA 1KMCA 3VR6H 1RCTE 3AQIA 3EFEA 5HTKA 1E1LA 3PIDA 1CX9B 4G37A 1RPTA 4IICA 2X3UA 1T2DA 2GEFA 2R84A 2V9CA 4FFBA 2CVPA 3GT3A 1KE1A 4PC6A 2O5VA 3R40A 1YJQA 1G0OA 2V03A 1WDMA 3AFGA 3M4NA 4RQBA 2F8TA 1BXGB 4NZOA 5HGXA 2GVDC 1X7ZB 1ZOIA 1ZEMA 1ZHFA 2A88A 2B8WA 2XDQA 4LQLA 3H3FA 1E9RA 1O5TA 1H8EA 1GKLA 1VJGA 2IYUA 2W8BB 3E0XA 5COAA 4C7JA 5A4JA 2IIBA 2QRVB 3PUWA 1EGHA 3SYLA 2HPZA 4AIIA 4HSEA 5F5NA 2QPOA 3OKFA 4HDNA 4QHTA 3RC7A 1CUYA 4E3WA 4EQ6A 1SBZA 4J0EA 1P31A 3KTAB 3V9PA 3AF3A 2YIJA 1EXVA 3WWEA 1YE3A 5CDUA 2VJQA 2VP5A 5KJ6A 4PNZA 4QJIA 2WQ6A 3KR2A 2O0MA 5DASA 3TQQA 4J16C 1YONA 1GT6A 3D8SA 4MGIR 1U2ZA 1MPXA 1N0IA 2GBLC 2H11A 3NB0A 4MWDA 2ZZNA 5E8RA 3TW0A 9LDTA 1KY5A 1PJBA 4BEWA 2I4OA 3JTEA 4B44A 5C5CA 3AKYA 1X15A 3F97A 4UREA 4NENB 3QPWA 2Y0PA 2R6FA 3VOAA 2DHEA 3NVAA 4QUDA 4U2DA 1MVOA 1FRNA 1W2WB 3USES 2M32A 4Q3DA 4CFZA 5ERGB 2O05A 1NI4B 2O1EA 1W47A 2QLNA 3HNRA 1OR8A 5EQJB 3WICA 1I32A 3N2IA 1L8OA 3ICOA 2BBTA 4I99A 3HKBB 4M3NA 2PSHA 3AJ9A 5KYWA 1A76A 1IM5A 2L19A 2OM6A 4AY5A 4EHIA 5AW5A 3UAOA 4BTEA 2DT8A 1V0JA 1UBGA 1VHWA 1BN7A 2JK1A 2J9ZB 5IAEA 1KDVA 3HVIA 3K05A 3OX4A 4QBIA 4R0MA 2YKGA 1BZYA 5ALHA 3WKAA 1XWFA 1CYDA 2ONZA 4DCGA 5AM0A 3HHEA 2WHXA 1I4DD 3QF4B 4RKRA 5MDHA 1QZTA 1RAGA 2II6A 5DNUA 3EX7C 1K75A 4G6ZA 3UKOA 2XTAA 3L8DA 5ILOA 2AG1A 3HACA 1N5KA 4MRVA 2RGNC 1XCBA 1KAHA 3C5HA 1HPLA 1RQGA 1NBMA 3LVBA 3OKCA 4I81A 7REQB 3BK1A 2BFCB 3BJIC 1ZRNA 4OBBA 1VBMA 2ROQA 3TK1A 4BVLA 4ZDIA 1EAMA 1Z62A 1IBKB 1QP8A 1L6IA 1GTRA 1F7UA 1QH1A 3JSAA 1RYYA 1Z0AA 1EZZA 5DU2A 5JAIA 3GLGE 4IO1A 4FUTA 3JQBA 1ZJZA 3VYTB 1JHAA 1ECPA 1KI3A 3OZTA 2BW0A 3REQA 4R71A 5F1KA 3WYAA 4CHTA 1QC5A 1WVGA 2A86A 4JB3A 1UPFA 2WR8A 2ZCUA 3N70A 3ES9A 1GGVA 2HEIA 4BLPA 5K3SA 4XYLA 2P69A 1VP9A 2NO5A 4XARA 1GAJA 4BJHB 1YZQA 3N9IA 4U1RA 2VRWA 3QTTA 3HBJA 4NBNA 1NOIA 1KO8A 2XGOA 4HXFB 1Q21A 1RADA 3BQ9A 5G4LA 3ZY4A 4P0QB 2AYZA 3CRMA 5GVSA 1A77A 1C1HA 4QECA 4TTVA 1VTKA 3DNMA 2P5SA 3UWDA 2PLAA 4NHOA 4P7JA 4E2YA 2VPPA 3A3OA 3PT5A 3TPZA 3F3YA 1QJCA 4Z7JA 1MTZA 1L5SA 2YXDA 2MR5A 2XDAA 3BF7A 3JWIA 4NPCA 1TVKB 1XU4A 2BIFA 4L5JA 1G7SA 4OHPA 4RUKA 1D3AA 2PKRA 2FX2A 4YS6A 2X8JB 3FLAA 2YNMD 3CSUA 2QE6A 4JS0A 4GQBA 1RIIA 1A96A 1NSFA 2WE8A 2JI4A 3GOHA 3OETA 3JALB 1K6JA 1SEVA 3HN2A 1U04A 3KDPA 4MQBA 4WJZA 5AW8A 3NI2A 3Q5GA 5BT8A 2OC9A 3FNEA 4Q16A 1OOEA 2NTNA 2ZP1A 3P8ZA 1U4SA 1JVSA 4HADA 1BEEA 2AWOA 3GRYA 4CF4A 4NJEB 1ODKA 3E5NA 3LPLA 4OUDB 4ENWA 3HEMA 3ZX5A 2VJNA 1FE8A 1VE7A 3OZEA 4O0MA 3ZQ4A 1C4WA 1U7PA 2RBGA 2XE4A 4W9NA 1UDWA 3NHBA 2KPOA 3NTLA 5A71A 2QP4A 4EA7A 4OHWA 3EOZA 2WICA 4Q4JB 3VU0A 1RPJA 1JLMA 2OPBA 2CVQA 5CITA 3F7TA 1NVWQ 2MYUA 1KI9A 1A27A 1M10A 2VQ6A 2X42A 2ZQ5A 3AUFA 3AU9A 3GX1A 3HFJA 2F9FA 1C3XA 4I50B 3KQUA 2C99A 3K5IA 3U1TA 1Y3AA 1G42A 2WC1A 3DUFB 4C6TB 2H1RA 1Z5OA 2WKSA 3E8MA 3WYBA 1LQTA 2QRVA 1QG2A 3JQRA 3AHJA 4GOXA 2I2BA 4H7KA 1Q1BA 4LX8A 1LNQA 3HN7A 3W05A 5LSAA 2FP4A 3X1JA 1QF9A 4NCKA 4CF7A 1MA0A 4R84A 4K0RA 1AZLA 2G77B 3RC2A 2OGTA 3PWZA 1HT1E 2JFFA 3IAFA 2NACA 2PKCA 1MC4A 2QRJA 3DZJA 1E3JA 4G85A 2IFTA 4ZVPA 1SU4A 4GI7A 5AUQA 4Y6PA 3VC1A 3ZCVA 4E5KA 5L3SB 4OP2A 2V7PA 3W8DA 3EW9A 1TJ3A 2HRQA 1DX4A 1B3BA 2ZKLA 3AR8A 4IHJF 2ZUCA 4BMXA 4CDGA 4QT4A 2QM0A 3CPSA 1KQPA 4B85A 2AG0A 1G5IA 2P67A 1MOQA 4N0QA 4RNDB 4S1VA 3EMVA 5EIBC 1VIYA 1QVWA 3UJ7A 4EPRA 2BCJQ 5CIYA 3OI7A 1S01A 4ETMA 5C53B 4LJRA 1NQTA 2JDID 1O6CA 4BNNA 1W0KA 1V25A 3OTGA 5K8TA 2A0YA 4BLWA 4B3TB 4Y2QA 3VPAA 1Z5VA 3FDZA 1T4CA 1C5KA 1D2AA 2X1HA 1HTTA 1EVEA 2QX6A 3UWKA 3WGIA 3HLYA 3PE6A 1TCAA 2IXDA 3ZE0B 3FOFC 1P45A 2BEVB 3GFFA 5K20A 2FOXA 3HCFA 3KZOA 3HJFA 2HA6A 1BNCA 1A5SB 1GNQA 2W4MA 5JCJA 4EMBA 2ZYTX 4EPYA 1HLFA 1RZ3A 2VHTA 4GIBA 2C8VA 1CF2O 1K89A 4WVLA 1ZMRA