4ZCSA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Choline-phosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 43
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcsA00
2E18A 3RFFA 1JGTA 1N75A 1YIDA 3D6VA 4ARCA 1H1TA 5JBNA 2CYCA 1Y42X 2EL7A 2QTMA 2NZ2A 3ZJUA 1KP3A 1ZJWA 2IP1A 3SYTA 4MWDA 1JZSA 3G6KA 1NUTA 1M8FA 5HUJA 1J21A 4NZPA 5J5AA 2J5BA 4NATA 5HG0A 4HK4A 1NUPA 4JXXA 5J58A 2OV4A 3UY4A 2EJCA 2RE8A 3OTWA 1O96B 4PBRA 1N78A 4HJXA 2DERA 1EFVA 2X1LA 1TEZA 3IODA 1JILA 1R6XA 1ILEA 5AHWA 3K9WA 1O94D 4ND6A 3FETA 5LFAA 5H7XA 3TZEA 1VLHA 1K97A 3H9BA 1YI8A 1IHOA 3A05A 2J08A 1PFYA 4NAUA 2A7XA 2PZ8A 2PXHA 1QU2A 3FOCA 2GM3A 3CVUA 2DPLA 1MBZA 1TYCA 4PBTA 4ZT7A 2V0GA 3L93A 1ZH0A 2WQ7A 4ZT3A 1GTRA 1KQNA 1KKUA 1KQPA 2A1TS 1WKBA 2A1UA 3FY4A 3ND5A 4MUHA 2BTEA 3INNA 2C5SA 3G5AA 1I6LA 2PZAA 2WQ6A 2H29A 1T9GS 2XRYA 1UFVA 1I6MA 4TS1A 2AG6A 4AS1A 5TS2A 1QRSA 3HV0A 1HYBA 3RK0A 4EG7A 1N2HA 3IMEA 1X8XA 1X6VA 1V8FA 1BS2A 4EGAA 1G8HA 4EG5A 3MMXA 4DDHA 3GUZA 1QTQA 2Z09A 1N3LA 2YWCA 4WSOA 4ZT6A 2ZUEA 2D5BA 4MW4A 4OUDB 3HMQA 1TYBE 1OWMA 1VBMA 1O95C 3PNBA 1FYDA 1KH1A 1VL2A 4MW7A 4DE5A 1DNPA 4DDMA 4G5FA 3FWKA 3HFJA 4I6GA 1EFPB 1M8GA 1IRXA 1GZUA 3TNJA 1N77A 1QU3A 2IJGX 4MAFA 1NI5A 2OQ2A 1Q15A 1U7XA 1ZH6A 4CDMA 4RPIA 3MLAA 1EXDA 1N2GA 1PFWA 3ILVA 1TQ8A 1WQ3A 2QTRA 2TS1A 3Q12A 3HL4A 3KT6A 4A91A 3A2KA 5DB4A 5K0TA 4OJMX 4L2IA 4EFKA 1J09A 2CSXA 1U7DA 3CVVA 3P0IA 2E21A 2X0KA 4MWCA 1GLNA 3ZJVA 1NSYA 1M8KA 2A4MA 3CLUD 1F7VA 1OWLA 4MW2A 3H05A 4YBRA 4X0EA 1M83A 2HZ7A 3RJZA 1GPMA 1T9GR 1NP7A 3AL0C 2X1MA 5TGTA 4S1OA 3COZA 2V0CA 2QJOA 3D6UA 3HZRA 3UMVA 1LI7A 2CYBA 3CLRC 3U1VA 1N2EA 4ZT4A 1VBKA 5KCMA 3N2YA 4MW0A 3M5WA 4HPWA 2Z3VA 1K4MA 4UZFA 2AZXA 4EG4A 3P0JA 1RQGA 4MQ6A 3AG5A 1WXGA 3GLVA 2VTBB 3DV2A 3N05A 1KP2A 2CFOA 3Q10A 3QTBA 1JEEA 1NUSA 1MRZA 4YP5A 1MB9A 1M8PA 2E89A 3VGJA 1WQ4A 3LE8A 1QNFA 3CLTD 1KAMA 2YWBA 3S3TA 4MULA 2A86A 4MVCA 5FO1A 5TEWA 3SEQA 1NUQA 3ISJA 2I1LA 4GU5A 1KR2A 2D13A 1JIJA 3UK2A 1SURA 4KPUB 2A84A 4RUKA 1H3EA 4ZCQA 3COYA 5BNZA 1JZQA 2QUJA 3PXUA 4ZT2A 1YULA 3SP1A 3DPIA 4Q93A 5LM3A 3TZLA 3ZXIA 1G8FA 3LCJA 1QRUA 1B6TA 1K4KA 2ZP1A 1GAXA 3TQIA 3G59A 3NV7A 4DNXA 1PFVA 3LOQA 4XFDA 1O97D 4GRIA 3TQOA 1J20A 4PY2A 3CVXA 1OD6A 4ZCPA 4YP6A 1O95D 4AQ7A 1EJ2A 3IVCA 4UZEA 2IELA 1JHDA 2PIDA 1R6UA 4H3SA 3SDBA 4QRDA 1PG0A 1ZUNA 5FO0A 4EG1A 3AIIA 3COVA 1O96A 3A04A 3DO8A 1TFUA 4DJAA 1OWNA 1KORA 3N9IA 3OP1A 3QE4A 2CV2A 3CLSD 4ARIA 1WXIA 3ZGZA 2QJTA 1IQRA 3KT8A 1J70A 4R2LA 3FDXA 5IHXA 4EG8A 1PFUA 1U3CA 1QJCA 4KR6A 1O6BA 2VXOA 3VRHA 3X1MA 4G6ZA 1U0BB 3FH0A 3PNVA 4MW9A 5IJXA 3PNYA 1I2DA 2DETA 1NUUA 1U3DA 4QREA 3MXTA 3IOEA 5K0SA 1MJHA 5DEOA 4MVXA 1LI5A 2QTNA 2RD2A 1NURA 4JFAA 2JAXA 2QUKA 1A8HA 1GTSA 3DLAA 3F3MA 1XNGA 5DK4A 2GOYA 2AKEA 1OBCA 2HMAA 3IOBA 1IQUA 3IDFA 4ZT5A 4K03A 1JMVA 2WB2A 4YMIA 4MUNA 1KH2A 2DUMA 3IVGA 4R0NA 1V47A 4I6EA 3AG6A 4OUDA 1EFVB 1N2IA 1TYAE 1WXFA 2J09A 4FZJA 3RK1A 4G5YA 4NAHA 3PRHA 3GMIA 4ND7A 1FFYA 2R5WA 4QBTA 4DLPA 5KWVA 3IVXA 1G8GA 4CDNA 1JEDA 2H2AA 3MUEA 4JZYA 4ZCSA 1O5TA 3IMCA 2XRZA 1M1ZA 2DR2A 1KQOA 3JXEA 3CA8A 4NX2A 3RBAA 4U7JA 1N2JA 2PZBA 1H3FA 2Z08A 3SZGA 3BL5A 3CVWA 1MOPA 2A1UB 1T6XA 4KR7A 1KAQA 2YXNA 3H99A 4F3RA 4MUJA 3SEZA 1N2BA 3H97A 3ND6A 3P52A 3CLUC 1F9AA 2J4DA 4MVYA 4PBSA 1Q19A 4MWEA 2PG3A 3AKZA 5F23A 1WOYA 1IVSA 4BWVA 2CUZA 3CVYA 1N1DA 4MUKA 1WZ2A 3ELBA 1T6YA 1YUMA 1WY5A 3FI0A 1F7UA 4XFJA 5J59A 4F4HA 1EUYA 1PG2A 3X1JA 1NYLA 1ULHA 1IQ0A 3ND7A 1M8JA 4ZCTA 5FNZA 4CQNA 1MB2A 2HGZA 1OWPA 1O0BA 2CV0A 2YY5A 3I05A 1LW7A 4J76A 3X1KA 1I6KA 3MLBA 1G59A 3ZUGA 5LLTA 1IFXA 4MWBA 4ZCRA 5HUHA 5TEVA 4U8HA 1Q77A 1XNHA 2E0IA 3ZJTA 1OWOA 2QUIA 1F4LA 2VTBA 1K92A 1O94C 3Q4GA 3RHSA 3AFHA 4MVWA 3CLTC 1S4MA 2QJFA 2ZUFA 2CT8A 4J75A 1MAUA 3ZIUA 2J07A 1J1ZA 3KT0A 1GN8A 1T6ZA 4WNYA 3SZ3A 4L2IB 4EG3A 5DASA 4EF6A 3UC5A 2DEUA 3QTTA 4HJRA 4XSVA 1JECA 3NBAA 3L92A 1O0CA 1JIIA 1MAWA 2GKSA 3FG9A 4KPUA 4R2MA 4MW6A 2X3FA 3KT3A 3HGMA 1YIAA 1CT9A 3A4IA 3IH5A 3CR8A 1O97C 3FIUA 3IUEA 4I6JA 4MUFA 4MLPA 1QQTA 4CT0A 1Q11A 3COWA 2D54A 4MW1A 4K0RA 2O5RA 3H9CA 3TS1A 3P0HA 2G36A 1D2RA 4U63A 2CV1A 4KR9A 1H3NA 4MUIA 4NDAA 3IMGA 2O8VA 3N8HA 4JYZA 4EG6A 3FNRA 1IH8A 1XJQA 2DXIA 4P2BA 2BYTA 3CLRD 3NBKA 4MW5A 5EKDA 1J1UA 4DDKA 1EE1A 1OBHA 2A88A 4YP7A 3ZXSA 1TYDE 4MUGA 1JIKA 3IOCA 2B7LA 3CLSC 1NZJA 4E1AA 2QUHA 4JXZA 3KFLA 1WXHA 3UOWA 1YUNA 2JA2A 4MUEA 3VU8A 1WJGA 4KKVA 2PFSA 2WSIA 1N2OA 1QRTA 3IUBA 1EFPA 1XNJA 3K32A 1EUQA 5H16A 1MC1A 2DLCX 1COZA 3E27A 1P7PA 4Q16A 1WXEA 3FHJA 2A1TR 3C8ZA 2NSYA 2CYAA 1R6TA 1VBNA 5KHAA 1KH3A 2JANA
chains in the Genus database with same CATH superfamily
1IN6A 1LDMA 1RSZA 2PWAA 2Q2QA 9ABPA 3LOPA 5IJ0A 3ZD6A 3T3PB 3SY8A 4AK9A 4OJNA 2XQJA 4D6XA 5LQAA 4DR6B 3HUTA 2E1PA 3FZYA 3LGAA 1QE3A 1T5LA 4JL5A 5EQDA 4CMAA 2OZEA 4NCXA 5IBPA 5HCNA 3I8OA 1ZGHA 3KWFA 2QG9A 5HEKA 4CV1A 3WAKA 1JFSA 4P31A 4MIOA 1NZDA 1I1NA 1KERA 4WXEA 1VPVA 2HIMA 3A0UA 3T38A 4CKWB 4RTOA 3KR0A 1IOWA 3A6GA 1QIKA 2BV3A 2P9FA 1JVNA 5G0VA 4KNYA 2BBTA 4EHAA 3WWEA 1M1UA 2GEJA 3L6UA 5J5AA 1W4AA 3A4MA 2C9YA 3AF5A 4QARA 4BQPA 1U7UA 1SVIA 3C5VA 2PSDA 1U0NA 3ZS9A 4XFKA 2NYVA 1UXJA 3D7NA 4TVKA 3WRXA 4AY2A 4RZIA 4PBRA 2PAFA 3CUKA 1JSZA 1E8DA 2Z98A 3F6BX 4UDYX 1JSRA 5IDVA 4DKXA 1Y4ZA 4HMOA 1EXNA 4DSAA 2RCYA 5JCPA 2A0YA 3DTTA 2P6NA 1RCTE 2DECA 2PQ2A 1EINA 2CXNA 3Q11A 5BNWA 1N0UA 1HZZC 1ZITA 3AVTA 1TKRA 2JIBA 1BMFA 1L4FA 2RCNA 3K70B 1ZUWA 3NYRA 5HDBB 4KREA 4QU9A 3QYAA 3SHQA 2ATCA 3CWCA 3LSYA 3N58A 3E48A 3TB6A 3ZW8A 2F1RA 2FP4B 4UZSA 1JFVA 4M22A 3QF7A 5DI3A 1V5WA 5JVDA 5P21A 2O5VA 1O87A 1VJRA 4UD6A 3PB3A 3GHYA 3HJGA 1BD3A 2F43B 2JLYA 1IB0A 4Q1FA 1PNQA 1YRQA 3MINB 2FW1A 4IG4A 3TX2A 3EMKA 3VR2D 1IZ9A 1Y9DA 3CC8A 4ZOLF 4X3CA 4COOA 5FBVB 6YASA 2PDAA 5JS6A 2CLCX 2WWHA 4HDAA 3INNA 3CN9A 3O03A 3G5AA 2MR5A 2PKXA 3L06A 3K9GA 4J3FA 4B4WA 2BZ1A 4XVUA 4JH0A 4GEGA 3JTMA 2WHEA 5TVKA 5CUQA 4BO7A 4AMZA 4GXRA 4ZO6A 2Y76A 2VP6A 1FLAA 3GUVA 4B4KA 3RC2A 2EYUA 3R3WA 4LY9A 4YJ3F 2IDMA 3ZXUB 3I39X 4XI9A 3UGQA 1B73A 4AN4A 4RGVA 5LBUA 2J3QA 2CD9A 4II7A 5MGBA 5EIBC 1UQTA 2W2VA 2ECFA 4DDHA 8MHTA 1VE3A 4JVSB 4L9WA 4M87A 3AEKA 1JKMA 4NMHA 2FZKA 4HAWA 4AROA 5CD9A 2G4LA 3FOWA 1XRNA 2R1VA 2WIGA 4CQMB 1XKQA 3Q6MA 1N7GA 2PUHA 5FOQA 3KYJB 4R3WA 3I6BA 2VXBA 1T8SA 3DZGA 4OQPA 3TE6A 3V8NA 3GFOA 4WLUA 4EKEA 4DLZA 1COWD 1OX4A 1CG6A 2H1CA 2ZQZA 3CF6R 2EKDA 2V6BA 4UHHA 2YJ4A 4XB2A 4KXWA 5B1IA 4KQCA 1USGA 1TZJA 1DC6A 3CW8X 5HBGA 3T1YB 2Q6VA 1QU3A 1NI5A 5L3QB 2O3RA 3DVLA 5J2UF 3OEHD 1NG9A 3FVTA 2QM7A 5CDUA 1V8OA 4HV4A 1I7DA 4Z1MA 4R7GA 3M9XA 4JV5B 3QEOA 4B3JA 1B26A 2Q2WA 2E5WA 2J9FB 4IKOA 3TD9A 3LYAA 3VJLA 2UV8A 4Z53A 1Q0ZA 3PC8A 4CHTA 1T29A 3U56A 3DEFA 3JD4A 5BQ3A 3MN1A 2V3WA 4BJ1A 1TF5A 4EUEA 4E2XA 2JG3A 1J99A 3Q3IA 4HRXA 5DB4A 2PU5A 2XSZA 3HKEB 1J06A 2VDOB 3DOJA 3H2HA 2XOKD 1B93A 3B89A 4MKZA 1DOHA 3EVGA 5DT2A 2VRNA 1X80A 5D84A 4PONA 2DF8A 3DA8A 2MSNA 3PNMA 4QTZA 2CHEA 3BICA 4FFBA 4XM0A 3A32A 1E66A 5AJWA 2O8DB 1Z22A 4INPA 3I9NA 4WJZA 1OI7A 2GZSA 1SOVA 3ZWNA 5A3QA 2JASA 1JQJC 3EIXA 2SECE 4AJEA 4LF9B 3BORA 3EVBA 3LQQA 2CFSA 3P9KA 4RHTA 1ZNZA 1TA0A 2RGEA 1FQKA 2GYVA 4LECA 4ZI7A 3H0CA 4OLAA 4EA9A 4COKA 3F0TA 2Q1TA 1G19A 3DZ8A 1JHAA 4X91A 3WA7A 4F3KA 3EN0A 3IR6A 3HUEA 1L4MA 4F45A 3M7IA 2EEZA 5CT8A 2QJOA 4CKYA 2AF3C 4ZN6A 5K8TA 3SZUA 4AZ3B 4TTVA 4DA7A 3E9NA 1E0JA 1H1LB 1MCZA 1ZBDA 3OE4A 1V43A 3M6UA 3ENNA 4FKZA 1PBTA 3OCXA 1CNFA 1IXYA 1A9XA 1UBOS 2X0IA 4AECA 4D5EA 4DCUA 1BXRB 5F5NA 2GM5A 1L7BA 2GCEA 4FW9A 2BF7A 4MWGA 1OLOA 3R7SA 3TYXA 5JD5A 2QLFA 2BR3A 4D25A 3MWFA 2RI0A 1TCBA 1C9DB 1Q20A 1H05A 4O4HB 2AZ4A 5I7EA 2BFCB 3WSTA 1JQBA 1F12A 1M2OA 3ANXA 1DX4A 3K6RA 3P0RA 4EKDA 1I13A 1Z35A 4DZZA 5EYPB 5JZOA 4F4UA 5JY6A 5TMPA 4Q01A 1RMTA 1SVOA 2X7XA 2YRXA 1KJIA 2IUEA 2K6GA 3A11A 1M2WA 3N8NA 4IV0A 4JJGA 4KSYA 3FAKA 4LISA 2A9OA 3LE8A 3W3AA 4LCBA 3C8DA 3D3WB 3U31A 2FOLA 3K9FC 4JODA 1O6CA 2B37A 2PA0A 2X5NA 4G97A 3T9BA 3VU3A 2DB3A 1SVSA 1ZN9A 1V4NA 2Z2IA 4YREA 1R64A 3U61B 1XDGA 4QATA 1G18A 3A1VA 4JT4A 1B7GO 2AW5A 2ZIVB 3HJBA 3KVRA 4L3OA 3WB2A 2NOAA 1DEAA 1TDJA 2VYQA 1W59A 2JCVA 3PDCA 4Q9AA 4E09A 5BVHA 2FPSA 5C4GB 4QNNA 4QM6A 1RI2A 1A2BA 1JDTA 2XZDA 2ZDGA 1TPZA 2BE7A 3CSDA 3AB3A 3OICA 3X1XA 1MFPA 2A9QA 3ZK8A 2QU7A 4B2LA 1EK2A 1GPNA 2H5IA 4OMCA 1CULC 3O8LA 2F3SA 1RLOA 3CW2A 4RGQA 4PY2A 2LUOA 2ZJ8A 4YIKA 2OBNA 4G24A 3K9QO 1NG1A 2IYNA 2ZSIA 1ECPA 2P5SA 1G98A 2VDJA 5CX1B 2FW9A 4IXMA 4KQMA 3A6PC 1Y4DE 3MRVA 5BN4A 3LW7A 4AQ7A 4R71A 4NPCA 2JK1A 3DOUA 3NLLA 3KTDA 2FRDC 3N87A 4H3SA 2FA9A 4R05A 2WKRA 3A6LA 4QRDA 1QTNA 5F1KA 2A0XA 3IA7A 3U49A 3VGPA 3ZZ0A 4RDXA 5K8LA 2JLXA 1Q83A 4NESA 1Z38A 4TX1A 3RC3A 3L8EA 1KMHA 1L1EA 4LCJA 3K0EA 4N9QA 4U9UA 2UUCB 4R2WA 4BZQA 4HH4A 1NFFA 3MA0A 2J9RA 2PH7A 2F1JA 1CUUA 4QDXA 4H7JA 2AKAB 4RH0A 2X1HA 3AUAA 4NLLA 1D2MA 2BSXA 2AYXA 3V7NA 2OHGA 4FJ1A 5KWEA 4NCAA 3HVJA 1IZ8A 1W5AA 2JBWA 3H8SA 4V0LA 3U2QA 2RHJA 2CV2A 4ARIA 5EG5A 5FUYA 1T9ZA 1A9RA 1J70A 3IQHX 3P27A 2AG8A 5JC8A 2OVBA 3CBQA 3DVAA 3EPPA 2VYND 3RUIA 4DMCA 3S8YA 5IM4A 2DTEA 2WRZA 5JCOA 2P4QA 4RANA 1VSBA 1XCGB 4XQGA 3SXPA 4DOMA 2YOFA 4J2HA 3KXPA 2ZRAA 2OZVA 3OT1A 4L08A 4HEQA 5B1HA 2ZVPX 4QYWA 3JQFC 4B7CA 2ZTMA 4BP1A 1CJBA 4O4JA 4HMPA 3DM9B 1FOEB 5TMEA 4U39A 5ALUA 5K4AA 3ESAA 2F90A 3DEJA 5CFOA 1B8UA 1O58A 2Q5JA 3DVSX 1V37A 5CNIA 3QU7A 5K0SA 4S04A 3CHYA 2P9EA 4C07A 1V6CA 1ZP6A 2O2EA 3JASA 4K9QA 3PA8A 2OVFA 3EARA 5FPSA 4FYVA 3I9JA 3AI1A 4QEDA 1GTSA 3R0JA 3PSAA 4DUZB 3USZA 1PNVA 4RTMA 4BC0A 1II8A 3M6IA 3DFMA 5GM1A 1II9A 3R6DA 3O94A 3R74A 5EE9A 1T91A 1YB1A 2FTKE 5CTAA 5I3ZA 3AHEA 1YOVB 3JQGB 3BMXA 4YUWA 9ATCA 1ISSA 3ET5A 1A95A 1THZA 4U0KA 1K6XA 2C98A 3H11B 2FQ1A 3QFRA 2JJMA 1N6OA 4Q39A 4PFQA 5JASA 3ZVKA 3M4YA 4HXGA 4NZYA 2I29A 2XUFA 1N2IA 1U8XX 4OLJA 4ZJYA 2LVBA 1CUWA 4IVNA 3RU7A 3UK6A 1P7CA 3AM4A 2BFFB 1FDRA 3L4SO 3F5FA 4XTRA 4Y2XA 1L5GB 3NTVA 5IFKA 3PITA 3T5PA 1I3OA 2PZFA 3NP7A 2E4UA 2B1QA 4M1OA 5DHPA 5KWSA 2MSCB 5HGXA 2IXBA 4D3XA 2FR1A 3HVUA 3OKPA 3R0VA 4XIJA 5DCYA 3TG8A 2WSSA 3AI3A 4C3ZA 4TT3A 4DUGD 5JXGA 1J0AA 4AO7A 4XYGA 4EECA 5JQWA 4WIAA 4L6IA 2A9VA 1A96A 2O2IA 3MXOA 4M7RA 1VL8A 2Z3ZA 3RSHA 1XU4A 5BSKA 3BN3A 1YHYA 2ODQA 3PGA1 5C3UA 4AJIA 2GRAA 5LQRA 5EJEA 2GN4A 4G5HA 4FSXA 5AP9A 4O2AF 2AFHE 3TEJA 1ZA2A 2GCOA 3HNOA 1X77A 1YQGA 4FEYA 5DF1A 1YJBA 3ZOZA 4BVLA 4LF8B 2V7WA 2BFDA 4YCLA 1I0ZA 1V1RB 4BE4A 1VMAA 4HGQA 5B6IA 1OAOC 1YACA 2EVWX 3KP1A 4BGUA 1NWCA 1S2NA 3B8EA 3IEUA 4P93A 5CIQA 2FPWA 3ZD7A 4JX8A 5AUPB 3N76A 1GNPA 5EVCA 2XUHA 3FPEA 1V45E 4URFA 4LWZA 2N47A 1AIPA 4G9EA 4JBWA 4YAOA 1JG2A 4YRAA 4B3TB 4DRZA 5AK4A 5IZCC 1HYHA 2P11A 2V7QA 2RGRA 1WEHA 3NTXA 1SUDA 3P5BA 1NU6A 1XQ6A 1H8HA 1DXHA 1WW3A 5I8WA 3ND7A 4LJ4A 1QFJA 1RAFA 3QKRB 4MKRA 4P86A 3CRQA 2A33A 1Y3IA 4AFNA 1PJ3A 1KJJA 1N33B 5D6OA 2B99A 1E79D 1NU8A 2G1AA 3OQ6A 1WPXA 2C9OA 3KKNA 2HDHA 1BN7A 1E0SA 4N1AA 2NAFA 2NO5A 4ESVA 4L95C 2KW5A 1KQ3A 3I1IA 4GPZA 4DMRA 2BMFA 2KPOA 3LFTA 4KIUA 3PJDA 3K5IA 3NVAA 5P8WA 5DIFA 3VPHA 4O1HA 4Y2QA 3C8UA 4U8HA 5JCXA 3W4KA 4V24A 2C5FA 1JN0A 4IHQA 5JPDA 1FUKA 1PLJA 4EHKA 3ZZMA 1DFGA 1GZ5A 1NNEA 4FZ3A 4FHDA 3ZE8A 1RT9A 1DBWA 1WDWB 2G76A 3CRVA 1DWQA 3EPHA 2I8LA 4TN1A 3K9HA 2VTKA 2GTIA 1P3Y1 2FUKA 3BH6A 3GWGA 3KALA 3NXSA 3PHCA 4OQEA 1NL3A 5CA0B 3ZG6A 1HL7A 1LPMA 4BZPA 4DPLA 3CG0A 2X8BA 2ZM5A 4ZQIA 1TRKA 3L92A 1XCLA 2FP4A 1O0CA 3FG9A 1C7QA 4ECEA 2OZLA 2WJGA 2BY4A 4TTAA 3DV0A 4BNKA 5JMOA 3TF5A 1KEZA 3L0IB 4OYYA 5GV7A 3HO1A 5FA8A 1P29A 1T34A 2FMFA 1UJBA 2PVPA 1ZGGA 2VF2A 1XPJA 4RMHA 3EDMA 3MINA 1Z28A 1ZUD1 4ZCLA 3NHKA 4AKHA 2HCTA 3QUQA 4GE3A 4A0HA 3HCWA 1XAGA 2UZ3A 4RD0A 3W6NA 1XK6A 3DAHA 4MHSA 5KS2A 4KRYA 2YN4A 2OEPA 1CZOA 4RO0A 5K6AA 3R75A 2ZJZA 1D4OA 3W3AH 4AICA 3OO0A 1D2CA 1Q0LA 5BUQA 1NP3A 2JGMA 4LSZA 1VHDA 1QKIA 1M2VA 3IVMA 1X1SA 1PK9A 4FHCA 4RHFA 1HDXA 1Z2CA 3ZJ4A 4NDAA 5C4IA 4NCBA 2A92A 4XGRA 4CM9D 3WRVA 4JYZA 1NF8A 1IQPA 3GXOA 2GDZA 5CVVA 1AHHA 3MG9A 2BHLA 3L02A 5AKKA 4FGJA 4NYIQ 3NT4A 3NPAA 4WK0B 2BYTA 1HDCA 1KETA 3M3PA 3GK3A 2BMWA 2P1RA 3M1AA 1J1UA 2V96A 2A88A 1MJ5A 1Z5OA 3DO5A 2JEYA 4ASUA 4I4NA 3S1SA 3BUSA 2R84A 1QZXA 1IXKA 1VG1A 3PFIA 2GXUA 4ZAWA 5HSGA 2PUTA 5G1OA 1K5PA 4ZHQB 1I51A 1BHO1 1Y1RA 1UJ4A 2FN4A 4MVJA 3V1KA 1ZO8A 2JIQA 3KYIB 5L40A 5HNKA 1UJ5A 4N3GA 1X92A 3AINA 3GVPA 1T10A 4MQEA 4WCFA 3TR6A 3IUBA 4OXQA 4QOJA 1A5BB 1P0IA 4NG4A 5CDFA 5KYTA 4YAEA 2FPXA 2FB9A 4H4EA 5ALYA 2RB4A 3AKEA 1UJMA 3OE5A 2IVZA 4HFRA 3ZGVA 2EQ5A 1S3FA 3ZHOA 5B7NA 3LYHA 4DY6A 3MUNA 5L3QA 1NQTA 1ANKA 4DLLA 4MQUA 1CHNA 1FZQA 3PC8C 1YHNA 2A1TR 1E6WA 1Y5IA 2NNLD 4HEJA 4J16A 2J7PD 2XVMA 2NSYA 5JI3E 1HNXB 3N0WA 3GGOA 4EYOA 3IE1A 4INJA 1ZH8A 4XYLA 1G9TA 1LS1A 3DCYA 4PX5A 1FXWF 3UWOA 5CA1B 5LKAA 1SQFA 3O2QB 6REQB 4C29A 5IMSA 4RFSB 3HYTA 4KRGA 3DBRA 6ADHA 2FF5A 1FNCA 4IIVA 1JEYA 1XHEA 2EAUA 1UBNA 2ONJA 3RAPR 1RAHA 2NZ2A 1CNMA 2AFVA 4Z0NA 4AC9A 3IIMA 2JA1A 5IC5A 3WNQA 1C50A 3RTDA 4CEIA 2FEOA 4MWDA 4MROA 4YMWA 4ZDJA 2VZEA 2FMKA 3QEBZ 1N2CB 4KQEA 2FR8C 3BCSA 4UMDA 1Y0BA 3AF6A 4A2QA 3KZXA 3WSWA 1E9EA 1KU0A 1CRQA 2I66A 4WXMA 3VR6D 5HX7A 3LOUA 1EX7A 3ZCXA 1QYDA 4UDXX 3SYRA 1PW7A 4DGQA 1AKRA 1TEZA 2A57A 2DMRA 3IUQA 1DTSA 3QU9A 1FQOA 2HJGA 3GO4A 4CHGA 4ND6A 5AKGA 3U48A 4F97A 1DTWB 2APJA 2W4MA 3L4EA 2QD3A 1NP6A 1V95A 4TQ9A 121PA 1D2HA 1H94A 3M9WA 4QVGA 1EGAA 3RHZA 1KO4A 3MRXA 3OMLA 5DFAA 3ZHQA 1W36B 4AXBA 2LIPA 3F67A 5AJVB 2AFIE 1ADGA 2OV6A 1RQLA 2WZQA 3FLAA 3RVPA 3SK0A 2H07A 3ZU6A 3K3PA 3OLWA 4WGGA 1J8MF 5G0UA 4S0XA 1SPBS 2DPLA 1XMQB 2X40A 5F2KA 1RBQA 2KI5A 5AXDA 3BK1A 2OBFA 4L3VA 3LT1A 3W2TA 1G20A 4D4LA 2X9LA 3D5QA 3OQJA 4ML3A 4JI5B 4MDHA 3RYFB 4AN1A 4EBFA 4WVLA 1I6LA 5AKYA 1DEHA 3A7DA 1AF7A 1F2UA 4NU0A 4IIYA 4RACA 1V3QE 3ZWOA 1DXQA 5KOIA 3BILA 1YVUA 2C7GA 2I2BA 4Z9FA 3SNKA 4CL3A 1LPBB 4RF4A 2JGNA 1GGJA 4BGDA 3HV2A 4IFBA 1X6VA 1CY0A 4QEZA 1A1VA 2B1GA 2GPTA 3S2IA 3UHPA 4G1UC 2IIQA 3E3OA 2EDCA 3NYQA 4YI3A 5HKAA 4IH9A 5IYZB 5EE1A 1JHYA 1ZLXA 3FPFA 1YQQA 5U9CA 1ZMBA 2IYZA 3ZY5A 2HU5A 4HR7A 3PDIB 1EP9A 2YWCA 4GI2A 1U65A 3P2JA 5LKRA 4I5GA 4ZYLA 4L75A 5E8JA 1F1BA 1CX9B 1GFSA 2C2ZA 2J9XB 2WM2A 1IK6A 1ZCFA 3BMCB 3FSEA 1N1MA 4WN9B 3NIGB 1MEEA 4NC9A 1UXOA 2NGRA 4OIFA 1I3NA 3P9RA 4DE5A 1HO3A 3H7AA 3GOHA 2MCFA 3PGXA 3KO8A 5A04A 4FW8A 2Q7XA 3PFGA 1RXVA 2IHBA 5TGZA 2VRCD 4ZMBA 1E1RD 1GILA 3FBTA 5E4TA 2BSQA 4MRPA 3GLHE 1K4YA 3PC7A 1FX1A 4A27A 2ZIXB 5AVOA 2VZ8A 1XXHA 3MLAA 1Y5MA 2GHIA 1V71A 1CZUA 2VEOA 1PQ4A 3EA4A 1XZPA 4F2PA 4BQQA 4D3FA 5DHUA 3S29A 4C4SA 1U1IA 2RGWA 1NMQA 2ZIWB 1YBAA 1R0ZA 3DAOA 4LRYA 2AWNA 3UEOA 4EKYA 3S7ZA 3CF4A 3QK7A 4LF6B 2Q5OA 3AOEA 3OLYA 3WLKX 2RB5A 5KOJB 3H17A 4RY8A 4TS9A 3BCRA 4EHIA 3KSBC 4TSFD 3ZCTA 5LXTB 4JT8A 1E5XA 1R00A 1Z0DA 4BWFB 4Z2AA 1RQ2A 5IAKA 3IT2A 3U6KA 3VKWA 4ICIA 4PQGA 4Z4CA 1ZD5A 3DMDA 3C3YA 4B31A 2ID7A 3B48A 2A5JA 4MLDA 4KUGA 2PRSA 1M33A 3WMFA 4B3MB 1KGSA 3IP6A 3MPOA 4ZO4A 6PFKA 2PYIA 2HZ7A 4XIYA 2DLNA 1J23A 1F6DA 1QYRA 1XZNA 2GD2A 2JGRA 5HIKA 5TLSA 5F3WB 4UHFA 1OASA 2ZETA 2ZRLA 1C7JA 4TROA 2WJHA 2WWFA 4JNKA 5AI5A 4Y2YA 2BEUB 2PM8A 4NCIA 621PA 5JAZA 2IUSA 4WZZA 3LLCA 5EZYA 1ZL0A 2JLVA 2H4YA 5C9ZA 3RF6A 3ORSA 2CHUA 4CRWB 2C57A 2P2NA 2NYAA 4OAOA 4PSCA 5A5DA 2BUCA 2O8FA 4GKJB 1OGIA 3R1IA 4CMBA 1OXXK 3KHSA 4PC7A 1OYYA 4FNAA 1JVBA 2C0CA 3UJ7A 1WW2A 1HG0A 3Q7QA 1VGVA 3U9SA 3WMRA 2BAGA 4R1MA 1FYXA 1QBKC 4Q9HA 4WA7A 4KYVA 3PWZA 2TSYB 5GJWC 3GEGA 3QA9A 3NEAA 4IOLA 1SUCA 3JQ8A 1Z83A 1YZFA 3R3HA 4P7BA 4DLVA 3O8QB 1I9CA 2GUGA 1KP2A 1Z6XA 2H7CA 3DV2A 4UBNA 4XQ0A 5BOVA 2Y1GA 1JEEA 2G8LA 2R86A 2C7OA 2VF4X 1LD3A 1QQ7A 1TZKA 1W47A 2GK7A 5FOVA 1SG0A 1WBJB 3C1TA 3OIGA 3RJMA 3OSUA 2CC2A 1NMYA 3EEFA 4IVQA 2Y4OA 4GR5A 2IXTA 3HR7A 4YACA 4YDHB 4M36A 3VU9A 2ZUSA 3FYDA 3WOHA 5JPCA 5DTQA 1OMOA 2GN1A 3K8ZA 4NBRA 3DTNA 5IC4A 2XF2A 2X9VA 5C5CA 2VK2A 4NPAA 2D7CA 3I5YA 3ZHSA 3W9UA 1QF9A 4YV0A 3U3JA 2YNMD 1W85B 2BGTA 2JCGA 2R1TA 2VP9A 2P9CA 1U31A 1XZIA 3AF1A 3OX1A 3PXUA 1OJ7A 1XZQA 4CQLB 5KJFA 1A8SA 2QD5A 3HZOA 3KKQA 3PR2B 4X24A 2JLSA 4KX3A 2H63A 1SH7A 4JA0A 3G59A 3NR2A 3NV7A 3UJ3X 1BKDR 4MVJH 3DCIA 2JFHA 2MIIA 1GKIA 2O9JA 3MT9A 3TD2A 3V32A 4JI8B 2GZHA 2I7VA 3KJXA 4D46A 3FSRA 4ZVOA 4YP6A 4OK5A 3LPCA 3M82A 3QIAA 4QELA 2IF2A 3K4HA 3OPYA 3L1JA 1O95A 2C4MA 1C1XB 1P8AA 1YJAA 4NE2A 1A4IA 3A9RA 4MNTA 3HPQA 5BMVA 1DJQA 1RHKA 3VTFA 1T4CA 4DDWA 2O52A 2JGDA 3KSZO 3FVVA 3KQMA 4IG9A 1ODKA 4MV7A 4N7RA 3HI4A 1R37A 3AIIA 3I23A 4RTPA 3DO8A 1T8TA 3CJQA 1QG0A 4DJAA 1OFHA 1ODSA 1JYEA 3GRCA 1NV8A 4OXKA 1NVEA 2JFGA 2CCGA 5IASA 1T36A 3LUCA 4BQFA 5I9LA 2HO4A 5CP8A 3R76A 3HKDB 2BTQB 4MVJF 4O2LA 2YWJA 4X97A 1RWOA 2XNHA 1Y3DE 2FUG1 3SIPA 4RYLA 1T0HB 2C8VA 3VSEA 3WGMA 2ZBGA 4R3NA 1Z68A 3ZDQA 4F86A 4PV7A 3AL3A 5H0IA 3M4JA 1AKMA 4JBNA 1OTYA 4KODA 5F77A 3TR5A 3MSCA 1CWUA 4MMXB 1ZCZA 4AJLA 1V3UA 4S24A 5AI4A 3FWPA 1LPNA 3UPUA 3PRKE 1RFLA 1GPDG 3IQGX 2OV2A 4BQNA 1NUUA 1Z2NX 3ADCA 2DETA 1RQNA 1XA4A 2RHWA 2AX4A 4QREA 4LRUA 1JZTA 2R7AA 5I7AA 1B6RA 1UBTS 1RE0A 3EEOA 3PGKA 4PZLA 1GCOA 2IS2A 4H3VA 5K3FB 4NYMQ 4YXWA 4HWOA 1M76A 1NURA 1BMDA 2B4KA 5CA0A 3I61A 1XQWA 1S2MA 3AGPA 1PSDA 1R15A 4TMWA 1B2RA 1JQAA 2C97A 2CHFA 2ZBQA 3T5TA 3WMEA 1Y8RB 1MU0A 4Y0AA 1SQSA 1J24A 3OECA 5AICA 3IDFA 3B6MA 1Q0SA 2CGEA 1A5AB 3TQQA 4D82A 2ZZMA 2XQKA 3NUZA 4TMKA 5K6AC 1GTL1 2YHBA 4K6OA 4O2BB 1I4EB 2YMLA 3ANSA 1O0SA 1SBYA 1N7IA 2CLFB 3IULA 3N74A 4OHKA 1YR9A 1JBEA 4GZ6A 4E5VA 2XIJA 1PFKA 4A03A 4P3NA 3SEFA 1KAOA 4QGSA 4YRKA 1HDIA 3OU2A 3PRHA 2AOTB 5JDIA 1VI6A 2GA8A 4J0GA 4FYKA 4KK3A 3FPGA 1C1DB 5DCUA 4QYSA 3UHOA 1Z5NA 4LWPA 1YDWA 5FYQA 4CDNA 1THTA 3T1OA 3GJZA 1WB9A 1NQAO 4E5KA 1P6QA 5JO0A 4KGDA 4BV3A 4XZ3A 3UAWA 3IMCA 3FTFA 1X19A 3UXMA 4NEQA 1JA9A 1YTUA 2C92A 4MKGA 1GUYA 2NZUG 2PNFA 1S8OA 4R1NA 2Y1DA 5F12A 1W93A 3S5JA 1T0JB 3UMJA 4M8KA 2AHOA 3KQUA 1U63A 3OWXA 4O4HF 4YCBA 2PZBA 4D4JA 1LI4A 4LZWA 3U3XA 2Z08A 1G9SA 4RPKA 2ZI9A 1HE3A 2OHFA 4P81A 4WCFC 4ZHQA 1A2QA 4RL6A 3AT1A 5CLIA 2P90A 1BA2A 2VWQA 4MJLA 3J81k 2X0NA 1KAQA 1NR7A 3EGWA 3PR3A 4DR7B 4Z4HA 3H97A 3A1CA 3PYLA 4D3DA 2WSMA 4PBSA 2Q0QA 5DLDA 4U4AA 5THKA 2XT9A 3AM5A 1BKYA 5F23A 4ESHA 1JDBC 4J16C 4K28A 3VR5A 4MEAA 2ZB4A 3IAM1 1ONOA 3GRVA 3QGMA 1UP6A 3BRCA 2VDVE 1I5OA 3FLEA 1M1YB 1RRMA 2VK8A 1C9NA 1CR4A 4Q9KA 3WICA 1XMJA 1FSGA 2QD2A 1UMBA 1K5GA 2YIVX 4N7MA 1F7UA 4FR0A 5ALTA 1Q7RA 4CLHA 4F7DA 1PG2A 4LF5B 5F5LA 1MV8A 2B8EA 3A31A 1RLIA 1WXDA 3CXUA 5FNZA 4KUEA 1ZQ9A 1GG5A 3K1AA 4CT4B 4MUXA 1B76A 1ZN2A 4AKTA 4CM8B 1TZCA 5DEIA 5DM60 5ITWA 3C6ZA 2QRMA 1EA5A 3S2YA 4DYVA 3CO0S 2X5KO 5IK2A 2Q49A 2F8SA 1VE5A 4KFSA 3TSCA 2UVPB 1V2HE 4RHCA 4UCXA 4ZCRA 4LJKA 3JZAA 4YDQA 1PN3A 3II6X 4GS5A 1Q77A 1P4AA 2W6QA 3E9ZA 4DREA 1GKLA 4N18A 1XTTA 3JWPA 5L6LB 3DT8A 2QW1A 1ZR4A 4CMCA 1VHWA 2EQBA 3GWZA 3BWVA 3TLMA 4TQGA 1M6VA 4GQBA 3KV1A 1L5OA 2OR3A 1DHRA 1N5IA 1C3OA 2K2QB 1C0KA 1ENPA 1MQAA 3F8WA 4PLYA 4ZU3A 3T5BA 3C41J 1SC3A 2ZSDA 3GLTA 5J2TA 4GUAA 2M9MA 1RYYA 3TL2A 5DM70 3VUEA 3N2KA 4OGLA 3GVHA 2YASA 4NV0A 3UC5A 5L95A 2M6SA 4Y2VA 1G59A 2Q8QA 3GEDA 3SQOA 1JIIA 3HR4A 3R77A 4CR8A 1PEYA 1OH6A 4M0UA 4H3HB 3VO9A 2XCIA 1CTQA 4M46A 3W2GA 4BTLA 5C1DA 5KCZA 1ABFA 3QOXA 3WGTA 4FEEA 4M76B 4J8PA 4B74A 2CLDX 2YJNA 2ZXUA 4JBGA 1NDHA 1TCVA 4DQDA 1ZZGA 2FUNB 2Q3LA 4C03A 5BN1A 2Q9AA 1CY7A 1PCXA 1QZ3A 4EYQA 1ZH4A 2OAP1 1ETHA 3LT0A 1AJEA 4CV2A 9GPBA 3ZJYA 3H9CA 2FSIA 5G3YA 3TS1A 4X65B 3L18A 5JZVA 1RIFA 5K05A 3AF3A 1JS1X 3NHZA 1DKMA 3H75A 1E6MA 3I0ZA 4LFCB 2IU0A 3EIOA 4QOSA 1H3NA 4YV7A 1GT6A 2H0RA 4B33A 2V5VA 1CU1A 4C06A 2XUIA 5B1YA 3DMYA 1BEEA 2CF6A 2O8VA 2NU9B 4FZ5A 1P5FA 4EMUA 5M7EA 2IE0A 3H2BA 4LNAA 3OE7A 4OHMA 1DAHA 2GVZC 3ROGA 3SF0A 5EEHA 2JJYA 4KOAA 2C2GA 2GJAA 1J0BA 2C2HA 1O77A 1AD2A 4RADA 4WNAB 5EXDA 2QF7A 1HQDA 4D2IA 3SBEA 4YMHA 2AFRA 3IOCA 1EJ0A 1XRSB 3K2EA 2B7LA 3CLSC 3P4YA 1GG9A 1FTNA 5D00A 2DSTA 1NBAA 2I7DA 4PYIA 3U4QB 1C0EA 4IWYA 2BELA 4D6YA 5AVUA 4WN9A 1E5DA 2FRXA 5CYFA 4Z9XA 3KQSA 2C9ZA 3TXYA 1PAUA 3DNMA 2PFKA 1UC9A 3DR5A 4D5GA 2P2SA 1MAAA 4E32A 5BV7A 3DFFA 1YJ8A 2QP9X 2XXAB 2LZ0A 2ADFA 2QR5A 2XBUA 3F6YA 5C1BA 1ZM4A 1YB7A 2IYUA 1PZHA 4G5OA 4EWLA 5DK6A 2DLCX 1BX1A 1WSAA 1CDZA 1EZZA 1Q95A 1P91A 3TUJC 2QZSA 2XMDA 1H0KA 2FXVA 2YJ6A 1U0OC 3TW0A 4B3CA 4REOA 2ZIXA 3V4VB 1Y5NA 3O0TA 4AKEA 5IT0A 1X86B 3C8ZA 4RGYA 1SM4A 5ICEA 4EJ6A 3AOEC 3ITEA 3ENZA 1MVNA 2AIRA 1KH3A 2P6PA 5E6RB 4HQRA 3AJEA 1AQ6A 3TSYA 4F92B 1E0KA 3I4CA 2H4JA 1F6WA 2JFUA 4LTMA 4KHPB 2YYSA 4Q1DA 1AV7A 3ZZ1A 4BPRA 1JBKA 4FYMA 3MWDB 3E23A 5LXTA 4RENA 1XMIA 4B44A 3IMFA 5G02A 1WDMA 3UCXA 3TCKA 1CQIB 4LJ9A 4G4JA 3ZWWA 4HYTA 3H5RA 5FAKA 1PWXA 2OM2A 3EZ7A 3G6KA 3PVCA 5FEUA 3PEWA 2CEKA 3B1FA 4ND2A 2P79A 1F38A 3M5CA 4NZPA 2W6JA 3I5XA 4UM9D 4BIIA 2IEAA 4G9BA 5J4KA 4JXXA 1N5KA 2IX3A 2R8BA 2C7PA 1NC3A 1KI9A 2O1WA 1F51E 1T3GA 3JR7A 3PUXA 5JFOA 4FMPA 3V8RA 3G89A 1FMTA 4E5PA 5E9AA 1RWKA 2CXUA 4FT4A 1BDHA 2OXCA 1OR8A 2ZG6A 1A5SB 2XBLA 4F38A 3AEQB 3BMQB 1E58A 1EFUA 1OLUA 2IIVA 2X8AA 1Z4JA 4GP6A 1E2DA 4JLUA 5ERYA 3SHFA 3VU0A 2UYGA 2XA9A 3V7UA 3DTVB 3JZIA 2AWOA 1R74A 4HB3A 2M2IA 4L50A 3NG1A 5JSYA 4WBNA 2OWEA 3A2LA 4EY3A 5IKEA 4OMDA 4GBJA 1ZW6A 3Q9LA 1T3LA 3DHNA 4IJ5A 1WZNA 4TZTA 2H59A 3KYCB 4FE4A 4IRMA 5B53A 5IAGA 4I5EA 5K3AA 2HK8A 1HT1E 4QHYA 3Q87B 1J2YA 1RJWA 2FF7A 1PJ4A 5CLHA 2XHEA 4KI7A 1F4VA 1C5KA 4PLPA 3JVIA 2IX9A 3TZHA 1G63A 3P19A 3TE7A 1WKBA 1QZTA 1CUFA 2OBBA 1J8QA 5FOSA 4HNTA 2IF0A 4ZPJA 2C0QA 5BR7A 1QK3A 3NDRA 1XO1A 2J6HA 3IHTA 2WQ6A 2H29A 2VTDA 2WPDD 6LDHA 1MOQA 2D1FA 2R85A 2GN0A 4W5QA 3IV6A 2IYYA 1YRLA 4PNZA 2XGSA 5CA0F 1DAKA 3U16A 3LA8A 5BWCA 1CUIA 2Q3HA 3OPVA 4RHYA 2A0KA 2W8BB 2HTEA 5JMWA 3OFJA 2JCXA 2E82A 4RS4A 2JGKA 1BE1A 2QRUA 1ZD8A 1X1CA 1XALA 2JH8A 1IVNA 1ZC4A 4X84A 1KDTA 2IL1A 3VNVA 4UVHA 4HVLA 1T3SA 3ZI0A 3K72B 4NOKA 3RSGA 4OY3A 2PGXA 3A1DA 3MGCA 1RACA 1HDEA 4TOIA 3STUA 3TLBA 1C3LA 5CX4A 3INGA 1CDDA 3LBNA 4QOFA 3ICPA 4YAJA 2OG1A 2R8ZA 5J58A 1O95C 3PNBA 1U1CA 2B6NA 1PR2A 1TUBB 2I6TA 3PIIA 2PGLA 3P9SA 1GTMA 3S6JA 3UOAB 1P2VA 1YDEA 2AN3A 2HFJA 1H93A 2W98A 3E7PA 5LB2A 1PLLA 2CUNA 2IYLD 2YOHA 3CTPA 3LY5A 3T1VA 2FVYA 4GPAA 1JL3A 2R8EA 3KKZA 3OIVA 3VR5H 1EJBA 1HQKA 2BLNA 1C1YA 2EFJA 5BSVA 2RGYA 4YRNA 1EG7A 3G7NA 4O1IA 1LB1B 4C4TA 3NOXA 4L8WB 1IJKA 5E6UA 4F72A 4MA0A 4PM4A 3CUWA 1GFIA 1YDFA 2WKQA 4NDZA 2J8ZA 3DC7A 4KLRA 3B12A 4RVDA 1Z88A 2D2EA 3OEED 1J25A 4TKLA 1L4YA 3ROZA 2YBEA 3ICVA 1M6YA 3I34X 4ZHQF 4PRLA 1Z8HA 2NYRA 3B9PA 4QUDA 2F4VB 3TLYA 3W2FA 4B81A 1I4TD 1JWBB 3A70A 5BV8A 3H8JA 4EFMA 3P0IA 5HPYB 1UK8A 3EULA 4J0KA 1PJZA 4QYXA 5EWLA 1GADO 5H68A 5LOVA 3CLUD 1HYEA 4ZXFA 1WHSB 3GXBA 1HPLA 2D8AA 4GL4A 2YRWA 3CRMA 3D43A 4AAYA 1GAEO 1PNOA 1W1WA 2ZIZA 3HHEA 4US0R 3NDIA 4C0BA 5KPDA 4MPRA 1VTKA 3ZCSA 1IY9A 3WGVA 2GWHA 2ZDQA 1IOLA 4MR7B 1Z73A 3HY4A 4M1MA 4KJXA 1U94A 3ESXA 3BJEA 2OK7A 2VVTA 2B8JA 3AXTA 2BI7A 3V1NA 1GL9B 1NQXA 4OGFA 4CQJA 1D2GA 3QHQA 2IYAA 1HDOA 5K3FA 2HA7A 5KQMA 1ZY2A 1NLMA 2QD4A 2OBMA 1KVRA 1P9WA 4KLAA 1I7LA 4TSKA 2F17A 2FUEA 2QVBA 1TVMA 2ZOSA 3AEZA 3IQDB 4JJKA 4I3GA 4BU1A 2HMTA 3G82C 4BCDA 1XZEA 1KRHA 3NBUA 3A6DA 3NTUA 1CETA 3KPJA 1PT9A 4JENA 1EE2A 3LS2A 1OIWA 4NBUA 3DYVA 2ZSKA 3F8SA 1KAHA 3BMNB 1X1AA 1RADA 1WXGA 3RHTA 2F00A 3GLVA 1G41A 4MZDA 1DSSG 4QECA 3FZEA 4JL6A 4PQEA 4U2DA 4Y2SA 1L8OA 5JDIC 3AYZB 3QTBA 1KVUA 1PYGA 1MAHA 3NXKA 2AQHA 3WKEA 3R41A 2OSVA 4XJXA 2DFKB 5EMJA 4CF6A 3NP9A 1JG1A 1I30A 3K4QA 5A4FS 4I9UA 2BM0A 2BONA 2R3SA 3SBOA 4B3SB 5ALRA 1V7CA 1NVWQ 4HY3A 2ORIA 3C4QA 4ETIA 1KR2A 3JYOA 2JAWA 4MDYA 3IEXA 2A84A 4OSPA 4UVDA 3Q15C 1PYOA 1C81A 2JLBA 3DZCA 5KX5A 3CR3C 3KZCA 3UWPA 1QG4A 1JQ5A 1JZQA 1NOKA 1W6RA 3WNCA 4Y7DA 1CJMA 4MS1A 4Y9DA 2ABWA 3I9V6 1IIBA 2F64A 1F1JA 3KOYA 2JGAA 4P98A 2GFHA 5DPMA 2X6RA 5GADl 1SCUB 4UE6A 3ANTA 5BRAA 4PO8A 3IESA 2HDNB 1F0PA 2BZGA 3P7MA 1T2FA 3OQPA 4PYOA 1TAHA 3L1HA 2WTNA 1D9XA 5ETJA 3UA3A 1A5ZA 4F2GA 1LSOA 3SOZA 1I2BA 3W5BA 1G291 5EIOA 3TAUA 4C43A 4EW2A 1F5SA 5B6JA 1EFTA 4YRCA 1JR3A 5E38A 2AOXA 2PKYX 4K6GA 5ADWA 1E32A 4P0TA 2BFWA 4X8LA 4G5QA 3X3HA 1NPYA 3KE8A 1YZKA 4Z1OA 4HLUC 3NBXX 1NVFA 1EWTA 4F4JA 4C1NA 1KO1A 4B32A 1C41A 5IYZF 2WM3A 3LP5A 3K15A 3QVSA 3IURA 1E1QD 2YVAA 3FM9A 4RKEA 1U3UA 1W48A 4DCSA 4RULA 1FNBA 3QPDA 4LOAA 4FDTA 4AG5A 2H7YA 3MUFA 4H15A 4HQFA 4C6HA 2I7XA 3B2EA 4YJ2F 5DLQC 5K9ZA 2XH8A 2W0MA 2XV1A 4HZUA 4G1CA 2CFIA 2FWPA 3GPIA 4YT4A 5DM4A 1EBBA 2QRHA 4Z0TA 4RZSA 1Z15A 3QWBA 4UCFA 2LCQA 1GPAA 4LC1A 1AO0A 1S9DA 3I04M 3ZKAA 2Q62A 4RKQA 4UU8A 1OREA 3H4VA 5MF6A 2FU5C 2UVPA 4HNHA 3SLKA 5JC1A 1I94B 1O6BA 3DEKA 4OGWA 4ZA2A 1GTJ1 1MJGM 2EX1A 4AMVA 1QXSA 1TKAA 4LY0A 3ZNNA 4LOKA 1ONPA 3B51X 2ZYRA 5JATA 3B6EA 2QY9A 1WR8A 2ZE5A 2Q3CA 3D4LA 3IXQA 3O91A 4QSHA 5CVEA 1Q7TA 1E6CA 4PR0A 1XTQA 4AY6A 1SK8A 1E7QA 1CY8A 2EFHB 2OFOA 5C5IA 1HX7A 4Z7JA 4DV5B 4L15A 2HIGA 3O1IC 4FBGA 2W2LA 2BP7A 1K86A 3IYLW 3GLUA 2J33A 1Q1AA 2RD2A 4TTPA 5IAJA 1G8JA 5LXTF 1WCIB 2QUKA 4BV8A 1KSHA 1PVDA 3GC6A 2QGFA 3AEUB 4Q3AA 2LCIA 3V4FA 2CL7X 2AKEA 3DMTA 2O57A 3EMVA 1YRWA 4HTFA 3R6WA 2WJJA 1QVVA 1STOA 4QAQA 1QR2A 3ZWKA 1YE8A 4KE7A 4ERXA 1LVUA 1RLTA 5REQB 4LZNA 4I14A 3GLQA 3C7AA 1QYIA 2CNWD 2GRUA 2YX1A 3MBOA 4BMSA 4DA0A 2PBZA 2GPWA 3FLBA 4P5EA 5IM4F 5EJAA 1K9SA 4YONB 2WT4A 3OQVA 3EDQA 1UUFA 1YR8A 4FPXA 2MT9A 5CRIA 1M72A 4G5YA 3GZ4A 4BRZA 5JAPA 3LJKA 4YAIA 2WT8A 4U02A 3PJEA 1UBRS 3CWQA 4FYJA 4J4BA 2I78A 2CLLB 3IDAA 1QYXA 4TWZA 1G8GA 2Q0XA 1Z17A 3P2MA 4AJJA 2OFXA 4KRXA 5IAOA 3ICEA 2PBRA 2X19A 3HCFA 1GNSA 4Y1GA 1GGMA 1OF1A 2UAGA 5F5XA 3WNVA 2C84A 3BIWA 4JGBA 5DVZA 5GAJA 4URYR 1YQ9A 1BXGA 2OCDA 3HL0A 4ZC1A 4IUYA 3IUJA 4N47A 1I4WA 1FYFA 1QO7A 2IYTA 5J23A 2Y77A 1DBPA 5EERA 3WKCA 4EW6A 4J0CA 3EZ2A 4ND5A 4ZK6A 3U4QA 4PYLA 3EJWA 2HA6A 1QGAA 3BGOS 3W5HA 3KM0A 3PXCX 4FXOA 1TI7A 3FJ1A 5FTMA 3K09C 3WJAA 4U2KA 1B8PA 1MX3A 1G1MA 3MOGA 2PG3A 4PN3A 5AI8A 3FPCA 5PGMA 3G3EA 1RZRA 2X23A 2GGSA 4PS1A 4LKOA 2ONCA 3S4YA 4MMYB 4DANA 4Z4IA 3LCCA 5DMXA 1JAHA 1M54A 2O0LA 4E4TA 1CW2B 3FFXA 1LGYA 3DMFA 4L0CA 4XARA 1Z56C 2RBGA 4KW7A 1CR1A 2OENG 3QUAA 4HB2A 3MT7A 1FRNA 2HJHA 3ZDXB 1KI4A 3FCUB 3FI0A 2QRQA 5J59A 3JD3A 5I7VA 1IYZA 3CN7A 4DLBA 2XCSB 2OORA 4O4HA 4ZVLA 3AEYA 1A7UA 1W7AA 1XD8A 3PQ3A 3QP9A 1EM6A 3BE4A 4FB4A 3CVJA 1WW8A 5J1SB 1U2PA 1R8QA 3IAAA 3QW2A 2LP4Y 1Y6ZA 1AQIA 3BWMA 3FKSA 3HZHA 3WLIA 5I7OA 1JLLA 3C7TA 4FC7A 4GO1A 3BMOB 1TK3A 2VP3A 3CFYA 3ZU5A 4ADSG 3N8IA 1MIHA 1SMKA 1IFXA 4BNGA 1EQUA 1BKSB 1N2ZA 1E1NA 1FMJA 2BBSA 2V5UA 1S2LA 1UINA 2D06A 3A9CA 3TR0A 1UEIA 5G41A 1KPGA 4EKIA 2FVXA 3STVA 4RABA 1W5TA 5FD8A 5BWBA 3TLCA 4DNPA 1P2FA 2FPMA 1Q0QA 4P9NA 5IYZA 2FPRA 3BERA 3AFHA 1L8XA 1W88B 1UFRA 4FYPA 3FVWA 3CH6A 5AH0A 1XBTA 2HLDD 1YVPA 1YS6A 4J75A 2J0QA 1XX6A 2N1MA 3AEQA 4K9DA 4YRDA 4JJ4A 5JH7A 2C7BA 2YWRA 4UOEA 3ETDA 2IUYA 2PVSA 2AMVA 4JVLA 5GZ6A 3WHLA 2PH3A 4YRTA 5LCXA 3UUGA 2W2KB 3ZUPA 4C4RA 1XOIA 3FOAA 2GKSA 1V5EA 4R2MA 5LOVF 4LHYA 3VZCA 5A9RA 5IDQA 3CUUA 4CN8A 4DSUA 1V1MB 2QTVA 1CEXA 4ARBA 4EHHA 4XTCS 3NBYC 5H59A 1LPSA 3EG9B 3FSGA 3AX6A 5HDQA 3MF4A 2CF5A 2HGSA 3TTUA 3WR5A 4LYYA 4LBYA 1Y7LA 3AFIA 1XZGA 2ZANA 4MUFA 4RKRA 1SUIA 1XB2A 4L16A 3PCRB 3D4NA 4PSDA 4RPCA 5JU6A 1OBVA 2PQ6A 2XB4A 3KQQA 5EXSA 1YZ3A 3GH1A 4EHBA 4EUHA 3LXUX 3P0HA 4TYYA 1PDWA 1U3VA 3GRFA 5GMOA 3U40A 1UM9A 4BGEA 3S8MA 3B9RA 1C8KA 4C7OB 2W8BA 2PIAA 5EE0A 2F8TA 4F7WA 3VDMA 2J0UB 5KWIA 3BIJA 2EBFX 3NWPA 2I7TA 1M6HA 1WZCA 3GDHA 1X7YB 4NHOA 5FFMA 3R6LA 1KZ6A 3A58B 3QOYA 5ILOA 4IX9A 1ST3A 1J42A 2ZVJA 3WV4A 3I2HA 1RKUA 4YP7A 4O2BF 5JRZA 4LV8B 4NE9A 4H7PA 5BSHA 5CVTA 2GHQA 2YZ2A 5GONB 4I1PA 1V35A 5C51B 1NJFA 4JXZA 4QULA 3QX7A 1HV8A 2ON6A 2C03A 4NICA 4HX5A 1JDNA 1P77A 3I01M 1UBMS 5IDYA 4HH1A 1HURA 3B7WA 2R68A 1SUPA 5DWQA 1QRTA 3G0CA 2N0SA 4IWXA 2P1DA 3UT5A 1EUQA 2FZVA 1QKKA 1J97A 1E62A 1VMDA 3VPXA 2FW6A 4A6DA 2NWQA 3HFSA 1I5RA 5DN6D 4GUDA 3FFAA 5IUJC 2XEXA 3O8BA 1RRKA 1R0KA 1F8FA 2A5DA 4H27A 4Q4AA 3OHPA 2N75A 3MYRA 1SAYA 1V5GA 3EH1A 2IS6A 1T9HA 2Q6TA 3KB1A 2FMTA 3UXYA 3M2TA 4YK7A 1WTAA 5TR9A 4GI3A 1X39A 4BAGA 3IXMA 4B2YA 3FMIA 3HKBB 2F1HA 4UUPA 5ERXA 2XQFA 3QPCA 5JBNA 4BMXA 1NN3A 2SKCA 4D9GA 4L8VA 2HIAA 2Z5GA 3RVRA 2IYRA 3IJEB 4QXRA 5FLEX 1UH5A 5AQ1A 5D86A 5HM6A 1D0VA 2H0QA 3T9CA 1YZUA 2J3KA 3S8EA 4NXMB 3G9UA 1E2PA 2BKVA 2ROQA 3AR4A 2QAGB 3QXJA 2R2GA 4HB0A 4KCGA 4OO3A 5HUJA 4ZTUB 2JLRA 1K88A 3TRDA 3NRJA 2QYOA 4NONA 3CCCA 4RH1A 4X20A 1YF3A 2BM8A 4Y6LA 1E92A 3UY4A 4IXWA 2K5UA 2J48A 3HWSA 1DMRA 3O1HB 1MAVA 1D4FA 4HJXA 4IDFA 5LYJA 4F2HA 1ISHA 2YN0A 2HT1A 4NENB 1PUIA 1Q6YA 1TM2A 2W6CX 4L3WA 4ZAZA 4AF8A 3GQBB 3MRSA 4YAUA 4J7XA 4YASA 1REQA 2OILA 1GAQA 1RNLA 2QXYA 4NH0A 4PXYA 3L7YA 1G16A 1TL7C 2JK0A 4WH0A 1PKXA 2AJDA 2YVQA 2PYDA 3QITA 5DBIA 5G4KA 5GP1A 2Q8PA 2P68A 3E9YA 3GA0A 1J9GA 4MVJP 3CKMA 1H23A 1L2TA 5GGXA 5IVPA 1GITA 1Z18A 2P2CA 1C0LA 2J08A 3FNQA 4OLHA 1PFYA 2XD9A 3TJRA 3VNUA 4M9CA 1QU2A 1FNNA 4LSWA 5A3SA 4K6KA 2AHRA 1F3OA 1YBFA 5L9AA 1YRAA 2A0FA 3L7CA 1GUFA 4TUYA 3H87A 1AGXA 1MBZA 2VAMA 3AFNA 3AESB 4FSDA 3RU9A 4EK9A 2XRMA 2J3DA 1QHXA 3HSSA 1GTRA 2GBGA 2Q3DA 3UJNA 4URWR 4MVJI 3W79A 2PZAA 1QLWA 3VPFA 1QK5A 3VYSB 5L4SA 3FHLA 2QKYA 3DNFA 3O6VA 1E2NA 3E35A 1OAAA 3A9WA 3QHPA 3VNBA 3TUIC 4MARA 3RTBA 3GA5A 3GUHA 1FCJA 3JWEA 3NIFB 1D6JA 1NN0A 2UDPA 3HA5A 4HQKA 4PCAA 1PGQA 4U2FA 4B76A 4DXDA 4JI4B 4XM2A 1CHDA 2YN2A 4Y30A 3MERA 3ONDA 1JIVA 4JC8A 4WZAB 1O08A 1SIBE 1NW6A 5IS2A 1ZD2P 2PSJA 3JQAB 4QWWA 3FHCB 3BXZA 2PKCA 2NT4A 3TZKA 4ER7A 1QCDA 5JYBA 1XJ0A 4F5EA 4ITRC 1IUOA 1KJ8A 3U39A 1ULZA 2BC9A 4RTLA 3BXFA 1SXJE 2YXPX 3ODPA 4KVAA 1Z0KA 1CEEA 1Y7HA 3D8NA 2D8MA 3KCQA 2M6KA 3PPWA 4DV2B 5ALJA 4S2EA 1TEVA 1JYSA 1SBNE 4C6RA 1JFFB 3G1UA 4R98A 1H66A 1SXHA 1NR1A 1GUZA 1H6CA 4I6GA 5TQ2A 3ET4A 4UTZA 4ZARA 4EGQA 1RWNA 2AFHA 1DRUA 1W96A 3L40A 2P6MA 1YDHA 1G21A 1VP9A 5LJLA 5F73A 4OH7A 3P5SA 1ZNYA 4FTWA 3O4FA 3RR2A 1OILA 3KQOA 1V16A 4RZUA 2QTWB 4R9NA 3NZEA 4BO8A 1I7QB 3DFZA 1A9ZA 3GLGB 1H1DA 1E3LA 3BWDD 3OA0A 4S1NA 4ZTBA 4B82A 1TIBA 2QX9A 2XIQA 1ISPA 1DJOA 3U0VA 1OBFO 1RQXA 4B0OA 2ASVA 5T64A 1D4ZA 1QIHA 3NKLA 4A91A 3B2QA 1K2WA 5TDHA 4N7BA 5ELXA 3W5DA 1TKCA 2KBFA 3R5JA 3TQFA 4X6UA 1RWXA 5TB5A 1LQUA 1XTIA 5AUNB 2X0KA 3OD1A 4OKSA 2HBYA 3A9SA 5IJAA 4QXOA 1L4GA 3AP1A 5JXJA 1OWLA 2MHCA 2BCGY 1GSAA 1IHDA 2KHZA 4ZEOA 4AYTA 1JFTA 5CCEA 1HRKA 3GRZA 1QKJA 3AIMA 3DL7A 4FSHA 3CPHA 3NEYA 4GHWA 4X0EA 3VYWA 4F3YA 5DOVA 4KAJA 2H2GA 3TGLA 1T5TA 3RJZA 1Q7GA 4MS4A 2PU7A 3TOVA 3LHFA 1T0BA 3OIWA 1UWKA 1Y63A 1T9GR 4A6XA 3SC2B 5A0TA 1CIVA 1C2TA 2O6HA 1U9YA 3DMTC 4Q3NA 1N36B 1GKYA 1QM5A 4YYZA 3SC3A 1W0JA 3UH0A 2YHSA 1V9CA 4IO1A 5IJZA 4CUZA 4QVKA 3PXGA 1YA6A 2YFKA 5IF9A 1FJXA 2XUQA 4X00A 1H4SA 1RQPA 3JX9A 4PC2A 4F91B 3E8SA 1Z08A 2D3TA 4ZV7A 3I8XA 1RQGA 3FZNA 5DT9A 4C08A 2M6RA 2QQEA 2QRLA 2O1EA 4N5MA 5I4KA 4LZJA 4QYIB 1LVHA 5KU1A 2ZXFA 1UIMA 3ITDA 3K0FB 1S96A 4INOA 1TQDA 2YWFA 3KCNA 3WVNA 3ZIAA 2OCGA 4N49A 3DC2A 2VF5X 2PS0A 3C6XA 3E9DA 3I30X 3Q5DA 4KXLA 2ZT7A 4QPNA 3SBXA 4MKHA 3RYCB 1CZNA 1D2EA 4BEJA 5E1OA 1QNFA 4YR9A 2OE2A 2V8OA 2YWBA 4C4OA 3LK6A 2W4QA 3ISTA 4F93B 4MVCA 2PO5A 3ODGA 3RVQA 2IGBA 3IUSA 2QTTA 5HJ7A 3MS4A 4PLGA 4KQJA 1R16A 3IDOA 4W5JA 3KQLA 1Y89A 4KPUB 4PN7A 1H3EA 4IGFA 4QBFA 3ZIDA 2EYQA 5E9WA 3QBDA 2PKEA 4H7HA 1Y6RA 2ZJAA 1DJNA 1UAGA 2EQAA 3LCRA 3DPIA 3SXUA 3TZLA 4ONEA 1PDVA 3F78A 2C42A 3NB0A 1G6HA 3LHIA 5MFZA 5IVKA 4TYPA 1NXSA 1PK8A 4OHBA 4KBGA 4D57A 1PFVA 5A5EA 3BTSA 1QS0B 3UN1A 3BD7A 1C30A 1IXSB 3CMCO 4P7FA 1G5QA 4RK1A 1TIPA 2XMSA 5JUWA 1R0WA 1ACLA 3NI2A 3P2OA 2GYYA 1EJ2A 5DM1A 3VTKA 1XEXB 1AS0A 1ZEMA 2QI9C 4CG2A 4D8TA 1R4MA 1WMAA 3AB7A 3HDTA 2Q50A 5BRNA 2V6GA 4LV5B 1ODFA 3F73A 2PGNA 1XD2B 3EXFB 4V0RA 4UQLA 5ALMA 1RXIA 1E3EA 3DYBA 4A0GA 2OORC 2Y66A 3BAFA 2O2YA 2WKSA 3SFTA 4C78A 1WDLA 2L2QA 1M2HA 3IKJA 2G67A 1KSGA 3EA5A 3EF0A 3D6HA 4W99A 3VHXB 1EESA 1VLMA 2AYZA 5AVZA 1K66A 4BP9A 4MJXA 1WABA 3PGVA 3OEYA 1NQOA 4J6EA 4Q05A 3V4SA 2H00A 2J3EA 4GVXA 4ACBA 4EPXA 5IKPA 3K70D 3VISA 2ZKLA 4NJEB 4QXAA 5HMLA 3EOBI 2Z56A 2IY9A 1U3CA 4FZRA 4JBXA 3D31A 5HF9A 4WK2B 1NT4A 3DMRA 4UU0A 5SICE 4OB6A 5JV5A 1G8AA 3I2GA 3QXSA 1D5WA 1VDMA 1U0SY 1GSHA 4HBZA 1YU6A 2Q1UA 2ZREA 4GZMA 5JISA 1WAMA 3PNYA 2HYDA 4BFWA 4D8YA 4B8WA 1EVJA 2WD9A 1U3DA 2I8CA 1W88A 4GYYA 4CGZA 3I5MA 4Q19A 4TKVB 1OVMA 2OLKA 2POCA 2RMKA 4UUBA 1PJLA 1Y4UA 4NS1A 5EPEA 5AR1A 3UVEA 1QB7A 2NYUA 1CK4A 1NYQA 2P4UA 5G1NA 1GHTA 1YA4A 4QUIA 3LHKA 2R6AA 1C9MA 3C3JA 2W2KA 4KXFB 3TRKA 4EATA 2QD1A 1YQEA 2GOYA 1EHCA 2VNHA 3BFXA 4NSNA 4ZFNA 5F9MA 2QRGA 2C58A 3V33A 3C3CA 2Y0BA 3KXLA 1Y9ZA 3DL0A 2FZLA 3B70A 2WB2A 1Q74A 1J49A 2XQVA 5IVHA 3EF3A 5ALNA 1YFKA 3FOEC 2CE7A 2AFIA 4C0JA 4CQMD 4ZDKA 5KTTA 4OUDA 4ZCMA 3ZWQA 3GUCA 2ID8A 5FI3A 1Z2AA 3IUPA 1F2DA 3C1UA 3DUFA 4CKEA 5I7SA 4DJFC 4DCVA 1CV2A 3O2SB 2RAVA 5KYUB 3LO5A 3LFUA 4AX8A 1GZ6A 4RVSA 1FFYA 1A4UA 2AD1A 1F17A 2FW0A 3PQEA 4J7AA 1A9PA 4ISCA 3T4UA 3ZR4B 5IN4A 5KWVA 4JA2A 3BXHA 3W5JA 3UUFA 1BDBA 4E5YA 2BT4A 3FMOB 3HYSA 3H9JA 3OLVA 2NPFA 1A4XA 1DXYA 2IY7A 2RONA 1EDEA 3NX4A 1VYVA 2HN9A 4QT0A 4TN5A 1FYWA 2OPHA 4BQSA 1Z06A 3FX2A 4D44A 1WBDA 3ABIA 1I32A 4WESA 5A71A 1L8LA 3AR3A 1OQAA 2GK3A 4I8DA 5KVVA 3A4LA 3TFOA 5SYMA 4LDRA 4EGFA 2GBLA 1HDYA 2A1UB 1PV4A 2FW8A 3HXLA 4UNQA 4CIVA 3D2LA 4I50B 5BMOA 1C8LA 2HU2A 3A0RB 4D97A 2VLBA 5KU7A 2F1IA 3I6MA 4EY5A 2YVUA 5FOTA 4OJYA 1QGED 3I6QA 3WB0A 3O90A 4MJ7A 2C3PA 1ZNQO 3HKCB 4W7SA 1K7SN 3D7LA 3NAQA 1JT2A 3B5JA 4OF4A 5TT0A 3ZTYA 3OAAA 2VHCA 4JJFA 3S0JA 4YRQA 5T4FA 5DM0A 3BHMA 3R8XA 4KKXB 5JRJA 1WZ2A 1U04A 1USIA 3CRNA 4WMLA 1WY5A 2J5XA 5TSDA 1UPAA 5E6SB 2E4YA 1CQPA 4J07A 2JLUA 1WMDA 4E4YA 4QLOA 4DLTA 3RRMA 3JWHA 2H08A 1DEXA 4ZMRA 3EXIB 2DX7A 1IQ0A 3D4IA 3RG8A 1CJTC 1QAQA 1W9HA 1SO8A 1YB5A 5EHNA 1MB2A 1NKSA 2NLOA 4AG3A 1LEHA 4FR5A 3CIOA 2PA3A 2VHTA 2VXYA 3DE4X 3G85A 4CEJA 2HHCA 3UAOA 2VJLA 3PI6A 4R9VA 2FPOA 2I5PO 1H2XA 2N9UA 2WYVA 421PA 1I6KA 1OFUA 2CNOA 3KSUA 3FUTA 3M1IA 3O4GA 5DMHA 5JE8A 1P18A 1JV2B 4DJEC 5KQLA 3RT7A 5KNCD 1CBUA 4O08A 4UCWA 4ND4A 1JW9B 1TO1E 2Y9PB 1R3DA 1OWOA 2WTXA 2AC2A 1Y8ZA 3JPWA 2B4YA 1F20A 1MIOA 2IQ5A 3PTZA 1W8DA 3A3OA 3PJGA 1OXKB 3RFCA 1XTRA 1JIQA 1UXKA 1I7NA 2PZMA 4J43A 2YHUA 1DIRA 1KF0A 1VJ0A 3Q9UA 4JOSA 5CT9A 3RVMA 4AB1A 4DWVA 3U7GA 1RHUA 2WMDA 1MB4A 3QH4A 4HS9A 4QFDA 3L7IA 2ZRPA 4V0NA 4DA6A 2BI4A 5IBQA 4OAPA 1JLMA 3LX4A 2LIVA 3WMXA 2NZYA 2XMRA 4YCDA 1DO0A 1FIUA 4BLOA 3REFA 1N5OX 1PNRA 1YB4A 4L8GA 4BO3A 2W6ID 1Y1KE 4IL5A 3QPBA 4JMPA 3ILYA 3BRWA 4MUMA 5D7NA 3VHRA 4A0QA 3GP3A 4Q4JB 2A94A 3F7TA 2UZ0A 1PZEA 3D9QX 1RTKA 3T9DA 2B98A 3WB9A 2QW0X 3V3KA 1L7DA 4PVDA 3C3WA 3EQ8A 3E7WA 3VR3A 4Q3DA 1OW3B 3WJ2A 1Z0JA 3R7AA 1EXMA 3IAXA 4G65A 4CTNA 5A2GA 2D54A 3FDZA 5AHXA 3VC3A 1DG3A 2EJWA 2FNAA 3K0AB 1FPMA 1Y3AA 2R97A 5B7QA 2ZRCA 4P4TA 3HBMA 3OM8A 1NVXQ 2EW2A 2HBZA 3BQ9A 3FKJA 3M3HA 4RETA 4E2ZA 4AS2A 4BOYA 2CLOB 4GMGA 3E84A 1YS2X 5FUBA 3VZBA 2DFTA 3N8HA 2OXRA 4LRWA 1BHJA 1X7DA 3B7PA 1T9BA 4Q00A 3INTA 3LQ4A 2XE7A 3HDVA 1NVTA 4K81B 4R1SA 2PUCA 1LV8A 4Q47A 3CMMA 3PWSA 4ZVVA 2QMEA 3CLRD 2ANCA 4U0JA 3N3AC 1MC5A 5AW3A 3IFSA 3KDPA 4TM7A 1MTZA 2X8JA 3LWNA 5DBHX 4AW9A 4Z0PA 1CJVC 4WZBB 2I71A 2JZCA 1OZHA 4TRJA 2OYCA 4AWXA 2N46A 7ADHA 2GCNA 4FMBB 2OK8A 4GW3A 4F6CA 1XVLA 1OFGA 3LU1A 3DAYA 2ECQA 3ECAA 4NMXB 1BH2A 2NTJA 2JBAB 4JLWA 2AB0A 2BTOA 3TXAA 5TF4A 2H3HA 4BY9E 3ICWA 4PLWA 2DHRA 5FPTA 1MEJA 4AD8A 1OX6A 4JLAA 3ETGA 2NU7B 4J0JA 5LQUA 2WYUA 1GTG1 5A9SA 1FP7A 2ZI5A 3T12A 5AM2A 3E1KA 2RJNA 3DHYA 4B45A 3ZK7A 4OFBA 3H84A 3WP0A 3EF1A 3T7EA 1KFCB 3PT9A 6AT1A 3DLCA 5KYYB 4L4UA 5AVQA 2H1HA 3L0OA 1R6TA 4AI6A 2MR6A 4RD6A 5LP1A 1Q1ZA 1PLKA 2FSFA 3SC6A 1JYFA 1Z7GA 5BSFA 3LX5A 1IC6A 4Y2JA 3G0HA 1Q2XA 2RH8A 1DVRA 3UWKA 1HNZB 3UPTA 2DCUA 2P3LA 3LRTA 1AHIA 4ZYTA 2A5FA 3WK6A 4ZZ0A 2DR0A 1U2DC 2QTMA 1OB2A 3WYCA 5ARDA 2VFAA 3PQ8A 1UMKA 2I4LA 5TJHA 3VUFA 4E22A 1P60A 1NKTA 1P0PA 3FDJA 3IEPA 1R4NB 5I47A 5HIAA 1XZ8A 1KI7A 3GYBA 2O06A 4W5RA 1D1SA 1W29A 1XVTA 5HG0A 1WKCA 1MPXA 1E3DA 3PUVA 3WYNA 2WTBA 3RVNA 5CGQB 4N7JA 2D0PB 3E2MA 4BNNA 5MFPA 1Z6ZA 2JJ2D 2FEKA 4G63A 4LW8A 4CW7A 1A8IA 3KUKA 4XDYA 3IJ5A 1EFVA 5LLSA 3H2KA 2OMKA 1PHPA 1UJ6A 1JILA 1HC7A 3ENKA 1ZD3A 2VZ0A 3MTIA 1TU4A 3SC2A 4MV8A 1O94D 3UBMA 1Z7EA 3OCUA 2B2CA 1XVUA 3KKMA 3MC1A 3RS8A 5BPFA 1Q3HA 4ROSA 2VNIA 1U1DA 2V7GA 1PR4A 2IBTA 1WZIA 2ZBFA 3G9TA 1WWKA 3AHDA 3L01A 2QVLA 4IRXA 1AQYA 2X41A 3L7LA 4HHEA 3HVKA 5HBRA 4CKCA 2P77A 1N5LA 5ALQA 3NDBB 3QG5A 5E0OA 3NUGA 3GDFA 3LWDA 2BGUA 1PK7A 2WLSA 1VI2A 4P22A 3IALA 4FLFA 1AQUA 3DE5X 3EQ9A 3NT2A 3V97A 2I87A 3QLUA 4B85A 1ENOA 3F1LA 2PLNA 1IBCA 2BMEA 1FDVA 2V0GA 1BVHA 3BH0A 4XGIA 3NETA 3K0FA 4KIJA 2JFVA 2RIRA 1KQNA 3WGJA 5MDHA 1AHPA 3S28A 1MA3A 1NKVA 5EGSA 4DNQA 1NE7A 1J6UA 1EFCA 1KI1A 1YI0A 3RLFA 4AXXA 4NJMB 3HGQA 4CLOB 2YS7A 2NXEA 3QU4A 4KE6A 3HJNA 2C8JA 1N6IA 2J0EA 1IULA 1HGXA 4WINA 1RMYA 5C0OE 4F8EA 2P3SA 3F1KA 3G68A 1V8FA 3LPNA 3PGJA 3RU2A 1MDFA 2DBZA 3V8VA 4RTJA 3VSAA 5EJ5A 3MMXA 4AN0A 4R9UC 5JALA 5KYKA 4Q4CA 4HGPA 3S1AA 2OHJA 4KHZA 4WXYB 3ZLTA 3OTQA 4WL0A 1EM8B 2ZATA 3FWZA 2C5AA 2OGZA 1XCBA 5DNWA 1B4DA 4JB0A 1ESZA 5AKHA 5FUQA 1YE3A 2Y27A 4ENUA 1WF6A 4RK5A 2IKSA 3FN4A 3L8GA 1KAGA 1SHLA 5LMUB 2B5VA 1SULA 1XRMA 2RBEA 1MQ9A 4DR4B 2GWRA 1OJLA 3TI7A 2IJGX 2X9NA 1GVNB 3BHJA 2D4AA 1U8AA 1XD2A 3TZ6A 5JJ5A 4PF1A 3ROMA 4E21A 3PHJA 3PC6A 1V39A 1ZXBA 1R9MA 2ZJOA 4G4GA 4U2EA 5K03A 1EK1A 1DV2A 1EDOA 1JHRA 1HTBA 3ILVA 2MYNA 4L4XA 3AERB 2GRJA 3FD8A 3SZRA 3HL4A 3VHXA 2C5EA 4YQFA 3P9IA 4IH1A 5K0BA 3PC3A 3X2SA 2QX8A 3VH1A 3KPVA 3UUWA 4KE8A 1DC3A 5DV9A 1LLDA 3GEMA 3RT9A 3CVVA 5BSGA 2D1SA 1LWOA 3OF5A 4KWIA 5DYWA 3GGSA 3C0KA 5EZSA 1X7ZB 4TMFA 3SQMA 2D5IA 3N70A 4GOJA 1M8KA 4P2GA 3VPAA 4EQZA 2BZ0A 5CH5A 4MLZA 5DBOA 4KFCA 2EP5A 4YBRA 2OCLA 2O2HA 3HCBA 1E9SA 3D0RA 4FE3A 4DSOA 2AX3A 2X6QA 4UTOA 2Y1CA 3TVTA 1N2XA 2GEDA 3LRXA 3PXBA 2BRUA 4LGMA 3EWNA 3R7LA 2HNAA 2QZ4A 3ZK9A 4C89A 2NP7A 1AKNA 2CDAA 2A0WA 1JFLA 2XOEA 4QOGA 4JHLA 1RI4A 5JT1A 4CF3A 1FX0B 3ZHYA 3MEQA 2ODBA 2XPCA 4B5LA 2ZUBA 2EZ8A 2J45A 3SI7A 4XX0A 2MDTA 3N2NA 3PVSA 4Q4HA 1D2NA 3L1KA 1LBTA 1M2KA 3HZRA 4BVBA 3NTLA 1JHZA 4QPDA 2CHGA 2NZVG 2EF1A 2OT3B 2HCJB 3D5TA 2ONKA 3THSA 3K0BA 1NMXA 2WAXA 1UKCA 3KTAB 3NRCA 1YCFA 2KYRA 1Q50A 1E2GA 1KFKB 3GMDA 3LP8A 1SQ0A 4EG4A 3W5SA 2CVHA 4C14A 3R9XB 3ONEA 5AOVA 4FFRA 3HN2A 4IIXA 1TYEB 2Y4NA 2GAFA 4DQUA 4WCVA 3JPYA 1I1OA 2Q46A 9MHTA 1JJBA 1QLHA 2O8EB 1ZIYA 2WMNB 1TF2A 2AJBA 3CPJB 1T35A 3JZFA 1OC4A 2POQX 2WINI 2XAAA 3L6DA 4M1EA 4M8IA 1SVLA 4YO7A 4F9GA 4BNVA 3RSQA 2O7VA 4CVNA 1IM5A 1I33A 3LT2A 1RKBA 2ZLBA 3LY9A 3TAXA 4PG8A 1QHHB 4TLAA 4JQZA 3IAUA 3W1WA 4I55A 2NQ2C 2XI4A 4A92A 4UEWA 5FWXA 4OJKA 3VPDA 1LY1A 1U99A 4BXOA 3RIYA 2BUAA 3NAMA 4YJDA 5DNAA 1JQEA 2I6FA 2YQ4A 3DAGA 3I32A 3Q98A 4CIWA 2GFQA 4ZQBA 5IZ4A 4Z6KA 1R5NA 1XFAA 2C2KA 1GXSB 1OXUA 3B6KA 1V8BA 3HNRA 1K4KA 4J1QA 5H70A 1V7PC 3E8MA 3CXRA 3ETNA 2Q1WA 2I03A 1ZM9A 3THWB 3PXDA 2A1IA 1GLGA 3A6ZA 4XFDA 1MGPA 3RRYA 3UJBA 3FYUB 4NECA 3V2IA 4IV8A 1DC7A 1Z34A 1OD6A 2KJQA 3PUIA 1NXTA 4YAWA 4IJMA 4NCKA 3VOTA 1KK3A 4C4ZA 1OPXA 1XGKA 5T57A 3KVNA 4BX0A 1YVRA 4GAEA 1W2HA 4G1FA 1VZ2A 4C0LA 1SEPA 3BBPA 3TPZA 2IBSA 2JCBA 3WNZA 5BN5B 2P2DA 5K3OA 3W5CA 4LK3A 3WGHA 5H83A 1QK4A 3JRWA 3B38A 2ZAYA 3PCXA 4J03A 3RVLA 4WJLA 1L5NA 4ZOEA 2AZTA 5E6SA 3ZHVA 2GK4A 3MCWA 1O4VA 3SYKA 3UGKA 3WFJA 4DLAA 1ISIA 3WAGA 3CLKA 4H6PA 1RJDA 4OBEA 4UDOA 3DT6A 3VJMA 4LZPA 1QH9A 2YVKA 1XWIA 3C6MA 2IXEA 4G0OA 4HLNA 4C0QC 4C4PA 4U7HA 1X38A 2JI6A 721PA 1DAFA 1A9TA 5AHRA 3AKYA 2R9VA 1EFRD 2ZBEA 3KV3O 4NVRA 3VVBA 4PQRA 3I6IA 1CVLA 1VE6A 5D2CA 4F1WA 4J0IA 2JVJA 4DIMA 2J85A 3C97A 2HQRA 2QXTA 2V0NA 4Q15A 4OM8A 5I9MA 5L3SA 4TLBA 5FX2A 1QQAA 3V6LA 5JFGA 5K8UA 2DHDA 2OCBA 2WU1A 4CMJA 1WV1A 6NULA 3K0HA 3OZIA 3VMFA 4GI5A 1CLUA 3RVOA 5D6NA 1M1XB 2IDJA 4NEGA 2PPLA 4PZZA 4S1WA 3B20A 4E14A 3GVXA 3HB9A 2WWWA 4R1UA 3I4FA 5JW6A 1HT0A 2G4CA 3PDUA 1T2AA 4L7QA 4P33A 1A8HA 3HB1A 3O7WA 2B4RO 4WKGA 2BJWA 1RLJA 5AYVA 4KPFC 4ABYA 5K6RA 4ZYVA 1NY6A 5FADA 1SIOA 2UYQA 4ZIRB 1OBCA 1K3FA 1YMVA 1ZN8A 2B82A 1G8SA 1LJUA 2YXBA 5GM2A 1K5HA 5K0LA 4Q4JA 3WHPA 2XR1A 3ZQKA 4EI8A 6Q21A 5LA6F 4LDAA 3GL9A 3CU5A 3KZMA 4LFAB 3ESDA 1N6LA 3VMMA 1WB6A 4YXFA 2E4WA 1W5FA 5F51A 1ZAKA 5G4LA 3PNOA 1N2SA 1SKUA 2Z2ZA 4GQAA 2EKBA 1W5EA 2XA1A 2R7KA 1QX4A 1SJ9A 2X5JO 3QFCA 1UMCB 2BHNA 3N28A 4POAA 4NDNE 5EFOA 2J09A 2OG2A 2YMMA 4ON9A 1ECCA 4TV8A 2GASA 4KZPA 4UPDA 4H16A 3AMVA 4IJWA 4OHUA 1U8ZA 2EXXA 3ZWYA 2NM0A 4EPRA 4RVCA 4XCXA 2PRKA 2H7XA 1DL5A 2QLJA 4RPGA 2YJTD 4LBVA 4UU7A 1Z5PA 4CM4B 3AV0B 1S1MA 2LE0A 2Z9BA 4I5IA 3DS8A 3HY3A 3VVLA 4DUGA 2MSEB 5CVCA 3PEEA 4ND8A 1L5KA 2PUWA 1U7PA 5HW0A 3RNOA 3ADBA 4D42A 8OHMA 1N2JA 2Y1KA 3HUDA