4ZCSA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Choline-phosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 43
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcsA00
2GOYA 2WSIA 3ND7A 1XNHA 4MWEA 3DPIA 1UFVA 4A91A 2HMAA 4R2MA 1PFYA 1O94C 1WKBA 1U3DA 4UZEA 2R5WA 2DR2A 1F9AA 1KKUA 3IODA 4OJMX 1O0BA 1KORA 4MVXA 1MRZA 2A1UB 3MMXA 2GKSA 3A4IA 5K0TA 5HUJA 4RPIA 4DLPA 4OUDB 1M83A 2QTNA 3UY4A 3SP1A 4DJAA 4I6JA 2NSYA 3RK1A 3CR8A 1I6KA 1QQTA 3IOCA 1EFVA 2VXOA 1IQUA 3E27A 2AG6A 2A88A 2PG3A 3Q4GA 3HV0A 1NURA 3ELBA 1OWNA 2DPLA 4ZT3A 3DV2A 1ZH0A 3AFHA 2A86A 3IMCA 4EG3A 3LOQA 1Q77A 2J07A 2RE8A 1QRTA 3KT3A 2YWCA 3IOBA 3HMQA 3I05A 2D5BA 1OD6A 4Q16A 3MLBA 3Q10A 1R6TA 1SURA 4WSOA 2YWBA 1T6YA 4EG8A 1H3NA 3IUBA 1EE1A 2WQ6A 2C5SA 4X0EA 3AG5A 2A1TS 3UMVA 1KH2A 1NUUA 3NV7A 3ZIUA 1M8PA 2WQ7A 1M8KA 1TYBE 1NSYA 2QUKA 4MW0A 4ARCA 4F3RA 1PFVA 3F3MA 1Y42X 2IELA 4L2IA 3FIUA 3PXUA 2E89A 2QJTA 1EJ2A 1JGTA 1RQGA 1TYDE 5HUHA 1JIIA 2AKEA 4MVWA 1O96B 1TQ8A 3CVVA 4H3SA 4YP6A 2EL7A 2Z08A 3CVUA 3RHSA 1NZJA 4EG1A 5DASA 3ZJUA 4MW5A 2D13A 2Z09A 3SZ3A 5FO0A 4QREA 3ND6A 3AG6A 4KR6A 3KT0A 5TS2A 1KR2A 2ZUEA 2A7XA 1MC1A 1GZUA 3COZA 4EFKA 1K4MA 3P0HA 3H9BA 4G6ZA 5DB4A 1N75A 4FZJA 1MOPA 1VBNA 1YIAA 1G8FA 3H97A 1ZUNA 1Q11A 3ND5A 3TZEA 3Q12A 1EUYA 1O97D 1G8GA 4MUJA 5J58A 3LCJA 1K4KA 1OBHA 2CYBA 1GTSA 2Z3VA 3SZGA 4K03A 4MUFA 1X6VA 5J59A 3RFFA 2J5BA 3JXEA 1N2HA 4JXXA 4NDAA 1R6XA 2ZP1A 1EFVB 3K9WA 1O5TA 1S4MA 3A05A 3AL0C 5FO1A 1KQOA 2X3FA 3FG9A 1JMVA 5TEWA 1XJQA 3TQIA 1LI5A 3RK0A 2DXIA 1QJCA 4G5YA 3D6UA 1N77A 3CLTC 4MUEA 5EKDA 1EUQA 1QNFA 2J4DA 4CT0A 2PXHA 3AIIA 4MUGA 3SEZA 1NYLA 2O5RA 2YY5A 3NBKA 4EF6A 1ULHA 2QUHA 4MAFA 4KR7A 3IVXA 4WNYA 3INNA 3N8HA 5AHWA 2CUZA 1KQPA 1G59A 1EXDA 2V0GA 1KAQA 1O6BA 4ND7A 4ZT2A 2WB2A 5FNZA 4J75A 1ZJWA 3SDBA 1M1ZA 1M8GA 4MWBA 2QJOA 3COWA 3PNYA 4J76A 4Q93A 1VLHA 4KKVA 3CLSD 3QE4A 3C8ZA 2PZAA 1TEZA 2PZ8A 4KR9A 2I1LA 1IFXA 1N2GA 3MUEA 4L2IB 1BS2A 5H16A 3X1KA 4DE5A 1CT9A 1NUSA 1T6XA 3IMEA 2H29A 2AZXA 1I6LA 5DEOA 2GM3A 4E1AA 1WOYA 3ZUGA 2EJCA 1N2JA 3TNJA 1YI8A 2NZ2A 3TQOA 1Q15A 1Q19A 1LW7A 4EGAA 1IRXA 1WXEA 5KCMA 4DDHA 4MW2A 2QJFA 4KPUB 1QRSA 3GMIA 3UK2A 4R2LA 4ZCSA 4DDMA 1U0BB 1QU2A 4MLPA 5H7XA 4GRIA 4NAUA 3FI0A 1NI5A 1D2RA 1MB2A 4MUIA 3IVGA 3PNBA 4I6GA 3UC5A 1JIKA 4ZT5A 1O0CA 1I2DA 2D54A 3KFLA 3CVYA 3N9IA 3VRHA 5BNZA 2CV2A 1MJHA 1YIDA 3CLRD 1A8HA 4PBRA 2PZBA 1F7VA 3VU8A 1X8XA 3FOCA 1MB9A 4CDMA 4ZT4A 1PFUA 2JA2A 1F7UA 2CV0A 4PY2A 2A4MA 4QBTA 2X1LA 1YUNA 1KH1A 1T9GR 4MUHA 3CLUD 2DERA 1O95D 4KPUA 5J5AA 1WJGA 4BWVA 4K0RA 1TFUA 2HGZA 2QUIA 4ZCRA 1KP3A 3FNRA 3P52A 1M8FA 1QTQA 3FHJA 3N2YA 1ZH6A 3FWKA 1NUQA 1FYDA 1N3LA 3TS1A 3RBAA 3H99A 3COYA 3AKZA 1QRUA 2E18A 1KQNA 1H3FA 4TS1A 5K0SA 4ARIA 3N05A 4HJRA 5TGTA 1GPMA 1JECA 1LI7A 3SEQA 1T6ZA 2PFSA 3A04A 1IQ0A 1KAMA 3ISJA 4ZT6A 4MW7A 1TYCA 4DNXA 3GLVA 4YP7A 1O95C 3BL5A 4G5FA 1F4LA 2OQ2A 1O94D 3G6KA 3QTBA 2X0KA 1K97A 4F4HA 2TS1A 4NX2A 2QUJA 1G8HA 3ZGZA 4U63A 5KHAA 4EG7A 3ZXSA 1O97C 1MBZA 1YULA 1H1TA 4MULA 1IH8A 1OWOA 2DETA 1J21A 3LE8A 5KWVA 1V47A 3PNVA 2CYAA 4R0NA 1PG2A 1JZQA 2XRYA 4YP5A 3L93A 4YMIA 2JANA 1JIJA 2OV4A 4U8HA 1JEDA 3ZJVA 3OTWA 1HYBA 4ZCTA 2VTBA 1EFPA 3CA8A 1B6TA 3M5WA 2QTMA 3X1MA 4EG4A 2DLCX 2QTRA 1U7DA 4ND6A 3DLAA 3CVWA 1MAWA 4ZCPA 1PG0A 5LFAA 4ZT7A 2CT8A 1MAUA 1WZ2A 4MWDA 5DK4A 2ZUFA 5LM3A 4AS1A 2CYCA 3FH0A 5IHXA 1WXIA 4YBRA 4JZYA 2YXNA 4GU5A 3CVXA 1WXFA 2G36A 1NUPA 1FFYA 1PFWA 3CLSC 4NAHA 2CSXA 4QRDA 4P2BA 1GTRA 1U3CA 1DNPA 1P7PA 2V0CA 3L92A 1YUMA 4PBTA 3ZJTA 4MQ6A 3A2KA 4XFJA 3G59A 4MVYA 1XNJA 4MVCA 2XRZA 3U1VA 1QU3A 5LLTA 2B7LA 4UZFA 1T9GS 3G5AA 4HPWA 4U7JA 2A1UA 3D6VA 1JEEA 2JAXA 1OWMA 2PIDA 1J1ZA 1OWLA 4MW1A 1OWPA 2E21A 1IHOA 3MXTA 3QTTA 4S1OA 1M8JA 3KT6A 1N2IA 5TEVA 1VL2A 1IVSA 1N1DA 4OUDA 2IP1A 1I6MA 4XSVA 3HFJA 1J70A 4AQ7A 5F23A 3KT8A 4I6EA 3RJZA 1WY5A 2HZ7A 4PBSA 1N2BA 1TYAE 4HJXA 1VBMA 2O8VA 1JHDA 4RUKA 3GUZA 4EG5A 1J09A 1K92A 1NUTA 2A1TR 2CFOA 4JXZA 3UOWA 1GN8A 5IJXA 3HL4A 4XFDA 2J09A 2DEUA 4ZCQA 4MWCA 2X1MA 3IUEA 2H2AA 4JFAA 1J20A 3IMGA 3MLAA 5JBNA 3FETA 3CLRC 3X1JA 3PRHA 3IH5A 4MUKA 1U7XA 2A84A 1N2OA 3COVA 3IDFA 4NATA 2RD2A 2BYTA 3P0JA 3H05A 4MUNA 2BTEA 1JZSA 1V8FA 3FDXA 3K32A 2J08A 3SYTA 3VGJA 1H3EA 4NZPA 1WXGA 1NP7A 3CLUC 3CLTD 4CQNA 1R6UA 1ILEA 1EFPB 2DUMA 2VTBB 1IQRA 4MW6A 3FY4A 4HK4A 4EG6A 1GAXA 1J1UA 4JYZA 1VBKA 3S3TA 1N2EA 4CDNA 3ILVA 3HGMA 1KH3A 1WXHA 2CV1A 4MW4A 1KP2A 2E0IA 3HZRA 1WQ3A 3IVCA 1OBCA 1GLNA 3DO8A 3H9CA 3NBAA 1N78A 3IOEA 3ZXIA 1O96A 3OP1A 5HG0A 1JILA 1WQ4A 1COZA 3P0IA 4DDKA 2IJGX 1XNGA 3TZLA 4MW9A
chains in the Genus database with same CATH superfamily
2HV9A 1JT2A 2UZ1B 1H0HA 4YMVA 4Y2PA 1JIQA 2CXXA 1SHUX 1WTAA 4NZOA 4ZRDA 5DM0A 5IMBA 1C1XA 3ASZA 4KAFA 3MWDA 2JL1A 2VDWB 3A1UA 1YONA 2HN9A 3TL6A 2AZTA 4DQLA 5BXQC 4C6SA 1YS9A 1JDUA 1P5RA 3W2TA 3TH5A 4YDRA 2J9XB 1NBOA 1C1DA 3LTEA 5E0KB 3JQAD 5IU6A 2X5KO 3EG9A 3D3NA 1M1YB 4UHJA 2Z3ZA 2Q6TA 2AVNA 3CU5A 1H2WA 5K0CA 3BF8A 2VHCA 1JG4A 1X9IA 5K8UA 3IDQA 1MAAA 1CCWA 2DFTA 3NTLA 1XMJA 5B64A 2FUNB 4CM8A 3LYHA 2G83A 2V6MA 4TLCA 4H6WA 4FUQA 4DJAA 4R2WA 2I78A 2Q3JA 4RF3A 2NSYA 3EGDA 1Y3BE 5KPJA 3INRA 2VYCA 3LGAA 4IQ8A 2IS1A 1RKQA 3LK7A 1Z34A 2VXOA 4XEUA 3JQFA 4WBNF 1ZD3A 4P53A 1E3WB 4FEEA 2SBTA 3SS8A 1YO6A 1T1SA 3LXRA 1XTZA 1N0WA 4FFLA 2V54A 5EOVA 1RZVA 1SBQA 2BKEA 4LQCA 2A86A 4IHJF 1DUVG 1BHSA 3LOQA 3A2NA 2AKAB 1MA0A 3QFTA 3ROTA 1OAOC 1IRIA 3T34A 1DDIA 2EJTA 2VLBA 3ITKA 1UKEA 4WLVA 2YXDA 2JZCA 3AP3A 1UXJA 4WY2A 3JX9A 1NKSA 1XVLA 5LP6B 1ISRA 2DJIA 4C20A 5JNUA 4Q16A 4OY3A 4R1UA 3DFIA 4IV0A 1WEHA 2H2IA 4W8HA 2ZRAA 1CQJA 4OAOA 1YKSA 2Z6AA 1NQTA 2CL7X 2YV5A 2WG0A 3G9QA 4EG8A 2EHDA 1NUAA 2J3KA 1XMXA 1U9YA 2Q0HA 2QL9A 3A4TA 4B7CA 2ANBA 1YB4A 4KO3S 3UQZA 4XD7D 1EEHA 1BX3A 2YDXA 3B5JA 2O8NA 3QM1A 4RHXA 4C2BA 1XWWA 3LF1A 4G5QA 2BI4A 2ABWA 2UXBB 4DTCA 2NACA 1G2IA 3F2VA 1R15A 2J7PD 2RH4A 2AYYA 5DGCA 4CIYA 1JR3D 3K1YA 3CRW1 1PGPA 2INGX 3K8YA 1WNFA 1Z0UA 2AGVA 2VAMA 4MYCA 1D2AA 1TI7A 3RT7A 2ZCJA 5ALHA 3GJRA 5AJZA 5BSGA 1ONNA 3DP9A 3DDCA 4EY7A 5CFQA 1PYGA 2B83A 2QLTA 3N8NA 2ZYVX 3DGFC 3KQYA 4KV9A 4R01A 4RSHA 5TVGA 1ZL0A 2DF8A 1JGTA 1JIIA 5EQJB 2P2SA 2GBIA 4DQKA 1A9XA 3NWJA 1TQ8A 5KJ1A 3DE6X 3I64A 2GAOA 4LMRA 4YDSA 3G2QA 4BFTA 1XV5A 5BNTA 2WU3A 3CT6A 2HIAA 3G9XA 3IA2A 6NULA 2Y68A 4UBLA 4QU8A 5DASA 5J4HA 3IP6A 4MW5A 5GGYA 5AYVA 3L8CA 3HCWA 3UMRA 1JU3A 4GI2A 5AICA 3JARB 3KQPA 3W9SA 3K8ZA 2ZXFA 4NBVA 3M83A 4FQ5A 2BEWA 3EVZA 2RI6A 4CT5A 1E3DA 2VP9A 5H1YA 1RDFA 2VUTA 4Z9BA 2C2MA 4JODA 1U2PA 1GPBA 2R6FA 3HR8A 4XJXA 3T4XA 5COQA 1WF6A 2Q8NA 5DB4A 4G6ZA 4LVCA 4C5AA 1HV8A 1C7ZA 1VBNA 4RY0A 3KXIA 1X77A 5KSPA 3T99A 1E1DA 3AHIA 1EDEA 5MN5A 2O8DB 3HY3A 3IP8A 4CMBA 1CZOA 5JWRA 2QIOA 4XKJA 1I5OA 4YJHB 5H4HA 5CT5A 4LFAB 4B40A 3OKCA 3I3SR 2ZM5A 4FMCB 4EG0A 2WAMA 1ETUA 3KLNA 1KAHA 5ADUS 2OCAA 1MJFA 3OCCA 4GLBA 3ICCA 1E94E 2BBSA 2W2LA 3FX2A 4K03A 4J0GA 1YZVA 3RFFA 4E4TA 4AMBA 2QHXA 5CAEA 3KQTA 3G1TA 3PL1A 2I2FA 3HKEA 4FZ5A 3I1IA 2CVZA 3RJ5A 4R5MA 3EZGA 1ND5A 2P27A 3RYFB 4BTVA 1MDFA 2VUSA 3I9KA 4ND5A 5AW6A 3OLVA 1CZUA 3U0VA 2HCBA 1E0JA 2CHGA 2FSIA 2P79A 4OK3A 3W3AH 1PEYA 3RK0A 1NP6A 2QPAA 4HH1A 1RBMA 2XUFA 3CC8A 2B1JA 1F6BA 2IPAB 5EKDA 2YVUA 3WICA 1RHQA 3QUQA 3GCZA 4ZICA 1RPZA 4PS1A 1EUCB 4HRVA 4CL8A 3THSA 4EF6A 2CUKA 2G08A 2FWJA 3ZK7A 2L69A 4R2IA 5CA1B 1YMVA 1FK8A 2IHVA 5AKJA 4BLOA 5BR1A 2WZQA 1VZ3A 4WCFC 1K5HA 4FYMA 4MR8B 3DC2A 1P1HA 3K6KA 1MAVA 1UFKA 4MQMA 4DARA 2VC2B 2JLZA 1FRVA 2V0GA 4O1HA 4FD3A 4LE0A 1YJQA 2ZWAA 3DFFA 5FUVA 1VJDA 1HE8B 1TO6A 1W4AA 4F3TA 1GV1A 4Z8YA 2DOKA 3CLSD 2QSUA 1V11A 4JXJA 3CFYA 1VKHA 3I0MA 3ZE6A 1R0CA 1KFKB 4IIVA 1T8PA 3JSXA 3Q7IA 4L2IB 3PNKA 4U7PB 3NWPA 4XGNA 1UJBA 5IVHA 2OAEA 1BIFA 1GPYA 1J2TA 1IWOA 3OE1A 4EKNB 4ZK2A 5A6VA 5K09A 4OLAA 2I4IA 1TAUA 2Y93A 3OIFA 3DTVA 3NTVA 1Q7GA 5C8YF 1ESDA 1EZ4A 4OJYA 4OMDA 3SR3A 5DVZA 5FTNA 5IZCC 1QPZA 4LTNA 1KMHB 4MV8A 1DHRA 4QD3A 2C9ZA 5KYTA 1JAYA 2ZSAA 1G21E 1AZWA 2FWNA 3BTOA 3QELB 1FFEA 4F3YA 1J06A 2VT3A 2YJ3A 2H59A 2ZT6A 3M6MD 1GV0A 2ZSKA 1QRSA 2G40A 2CFRA 3DL4A 5TF0A 3NNDA 2O2CA 3WSVA 2PKCA 5IKEA 3ZZNA 5FI1B 4A7PA 1Y4ZA 3F4BA 4WACA 1P73A 1ZM3A 4HDKA 5JRJA 3WGYA 4BV2A 3JD0A 4LX0A 5IKMA 2WPNA 3KSBC 3BIXA 2WOOA 4TZKA 3VC7A 3TD6A 2E87A 3MINB 5ICEA 3EPPA 4Q24A 1AUXA 4MUIA 1NXXA 3MWFA 3CSSA 4G0UA 2JJQA 2NZYA 4ZT5A 3EW7A 3IPAA 2XXBA 5H3LA 3OX1A 3ZWMA 5JHHB 3FHTA 4W8OA 3Q3VA 5BNZA 5CVUA 1MRNA 3QVMA 1WZNA 4DL9A 1Z26A 5C7YA 3OH8A 4BOYA 1DCFA 1CUSA 3CHYA 1IMJA 3EXAA 2AE1A 4MK4A 4PBRA 4TTQA 1PZFA 4QDTA 4IDFA 3WK5A 4YXFA 3IYLW 3IAAA 3E8SA 3R20A 2QG9A 2BFWA 4ZT4A 3T15A 1E2JA 4RFLA 1IY8A 1YQDA 2Z2JA 3B6IA 4JJFA 4XLZA 3DAPA 1P4GA 3K5PA 4HL6A 4D3XA 4XSHA 3I6QA 2Z2IA 1TZKA 3CUYA 1WZEA 4YI5A 5G3ZA 2FFQA 2HMYB 3AVWA 1A4RA 5B1YA 1F3OA 4KIUA 1Z13A 1QG0A 3E05A 4UEJA 5HCIA 2JKVA 2P4QA 3R74A 4EF5A 3T4EA 5TIIA 1GAWA 4C88A 2B4QA 1V9SA 3I5UA 2GX6A 1CUEA 4JJ4A 3QW4B 2XRMA 1KYWA 2G63A 2PQ2A 4L8YA 4IF4A 3U37A 5FPQA 3NJ4A 1XDGA 1G64A 1MEJA 3V9PA 3EGXB 4XD2A 3L0OA 1QRUA 2BM1A 4RTSA 3KS9A 3LVQE 4AJKA 1QHYA 1K6MA 3SC6A 1GGVA 4RIIA 4US1R 2FX5A 3PDIB 5JSUA 1ZW1A 4TYNA 1E3IA 2BFDA 1BHO1 1ZEMA 1JUDA 5AW8A 1NFRA 2ZRLA 5C4MA 5JYDA 4A6XA 4I99A 4RK1A 1Q0RA 3B70A 3N7UA 5BSWA 4RAQA 4AYWA 2C9OA 3IDOA 1KJJA 4ZT6A 1SA0A 4C1NA 5B30A 5JZ9A 3BL5A 3LWDA 1IN5A 3QE2A 4G5FA 4NMLA 1XCOA 2OQ2A 1M10A 2P2GA 4DDVA 1MFZA 1H66A 1EWRA 1N3YA 3U44A 1HKUA 1Y1LA 2ZS8A 3VAAA 2C8LA 2V4MA 3OJLA 4D9MA 2QGFA 3FGZA 3C8HA 2G80A 3NH6A 3TI9A 2YRWA 3M5PA 3RSFA 4BNTA 1TVKA 3SBDA 3DVQX 2HU8A 4GYWA 4OL9A 5LU9A 1OH7A 4MQFA 4ZVOA 4FEGA 3QIVA 4K8RB 1KVQA 4QJ5A 1P2GA 5BV2P 3OIVA 1FRFS 5HTKA 4OYHA 3HVIA 5FTMA 4ZI7B 3IBGA 3Q7RA 4A5OA 2BGUA 4C76A 1TUGA 1NVDA 4J90A 2V3VA 1PG2A 1Z7EA 2G5GX 3O3MB 3BL6A 1GYQA 3LLUA 1AHNA 1G6OA 1X7XA 1JYEA 2EFHB 3A3PA 3NU1A 4IX1A 1FSSA 1WPRA 1IJFA 2J9YB 4OQYA 1SG6A 2HI0A 2W37A 1GZVA 3GK3A 4C5CA 1YA8A 2Q5LA 3LLCA 4IGEA 5AKIA 4BMXA 2AQHA 3ZE1B 3ESYA 3ZHTA 2C4NA 2NX2A 1CUBA 3GRAA 4HAWA 4M9QA 1DDGA 5GV7A 5KOJB 3ZNNA 1AK9A 5CPFA 4HPJB 2RIRA 1RTKA 4LOKA 1ESMA 1DAMA 2QTMA 1ENOA 1YFKA 3MG9A 4EFNA 3FLBA 4EL0A 5A2QA 3W3AA 3TG8A 1UT8A 3MSXA 3SDSA 3V7UA 5JSZB 1WMDA 3KVVA 3GGDA 2XDYA 2VDNB 4KMOA 5BSFA 5SYMA 1SC4A 1FPQA 3B20A 4EJ0A 4OHRA 4BP1A 4BKMA 3TOXA 5JNWA 5DK4A 3GN2A 1L4EA 2WJ3A 2CYCA 5IHXA 1XWIA 2WINI 1L7PA 2A59A 4OLFA 1SQ5A 1KHHA 4RK6A 4CMKA 2FLKA 5BN4B 2PUVA 4N1AA 1K8RA 1BX0A 1JR4A 4X71A 3I9V1 1HDYA 2O8EB 3IVMA 1G20A 2Y8EA 4IDCA 2I29A 3DDWA 4GP7A 4MINA 3ZDYB 4FFSA 5JDCA 2R60A 3AY0A 2GM9A 3OWOA 4RK7A 3WWEA 1I5EA 3KHSA 4Y2XA 2QN3A 2UZ1A 3PT9A 3GRYA 4PG7A 1XXLA 2XGMA 4NBRA 5LD2C 5E1MA 4ZAVA 2XVAA 2ZB3A 3UV3A 2UVPA 3IHWA 3NI2A 5J2TF 2Q0QA 5E8JA 4KN8A 2GJKA 1YIOA 3BIJA 1E6UA 3R5XA 4YAFA 1S3GA 3TLMA 4KQ9A 1JJ7A 3SVZA 1HRDA 4HWPA 4CM9D 5JW6A 2AWNA 3GX1A 1FDOA 4OREX 5G1PA 1JXMA 2C03A 1A5SB 4CTMA 2GNOA 1J0DA 2WC1A 2A2ZA 2NNLD 1PZMA 2PK3A 4MRSA 1GQFA 4JOCA 1SUIA 4M6WA 5EUBA 3EPHA 2ZRGA 2DX7A 2Y1LA 5IXJA 4EB3A 4KMRA 2WVGA 1IDOA 1Y1QA 3NBYC 3VKVA 1AHPA 2W8ZA 3ZIAA 3CQ9A 2X3YA 2HZ7A 3E8MA 2QV7A 1GRVA 1TYAE 1B0UA 3DR3A 3L84A 4H7KA 2YHUA 4EH1A 2J0UB 4XEHA 4FI3C 4IY1A 2CFOA 1PZEA 2P2YA 4KO2S 4MP6A 2QOEA 3UW1A 1E3WA 3BXOA 3PVCA 4EJ6A 1C8LA 4MWCA 5CJJA 1XCMA 2WA2A 4GMDA 2I6QA 3PEEA 3WMFA 5CDFE 4DJFC 4TTRA 1YHYA 2A9RA 3H2GA 4JAVC 4R71A 5JAOA 4BZXA 4P93A 3GUUA 3TQSA 4MQBA 4GVPA 5FNVB 4WJKB 3NUZA 1YQEA 4KJZA 3ST7A 3HN7A 3B6KA 4KK4A 1B23P 5FBKA 1EESA 3F71A 3DLIA 5ALZA 5C34B 4J2OA 5LP6A 1OHHA 1S0UA 1SD5A 3EIFA 3FTNA 1UXGA 4Q9HA 1YNOA 3R4VA 2ACEA 1H6CA 3QEKA 1CQPA 1RYHA 1UPAA 1TKBA 1UBTS 4OXYA 5J2UB 1J99A 3K5IA 3CLUC 4TTJA 3W8NA 2Q3LA 3C14C 3RYCB 5FWDA 1TU4A 3NATA 4TQGA 4KIGA 4ZI2A 1GCGA 2NLOA 4DV4B 1Z8FA 4CODB 2ECKA 1E7QA 3LCUA 1XYVA 3D54D 5BNFA 1Z4KA 3ILVA 1JI3A 2AR7A 2X42A 4LOIA 2UU9B 2E0IA 3DPSA 1FYVA 4X91A 5A62A 6PFKA 1R0RE 2PBLA 3PLNA 5IC6A 3AI1A 3W5BA 2PWBA 4Z1MA 1NW9B 4QLAA 3HDQA 1G55A 4BNIA 5C37A 4MICA 4PIMA 4YMUA 2BPOA 4RVHA 1E4EB 1WP4A 1UADA 1PNQA 1EU1A 5DHFA 3S2IA 3WBKA 3G9ZA 2C3YA 1JILA 1OA1A 2GZHA 1OUMA 3R6DA 5JVDF 4DDKA 1WVMA 4OQNA 1BJTA 2OXCA 4QVKA 1EFRA 3FFXA 4HWTA 4R68A 3IUSA 1S2IA 2VR1A 3JARA 2JHCA 1MB0A 4GBED 2Y66A 3C6BA 1HDRA 4MW9A 3FVVA 1E9DA 3ZH9B 3TE7A 2QL5A 4CKCB 1C5KA 2PX5A 4KWEA 2C82A 2V5UA 1GAQA 2PDAA 1PFYA 1TQ6A 3B7PA 3EYAA 1WKBA 1U3DA 2IY9A 4PRZA 4R2MA 3CN9A 5AVUA 2R4TA 4P22A 3B2NA 5JFTA 3EZNA 4C0KA 2E2WA 2JLCA 2PZMA 1MRZA 1XRQA 3L5KA 3MMXA 2O8DA 4ZYUA 2CUTA 2HO4A 2IYQA 4W4TA 5EJMA 1G38A 2EGGA 2B61A 4TSFA 1TXGA 4Y9SA 1NMSA 5AKEA 2YC2C 1HYQA 3DMGA 2PR7A 1WPQA 2EKBA 3KKEA 5T4HA 2WHPB 5FA5A 2VWQA 4NENB 3NO4A 3UXHA 4DWJA 3QTLA 4GL4A 4NY1A 3BBLA 3MB5A 3OZCA 3OZIA 5C1IA 3S2UA 3UJPA 5KJFA 3RC3A 4XYMA 3QLTA 1G291 1HM5A 4IX9A 1TK9A 2FYTA 3BGIA 3K2EA 4KWTA 2YZ2A 1BAPA 1KK0A 1GL9B 4KXWA 3PTLA 4FJ0A 4UMFA 4V02A 3RYFA 4EPXA 3K72B 2C92A 3TG2A 1E66A 1HDZA 4QPJC 1Q92A 3G02A 1OPRA 2CXUA 4P54A 2BLLA 2ONYA 3HJTA 2GN0A 3MN1A 3PJEA 1AGXA 1J9EA 3IRUA 3C7TA 3K9NA 3BJMA 3QMWA 4PE5B 3ZCSA 2HWUA 5LDGA 1CUDA 1EYZA 3N2EA 1GP2A 3HDGA 1S9HA 1X15A 4NK4A 2X0FA 3GOQA 1YQQA 1Z4NA 3JRNA 3Q10A 4TLEA 1W1UA 1IU9A 1SC3A 2M2IA 2Z9BA 3I04A 2E1PA 4K9KA 4EK9A 2QBYB 1N8SA 1YS1X 2ZFUA 3ANNA 1X7HA 5EAIA 4GGPA 5CA1A 1YC5A 1CJTC 2C5SA 3AMVA 1VL1A 3EJ6A 3C3DA 1IVNA 3TUIC 4B3DA 4EGCB 2P67A 4MR8A 2AJCA 4MYUA 4NARA 1CZLA 3GLHA 3SF8B 4F2GA 4OG2A 4EFMA 1JEJA 1W0JA 3G0OA 3HM2A 2PZKA 3WGVA 1MT3A 2OENG 2FPLA 3IDAA 3L79A 3WRWA 4IFTA 2ATEA 4JBNA 2R84A 1RABA 4D3YA 4Z49A 4DSUA 3AJ8A 5EMKA 4MIYA 4KQ6A 1Y42X 5A6SA 2F8SA 3FN4A 2IELA 2Y6UA 4AY3A 1FNSA 4L2IA 5HOQA 5AUQA 1U2TA 2ZUVA 1RWPA 2VF8A 3C7CB 5I3ZA 4R1QA 4REOA 4N3GA 4HV4A 3TLYA 5FPTA 4F6LA 1CU1A 3VPCA 3GLFB 3OWXA 1OMOA 3EB9A 3O1JC 2CKMA 4RXMA 1KC3A 4X94A 3RT9A 4G0VA 2X8JA 2C99A 2V6JA 2P77A 1JLRA 1U8EA 3Q1LA 3QELA 4UPDA 4QYWA 3CWZA 4Q9KA 4DB2A 4WZAB 1R8XA 4X8OA 5JECA 4AY6A 4K46A 2P5UA 4O4JA 4QWWA 5D51S 3EGOA 1EM6A 1C9NA 2HJSA 3HZZA 1B26A 1GPKA 4BNYA 4H7PA 4NEHB 5CT6A 2OYRA 3KQKA 3R9WA 1UOPA 1Q2XA 2BFNA 1LA2A 1MC1A 3BREA 1BU8A 1E0SA 4AMYA 2CNLA 2D62A 2G1JA 1LJ8A 1OB5A 1EFTA 2D2VA 2R85A 4IPTA 2JI4A 4V24A 2OORA 1MO6A 3MINA 3K73O 4HSEA 4RWZA 2GN1A 4ZAZA 4PPGA 4B73A 3X1DA 5DRTA 1UBLS 3T7TA 2JCXA 4MGZR 4QDJA 4JP8A 1T3TA 4M0EA 1KFEB 1RIIA 4ON9A 3ZHBA 2PXCA 1DQYA 2FWMX 2IXAA 1IMOA 4AWBA 4EPTA 1T3GA 3DE4X 1LRJA 4RS4A 4MS1B 4N7MA 4IMIB 5G0VA 4J3JA 1L7DA 4WY8A 3T3MB 2AF4C 3USCS 2QVLA 1DRWA 2DWPA 2P9CA 1O5TA 2IUTA 2XAAA 3E3LA 3FZEA 5G40A 2JDIA 1UPUA 2CNWA 4ESOA 3KQMA 5JFOA 1KEWA 2AJTA 1D5WA 1WM1A 2P35A 3ANXA 3SYKA 4RXUA 2YHBA 1EWYA 3IQFA 3ZXYA 3ONEA 3PXDA 4PR0A 3WLAA 1LK7A 1KBQA 1F48A 2GMWA 3AF5A 2D2XA 1S3IA 2Q5CA 3HH8A 2I7XA 2B2NA 3CLTC 2XE7A 5DXJA 5DP1A 4B31A 4X20B 2WMYA 4ZZ1A 4EQZA 2ONKA 4F9FA 1F0NA 4A15A 2P0EA 3U26A 3V80A 1YK1A 4HKTA 1FP6A 2PXHA 4CT0A 4URYR 4JDUA 5HF5A 1TM4E 1KFBB 4HGYA 5H80A 1OLUB 3GLUA 1ZK0A 5JH7B 4LF5B 1DBQA 1IXRC 1L7MA 4HDCA 3U13A 3TF5A 1MHPA 1MPXA 1V7CA 3EA5A 1DKOA 2WMOB 1RMYA 1NBAA 4N7RA 2H2FA 2YR0A 2O8BB 1DPGA 1JDJA 1ECLA 3T9BA 2Q3CA 5DGTA 5DX0A 4DDUA 2R8YA 2WIFA 5K0LA 2VQFB 2QMOA 1OZGA 3AJEA 3P9NA 4PZAA 1CUZA 3K16A 3PDIA 3SDBA 1DG3A 1XVTA 2HFKA 3QUAA 2XKJE 2V6BA 3BQMB 1C1YA 1ZBDA 3PHCA 3RUDA 4DYVA 1OLSB 2WJAA 2JIPA 4HLDA 4F04A 1H6BA 3M7IA 1SIOA 1MG0A 4TVOA 1IZ8A 4K87A 3RI3A 5L3SA 1NW3A 2AD5A 4KI0A 5FUWA 2BMEA 4DLVA 3K70D 1F1JA 1XQWA 1Y9AA 5C81A 3N2IA 2BFAA 1H6DA 4KGDA 3BA6A 4X90A 1YTLA 4JL8A 1SU7A 1YI8A 4DMMA 4BRUA 6YASA 1I4OA 1PEDA 4E4RA 3G2IA 4PG5A 1PJSA 4EVIA 1I2CA 2V3WA 3FDIA 1Q15A 4HAVA 1SCJA 1R74A 2B69A 4EGAA 3EF3A 1C9YA 4GXNA 1PZHA 2Q3EA 4O8CA 4OHXA 4TRNA 2BYTA 2CLLB 1FVHA 3DG9A 1Z2DA 3HVKA 4OQMA 3NEJA 4KXLA 3HBAA 4D98A 5BMVF 4DNOA 1L6RA 1O4WA 3GJ7A 4BLSA 2ILVA 4FW9A 1AN0A 4JJ8A 2XMZA 1A7AA 4TMVA 3AO0B 5FBZA 3WDSA 2I7CA 2UUAB 4CV3A 2Z0MA 3D3EA 4TQAA 2XVXA 4ZI7A 3BH6A 3OM1A 5A9TA 3NVDA 4M0PA 1MX5A 2HDOA 4U39A 3D7MA 4Z1OA 1JHQA 1HL7A 2D8AA 3EXEB 4HPXB 4CV1A 1ZIYA 3OPYB 4J4HA 1TA9A 2COUA 3HFGA 5KSYA 2H2WA 4CKWB 3QU2A 3SQXA 3HNRA 2XECA 2IXFA 4LCBA 4M8SA 3UO8B 2GBFA 4L74A 4TV8A 4UVDA 1YOBA 4KAJA 2VT6A 4I2NA 3Q7SA 1GYPA 1EA7A 3T5TA 4B3RB 2OQVA 1HBJA 3RSCA 4EMUA 2CVHA 3A37A 4YJFB 1MB9A 1WW8A 3ZPXA 2JA2A 3UYKA 1V3TA 3CINA 4MLCA 2HJHA 4HEA1 5B6IA 1O58A 4WZBB 5JSZA 3AUJB 1SKAA 1UEJA 1XQ1A 3NORA 2CLMB 5HE9A 2PO5A 3I52A 2VNJA 3QV1A 4WH0A 5K0BA 2C3UA 1AMNA 1LF0A 4MI9A 5KVVA 1MJGM 2A94A 1M9NA 5GTDA 1E5VA 2E1RA 3LGXA 4G1MB 4TXHA 5ECWA 5TPZD 1M7HA 4CBVA 3S5UA 2NXWA 4V3BA 4Q1AA 3PV0A 2OC9A 3M4NA 1Q84A 5CIQA 3FNRA 5BSVA 1L1EA 4NEGA 4J4TA 4BBAA 3CNHA 5DFAA 2D00A 4J1NA 1MU0A 3PHLA 3IMFA 3VPDA 4Y2QA 1K75A 2ALJA 3RRMA 1IN6A 2HXGA 2PX4A 3SCZA 1U6IA 2YC4C 2ZWVA 1U5BB 2C0PA 3CX7A 3LUAA 2H17A 3VBEA 3DMRA 2YNMC 1UIRA 2CMGA 4M9RA 5I8ZA 1KQNA 3VKGA 3WGGA 1FVFA 4A6DA 3CUSA 5JI2E 2HREA 5LA6A 2PANA 1P7WA 1T6ZA 2FN3A 5JS7A 1UQTA 1KZ9A 1NJ1A 4J16A 3H5IA 4XB2A 2CBZA 4KQIA 5GIPE 1MFPA 2CF6A 4O1MA 3WYBA 1LPNA 3ELWA 4NQRA 4I5FA 1FY2A 2QTLA 3N2NA 4YP7A 3RRZA 1ORDA 3SM3A 3UGKA 4DFDA 4UDNA 2HBQA 2X6RA 1KOLA 5JZMA 2PMWB 4RHFA 2GBGA 3V55A 5KYYB 1PQYA 1ENPA 4IIJA 1YR2A 3FCAA 3W7BA 4CKYA 2X0KA 2MYUA 4HMQA 2A4KA 4GSKA 3ZHCA 5EZQA 5FHQA 2BUAA 3V7FA 4KTVE 3WBJA 3AHJA 4F4HA 4AUMA 4K2HA 2WKWA 4WK2B 1Y4SA 1T5DX 2Q9AA 4NMXB 5EP1A 3PJGA 4YCBA 3PEUA 2W2TA 3W8FA 1QFJA 5EJ7A 2A5LA 3B78A 3BJRA 1C0IA 1YV9A 2HH9A 1L7EA 4NS1A 1SVLA 1QK5A 4DMFA 3FRHA 4CTOA 1KMCA 4R6XA 1DXYA 1PTJA 1LU9A 4KQKA 5FNVA 3HWWA 2PSFA 4J94A 1FNDA 1H2AS 5JASA 3EEIA 3WK4A 3SPXA 3WRXA 4Q9JA 5BV1A 3L02A 3LUDA 3SSMA 5B1EA 4M0LA 3VTFA 1EINA 1WDMA 3W90A 2GZSA 5JCOA 3ILHA 3RUHA 3FLEA 1VYVA 4MKXA 1DKLA 4RTNA 3FSGA 1JIJA 1UDBA 3Q8WA 3LDUA 3K09A 3LKZA 5A5VA 2FETA 1E6MA 1D04A 1Z2PX 2KHZA 3DEKA 3QYPA 4QBGB 4PCUA 4U8HA 3UOGA 4BP9A 5J2UA 3FMPB 3GVXA 1ZPDA 2Z2XA 4E88A 3OFSA 1PR2A 5BSTA 1NF9A 4ENWA 4HNRA 2DTXA 2O2GA 1LBSA 3JAWB 4CCYB 1OW3B 3BC1A 2R6JA 3AQ4A 4ACAA 5CCXA 1ECBA 1I1HA 4RA9A 1SOUA 1FLAA 5KWJA 4RMJA 2I5PO 1RPJA 5EE3A 1NWCA 4RIEA 2FW8A 1COWD 2QGNA 4LRQA 3WTBA 4ADSG 5ITVA 2DSNA 3GG2A 5E4TA 3QVWA 4AL4A 2EFJA 3IVAA 3FH0A 4A0SA 1HDCA 1HWYA 1L7VC 2EFYA 3G2NA 2QPOA 2GPSA 2WU0A 3OCJA 4YEDA 4C2UA 2GPNA 3AOGA 3FFBA 4B3IA 1HQKA 3MBKA 4ZEMA 3ROQA 2IX9A 3CPSA 2XXJA 4Q3NA 5A4FS 1XDUA 3L1IA 3DE0X 1L4HA 4FHEA 2VDUE 3WZLA 1M72A 2WFLB 1V43A 3HJUA 3Q72A 1TC2A 1JLLB 4PBTA 2H31A 4U5QA 3UA4A 1WSBA 4CKCA 2YUTA 3IIIA 1KO7A 5CB0A 1U1GA 1Z5VA 1L4MA 1E3TA 4YNBA 4DCUA 1TLFA 2BKAA 2YFHA 2GPWA 1ZM9A 4DIKA 1FBTA 4DMCA 4HFRA 2QTVB 1FMCA 3ELYA 3P2YA 2OD7A 4TZ6A 1FYWA 4IVPA 3HLTA 2QN1A 3IO3A 3OIGA 5ENVA 3LUJA 3GFFA 3S1AB 5LQSA 4TS4A 5TEVA 1J8YF 2WHPA 1IE3A 1KYTA 3CB2A 4PZLA 5K3SA 4NENA 2CJXA 3V8BA 3BTUA 5HOEA 3IKTA 4QLOA 1X9HA 2AFIA 2WIDA 2YDYA 2FN4A 3NHJA 5B6JA 3H87A 3TTWA 2GAFA 1JHDA 3KZKA 4X65B 1PNRA 4WECA 3EFEA 1YASA 3S5JA 5HUQA 2JZNA 1XZDA 1P3DA 3ECSA 3EZLA 3OHSX 4R7GA 1EGMB 1BC5A 1UM9B 1I3OA 1XTRA 1UJMA 2FA9A 2AOTA 5SZIA 1Z8NA 3TMYA 1PLJA 2GZ3A 3BIWA 2H2AA 1ZGHA 1MH1A 1VL8A 2YW2A 3RHFA 4D9HA 2GEVA 4DG8A 3FTDA 2R9VA 5CVEA 2AH5A 2M98A 3G2MA 3PC2A 4ISBA 2C88A 3K15A 4A0FA 2QDXA 4QX6A 2QX6A 4Z54A 2OHGA 4OB8A 3UJ7A 5I5GA 1ZVJA 2JFPA 2R8PA 1K98A 3H05A 2P11A 3C48A 3U17A 5J4KA 3SYTA 3HRHA 1V5WA 2O2JA 2PYIA 3K9GA 2A9QA 2QBYA 4G89A 1E3JA 2OLKA 3PQ8A 3SHVA 3OEEA 5B3JC 2DBQA 2I6GA 5K3OA 2YFQA 2PJZA 4AN1A 1CJVC 1GSAA 1FSFA 2JD1A 3QKIA 3SF8A 2JFYA 4M88A 3F1KA 3NG1A 5JSQA 4WFQA 5K20A 1Y33E 1SHKA 1XAGA 3CXUA 1KOJA 3ANMA 1ZOOA 3HXPA 4RFVA 4RTLA 4G5XA 4N01A 5BPFA 2HQ1A 1T0PA 3A4LA 4AB1A 4C14A 1YTUA 1J23A 3DAFA 4RJLA 3TN7A 2C5FA 1NJ8A 2JIQA 3IAEA 2ZYWX 4RORA 5LCXA 1U9ZA 3WHKA 1VYHA 4PCAA 5HK9A 3BGOS 1ZG3A 5IM4A 1ABFA 821PA 1CNMA 5L4NA 4NZNA 3N6RA 3ZXIA 1P2FA 3V8EA 3JALB 1E9AA 5DOZA 4LAFA 3WAKA 3GLFA 3DVSX 2JZOA 2AT1A 4JBIA 2ZJAA 3VNRA 3MCZA 2BCGY 5JMOA 3G1UA 1KI9A 4CWAA 2EZTA 4BP3A 3LX6A 4S35A 3D5EA 4WZAA 4GPD1 3CWQA 4D4HA 2AZDA 1GPDG 1YAJA 2ZK7A 1MZVA 4AYTA 2OBXA 4V0RA 1UBUS 1QK3A 2A3NA 5AVOA 5ALPA 3ZV6A 1NN5A 2ETXA 2R5WA 3OE4A 4MMYB 4UZEA 2ZTHA 4JUAA 1IUOA 2G8NA 2GF2A 3UK6A 1V5EA 1HF3A 4ZVRA 4DR2B 4BNFA 3CW8X 1A4IA 1PYOA 3GL9A 1Z0DA 2K2WA 3SQDA 4E15A 1GM5A 1W36C 3E22A 4GE0A 1CJBA 2O2IA 2V7GA 3IJEB 4RE6A 1QP7A 1U0NA 3ESBA 4LYDA 4Y2HA 4IQ4A 3LIPA 3V2GA 4GO1A 2FV8A 3UWKA 2VZ0A 2ADFA 5CFNA 1DBIA 4PR3A 1F38A 2I34A 2QDKA 2AIRA 5KQGA 2G07A 3H5RA 2AW3A 1IXKA 4RJTA 4MS1A 5BORA 3H1EA 3EIQA 4B85A 4CV2A 5K0EA 3DZJA 4TWBA 1R27A 3CO5A 2G25A 4EHHA 3CW9A 3K7EA 5C3MA 1AX9A 4EYEA 4P7KA 2XBUA 2FKAA 4PPYA 4E1VA 2PL5A 1I7PA 3MTBA 5INTA 3HR4A 2W6ID 3EEOA 2ZBGA 4WGFA 3ENWA 4GG1A 1XVVA 4EG3A 2Z5GA 3H9QA 4QPNA 1RLIA 1MO2A 1O9GA 2PGXA 4PVCA 1XCBA 3WR5A 3SHQA 4HDSA 5JRDS 3NONA 4J0CA 2FN8A 4X20A 2GPAA 2P1DA 1SG0A 2KB0A 3IP3A 3U4IA 5DCWA 1JSRA 5DYYA 1Z5UA 5JLAA 4ENUA 4DB4A 2B9EA 3HMQA 4GZ5A 3RS0A 1OLUA 3FPHA 2HSZA 3CH6A 4OGKA 1A2BA 1EE1A 3EIWA 5CW2A 1U80A 5CVJA 1GPJA 3SHOA 4XWTA 1C8BA 1YVDA 3E81A 1OT3A 1NUUA 2GQ0A 2FNAA 2J67A 3UMVA 4YECA 3SJZA 3SJBA 8OHMA 3H6HA 3PE4A 1Q3KA 4IUCS 3WKEA 3G8BA 2V8BA 4W5HA 4WKGA 3GGJA 1TJ3A 4O4LF 4QGGA 1RHUA 5FUMA 1KVSA 4XXHA 3DW1X 4FX5A 4TTSA 1JTVA 1P91A 5E7IA 1M2OB 1PFVA 4K6HA 1OLSA 4JP1A 3ITNA 1SVIA 4BO2A 3T5PA 1KEZA 2I9PA 4OJTA 2EKPA 2H85A 4PLGA 4PS0A 2Z56A 4U6SA 4EKDA 4ZIRB 1HEUA 4AKEA 2Q1UA 2QT9A 1AJEA 2C9BA 2O14A 1KE2A 1V8OA 1O9HA 5L7TA 1XX6A 2EDAA 4I1OA 3LTNC 3TB6A 2D0OB 1CUJA 2C2GA 4OGGA 2AKEA 3DYVA 1B73A 4P3KA 4WXHA 1VPTA 4JXKA 1PDOA 4FBGA 4V0QA 1NZJA 3RHSA 1JJFA 5I45A 2FQXA 5F5LA 1YGPA 4A6PA 1Q74A 2WPDD 3WZMA 3CX8A 1MV8A 2SKDA 2EFCB 4G4IA 4H4DA 4J1TC 3AI7A 3RVPA 1HTWA 3Q6IA 4FDMA 3DOUA 4NFYA 4XH9B 4PO3X 4L5YA 4QREA 3COPA 3CX6A 2W93A 3DDZX 3ZZMA 1XMPA 3KVNA 1TO1E 4GQAA 3OLZA 3ZY2A 4ZI3A 5LL6P 2W6QA 5FR1A 4DGSA 3SKYA 3R77A 4ER3A 2XB6A 4EIWA 4ENTA 1Q0TA 4PGHA 4BNHA 2VRBA 1QVVA 4Z4HA 1Z5WA 2VHZA 1TC1A 3IQDB 1CY8A 5EERA 4XSGA 3BJIC 1WVGA 3Q0EA 3HDJA 2BFFB 3QVUA 4F97A 1EXVA 4G0WA 3EXEA 3B6ZA 4WFJA 1IJKA 2BHSA 4CVNA 2DWCA 2ZRHA 4CKWA 4ZGBA 3U4QB 2WFMA 1N5DA 1NN1A 1SXJE 1U8CB 1BD3A 4LUCA 3HXMA 1RWVA 3O5AA 4URFA 3MM4A 1I1QB 1ZOIA 2NZXA 3M4JA 3RO7A 4DQUA 4YJFA 4Y18A 2IODA 4YLGA 2Z6VA 2JGRA 3D0KA 2VP3A 5AKHA 3N7TA 1E98A 1SFRA 1KQOA 5EWLA 3FG9A 4WZBA 2ECOA 2WLTA 1QF6A 1QDLB 4RKEA 2R6AA 3KJFA 5A0FA 5ARCA 4OL0A 3KAPA 4LXQA 5CNKA 4B87A 1EP9A 1IIBA 1PJTA 4JCCA 1IEVA 4UEQA 1QVRA 4BFUA 5BRAA 2BD0A 1OY1A 2RDMA 3I4FA 4NZMA 1PX0A 5DX8A 1ZHHA 3IPXA 2HEIA 3CUTA 1K3FA 3GAAA 3AIIA 3QRWA 4Y8VA 2XE6A 1HDXA 3OC6A 3NBKA 4JHXA 1IUNA 1OFGA 2CEKA 2Q1YA 3NVAA 4YRDA 1ULHA 2DY0A 3BDVA 3EPRA 1E2MA 4MAFA 2NXNA 4WK4B 4FLMA 3PWZA 4B47A 3G2LA 4DG9A 4MPTA 1D8AA 1KPHA 3WLRA 2F3UA 2HV8A 4C0WA 3TVDA 4D74A 3KVYA 3PWSA 4B9EA 3O2NA 1RWXA 4BGVA 3ZZ1A 3THRA 3ZVNA 3FNFA 2B78A 3NW9A 3COWA 3RHZA 5KCZA 4EITA 1NJ5A 3DVRX 4FVTA 4JL5A 5GJVC 4OHVA 2OHVA 1L5RA 4TL6A 3CLVA 1RKBA 4Y2YA 4UVHA 4BNXA 1IFXA 4R9SA 1C9EA 2RJ3A 1T5IA 2XCIA 4HI0E 3JATB 3UWDA 1BWSA 4WE3A 1LVGA 3OOSA 2ZKLA 4L3WA 4LZAA 4Y6GB 3Q15C 3AF2A 5KYYA 2ICAA 3AF6A 2PUWA 1V3VA 4NPCA 3H11A 2D7DA 4P58A 3QVXA 3UUFA 1J25A 5B3LA 1F8YA 4BJ1A 1HE4A 3D4NA 4MYTA 4JI6B 1AXRA 2HQRA 2DECA 3I53A 3DTNA 4GHWA 3JTEA 1KY2A 3CNOA 3S4YA 5IX8A 2HCTA 3MCUA 4D99A 5C7OO 3THWB 4J49A 4K28A 2GS9A 3W9YA 2HWWA 4Q4DA 4ND1A 1Y8QB 3F9CA 2BHNA 3L7JA 1FFDA 3NPAA 3LQQA 2X9GA 3DCJA 4FXPA 3Q7PA 4QARA 3K6SB 4NCBA 1L4BA 3I2KA 1Q83A 3EOZA 3GVIA 4JT9A 3ANYB 2CFCA 4OHUA 4YDHB 4ZCSA 4DDMA 2IPXA 3KCNA 3LFHA 4S2UA 4EJ2A 3RC7A 3OAAA 4GRIA 4ZCLA 3TPZA 1ZGZA 4LZPA 5EKTA 3ES9A 4MVJM 2OAQ1 5FOUA 5TV2A 4BYGA 3EVEA 1E5LA 4IKEA 4TV9B 1ISMA 4ATNA 4LEIA 3KKKA 5GAJA 1N0UA 1D2RA 2QMQA 3BK2A 3IVGA 1U2GC 2H0RA 3P9CA 4KXFB 1V1MB 4IVNA 1RNLA 4Z0HO 2ZI5A 1N7HA 3CWCA 3KKMA 4ER7A 4IWNA 1PZGA 4JENA 1FW6A 1W8IA 4NYJQ 4L50A 1TZCA 3UHFA 2I80A 4DR7B 1WG8A 1Z08A 3TMKA 1MPTA 1S89A 3ZBTA 3RIEA 6ABPA 2IOFK 3ZZUA 3ETGA 3LY7A 4UHHA 4YJGB 3GPDG 2O3JA 3JAWA 1NA5A 1ODTC 1X8XA 1KU6A 3GV0A 3GA0A 4CCYA 4OQ4A 4J2HA 2VP2A 5JH7F 1MX9A 2W6OA 1PLLA 2VJNA 2P2NA 3LV8A 4LVUA 3TRFA 3RJ9A 4QBTA 2OGSA 4XZ3A 5CMLA 3WBBA 4CM1A 2JAUA 2OECA 4N0EA 3UBTA 2JCGA 5JMPA 1D0VA 2R7NA 1QFSA 4ZQBA 4D4IA 5EJ5A 4LZOA 5GVSA 4ITVA 4RD0A 1MP0A 1QGDA 3DHVA 3GLSA 4FR2A 3PQFA 4NG5A 5EY5B 1YT5A 4IM7A 5TMBA 2JKYA 4K9MA 5DMXA 2FEAA 2N1MA 2J30A 3NGXA 2QZ4A 4GBMA 4ALIA 4PFJA 4MI1A 4GMXA 2ZSBA 3N2YA 4U2KA 2IOQA 1U2DC 4N18A 3TW6A 3V2IA 2H65A 3PP8A 4X3CA 1KDTA 5DP2A 1PQPA 2RB4A 3ZCXA 3M0EA 1O6ZA 4D26A 3PEYA 2WFLA 1L5HB 2ZRDA 4QEKA 1JLLA 1DQNA 2IUFA 4KFSA 1DO2A 4ZAYA 2DFDA 5IXYA 1KP9A 4N3BA 4UUMA 1FP1D 1PE0A 2ZYGA 4KGVA 4JJ6A 4PLFA 4QGHA 5TGTA 2QE7A 4BQRA 3EPJA 1ZS9A 4UVEA 1GPMA 5HFNA 1ZJZA 2D8MA 2QTVA 3ROPA 5BT8A 1ORVA 5JNSA 1IQ0A 3NBFA 4W5NA 4TXNA 3N2GB 4ME6A 2RH5A 2QX4A 4R8SA 4CXMA 1USUA 2AXQA 4MW7A 1TYCA 4UM5A 2WY2D 1TT7A 3S1AA 3NP7A 2GXAA 4MV0A 2EG5A 1C7QA 4RGBA 1F4LA 3GBVA 4R16A 3VNBA 5B55A 5BSEA 5IVPA 1QZZA 1VL6A 1ZBQA 3BFVA 1JEQB 1XWFA 3OUTA 1Z63A 4PRYA 3O4FA 3KKPA 5LQDA 3U3KA 3KHKA 1IQPA 4FOLA 2I1QA 4HH0A 1L7QA 2LRHA 1POXA 4LJRA 2FMKA 4AAYA 4KK3A 5KYXB 2BEJA 2BH2A 2H1RA 2Y1CA 3EIOA 5KHAA 2NV2B 1BVHA 3QLVA 3HO6A 1UM9A 1P7VA 4P3YA 5CCBA 3L4BC 1ID1A 3ROFA 1TIPA 3L6OO 3UV7A 1U1EA 2WYOA 2WWHA 2CE7A 1G3RA 2ZUUA 3VO2A 3IPYA 4PWYA 4EW1A 1L8LA 2AEEA 3CRNA 1E4OA 1N0IA 1QAQA 1DTWB 1V1JA 3RVRA 1EQAA 2C4WA 4CM7A 2H63A 4ETNA 1CR0A 1W0KD 5KOHB 2OFWA 4JBHA 1UXKA 1XLTA 1ZMXA 1CDOA 4JLPA 2I9KA 2P9GA 2XCQA 5H4GA 3H04A 2HWKA 2AKYA 1XOIA 2AOUB 3EBOA 1VIMA 3QYAA 4D81A 4IG9A 4PSKA 2IYZA 3A28A 3JQ9A 3D9QX 3U80A 2C97A 3LYUA 4Q3BA 5HQJA 2ZJ5A 1O03A 3KQSA 3PHBE 4XGKA 3RF6A 3UAXA 1RRGA 4GW3A 1FSZA 1TQHA 4JC4A 3CVWA 3TTSA 1NRWA 5DTMA 1A0OA 1U2QA 2WAAA 1BQ3A 2G4CA 3L6CA 4JWKA 2CHVA 1P5FA 4A3SA 1H2ZA 3LCMA 3B9BA 1N2CA 3IP5A 1T24A 2XCLA 5C31A 4US2R 2CLDX 2VH2A 5GIOE 2O54A 3PXBA 1XD8A 5FFFA 1E89A 1OVMA 1XQ9A 5G2OA 3OOHA 4QGFA 2GO7A 4EKYA 5DYGA 4A2CA 1E60A 3JALA 4NH0A 5AJHA 4LDJA 2IHJA 4ZV7A 3RYIA 1KF0A 1PFWA 1X1BA 3GRRA 4YQYA 4BGDA 1JQ3A 1E2NA 1GGFA 2FQYA 1T1RA 1LSOA 1WUJS 2JPDA 1M6EX 3CLSC 4NAHA 4BVEA 4C7MA 1LBTA 2CSXA 1SUSA 3VKHA 2M6KA 3DKIA 1SQFA 4P4NA 4S2EA 2NSHA 1CZHA 3L06A 4IMPA 1YZGA 5HNKA 2R4UA 1PR9A 2EU8A 2V4UA 3OQ1A 4KXQA 1L8AA 1NYQA 4PC6A 4MV5A 1RC0A 2XRZA 3FW1A 2YL2A 1TAQA 2NQ8A 3QVSA 1VG9B 2NZ8A 4I55F 4KWIA 5LZ7A 3ZVRA 2VO1A 1UDWA 1GKIA 3R9XB 1E3QA 2C1EA 2QZZA 2B7LA 2XHEA 1H23A 4WQMA 5D86A 2EXXA 2XIQA 3J7TA 4DEXA 4IUYA 2OAP1 3K9BA 1SU8A 1W5AA 4W5TA 2ZJ2A 3TQRA 3PRJA 4R7TA 1TK2A 3O47A 3CNLA 1Q2UA 2J6IA 4ZTZB 1DAGA 4FLFA 1ZEJA 4KSCA 3KAQA 3P9YA 3UUGA 4D8UA 3I3OA 1N1DA 3VZPA 1NI4A 3RASA 1ONOA 1UZAA 4XSVA 4D42A 5A7FA 5M3BA 1SRRA 4I6EA 4BVKA 4TMYA 1R16A 1YB2A 1U3UA 1YMQA 1NLYA 4WEOA 2GPTA 1M7BA 4M9CA 1RYZA 4PNZA 3VU1A 1VBMA 1X1DA 3DAYA 1W25A 2BFOA 1P9RA 1YR1A 2VP4A 2KBEA 1XPUA 2ODPA 2CMHA 2VNAA 5C32A 2X1MA 3LDGA 5CPBA 5AJYA 4LZJA 3A32A 4YPFA 2LUOA 1Z4OA 4RKWA 3RUFA 4MYRA 1JDVA 2ZRNA 3MJFA 2ERCA 3INYA 4QU0A 3LZDA 3WQSB 4D6YA 4QJ3A 2Q50A 4BV9A 2XUAA 3IHLA 3I6MA 3Q8KA 1VCIA 2ZE5A 2XOKA 3BCUA 4XM1A 4LFCB 1E6WA 4Q12A 1DJMA 2I4LA 5I7AA 4RZQA 5DN6A 3L8EA 3MCAA 1OGYA 5CDYA 2P9FA 2XNDD 3MXOA 2FQQA 2YY6A 4R8RA 4QHYA 5JR3A 1R9JA 2ZTUA 4TWIA 4QBFA 2QZPA 3M49A 2CL0X 5FL7A 3QPUA 4ALLA 4DM7A 4NRDA 1NXOA 1V7QA 2NXCA 4TSKA 3T1NA 4EI7A 1QR2A 1X7WB 2AN9A 3U48A 4Q15A 2XMQA 2YUIA 4WASA 4ZIRA 3T3OA 1DIHA 1WQ3A 3CUUA 3H18A 2ZAYA 5EJ4A 1ND6A 1M34E 2DHQA 2B7CA 3I37X 1UMCB 2NVWA 3BYZA 2EKDA 4MWZA 1FE8A 4WCFB 2H7XA 3RS4A 3VTKA 5HYVA 1QFYA 1T8RA 1CBUA 1AUOA 1US8B 3BTSA 1CSEE 3BWMA 1HQCA 3QLUC 3A0UA 3ND7A 4JP3A 2DWUA 2C4VA 3A1CA 3KOWA 1M76A 3PSHA 4IBOA 4X7PA 5FPPA 5B4UA 1NKVA 4RZ3A 4YRSA 1UFVA 1ZAKA 1NYTA 2HF8A 4A91A 3AV0B 3RTBA 3GRVA 2EFDB 3EK2A 3FHCB 3W6OA 3CNQS 2GBPA 2W2MA 3JYPA 1VI2A 3MHPA 4LX8A 4MROA 1JG7A 2R00A 1ZRNA 2P4EA 4Z2YA 4R9RA 1KORA 3ZU2A 1Q3TA 2A1UB 3MAGA 3ETLA 4A8TA 1BDHA 2MINB 2B3DA 4W1RA 4DA9A 4RETA 3H9GA 1Z17A 2BFFA 2X4DA 3B9PA 4PXSA 2WWYA 3HWX1 1VXRA 5JEEA 3E7DA 4QG7A 3O4JA 1T9HA 3DULA 2QLLA 4BMCA 1YCFA 4CT4B 4G84A 2HBYA 3B1FA 4MS3B 5KVAA 4FYVA 2BUBA 4DCPA 3SIRA 2IU4A 2GH1A 2A0XA 2C7GA 1QQTA 4HNGA 4X9XA 4EY6A 1BH2A 1L9XA 2I65A 3T1HB 2JGJA 3DE1X 1B74A 4Q3KA 4KOAA 2PBFA 5MDHA 1FTNA 2VF7A 4LJLA 4FNOA 5A3JA 2HR1A 3DV2A 1ABBA 3AV3A 1TUIA 5FWYB 4YREA 3JWEA 4OQZA 1Q77A 2BBOA 4IOMA 1SVKA 3IE2A 2QVYX 3JQQA 1ZCFA 1Y6RA 1NSFA 1R1DA 2LNDA 1ADYA 3MBIA 3NLLA 1G3IA 4OPMA 4Q01A 4U2DA 4M1OA 4HZIA 1P2TA 2ROQA 3IUNA 3GJ3A 2JBAB 2VS1A 1KBOA 3K6JA 2C8JA 4RACA 2E48A 2WF9A 4H7HA 5F3RA 1EMDA 1BFDA 2H16A 3K96A 1VJRA 4UTZA 3H4TA 3OETA 4JJIA 2A1TS 4HO1X 2PX2A 4X0EA 4I5GA 4J0IA 5EZ6B 4PGGA 4QYIB 1FXWF 1TKCA 4YQZA 5IASA 3EVGA 4TN5A 1NSYA 2NPFA 1HNWB 1KL7A 4II3A 1FFXA 1XPOA 1KS9A 4E13A 2SICE 1MTZA 5KJ6A 4RPGA 1LGYA 1T4MA 2DKNA 2ZSHA 4HH3C 1W46A 3TNDA 1U8FO 2QT1A 2HADA 1VBFA 4Q3OA 3GRCA 4DLBA 3K0AB 2O0KA 4R2XA 4LGVA 3JATA 4RQTA 4A0GA 3KQNA 4HN2A 1RFGE 2JS7A 2VRCA 3CEHA 3NHZA 4JSRA 5A4KA 1GGJA 1KY3A 4H3SA 5HZKA 2YYZA 1H2FA 4IMRA 4ND3A 5LB2A 4ZQEA 1AF7A 3PUVA 3S0JA 3VC3A 4DPMA 2Z2KA 3MW8A 3UEOA 1GD1O 1P6UA 3THWA 4B8ZA 3S1SA 2B4YA 1IOZA 3QFHA 2B9VA 1DXOA 4L51A 1GU0A 2Q7XA 1Y8QA 2XB8A 4JNCA 5KKNB 3HPRA 4DAEA 1TMKA 4IDHA 1G2QA 2NYRA 1GPLA 1GTG1 1AV7A 3E5RA 1B6RA 4PQRA 3L77A 3QNWA 4BNVA 5LNK1 2VNSA 3UHPA 3DDUA 2JFBA 2QN2A 4LHXA 3GEPA 3TIIA 3KHTA 1D9XA 5JBQA 1NG1A 1YVPA 3LOUA 5DX1A 2ZIAA 2XUJA 5B2FA 2V7BA 3V9AA 2MYTA 3PU6A 4X1YB 5HILA 2FN9A 4AN4A 1O97D 1G8GA 3VBCA 1ZM2A 1V1MA 2H9IA 4FDVA 3TZQA 3K0CC 1T13A 2IGBA 2P6PA 4OYLA 4EB6B 2FSHA 1I13A 2QD4A 5IFLA 3AYZB 5JYBA 4C04A 1LEHA 3JVDA 4D82A 5DNEA 1MB3A 1ODCA 1S4QA 2JFWA 2ZI9A 3VR4H 4PYLA 4AMZA 2J5BA 1FJXA 5F3WB 5I9BA 2RKBA 3CPHA 4KRFA 3LLSA 1VP3A 4YJGA 3SSNA 1ECPA 3OJFA 3X44A 3ZCVA 1A76A 2KQUA 2Q4OA 4OK5A 4UEOA 5EE9A 1XZBA 3C4JA 2HHLA 3LO5A 5GOZA 4JI0B 3OLXA 4LYJA 3QF4B 4HDOB 4HSGA 4MEJA 3I09A 1F6WA 2ZAOA 3M6LA 3SN6A 3SJUA 3WL6A 1Q57A 5FBRB 3K2IA 1U0SY 1E77A 1UAYA 1E1QD 1W35A 3DS8A 3WA6A 2VKTA 1S5PA 1SCAA 1SCUB 3ZDQA 1UM8A 3N2LA 3IR5A 1RRPA 4E32A 2DBZA 3ZEAA 3RADC 2PWZA 4D0SA 2DQ4A 5M29A 4ESHA 1ATIA 3QJYA 3SEZA 4MVJD 1YZFA 4TPKA 1IBCA 3EVDA 4M1EA 3VPHA 2VWGA 5C1BA 3SAJA 3TDKA 3EG5A 5KSZA 4QBKA 1VGQA 1BFKA 1BXRB 4BIMA 5KNCD 2TRSB 3G8YA 2CUZA 1LPOA 2F17A 4WXMA 4NV3A 3P4XA 4NZYA 4AKTA 1QAOA 2YJTD 4RNDB 4KH1A 4R1NA 2WB2A 3NTUA 4JMPA 3RYTC 4AF6A 4EDFA 3OCVA 4V0ME 4JD5A 4RDIA 1NPYA 4KW7A 1IDN1 4XWWA 4KXMA 4LTDA 1R9NA 1I7NA 3ER6A 1V8PA 4RJ2A 4ECAA 3GLIE 3OE5A 3C3EA 3PLAE 3E9QA 4BUJA 2IYPA 3N2GA 1EKXA 5LQJA 1N2GA 2V9CA 3DVLA 3W6UA 3WISA 3AU9A 3GDFA 3NRBA 4MARA 4MGKR 4XB1A 5CLIA 5EIWA 4NDNE 5E6RB 3SR4A 2EQ5A 3TKYA 4UBNA 1RC8A 3CVJA 2PRJA 1Y4AE 2KI5A 2JVKA 4I8DA 3SQOA 3TQTA 4CU2A 5J47A 5JUWA 5JZVA 5LVAA 3ZUGA 5LD2B 4POAA 1H0KA 2DP4E 3DEFA 1I2MA 1N9GB 1FFGA 1WCWA 1GARA 5KYXA 1DIRA 5CJ2A 4ZVNA 3HTXA 3DOOA 1KRWA 2RGXA 1NBIA 4X24A 3LDAA 2GXUA 3PI6A 5DE3A 1JDTA 1OKKD 3DFMA 1H4VB 1O8BA 3K92A 4RK0A 5B1DA 3UNXA 4IJMA 4HN9A 2ORYA 2WNSA 3D5TA 3VR5A 1OI4A 2Q4EA 3FSEA 4B48A 3R23A 4PTLA 4CUJA 1KYVA 2B25A 3ZD7A 1U4SA 1W30A 2AFHE 4U2BA 1VZ2A 1UMDB 1PR3A 1DTWA 1WA5A 2RHWA 3FGNA 4FKBA 5COAA 1P8JA 2PGIA 4BX9A 2QI9C 2HXYA 3WWYA 4BMYA 2XEXA 1B2LA 4G9BA 2VAPA 1WUKS 3EEBA 5J5VA 2ECFA 3DBIA 1QLWA 3R5TA 1U0JA 4HS4A 2D54A 3KFLA 1YJ5A 4MVJI 4HDQB 2AOUA 2WTUA 3VNSA 4CEIA 5LQUA 5EZYF 1FDRA 1UBGA 2QAJA 4QQRA 1XMIA 4E2YA 3NT2A 1NONA 1B1CA 1Y1RA 2GCEA 2GFIA 1OAOA 2O3SA 3BE8A 1QR6A 2JGLA 3HCDA 3OSUA 1Q21A 4B3MB 4IEIA 1E4VA 3TKLA 3QI7A 3JQCA 4KDEA 3GVPA 3TNFA 2GR9A 1W75A 3P9IA 3PE6A 4BKRA 1KY5A 2Q2WA 1XUOA 1DRKA 3VR6A 5AJWA 4LI0A 1RHJA 1QYCA 1RM5A 2IVFA 2BM8A 4HWRA 4S24A 1TJYA 3TJMA 4D56A 4C0JA 1H2HA 4F45A 3EXIA 4CQMD 2BELA 1XZIA 1ZVKA 2AV6A 3AFOA 4K0RA 5JISA 3ILYA 4FMBB 4K1LA 4GL2A 3W3ZB 1QGUB 2LPMA 1Z0SA 2RJNA 3ONFA 2XVZA 3ABOB 4HD8A 1CV2A 2C04A 4PO9A 3V4ZA 4B4WA 3AEZA 3V1LA 5EGSA 2OXRA 3K6RA 3V4RA 3NOOA 5KDLA 2F64A 3ZVMA 1D2MA 3H99A 3TI7A 4LJ7A 4B6PA 3LX5A 2FHSA 2YQ4A 4NU0A 1B0AA 1W8DA 5CB4F 1SBHA 4P4SB 3R9XA 4FYHA 4MRNA 4C0SA 3T3IA 2A0YA 3OT1B 1LI7A 4FSDA 1Y63A 5JRZA 2AX4A 1NV9A 3GFRA 1J07A 1QOQB 3CBQA 1XRLA 3K53A 3WNDA 1R0BA 2JHPA 3SK0A 3H5VA 3CXRA 3H5LA 1N32B 1XVIA 1T2NA 3MLEA 1RCTE 4PZDA 3KM0A 3GFBA 2R25B 4M0UA 4MDYA 3RT1A 4DNXA 5LMNB 1FZQA 4D8WA 1FFWA 3TSOA 4FGUA 4CKZA 2VYVA 1C7EA 3M5DA 4A8JC 2E9SA 4QXRA 1YB6A 4I1UA 3E48A 4QFMA 1EH5A 3W78A 2YJ4A 1G8YA 3BKXA 3CF4G 3P7MA 4O4IB 4DF3A 3C6MA 2CW5A 4TV9F 2BGKA 1KIFA 3TTVA 2A58A 2PKWA 1KQFA 4QPZA 1QF9A 4ZDKA 5ARBA 2YX1A 4C2AA 4ED9A 1VJ5A 1A7JA 3OZBA 1DEXA 3T4PA 5KINB 2WW8A 4PN7A 1IH8A 2O4CA 5AVQA 3H4MA 4DM4A 4C6RA 5F5NA 4DAOA 4JKOA 1XYGA 1YK0A 3EUEA 1VE6A 3AH8A 2BEUB 5I7UA 4R9UC 4OHCA 1OSNA 2ZSDA 3KTFA 4K9SA 5FOWA 1JMYA 3O8BA 4PNHA 3HB7A 1VPLA 2GZRA 3HCNA 4OHKA 1IG3A 1NW4A 2FU5C 4AF8A 3P9PA 3M5CA 2XWBF 2EQBA 3WGNA 4MO9A 3UV6A 4G9EA 3OTWA 2C95A 2WSYB 1PT7A 2YCLA 1BXGA 1W19A 3PI7A 4W7HA 2BSAA 3CF4A 1HLFA 2FEOA 1Y8RB 4FE3A 2I03A 3UTDA 3BCSA 3DWEX 1J8MF 3OQMA 3MCTA 1GCIA 1GTZA 2DFLA 3QXSA 4L5BA 3DUFB 4YACA 3TLKA 3P2JA 4K2AA 4MZDA 1YRBA 3WLKX 1D2GA 2EAUA 5JNLA 1H4QA 3WFJA 4ZCPA 1X0XA 1ECCA 2EKZA 1E99A 3AIOA 1D2NA 3OCYA 3C2QA 4HAOA 3RLIA 1KS2A 4CKEB 3PG5A 1MAUA 2CKDA 2KPOA 5D00A 4BWGA 1IONA 4E6EA 4ZDJA 2JBHA 2O5CA 2ZB4A 3BSFA 4I9FA 4QVIA 2XADA 3UF0A 4BAGA 1RP7A 1UMCA 2DUUA 3SS7X 3IKLA 1GFWA 2DCMA 2NVOA 4WCFA 1PO7A 5E6UB 1R4ZA 4O2AB 2VZ8A 4LZZA 4OGLA 1OJLA 5B3AA 3L43A 3MWYW 1US8A 1Z22A 1FQOA 2IDKA 2P30A 1HYGA 2VUUA 3EY4A 3JZDA 3JPWA 4KRXA 4M1ZA 3RBXA 5DBEX 2PKRA 4HQFA 2WYUA 4Z4QA 2GVZC 3VVLA 4W6QA 4B3CA 4E22A 4M7WA 3DKRA 3BXPA 4B3SB 3IAHA 3JQPA 5K8TA 5GONB 3V3TA 3K70C 2FPGA 1ZVVA 2B1IA 1CB7A 2WUFA 4RBNA 1G0OA 4MVCA 3S2YA 3ZWAA 4EHIA 4CG0A 3SLGA 5JEDA 5DHTA 4CF4A 4I1RA 1Y89A 1HLDA 2VDPB 1UIMA 2HTEA 1WR8A 3NC0C 4Q9NA 1L7OA 2A1UA 4AJ9A 5IZCA 1EWTA 2MINA 2SCUB 2XGOA 4DJDC 1YA4A 2JFFA 3LLVA 3Q41A 2E21A 4ZJUA 3UENA 3D7RA 1KZ1A 4R1PA 5BOSB 5JY1A 2XR1A 5DWQA 2EJBA 4RSMA 1CJUC 2O1SA 1FRNA 2X9QA 1ISIA 1RBYA 2GASA 1CZNA 4M0FA 3BAZA 3R3ZA 2DYKA 2WTXA 3Q9LA 4RTMA 4BJHB 3KT8A 1K3UB 2VK1A 3AC0A 3FTCA 3BD7A 3E8XA 5JAPA 4HNSA 2ZI6A 3R3JA 1X1RA 2QU7A 3MGBA 3OZDA 3CPJB 3GHHA 1K92A 2A1TR 1DAOA 1RQ2A 1UEIA 3BBPA 2EX0A 2A57A 1L5FA 3N8GA 3U7EB 5LIPA 3K0HA 4R8MA 2XJ9A 4AIRA 4K9NA 3KALA 4QDOA 4QOJA 2HMSA 3OZEA 5AI4A 4LFBB 1CQXA 2EVWX 4JVSB 2GCIA 2GEUA 3ZCRA 2X4GA 2LCQA 4LOLA 1E5QA 2CFTA 5FWYA 1E2BA 4ZQIA 4O2RA 1W5BA 1YL6A 2FEMA 1JHVA 5AKZA 5FD8A 5LYYA 2Y2VA 5FUXA 4C01A 2QY6A 3PRHA 1ZSVA 3QOXA 4PYQA 3C45A 4X6XA 1D1SA 5DJ5A 5CLFA 1NVKA 2ZE8A 2D74A 2VDJA 3L0YA 2VHVA 4G23A 5U4XA 3WIUA 3ORHA 3K32A 3NP9A 4IWYA 3HGTA 3EWNA 5LBIA 1GITA 1E2GA 1OXTA 3OZUA 3F73A 1VJTA 4EVRA 2HNBA 2MJLA 1G41A 4Q21A 1T2AA 1M6VB 1P29A 3IEVA 1IQRA 1Y5IA 4QYIA 4F0JA 4EG6A 3ERCA 3NAQA 2H2GA 2XWQA 3GGOA 4CPDA 2BHRA 4PM4A 3VSAA 4PG8A 2ZAMA 2ZYAA 3R2JA 4CM4B 1DX9A 1Z37A 2R2GA 2CZGA 3WB2A 3B1VA 4MPJA 3HKBA 4I19A 4ENRA 1FFCA 1YB1A 2HFJA 4DC0A 4BB6A 1JSCA 1OFUX 1QQBA 3ZHVA 2D1TA 3E0QA 2Y3IA 1B93A 3GPLA 4X8HA 1D2EA 3EXFB 3T12A 3YASA 1EB9A 5CDGA 2JLVA 1D4OA 1P9WA 5HG0A 3DR5A 3HRKA 2PV7A 1G19A 1JA0A 2IH2A 2GGSA 3NHLA 1BKYA 1HI9A 6GPBA 2IJGX 4KIFA 4XOUA 4N3CA 1Z88A 4IEEA 3LC0A 5DZSA 2HXSA 2KLHA 1RZRA 5F77A 2CBGA 2X4IA 2OSVA 3ZIDA 1WOMA 3T0FA 1SWWA 1K4YA 5EXDA 1LLUA 2FE1A 3I9JA 1CKEA 2C2KA 3L6BA 4G8CA 1A88A 1C3JA 3WL8A 2J0EA 4CFYA 2ZRQA 5DTEA 2GTPA 2D06A 3AERB 3KTDA 2IV7A 3U9LA 2JIBA 1DX6A 3WV5A 3PQ5A 1TM3E 1VLQA 3E0XA 2WP8J 4LXGA 4X1YA 3VJMA 1CY6A 4RS3A 3PXGA 1J49A 1SPXA 3ABRB 3VHRA 4B2LA 1AA6A 4MV7A 4CL2A 4EB6A 5HWSA 4BDTA 4GI1A 4Y6SA 1DC8A 3D31A 1LF5A 3RRYA 1U7TA 1N8KA 1WEKA 2RH8A 4MWOA 1E9VA 1THZA 2CLIB 2C5AA 4YROA 1C7IA 2WBLC 4CU5A 1ZSNA 2G3YA 1P80A 1KJZA 1KEEB 1UBOS 1AG9A 2PKEA 2WK1A 4EY8A 1XSEA 3WKDA 2YJGA 7AT1A 2LDXA 1UAAA 3QF4A 1BGXT 1TCVA 1VE3A 4CLEA 2E55A 3ET4A 5IJZA 3KQLA 4M60A 4GPAA 5F3DA 4K40A 1ULZA 1D6MA 4B80A 3FROA 2G71A 2RE8A 1UPBA 1Z4LA 2OFPA 4I46A 3O92A 5B2EA 3DL7A 2YV4A 5FAKA 2O6HA 3AKYA 4EYKA 3IOBA 1JSLA 3A11A 1DMRA 2D5BA 3ZV3A 5K6AC 1K7FB 1W7AA 3MS4A 4FLEA 1JIUA 1HO3A 4BJ6A 4RF4A 1O3YA 2FB9A 1P4JA 5CK5A 1T6YA 3KU4A 4ASUD 2DFNA 4B0OA 2PPLA 4HLQB 3EUFA 3B1WA 3ZE0B 1BXRA 1CP2A 2P9HA 2ZRPA 3I73A 5DCUA 3UHAA 3MYYA 4KR3A 3PGXA 2ONCA 3ZIUA 5GZ3A 4HUTA 1I7LA 1M8PA 2NTEA 4JIGA 1WB4A 4LF8B 1CYEA 2NO7A 3KFVA 1JYFA 1NXQA 1TYBE 2Q45A 4NCXA 4Q3CA 3UPTA 4KE7A 3ZDFA 4FB5A 1EE2A 1YE5A 3GJZA 3NDJA 1JKFA 1BYUA 3F7TA 1SC6A 1NDQA 1ZCJA 1PJ8A 1SY7A 1WSDA 1Z56C 3AJAA 3AFNA 3O6VA 1U9JA 3GFQA 3O26A 2LZ0A 1YJBA 1DFHA 2V7EA 2W7TA 1PRYA 1CERA 4RLHA 1K5PA 4C4SA 1N5RA 1SCKA 1FP2A 1TYDE 5AJTA 5E6RA 1BN7A 4Y2GA 3A6JA 4C89A 5MGBA 4H7DA 3FWNA 3PPVA 4BTLA 7MDHA 1V5GA 1CUCA 3RWBA 3PX7A 2J4CA 3ZBPA 4KX3A 1MIOB 4JKIA 3EZ6A 5T67A 3ETEA 3R5KA 5JSHA 3FPSA 1PEKE 1LTKA 1ODSA 4IIEA 1HUQA 2P9TA 1TAHA 4HYYA 4LJ8A 3TAXA 4A16A 4FEAA 2R11A 4M0MA 1W5TA 3PUIA 1BYIA 1SOVA 2J3HA 4XQ9A 4GECA 2AMYA 4QGSA 1CWUA 3R5FA 4LJYA 1QNLA 1II9A 4ETIA 3MT9A 2PX3A 2Y1FA 1FNBA 2A7XA 3PFNA 2NU8B 4KI7A 3CGWA 5FFMA 3URMA 4C87A 1UZNA 2KW5A 4C3UA 3WP1B 3VR2A 1KVTA 2IYOA 3LVFO 4OJNA 5H68A 2Q8PA 3EDRA 3VH3A 5ALYA 1FP7A 3W3AD 1OXUA 2QGZA 4YAWA 1HG0A 1TVCA 3HKDB 3MC1A 3Q5EA 4GLFA 4GOLD 4XPZA 3SEFA 4B9AA 4YWHA 3SNKA 4JJAA 4E5KA 2FFRA 1CETA 1EP1B 2G06A 1UDCA 2H4FA 3OF2A 4F5ZA 3MQ2A 4I9NA 4GM0A 3ROEA 4UQLA 5KOYA 2J3MA 2O2EA 2P41A 4FSXA 4Y7DA 4LSGA 3WLPA 1MB4A 2FJPA 2XUQA 2ZPTX 3GRFA 2DQKA 1PGOA 1U5CA 4KBFA 1Y7HA 4XYEA 3AUYA 3P9ZA 3DE5X 4I3FA 1WNTA 2ZP1A 1OCEA 2GERA 3K9QO 4C4TA 4TVSA 4F4CA 5IJ0B 1DC7A 5L4LA 2B5VA 2G9ZA 3CRQA 1BEEA 4TLLB 2RB5A 4ARUA 3K0EA 2CB9A 3HSSA 1ZNWA 4GKVA 4I50F 5KTNA 3DCYA 4U2EA 3BIFA 4PAWA 1PNOA 1FUIA 5HKLA 3QXHA 3D7LA 3FWZA 5AKYA 2ZUSA 1USKA 2C4KA 5HPYB 1WD7A 1HE3A 3U4CA 4XCQA 2D3TA 3NTRA 3K1ZA 1P6XA 2VK2A 1NYLA 5FL3A 5EJEA 4IJVA 2ZWIA 2X5NA 3PD0A 3I01A 4JLBA 3I28A 4P36A 4X85A 4BE4A 4PYJA 3ZDAA 1SIWA 2OBYA 2PU5A 3PL5A 1THMA 1AV6A 2NP7A 5CA0F 2N9UA 4KREA 1I4EB 1X3LA 3L7KA 5AHWA 3JYHA 3U7FB 1G59A 2G1AA 1DWUA 3W6ZA 4FFRA 4KYIB 5IVDA 3X2EA 3TPCA 2D3WA 1CDDA 3O4GA 3OG9A 1ZOLA 5PNTA 5HKBA 4DIFA 2DLDA 3B8EA 4LGYA 4P4SA 4TL7A 3VV3A 4R0VA 4N48A 4YRNA 2Q5QA 2XW6A 2X76A 2IF2A 4UPEA 1GZHB 5I47A 1NVGA 5D5HA 3C8ZA 2NU6A 5AOAA 4GI5A 2PZ8A 3B3AA 2PGAA 4DA7A 4MDFA 4MVJE 4BEVA 1DSSG 4U8GA 4CR6A 3GDWA 5CFLA 1UR5A 5BVHB 3HABA 1CHDA 4UBMA 4AX4A 3E18A 3P8ZA 4IRUB 4DLYA 2GBLC 1WOYA 1XZKA 2XQIA 4Z51A 3TNJA 3OBIA 1FFBA 2AB0A 4U7DA 3BG5A 3P1JA 1WO8A 4O4IA 4PZPA 4UCWA 4CMJA 3FZQA 1LB1B 4CCWA 4K6KA 5H3HA 2BSQA 2IHKA 1RD4A 3O8RA 2E4UA 2AW5A 4KPUB 4BP8A 2J3DA 3HJGA 1T8TA 4V1CI 1YACA 2WT8A 1D2HA 4YMSA 3AF1A 1NFQA 3VTAA 3PK0A 1P0MA 4TTAA 4IDOA 1E32A 3FJYA 4W6ZA 4G37A 4JC8A 3L6EA 1P4AA 5JNTA 2AG5A 1PNVA 3GPBA 2BEUA 4DLUA 1ISJA 4D92A 2WJ6A 4RTKA 2VG8A 3OFKA 4QT0A 2GN8A 3H2YA 4UQPA 3DB1A 4FR5A 1ULAA 5BRNA 3KPYA 1W4RA 4Z1MD 2P6RA 3R7NA 1JAHA 1HQDA 4NI5A 4DLKA 3L6DA 4P4LA 1YIDA 1GQ2A 4Z4IA 1UWCA 2O7QA 4QAJA 3ZHSA 3OOWA 4BNLA 3DUFA 3LL7A 3SOZA 4FN4A 3TLXA 2QTBA 1E3SA 1E6LA 3VZSA 3EC1A 4AN0A 4PY2A 2A4MA 1TM5E 4JR1A 4Z6KA 3V1MA 2J31A 2ZBRA 2ZREA 4Q3EA 4CKEA 2XA1A 1PSDA 1JPJA 1OXSC 1NVXQ 1E92A 2WHEA 3CCCA 3H5OA 2FUKA 3ESCA 1OXVA 4P08A 4YB8A 3AUFA 4Q00A 4JB8A 5EHXA 1ZJ5A 3LF2A 4LSZA 3OJCA 4QECA 4YRGA 2J6HA 4ZWNA 4BPBA 2V3CC 1XHEA 1RTTA 1TFUA 1XTBA 1LCIA 2VPIA 4TRRA 3C70A 2JD0A 1TW3A 2SECE 4WLFA 4L4RA 5E6UA 1K2VN 1IPEA 2H07A 2ZJ0A 3IGFA 5BUZA 1NBMA 5ESWA 4Z7QB 4I4TF 2A6PA 3KKLA 621PA 1LLCA 4TSFD 3I0NA 1MO3A 3AHGA 5B57C 1MZPA 3KIPA 3TS1A 4GYKA 4M83A 1H05A 4XWGA 2I6TA 2JFVA 5BUCA 1MJ5A 3VGPA 3GJYA 1T9KA 4B4OA 5FR2A 5GONA 4NFHA 3HFRA 3Q5DA 4P4GA 2REBA 1TADA 4CM5A 1O54A 1P18A 1SIBE 2R2AA 4NG4A 3M3DA 5EUCA 3U7RA 4CIBA 1UJ4A 2H8KA 4TT3D 2W6NA 1GILA 3CH4B 1X1AA 2CVQA 5K5EA 4ALJA 1KK1A 1RXUA 1ZCAA 2SCUA 3VPFA 3GB9A 2GK7A 4GOJA 2QAGB 1CJSA 4NF2A 4HVCA 4II2A 5AM3A 4NBUA 1O95C 2KM1A 2QLFA 2VLIA 4NWIA 1Q6ZA 4MA0A 2ZJOA 3P19A 2WYIA 2NO0A 3SG0A 1NRIA 1ULUA 3GRKA 3P5BA 4RANA 4AJEA 3OD1A 2EBUA 4OHOA 3NNNA 3FKSA 4L4UA 2G1KA 1YR7A 3FPGA 1XGKA 4OLHA 3T0IA 3W6PA 5IK2A 1WETA 4U63A 1XCGB 1CXZA 2CFSA 5KNBH 1SKMA 1YULA 3KUCA 1I7QB 1D1QA 1PJCA 1W36B 2GFHA 2K5UA 2ST1A 2GF9A 2EBWA 2QRQA 3PQCA 5FBWB 5TQ0B 1LRLA 4TOIA 5CX1B 3FHLA 3U4GA 5LP1A 3WB1A 4LWQA 4BEBA 1J21A 2CXPA 3BJZA 2WFAA 1PK8A 3AX6A 4YQFA 5TLSA 3NBXX 2FFHA 1XZAA 4Q82A 5AHKA 5IF9A 1N6RA 1F60A 1U02A 1MLDA 3AKCA 3OU6A 4AULA 5HM6A 5KU7A 5JXGA 2BRUC 1RWKA 2UYCA 1PT8A 3NIBA 2CMDA 1H9AA 2WJWA 5LOVB 1XEFA 1XXHB 5DWVA 2EC5A 1W5SA 4B6QA 3GLKA 2G0NA 4L6IA 4H7EA 3EZFA 4RGYA 3FAKA 1HYBA 3AILA 1PFKA 4UAVA 1QLHA 3O1LA 3QWFA 1INLA 1XLUA 4GM1A 1M6VA 4XVHA 3LP6A 3WMEA 2YIMA 1T25A 3F5SA