3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
molecule keywords Pantothenate kinase
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
4K46A 3CH5A 2AL7A 3ASZA 2Q6TA 2WWYA 2QQEA 3AP3A 4YMVA 4B34A 5JEDA 1FP7A 4FW9A 1IN5A 1LW7A 3P26A 3MJRA 1MH1A 3EAQA 2GEVA 4PO1A 2JCSA 1OIVA 2HCBA 2ODEA 1O87A 4RVCA 3TKLA 4QKQA 5HE9A 1Z3IX 5JZVA 4QM6A 1L4UA 3FFAA 2YVUA 1TF7A 2W6IA 1ZCBA 3TW8B 2WPDD 5J40A 1P3JA 1GILA 2ZR9A 1G21E 3LBNA 5FPKA 1NLFA 3CX6A 2ZJZA 4Q03A 5JJKA 5EXPA 3Q72A 4NCHA 5J4LA 3BAFA 1D2NA 2NZJA 2XNDA 2WIBA 3K9NA 3LX8A 3GFTA 4IVQA 2FPLA 3MUFA 4DSTA 5KNCA 2H1LA 2J9RA 3QF4B 2W2XA 1JAIA 1QHYA 1J8YF 2GK6A 4DIDA 3R9WA 4Q18A 4WAUA 2FX3A 3N5CA 1ZJ6A 3PG5A 2MMGA 3FFBA 1C1YA 1E1QA 4PQYA 2P5SA 3K9GA 2YC2C 4D4MA 2BC9A 3B85A 4KODA 3ZJYA 1DAMA 4UNRA 3I3SR 1E4YA 3I61A 3E2IA 4JLAA 2OEPA 2OO7A 3SOPA 3MCAA 3KKNA 4Q4AB 1E9AA 2PH1A 3KJHA 1P60A 5FTMA 2ZR0A 4IDPA 1XRJA 5L3SB 3RS2A 1XX6A 1WE2A 1WP9A 4QGAA 3S1AA 3PEUA 3QVVA 4RD1A 5GVSA 1G4AE 1NN1A 1U0LA 1P7CA 3B13B 4TMWA 2ZRPA 3H86A 3SFZA 1W4BA 2V7QD 3FMOB 1IBRA 4DC9A 3O8RA 5J4KA 4V02A 4BFSA 1PJRA 1IM2A 4HI0E 2JLQA 5KSOA 1JEEA 5KO2A 1NN0A 1E9FA 2ZROA 4L9WA 2IF0A 5JFGA 4X8HA 3AGPA 3A8TA 2AK3A 4A0RA 1UKYA 1XXHA 1M1YE 3OFNA 4ZKDA 4NYJQ 3NEJA 2C98A 3PUYA 5KOYA 2DWPA 1Z0JA 1GSIA 3WYAA 3EPJA 3W6NA 1A4RA 3B60A 5K8TA 5CYOA 1EFHA 1W1WA 4DWJA 3THYB 3B1ZA 3TSOA 3A4NA 5FOXA 3EW9A 2J7PA 4QM7A 3R9IA 3GLGB 4DDVA 2OHFA 4IJMA 3RLFA 2WWWA 1F2TB 3ZDQA 1IXZA 4LHZA 1Z6GA 4DLXA 2JDIA 1Z0KA 1KIMA 3FGNA 1NIJA 3GP8A 1I4LD 1ZU4A 2J1LA 2ZS7A 1P75A 2EFGA 4HZUB 1GNQA 4WZ6A 1W36B 1JECA 1P2SA 1OLOA 2O0KA 3QKSB 1SXJC 1NG9A 1ZM4A 2JLRA 3CLVA 1KTVA 5IK2D 1E99A 1W47A 2R6GA 3TQFA 4FINA 4AC9A 4D0LB 5D3QA 2O8DB 2P5TB 4JVSB 2AFIE 5L3QA 2QAGC 4Q02A 1R0WA 2WSSD 3N70A 4IHQA 4UNNA 1XEXA 2GF9A 3FHCB 5AUPB 1DE0A 1UPTA 3AKYA 5KNBA 4KO8A 4Q1AA 2WJHA 2N46A 1XTIA 2GBLC 3IEUA 4KVAA 4LJ7A 4TYYA 1Z6XA 4EKDA 2FU5C 1S1CA 2XEXA 3AQ4A 2IA5A 2HT1A 5FH9A 3QUSA 3IUYA 2B7BA 1ANKA 4JMPA 4D26A 1JJVA 4G3XA 2WM9B 4TZ6A 1KMHB 5JJIA 1KDRA 1CS4C 1BMFD 4LJ5A 5JS7A 4KYIB 3WBKA 5CB8A 1T0JB 1XP8A 3EARA 1GKIA 2XTMA 3CNOA 1UBCA 4NZYA 3T1OA 2EWWA 4DRZA 1VG0B 4WBSA 4DZZA 2QUZA 3BRWD 3UKDA 2QZ4A 1W4CA 3QXXA 4B47A 3UMRA 4AYXA 2WWXA 1G8GA 3E70C 1XEWY 1VIYA 2G1KA 5EE0A 1WB9A 2ZSFA 1W4RA 4KSBA 3UANA 1YZUA 2ORIA 3QY0A 2Q9BA 5CK4A 2CCGA 4JBWA 4Q1DA 3PXGA 4OQMA 4PHHA 3OIUA 1CIPA 3ADKA 3CRVA 4JYBA 1MO5A 3A1UA 3B2EA 4JS0A 4LX0A 4F7WA 5BQ5A 1F2UA 1VG8A 3LBIA 1KZGB 4DLTA 3T61A 3AP1A 4YQFA 3QF4A 4JLOA 3A36A 1NNEA 2BBOA 1T5LA 2PJRA 2WOJA 3A37A 3OEHD 4E09A 2GJAA 4KFUA 4NCJA 3DM9B 4BLPA 1R6BX 1JR3A 1XTQA 4MYUA 1PLJA 4GP7A 1G3QA 4KBFA 1KAGA 2BWJA 2UZ3A 2RMKA 4TQ9A 1II8A 1TQ4A 3P4XA 2YHSA 3WP1B 3C5CA 3BERA 3VMFA 3TNFA 4YMSA 1TNDA 4DUGA 4F38A 2VP0A 4IOLA 4HZIA 2RGNA 3SZRA 3KKPA 1ZCAA 2VTKA 4B3XA 4BFXA 1KI3A 4K8OA 4ZKEA 3OHMA 3RSLA 2J0SA 4R2HA 1KO1A 2YZ2A 2BEJA 3UWOA 1G19A 2ZI7A 4A8JA 4P4UA 5JCPA 4M1YA 1DAHA 1G16A 4TL7A 2VP4A 3U3KA 1N6OA 1W48A 1SKYE 3U3MA 3L0PA 4LPSA 1CXZA 1ETUA 2MMCA 2NO1A 2QRZA 1J70A 3K70D 2TMKA 3CNLA 4TN1A 2DB3A 1GRNA 2FMXA 2WWHA 5LD2C 1KSGA 1XZQA 1OFTA 1YR7A 3PR1A 4MGIR 2DWQA 3K09A 1AM4D 3LVRE 4AG6A 4UNQA 3CZPA 2R9VA 4XIGS 1OH8A 2GZDA 4Z1MD 4M9QA 1T9HA 4IFEA 2QTFA 2GK7A 4LOAA 4P31A 3I72A 3K0CC 2F43B 4PC1A 2J59A 3C7KA 4JL8A 3RAPR 2HCJB 2GZAA 3DVLA 4Z8YA 2ZE8A 2WJYA 1P73A 4D0NA 1KK1A 2PEYA 1P9NA 3QVUA 1DEKA 2FZLA 3C4JA 3RYTC 1YZLA 1E2QA 3SS8A 4HB0A 3DHWC 4FIDA 2CJWA 1HY3A 4XTRA 2H18A 2ZITA 1NN5A 3L0IB 2W2VA 3DKPA 4BZXA 2CE7A 4HAXA 1ZD8A 2WMOB 2QQ0A 3U7FB 1HV8A 3BK7A 4XD7D 4Q4HA 2OCPA 1KY3A 1ODFA 1S8FA 621PA 3ZIAA 5C18A 3VU9B 4M9SA 1X8KA 2YWHA 1TF2A 1OSNA 4DLSA 1Z08A 3K0CA 4BLTA 1FQKA 4GMXA 5KU1A 1P6XA 4IFBA 4R98A 5G3ZA 2HT6A 3RC8A 2WICA 5FUVA 5SZKB 3U7HB 3IDQA 2J41A 2CVHA 3OE7A 5LBIA 4OHZA 2IS4A 2RGNC 3IIKA 4MH0R 5A5GA 2NQ2C 2JAQA 4LWZA 5EE3A 1BO6A 2J0UA 3M1IA 4ITRC 4IXMA 3ND9A 2XITA 1IONA 1KI7A 3WNDA 1KI9A 2HJGA 2ZRJA 3LBHA 3GLHE 4I4LA 4M1WA 3AF3A 2F1HA 4XSHA 1IY1A 4Q7KA 4X8MA 3W8NA 1JXOA 1NIPA 3I5YA 4ZV4A 1MO3A 3QXHA 4V0LA 3P27A 2D4HA 3I1FA 2I4IA 3HU3A 3IO5A 2AFHE 1U0JA 3SHFA 3WYGA 2QTHA 4DBLC 1I2DA 4JLPA 1EG7A 2GA8A 4QJ3A 4OK6A 3BORA 3MRSA 2GILA 3B1XA 3RHFA 3LD9A 4YXWD 2IYRA 4TSFD 4RD4A 3AVUA 1AKYA 3BS4A 1W36D 3U4QA 1PVOA 4AKIA 4RZ2A 1VMAA 1OH7A 2R44A 3MWJA 4B35A 3A1TA 3K9LA 4WXRA 1E2EA 4D2IA 5BW8A 2W2TA 2HV8A 2ZQ5A 3ZVLA 1M74A 3QPUA 5TDHA 1E94E 1MABA 3ZZUA 1P72A 4I1OA 5DI9A 4DT1B 3C41J 1XEFA 1G3UA 1R10A 4QBIA 4C0KA 4D4LA 1LF0A 3JZAA 5GJBA 1X1RA 2ZSAA 2W6JA 1SXJA 1E2KA 4O2RA 5FL7D 2AXPA 2V54A 2BMEA 1G3RA 2O8FB 2WPDA 3OF5A 4CRWB 3VX3A 3SR0A 2QY9A 2CCJA 4P32A 1G9XA 4PSKA 1S9DA 4LJ9A 4TMVA 4K81B 4M1SA 2ZR7A 3W5JA 1DAIA 2A7QA 2ZI6A 2CLDX 4PPGA 2KJQA 2Q3MA 4M0LA 4AK9A 3RRMA 1JPNA 2RGGA 2BHRA 1FMJA 1Z22A 1MR3F 1COWD 1GFIA 3LVQE 3C15C 2IHYA 3NHAA 5D3MB 3D8BA 4E5UA 4RD2A 4A92A 4QHTA 1WF3A 3QE0A 1EX6A 2P3SA 3K09C 2OBLA 3CF6R 1YU9A 2CL6X 3MWYW 2OBNA 2V1UA 2ZI5A 4M4SA 2ZRIA 1RRFA 3TJZA 4KAXA 3WRXC 2ZM5A 3QI2A 2DYKA 3KKMA 3VX4A 5H8WA 3U4QB 1TTTA 2GETA 3W9YA 2G6BA 5E7MA 2OAQ1 3D3QA 1OPXA 3FMIA 4R9UC 4Q00A 2W83A 4GOKA 4KJZA 4P33A 3BXZA 2D2EA 3MLEA 1E1RA 2VSOA 1EXMA 3KTAB 2FZ4A 2IUSA 3T5DA 2A78A 2QEQA 2JGNA 4MGKR 5D3MA 1XJ0A 2JEOA 3KJIA 1T6NA 4W5JA 2GCOA 2KWIA 2R6DA 1IJEA 3QBTA 2ORWA 4O25A 3TRFA 5G53C 4C0JA 3EASA 1LB1B 4DB2A 4LV5B 5DI3A 4F4IA 4DJTA 3AVOA 2NO9A 4V0OA 2AN9A 5AJWA 2HF8A 4U00A 3LLUA 4M1TA 3SU8A 1O3YA 1KGDA 2XNSA 2JJ2D 3KQUA 4H9GA 2CL0X 2H5EA 2QT0A 2ZRLA 2IS2A 4H1VA 1KO7A 4HDQB 1M34E 4BQSA 2PZEA 2RH5A 4QHSA 5SZHB 2K5UA 5FPHA 2ZTSA 2AR7A 2ZPTX 4GRAA 3T06B 3EPHA 1NY5A 3CB4A 2C5LA 4OI2A 4DLWA 2DY1A 1UEJA 2REBA 4HATA 4PC7A 4GP6A 1G8FA 3IKJA 5E3HA 5BXQC 2OFXA 1DAEA 3P20A 2OXCA 1FFHA 4LUCA 2XSZD 1H65A 4BFYA 3X1XA 3B7GA 3Q8XB 5KDOA 3GD7A 4QBHA 3RABA 3FVQA 4AKEA 4ERNA 4NH0A 3HP1A 4RD6A 4UXHA 1MOZA 3WMGA 2PCLA 1X3SA 2O5VA 4G01B 4A8JC 5EP2A 1S3GA 1S96A 1XF9A 2O52A 5KSPA 4CEJA 2DHRA 3UG7A 2LWIA 4D4KA 3NC0C 4O2LA 2PZGA 5EUQB 5HKKD 2ZI3A 1CJMA 1AZTA 1PUIA 4BECA 5AUQA 1TUEA 1EESA 3VR6A 3Q85A 4ZCLA 1HEIA 5C2JB 3K0EA 1MKYA 2QAGA 4PSAA 3SBDA 4CZ2A 4NYMR 4URVR 3Q5EA 2B21A 4XVUA 1X86B 3MWLA 1RZ3A 2ZUBA 4LYHA 4II7A 1GL7A 2CXXA 4Q9IA 2CEAA 4LBWA 1DELA 2WWIA 2GAOA 4JL5A 1RE0A 5FL7A 2CNWD 3WYFA 1EWRA 1HTWA 2EQBA 2UVQA 3C16C 3PV0A 1T4GA 2JASA 4PC2A 2ODWA 3X2SA 4Q1BA 3W5IA 5J47A 4HLUA 4ACBA 3IQWA 1LS6A 3H0KA 1YKSA 4PHTA 5GJCA 5DHFA 1R7RA 4RD0A 1XDBA 1NI3A 4S2EA 2OUKA 5FUWA 1PUJA 1Q12A 3CO5A 3GFOA 1U9IC 1E2HA 1ZUNB 2A5YB 3LXRA 2GNOA 4IEIA 1P62B 4M53A 2KB0A 1OXVA 4GBMA 4WIAA 3W34A 3QBVA 4KLZA 1SVIA 2Z83A 2GEUA 2OCYC 2D3WA 1V5WA 2G3YA 3CF0A 2ZI4A 4UNPA 1G8PA 1P2TA 5GJWC 1OB5A 1M8PA 1W36C 4L4UA 3IBYA 4MKIA 3QKRA 3F0TA 4FI3C 3ZYCA 3VR1A 1U8YA 4EJSC 2RHMA 4MDFA 4B76A 5G40A 4C0QC 3BD9A 3VR5A 3LX5A 3BWDD 2ZVQX 1KDPA 4B33A 4HLUC 4RJLA 2WKRA 4C0LA 1BIFA 4FWIB 1NVUQ 2VP2A 2C9OA 1E2MA 1CF4A 1Q1QA 4LYJA 3K70B 4KHZA 2RCNA 1SZPA 2FPMA 1H8EA 1E9CA 1N5IA 4B75A 3VNVA 3B9PA 2DCUA 2ZAOA 5GADl 4A15A 1AGPA 2ODNA 3FDIA 3ZVNA 4Q1EA 4QC2A 2XOKA 2WJGA 5JRJA 1RFLA 3G0HA 5EZ5A 5EXSA 1XCGB 2A30A 3NIBA 4AD8A 1G6OA 3A1WA 1EFRA 1E2IA 2EYQA 1Z47A 2NTYC 1U81A 3KKQA 4C0BA 3UATA 3AP2A 1NKTA 4OHWA 3WMFA 3WBJA 3SN6A 3SYKA 1S4QA 3KQHA 3BC1A 4MA4A 3TR5A 4XSGA 2EYUA 3H4MA 2NMVA 1KHTA 2FEMA 4HDOB 5HZKA 1XMIA 1KO5A 3T1TA 3D31A 4EIWA 2RGXA 4Q7JB 5TARA 4M21A 4KLNA 1UF9A 2WAYA 2I3BA 3IO3A 3KB2A 1XMSA 4RSGA 3SJZA 4BLRA 2WVJA 4JLKA 4RFSA 2DBYA 4TYNA 3VKWA 3CF2A 4TTPA 2CHVA 1AIPA 4FCTA 4CT4B 2AHOA 4TSFA 2J45A 3GCGA 1I4DD 4B73A 2F3TA 4JVLA 3SBEA 1W49A 4G5GA 4CT5A 3KX2A 1GRQA 1PLKA 2CJWB 4BGDA 3TW4A 2J5XA 1RJ9B 1YZTA 3OFND 2RKOA 1IN7A 2CL7X 4DUGD 4DDWA 1SKYB 4IW3B 5TB5A 2ZRAA 2YOGA 1KNQA 1CR2A 2WSMA 1W5TA 1NVXQ 3MSXA 4EDHA 4PPNA 5A4JA 4HAVA 5C46F 2VHJA 2XJ9A 2QGZA 2UKDA 4DXAA 4ZO4A 2GXAA 3M0EA 4M2LA 3RS3A 5JRZA 1KNXA 1XPRA 4X8OA 3TAUA 4OQFA 5J4HA 2IYTA 1XEWX 4F4JA 3DMDA 2IS6A 3VKHA 1ELOA 1Z5ZA 3B82A 1G8YA 4LBYA 3K0AA 2CLSA 3CH4B 5EE5B 3TIFA 5B30A 2BJWA 4BZQA 4F4CA 1D2MA 4MKHA 1D6JA 2VA8A 4Q9HA 2KBFA 3T34A 2ZXUA 4TMZA 3KL4A 5BN4A 4RY2A 1G20E 4X8LA 1DG3A 3P32A 4ON9A 3TE6A 5JWHA 1P61B 5KPDA 1U8AA 1FX0A 1UBGA 1UKVY 2XJ4A 3K70C 3CRMA 4OHYA 1XFAA 2B8TA 4LC0A 4I1VA 4D81A 1S2MA 2P6NA 2REOA 1SVKA 3B9QA 1E1QD 1SVMA 2XB2A 3K9HA 1OYWA 3TQCA 3NTUA 2ZRCA 1G291 8OHMA 1BYIA 2CK3D 3MWKA 1SVLA 1P2UA 2PBRA 2VLIA 3DOEA 1QRAA 1E9RA 4JL6A 3PQCA 3ZZTA 3GLIB 5FUXA 1QHGA 4E03A 3CW2A 1ZUHA 2OT3B 1VHTA 1SXJD 1G5RA 2G0TA 4LHVA 5SZIA 4PQFA 2X2FA 3CX8A 4JBXA 1D9ZA 1KI8A 3KFXA 4PZLA 4HAYA 1E2DA 3I4LA 5FOUA 3GMTA 4QBGB 2KE5A 1KK3A 4BWYA 1X8JA 4IOKA 821PA 3GLIE 1M7BA 3GEIA 4MRVA 1KKLA 1JB1A 4OHXA 3TUJC 2GXSA 2MSCB 1Q1BA 3LW8A 2O8DA 1R0XA 1SXJE 3TBKA 1DVRA 2ZS8A 5FR2A 3DL0A 3PENA 3OIVA 4TTRA 4CEHA 2RGEA 5DHAA 4URXR 1J2JA 2C8VA 2FFAA 5FPYA 1VCMA 4GI7A 4LYAA 4JBYA 1F48A 3IBGA 4DSOA 521PA 1SVWA 3LDAA 4D6PA 3QXSA 5CK5A 2GAAA 1J99A 5L3RA 3LRPA 4PHGA 5DN6A 2WZQA 4A0GA 2DFKB 3THXB 1RC8A 5JHGB 3GJXC 3H84A 2GXQA 2A3RA 1TUIA 4R7ZA 1MV5A 1XEXB 1E3MA 3P4YA 1US8B 1MT0A 4IEEA 4QRHA 4G5RA 3CPEA 4NKRA 4ASUA 4JJZA 721PA 4UXIA 4TLDA 4DIEA 1FL9A 4KI0A 3TUIC 4YMUA 1NRJB 1DPFA 1VG1A 3C14C 3SJCA 1QF9A 1DADA 1ZNYA 5AWFC 3CRQA 4BE7B 4Q47A 4OI4A 1XNJA 4E22A 2NO6A 4D80A 2OESA 3TSWA 5BWMA 1P2VA 3CR8A 1DS6A 4TL8A 1XD2B 5B64A 2VPPA 1G7RA 1SVSA 3SHWA 1A7JA 1TF5A 1J7KA 1XCPA 5FBLB 1XPUA 4HUQA 1FNMA 1VTKA 4RKEA 3WNBA 4C0HA 3NDBB 4URZR 3K53A 4BEBA 3SQWA 4QJ5A 2QI9C 3BBPA 1IXRC 2AKYA 4Q7LA 1YR8A 1G6HA 3SNHA 4ARZB 2BOVA 3FMPB 1B23P 5KUTA 3EG5A 1GKYA 3GLGE 2XSZA 1GAJA 1T3LA 4TWZA 4TLEA 1RRPA 5FL3A 4L16A 4Q4JA 1GL6A 1SGWA 4EJSA 1NP6A 3U6BA 3X1ZA 2NPIA 4W7SA 3LWNA 5FR1A 1XZPA 4I1SA 2BBTA 1FTSA 1GOTA 2EWVA 3PFIA 4MKFA 4UJ5A 4FWTA 1ZRHA 3QKRB 5AJYA 4BFWA 3RS4A 2WKPA 1YQTA 2Z43A 4UNSA 1R4AA 5L8VA 3PUVA 3BFXA 5KHOC 3THYA 1E96A 2WMNB 5CLQA 3Q3JB 1II9A 1YR9A 2ZETA 4TYQA 1KI6B 2QMOA 3U61B 4Q21A 1AN0A 2JLVA 1LV7A 3HPQA 1Y63A 4OKSA 4PAOA 3HPRA 2IXEA 2KSQA 3CR7A 4EJSB 5KPJA 1ZD9A 3ZGXA 2VIIA 1U90A 3UK6A 5AK0A 1W7AA 3PEYA 2JDID 3GJ6A 4CEIB 1G41A 1LNZA 2ASEA 3CRRA 2LKCA 4PO8A 4BUJA 2GZHA 1QG4A 4R2IA 1G7SA 3U7EB 4B6EA 2P2LA 5CJ2A 1KMHA 3SDZA 2A5DA 3GEHA 2C9YA 5JWOA 1NY6A 3NBXX 2VP9A 3CNNA 2XZPA 3IIMA 4W5HA 1CP2A 1N5KA 3U44A 1UJ2A 3Q7PA 4RFSB 1A1VA 1OFHA 4YLGA 1ZAKA 2HLDA 3BFVA 2GEDA 1OJLA 4YDSA 3AEZA 2WJJA 4B32A 1RYHA 2RGDA 2YJTD 1I2MA 3B1WA 4PFSA 1JAHA 2N1BA 2H16A 1D9XA 1M7GA 4HLQB 4TYWA 4WW0A 3SYNA 4PZYA 1U8ZA 2Q21A 4JLMA 2DPXA 4JYCA 4NE2A 4ZDKA 2CLCX 3EZ9A 5FPTA 3BB3A 1G5PA 1IN6A 2FNAA 1JNYA 4NBSA 2EU8A 5BN5A 1U2RA 2QMUA 5JS8A 3NWJA 2X77A 1W4AA 4GT1A 5LDDC 3OAAA 1S9HA 3OIWA 5CM9C 2O0HA 2ONJA 4PSVA 4YXWA 1DG1G 4IOMA 2P6UA 2IXFA 1JQLB 4FMCF 2KBEA 3L43A 1K5GA 4MRPA 3SEAA 3VHXA 5J4YA 2VH5R 3ZD6A 1EX7A 4QL3A 3HDTA 4LBVA 1UM8A 1ZNXA 2PLRA 2PMKA 2QP4A 4RCYA 4EQ6A 1F5NA 2ZUCA 2JIZA 1ZIPA 2QAJA 2V3CC 1XU4A 3DPUA 4G5OA 5ANRB 2FDCA 3GJ5A 1PLLA 4EPWA 2OCAA 2ZE6A 1VECA 2FG5A 2J7PD 4MRSA 1KI1A 3K8YA 2GESA 3X1YA 5EP3A 3NBZC 2GCNA 2GRJA 4F91B 1R0YA 3BFKA 3NEYA 3QKUA 1TQ6A 5G3YA 1N3BA 1N6KA 1N0UA 3RC3A 1NBME 2IYZA 3CM0A 3IGFA 1R8QA 1XWIA 4CIDA 1IY0A 1CR1A 1COWA 1EWQA 3AH8A 3FYHA 1TU4A 3MAAC 3GEEA 3Q7QA 2DWOA 3WNCA 3WP0A 1G3MA 2ATVA 2F43A 2ZRBA 4LHWA 4HUQB 2R65A 1X1SA 2ZSBA 4UJ3A 5IDVA 5JSZA 4HB2A 2VP5A 3A4LA 2CVFA 3L8YA 2ZE5A 3L2OB 1CTQA 2PL3A 2VHQA 2C04A 4DCNA 2B6HA 3SI7A 1ZNZA 4D4JA 4HB4A 1OFIA 2ZSDA 4PAMA 2ATXA 2ANBA 4ESHA 1QHSA 1P5ZB 1HH4A 3B78A 2MSDB 2GDJA 1KJWA 3L8ZA 3GLFA 2O8EB 1SHZA 5LD2B 4TL6A 2C9CA 2A5GA 2WIAA 3REGA 1XB2A 1MRSA 3RRZA 1TEVA 3SJBA 2CDNA 1NL3A 4Z51A 2VHCA 1MO6A 3EPLA 2BBSA 1FP6A 2QENA 3REFA 2RHDA 4DDTA 4KYUA 3O8CA 1PV4A 5H68A 2Q9AA 5CYPA 5GJVC 4BRUA 4V0NA 3AM1A 4RFVA 5EUMA 4DVGA 5E7JA 2HDNB 3TMKA 4PANA 3HU2A 1NJFA 1R0ZA 1XJQA 4YMWA 1IOZA 1NSFA 1UADA 2QRNA 4URUR 3ONWA 4V03A 4BASA 1X6VA 5DYGA 1ESMA 3LFUA 4TTQA 5FBRB 1OE0A 2E1RA 2XOKD 3QIAA 5DGXA 2W6JD 1E0AA 5TVKA 1Z6TA 1ZBDA 2RGAA 4XWOA 4W9MC 5H70A 4AKGA 1HE8B 2G83A 2FFHA 3GJ7A 1Z2CA 3HU1A 3CX7A 3NXSA 3AVYA 3QOFA 1E9SA 1AS0A 1N5JA 1Z0IA 2P67A 5JI2E 1SQ5A 4Q01A 3FPAA 1CKEA 1YE8A 2JLUA 4C0AC 4B71A 2BMJA 1JEDA 4B2PA 3EIHA 1HT2E 2ZRMA 3VR2A 1E0JA 2C95A 3LLMA 4C7OB 5GVRA 1H8HD 4OHVA 2IUUA 1Z28A 2R6FA 2OXRA 2ZJ2A 4NMMA 4B3CA 1AGRA 1OT3A 4BLOA 3ND8A 1Z6YA 2Z6VA 4EUNA 3GLGA 1UDWA 3GQBA 4EPRA 4D0GA 1SKQA 2WSSA 2XNDD 1K8RA 1A2KC 4PPQA 1AKEA 4IRUB 1RKBA 2ZJ8A 2AWOA 2ZRDA 2Q3FA 3VAAA 4FXPA 4GZLA 3PEVA 1Z0AA 2ZRNA 3G82C 1CR0A 3RDPA 2GHIA 4LYFA 3SJAA 1Q44A 4L9SA 4A0HA 2BM0A 1YRAA 4MRRA 4U5XA 2BKUA 3T35A 4AKHA 1Q21A 4EFLA 1Q57A 2BIFA 1GZSA 1KK0A 1KDOA 1IQPA 1NMXA 2H8KA 3EZ2A 2O8FA 1R8SA 2VQSA 2D2FA 2ZI9A 1N6LA 3THWA 1HYQA 4J0QA 2VL7A 1Q3HA 1TQDA 3VFDA 1WBBA 2J87A 2YWGA 2D06A 2E9SA 1D2EA 1V43A 3O8DA 3B1VA 3PIRA 3KFVA 4I81A 1LF5A 4AYTA 4TLBA 2ANCA 2Q3HA 2ONKA 1VPLA 2ZJOA 3D7MA 4PO9A 4Q7MB 4Q4AA 4JLNA 4QFMA 3FHOA 3I8SA 4M1KA 1RVDA 2GCPA 5KNDA 1II8B 4EPYA 4MYHA 2FV8A 4POAA 3V00A 1OH6A 1E9BA 4TZ0A 4WA7A 1XTSA 4RKFA 2ZYUX 5A0FA 4DLVA 1YZNA 1FNNA 1ZUIA 3LW7A 5DISB 5FUYA 4E07A 3TGPA 5E7IA 1OW3B 1G5TA 3ZD7A 2X19A 4B3GA 4A2QA 3KXLA 2C99A 3HYRA 3TUZC 2ZSEA 1UKEA 4A4DA 4RZXA 3BH0A 3K0FA 2NIPA 4NTZA 5B58C 5H1YA 1DAKA 2IYUA 5L3SA 2BDTA 3I5XA 2ZYVX 1N6HA 4B74A 4UKDA 3HR8A 4TMXA 1A2BA 1Q1EA 3MD0A 3RRYA 5HKKA 1ZINA 5JLJA 1WRBA 3BH6A 5EXTA 1CJTC 2C77A 3U2QA 3LXXA 3J81k 3R7WA 3LY5A 2G77B 1YVDA 3HJNA 2AD1A 4EFNA 1QHHB 1G18A 5FBWB 3C8UA 3EPKA 2A5FA 1N0WA 1QHNA 4M1OA 2IX3A 3DEFA 5DNYB 1F60A 4DSNA 3EA0A 3TVDA 4KU4A 1HA3A 4ZCIA 2G88A 1SVOA 3KQKA 4DLYA 3T5GA 2WTUA 1KYIA 1LY1A 1T8UA 2F6RA 5DI3B 1KO4A 3NBYC 2IF2A 3R7WB 3E1SA 2G0NA 3ZLJA 2EFCB 1NBMD 2JA1A 2QP3A 4HAZA 3DZDA 1OH5A 1K5DA 3OAAD 4LJ6A 5JBQA 4M22A 5FFMA 1LFDB 2B8WA 1N6PA 1KI6A 3FWYA 2IEYA 5AR1A 1L8QA 1OF1A 5DSZA 2Z0MA 3TH5A 5EZ6B 2BBWA 4NHOA 3CONA 3MFYA 1W0JA 2O8BA 2X2EA 2ECKA 3F5FA 2VYFA 3QENA 1OKKD 2J0QA 2R6AA 2NG1A 2FWRA 4PC3A 1E4VA 5FTKA 1OB2A 1XXHE 3S1AB 1QDEA 1OXUA 1W2GA 4AI6A 4DEXA 1ZM9A 4ESVA 2JLWA 1PZNA 2X8AA 3FKSD 5P21A 3P1JA 2V9PA 2A9KA 3A1VA 3BIFA 1XJCA 2QMEA 5B2ZA 4C30A 4C7OA 1N2CE 1YRBA 2R2AA 2QU8A 3F8TA 3IHLA 4Q66C 1U99A 4LY6A 2ZAMA 2J0VA 5F9FA 2H57A 2BM1A 4BLQA 1U98A 1E2PA 1E69A 3UMFA 4DB4A 4DLZA 1UEIA 1XCMA 3U44B 3I8XA 1KK2A 4V0ME 1N0VC 2DFNA 4CGZA 2NOAA 2V6JA 2A2ZA 5DYIA 2BCJQ 2ZJ5A 3ICQB 2OZEA 2GVDC 2DR3A 1KJZA 4C2UA 2A5JA 1XBTA 2QPOA 3EZFA 2GVZC 2QA5A 1F2UB 2C2HA 4MUAA 1UBFA 5AJXA 3AVQA 4FD2A 1E98A 3AUXA 5FOSA 5EJEA 4PTLA 4DCTA 121PA 2WWGA 4LJYA 4JT4A 4CVNA 3QPVA 4TT3A 4DKXA 3I32A 1U9IA 2G1JA 1QHHA 3ECCA 2W0SA 2ZJYA 4IOJA 4PX9A 4LHYA 3TVTA 5CITA 1WBDA 2HLDD 1CR4A 1KMQA 2OFWA 2HYDA 4F92B 3CPJB 3IEVA 1F6BA 3AB3A 2QGNA 3EIEA 1T8TA 1ZIOA 2I1QA 2OM2A 2BVNA 2FA9A 2R8RA 3HYTA 5JEEA 5LPNA 5E95A 3AKCA 5HE8A 4KSCA 2HJVA 2GCOB 3SFVA 1R2QA 5CDFE 2IHBA 2H7VA 4G0NA 1XTKA 5FI0B 3V9PA 1G7TA 1GTVA 1YR6A 1HT1E 2DFLA 3SQXA 1KOFA 3U3RA 4BRWA 1T0HB 3QXJA 5BYJA 2Z5FA 4CYMA 4EQ6B 2L0XA 3EA5A 1DARA 4V0MA 4WZAE 2J7KA 4FN5A 1QG2A 2FEOA 1Z63A 2REXB 4ILEA 4GDFA 221PA 3KUCA 4B6FA 1VDZA 2VBCA 2ZRGA 5FI1B 5ELXA 1TX4B 1H8HA 2QROA 2YC4C 4PZZA 3QF7A 4YC7A 2P65A 4LI0A 5DE3A 4ZI3A 1L2TA 2IYXA 2C03A 1DOAA 1FUKA 1YZKA 2CHGA 5L3QB 1CLUA 4Y0VA 2Z4RA 3U5ZB 3RS7A 4RCZA 1VG9B 5HTKA 2WHXA 4OQXA 4XOIA 3UPUA 1E2NA 4XTCS 2HUPA 3EIQA 3VKGA 4I1UA 3KXIA 1E79A 4A82A 1UAAA 4LRWA 2J46A 5UKDA 3UG6A 1XD8A 4AYWA 1G4UR 1S1MA 1OXTA 4AY2A 3V4FA 4N3NA 4GPTA 2Q0HA 3PVSA 1GWNA 2VF8A 4CF7A 2PCJA 1H8ED 4YMTA 1E9EA 1ZVQA 3AV0B 4OK5A 1JBKA 4KCGA 2OCBA 4GNKA 3FB4A 1ZU5A 1CBUA 2V8OA 1B0UA 4QJ4A 4US0R 3FHTA 1KO8A 1G64A 3CPHA 2GF0A 2OLJA 4M9XA 3GLHA 1WXQA 2NO7A 2FJUA 4PHFA 1EFCA 3M4YA 4O0MA 2C96A 3GPLA 3KQNA 2HEIA 1T3SA 2XXAA 2FOLA 2WOOA 4NCIA 3H1TA 4B3FX 1R5NA 3LA6A 5K8UA 3NVAA 4GMDA 4NCNA 1UKZA 1FOEB 5F9HA 1ZM3A 1OXXK 5DH9A 1J8MF 5TV2A 3BOSA 3BJIC 1MRNA 2FSHA 3N2EA 4CEHB 1JI0A 3PUZA 1P9WA 1T91A 1EK0A 1TU3A 4GL2A 3JVUA 1OHHA 4JLDA 4Q1CA 1Z06A 2EFEB 3KJGA 5BN3A 3LNCA 4TQUS 4B2LA 2F9MA 2PZFA 2D7DA 1E2LA 1LTQA 3MMPA 4DCUA 2VEDA 3A58B 3IQXA 5TXGA 4C4PA 4A36A 1OFUX 2CHQA 4IDNA 1CJVC 1SXJB 4LJ8A 2E87A 1E32A 3KZ1E 3THOA 3BB1A 5F3WB 3EX7C 1ZM2A 4HAUA 2G9NA 5IK2A 2AKAB 1HE1C 1G1MA 3K0FB 4HLDA 1RRGA 4B44A 5IF9A 1E2FA 4A6XA 1ZYUA 3GLIA 5KTYA 4L15A 3ETLA 2FSGA 3L0OA 4MYCA 2OILA 1NG1A 2WJVA 2F9LA 2B7CA 4NONA 4TL9A 5TY0A 2O8CA 2EFHB 4GSYA 4AG5A 1JQJC 3W3AA 2YWFA 3QPWA 1KAOA 4IDHA 3AVWA 1W5SA 5JCZA 2QL6A 2F1RA 4KFTA 4U7DA 1L4YA 2RGBA 3VQTA 1E0KA 1A82A 1YJ5A 3CBQA 4JZKA 1DO0A 4XD7A 3ICEA 5KDLA 4QG7A 4B3DA 2QORA 2CE2X 4MRNA 3AVTA 3MJHA 4H1UA 2IYYA 1UFQA 2FH5B 1SHKA 3NG1A 4Y0AA 2JIZD 2ZEJA 3B8HA 3T1QA 3FKQA 3CWQA 4BPBA 4JLBA 2GJ8A 4LGMA 4NDZA 3CIOA 1AA9A 1W0KA 1S0UA 3CUEF 2FF7A 2WAXA 4HDCA 3U3JA 2F1IA 2PJZA 3U3OA 421PA 1C4OA 3A4MA 2IL1A 5KSYA 2EW1A 2RB4A 4GFDA 1KSHA 4C0SA 2FFQA 1FPMA 1ZW6A 4WOPA 4O3MA 4JSYA 4EPTA 2ZANA 4MYTA 4NYIR 3NC1C 3QG5A 1RRCA 1OIWA 5AJVB 3BGWA 4OI0A 3GFPA 4LV6A 1G8HA 4JVMA 4EAQA 3DO6A 4CEJB 3T1VA 1Z83A 1JR3D 3LO5A 2ZJAA 2P0EA 1HURA 1BOFA 4CDGA 1YZQA 1D5CA 4TLCA 5AJZA 2ERYA 2V55B 4CEIA 3K0AB 3EC1A 2ZYTX 4OYHA 3LQQA 2OG2A 4JKYA 3T15A 1N25A 3NH6A 3H2YA 2O8BB 3QXCA 2QSYA 3OESA 2FN4A 1Z29A 4WZBE 3FKSA 5FOWA 4B3BA 5JI3E 3RS0A 3ADBA 3L82B 1JXMA 1F3OA 4Q1FA 5HPYB 4IKEA 5FPSA 1GKUB 4NPHA 3BH7A 2EVWX 2NGRA 1GNRA 2HYIC 3ZVMA 1NMZA 2HXSA 4DT1A 4DHEA 1GRRA 3CKLA 3V4RA 4KITB 3M6AA 2XZOA 3IIJA 1NVVR 1CRQA 3W3ZB 3WHLA 4ZI2A 1QBKC 2IXGA 1QZXA 5AUOB 4MKGA 2VHTA 1YZGA 4B48A 2IK8A 5FTLA 1VCIA 4BZPA 2ZU6A 3W90A 4DCSA 1NN3A 5M04A 1GVNB 2XTNA 1Z0FA 2YOFA 5DLQC 3PEWA 4LV8B 1NSTA 4Z1MA 1KI2A 4A0FA 4ARZA 2DFTA 1W0JD 5FTNA 1DTSA 1VKJA 2ERXA 4IDQA 4KXFB 5EE1A 4P4SB 2D62A 4QNRA 3MG9A 3QQ5A 4HB3A 4LJAA 1E6CA 1E9DA 2OAP1 3AUYA 3EXAA 1XD9A 2YWEA 4HZUA 3R20A 3RWOA 2QP9X 1C9KA 2MSEB 2IYLD 3NKVA 3B6EA 2F55A 3B1YA 1KSFX 4M9ZA 3W8RA 4XWAA 3AF1A 2BJVA 1GL9B 4FCVA 3U7GA 1RYFA 1E79D 4D25A 3A6PC 3O8BA 1E2GA 1XMJA 5KYKA 2ZRKA 3ZQ6A 2OFOA 4DSUA 4F93B 2ZE7A 3DZ8A 4Q9KA 3KTAA 1ZNWA 2WWFA 4WVFA 4MDEA 5F98A 2QNRA 3R8CA 1QHIA 4TMTA 2CNWA 2QM7A 3O47A 5CB6A 2JJ8A 2GJSA 4G5QA 2WBLC 1EFUA 1W44A 4URWR 3KQLA 1AS3A 1FMLA 3NDPA 1Q1ZA 3OIYA 4QGHA 2RGCA 1OYYA 2IW3A 4MITA 3AVXA 1VYVA 1WA5A 1BS1A 1OIXA 1QVRA 3WXMA 2JJ2A 4KVGA 4W5WA 3G5UA 2XTZA 4NU0A 3SE0A 1G17A 1LVGA 4LCBA 5FTJA 3GLHB 2IYWA 3Q5DA 2X1VA 5CIWA 3EC2A 4PR0A 1KZ7B 3THWB 4QHYA 1KI4A 5JSZB 3ZH9B 2J0UB 3FOZA 4JJKA 3LAWA 4QBFA 1ZM7A 3OEED 2AXNA 4EFMA 1T3HA 3EZ7A 3ZVRA 1IAQA 1W2HA 3AF4A 4ASUD 3E5HA 1AK2A 1XXHB 4I99A 1Q3TA 3LH5A 3D6TB 1UBEA 3KB1A 4M1MA 2YKGA 1NVVQ 3IHWA 3KKOA 4Z54A 1A5TA 3OEHA 4OI1A 3KJEA 1N6NA 3ZIAD 1GM5A 1OHHD 4XJXA 1Z07A 2FFBA 1KSJA 4P0TA 2F3RA 3RWMB 5FBVB 3I62A 1BH2A 1GITA 1IXSB 2XAUA 1F2TA 2FGJA 4OL0A 4P4SA 1IN4A 3QEOA 3UMSA 4DLUA 3OE7D 2GJKA 4Q48A 1NF3A 1ZC3A 2ZU0C 2VHUA 1WDTA 2V6IA 2C78A 2IYVA 4L8GA 2QM8A 4XVQA 4URYR 2YV5A 3DOFA 2GJ9A 1GDDA 1KDTA 1FQJA 4A6PA 5C1BA 1Q22A 1AQUA 1E1RD 4KBGA 4OBEA 1VHLA 2CCKA 2N42A 4P3YA 4AURA 3VNUA 3BE4A 4BFTA 1RW4A 3SC3A 4C9BA 1IN8A 2XX3A 2PEZA 4S35A 1LS1A 2QG6A 1T5IA 5IT5A 1VIAA 2NO0A 3UWKA 3EZ6A 3K0SA 4PQRA 4UXJA 2IT1A 3AKEA 1DAFA 4FMDF 5JMTA 3ADDA 1L7VC 4OJQA 1AZSC 3GJ3A 4A1FA 5EP1A 3CZQA 5CM8B 4BEJA 1CRPA 4CW7A 4R71A 2ZUDA 2Y8EA 4KFRA 4EPVA 1WQ1R 4TT3D 2H92A 1HQYE 4EPXA 1NLYA 1ZP6A 1FZQA 2QMHA 3B5JA 5DN6D 1OXSC 4JSTA 1I4TD 2FPKA 2AK2A 2VP6A 2W58A 3VR4A 2AWNA 2EFDB 4NCKA 2VF7A 1QHXA 3DMNA 1US8A 3L0SA 4M8NE 1RJ9A 4Q19A 1TEXA 3X1DA 2CMKA 3A1SA 3AVPA 5CIQA 1TADA 4FMDB 2QT1A 1GG2A 3TR0A 1NVWQ 4C2TA 4Q4HB 1IY2A 1G7CA 2GWHA 3ZQJA 3KDSE 4D82A 1K6MA 1BMFA 1U94A 4MUBA 4JLJA 4WXPA 5JJLA 4PPFA 4BFZA 3JVVA 3GLFB 2OV2A 4TYPA 4US2R 3ADCA 4TMKA 2D74A 4HSEA 3ZZ0A 2O8EA 2ZJBA 2XXAB 4Q4JB 3LV8A 1II0A 3UXMA 1VCOA 1E2JA 5FOTA 1CJUC 4QGFA 3RVBA 4ZCMA 2WV9A 2LCFA 2FE4A 5HCNA 2AX4A 4MQBA 3AKDA 4Q4LA 1N6IA 1R5OA 4RD3A 2QN6A 3GLFE 1OKKA 2JJ1D 6Q21A 1M7HA 1ONBA 2RAPA 1Q0UA 3GJ8A 5DIFA 3JZMA 2VRWA 4QXAA 1NKSA 1BKDR 1XTJA 4N1AA 4C3ZA 2W6ID 3IILA 4LBZA 1SULA 2H17A 1TQ2A 4NP6A 1TL7C 1JALA 3K1JA 2WJIA 4FMBB 3LQRA 5EQTA 3RSOA 3EWSA 4HUTA 3FTQA 5F2EA 2CK3A 2GTPA 2BMDA 4FCWA 2HXYA 1NBMA 4PXAA 1X8LA 4B2IA 5KDDA 3QJYA 1FW6A 1XTRA 1U0HC 2ODBA 2PT7A 2QPTA 2ZREA 1CEEA 2IC5A 2PMDA 5IHPA 3TSZA 2V1XA 2QSZA 2P6RA 3I73A 2YINC 4A8JB 3RS5A 2WKQA 4LSGA 1R5BA 3TK1A 2BMFA 3GJ4A 3ASYA 2SHKA 4LZZA 4ZIRB 4PAQA 5AUNB 3SYLA 1CU1A 5B57C 2IYSA 3KXKA 4LPKA 3U60B 2ZRFA 2IWHA 4ZDJA 1NMYA 1JR6A 3THXA 4ABYA 2QE7A 3IPYA 3KUDA 4FMCB 2IYQA 1NLZA 3WY9A 4B43A 4UQOA 1XD2A 2VSXA 3DDCA 5EXXA 2JJ1A 4KV9A 2IUTA 2QTVB 3QNUA 4OJKA 5K8IA 3UIEA 5J5CA 1P4SA 1QVAA 3NH9A 1W0KD 2QPAA 2QAGB 3QSYA 2D7CA 5JECA 3AGQA 1P9RA 1IHUA 1M6NA 2OLKA 3QEJA 1AS2A 4NL4H 2AD5A 3NHBA 1ZMXA 4OQLA 1EGAA 1JPJA 4GOXA 3IPXA 2GXUA 4OQNA 1HUQA 1ZD1A 4Z8XA 5TMPA 1Y3AA 2BV3A 4JT2A 5JWRA 4IVPA 5BYKA 3CWZA 3Q9LA 2PX3A 4GZMA 2VSFA 4MGZR 4ACAA 2R62A 1KKMA 2CBZA 1Z2AA 2KI5A 5JHHB 1Z8FA 1VCNA 1XPOA 2Q9CA 4NYIQ 5CDFA 4HAWA 1FUUA 3OZXA 1Q20A 5HR5A 1AJEA 4G5SA 4LJ4A 4AIIA 2ZRHA 4NYMQ 1Z0DA 1TAGA 2Z4SA 3W6PA 2OBMA 3VHLB 1GUAA 1HQCA 1ZC4A 2F1JA 2LKDA 3MGCA 2JATA 1MABB 2O8CB 1DO2A 5E4FA 3GJ0A 4JVNA 1D8TA 5C4MA 1N5LA 1VYUA 3FE2A 4A2WA 4AWXA 3F3YA 4BLSA 4LHXA 4XH9B 3PUWA 1JR3E 4OK3A 3C5HA 4YDHB 5EP4A 4IVRA 2NZ8A 3ZS8A 3QG1A 1AQYA 2IEZA 5DO9A 1VYTA 4A2PA 3X1WA 3RNLA 4TLAA 2FGKA 2FSIA 4MGYR 4P4TA 4RZUA 3VU9A 1E0SA 4BFUA 3BB4A 4NYJR 4U02A 3FMFA 1WMSA 2YYZA 4Q9JA 2NPFA 2ZVPX 5K8LA 2IS1A 2IWRA 4Q5IA 5LB2A 2XB4A 4KFSA 3PITA 1GNPA 1W46A 4ZDIA 1IJFA 2QBYA 2R6CA 2JLXA 3R9XA 3AF2A 4JKIA 4PC6A 5KSZA 1CJKC 5L3VA 2OSBA 1TPZA 5C4GB 1FTNA 1UDXA 1GIAA 2V4ZA 4IDOA 2F7SA 1EFTA 1ESNA 4QGGA 3OEEA 1XMVA 4DCVA 3WMEA 3HR7A 2W0MA 3I92A 3PCRB 4HLCA 1RIFA 2V7QA 3TLXA 2ZIAA 2ZYWX 2XGJA 1WCV1 5J4VA 4US1R 4XWKA 1CULC 2UZIR 2QBYB 2I1VB 1KY2A 5LB4A 4DEYA 5FBQB 1TMKA 2JLSA 3T12A 4G1UC 3QKSA 1M2OB 3TAHA 2GKSA 5CLLA 4LK2A 5IRCD 1DAGA 4XVRA 4DDUA 3AVVA 2YOHA 1FX0B 1S3SA 2O0JA 2YNMA 2ORVA 2JLYA 3QKTA 1YHNA 4ZDWA 3PJRA 3PUXA 4Q9LA 3EWAA 3CRW1 2BKEA 4GOJA 1EFRD 4JLVA 2BEKA 5SZJA 2GBLA 5HCIA 1KJYA 2QE7D 4N0DA 1OV4A 2OE2A 4TQAA 4ZPXA 1MO4A 3RRNA 3U6KA 2ZS9A 1GP2A 1J90A 4N0EA 1N6RA 3WHKA 2JLZA 1Z6AA 2W00A 4QOSA 4QNMA 2HF9A 3N2IA 4ZIRA 4BFVA 5HZHA 2BCGY 4RZ3A 4A9AA 4IXNA 2PLFA 4V0KA 2B92A 4LC1A 2IBMA 2PT5A 3VR3A 3HWSA 5EE9A 3WRYC 3ZS9A 4HEJA 4YONB 5G41A 1JJ7A 2VO1A 4L5BA 5CJPA 3VTKA 1DBSA 3DM5A 2PX0A 3W6OA 2FSFA 1G3IA 1RPZA 1BYUA 4LDJA 3DKVA 3AF0A 3R8FA 2XZLA 3NBFA 4HYYA 4JIMA 2J3EA 5FOVA 3RANA 1NJGA 4DLRA
chains in the Genus database with same CATH superfamily
2BHSA 2AL7A 4FI3F 4GP9A 4RZSA 4DMLA 2WWYA 2R7NA 3ZK7A 3CEMA 1W0CA 3MTAA 5CHEA 4B34A 4EI8A 2NUAB 3H05A 4H31A 3EAQA 4PO1A 4ZU1X 4BV2A 3D5TA 4ONEA 3NTQA 1KMMA 1CW2B 4RVCA 5LPNA 2HYIC 1U11A 2DERA 4YCLA 1ZCBA 3G2PA 4M49A 2WKSA 1ECPA 1ONOA 3LKZA 4D56A 1BZYA 3W9BA 2PJDA 5DNVA 1RWNA 3MQ4A 4CMEA 3EY4A 4TZKA 1JHVA 1UBRS 2RB5A 2XBLA 5FPKA 1NLFA 5LA6F 5KKAA 4ZYZA 5EXPA 2W6MA 5ALSA 4MV1A 4U9IS 5HRCA 1Q92A 1YC5A 5D2CA 3K9NA 3DXFA 4FWBA 2ADFA 1K8YB 3MUFA 4P9NA 3AEUA 1AMUA 5I3CA 5IYZA 5KNCA 2WUVA 3B5IA 3S1SA 4CKYA 4IMRA 3BXOA 5DNWA 4M0EA 3MHPA 1A8UA 1EXVA 4W6ZA 1J8YF 2GK6A 4GQBA 3AR5A 3V80A 1LBQA 2DY0A 1VE9A 4EUEA 3PG5A 1ZJ6A 4BATA 5LIPA 2AMVA 5AO9A 3AJAA 3L41A 3LUJA 4RS4A 1A50B 2C7BA 1MH9A 1NVTA 1TMGE 2Q5JA 1Z68A 2JAWA 4D4MA 1DWOA 1UIRA 3OBBA 1UMCA 3B85A 1OWNA 1NGSA 1XELA 2H4YA 4R6XA 1O6ZA 1DAMA 1W8IA 2JBAB 3I3SR 3V2GA 4UNRA 1BW9A 4B6RA 3AR6A 1UZMA 3I61A 4JLAA 3ZKAA 2DSNA 4F5DA 1NWHA 4J1TC 2I80A 1UFVA 5BOSA 2PH1A 2C61A 2YH2A 3ZWDA 1DV1A 4Z1OA 4ZEXA 1XRJA 2HRZA 3KAKA 2NVUB 2IH2A 5IM5A 1XK7A 3UAGA 3EOAI 3PEUA 1UL1X 3QRWA 5GVSA 1G4AE 4I9GA 4ZT4A 3UAOA 1QYIA 3DCJA 3N1UA 3TQOA 3PBKA 4D79A 3IV9A 4DC9A 2JFQA 3CVWA 5CH5A 3LPCA 3V4ZA 4XUGB 5LWHA 5D00A 3LY7A 4LXXA 5KO2A 1E9FA 1TIPA 4DZRA 3DOIA 2Q4EA 2ZK7A 3EVDA 2XTAA 1DCFA 4P3KA 4AJHA 2R1VB 4S24A 4A0RA 3ONDA 4L0QA 5DF1A 1M1YE 3OFNA 3RF7A 1SEPA 5JEEA 5IVIA 4F6CA 2DWPA 4LE1A 4XWYA 3FYUC 2WQZA 4JI8B 1TECE 3H42B 4QGSA 2VTBA 1A4RA 2PD3A 3S81A 1YB4A 4OJNA 4W7HA 2BONA 3B1ZA 3JASB 3REQB 3QE2A 5KU7A 4EABA 4KE6A 1RMQA 2A1UB 5DZSA 2Z2ZA 4C3VA 1CS0B 2J7PA 3ABIA 4LRXA 1B8PA 1BGXT 1DIGA 1ZXXA 4GM1A 4I2VA 4GPIB 4YO7A 3UUFA 3LHSA 5C8ZA 4ZTUB 4MDEA 3IVRA 2UUAB 5BV0A 1IXZA 1V6SA 2QJTA 4P0PB 4JY7A 4DLXA 4CLHA 4UTPA 1KIMA 3ZE8A 3HXTA 3STWA 4C6HA 3DDSA 1YL7A 4YV2A 1JQBA 3DHNA 2HMWA 4HRAA 1ZU4A 2J1LA 2ZS7A 3EXG2 3WLSA 4ZT6A 1MQ8B 4HZUB 2COEA 2DHEA 4PTZA 4YBRA 1GNQA 1U5BB 2J0EA 4GWLA 2X7JA 4IDEA 1W36B 1GGEA 4AN4A 3UAYA 4WACA 4B3SB 1W76A 4W4TA 4W8OA 4IKOA 5FB3A 1ZM4A 1HL7A 1NPTO 1LLCA 1L8OA 3ELWA 1NPDA 3TQFA 1U04A 1AQ6A 3H19A 3I5UA 4D0LB 2LDBA 4JVSB 1QVVA 1SK8A 1HEUA 1BU5A 2WSSD 4GKAA 4M7WA 5L95A 4IHQA 5CB4A 3FHCB 1ZGCA 4R6WA 1BWSA 3BEDA 1DE0A 1EQAA 3FNFA 3NASA 3ZNPA 4XASA 4KK4A 3WGUA 5BMOA 3ZDAA 2CFIA 3NPAA 4PONA 4EKGA 1N3YA 3LKBA 1K3FA 2E55A 2P5YA 4KO8A 4Q1AA 2N46A 3SICE 3GCXA 3IEUA 4LMBA 1Z6XA 2YJ6A 1S1CA 2XEXA 2Q8PA 3B3QA 5K51A 2O14A 3PRYA 2IA5A 2ZCUA 4X7PA 3SKXA 5FH9A 3QUSA 2GZ1A 4WPGA 4DE5A 3AETB 1RHUA 3ANTA 3A32A 4UE6A 5KMGA 1RYYA 5JJIA 4UVGA 2WFMA 1U02A 3H5VA 4JBLA 4RADA 2DUUA 2AVNA 4KQMA 1O6CA 3JYOA 3NT5A 4QUJA 4NZYA 3WRWA 1UOQA 5I9TA 3BL6A 5BSEA 1GPYA 3K1AB 4MINA 4AULA 4DMRA 2Q5HA 1J24A 3EBOA 5A4MS 3DV9A 4KIWA 3UKDA 2XUHA 2ETXA 4MIEA 2VRCA 4TUYF 3UAZA 2A9PA 2WWXA 1G8GA 3E70C 3H5TA 2CB0A 2N1MA 1VIYA 3MPOA 5IH3A 1IVNA 3RVDA 3U1TA 3GG2A 3WO1A 5BMVB 5EE0A 3ZV3A 2Y1DA 2ZSFA 3L1VA 4LTDA 4TKZA 4RACA 2W2KB 2Q9BA 5CK4A 1T8YA 2BHTA 3P2MA 4JBWA 3RYFA 3MUOA 3T7AA 3NHPA 1QGED 3OIUA 4K7JA 2TMYA 2J08A 3HRIA 4GQAA 3A1UA 1WDWB 4LX0A 3ENVA 4B3IA 4F7WA 1KQPA 1YDHA 2PNFA 3BCHA 3RUEA 4AJ1A 2FP4A 3G1TA 4DBLE 3EUEA 1ENOA 3AP1A 2WYOA 3SCZA 3SXJA 1VDMA 4YV7A 4WUVA 3SMQA 3SD7A 1T3ZA 1A9OA 3HDHA 2N47A 1T5LA 4ZOLA 1GPDG 3OP4A 1RWQA 2OENG 2C59A 4CDMA 2PJRA 4L8WB 4OPMA 2VDVE 3VV3A 3HXOA 4C7JA 3OEHD 2I91A 1TTQB 2OLEA 4NENA 4E09A 5K09A 3VJRA 4XX0B 5EJMA 4ZI7B 2ZSUA 4PYIA 3DTTA 5DU2A 1JEQA 1EXDA 3COWA 4BJ6A 4L22A 1XTQA 1E4OA 1PBNA 1PLJA 1SG0A 1KAGA 2Z9BA 3BWVA 2OGWA 4KBFA 4MVJP 5TRTA 4IO0A 5HZMA 4WKPA 5HRUA 2YHSA 1FE8A 3WP1B 1J8VA 4XRRA 1B1AA 3TDNA 1PBTA 1SC3A 4KC0A 5CH3A 4B17A 4WOCA 1Y1LA 1MC8A 5EWJA 4Q7QA 4IAOA 2VP0A 4IOLA 4HZIA 1PFGA 3SZRA 2Y4OA 1C7QA 2QDKA 1D7OA 3RREA 4ES6A 2B5VA 2VTKA 1ORHA 1G59A 1W581 3F1KA 3LCMA 4K8OA 4LCJA 2OO5C 3JQ7B 1KR5A 5DNCA 5AVUA 3O2JA 4PCAA 5B6JA 4C5BA 5CDUA 2GDZA 2H54A 4RGQA 4P34A 4P36A 3TB6A 1H0SA 1NWCA 3QQPA 5DHQA 4P4UA 4A8JA 4HYQA 3X2EA 1DAHA 1G16A 1TQHA 1MX1A 2Q5IA 2R48A 1YDGA 3FSGA 2PVCA 2P9CA 2CVZA 4TRMA 3VSBA 3L0PA 4P5DA 3DKRA 1J70A 4ZTZB 2TMKA 3CNLA 1UBUS 5E9AA 3M33A 1T1GA 1WU8A 3KNZA 5FD8A 1OFTA 2X9NA 2ZKLA 2CDCA 3BHNA 4BAZA 4MGIR 2DWQA 4AG6A 4HEHA 4G0XA 3CZPA 1Y81A 3P2KA 3RT7A 1OH8A 2V9CA 1BKYA 2GZDA 1QORA 4QTUB 1T9HA 4IFEA 4R84A 1KFCB 1O8BA 4LOAA 1UC4B 5FYQA 4P31A 3I72A 3TQRA 1CNFA 2F43B 4XQGA 5K2OA 4B3TB 4CLDA 3RU3A 4UD6A 3GD5A 4AJLA 3RAPR 2E49A 1RDFA 4FONA 2GZAA 1NRWA 1VC2A 2ZE8A 5JAHA 1P6QA 3EISA 4LRTB 4D0NA 2LTAA 8GPBA 3E15A 1E7YA 1I51A 3EXEA 4PCLA 1KP3A 1QCCA 5CYFA 3RYTC 1YZLA 1K5PA 1M1UA 3SS8A 1ISFA 1S2DA 5DLYA 2CJWA 5IPFA 2ZBUA 3DE6X 3ZW7A 3K32A 2ZITA 3RVKA 2W2VA 3DKPA 4BO4A 4DRXB 1SXPA 4HAXA 1YTUA 1ZD8A 4DNXA 2QQ0A 4EJFA 1HV8A 1C4XA 3CLUD 4XD7D 1S8FA 2P6PA 4JEHA 4FB4A 3A3NA 3AOGA 1U1GA 2VYCA 2XYPA 2ZDGA 2WE7A 3VU9B 4EF6A 2XYHA 1V1RB 2YWHA 1GV0A 4DQ0A 3DT9A 3RVJA 4JB3A 1NBAA 2X23A 3CNBA 4Z7JA 4PIMA 2VTEA 3JQEA 1P6XA 3MJCA 4MWDA 4R98A 5EMJA 5E9WA 4DCGA 5G3ZA 3L7MA 1FIUA 2PBLA 4YQYA 3IDQA 1B42A 2CVHA 3OCZA 4AP9A 5LBIA 3TAXA 3S1LA 2VYNA 3H97A 2RGNC 3DT6A 4CM9D 4ETMA 2OV4A 3UCEA 5A5GA 2NQ2C 2JAQA 2YV3A 3IPRA 3RV3A 3U39A 4DG5A 1DHTA 1QH9A 3HBLA 4DGQA 3AK4A 1MDBA 2PAAA 3HYCA 2FYTA 1EK1A 1QBGA 3I6MA 5AOVA 2BYTA 1JAYA 1UT6A 3Q98A 1ZD5A 9GPBA 3AHEA 3E5MA 1XOIA 2WU3A 4X8MA 3KKZA 4U0KA 4RE5A 1D09A 1MA3A 4DLBA 1MO3A 4V0LA 3V1NA 5HKOA 1WCIA 1B1CA 4N54A 3C3CA 3HU3A 5FAXA 1U0JA 4FS3A 3SHFA 4NV3A 5EZQA 2G04A 2RC6A 3SLRA 4DBLC 3P5SA 4E11A 4ENWA 4QJ3A 2YX1A 3MRSA 1SXGA 2FMHA 2Q1WA 4RA6B 1LLQA 2DX7A 3LBFA 3RHFA 4RD4A 2E6UX 1ZOOA 4YXWD 4IYJA 1BX1A 3I58A 4P7GA 1SXHA 1GVHA 1VOTA 5HQ3A 1OH7A 1NBEA 3RC1A 3T94A 5T41A 4JX9A 5KNCD 3EUAA 1F5SA 1NTRA 5EIOA 1C4KA 4N3CA 5BW8A 1BJRE 5IU6A 1R74A 1M74A 3QPUA 3QI7A 1E94E 3VI4B 1P72A 1TT5B 4HQLA 1P5HA 4RK5A 3E9NA 5DI9A 1R10A 4QBIA 4C0KA 2C9DA 1LF0A 5FHQA 2FUKA 1X1RA 5CG1A 3W5BA 3FZQA 2FR1A 1GUYA 5KIAA 2BMEA 2FW8A 2A9QA 3KSRA 4YFVA 4DWWA 3VX3A 3VTKA 4P32A 4PSKA 1S9DA 1XO1A 5ED0A 1V0JA 1JDPA 1HSOA 1YA8A 2JKYA 3PS9A 5BY2A 2BE7A 2O05A 2Q3MA 3ZHOA 4NENB 2JJMA 5E3JA 1FY2A 2ZT8A 4FZ3A 4DV2B 4J0GA 1L5YA 2BHRA 1FMJA 1JL3A 1DAPA 1Y5NA 1GSAA 5B37A 1QQ7A 4U5QA 3GPCA 2IHYA 1EXNA 1SVNA 3NHAA 2FZWA 2O23A 3ZLUA 5D3MB 1IBSA 3D8BA 1IMOA 4D96A 3Q8LA 4FB5A 2MU1A 4Z53A 3LX4A 3VRHA 3D3WA 4IHJB 4MVJI 3QE0A 2DPGA 5LJLA 1EX6A 2P3SA 3K09C 2OBLA 5K8VA 3SQMA 4EBBA 2HEGA 3MWYW 2OBNA 4NNOA 3LXUX 4P38A 2F17A 3O5AA 1AKUA 3TJZA 5BYAA 1WO8A 3T5BA 4CJXA 3KKMA 1UJCA 1TTTA 1NZFA 5IAJA 2G6BA 2Z5GA 3VR6H 4QECA 5ECYA 3KZNA 4Y0NA 1E66A 1O6FA 4YT5A 5B1DA 3OI7A 2W83A 1ZUWA 4U39A 3SC6A 1E1RA 4EZIA 5HJ2A 2FZ4A 2R8EA 3AHFA 2BFBB 2LDXA 4IRXA 3RG2A 4KRYA 4CE6A 1SCAA 2DKFA 3A9SA 4DV4B 3AUAA 4QEDA 3DMYA 3RYHB 3LT4A 1IJEA 4BNNA 1GNSA 2ORWA 2A14A 3LQ4A 1PHPA 3TRFA 5TS2A 4YP9A 4LZWA 5DI3A 2JB9A 2QIOA 2OP1A 3AETA 3L0BA 4V0OA 4C1NA 2AN9A 2B1QA 3P9XA 2F8TA 3G6WA 1Z74A 3UWSA 2JFGA 2FFRA 1LJLA 1PZFA 1O3YA 3B3JA 1KGDA 2X9GA 2YV2A 4Y98A 2BGTA 4H9GA 5IHXA 3KQUA 3VVBA 2ZRLA 1CERA 3KBBA 4R1PA 2OYCA 1Z4QA 1C9YA 3SSOA 1M34E 1CUZA 4AMBA 4BQSA 2PZEA 5DM1A 4HEA1 2RH5A 5COBA 3V4SA 1DBRA 3KWFA 2A33A 1VJ5A 3HKEA 2GPBA 1A8QA 1DQZA 3WLJA 3NLLA 2HSEA 2XWQA 3IUBA 2QRQA 3CX3A 4J29A 3OIDA 3FKJA 1KPHA 1U7XA 2C5LA 4OI2A 4DLWA 2DY1A 1RI4A 1CB0A 3CVOA 3DB1A 3ETJA 2VPXA 3E9QA 5F5XA 4TN5A 5E3HA 4D9CA 4JWKA 3P20A 1DAEA 3TE7A 3UH0A 3EXG1 1E3IA 2HWYA 3C85A 3FUCA 5IBRA 1H65A 3ZU3A 5KDOA 3Q8XB 2X8WA 3DXZA 3RABA 5KTNA 3FVQA 4KG7A 2VCEA 1T24A 4I8XA 4TKUA 5AKLA 2QQGA 4KDFA 4G01B 3A1FA 1S3GA 4YECA 1XF9A 5BV8A 2A4MA 3AR2A 4F85A 4ALMA 1B0AA 1DEAA 2DHRA 2LWIA 1SNYA 4MWZA 2J3IA 2YQ5A 2PWYA 3EMKA 4FJ0A 1CJMA 2ZBFA 1TM3E 5LWQA 4Q3EA 1EUCB 3QMWA 1FQWA 1Y6QA 1YASA 5AUQA 4PTYA 4Z4GA 4IJVA 1CY4A 2P4EA 2V97A 4CG1A 1GEGA 1HEIA 4HY3A 2JD1A 1RXSA 2IYAA 2POQX 3K0EA 1YJ8A 1M6YA 3ER6A 1XVIA 3NRBA 3SBDA 4EEXA 3FVVA 3T5PA 1HYEA 2Z6QA 1HR0B 5A7FA 2ZPAA 3DZIA 3IQHX 4BQFA 1X86B 1PWXA 2VF4X 3MWLA 3ZVKA 2XHEA 1IAVA 2ZUBA 4KWEA 3JQGB 4II7A 1GL7A 1R6DA 2QS9A 2ACVA 5MN5A 3A4VA 2OO3A 4GM0A 4BO2A 5M5BA 1DELA 2PR7A 5IM4A 2GAOA 3LUDA 2ZIFA 1T4CB 3FYUA 3JAKB 4WJKB 3WYFA 2JIBA 4L6CA 3AUKA 2WK1A 3C16C 5GP1A 2Y1FA 3PV0A 2PS9A 1VGVA 2JASA 1IOVA 4TXMA 4WEOA 3HJGA 2CBXA 4HLUA 5BWNA 3IQWA 1IHPA 1JSLA 1WTCA 1WU7A 4G0ZA 1Y98A 4HJXA 4O1IA 3CVYA 3T3HA 1CZHA 1UDCA 2I6UA 1FFCA 3NTRA 1R7RA 3BN3A 3C6QA 1XDBA 5GJCA 4JP5A 4DQKA 3RS8A 4CGYA 1U6KA 1IM8A 4OQQA 3W8FA 3GFOA 4GWKA 5ALRA 5AW3A 4BGIA 1NV8A 5KWIA 3BJRA 4IEIA 3W34A 3COZA 5BSMA 1O77A 3E8SA 2IKQA 3R7AA 3Q9NA 1SVIA 2YRXA 2JI6A 2QD2A 2Z83A 2KX7A 1FP1D 4L02A 4X24A 2IS6A 1R1DA 5HUQA 5BSWA 3RH0A 2XEDA 2HIAA 5GJWC 1GCUA 4JJ8A 1OB5A 1M8PA 3OOJA 4ND3A 3OETA 3T7JA 4X6LA 3I34X 1KL7A 5JROA 2IE8A 2DUMA 2PZAA 3QKRA 6ADHA 1K9VF 4FEGA 5J58A 3JXEA 1R15A 3WKDA 2RHMA 3CLSD 4DRXA 1YA6A 1OBVA 4MDFA 2ATEA 3DEAA 2JK1A 3ER8A 3MTDA 1BA3A 2IGTA 5I6DA 5EZYF 2RJNA 1A97A 3H9BA 2EBWA 2WSYB 1KDPA 3C8MA 4HLUC 1L3BA 4X7RA 4DIFA 3P71T 2WKRA 3RR2A 5C7OO 2P68A 4ZQFA 4CHGA 3F78A 5DW0A 3BT7A 1U7ZA 2VNKA 1NVUQ 1Y8RA 2VP2A 3DWFA 1ZK1A 3G68A 3GCZA 1P1RA 1QTNA 4WECA 4E5DA 1PYGA 4BLWA 4RH1A 4NZPA 4A8HA 1SZPA 5JNWA 1EGHA 1VBFA 4JFRA 3SM9A 5IMBA 4G0PA 5CDGA 4XD2A 1YOBA 4ITVA 2P9ZA 3FDIA 5JTUA 4P7BA 3B6ZA 3EVEA 3G0HA 3BDVA 4IH9A 1YDMA 2XE8A 4M7OA 4HX5A 1X42A 2HO5A 3E7XA 1TM4E 1XCGB 5EXSA 5EZ5A 3T4UA 3M6VA 4FOLA 3A1WA 2EYQA 3LSYA 5EIBC 4G2NA 4ZI7F 1TKRA 3KKQA 5I4KA 2XCRB 3TIIA 3UATA 3AM3A 4IDCA 3L93A 1M9NA 1FYVA 4JWTA 4ZT7A 3ZUPA 5A6SA 3SYKA 1PS0A 2W6QA 3GAZA 3QE3A 4ZQCB 3TM4A 1YIDA 4YCDA 3BC1A 2AT1A 4UVEA 4EMUA 4Y9UA 4RTMA 1FUEA 1U0BB 5K20A 1U3DA 2J6HA 1XQVA 2EYUA 2NMVA 2ODAA 2FEMA 1K86A 1Z4IA 3AR9A 4BNUA 3IEXA 4C5CA 1ODCA 2C3MA 4LNUB 1C9MA 1DKMA 2BMAA 4RSGA 3KJQA 2WVJA 3GBPA 4TKVA 2OVFA 5IEJA 3VKWA 2OV1A 2QLFA 4ND8A 2CHVA 5E6RA 4KE9A 1KVSA 4DR2B 2J45A 3GCGA 1I4DD 1U2SA 2F3TA 1QRSA 2JRLA 4CIWA 1UAYA 4KIJA 3FFXA 3C43A 4INZA 4G5GA 4CT5A 5ABPA 3ENWA 4CF3A 2ZCVA 2CJWB 4RF3A 3TW4A 3PNLA 4E32A 5HIKA 1NM5A 1M6VB 1YZTA 2C58A 2RG1A 1EUYA 1DMSA 3FYDA 1AA6A 2I6FA 3RVPA 4IW3B 3V8BA 1X7WA 2D13A 4HPXB 1GUBA 1NUQA 2CZGA 3K35A 4TXHA 1VHQA 1JG1A 1KNQA 1CR2A 4TZTA 1EJ2A 2MJLA 4ZI7A 5C8YF 4IH4A 4M0PA 1KR2A 5C46F 2JFZA 2IYFA 1JDBC 3G0IA 2QD5A 4KRGA 2UKDA 4HS9A 4ZO4A 1NJ5A 2GBPA 4BJ3A 4DA8A 5BQXA 1KNXA 5HOEA 1XPRA 5B1HA 2R84A 3L18A 4JAVC 3QWBA 2YVAA 3IMFA 2IYTA 4G85A 2PFSA 4KVFA 3W77A 1GAXA 5JOQA 5CEFA 3IELA 1PU2A 3B82A 2FUNB 3DBHB 4P35A 5EE5B 3K0AA 2CLSA 3H11A 1ZMTA 3I0ZA 5T4FA 4JYAB 2BJWA 4BZQA 3DF7A 1D2MA 4WCDA 1X15A 2VA8A 3FWPA 3LOPA 4Q9HA 5CA0A 1LSUA 1QIEA 4RHYA 4NOLA 4W1PA 1EVLA 1G20E 4HEA6 4LZJA 2XIJA 2O2CA 4COKA 5K0BA 5KPDA 5J63A 4UD2A 2XJ4A 3K70C 2AOVA 3AO0B 3NORA 1XFAA 2HPVA 3T95A 4Z3OA 2F8MA 3U0VA 3AEKA 1IBMB 2ETVA 3P7MA 1BVUA 4EEKA 1SVKA 2V8BA 3F8WA 3PXBA 1HDXA 3M1YA 2MSKA 4AQ7A 3ASUA 3L7YA 2XB2A 3B1KA 5L45A 3SHQA 3V3TA 4XCXA 2EP8A 1BYIA 7YASA 4F2GA 1SVLA 1P2UA 1PR0A 1Z5UA 3KSBC 4PBSA 5A3VA 4JROA 3ZZTA 4BCDA 2QRUA 4LYGA 4E03A 1ULTA 1WQ4A 1ZUHA 1VHTA 1NI5A 5AI0A 4FUQA 4GM4A 1U0OC 3R3HA 5AKIA 2HSWA 2A59A 2W93A 4LHVA 5CEEA 1F8YA 4PQFA 5I7RA 1PFQA 3AHCA 4ZJZA 5HTOA 3AF6A 1Q7BA 1HL3A 2Z58A 1FB5A 3VR5D 4DL9A 2Q1YA 1P2DA 3MTEA 3U26A 4RPIA 5FOUA 3H2SA 3V1KA 3GMTA 4RL6A 4L5IA 4XUEA 3D6MA 4XPIB 1FP2A 3MGGA 4BWYA 1X8JA 4IOKA 4DREA 1TU0A 2W2QA 3BHMA 3FPFA 1N1MA 4MRVA 4R16A 3T0IA 4HN4B 4J0FA 3U4CA 2NWQA 3AU8A 3ULKA 3ZE7A 4JLSA 2C8LA 4ADSG 2QSUA 1MIOB 4G5FA 5FR2A 3VTZA 2HRCA 1TB4A 2H2GA 3HCNA 4TTRA 2RGEA 3EPPA 4YK7A 1YC2A 2BEWB 4V38A 5DHAA 1U1IA 4URXR 5CFNA 1QU2A 2C8VA 3O8OA 2Y1OA 3H6HA 3N0XA 2C92A 5INTA 1VCMA 4DR4B 4D9GA 4FDAA 3FOAA 1NUUA 1D1TA 4PG8A 1COZA 3DNFA 4RJ2A 5I9MA 4E31A 3LDAA 5FUQA 4D6PA 5K01A 3QXSA 1KYWA 1ZN9A 1M8JA 4N7BA 3EYWA 2GAAA 5CK5A 4HO1X 3T3PB 1J07A 5I45A 3FB1A 5DN6A 3WS7A 4A0GA 1YB5A 2DFKB 3KLOA 1YBMA 2VNJA 5JHGB 3OQJA 3L4JA 3GJXC 2AQIA 3F46A 2GXQA 1CY1A 4R41A 5HFAA 3JSAA 1GXSB 5CU7A 3MGBA 4RMHA 1MV5A 5GZ3A 4QXMA 2YVQA 2FTKE 1MT0A 4QRHA 3B3AA 3HKDA 4JJEA 4HGNA 3CPEA 4XR9A 4ASUA 3AJ9A 3AHIA 3UUEA 721PA 4U2BA 4CKZA 2J4FA 4BKMA 2NSJA 4ZK6A 4TLDA 3TX2A 1FL9A 3GFGA 1DPFA 1RMTA 1YS1X 5D3KA 5ENDA 3C14C 4RYDA 3WK9A 5CAEA 1YFLA 4GKJB 4X90A 3GIWA 5U4QA 3TNYA 4NH4A 1PSDA 4Q47A 3P0HA 5C81A 1NE2A 3GZNB 1XNJA 2RI0A 4H7DA 4I6JA 4D80A 3ZQ4A 1I5EA 5KTSA 2ZDHA 3TSWA 1GO2A 1P2VA 1UWVA 3CR8A 1HLGA 1JU9A 1XD2B 2VJAA 3HCRA 3HN2A 4LN1A 5EMMA 5JVDB 3UJBA 3V9AA 1PW7A 2CFSA 4MR7A 3VGJA 5KKCA 1TF5A 5FBLB 1J7KA 1E63A 5B36A 4HUQA 4YAUA 2Q99A 1VTKA 4JOCA 3HBAA 4P98A 4C0HA 2R1UA 4C4SA 4URZR 4BEBA 1N9GB 2YS6A 2FZKA 2QI9C 2I34A 3BBPA 2AKYA 3D6FA 4QJ5A 1N1EA 1ZL2A 4REMA 1R0SA 4M8KA 2V59A 3RUFA 3WGGA 5K5EA 4G26A 1DL5A 4IIBA 4ARZB 1TKBA 4D8UA 5LR6A 2XWJI 5KUTA 5ER6A 5LLTA 3GLGE 1GAJA 4TWZA 4BZZA 1K8QA 2WFLB 4Q4JA 1GL6A 1SGWA 3U6BA 1EMDA 4PCUA 4QUGA 1YDEA 2FEPA 2NPIA 3BWBA 3BD6A 3GB9A 3X1ZA 3LWNA 2OC4A 5AM3A 1XZPA 4BNDA 3PFIA 4FWTA 2DPHA 4Z3DA 1X87A 4PGMA 1ZRHA 1V1MB 3JQFA 1RSZA 1H85A 3LVFO 4BFWA 1QQ5A 2WKPA 3BJMA 2IOYA 3MOGA 4NBVA 3FJ1A 4LQCA 3P9NA 5T7BA 1MZPA 2W2LD 4X71A 4TKMA 2XY4A 3PUVA 2UYYA 3DE5X 3HGMA 1N2XA 2BSAA 3THYA 2BTQB 1DJLA 2LGJA 4A23A 1YR9A 5BWOA 2Q45A 3AEUB 3INRA 4MA0A 2AEJA 3FBTA 4EHBA 1ZL0A 1UOPA 1I1NA 2IW1A 4Q21A 3WB1A 3LUGA 1BEUB 1W35A 2E48A 3MCUA 4OKSA 4PAOA 3C98A 2X4GA 2RAUA 4ZQIA 2VCYA 3HPRA 1H2RS 5EHZA 1OWMA 1VJ1A 3WRXA 5EOVA 3ZLBA 4B0PA 1ZJJA 4XWWA 4D6XA 5IAAA 1U90A 5K3CA 5AK0A 2JDID 5HDBB 2JKZA 1S02A 4DF3A 3GJ6A 1O9GA 1G41A 3F5MA 3JQBC 2GKGA 3HUUA 4ZQEA 3WB0A 3CRRA 4JUCA 3PX7A 4BUJA 1X14A 2QRVA 1YJBA 2EDAA 3ACCA 3CGWA 4NK4A 2Z08A 1ITZA 2DLDA 1VLLA 2R0QC 3ESQA 1C2TA 1XJWA 2Q4TA 3HFRA 2YJ3A 3ZE2B 1JXAA 2JHAA 2V9ZA 2Z1MA 1TLTA 1NXXA 2IUFA 2C9YA 1I6LA 5JWOA 2CLEB 3VOSA 1NY6A 3NBXX 3PD0A 1XL1A 2FY8A 2I9PA 3JQGA 1L5VA 1K97A 4DZTA 1O97C 4INAA 1UJ2A 3Q7PA 4WMLA 5D5HA 3S70A 2ZZNA 3M5DA 4XJSA 4XOUA 4B4UA 4YJ3B 4E2ZA 2AZXA 5EXDA 1PJ2A 2XDAA 4YRQA 2WIGA 1L4EA 2QJOA 2C8JA 1JX6A 4GZ6A 2DKOA 2FHSA 1J2EA 3L6UA 3LFTA 3NALA 4W9NC 4KJXA 3SDBA 4O63O 2DETA 2N1BA 4YIKA 3DAGA 1UWKA 4N6GA 1QJCA 3FI0A 1CEYA 1M7GA 4HLQB 2NYUA 4ME6A 3SYNA 2G8LA 2H1FA 1D2GA 1QVWA 2DPXA 2JI9A 2XNHA 4PZYA 1ZGAA 4ZDKA 1SXIA 5FPTA 4MR8B 4PN3A 1KOLA 1SUBA 4CMEC 1MC4A 1IN6A 2YCBA 2X86A 5BN5B 1KEWA 3LZ6A 4NBSA 1UAGA 5D1NA 1PL6A 4WFIA 3WGNA 1EK5A 1NR1A 1R9MA 2IEDA 5EWMB 5TE9A 3RTCA 1FFWA 1XDUA 1EVZA 3PF9A 2JIMA 1DRVA 3OIWA 1XZFA 4UMFA 3TTYA 5A4KA 5TS3A 4X65B 4PSVA 4EUSA 1PSZA 3A1CA 3I37X 5JCXA 1QK5A 2JC3A 2GO7A 1R0BA 2KBEA 1K5GA 2WTMA 3QVGA 4MRPA 4ALJA 1PYOA 2VH5R 4GSKA 3ZD6A 4QL3A 3SEFA 1UM8A 3KEMA 3RSQA 2O1EA 3OQ1A 4MUMA 1F5NA 5JZSA 4IWXA 1JFLA 1FFXB 4KGZA 4G8DA 4BE9A 3PICA 1Z4OA 1DIOB 3JWPA 5FV7A 3VGPA 4EYGA 3DPUA 2BZGA 1JHRA 3HE3A 4OLJA 3HVUA 1LW6E 1Y7TA 2ZE6A 1VECA 4ZVNA 2XXBA 4MAFA 3A7DA 3FX2A 4YGYA 5DCWA 4DOMA 2R97A 1A8PA 3IP3A 3H2GA 1KI1A 2CNLA 3K8YA 4OD0A 5EP3A 3R3YA 3NBZC 1WXIA 4D3XA 4DAEA 4U2KA 4BY9E 3O4FA 3NAQA 1UFOA 3BFKA 1Y8CA 1Z7EA 5TMDA 1KWKA 5EHNA 1I33A 1IK6A 1N0UA 1V7ZA 2XT9A 5JG7A 3U5TA 4L5JA 1HTBA 2IYZA 2EX4A 3MAGA 4M38A 1EWQA 2OD9A 2VSYA 3AH8A 1DGQA 3WYDA 4B83A 4BGVA 4ESOA 3FYHA 1TU4A 4WNCA 1KQGA 3HK2A 2XVXA 2FN8A 3Q7QA 4KPUA 1Y7LA 3L8EA 4AY4A 3EBPA 1G3MA 4X1KA 3DMHA 2ZRBA 4K9PA 3RJMA 3EVBA 3CLKA 1PRYA 3EXIB 5CT8A 5C5DA 5KCZA 2IH4A 4TSKA 1NLMA 3EGOA 4ZYYA 4V39A 3TLMA 3L8YA 1GQRA 3L2OB 1CVRA 4DCNA 4WHMA 4HB4A 5LQCA 3U1BA 2ZSDA 3QVKA 4RULA 1GCGA 1ULUA 2H4HA 4BWVA 1P5ZB 1JNXX 1TD9A 3B78A 1NHGA 1P7VA 2B8EA 3SNKA 5LUAA 1KJWA 4P0QB 3GLFA 1U1EA 1AT1A 4RQUA 1PWEA 1SK9A 1O0BA 5CVTA 1VL1A 4WEQA 3REGA 2C2GA 4MP8A 5DPMA 3WL8A 2I5PO 3PJFA 1TEVA 3WGJA 4CNQA 2WUFA 4R9SA 3GLQA 4OBWA 2PFGA 1MU0A 2PMWB 1QH8B 5DLEA 5IAGA 1Z4PX 4EA6A 5I7SA 2BBSA 1UODA 4E21A 5LZ2A 1FP6A 3EPLA 1J25A 3NAMA 4DFDA 1BE6A 1QCDA 3H4VA 1CK4A 3CKYA 3KOZA 4PWYA 4DDTA 1SCNE 2QTTA 1U9CA 1PQ4A 3IOMA 3ZGLA 3O8CA 2YWCA 4TRJA 4V0NA 1L4GA 4KO2S 5EUMA 4RDHA 3TMKA 3GZ4A 4F3RA 5CNKA 3HU2A 4MS3B 2DTDA 2ERCA 2ODQA 3W05A 4LDNA 1KU6A 4CG0A 1J8QA 4LDPA 4AZ0A 3WHIA 4BASA 1ORWA 1PEYA 1X6VA 1T2UA 4EA9A 4E14A 4MS4A 4HV4A 1M83A 3HVRA 1ESMA 3IESA 4TTQA 1J21A 5FBRB 1OE0A 1XLVA 3IP5A 4E6EA 5KWJA 3F74A 3KG2A 1C7ZA 4DCMA 4S1WA 2PBZA 4EO9A 3H11B 4QQRA 5TVKA 3VISA 5BWLA 2B83A 1RQGA 2RGAA 1TZBA 4XDGA 5G4LA 1R8XA 4B3JA 2Q3BA 4EVQA 2QMYA 5C8XA 3TZEA 4ZO6A 5CB0A 2CUTA 3CX7A 1FTWA 1KPGA 3ICOA 1FYDA 3NXSA 3PR2B 4L7QA 4KGDA 1AS0A 2P67A 1GU0A 4I0WB 1DMRA 1YE8A 3R5XA 4IDGA 4ND4A 4U2DA 3V6LA 3G5MA 3QMPA 4MPTA 4OF4A 4WBNB 2OYSA 4B2PA 1O9HA 1ZKDA 1HT2E 2Q8QA 5IDYA 3IULA 2PPLA 2C95A 3B9BA 3TZCA 1SKUA 4OHVA 2IUUA 5T5QA 3RFTA 2R6FA 3TOZA 3V6MA 4B3CA 1ECCA 1R4NB 4TMYA 1E7RA 1MCZA 4PGAA 3HWWA 3S2IA 2RGRA 1PE0A 1AUVA 2V5UA 4TT8A 2WSSA 1JRLA 2XNDD 4EY7A 1AKEA 4N7RA 1YJXA 2XW6A 4IRUB 4ENTA 2ZJ8A 4UFNA 3N8DA 1YB6A 1I30A 1ISIA 4PY2A 2C1XA 1VKOA 3T7EA 4BXOA 5FWYA 3CJQA 3KS9A 1G0OA 2OB2A 2FWPA 4LYFA 5KEIA 4J0CA 3GBSA 5IAEA 4YRNA 4A0HA 4WUTA 4U5XA 2YNMD 2NUPB 3NTVA 2QLJA 4AKHA 1UDRA 2OUIA 1Q77A 4I9FA 1GZSA 1IQPA 1KDOA 2BUCA 2P7HA 2R8PA 3DMTC 3EZ2A 3OLCX 2O8FA 1V11A 2H4ZA 3COSA 4KXYA 3C6XA 2D2FA 4DABA 1N6LA 4WXYB 3EXHB 3PTAA 3MINB 4LMAA 3ZX5A 4MWEA 4J0QA 2DM6A 4ZGWA 1R0KA 5DWDA 1E8DA 1OCEA 5LQRA 4AO8A 1ODSA 1FPQA 2J87A 1WBBA 1V43A 2UYCA 3PIRA 3UGJA 3KFVA 1ZK0A 4XB6B 1A71A 3T0FA 2VNSA 4E7PA 3RROA 2DUNA 2ZJOA 1FBTA 2UUPA 4LGVA 4Q4AA 5DHRA 3LT5A 3X1JA 1NJSA 1E58A 2C2XA 2GCPA 1RVDA 5HNKA 4JI2B 2E89A 2VTBB 1ODTC 2HBYA 2I3ZA 5D6NA 3RARA 5LC1A 3V00A 1P5FA 1R0LA 2X13A 4BHTA 3K1YA 4ZWNA 4Y30A 4TZ0A 3LQYA 2PKCA 3UJHA 1FNNA 3KOMA 3FUXA 3DLCA 3PUJA 1Q95A 3T7IA 5DISB 4NJEA 2YWXA 1X80B 5KTPA 2J5BA 1T9DA 3TGPA 4F2HA 1R00A 4P4NA 4CKBA 4J0HA 3AZPA 4I3GA 3ZD7A 2XDYA 1MC5A 4K9SA 5JUWA 4ZCTA 4F6RB 3JQ8A 4XLLA 3ZDFA 3FJYA 2ZSEA 4E1BA 2PD6A 4S1TA 3PQ7A 2HOQA 4UHJA 4AJKA 4F6LA 2QY6A 2AI3A 3CPSA 4RZXA 2I3GA 3AL3A 3BH0A 3ZWOA 2QRVB 2E18A 5SV2A 3WXBA 1WSAA