3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
molecule keywords Pantothenate kinase
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
2P5SA 3GEEA 2ZJZA 4TYQA 3H4MA 2PT5A 3U6BA 3TUZC 4D2IA 2W6IA 2C9YA 4WXRA 1TPZA 4OQNA 4O3MA 3K9GA 1N5JA 2Q0HA 4DHEA 4EPRA 4RFSA 5EZ5A 3JZMA 1XCMA 2QRNA 1D9ZA 3GLHB 4NU0A 4NYMR 4B6FA 3CH5A 1FQKA 2Z5FA 3EPHA 1SXJA 3FKSA 5FTNA 1ZUIA 2QN6A 1HURA 3M6AA 4L5BA 2ZE6A 2V3CC 3U44B 4JBWA 4TLCA 4C2TA 2FGKA 3FWYA 2Z0MA 4JVMA 1LY1A 4GBMA 2WZQA 1E2GA 4LJAA 4MH0R 4C0HA 2FOLA 2OZEA 3AVXA 2PL3A 1US8A 1Q1EA 4Q03A 2FV8A 4M1WA 5AJWA 3FKQA 2YOHA 2FWRA 1IN6A 3BFVA 3MWKA 3P26A 4XD7A 4FN5A 4P32A 3IQWA 2GXQA 2GCOA 3NBFA 4MYCA 4ASUA 3BERA 5JHHB 1NLYA 3B13B 2HYIC 2YKGA 1E6CA 1XMJA 4GOKA 2MSEB 4KSBA 2NGRA 4PZZA 4DLXA 2WWXA 4BEJA 1IY1A 1W47A 3T34A 3WXMA 1NJFA 2ANCA 1FW6A 1TX4B 1R5OA 3ZD7A 4QJ3A 1KJWA 1G9XA 2W2TA 3W5JA 2FGJA 1GKIA 2F43B 2FFQA 1ZW6A 4KV9A 3NTUA 3SJBA 1CLUA 3RYTC 3B1WA 2H5EA 3RRMA 2F3RA 3GJ7A 4OI0A 4IDPA 2HLDD 5EP3A 2DFLA 1NF3A 1TU3A 2C78A 4B33A 5JMTA 4IDHA 2YVUA 1SHKA 2IXFA 3ASZA 3H1TA 4GRAA 3J81k 4ZCLA 3AF4A 4W9MC 2ORWA 1XX6A 2RGBA 3M4YA 3QXSA 5G40A 5L3RA 3GEHA 2QQ0A 4HUTA 4RD6A 4I1OA 2C04A 5IK2A 1NG1A 3OFNA 1MR3F 2ZTSA 2GJ9A 3EWAA 4LHZA 4PAOA 4KSCA 2QE7D 1W49A 2J7PD 4WZBE 4F4JA 1D9XA 4FWTA 3PFIA 3A4LA 4MDEA 2ASEA 2G1JA 2QQEA 3PG5A 2AX4A 1WBBA 3QOFA 3TH5A 2A30A 2IYYA 3KB2A 4NYMQ 2WVJA 2AFIE 1NKSA 1XFAA 3BAFA 4A2QA 2O8EB 4EPVA 4LCBA 2RGXA 1AKYA 1S9HA 1G3MA 1J90A 4YC7A 3B9PA 5B2ZA 4QHYA 1PUIA 1E98A 4LHXA 1XTRA 3U7EB 4DLVA 4G5GA 3QPWA 2O8DB 1JR6A 4C0QC 4KJZA 2CJWB 1OH8A 1EWRA 1R0WA 1WP9A 2AWOA 2OHFA 4LJYA 3T5DA 4PPGA 2F9MA 1EFTA 2WIAA 3AM1A 1U94A 3EWSA 1TMKA 5JSZB 4JS0A 4C0JA 2P6UA 3V4RA 3QIAA 3LVRE 4IDNA 1A5TA 2A5YB 3C16C 4Q02A 3SBDA 1ZNZA 2ZAMA 5DLQC 4KVGA 2W2XA 4IFBA 4IW3B 5D3MB 5LDDC 1P9RA 1E9AA 3FHCB 1LS6A 2GBLA 1F2UB 3BH7A 1G8GA 3ZD6A 1RZ3A 2CMKA 2HCBA 3CLVA 4MGYR 1DAMA 1OXXK 2DYKA 3T61A 5CDFE 4DLRA 5EJEA 4KYUA 5CIQA 1ANKA 3SJZA 4Z54A 3ZDQA 4LJ7A 1FP6A 3SFVA 2XNDD 3W8NA 4JSTA 2XJ4A 3DM9B 4B3XA 1Z6AA 1DPFA 1KK0A 3F5FA 3W6OA 2IS1A 2R44A 4LBVA 2W6JA 3K9LA 3THXA 3AKEA 1G3IA 2DFNA 2O0JA 2BMFA 4OQXA 3W6PA 1XBTA 3RC8A 1T4GA 3QBTA 4DDWA 2D7DA 5KNDA 2ZU0C 5LPNA 4LJ5A 1KO4A 2ORIA 3LQQA 3H84A 1QDEA 1UDWA 1FP7A 1KK3A 2IX3A 3GCGA 1KSFX 2ERXA 3BFXA 3LVQE 4RFVA 3ZIAA 1ZVQA 4G0NA 5FPTA 3OEHA 2GCNA 4JLKA 2FFBA 2XOKA 4WAUA 4Q1EA 3AVTA 1QBKC 4P4TA 2XTNA 2OV2A 2V4ZA 1QVAA 4A6XA 3VR4A 1XTIA 3LXRA 1JAIA 1AZTA 1W4AA 2ZR9A 3ICEA 5A4JA 4V0NA 4DB2A 3K09C 3ADCA 1E9CA 2ZYWX 5HE8A 3T15A 2OFOA 1CBUA 2B7BA 2IL1A 2ZRJA 2XXAB 1XD8A 3ZIAD 1Q12A 2J87A 2H57A 3CKLA 3H86A 2N1BA 1YZLA 2VL7A 4B2PA 2YC4C 3QVVA 4R2IA 1N6OA 3CM0A 5KU1A 2EFEB 3QPUA 5BYKA 4PO8A 4P4UA 4B44A 4L16A 4OL0A 2C8VA 2XZOA 4PZYA 4PC6A 2F1JA 4JLBA 1II0A 2J46A 3QEOA 4KO8A 4ARZA 5K8UA 1KMQA 4OKSA 4AG5A 3REFA 1OSNA 4XWKA 3D31A 2ZSAA 1G17A 3U61B 4BPBA 3U4QA 5DI9A 2PZFA 2A9KA 1BMFA 1Q22A 3P4YA 2VBCA 3CF2A 4PSAA 1ZNYA 3R9WA 4LRWA 4B47A 2ZUBA 4E07A 2EW1A 4XVRA 4BLOA 4ZCMA 3WHLA 1ZM9A 2YOFA 2ZRAA 1SKYB 5D3MA 2F6RA 3AP3A 3FVQA 4RZ2A 5J4YA 4CT4B 1NLZA 1HA3A 3X2SA 2B7CA 4RKFA 4V03A 4QG7A 3QF7A 2AR7A 1TAGA 2EFGA 2P0EA 2JIZA 4D0GA 1W2GA 2R62A 3SS8A 5JJLA 2R6CA 5FOTA 1KO8A 2QRZA 2GHIA 4K46A 4A0HA 1NN1A 1T91A 1J7KA 1XF9A 4HAYA 4NTZA 2QBYA 3R9XA 1NG9A 3L2OB 1IJEA 3SYLA 4M9QA 2P6NA 1AN0A 2WICA 3KKPA 3KQLA 1MO5A 3QY0A 4LV6A 5EXSA 1KHTA 2IS4A 4JLVA 3RAPR 3QVUA 2L0XA 2MSDB 1T0HB 3KL4A 1J8MF 4IOLA 5BYJA 4LI0A 3PUYA 1XEFA 4B35A 4OQFA 4FD2A 4QJ5A 4U02A 1YZTA 2YC2C 1FMLA 1Z2CA 4F92B 5CDFA 4URYR 1LF5A 4NHOA 3FHTA 1J99A 1RPZA 3EX7C 4LHVA 2AXNA 2CHGA 3OIYA 3REGA 2R8RA 4D4KA 4LY6A 3C15C 4NYJQ 1GITA 4G3XA 4WIAA 4TZ0A 1G291 2FEOA 1IXZA 4ZDIA 2F3TA 3CO5A 2GESA 5JWRA 5E7MA 4PC1A 2JA1A 2NQ2C 2XSZD 1SKQA 1KKLA 2WOOA 3K70D 4D4LA 4L9SA 1PZNA 3TE6A 3WBKA 2RGNA 3GLFB 3VR3A 3X1ZA 2IBMA 1HQYE 4KI0A 3NG1A 3Q72A 1MABA 3FFBA 1HE8B 2WBLC 3A36A 5L8VA 4L4UA 3I62A 2G1KA 2DB3A 3KKNA 2BMJA 1E2FA 3U4QB 5BN5A 2Q6TA 3SU8A 3CWQA 3LO5A 3BORA 1W36B 5FI1B 5HE9A 1KI1A 1NMZA 1ZM3A 4Q66C 5TVKA 5KO2A 3FMPB 4M4SA 4UNSA 3RWOA 4ZV4A 3CZQA 1U9IC 4GP7A 2QMUA 4EPTA 1K6MA 4D26A 3HJNA 5E95A 1KY3A 3V9PA 2O8FB 5E7IA 5FPSA 4M1SA 5BN3A 3EZ7A 1KI7A 2OFWA 2FPLA 2ANBA 4OHZA 2ZSFA 4BFYA 2JLQA 2C99A 4QGAA 3AUYA 2A5GA 3U5ZB 2ECKA 2GDJA 5FOUA 4WW0A 1KK2A 1QG2A 4FI3C 2FSFA 2QTHA 3PENA 4NH0A 3TLXA 3TVDA 1C9KA 2EFCB 1AK2A 1KSGA 3A4NA 4KCGA 3LLMA 3NH6A 5FBRB 4EPXA 1DEKA 3E5HA 4Y0VA 2FZ4A 4PQYA 3GLFE 1TADA 1I4LD 1U81A 2CVFA 3CRVA 4D4JA 1E3MA 1ZU4A 1G3RA 1VDZA 4TMVA 1A4RA 1F60A 4JLOA 4IDOA 2VP9A 4R9UC 2VHUA 5J4HA 4GPTA 4MGKR 2J45A 4M21A 1DADA 2EFDB 1S3SA 1XB2A 1XZPA 2CVHA 3VHXA 3QF4A 3AVYA 1E99A 3R9IA 3E1SA 3N5CA 1VYVA 4Q1DA 3U3MA 1AGRA 3ZVNA 2QAGB 3BB3A 4HB2A 4JIMA 4WZAE 5H68A 4BUJA 2GWHA 4JT2A 2FFAA 3K53A 2FDCA 4M0LA 3ECCA 2QAGA 3MSXA 4M1YA 2GAAA 3DZDA 4X8LA 3V4FA 1YR9A 4U5XA 3ND9A 4XSHA 3BWDD 2H17A 4G01B 1RRCA 1HYQA 2W83A 1F6BA 4QNMA 2D74A 4AIIA 1Z63A 4C2UA 1JJ7A 3IO3A 4LBWA 1E1RA 1F2TB 3OEEA 4JLMA 4DLUA 5FTLA 2G0NA 4NCHA 2WKQA 4LJ6A 4V0MA 5JWHA 4A6PA 1WRBA 2IK8A 1ZC4A 2I1VB 3CF6R 5KTYA 4RJLA 3NBXX 1YRBA 3G82C 4IOMA 2G88A 2MSCB 1Z22A 3IBYA 4JBYA 3AGQA 1GRQA 4QBFA 1TUIA 4N3NA 1R0YA 1YJ5A 2F9LA 5TDHA 2GCOB 2VRWA 2AFHE 2NZJA 3WP1B 2C96A 3Q5DA 1FMJA 2CL7X 4C9BA 3CR8A 1XPRA 1ONBA 1SKYE 1T8TA 4DWJA 5E7JA 3TSOA 3MG9A 4HATA 4PXAA 2X1VA 3ICQB 2C77A 3I4LA 2GAOA 1PLKA 1CR4A 4PTLA 4O2LA 2WJVA 4XJXA 4BFZA 4B43A 4LV8B 2WHXA 3KQHA 1YKSA 3AF0A 3QJYA 3TAUA 1OXSC 2OESA 2Q21A 3GJ6A 1ZM4A 4XOIA 2R6AA 2RGNC 5B64A 2RGEA 5SZJA 3B2EA 2ODBA 2JJ8A 3DEFA 2FEMA 1HTWA 4BLRA 3SYNA 1EESA 2DY1A 1EG7A 2ZJ5A 1GDDA 2GJSA 2CE2X 2D7CA 2X2EA 5CB6A 1OH6A 4KFSA 4QGHA 2ZREA 1KMHA 3QXHA 2ODNA 4MKFA 1JEEA 1P72A 4ZPXA 5KHOC 4GNKA 5C4MA 2PEYA 1Q44A 1GP2A 4RKEA 1P75A 2R6DA 3CWZA 4ESVA 1P2SA 4D82A 1ZNWA 2O8DA 2HT1A 1X1RA 2OAP1 3W34A 1N6HA 2Q3MA 3TAHA 5FPKA 5F9FA 4Z51A 3QPVA 3Q3JB 3AVUA 4Q4AA 2KB0A 2J0UA 1DVRA 2CLDX 1CIPA 1GTVA 5KNBA 3T1QA 1Z0AA 2ONJA 3RS4A 4C30A 2VP4A 2J0UB 3LA6A 4U7DA 4DSOA 4M22A 3AGPA 1GSIA 1D2MA 4AI6A 5FPYA 5TV2A 1E9DA 1KSJA 3NEJA 2XB2A 1DG3A 1E2MA 3U44A 4O0MA 1W4CA 4AYWA 1HH4A 1LV7A 3U3KA 1FNMA 4HLDA 4UXIA 3LBNA 2NIPA 4NP6A 1SHZA 5A0FA 3ZZUA 4F7WA 1JR3E 4B6EA 2ZUCA 1W0KA 1ZM7A 3N70A 2F1HA 1MH1A 4IOKA 1S0UA 4QC2A 1TEXA 5DHFA 3MUFA 4PSVA 1XPUA 3CNLA 4RD0A 5C4GB 5L3VA 1VCIA 3AF3A 2ZJOA 2BKEA 3U7HB 1OIXA 2IYSA 3F3YA 3GQBA 4LYAA 3RANA 1VCOA 1IQPA 1DOAA 1JQJC 4AK9A 4PC2A 2RHDA 4XVQA 3ADKA 1XXHB 2ORVA 2NOAA 2WAXA 2HDNB 4Q1BA 4B74A 2QGNA 3BIFA 3TSWA 4R98A 3U60B 2CNWD 3WYFA 4PAMA 2QEQA 4GMXA 1KO1A 2OUKA 3O8BA 4CEIA 1NSFA 5F2EA 1NI3A 3VNVA 4RCZA 1S1MA 3LY5A 4A0GA 3A1SA 3ADDA 3AVOA 1FOEB 4YMVA 2GETA 4M9ZA 3I73A 3A1UA 3RDPA 1OIVA 2YZ2A 4DXAA 4MYTA 3W6NA 4EFLA 1W44A 1Z6XA 2XB4A 1E9RA 4B3DA 5CM8B 1LF0A 3ZS9A 3HR7A 3HPQA 1QHXA 4NE2A 1YR7A 1E2EA 4XTRA 8OHMA 5JFGA 1IN5A 1KNXA 2ZI9A 3QKSB 4Y0AA 1NBME 3SYKA 3TUJC 4C0BA 2J9RA 2QT0A 3IHWA 5JJKA 3A8TA 4Q4AB 3TJZA 1HT2E 4QJ4A 4FCWA 2BM1A 4LHWA 4BLTA 2J0QA 3ZH9B 1UFQA 4DLWA 1EX7A 1GRRA 3L8ZA 3AQ4A 2D2FA 5DGXA 4URXR 4BZQA 3LQRA 2MMCA 3CBQA 3SHWA 1IN7A 4S2EA 1XTKA 1U0HC 4GSYA 4ARZB 3PEYA 5DYIA 2QPTA 4AKGA 1NVUQ 2IUUA 4Q21A 1RJ9A 2CL0X 2GA8A 4HYYA 1MT0A 2PBRA 4GOJA 1AQYA 2BEJA 3EPKA 3IEVA 3LDAA 1Z0KA 2A78A 2VSOA 3ADBA 4JVNA 1WA5A 3ZYCA 4CYMA 2CJWA 1MOZA 4GFDA 5C2JB 3I5YA 4GDFA 4I99A 3AVPA 2G6BA 1FUKA 4AURA 4URWR 3X1YA 1N6KA 2E87A 1E94E 2IYZA 4DSUA 1JR3D 1AS0A 4B73A 3BJIC 4DUGD 1G5PA 1W4BA 4V0OA 1CR1A 4YONB 3R7WA 1BKDR 5SZKB 3BB4A 1G19A 2HF9A 4D0NA 4E5UA 1YZGA 3KJIA 2Q9AA 1VHTA 1KSHA 2G83A 4TL9A 2VSXA 3KUCA 3WMFA 2O8CA 3QENA 2P65A 3D7MA 4K8OA 2BOVA 4OJKA 4TTQA 1IY2A 1SVSA 3SDZA 2QY9A 2GXUA 1Z6GA 3B9QA 3ZVRA 4NDZA 3UPUA 3BK7A 1ELOA 1G8YA 1UKEA 2JEOA 3NVAA 2IUSA 1E0AA 1G5RA 1N0WA 3FMFA 2OCYC 3I72A 1XNJA 5JI2E 2FPKA 1I2MA 1XDBA 2ZJAA 3TUIC 1W7AA 4O2RA 4RZ3A 1RE0A 5EE5B 1EFUA 4DLSA 2VHTA 2RKOA 2XNDA 1QHHA 3M0EA 5J4KA 4HAWA 3GLIE 3HYTA 2VHJA 3WHKA 3SQXA 4OK5A 2QMOA 5FR2A 2PJRA 1ZYUA 2HF8A 1MO3A 121PA 4BECA 1A82A 4IXMA 2WJYA 4KXFB 4TL8A 2FZLA 5FTJA 4DDUA 1E0KA 3RABA 5FTMA 5EP2A 3MRSA 4BASA 1DAFA 1VG0B 4Q1FA 4J0QA 4G5OA 1P73A 1LFDB 4PANA 1ZU5A 2I3BA 4JT4A 2BBOA 2ZM5A 2PZEA 1F3OA 4MYHA 2Q9CA 5JEEA 2ZRFA 2FA9A 3A58B 4DRZA 5DIFA 1G18A 3U2QA 3FMIA 5GVSA 3RRZA 4HZIA 3AKDA 4CRWB 1E2HA 1XMSA 3ZLJA 1E0JA 2CHQA 3ZS8A 1NL3A 3QKSA 4FMDF 3GLHA 2J1LA 3WYGA 2DFTA 3IQXA 1V43A 2PX0A 2FFHA 1RYHA 3CRW1 4CEJB 2GZDA 4HDOB 1TUEA 5AR1A 4B32A 4QBIA 3IHLA 4A4DA 3CRQA 4JYBA 2NPFA 3DMNA 3PJRA 1GL9B 1S2MA 3THWB 5JHGB 4ACBA 1D8TA 2ZS7A 3BB1A 4XD7D 1NVVR 2A7QA 2UVQA 4URUR 3RSOA 4CEHB 1KGDA 1F48A 2IYTA 2OILA 2P2LA 3K0CC 3R8FA 2J0SA 1XU4A 3T12A 2CL6X 2ZRMA 1LVGA 5L3QA 2CNWA 4TMZA 3LBHA 3ND8A 3Q5EA 3X1XA 1FTSA 2I1QA 3B82A 4Q4HA 4YDHB 4ESHA 4TZ6A 1G64A 3PEVA 5F98A 2GKSA 2AD1A 1OXUA 1E2JA 1OE0A 2C98A 1RRPA 5AJYA 4QM6A 5DO9A 1CKEA 3RC3A 4TMXA 5BWMA 1JQLB 5AK0A 4M1OA 1R0ZA 1NN0A 4HZUA 4LPKA 4DZZA 4F91B 2P5TB 1E79D 4LC1A 3MCAA 2D3WA 1YE8A 3GLGA 4NCNA 4AD8A 4RD2A 4EQ6B 1XXHE 2ZI6A 4BFUA 4AKIA 5SZHB 3WMGA 1JB1A 1GNPA 4BLPA 2ZJYA 1YR8A 3UIEA 1P6XA 1ZUNB 221PA 1CJVC 3C8UA 3PR1A 1RIFA 2ZAOA 4CF7A 2RCNA 4D25A 1M74A 2QAGC 1E2DA 4BFXA 2XXAA 3CNOA 1HUQA 3O8RA 2OXRA 2GTPA 3GLHE 5K8IA 1G6HA 3VR6A 5B57C 4LC0A 1UBFA 1W5SA 5JRZA 5SZIA 2OM2A 3I32A 2GF9A 1UKVY 2IYWA 4HLCA 721PA 4FINA 5ELXA 4OQLA 1QVRA 2PCLA 2WSMA 4JYCA 3EZ2A 3HWSA 2GEUA 2YV5A 2X2FA 5GJVC 5HKKA 1JXMA 1XMVA 3OEED 5ANRB 1SXJD 1EFHA 2KE5A 4KYIB 5BW8A 5CYPA 2QSZA 3A1TA 2WMNB 1AS2A 2J41A 4B34A 2J0VA 5FFMA 1G4UR 3CH4B 1TQ4A 3CX7A 2FPMA 4KFRA 1E2PA 1P3JA 4LJ9A 1OB5A 3G5UA 4CW7A 1ZIOA 4LBZA 2OE2A 4YLGA 3W3ZB 1VG1A 4DBLC 1DAGA 1W0JD 5D3QA 3UMRA 1N2CE 3KKQA 1UBCA 1MKYA 3FE2A 4XSGA 3DDCA 4M9XA 1ZCAA 5P21A 2FSGA 2GILA 4CEIB 3I92A 4JMPA 4TT3D 3EARA 3NH9A 521PA 1G16A 4HAZA 5EUMA 2R6FA 3L0PA 5TB5A 4TQUS 1NVXQ 2IF2A 3RLFA 1XCGB 1OH7A 2AN9A 2IHBA 1OXVA 5EXTA 4BFWA 3MLEA 2QBYB 3BGWA 1NSTA 5JS7A 4UQOA 2OCAA 2H1LA 3QG1A 3SE0A 4Q9IA 2J3EA 4Z1MA 2B8WA 4LJ4A 4KITB 2IS6A 4JLNA 4NPHA 3R20A 4OK3A 3SBEA 4HDCA 3NBZC 3LLUA 4I4LA 5CB8A 3VQTA 3M1IA 1FX0B 1G5TA 3KTAB 4R71A 1G41A 1OB2A 5EE1A 4MKIA 2JJ2A 1Z0DA 4BE7B 1G7CA 2AWNA 3OIWA 3KXKA 1C1YA 2GBLC 1VIAA 4TLAA 4AKEA 1OYYA 3EW9A 3DL0A 1XD2B 1ZM2A 4G1UC 4HZUB 1Y3AA 1OKKA 2JLRA 2HT6A 2F1RA 2ZITA 3IILA 3OZXA 1OFIA 4FXPA 4PZLA 1F2TA 4MA4A 4WBSA 4QFMA 4MYUA 2WV9A 4B3BA 3QXCA 5M04A 1M7HA 2GVDC 3EASA 2CLSA 3TGPA 2WOJA 4IKEA 3I8SA 4DKXA 3KKOA 2HLDA 2Z6VA 1A7JA 3THYA 1N5KA 1RW4A 4MRSA 4CT5A 1KDOA 2OT3B 4BGDA 2GNOA 3JVVA 3QSYA 3VKGA 2ZXUA 1WDTA 1PLJA 5FOXA 2OG2A 3AVWA 4MRVA 5CLQA 2WPDD 1NLFA 1XXHA 3K0AA 1KKMA 1WCV1 3CB4A 1O3YA 3EIQA 4PPFA 4Q47A 3SQWA 5L3SA 4UNRA 2ZVQX 1DG1G 5FUWA 2ZQ5A 4D81A 3ZVMA 2WMOB 4IOJA 4V0LA 1QZXA 1G8FA 1Z5ZA 2NPIA 2A2ZA 3SZRA 4A0FA 4JL5A 1S3GA 1LNZA 3OAAA 1B23P 1CR2A 2F7SA 1JXOA 1G7RA 1VCMA 2YWHA 1HV8A 2F43A 2QE7A 2P6RA 3UWOA 4P0TA 2V6IA 3A37A 3L0OA 3AF2A 4CVNA 2B92A 3KKMA 4Q9LA 1CEEA 2AK2A 1AA9A 3CRMA 1BYIA 4URVR 3B78A 4ERNA 3H2YA 1D5CA 4MITA 1OF1A 4EJSA 4KHZA 3C7KA 3CW2A 5FL7A 1W36C 5G41A 3A1WA 2Z4RA 3PCRB 2IYRA 2KBEA 3GD7A 3EZ9A 1Q3TA 1KNQA 2QMHA 1KDRA 3LX8A 2GXSA 4EIWA 3VR1A 5C46F 5G3YA 3FGNA 5HR5A 4BFTA 1E0SA 2JLSA 2BDTA 1G7TA 1YR6A 1J70A 4DLTA 1EWQA 1E1QA 2ZUDA 1E79A 3GFTA 1T3HA 1RKBA 4A2PA 1GKYA 2NO1A 4W5WA 3RS7A 3WNCA 2YWGA 3BRWD 1YZQA 4ZDJA 4URZR 2O8EA 1TL7C 2IT1A 1AM4D 4KBGA 4OQMA 3FDIA 1CJUC 4PR0A 1IAQA 2IXEA 4IHQA 1VMAA 1JALA 3IPXA 1CU1A 3QE0A 3UWKA 5BXQC 2IS2A 2X8AA 5HKKD 1MRNA 2OBMA 3DM5A 1H8HA 5LD2B 2OEPA 3O8CA 1VPLA 1R5BA 1MRSA 2UZIR 4JL6A 2BM0A 1R8SA 3THOA 3GP8A 2HXYA 4P33A 2BBTA 4F4CA 1P5ZB 2QTFA 4LSGA 2ZJBA 4HB0A 2QG6A 3EZFA 3THWA 1U8ZA 1JI0A 1R6BX 3OIUA 3ZJYA 1BH2A 1E96A 3VAAA 1E2QA 3OIVA 2K5UA 3Q7PA 4N0DA 3RS3A 4RCYA 2X77A 3B1ZA 4TTPA 1KYIA 1XJCA 4OJQA 1OFTA 2ZE5A 2JLYA 2LKDA 2ZU6A 2RGGA 1FTNA 3CNNA 4NKRA 3CPEA 4PX9A 1N0VC 5DI3B 1UM8A 1LS1A 2AXPA 2V7QA 2ZRPA 3HR8A 1XWIA 3KXIA 3U3JA 1OFHA 2QORA 5DHAA 4HEJA 2JLXA 2XEXA 3NBYC 3K9NA 3T1OA 5EE3A 1MO4A 1JNYA 3LW7A 1OPXA 1QHYA 2C9OA 2H16A 1NBMA 4PO1A 4TL6A 3AP2A 2O8BA 4B75A 2W00A 2FG5A 1JPNA 2GEDA 3MWJA 3PITA 2D06A 4B2IA 2QGZA 3FB4A 3KB1A 1Z83A 1Z6YA 4Q7KA 4X8HA 3UMSA 1QG4A 4EFMA 1HT1E 1R10A 3DHWC 4DCUA 2IW3A 3U3OA 4O25A 4TLBA 5IK2D 2WWWA 3TK1A 4M8NE 1VKJA 1F5NA 3W5IA 1QF9A 4ZI3A 5DYGA 5H1YA 1D2NA 4JVSB 4EJSB 1Z47A 3T35A 3SN6A 2IYLD 1WB9A 3SNHA 4A8JC 2KI5A 2ZRDA 2HEIA 4FMCB 4IJMA 2PT7A 1L8QA 1KTVA 2TMKA 2Q3FA 2GJ8A 3B1XA 3EA0A 1EFCA 1KI9A 1ZIPA 3CZPA 4UXHA 1GZSA 4GI7A 1P7CA 1Z8FA 1G7SA 2H8KA 3CONA 3KJEA 1IONA 3UXMA 1UPTA 1NVVQ 1ZRHA 3JZAA 1KDTA 3B1YA 3OE7A 4X8OA 5JS8A 5JSZA 4QNRA 3C5CA 5GJBA 3PUVA 3T1VA 3FMOB 1JEDA 3OFND 4DIDA 2FSHA 4AYTA 3MFYA 1OT3A 421PA 4EJSC 1OHHD 2IA5A 4A0RA 3TRFA 2RB4A 2IEZA 3QXXA 3VU9B 5FBQB 2Q9BA 5AJZA 5BQ5A 1Z07A 5CLLA 5KSYA 3AKCA 1ZBDA 4PHGA 1GAJA 3BD9A 1R2QA 2JATA 2QU8A 4FCVA 1VHLA 1IN4A 4JJZA 4Q7JB 1LB1B 2EU8A 4M1MA 2ERYA 4RD4A 3ZZ0A 1DAIA 4M9SA 3WNBA 3I8XA 4PPNA 1Z0IA 4CEHA 1E2IA 4C3ZA 3KJGA 1FZQA 2VHQA 1AIPA 4KBFA 1HEIA 4ZCIA 2QT1A 2PX3A 4CIDA 4YMTA 4R7ZA 1CJMA 3MMPA 2CLCX 2VQSA 1XD9A 2NO0A 2HUPA 2JGNA 1FQJA 3VKWA 1J8YF 4FIDA 4Q4JA 4RZUA 4DCTA 1L4UA 4QHTA 5FBWB 1UEIA 4LGMA 3ETLA 4DCNA 4IXNA 3QF4B 2ZRCA 4KODA 3KZ1E 3QNUA 3LRPA 1M6NA 1BMFD 5J4LA 3GLIA 1X6VA 4DT1B 4AKHA 5GADl 4LOAA 3PUXA 4QOSA 2XOKD 3MJRA 3EG5A 2RH5A 1XD2A 2DPXA 2PH1A 4P31A 4DLYA 2GJAA 3VNUA 3HU2A 1Q57A 2ZYVX 5CJPA 2VP6A 2C95A 3HPRA 3WYAA 1A1VA 1V5WA 1Q0UA 2H92A 4ZIRA 1U9IA 1E2NA 2EYQA 2VSFA 2EWWA 4NYJR 1GIAA 4UKDA 4RZXA 2W2VA 3K0FB 4QRHA 2CXXA 2D4HA 4B3CA 5KDDA 1KO7A 621PA 2DWQA 2QSYA 4US2R 2WWGA 3B5JA 3F0TA 3W8RA 1N25A 2KBFA 2C03A 4KU4A 3EPJA 2C5LA 2DCUA 5DSZA 1KI6A 1QRAA 3K1JA 3OE7D 3CRRA 5EP1A 2DHRA 4AYXA 3UG7A 5IT5A 2XGJA 1VG9B 2BMEA 4H1UA 2X19A 4EDHA 1DE0A 3U7GA 3DMDA 3QI2A 1JECA 3W9YA 3G0HA 2KSQA 2GK6A 2ZJ2A 3LV8A 1SVWA 1VCNA 2IEYA 2Z4SA 3K0EA 4DIEA 3RS0A 3LX5A 4Q7MB 3L43A 4LBYA 1W48A 2OLJA 1IBRA 1H8HD 3B1VA 5C18A 1T5LA 2WSSA 4YMUA 2IWHA 4NBSA 1CS4C 1TTTA 1N0UA 3VX4A 5EZ6B 3WRXC 3ONWA 4WXPA 3QUSA 1SVIA 1CF4A 1Z3IX 2IYUA 1GKUB 4MRRA 1KZ7B 3CR7A 5HTKA 5DE3A 3NIBA 4C7OB 1W0KD 2ODEA 1DO2A 3R7WB 5JEDA 2YWFA 1QHIA 2E9SA 5EE9A 1AJEA 3GJ0A 3RRYA 3PEUA 4ZDKA 4IFEA 4MDFA 2ONKA 4BWYA 4M1TA 3TVTA 4F4IA 2XZLA 3HYRA 5J47A 1I4TD 3EIHA 1FX0A 4XH9B 1E2LA 1AGPA 4HAVA 1R4AA 4U00A 5JBQA 3K0SA 1FNNA 1PJRA 4RVCA 1RRFA 2AL7A 3SJAA 5AJVB 3RVBA 3SHFA 1OIWA 2KJQA 4OHXA 4UJ5A 4PO9A 4A2WA 4B2LA 1X1SA 2ZR0A 2ZR7A 1B0UA 1GILA 2O8BB 1II9A 4HDQB 2NO9A 5KDLA 2DR3A 3SEAA 2N42A 3NEYA 4HUQB 5LB4A 3ZZTA 2KWIA 5AWFC 3EC2A 3HU3A 4RFSB 3KQUA 4Q5IA 3UATA 3AVVA 3K9HA 3VHLB 1E9FA 2ZI7A 2IYXA 2PEZA 2OBLA 1L2TA 5DNYB 3GLGB 3VMFA 1RC8A 2JLVA 4ABYA 4YXWA 4DT1A 2PLFA 3LH5A 1IJFA 4QM7A 3JVUA 3BH0A 1UF9A 3GMTA 4DLZA 1QHHB 4NCIA 4FMCF 4C4PA 4ZDWA 1COWA 2I4IA 2P3SA 5HZHA 1Q20A 3Q7QA 1DS6A 5JLJA 3KFXA 2LWIA 2P67A 4A36A 5F9HA 3SJCA 2WJHA 1TU4A 6Q21A 2LCFA 1QHGA 4DEYA 1U0JA 1AQUA 2BV3A 5EE0A 4BZXA 2VLIA 1R0XA 2WJIA 5FUVA 1KI4A 3NKVA 1NN5A 1N5IA 1JAHA 3OF5A 2OSBA 1PLLA 2DWPA 3X1DA 2WWHA 2FMXA 3OAAD 4UNPA 4Q9KA 4OHYA 3V00A 3MJHA 4ZKEA 5GVRA 2VH5R 2RGDA 2ZVPX 4LYFA 1SVKA 4DUGA 4HB4A 2CK3A 4PFSA 5L3SB 1NBMD 5H8WA 2GZHA 4A8JB 2GK7A 4M53A 2V1UA 2IYQA 3GJXC 3I1FA 5CM9C 2EVWX 4TN1A 1X8KA 1BOFA 2QL6A 1ETUA 1JJVA 5JCZA 1M8PA 1D6JA 2ZYUX 2FE4A 2RGCA 2JLWA 1KAGA 2HJVA 5EP4A 3TR5A 3KUDA 1DAEA 2V55B 4W7SA 2IF0A 3DPUA 2BC9A 2YWEA 2NMVA 4HLQB 3R8CA 1CP2A 4PC7A 2A5FA 1DELA 3ZQJA 4MUBA 3KJHA 1U98A 2RHMA 2ZRLA 1I2DA 2UZ3A 1P61B 4MGIR 4YQFA 2JIZD 3AKYA 4Q7LA 1NMYA 2JASA 1T0JB 3ZGXA 3QG5A 4KLZA 4TSFA 1FPMA 2OO7A 3NWJA 3SOPA 3P27A 4TT3A 821PA 2QPOA 2ZE8A 4JLDA 3TQFA 4AC9A 5K8LA 2JCSA 3CX6A 2CE7A 3T5GA 3CIOA 1N6RA 3S1AB 2BJVA 4Q4HB 1FUUA 2D62A 4MRPA 4MKHA 4MRNA 1XEWY 1K5GA 2ZIAA 4QBHA 2JJ2D 1S4QA 2JDID 4LJ8A 5EXPA 3RWMB 1OLOA 4EAQA 1NJGA 4Z8YA 1OV4A 3BE4A 3KTAA 2ZETA 1US8B 3CF0A 2XZPA 1W0JA 3L0SA 2VHCA 2YYZA 2W6JD 1G3UA 3RRNA 4UNNA 1P9WA 4DSTA 1PV4A 3DKVA 1N3BA 2FF7A 1NY6A 1U8AA 3VU9A 4NL4H 4GT1A 5KUTA 5F3WB 2IYVA 4ZKDA 1P2VA 2WJGA 5KOYA 1M1YE 4IEEA 1NRJB 1H8ED 2QNRA 3EAQA 3EIEA 2VP0A 4IRUB 2W58A 4DJTA 1OH5A 1KI2A 2CBZA 2Y8EA 4G5QA 3EZ6A 4IVPA 2ZPTX 1WF3A 3L82B 2PLRA 3PEWA 1TF7A 1UADA 1OYWA 2QENA 5FI0B 3UMFA 4C0LA 2BMDA 1M7GA 3PUZA 2GRJA 2JDIA 2HXSA 1U0LA 2VEDA 2QPAA 2ZI4A 2ZSBA 3T06B 3U6KA 2GXAA 2REOA 2GF0A 2GVZC 2CK3D 4B3GA 4V0ME 4ACAA 4TSFD 4AWXA 2D2EA 1CXZA 1N5LA 2IUTA 2AD5A 4XWAA 2G9NA 2H7VA 5AUOB 5HZKA 5JECA 4Q4JB 5CITA 4LZZA 4TWZA 2WTUA 4JLPA 3MAAC 4ZO4A 2IWRA 4G5SA 4TYYA 4LK2A 4OI1A 3TW8B 1E4VA 4LDJA 4TQAA 3LW8A 4RSGA 3C14C 3BH6A 1Z0JA 4B3FX 1T3SA 2BBSA 1TEVA 1CTQA 2OFXA 4C7OA 2JAQA 3MGCA 2WPDA 3EA5A 3GJ4A 2R65A 3IGFA 3W3AA 3RS5A 1SQ5A 1SVLA 1XJQA 4PHHA 4WOPA 3B6EA 2QTVB 2O52A 1E4YA 2W0SA 2PZGA 1AS3A 4LV5B 2AHOA 4ILEA 3O47A 3D8BA 5UKDA 4DVGA 1R7RA 2A5DA 4ITRC 5JZVA 2QM8A 4M1KA 3NDPA 4IDQA 5TY0A 1EFRD 4CDGA 1J2JA 3BXZA 1ZD1A 4P3YA 4GZLA 5CIWA 1O87A 4R2HA 1ZD9A 4UNQA 3TBKA 1TQDA 5FBLB 5DN6D 4H9GA 1W5TA 4Z8XA 3NC0C 2BVNA 4OHVA 4G5RA 1DO0A 2DBYA 3PV0A 4QBGB 3FHOA 1N6LA 4GP6A 5FOSA 3KQKA 1I4DD 3AB3A 4H1VA 5A5GA 1XTJA 3K0CA 4QGGA 2OLKA 3S1AA 3LAWA 1VG8A 2PJZA 2F55A 5KYKA 3GFOA 4BRWA 3O8DA 4YXWD 4X8MA 2CEAA 1N6IA 3MWLA 4POAA 1G1MA 4E03A 4MUAA 1EX6A 2V54A 4I81A 2QP9X 2V1XA 5TMPA 4GL2A 1COWD 4L15A 1EFRA 1G6OA 2G3YA 2HYDA 4B76A 3N2IA 1P62B 3LXXA 1S96A 1G21E 4Q1CA 4TTRA 5AUQA 1XMIA 1E1RD 3P1JA 2J7PA 4N0EA 4PHTA 4KFTA 1N6NA 1VIYA 3GEIA 1F2UA 3DOFA 1RYFA 3VR2A 3C41J 3Q9LA 4D6PA 2BCGY 3THYB 1Z29A 3IO5A 5J5CA 1NP6A 1CR0A 2G77B 5LD2C 4OHWA 1NMXA 5KSOA 3D6TB 3KDSE 3GJ8A 2YNMA 4RD1A 4CZ2A 2JJ1A 4IVRA 1ZC3A 4JSYA 5FBVB 4HLUC 2VP5A 4KFUA 1TF2A 2WJJA 2ZSEA 3EC1A 2VF7A 4RY2A 3LWNA 1CRPA 3TQCA 2R9VA 4PSKA 4LPSA 1XJ0A 1KY2A 1W46A 2Q3HA 2QA5A 4P4SA 1TNDA 5GJWC 3GPLA 4DCVA 3CPJB 4DDTA 2H18A 1X86B 4EUNA 4Q9HA 5FR1A 4HUQA 1OW3B 1SVMA 2NO7A 3AUXA 3ZQ6A 2IHYA 4BZPA 1UBEA 2VIIA 4JBXA 3K8YA 5AJXA 4DEXA 3W90A 2NG1A 2IC5A 1XTSA 3IDQA 2ZANA 2CCKA 2V7QD 3LFUA 1S8FA 3DVLA 2FU5C 2WSSD 2CDNA 3GFPA 1IY0A 4QGFA 1QHSA 4ON9A 2ZROA 1II8A 2CHVA 2FJUA 2J59A 2C2HA 2VPPA 4A1FA 5J40A 1WXQA 3MD0A 1UKZA 2A3RA 1ZNXA 4I1UA 2ZS9A 5CK4A 5KNCA 2J5XA 2LKCA 5TXGA 2ZI3A 1II8B 3DZ8A 1BYUA 4HB3A 1Z0FA 1OJLA 1NIPA 1YHNA 4TMKA 4EFNA 3UG6A 1ZP6A 4W5HA 2ZEJA 2BWJA 1WQ1R 3P4XA 2QAJA 2EYUA 1TQ2A 2RMKA 3TKLA 4WVFA 3UKDA 3AV0B 5KPDA 1GL7A 4LX0A 2OXCA 1PVOA 3P20A 4BFSA 3OEHD 4B71A 2ZE7A 5G3ZA 4BEBA 1E69A 4YDSA 4HSEA 2OAQ1 2HV8A 1BO6A 2V8OA 2CCJA 5KSZA 2NTYC 3I5XA 2NO6A 1GRNA 4TYNA 2O8FA 4D4MA 4YMWA 4JKIA 2BCJQ 1ODFA 2GCPA 4GZMA 3QQ5A 1YRAA 2B8TA 3NC1C 3AH8A 2JLZA 3ZVLA 1JR3A 1P4SA 5KPJA 1K8RA 4WZ6A 1IOZA 3THXB 4TQ9A 3B8HA 2R2AA 2RAPA 2WAYA 1CJKC 3X1WA 2ATVA 2DFKB 4TLDA 1OHHA 2A5JA 4RD3A 5DH9A 1DTSA 1OFUX 3NHAA 1UJ2A 2XJ9A 4Q1AA 3DOEA 3E70C 3AP1A 3GLIB 1XRJA 2YHSA 3SR0A 1A2KC 2MMGA 3PVSA 3SC3A 5DI3A 1N6PA 2ZRGA 1HY3A 5B30A 4QXAA 3WBJA 4DDVA 1YZKA 4V02A 5CJ2A 4QKQA 4QHSA 2BIFA 1KO5A 4NYIR 3BC1A 4EKDA 3LBIA 3ASYA 1Z08A 3WRYC 4BQSA 2BBWA 1M2OB 5TARA 2YJTD 3BBPA 3WY9A 2WKRA 3CX8A 2Z43A 2QROA 1G8PA 4XWOA 3HDTA 3NXSA 4PC3A 2ATXA 2E1RA 1YU9A 1JPJA 1YZUA 1Z28A 2VYFA 4FMBB 4BFVA 2WM9B 1MO6A 4Q00A 2QP4A 3AEZA 1YZNA 3Q85A 2B6HA 4HLUA 1KIMA 5J4VA 2WWIA 1L4YA 1LTQA 2PMKA 1W36D 1ZUHA 2ZS8A 1XCPA 4S35A 3TW4A 2ODWA 4Q48A 2QMEA 2PMDA 3QKUA 1XTQA 1EGAA 3PUWA 5DISB 4IVQA 1KI6B 1P9NA 1G8HA 2ZRBA 1RJ9B 3DO6A 2BKUA 3VKHA 4CEJA 1ZINA 1ESNA 1W4RA 2NZ8A 3MWYW 4LYJA 3WMEA 2EFHB 1BIFA 3U7FB 1NKTA 2O0KA 1NY5A 2YOGA 4XTCS 4L9WA 1GG2A 3L0IB 1CULC 2ZRNA 3QKTA 2YINC 1E9BA 1Z2AA 4QL3A 1T8UA 1EXMA 5CK5A 3Q8XB 5JI3E 1Z6TA 4V0KA 2O5VA 2XTZA 2F1IA 1YQTA 3IUYA 4UJ3A 3T1TA 2J7KA 5EUQB 1XEXB 3HP1A 2W0MA 1P60A 1M7BA 3D3QA 4MKGA 2ZRKA 1IXSB 1MV5A 2QP3A 4PAQA 1RFLA 4Q4LA 4TLEA 4LWZA 4US0R 5FUXA 2QM7A 3I61A 4UXJA 3CPHA 1VTKA 1R5NA 3IBGA 1GUAA 1CRQA 4HI0E 1W1WA 4JLJA 1A2BA 5FOVA 2OCPA 2SHKA 1U90A 1VYTA 2WKPA 3C4JA 4MGZR 4MQBA 3F8TA 2HJGA 2REXB 1UEJA 2XNSA 3IIKA 2DWOA 2GZAA 5JRJA 5HCIA 1DBSA 4L8GA 1S9DA 1TF5A 5KDOA 3WNDA 4JJKA 1BS1A 1T3LA 5H70A 4K81B 1ZD8A 3GJ5A 2VTKA 5HPYB 4OK6A 4KVAA 1IN8A 2AK3A 1QHNA 1UBGA 2JJ1D 2ZRHA 3EXAA 4C0KA 1IM2A 4EQ6A 3QBVA 1LW7A 3SI7A 3RNLA 2REBA 5JJIA 3IKJA 1HE1C 1HQCA 3FKSD 3VFDA 4A92A 4D80A 5G53C 4TYWA 3OHMA 4DB4A 4PHFA 5KSPA 1RVDA 4D0LB 5E4FA 4Q19A 3B7GA 4HAXA 1JBKA 1Q1QA 1W2HA 1NNEA 4US1R 4KLNA 1GL6A 5E3HA 5B58C 1ESMA 1H8EA 2W6ID 2ZYTX 3QEJA 4A9AA 5JWOA 1Q1BA 1XEWX 1FFHA 3QXJA 2FSIA 2GJKA 5GJCA 2UKDA 5C1BA 4A15A 1SULA 4DSNA 3AVQA 1DAHA 2FH5B 1E2KA 3SFZA 3GJ3A 3RSLA 2BJWA 3UK6A 4CGZA 1AKEA 4XIGS 4WA7A 3I3SR 1KK1A 2VF8A 1GM5A 3TSZA 4PPQA 4AY2A 4C0SA 3E2IA 1U8YA 4BLSA 2C9CA 4F93B 1NN3A 3BOSA 5FTKA 1MABB 5EXXA 3IIMA 3TIFA 1SVOA 1ZJ6A 4OYHA 4OBEA 1G20E 1E1QD 4BLQA 3L8YA 1XPOA 4DC9A 1L7VC 1WE2A 5IDVA 3NHBA 1NIJA 1T5IA 4KAXA 4IEIA 1VECA 1X8LA 1SXJE 2VO1A 2BHRA 2Z83A 2AKAB 4A82A 2QUZA 4W5JA 3P32A 3KQNA 2V6JA 3FYHA 1K5DA 3B60A 4A8JA 3HU1A 3K70C 2JLUA 1Q1ZA 1KMHB 1RRGA 4EPWA 5FOWA 1SXJC 1ZMXA 4OI4A 4AG6A 4Z1MD 1UKYA 4FCTA 1DAKA 5DN6A 1KJZA 4FW9A 2OBNA 1E9SA 2EQBA 3BS4A 3H0KA 4NONA 1U2RA 5AUPB 2WWYA 1XEXA 1KJYA 2FX3A 5FL3A 4XVUA 4LYHA 2O8CB 4F38A 1E9EA 4NMMA 3CUEF 4Q01A 1WMSA 1ZAKA 1GNQA 3NDBB 1SGWA 1VYUA 1KAOA 3KFVA 3EPLA 3FTQA 3K70B 2V9PA 1KI3A 2OCBA 2IXGA 5BN4A 2HCJB 3A6PC 3B85A 1P2UA 3VR5A 3K09A 3KXLA 1SXJB 3C5HA 4NZYA 2O0HA 1OXTA 2XAUA 1AZSC 1KOFA 3U3RA 3WP0A 2XITA 1Q21A 1GVNB 2WIBA 3A1VA 4EPYA 4NCJA 4TL7A 1KDPA 1X8JA 2ZRIA 1DARA 3OESA 2GEVA 5IHPA 1M34E 4ZI2A 1TQ6A 4FMDB 3VTKA 5IF9A 3IPYA 2FN4A 1P2TA 5FH9A 1PUJA 3UANA 2EWVA 1KZGB 2WWFA 4YMSA 4M2LA 1X3SA 3PQCA 4GMDA 5CYOA 5FPHA 2QZ4A 1KI8A 1T9HA 4E22A 4NYIQ 3DKPA 3K0FA 3AF1A 3PXGA 3KX2A 1EK0A 4JVLA 4FWIB 2R6GA 4II7A 4JZKA 1U99A 4LUCA 4BRUA 1SZPA 1Z06A 4JL8A 4N1AA 3K0AB 3FPAA 3RHFA 1FL9A 1G4AE 1IHUA 5FUYA 1XZQA 4TMWA 1UDXA 5EQTA 2CCGA 4DCSA 1Q3HA 4Q9JA 4P4SB 2ZJ8A 2RGAA 3N2EA 4JLAA 4PQRA 3VX3A 3GLFA 2XSZA 3BFKA 2QI9C 3PIRA 1T6NA 1Y63A 3QKRA 1GFIA 3LNCA 4ASUD 3LD9A 1R8QA 2G0TA 2PCJA 4TMTA 5LBIA 2FNAA 1G3QA 3QKRB 4NCKA 4E09A 2XX3A 3FOZA 2BEKA 1GOTA 2ZSDA 1WBDA 1OKKD 1D2EA 3FFAA 1YVDA 1GNRA 5AUNB 5JCPA 5K8TA 4GOXA 4I1VA 2VA8A 4PQFA 5LB2A 3IIJA 4LHYA 1IXRC 1NVWQ 1E32A 3TMKA 3GLGE 4C0AC 4JKYA 5IRCD 1H65A 2XTMA 2B21A 1GWNA 1S1CA 4B48A 1XP8A 4OI2A 3TR0A 4TYPA 4HAUA 5L3QB 5FL7D 2AKYA 1ZCBA 2N46A 4ZIRB 3RS2A 1CJTC 3IEUA 2VP2A 4I1SA 5HCNA 4Q18A 1C4OA 2ZI5A 3A4MA 3TNFA 1UAAA
chains in the Genus database with same CATH superfamily
5LDHA 5D5HA 4WXYB 2Z8YM 5AJTA 3VC7A 1LW6E 1Z82A 5J9FA 2ZJZA 3R7LA 5JZMA 4X7MA 3VHXB 2OPBA 1K66A 2GN6A 2PT5A 1NQTA 5THXA 4M0CA 4I4CA 1C7RA 2C8JA 2W6IA 2R66A 5IASA 1M73E 4G24A 2X5OA 1SIBE 5LN1A 1J2RA 1YUNA 1LZLA 1CIJA 1ZUD1 2XMGA 4O3MA 1UZMA 1GPBA 1KVQA 2I62A 2CJXA 2WUDA 3PRYA 4DHEA 5HOEA 4EPRA 2REQA 5NULA 3X44A 5BVHA 4RFSA 5EZ5A 1C9YA 3M33A 4OM7A 3GLHB 1D9ZA 4RS4A 4NU0A 1T5HX 4XLTA 4YJGA 2O5CA 3CH5A 1FQKA 3NEPX 3VDQA 4EI2A 1OA0A 3CLKA 3Q7EA 1RXSA 4HGZA 5FTNA 1JLLB 2HQBA 5E6SA 3WWCA 4CDNA 1K68A 5B7NA 4MROA 4QYWA 2V3CC 2QRVB 3LTEA 5CPBA 1RCTE 1U7UA 2FI1A 2I99A 3KOUA 3BWEA 4P93A 3SS9X 4ILKA 4C0HA 1XAIA 3TTUA 1JEQA 5KIAA 3HVRA 1EUQA 4HNHA 3KPVA 3O4IA 3JQBA 4Q03A 2ZJ3A 2IE0A 4M1WA 4QU5A 2J9FB 3G2OA 5T8KA 2JGJA 1JTVA 2GQ0A 4HGYA 4O4IA 3JYLA 4KIWA 4MIEA 3WKEA 1IN6A 4DJEC 4L50A 4KGXA 4UMFA 3GRRA 3QA3E 4NBRA 3S27A 4XD7A 3VXKA 3PTLA 4WLOA 3IT1A 1FJ2A 1V26A 2VJCA 5IHXA 2GNAA 3IE0A 3P9ZA 1XMPA 4MYCA 5HQJA 1K4MA 5CA0A 1G55A 3B13B 3MCVA 5LFAA 4V3CA 4X91A 5DTMA 1U2SA 2B4KA 1E6CA 1XMJA 2VOEA 4GOKA 3KQTA 5EINA 2WWXA 3OJLA 5JD4A 3UJ3X 3T34A 1FW6A 4UPDA 5JATA 2WHPA 3GJQA 4KKVA 1QS0A 4FFBB 3LIIA 4F3YA 4P35A 3CKMA 2K87A 5T5QA 3H05A 4FQ5A 3N53A 3O4FA 3UOGA 1I7LA 1WJGA 3CW9A 4YREA 4KV9A 4CF5A 4ZYWA 4W6QA 4FFMA 3FZYA 3HU5A 1R9JA 2BGTA 3TZQA 4LDQA 1V3TA 4DBVO 2JHCA 4MVJD 3VVCA 4OI0A 4IDPA 1UC4B 2OR3A 4MHOA 2QTMA 4IIXA 1NF3A 2C78A 4FFVA 1I01A 2CJFA 4HXYA 5D6NA 4AO8A 2Y0CA 4P3NA 5IC5A 4O1HA 1VL8A 3TPFA 1ISIA 1CJCA 3UW3A 3WDSA 1BGWA 5IT4A 1SHKA 3OX4A 3N87A 4GRAA 3QU7A 4ZCLA 4GM1A 3E5NA 2OV1A 2RGBA 3R0VA 5BVGA 5C32A 5L3RA 2QQ0A 3QU9A 3OZ7A 1NG1A 2GOYA 2ZTSA 3EWAA 4LQDA 4CBVA 3D43A 1FS4A 1HOXA 1W49A 2J7PD 2QE7D 1IG0A 2XQVA 3E05A 1UIRA 3ONNA 2DQYA 5ALWA 3WLSA 3PFIA 2IEGA 1MUUA 1Q0HA 3A4LA 4UEQA 4RPCA 3RYFA 3OLWA 3CLTC 1R6UA 5C31A 1EM8B 2IXTA 2ASEA 4B3RB 2AGVA 2E4VA 3PG5A 5GGXA 4FJ1A 4G4GA 1JFRA 2PX4A 1WBBA 1UPXA 1EJ2A 1LGYA 4XJVA 4A2QA 3LUHA 2O8EB 2QTZA 4Z2YA 3U3DA 2OC4A 2WVHA 4EPVA 2RGXA 1AKYA 4NC9A 4YC7A 1R12A 1V4BA 2A1IA 3DE2X 2ZOSA 4QHYA 4MPJA 3GBVA 3SF8A 1LQUA 4REOA 3U7EB 2O8DB 3H19A 1JR6A 1VCHA 1ZXBA 3V48A 2AWOA 4WE3A 2OB1A 2FWAA 3PFHA 3TKAA 1RLTA 2F9MA 3D3JA 1E62A 3GLRA 1PR6A 3DHYA 3ER9A 3K5IA 4AZ3B 2EFJA 1DQZA 4C01A 4G56A 4KE9A 2L18A 3BXGA 1GZ4A 3PSAA 3QIAA 2IGTA 4IDFA 1YCDA 4C2AA 5BN1A 2A5YB 3IXMA 2JHPA 4Q02A 3LX6A 3SBDA 1J23A 1Y5MA 2ZAMA 2C2ZA 5G4KB 1Z7BA 1U28C 2ET6A 3LM8A 5E9QA 5FA8A 5HZMA 1TYCA 3GEPA 4IW3B 3UV6A 4XQ9A 4IDDA 2WSIA 1WXFA 4WOKA 1E9AA 3CF4A 4AWAA 2GBLA 1F2UB 3BH7A 1RWMA 3JQ9C 3ZD6A 1RZ3A 3S0JA 2TMGA 1JEQB 3MWEB 4KYUA 3PC4A 4HYEA 1ANKA 1D6NA 3SJZA 3PRJA 4LJ7A 3SFVA 3KETA 1L5SA 2DBQA 2XNDD 3GEBA 3IOCA 3PNLA 5KWJA 4JSTA 3CPSA 1KK0A 3F5FA 3W6OA 1Y7IA 4LBVA 2W6JA 1IHXA 3DNFA 3K9LA 1G98A 4ND2A 1G3IA 4RXUA 4AJLA 3WAJA 4C08A 4KW7A 1H22A 1N2IA 2GD1O 2RGYA 2A9QA 1AKWA 3LGAA 4YAOA 1KBZA 3UJAA 4DDWA 4IWXA 3VV3A 3DVQX 4G4SO 3T7JA 1UDWA 2G4CA 3EZXA 1FP7A 1GXSA 4DMCA 1RWKA 3U1TA 3B6JA 3FPBA 2BR3A 3FF1A 4RFVA 5C7IO 1Y8ZA 3OEHA 4H4DA 4FGKA 2GCNA 1M2FA 2WUEA 3R6WA 4JA2A 5EPUA 3IT3A 1MPXA 1TDJA 1XTIA 4TRMA 4EJMA 1X7HA 3LXRA 5JUWA 1W4AA 4YT4A 2XT9A 5A4JA 1SXHA 4V0NA 1TAQA 3K09C 4KQ2A 4DB2A 3OMWA 3TOZA 4PLPA 4KO2S 5HE8A 4RPLA 3T15A 1KYZA 3C6MA 4GICA 4MLZA 3ONFA 1VJDA 4MR8B 5DHRA 2X0FA 5INTA 3UC9A 3ZIAD 1H3NA 2E6KA 1GGHA 2H57A 1YF3A 1H94A 1QANA 1TMOA 3GLTA 3LQYA 4PGFA 4BWFB 1NPDA 5KU1A 2HRRA 4UCXA 1KEVA 2PGDA 3MQ2A 2AR9A 4UBMA 4PPYA 1NXQA 2JARA 5EQFA 3DDHA 3W2GA 1JKJA 4QZVA 5FAXA 5AHXA 1L5MA 3IIEA 1II0A 4ONEA 4KXMA 6LDHA 2RI6A 1I2AA 1Q0PA 2Y77A 3OOWA 4FONA 2C07A 4N9WA 4OKSA 2OUIA 1ZIXA 3T5CA 2WF6A 3CISA 3ZWMA 1Z4KA 1TIPA 2LXNA 3U0BA 1XQWA 4P82A 4HNUA 5GP1A 5B6JA 3A26A 1X92A 3JX9A 1ZMOA 4GEKA 1WXDA 4X00A 3P4YA 2VBCA 5BNFA 4AN0A 5LL6P 1GADO 1G21B 4N6OA 4K9NA 3AR3A 5CVCA 1BGVA 4GWLA 4MHTA 4XVRA 5DLEA 4V1CA 1KC1A 3G59A 3ESBA 4KVZA 2HHAA 2YOFA 4XJSA 5FJIA 3L05A 4NPAA 3FVQA 3I53A 1NLZA 2GM3A 3X2SA 2PKQP 3NNSA 3Q12A 3O5AA 2HK6A 4XR4A 1TZ2A 2C00A 1U3VA 3NANA 1OBOA 5A4MS 1HFKA 2XCOA 2ZIXB 3QF7A 1KC3A 3NX4A 4FSDA 3NXKA 1E3SA 4B3SB 2ICAA 3ZHCA 3L04A 3FYCA 5FXMA 5LOVB 1KO8A 1RI1A 2GHIA 4DAOA 2E4WA 4RHCA 1UDBA 1J7KA 1XF9A 1HT0A 3BAZA 3B51X 1J9ZA 1TVKB 4HN9A 4JENA 3FNIA 2IUFA 1NXVA 2NACA 3BF7A 4M9QA 2P6NA 4RENA 3TIVA 5HJ7A 3EOBI 3L40A 4KH1A 1W5AA 4MJ3A 1MO5A 3E9ZA 5DHPA 1GXSB 3RAPR 2L0XA 4LF5B 5LBUA 4C22A 4EA9A 4Z4FA 3GMSA 4U1RA 1QFSA 3R7DA 2XBMA 2J31A 4U7TB 1CVIA 3WB0A 4YMLA 5CAEA 1AXEA 1ODJA 1ZGAA 2YC2C 4U02A 5GWXA 4CNBA 5TGDA 5CDFA 3H5TA 3F4LA 3TDMA 1SQ0A 2RJ3A 4W8GA 1PEAA 1B3BA 1X80A 4O4HA 4IEFB 4OP1A 4ROSA 1RPZA 1GDTA 5AVOA 3IEKA 3ZHOA 1MFPA 3OIYA 4PNHA 3REGA 4IYJA 2DQ4A 4G3XA 4GPIB 4PRLA 1M2EA 1SA0B 4HFNA 1EHIA 3IAXA 2FEOA 1A4UA 3LP6A 3ZJ4A 2F3TA 2JA1A 3G02A 1ZGZA 4J94A 1VL0A 4QFDA 1KKLA 2WOOA 1PWYE 1BVHA 4AVYA 4XKJA 4FE3A 3WBKA 2WIFA 3ZKWA 2HREA 3U16A 4J0DA 5DEOA 1X7YA 5EIBC 2GPJA 1HQYE 2IBMA 2E7ZA 1MTZA 2Q0QA 3HBJA 4GBJA 4DNXA 2RIPA 2DBZA 3H17A 2ZUFA 3Q72A 3LUFA 1MABA 1Y5NA 3IQGX 3EXFB 4EA6A 3WGGA 2GEFA 1NNI1 2BMAA 2DB3A 4WKOA 4D92A 5L3ZA 1DJLA 3JD1A 2PGJA 3CUVA 2P2SA 3OT5A 3CXRA 2PGOA 2Q6TA 4IHAA 3T9AA 3TL2A 4E5PA 1GZHB 2COKA 2JIPA 3BORA 3H2BA 4J3FA 1W36B 3WO0A 1U7TA 3T7DA 4AJOA 1NMZA 1ZM3A 4Q66C 4RK1A 2HOQA 2CLOB 3INYA 3V46A 4EI7A 2TS1A 1L4KA 1Z3CA 1RAHA 1NATA 2PIAA 3CZQA 1DXOA 4JXJA 1O95C 5F1PA 2BGJA 1K6MA 4D26A 3HJNA 3AOEC 3LVBA 1F6DA 4G09A 7ADHA 5BN3A 3I9JA 3OWOA 3AEUB 2PHZA 1YRHA 4ZICA 4ZT3A 1CY4A 1UMBB 2ANBA 2FPLA 3TJMA 5JDIA 4WI1A 4QGAA 4D44A 1T0IA 4Z9YA 1WWKA 3AUYA 2PSSA 5KYWB 3NW9A 3E58A 4DY6A 2Z09A 4TTVA 1H4QA 4L73A 1QG2A 3W2HA 1YJXA 1IZZA 2JGEA 4MQEB 2B1RA 2QTHA 2AEJA 4DF3A 5IKEA 1ODSA 3DAFA 3QE9Y 4EYGA 3RJZA 2X23A 2EFCB 1J20A 1KKUA 2P3QA 5JJCA 4D8TA 1MZPA 1U80A 1DEKA 4Y0VA 2FZ4A 1K2WA 1SEPA 1U81A 1EZ4A 3AFHA 3WWEA 3V2IA 4DMUB 4E5VA 1ZU4A 2XUFA 5CFPA 3C6XA 5IUJC 1PIWA 2WPNA 1RWVA 2OMEA 2VP9A 4JLOA 3B6KA 5J4HA 3GDWA 1SKAA 4MGKR 4ZPJA 4M21A 4XYBA 1DADA 5ADVA 3RAGA 1S3SA 5E6RA 5KYVA 3VDNB 4EG5A 3WRXA 1E99A 2Q5IA 3T3OA 5EJ6A 1VYVA 4Q1DA 3HDGA 5GIPE 3SK0A 2ZWIA 3C3KA 4L8FA 4OX9Y 4FOSA 3BUSA 4JIMA 4I4TB 4WZAE 5H68A 1PJLA 2GWHA 4BUJA 5K0ZA 4CR8A 3K53A 3M49A 3QY9A 3WL5A 2FDCA 1M1UA 1NI5A 2DBVO 4IXTA 4YLEA 2EKPA 3NHRA 1UJ5A 4M0LA 1BMDA 1M1XB 3VR6D 3BE5A 2JH3A 3DCIA 3ABRB 4X8LA 4CR7A 1DI0A 3CV3A 3MJFA 1WAMA 3V4FA 3ND9A 1XKQA 3TAXA 1AGXA 2J9XB 2QUIA 4CCWA 1EFLA 3T5PA 2P9HA 4G01B 1RRCA 4HMQA 3ZXUB 3SE7A 2W83A 2AUNA 2D74A 1MFZA 4AIIA 1FW8A 3DGEC 1JJ7A 3T94A 1C2TA 2OHXA 2WYVA 2RD2A 3BRCA 4K6OA 2YFQA 5FTLA 5FYDA 4LJ6A 4QUEA 4GS5A 1WRBA 1CUHA 1XA0A 2OSVA 1USWA 1WG8A 2G9QA 4RJLA 3T3GA 3MS7A 5EVCA 1NUTA 1YRBA 3PPYA 2G88A 1HEUA 2LVBA 1RHUA 2X5XA 2Q49A 2Y0PA 3KYIB 1K1EA 4UHDA 1R6DA 4QBFA 4TGLA 1L5OA 2E4XA 3ZNNA 1EINA 4NX2A 4HMPA 5TDHA 2VRWA 1HYBA 1LTHR 5MN4A 3QE2A 2C5EA 2XVAA 4CKBA 3FPSA 1EJ0A 1GHTA 1DT5A 1YU6A 3EIXA 3Q5DA 4FDMA 1FK8A 3KEFA 3TEJA 3JAKA 3CR8A 4JI3B 3ZHZA 5CDTA 1XPRA 1T8TA 5E7JA 1ISFA 3WSWA 2CV0A 2PUBA 3TW6A 3ICQB 3MRXA 1C9JA 2C77A 2VJMB 3MQFA 4MQ4A 4Y2HA 3VUFA 4QVIA 5M7EA 2EWMA 3EF1A 4O2LA 2WJVA 3JASA 3O3MB 4PTLA 4BFZA 3QHAA 4QXRA 5K3BA 1ZJJA 4LV8B 2EGGA 2WHXA 4POOA 3K4PA 1KR5A 3AF0A 4HN4B 2WYHA 3HXKA 3ZU6A 1OXSC 1ZM4A 3F90A 4XOIA 4RSHA 1OX5A 2R6AA 2V03A 2RGNC 4C7KA 1A5SB 5B64A 2RGEA 3FRIA 3UK2A 1I3OA 1XTTA 2Z30A 3HACA 4I50A 4J2TA 2ODBA 3DEFA 4I0WB 2FEMA 2DWCA 2V6FA 1HLDA 1W87A 2CE2X 1WPRA 1Z33A 1NOJA 3FFTA 1GR0A 4GPZA 1PWEA 3TNLA 1DDOA 4JN6B 5B7QA 2QGFA 3R4VA 2PUEA 4KFSA 5FCDA 3C2QA 4QGHA 4ENPA 4WXHA 4K9PA 2K2QB 2QD4A 3STTA 3QELA 4KVFA 4MKFA 3CIFA 1JEEA 4ZPXA 1SBNE 4MP3A 2EV9A 4RKEA 1P75A 2R6DA 3CWZA 4I2VA 2ZYIA 1A4IA 2HCTA 3RU3A 1E3IA 4TXJA 1USGA 4JXZA 3W7AA 1C14A 5F9FA 1J0DA 3Q3JB 1TEZA 3AVUA 2AUTA 3KU1A 3I2IA 3L3BA 5DWVA 3EBPA 3ZU3A 1A5BB 2NSDA 3RS4A 2YXNA 1G2IA 4A2CA 2E4AA 5AJHA 2HLNA 2VP4A 2ZR8A 5HRUA 5JQGF 4Z9AA 4U7DA 3INRA 4QREA 4M22A 2A1UA 2ODAA 2VPQA 4HDRA 1ORTA 2I1LA 3DS8A 5JARA 2RGRA 5TV2A 4F1KA 1C1XA 2Z2ZA 4FNOA 1ECBA 2R8XA 1BXRA 3DWIA 4GYJA 3DYVA 4V1CI 1ZONA 3O21A 1W1UA 1WEKA 2WZDA 4EX6A 1CR6A 1G5QA 1PN3A 2NIPA 4AP9A 4CU5A 1C8LA 1GNVA 2JBWA 3BHMA 5AHOA 1SHZA 5A0FA 4ES6A 1JHVA 1PYGA 3GZJA 5CT8A 5FHQA 2V7EA 5ECGC 4B6EA 1SC1A 1JIQA 3OZSA 1PFQA 2VBIA 3N70A 3QFTA 4OXQA 1Z36A 2F1HA 3GJYA 3QZUA 4NEQA 3OU2A 5EIXA 1LSSA 4H77A 3HE3A 4QC2A 2XHEA 5DHFA 4BCBA 1QQ5A 3IFSA 5IBRA 1AA6A 4Q34A 3NI2A 1XPUA 4RGBA 5B1SA 1TU0A 4XWYA 2DU8A 1I4WA 4YBRA 1U8TA 1B16A 4MB2A 3RJ9A 3EGWA 4ZCQA 4LYAA 4RTOA 5EMMA 2Q41A 1IQPA 1DOAA 4QRIA 4AK9A 1FS6A 2RHDA 2XMQA 3LX4A 4N65A 4EKYA 4TWAA 4DS3A 4U9HS 4F72A 1V25A 1V9LA 3KQYA 1Q7GA 3G5LA 3O93A 1KEPA 1QKKA 2XPCA 2W8BA 3JTMA 5IJZA 2C0CA 4R98A 3PNKA 5FUBA 4PLTA 2NVUB 4CWAA 4GPD1 4PAMA 4UBOA 4GMXA 1HTBA 1JGTA 1VKOA 1DC5A 2ZTMA 3AEUA 4QXPA 2OUKA 4JDUA 4JT9A 1B8OA 3ROZA 4E5MA 1UIMA 4TV9F 4HOYA 1SUDA 1NI3A 2IV3A 1B23P 4XIYA 3VBCA 4ZGBA 1Y6GA 5F7ZA 1K08A 4C4ZA 2EATA 2DMRA 2XF8A 4GOMD 4RCZA 1WKBA 1M5TA 3IUMA 5C35A 1D0SA 1EBUA 2B35A 3LC1O 3NVMB 5BQPA 4YMVA 3K6SA 4M9ZA 3PLRA 1LC3A 4YCAA 4ZD6A 2IZZA 4YP9A 1Z6XA 4PE5B 1QCYA 2WM3A 4E1AA 1E9VA 3F1LA 4B3DA 1LF0A 3O90A 3HR7A 4KBYA 3HPQA 4L3WA 5I7EA 4B82A 1DC7A 1QZZA 2RAFA 1ZSVA 1YR7A 1QLWA 4FQ7A 4TYMA 8OHMA 3D3KA 1IN5A 1PFUA 4Y0AA 3I9MA 3QKSB 3SBXA 4ARAA 4DC0A 1FMFA 2BFMA 2J9RA 3CX4A 5JJKA 1Z45A 3A8TA 3GMIA 5SYAA 4FCWA 4LHWA 3ZDRA 4GF5A 5AI6A 3L8ZA 3AQ4A 3OJOA 4Y2VA 5AVZA 4Y6PA 3LQRA 3QLUC 2P7IA 2PUVA 3OQ1A 5D7BA 4N48A 1Q5PA 2OENG 4S2EA 1EBFA 1XTKA 2O6LA 2H3HA 4MV0A 1U0HC 4Z5XA 1X1DA 2CV2A 1YNSA 4AKGA 4AZ3A 5CG1A 1SUCA 1LSOA 1TW2A 4KQWA 1Q17A 4Q21A 4WUVA 3WDKA 1MT0A 4EECA 2NU8A 2BEJA 2XCIA 3FPGA 4X92A 3JRNA 4TS4A 4K9SA 1E2UA 4WACA 4ROTA 3ADBA 4CMIB 3RT1A 4HNVA 3M6UA 4ENQA 4PGMA 2C57A 2P68A 3BIWA 3O3CA 1QGAA 2GK4A 1AT1A 2XYVA 4GDFA 1OX4A 1RJEA 4I99A 4BEVA 3NWOA 1FUKA 2Q5CA 2WB2A 4DUPA 1ZH6A 1N6KA 2PWBA 4JR1A 2E87A 1HNNA 1SELA 4U2KA 3GDFA 1DRUA 2PA3A 4WDQA 2VPZA 4Y6GB 4BV2A 4JB2A 4OU5A 4ZEVA 4DUGD 4GH5A 1W4BA 4V0OA 1PQ4A 2YWDA 4DAEA 2BD0A 8ABPA 2FJ0A 5H4GA 1J4AA 2FQXA 4BMOB 1CDOA 1E4EB 3HYNA 4FDTA 3KJIA 2V7XA 1H0RA 1T9KA 4H3KB 2ESRA 4K8OA 4V24A 2E1PA 1UM9A 2OXIA 3BG5A 2BOVA 2WUVA 1X8XA 1EDOA 1U1GA 3OEYA 4OJKA 4OHPA 1C9DB 4EVRA 4UCFA 5TT0A 2QY9A 2QRLA 3HP4A 2GXUA 5BMVF 2H4HA 1OJ7A 2QTTA 3WWOA 4NDZA 1XDGA 1YDGA 1L5HA 5KAMA 1NFRA 1G8YA 1SUBA 4HPXB 2JEOA 1XNGA 1VI6A 2E5LB 3OZWA 4Y67A 5CLJA 1H0KA 1NBAA 1KYTA 2E2WA 3AETB 3OUZA 4M88A 2FPKA 4GSKA 1I2MA 1OAOA 1XDBA 4O2RA 4RZ3A 1JFVA 4X1YB 2PYDA 1FFWA 3WL4A 5KSWB 4DM4A 2XUZA 4YPFA 1GQQA 5IVHA 2VHTA 2FWIA 2XNDA 3M0EA 3NYIA 4NNPA 3RFUA 3RVQA 2UAGA 3DD5A 1BDMA 3HYTA 3LUJA 1UOEA 2DFVA 4RIHA 4IMPA 4U7HA 1ECCA 4Q3DA 3ZHQA 1W5EA 3PPWA 5FR2A 1YL6A 5GONB 2CVZA 4UNRA 5ER9A 3F8SA 3C3PA 1H2XA 2PFKA 3WLEA 121PA 1A82A 1JHUA 1LH0A 3G2QA 3GVXA 4KWTA 3F71A 2F1OA 4TL8A 2FZLA 2YNMC 4MK4A 3PTZA 5EJFA 5EP2A 4BASA 3D59A 2GHQA 3DB1A 4G86A 4J0QA 4LJSA 5CCXA 4PANA 1ZU5A 3JQGB 4WH0A 4MR7B 4PG4A 3UMBA 2PZEA 1F3OA 4JBLA 4UQLA 5JEEA 4F46A 1BSVA 3A58B 3OMXA 4GMKA 1YIOA 1G18A 1Q15A 4DLPA 1T9DA 4RTSA 3Q3IA 2B1IA 2JGFA 4HZIA 4YP5A 3AKDA 3IUPA 4MEBA 3PTAA 1OZ0A 1QTIA 1NL3A 3OJXA 3UWDA 2HJSA 3QKSA 1L5YA 3CRZA 3GCXA 4FMDF 3F49S 4KNWA 3S7TA 3PK0A 4BDTA 2DLCX 4Y9SA 3H5WA 1VI2A 2J1LA 4BO3A 3AWIA 4J0EA 5JASA 3WYGA 3IQXA 1MC5A 1TGVA 3F6BX 3OWHA 1T13A 1IUNA 5JVDF 1V43A 2PX0A 2PTGA 4ED9A 1V3QE 3WISA 4CTMA 1C3OB 3CRW1 1IHYA 2D0OB 3NWBA 1Y8QB 5AR1A 1YR3A 4K28A 4QBIA 1CZOA 3IHLA 1I7QB 3R5JA 2GNPA 2WTEA 4JYBA 3IT2A 1LPBB 3I6MA 1GL9B 2R8YA 2WU3A 3PD7A 1S2MA 3THWB 2QV0A 5JHGB 4ACBA 4C88A 1KAHA 2G08A 3GT4A 3PA6A 3DZBA 4RF2A 3GK3A 3UUFA 1IB0A 3K0CC 3P8ZA 2I8AA 3IEPA 3S3TA 1UZNA 3NC4A 4B8WA 3ZE2B 1E5TA 4EYKA 2QQ5A 1MRZA 2CL6X 5CFLA 3PKIA 1S02A 1LVGA 2HN9A 5JD5A 3W5CA 1N34B 4MVJF 4N3CA 1LKZA 4G1EB 1J6UA 5KWVA 2G82A 3DEJA 3ND8A 1LVUA 3WB1A 2L19A 2B8EA 3B82A 3HYLA 1QNFA 3S2FA 1GTG1 3DFKA 3P7MA 2YCLA 4CTOA 1OXUA 1E2JA 1OE0A 4OQZA 4CM3A 4TSRA 4HDSA 1RADA 1DUVG 3N3AC 1U7DA 4PWZA 4R2LA 4QM6A 4FX2A 4HRXA 3LHDA 4PLFA 3ZE6A 3U0VA 1RYBA 1HSZA 2P4HX 4TMXA 3V8QA 3ENQA 3W1WA 1JQLB 1NN0A 4DZZA 4IS2A 4F91B 3TCXB 1E79D 3C8HA 4DVJA 5EIHA 4ZEWA 1IVSA 3GLGA 4AD8A 2OA0A 4J16C 2H9YA 4Y1RB 4EQ6B 4BFUA 5HHTA 1JB1A 2GS9A 3HO6A 3JD4A 1AX9A 4Q4DA 4IH4A 5EHGA 2OGSA 3UIEA 4CG3A 1QH1B 5L6MB 1K7XB 1CUGA 1QNLA 3FBWA 3U7QB 3K92A 2NYRA 3EB9A 4BFXA 2BRUA 2XXAA 2Q46A 3T3IA 5KYTA 1IFXA 2BI7A 2OXRA 2XF2A 3WLQA 4LK3A 4HNSA 3M3DA 1R0RE 1EWKA 1G6HA 3VR6A 5B57C 1WXWA 1UBFA 4IH9A 4YX9A 5BW4A 2OM2A 2P4EA 1QYCA 2PQ0A 3G79A 3I32A 1HXHA 2RDMA 1GZVA 1PEDA 1O08A 3BWXA 2Q4OA 4M89A 1T26A 2WF8A 3D0RA 3SC6A 2PVSA 1M0SA 1JG2A 4FINA 5I5EA 3EZ2A 3WLTA 2GEUA 1EB9A 1JXMA 1NR1A 1YRLA 3EYWA 1PZFA 5ANRB 5HS6A 1GGMA 4EJ2A 2KE5A 5BW8A 2VQEB 2UUBB 2NXWA 3R0JA 2CLKB 1RM4A 3G2LA 3A1TA 2IBTA 5CA1B 3JATA 2J0VA 3CX7A 1ISRA 5TF4A 2A6PA 2ENUA 4N40A 1V6SA 1E2PA 2FWJA 4F0JA 1WDLA 4BTVA 3AR4A 1YR1A 3R0IA 3UXEA 2R68A 5DW0A 5BR4A 1XZIA 4G4SP 3EPPA 3GFQA 4B2YA 1JAYA 2AOVA 3UT0A 1O5TA 1LWOA 3VYWA 4DBLC 1SIUA 3G8YA 4LWPA 4B8ZA 2LIVA 2GM5A 1L7OA 4N6NA 3UMRA 1LX6A 1N2CE 5EKSA 1UBCA 5KVVA 4DDKA 4INJA 4KO3S 3UENA 1TW3A 3GRVA 4GKAA 1TO1E 1DJNA 2FR8C 4ZAGA 5P21A 3SKVA 4ZANA 4KI7A 2GILA 4L8WB 4ZU1X 4CEIB 4TT3D 2H4FA 1WUYA 3NBQA 3E2MA 3NH9A 4J75A 1G2QA 4UU0A 2QUJA 3RVOA 1RXVA 1BWQA 4E2WA 1H0HA 1O89A 1NDUA 1W35A 1Y4SA 3PHJA 5AI9A 5BOSB 5LWHA 2AN9A 1GCGA 3CYFA 1L9XA 1OXVA 2ZRQA 5HKKA 1GFSA 2QBYB 1NSTA 4UQOA 3AIKA 3OCUA 4PTYA 2I03A 5FO1A 3UCEA 1MHTA 4UTXA 4LGVA 4P3PA 2B8WA 2ECPA 1NWCA 2L82A 4KITB 3BIXA 2V3VA 3JY6A 3O26A 3TWOA 1MC1A 3R20A 4JC5A 3WGJA 1E1CB 3VC1A 5GTDA 1C8KA 3T3NA 2O3TA 5HS4A 2VQ6A 2FZGA 4Z3OA 5CB8A 3BMOB 3RUAA 1FX0B 1X1AA 1DC6A 1BKSB 4PX2A 1O54A 3Q7SA 1P0CA 3KTAB 3MTJA 1E3WB 2ECQA 4MP6A 4Y2GA 4R71A 4H7HA 1OB2A 1VIDA 5JAOA 1QXSA 1Z0DA 1XYYA 2WU8A 3OQVA 1G7CA 1XLWA 1ZD3A 2DJ5A 3ILHA 1L8XA 3KXKA 1RWNA 1HDXA 2EEZA 1C1YA 3OIWA 1EVYA 1VIAA 3COVA 3FWNA 4I8XA 3MTAA 4AKEA 3EW9A 4L76A 2EHJA 5K05A 1DG9A 1H4TA 3FETA 3UN1A 2NP6A 4J7UA 1F0NA 3ROKA 3TTTA 1OKKA 2JLRA 1R0SA 2BSXA 1XQ6A 3IILA 2XKBA 4IMIB 4WBSA 4F5EA 2XV1A 4BTLA 3QXCA 3ICPA 1QWOA 4KREA 2XBLA 1IL0A 2A9JA 3WO1A 1KY5A 3ETEA 2HLDA 2QSUA 4Y6QA 1L7QA 3I83A 1A7JA 1ZUNA 3OJFA 1RW4A 3LZCA 4K86A 4CMHA 3DTYA 1QUFA 2HWUA 1E64A 2GNOA 2OT3B 3JVVA 3PXUA 4R1NA 4LFCB 1AMOA 2ZXUA 3QSYA 3H4TA 2P9EA 2EBFX 3H3XA 3BXXA 1KEEB 4ZT7A 4RZSA 1USVA 3RTDA 3N8IA 3P71T 2CLIB 2AG8A 3QV2A 4KYTA 2WTXA 5FOXA 3DEYX 1EVEA 3GI1A 2DPLA 3DHNA 1QV6A 1M1YB 2ZXEA 3ROXA 4BMDA 5IG2A 4DV6B 2ZAIA 1NULA 3NHKA 4BUCA 2WPDD 2AW3A 3O75A 2XAAA 5JISA 3K0AA 1E7MA 1WCV1 2OHJA 4HG2A 5HVNA 4QODA 1O3YA 1TM4E 3OFVA 4MW7A 3WR5A 3KYCB 1IOLA 1TJNA 4JA0A 1YOVA 4DQKA 3AUSA 5AM2A 3SQWA 2ZVQX 2Q29A 4PG5A 4IOJA 3O7WA 4V0LA 1C3OA 1QZXA 1Z5ZA 1YSCA 4JWKA 3RASA 4JL5A 2IW1A 3OAAA 4Q3BA 3OU6A 2FPGA 4EG4A 2F7SA 3L8CA 4L4SA 3IDZA 1V7QA 4QYIB 1WIWA 4GGPA 1JSRA 2F43A 2HRZA 4RE6A 3WLKX 4ZHQA 1JJAA 3R23A 2V6IA 1HR0B 3AF2A 4XRRA 4EMBA 2R84A 3I8OA 4MQLA 4TV8F 4F86A 1NUPA 1V5EA 1D5WA 1MV8A 4LJLA 4C43A 1BYIA 3SC2B 3DDZX 2E4UA 1VI5A 4NBNA 4ZOAA 2X1LA 4MDYA 2HA6A 4EG3A 3KR2A 3Q2IA 5J58A 3ZVKA 3AERB 3PCRB 4GL4A 3K6SB 5B1YA 2IYRA 2KBEA 3GD7A 3HN7A 1SHJA 3P9SA 3LX8A 4AJPA 4JYAB 2GXSA 3LT0A 3VR1A 5EUCA 3EWNA 3CU5A 3FGNA 2GX6A 2V7BA 2IDJA 5JSYA 5AVQA 5B3AA 3CLRC 4D43A 4BFTA 5C0OE 2BDTA 3AEKB 4D9BA 2B9EA 3AEYA 1DWOA 1G7TA 1J70A 1YAHA 2ZWAA 4DJJA 4BMSA 5LNK6 1ISGA 1V47A 4HYTA 3PQ4A 4L8VA 1RKBA 2PZMA 1EE9A 4A2PA 1AKVA 2NYAA 3HHPA 3BRWD 5IFLA 4AZ0A 3KHUA 1XN1A 4LCJA 4FLEA 4RF4A 2IT1A 4NJMB 4L4XA 4UTOA 5LYYA 4RTLA 1YRWA 1CJUC 1LLCA 3IP1A 5I45A 1IAQA 2E18A 2HSEA 2HHJA 4RS3A 4ER5A 1VMAA 2C7GA 2HM7A 1JALA 4R2KA 3EEOA 3UWKA 5COQA 1QC5A 2YL2A 4OBWA 2MOKA 3M4JA 4QOFA 2ZBDA 3GRAA 5LD2B 2OEPA 1SC4A 1O97C 4JK3A 2C2KA 3S68A 1T2FA 1OUMA 1VPLA 4R0MA 1RAEA 1VPEA 3MTGA 1F51E 1WB5A 3FPHA 2BBTA 2RH8A 2AG5A 4F4CA 2BL4A 2GZ3A 3GNLA 3OOYA 5DN9A 2R60A 3E82A 4JJ7A 4LSGA 1XZNA 3KKLA 1SQFA 1A76A 1JI0A 1EXWA 1FUYB 1R5JA 2YZMA 1NW6A 2O5RA 3HJHA 1DWUA 3Q7PA 4N0DA 4RNDB 3TL3A 3BWMA 4DLBA 4AROA 2HRDA 1FDSA 1IPEA 3OZIA 4QUJA 1XJCA 5KBYA 4KN8A 3PJFA 2I6SA 1ZK0A 2ZE5A 1GN9A 2YHUA 3DGFC 1P7YA 3L4EA 3LCRA 3PA8A 1YXMA 4BQQA 1XVVA 1QCDA 3CPEA 3FJ1A 4JJAA 1LX7A 1N0VC 1UM8A 2OWDA 4TKZA 4X90A 2G4LA 2QRJA 2PO5A 2V7QA 1XWIA 4UTRA 1OFHA 1R37A 1XZDA 4LOLA 3U4IA 4MWDA 3GN2A 1V9SA 2PZ8A 3C85A 4FHFA 4MVJH 5EE3A 3HVJA 3RU7A 1Z5OA 1UMDA 4GEGA 3LW7A 4GLJA 2V7PA 3DAOA 5K3DA 3DKIA 2H16A 2I6QA 4PO1A 4TL6A 1M2OA 3T95A 3DULA 4DBLE 2Q0SA 3IVXA 4U2GA 1X9GA 2QI9F 2QRKA 2W00A 1P2GA 1M67A 2WSLA 1V16B 4NESA 3VR4D 4U6NA 1P0PA 1CF2O 2GAIA 1MP0A 1RMQA 2KHZA 1G60A 1RR6A 3MWJA 4HDAA 3PITA 4HRYA 4LSZA 3TZLA 4F6LA 2FWMX 4CKZA 1ZH2A 4L74A 3CLUC 4N8DA 1CUSA 1K86A 2B4RO 4Q7KA 4FB5A 1XVLA 4X8HA 4KXNA 2VN8A 1Y5IA 4LXXA 2COEA 1QG4A 1RCUA 3K32A 2B1QA 4EFMA 5HRAA 1THZA 3QEAZ 3UXHA 2I9KA 2R6R1 3IHTA 1R10A 3M3HA 1VM6A 3DHWC 2IW3A 3A3KA 1THTA 3COPA 2AFIB 2XCLA 1N36B 3DZHA 2ONYA 3DE3X 3F3MA 1Z4PX 2X58A 5H7XA 3THRA 3ZGNA 3GZNA 1ES9A 3TK1A 3O94A 1BZYA 4H35A 4BP3A 2D2VA 4EATA 3RK1A 2E48A 3CVVA 1SOWA 5H1YA 2PUGA 3C6ZA 4JVSB 3LDFA 1Z47A 1KXZA 2FUEA 2IYLD 5KJ1A 2JFQA 1JBQA 1I3KA 1I8TA 2AQ8A 2J5KA 4KUGA 2DGDA 5EJAA 2HEIA 3KBBA 4FX5A 5E6RB 2GJ8A 2ZZKA 4D9KA 5JH7F 4KQ6A 4JYZA 1X9IA 2Z5GA 3JSXA 1VL2A 3PJEA 1ZIPA 1AQ6A 4TTJA 4Z4IA 4BN5A 4UXHA 4EPXA 1UXOA 3EXEB 3NUGA 1Z8FA 2FLKA 1G7SA 4R69A 2GPBA 2ZIVB 1C30A 3GGDA 4ZRDA 1G2OA 5KVSA 1UPTA 4MW4A 5K1ZA 1KDTA 1ATIA 1ADBA 1EUDB 3AFIA 4QPJC 3R3WA 5GJBA 3H97A 4C6TA 3FMOB 5A05A 2BFBB 3MAGA 2GN9A 1QQAA 2FSHA 3N7UA 3MFYA 1OT3A 4AYTA 1VHWA 1OY1A 2VHZA 2OYRA 3M8KA 3V6LA 3NGMA 4A0RA 3TRFA 4KR3A 3QXXA 3KEGA 3VU9B 2B98A 3PIDA 4R3WA 3DV2A 5IABA 4JI6B 1NMEA 3TBFA 3DNPA 5CEFA 2PFSA 5CLHA 4CXMA 1R2QA 2OZKA 2QU8A 5AKEA 1VHLA 1IN4A 3PCXA 4NNOA 1U1CA 3Q7RA 4M1MA