3TQCA

Structure of the pantothenate kinase (coaa) from coxiella burnetii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
309
structure length
303
Chain Sequence
ITPYLQFNRQQWGNLTLTESDLDKLQGQIEIVSLKEVTEIYLPLSRLLSFYVTARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKGFPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFSLFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKAADHSIQKVYLRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate kinase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
total genus 106
structure length 303
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqcA00
3NDPA 2VP5A 1E2MA 2J45A 2P5TB 4PHTA 1YU9A 5JSZB 1X86B 2OM2A 1NG9A 4P4UA 4B76A 4URWR 4EFMA 2QROA 2NO9A 2GXAA 3CWQA 1T8TA 3CH5A 4EJSB 4ACAA 1T3LA 4IOLA 1TU4A 2GZDA 2HV8A 3T1QA 4O2LA 1YR9A 3CR7A 2E9SA 3EA5A 2QPTA 4LPKA 5FH9A 4L16A 1Z6AA 2GESA 2I3BA 1V5WA 2QORA 3BBPA 3MMPA 2ZRNA 2MSCB 1MT0A 2X19A 2BMFA 3PEUA 3RWMB 4Q4JA 3A1UA 1VTKA 2J41A 2WOOA 3UMSA 1F2UA 4PAOA 4JBWA 1XTQA 2GJKA 1Z6YA 1XEFA 2C96A 3ZLJA 3PR1A 2WBLC 2DB3A 1I2MA 5JSZA 3NH6A 1IN5A 2GNOA 1GM5A 1EGAA 3B2EA 4EPYA 4KFTA 2QE7D 3QKSA 5E7JA 3RS2A 1U9IA 1Z0KA 4HATA 4IVQA 2C9CA 1K8RA 1J70A 5EE3A 4EJSA 5FOTA 1E9FA 1TX4B 2FPLA 4TL9A 4RY2A 4CEIB 2ZREA 4Z8XA 5L3QB 2ZVQX 2YC2C 5SZHB 2J5XA 3AF3A 3OHMA 4D0LB 4LYAA 4EIWA 2QAGB 1P9WA 3K70D 5AJYA 1W0JA 4QRHA 1QF9A 5TARA 3I5YA 2ONJA 1QHNA 3QXJA 3B1XA 4Q4AB 5CJPA 3MFYA 1JECA 2PBRA 5J4HA 1O3YA 2J7KA 3DPUA 4R98A 3QPUA 3MJRA 1P5ZB 1ZC4A 2FFHA 1YR8A 1G20E 4X8LA 3OEEA 3TW8B 1Z0DA 1SXJE 2YZ2A 4HDCA 5FOSA 1MOZA 4K46A 3UWOA 2OSBA 5JLJA 1OH6A 3WNBA 4D4LA 2VO1A 1ZM2A 4CEIA 5L3QA 3KUDA 1BH2A 2FFBA 3RS0A 1Z2CA 1CEEA 2IYVA 2QAGA 3ZYCA 4TLDA 3SYNA 2IK8A 1QHSA 4F4CA 3C41J 1M74A 2CE7A 2FZ4A 3CRW1 4M1MA 3HJNA 3DMDA 1KKMA 3EASA 4M9SA 4Q4AA 4RVCA 3UXMA 2J0QA 2V55B 3EX7C 3SFZA 1XTKA 4EKDA 1P2VA 2A2ZA 1RW4A 4M4SA 4AURA 4DSUA 1COWA 2PT5A 3GLHB 1FQJA 3U3KA 4TQUS 4Q7JB 5G40A 5IK2D 4JS0A 1L2TA 1OIWA 1R2QA 5DO9A 2G1JA 1EFTA 3CNNA 4AI6A 1W36D 2XXAB 4DUGA 4AYWA 2IBMA 3TSOA 2A5JA 3SZRA 2H92A 3DMNA 5FPSA 3RSOA 4DLXA 1ZW6A 4DDVA 2J0SA 4HAUA 1ZD9A 4FWTA 2YINC 5IT5A 2RCNA 3W34A 2QN6A 1CXZA 2CJWB 2ZR7A 1XCGB 1YR7A 2QRZA 3SS8A 3ZGXA 3OF5A 1RIFA 1E9EA 5BYKA 3V4RA 1CJKC 1E6CA 2IL1A 2XZOA 1KDPA 3QXCA 2G0NA 1QG4A 2GEDA 1OKKD 2YNMA 3FDIA 1OHHD 4ILEA 1YZGA 5DYIA 221PA 1AQYA 1EG7A 3CLVA 4Q9KA 1KGDA 5KSYA 4Q9JA 3GLHA 2CL0X 3QPWA 3T15A 5A4JA 2W2XA 1YRAA 4JSYA 1MRSA 4PHHA 1X8LA 3DO6A 4JKIA 5FBVB 3IBGA 3OIWA 4TTRA 4UXHA 3KQNA 3AVYA 4NP6A 2G9NA 2XXAA 3TQCA 4HDOB 2RMKA 2ONKA 1OXTA 4TLCA 1R4AA 3DZ8A 4TSFA 4KSBA 3T61A 4HLDA 1OSNA 2CJWA 4G5OA 1US8B 4A9AA 4TTQA 4U02A 4ZCMA 4GNKA 2CBZA 4M1SA 1DARA 2BMDA 4EPWA 2VSXA 3B1VA 1SVMA 1XMVA 4B73A 2R65A 4NCIA 4CRWB 3QY0A 3HPRA 3LD9A 2EFEB 2OILA 2VBCA 1CKEA 1SVOA 4PXAA 3QIAA 4N3NA 3T5GA 5FL7D 3RRNA 4BGDA 4A36A 1E1RD 3X1WA 1HTWA 2RHMA 1P3JA 2E1RA 2ZRGA 4TYWA 3U7EB 2CHVA 3U3MA 2FU5C 1NN1A 2XOKD 1QRAA 3QI2A 3K9LA 1JR6A 1SHZA 1YZUA 1KIMA 3EIHA 1TEXA 4C0KA 5TY0A 4GZLA 3AKCA 4MYUA 2JATA 1W2HA 2GRJA 2BEKA 2HDNB 2HYDA 5JJKA 1US8A 2JLRA 5BN5A 1F6BA 2B6HA 3PITA 3A36A 5UKDA 1NMZA 4YDSA 2ZSFA 2WKPA 1X3SA 3CB4A 1WQ1R 2WSSD 5TMPA 1T5LA 5C18A 1SVWA 5CM9C 3FKQA 2GJ8A 5JI2E 1GOTA 3GJ8A 2QQEA 3FKSA 3QF7A 5B57C 2WM9B 4GL2A 2J0VA 4ZO4A 1U9IC 4XVRA 3T06B 3THOA 1OH7A 1M7HA 4HAWA 1FFHA 3B7GA 1W1WA 4GT1A 4EJSC 5EP4A 1Z0AA 5G3YA 1QDEA 2BBWA 3Q5DA 1AZTA 2LKCA 3KXKA 4BFUA 3THYB 3WBKA 3NBZC 2RGEA 2G83A 5CIQA 1DELA 4JJKA 5DI9A 3R9IA 3BWDD 3WYAA 5ANRB 1D2EA 3DHWC 2ZM5A 1U90A 1E4YA 1JEEA 1E2EA 1Z08A 1WB9A 1QVRA 3QXSA 4IJMA 5DHFA 5BW8A 1AM4D 5E3HA 1IN6A 2ZI3A 1P60A 1MABB 3PVSA 4JLOA 2FPKA 3AF1A 1FUUA 2H17A 2JDIA 2REXB 1KK3A 4TMKA 2YJTD 3MGCA 1DE0A 1M6NA 2HJVA 2JCSA 3ADKA 4R7ZA 1UBCA 1OFIA 3HR8A 5EXTA 5FBLB 2OCAA 4DDTA 1WCV1 1PVOA 2KWIA 3CNOA 3VHXA 1CJMA 4GMXA 3A1VA 1D9XA 1QVAA 4RZUA 2B21A 4MQBA 4OI4A 4BQSA 1W47A 3BB4A 5CLQA 3CPHA 1ZM7A 2RGNC 5HR5A 3SI7A 3THYA 2GBLA 2ZSAA 1Z06A 4OQLA 3AEZA 3VR2A 5LBIA 3OIYA 3SU8A 4N0EA 2W6JD 4IOJA 1YRBA 3I92A 4G5SA 5AJXA 5FOVA 2TMKA 2PL3A 4LJ4A 3KQHA 4Q48A 3VKHA 4ZDKA 1MABA 2V1XA 1RVDA 2IXGA 1LVGA 4P3YA 1UEIA 4M2LA 1VDZA 2VSOA 4LOAA 4JL8A 4OHXA 1N25A 3BFVA 5F2EA 1S4QA 5EE1A 4EFNA 1S9HA 1N2CE 2FFAA 4KBFA 2ZE5A 3W9YA 1J2JA 4JLJA 5HPYB 1DAHA 2R6FA 2YWGA 5K8LA 3QF4B 4B2IA 1NBMA 3RLFA 2IYLD 2JJ2D 2IUTA 3I73A 1KJZA 4LX0A 1O87A 4E03A 1Z29A 1WBBA 2DWOA 1DS6A 4Q1BA 1R5BA 1OB2A 5FTMA 1G16A 5EZ6B 1BKDR 5H70A 3T1OA 4LHZA 2JJ8A 4FMCB 3MWLA 1EK0A 2Z4SA 1AS2A 3WRYC 2ZRFA 1K5GA 1II8B 2RGAA 5JRJA 2Q9CA 5FFMA 3U7HB 5LD2B 2KBFA 3ASZA 3UMFA 4DB2A 2B8TA 2VQSA 2V1UA 2L0XA 2A9KA 3NWJA 1OJLA 2FSIA 3GLGB 4JJZA 1IHUA 4M1YA 2FV8A 4H1VA 2REBA 3QKTA 3R7WA 1NLZA 1Z0FA 3LAWA 1IY2A 5FUWA 1QHHB 2DFLA 1CS4C 1SKYB 2ZIAA 4PC3A 5FPHA 4DSNA 5CDFE 3MLEA 3QF4A 1OYWA 4AKEA 4A0GA 1ZMXA 3AF0A 2WPDA 1XFAA 2IW3A 3RSLA 1TPZA 1KNXA 3BRWD 4U00A 3ADDA 4RKEA 1F48A 3C5CA 1R5NA 5JJIA 1AS0A 3IEUA 3OE7A 1T6NA 2C98A 3H86A 3IIKA 4L9SA 1UBFA 4B33A 1II8A 3AKEA 3BH7A 4IEIA 1XX6A 3CR8A 1XNJA 4LBWA 2A5YB 3DOFA 4LPSA 4DBLC 2VP6A 3F0TA 1X1RA 3GJ5A 3NDBB 3LX5A 1R8SA 2RAPA 2NQ2C 2WJVA 4MGKR 3GLGA 3V00A 4LBYA 3CKLA 1ZM3A 1IOZA 2EW1A 1G5PA 2ODWA 2VP4A 3LLMA 3LVRE 1Z6TA 2ZUDA 1IN4A 1QHHA 3DOEA 4OQMA 2YHSA 1XTRA 4DB4A 3G0HA 4OK3A 1FNMA 2Q21A 5IHPA 1W0KD 1RFLA 4EDHA 2A5DA 2DR3A 1EX6A 4D26A 3AVVA 4PPGA 1OH8A 1E9RA 2I4IA 4I81A 3TK1A 1XTSA 2VL7A 4HI0E 3ICEA 1KMHB 3I61A 2C03A 2OBNA 2UVQA 3KJHA 3ZIAA 4DLRA 3VNVA 1TQ6A 5JJLA 4K8OA 4BLSA 4I1VA 4DDWA 3BFKA 5DI3B 2WV9A 4BZQA 2QBYB 3GLIB 5SZJA 5E95A 2XB4A 4Z1MD 1NVXQ 1KJWA 4Q02A 4X8MA 3LBIA 3L43A 1OFUX 1S8FA 2ANCA 3CW2A 1U8ZA 5AUOB 2Z4RA 3P26A 4YC7A 1IM2A 3OAAD 3O8BA 4ESVA 1JAHA 5FI0B 4BLOA 2VHQA 3GCGA 4JLDA 4MRNA 4MA4A 4MDFA 4P4TA 4KXFB 2AD1A 1WDTA 4NDZA 4Y0AA 1HY3A 1XXHE 1ZM4A 4LJ5A 4V0ME 2P6NA 1OXUA 3MD0A 1GIAA 2F43B 3NTUA 3SJBA 2SHKA 4S35A 4S2EA 2EU8A 3VHLB 8OHMA 1KMHA 4US2R 3GLFE 4DSTA 4CEHB 2CCKA 4LV5B 4XVUA 3NC0C 3PENA 2ZRIA 5DI3A 4JLVA 2QBYA 1XJQA 2G1KA 1IJEA 2IF0A 4D82A 2OCPA 1UAAA 1U99A 2Z83A 1E94E 4B32A 4FCVA 2QY9A 2P6RA 1XCMA 4F92B 4DEXA 4AWXA 2NIPA 4V02A 1M34E 1NIJA 3VFDA 2O8DA 2X2EA 2IS6A 4ZI3A 4W5HA 4GP6A 1JAIA 1Y3AA 2OEPA 5G53C 3X1DA 1TF5A 3RANA 4IVRA 4Q66C 3PEYA 4PQRA 1M8PA 4RD0A 3CZQA 1DAFA 4LYJA 4F4IA 1M1YE 2F43A 3HU2A 3VMFA 3P27A 4RZ3A 4CEHA 1SXJB 3DVLA 2BCGY 4KFRA 1QBKC 2YOHA 4GI7A 2OFOA 4C0JA 2X2FA 3EZ7A 2G0TA 2HF8A 3KL4A 1UF9A 3TBKA 1DAMA 3W6NA 2RHDA 5JWRA 3ECCA 3BC1A 1CJUC 1DPFA 1YR6A 3KJEA 4BEBA 1JR3D 1W44A 2GVZC 4C0SA 3O47A 2IYXA 4QJ3A 3K0CA 3T34A 4C2TA 2FWRA 4WW0A 1Q3HA 1BMFD 3IO5A 3K9GA 1NVVR 3K0EA 3UG7A 2XJ4A 3FE2A 2XEXA 3HYRA 2FA9A 4IRUB 4L4UA 4XWKA 1SXJA 1XMIA 3CPJB 1W0JD 3GJ6A 4PC2A 3W90A 2GEVA 4UNPA 4U7DA 4XTRA 5E7MA 1CLUA 3QEJA 4M22A 1BYUA 1G3UA 2V7QA 2JLZA 1PLJA 4HB4A 3H1TA 4JMPA 4JL5A 1OXXK 1OB5A 2H5EA 3KKMA 3UMRA 4EPRA 1RRPA 3SHFA 5GJVC 2UKDA 4LBVA 4MYCA 2Q0HA 3MWKA 2O0JA 2IYYA 2PCLA 5FTNA 2IX3A 3OEED 2XTMA 1IN7A 3QUSA 5KPJA 1FOEB 1S3GA 4HDQB 1Q57A 2ZAMA 2WOJA 1P2UA 4TMXA 3X1ZA 1TF7A 5LDDC 3ZZ0A 2BM0A 4KU4A 4G5QA 4LYFA 3TH5A 4AY2A 1I4TD 1SQ5A 2Q6TA 1UJ2A 2JIZD 1KK0A 4PO8A 1KK2A 2ZAOA 3FMFA 5HTKA 2RGXA 3AVUA 2YC4C 3TAUA 3L0PA 2GDJA 1G8HA 5LD2C 2V54A 2DBYA 2Q9AA 4M9QA 1XP8A 4WOPA 2WIBA 3QVUA 3AV0B 3N2IA 3L0OA 4QJ5A 2J59A 2FF7A 5JCPA 1FZQA 3GPLA 2W6IA 2OFWA 4II7A 5EXPA 1UKEA 1E2PA 3SEAA 1MO4A 1FTSA 1G8YA 1DG1G 4D4JA 1VYVA 1NKSA 2GXSA 3K9HA 4AKHA 5JZVA 3LDAA 4DUGD 4ZCLA 2FG5A 4F91B 2P3SA 3CX7A 1E0JA 1MKYA 1F60A 4ITRC 3VU9B 1W5TA 2WTUA 1NY6A 4CT4B 3K0SA 4JVNA 5EUMA 3T1TA 1E2QA 2GJSA 5EZ5A 3GLGE 1G8PA 1SVIA 2CLCX 3AGQA 4G01B 521PA 5AJWA 3THWB 1SKYE 4Q01A 4QNMA 4R2IA 3FFBA 1NMYA 1AA9A 1AJEA 1MR3F 1WP9A 3EZ6A 2LWIA 1XEWX 2CVFA 1XCPA 4B48A 1GILA 2C5LA 5C2JB 4A6PA 1E2HA 3BORA 3VX4A 3TRFA 4QKQA 4DVGA 2DPXA 3KKPA 2BBOA 1JJVA 2GCOB 4YMUA 4TT3D 3VU9A 1CR1A 5JEDA 1IAQA 1Z83A 4D2IA 2DCUA 1RRFA 1LY1A 1IN8A 4L15A 1HV8A 2ZYTX 1NG1A 4Q1CA 1ESNA 3JZMA 1AS3A 1CJTC 3THWA 1U0LA 3GJXC 4JLPA 4WZAE 5KNBA 5BXQC 3ND8A 4RZXA 2GAOA 4M9ZA 1Q1EA 1E3MA 3VX3A 4QBGB 1ZUNB 4JSTA 4NYIR 4Q4HB 4YONB 1IXRC 3LA6A 2IA5A 4QGAA 4J0QA 5DLQC 3GLIE 4ZDIA 4MUAA 2GCOA 1WA5A 2NZ8A 1DAEA 1KI7A 2XNDA 4RCYA 1FX0B 2C99A 3BH0A 5JHGB 2XZLA 1L4UA 2R8RA 2JJ1D 1ANKA 2N1BA 4BFTA 4JYBA 5C1BA 4QFMA 2GK6A 1N5KA 2GCPA 1DBSA 3KQLA 2ZRMA 2A5GA 2OCYC 2D7DA 4Q1AA 3F5FA 5AJVB 5KHOC 1W49A 1ZU4A 5FI1B 4I1UA 2IF2A 3FKSD 1TNDA 2WWWA 2A5FA 1J8YF 1XD2B 2PLRA 1NNEA 4UNSA 4A6XA 1JALA 5FBRB 3BB1A 2VEDA 1XPUA 3MWYW 3SQXA 4I1SA 4YDHB 3K0CC 4KLNA 1N6IA 1OFHA 4OHVA 2ODNA 4Q4HA 2CVHA 3K0FB 3QENA 4B43A 1A2BA 2MMGA 3EG5A 1AIPA 2QMEA 1M7GA 4AKIA 2V9PA 1RE0A 1SXJC 2XSZA 4NBSA 2JLQA 3RS5A 1TEVA 3BD9A 4EPTA 1FX0A 4KCGA 1UM8A 2ODBA 2ZRBA 4A8JB 2LCFA 1KKLA 4ACBA 4QXAA 4DIEA 2VF8A 2OXCA 3ZS8A 4E09A 4NCHA 2VH5R 1NN3A 2JDID 2J7PA 1DG3A 2EQBA 1T5IA 1EESA 3WXMA 3T5DA 4BFSA 1XD2A 2ORIA 4LGMA 4LZZA 4QHYA 4WAUA 5J4LA 3BJIC 1Q44A 3PV0A 2GETA 3FTQA 2EFDB 1RYFA 1OPXA 4Q1EA 4Q1DA 5TB5A 2VRWA 2ZUBA 2WJJA 3HR7A 1UFQA 3R8CA 3IEVA 2WHXA 4I99A 2G3YA 1M2OB 3CBQA 3DDCA 4FD2A 1KI1A 3RDPA 2C9YA 1IY0A 1U2RA 4DCNA 1VIAA 1IY1A 2IYQA 4A8JA 4BLPA 1AKEA 4C9BA 2XGJA 4DRZA 4PR0A 1G7TA 4DDUA 1IONA 2ORWA 1EWRA 1KO8A 5FOUA 1HE1C 3U4QB 4B6EA 5LPNA 1G4UR 2VPPA 5C4GB 4LHXA 3IKJA 3GJ4A 5G41A 4BRUA 3VR3A 3W6PA 3MUFA 1NBMD 4BFWA 3EWAA 1RYHA 1JNYA 1GRNA 2DFNA 2WWYA 1WMSA 3AH8A 3RAPR 5FUYA 1Z22A 3TR0A 4LJ9A 1DO0A 2GAAA 2Z43A 1NY5A 3HU3A 5CDFA 1UKYA 1IXSB 5FR1A 4AK9A 4B71A 4C4PA 3P1JA 2GILA 4YQFA 3QBTA 3U4QA 1R5OA 4ASUA 1E9CA 3U7GA 2ZJ5A 2A78A 2RGDA 2VHUA 2HUPA 1SULA 1GL7A 4QNRA 2ERYA 2QGZA 1G7SA 2F6RA 4NZYA 4OYHA 4CW7A 3LNCA 4DLZA 5HKKA 1PUIA 4WXPA 3ZVLA 5FOWA 1HURA 4C2UA 2PX0A 1KK1A 2FSGA 1JQJC 4DIDA 5GJBA 2Q3MA 2ZRKA 2ZU0C 4JLAA 5L3RA 2OCBA 5CYPA 2ZYVX 1DOAA 4CZ2A 4G1UC 1GDDA 4BRWA 4PO1A 5H68A 2QPOA 2R6GA 5EE9A 4JT2A 4MKIA 4URVR 1NLYA 4Q1FA 3IPYA 1C9KA 2R6DA 2ZYUX 1E1QA 2OAP1 4FI3C 1E9SA 1XXHB 5J40A 4X8HA 2YYZA 2C04A 2W0MA 3PXGA 2XAUA 5KDDA 3OZXA 2FH5B 1TUEA 2YWEA 3KKOA 1YJ5A 2OLKA 3GLFB 4OI0A 1MH1A 2ATVA 2AFIE 5EP1A 2ZI9A 2QGNA 3EPKA 2IWHA 1ZCAA 4O2RA 4Z54A 4US1R 5KSZA 1Y63A 3G82C 4PANA 2QQ0A 1SHKA 3IQXA 1P75A 4JBYA 1S96A 3T35A 2WZQA 4AYTA 2ZI6A 3EPJA 2RGCA 2BEJA 4BFZA 4FCTA 4MYHA 3VR5A 4XOIA 2EFGA 1FMJA 4PC6A 1QHXA 5FBWB 3TIFA 3Q85A 5DGXA 3IIJA 2XX3A 4ZI2A 1ELOA 4BFXA 3FGNA 1ZNXA 1G17A 1UPTA 1XXHA 4V0MA 2CL7X 2WWIA 2W00A 4FMDF 3GLFA 2GXUA 1OW3B 2IUSA 2X77A 4IDOA 5C4MA 5L3VA 1LF5A 3KUCA 1KZ7B 2DY1A 4Q18A 4WVFA 4FCWA 1CULC 4G3XA 2ZE6A 3WNCA 4FN5A 1AGRA 4OK6A 1A2KC 3OIVA 4D80A 4IFEA 1T0HB 3FMPB 3IGFA 2GEUA 4P31A 4QGGA 3K70B 3FMIA 4PFSA 3BOSA 2ZJ2A 1JI0A 1U0HC 4MKGA 5FBQB 1KI9A 3EC2A 2JLWA 3U3JA 1X6VA 2ANBA 5HCIA 4RFSB 5J5CA 4US0R 1CU1A 1DADA 1F2TB 2JEOA 4G0NA 5F3WB 4FW9A 2QSZA 4W7SA 4TWZA 3B1WA 1KI2A 3UWKA 1HH4A 1KDOA 3SNHA 3LH5A 3ADCA 1DO2A 4GSYA 3CRRA 1TTTA 2PLFA 3CIOA 1E2IA 4KHZA 2C78A 3PUZA 4YMTA 4HB0A 1FTNA 4PQYA 1NSTA 3EXAA 4XWAA 4IXMA 4X8OA 3I1FA 2ZANA 4V03A 3CZPA 4XIGS 2IT1A 4KLZA 1NJGA 2CEAA 4YMVA 2NPFA 1G8GA 3SQWA 4DCUA 5KNCA 4XVQA 4BUJA 1XD9A 2QAGC 3ASYA 3QG1A 4Q9IA 3D3QA 3V9PA 4A8JC 4CYMA 3MG9A 4UNRA 3QJYA 4MRRA 4RFSA 2FSHA 2D06A 1YZQA 1KO4A 1CTQA 1ETUA 1F2TA 3BS4A 1TQ4A 1E2LA 3FYHA 4Q7MB 4RKFA 5F9HA 3C15C 3D7MA 3EIQA 4LJ7A 4IHQA 3NHBA 3WRXC 2CNWA 2C2HA 4RD2A 4HEJA 5CB8A 2P0EA 2QU8A 1P2TA 3E70C 1E2DA 1OXVA 4POAA 4FMBB 3IO3A 3SYLA 2GTPA 4ZDJA 1W36B 4HUTA 3H4MA 4WA7A 3MCAA 2FE4A 4OJKA 1NVVQ 5DH9A 3BK7A 1LNZA 1ZRHA 2OO7A 2V6IA 4LRWA 4GOXA 5J4KA 3R9XA 2OBMA 5EJEA 5BN4A 1B23P 4RZ2A 2HT1A 4F93B 2GJ9A 1ZNZA 2AR7A 2P65A 1H8HA 4NTZA 5J4YA 2HLDD 1R0XA 3IILA 4HAYA 1SVKA 2XJ9A 4DCTA 4UXJA 4PHGA 2BHRA 1GKIA 5KSPA 2CE2X 1QHGA 3CONA 4A0FA 5DISB 3DKVA 3CPEA 4W5WA 1JEDA 3LV8A 4NCKA 2PH1A 2GA8A 2R44A 2V7QD 2WIAA 4OK5A 3I3SR 4LSGA 2H8KA 2JA1A 3I4LA 3LY5A 1JPNA 2ERXA 2B7BA 4I1OA 1Z47A 4MUBA 3U60B 2ZI7A 3EWSA 1OT3A 4DCVA 4NYMR 2QZ4A 2QAJA 2JLVA 2R62A 5TVKA 3HPQA 4JLNA 3KJIA 2XB2A 2D7CA 2GK7A 2J3EA 3ZH9B 3A1WA 4OQNA 2VTKA 4EFLA 1XJ0A 1GNRA 1HYQA 1NMXA 1KMQA 3C8UA 1KOFA 1OKKA 3AP3A 3B9QA 1OHHA 1FMLA 1DTSA 3Q8XB 4NCNA 4Q03A 5B2ZA 3GJ0A 1CF4A 4ZIRB 3SJAA 1U8AA 2NPIA 4C0QC 2IXFA 1JXMA 1R0ZA 4KFSA 1RPZA 4DLVA 3ZS9A 2GHIA 4Q00A 3WMFA 2VLIA 2BCJQ 2C95A 4LJ6A 2QMUA 4M53A 1VG0B 2QP9X 4Q4LA 3M0EA 4LC1A 1VMAA 2QL6A 2RB4A 4JKYA 4NE2A 1Z6GA 3C14C 1S1MA 1RC8A 5AK0A 4D6PA 2ZSEA 2WWGA 4QBHA 2OXRA 4EPVA 3F3YA 1XMJA 2HEIA 4NYJR 4TL7A 4DLWA 4GOJA 3PJRA 4AKGA 4CT5A 1AGPA 2ZI4A 2GZAA 4PQFA 3IHWA 4PZLA 1E9BA 4M1TA 4TTPA 4AIIA 1VHLA 3EARA 3X1XA 4DLSA 4TMWA 1FW6A 1ZUHA 3NKVA 1E1RA 2D3WA 2ZU6A 4ZIRA 1KI8A 3FHCB 1Q3TA 3AKDA 1C1YA 4LJ8A 1E2GA 3B1YA 1W4AA 3DM9B 3IQWA 3K0AB 3MWJA 4HAVA 4NL4H 3RNLA 1ZCBA 4F38A 1F3OA 3CH4B 2O0KA 4QHSA 2FN4A 2ODEA 4UNNA 3LO5A 5LB4A 4HLUA 3KKQA 2WJYA 3BIFA 3FWYA 4KAXA 1GKYA 2ZR9A 2KSQA 4O25A 3RRYA 4EQ6B 1CP2A 2VSFA 4TQAA 4NMMA 2O8CB 1W4CA 3IHLA 3UKDA 2A3RA 4TL6A 2WSSA 4IDPA 3KXIA 3WHLA 1G41A 3UIEA 1Q22A 4A0HA 3DM5A 2NO6A 4W5JA 1V43A 3GLIA 5P21A 1R10A 2YVUA 2NGRA 1SGWA 3REFA 3K0AA 4R71A 2BKEA 3HWSA 4BZPA 1KY3A 4JLBA 4P32A 3Q9LA 5AUPB 3WHKA 4TZ6A 4URYR 4NYIQ 1JBKA 3GEIA 4PZYA 2W2TA 3VKWA 2VA8A 2YWHA 4IDHA 2K5UA 1Q1QA 4TL8A 1FP7A 1G18A 3WBJA 3KQKA 3U5ZB 1XMSA 2BDTA 2GBLC 1UKVY 1VCOA 2BBSA 3AVTA 1KYIA 3FPAA 5IDVA 1CRPA 1G9XA 3VQTA 4B3CA 2DYKA 1A82A 3CM0A 3KFXA 3Q72A 4EQ6A 1C4OA 4Q9HA 1Z6XA 2OT3B 5GJCA 3TGPA 2O8CA 2WVJA 3ZD7A 4MRPA 2AWNA 2OUKA 4QGHA 1J7KA 4IVPA 3TSZA 3PUXA 1ZD8A 4KODA 2BJVA 2QP3A 1DVRA 2CLDX 1QHIA 2F9LA 2GXQA 2J0UB 821PA 4KO8A 4JLKA 4ESHA 2FEOA 2XNSA 3L0SA 2C8VA 4WXRA 3TR5A 4A0RA 4B75A 2IS2A 1ZIPA 4TMZA 2NMVA 3OFNA 3D31A 4RD1A 4HB2A 4LBZA 3KB1A 1Q21A 4PSKA 2OV2A 3P32A 2DWQA 3CX8A 4ON9A 2QP4A 3WP0A 1E0KA 2KJQA 2W6JA 5TDHA 1HQCA 1N6KA 4M9XA 4K81B 2F1RA 2IUUA 3M1IA 3B1ZA 3HU1A 3U2QA 2XSZD 4HAXA 2PMDA 3EZFA 3A4LA 1H8EA 3AP2A 3CF0A 3GD7A 1T0JB 3ZVNA 1A1VA 1PUJA 1YQTA 1DAKA 3QKRB 2W0SA 3MJHA 1W2GA 1D9ZA 3DZDA 3A37A 4KSCA 1ZM9A 2J0UA 2J7PD 3OEHA 1X8JA 2ZJBA 4RD6A 2DHRA 4R9UC 1N0VC 3CUEF 1W4RA 3E5HA 1D8TA 1ESMA 4DC9A 2OHFA 1XWIA 2EVWX 1ZU5A 2J1LA 2MMCA 1IQPA 4DWJA 1DEKA 2IYTA 2VP9A 5EXXA 2GKSA 4JZKA 1W4BA 4D4KA 2FNAA 2P5SA 2OLJA 3FOZA 4B2PA 1B0UA 1JQLB 3L8YA 1CR4A 3JVUA 1HE8B 3H2YA 1GUAA 3M4YA 1OE0A 2AK3A 4MITA 4BFVA 4MDEA 4C0LA 3IIMA 4GBMA 5DNYB 4E07A 1OLOA 2EFCB 1OYYA 1Z63A 3TAHA 3GJ7A 2PZFA 5KPDA 4LHYA 1OIVA 3QKRA 3IUYA 721PA 5TV2A 3VNUA 2D2EA 4V0NA 2DFTA 1Q1ZA 1EFHA 1JB1A 1LTQA 4GZMA 4D0GA 3U7FB 1G19A 2AXNA 1KJYA 4DLYA 4TLAA 1YZLA 4QOSA 3PIRA 4OJQA 1COWD 4RSGA 4XSHA 1SVLA 3IBYA 3RS3A 3ND9A 1VECA 3EZ2A 3NG1A 3S1AB 5EUQB 2E87A 1XF9A 1RRGA 2F9MA 3C7KA 3GEEA 3LWNA 4HB3A 4OI1A 121PA 3MRSA 1QHYA 4A4DA 3NHAA 3TLXA 2MSEB 3MAAC 3KXLA 5EP3A 3C4JA 4DT1B 2GVDC 4BWYA 5GADl 3DKPA 1G3QA 2VYFA 3MSXA 3ZQ6A 1S2MA 2Z6VA 1BS1A 4D25A 3VAAA 1Q12A 4Q7LA 2WKRA 3J81k 4HLQB 4LV6A 2O8EB 1L8QA 1Q1BA 5AR1A 2PJZA 4LY6A 2ZQ5A 2V3CC 3GJ3A 5GVSA 4ASUD 3NXSA 4AG5A 4DSOA 1NVUQ 5KTYA 4KV9A 4LUCA 3KFVA 4UJ5A 5SZKB 3GQBA 3NH9A 1TL7C 1LV7A 5DIFA 1GSIA 2D62A 5HKKD 3S1AA 5BYJA 2HXSA 3SDZA 2CK3A 2DFKB 4B34A 1TADA 1KO7A 1LS6A 1TF2A 2VHTA 4XJXA 1D2NA 2KBEA 4QM6A 1RRCA 4OHWA 5HE9A 1DAGA 1GFIA 3AVOA 3FHOA 4Z1MA 1G64A 5K8UA 4DT1A 4TSFD 5DSZA 4MGIR 1E1QD 1G3MA 4FMCF 4TZ0A 2PT7A 3NEJA 2O8EA 2VP2A 3B8HA 3OAAA 3TUJC 2GF9A 3LQQA 4U5XA 4WBSA 4G5GA 3SYKA 2IHBA 3I8SA 2RH5A 4H1UA 1NIPA 2QTVB 4RJLA 1W48A 4NCJA 2ZUCA 4ZCIA 3V4FA 1EFCA 2FZLA 2GJAA 2JAQA 3RVBA 3NBXX 2AX4A 2N42A 3BAFA 5JWHA 2WWXA 4TYYA 1TQ2A 3AGPA 5ELXA 4C0HA 2IYRA 3U3RA 1ZIOA 1JPJA 1KDRA 3TW4A 4L5BA 4V0LA 1VCMA 3U3OA 2FGKA 3LW8A 2B8WA 2PX3A 2HXYA 1E2FA 3NVAA 1E79A 1GAJA 3NEYA 4QC2A 1XB2A 1VG8A 4EPXA 1T8UA 2YV5A 4BLQA 1WE2A 3PUVA 2FPMA 3T1VA 3W6OA 2AL7A 1Q0UA 5KDOA 2VP0A 1ZD1A 5H1YA 3QKSB 3SHWA 2EYQA 4O0MA 2ZRPA 2F1IA 3Q7PA 3CF6R 3TKLA 3QSYA 4KVGA 1UEJA 1G1MA 3ONWA 4Q47A 5F9FA 3QNUA 2W2VA 2R6AA 1FQKA 2XITA 4LHWA 2J46A 4IW3B 3RC3A 5JEEA 2P67A 5JFGA 1P7CA 2PEYA 4H9GA 4KYUA 1BYIA 4YLGA 4KFUA 1YKSA 2CMKA 1TU3A 3I32A 5EXSA 4DKXA 3U6KA 4HSEA 2JLYA 1AN0A 1G6OA 2A30A 2ECKA 1KI4A 3OESA 5CM8B 4BE7B 1BOFA 4KI0A 2QNRA 3WY9A 1LW7A 1X8KA 4JYCA 2REOA 3NBYC 2GF0A 4UXIA 2C9OA 1H65A 2G6BA 4IDQA 5FPYA 2P2LA 4KITB 1Z0JA 2Z0MA 3AKYA 1JR3A 2HJGA 1E96A 1FNNA 2ZJOA 5FTLA 1Z5ZA 3B60A 1UDWA 4AYXA 2ZSDA 3TUZC 3F8TA 1KSFX 1GRQA 1BMFA 1OXSC 2OZEA 1XZPA 3TQFA 1CBUA 4BASA 1G4AE 3LQRA 1N6NA 2A7QA 4MKHA 3UG6A 1TQDA 3TE6A 3K0FA 5DN6A 1A7JA 4DLUA 4ZV4A 5IF9A 1VCIA 2BOVA 5EQTA 1NF3A 4A2PA 3O8RA 2LKDA 3LRPA 4F7WA 1NKTA 4PAMA 3WMGA 1R0WA 1MO6A 4QBFA 3G5UA 5DYGA 4L9WA 2ZS8A 4OKSA 1VHTA 3A4MA 2BC9A 2QMHA 4A92A 1GITA 1EFRA 2HYIC 2CNWD 3HP1A 3AVQA 3QPVA 1T3HA 2ZR0A 4IKEA 2J9RA 4PPNA 2XTNA 4FIDA 4KJZA 4TN1A 5CLLA 4PC1A 2RGNA 2HT6A 3TMKA 1E2JA 3L0IB 2ZROA 2CHQA 2JIZA 4WZBE 2JLSA 2H1LA 1GKUB 1H8HD 5CJ2A 1L4YA 1W46A 4PPQA 4LJAA 1P6XA 3W5IA 1NL3A 4B74A 5JWOA 4Q9LA 1EWQA 3LXRA 4JVMA 2Z5FA 4XD7A 5FR2A 1ODFA 4P4SB 4JVSB 5KDLA 5JS8A 1T91A 1KI3A 4HYYA 1GZSA 1XJCA 3ZD6A 1YVDA 4B3GA 4NPHA 2WWFA 3Q7QA 2EYUA 4IOMA 4NYMQ 1OIXA 1PZNA 4B3XA 1AKYA 4A15A 1G21E 1CR0A 2ZRDA 2ZJZA 5L8VA 5J47A 3AVWA 1BO6A 3PQCA 5M04A 1XRJA 4EAQA 4N0DA 4RFVA 3VKGA 3T12A 2F3RA 3EPLA 2IC5A 1XBTA 2AD5A 1GL6A 1VYUA 2I1QA 1SKQA 3BERA 3TUIC 4DHEA 5AUNB 4A2WA 3ZVMA 1N6RA 1XEXB 1KAGA 1R7RA 2BJWA 4IFBA 1E69A 2WPDD 1ZP6A 3ZQJA 1E2NA 2VIIA 3CF2A 2QT1A 4M21A 1CRQA 4P4SA 4YMWA 4O3MA 4QG7A 4L8GA 3PEWA 3KZ1E 5C46F 3PFIA 1NRJB 5GVRA 3OE7D 1HT1E 1P61B 3JZAA 5FOXA 1BIFA 3FVQA 2W83A 3B13B 3WYFA 4B3BA 5AUQA 1Z8FA 1IJFA 4IOKA 5HZHA 2PEZA 2GZHA 1KSHA 2BKUA 3X1YA 4YXWA 3RRMA 1R8QA 2FX3A 5JECA 5JHHB 2IEYA 4UKDA 3CWZA 3RHFA 2ORVA 1Z0IA 1ZBDA 2G88A 4NYJQ 2F1JA 4PTLA 4C0AC 4TT3A 4D81A 2B7CA 1XEXA 4MRSA 2IYWA 1RKBA 4PSVA 4GOKA 4ERNA 3RYTC 3NC1C 5KO2A 3FMOB 4M1OA 3L82B 3ZIAD 3FFAA 3ZZUA 3AUYA 3D8BA 3KJGA 1CR2A 2QENA 2VHJA 2ZRJA 4LJYA 5CYOA 1A5TA 1P9RA 2V6JA 3H84A 4OI2A 4LV8B 1II9A 1M7BA 1N6PA 4DCSA 1JJ7A 1LB1B 1KZGB 4MGYR 4BEJA 3TVTA 3N5CA 2PJRA 2KB0A 4TYNA 3THXB 4M1WA 4NKRA 4LHVA 2NG1A 621PA 4PSAA 2IHYA 4DZZA 4JBXA 4AD8A 2ZXUA 5KNDA 4I4LA 4LC0A 3WYGA 2OESA 1UADA 3R9WA 4FWIB 1E98A 4CIDA 2H57A 4IDNA 1MO5A 4Q5IA 4M8NE 3I62A 1GRRA 3CNLA 2JJ1A 3E2IA 3L8ZA 2WSMA 4CEJB 2O8BB 1NSFA 3LFUA 2OFXA 2V8OA 3B85A 3CRQA 3U44B 1XPOA 2QPAA 4TMVA 3FHTA 1EFUA 4P33A 4C3ZA 1KSJA 4RCZA 1UKZA 1WBDA 3GEHA 3ZDQA 1EX7A 3EAQA 5KUTA 5JRZA 1XD8A 2BVNA 2QT0A 4AC9A 2QA5A 1MV5A 2QE7A 3CRVA 1I4LD 5IRCD 2QM7A 4B2LA 4BLTA 3THXA 2QTFA 1RZ3A 5D3MB 3K53A 2KE5A 5KSOA 3W8RA 2QMOA 4XSGA 4BFYA 1G5TA 1P73A 3W3ZB 1WF3A 3KTAB 2AK2A 2H18A 2NO1A 2FGJA 1ZNWA 4KVAA 4MRVA 2AN9A 1GL9B 2FSFA 2ZRCA 3REGA 3O8CA 3DL0A 1GWNA 3Q3JB 3VR4A 2W58A 1FUKA 2BBTA 3KQUA 4CEJA 1RJ9B 3C16C 1K5DA 2O8BA 1E0AA 3BH6A 2ZVPX 4G5RA 5D3QA 5KU1A 2AXPA 1JR3E 3U44A 2ZETA 3ZJYA 2CLSA 2BMEA 2ZSBA 2Q3FA 4M1KA 3ZVRA 3RC8A 1OF1A 1P62B 2WJIA 4GPTA 3B9PA 5FTKA 4WZ6A 3C5HA 2C77A 4TLEA 3EPHA 1ZUIA 2QI9C 3KKNA 3K8YA 3W8NA 3EZ9A 5BQ5A 1KTVA 1NP6A 2RGGA 5HE8A 5LB2A 4BECA 1OFTA 3VTKA 5DE3A 3OFND 5D3MA 3PUWA 2ZTSA 3KTAA 4HAZA 4Q7KA 4BZXA 1XTIA 3TNFA 2F1HA 1HT2E 4NONA 3UATA 3N70A 1LF0A 4TMTA 5E4FA 2O52A 2ZPTX 3RWOA 1RJ9A 3NBFA 1U98A 1H8ED 3CX6A 3K09A 1UDXA 3GMTA 1SXJD 2WKQA 1CIPA 1NI3A 4LI0A 3PG5A 3NIBA 4MGZR 1WRBA 3OEHD 3W3AA 3R7WB 3TJZA 4GP7A 1N5LA 4KYIB 5IK2A 3UANA 2ZS7A 4PPFA 2IEZA 4URUR 4QHTA 2NTYC 2OG2A 1E2KA 2V4ZA 3B6EA 1UBGA 1KNQA 1P2SA 3SBDA 3IDQA 4GRAA 4XH9B 3N2EA 5AJZA 2YOGA 1OV4A 3SN6A 3H0KA 1NVWQ 1P72A 3QBVA 2UZIR 3P20A 3Q5EA 4NHOA 1HUQA 4NH0A 4GMDA 3UK6A 3P4YA 5CB6A 1QG2A 2WAXA 2ZEJA 1KDTA 4GDFA 2QRNA 3AP1A 4P0TA 1NN5A 3AF2A 3EC1A 2IYSA 2JGNA 1NLFA 2MSDB 3LBNA 3AVXA 1PV4A 3QG5A 1PJRA 3EA0A 3U6BA 2BWJA 2ZJAA 2P6UA 3EIEA 2RGBA 4M0LA 2CHGA 4B6FA 2BIFA 3RABA 1KSGA 3PCRB 1G6HA 2W6ID 5SZIA 2JASA 4PX9A 2Q9BA 3O8DA 5FUXA 5A5GA 2CDNA 2PZGA 3KB2A 2Y8EA 3GP8A 2ATXA 4ZDWA 2WJHA 1G5RA 1I2DA 4V0OA 1SVSA 1XTJA 2EWWA 3GLHE 2PZEA 2DWPA 5DHAA 2OAQ1 1J90A 1EXMA 1U94A 3B5JA 1FL9A 3ETLA 5B58C 1PLLA 3RRZA 2ZYWX 1G291 3I5XA 3VR1A 2O5VA 5CK4A 4ZKDA 5FL7A 3SJCA 3OIUA 2RKOA 5F98A 4ZKEA 1T9HA 4LWZA 5HCNA 4B3DA 4Q21A 4D0NA 2F55A 2NOAA 3AF4A 1ZAKA 1E0SA 2XOKA 5K8TA 2FFQA 2FEMA 4ZPXA 1VIYA 2AHOA 3RS7A 5JBQA 4RD3A 3AUXA 1GTVA 5TXGA 6Q21A 3EW9A 1N0WA 4V0KA 2CK3D 1KAOA 4Q19A 5CITA 2X1VA 1ONBA 3VR6A 3LX8A 3BE4A 1G3IA 1UBEA 5CIWA 2IWRA 2D74A 1W7AA 2F7SA 1GP2A 1L7VC 1G3RA 2WICA 4IEEA 4KBGA 4Z8YA 1T3SA 5K8IA 2CCGA 5EE0A 1ZNYA 3SC3A 2R2AA 2O8DB 3WNDA 1HA3A 3RS4A 1MRNA 3PEVA 2D2FA 2QM8A 1KO5A 2EFHB 4B35A 2B92A 4JL6A 4RD4A 1G7RA 2WAYA 1LFDB 4DEYA 1DAIA 1ZJ6A 5JCZA 1YZTA 1PLKA 5H8WA 3ICQB 3K70C 4UJ3A 1U81A 2AKAB 1NN0A 5BWMA 1LS1A 1KY2A 2IYUA 1GNQA 3BB3A 4DJTA 5E7IA 1GNPA 3I72A 2XNDD 1E79D 2IYZA 2QSYA 4D4MA 4F4JA 1AK2A 4TYPA 3LXXA 4W9MC 2AKYA 4MH0R 3HYTA 3SOPA 3QKUA 3QOFA 3AB3A 4C30A 1XDBA 3P4XA 1TMKA 2QTHA 4DXAA 1E9DA 1Z28A 3QXXA 1OH5A 5FPKA 1P4SA 2NZJA 1N5JA 1KO1A 1S9DA 2UZ3A 4GFDA 5GJWC 4AG6A 1I4DD 3DEFA 2R6CA 4OL0A 2ZRHA 1S1CA 1N6OA 2FJUA 2IXEA 1KHTA 4BLRA 4FXPA 3QQ5A 3PUYA 4QGFA 4ARZB 1SZPA 5CK5A 1VCNA 2HCJB 1CJVC 1QZXA 2PCJA 2WMOB 4C7OB 1II0A 2XTZA 1R6BX 3A1SA 3LVQE 2FOLA 1XU4A 4XTCS 3E1SA 4B44A 1R0YA 3K09C 3BGWA 2GCNA 3WP1B 5B30A 4E22A 4CF7A 3D6TB 1A4RA 1KI6B 3QE0A 3SBEA 1XPRA 1P9NA 4A2QA 3SR0A 1W5SA 1U8YA 3SE0A 4WIAA 1J99A 4OHZA 3UPUA 3U61B 1D6JA 4PAQA 1Q20A 3AM1A 3I8XA 2QEQA 4CDGA 5EP2A 3M6AA 3R8FA 1W36C 3QVVA 4UNQA 4R2HA 1VPLA 3SFVA 5J4VA 2WMNB 4LYHA 5G3ZA 2JJ2A 5B64A 1Z2AA 2ZS9A 4ARZA 5KOYA 2HLDA 1ZC3A 2VF7A 4LCBA 1D2MA 1VYTA 1YHNA 2AWOA 2ASEA 4C7OA 3ZZTA 5DN6D 4OQFA 4OQXA 4A1FA 5FL3A 3TVDA 2XZPA 1NJFA 2D4HA 1GG2A 2VHCA 2WJGA 2CXXA 1TUIA 3R20A 4JVLA 5HZKA 3AVPA 2IS4A 4QM7A 1KI6A 2YOFA 1NBME 2QUZA 1N0UA 1WXQA 1N6LA 1E99A 4EUNA 4URXR 2Q3HA 1EFRD 2QG6A 1FPMA 2H16A 2ZJYA 4FINA 4LK2A 1N3BA 3QEOA 4IXNA 3A6PC 3IPXA 1IBRA 1IXZA 2BM1A 1N5IA 2HF9A 4ABYA 1AQUA 1D5CA 3K9NA 4Z51A 1S0UA 2PMKA 1G7CA 2ZRAA 4PC7A 2R9VA 2ZITA 2NO7A 2CL6X 1XZQA 2OBLA 3LBHA 4JIMA 4PZZA 1X1SA 2ZE7A 3A58B 3L2OB 4QBIA 4TQ9A 3K1JA 1FP6A 5JMTA 4HLCA 1G8FA 2X8AA 2FMXA 2IS1A 3BXZA 4XD7D 1XEWY 1ZVQA 4Y0VA 3X2SA 5A0FA 1E32A 4FMDB 2GWHA 3LLUA 1AZSC 4N1AA 1K6MA 3B78A 5L3SB 2AFHE 1HQYE 4TYQA 2YWFA 4HZUB 5FUVA 3WMEA 5BN3A 3A1TA 1F5NA 4MYTA 3CRMA 1YZKA 1ZINA 2FDCA 3HDTA 1ZYUA 2HCBA 2G77B 1YE8A 2O8FB 5FTJA 4XWOA 4HUQB 1TAGA 2BMJA 2NO0A 1W0KA 4HLUC 4DLTA 2JLUA 4CGZA 2BV3A 1Z3IX 3GFPA 2ZJ8A 4OBEA 4TLBA 3TSWA 2EWVA 5EE5B 2O0HA 4UQOA 4OHYA 4PHFA 1VKJA 1JXOA 1E9AA 4YMSA 1T4GA 3GFTA 5JS7A 1YZNA 3FB4A 4JLMA 4JT4A 2ZRLA 1J8MF 4PO9A 2KI5A 1Z07A 5JI3E 3CO5A 4B3FX 1VG1A 2I1VB 1S3SA 5AWFC 3ADBA 4NU0A 3QXHA 5L3SA 3W5JA 4LDJA 2N46A 421PA 5KYKA 4HZIA 4HZUA 2OE2A 2WWHA 2JLXA 3LW7A 4YXWD 3SJZA 2ZE8A 3KX2A 4CVNA 3JVVA 4QL3A 2O8FA 2ZI5A 3AQ4A 4MKFA 4HUQA 1E4VA 4C0BA 2CCJA 3B82A 5FPTA 3BFXA 4B47A 3GFOA 1N6HA 4QJ4A 4E5UA 2J87A 1MO3A 1U0JA 3A4NA 4Q4JB 1VG9B 2YKGA 1F2UB 3A8TA 4URZR 1HEIA 2F3TA 3KDSE 4A82A 4BPBA 1GVNB 2H7VA
chains in the Genus database with same CATH superfamily
1AUQA 1MX9A 1XZGA 1PYDA 2VP5A 3H3XA 2VHYA 1Y3CE 1TMYA 1X86B 5CEEA 4O1MA 3IBTA 3RRJA 1A50B 2JGJA 4EFMA 3ORSA 3AINA 3ABIA 4RF5A 1XN1A 1S01A 3O9MA 1EDBA 3K2EA 1Z56C 4EJSB 4D4IA 2ZDGA 3CLSD 4IOLA 1ODCA 4KE9A 1CUBA 2JCVA 5IH7A 4NX2A 1YR9A 3GJQA 3H19A 5KYWB 2Q3BA 4KPGA 1ZZEA 4Z0TA 4DQKA 1SPBS 5TQ2B 3N74A 1Q15A 3WJ1A 1G8SA 2ZRNA 3OHSX 2EFYA 2MSCB 4QYMA 4QZVA 3PEUA 3RJ5A 3RWMB 5BR4A 5ECGC 1MAVA 1SB9A 4IIBA 3V8EA 3F9IA 2D3TA 3NFRA 2IIBA 1KFEB 3KFLA 2GM5A 3OQIA 3P2MA 2X4IA 2QX7A 3FRJA 4JBWA 4PAOA 3NGLA 1UK9A 3ZWBA 1PDVA 3W79A 2OZKA 1GZUA 1Q14A 3DGEC 3DL4A 1KRWA 3ZLJA 2PX6A 3PR1A 1YB4A 5AKHA 1I2MA 4ZQEA 5AM3A 2Q1WA 1WUTA 2MDTA 5JC1A 1GM5A 2HM7A 1EGAA 4KBYA 3GBPA 2DKOA 2J3QA 1X1DA 2QE7D 4KFTA 1HX7A 3TD6A 1Z5NA 4QQKA 3GFQA 5EHQA 1EUZA 1JEQA 1K8RA 2C9CA 1HE3A 3F74A 1J70A 3QVWA 5EE3A 3QW4B 2JHPA 4WERA 4XAQA 3UA4A 5FOTA 3OC6A 5TT1A 3ZQ4A 3SWWA 4GO1A 4RK5A 2OBBA 2EP5A 2P2DA 3P0FA 1L7BA 2O06A 3L1JA 1P1HA 2ERCA 5SZHB 4RADA 4D0LB 4EIWA 3ZKAA 4IS2A 5CAEB 5AJYA 3RLIA 1DC8A 1UCFA 3EXFB 4NZZA 4QRHA 3RBXA 5I9SA 2FEXA 1L5GB 1QHNA 4IDDA 3QXJA 3DVQX 4F0JA 5CFRA 1IEWA 5CJPA 3C8MA 5CLGA 4J0EA 1BH6A 1JA9A 2OENG 1JECA 3DVAA 3OIGA 5J4HA 1RE1A 1WXXA 1C0EA 1E5DA 4ECAA 4JI3B 3SZLA 2JD2A 4H7FA 1KAMA 4N7MA 3L8EA 4PLFA 5CW1A 2EZ8A 3WKDA 4FUTA 1CS0B 2FPOA 4I14A 4O08A 5BOSA 2RAFA 3VPFA 4O4JB 4TM8A 4Y7DA 4AZVA 4D9JA 1OZAA 1SXJE 2Y0CA 3DA8A 3PNLA 3NTOA 5FOSA 4K46A 4X1OA 2C00A 2H4ZA 3A4TA 4AFNA 1EP1B 2CXRA 4KAFA 4CTMA 3CLTC 3OX1A 4FE4A 1JKFA 1ZM2A 2DUNA 4GLLA 4X1YA 2Q3JA 4QPPA 3NT5A 3KUDA 1BH2A 4FU0A 5FFFA 3QMPA 1XRRA 1UBKS 2QAGA 4TLDA 1ADBA 3B20A 3FYTA 2GCEA 1QHSA 4UUMA 1YULA 2JCGA 1M3SA 2C4HA 1S89A 2FZ4A 2MT9A 3KSMA 1KKMA 4M9SA 4Q4AA 1OA0A 3H2ZA 3WGMA 1KIAA 3TX6A 2QF7A 2NYAA 4UOZA 3ZDBA 2BFPA 4M4SA 3BTUA 4P81A 1E1CA 4DSUA 3QWFA 4LQDA 1COWA 3KR2A 3DTNA 4RC9A 4B84A 4TQUS 3I9V6 3LT2A 3ZXIA 4BLWA 1E5QA 4JS0A 1DI0A 1FFGA 1VI2A 1YCGA 5DO9A 1KKUA 4UZFA 1TM4E 4YACA 4U7WA 1MZPA 1RSZA 2G9QA 4H15A 4TKMA 1OLSA 4ZD6A 1W36D 1AA6A 2FPRA 4C04A 3FJOA 3BZBA 4RDHA 5BSMA 3LPNA 1UZUA 2QN1A 3I2JA 3NM6B 2YINC 4X41A 2IIPA 3G2JA 4J4BA 1E7WA 3W34A 5FLKA 1ABEA 4TV9A 2ZR7A 4I4TB 2BPOA 1BVUA 1MAWA 1L5SA 4R81A 1L5HA 5FOQA 5IM4A 2DR2A 4NOJA 3OF5A 2HIAA 1Z7GA 3EG9A 2IL1A 1KGSA 1KDPA 4HMPA 2GEDA 2YNMA 4JIGA 3HB9A 3KEGA 1P4GA 4Y1RB 1IK4A 4INOA 2IDJA 4QOFA 221PA 4OGWA 2G4LA 1EG7A 3CLVA 1TW3A 3O8OB 1GNVA 1DHTA 5SYAA 5KSYA 4Q9JA 4G0YA 3C3JA 4KIFA 2CL0X 3UHJA 5B6PA 2W2XA 4E11A 1YRAA 4WESA 1MRSA 4PHHA 1WB5A 5FBVB 1DEOA 3H7IA 3BEOA 3E22A 3IBGA 3FWZA 1RMTA 3GR6A 2AW3A 3OIWA 4QUJA 4AQ7A 1CQXA 2X0JA 4GM0A 3TIGA 3TLKA 2QJRA 1M33A 4JD5A 4ENPA 5A5DA 3TQCA 1TDJA 1D2HA 4FSXA 4M0UA 3MERA 4BGUA 5E7QA 3K72B 4TLCA 3ORFA 3PJGA 5A62A 4NWIA 4QOEA 2NU7B 3B9BA 4TSFA 5KJFA 4UQPA 2ZIXB 1OSNA 2CJWA 4HLDA 2WZCA 3GMIA 2CBZA 3HGQA 1UJMA 1DARA 2BMDA 2VZ9A 4KQMA 4M1SA 1UP4A 3Q9SA 4L95C 2XUAA 4LRQA 4QD3A 4BDSA 2G1AA 4NCIA 4CRWB 3QY0A 2JFVA 4BYGA 4F6RB 3OBIA 3VGJA 1B6GA 2NZXA 3DNMA 1JG7A 3H65A 4CL8A 3NM4A 3RRNA 8LDHA 1NE7A 4EZIA 1VFNA 2IITA 1P3JA 2P4QA 4R9RA 4MMXB 1Y7IA 3GFVA 2FU5C 1QRAA 5CX1A 3GUCA 1AV7A 3QI2A 3K9LA 2YZ7A 1FFXB 4R1OA 1WOMA 3CT4A 2YZKA 2Z30A 4BL5A 4R7GA 2D4AA 4E51A 1AD2A 4W1QA 3SR4A 2RFLA 5TY0A 3VYWA 4H1WA 2NXCA 3AKCA 4MYUA 4MIEA 3RSZA 1W2HA 3MWFA 4AZ0B 4FHFA 4ZYVA 3MJCA 4RVGA 1RWMA 2ZT6A 5CLIA 3M4XA 4M98A 1V3VA 5BW5A 1NDHA 3OPYI 1JIIA 1MPTA 1SU7A 1F0KA 1U8CB 3CB4A 3B6ZA 1WQ1R 3AYXB 4QQNA 1C1XB 1A4XA 3VJKA 4E7PA 1A9QA 3FKQA 4G25A 5JI2E 3GB9A 2W6PA 4WI1A 5B57C 4PRZA 1HT3A 4MHSA 4ZO4A 3VHXB 3UPTA 2HIGA 2PS1A 3SSAA 1M6EX 1M7HA 4DR7B 4EJSC 2GEFA 5G3YA 5IFKA 2BBWA 3Q5DA 5DW3A 5KQPA 5JCJD 1AZTA 4R01A 5LDGA 3PVCA 1P1IA 3VH3A 3WBKA 4C2AA 4OLHA 1LDMA 1DELA 2HTEA 4JJKA 2NUAA 2PPLA 1PX0A 3PC4A 4GC5A 1XUOA 5BVGA 1U7HA 2O3UA 3EEIA 5IG2A 3AF6A 4N5HX 2XD9A 1T5DX 3FCCA 3NHPA 3C3AA 1NFQA 1EUDB 3GAFA 5L6LB 3JPWA 3KR9A 2RJOA 5BRNA 3SOZA 2UDPA 5AQEA 1EWVA 2QXUA 1AM4D 2X41A 2FG6C 2YVAA 4U2EA 2UXBB 5JSYA 2P1RA 2EC5A 3PD1A 1MEJA 1OLXA 3AF1A 1A5SB 1AX9A 2P6PA 1LLFA 4HDNA 4JLOA 3T7SA 2LCQA 2AVNA 4U7JA 3I6BA 1OFIA 5FBLB 4EYSA 4E5DA 5DLYA 1P8JA 2I4OA 1B8VA 3PEEA 1Z5OA 4WLFA 3GQVA 4UHCA 5AK3A 2QUJA 2J32A 4WVLA 4XPIA 1B00A 4RV9A 1QLJA 2W8ZA 2WF8A 3HKBB 1VJ1A 4YJDA 3W5SA 1ZJ4A 3ZWYA 4QDJA 2ZBVA 3H2KA 5CLQA 4QDXA 1KBZA 4QODA 2BONA 3SI7A 5ICGA 1DIGA 2V58A 1USVA 2PJDA 2PUEA 3QX3A 1EK2A 1U0SY 4OQLA 2QX9A 2D0IA 4XFDA 3HUEA 4RHEA 1SD1A 2EJCA 3OIYA 3EDCA 5LBIA 4BUZA 1RJWA 1JMYA 1RLIA 4RY8A 4IOJA 3JW8A 5TSDA 3I92A 5AJXA 5FOVA 3D7NA 1HFWA 4YO8A 4EB0A 1VJDA 4IDCA 3N0RA 3WLEA 4EA9A 3KQHA 4JROA 3VKHA 2ZUWA 3EBOA 3ONEA 4PG6A 1MABA 1Q7EA 2PO7A 1OLUB 3DP9A 5DNVA 2EJBA 1RVDA 4PS0A 4V0SA 4NZOA 2NLOA 1NXWA 1UT6A 3F4BA 4M2LA 3ORHA 3FBWA 1PSDA 4ZVOA 5KEIA 2WYVA 4OHXA 4IHJA 1KH3A 2OV1A 4QWWA 4CETA 1F7VA 1XK7A 1ZRSA 4IIJB 5F3DA 1N2CE 1GPLA 1XL0A 5JUWA 2HU8A 3TLGB 3EWIA 1DWPA 2YWGA 3WYCA 3CFYA 2L82A 1C3LA 2O7VA 3K9QO 2AXQA 2ZSKA 3QF4B 3SK0A 1SA0A 2BFEA 4YEDA 3RLFA 1DQYA 1PGQA 1A8IA 2XE6A 3ZEAA 4ENWA 3D0QA 4UAUA 3TL3A 2VDOB 1GUBA 3WS7A 2E85A 1G16A 1TA9A 4S05A 1TRHA 3KYDA 1GZVA 2BCEA 2JJ8A 4OXYA 1Y1RA 2C2WA 3DZJA 2CNKA 2PUFA 2FCRA 4ZHSA 1K5GA 1Y8CA 2YV4A 4URFA 4WFQA 3LPMA 3NALA 2E1PA 1Y4DE 2VDJA 2II6A 2Y6UA 2KBFA 3ASZA 4HNTA 5AVWA 3VZCA 5ALIA 1L5WA 2A9KA 1XQVA 1IHUA 4IQ4A 1E4EB 2EKZA 3DXYA 3JALB 5CVCA 4ZOLB 3VYUB 5JRDS 2UVPA 1NLZA 3LCCA 3QOYA 4IIGA 5LL6P 3GRVA 3HO6A 4DSNA 1QHHB 4YMGA 5CDFE 1UPAA 3R3ZA 3MLEA 3LQ4A 4DNPA 4MPJA 3BWYA 4E15A 5JXWA 1OYWA 2YZGA 4RPCA 4DAOA 4EHFA 2B8NA 4DQUA 3WA7A 1ZMXA 4HC4A 5P8WA 1ZD3A 3SS9X 3NHYA 3CLTD 3NV7A 1XDDA 4HQLA 4NNPA 4EG6A 3HKCA 1CV2A 1DUIA 1E3WA 2GNAA 2H1HA 2QRGA 9ABPA 1CUSA 1QV7A 2FPGA 4D56A 5FUMA 1F48A 1N7JA 2HDWA 2J4FA 4FW8A 3AMVA 4MVJM 1P7YA 1YNOA 4AB1A 4C08A 1X1CA 3BTSA 4ICIA 1W88A 4AO6A 4DV6B 1FTYA 3EXHC 3IIKA 3RIMA 3I6ZA 3O2JA 4DVJA 3VJRA 3TECE 3N0TA 1QRSA 1QZUA 1A77A 1NURA 1JKJB 2GASA 3DOFA 4GLBA 3N2YA 3LX5A 1REQA 3EPPA 1U9ZA 3N3AC 4A5SA 2RAPA 1Y1KE 1Y3FE 2YXLA 4MGKR 1RWXA 4LBYA 5U4QA 1IOZA 3IP9A 4B0PA 2ODWA 3KVOA 4R1TA 2NU9B 1LDEA 3FYUB 4IHAA 1MGOA 1ZIXA 3H16A 2MYNA 3ITEA 1IN4A 4I19A 4PCVA 5AW3A 1FNMA 4F3TA 2I67A 3O4RA 2AYYA 1DCMA 2YQ5A 1VOTA 3DCIA 4FFDA 3ETDA 4YCBA 4PPGA 1WQ3A 1OH8A 4JQOA 1E9RA 4GRDA 3ICEA 2VL7A 3ILVA 2P5UA 4C4YA 2UVQA 1DXHA 3KJHA 4TUYF 3T4EA 3I61A 3NRCA 1HMYA 4K8OA 4I1VA 3W06A 4U5QA 2WRZA 5DI3B 2WV9A 2AMYA 2IYFA 3GLIB 2R85A 2I3AA 4HGOA 4Z1MD 3DBRA 3KOWA 3T99A 4EUHA 4X8MA 3ZXSA 3L43A 3B5IA 4MLPA 1K92A 5K09A 4FJ2A 4EMSA 1H3FA 4QUGA 4TROA 1Q0RA 3IAXA 3DJFA 4HAOA 3W5UA 4E4TA 2P8JA 1SCKA 3CKMA 2PZBA 1LSOA 3IVAA 4GUAA 2OB1A 4JU9A 2XB8A 3O8BA 1VJRA 1JNXX 1JAHA 1U7ZA 4HGQA 4R2WA 3SIRA 1M2EA 3B3GA 4MA4A 5FRDA 4B7ZA 3OZUA 1BQ3A 2P7HA 1OREA 2LGJA 4KXFB 4UEOA 4YV7A 1Z2NX 2Q4BA 2AD1A 2VUUA 1WDTA 3DEAA 4NDZA 3D5EA 4RHYA 1XXHE 4YJFA 1OXUA 4QUKA 2F43B 2J6CA 1U31A 5GGXA 3OP1A 2EU8A 1AG9A 3QI7A 4GPBA 4DSTA 2D1TA 5DT2A 3VA7A 2HGSA 5LVAA 4DV2B 1QCDA 4ZOQI 1RJGA 3PENA 4ZVMA 2ZRIA 4EGFA 4BNZA 4JI0B 3WIVA 1B73A 1R8JA 1XJQA 3IH5A 2G1KA 4B40A 3U1TA 3EQZA 5FLXA 3MWEB 2YRWA 4D82A 2C5EA 5F7XA 3HJUA 1CQWA 3A11A 3FVWA 3GCXA 2AVDA 2BISA 1E94E 1Z5WA 2HHJA 2QY9A 5BV2P 1TZBA 1X94A 2VRCA 4LTDA 1WTCA 3WGQA 3O74A 4MUNA 1KJNA 1C2TA 4M37A 1T8PA 1GQQA 1GPWB 4G2TA 4OB7A 2ZCUA 3FFTA 3N2ZB 3VFDA 3KLNA 3PGMA 5CCXA 1Y3AA 4YVFA 1TF5A 3LUHA 4IVRA 1U6IA 1XAJA 4DDMA 4HTFA 3PEYA 4KR6A 3CZQA 3NC4A 3UM9A 5EY5B 1U11A 4F12A 1FJHA 4PIVA 2AS0A 2B9VA 3HU2A 1UJNA 3PFWO 4RZ3A 1K8XB 4NOMA 5ALKA 4QLBA 3ZU3A 4ZXFA 4MS3A 1EHIA 3T1NA 2DUUA 2ZRQA 2IH2A 2O2JA 3K94A 1WETA 2HF7A 2VJPA 4EGCB 1NRIA 3G5LA 3ZGZA 3RUDA 3KYBA 5E4TA 4F9FA 4C0JA 4F3RA 1PKEA 4J0CA 1FCJA 2HF8A 3KL4A 2DC1A 1UPUA 3E35A 3HNOA 1AURA 5LMUB 2EBUA 2QTWB 4X1IA 1YV9A 4IH4A 2X14A 3KJEA 1MVLA 3BXHA 3OQ6A 5SYMA 5F1KA 2WYHA 5SYNA 2JK1A 4U8HA 3WLFA 3O47A 4QJ3A 2YZNA 3QVMA 4YK7A 5DPMA 1QRUA 4WW0A 3NVKI 1BMFD 1ZHOA 4H3KB 3IO5A 2A84A 4J1NA 1VA5A 2FQQA 1NVVR 2OO5C 3K0EA 2FW8A 2OWDA 3PHGA 4QYXA 4XPZA 4Y8VA 1SCBA 4LQCA 4R4JA 2B2CA 1QRRA 4IRUB 4L4UA 4NBTA 3VR6H 4DV7B 1SXJA 5I7HA 4DCOA 4G1FA 5BQFA 4PC2A 5JROA 1PJZA 2JBAA 2FWNA 1JHPA 1L8LA 1CE8A 1RC1A 1JWBB 3QEJA 3HA2A 4Z7JA 5F7OA 3REQA 4GDMA 3HXQA 2I6XA 1M0SA 2EX4A 3H1GA 4CDRA 1OB5A 5DWVA 2HTFA 1MIOB 3ILSA 1Y7LA 3TTSA 2C59A 2H5EA 2YZMA 3AEYA 5HGXA 5JYDA 3ONFA 1V45E 1RRPA 2I55A 3UB4A 2PCLA 5FTNA 4D9GA 1GG9A 3BDIA 4WN3A 3ZNNA 2IX3A 5EJ5A 5KPJA 5TF0A 1KZYC 2IPXA 1S3GA 2WKSA 3GXOA 1Q57A 3KJFA 4HQOA 5IAGA 2ZAMA 4MQMA 4BQEA 2G80A 5D84A 5AVUA 2G28A 1GG8A 3DMTC 3K1AB 3X1ZA 1ISFA 2IU6A 3ZZ0A 4PLGA 3C1AA 3PC6A 4YREA 3SC6A 3ZV3A 3Q98A 5IXJA 4G5QA 4TTJA 1K6IA 9LDTA 4AY2A 1F8XA 1SQ5A 1UJ2A 3ZGYA 4DUYB 4C3OB 3F6RA 1CY1A 2F64A 1DT5A 4IQGA 5T5QA 3KZVA 4L22A 3ZHUA 5F2NA 3W2HA 3AVUA 5B4TA 1ISJA 2OHGA 2YC4C 4RHCA 3S28A 2X8BA 1IVNA 3L0PA 3PQEA 4BO4A 3NBKA 2V54A 2Z1MA 3TVYA 4M9QA 4S1PA 1FNCA 3S2SA 2VC2B 3QVUA 3AZQA 4BO6A 1JLMA 3N2IA 1V5IA 4QJ5A 2W42A 1T9DA 2CFIA 3TOXA 3I53A 4N41A 4LZPA 2EJUA 1JLLB 3VO1A 5ES4B 1EFPA 1GZDA 1WZUA 4XQGA 1E2PA 5EXPA 4BX3A 2AMJA 4P5EA 2RBEA 1UH5A 2DTDA 4XVHA 4IIUA 3SFTA 8ADHA 2ZVJA 4X6LA 3D3EA 3QVGB 3PX2A 5EWLB 1IBKB 2BF7A 1JDPA 1YS7A 4AKHA 5JZVA 2A57A 3LDAA 3PNPA 4RIFA 2FG5A 4ALIA 1O9GA 3KE8A 5A03A 3E7XA 1NYRA 2I2XB 1PJAA 4ITRC 2I22A 1W5TA 4XM1A 3K0SA 1NY6A 4CT4B 1PTKA 5EUMA 3DWGA 4N03A 4B9EA 2PXCA 2EJVA 1TUBB 4BB6A 5COAA 3T1TA 2Y27A 2H4FA 3GLGE 1JDSA 5J59A 1R9NA 5T3YA 3VNAA 5CB4F 1GYRA 3LL7A 2CLCX 2WF6A 4MQEB 3P5SA 2PAAA 521PA 4OYRA 1QLWA 1SKYE 4EYEA 2JIQA 3BA1A 1MR3F 1ZRMA 5IARA 1IZ0A 5C7YA 2QD4A 4BO0A 1OV6A 1DXYA 2BFCA 3IHKA 3FYUC 1XCPA 4EABA 1UBOS 1GILA 4JT9A 3QVTA 4ZHQB 4P84A 3R3VA 4G5XA 5CRIA 1RFGE 3IPLA 2VCHA 4DR1B 1ZEMA 4QU5A 1FP1D 2BHSA 2EWMA 4DV1B 4MUMA 2ZJ4A 5ARDA 4AQDA 3ZY5A 1DDGA 1EA7A 1O6BA 3OZ7A 2QR5A 1FTQA 3P9PA 4PYLA 1UZNA 1NXSA 2G9VA 1XR3A 4H17A 1M83A 1NDUA 2RSLA 3DXXA 3HG7A 3EHEA 1IRIA 3L4KA 4D9CA 1IAQA 2XODA 2BDEA 3T9DA 2CT8A 1J5EB 1XA3A 1LY1A 4I08A 4OBXA 2XWBF 3I04A 1PR1A 4L15A 4P0PB 2ZTMA 1I30A 2DPYA 1NG1A 4Q1CA 4AWBA 3C43A 4MYRA 2VDRB 5A0TA 3TBFA 1H4QA 5DP2A 3S55A 1ZAYA 1XZLA 3GJXC 4JLPA 4WZAE 3IP3A 4X7PA 3IELA 2VPQA 5MF6A 2OECA 4J3FA 1QO7A 2OCLA 3GHHA 1R9GA 3D6FA 4V0RA 2DAPA 4RF3A 1D03A 2AQHA 1IXRC 3JRNA 4CV2A 3KOZA 2UYYA 5AVRA 3DHVA 4G63A 4J0QA 1X0VA 5CNKA 1KPHA 3OLZA 4IIXA 3V1LA 5IDYA 4RCYA 3WQQA 1TZKA 2C99A 2EFJA 5F5LA 1NI4B 1LQTA 3RCBA 1KZ1A 1T3ZA 4HEHA 4PRLA 3VI4B 4ZJYA 5HQTA 5JHGB 4C4ZA 3MGGA 2K2WA 4PV7A 1VL5A 2HZBA 4DYDA 1BEEA 3V7YA 2X5OA 2ZAGA 1K9VF 5ENVA 5FPQA 2A5GA 1V11A 2GK4A 3F5FA 4DJAA 4G41A 5KHOC 3LI2A 1AQJA 3KZKA 3EEFA 4L4ZA 2IF2A 3FKSD 3B12A 2WWWA 1J8YF 2WUDA 5LQUA 2XDQA 4MCIA 4A6XA 5FBRB 1KTIA 3L6CA 1NNEA 4B3MB 3ZBUA 3BB1A 1K6EA 1E1KA 2GBIA 3MWYW 3UK7A 4I1SA 2FK8A 4YDHB 3A6DA 3K0CC 4KLNA 4B8YA 3SQXA 3FDJA 4OHVA 5GV8A 4IGFA 2ODNA 1ZUNA 4JR1A 4OP3A 5K3SA 5TMDA 3WL3A 3K0FB 4B43A 2FOIA 2UZ4A 1MNAA 2IHJA 3EG5A 3RSSA 4A1OA 1MX5A 2QMEA 1M7GA 5JQGA 3GGSA 5AW1A 3Q41A 2ID9A 1BS9A 2JLQA 1FX0A 3TRHA 3LHFA 3LSTA 4KCGA 1V0JA 4DBZA 4N5MA 4A8JB 2QRQA 4Q3EA 5I9TA 3PUIA 2ZB3A 1WD7A 3L7MA 2DMRA 1VE6A 3ER8A 1X39A 4BJ5A 2ZBPA 3E4DA 4EMUA 1JHVA 3ZS8A 4TVSA 3BWMA 4G1BA 3KVNA 4A73A 3HJHA 2JDID 3JARA 2O1XA 1A96A 1HMPA 2EQBA 4IJWA 2XNJA 2ENWA 2H48A 5B4VA 3QEMA 4AECA 2Z58A 4A6EA 2HMWA 3PVZA 1M2NA 2VUIB 4IKPA 4MEJA 3WXMA 4I6GA 1H22A 4BFSA 1XD2A 1ZXLA 3KELA 1X1BA 1AUPA 2CUTA 1DJLA 4NBUA 3UWPA 1P77A 1SC4A 3BJIC 3ZE8A 3PV0A 4G0VA 3DQQA 1YI1A 2I99A 3JTMA 4UBIA 5G4KA 3PBKA 4FLFA 4YRJA 2OFFA 3PFBA 3ZWWA 1I14A 4F8JA 3WK4A 3K4QA 1JSLA 3X1KA 5E38A 4CNBA 3FPFA 4GBJA 1XQ9A 2VHEA 2J3KA 2WHYA 3WJAA 1UFQA 1X7WA 1GSAA 1V8ZA 5REQA 2QTNA 1TK2A 2AJBA 3RC9A 1XTTA 2HHHB 5EQJB 4R2LA 3IEVA 2GB4A 4FIZA 4KPUB 1N2CA 3CBQA 3RDPA 3UYKA 1QPZA 2BM8A 1YQWA 2C9YA 2C20A 2CMHA 1U2RA 4DCNA 4CU5A 1IY1A 2NSYA 3UFBA 1AKEA 4WFJA 1N8KA 4C9BA 5B7GA 4GMFA 1G7TA 1EGHA 1NF2A 4PR0A 5CGQB 1IONA 3PB3A 3T7IA 4O4IB 4DDUA 3SVTA 2XB6A 2PRJA 1L7AA 3CZ4A 1OBHA 1EDOA 1OAOC 1RRVA 4KLRA 3JQ8A 2XVAA 4B6EA 1L5RA 4IDEA 1T9CA 2ZQYA 4ZMSA 2FETA 4CM9D 5L95A 3MT0A 4C06A 1BMDA 2BJHA 1W85B 2I7DA 2J08A 2PMFA 3AY7A 1GR1A 1XF1A 4QOHA 5JD6A 2WU3A 1V16A 3B5EA 3IEIA 4L07A 4BRUA 3VR3A 4PZ0A 1Y42X 4KAAA 1ULBA 1V6AA 4F2PA 4AZWA 4CUZA 1NBMD 5I7FA 4ML3A 1CYDA 3ND6A 1GRNA 3C6BA 3LECA 2WWYA 1FDOA 3CRZA 1WTAA 3AH8A 1E61A 2C4NA 4BGEA 3TR0A 4LJ9A 2C1EA 3LT5A 1KJIA 3SJ7A 5CDFA 3A25A 1UKYA 1UDAA 2WJAA 5LA6A 1IXSB 4I55B 1KVSA 3ROZA 4AK9A 5JPIA 2W9XA 3DBIA 1YA6A 3AETA 4PG4A 3HLKA 4I0WB 3R77A 4IP0A 3CMMA 1N2GA 4K8RB 4OMCA 4AJ4A 4CKBB 2FXVA 2Q1TA 5JMWA 1K5PA 4HPJB 2XY4A 3W5AA 4NH4A 5B3JC 3GY0A 1P44A 1SULA 2HUPA 2P2SA 2QGZA 2VNIA 1G7SA 1VXOA 1ZJ5A 4OYHA 2PUHA 3LNCA 4MWZA 5HKKA 1KQOA 4MQ6A 2B99A 2XD4A 4HNHA 2FUCA 1UWVA 2FKAA 3KAJA 4NJMB 4PU0A 5MGBA 1KK1A 2PWAA 4UDNA 1TCUA 2I33A 3KU1A 1N4DA 4CG3A 1IL0A 3OTOB 1MQSA 3FX2A 1UL1X 3PDIA 4CZ2A 2VVTA 5C8DA 2PMBA 3EFOB 5JXHA 3OWHA 2OD9A 3P9ZA 4WQMA 3TL6A 3I9MA 4FB5A 5EE9A 3VOTA 1GA6A 1NMEA 2HWXA 4URVR 4JB8A 5DMHA 2WJPA 4OHOA 4P3XA 3FY4A 3BL8A 1RXSA 4JELA 4NMLA 3T3PB 1E1QA 3TSCA 1E9SA 2QWXA 2W2QA 4IO1A 3ESAA 4X8HA 1N75A 2W0MA 2Q5OA 3PXGA 4A8PA 4CLRA 2DLCX 1T0BA 1BN6A 3HUTA 4RHFA 4HL6A 5C3UA 4HVTA 2PL5A 4UHKA 1YS4A 4WCFA 1MH1A 3MRVA 4U2KA 1W59A 2ATVA 4NU6A 1KH1A 2A0KA 3DL2A 2QGNA 4M38A 1PNVA 1ZVJA 5D87A 1NYTA 4KWTA 1ZCAA 4O2RA 4Z54A 4DMMA 1LX7A 3G82C 4PANA 4Q39A 3IQXA 3LDGA 1S96A 2V59A 4V3BA 2XPCA 3LX6A 1TJNA 3UA3A 3EPJA 3LCUA 1QUEA 4EY4A 3TLEA 3WOHA 2BEJA 4XYEA 4DM7A 4HDSA 1EFDN 1YZFA 4FX2A 1ZI6A 1LLUA 4ITUA 2YFYA 3EGDA 4PX2A 3R7AA 2GN0A 1ZMBA 3Q85A 1Y5LA 3OMLA 5K4HA 3H5IA 5AJUA 3ZKWB 4BFXA 4FGWA 4BN5A 1PHPA 5AW7A 1ZNXA 3LCVB 5GP1A 4BLUA 1BKSB 1WR8A 2ZWVA 1XXHA 1SG9A 4KGXA 2E48A 1M1YB 1CP3A 1QTRA 1X7GA 2YFQA 2CL7X 3H11A 3QFRA 2V5AA 5BYAA 3UWMA 3L7JA 3MOGA 3EGVA 2C9ZA 5MHTA 3R0JA 2X77A 1LJUA 1PWEA 2RI6A 4JCOA 5L3VA 1T35A 1OX4B 1WZ2A 4WVFA 3NB0A 2H1RA 4X3PA 1QYXA 3ECSA 4MJXA 3WNCA 4EJ0A 4FN5A 4D42A 4OK6A 5DU2A 3LBAA 2Z09A 3OIVA 1H2HA 4D80A 4ZODA 3IGFA 2GEUA 4BVGA 3K70B 3HMKA 1WXEA 4L08A 4YRFA 2H5LA 2ZJ2A 3HCAA 1KYYA 1DSSG 3HJCA 3R6TA 3BMCA 3ZC3A 3LJKA 5JAZA 2WTEA 4W1PA 3IOBA 4L8LA 2AZ4A 2XHZA 1Q11A 3U3JA 2C82A 4EYGA 1B41A 5J5CA 2XCOA 5EPUA 1OPRA 1DADA 1F2TB 2CVPA 2JEOA 5C32A 1N8SA 2HIHA 1ODKA 4AJOA 5K8CA 1KVRA 2QSZA 4TWZA 1S3IA 1D2RA 3N7AA 3SNHA 4O2AF 5A9SB 3AFMA 4IDBA 3FNIA 1Z12A 1XP5A 2Q1YA 3F3MA 4PG7A 1TTTA 2WTAA 4KHZA 3PUZA 3AIOA 2DX7A 1ZLYA 1ZOIA 5K3BA 1L4BA 5COBA 4DMRA 4YV0A 3QLVA 1NSTA 4XWAA 3PQ4A 2WTBA 2CWDA 2BUCA 2NUPB 1L7QA 2H4YA 3I1FA 2ZANA 4XIGS 3CZPA 2NVOA 2R68A 4KLZA 5KTKA 3JD1A 3EEYA 2YV1A 3KLBA 4YRGA 1G8GA 4DCUA 2IY7A 3QYFA 2CC2A 3INYA 4JK3A 4CQMD 3OI7A 4Q82A 4N54A 1Y9EA 4ND8B 3ASYA 1XDSA 4WEOA 4Q9IA 4A8JC 1JKXA 5DGTA 5CFPA 4PLVA 5E9AA 4MRRA 2FSHA 4NEHB 3O3MB 3BS4A 1ETUA 2UVDA 3WL6A 2FRVA 5F9HA 2BLLA 4JLUA 3KOOA 1PR0A 1DG9A 1I1NA 1R6VA 4KNVA 4LJ7A 1BXGB 4ARSA 3R3SA 3BMNA 1CVRA 4RD2A 2I6FA 4HEJA 2SKDA 3P9IA 5F21A 3HY6A 1TT7A 4A3SA 5E1BA 1V2HE 2QDXA 4CF5A 4HUTA 2ZIVB 2ZJ0A 3PXAA 3R41A 1JZSA 3TM4A 4AMUA 5H4HA 1BTOA 4DBVO 5KOHA 4OX9B 4GOXA 3R9XA 5I9BA 5BN4A 4RZ2A 1SOWA 2WUWE 4ZV9A 2GJ9A 1ZNZA 4NTZA 4FLEA 3U16A 4MHTA 4AM8A 5J4YA 4LK3A 1FFAA 3BQ9A 3IILA 4H7IA 1ISMA 1T2DA 3A3PA 3MAGA 2DFVA 4DCTA 3PQ7A 1QHGA 4A0FA 3TB4A 3E9QA 1CZKA 3AIIA 2PNFA 3UUGA 3LFHA 4B79A 1O94A 2BGGA 1SOAA 2G8NA 2GA8A 2HQ1A 2G08A 2DQSA 2V7QD 2EF1A 2XYVA 2YS7A 1K9SA 5KCMA 2ERXA 3NHZA 3O95A 4I1OA 1F6WA 3GUVA 4KMSA 4QXMA 4FQ8A 1KZHA 1OT3A 3OU6A 1ZW1A 4B2IA 3L7YA 3LT4A 3RR2A 3FWPA 4OXQA 1NQOA 2V96A 1A5AB 3CW8X 1R27A 2JK0A 3GBSA 4JLNA 3IR6A 3L77A 2IE0A 3WAJA 1FXWF 4KEAA 4Q3NA 1GLGA 3GIWA 3LZCA 3O8QB 3Q0EA 5A4IS 3CT6A 6ABPA 5L51A 1A8PA 3KQPA 4UFNA 1C7FA 3PXBA 4IPTA 4QSMA 2WB2A 1GNRA 3HKEB 1FEZA 4TTVA 1KMQA 1T4BA 3C8UA 4NULA 1C9DB 3AP3A 5L53A 2TMDA 3T5MA 3JQGA 4NCNA 4UU7A 1MJGM 4PGFA 5DHSA 3V8NA 3R8XA 4H4EA 5LP6A 3V1UA 5AESA 3IKLA 4BNXA 1R0ZA 2QLJA 4TZKA 4DLVA 5B1HA 2BCJQ 1EZ4A 2J3JA 4LJ6A 1A8QA 1EJBA 3HLYA 1JLHA 3PWTA 4HNAB 5G0UA 1LPMA 3M0EA 3HM9A 1GU1A 1O0BA 4X54A 4CNQA 4FEGA 2R4QA 3NTVA 4U1RA 1PZGA 1UUFA 4YYZA 4CFSA 5JDIC 3VBCA 1UPFA 2NSLA 4O4JF 2QL6A 2ZJ7A 4DWWA 4NE2A 2SBTA 3DOIA 4B3IA 2UAGA 3PTZA 4D6PA 4HF7A 4Z49A 4CI9A 4EPVA 3UN1A 3VZDA 4R68A 3GJZA 1R74A 1XMJA 3RT1A 9GPBA 1C7RA 1P45A 1VLHA 5DX1A 4CT5A 5BPHA 1XU9A 1DJOA 4QU9A 5IBPA 4YJ3A 5LOVA 3GCZA 1VHLA 1ZHHA 2P78A 2OZLA 1QRTA 1CW2B 3U7JA 4GYWA 4TMWA 2RHBA 4NFSA 2ZU6A 1JBEA 5FD8A 3RV3A 3TB6A 5IVHA 2PX8A 1I01A 3K0AB 3AZPA 3LUPA 3M33A 1MF7A 3I09A 4N3GA 4MO9A 1ZCBA 5FJIA 3ESDA 1YCFA 2O5RA 3P9CA 3CH4B 3M1LA 5B36A 5T8KA 4YRIA 2O0KA 4XXHA 3T4UA 5JCOC 5FNVB 3G2LA 2F62A 1TGVA 1TZCA 3GDFA 1LFAA 5LB4A 4FYHA 3AI3A 3KKQA 5FI5A 4FOLA 5AQ1A 4DR3B 2WJYA 2BKLA 5C9ZA 1JJIA 1GKYA 3CLRC 4WADA 2V5UA 2ZLBA 4WZAA 4YRQA 1VZ3A 2Q49A 1JHOA 1PJLA 2WM2A 5CYGA 2GJ4A 3IUEA 2CXNA 3S2EA 1W4CA 1ZN7A 3FWHA 3UAOA 1N0HA 3IQFA 4B75A 4E08A 3M6IA 2A3RA 2PKYX 4WV3A 5AMXA 4DA4A 4RKRA 1USIA 1Y98A 5BV1A 4W6QA 2ISCA 3AYZB 4I4TF 5F12A 4CTKA 4K5QA 4W5JA 1V43A 2OQRA 1KBOA 5P21A 4ZYXA 4DLLA 1XRPA 1KZ9A 3ZBTA 1SGWA 4TWAA 1NNUA 2XBUA 5BQPA 4R71A 3DC2A 3KDAA 1KY3A 1U7XA 4JLBA 4TXMA 3FPKA 5TPWA 1XT6A 4AKSA 1USGA 3WHKA 2FPIB 3RYHA 3WL8A 4AS1A 1KYTA 3P2IA 1J2EA 1S7GA 2K5UA 2I54A 3Q6MA 1OX6A 2HRZA 1QDUA 2IIQA 4IO0A 4O29A 2ADOA 4E5PA 1KAHA 2WVAA 3A31A 4QUAA 1EB8A 2BDTA 4RTJA 1TCBA 2GBLC 1VCOA 1GCAA 3LVBA 3LQFA 4JI2B 1KRXA 5ITZA 5JRZA 3I3OA 2GAFA 2GKGA 4FR0A 3U39A 4PY2A 3VQTA 4C43A 2DYKA 3CM0A 4YLYA 3RAEC 1C4OA 1JDTA 1EVEA 1FX1A 1OYOA 1Z6XA 2QVYX 4JKOA 3V2IA 2WVJA 1V71A 4YRKA 1YFJA 2OUKA 2YJZA 2J5KA 4U7FA 1UJ5A 3RQIA 4DE5A 2IKQA 4IVPA 4FM9A 1V8PA 4FHZA 3PUXA 7REQA 2I6SA 1ZD8A 2BJVA 1DVRA 1PNTA 5BWOA 2CLDX 3NIWA 2GXQA 1GDHA 2J0UB 3G8BA 2B20A 3CEMA 3LLCA 4A16A 5BW4A 4P4GA 1U7TA 1Y8AA 3WHIA 4ESHA