3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
3WNBA 4HB2A 2GXUA 2QG6A 1GRNA 3H0KA 3CZQA 5SZJA 1N6PA 1G3IA 1E9FA 1R5BA 3GJ0A 2J0UA 2XEXA 3BRWD 2DFLA 3QE0A 4G5OA 6Q21A 5SZIA 4M1WA 4E5UA 1WMSA 3NWJA 4U5XA 4URWR 4DDTA 3BB3A 1ZU5A 2Z6VA 5KSYA 3H1TA 1FNMA 5LDDC 1DAIA 3AVVA 3DZ8A 4ITRC 4L16A 2HYIC 1P2UA 2FEMA 2JJ1A 2OT3B 4NYIQ 4B2LA 4D82A 3OZXA 4PAMA 3ZS8A 5JLJA 4D4MA 4Q21A 5C4MA 5AUNB 1OF1A 2ZJYA 5FTNA 4Q9IA 4G5SA 1RRPA 4HDQB 5D3MA 2FSFA 3I8XA 2O8FB 2Q3MA 2V54A 1ZINA 1SVSA 1EFUA 1DOAA 2BVNA 3IPYA 4JBYA 1OXUA 3QKRB 1M34E 3MGCA 2OCPA 2ZJAA 3ZVRA 3EAQA 2QT1A 4UNRA 5DGXA 4ABYA 2EU8A 3N70A 5FTKA 2LKDA 1E1QA 1P60A 2GILA 3KX2A 5D3QA 1E1QD 5CDFA 3QEOA 3AB3A 3UIEA 4BQSA 5LB4A 3TE6A 3TW4A 2YOFA 1N6RA 2HJVA 2ZRGA 1E2KA 2LCFA 3U44A 3SJZA 2ZR9A 4C0LA 1EFRA 1HYQA 1XCPA 2GJ9A 2WKQA 1NY6A 1Q1EA 1FP6A 2DFTA 2ODEA 4NCNA 4A4DA 2PT5A 2EFEB 3EZ2A 1EFRD 3QF7A 4TYWA 1Z83A 3PUZA 4JL8A 4DIEA 1P75A 5B57C 4OYHA 5KYKA 2VSOA 1GNPA 3KQUA 1U98A 3P32A 2QGZA 1TF5A 1SKYB 2QZ4A 2XOKD 2RGDA 2YWFA 4WOPA 4NDZA 3DMDA 4Q7MB 3WMGA 2J3EA 5KHOC 4CZ2A 4DBLC 1ZAKA 1K5GA 1NRJB 1AKYA 1VCMA 5TDHA 2MMCA 4BLSA 5JCZA 3NH6A 2ZVQX 4KU4A 3KJHA 2NO6A 1LV7A 5M04A 1JR3E 3SYKA 2AKAB 2ATVA 2VL7A 3AGPA 1Q20A 1AQUA 5AJWA 5FOVA 3UKDA 1U99A 2WOOA 3VMFA 1VG1A 2OLJA 2ZYWX 3WRXC 1G8YA 2O8EB 1TUIA 1E9BA 2FFQA 3TJZA 3SBDA 1NIPA 2BJWA 2W2XA 1N2CE 4LPKA 4B3CA 3BFXA 1YZQA 5FBQB 2VP0A 3KUCA 4RFSA 2P6NA 1R0YA 1T6NA 3FE2A 4YC7A 3IEVA 5J40A 1ZNYA 5E3HA 1IOZA 1CP2A 1W0JA 2ZRMA 3CBQA 3ND8A 1GG2A 2PT7A 1ZNXA 2FV8A 4Q18A 1DPFA 2O0JA 2OXCA 4ZI3A 1OB2A 4OI0A 1W36D 1L4YA 3BC1A 1VECA 3SU8A 2JJ2D 4JVLA 2HEIA 4QM7A 4JBWA 3SJAA 2OESA 4LBYA 1JQLB 3G5UA 4JLKA 3Q5DA 4JLNA 4GFDA 4U02A 1RKBA 4ARZA 2QSZA 2ZE7A 3NC0C 721PA 2GXAA 1G5RA 4BLPA 3LXXA 2JEOA 2P2LA 1ZC4A 3QPVA 4B3GA 5AWFC 2QM8A 3FKQA 5DI9A 2DBYA 1YR6A 1GKYA 4Q9LA 1GRRA 1KOFA 5L3RA 4B32A 2J7PD 1KSFX 4TSFD 2BM0A 4V0LA 3CPJB 1GOTA 3VR2A 1FUUA 1XCMA 1W4BA 3PR1A 2GCNA 3UMFA 2ZSDA 3ZH9B 1OXSC 2GAOA 2I1VB 4DCTA 2BEJA 2PZEA 2ZJBA 3TKLA 3RC3A 4BLTA 3SJCA 4IOJA 4DLSA 5G53C 4IOLA 3RYTC 4ON9A 4LHYA 1XEWY 4WA7A 5JS7A 5JWOA 2CK3A 1ZD1A 2FA9A 2AR7A 2IYZA 1HA3A 2FF7A 1Z0IA 2G77B 2W58A 2J1LA 3OHMA 4TL9A 3TIFA 4B3FX 4GZMA 1A5TA 2CL7X 4DB2A 5JHHB 1JNYA 1D2MA 3OE7A 4B6EA 4Z51A 5HKKA 4QL3A 1KI8A 4RCZA 1CJMA 4K46A 3SQWA 1ZUIA 2IK8A 3B1ZA 4NCKA 4Q03A 4BECA 3QKSB 4ZI2A 3EIHA 1E4YA 1K5DA 4ACBA 5H8WA 3IKJA 3K8YA 2GBLA 3THOA 3QXJA 4WZAE 3CZPA 2ZTSA 2K5UA 3WYAA 3AH8A 4MA4A 4OQNA 4JVSB 1ZUNB 5F98A 1HEIA 1R5OA 3U3RA 3RLFA 3ZZUA 1AKEA 4BFZA 1L7VC 2GHIA 3DPUA 2ZROA 3V00A 4WAUA 5TB5A 1AA9A 2X1VA 3KXLA 3VFDA 3TW8B 1XEXB 4EPXA 4MDFA 1B23P 4DSTA 4M1TA 2QMUA 1QHNA 5JECA 5JHGB 3X1XA 2DWQA 1P6XA 1V5WA 2FG5A 5HE8A 4FIDA 3O8DA 3ICEA 3K0EA 2OHFA 2W2VA 3RS0A 1BIFA 1KZ7B 3IBGA 3QF4B 4CGZA 2QROA 4MRRA 4LRWA 2C78A 4CEJB 3WP0A 3DZDA 2CJWB 4KFRA 3CLVA 2RAPA 5SZHB 1S96A 1N0VC 3THYA 2WAYA 1TMKA 1YQTA 3AF0A 2WTUA 4R9UC 3CF6R 1NN3A 4P3YA 3DHWC 2RGEA 1ZYUA 4WZ6A 4I1OA 1ZM3A 3B60A 3E70C 2XX3A 4LWZA 2FDCA 3K1JA 3KJIA 1KO8A 1W5SA 4JKYA 1AN0A 3L8YA 1RJ9B 5CB8A 2O8DA 2ZVPX 3SC3A 2V8OA 2Z83A 3L82B 3WXMA 1VG0B 3PUXA 2MSDB 1ZD9A 1ZNZA 2ZSAA 3PFIA 4QBFA 4B47A 3C41J 1FX0A 2AWOA 2HJGA 3H84A 1R4AA 3OEHA 4Q9HA 5EXSA 1TADA 4YLGA 2Q9BA 1BYIA 1E96A 4MYHA 1NY5A 1ZCAA 1SQ5A 2ZETA 3GJ3A 1E6CA 2ODBA 1EFHA 1G9XA 1TU3A 4HYYA 4LUCA 3UWOA 3HWSA 2C04A 4EQ6A 2J45A 2E87A 2YNMA 1V43A 2ZS7A 3NTUA 4NCIA 4MYCA 2H7VA 4OK5A 4PZLA 1L2TA 2XNSA 1HQYE 2WPDA 1TL7C 4CYMA 1LB1B 3P26A 3ZVLA 4IKEA 1ZIOA 2BHRA 3DVLA 4M21A 4IXMA 2WJIA 3VQTA 1PZNA 3K70C 4XWAA 4Z8YA 3L0IB 5GJCA 1C9KA 4B33A 3AVOA 3LBNA 4KSBA 1ESMA 2A5JA 3LLMA 5TV2A 2V1UA 2FSHA 3K70D 1ZC3A 1WB9A 4DLXA 2ZRJA 3W8NA 2IC5A 3C14C 5FUVA 3HU1A 2WWYA 4Q1AA 5DHFA 1W2GA 3CWQA 4FMDB 4LK2A 1S4QA 4JL5A 3ADCA 4JSTA 3CF0A 4BUJA 2FH5B 2VP4A 2BIFA 4UQOA 2NO7A 4ZDKA 4IDHA 4OHZA 2GVZC 3MUFA 2AN9A 1E2JA 1OV4A 3GLFB 1GL6A 5DHAA 3RRZA 4JL6A 3X1YA 3ADKA 2G0NA 1WQ1R 1JI0A 2WM9B 2GWHA 4A82A 3LW8A 4KYIB 1R8QA 2QA5A 1XJCA 3EARA 4LGMA 3DL0A 3BH0A 4A92A 3OFND 4DCSA 5FFMA 5AJVB 4PZZA 1G3RA 2ZRBA 1XF9A 1XZPA 2NQ2C 4CIDA 1R0WA 2C95A 4DLUA 4IEIA 1OH8A 1II9A 2YHSA 4CRWB 5B30A 4KCGA 4TLEA 1EFTA 4IDPA 1SXJD 5L3QA 1W5TA 1OXXK 2NO1A 5JZVA 2XJ9A 1E1RA 1J2JA 3LRPA 1KDRA 1KMHB 4BGDA 1G7CA 1VCIA 2J5XA 4AIIA 2X2FA 4XSGA 1GNQA 5FPYA 1XTRA 1E1RD 1CIPA 4Q1DA 1GDDA 4UNPA 4M1KA 2YOGA 5K8TA 4TMXA 3P1JA 3L8ZA 2G0TA 3VKGA 2ZRPA 3AVPA 1I4LD 4NPHA 1OKKA 1N6LA 4I1UA 4OHXA 1Q0UA 2HF8A 1OKKD 2A5FA 1EG7A 1LF5A 2PZFA 3W3ZB 4EIWA 4OHWA 1A1VA 1F6BA 4EAQA 4PTLA 3B1XA 4LV8B 1VYTA 2FSIA 3RANA 2HCBA 1FP7A 1JB1A 5L3SA 4LZZA 5LD2B 4KJZA 4RZ3A 3D8BA 2VHUA 2XTNA 3H86A 4ILEA 3FFAA 3W8RA 2ZSFA 1E2FA 1G7TA 4A8JC 2XZPA 3ZYCA 4PHHA 4US1R 1CF4A 2H18A 4D81A 3SDZA 5LBIA 1BS1A 1NN1A 2GK6A 1ZRHA 1KJYA 621PA 1LW7A 4XTRA 3BOSA 2ZI6A 4LJ6A 4C0SA 1UEJA 1MO3A 1SGWA 2WSSD 3OIYA 4KV9A 4L9SA 2P6UA 1OH7A 1XFAA 2F1HA 4XTCS 2XJ4A 1R0ZA 2BOVA 1PV4A 3X1ZA 4C0KA 1N5IA 5FPTA 3P4XA 2PBRA 2BKUA 3K0SA 4FINA 1TEXA 2B7CA 3ZIAD 5FL7D 3J81k 1E2NA 3GLGA 1ODFA 4Y0VA 1J90A 4NCHA 2W83A 1CJVC 5JEEA 4P33A 1WF3A 5UKDA 2D7CA 4DCVA 1QBKC 3TSZA 2GCOB 1Q1QA 5CLLA 5IK2A 4Z54A 2JGNA 1XU4A 2EYUA 3IHWA 3GJ4A 5H68A 3RDPA 2JLVA 2E9SA 4IFEA 4AWXA 1G1MA 2XAUA 4B2PA 1H8HA 2QP3A 4UJ3A 4RKEA 4ZIRB 4JLVA 3RRMA 1CRQA 3KTAA 3LNCA 2PH1A 3CRQA 1H8HD 1CR1A 2HT1A 4EPVA 1NN5A 3EW9A 4GOXA 1F2TA 4PHFA 5IRCD 1OIWA 4NTZA 1MKYA 1OFUX 1S3SA 2YJTD 1II0A 5C2JB 1GFIA 3CNLA 4TYQA 2QQEA 2NPFA 2MSCB 1QHSA 3RAPR 3THWB 1E4VA 2YC4C 2ODNA 4IFBA 3REFA 1RC8A 1KI3A 3HU3A 1N25A 4Q9KA 5B2ZA 1AGRA 4PO1A 3ZZTA 2ZRFA 4D0GA 4OK6A 3D31A 3FMPB 3FWYA 3W9YA 5FBLB 1JECA 1MR3F 4D4KA 2C2HA 4WXRA 2EW1A 3BJIC 3LQQA 2ZJ2A 3K53A 3QJYA 4E03A 1T5IA 2GAAA 5JJKA 3EXAA 3TNFA 4OI4A 3R7WA 1QVAA 1XEWX 1SVLA 1XD8A 1YR7A 3FFBA 2AL7A 3K0AB 1HE8B 2KBFA 1YZLA 3A58B 4Q47A 4PSAA 3MJHA 2RMKA 4QJ4A 1KTVA 1JR3D 5DSZA 2F3TA 2HF9A 2IXGA 1RYFA 2DY1A 2W2TA 2EFHB 4H9GA 1SZPA 1ZM2A 1TQ2A 1P9WA 2CXXA 5EXXA 2BV3A 1S9DA 4IDQA 4Q1BA 1IXRC 1Y63A 1TF2A 4Q4AA 4EPRA 4M9QA 3LAWA 1KYIA 1KMQA 4LBWA 3EC1A 4RZ2A 5FTJA 5LB2A 1T9HA 3QPUA 4LI0A 2FPMA 5F9FA 1E2IA 2VP5A 1OHHA 3PCRB 3LQRA 3JZMA 1E79D 2JDIA 3I5XA 4W9MC 1CRPA 3QSYA 4F91B 2N42A 2IUUA 1U8ZA 5EQTA 2WWFA 5JWHA 2ZAMA 4TLBA 3O8CA 2KJQA 2CL0X 4BEBA 1XD9A 2IXFA 4C7OB 2V6IA 4QHTA 1A7JA 1DG1G 1XX6A 3GLHA 3EC2A 2F1RA 3MWJA 4GMXA 4D6PA 1KI6B 4NH0A 4IOMA 4L8GA 5GVRA 4G5RA 3RNLA 3U5ZB 4JMPA 1MO6A 1U8YA 2A9KA 4V03A 1X1RA 1CS4C 1W48A 2HXSA 1Z2AA 1KSHA 2YYZA 3NVAA 2QTVB 5C1BA 4LSGA 3KKQA 1YVDA 2VTKA 3A1WA 3IIJA 2QMOA 2HCJB 2ZRDA 1XJ0A 2OBLA 4CT5A 3AVXA 1AS2A 1TX4B 5CYOA 1NKTA 5J4KA 5GJWC 2KBEA 2V7QD 4LJAA 1T0JB 1P4SA 2C96A 4DSUA 2OXRA 2ZRNA 1G8GA 4QBHA 3WHKA 4BLOA 5K8IA 4TL8A 5BYKA 2Y8EA 4JSYA 1RYHA 3CR7A 2RB4A 1N6KA 2DFNA 3CB4A 4PO8A 5AK0A 5F9HA 1ZVQA 1NP6A 1GL7A 4LHVA 2C03A 3SNHA 1XD2A 4RD0A 4HLUA 4BE7B 2FFAA 2UKDA 5CM8B 4JLBA 2QPOA 1T3LA 4DIDA 2CHGA 3REGA 1SXJE 3QKTA 3EZ7A 1M7HA 1N6HA 1ETUA 1P2VA 2G88A 5TARA 1NG9A 4KBFA 1QHHB 2W0SA 1GITA 3SE0A 4YQFA 3CRW1 3LBIA 4TTRA 4B73A 3RHFA 1XPUA 4IJMA 2IYVA 2QQ0A 1D9ZA 4U7DA 2AFHE 4MYTA 3L0OA 4PHGA 5AUOB 2FSGA 4TL6A 2JLQA 5E7MA 1US8A 1FFHA 4GL2A 1ZMXA 3AF2A 4ZDIA 1P72A 2GRJA 3PIRA 4BZPA 3FHOA 4LY6A 4LYJA 5FBRB 1IONA 1NVVR 2R6CA 1H65A 3EPJA 4Q00A 5FOTA 4QG7A 4QKQA 2XSZD 4EFNA 1XNJA 4DB4A 4YDSA 3AKCA 4W5HA 3QNUA 3SQXA 4RKFA 1EGAA 3W5JA 1HV8A 1UKZA 4BZQA 3EPHA 1KK2A 3CNOA 4FMBB 4AYXA 4Q19A 3AVUA 1W36B 3E1SA 1VKJA 1ONBA 4BWYA 3I62A 1KI7A 2WMOB 4PSKA 4K8OA 1PUIA 1O3YA 2OBMA 1GTVA 2WBLC 2IA5A 2CVFA 4NYJQ 4AY2A 1WA5A 2O8CB 2YC2C 2G83A 1DAEA 2ZUBA 2G3YA 2YINC 1OXTA 1VDZA 4ZDJA 1UKYA 2IX3A 2JJ1D 2QAGB 3IQXA 1HTWA 2D62A 2W00A 3GLGE 2ZE5A 3TAUA 3SN6A 4R2HA 2CVHA 1VG8A 5JI3E 3K0FA 5EXTA 2XXAB 5KDDA 2FFHA 1CJKC 2VHCA 2ZRCA 3CRRA 5DLQC 3SS8A 4L4UA 1OJLA 1HUQA 2ZRKA 1C4OA 4D80A 2EFDB 4DT1A 1OFHA 3L2OB 4P31A 4KSCA 2KB0A 2Q0HA 3MWKA 4URVR 1IN4A 2EFCB 2ZRLA 1NMXA 2JLSA 4X8LA 4HUQB 4Q5IA 4DUGA 1E0KA 1FMLA 2HYDA 1XTSA 2ZS9A 1SVOA 4LJ5A 4A2PA 4DUGD 2WAXA 3EIEA 2HLDA 2I4IA 3FMOB 3EZ6A 2REOA 3SFVA 1E2EA 4LJ7A 4S35A 5EZ5A 5CIQA 1IN5A 3TUJC 3PEWA 2C77A 2QP9X 4TL7A 2IWHA 4DLWA 3QENA 1GKIA 2H92A 4WVFA 3CX8A 1KO1A 2FFBA 3KXKA 1AJEA 2FPKA 4ZKDA 2XZLA 4PQRA 3S1AB 1MH1A 5L8VA 2R6GA 2AWNA 2NZJA 2BDTA 2G6BA 1RE0A 5AR1A 5KPDA 2JLWA 4X8HA 2DPXA 2WICA 2ZRHA 1G5TA 1E0JA 5GJBA 4RSGA 4AK9A 4G01B 1BH2A 4GDFA 5C4GB 2LWIA 4AYTA 1DEKA 2ORWA 4QNMA 4MRVA 2QAJA 3NHBA 4KLZA 5EUQB 2R44A 1RRGA 4TYNA 1TPZA 2KE5A 2V6JA 3KUDA 4OI1A 4MKFA 4PQYA 2XNDA 4EFMA 2O8BB 3NDPA 1IY2A 4Y0AA 3ZQ6A 3SFZA 5FI1B 1DO0A 4QGGA 3THXA 1KJZA 2F55A 3FHTA 4C4PA 3KFXA 1XXHB 3AV0B 3QBVA 1YR9A 5E7JA 2WWHA 1GAJA 1M74A 3VKHA 1RZ3A 3GFPA 3KJEA 3QI2A 4IDOA 4NU0A 3AVWA 3GMTA 2J46A 2CCJA 2OG2A 3EIQA 2Q21A 2B21A 1VYVA 3VU9A 3ETLA 4DCUA 4AG5A 4WW0A 3VKWA 3ICQB 2GJAA 3IO3A 3UANA 4P4SA 1VPLA 521PA 2HDNB 3B6EA 3T5GA 2OUKA 1W0JD 2GF9A 2CCKA 2O8DB 2GJSA 3GLHE 2QY9A 4IVPA 3RS2A 3MJRA 3KJGA 3SHWA 2IS2A 4F38A 2O5VA 5FPKA 1G8FA 1Y3AA 2OCBA 1FX0B 3HDTA 1AZTA 3AF1A 3D3QA 2FE4A 3QEJA 4RVCA 2LKCA 2VEDA 1UBCA 1Z8FA 2AFIE 5BW8A 2RGBA 3LFUA 3CKLA 1XTKA 2PCLA 3PG5A 3DKVA 2V9PA 1G5PA 1NIJA 3OIVA 2ZI9A 1KK3A 5DI3A 4TZ6A 1OIXA 2J87A 3TLXA 5A0FA 3BBPA 2AK3A 1JJ7A 3FKSA 3R20A 4GOKA 1FZQA 4NHOA 2FGJA 1KGDA 4HLQB 3B1WA 3ONWA 1NJGA 2QRZA 4ASUA 4YMUA 2FZ4A 4HDOB 4UXJA 3B7GA 5B58C 2IW3A 2N46A 2DHRA 3A8TA 4NKRA 5TVKA 4OJQA 2J0QA 4M1YA 2F3RA 4TLAA 3K70B 3CWZA 3KB2A 2C99A 2QMHA 3VR6A 5CB6A 2QSYA 2O8FA 4IOKA 1E2MA 4BFUA 1EESA 1G64A 5FBWB 5IDVA 4D0NA 2IUSA 4XVRA 2A5YB 3FGNA 3QXCA 3VR3A 2JLRA 3KQHA 2CK3D 3QVUA 1KNXA 3LW7A 3WBJA 1D5CA 2Q9CA 3C5CA 1HT1E 3K09A 3K09C 1GKUB 3RSOA 3PEYA 5HR5A 3GCGA 2VIIA 5HKKD 3OE7D 3H2YA 4EPWA 3E5HA 2X2EA 2DCUA 2XB4A 4Q7KA 4YMWA 3KZ1E 4DXAA 4XWOA 2BBOA 2GBLC 3GJ5A 3F8TA 4XOIA 2PEZA 3AVTA 1M1YE 1U2RA 3IHLA 2ZRAA 1N0UA 3GLIA 3WRYC 2UVQA 2PZGA 4CVNA 4BFYA 2ZREA 2ZI5A 3PUYA 2V3CC 4M4SA 1A82A 2WWGA 4RD3A 1SKQA 1II8B 4OI2A 1ESNA 1JAIA 2BWJA 3D6TB 4MGIR 4Q01A 5G3ZA 3ADDA 2QUZA 3ZVMA 4A0RA 1CR4A 3U3KA 2CLSA 1JJVA 1F2UA 1KY2A 1SXJB 4NCJA 4B3DA 2ZQ5A 2W6IA 3F0TA 4RD4A 4LYFA 1VYUA 2Z4SA 2DFKB 1U90A 4KBGA 2XZOA 1T5LA 4I81A 4XIGS 5FOSA 3I32A 3U7FB 2OLKA 1I2MA 2GEUA 1QRAA 4ZDWA 1XEFA 2ZI3A 1XMJA 1GUAA 4B3BA 1WBDA 4ZCMA 3MD0A 4EJSB 3RWOA 3DM5A 3LX5A 4C30A 3IUYA 1J70A 1UKEA 3SYNA 4N3NA 2IHYA 5G41A 4B43A 4JLAA 1IY1A 2D4HA 1WCV1 3QXXA 2JIZA 4LJ8A 4HZUB 2O8EA 5FUXA 1NI3A 3R8CA 3T34A 421PA 4IRUB 2OZEA 4V0MA 3Q3JB 4FWIB 2BCGY 1WXQA 1Q44A 2RHMA 4BRUA 4TLCA 1SVMA 4X8MA 2PMKA 3OEHD 2ZJOA 4FMCF 3OESA 4A8JB 4CDGA 3LV8A 1Z6TA 1UEIA 1QVRA 1AGPA 2OSBA 5CDFE 1YKSA 1IN7A 2AK2A 3T06B 1O87A 1S0UA 3LX8A 5KSPA 1KIMA 2QT0A 4NONA 2CEAA 4UNNA 1QZXA 4M2LA 1UADA 2GJ8A 2Q6TA 1NVVQ 3W6NA 2IS4A 5FUWA 3FOZA 1YZUA 2WOJA 1JBKA 2OM2A 3MG9A 1KO5A 2ZEJA 5E4FA 1JPJA 1Z08A 3DDCA 2A3RA 2F1IA 2P65A 2WPDD 1YHNA 1Z06A 4UKDA 4YXWA 4XD7A 3O8RA 5FL3A 4FD2A 1ZNWA 3NH9A 3N2IA 4XD7D 1G16A 5FOUA 5AUQA 2Q9AA 1SVKA 1T8TA 2A7QA 3CUEF 2GVDC 2BBWA 4M9XA 1UFQA 2VPPA 3HP1A 3FMIA 4MRPA 4D0LB 2YWHA 3F5FA 3AP1A 4AG6A 2GZHA 4QFMA 4AKHA 1WBBA 4C2UA 4GOJA 1KI4A 2R62A 5G40A 5DYGA 2GZDA 2IL1A 4ZCIA 4CEHB 2ANCA 2GCPA 2KI5A 1M7GA 2A5DA 5FTLA 1MOZA 2H17A 1CR2A 4D26A 3ECCA 1L4UA 3LBHA 4C0AC 1OE0A 2D74A 5AUPB 4WZBE 3GJXC 1PVOA 2RGAA 2WJYA 5JI2E 4GZLA 4QXAA 2DWPA 3U4QB 3QKSA 2ZJZA 4KODA 2IYUA 2ZYVX 2R6FA 1JQJC 4TYPA 5FUYA 4FWTA 1MV5A 3RS4A 1BKDR 3SHFA 3NDBB 4R2IA 4RFVA 2JA1A 5EE0A 3B5JA 4PFSA 5K8LA 3DEFA 4DDWA 1QHXA 4NYIR 4A0GA 3LDAA 2DYKA 5EP4A 1XEXA 4JS0A 3B1VA 4JJZA 2AKYA 2Z43A 1E9RA 2IXEA 4Q9JA 4B3XA 4F4JA 1DAFA 2VHTA 1S1CA 1G7RA 3T1TA 3DM9B 1NLFA 4MGZR 1BMFA 4EFLA 1SHKA 2GA8A 3W90A 4KI0A 5BWMA 1FQJA 1FOEB 3E2IA 2DB3A 1DELA 1KZGB 4AURA 4R98A 4BLRA 3M1IA 2YVUA 3QF4A 4KFTA 1Z0FA 4CT4B 1AZSC 4CEJA 3MRSA 1MO5A 2OEPA 5DYIA 1Q1ZA 3VTKA 1KK0A 2CJWA 4RCYA 2B7BA 4DJTA 8OHMA 1FTSA 5JBQA 3L0SA 4OKSA 2J9RA 5GJVC 1KHTA 3SR0A 1Z6YA 3TRFA 3CO5A 2D2EA 3EA0A 1MABA 4BPBA 3EG5A 1RJ9A 2IEZA 4M1MA 1E32A 3A4MA 1R8SA 3HPRA 4QRHA 2QRNA 2OV2A 3BFVA 2WHXA 3BB4A 3T61A 2JLUA 1FQKA 1KY3A 4DLZA 4O25A 1ZUHA 3X2SA 4Q1CA 5AJXA 1I2DA 5F2EA 3I3SR 3EZ9A 1U9IA 3U6BA 2XITA 3N2EA 1FUKA 2JAQA 4LPSA 4DLVA 4MKHA 2QBYB 3AKEA 4M1OA 5HZKA 1R5NA 1E98A 1J99A 2VSXA 3IEUA 4HAYA 1EX6A 2IYTA 2QEQA 5EJEA 3KB1A 3BE4A 2CLCX 1GILA 2ZANA 3GLIE 3HU2A 5P21A 1S3GA 3L0PA 5IK2D 4O2LA 4PC3A 3IPXA 3LWNA 2V4ZA 4LHZA 1KSJA 4OK3A 1DTSA 3CR8A 4DLYA 3CNNA 1N5KA 3AP2A 2GJKA 2OO7A 4MUAA 4JIMA 3A1TA 5EXPA 3TK1A 3MWYW 4HAZA 2Z5FA 3CRMA 1S1MA 1TQDA 2F1JA 3IILA 4LJ9A 1N5LA 1P9NA 2CDNA 3B78A 3RABA 3TUIC 5KOYA 3R9XA 2FEOA 1SKYE 2ZITA 5DO9A 4MUBA 3U7EB 4ESVA 4MKGA 1U8AA 3NIBA 2EYQA 3AVYA 4PXAA 4P4TA 4CEIB 5JS8A 2UZIR 1CEEA 3OAAA 3U6KA 4KXFB 4HAXA 4DZZA 4JLDA 3LH5A 1U0LA 2VSFA 3OAAD 4Q4JB 5FOWA 3GLFA 1XMVA 4GP7A 2FN4A 2WMNB 1COWA 2W0MA 5BN3A 1N6IA 2CE2X 3A4NA 1E2PA 3NEJA 1DAMA 2OFXA 2PCJA 2PLRA 4H1VA 4B71A 2IBMA 1RRCA 4A36A 1G4AE 3BXZA 3VR4A 2TMKA 1G18A 3QBTA 4V0NA 1Q57A 1VIYA 2J0VA 4GT1A 4L9WA 4E07A 3I61A 1NVUQ 1MRNA 2QGNA 5FR1A 4HLCA 4V0ME 3A4LA 2PMDA 1NMYA 1N6OA 3QVVA 4JT4A 1XJQA 2PJZA 4AKIA 2J0UB 1T4GA 1UJ2A 1OH6A 3AM1A 5CJ2A 3TQFA 1DAHA 1KMHA 3MFYA 4JVMA 1JEEA 2Z4RA 4TMKA 1Z22A 1ANKA 2NOAA 2Q3FA 5JCPA 1FPMA 1CKEA 2DR3A 2NMVA 1CTQA 1OHHD 3A36A 3SI7A 2JDID 2QE7A 1XP8A 1OT3A 1WDTA 3X1DA 1PLLA 3AUYA 2J7KA 4FCWA 3Q8XB 3EX7C 2RH5A 2B92A 3JVVA 2W6JA 5D3MB 1Z0KA 2L0XA 4ZO4A 4RJLA 3A6PC 2IYWA 1AIPA 1DVRA 1HQCA 4TMTA 5LD2C 3KDSE 3UWKA 4TQUS 3TUZC 1NL3A 3QG5A 4W5JA 1E9EA 1G17A 2AHOA 1D2NA 3T1OA 1TQ6A 1Z28A 2XTMA 2H57A 1Q22A 2C9CA 4GPTA 3CRVA 3V9PA 3TMKA 4P4UA 2VO1A 3AP3A 1G3QA 5KPJA 4HB0A 4TT3A 1SVIA 2GZAA 3AUXA 4PC6A 3U44B 1TAGA 1D9XA 3QY0A 2PX3A 1TQ4A 4Z1MA 4KHZA 1OFTA 4AI6A 1HH4A 2CNWA 3GJ7A 4HLUC 4DWJA 3P4YA 3V4FA 4ACAA 1E0SA 1D2EA 2V55B 4QBIA 3EPLA 5JFGA 3OIUA 2P6RA 4EPYA 1D8TA 1LS6A 1VHLA 2XGJA 2IYQA 5ANRB 5A4JA 2C98A 3ZJYA 2ZJ5A 4O0MA 4PR0A 2GCOA 1PLJA 1W0KA 4Q4HA 5EP1A 3W5IA 1E2HA 2EQBA 1EWRA 1X8LA 3C7KA 2AD1A 4M9SA 2D2FA 4YMSA 4TMZA 4ZIRA 2GXSA 1L8QA 3RRYA 4LJYA 3WY9A 1X8JA 5J4HA 2ODWA 1P2TA 5EZ6B 3MSXA 4HAWA 3VX3A 3EASA 1E9SA 4G5QA 2I3BA 4LJ4A 3R8FA 4QHYA 3WP1B 4POAA 4HSEA 4KLNA 1TF7A 1QHGA 4B2IA 2YOHA 2HUPA 1OIVA 1MT0A 2BKEA 2XB2A 1CJUC 4IHQA 1TNDA 1G6HA 4URZR 3THWA 3IQWA 1G8HA 2UZ3A 3OEEA 4D2IA 2G9NA 4M9ZA 4R7ZA 3KQNA 4FXPA 5FPSA 4Q4LA 2REXB 1AK2A 2OAQ1 3UMSA 1NBMA 1P5ZB 3EA5A 1F60A 3K9GA 4RFSB 3A1UA 3U7GA 2BMJA 3AEZA 1NBMD 1VCOA 3TAHA 3W6PA 2R8RA 2IYYA 4P4SB 4DDUA 1XWIA 3GJ8A 4S2EA 4XJXA 2F43A 2NTYC 3B13B 4QOSA 3QXSA 3UG7A 5TXGA 3K0AA 1XPRA 4B34A 1XTIA 2VYFA 1G8PA 3LO5A 4PC1A 4ARZB 4LC1A 3G82C 1KAOA 1JPNA 2R6AA 1G4UR 2YV5A 1S8FA 2RKOA 5DN6A 4QJ3A 1QHIA 3T35A 3ZGXA 4KFSA 1YZNA 2ZI4A 3GEEA 2WVJA 4IEEA 4V0KA 1VCNA 5DN6D 3PVSA 1DAKA 1NG1A 1N0WA 1ZCBA 2VP2A 5AJZA 5DI3B 1CU1A 3FMFA 4BZXA 4OQMA 5EP2A 4XVQA 5JMTA 3HR7A 1R6BX 3EPKA 2EWVA 3RS3A 4KYUA 4A0FA 1R7RA 4RZXA 1TU4A 3I73A 2ASEA 4JYCA 4M0LA 5CLQA 1T8UA 1UBEA 4OJKA 2X8AA 2CCGA 4UXHA 5DE3A 1XMIA 4HAUA 1R2QA 4HI0E 4NYMR 3PEVA 3W34A 1OXVA 5L3VA 1VG9B 5JSZA 3M4YA 3ADBA 1Q1BA 1W2HA 4C7OA 3FYHA 1NMZA 1OYYA 1KJWA 2EFGA 1BYUA 2QM7A 3LLUA 1KI6A 1NN0A 3UK6A 2RCNA 2VBCA 2ZUCA 1P2SA 2HLDD 1NSTA 5SZKB 2ZRIA 5E7IA 1UPTA 3NKVA 4JLOA 3IBYA 4NP6A 1D6JA 1N5JA 1TTTA 4F7WA 1G41A 2PJRA 3LVQE 1G21E 2WJGA 2WWWA 4MH0R 3RC8A 3GP8A 3KFVA 2EVWX 1ZM9A 3KKMA 3WNDA 3ZDQA 4JKIA 3UG6A 1J8YF 3C16C 4M8NE 4NL4H 5FBVB 3GLFE 4AKEA 5H1YA 4LOAA 5G3YA 1OLOA 4N0EA 4A2QA 3SOPA 2IF0A 2F7SA 3NG1A 5CJPA 1QDEA 1OYWA 4QJ5A 4PPFA 4UNQA 3GLIB 2R6DA 1E9AA 1I4DD 1JXOA 1KI1A 2FJUA 1FW6A 2OCYC 1VIAA 3K0CA 1U0HC 3RWMB 5KNDA 3K0CC 1JEDA 1WE2A 1OH5A 3B9PA 2X19A 2D3WA 1Z0AA 2XOKA 1F2UB 1N6NA 4TMWA 3T12A 4C0BA 1F48A 1QHHA 1IBRA 1UBGA 3MAAC 2FGKA 2G1JA 1KNQA 1X86B 2XNDD 4TQAA 1GNRA 1PLKA 2AD5A 3AKDA 4PPQA 4AC9A 1NVXQ 2GF0A 1T91A 2NO9A 4D4LA 3GPLA 2ZAOA 3PENA 4KVAA 1HE1C 1KI2A 3UATA 4YMVA 4HB3A 2JATA 1G20E 4QBGB 2QP4A 2GNOA 2WSMA 4P32A 4TLDA 2KSQA 2BMFA 1DARA 3THYB 1BO6A 4PAQA 4N0DA 5TY0A 4BFWA 1ZD8A 1R0XA 4DRZA 2P5TB 4QGFA 3PITA 2IT1A 5CK4A 2CHQA 1NLYA 1P73A 2PLFA 4QNRA 5FOXA 3T1QA 3EWAA 4OBEA 4F92B 4A6PA 5J47A 1BOFA 1Q3TA 1J7KA 4NBSA 4C9BA 4A2WA 3ZS9A 2Q3HA 4P0TA 4TYYA 1W49A 2FU5C 3A1SA 5KU1A 3MCAA 3QG1A 4WXPA 2OILA 1EXMA 2FX3A 2MMGA 2BCJQ 2ZM5A 2VHQA 5JJIA 4NE2A 4HLDA 1CR0A 1W36C 1Q3HA 3LD9A 2JJ2A 1E2DA 2ZYUX 1GIAA 2OAP1 2ZSEA 4MDEA 3BD9A 5LPNA 1DE0A 1XTJA 1E3MA 1F3OA 2IF2A 2P5SA 4EKDA 3C5HA 4FN5A 4EQ6B 4JT2A 1J8MF 4EUNA 4UNSA 3CIOA 4MRSA 5H70A 2O8CA 3DKPA 1AS0A 4Q1FA 3FKSD 1XDBA 1KK1A 1Z0JA 2CMKA 2FOLA 4LBZA 1WRBA 4C0HA 2F9LA 5HCIA 1UM8A 2QAGA 3IIMA 2QAGC 1RIFA 2BEKA 3G0HA 1IJFA 1EFCA 2J7PA 4ASUD 4C0QC 1Z63A 4MQBA 2VRWA 5EUMA 4GI7A 4NZYA 2VF7A 4I1SA 3HR8A 2XXAA 4TSFA 1G3UA 3TSWA 5J4YA 3DOFA 3K9HA 3O8BA 1Z6XA 4FI3C 3QKRA 3TBKA 3VR1A 1OPXA 1X3SA 3K9NA 4XWKA 3LXRA 1U0JA 4V02A 4A1FA 1W46A 4HUQA 4KITB 3T5DA 3ZD6A 3U2QA 4BEJA 4G3XA 3QQ5A 2ECKA 3HPQA 2N1BA 2ZIAA 3CH4B 4Q02A 1G7SA 1NLZA 3SBEA 4GSYA 1U81A 4D4JA 1G3MA 4F93B 1IHUA 2O0HA 5IF9A 4BRWA 3I8SA 3TH5A 5EP3A 4MITA 4US0R 2VA8A 1YU9A 1N3BA 4HUTA 1LFDB 1ZU4A 3FB4A 3MMPA 3ND9A 1DS6A 1P61B 4TN1A 2QI9C 3D7MA 3U3JA 4B76A 3S1AA 1F5NA 4FMCB 4B74A 1LY1A 3AQ4A 5FI0B 4C0JA 3V4RA 1NBME 3M6AA 4MGKR 4PX9A 2FNAA 4QM6A 3VNVA 5JWRA 4LYAA 2CBZA 1M8PA 3U3OA 1HT2E 4X8OA 5F3WB 1EWQA 2P0EA 2ZPTX 1Q21A 5L3QB 2W6ID 2SHKA 3BK7A 2QENA 3KL4A 3FTQA 2ZU6A 2V1XA 2CL6X 3BIFA 1K8RA 1JALA 4CF7A 1XMSA 3WNCA 3I4LA 1CXZA 1KAGA 2C9OA 2P67A 4PANA 2I1QA 3H4MA 3B1YA 4XSHA 5HPYB 2O8BA 3HYRA 2YZ2A 4IVRA 3Q7PA 1GRQA 4OHYA 3MWLA 2IS1A 4BASA 4HATA 4M53A 3BFKA 5EE1A 2C8VA 2ZR0A 3QIAA 3L43A 1NNEA 4AKGA 1UBFA 1MRSA 1KI9A 1A2BA 1XXHA 2IEYA 4PZYA 2WZQA 2ERXA 2JIZD 4A0HA 1UF9A 5L3SB 2ZSBA 3Q72A 3AKYA 1Z29A 3MLEA 4I99A 2ZUDA 4DEYA 3U7HB 4K81B 5JRZA 4CW7A 4WIAA 3CX7A 3AF3A 3U60B 3PV0A 1PUJA 1SHZA 3R9IA 1MABB 3Q7QA 4DVGA 1G19A 4JZKA 2ORIA 2ZXUA 4PPGA 1NVWQ 3RS5A 3OIWA 2GK7A 3GFTA 2VLIA 4C3ZA 3VNUA 1ZIPA 3HJNA 4L15A 3BGWA 4URYR 1GZSA 1RW4A 2R9VA 2XTZA 2RHDA 1VMAA 2NIPA 3F3YA 2B6HA 4DSNA 4WBSA 1E94E 2FZLA 5C18A 1E99A 1X6VA 1XZQA 1KDPA 3RSLA 5IT5A 4QC2A 2RGGA 3GQBA 2ORVA 3UXMA 4RD2A 3VAAA 4G0NA 5JRJA 1VTKA 3BB1A 3LVRE 3GLGB 1LS1A 1YE8A 4BFVA 2GEDA 3DO6A 3BS4A 1XB2A 1ELOA 4AD8A 1GP2A 4JLPA 4YXWD 2ZU0C 3NEYA 4GMDA 1Z07A 3TGPA 2B8WA 1T3SA 3PUVA 4G1UC 3VR5A 1IXSB 2OFWA 2ZJ8A 4JJKA 2HXYA 1ZJ6A 4W5WA 3QUSA 1YZKA 5FH9A 1W4AA 2JLXA 2HT6A 4DEXA 2X77A 5KNCA 4YMTA 1XBTA 2QU8A 3W6OA 3KTAB 4N1AA 1G291 4PC7A 3Q85A 3WYFA 4DCNA 1M6NA 4B75A 5HE9A 4US2R 3CX6A 1Z6GA 5KSZA 1U94A 1YZGA 1JAHA 1SVWA 2GTPA 1CBUA 1R10A 4LCBA 4JYBA 3NBYC 4Q7LA 1UDXA 1F2TB 4A9AA 1LF0A 2AXNA 1OFIA 2A30A 2FMXA 1CJTC 2WIAA 3I1FA 3JZAA 4F4IA 2IYRA 5DISB 3BERA 4U00A 1E2LA 3CW2A 5BYJA 3ASYA 1B0UA 4H1UA 3PJRA 2QN6A 4Q7JB 4JLJA 1RFLA 4ESHA 3TR0A 4LHXA 2C9YA 1X8KA 5FPHA 1E69A 1ZM7A 1Z47A 2VP6A 2WWIA 1E0AA 2IS6A 4GRAA 4JVNA 2QL6A 1Z2CA 2BC9A 1G6OA 3C4JA 4NYMQ 1JXMA 1PJRA 3FPAA 1XCGB 3LA6A 4IW3B 4M22A 4ZPXA 1QG4A 3T1VA 4HDCA 4BFSA 3QPWA 1I4TD 4GNKA 3OFNA 4NYJR 3B8HA 4PHTA 3R7WB 4PSVA 2JLYA 1IXZA 2YWGA 5JJLA 1X1SA 3K9LA 4AYWA 1II8A 1ZBDA 4FCTA 1IAQA 5KO2A 2VP9A 4LC0A 821PA 1EX7A 3W3AA 1SXJA 3RS7A 1SXJC 4Z8XA 3SYLA 3T15A 2BMDA 2IYXA 3WYGA 2YKGA 1RPZA 1QG2A 3BAFA 2NG1A 1KKMA 3BORA 2GETA 3GFOA 3B82A 1BMFD 4OHVA 3GEHA 5EE3A 4QGAA 2ANBA 4Q4AB 4TMVA 1NF3A 2IWRA 5JEDA 2CE7A 3WHLA 1XTQA 2GKSA 3IIKA 4G5GA 1OB5A 3N5CA 5AJYA 4FMDF 4EJSA 4EJSC 5KUTA 5K8UA 5CK5A 4TZ0A 2WIBA 4NMMA 5HTKA 3A37A 3CPHA 2GESA 2J41A 1P7CA 4RD6A 1E2GA 1SULA 121PA 3ZVNA 2FPLA 2ERYA 3NBXX 4HZUA 4KAXA 2D7DA 4LV5B 4URXR 3GLHB 4O2RA 2J0SA 3OF5A 4PPNA 4DSOA 5A5GA 2O0KA 4HEJA 2BJVA 5BXQC 2PEYA 2F6RA 4TTPA 2JJ8A 2IHBA 2ZE6A 4HB4A 3X1WA 5DIFA 5KDLA 3U3MA 1TEVA 1W44A 1NJFA 4A8JA 1GL9B 1DO2A 4OQLA 1ZM4A 1P3JA 4PAOA 3Q9LA 1U9IC 3FHCB 2JLZA 1IQPA 4HZIA 3TSOA 4II7A 2WSSA 3FVQA 2AXPA 3C8UA 1RRFA 4A6XA 1IN8A 4F4CA 1P62B 3VHLB 2F9MA 2KWIA 5ELXA 1XPOA 2WKPA 3AVQA 2PL3A 3B85A 2WJJA 2O52A 2OFOA 4D25A 3ZIAA 3KKNA 5FL7A 3TVTA 1Z3IX 1XD2B 1XRJA 1NKSA 5B64A 5CM9C 1W4RA 2OBNA 3CH5A 3VX4A 3Q5EA 5BQ5A 3RRNA 1TUEA 4FCVA 1GWNA 1HURA 1LNZA 1NSFA 3VHXA 3O47A 2WJVA 4PO9A 4ERNA 2CLDX 2WJHA 5GADl 3SJBA 2A2ZA 4Q4HB 2BBSA 4TQ9A 1W7AA 1IM2A 1WP9A 4ZKEA 1RVDA 1HY3A 2H16A 1Z0DA 3JVUA 4J0QA 4LHWA 3TQCA 3IGFA 3KQLA 1H8EA 3IDQA 4IXNA 2VQSA 3PXGA 4C2TA 4PC2A 2GXQA 1US8B 4LDJA 1H8ED 4B35A 1T3HA 2IYSA 4URUR 1JR6A 4CEHA 4KO8A 5DH9A 1KDTA 1QHYA 2GEVA 4ZCLA 3SEAA 3TR5A 5TMPA 3ZD7A 1YZTA 2IUTA 1COWD 2R65A 2NGRA 1T0HB 2OE2A 2P3SA 1M2OB 1XXHE 3KXIA 3A1VA 2RGNA 4OQFA 4OQXA 221PA 2RGNC 4E22A 1QF9A 2ONJA 3BH6A 3GD7A 4RY2A 2ATXA 4YONB 2OCAA 1LTQA 2B8TA 3U4QA 5GVSA 2VF8A 3AGQA 2ZE8A 4IVQA 1DG3A 1UDWA 2H1LA 3NHAA 5IHPA 3NBZC 2R2AA 2REBA 5KNBA 1OW3B 5EE9A 2BBTA 3UMRA 2F43B 4UJ5A 2JCSA 3P20A 3QXHA 1ZW6A 3RVBA 3QKUA 3NBFA 4LX0A 4PQFA 4W7SA 2ZYTX 4B48A 4BLQA 4GBMA 1AQYA 1JR3A 3GJ6A 4DHEA 4XH9B 1IN6A 1OSNA 2G1KA 3WMFA 4O3MA 2NPIA 4FW9A 4DC9A 4DLTA 3C15C 4BFTA 4L5BA 5CITA 2MSEB 3ZLJA 4GP6A 1M7BA 5J4VA 2QE7D 4RZUA 2BMEA 1VHTA 3K0FB 2VHJA 5BN4A 1E79A 2W6JD 1YJ5A 2QMEA 3IO5A 4KFUA 3DMNA 4M1SA 4B6FA 4DT1B 1UAAA 1FL9A 4ZV4A 3EZFA 3I92A 1CULC 4I1VA 4B44A 2GDJA 1CLUA 5J4LA 3TVDA 3ZQJA 2ONKA 1Z6AA 1S2MA 3PUWA 3R9WA 5J5CA 1A2KC 3GEIA 5JSZB 3PEUA 1ZP6A 2ZI7A 4RD1A 3EWSA 1K6MA 3FDIA 4Q48A 2FWRA 5HZHA 1E9DA 2YWEA 1KKLA 4MRNA 3BWDD 1KSGA 1DBSA 1GSIA 2EWWA 2JASA 4TTQA 2AX4A 4Q1EA 1DAGA 3DOEA 4HAVA 4TT3D 2QPAA 4DKXA 3B2EA 2WKRA 5KSOA 5KTYA 4EPTA 1GM5A 1MO4A 4I4LA 4OL0A 4Z1MD 5HCNA 1E2QA 4JLMA 2V7QA 4V0OA 2CNWD 5DNYB 1IJEA 1Z5ZA 2Z0MA 2QBYA 3WBKA 3KQKA 2ZS8A 1GVNB 3KKPA 1S9HA 1YR8A 1A4RA 4BFXA 4E09A 3AF4A 1P9RA 3CF2A 1KDOA 5CYPA 3NC1C 2H8KA 5EE5B 1AS3A 2J59A 1W0KD 4IDNA 4MYUA 3SZRA 3UPUA 3QOFA 4LBVA 1W47A 2VH5R 1IY0A 2NZ8A 1AM4D 4LYHA 1W4CA 4UXIA 1YRAA 2QTHA 3CM0A 2A78A 1C1YA 2A5GA 4R71A 2ZR7A 3CPEA 4YDHB 2WWXA 3I5YA 4MGYR 3KKOA 5FR2A 1DADA 4A15A 3I72A 4QHSA 3THXB 2HV8A 1W1WA 2DWOA 2PX0A 3LY5A 5BN5A 4KVGA 2BM1A 2RGCA 5E95A 5CIWA 5KDOA 4CEIA 5C46F 2QTFA 4TWZA 1FMJA 2CHVA 3WMEA 3OEED 1EK0A 4DDVA 1E9CA 1UKVY 3CONA 3B9QA 4Q4JA 4QGHA 4JBXA 4LV6A 3VU9B 3P27A 4XVUA 2QORA 2QNRA 3ASZA 3U61B 1FTNA 3BH7A 5FTMA 3HYTA 4DLRA 1FNNA 2NO0A 2E1RA 1YRBA 2QPTA 2RGXA 4Q66C 2XSZA 1KO4A 3PQCA 1Q12A 3M0EA 2WV9A 3NXSA 3ZZ0A 4EDHA 2H5EA 1KO7A 4MKIA 2C5LA 2D06A 2IYLD 1LVGA
chains in the Genus database with same CATH superfamily
4MW4A 4ZRDA 3C6KA 5FNZA 3WNBA 4HB2A 2QG6A 1ZSVA 1PZMA 1DFGA 3OURA 4KQIA 1M0TA 4LQ4A 1R5BA 3RPEA 1QC5A 2OP1A 2XEXA 1Q0HA 3RREA 4CUJA 4OSOA 2O2GA 4XM0A 3BRWD 3I52A 1TO6A 2DFLA 1GZ4A 3OX4A 6Q21A 1DTEA 4M1WA 1M6HA 1U0BB 4U5XA 4EB6B 3C3CA 1OWOA 3LUKA 1QGAA 3QYFA 3LUBA 4OXIA 4DDTA 1GGHA 3G0DA 1HTBA 4INPA 3SHVA 1ZU5A 1CZKA 3KNZA 1TM7E 3OFSA 4FCCA 2V03A 2NSYA 4FHZA 3RQIA 4DMRA 3DS8A 4LRSB 5EIWA 4XQEA 2A4MA 4F4DA 3WL5A 4GLBA 1AY0A 2FEMA 4Z0HO 5AW4A 2BF7A 3IEKA 1YUMA 2P78A 4HQFA 4PAMA 2ZBFA 1QUFA 4C4SA 1E7MA 1LBIA 1HX7A 4G5SA 5KJ1A 1TYAE 3PFNA 1RRPA 4HDQB 3UJCA 2GM3A 1TJ5A 3DZCA 1E6MA 2FSFA 3M8KA 4EEZA 1ZK4A 3RBXA 4EJ2A 2V54A 2VZ8A 2A9PA 1EDZA 1ZINA 1Y0BA 1G1AA 2BVNA 3QFTA 4ZVNA 1FDTA 4CMHA 1OXUA 5IM4A 1M34E 3MGCA 4P0PB 2OCPA 2E4AA 3ND7A 3ZVRA 3GPIA 2NNWB 3HCCA 3DEKA 2EU8A 3LIIA 3N70A 4GECA 4L57A 5ENVA 3W4IA 4RTNA 1P60A 4MV3A 5JU6A 3Q0IA 3LQKA 2PO7A 3LZ6A 5CNJA 3I0ZA 3M81A 3PDUA 1E1QD 1OASA 3LBAA 3AB3A 4ER7A 4KRGA 1B74A 3UIEA 3ZDDA 3GU3A 1TECE 3L7IA 4GR4A 2EZ4A 1HNWB 3EJWA 1YNSA 4RHCA 3SEQA 3UYKA 3IMGA 2LCFA 3OQIA 2ZR9A 2VT7A 1SC6A 3KS9A 4HH0A 5CG2A 4EG8A 3PHBE 2PUBA 1Z5OA 1BU5A 1P1CA 1KRXA 1Y5MA 3QBDA 3BHNA 2DFTA 2ODEA 4A4DA 4NCNA 4FD3A 1CNMA 1R12A 1TFUA 1W85B 2PT5A 3FSRA 3QF7A 4M54A 5CYFA 4ZALA 1TA4A 3PUZA 2HIGA 5FEMA 4RL6A 1P75A 3WWDA 3AYZB 4B3RB 1GQFA 1L4NA 3OBBA 3KQUA 2YICA 5DASA 1AMUA 1KAEA 2QTLA 5CA1A 4PGFA 4HFJA 2YWFA 1GG9A 4WOPA 3WMGA 2J4DA 4BNMA 4HNRA 1ZA2A 5HJ2A 4DA6A 4E14A 1R6AA 4PLPA 2MMCA 5TDHA 4EG7A 2XUAA 3MAGA 4NFLA 3NH6A 3KO8A 4R9NA 1PZXA 3LTEA 3GIDA 3L7NA 4KU4A 3KJHA 1JR3E 3SYKA 3UUGA 2P7HA 5CFZA 1N34B 3B53X 4MCJA 2ZWPA 5CMLA 5AJWA 3I5MA 3SF8A 1EFPA 1RWKA 1UBSB 3GHHA 3LC1O 2C0QA 4GE0A 4HGPA 4ZMRA 1JG2A 3VAYA 3S68A 1P6QA 1LPMA 3A3YA 3WRXC 1Y5RA 4PN3A 1TUIA 3NJ4A 3F97A 2W2XA 4LPKA 4B3CA 1N2CE 3I1IA 5GZ3A 5HM6A 1DQPA 3RS8A 1S8AA 1SVNA 2OB2A 2VUIB 4IMPA 4NRDA 2O1EA 1I8TA 3PX2A 1PJZA 3R40A 1E2BA 4ZARA 1UPFA 3FE2A 3B1KA 3LVBA 1ADGA 3GVHA 3Q6MA 4YC7A 5BSVA 1C0PA 1ZHFA 1T4BA 3F2VA 4LI3X 3QVLA 4LZWA 5E3HA 2GBPA 1FDSA 2RI1A 3SIRA 4YRKA 1GG2A 4N6NA 1ZNXA 4Q18A 1K66A 4OI0A 3V6LA 1C41A 2JCVA 3ZY4A 3PFFA 3C3JA 1FS4A 4J49A 3WDSA 4AF6A 3BC1A 2JJ2D 4F8JA 4QM7A 2VPTA 2KM1A 2XUKA 1JQLB 5K8JB 2HBYA 1RRCA 1IBKB 3N8HA 1B16A 4IG9A 4ARZA 2QSZA 3WIBA 1XHFA 2ZE7A 1YGYA 4BLPA 3R5FA 1Y8CA 1YFKA 4TUYA 2A14A 2JEOA 2P2LA 2PN1A 2WJ4A 2ZVJA 3LS2A 5A5EA 3TM5A 3BCSA 5AWFC 1KDVA 4EG1A 1L0BA 4NU8X 5EJAA 1Y1KE 4YDRA 2HREA 3ENWA 3TB6A 4DV7B 1YRLA 4FYHA 1FU7A 1YR6A 1GKYA 5JS2A 2GK4A 5HSGA 3RYHA 1KOFA 5L3RA 1LZLA 4B32A 1KSFX 3AXSA 3KXDA 4KQ6A 1YKFA 3EH2A 2WHYA 1OU4A 5JSYA 4O4HB 1QGOA 3GHYA 4Y7CA 4IQGA 1YQQA 3VKFA 3ASUA 4X93A 4JQOA 3V1YA 3VR2A 3DBHB 1ISGA 1PJ4A 3CZMA 3PR1A 4RACA 2WM3A 3C2QA 3PQ3A 5IDYA 1XLWA 2IY8A 1MAAA 2IPOA 2GAOA 4XYEA 3VJMA 1I3LA 3EYAA 2WKSA 1FXSA 2ZJBA 3AG6A 3EBLA 3CA8A 4PYQA 3RC3A 3WDMA 4DLSA 5JALA 5LKRA 1VPWA 2VSQA 1HYEA 1VP3A 5B2FA 1X80B 3RT7A 3ZU5A 4FZVA 2PD4A 1SELA 5ALGA 1ENZA 2OLEA 3NVDA 3O8NA 2FF7A 1Z0IA 4RIEA 4ZJZA 1VJCA 3A32A 3OHMA 3TIFA 3W6ZA 2GGSA 4GZMA 2HFKA 4FJ0A 4G1MB 5ALFA 4MQUA 3OPQA 1E18A 3MTGA 3JALB 2V9CA 3L92A 4ZANA 3M82A 3G7SA 3DMPA 4MPDA 4OIMA 1KI8A 3DR3A 4OB7A 1OC2A 4CFYA 2AN1A 3B1ZA 1JIQA 3TFQA 1ODCA 1ZNQO 1DWUA 2FEWB 3EIHA 1K5DA 3KAKA 3S2ZA 4ACBA 4D8UA 8ABPA 4RMGA 2GBLA 3AY3A 3THOA 1QRRA 5H8WA 1X8XA 3QXJA 3CZPA 4WZAE 2K5UA 3GJZA 3AH8A 3BSWA 3KCNA 4OQNA 4C4RA 1FJXA 4BFZA 1MDFA 2BFNA 2PX6A 1ECJA 4ZOLA 1JHAA 2BFMA 3V00A 2ZROA 4C2AA 1T0PA 1AA9A 2NQ8A 1N2HA 1WMAA 2X1VA 4OJYA 4YRPA 3VFDA 3WV4A 2R5WA 4EPXA 1QHNA 4EY4A 3DYIA 4ZO6A 5C8XA 1K2WA 1LPOA 1F0YA 1P6XA 2Z58A 3O4VA 3H8VA 1ZWKA 2K6GA 3T7AA 1IXKA 4J7AA 1SB9A 1SIWA 2I71A 4IY1A 2IPLA 4G5FA 2QX4A 2H5IA 3K94A 4O4LF 3HEAA 2RFLA 1BXGA 2BGJA 4P3OA 4CGZA 1IVYA 2RKBA 4RWEA 4LRWA 4KR9A 5F12A 4R4JA 3WP0A 5BUZA 3IKVA 2ADOA 3JQ8B 4NOMA 4UFPA 4RVDA 3CLVA 3ABOB 3MPUA 5K99A 3BCHA 2XVYA 1SCIA 2WAYA 3NANA 2ODAA 3PTZA 5I9NA 3THYA 1NN3A 2H4JA 4P3YA 2BW0A 2WDPA 3QU7A 3D4IA 2VI5A 4I1OA 4LWZA 2QKYA 1QWOA 4HDRA 4L07A 3AL2A 3CIFA 1GGJA 3W06A 4OSEA 1GU1A 3MF4A 4URZR 3VHQA 2VK4A 4NATA 5AFSA 3SC3A 2V8OA 1AGNA 2Z83A 3QUCA 1D8AA 3G2IA 4H18A 1VG0B 3H5LA 3RIXA 1ZD9A 2ZSAA 5IM5A 1OR8A 1P9LA 3C41J 3AFGA 3LQ4A 5AI4A 2VQ3A 2XGGA 3H84A 3I4CA 4DDKA 3FHJA 1YBFA 2XMRA 4B4WA 5A3VA 3SFTA 4D5EA 4UBMA 3DWEX 4PAGA 4YLGA 2IYNA 4QU9A 2Q9BA 1E96A 4MQLA 1USKA 3PNLA 5J1TB 3STHA 4F6RB 2ZSKA 4U7WA 1SQ5A 3T5TA 4OGWA 2Q2NA 3GJ3A 5DHQA 1E6CA 1R4MA 1YB1A 2ODBA 1JMKC 1EFHA 5CA0B 3B70A 2GR9A 1G42A 5MN5A 4HKTA 3IP9A 4DR7B 1N7IA 5MF6A 1NJ2A 3UWOA 4RFLA 2JFZA 1Y6RA 1R50A 2QTRA 4IMJB 3SC6A 1UMBB 1UQRA 3LCVB 4XLLA 3S2SA 3VR4H 4DCJA 4RTKA 2XMQA 1I36A 2YNMA 4WLVA 1V43A 2YL2A 3F7TA 2WFLB 2DM6A 1BZYA 3CTMA 4NCIA 1ADFA 4Y9RA 2I78A 4IH4A 3IV7A 1ZUWA 3O8LA 1TL7C 2GPAA 4D9BA 4B79A 2UZ1A 2BHRA 3UENA 2J3DA 4YQZA 5AKZA 3WLAA 3SXJA 4AKTA 2WJIA 4S1VA 3DBRB 3EQ9A 5KVAA 3K6RA 4D1YA 2CUZA 3GVIA 4IDDA 2YUTA 4Z8YA 1C9KA 3T3PB 4RORA 3G49A 4XPIA 3H5VA 1T9CA 1JSLA 2A5JA 1J2UA 5B1SA 4AMBA 3OPYI 1WPQA 2IEAA 2DWCA 4EI9A 1DKOA 1R0SA 1ZCJA 1PTJA 2AMFA 2MSKA 3KLBA 1B2RA 1W4LA 3KHUA 1XU9A 4KNWA 3W8NA 2WWYA 3C14C 5FUVA 1R9JA 3HU1A 3MTEA 3EG9B 3R7AA 1W2GA 4KDFA 1C30B 1TQ8A 2EG5A 3BUSA 2OXTA 4BKOA 4FMDB 1S4QA 1VE9A 3L07A 3VPHA 2VP4A 1JEOA 2BIFA 2NO7A 4UQOA 3A3PA 3RK1A 4OREX 1P0IA 3WMWA 2WHRA 4RZQA 2EBHX 1GCGA 1FNDA 1X2EA 2O23A 3PIDA 5A6SA 3IX7A 3RD5A 4DLAA 3UC9A 3EHEA 2Z30A 3OJCA 5A0VA 2VBFA 3QHAA 1JI0A 5BN3B 1N8SA 3FTCA 2HEGA 3EOBI 1R8QA 4MPJA 1HNZB 1XJCA 2G36A 1DJPA 1PJSA 2ZATA 4I55B 4C5BA 1Z4QA 2VPWA 2O2EA 3D5QA 4LGMA 1ZI6A 1LTHR 3E48A 3R7BA 3BTUA 1Y7LA 3T94A 5HRCA 3K8ZA 2FX5A 3G9ZA 1RI3A 3H4TA 2X6TA 3OOWA 4YACA 3TG8A 3ZV7A 3UXEA 4D41A 1G3RA 4WK0B 1AMOA 2CUTA 3HEMA 1UWLA 4ZTUB 2C95A 3JV7A 3I23A 5IN4A 4JI1B 1Y4AE 5C32A 1F38A 4X91A 4ZVKA 1JEAA 1ONPA 1SXJD 2E6UX 3NU1A 4AXXA 1QP0A 2OL4A 1RP7A 2QN9A 2CNNA 3FPFA 1J2JA 3LRPA 1KDRA 1KMHB 2NN3C 3OMLA 4OHBA 2QLJA 4D6XA 3H3JA 4HQOA 3U1VA 5BVGB 5FP0A 4HBGA 3NGLA 5LUBA 4QOJA 2O50A 2YXEA 3O84A 4W1QA 3KE9A 2YOGA 4BCCA 4TMXA 2GD2A 3C8ZA 2G0TA 3AJEA 3ZWAA 3AVPA 3JSXA 4X1YA 4NPHA 5IUNC 4XWWA 3N58A 5CDGA 5CXXA 2BMWA 1N6LA 4I1UA 2HWUA 4NXNB 16PKA 2H3HA 4ZOQI 1KP3A 3Q41A 5KBYA 1OKKD 3A9CA 1EG7A 3W3ZB 2FK8A 2ZM6B 3B1XA 1IJKA 1OA0A 4CM7A 3TQTA 2GM9A 5KDOA 3GEBA 1JB1A 5LQCA 3P9ZA 4LZZA 3U4IA 3D8BA 3SVZA 4C6SA 2VAVA 3C3EA 3H86A 1SOUA 1TCUA 1W87A 2EX0A 1XAIA 3FCEA 4GI3A 1A8UA 4LN1A 1OAAA 4MI6A 3RC2A 2CLFB 4GPD1 1R0KA 1Z2EA 3TW0A 2PY6A 3UA3A 3ZYCA 1MJNA 4KAFA 4IQFA 1AQJA 1QIKA 1PYDA 1GQOA 3MILA 3SDZA 3W2GA 1BS1A 1IZ9A 5G1PA 3TL2A 2C57A 4BL5A 3ET4A 4P53A 621PA 5ALYA 1GPKA 4YAEA 3BOSA 2ZI6A 1ZVKA 2IEGA 4UEKA 3BKXA 4BB5A 3ZWYA 3DT8A 3FGOA 3PD7A 5JXGA 3RGWS 2GN9A 3ZDBA 3OIYA 1FB5A 4REQB 4DJEC 4ARBA 5GM1A 2HIAA 3IT2A 1GCUA 1R0ZA 1PV4A 4MVWA 1Z17A 1CUAA 1CB7A 1N2JA 1N5IA 1PR5A 2G28A 2V7PA 3IAS1 3MXOA 3P4XA 3GT4A 4AICA 1TEXA 3ZIAD 4G56A 4YJHA 4P58A 1WDLA 1Y8AA 2X9VA 3GLGA 5CLHA 1KU6A 3ONFA 4JIGA 2I2AA 4LYEA 4NNOA 3RVSA 1ADBA 1CJVC 1FU8A 5JEEA 1PWZA 3ZY2A 5BSFA 2PLAA 2R5FA 1WF3A 4NY1A 5UKDA 5LMCA 1KJNA 3ABSB 4Z54A 2YVLA 1NRXA 4RVHA 2JLVA 5CEJA 5HBRA 5CDYA 5F9FA 4UJ3A 3H2KA 3K92A 4J1TC 1U7OA 1UJ6A 3N6VA 3A0UA 3RRMA 4O1IA 4E08A 4F3YA 3KR0A 1C9NA 1CR1A 5F52A 3VH2A 1NQXA 1Q6ZA 4HN2A 2BFWA 1KZ4A 3H9CA 4HNAA 4KXMA 2DLCX 3IESA 5A7GA 3VDXA 1SKAA 2G0AA 4QJIA 1OFUX 3E61A 1O5TA 1GFIA 5BQPA 4TYQA 3D3WB 4X7PA 1C9YA 1EG2A 3W8FA 4YAGA 1MFZA 5HJEA 3JYNA 3NATA 4FGJA 1S8OA 4CQMA 2VCEA 2OCKA 5F3DA 3THWB 2ZUUA 3GK3A 4L5JA 1G21A 3REFA 4F04A 1A1SA 2V6BA 4EYQA 3IEMA 3V6MA 4E88A 4BYMA 2PUTA 3KVVA 4XI9A 2CB0A 5JD5A 3FWYA 3W9YA 2VJCA 1AHPA 1ZW1A 4X7MA 5LL6P 1L5OA 4AFNA 1DOZA 1UDRA 1SC1A 4QU8A 3HDJA 1NI4A 1T5BA 2EW1A 3IUMA 3L8CA 3LQQA 4OKNA 4ANFA 1E6KA 2HRQA 4BGVA 3K8QA 3MT0A 1T5IA 5JJKA 5J2TA 1KQPA 3ORRA 3WAKA 4W63A 4GYJA 4FC7A 1SVLA 1XD8A 1E5XA 1RI1A 1YR7A 2J30A 2WC1A 2PGOA 1H6AA 4Q3CA 4QO8A 4UD6A 1HE8B 1OZAA 4PLHA 4GGPA 3PR2B 4MWOA 4W9NC 3QVTA 3A58B 3EWNA 1W25A 4DWVA 4MARA 2RMKA 4HQNA 4G1FA 3JQ9C 2BFBA 5DM70 1KTVA 2LIVA 4C7XA 1I7QB 2WRZA 4AP9A 4IX9A 4EGQA 4MW9A 1U3TA 1ZM2A 4F8EA 3ZGLA 4GZ5A 3R8XA 3VYSB 1MIOB 3RIHA 4ARVA 5ALMA 3SYMA 2BF4A 4NX2A 4FEYA 3FLMA 1TF2A 4K9QA 1CG6A 1VJRA 1YDGA 3DDSA 3IE2A 1KYIA 4NDNE 4Q4AA 4UZSA 1KMQA 3VH3A 4RZ2A 1XUOA 3QPUA 4LI0A 1E2IA 3SQDA 3ZOKA 5BW5A 1OHHA 5FWXB 1SOMA 3PCRB 3LQRA 4X1IA 1VIMA 2OZLA 4BCDA 3EODA 5IKOA 5TIIA 1D2HA 1E66A 4CIXA 4BKQA 3S4YA 2IEIA 1ULUA 3PWKA 3QU5A 4LXTA 1R00A 1XD9A 1FFSA 3BWCA 2IXFA 4C7OB 3UN1A 4NBNA 4C5CA 1JEYB 3NEPX 5TX7A 3NRBA 3EC2A 4LX8A 2E3JA 2FMHA 4GMXA 1KI6B 4NH0A 1DFIA 1RZRA 4UHFA 5GVRA 2YS7A 1H2HA 1THGA 4ND5A 2A9KA 4QDTA 4V03A 1EUCB 1W48A 3AWDA 1Y6GA 5EEHA 2R1ZA 1Z2AA 4WCFC 4E32A 5KKNB 1KQOA 1T0UA 4LSGA 5KYUA 1NX9A 3K1TA 4YMGA 3WZMA 2WTXA 1P91A 3NP9A 2QMOA 1NLUA 2JFGA 2ARKA 2OBLA 5HZGA 1M0EA 1TGVA 2ORYA 2QUAA 2GAJA 3UB4A 1TX4B 3DUFA 3VR0A 5CYOA 1U5AA 1BGWA 1UXJA 1TJPB 1ESCA 1BVRA 1LXCA 3BJMA 4J0FA 5GJWC 2GZSA 4LKRA 1TAQA 3CLTC 2WJZB 3D4BA 4HEA1 4BB9A 1G8GA 3O3MB 4XDYA 5BYKA 2Y8EA 1TMYA 1RYHA 2M9MA 1E3DA 5A03A 4PTYA 5AK0A 3S7TA 4G4IA 3QUQA 5HWSA 5JZ9A 1PV1A 2ZWIA 5TQ0B 2W93A 1HEYA 5JC1A 4N49A 4N40A 1M5RA 3WGLA 1H3FA 4JLBA 2DHEA 1BJTA 1JA1A 2I4OA 4DIDA 3U16A 1MAUA 1UIRA 2CHGA 2W6OA 1VLZA 3QPCA 3O95A 4NICA 5IAEA 3REGA 4ZT7A 1SXJE 2PGIA 3TLZA 3QKTA 3U09A 2JFFA 4LTNA 1OTYA 2RHCA 4RX1A 4Y2HA 3HA7A 1GQQA 3SE0A 1AK1A 3A9SA 2Y77A 1EWVA 3ABZA 3ILVA 3H7IA 3AI3A 3F4KA 3RHFA 1FJHA 3ZEIA 5MN6A 1XPUA 4IJMA 2HHHB 5BQOA 2VXYA 3R0IA 2PX4A 3W79A 2QQ0A 1MB2A 2X0JA 1D9ZA 5BV1A 1AX9A 2AFHE 2DQYA 4H3SA 3C98A 2FSGA 5COBA 2FVXA 2Y67A 3ROEA 3OQOA 4ZCTA 1HE5A 4MKZA 3OIFA 3V2HA 5JFOA 1US8A 2SECE 3KD2A 4BTEA 2G1PA 5JAQA 4ZDIA 2JGJA 2QT9A 3VYRB 1XRMA 4RSHA 5JFTA 2R8YA 2QG9A 2VLBA 3PIRA 1VMDA 4LZAA 4BZPA 1H5QA 1P7ZA 1AQ6A 1RDFA 2J3LA 4GMFA 4H16A 5FBRB 2XD9A 4S12A 4F4UA 4LHSA 3HZOA 3U7QA 1CC1S 2ZULA 3EVCA 3OEYA 2WE8A 2ZPUA 2KLBA 2VHXA 3AUAA 1DBPA 1SU7A 3EXIA 4JR1A 4BRSA 5BR1A 1WM1A 4PY2A 2BHTA 5LYJF 3KETA 1UBUS 1OA1A 3TSCA 5CBPB 4ZVPA 1T2AA 4TV8F 3NALA 4YDSA 1RC0A 3TKYA 5J2UF 3SQXA 1WXGA 1Z0SA 2AA3A 5CIYA 4G63A 1T3GA 3KL2A 3A27A 1HV8A 3LDGA 3EPHA 1KK2A 1O0SA 1RM0A 4KR3A 3AVUA 2ADMA 3ANMA 3ET5A 4ENPA 4YHHB 4MIOA 4X94A 3ZZNA 1IYZA 1R66A 1VSVA 2RB5A 1J2TA 5IEJA 1IMJA 4I4TA 1RM3A 1W0CA 3TTVA 3DQPA 1NF8A 1P3Y1 4H08A 4PSKA 3RBZA 3SEZA 4D0RA 4MHOA 1UBRS 3USCS 1QWSA 3HWRA 3BJEA 1TO1E 2I6GA 4HADA 4PFKA 2YINC 4W5QA 5FT9A 1GPYA 5DYWA 2QAGB 3IQXA 1FJ2A 1J1ZA 1QGUA 2J48A 3AESA 3HXTA 3JYLA 2B4YA 4J8PA 5AXBA 5C0OE 3ROFA 4V3CA 3I9KA 3P5SA 4KWCA 2YZNA 4L85A 4IDFA 5F5XA 5JI3E 2HSWA 1AE1A 1APBA 3E9RA 1ORHA 4PCLA 5KDDA 2FFHA 1U3WA 1EDBA 2ZRCA 3C5EA 1Q0TA 2H48A 4HQ0A 3T54A 2EFDB 3SSNA 4GWGA 2AF4C 1XROA 2JFNA 4MVJF 2KB0A 4YVFA 3BDAA 1U7PA 2ZRLA 1YF3A 1NMXA 1RQGA 1Z6QA 4X8LA 4DUGA 3MGKA 1PX2A 4ZO7A 1QQTA 1SVOA 3ODPA 1T3ZA 2O3QA 4CKYA 5GGXA 2HLDA 2QRLA 3FMOB 2EQAA 3EZ6A 4HRXA 3RFUA 1CUHA 3SFVA 4DZRA 1E2EA 3OICA 1GGFA 1PO7A 2XMBA 2IQIA 3MGBA 4JCCA 4UDYX 5EZ5A 5ULLA 4X71A 5D5QA 3GY0A 4AZ3B 3RTEA 4YR7A 1UC5B 5JISA 3OJFA 4PIMA 3OKFA 1GKIA 2H92A 2J6BA 1T13A 5AHRA 1KO1A 2HMTA 2J3MA 2FFBA 4Z0TA 2PKXA 5CR9A 3OH8A 5B2EA 3TR6A 4ZKDA 1H2XA 4PQRA 4H17A 1MH1A 5L8VA 1MQ9A 3GZTB 1LQ2A 3UGJA 2BGIA 3P2MA 3IOCA 1BRTA 2NZJA 4G2NA 4ZOCA 4K7JA 4CV3A 2BDTA 4HNHA 1NC1A 1H0HA 2D1RA 4LDRA 5AR1A 2WICA 1E0JA 1G5TA 3IVXA 3OZUA 2I9PA 3WOVA 2P62A 1NUHA 1Z75A 1Y42X 2IDMA 4G01B 3EDQA 4GDFA 3OCUA 5F64A 3PUHA 5DM2A 4F9FA 3FPSA 4R68A 5H02A 2QAJA 1BFKA 2ATCA 3JQQA 5LWHA 4RTRA 1BGVA 4OHOA 5EUQB 4RA9A 5I5GA 2C4TA 2Q41A 5DT9A 2CBGA 1PF7E 4QGBA 1P33A 2KE5A 2XE8A 2WSLA 2O07A 3ELYA 3R09A 1JPUA 2H06A 2XNDA 3T4PA 1ONNA 1VE3A 3LRTA 1YOVA 1OMOA 2RBEA 1U8TA 2YJ4A 2ZDHA 4JJGA 5AKIA 3PFGA 2HW8A 1C3OA 3HZRA 4X20A 1GLNA 5FI1B 3L9XA 2D2IA 2C29D 4UMFA 2HRCA 4UUPA 5IC6A 3E3AA 4AWBA 2P6OA 1XXHB 3L41A 3QBVA 1CUFA 1RYMA 3D8SA 3LUPA 4PCVA 4H3KB 5E7JA 3WK4A 3NOQA 4AQDA 1G9TA 3FZNA 3HUDA 3V7WA 3GFPA 1D6MA 3U0BA 1A27A 5KQGA 3AVWA 5K0LA 1S3FA 2HK8A 5T4HA 3H11B 1C29B 2OG2A 3EIQA 3FXAA 3WJAA 3CHYA 4WEQA 4DCUA 1TJ3A 5ECDA 4S1PA 1U9JA 2Q3DA 3UANA 1NDUA 1VPLA 3KUXA 1FVFA 1X7DA 2HDNB 4R9RA 4EHNA 1OI4A 2GF9A 3UUFA 4M9CA 2CCKA 3K6KA 2DPMA 4ZD6A 5GZ6A 4P92A 2QY9A 4ESEA 1Q1AA 5EJ4A 3LVFO 3N7UA 3O4HA 4G1EB 5FPKA 1Y3AA 2OCBA 1FX0B 3HDTA 3NWPA 1AZTA 5HW0A 1WULS 1U28C 4RVCA 3PHIA 3GEDA 5K0SA 1LI4A 1UBCA 2AFIE 3JVIA 2GNPA 3TZEA 3HN7A 4KLCA 1RLTA 3LFUA 1XTKA 3CTPA 3L6EA 3JAMA 1ZH4A 2EKDA 5DPMA 1N8KA 2FWNA 1NW5A 1YL7A 2B1JA 2G1AA 2G5CA 4UHKA 3OT1A 1JFRA 1J42A 1NIJA 1I6KA 1KK3A 4EB6A 4TZ6A 1S2OA 3SZLA 1EU1A 1WSBA 3CE9A 4FQ7A 1VMKA 1BRMA 2G9VA 5A0FA 3BBPA 4KQMA 4XFKA 1U7TA 1ZH8A 1C8BA 1TYEB 2XVAA 1UOPA 4LMRA 4N5DA 1GUZA 3R3WA 2Y1KA 1VSUA 1N32B 2DJIA 3H13A 3R41A 1NJGA 5IWAB 2GPNA 4ENSA 1J00A 4YMUA 3VR2D 4UXJA 1KFKB 3B7GA 4UZEA 3F8SA 2Q3JA 4NBKA 3CC8A 4NKRA 5TVKA 3PJEA 5B6IA 3SHTA 3DONA 4O4LB 4EKGA 1FSZA 4Q1VA 3UCFA 4D9JA 4Z3OA 1RLIA 1E2MA 3OO1A 4FXOA 1Y1LA 1EESA 4YLYA 3D8HA 4W1RA 3UC5A 1JHZA 4D0NA 1G5IA 2DKOA 2A5YB 2MSLA 3K9CA 3NRCA 3QXCA 3PDHA 1AHHA 2PLWA 2CYCA 4KX3A 4X85A 5H82A 3VR3A 1KNXA 5EJ2A 3LW7A 5K3OA 3SZOA 1D5CA 2O14A 6AT1A 2WAAA 4RPCA 5B3JA 5KINB 2FHSA 3RSOA 4NQRA 3N7AA 4RA6B 4RY9A 5HR5A 3KQMA 2VIIA 1J20A 3F7OA 3FUVA 1PFVA 3JTEA 3H2YA 1THTA 2QVYX 2X2EA 2VWQA 4YMWA 1QR6A 4DXAA 1WX1A 2BBOA 2GBLC 1NV8A 1WZNA 3STWA 4XOIA 2NUPB 1BS9A 4PX2A 4CIWA 3HUTA 1QNLA 2ZRAA 3WRYA 3IE1A 4BFYA 1TCBA 2ZI5A 2ZREA 2I33A 3DFZA 3PUYA 8AT1A 2V3CC 4M4SA 1CUVA 1A82A 1WNTA 2O6HA 2XQGA 1W85A 2E7ZA 1D2GA 4JA0A 4KPYA 1II8B 3LQ2A 3ADDA 1DRKA 1UBKS 4Q3BA 2QUZA 2VDOB 4IP0A 2A9RA 4N41A 4ZAYA 1HC7A 1F2UA 4JOSA 5B4VA 2BR3A 1VKZA 3ZXIA 1AQLA 2GERA 3ZGOA 4X6XA 1X77A 1DKMA 2JLBA 2VPIA 3N8IA 4LYFA 4RD4A 1VYUA 3S0JA 2Z4SA 3U9TA 1U90A 3E23A 2QZZA 1M33A 4MWZA 4Y2VA 4BEWA 1LX6A 1T5LA 2QTTA 4GEGA 4XJTA 4XIGS 2XUQA 4O4IB 3U7FB 4E1AA 2PGDA 4ID9A 3UUWA 5CFQA 2FUCA 3ZQUA 1I2MA 2GEUA 3NTRA 1CUEA 4KN9S 1Z2PX 1V7QA 2ZI3A 5DJ5A 4QYWA 1YK0A 3M3PA 3VZBA 3F73A 4W8OA 2EW2A 4ZCMA 3MD0A 2RJOA 3RWOA 3DZFA 1LCIA 3LX5A 4TVSA 3IUYA 3KG2A 5C8VA 2QIPA 5CT9A 1H05A 1Y5NA 1YQXA 1YONA 2IHYA 2A88A 5B3AA 5IVDA 2Z8XA 4JLAA 2DE0X 2D4HA 1WCV1 3QXXA 5LQSA 4LJ8A 4HZUB 4WKPA 3SZ3A 1A76A 1NI3A 1SFRA 2B8NA 2UUOA 3WWPA 2G07A 5FV4A 4NZNA 3GNSA 4E11A 3Q11A 2OZEA 1YB7A 4J16C 1ODJA 4DDMA 3DO5A 4CDRA 3IC5A 2EWMA 5FTWA 3BK2A 2RHMA 3MRVA 3UMVA 4EI7A 4TLCA 5F23A 2B8JA 4NLLA 4X8MA 1AXRA 3RT9A 3OESA 3PQ5A 1PNVA 2X0IA 3KV1A 4J4HA 4KE8A 3H3FA 3LV8A 4MB0A 3WB1A 4QTUB 1GU7A 5B6PA 3S5UA 1UEIA 2EZTA 3O9MA 3K0SA 1AGPA 1FDVA 1YKSA 3T06B 1WOMA 4WD3A 3GLUA 3U48A 1CRZA 2UV8A 2CEAA 5J43A 2Q6TA 4JI6B 3W6NA 3IR5A 2MINB 1KYVA 2E4XA 2YNMD 1BCRB 5J23A 2QD3A 2HIHA 1F51E 1SEVA 2E82A 1MX3A 4OGGA 1K4MA 4Y2QA 4BQRA 1YT5A 2MU1A 1KO5A 2ZEJA 3JCZA 1PJ3A 1YRHA 1Z08A 1PJLA 2A3RA 2F1IA 3PWZA 5TF0A 3OOJA 2AOTB 4N54A 5B7GA 5JAUA 4FD2A 5JOQA 3BXPA 3GYBA 2D59A 2LTAA 3DFUA 3K2QA 1W9HA 3HDVA 4LTMA 2V7BA 3O2QB 4QUEA 4R54A 4O4HA 4DQKA 1SVKA 5DOVA 1XMQB 4U7GA 3CXRA 3CUEF 3GLVA 1WXIA 2G9QA 3JS5A 3DBHA 1Y9ZA 1UP7A 1UFQA 4YRIA 3HP1A 3FMIA 5BXYA 1V26A 4D0LB 4GLLA 2BI4A 3AP1A 2FPIA 3QI7A 3DMTA 4ZOBA 4AG6A 5JYDA 4RXTA 1P7PA 4RMHA 2J07A 2GZHA 2YMMA 1GU0A 2HMAA 5K05A 1H2YA 1JBQA 1T1IA 3SHQA 4HGZA 1X80A 2GRUA 3ZW8A 1W5BA 1NYTA 5DYGA 3VZRA 2ZCJA 2XBLA 1OCEA 4KQKA 2JGDB 2JRCA 3S8MA 3DP7A 2HRZA 4CEHB 1LBSA 1RAEA 4AXBA 4BV9A 4XR9A 2JJQA 2B4RO 2ONYA 2XWPA 1XL1A 3GVXA 4N5LA 4OCZA 5I45A 4D26A 5I3CA 3O21A 3OECA 2Z1NA 3BKWA 4TS4A 1NOKA 1ZD4A 4U2DA 3UAXA 1O5IA 2W6QA 3JALA 4MMXB 1TM1E 5LMUB 3B8EA 2YIMA 1L1FA 2D74A 5JPCA 1QYRA 4AW9A 1F7VA 3DMYA 5ADHA 4F1KA 2GFHA 4QXAA 1WUIS 1C0EA 3F3SA 3N3AC 4KODA 2PU5A 2IYUA 3WLOA 1K0FA 1JQJC 1Z36A 4V0RA 1T1EA 1VHQA 1WTCA 3RM3A 1QLHA 2RD2A 3PDCA 3I1YA 2XE6A 1QP8A 1QS0B 1QPZA 1U2DC 2J67A 4RFVA 5D2CA 2JA1A 4ZVUA 3C0KA 3DLCA 3GT0A 4FVTA 3RC9A 3S6JA 2ZIUB 4GU5A 2PUJA 3W5CA 3TGWA 1H2EA 2A5LA 4FKZA 1ZI9A 3H2IA 3W2FA 4LYHA 4A0GA 2D1FA 4YRZA 2DYKA 1SOVA 1CVLA 3UJPA 4UVIA 4Q9JA 4F4JA 3QVGB 5AD1A 4WY5A 1GA6A 1UAGA 2HA7A 2P79A 1NLFA 4MGZR 3R9KA 3REOA 3RVLA 3T1TA 5KI6A 1SHKA 2R7AA 3N59A 2I6QA 4KI0A 5CVVA 1KZGB 4MUMA 5AVQA 4U7FA 3GJYA 4L02A 4P4NA 4EA8A 4LXIA 4KFTA 3FUXA 2FZWA 5IFLA 1Z0FA 2IELA 1EHYA 2PIAA 1C1DB 1R1DA 1FSPA 1MO5A 4PYRA 4H6WA 1KK0A 3JQ8A 4Z4HA 3U3XA 4N47A 4G1CA 1IVNA 3OCJA 4BZZA 4MAFA 4MV8A 4QQRA 1FTSA 5K09A 3AUTA 1QJ4A 1DT3A 1UL1X 1PK7A 1SUCA 3PHGA 5AP9A 4K5QA 5JXJA 4UCXA 1U2PA 1E92A 4IDGA 3ZLVA 3CY6A 4F1WA 1C9DB 3KTFA 5ALQA 2D2EA 3EA0A 4YRMA 4HYTA 5C80A 5J63A 2QHXA 2H0AA 3KVOA 3IP8A 1BDHA 1TC2A 1IULA 2R79A 1XP5A 1ECGA 2WJ6A 2Q5HA 3AT1A 4LXHA 3ZE1B 5JARA 2AXQA 2Z2IA 4URHA 4O2AF 2JFPA 3T61A 3J81A 2PA3A 1KMCA 1S7GA 3ZLBA 4O2BF 4DN6A 2X1LA 4UNIA 1PG2A 3DCIA 3KRTA 3L5KA 4F6RA 3D0QA 4AO6A 1KYWA 1XCBA 4ADSG 2PKQP 1XWFA 2JHFA 5A02A 4R1PA 2CKDA 2XUIA 1YULA 3JATB 1R6XA 2VS1A 4XGNA 4ZU6X 2QBYB 1BMDA 2WTEA 1OFGA 4YCAA 1UMBA 5ALNA 1J99A 4MB2A 4AY4A 4KWEA 4MB6A 4ZVOA 4OFZA 3DVRX 5EJEA 3KB1A 2XXBA 1IN1A 1HMYA 3AOEA 5DCWA 3HU2A 3LWNA 4LHZA 4K6FA 4BP8A 1B4DA 4FYJA 3HZHA 2A57A 1NPYA 4JIMA 3DBRA 5EXPA 5A9TA 1SY7A 2Z5FA 3V2GA 4ETNA 2VNSA 1RPNA 4HFMA 4MJXA 2JIQA 1MNQA 4OQPA 3FLEA 3DT6A 3EEBA 1SKYE 3ZHBA 3GAAA 5C5EA 1N7HA 5U4QA 1V35A 4JUAA 3KWJA 4MKGA 1Q2XA 2E4YA 4A5SA 3EG9A 2G72A 2QW8A 1C30A 4C4YA 1MPTA 4P4TA 1EVYA 3W5AA 4CQMD 1CEEA 4MJLA 3U6KA 3ZV6A 1GZ6A 3QLUA 3HABA 4WZZA 4DZZA 1SG0A 5HK9A 1BMTA 2GM4A 3ZCXA 2WU0A 5DWVA 3IAAA 4F84A 1D0IA 1PVVA 1XMVA 5A5VA 1F0PA 2WJAA 4GP7A 2YJZA 4C7MA 4UU8A 5BN3A 2DPGA 4D44A 2BE9A 1XZJA 1M1YB 2O1WA 2OFXA 2PCJA 1YJ8A 3I04A 4H1VA 1EFKA 1MB4A 1WPXA 3DQQA 2VXBA 1CHNA 3NT4A 4QASA 3ZYZA 2WWRA 2PKCA 4BN4A 1G18A 3EF0A 2PANA 5DCUA 1AUVA 1Q57A 1IHXA 2XQJA 1K9SA 3ORQA 1NVUQ 2QGNA 2YTZA 5FR1A 3L0CA 2JIBA