4ZCSA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Choline-phosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
total genus 43
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcsA00
3MXTA 2QTRA 3COWA 1F4LA 4EGAA 1O95D 4GU5A 1IQRA 4G5FA 1F7VA 1YI8A 1G8HA 4ZCPA 1PFYA 3FNRA 1V47A 3LCJA 1CT9A 3CVUA 4ARIA 4S1OA 1EJ2A 1VBMA 4Q93A 1IQUA 4HK4A 1I6MA 4NAHA 1A8HA 1MRZA 2CV0A 2HMAA 4JXZA 4MW5A 3H9CA 4MULA 4MUFA 3CVWA 1N2EA 3GMIA 3SZ3A 3ZJTA 3M5WA 3TZEA 1TFUA 2D54A 3SEZA 3CLUD 1S4MA 4ZT6A 5J58A 1RQGA 3RHSA 1M8GA 1G8GA 4K03A 5HUHA 2DEUA 4ZT5A 2OQ2A 1QU2A 3AG6A 3IVXA 1N2HA 2A86A 1NSYA 4QBTA 1R6TA 2ZUFA 4U7JA 1TYBE 3FH0A 4KR9A 3IOCA 1VL2A 1QNFA 2IELA 1PG0A 5IJXA 3ZXIA 4EG7A 3P0HA 4F4HA 1EFPA 5IHXA 4MUGA 5TEWA 1H3NA 2YWCA 1KAMA 2PZBA 3FWKA 1G59A 2CSXA 2C5SA 4PBSA 1XNGA 3AIIA 4NAUA 4ZCTA 1M1ZA 4A91A 1X8XA 3KT3A 1I6LA 4KPUA 1NZJA 1M8JA 3RBAA 4AS1A 2DLCX 2Z08A 2JANA 1U3CA 5BNZA 1WJGA 4G5YA 1IH8A 3HV0A 3MUEA 4XFDA 4RUKA 1R6XA 4HJXA 4YP7A 1QJCA 3IMCA 1P7PA 4ZT7A 2QJOA 2V0CA 2GKSA 2GOYA 1XNJA 1XNHA 2A4MA 1OWOA 3LOQA 1J20A 3AG5A 1Y42X 3OTWA 1GTRA 1K97A 4MAFA 2R5WA 1N77A 3UMVA 1J1ZA 3ZGZA 3TQIA 2E21A 3X1KA 3IDFA 3JXEA 4ND7A 3L93A 4PBTA 4PY2A 3P0JA 1NUSA 3L92A 3KT8A 1WQ3A 4MUKA 4YP5A 1N78A 1J70A 3CLTD 1TQ8A 1KP2A 2PXHA 3FDXA 2HGZA 4MUJA 3ND6A 5FNZA 3OP1A 5LFAA 1WQ4A 3ZIUA 1EFPB 4J75A 1O95C 3N9IA 4ZT4A 3PRHA 2E0IA 5J5AA 4YBRA 1KH1A 4I6EA 4MVYA 3F3MA 3HFJA 3HMQA 2CV1A 3CLSC 3IVGA 3C8ZA 3G59A 1WOYA 4K0RA 4ND6A 3TQOA 2DUMA 5LLTA 1EUYA 5FO0A 4JZYA 3QE4A 5TS2A 2V0GA 1KH3A 5J59A 3INNA 1O97D 1X6VA 3A05A 4EG3A 4MUEA 1Q19A 2X3FA 4DJAA 1O96B 2ZUEA 1YIDA 1PFUA 4R0NA 3VGJA 1PFVA 1XJQA 4MWDA 3CLRD 4U63A 1F7UA 3SEQA 4NDAA 1N2OA 2CV2A 1LW7A 4R2MA 4X0EA 1OBHA 4CDMA 1K4MA 1NI5A 3I05A 1MC1A 2IP1A 5HG0A 3IOBA 1QTQA 1SURA 1I2DA 3NBKA 3IMEA 1NUUA 2A1TS 3ISJA 3Q4GA 2BTEA 3H9BA 1NUQA 3DLAA 3IVCA 1H3EA 2X1MA 3E27A 1JMVA 3MLAA 1T6XA 5DB4A 1OBCA 1ZJWA 1EUQA 3IMGA 3P0IA 2QUKA 1NUTA 1EE1A 2YWBA 2J08A 3FG9A 4TS1A 3VRHA 4CT0A 1NUPA 1V8FA 1JILA 4G6ZA 2QTNA 2PZ8A 3SYTA 2XRZA 2YXNA 3COZA 1R6UA 1T6ZA 1WXIA 4L2IB 3ZJUA 1MAUA 3RK1A 4DE5A 4AQ7A 1KKUA 2VXOA 5AHWA 3UY4A 3AFHA 3SZGA 3GLVA 1MB2A 1J1UA 3NBAA 1M8FA 1IQ0A 4QREA 3BL5A 2AKEA 2PFSA 2CUZA 4P2BA 3Q10A 1K4KA 3Q12A 3H99A 2I1LA 1NURA 1JIIA 5KWVA 1EFVB 3CLTC 4XSVA 2PIDA 3IUEA 3KT0A 4J76A 2Z09A 1KQOA 1GLNA 4HPWA 1GTSA 1I6KA 2J5BA 1O96A 3QTBA 3S3TA 1G8FA 1IFXA 2A1UB 1VLHA 1YUNA 4EG8A 5JBNA 3K32A 3PXUA 3FETA 4GRIA 2DR2A 2ZP1A 4MW9A 3TS1A 4DLPA 3U1VA 4EF6A 1O0CA 1ILEA 4CQNA 2A1TR 3K9WA 2JA2A 1O0BA 4EG6A 3ELBA 5EKDA 2QUHA 3TNJA 1ULHA 4ARCA 1TYCA 4JFAA 2Z3VA 4NZPA 1U0BB 5H16A 1OWMA 1M8KA 2A84A 1JZQA 2EL7A 3HGMA 3DV2A 1Q77A 3HZRA 1O94D 4I6GA 2E89A 3CLRC 1PFWA 4MW2A 4ZCQA 1KR2A 3MMXA 3CR8A 5DEOA 4ZCSA 3FOCA 4EG1A 3HL4A 3IOEA 1M8PA 4U8HA 1IVSA 3FIUA 4L2IA 2A88A 3CLUC 4KKVA 1YUMA 3ZJVA 3FHJA 4H3SA 1GPMA 1JIKA 3H05A 4MVCA 2D13A 3IODA 1GAXA 1LI7A 2BYTA 2PG3A 3D6UA 2OV4A 4DDMA 4EG4A 1ZH0A 4MW1A 5F23A 4EG5A 1OWPA 2WQ6A 4NATA 4DDKA 5KCMA 2A7XA 5K0TA 3AKZA 3CVVA 3ND5A 4MW4A 2J07A 3PNBA 2J4DA 2H29A 2NSYA 3KT6A 3N05A 5TGTA 3CVYA 1EFVA 2QJFA 3DO8A 5DASA 4PBRA 4MW7A 1FFYA 2O5RA 1QQTA 2G36A 1N75A 1KAQA 5LM3A 2VTBB 1M83A 4CDNA 3H97A 4QRDA 2AG6A 4UZFA 3SDBA 2CFOA 4MWEA 1MAWA 1Q15A 3PNYA 1OD6A 3CLSD 4MUHA 2A1UA 4WSOA 2WB2A 4F3RA 4YMIA 2PZAA 5H7XA 4WNYA 4ZT3A 2H2AA 3RFFA 3G5AA 1DNPA 1VBNA 3ZUGA 1MBZA 1B6TA 3N8HA 1LI5A 4MVXA 1J21A 1QRSA 2AZXA 4ZCRA 1UFVA 3UK2A 1N2GA 1WY5A 4HJRA 5DK4A 1KQPA 3SP1A 4E1AA 2RE8A 2DETA 1YIAA 1T9GS 4KR7A 1PG2A 3TZLA 1N2IA 4UZEA 4MLPA 3A04A 3UC5A 1N2BA 1O6BA 5TEVA 3CA8A 2QUIA 3G6KA 1MB9A 2X1LA 3IUBA 1JIJA 2DXIA 1U7XA 3RK0A 1BS2A 4OUDB 1IHOA 4Q16A 4XFJA 1H3FA 2X0KA 1KP3A 3COYA 2CYCA 5FO1A 1TEZA 4OJMX 4JYZA 1JEEA 1EXDA 1KQNA 3COVA 1J09A 2EJCA 1IRXA 2HZ7A 3FI0A 3VU8A 1WXHA 1U3DA 4MW6A 1WKBA 4MWBA 1U7DA 3RJZA 1JZSA 4DDHA 2TS1A 4MW0A 1TYAE 1KH2A 3A4IA 4I6JA 1TYDE 1O94C 2DPLA 4DNXA 3UOWA 3ZXSA 1ZH6A 3MLBA 1WXGA 3AL0C 1N2JA 2QJTA 4NX2A 1Q11A 3X1MA 2VTBA 3QTTA 1OWLA 1N1DA 3N2YA 2RD2A 5K0SA 3CVXA 1WZ2A 1JEDA 1VBKA 2WSIA 3D6VA 3ND7A 4KR6A 4MWCA 1N3LA 1O97C 1WXEA 3ILVA 4FZJA 1FYDA 3PNVA 4BWVA 4ZT2A 2D5BA 1OWNA 2YY5A 4EFKA 2B7LA 1QU3A 2O8VA 2WQ7A 1K92A 4JXXA 2CYAA 4YP6A 3GUZA 2XRYA 2JAXA 3X1JA 4MQ6A 2GM3A 2E18A 3P52A 1HYBA 1YULA 2IJGX 4RPIA 1D2RA 2DERA 1COZA 1NP7A 1MOPA 1T6YA 1T9GR 1F9AA 1QRUA 1WXFA 1GZUA 2J09A 3KFLA 2QTMA 4MUNA 4MVWA 3LE8A 3FY4A 1MJHA 1ZUNA 1QRTA 4R2LA 4MUIA 4KPUB 5HUJA 2CT8A 5KHAA 1H1TA 3A2KA 1JECA 3NV7A 1KORA 1O5TA 3IH5A 2NZ2A 3DPIA 1JHDA 1GN8A 1JGTA 2CYBA 2QUJA 4OUDA 1NYLA
chains in the Genus database with same CATH superfamily
2XNHA 2OB2A 3OLCX 2EFDB 3OCCA 3IQXA 5BRJA 1I1NA 1WXXA 3C7TA 3W4KA 2RH5A 2B4QA 1YHZA 4FMCB 2P91A 1GG8A 3FGOA 2ZBUA 4IQ8A 4PZDA 3TIXB 3IO5A 4JB3A 2QUBA 4G8DA 2EARA 5K0GA 1ECPA 1QVWA 3K15A 1QTRA 4QOHA 4K6CA 4PINA 1A27A 1PFGA 3JAKB 1G60A 3F6SA 4MUFA 5JBIA 2YWHA 5HE9A 3U9LA 5HQ3B 3TQSA 1EX1A 4LXUA 3FSJX 4G65A 4M83A 4BNZA 1TUGA 1UBRS 1TFUA 2QRVA 4U2DA 1MNAA 1HTTA 3UFBA 4UXJA 4EARA 5KSOA 4UM9B 1LQUA 1VFNA 1K63A 1E2EA 1Z36A 4MDYA 4QO8A 5L6LB 3SX4A 2HSJA 3C3JA 1E0DA 3KV1A 4HN4B 3TSCA 2H4HA 1C3LA 3F6BX 4DV5B 4JV5B 2FUG6 2UUPA 4R4JA 1IOZA 4BNYA 1GQOA 1ZOOA 3VZBA 1BWSA 1MT3A 3OQJA 4LZPA 1SY7A 2AA3A 5F2EA 5A7FA 3BD7A 5EZ6B 1N5RA 3VSDA 4CN8A 3BWDD 4YT4A 2XWBF 3N58A 3TD9A 3PUXA 1V5GA 4RGBA 1PNRA 5JNSA 3T3IA 5EIXA 1IBMB 3AIMA 1C41A 4JKIA 1RYMA 3IURA 4YR7A 2ZLBA 5JADA 4CIAA 3U5TA 4WLUA 4ZJYA 3NDJA 3TLAA 1VHJA 1RVDA 4MKGA 2PZBA 2VDUE 3OX1A 3VC3A 3W1WA 3AUFA 1PW7A 4PX9A 3WDSA 3U3ZA 2C4KA 2NACA 3TX2A 1SULA 2IHTA 1DXYA 4M0LA 3TFQA 3MJDA 2QTVB 4CRWB 2PR2A 1KI8A 4W1PA 3RABA 4BV8A 1OF1A 3O75A 4XCVA 4K05A 2ORWA 3O8BA 3ONNA 2PQ2A 1E79D 5EE5B 2P2DA 3P45A 2QPTA 1EVQA 3R8XA 3DOJA 2TYSB 4JN6B 2BCJQ 1JKFA 3ZDRA 4M49A 5KJ6A 1H1LA 3K5WA 4GI7A 2BMAA 2CWDA 1BS1A 1TEXA 3V00A 2FTKE 4HQLA 4QFMA 3PXBA 2GVDC 3VNUA 2FA9A 1GAQA 3IMCA 4JELA 3PC7A 4OGFA 4DR5B 3R9IA 4MJLA 2E5WA 2C0CA 2VEOA 3T7TA 1E7WA 4YACA 5CYPA 5I4CA 2FX5A 2XYHA 4AB1A 5LZ2A 3E5MA 1G2OA 1A5SB 3KUKA 4X45A 3DF9A 1AE1A 2OCYC 2UYQA 2CBXA 3LDGA 2PRZA 4OXKA 1DEOA 4GRDA 4GPZA 4OQ4A 2DWCA 3F5MA 4K87A 1WUIS 3VNQA 4ERXA 4EUNA 2WVAA 4QJIA 4R3NA 1EQ2A 1ZVMA 2O4UX 1N9GB 3RUAA 3TPFA 3VHXA 3X1KA 4W5RA 2WHPA 3FGPA 2I7XA 1XCMA 3LTEA 3CC8A 2BZSA 1D0VA 3QXCA 4GLFA 5L3RA 1XMSA 5TMDA 2HGZA 3ND6A 4LOHA 1U8XX 4JWKA 3WICA 2MT9A 1JLSA 1E0AA 2IV7A 1CY7A 4F04A 1F0PA 3EULA 3GI1A 3FKSD 5E6UA 3ZXYA 3R5HA 3OZDA 2OXTA 5MGNA 1NJ8A 1QE3A 2F59A 5TPWA 2H1FA 2QTHA 4UCQA 2V6IA 1SM4A 5DHQA 3HUDA 4YBRA 4D4MA 2UZ3A 4BP9A 1LRJA 2TECE 3KKEA 4ESEA 1Y5NA 2BTQB 2ZYHA 2NVWA 4K2AA 3PDIB 3WTBA 4G97A 2CVQA 4JSRA 3R3JA 4KE8A 1K66A 2VAVA 4QOSA 4B2LA 3S44A 1IHPA 2Q8NA 3R44A 1FRFS 4ZTZB 4YMLA 3WFZA 1Y4ZA 4GVPA 5EJ2A 4E88A 1CUHA 5AOCA 3S5UA 4IILA 4RL6A 1FYFA 1N8SA 3TAXA 4EY6A 1YRQA 1Z22A 2H4ZA 3E48A 3R0ZA 3WLOA 1LV8A 3HHPA 1Y5LA 4HGYA 2WJVA 3K09A 5TS2A 1ENOA 1PJ4A 4WOBA 5LYJB 1S1CA 2G83A 1DKPA 4AU1A 4TT8A 2MSDB 1A9SA 1IOLA 1WB4A 4TXNA 4IKPA 3OCVA 1ZP6A 2VRCA 2Q4BA 3BWBA 4MYTA 5CFPA 4U7DA 4JYCA 1ZCJA 2W6JD 3O3NB 4K6MA 2P2ZA 1CZOA 1NP6A 4EYKA 5E2AA 4CM5A 3DULA 4PSCA 3VYTB 3O8DA 5F4BA 3F71A 3R0VA 4MYUA 3CLRD 4BP3A 3WSWA 2WJJA 4B9EA 3GCZA 2ZQ5A 3MJVA 4CMJA 4PNEA 4PZEA 3ZU3A 5K5EA 3ZLVA 3HSKA 4LZZA 4QU9A 3IO3A 4A1FA 1ONBA 4LF8B 3HE3A 1QTQA 3HDHA 2A7QA 5AJUA 1FQKA 4C6TB 2ISCA 5G4KB 1OV6A 1NUUA 1JR6A 4TSFA 5COQA 4N7RA 4CU2A 4YQYA 4S1VA 3NWBA 3L3BA 1NUQA 4G85A 4QHTA 4TL6A 4BE7B 1E2JA 3B5JA 4EB6B 1CUIA 1VBFA 2ZROA 3KALA 4L9RA 2I4NA 4PGMA 6PFKA 1EP9A 4IIDA 2ZPUA 2RG7A 4NZMA 1NW7A 3RAFC 1KO1A 4BBPA 3L7JA 1OCEA 2X5NA 3UEOA 2Q5JA 2X8LA 3S40A 4J2TA 4LY3A 2QRZA 1J23A 3EDYA 3A25A 5D2CA 3EDMA 2R25B 3CG0A 4HLUA 3AKEA 4HMQA 4RKEA 3IKTA 4ND8A 4AZ3A 4JLVA 3UENA 4BJ6A 2J0QA 2FWJA 5A9TA 4YT2A 1YQGA 1RQPA 4P4NA 1PKXA 1CR2A 1T29A 2BMVA 2WOOA 3TLKA 3TEMA 1SB9A 2QMEA 4JJFA 2YINC 2WJ3A 3NIBA 4JUBA 3KYDB 4ZN6A 4M7OA 4ZJPA 1R66A 1M8FA 1FNDA 1QHFA 2FPIB 2R00A 2ZPTX 4P81A 5FI0B 2DULA 2GGSA 3FROA 3KR1A 4RPKA 3D31A 3P9YA 3IP8A 3MNFA 4M1OA 4PHGA 4CV0A 3W5DA 2Q2OA 3U5ZB 1CXZA 4OHKA 1SC6A 3RYCA 4QELA 2Y6VA 4EZEA 1PEYA 1K7XB 4HR7A 3RS4A 5JC1A 4DUZB 4NCXA 2P8JA 1OGYA 2JVKA 5ULLA 1G5QA 4W9RA 3I64A 1FMFA 4YPFA 2JGKA 4WOKA 4JI0B 1QG0A 1ONPA 3DQZA 3L0IB 3L7LA 4AG3A 4HPXB 4ZQFA 4PO1A 4DXHA 5F35A 1KZGB 4K6OA 4YLYA 1JHRA 4ITRC 4R68A 1Z5NA 1PKEA 1R0YA 1SCKA 3F3YA 4M4SA 3VDMA 5JD6A 4CNQA 2AXNA 1JA9A 4UEWA 1KI6A 1MEEA 2WWIA 4NOKA 4U3JA 4UASA 1OH5A 3CW2A 5EP3A 3GQBB 3GCXA 2VOEA 3LT1A 5DSZA 1C80A 1WCWA 4CQJA 4F4JA 4E5YA 1TE2A 3D7KA 3AXTA 5FQNA 5KBYA 3FVTA 4QBKA 4PRLA 3AEUB 1UZUA 3HCNA 3WNZA 5H8WA 4TSKA 2QMQA 3DAFA 4OD0A 5DI3B 3FWYA 2AL7A 3LUHA 3QEMA 4FLEA 4BQNA 5B4UA 5I51A 1ILEA 2VO1A 4EGFA 5J43A 4TYNA 1K8YB 1P7WA 1VLZA 4FFBB 4LJLA 3ST7A 4CV3A 4NXNB 1M0SA 2PMKA 2QUHA 4F3NA 3AB3A 3RVQA 1Y9AA 3E9RA 3ISVA 5EFOA 4CIDA 3D0OA 1T4CA 3H7AA 5L7WA 5A6SB 2VNSA 5AK3A 4PZLA 1CEEA 2L17A 2NO9A 1Z6QA 3HKCB 3GLHA 1WKCA 3GYGA 1CQPA 2E89A 3PCXA 1KDYA 4DCMA 5B7QA 5K05A 2YH2A 4P80A 5EZ5A 1EUDB 4S04A 3GJ7A 1TFRA 3GGDA 1E2BA 4N03A 1ZINA 1GNQA 2ASEA 3PFBA 3ZPXA 1ZK3A 3U7HB 4W63A 2A33A 1NP3A 3UYKA 4R8SA 2AWNA 3H05A 3G9TA 1MABA 3WJ1A 3I0NA 1SIBE 5DNAA 4OXXA 3AGQA 4CMEC 2E1RA 1LW6E 1MVLA 1F8YA 2P2NA 4LJ9A 3VBEA 1GIAA 3H6GA 2IHJA 4OAPA 2ZUTA 1Z4MA 1LX6A 1G55A 2O2DA 2BJWA 3P94A 5BQFA 4D26A 1LPMA 1RBZA 1O6GA 2IP2A 4ZAVA 1RU3A 5F76A 5IJZA 1YIOA 2W37A 4EYEA 2J4DA 3EPJA 2ZKIA 3KT6A 3E2MA 1CUFA 1IC6A 1N9KA 1WSAA 1FSGA 2NYVA 1AQLA 4OLHA 1EFVA 1ZYUA 4Q3EA 3SOZA 3UT5B 4DJ5X 2YJ5A 2OKCA 2O5RA 4L3WA 1HLGA 2X5XA 3AEQA 2ILVA 3C2QA 3UAXA 4HP8A 4A6EA 3G2NA 1NLYA 3QKSA 4G4IA 3H97A 3OZSA 1FFSA 1S3IA 3REQA 4FW9A 2AMFA 4Q03A 4D3XA 3L8ZA 1M10A 5CG2A 3ID6C 1Q15A 3PNYA 1XN4A 3RARA 3UWKA 1LVGA 4GMXA 3OCXA 4WIAA 4DCVA 4DPMA 3TSZA 4W1RA 3UWDA 3AF5A 2XV1A 4FI3F 3SICE 1FQOA 1OXKB 2PT5A 3CB4A 4RQBA 3TKLA 3TOCA 3TQRA 3ZCVA 2WAOA 4MMXB 7AT1A 5JLJA 3HRHA 3KD3A 1IZYA 4X7BA 5KKNB 2B1RA 4J7UA 1VBNA 2R97A 3HPRA 4Z7OB 1NN3A 3EVBA 4OF4A 3BMXA 5LA6F 3VH3A 2IU3A 4LZOA 3FPGA 1BH6A 2IV2X 5KKAA 2CLHB 3LOUA 4E15A 1WY5A 4BEJA 3ANSA 4D57A 1YC5A 1VCIA 3JQGB 1MJGM 2DETA 3RIMA 3GOHA 5IAJA 3NM6B 1GY8A 1Q2XA 1SG6A 1T9GS 2I6GA 3QVOA 4RA6A 3ONVA 3I6YA 1Y4DE 3QUQA 5CFQA 3ZU6A 1BN6A 2OHIA 4UQLA 4ECAA 1J07A 3QY0A 4R1UA 4YCLA 1EQUA 3CW9A 1KVTA 1PR9A 1UFRA 3G0DA 3MRTA 3ZLTA 4D41A 1E1YA 4FMDF 4GP9A 3UWMA 2NUPB 1MB9A 4EMUA 4K7JA 3L05A 3VGPA 3BM5A 2PPLA 1JAXA 2O8EA 4FINA 1JAYA 1UDRA 2Q3DA 5KVQA 1CUXA 3M6IA 3T61A 1BJKA 2Z5VA 3AI2A 5T41A 2ZB2A 1WL8A 3QMMA 2XR1A 2RGRA 3DTYA 3P19A 5KJ1A 2O2YA 3WNCA 3GROA 1NIPA 2EJUA 1IDOA 1SPBS 1V7CA 1GL9B 3WTCA 1P18A 3SKXA 2H4WA 3KYCB 4TWZA 3VI3B 3KETA 1CQJA 5DW0A 1MT0A 3X1YA 1L3CA 2FR1A 5BMVB 2AJ8A 3D8TA 2I6QA 1N7IA 1FP4B 1XRLA 2WPDA 4KQHA 1P7CA 3RTCA 3RVSA 1X7YA 3ZCXA 4DBZA 5JAMA 1RI3A 4UM8B 3X44A 3T1OA 1K8ZB 3TIGA 4U6NA 3SF8B 1I32A 4RJLA 2YCLA 5CW2A 1FMCA 2GLUA 2WJ6A 5K6TA 1ML3A 3RUIA 1QO9A 1ENYA 3L6UA 1CCWA 2GZAA 5IAAA 2CHQA 2P11A 2LDXA 3A1NA 1W73A 2GSDA 2HKIA 3FPSA 4MP3A 5JECA 3RFXA 3AVVA 1M5UA 4R9UC 3BTSA 5CVUA 1OWLA 2HA0A 3H6HA 4DHEA 1Z4OA 1P39A 3NUZA 4M86A 2YHBA 3FAKA 1OZGA 2B3DA 1WU8A 2ZSKA 3D6VA 5K2MA 1O97C 1LB1B 2HIMA 4HH0A 5F7ZA 1C50A 1XAHA 3RIXA 1KFCB 1XQYA 1K7SN 3O91A 3RSSA 2M98A 3FTCA 1RXIA 5GADl 1J2UA 1Z63A 2JASA 3COJA 4X24A 3PNVA 4EJMA 1MEOA 1T4GA 1DP4A 4RVOA 1H2ZA 2ZAIA 3G3EA 1EVYA 1P6XA 1RWVA 3USCS 3ELYA 3M33A 5L45A 3OURA 2WQ7A 16PKA 1I30A 4H7EA 3WYGA 2IEYA 1T13A 3CUSA 2PO5A 1D03A 2IJGX 3HV2A 1ISMA 4PZ9A 4L8YA 8MHTA 4QBIA 1Y8RA 1IIBA 2O3RA 8AT1A 4E32A 1CNMA 2GEFA 1S1MA 2OAGA 5F51A 3L1JA 5DM2A 1GZUA 4NECA 2JFZA 2EF1A 1G7RA 4KIGA 4EUFA 1L5QA 3VX4A 3GT3A 4MVWA 5I9TA 5DM70 3QVMA 1U8EA 5DX1A 1KC3A 2YUTA 3MIIA 1GARA 2QTBA 5LQDA 3OC0A 1KBQA 2RJOA 5HF6A 2M9MA 4ZHQA 1VMEA 5LQNA 2CD7A 2R6JA 1U2DA 1ZMOA 1Z6XA 5KQPA 3K70B 3LBHA 1MQSA 1ZJYA 4D4IA 1GYRA 2BM9A 1JHDA 1HDXA 1BVUA 4Q4CA 2XQKA 3HKEB 3QNUA 2WV7A 3B1WA 2WDZA 2R6CA 3FB1A 3T3GA 1S2GA 2VRNA 5FPPA 3JD4A 4LYHA 2I6TA 5T4FA 1F7VA 5GZ6A 3BBLA 1QP0A 5A0VA 3LCJA 1WMDA 1P9LA 1Y3CE 1IQUA 4MS3B 2ZR0A 1QFXA 4XWTA 5EGSA 1A8HA 4Z1MA 3VH4A 5A5DA 2CXTA 1P80A 1NJ1A 3OIWA 5KKCA 1HM5A 3SPXA 4F7DA 1SB8A 1P2UA 1V6SA 3H9CA 4IW3B 5TRTA 3KB8A 5I7AA 4B6GA 4IYRA 3OQOA 1E2IA 3AR7A 3OP4A 1R16A 2IW3A 3T7EA 1A95A 2NW6A 3TZEA 1TNDA 4HVTA 3UK1A 3WRVA 4W5NA 1A4RA 5CTJA 1ZJ6A 1CJMA 2AOTB 3OE1A 5HYVA 3AM1A 2V97A 4FYIA 2ESRA 1YI0A 3V4VB 5GJVC 3EXFA 1GGFA 3ACBA 4DLKA 1M8GA 3E05A 4FDAA 4K03A 4M7PA 3LL7A 5ALWA 3ZCSA 1JH9A 2JW5A 3C8HA 1XTVA 3VOTA 4IHQA 4TN1A 1I4DD 1Z5PA 3DEZA 2FDRA 4YGXB 4Y0VA 2LXNA 2CUKA 3QUCA 3NTUA 2L42A 1MH1A 2GAOA 3A6JA 5J3JA 2GPWA 4JHXA 4WERA 1Z5WA 2A5JA 2JBWA 1JB9A 3ZNOA 4CL2A 1UBNA 4BB6A 4NMLA 1OIVA 2HM7A 3BWXA 4F92B 4CQLA 5JV5A 3ZWXA 4DUPA 4FOSA 5J2UF 4IIUA 2FW7A 5AKYA 4HXYA 1DIHA 2C83A 3IR7A 2CHFA 2QMYA 4UZSA 2GARA 2CDBA 4F4HA 1X13A 4UD6A 3BH6A 3C48A 3GJ6A 1KKMA 3OOHA 4TUYF 1JDJA 2NPIA 1JFTA 1E2FA 3QVWA 4R84A 3A1TA 4JB8A 2WJZB 2XADA 1W46A 4KK4A 2ZR7A 2VHVA 1M1ZA 4G0NA 4BQQA 2PYIA 4EAAA 5LDDC 1NRJB 5F1YA 1FDIA 1OPRA 1IN4A 2DTDA 4LV6A 4RK7A 1AURA 1CV2A 2ZJFA 1BMTA 3BRWA 3DMGA 4JC4A 1Q5PA 4EUSA 4L76A 3WAGA 2VF5X 3DW1X 1AG9A 4L08A 4N7JA 5AQEA 4YCSA 1Z0IA 2FP4B 1WCYA 2WJGA 1Q0SA 3S2YA 4U9HS 1G3UA 3V1NA 4N8EA 5J1SB 4X66B 3W34A 1OYVA 2CVPA 4IJUA 4QARA 3F8WA 4GSLA 1E6MA 5INTA 4C7MA 3O8LA 1UIMA 4MVJH 3QKRB 3I8OA 1H0SA 1Z88A 3MPOA 1OTXA 4IPTA 4ARVA 1AN0A 1NI3A 1P1RA 5KNDA 4Y98A 1XVAA 2V0CA 1J7KA 1LLDA 1GOTA 5E3JA 4EFDA 2E87A 1A7JA 2ORVA 4KRGA 1X1AA 4TT3D 1VMKA 1SVIA 5AVZA 1E1RD 4BLOA 3SQOA 5I9MA 1OZ0A 1EDOA 4G4SP 2HPHA 1WSWA 2O0LA 3THSA 4R2WA 3MINB 1G8SA 1YZKA 4IX9A 3VTAA 1XQXA 4N5DA 2F3QA 2ZUVA 4H31A 5FWNA 2IS2A 2TMKA 2OBYA 4FOLA 3ZCRA 4X97A 1EGVB 2H5LA 3E4CA 1VB3A 1P0FA 3HUEA 1OVGA 1ZESA 1Y89A 5ECDA 4C9BA 3CLTD 3F3KA 3U40A 2BKAA 3EGXA 3HR4A 4HLCA 4YTEA 1I5RA 4FFNA 1ZHHA 4ZT4A 3ZWDA 5DTMA 1MA0A 3PTLA 3D4NA 3R3WA 5DLYA 1PK8A 3O2SB 2P2GA 3ZLJA 1FVHA 3AVPA 3F4KA 4PC6A 4DDUA 2GEUA 1DTSA 2XYQA 1MZVA 4YRSA 8GPBA 2EKDA 1DUVG 3C97A 1JHVA 1HLPA 1ORDA 3M6AA 3NYIA 3TLZA 5JZVA 2FFRA 4I5GA 3QPCA 3MMNA 3SC4A 4OHVA 1NG1A 1JQ3A 1N5MA 2JFHA 3C8ZA 3CO0S 4F2PA 1HX7A 4GG1A 2JCSA 2V7TA 4O4IF 2A67A 3EHEA 2JFNA 1HZJA 4UXIA 3RFCA 2GS9A 4UKDA 4X1IA 5EL0A 3EVEA 1NW8A 1C9DB 3ROMA 1QR6A 2YMLA 2VPPA 3DMFA 5AXDA 2CMDA 4LWPA 1C5KA 4C06A 3DDNA 2BP7A 3CM0A 3HEBA 4NCJA 1WDWB 1WV1A 2ZVDA 2FI1A 2SCUA 1RWMA 1YE8A 1H5QA 3KSUA 1RJ9B 1GT6A 2V7WA 2X1VA 3FX2A 4WXYB 4Z4CA 4N4AA 2HDOA 3HLKA 1INLA 2WSYB 3I4FA 5C4MA 5CJPA 1A2BA 4DJAA 3DLPX 4Y1GA 4OLAA 3TRFA 2WD8A 3DPSA 3K6JA 3QBTA 4PV7A 5IHPA 4CL3A 4AKSA 2XMQA 3K0KA 4U63A 3V4LA 3WBKA 3UMBA 4C7OA 1XLTC 2W6ID 1LY1A 2V3WA 1MOSA 2ZYWX 1KI7A 3NEPX 2HXSA 4JDPA 2W2MA 2FZCA 3MJHA 4DQVA 4N6GA 5HVNA 1TLTA 5LA6B 5HG0A 4OHYA 1DG1G 1IEXA 4GMFA 2C5AA 2OFOA 4IGFA 1QGAA 4BFCA 1Q83A 2A1TS 2H4XA 2PUAA 5IK2D 3RRBA 2BTEA 4JEHA 4HADA 2QGNA 1GUDA 4CG0A 3SXPA 5BNFA 3ZZTA 3DE0X 3MLAA 3NHLA 5GJWC 2ZUBA 5I4BA 5LQJA 1NQWA 4W1QA 4M22A 1K7CA 3BD6A 3L0SA 1PHRA 2UU9B 4FDTA 2CCKA 3HM2A 4YIKA 3U44A 2UKDA 4KR3A 1T1SA 2ZSUA 1E77A 1UBEA 5JQWA 4R7TA 1QIHA 3GY0A 4FMDB 4ITUA 2FF7A 4U7HA 3V8BA 1G64A 1O2DA 3I5YA 4FI3C 2L2QA 3S1AB 3KSBC 3JVDA 3OD5A 2ZRGA 4HAIA 4FK8A 1P0MA 4UU8A 5IUJC 2BM0A 4RTMA 1UDAA 3PC3A 2WIGA 4L4YA 1EIWA 3WGOA 1CY6A 2H1VA 3LUAA 1RPAA 3MMZA 1V3VA 2Q1SA 3NH6A 4A8PA 3MMSA 4TYQA 3NORA 2N42A 1E6KA 4DARA 4YB8A 5FUXA 1XZCA 4J90A 3ZV3A 1B8OA 3Q2OA 3K0EA 3N0VA 1OX6A 5KYXB 2JLXA 4M0MA 2FJ0A 2OPBA 3Q12A 4FIDA 2C7GA 4MQBA 2W2OA 4Q37A 3K9CA 1LPOA 3QXXA 5EQJB 3DCYA 4BMZA 4BQPA 5CD1A 3Q98A 2IOYA 3DH0A 2DHEA 4ZI7F 2G9UA 1R4NB 1SMKA 1E3TA 4NEGA 1NURA 5KMGA 2QN3A 3A4VA 1XZNA 4G4SO 3IP3A 1PT8A 4PG5A 3H4MA 3DFUA 3D8UA 4LA4A 4R1QA 2RGGA 3R7SA 1SUAA 2Z8ZA 3PE3A 1YONA 3QU5A 4G23A 1EG2A 1XYVA 3RKRA 4HNUA 5AFSA 4GOND 2PJZA 3OZCA 4AO8A 1UP7A 3VAYA 2Y27A 3QLVC 1A2QA 3OWXA 1H6AA 4WFQA 5EXEA 2AW5A 4QXRA 4CFSA 4HDOB 2IYQA 1RXEA 5KNCD 1RWNA 3PF9A 3HWSA 3HJAA 4RV4A 3IQWA 4ZTBA 1E7YA 5KJEA 1YVEI 1JXQA 3C14C 4WN3A 1OI2A 1SVUA 2XVMA 5JYDA 1FRVA 3R7NA 1DTWA 3GR6A 4OHMA 4ENWA 1AHIA 3KTDA 2KLHA 4UVDA 1WXWA 3MUFA 4G26A 3C4VA 3VU3A 2NZWA 3JQFC 1F0KA 2FB9A 3BFKA 1N6IA 2IEIA 2NU9A 4O4LF 5CM2Z 1D6JA 2W4IA 2V7QA 1BO6A 1YE5A 2XPCA 2VWQA 3PENA 2Z4RA 1PG5A 2HRZA 4P34A 4JL8A 3C3XA 4JFAA 2BD0A 3D7NA 3NX4A 4V1CI 1B0ZA 3A8TA 2IF2A 4CDRA 2FQQA 4WMLA 4J8PA 4V0NA 3IDZA 3KAJA 1VL1A 3EF0A 4L28A 3BD9A 2QPAA 1RTTA 3WGHA 1X8KA 1ZJ5A 2WP0A 3HL0A 1M8PA 4QNRA 4F6LA 3FIUA 3H5VA 3USES 4Z8YA 3TW0A 1IVSA 5DTRA 3NS7A 1DWOA 1BU5A 3AR6A 4OYHA 3EUEA 1FFAA 2AFRA 4L8WB 4N12A 3DBHB 1BXRA 2WLSA 2DY1A 1XCBA 5CX1A 4ER7A 3ZE7A 2O3JA 2AD1A 3E6AA 4X6XA 5BVHB 3R4VA 2AHRA 1IZ8A 1AK9A 2GA9A 3BWVA 4QUEA 2HSGA 4QLBA 4R6WA 1YS4A 4B82A 4L72A 1M1NA 3HXKA 4N7MA 2XXAB 2PZMA 4LGCA 4Y1FA 5AK4A 4DA7A 1C7IA 4X3PA 1DEHA 1CZLA 1OLXA 1KXJA 5K0TA 3CVVA 3NHYA 3ROGA 3R74A 4J2HA 2UVDA 5T8KC 4HDAA 2IV3A 1B7GO 4BZPA 3S1LA 1I4OA 3R0XA 1HT0A 1YR2A 2QXTA 2D3WA 1HQKA 1USVA 4YQFA 1OAKA 3KZOA 5D00A 3OF2A 2ZYDA 1QQTA 3EZXA 1GITA 3NKVA 1AQYA 1EJ0A 3B6IA 3N07A 1XEWY 1Y5MA 3Q88A 3R5SA 4MRMB 3LUFA 5CNKA 5ILGA 5D86A 4XD7A 1SBZA 3OQNA 3A6PC 2Z1MA 5I5GA 1L7DA 5E4JA 2WYOA 4LAFA 4UHJA 4X63A 1P1CA 3E3AA 3RQSA 3HZZA 3O93A 5A4MS 2A1UA 1P5FA 5LCXA 3MWKA 3KP1A 3MWGA 4I50F 2AQKA 2PBZA 4CM4B 2H4FA 2PZAA 1T4MA 4KI0A 2D2FA 2X76A 3C7AA 3RAEC 1EFAA 3KJIA 4ND5A 3QUTA 3FOWA 3CNHA 3E53A 1VHQA 2JBHA 3ZUGA 5J2UB 2O0KA 5KVAA 4DR6B 3C16C 1QRSA 1ZXXA 4CZ2A 4NZYA 3KL4A 3LNTA 4PXSA 2YZ7A 4ILKA 4M21A 4CKYA 3PBKA 4J7XA 2HWYA 4LYEA 3RB8A 4TUYB 3FLAA 5ADUS 2RE8A 4YCAA 1NOKA 4XRRA 1S2MA 2OCGA 4YMWA 3ZW8A 2QW8A 2RGYA 4JLUA 3TZLA 1QCCA 4KWIA 4R8RA 1KI2A 2PK3A 4X6UA 5AJVB 4AKGA 2GJ8A 3I53A 4UHCA 1W49A 1E5XA 2J6BA 1VSBA 1EM6A 3AVQA 2WAAA 3U9TA 1ZGHA 2R1VA 4OCZA 3RG8A 3QKIA 5DX8A 4EA8A 1BA3A 1QLJA 4IVPA 4P7GA 3WGKA 1T1RA 2D5CA 3QELA 3QUBA 4R3UC 4RAOA 3G2QA 3ZGYA 2B7CA 2O3QA 1NNUA 5CA1A 4FLFA 2A9OA 2J67A 1GU7A 1N6HA 3O2JA 3A2MA 3GJQA 3LPNA 4XCQA 3L1KA 4I5EA 4NBSA 4Y9UA 4JR2A 1L5GB 1BS9A 5LP6A 4Q9LA 5JJCA 2VZ9A 2VPYA 4Z4QA 4YY3B 2JGMA 3ZQJA 1XRNA 1L3IA 3WC4A 1J09A 3TBKA 1XKQA 2C2YA 3FI0A 3GCGA 4FGJA 1UH5A 1L7NA 1JDUA 1ZFNA 1U3DA 2FW1A 1FFGA 1HA3A 3BS4A 4IZIA 4JOQA 5DCYA 2GWRA 3LLSA 2WMYA 2NO5A 3BSWA 4NC9A 2O5EA 1EP3B 5CAEB 2V7GA 3W90A 4DNXA 1G20E 1NVUQ 3EJ6A 4ZYLA 3A32A 2B9VA 3G2OA 5FH9A 5KYTA 3AL0C 5DT9A 1GCGA 4CEHA 1IHXA 3HPQA 2YYAA 3F47A 2FK8A 4MB0A 3R3UA 3ZZUA 2FE4A 2XA2A 3Q3HA 1V26A 3W5SA 5EXTA 2V7PA 2RGBA 5F9FA 1RQNA 1YKGA 3T7IA 4JLNA 1CZNA 2AEMA 3U3XA 1ZM7A 1XQ9A 4QAQA 3FTQA 2VXYA 1TVKB 2H92A 2GO1A 2XOKA 4G09A 4C05A 5B64A 4X65B 3E9NA 3UOAB 3PWKA 5SY6A 4MIEA 4DKXA 3KTFA 2BKVA 1DBSA 4B87A 3MT9A 1NHGA 3PKJA 5T3YA 2D5BA 2FEWB 1KGDA 3QPDA 5C32A 5ITSA 5C7LO 2YOGA 4TKLA 3JD3A 5E0OA 1RRGA 4PZ0A 4HGZA 5IT4A 1NW5A 3JQ7B 4G36A 3D4BA 2H7XA 2YXLA 1MHPA 4IMIB 4TV9F 4WDRA 5FV7A 1A9OA 1VYHA 5F77A 3ZDCA 1NQOA 2E18A 1B4DA 3KFXA 3P52A 5JCOA 4BNDB 1XP5A 2BGTA 4CKZA 1SVLA 1W52X 4I3GA 4XIYA 1NSTA 4JXKA 2I3DA 2QENA 2VYND 5A03A 3UGJA 2AYYA 3DXFA 4GI1A 3JYNA 2VQFB 4RACA 1IZ7A 2VTVA 3NEJA 2ZKLA 4ZI2A 2VQEB 4N3BA 3TMKA 1XZLA 3CKKA 1URPA 3MJCA 3I4CA 4LRUA 3L1VA 2P9BA 4O2AA 1HT2E 4MPJA 3TOZA 5B6IA 1HWYA 3IT1A 2NZ2A 3O21A 1SRRA 1H93A 1ZD4A 3I8XA 1FTNA 4X44A 4RSRA 5CIQA 1WVMA 3CZQA 1Q74A 2PR7A 2Q5HA 4IWYA 5C81A 3RS8A 2RARA 3C7DB 4BY9E 3WKDA 1X1CA 1NXSA 3F2VA 5H1YA 4Z2YA 3RAJA 1FTWA 4GKKB 1PSZA 2AEJA 3AJRA 1CT9A 1M1YE 3GHHA 1CKEA 5D3MB 4ARIA 1HNWB 1XPOA 1E4VA 1I2BA 3A36A 3CG4A 4L5YA 4NAHA 3LUBA 5HIMA 1HSOA 1OMOA 1NY6A 4DMKA 3TMAA 2ECQA 3U60B 2OBBA 1II8B 3CVWA 2VZ8A 4EFNA 3A6KA 3T4PA 2E4WA 2EKBA 3U1TA 3ZY5A 1DKUA 5BYAA 2X0JA 4H3KB 3UBTA 4LNHA 1CERA 3PEEA 3HWWA 4TWBA 4HDMB 4JK3A 4X41A 3QPBA 4X6LA 1NIJA 4QU8A 4WI1A 3T5BA 1G3QA 4CR8A 2C2XA 4P0QB 2OPHA 3AQ4A 4N3AA 5A3JA 2QZ9A 4ZT6A 1TM4E 1MORA 5IKMA 5CVTA 4M36A 3IJRA 1YQTA 1G21E 4RY0A 4OQPA 2FSVA 2IYUA 4FOOA 2DEUA 4EW6A 1V45E 1ONSA 3GUYA 4D43A 4D46A 5EP2A 2A0WA 3VSAA 4DR3B 1T2EA 1V2GA 4U7JA 4LECA 1QFSA 1BQ4A 5IN5A 3EPPA 3AI3A 3UFXB 1EFRA 4U9UA 1SBIA 1FL9A 1T91A 2DSNA 6YASA 1F5NA 2KX7A 2NG1A 5LQAA 4ZAZA 1FUUA 3NGLA 1US8A 3CINA 1X1SA 3PLAE 3RJ5A 5JY6A 2EEZA 5F9HA 2RAVA 3PR1A 3VYVA 5SY9A 3LKZA 4KTTE 3WGGA 1MQAA 1SUBA 4CHTA 2NU7A 821PA 1TF2A 4ZI7B 5EHXA 1PZXA 3G5LA 4HQOA 4ZANA 5K3AA 4JUDX 5CK5A 3AJDA 1NPYA 4I9GA 1SUDA 3FWKA 1EYZA 5CT4A 3RREA 4PCAA 1M34E 3T34A 5JAPA 2WU0A 5KI6A 5C3UA 1KRXA 1QANA 1Y3IA 2FFQA 3OTGA 1PDWA 3N59A 2YVUA 2FQ1A 3I04M 2BDEA 4NV3A 3VH1A 3GZNB 4DMUB 4RU1A 5SV2A 7MDHA 5JY1A 3WE7A 2V3CC 2MINA 4I1OA 4M1EA 1SCUA 4MVJI 1PV1A 4A92A 3QEJA 5AW0A 4GQIA 1UMKA 3ICEA 4AI6A 1WJGA 4ENPA 3UW3A 1ZHOA 2ORED 3CMCO 1P4AA 1NJ6A 4KQ6A 2AC7A 4IGAA 4JBYA 4OFBA 4ZVOA 1R6XA 1WUTA 2YQ5A 5CB0A 5SZIA 4NABA 5HIIA 1Z7YA 4CLEA 4X5OA 1P7PA 2C2GA 3AJEA 2C61A 4CG1A 4P31A 3PXXA 2CSUA 1G18A 3QU2A 5HJ2A 4CLDA 4OKSA 3BCSA 2QR2A 4TKVB 5DN9A 2HK8A 1XZHA 4X8HA 5AW8A 1XTJA 4O4LB 1I10A 5CHEA 4P22A 4U2BA 1R8YA 3NC0C 3JZIA 1K97A 3C7KA 4MAFA 3FVWA 1G5HA 1KEEB 2ZIVB 2QU8A 4II7A 4PLTA 4V0MA 4G0VA 3I73A 4QJ4A 2Q4DA 1C0KA 1QH0A 2NUAA 1Y1PA 3AFGA 3DKIA 1SCNE 3DAPA 1WQ3A 1N78A 1LPAB 1AZSC 2Y1FA 4I5DA 5CFMA 1F8XA 2EHJA 2QI9F 3AHHA 4UUQA 4ZVPA 4J75A 1O95C 5EYPB 1A72A 3ICQB 4PN3A 3ZOKA 1RJDA 2IZ1A 2C57A 4JQCA 4PG7A 5FEMA 3PC2A 4HRXA 2NZUG 1KZ4A 3GA5A 3HEMA 2PGIA 3PUVA 4KBYA 4MGZR 3ND8A 3EAGA 1RYBA 3ETEA 4G24A 3TPCA 1TM3E 3OFND 2YCBA 4A2PA 1XTTA 2A57A 4OJNA 4FZ5A 4OHFA 3WDLA 5I4IA 1YFKA 4D9MA 1Q12A 2DAPA 2IC5A 4LVCA 3CU5A 3ZWCA 4AP5A 2QY9A 5SZJA 4DANA 1YNSA 3HG7A 1XPUA 4MPRA 3WBFA 3HY3A 5IWCA 1ZO8A 5KHOC 3N6RA 1VP3A 3HR7A 4UM7A 1MG0A 2I7DA 4V03A 2MYPA 3PGLA 1KZ6A 2QOEA 3CY6A 4J0CA 4DNOA 2O2CA 1WB9A 1ZEJA 2QBYA 1WO8A 1A5TA 2YZMA 3KSRA 1V1JA 3IDSA 3QE2A 2HV8A 4LBVA 5K01A 5F33A 4G1FA 1E3IA 1E9CA 2P8SA 1NE7A 1PVOA 1R4MB 4EG3A 1GILA 3L8CA 4ARZB 4Q4JA 5ICSA 2ID8A 4C0BA 4KQJA 1TECE 1W35A 5DBOA 5EWJA 1G63A 2MR6A 3P4UA 1WW2A 1KIMA 3T7SA 4MWDA 4INAA 4O63O 3SJCA 4UFPA 5BW5A 5JISA 1YZQA 5EE1A 2E5LB 1J2RA 4IDOA 4FGZA 3ITKA 3OIGA 3E8XA 4IUBS 2CV2A 2NU8A 1NQXA 4QU0A 4OYLA 4BUZA 1EXVA 1XD2B 3FCOA 4ZV9A 4CDMA 2GBLA 1QZZA 2V98A 3OFKA 5B55A 1FF9A 5HKBA 1R0BA 2XBLA 4I14A 4G4GA 4PTZA 3K6SB 1E6LA 2O2IA 4KO3S 3GLQA 1YBHA 3I0ZA 3SVTA 1N5KA 3BAFA 3RV3A 3WQQA 2DWOA 1NBWB 4NBKA 3ABSB 1ZSVA 2ZBVA 2PKWA 2WG1A 1T6XA 4PR3A 1IYZA 1OBCA 1JAIA 2SHKA 1FVXA 3ASZA 3DAHA 2QRJA 2V1UA 5E3IA 5IX8A 1O9BA 4D4GA 5B2FA 3CWQA 4LJAA 2FJPA 3AW9A 1GAWA 3LHSA 4G6ZA 1ZI6A 3QM1A 2FLWA 3CKLA 4QKQA 1JJBA 3L8YA 1X7GA 2FEPA 4BYMA 1N33B 2GN1A 3GFVA 5BV1A 4DLVA 1QQ5A 2X86A 4FXOA 5D51S 1Z9BA 2Q0SA 4JUAA 4O8ZA 2B98A 3GLTA 3UMRA 4KH1A 5IJ0B 2GMWA 4UVGA 1R6DA 1UQUA 3ED1A 4JDUA 3BJMA 1EUCA 3Q3JB 1RMTA 1W94A 4YDQA 5LVAA 1RWKA 2I6FA 3H2KA 1T2VA 2JKZA 1U8TA 3C6MA 5FI5A 4NBNA 3VR4D 1IZ9A 1Y3DE 3H5WA 3IB6A 4Z9FA 4DDTA 1GLVA 4JL6A 3UMSA 5GMOA 4MP8A 3AP3A 3HDYA 3KEGA 1H23A 4TLEA 4Y2YA 3C15C 4GL4A 2IU4A 3C45A 1Z2EA 2HW8A 1ZK1A 3IUQA 2FMUA 4EKYA 3FFBA 3GJSA 3SM9A 1M2OA 3N2KB 3L8GA 5BQPA 4PZCA 5JWRA 4YYZA 3MBIA 4Y6SA 4TMFA 1M33A 1RWBA 3PNOA 3WWYA 1IEWA 4F7WA 1KO4A 3GIDA 1U8ZA 3RDPA 1YL6A 4WOJA 2W6CX 2ZRQA 2J5QA 3JALB 5CXSA 1XELA 1AGRA 2ZI5A 4CLHA 3NVAA 5FHRA 3WP1B 1E8NA 4BLSA 1TA0A 5AK5A 3TZBA 3WBBA 3Q3IA 2EKLA 2Z4TA 4RMJA 3KXLA 2W8ZA 3OLZA 3HXMA 1L4KA 2GZ2A 5B4TA 1KAHA 1NXWA 1Y9EA 4L4ZA 1J8VA 2O07A 4COOA 3OH8A 3TEFA 3L7YA 1JHOA 3FYTA 1P5JA 4BUJA 1KI3A 4DLPA 1IPFA 3VVMA 4BYGA 4A10A 1YB1A 4F8EA 4PCUA 2JHFA 4M0PA 4P84A 3B3GA 4M0EA 1PQ4A 3LQRA 2CNNA 3Q3CA 4CM9D 4TWAA 2CXOA 1Z5VA 4KQXA 1L8XA 3FFWA 4EG6A 3E81A 5BOSB 1VE6A 3WNBA 1QYCA 2R6ZA 4DDWA 5EKDA 4B84A 3AX6A 4LJRA 3W2GA 7REQB 4CYMA 1ULHA 2EIXA 3BE5A 3G5MA 1UZMA 1Y3FE 3B48A 4MA0A 2O8DA 4PX3A 5H16A 3EPKA 1OY1A 1W4BA 2BCGY 5CM8B 3PWTA 2B8WA 3QG1A 4PLYA 4ALNA 4I6GA 1L5KA 1H4QA 1NONA 3CR3C 3HA2A 2ZUDA 2NVUB 5AT1A 3TOSA 1UBMS 1I3NA 1TO2E 3MD0A 2BGLA 3SQDA 3AHFA 3D7SA 1EX7A 2G71A 4IAOA 4L2IA 1YJQA 2CN1A 3B82A 3GLFE 2BH2A 1NMQA 2IBTA 3A6ZA 1OFUA 3AUJB 4M8SA 2VPIA 4LC9A 1T1IA 2QE6A 1RP1A 1SKUA 3SYRA 3KQYA 2GWHA 4XQ9A 4D42A 2D4HA 2H7VA 5TE9A 3PEVA 3QV1A 5AWFC 1Y9JA 3ZHCA 1NATA 3IB3A 4AD8A 3MERA 5CH3A 1TMYA 4J9UE 2E6UX 2XAAA 5CYOA 1DFHA 2J07A 1JZTA 1UPAA 4G5SA 3KSAC 3ZDDA 1DAGA 1VTKA 2A9PA 2V6MA 3BILA 2B3TA 4DTCA 4LDAA 1V5WA 1L8AA 4GOLD 5DF1A 2QJFA 3AEZA 3BCRA 5BWCA 1U81A 2HNBA 3DZGA 4NJEA 4NEQA 2KB0A 2G36A 3ENVA 5EZQA 4D96A 1ATIA 5HW0A 2PWBA 1LWOA 1UDCA 4LRXA 3UPUA 4IX1A 1GKLA 4E07A 1JTEA 3TB4A 5DK6A 1FFXB 3QVGA 3JQAB 2QU7A 1QAMA 1SCIA 4QULA 3C8DA 1OPXA 3KUCA 2AE2A 2P3LA 1UBCA 2R4TA 1T8YA 2FZGA 3LUPA 3ORHA 3RF6A 2XKJE 5DRTA 4R71A 4M37A 3HO1A 3JATB 5H7XA 2QRLA 3D4IA 5B12A 5FPQA 4LXXA 4B3JA 4MDHA 4B0PA 3E9QA 5E4TA 2L18A 4JOSA 2B92A 1KMHB 2QD3A 2W90A 4MROA 4TVOA 1SOWA 3NANA 3ORRA 2NWQA 4DNFA 2B8EA 1EEXB 4LDRA 4TN5A 4RFLA 4P1ZA 1J21A 3GBSA 5GVRA 4TMYA 1TEVA 1E0JA 4BPBA 1U0TA 2IIVA 4AX4A 4WZBE 1M76A 4ZQBA 3U7GA 1GXSB 1BX1A 3K9QO 1ZEMA 2VAWA 1JBKA 1KRWA 5C8YA 1YIAA 4YIHA 4EKGA 1LPNA 1NOJA 2OV1A 2Q2QA 2ID7A 3JD2A 5ENZA 3TLGB 3UAVA 5JHGB 3GRFA 1KYTA 1XMPA 5ALEA 4Y9RA 3WRXA 2AZ4A 4R1OA 3ZTWA 5LXTA 1U6KA 2GXSA 3HS3A 2QB5A 3S2SA 1XDZA 1OT3A 2GPAA 2R60A 3WGNA 3I23A 5THXA 1ZUNB 2YWRA 4KN6A 4MEAA 4BLVA 4DWJA 1I7SB 2WEKA 2XSZA 3I0MA 5CB4B 1P1IA 5TJHA 3I83A 1EK0A 2W6OA 3FMGA 3W5IA 1KDTA 2ODWA 2YICA 1XQWA 2WYIA 5HM8A 1KO8A 4KQGA 4MVJP 1QYDA 1YBAA 2VJPA 3UXEA 3DWIA 3ICOA 5BT8A 1U31A 3N28A 3OPMA 1FDRA 3P2OA 4UREA 4FQ7A 1P31A 1DQNA 1LDMA 1VZ2A 2HLDA 2V58A 4UXHA 2VH2A 4DR4B 2VUHB 4IZ6A 5JT1A 1PT7A 4B6EA 3ECSA 2UVQA 4LW8A 1PQUA 4JYZA 3GGPA 1QNLA 1IBKB 4Y6PA 4DPKA 1NXOA 1K88A 3FCAA 1HDZA 1T2AA 3A3YA 2TRSB 4UFNA 1NASA 1VIMA 1DSSG 2D1TA 4MWBA 3TQTA 5BWBA 4GMGA 3JWIA 4EP1A 1USUA 3WKBA 4Q7KA 1DCKA 2MR5A 3KJZA 1ZH4A 2UXDB 1EU1A 2ZRAA 3NCTA 5IFLA 3L0CA 2F8SA 1XDSA 3DCIA 5AD1A 1UWLA 1ZH6A 1VL8A 2QRVB 1YK1A 2RC6A 4UHDA 1KHTA 4FYWA 1ZVKA 2WG2A 1NFRA 2X4GA 1XLUA 1BD4A 3SYLA 1L8OA 2WD9A 1U3FA 2W7TA 2EWMA 4AZ0A 3FOFC 1M6YA 4DV1B 2YIMA 3NOXA 3PCRB 4Q82A 3EG5A 2UUOA 3QTTA 4OA5A 1A5ZA 5EXXA 5H4GA 1ENPA 4KKXB 2RD2A 3MOIA 1BIFA 4MKZA 3C7CB 4MLCA 2OCBA 1CVLA 5B1SA 3ADPA 3LIPA 2PFKA 1UP4A 3OD1A 4QXOA 3E0XA 5KC9A 1YRYE 2XLCA 1SR8A 1RMQA 1U7HA 2Y1GA 5FBLB 3SHTA 1XV5A 4B4UA 4KXNA 2GCGA 1UAYA 1YS1X 2Q6TA 4KLZA 3BA6A 3MTEA 4Q05A 4UE3S 3WZ2A 5AW7A 2H08A 3JZFA 3OX4A 2QN2A 3INGA 5BYBA 1C14A 3T5AA 4CCAA 4B73A 1DIAA 5LDGA 2IS1A 1J8MF 2B4YA 3B1ZA 1AKRA 3IAXA 1GHTA 3EY4A 4A82A 4JMLA 3RU2A 4R2HA 1JQKA 1WMBA 2CJPA 4K3VA 4UBKA 5LB2A 2BR3A 4OK6A 1KEWA 1UM9A 2HSEA 2V4MA 3WMFA 1ZIYA 1I7LA 5C31A 2A6PA 3TCXB 4ALMA 1NU6A 4G5QA 2PX2A 1JDSA 2WAYA 1WABA 3KKZA 5E3HA 2QI9C 5JS1A 3PX7A 2YWFA 3OOEA 4KYIB 5LZ7A 3DB1A 1TD1A 1IAVA 4DSUA 1O94A 2R85A 3Q2IA 4I4TA 5BOVA 1MENA 3NJ4A 4OHUA 4GWGA 4MV0A 4XLZA 4ZEVA 1T8PA 5JDCA 3FNQA 4WY5A 4JIGA 4ROTA 5T3UA 1LNZA 2OHVA 2HCJB 5M34A 1H1LB 1XBTA 4XWGA 4OUDA 2O7NA 2VBFA 2QTRA 1J0EA 4V0SA 4CM3A 3VJRA 4XYLA 3KFVA 3PFHA 1IQRA 1ULAA 4X91A 1TKBA 4XUCA 4G5FA 1I2CA 2I5PO 1I7PA 3NFYA 2WW8A 3G8CA 4Z6KA 3CONA 5HXAA 3H04A 1VCMA 2ISSD 2NTVA 1S7GA 4A15A 2GHIA 3LFTA 1AY0A 1LVHA 5JPIA 1YDEA 2I4MA 3GC6A 4ZFNA 4ITVA 2ZXFA 3PDHA 3WLRA 2NO0A 1JFSA 1QORA 1E2HA 2DQ4A 2IYFA 3F78A 3FRJA 4CPDA 3AF6A 3B6EA 2CV0A 2O5VA 2Q46A 1T8RA 2OILA 3DTVD 3LZ6A 4AJEA 1WP9A 3ELDA 4ATNA 3ESRA 3TQQA 3DBLA 2E2WA 3BHMA 3K0BA 2QRQA 3L4JA 3VHXB 1OVMA 1M54A 1XFDA 2WHPB 3K4PA 3KDSE 4YJGA 4ACBA 1FP7A 1NQAO 2A5DA 3LXRA 1YTLA 1A8UA 2K87A 4EATA 3OWOA 3M6MD 1UQTA 2GTHA 4HRVA 4M38A 2ZU6A 3NFRA 1G8GA 1XTQA 1L9XA 2FEAA 4UU7A 2AOVA 1I3MA 2PS0A 4X3OA 3U4AA 2PX8A 4II3A 3L7CA 1HE1C 4MIKA 3S8YA 1XEFA 4BNVA 3ZZ0A 3JQEA 5TPWB 3EY9A 3V1UA 3BE6A 4Q9DA 3R23A 4EHNA 4RTRA 1CG6A 1D2NA 1Q0RA 2I7CA 3PL1A 4OKIA 3TLJA 2NP7A 3W04A 1OB5A 4LZNA 5A71A 5P21A 1C7FA 2MSKA 3BK2A 1GNSA 3NM5A 4HDCA 5EMKA 3B52X 5KOHA 4GF5A 5JZSA 3HCBA 1RZRD 2OG2A 3CNOA 3EGIA 3ENKA 4MJXA 1YRHA 3KYBA 5IJWA 1MX5A 3EZGA 2E37A 3FUUA 3ND9A 3D1JA 5LIRA 1TQHA 1TUEA 1H3NA 2EIHA 2QR5A 1QKIA 2CBGA 3A6FA 1OLSA 3H65A 3CSUA 4HGNA 1FB5A 1I2ZA 4EDHA 1R9NA 1RIFA 3UT6A 5GJBA 1IXSB 1Y1RA 2H51A 5EFZA 3RANA 2E9SA 2PH3A 1SC9A 3IPAA 3THXA 4DTIA 1NXQA 4IBOA 4EPWA 4DUGD 3KUXA 1HBJA 2O8FB 2CHGA 3S1SA 1NWHA 4OXRA 2ZWPA 2W00A 4GM0A 1KI9A 1QFMA 3KPVA 2QVZX 2F67A 2MSLA 1UXGA 4ZHQF 1TOAA 2Q3EA 4FMBB 1H5NA 1VECA 2JANA 3KZKA 4UVHA 5HA5A 4BO6A 2WDPA 4KUGA 4V1CA 1T5OA 4B76A 1NV9A 5EP4A 2LW7A 1RS0A 3A3NA 1W4ZA 1WAMA 4OYRA 1UMBA 3TLMA 4DLXA 3H3XA 1ZUWA 4DQ0A 2GETA 2H11A 4D9KA 5ESDA 1GLGA 1AA9A 1JV2B 3KB2A 4I9NA 1R0ZA 1S2LA 4KWTA 4ZQCB 4AJPA 2W98A 5LMCA 4BVAA 4QUAA 1AZWA 2A4MA 1OWOA 5IEBA 3K09C 3IIMA 1X7HA 4ER5A 2DFPA 3B3QA 3FJ1A 1NVKA 5DNUA 1J20A 5H0IA 4LSMA 3FSGD 2OBFA 3K0AA 2ZT6A 3G85A 4DSZA 4PYJA 1N7HA 3PG5A 2ATXA 4WFJA 3TQIA 4FEAA 2HZBA 1C2YA 5BWLA 4LHYA 3F2IA 1R8SA 4E2ZA 2E82A 1EA5A 1IIRA 4MMZB 3L92A 4D9IA 3KJXA 3VKGA 2CNOA 1J2JA 2P4HX 4RM2A 5EHIA 3W3AH 1KZ7B 1XDBA 4FDMA 3MOSA 4JKYA 4ZOLB 5H5JA 5CLHA 2R86A 3OP1A 2W70A 3UV7A 4AZ3B 1ESCA 1ZL2A 4RBNA 3E5HA 1NDQA 3SEFA 5IVKA 3HLTA 4U6SA 3R9XA 1PR2A 1JEOA 4KIWA 1UT5A 1MOQA 2OXCA 3ISTA 3BGSA 2IZ6A 2JJ8A 3F8TA 3QXHA 1H6DA 4LEIA 2CNBA 5C7OO 1KJNA 2ERCA 2QG4A 3KV3O 5HZGA 1W85A 5B7PA 1EWQA 1D8AA 1NYTA 3MYYA 1XU7A 3OPQA 8ABPA 4UNSA 1SXIA 2XYVA 4QXMA 5IFKA 4K0RA 3KPUA 3ZV6A 5CEFA 1J42A 2BY4A 3O2NA 3RAPR 3RYCB 4RZUA 3EIWA 3JVIA 3NHJA 3BMCA 1CYDA 4HB4A 3DWGA 5BN4A 3JASA 2I3AA 2F4VB 4NXMB 1E9SA 4P3OA 2K7FA 2V9ZA 4LDPA 4HWOA 4ZVLA 1Y63A 2IYAA 3F8SA 2JF0A 1VSQA 4BMOB 5K8TA 3D54D 4HLUC 2NTYC 5CNJA 1W47A 4BV3A 3ON5A 2YXPX 4N5LA 1K6EA 4JI3B 1XK6A 2JI7A 4IXNA 3PNQA 4W8GA 1JWBB 3S55A 2XMDA 4FCWA 5HMMA 2I4IA 4PYQA 4ND1A 3TM4A 3UW1A 4Z9XA 3NBUA 3VDNB 3WK5A 5D7BA 3FF4A 3PQ8A 4IRXA 4MVJG 4EOGA 3O5AA 1FBNA 2WA1A 1WD7A 1G6OA 1KI6B 4MI6A 4U3JB 1KKLA 5JFOA 2G7MC 4NMMA 4ON9A 1NN0A 2R00C 2NXWA 3KOMA 3R7DA 3VISA 4EG0A 2HA6A 2QORA 3PLRA 2WZQA 2J3HA 4HV4A 2GQ0A 5AVSA 1ZBQA 1BDHA 4G0WA 3U2QA 2RH9B 3LQ2A 4B81A 4Z54A 1JEYA 2R48A 1Q95A 4YHHB 2JFYA 3IKMB 1XWFA 4QG7A 3ZDXB 3WGJA 3QEMB 4F0JA 3KLMX 3ENZA 4UJ5A 3MCWA 5E1MA 3CRRA 2XX3A 3DEYX 3ISJA 1ANKA 2F4NA 1NQVA 4WN9A 4ZC8A 3IVCA 1UBTS 3WIUA 2OUKA 1G8YA 3E27A 5BSRA 1JQAA 2FX2A 2WIDA 4XYGA 4ANFA 3T4EA 6Q21A 1ZUIA 3X1DA 1YDMA 1DTEA 1T4CB 3EGEA 1POWA 3LSYA 2CNKA 1CDOA 5K3CA 1AT1A 4FBGA 3GLHB 1R0SA 3TGPA 3DDSA 4FHEA 3GP8A 3ZHTA 4WBNA 4NPCA 1L7OA 1SBYA 1UOOA 3BVPA 4XUDA 2XRZA 5KDDA 5IWAB 4Q9KA 3A10A 5HK8A 1DELA 4AP9A 3RU9A 2XI4A 1HI9A 3SBOA 3GRVA 2ZIEA 3D4PA 4EABA 4E94A 4BVBA 4HH1A 3JR3A 1MAUA 4RGQA 2I87A 2XZTA 4ZZ3A 5B5SA 2C3OA 5JSZA 4S05A 1XHLA 1ZD1A 2VXOA 4NBUA 3UUEA 4FKZA 4L5BA 1WB5A 1MABB 3GNTA 2CZQA 5T6MA 1MW9X 4IHJF 4PIMA 5KTOA 2HIHA 1RCFA 2HU5A 5BSWA 1ETUA 2IYSA 2J30A 4A5OA 4A8JA 4BDTA 4CMKA 5IBQA 3NC1C 3VV2A 3W05A 2ZJ0A 2IQ5A 5CG1A 3UHOA 2WWFA 2RAUA 1X86B 3E7PA 3B2NA 3O8QA 1MMFB 1JNYA 4OGGA 1EH5A 5DN6A 4PFKA 2YNMA 4GGMX 2G04A 4DIDA 2CHVA 1EFVB 1CK4A 3FXAA 2Y1WA 2IHVA 4KMMA 3IUEA 2V6BA 4JNCA 1L4UA 1JR2A 3G2KA 3C3BA 3I45A 4PYNA 3RRXA 3ZWAA 1QBGA 2C29D 2WI8A 3AEQB 3GELA 2UZ0A 2A0FA 3LK6A 2OMKA 3DHYA 2G09A 3QKSB 5BUQA 3L1UA 4EUHA 2PA3A 3REQB 4DUYB 1DV2A 1SELA 1WE2A 3L8FA 3LL4A 4DCTA 4E12A 4CEJA 5JYCA 4YAEA 2Q4OA 4LZLA 2C82A 4HS4A 1HH4A 3PNKA 4L5JA 1Z37A 2X5KO 1V7QA 4OFWA 4UCXA 1KVUA 2AI2A 1T9DA 2R96A 4L73A 1IBCA 4OK3A 4TTRA 2CLDX 4RULA 3RYIA 1P9WA 4JXJA 3KQUA 1C0EA 2ZAYA 3E61A 3QQ5A 4BNGA 1TC1A 2BHTA 3CZPA 1RHMA 4CKWA 3N2EA 1JHAA 4YCNA 1ECGA 1RJEA 2I55A 2FZVA 1Y6ZA 2V96A 3ZWQA 4MO2A 5AI5A 5ALLA 5TF4A 3LG2A 1FYWA 1WDTA 5PNTA 1YGYA 3PNLA 4C3UA 1VMDA 3NIDB 3C5WP 3ELBA 3EXIA 1BGWA 3EWAA 3WB1A 3WB9A 4AP6A 5ER9A 3KQVA 3TNJA 1UK6A 2H07A 3DV0A 2ODPA 3JQ9A 1IK4A 2JD2A 4NWIA 3CPEA 1GQ2A 1J2YA 4PYKA 1F9EA 3NHMA 3VUFA 4ILEA 1V8DA 1NLFA 3N76A 1J0AA 4Q3OA 5K4AA 3QLUA 3GFFA 4A2CA 2AMVA 1P9NA 4FFOA 5G0VA 1Q1ZA 1MR3F 2OQRA 1KR2A 1ZWLA 2YX1A 4N39A 2N9UA 4ZCSA 3RSHA 4ZI3A 4RD0A 1Z8DA 3PHHA 5JRZA 2GR9A 2O8EB 3VVCA 2A59A 4PRKA 3CVJA 1KARA 1SD2A 1SZPA 1AS2A 3L5OA 1RYHA 1ZCZA 2XCUA 5DE3A 1YBVA 4NV0A 2ZTVA 3JVEA 3P2YA 1JIKA 1PVDA 4AL4A 2VSQA 1ZXLA 4NEHB 4QDKA 4CFZA 3L07A 2FW0A 5EOVA 4F9TA 2OGSA 2PG3A 4Q6BA 2XKBA 3OOSA 1CQJB 1TI7A 2Z8YM 4EG4A 4MDEA 1NVFA 5A9RA 5HJEA 5HRCA 1N5OX 1IOVA 4C07A 1PJ8A 1CIPA 3OEHA 1X7YB 1VHTA 3ZNPA 1B3RA 4MW4A 5G2OA 1FXSA 1RD4A 1UPBA 1N8NA 2PUTA 4PC2A 4AFNA 1E9VA 3MRSA 3QF7A 3CVYA 4EDFA 1JSCA 1WPXA 2E4YA 4YI5A 1FFYA 3NPAA 1WF6A 3DGEC 1OU4A 1IE3A 3S70A 5LUAA 1OI7A 1JG7A 1XI2A 5AVYA 2OCDA 5CVCA 2W48A 3TB6A 2JZNA 2AG6A 1T9AA 4PHFA 1MUUA 4WHMA 1N7JA 3DXYA 3RWOA 2VAMA 1XB2A 3AOEA 2HMSA 2WB2A 5K3FA 4F3RA 2H1WA 2QLMA 4OQFA 3W7BA 3WGUA 4A36A 1Y1KE 4D9FA 4EZBA 1TJ3A 2PSFA 3OUTA 3T06B 3NKLA 4LFAB 1LC3A 3D6JA 1LKZA 1TJYA 1EJ6A 2Q45A 3GDGA 1IN5A 3UK0A 5HUQA 2PMWB 3AHGA 4L6AA 4XVRA 5CEJA 3NQ41 2D1FA 4MVJA 3G2MA 1D2MA 3GRRA 4C6SA 3HYCA 3IAAA 1DJPA 1PZNA 3UK2A 1UDBA 1HFKA 5E1DA 3HUUA 2JIOA 4R7GA 4L5IA 2EATA 1Y8RB 4MUMA 4YQEA 1YNOA 4B71A 3LT2A 3JCZA 4OHWA 3V46A 4S2EA 4FGUA 1IJEA 3TGWA 1I1QB 3DDCA 4JEUA 2IOFA 1H6BA 1TO6A 2PKEA 2V5VA 1D6SA 2HTEA 3LHDA 3LVRE 4UM5A 1H8ED 1UKVY 4BCBA 4DMFA 1GEGA 5AUNB 1Y5IA 3B2EA 4R9NA 4Q3AA 4J16A 1G5TA 7YASA 2MYNA 3FBWA 1LBHA 2L0XA 4ZVTA 1OFGA 1LSUA 4ZHQB 5DM0A 3DQQA 2R7KA 1PLLA 4LMBA 3OZ7A 4OGWA 4R8LA 2FZKA 1E1DA 1U2QA 2PZJA 4XKJA 3KXIA 2IPAB 4Q16A 2C8JA 3COYA 5FLXA 1X0VA 1UOQA 2N46A 2ZAGA 3HXLA 2CW5A 4ETMA 3QTLA 3AGPA 5ALYA 4GH5A 3WADA 2HK7A 1L8QA 4MIOA 5BW4A 4Y18A 2ZXEA 2PX3A 4M6WA 3HDQA 4BMNA 1QV7A 4UC0A 5B1YA 2HZ7A 2ZVQX 1VLLA 3G5UA 4IDHA 1JG2A 3E3LA 2FUG1 2QLNA 1KEVA 4QEZA 2PEYA 3RTEA 5JXIA 2AUTA 3T9BA 5ADVA 2Y77A 1UPUA 2FHSA 1WP4A 2ZWAA 3FMIA 3RJZA 3TI9A 1CQIA 1U9CA 2WWGA 1KBZA 2OM6A 4IIBA 3AP2A 1JVBA 3HYRA 3GAFA 1OLOA 3A4IA 3ROQA 1Y8QA 3SSMA 3ROTA 4Q3BA 5EAIA 4AMGA 1K8RA 3PDJA 3B3JA 1JDPA 3IAUA 3GWGA 3Q0TA 4K9SA 3EG9A 1OC2A 4TYPA 4KZPA 4C88A 4PG8A 1C8BA 1Q11A 1SZCA 4RV9A 3DYVA 4OYYA 3NBZC 2J3MA 1DAMA 4UM9D 1PJQA 1YZUA 2A5YB 3EXFB 4A0RA 5AQ1A 2O20A 1HL7A 4MHOA 2PMFA 5A1TA 2EZ8A 4QYMA 4BE9A 4W5QA 1YJ5A 5AKZA 4CDGA 1COWA 2Q9UA 2JAWA 1AUPA 2P9FA 2H2DA 2ECFA 4L5AA 3LJKA 4EY7A 2AFVA 4FZJA 3AU9A 2GAJA 3N8NA 2VXCA 3VO8A 2BGNA 3LXXA 4PFSA 2VJDA 2B7LA 2EBFX 3RS7A 1CLUA 1TTHA 4CQLB 4DLUA 5TX7A 3PITA 5IPFA 5JAIA 3FTDA 3ZQ4A 2C95A 2QM7A 3A9TA 3I76A 1O89A 5C2JB 5AW2A 4GXNA 1PS0A 1FRZA 3CRVA 3L6OO 2EC5A 5CM9C 2C5BA 1QHNA 5T5QA 3EUWA 3CR7A 1PR5A 2RBKA 1VA4A 4EX6A 3W4IA 2BGKA 3QVSA 3WYCA 3GLKA 1WOMA 1N6NA 1C9JA 2J09A 4BQRA 2BSXA 1GPWB 3GLIA 2A5LA 3RJ9A 4QGGA 4HDSA 1P4SA 3HCWA 3KXDA 5DWDA 5KYWA 2WU1A 2WILA 3IQIX 1Q3TA 3LE8A 3SJBA 5L95A 1I2AA 4GP6A 5DU2A 1E5VA 1Z34A 3E82A 3QPAA 5E2BA 4QTZA 4P98A 4X8MA 1ZVVA 3D3JA 1MIOA 4AUEA 2WM2A 3EEQA 3I6BA 2FQWA 3PQFA 4EY8A 5BQXA 1G2QA 3Q41A 1BHO1 3VYUB 1YTUA 4O4HF 1VG9B 2Q0XA 1MDBA 5F1KA 3I1FA 1QO7A 4TKMA 621PA 3AETB 4PR0A 4QEKA 1TCBA 1DX9A 1JLLA 1YI8A 4V24A 3TQFA 1ND6A 1S8FA 1FRQA 3C1UA 3WB2A 4BZZA 1CRQA 3ASVA 3LWDA 3Q2KA 5AKGA 3N7UA 2WTEA 4XGIA 1P4RA 3TJMA 3L1IA 1NR1A 1YDGA 3ZGXA 3LQ4A 3PX3A 2OZKA 2GNAA 2HMAA 4ASUD 1BHJA 1X1DA 4MW5A 5IDYA 3TXXA 1Q21A 2JFBA 4OBXA 5H3HA 5IKEA 4BMYA 1T8UA 3E03A 4QOGA 2FWAA 3ZX5A 5ALVA 4NTZA 4PX2A 2ZEJA 5B58C 1SUWA 3VFDA 1RQLA 2XF8A 2P2SA 3OUZA 1SGWA 1QHHA 4KUEA 4BN0A 3H9GA 4INPA 3H4TA 1E3DA 1YR8A 2NAPA 3DP9A 1IN7A 3R5FA 2CVHA 3RHSA 1NL3A 4KUHA 3H1AA 3EGXB 5EGNA 2XNSA 4DEVA 2YY7A 3W77A 2A5FA 3E18A 3EGVA 5FNVA 4ZT5A 4U02A 4CU5A 1KSHA 3QWHA 4WD3A 2FSFA 4HZIA 3GRKA 3TG2A 1VKNA 1N2HA 2MSNA 4IG4A 4QGBA 4WLOA 2AVDA 2VBGA 3TR6A 5AH0A 3HWRA 1HE8B 2OZVA 4UATA 1YQDA 3H87A 1DV1A 4LSGA 4C0SA 3V4OA 4Q15A 1A2KC 4C22A 4TLLB 2QT1A 4EO9A 2WTNA 3CGGA 5L3QA 1RQXA 3Q8WA 1W5BA 4LRSB 1P2TA 2I1WA 1CFJA 1K0FA 2BH9A 2DTEA 3GUCA 3P0HA 1DX4A 1T3LA 4X1IB 2GJAA 3KJHA 5H9VA 1C9NA 3JAMA 3BQNB 4LBWA 4YRQA 3RUEA 2GKGA 5A2QA 5AK6A 4V3BA 4EEKA 4COKA 4H59A 1JBEA 4PBSA 2BP7B 4HFRA 3X0DA 4OBBA 2IYLD 3HP1A 3BWMA 4D9CA 4A91A 3CEPB 2ZB4A 2SCUB 3NWOA 4F4FA 1IXKA 2H63A 3U61B 3ZDYB 4I1VA 2PA0A 3P0RA 2LNDA 5EKTA 2RGUA 1R7RA 3CF6R 4O2LA 4KPUA 1PK9A 2AFHA 4JQYA 2GCPA 3WHKA 3B89A 5TMPA 3MBKA 4O2AF 1NMZA 3SZOA 4IJKA 4GXTA 1J5XA 3C3AA 5TMBA 1VRCA 4LCBA 3KPJA 4B2IA 1QAOA 4RDHA 1BFDA 1U7ZA 2OXIA 2YRWA 2FEKA 3BFJA 2R8EA 3CRZA 3IULA 4ISBA 5DHRA 1BG6A 4IXTA 5JALA 4QFDA 5K20A 4C7OB 1RJGA 1OXSC 1SOUA 3ZI0A 2IY7A 4XFKA 5EE0A 4YP7A 3F4LA 3J81A 4UDYX 3R09A 1JT2A 3EX7C 1SVWA 4N5MA 3W5CA 5HILA 3WK6A 3GB9A 4XVUA 3AUYA 1MB0A 4JBIA 1A3CA 4UUNA 4ZOCA 3K1JA 4WBXC 3FVQA 4E30A 4O25A 2C20A 1V0JA 4TL7A 2G76A 1FEZA 3SQWA 3K9HA 3M6LA 4GWKA 4MGYR 4RA9A 4JQZA 3V97A 2W2VA 1L5WA 2A9RA 3N8DA 2Q6VA 3W4JA 3MJTA 1P2SA 3D5TA 1VYVA 2AMJA 4LPKA 3E22A 4NARA 4C0XA 2E21A 5K3EA 5LC1A 4WOCA 3U44B 1TVMA 2COKA 1Y6JA 4B74A 3RC9A 4QM6A 3OCYA 3BFXA 2D4AA 2F3RA 2A78A 3AU8A 3H8SA 5G4KA 1J49A 4R69A 1EXMA 1UP6A 3THWB 3OQMA 2SECE 5JSHA 3ZG6A 5CD9A 2XB4A 5K8VA 3WLNA 2RI0A 4C0LA 1V5EA 3QLEA 2FK7A 4JS0A 1CJUC 2IYYA 4RVDA 3TNYA 1BCSA 3B7PA 1KS2A 2AW3A 3OIYA 3AR3A 2JDIA 5ALMA 1KI4A 5B1IA 4ZOLA 4R6XA 2XLBA 2JCBA 2BKXA 2XGOA 4YV2A 4YRTA 2OGUA 2EKPA 3TE6A 3MM4A 3QEOA 4ND6A 2E48A 4UDNA 4NBRA 1ML4A 3FYUA 3UNXA 1ODIA 3F5SA 4EYGA 3TZQA 4H15A 5CLGA 3VC7A 1EEHA 1SBCA 1G9TA 5KMGB 1EUYA 1LF5A 4J91A 4IIHA 2PH1A 3GD5A 4J49A 3WDKA 3N8IA 4YXWA 4EUKA 1DAKA 2KW5A 2HRCA 4E2FA 2QHXA 3DPUA 2PCLA 3EH2A 2FE1A 1QV6A 4JX8A 3BKWA 1TJNA 3WQBA 3OU7A 1V4VA 3NXSA 3OEYA 5KTPA 3H9JA 1FUEA 1FDOA 1OXBB 1CDEA 1EWRA 1GDHA 1V8PA 1ZM9A 2JAHA 2OEPA 2ORIA 1CUVA 2WNSA 3NRCA 3TVDA 2B8TA 1EX6A 3NYQA 2J6CA 1A1VA 1PFUA 2PS1A 1GGMA 3EARA 3PIRA 1ORTA 2ZT7A 5E4FA 3R8CA 4ZCLA 1W29A 2VZEA 4X54A 4EO4A 4F5YA 4PHHA 4UEQA 1F7UA 1E9DA 2GM9A 4PQEA 3D8BA 4NPAA 1E60A 3L40A 1DTWB 2M6RA 4F2WA 2H2WA 1W0JD 1XQ1A 2GXAA 4D8XA 4C3OB 5BSVA 5JAOA 4PPGA 2UYGA 3C3MA 5ILOA 5I9SA 4GLBA 5B1EA 3QSYA 4RYDA 4CUZA 1LPBB 1YSCA 1DAFA 2GLTA 1R18A 3P5SA 2R8ZA 3GLGE 3LZCA 2HLHA 5GV8A 2NU9B 4F8JA 3A11A 1Y7IA 1KK1A 3LT4A 2KJQA 4KG7A 3T3MB 2Q5OA 1CBUA 2G4LA 4PS0A 4Y1RA 1HNXB 4UAGA 5DB4A 3A1EA 1GZSA 1WNTA 2OC9A 2WWVD 4LF7B 4C0KA 4E08A 1AKYA 5HMLA 5LQSA 2HYIC 2DHQA 1M1YA 1IBLB 3U7RA 3LRXA 1JSRA 4RJKA 2FYTA 3EQ8A 3QVLA 1TTPB 3PXEA 1U3WA 1E8DA 2F8MA 4IF4A 4QTTB 4L78A 2RCYA 2IUFA 1WXDA 2K6GA 4GSKA 5FTWA 4CF7A 3G6WA 2QTNA 2NIPA 3QFHA 3HVRA 1PFQA 3PXDA 5AVVA 2GPNA 3DT8A 4IRMA 2B30A 3EMKA 3L0OA 3HVJA 1T6ZA 2W8BA 3ANMA 1CUJA 3EGDA 2VYVD 1L4GA 1WHTA 1FTSA 1OKKD 2I0FA 5ALPA 3CF0A 2HJSA 2VBIA 1Q1GA 4FFBA 4DA9A 4RPJA 3OQPA 5TARA 4X1YA 2GAIA 3RK1A 4PSKA 1BXRB 2G06A 2VZ0A 4YRIA 2C7RA 5CX1B 3DKVA 3UY4A 1MPTA 1YS2X 1FSPA 1AV6A 4R1NA 4KWEA 3ZDFA 1NYRA 1ZOLA 5CYFA 5EKXA 3UATA 2BEWA 2C9ZA 3LPLA 3ACCA 1W8DA 3NAMA 5AVRA 5U1PA 4KYVA 3VO9A 1M1NB 3R7LA 1JHMA 1YMUA 4G9EA 1NJ5A 5K3SA 5FV4A 4KMRA 1X3LA 4FN4A 4RCYA 1OLXB 4U5QA 1THGA 2GASA 3IDOA 2RIPA 4KFUA 3VPDA 4B1FA 5IDWA 4MV1A 4KWCA 4LF9B 4JP8A 1K89A 2J33A 3WLJA 1JDBB 2ZWMA 2A9VA 1J2TA 1PJ2A 2G1KA 3SYKA 1UT6A 4F56A 3OZBA 3H1TA 2E5FA 1N5JA 5I9NA 3FRIA 3P0EA 3R7BA 3OIVA 2HSZA 1Z08A 4HQ0A 4LIPD 3D2CA 3CUYA 4LX0A 1ZGZA 5A7HA 3TAHA 3ONWA 5FHQA 1TRKA 5EN4A 2O48X 1XRSB 2ZBDA 2ZIWB 2PWZA 5ALZA 5JAUA 2A1UB 2EYQA 4R2IA 3STUA 2OORA 4MPTA 3RIHA 1PRYA 3K5IA 1QIJA 1QHYA 3N8KA 4BU0A 4C6RA 4DHWA 4TQAA 4X1KA 1TVEA 2ZRIA 3K1AA 2D06A 4PLVA 1XCJA 3WXBA 4IDAA 5IZ4A 4A27A 3KSDO 3C6QA 5DHFA 5KVCA 1UBOS 4JJ7A 3TS1A 4C03A 1A77A 1O6ZA 1CW2B 2CVOA 2IEDA 3D6MA 4RFVA 4RMHA 1XSEA 3R5TA 4P2BA 4DS3A 1N3YA 2B78A 4A03A 2ECKA 1NR7A 3B1FA 1JDBC 3QEKA 4KX5A 3VZQA 2GK6A 3HSSA 3DMYA 1VPDA 2X77A 1CEXA 3LYHA 2JD0A 2XWQA 5F5LA 5G0WA 3UF0A 3IKLA 2XOEA 2IF0A 4F5ZA 4NZPA 2Z3VA 3P9XA 1ZC3A 1P1FA 4K6GA 4GECA 4RF5A 1RM0A 3GH3A 4ZRNA 4L50A 4E5NA 5DBFA 3BG5A 1H0KA 3H8VA 5P8WA 2PUGA 1EUZA 5J4YA 4PAMA 4MW2A 4ZCQA 2B8JA 3UM9A 2HA3A 4CIBA 1S3SA 5AUQA 2VSYA 3NZEA 3Q5EA 2POCA 1YZHA 1RYFA 3O1HB 3QELB 2W83A 4L9WA 2C92A 2CE2X 1JPVA 2H3EA 5CA1B 1PP4A 2ZIXA 3PEFA 2A88A 4DCPA 4MQ4A 4GGPA 1JPJA 1HSZA 1MQ8B 1RKUA 2G6BA 2ZGVA 3FNIA 3W5VA 3GEIA 3FHJA 3KXPA 3LECA 3V6MA 4M9RA 4H3SA 4JLWA 5LP6B 3UO8B 2IYRA 3IODA 3GK3A 2DFVA 3AM5A 1LI7A 5LL6P 1GAXA 1ESMA 2C54A 4V39A 4V0QA 5ALRA 3ZCQA 5KYNA 1WY7A 2IU0A 5EPEA 4CWAA 5K0FA 2CFTA 2EEPA 2BM1A 4EB3A 3L77A 2ZVPX 1D3AA 3SIRA 4FM9A 1OXXK 4LYJA 4GR5A 4DIMA 1AQNA 3T41A 2A7XA 1F1JA 2F9MA 4O5OA 5C5DA 4HVCA 5JXHA 2CL0X 3GBVA 3HACA 4W5OA 1OFTA 1GTZA 1U0FA 2AMYA 5EZYA 5BT9A 4G5OA 1XOIA 3M8KA 3MMPA 1C8LA 3TSWA 2X3UA 3TRIA 1LI4A 4CEHB 1TZKA 2P0EA 4KITB 2VDOB 5KDLA 3UXYA 4DJTA 2H2FA 3H0EA 2LV8A 3AI7A 2B0JA 4BO3A 1N0IA