4ZCSA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
molecule keywords Choline-phosphate cytidylyltransferase
total genus 43
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcsA00
4ZCQA 1XJQA 3MLBA 5HUJA 2CYAA 3GMIA 1F4LA 4QREA 5EKDA 1GAXA 1IHOA 1LI7A 3IVGA 3FIUA 2E0IA 4YP5A 3ND7A 1JHDA 4Q16A 1XNJA 3UY4A 1P7PA 4EG1A 4JYZA 3GUZA 1M8KA 4KKVA 3IVCA 4EGAA 2V0GA 1I2DA 2O5RA 3GLVA 4R0NA 3CLRD 4ZCSA 1NI5A 4MWBA 3H9CA 1EUQA 1J21A 4U7JA 1PFVA 1N75A 4NDAA 4EF6A 4KR7A 1M8JA 1PG2A 4YP6A 1J1ZA 4NX2A 3ND6A 3ZIUA 1WQ4A 4ND6A 4YMIA 2O8VA 2CYCA 1O97C 4EG7A 3A2KA 4MW9A 1MRZA 2B7LA 3OP1A 2RD2A 3QE4A 2GOYA 2RE8A 2A7XA 2D5BA 1WXIA 2R5WA 1QQTA 4MUKA 1KH3A 5DEOA 4U63A 3K32A 3UMVA 1EUYA 1CT9A 4MW5A 3VGJA 1J20A 1OWMA 3KT6A 2E89A 1BS2A 1NUUA 5LFAA 1G8FA 1KAMA 3MLAA 3CLUD 4KPUB 3ILVA 2HMAA 3KT0A 1WXGA 1EFPB 3SZGA 1K4KA 2IP1A 4OUDB 1U0BB 1N2JA 4JXZA 2X3FA 3SEQA 2BYTA 3H99A 3S3TA 2GM3A 2EJCA 4NZPA 3PNYA 1J70A 3SYTA 1EFVA 4ZCRA 5JBNA 1OBHA 1GTRA 1EJ2A 1NUTA 1X6VA 3NBKA 3AKZA 1Q11A 3P0JA 3CLTC 1TQ8A 4G5FA 2QUKA 1V47A 2J09A 1NP7A 1T6YA 4EG4A 2YXNA 4FZJA 2A84A 4JFAA 2QTRA 3P52A 3HZRA 2CYBA 4Q93A 1JIKA 4ZCTA 1U7XA 3Q10A 2XRZA 4ARCA 5LLTA 4G5YA 4A91A 3TZLA 1KORA 5K0SA 1N2EA 3PNBA 2PZAA 1I6KA 3HFJA 3CA8A 4J76A 1H1TA 5KHAA 3C8ZA 4NATA 4MUFA 1JEEA 1KR2A 4XSVA 2H29A 4K0RA 3P0HA 3FI0A 2DUMA 2E21A 1IFXA 1RQGA 4F4HA 3TZEA 1UFVA 1KKUA 4K03A 1R6TA 4AS1A 1ZH6A 3L92A 3COYA 2EL7A 2YWBA 4JZYA 4MLPA 4CDNA 3FH0A 2G36A 1N2HA 1YUNA 1J1UA 2YWCA 4DE5A 4KR9A 5KWVA 3CR8A 1JIIA 3RFFA 3ISJA 1U7DA 5AHWA 3RK0A 4XFDA 4KPUA 1K92A 4MW4A 1GLNA 5K0TA 1NSYA 4I6EA 1KP3A 5DASA 4EG8A 1MJHA 3A05A 1TYBE 2PZBA 5J59A 1JGTA 3DV2A 1NUQA 1YULA 3D6VA 2AZXA 2HZ7A 3H05A 3IH5A 3IMGA 5HG0A 4EFKA 1IRXA 4ZCPA 2DR2A 1YIDA 3FNRA 1MAUA 1WXHA 3INNA 1VBKA 2PIDA 3CLSC 1GN8A 3NV7A 3Q4GA 1B6TA 2VXOA 1GTSA 4MW2A 3TQOA 1G8HA 1JZSA 5FNZA 3VRHA 3HV0A 2AG6A 3KT3A 4OUDA 3M5WA 3ZUGA 4L2IA 3BL5A 3CVWA 2A4MA 3I05A 4NAUA 1MB2A 1XNGA 2CSXA 1J09A 1ZUNA 4XFJA 3SDBA 3X1JA 1TYCA 2J5BA 3RHSA 1S4MA 5H7XA 3HGMA 2WB2A 3AL0C 1GZUA 3CLSD 3F3MA 3HL4A 1V8FA 1OWOA 4X0EA 1TYDE 4RPIA 1A8HA 4MUIA 5DK4A 4EG5A 4MUNA 4R2MA 2QJFA 3QTBA 2QTMA 5TGTA 1M83A 3UOWA 3G6KA 3ZJUA 1O5TA 2CV2A 4KR6A 3MMXA 1R6UA 1KH1A 4OJMX 1N1DA 4MVYA 3SZ3A 4I6JA 3TNJA 1JEDA 5H16A 1SURA 1TFUA 3X1KA 4DJAA 4EG3A 4HK4A 4WNYA 4MVCA 3MUEA 3KT8A 1M8GA 3RJZA 1N77A 1O0CA 1N3LA 4CDMA 1Q77A 1PG0A 4MUGA 3QTTA 4MUHA 3IOCA 2OQ2A 1I6MA 4MQ6A 2D13A 1OWPA 3E27A 1JMVA 1G59A 3CVUA 3UC5A 4R2LA 3FDXA 1WY5A 3ZJTA 1COZA 3DPIA 3FETA 3ELBA 1N2OA 2A86A 1ULHA 1Q15A 2Z3VA 3H9BA 2HGZA 4MWEA 4P2BA 4PBSA 2ZUEA 2DERA 1Y42X 4MUJA 4L2IB 2A1UA 3COVA 4ZT5A 4CT0A 1F7VA 1M8PA 3NBAA 1OBCA 3MXTA 4H3SA 1VL2A 2E18A 4UZFA 2A1UB 1IH8A 5FO1A 4J75A 3CVVA 1N2BA 1IVSA 1MOPA 4PY2A 4TS1A 2GKSA 3D6UA 3HMQA 1D2RA 3IUEA 1ZH0A 4U8HA 1TYAE 1MB9A 4PBTA 3TS1A 1PFYA 5KCMA 1JECA 2CV0A 4HJRA 1F7UA 2DETA 1YUMA 3DO8A 1Q19A 2QUJA 4CQNA 1M8FA 3A04A 1QJCA 2JAXA 3CLTD 3SP1A 2Z09A 3PNVA 1JIJA 4WSOA 3IUBA 1IQRA 1JZQA 2ZUFA 1O95D 4HPWA 2CV1A 4AQ7A 3IODA 2H2AA 1WQ3A 2VTBA 1QNFA 3KFLA 1KAQA 3K9WA 1ZJWA 2J07A 2PFSA 1HYBA 5F23A 1MC1A 3A4IA 3LE8A 1O6BA 3OTWA 4ZT3A 3G5AA 2NSYA 1EFVB 3RBAA 2D54A 1FYDA 5J58A 4RUKA 2DEUA 4JXXA 1QU3A 3FHJA 1NUSA 4ND7A 5TEWA 4MWCA 1IQUA 1MBZA 1NURA 3LCJA 3VU8A 4GU5A 1OWLA 1QU2A 2A1TR 1WOYA 2PZ8A 1IQ0A 1FFYA 1XNHA 1N78A 1O94D 3AIIA 2QUHA 3AG5A 4GRIA 1T9GS 3H97A 1YI8A 3G59A 2CT8A 1WXFA 3ZJVA 3N05A 3IOEA 4YP7A 4MW1A 5IJXA 4DNXA 4DLPA 2DXIA 1VBMA 3TQIA 3DLAA 2TS1A 1OWNA 4QRDA 4DDKA 1H3EA 4G6ZA 1KQNA 4MW0A 2QJOA 3COWA 1O96A 1KP2A 1TEZA 5LM3A 2DLCX 1O96B 1OD6A 2WQ7A 2QUIA 4UZEA 2PG3A 1NZJA 1T6ZA 5BNZA 3CVYA 2IELA 2QTNA 4YBRA 4MVXA 2JANA 3PRHA 3CLUC 2VTBB 3U1VA 1KQOA 3IMCA 3AG6A 1VBNA 2WSIA 1KH2A 1K4MA 2ZP1A 1WJGA 1H3NA 1R6XA 5TEVA 1ILEA 1PFWA 1T6XA 2NZ2A 4ZT2A 3P0IA 3ZGZA 1QRSA 3IVXA 2A1TS 3AFHA 5TS2A 4QBTA 1X8XA 4EG6A 2QJTA 4ARIA 3Q12A 4DDMA 3FG9A 1EE1A 3PXUA 5FO0A 1WZ2A 3UK2A 3ND5A 4NAHA 3L93A 4MW7A 4ZT4A 2WQ6A 2X1MA 2JA2A 3N2YA 2DPLA 5HUHA 4MAFA 1WXEA 4ZT7A 5IHXA 2V0CA 2J08A 3COZA 3N8HA 1GPMA 3CVXA 4PBRA 3N9IA 4DDHA 1O0BA 2AKEA 3RK1A 1F9AA 2X1LA 4MWDA 1N2IA 3JXEA 2YY5A 1EFPA 1PFUA 1I6LA 5J5AA 1U3DA 2C5SA 3IOBA 1N2GA 4MW6A 1QRUA 1G8GA 1MAWA 1JILA 2A88A 3X1MA 3CLRC 1QTQA 3IDFA 1K97A 2BTEA 1H3FA 1EXDA 3IMEA 2PXHA 1U3CA 1NUPA 4F3RA 1DNPA 2CFOA 2IJGX 2I1LA 3FOCA 3ZXSA 1QRTA 1O95C 1VLHA 1T9GR 2X0KA 2Z08A 1WKBA 4I6GA 4MULA 2CUZA 5DB4A 4S1OA 4MUEA 3FWKA 4ZT6A 1O97D 2OV4A 4HJXA 1M1ZA 1LW7A 1LI5A 4MVWA 1O94C 3SEZA 3ZXIA 1NYLA 1YIAA 3FY4A 3LOQA 2J4DA 2XRYA 1KQPA 4E1AA 4BWVA
chains in the Genus database with same CATH superfamily
4Q3LA 2VHXA 5GADl 2PUDA 3KB1A 2YFKA 1ODJA 4JV5B 1NVGA 1VKHA 1B74A 4UVDA 1GEGA 4JYBA 4DMUB 7YASA 1DAKA 3IUMA 3OBBA 4QELA 2DLDA 1SD5A 2JARA 3ND7A 4ZOLA 1ISGA 3PP8A 4LOHA 4TL8A 3N7TA 1BJKA 1X77A 4X7RA 2ZUCA 4FONA 4LZOA 3U49A 3UY4A 1AMUA 3HLTA 2A30A 1N0WA 5E9QA 5LA6B 5A5VA 8OHMA 3AY6A 4L07A 4GNRA 3NT5A 4HDMB 4NZ9A 4UU1A 2IXBA 4ZYXA 1ZUNB 5JMTA 3ZD8A 3ZJUA 4RF2A 3PUKA 4OHMA 1ZR2A 2EP8A 3IEUA 1P31A 5H1YA 5HKAA 2P6RA 3FFTA 2YHUA 2Q6OA 1N75A 1NPYA 1R0LA 1RRPA 1TUEA 1GUFA 1UP7A 3H13A 4G24A 3TX6A 1JYSA 2B7CA 4QA9A 4P7GA 1UL1X 2XE7A 4HYEA 1UMBB 4PSDA 2A9OA 3ZIUA 1X0VA 1NNSA 2VRWA 4W7HA 1PR6A 1NY5A 4Q1CA 2R7KA 3OCJA 1P44A 2B8WA 4IMJB 1I3LA 1R5JA 4JT4A 3UZUA 1NXQA 4ZCMA 3GLTA 4HFJA 4IM7A 4LXXA 1JQ3A 3LGSA 2PRKA 4OB7A 1V8DA 4BUZA 4UM5A 2HA6A 2IU0A 3TVDA 5F78A 3HA3A 3O3NB 3CZPA 3HCOA 3U6BA 2XA2A 3L0BA 4MS4B 4WERA 3EQ9A 4DYVA 1A2OA 5ICFA 2P4QA 2GHIA 4WPGA 1DC8A 3JQ7B 2UUBB 2FNAA 2Y2VA 3GLFB 1U2DC 4MW5A 5BUQA 1ZM2A 1VKJA 1XU7A 3EXFA 1CW2B 2IV2X 1A5AB 1NUUA 2FR1A 4QG7A 3T0FA 3W9UA 4YUVA 1Z5NA 2I2BA 2VG8A 3A36A 2Y0PA 3JU3A 4O4IA 4V24A 5AVJA 5IAKA 3I5YA 2HMAA 4H3KB 2BFFA 4ZC8A 1SOAA 3W2EA 4MA5A 4P92A 3FXAA 1BEUB 1E2MA 1O4WA 2A9VA 1P18A 5CT5A 4PR3A 3DFKA 1LLQA 1V2GA 2X3UA 2CC2A 1TC1A 2G9VA 4GEKA 4B83A 2FFJA 3PNYA 1QLJA 1UPXA 2FSUA 3QIAA 4MH0R 4YN3A 1BHO1 4CR6A 4TV9F 3AVPA 3C1UA 3VBEA 2FSVA 4YYEA 2XKJE 1EJ2A 1X6VA 4RKQA 5EA2A 1JW9B 1MVLA 4BNLA 1CZLA 1SUPA 3PNQA 2FUNB 5M2QA 4V0QA 1Y1SA 3RRFA 3VR4A 1PR0A 4DIBA 3TRJA 5I8ZA 4P0TA 3MFQA 3AR7A 3WX0A 5AUPB 4N49A 1V47A 2WUEA 2Q0HA 3GGGA 4Y6OA 2FSPA 3BIWA 2IEBA 2P5SA 2AI3A 3KZ1E 1XDDA 1W88B 2V54A 3OQMA 1YKFA 3P52A 3CZ5A 4AJ2A 2XKBA 2VH5R 1QV6A 1M34E 4FDAA 4X20A 1CR6A 4A5SA 4KAFA 1A98A 1RJEA 3B3GA 4ZYUA 2HBRA 1LCIA 1OXKB 2Z5FA 3DE6X 3F4BA 5AHKA 4EZBA 3OC6A 4H35A 4ER5A 2VUUA 4CMKA 4PHFA 1H2XA 3ZGLA 1PZNA 5IG2A 3QLVA 1I6KA 3PFNA 5D84A 3B51X 3LF2A 3JQAB 4R4JA 4O3FA 1PR4A 3OOYA 2BFWA 4RXMA 1KPIA 5FUVA 3C8ZA 4NATA 4TSFA 4POAA 5JHHB 2I3BA 4AP5A 1VTKA 2WU4A 1GGEA 2HA0A 4E2FA 2HU7A 2WQZA 3EVTA 3T7KA 3DOIA 2NSLA 3VAZA 3L5KA 4YIHA 3QPBA 1AGNA 4JB0A 4A2PA 4LPSA 4QO8A 2HJGA 4UMFA 4GPIB 5JJKA 1E7RA 1TQ6A 2AE2A 2WWHA 4K9QA 4XSGA 3O9MA 2PNJA 4PV7A 3K2QA 1FF9A 5B6JA 2F48A 3SJAA 1L0BA 1KVRA 2P78A 2CVPA 2WG1A 2ZJ5A 3UAXA 1FLDA 5KTPA 1TJ5A 3IGFA 4FBLA 4U9UA 3GLSA 1ZIPA 3GPIA 4LF8B 4X85A 2AN3A 3L18A 3CR8A 4OQ4A 2JJ2A 2I4OA 3KTAA 1DG9A 3OZDA 5DNEA 3T0GA 1ZD2P 3QEBZ 2NZJA 1RYEA 1U7DA 2HCTA 3BKWA 2WYHA 4V2IA 4OLBA 5GWXA 4L8LA 4ZPJA 1OAAA 1VG8A 1NSYA 4P84A 3BXZA 2VYNA 4TWZA 9ATCA 5ITZA 5KPDA 5IBRA 1FQWA 1CUEA 2J0VA 2JCSA 1A2KC 4OH1A 4WESB 3VSCA 3GELA 3BD7A 1A9YA 2NV2B 3JZAA 4M49A 4Y1RB 3LUFA 2XCQA 2ZRFA 4OAPA 5JWHA 3TMYA 4F91B 1G20E 2FY8A 4QFCA 4ZVRA 4PG8A 1UDXA 4YQFA 4YT8A 2MYUA 1ZD8A 2W2OA 2W7TA 3FNRA 2D1SA 3OSUA 1O9HA 2PUJA 2J9GA 3HC7A 3Q6MA 4HRXA 4JYCA 3EGVA 4KMOA 4A2WA 8ATCA 1YT5A 2F9FA 3H4TA 4F1KA 1XELA 4D81A 4UXIA 3ZLUA 3E8SA 2GEFA 4BQPA 1KFCB 4OQMA 1G8HA 1Q5PA 5FNZA 4B3MB 1BA2A 4S1NA 1EFKA 3A4YA 1RADA 4GM0A 3UJ6A 2DRIA 1TTQB 1CU1A 2QYOA 2V58A 5CIWA 4I1OA 2CVOA 1MR3F 3TIVA 4CMBA 4EX6A 1H22A 3MEQA 4OLFA 1FP4B 4BLSA 1P9RA 3OIDA 1GNLA 1D5WA 1WS6A 3GNQA 1V6SA 4RCVA 1H8HA 2QI9C 4J7UA 1ZUNA 5CLQA 4K2HA 4KJXA 5FQNA 1ZX1A 3QHAA 3X1JA 4EMSA 1NW7A 4UAGA 2WV9A 3ER6A 4EPYA 1ODKA 5FLKA 1S4MA 4BWGA 4AYXA 1AKMA 1PNTA 2BSXA 2P8SA 3U0VA 1S8FA 2ORED 3JD3A 4MO2A 2GSWA 3AJRA 5ALPA 5EINA 5JRZA 3BOSA 1FDUA 1FFXB 1E1MA 1KDTA 3ELYA 3MQ4A 3ZHVA 1V48A 5G0UA 2WIAA 1BXGB 1JMKC 1M76A 2ID4A 2UZ3A 2FW9A 5KVVA 2V6FA 3LBYA 2QORA 4MUNA 4HQLA 4N3AA 5BXQC 4CPDA 4BZXA 3LWBA 2LKDA 5EHQA 1JLHA 4AY3A 3QTBA 4IIYA 4V3CA 1UT6A 4ZYZA 2HWYA 1T5DX 3CW9A 2RI0A 2P67A 1WUHS 4RA6A 4ZO4A 2IC5A 4OJMX 3KBOA 3D3EA 4JUFA 3T7EA 2B2XA 3I9NA 3NGXA 5AWFC 9LDBA 5SZKB 1PJQA 2Y1LA 4N7RA 4JT2A 3QMMA 4Y6PA 3KHUA 1U0NA 1SXJE 3KJHA 5FUYA 3CUSA 3KT8A 2VJKA 4GIBA 2Z98A 5ED4A 2H7CA 3UFXB 3U60B 3IE1A 4KLRA 4MR7B 3I61A 3G85A 221PA 2ZCJA 1OXBB 4M46A 2FRDA 4YRIA 4DC1A 2DPHA 4ND5A 5IJZA 1D6SA 1PZGA 3PCRB 1ZM7A 3DQQA 2GJAA 3CTMA 4QDXA 3TRFA 3UC5A 2H0RA 3NWBA 4PCUA 1ZSNA 3IKTA 2OCLA 3MMNA 4Z1MA 3RFCA 2A86A 4EHFA 4HDAA 5C9ZA 5AK0A 1S6YA 2OPHA 1C8BA 3O73A 2RAPA 1VSTA 2FSSA 1W6RA 4I14A 1U9ZA 1DEOA 4B6OA 1GPWB 1F7VA 1M8PA 3DJFA 4OHUA 2XQIA 3MOSA 3IERA 1KVQA 4UUAA 4MYHA 4O2RA 3AY0A 5K3DA 1KYXA 1XJCA 1W52X 3GJ4A 1TM2A 5I8PA 4I55B 4LNUB 4UOEA 2ZSUA 1DWPA 4CI0B 2OCGA 1IVSA 1KEUA 2IYPA 4GWGA 4LKOA 4TS1A 1DAOA 2QYTA 4BDSA 1D0IA 5L3RA 3O93A 2YOGA 3NKLA 4KU4A 2WWTA 4LCJA 4QASA 1H9CA 3CISA 1WMDA 1UQTA 4HSGA 2ADMA 4PYOA 1CQWA 4L4ZA 2I5PO 2W2LD 2WFAA 3GZNB 3H75A 3O2NA 1VHQA 1NMXA 3M6IA 4LNHA 2W42A 2EGUA 3LKBA 4EATA 3QU2A 4D9CA 1QIEA 1JECA 5HQTA 3MSCA 2VJCA 5FQOA 4EGJA 4X41A 1NF2A 5EJAA 1YUMA 3LPLA 1XMOB 3H86A 2P6UA 3FWYA 4IZHA 1MVOA 2P5UA 1XZCA 1CUSA 2PUHA 4Z0TA 3SP1A 2WJHA 4R31A 5ULLA 2Z09A 3MBIA 2BISA 3A37A 3GIDA 1G63A 2DU8A 4HUJA 1L5KA 4F5EA 4ZOAA 5DTEA 4JGIA 3OOJA 1BNCA 4NV0A 1UWKA 4IGKA 3UJ8A 2V7WA 3M5PA 1FYFA 1O95D 3QOYA 2PLAA 3C7KA 3VISA 3OMXA 4BHTA 1Z0IA 5CK4A 1HOTA 1EA7A 4U2GA 3HVRA 2GCOB 3LUJA 2J07A 4EHKA 1I9CA 1H2WA 2X4DA 2G4LA 5BWBA 2XNKA 4J90A 2BM9A 2ZQ5A 1W0KA 1FYDA 1Z5VA 5LZ4A 3H87A 1RLIA 1XA0A 1V39A 3GVIA 4P33A 2VHCA 4RTJA 1M6WA 2NN3C 3X0DA 1DJQA 3NM4A 2JLWA 3QMPA 2JJ1D 5LNK1 1BMDA 3ORRA 4D3DA 5EIBC 3QKTA 4JT8A 3DYIA 3ONDA 4QOIA 1N34B 1LRJA 2VTEA 1TCUA 3WBKA 1TD9A 4NC9A 4URWR 1VG1A 5SZHB 1BVYF 2F9LA 1ENOA 2CHGA 1NVEA 2BGKA 2C59A 3MJCA 4Q3NA 1ZMOA 3BWYA 4BLRA 2ORIA 3N0WA 2MHCA 4NYMR 4ZWNA 4QOEA 3RSOA 5BMVA 5BSRA 3X1ZA 1T9GS 4LHSA 3H97A 1HNZB 5ICGA 2Q3JA 3QVGA 1JQJC 2OAGA 5IDXA 4B3FX 3PQCA 1XLWA 2XMPA 5D5QA 1E6MA 4MYDA 5ALMA 2DXIA 4JOQA 3OE4A 2OZVA 4AP6A 1FRFS 4BQRA 3H1GA 5C1PA 2GZDA 5HTKA 5KYGA 4WT7A 2ZJOA 1KK3A 2FJPA 3HFGA 3K0CC 2IYRA 5HE8A 2OFXA 2IYXA 4HFNA 1J5XA 5IFLA 3BE8A 4G5RA 2QRUA 4UARA 5KI6A 1P8AA 5FBWB 5EJ5A 2XQJA 3OFND 3OAAA 4OHBA 1G9SA 2NO4A 2YWEA 2P9FA 4YJKA 4Z4EA 2BEVA 1KZ6A 2X9QA 1R0BA 1GTL1 1PQYA 2MYNA 2QMEA 3K0CA 3KB2A 3NTQA 4JI3B 5KYUB 2X9VA 3PFKA 4CT4B 5CA1A 5HZGA 2QN9A 2WFZA 3AXSA 2YL2A 5BNZA 2RJ3A 3F7TA 1UZLA 4KUGA 3V4SA 1DOAA 2V8OA 5G0TA 1C1HA 1JR3D 2AIRA 2YCLA 4PS0A 4RVFA 2VUHB 2QTNA 5I9TA 3Q7EA 1O6FA 4JASB 4YPOA 4WKOA 1JN0A 1F51E 1PJZA 4EFNA 3BERA 5EOVA 1WL8A 3BMCA 3ERCA 3FF1A 3QYFA 5CVJA 1XAHA 3IESA 1RM4A 1TAHA 1W0JA 2FWMX 2PU7A 4KMMA 4LTMA 3AVUA 3V8QA 3Q6IA 1OROA 4NAVA 3E3NA 4C1BA 1KVSA 3S7TA 1H4QA 3E1GA 2UZ1B 3UF0A 3HRIA 3ZGZA 3H2KA 4RVCA 1JTFA 2B5OA 3DBLA 1DJLA 4Z9FA 4JSYA 5M5BA 4MKRA 1E9DA 5IJAA 1L4YA 4FYKA 1XA3A 2GVZC 1S96A 3R0XA 1QH8A 4FFVA 4IDQA 4F4CA 2JFVA 2H31A 4GMKA 2JFNA 1WZ2A 3MD9A 1U3TA 2AEJA 4OSOA 4QVGA 3D4IA 5FNVB 4C07A 5IEBA 3AJ9A 1NX6A 1Y0BA 4E5UA 2VHQA 4UEKA 3IEPA 3DE4X 4EYKA 1JP7A 1LVGA 3LRPA 4FMDF 4L28A 3WLHA 1FVXA 2QE7D 5IHXA 1QWSA 3THWA 4ME6A 4N5MA 1YVRA 3SIPA 1W44A 3W5CA 2VK2A 1ESDA 2A14A 3FNHA 4WHMA 4QKQA 2A67A 1LB1B 1P3DA 2IBMA 3M4XA 3RSQA 1J2RA 3L7KA 1J24A 1Y4ZA 4YQYA 4EMTA 3DMTA 3BHNA 3WSTA 5I9IA 3FR8A 1A77A 4O4IF 2YUIA 3T3IA 1DJNA 3RWOA 1RYMA 2QVCA 3DAYA 2H2IA 3X2EA 1JDSA 2AE1A 3OF5A 5EMNA 1XHFA 5TGDA 4AKTA 4ANFA 1PFUA 2VYVA 4KVAA 3R9WA 1GV1A 5BV7A 2BR4A 1G5HA 4J0FA 3R7WB 1OX5A 2IPXA 4LF4B 2D06A 3HU3A 3PB3A 3UWMA 4GMGA 2Q5QA 3DEKA 5GJCA 1NBHA 4KQMA 3PQ4A 5M04A 1QIIA 3MQ2A 1AUVA 3IMEA 4BQQA 4A73A 4QUKA 4QRHA 4C0SA 1Z8NA 4PWYA 1W5EA 4NFYA 5J63A 1J25A 4KH0A 1WB6A 2C0CA 1LBIA 2XTNA 1GWNA 3OLQA 3QKIA 4WOBA 2IEZA 4R0VA 4FZVA 4Q4JB 4MULA 4I6GA 5KJCA 1UEIA 3BH7A 3GK3A 3MOGA 5DB4A 5TPZA 4ENRA 1SVWA 2I1QA 2Q0XA 3STWA 3KPVA 2WD8A 5HBRA 2LD4A 3DV0A 2GK3A 5TNXA 1DZ3A 2X5XA 3C1OA 3O8OA 4GR5A 5ILQA 3S0JA 4REQB 4BLQA 4C4OA 3AM1A 5TQJA 2Q8QA 4LEIA 1XDZA 1W5TA 4C4AA 3AL3A 5LYJA 4B6EA 1K1EA 1ZOLA 2XRYA 4D0NA 2FPSA 2FPGA 2XE6A 4GZMA 1CLUA 2J3IA 2EKBA 1M0TA 2GILA 1NI4B 1ISJA 2PT7A 4JCCA 1UK7A 1TVKB 4TMYA 1L4MA 5HKKD 5KSOA 1Z0AA 4JYPA 4I5DA 1J39A 3CLVA 5EZ5A 4HH3C 3T52A 5KNBD 2AEEA 1M2WA 2JH8A 2K7ZA 2H52A 3EAQA 4U6QA 3B6JA 4N18A 1GDTA 1ZH8A 3BFJA 1SVMA 1J0CA 4C2UA 3IKVA 2LP4Y 4D9JA 4DZTA 4JYZA 3EGWA 3TLJA 2YIDA 3TLBA 4LC0A 1BH6A 1Z5OA 2O5RA 2WPNA 4QFMA 5LXTA 4HGNA 3MJVA 4YCSA 3PCTA 1PZHA 4MWSA 1JG1A 1CP3A 5CNIA 4B1FA 3NUQA 2DBQA 3SICE 3UJDA 4IIFA 1KOJA 1A9ZA 4IXMA 5EXTA 4IVQA 2PSFA 5K0NA 1MEOA 3NBQA 1PJBA 4GLOA 1ZU4A 2YWJA 1RLUA 1XQ1A 3GEBA 3T5CA 1N6NA 3N6XA 4NX2A 4BJ1A 1LY1A 3HKCA 3OC0A 2A4KA 3W77A 4NCAA 1MPTA 4EK9A 3WHKA 3PX3A 5KQMA 1AK1A 4KV7A 3SBEA 4R1OA 1N2XA 1JEJA 2A35A 2ACVA 1USKA 2EFDB 2QX7A 3R0VA 4WH0A 3BREA 3GXBA 3QKRA 4RQUA 4KQEA 3PDIB 4HNRA 1HSOA 1PAUA 1T8SA 1JJ7A 4XGIA 3HB1A 2V0NA 1PR5A 1YJQA 2GBCA 2ILVA 2Z56A 3Q3CA 4GLFA 2O48X 1TDJA 4CYMA 2FQYA 3D3NA 2W4MA 4R1TA 4XM2A 3A9SA 3T9EA 3V8MA 4B3HA 3HA5A 5COAA 4I81A 4S24A 4MQLA 5DP1A 3HVKA 4B3GA 2YKGA 1M3SA 3T35A 2JHCA 2BH9A 4EP1A 4ZAXA 1J20A 1GPUA 4MRMA 5LFAA 1BS2A 1DQZA 4A0HA 4D8UA 3SSNA 1FZTA 3QZUA 4MRMB 3T1TA 5HNKA 3ACCA 3CLUD 2DC1A 1UZUA 1OXXK 3ILVA 1D4OA 3NANA 5AK3A 4WLUA 4UNIA 2B1GA 1GFIA 3P2JA 1J9ZA 5E6RB 1J42A 4IW3B 1HTBA 1ZEJA 3I0MA 2KBFA 3OJEA 3DV0B 1KO5A 3DMFA 5DGDA 1P7WA 1SQGA 2EJCA 3AHHA 4NHEA 1E8NA 1J70A 4CKCA 4IDHA 1C7RA 2RH4A 1T35A 2QOEA 4C08A 1UKBA 3NHFA 1EA5A 3IVMA 2WSSD 4FT2A 3T7IA 3JVDA 2XV1A 3OE1A 5KO2A 1QHSA 4OL0A 4ITRC 3EWIA 2NXNA 4PPQA 1I7LA 1TA4A 4M1TA 4B75A 1OV4A 4JA0A 3WJAA 4JLAA 3JAKB 4QGBA 1GUAA 1UOOA 2WOJA 3OFKA 2BDUA 4UTVA 4TV8B 4NE9A 3PFWO 4XM0A 2ECQA 4ZTZB 1FLAA 3OM0A 4NBLA 4O8CA 3WG9A 1CNEA 2ARKA 3TSYA 1OFGA 4RMGA 2J59A 2GM5A 2WJGA 3MAAC 5L3SB 2IYZA 3I2IA 1HLPA 2QW1A 3A10A 4AXBA 2HXYA 1BE1A 1EGQA 4EKEA 5IM4F 4EUSA 4L4UA 4H60A 3W3ZB 1Y3IA 2DUNA 1BDBA 1BU8A 5FIUA 3K1AA 3D0KA 5H70A 4EZIA 3T3NA 1OC4A 3I2GA 4NVRA 1DO8A 4DG5A 4BO2A 2OD7A 1FYWA 3FB4A 4YRAA 1RZRD 2A0XA 3WQSB 1YZLA 1Z0FA 4TZKA 3K35A 4RJTA 1SKYB 2IZOA 4IEEA 2VDJA 3Q98A 5EXSA 4YMLA 2VWHA 2ZETA 2E21A 2NAPA 4HNGA 3P27A 3E1SA 3MJSA 3QFCA 3OZVA 5AJYA 4DZZA 3AIKA 5GJBA 4LOAA 3SYNA 4N1AA 1Z8FA 3B20A 1P61B 3UAYA 1X92A 4QFDA 3EJ6A 3AVQA 3KSZO 1YL7A 3LFTA 3L7CA 5SYNA 3TLGB 4CDNA 4BECA 2J3JA 2G36A 2P9QA 1UBFA 1YUNA 4MS3A 16PKA 1J1UA 3ZX5A 2YIJA 2G1UA 5LZ2A 1ZZGA 5B6IA 3TOZA 4KXLA 1Z22A 1C3XA 5JNVA 3SQXA 1JSRA 3SBDA 3MGAA 3NHPA 4B44A 5AHWA 1C9KA 4YHBA 3RK0A 1U8XX 3Q3GE 1DWQA 2FX3A 3D4LA 1LK7A 3GGPA 3SYMA 4Q9KA 1ZIYA 1RTKA 1MC5A 2HMTA 3L7OA 3CB2A 3AM3A 1UBRS 2W6CX 1CYDA 1SQ5A 1VJGA 2D2FA 4FYXA 4GUAA 4TTRA 1XZPA 4BKOA 3E18A 3NHAA 3QI7A 1Z4QA 3PFFA 4X71A 4R54A 4V0OA 1D7OA 1TM1E 4AI6A 3D6VA 4LJRA 5IUNC 2PS0A 2HZ7A 5FORA 5DTRA 1CVLA 4DPKA 3EEBA 4JUAA 3VKWA 4X45A 2B5WA 1QFZA 3JAWA 4E08A 1E0AA 2B37A 4YTEA 4EPXA 2HU2A 1K98A 3ZVNA 3IX7A 4JQOA 4S2EA 3VDQA 2NP7A 1EVLA 1R6VA 1GN8A 3CXUA 2R79A 3B70A 5ARDA 1E1KA 4CEJB 5IBQA 3GRZA 4O29A 5HR5A 4ZRNA 5CCXA 4L73A 1XQYA 3CVWA 3ZUGA 2VK8A 3VH1A 4EI2A 3ORHA 4J6FA 3T9AA 3BHJA 4NZYA 2OAP1 3ENZA 3I05A 4F9EA 2W6ZA 1N0UA 1MB3A 1YR6A 3LO8A 3LJKA 4Q9LA 2PWAA 3R5HA 5FB3A 2RHJA 3ZWNA 2GJKA 2CSXA 5DRTA 5CM2Z 3EFOB 3JQ7A 2QVBA 3F67A 1DC5A 2VPWA 1F2TA 3ND9A 4XFJA 3SDBA 3RHSA 4C14A 4JJIA 1ADBA 3DC2A 1M2HA 3NLLA 3ILXA 6ADHA 4FW9A 1A04A 4JIMA 2Q7OE 1AJEA 1A8PA 4IRXA 3T3MB 1CUXA 2KLBA 1PJ3A 1V8FA 5G1OA 4ZZ2A 3ZX4A 4JUDX 1YS7A 4WCFC 2H1FA 1JXOA 4I0WB 3I8SA 4K6OA 4DDTA 4W7SA 2PL3A 1XBTA 2OCBA 2XJ4A 4CIDA 4BNTA 3O47A 3Q0EA 1KI6A 2H63A 2QTMA 5HRUA 2LDBA 3G6KA 2CBGA 4JLKA 3DHVA 3PL5A 2DT5A 3QBVA 3KJIA 3S2FA 4B45A 4FOPA 1F3OA 4YAWA 1CRZA 1K6JA 4AF8A 1PK9A 4D46A 4NMMA 4IR7A 5E7QA 1GGVA 3NAGA 4HVTA 2XX3A 3ZHCA 4PN7A 4JJ6A 1BVHA 1JFRA 1A2QA 2Z2XA 1EIWA 2WPDA 3HBMA 1DAIA 2VDVE 4P36A 2BSAA 2Q1TA 4LYGA 3HNOA 2BGGA 3L0ZA 1H6BA 1M72A 4RTPA 1FJ2A 1ZN2A 2ZRGA 2AUNA 3VH3A 2HRDA 1SH7A 1XKXA 3ABRB 2PUCA 3Q5DA 3OZXA 1A7JA 1DX9A 3DOJA 3OIVA 1RWXA 2BEVB 4GOOD 4R68A 3W2TA 4MWZA 1CQPA 1Z4PX 1V11A 4Q7EA 4B0OA 4EHNA 5HW0A 3I83A 5A04A 3ENNA 3N07A 3AFIA 3K53A 4PBSA 1XUOA 2XWPA 4V1CA 4DV6B 3A6PC 3W7BA 3PGA1 2SICE 3GPLA 1KMQA 3IRUA 1JUDA 1IBRA 3ZWVA 1USIA 2XOKD 4H3SA 1TM3E 2OHJA 1W7AA 4FFSA 4HDKB 3PUIA 3UUGA 1G66A 1EZ1A 4ILKA 2QU8A 5JISA 3ZTTA 2NUTA 3DW3X 4J75A 4C7KA 2ZRMA 2QK4A 1K06A 3AINA 5EHNA 3VKFA 3FN4A 3OHSX 4KGVA 4WX2B 4QVIA 5TX7A 5JBIA 3GLGB 1ES9A 3A6ZA 1G19A 1EKXA 1RZUA 3IUEA 3AI3A 1ONSA 1SUSA 3CZAA 4JCOA 4XIJA 4JJ7A 1OAKA 5DVZA 5KCMA 1EZ4A 4RIHA 5JDIA 5TY0A 2NP6A 2B4QA 1XF9A 3GX1A 1TECE 5F1OA 2O3JA 4TQUS 3OOHA 4YCBA 3HXMA 3C6QA 3H5WA 3WXMA 2PIAA 4PU0A 4R3WA 3E81A 1CR4A 1YZYA 1Y80A 2HMSA 4NXNB 2XBMA 5G4LA 1J6UA 2QD2A 1JYEA 4LYEA 3JWGA 2WJYA 2WAMA 2YWFA 4IJ5A 2WC1A 3LX6A 4LOIA 4JOBA 2HADA 4OYYA 4WZAA 2OUKA 2DFTA 4K7JA 1EFLA 2PSHA 3LX8A 4HNAB 4K05A 3DB1A 1N2CB 2VKQA 4PHCA 5KWEA 1YHZA 4JLBA 5BOSB 2BLNA 4CV0A 3I6ZA 2V4MA 3B3AA 3MTAA 4C21A 5L4SA 4F5ZA 3JQ6A 4INJA 2ET6A 1S2GA 1IVNA 2XYGA 1HYBA 2EZ9A 2WJAA 4GS5A 4X00A 5H5JA 3TAUA 4DB2A 2XF8A 4LYFA 4Q12A 3WO1A 3QBTA 1J9GA 1UXJA 2RK6A 5CTJA 3PEUA 1ZVVA 5T6MA 1P7ZA 1Q0TA 4Z53A 4M22A 1DX6A 1R9MA 1FA9A 4HSEA 5F7OA 1ZITA 2FOLA 1JFSA 2BFEA 4GR4A 5KOHA 4TV9B 2VAVA 2GR9A 4CMCA 3G8DA 4P31A 2HWWA 5L7YA 1Y3DE 3NETA 7AT1A 4FNOA 3FBGA 3KD3A 4IYRA 4GMFA 1R0CA 4BZQA 2BR3A 3VNSA 5KCZA 1NP6A 1Z15A 3JQCA 4LA4A 5P8WA 2FP4A 1N5DA 2QUHA 3K4HA 5K6AA 5K8TA 4LWZA 1PGQA 3NWJA 1X3SA 4QE3A 3AG5A 5AJXA 3EISA 2ZRJA 3FVQA 3G59A 4QQKA 5CLHA 1FSPA 1QBGA 1NT2A 4ZU1X 5F98A 5K3OA 3WLMA 2TYSB 3RVJA 1UZMA 2P27A 3DHWC 1MO6A 4RAOA 4C04A 4YX9A 3ZU2A 4IIXA 3T94A 4LDQA 2Z4RA 2YBEA 1ZW1A 4PRYA 3UKJA 4FIZA 3JARB 1USWA 1Q22A 2EC5A 4G6ZA 5DHSA 1ZRNA 2PXXA 5T4EA 4J0HA 1KP2A 1L4NA 5FWXA 3ZDDA 5LM3A 1CUAA 1EVIA 4ZPXA 1CK4A 3MK31 4YHHB 2BFBA 5JHGB 2FZKA 4KPEC 2BP7A 3FOEC 2GLXA 1NV9A 2CDBA 3COPA 4EVQA 4TYQA 1T1GA 2AMJA 4UREA 5C5IA 5BSFA 1YDHA 1RHKA 3PVCA 1T3SA 3V42A 1NYRA 1H5NA 2C9YA 2V4UA 4RMHA 3WB1A 1ORWA 3VHRA 3TXYA 1P4GA 2LE0A 4CG1A 1G38A 2I6FA 2XI4A 1GOTA 1X13A 2ZK7A 3AY7A 2C4MA 1KHHA 2OKCA 3ANMA 3HDTA 3TL3A 1SBYA 3H1TA 1HE1C 2GASA 1J4AA 3ZCTA 4UTOA 3AK4A 4F9GA 3RFXA 2ZU6A 3E7WA 5ILGA 4CMJA 3AEZA 1WJGA 3GDGA 1H3NA 1X9IA 2HJ9A 3EFHA 3F6YA 1M2OA 1R9GA 5CT6A 4F3TA 2NWQA 5DW3A 4XKJA 2GWRA 1GQOA 3MWLA 2YOHA 2ZI7A 2FWJA 4Z0NA 3FNGA 3RWMB 4B6RA 3OQOA 1QIFA 2Q4EA 4UQLA 1BWSA 3I92A 4II2A 4OGGA 2C82A 4MUYA 4TM7A 3C8DA 1WB5A 4A0SA 1IJFA 1T0JB 4LY6A 1JL3A 5G40A 2OV8A 1RTTA 1Y33E 3NALA 3FNIA 4BNFA 4KFUA 4Z4FA 2BFDA 3OHPA 4IKPA 4QPNA 5NLLA 4YT2A 1V0JA 5B12A 4ZYVA 3GUYA 2AOXA 4ESOA 4PW0A 4RORA 4PIVA 4WMLA 3BM5A 4BQEA 4FXPA 1E20A 3DGEC 2J9ZB 3N2YA 3DV9A 1JIQA 3NPAA 4J0QA 4FNMA 1XCGB 3FLMA 3CUWA 4PZ0A 5IDWA 4DCCA 4RH1A 4B8ZA 1KERA 4HEA6 4M9QA 3PQ6A 1QGAA 4C0KA 3EIHA 1N0IA 1MMFB 3MWEB 3P9XA 4RLHA 3FMVA 3RK1A 3VKGA 2NZVG 2OSBA 4O0LA 5HM8A 2QWXA 5A1TA 1E2BA 1G6KA 3NAMA 3UAZA 1B00A 1WBDA 3N2LA 3ZHBA 1RCUA 1K5PA 2HNBA 2YW2A 4MEJA 3SQDA 2HYIC 5TLSA 1XMXA 7REQB 2FJUA 5EJ7A 5U9CA 4FDLA 3LGAA 1J2EA 3ZNPA 2D5CA 5IRCD 3M82A 1YRWA 3CLRC 1NBEA 3B6ZA 1QTQA 1NW6A 3Q9SA 1GCIA 3HEMA 1H3FA 4TLEA 4CKBA 3HM9A 2H1OA 2EJBA 1A8UA 1JKMA 1UWCA 1POXA 1U3CA 1Z28A 2IE0A 2A0YA 1YR7A 2ZUTA 4Q7KA 3BWDD 4F86A 4W1QA 5AKHA 1BX3A 1FYEA 3UKOA 2DBYA 1SVLA 3A1FA 1CX9B 2W6NA 5T64A 2DF8A 2KI5A 3MJRA 1XQ6A 4UTZA 4ZANA 4JNKA 2ICAA 3ZV3A 2C2ZA 2ZJ2A 4ZT6A 5DN9A 4KHPB 3UBTA 4BO1A 2Q4BA 2OMEA 3X1DA 3OA2A 4HNSA 4PC6A 1KNXA 3EXIA 4MRSA 4E51A 5A7FA 1VI2A 4F2HA 5L3SA 2CMKA 1Y8AA 4KYUA 4CCSA 5HOEA 2IKQA 4C4ZA 3FY4A 2P6PA 1TADA 3FWPA 1OFUA 4X9XA 2GVDC 2YS7A 2V7BA 3BD8A 1YB2A 3BE4A 1PW5A 5G4KB 1E32A 1N8KA 2ZBDA 2XCRB 1IHOA 1KZ7B 1ZA2A 1M7GA 3MJTA 5YASA 2ZTMA 4TRJA 2FB9A 5HCNA 3BK2A 4BATA 2O1SA 1E1LA 1OFHA 1T5LA 3NYIA 2NT3A 4G9BA 4JBWA 3P19A 1ML3A 1T5BA 2IGTA 4KKVA 1LTKA 2C2GA 2A78A 4RKRA 4EGAA 5T7BA 4E2XA 1KRXA 3AEKB 4CMHA 1RHQA 3MINA 4N0MA 1M67A 2JD0A 3BJZA 1MXHA 1V71A 3L1IA 4ZCSA 3Q8WA 1ZYUA 2C5HA 3CIFA 1JLLA 3ENQA 2EG9A 2PKQP 4HP8A 5KNDH 1L5WA 3K9GA 3CVJA 4KWTA 1Z6AA 4M9XA 4AL4A 4L9SA 1JBEA 2M1XA 4M1QA 3VHXB 3PA6A 1BD4A 2DHEA 3OM9A 1THZA 4KOAA 1PT9A 1U81A 1X0XA 2QD5A 4X7MA 4YONB 4QATA 3AW8A 2R5FA 4GSKA 2SKEA 1XEXA 3MIIA 2R8ZA 1N5JA 4TSFD 2P1RA 3HXQA 4JB3A 3UXEA 5LYJB 5IYZA 1G4HA 1T36A 3SIWA 1S8OA 1CY7A 1U8AA 1U8ZA 2RGAA 1Y1PA 2XSZD 3I2FA 1DRWA 4LHXA 3DLTA 1G7CA 3F9RA 3F4LA 2IHKA 3QITA 4IYJA 4N3NA 2O8CB 3P9ZA 2I55A 1V1RA 4O4JA 2A59A 1H4VB 3PYLA 4KQJA 4GOXA 1VCNA 5E9JA 2A7XA 2V7GA 2YJ4A 1WXIA 1KF0A 2AHOA 3CLHA 2GUGA 4HLQB 3U16A 4EUEA 2GETA 4HPXB 2XVXA 1OFTA 1SD1A 2EOAA 2P0YA 4HZIA 4V2UA 1C3EA 4NULA 1PV4A 1SXJC 3S1AB 5K6AC 4R9VA 9MHTA 4KJZA 4UFOA 3W8FA 1WIWA 4CQMB 1G8FA 4M0LA 1Y8QA 2MYPA 3BB3A 4TROA 5JWRA 2EZ8A 3EK2A 1E3MA 4AYTA 2ZDQA 4JXZA 1GNVA 4IRUB 3TL6A 3CF2A 3AFGA 2HU8A 3KZNA 4I4LA 3OZ7A 1G6HA 1FTWA 3VR4H 6CHYA 2WJ3A 2O8DA 2DBRA 5AJZA 2X5JO 2VDUE 4H3VA 1EFVA 4FR0A 3TLXA 1MT0A 1JQKA 2Q2VA 4AMVA 1GTRA 4FCTA 4EW3A 2VT2A 1QE0A 1QR2A 3BDIA 5KJ1A 5JCZA 4J8PA 4Q7MB 3BIXA 3BSWA 4O1HA 4HT3B 4BX3A 3M6AA 4D8TA 1CF4A 5BYJA 2I2CA 4MMYB 5TJHA 4INOA 13PKA 5AM5A 4DVGA 2Q3FA 2ST1A 3PX7A 1G18A 1EFRD 4D1YA 4MRVA 3HP1A 3VBCA 2ZSDA 5IM5A 1MO2A 3H42B 4Q93A 4JDUA 4ARCA 4P86A 5K3CA 2Y76A 2VZ0A 3RU3A 4AURA 2OUIA 4HEJA 5EJIA 2Q9UA 3IQFA 4OBXA 4JI4B 4C3VA 1S0UA 4KI0A 4QOJA 1E98A 1PSDA 3EIFA 2ZWOA 3EIEA 3IUNA 4OM7A 5CW1A 4LBZA 3GCWA 4J76A 4JD5A 4OQYA 1EI9A 3RS5A 1I2AA 4II7A 4CIAA 2QRMA 4LJ8A 2REQB 2WRZA 3DP9A 2BHTA 4GKAA 1TVEA 3IULA 2AQHA 1Z26A 2BFPA 4GL2A 2C4NA 3L1HA 1PLKA 3FLAA 3VR6H 5CJ2A 3UG6A 4GLBA 4UVIA 3KVYA 2OYCA 4KITB 1E9EA 3TRHA 1FDOA 1YTLA 4CL0A 1ZH6A 4W8HA 2JI8A 3HZZA 4YY3B 4KBFA 3QW2A 2IYFA 1CFZA 1WDTA 2N1MA 2Q6TA 4RGBA 3WBJA 4DCMA 3VYVA 2Y71A 3DQZA 3NEAA 2R11A 4P4LA 2XNSA 1VHWA 1LJLA 4GRDA 1CR2A 3QNWA 1BRTA 1QGED 3MHPA 4LJ6A 4AJIA 2UUAB 1MAVA 3KG2A 2R1VA 3ADBA 3ISJA 1IZYA 1ZK1A 2OGUA 4YJDA 2CLIB 2NACA 3LVRE 5LXTF 2OYRA 4DWOA 3USCS 3BULA 3T3EA 1E79D 2OVBA 4I6EA 5EQJB 3GOHA 3RHFA 1FNSA 5CX1A 5KMGA 4DLNA 5CBPB 1OIWA 4JWTA 3KEMA 4ZZ3A 1H2AS 1UBHS 3O8NA 1YULA 3KSDO 4HXFB 4JHXA 3RG2A 3A2MA 1IDN1 1R10A 1VFPA 3WMFA 4CUZA 4EL5A 4NSNA 1WSAA 2J7PD 3B2EA 4MX8A 4R51A 4RSRA 4Z1MD 4OOEA 4Z3KA 1L4BA 3BHMA 3NGLA 4EA6A 4YRJA 1P7YA 5LYJF 4JQYA 3DOOA 3ESXA 3QLEA 4Y98A 2RBGA 1SUWA 2OXCA 4KVFA 3L7MA 1SQ6A 1YS2X 3CR7A 3PBKA 3VTAA 1I4OA 2H9IA 1E0SA 3KJNA 3Q4GA 4ZI7B 4BO6A 4PG7A 3JWEA 3ZNOA 1FOEB 3IDOA 3SIRA 3MS2A 3JQFC 1JLKA 5BSVA 4GVXA 1MOSA 2ZREA 4NAUA 3AHGA 2R68A 5JAQA 2NYUA 4MB0A 4DV7B 2BDTA 4DSTA 1EFTA 3KCNA 2HRCA 3ABIA 1SKQA 3HKEB 4WCFA 3IR5A 3VJLA 3J7AC 1PLLA 3DDHA 1C9DB 2OQRA 5H7XA 3AFMA 3ZZUA 3HKEA 5FTWA 4B32A 4BMNA 4C03A 4OHVA 1T2EA 2G9QA 4OHYA 2UVPB 4PWZA 3JQAA 4RLFA 1I3MA 3FDZA 1LPAB 4GC9A 2CVQA 4RENA 3SFVA 4YQZA 4MUXA 1IZ0A 2A57A 3U3KA 5ADWA 1ITZA 2AYXA 3G17A 5FJIA 1ZH4A 2CXOA 4YQEA 2IY7A 2CLLB 4WXEA 4EG5A 1EP1B 1W46A 3CM0A 4Y9UA 1AKTA 4M1WA 3PYMA 5CJJA 3JWIA 2ODTX 4UTPA 3JW8A 1P0QA 1DIOB 4AJKA 5HJ7A 3VNUA 3REGA 4W7IA 1PJSA 1PJ2A 5EC8A 1XVIA 4KWCA 1LX7A 2BUBA 1P9OA 1LGYA 2F3RA 3UC9A 1N1DA 3HBFA 3KE8A 2Q1YA 2I7XA 3WP0A 2CMHA 2AVDA 5EXEA 4TKVB 5LP1A 4JC8A 2FMXA 4ZAYA 2C5GA 1KS2A 4ZI5A 4LK3A 5C31A 4CF6A 3MJFA 1XCMA 3BBLA 4EG3A 1KK0A 4UEOA 1R5NA 1KIAA 4BLPA 5FFMA 3H8SA 1FXWA 3CX7A 3R3JA 4EHHA 3MWDA 1O0CA 3C5VA 5EIFA 4BEJA 4QTZA 3DOFA 4MUGA 2JIOA 2WMYA 2ZTHA 1BS1A 3I12A 5HE9A 5B1SA 3WMGA 5CLJA 4QPZA 1BU5A 2ZZNA 2EJUA 2D13A 1ETHA 2ZYGA 4FFMA 5AVTA 4GC5A 2HUPA 5ALIA 1KEEA 1QH0A 2VSNA 4QUIA 4YJ3B 2BBWA 4I55F 2AD1A 2B4YA 1GSOA 5U4XA 4Y0AA 1JDPA 5CHEA 3VFDA 2QRNA 3N0RA 3IPAA 4IMPA 5ALJA 3TUJC 4UM7A 2D7CA 4NABA 1O2DA 5IP5A 2EFCB 1KO4A 5IJ0B 1YV9A 2LVBA 1YGPA 4GD3Q 1AF4A 3EUFA 4CTKA 3IJ5A 1BWPA 3I28A 4UOZA 4EMBA 3WLJA 3USES 3AOGA 2PHZA 2IYWA 3C4JA 3D8NA 1QMGA 4A4DA 2PK3A 2MSWA 2ZRDA 4CU5A 3SJZA 3K0FB 4E21A 2CJWA 3KLPX 1HT2E 1N2BA 2L0XA 4IG4A 2L19A 1PUXA 1HETA 1ODIA 2G82A 1CS4C 3D6UA 2Q3CA 4MQFA 3R9KA 2ZVPX 1RSZA 3GGOA 5CFRA 3HMQA 3EXFB 3Q7TA 3V2UA 3R9XA 5C0OE 3FPBA 4AJPA 2VXCA 2YNMD 3G2PA 5ETJA 5I48A 5IYZF 3TGLA 4NOMA 1L7PA 4MHTA 1Y1TA 4PBTA 3ZGNA 4FYVA 1NC1A 4F3NA 5SICE 2BBOA 3QENA 2TMDA 1MXFA 2ZCVA 3HXOA 3R4CA 3I5UA 3VKHA 1R27A 1DV1A 1N5IA 1EHCA 3F5DA 1AHNA 2H07A 2ZIFA 4ZAVA 5C8ZA 1E2HA 3DHEA 1GNTA 2AC2A 2RONA 3BQNB 1U98A 2J6HA 3MGKA 4GZLA 5KNDD 1ZISA 4R41A 5GVSA 5KQSA 4KIFA 1JKXA 1CJBA 5CLLA 1TEHA 2NO5A 3HUUA 4ENQA 2QX9A 3M6WA 4CV2A 2BPOA 3VAAA 1YASA 1TQDA 4IUCS 2XQFA 1ZINA 4HPWA 4YJFB 1OYVA 4CHTA 4ZOLB 5IKOA 1CDEA 1HE8B 1FFCA 2CXSA 1AQNA 2NXWA 1G16A 4CV3A 4Y6LA 2GAOA 2VEOA 3WLOA 1LQTA 2GNOA 1I7NA 3ULKA 2RHMA 4X7PA 3WGQA 1QVVA 1Y7TA 1YB7A 1D1TA 2O52A 3M6LA 5AUQA 3UJ3X 3GHYA 4OAQA 3U7QA 3PRKE 2ODWA 4ZT3A 1LS6A 3K0BA 3L7YA 1WPQA 2REQA 1LSSA 3SM9A 2DEUA 4KG7A 1QYWA 1ENYA 4NH4A 1QU3A 5BWOA 2HRBA 1VA4A 4M0UA 3O1IC 4AJOA 1NURA 1U9IA 1JQBA 1UFRA 2NV0A 4Q9AA 5HDQA 2WIGA 1R88A 4RIFA 3GPBA 1FTSA 2RHOA 1J56A 1K3TA 1QP7A 2H4ZA 5JC8A 1Q20A 1TM7E 1WOYA 1B8NA 2G0AA 3PQ5A 3QPDA 5J2UB 3K1JA 4CM9D 4W1RA 4UE2A 1Z7EA 5K0EA 1IWOA 1W59A 3LV8A 1ZD1A 5JWOA 3RYFB 4GECA 5K3BA 2BKVA 3QU9A 2DSTA 1XRJA 3ME5A 1RZ3A 2W93A 3LY9A 4GE0A 3S29A 3N05A 4D6XA 3TF5A 4A5OA 3I8XA 1CUJA 1T8UA 4RPGA 4TLCA 3FSEA 3FNFA 4N6GA 4EF5A 2CXUA 4YC7A 1KBZA 2DWPA 1NXXA 3GCGA 4HDSA 3C87A 3VZBA 1P1CA 1D2AA 1EK1A 2R751 2XMZA 4BTLA 2VJDA 4FX5A 2F1KA 3DKIA 2BMWA 4IF6A 1LLCA 4AICA 4FB5A 4HTFB 4BNNA 2BFNA 2BMVA 2PGJA 5BV1A 4K0KB 1TQ2A 2JDIA 4CG0A 3JWJA 3MT8A 4TV8F 3M5DA 5L3ZA 4E6PA 2PBRA 2QPTA 2UYGA 5IHPA 2JFQA 2MMCA 3QLUC 2ZSIA 3CFYA 3FOBA 4G56A 4WY2A 3UCFA 2WG2A 2HQ1A 1SQFA 2XMQA 1SVOA 1ML4A 1HNNA 3KPJA 5JQGF 1YXMA 1PQUA 2O05A 1CEEA 3TLGA 1P2VA 1A4XA 1U7OA 3STHA 2IDJA 5EJGA 4L3VA 1G8YA 2JANA 1A7KA 1A71A 2DJ5A 1Y34E 2K87A 3FOAA 3GLUA 3OH8A 1GDDA 1OAOA 4R5HA 1AF7A 1KQOA 2JIDA 3FFWA 2FFRA 3TEMA 3UO8B 1C9MA 2WTMA 2XHEA 2Q1UA 5ALKA 5AXAA 2BDEA 3VR6D 3WMEA 4AAYA 3D2AA 1KPHA 3UENA 5EMMA 3HB0A 2G70A 3EXEA 3LTEA 4FOTA 4NYJQ 1YZ3A 1ILEA 2NV6A 2RB5A 4MGEA 3WZ2A 3UB3A 4E1BA 4RQAA 5IYZB 2H17A 1E2LA 3H5LA 3IUYA 5AOAA 3T1OA 4HPJB 4KW7A 4E2ZA 4NMWA 1NE2A 5K0BA 5HXAA 4JKYA 2Z6QA 3IBSA 4ETWA 4P81A 3K4PA 1DKUA 2ZTSA 5CURA 1QVAA 3WTCA 2I6TA 3O8OB 1RACA 4WL0A 4TMXA 5BWCA 2V98A 3BWBA 4UMVA 1SZDA 1JIUA 1QPGA 1J7JA 3FG9A 1ZUIA 3IQEA 4RVGA 1VPWA 4AJ9A 4O6VA 3WGKA 3ORYA 4WXHA 4CL3A 1IAQA 1K5HA 1KZYC 1S2MA 3BXXA 3O21A 4IVRA 4TYWA 4IL5A 1W88A 5BW6B 3WLRA 2X9GA 4WD3A 4Y1RA 5FTJA 5KKCA 4ZU3A 3GW8A 2P11A 3IMFA 1DV2A 2IEIA 2C97A 3E2MA 3OPYB 5CGZA 3SSMA 4E4RA 3IUJA 3VV3A 1PT6A 3LHIA 2QVLA 3STUA 4G5XA 3N9IA 5ENVA 2UAGA 4QXQA 1MX9A 2ZDGA 1MO5A 3TTYA 4FFDA 5DX0A 3BDVA 4LBYA 1MHPA 2VP0A 4KQ1A 5EJ8A 4DM7A 4RKFA 5KZMB 4RY8A 1MKYA 2LR0A 4GXNA 4B43A 3KR9A 3BILA 4C7JA 3RYIB 4DJ5X 2RC5A 4LDPA 2GESA 2CFRA 2PJUA 1KKLA 1JT9A 4Q05A 5LUAA 3SEFA 1NVBA 4CV1A 5FTMA 3I9V1 1I3CA 3DMTC 2VWGA 3L4JA 2ZJ1A 4CCAA 3IDFA 1CPYA 3GP3A 1NT4A 3P4UA 4IH9A 3SF8B 4Q24A 3IVAA 5E7MA 2GJ4A 3VSDA 5B3LA 2PBLA 1YNOA 3ESYA 4W99A 2JLXA 1GQSA 1OLOA 3FHOA 2O0MA 3LO5A 4YT4A 1L4UA 1NUPA 3ZHUA 3OFJA 4Q66C 1S2IA 2O4CA 1TLFA 2QW8A 3MWGA 4FS8A 4CLDA 4KN8A 3JQBA 2BZSA 5IT9A 1P1RA 4N8SA 2F8SA 4MS4A 5DWDA 1SCUB 2QYSA 2Z08A 1L4HA 2GBPA 4X8MA 3VKUA 3HCRA 3F5MA 1V1MB 2E85A 2YCBA 4LRQA 1HEIA 2A3NA 3KOWA 3CWQA 5HSGA 5LQJA 4MMXB 2WKSA 1P45A 1XP5A 2NUPA 3OCZA 1GPNA 2WT4A 1T5TA 1WCIA 4G2TA 3THXA 1P4SA 5A4MS 2L42A 1MGOA 4F1WA 2GZHA 3GFSA 4Q9NA 3D7KA 1GAWA 3GPDG 3A14A 4CR7A 1RLOA 3K70D 2R84A 3ADDA 4HUQB 2G83A 3EGEA 3ON5A 5DCUA 5TC4A 3GEHA 3QY0A 3OU6A 5C37A 4L7QA 5EHXA 5JIBA 2OXFA 1H0KA 4I66A 3DYBA 2QW0X 2R65A 4OQZA 2WZCA 1GTZA 5THKA 3O8LA 2AN4A 1XVVA 4GH5A 4JN6B 4OH7A 1UMDB 3PQDA 4NK4A 5AJTA 3F73A 4RSHA 4KGDA 2AD5A 3KEOA 2P90A 4LZWA 4UATA 1E7WA 3V80A 4BKMA 5BSEA 1ZHHA 1ZR4A 3EGXB 2R6AA 1UFOA 4KAAA 4OKNA 1JAXA 1FP4A 1Y6RA 4D9NA 4UNRA 4QGFA 2GLTA 3O4RA 4L5AA 2IOYA 1F8XA 2P3SA 3ECSA 1M8JA 4L8FA 4EUKA 4X8OA 1I0IA 5KKNB 1IIRA 4OK6A 4KXXA 2IYOA 2IVZA 4ND6A 1DKOA 4OB8A 4S12A 2Z1DA 4Q7LA 1PG5A 3K8ZA 4RPJA 2YXEA 3FPFA 3UHOA 3I09A 4K6MA 2ZI5A 3T7DA 1PV2A 3O0TA 4GGPA 1G41A 4TL7A 1I1HA 2C84A 4YACA 4QU0A 5KEIA 5E1OA 3KZXA 1F6WA 4BBPA 4LCEA 2G9NA 4M86A 3ICEA 3S1LA 3PUXA 4BUCA 3ZW9A 4Q03A 2XQKA 1H05A 4NBTA 1NQOA 2FH5B 3A9RA 1EUYA 1ZH2A 3L8CA 3CQ9A 2Q5CA 1T43A 2ZSJA 4OG2A 4N9QA 1I9GA 1H1DA 1P1HA 2QG9A 5D86A 3MLAA 3Q9UA 1I8TA 3SJUA 1P5FA 5ELXA 4B71A 1OR8A 2I76A 3JALA 3KT0A 4YWHA 4DMKA 3COJA 4DMRA 2FYTA 2D2IA 1YJAA 2O50A 2R00A 2HMUA 2C7BA 4OUDB 4ZIRA 4HN2A 2LCFA 2XMCA 2WB4A 3EEOA 3EMDA 2OHHA 3T7CA 4AJ1A 3U13A 2AG0A 3T99A 3N39C 5EIAA 3SVTA 2QR2A 1VKZA 1KEVA 4PONA 4XWWA 1GT6A 3QX8A 2XXBA 4LZNA 1GPLA 1LSOA 4HEQA 2QY9A 5ALQA 5GV8A 1ZNYA 4QJ3A 1E0DA 3DZKA 3Q7SA 1L4EA 1FLNA 4PGGA 1BX1A 2BCJQ 4JJZA 3QE0A 1WDLA 2V45A 3GA7A 3ZWYA 4PYRA 4ZEMA 2IZ5A 4QODA 2B61A 5KC8A 1HNWB 4FZJA 4R1SA 4A8PA 2XYHA 2AZDA 1DL5A 3JQQA 1YQQA 4P3YA 2GZ2A 2GJ9A 3FDFA 3PGKA 5K2MA 1ZICA 2QPLA 5LZ5A 2QS9A 4B47A 2ZIXB 3A06A 4MVJH 2W58A 2WJVA 4O2AB 1N25A 1KHTA 4DF3A 6ABPA 4P38A 1UOPA 1E9AA 4QJIA 4BWFB 2X4LA 3HFJA 3OTHA 4HAWA 3DOCA 3D6MA 1QG4A 1P8JA 3AU8A 1HMYA 1UWVA 4M87A 3K9NA 2PZLA 4HAVA 5F5XA 1YQTA 4ZRMA 4LE0A 5ALVA 4LY3A 5JJBA 1CJKC 2QG6A 4Y2XA 1ZI8A 3D2CA 3KKNA 2XWBF 4N6NA 2HYDA 4NPHA 4RO0A 5A5DA 4BY9E 1DQRA 4TXHA 4RGQA 1IB0A 1NJ5A 1EH5A 1RQLA 2GK4A 4TLBA 3RFTA 3U5TA 3UB2A 1KJ9A 5CDYA 2VJMB 3QF4A 2RCYA 5A71A 1R9JA 1PUJA 5A6SB 4J1NA 2PRJA 1KEPA 1U02A 3AOEC 2FQWA 2V5AA 2WIKA 3LRXA 4JR1A 1QLHA 5A6VA 4COKA 3G2QA 2HMWA 3EXHC 3NBFA 1S7GA 4R2HA 2UZ0A 3PHJA 3UMRA 4DM3A 5ABPA 4G5SA 5DGIA 2LNDA 2ZYRA 3QUBA 3KL2A 5D01A 1SCJA 3BWMA 5B3AA 3F6CA 3DBHB 4MV3A 1QHFA 4A8TA 4F9TA 5B6PA 5KDLA 1H0HA 1BXKA 3PPIA 4O5OA 2JDID 1U2RA 1M75A 1MHTA 2JHGA 3A3YA 1TCBA 3FROA 4YMTA 4XVHA 5K0TA 3X2SA 5K3FA 3ZWWA 3IEVA 3HPRA 3WLFA 1CDZA 1WSDA 3WWYA 3DEFA 5HDBB 4LHZA 3WA7A 1TYBE 4ND3A 1GVNB 4B7UA 2NIPA 2NO7A 3QWFA 5MHTA 3HJCA 4NCIA 2YYYA 4ARUA 1X7YB 1MB4A 2ZITA 5TJ9A 1XMJA 3ZYZA 2J0QA 1G9TA 3VR5A 2CBXA 4FR5A 2Y0DA 5ALNA 3TNDA 1F20A 3KAJA 1C29B 3M3HA 1UPTA 1MAUA 4H4EA 4HZUA 2OQIA 3B8HA 3FLBA 4FZ5A 2ZE8A 4YGYA 3SJ7A 3U4QB 4OXYA 3QE3A 1OB5A 3S2UA 1M1NA 1BHJA 2Z8ZA 3N86A 1QYXA 1U7TA 4LOKA 1YZUA 1ZBQA 3RRZA 3RU7A 3TG2A 2E3JA 1R8JA 3CW2A 3DM5A 3HNPA 3LDGA 4R1LA 1SUFA 4WOCA 3A3NA 5HBGA 2MOKA 3G2JA 3HSSA 1NQXA 5IABA 1CUHA 4HV4A 2B7BA 4HQFA 2GFHA 2PWBA 4KIJA 4Y30A 3RREA 3X2FA 3ADCA 4Q6BA 2AJBA 3PPWA 3S2EA 3N1UA 2QTAA 3AVTA 3A7EA 5H3CA 4XUEA 1HQYE 1H2FA 1VE9A 3G9ZA 4RZ2A 5AR1A 2P30A 1C9YA 3QK7A 1U9YA 5B5SA 3ZKAA 4JNCA 4MKXA 3ASYA 3FDIA 4BC1A 5BNWA 4N48A 5EFZA 2OA0A 1L4GA 2C98A 1QP0A 1G7RA 1W5SA 5LC1A 2QDKA 1SHTX 5JROA 2ZUUA 5C7LO 3CUTA 1V4NA 2GXAA 3PC8A 4OLAA 1U63A 3NHUA 1RW4A 3AUYA 5F5LA 2X2FA 5D5HA 4UUBA 3D8UA 3I37X 3RV3A 4CEJA 1O87A 1VDZA 4IXTA 2I80A 2NZ8A 2HIAA 4BX0A 3A11A 3CUUA 1G2PA 4X91A 2V65A 3G0GA 3H5IA 3WIBA 2F6RA 2XXAB 2AW5A 1BD3A 3HYLA 4RZUA 1ODLA 4BAGA 4D26A 3U56A 3MCTA 5DT2A 2IS2A 2VPXA 4OQDA 4WA8A 2EEPA 3ZWCA 5AI8A 4D4KA 3FCAA 3G13A 4L3OA 1F4VA 3B7WA 2A2ZA 1DKPA 1FCJA 1WMEA 3NFYA 1SCDA 5EP4A 2P75A 3OHMA 2OQ2A 3WK4A 5BSHA 4OU5A 3L8ZA 1JJBA 4QZVA 1GDHA 5AJWA 1JMVA 4UU0A 4YK7A 5HWSA 4LHEA 3EGOA 5HJEA 4EGCB 2P7HA 1KMCA 3VYRB 1WY5A 2RIRA 1NVMB 1JDBB 4O4LF 3QH4A 2FN4A 1BFDA 1G7TA 1Q15A 2J31A 3R09A 4AK9A 4DBLE 5DBGA 1H2ZA 2O3SA 2V03A 4U02A 5EKTA 3THYA 4N3BA 3PV0A 2BCEA 4FMDB 4A2QA 4D3XA 1DELA 3ZGOA 2Z58A 4LZLA 1JG6A 3RJ5A 4LV8B 2H2DA 4R71A 5BSWA 1A9SA 1XZKA 5KX5F 1A76A 1OZFA 3TSCA 1N7GA 2VF2A 3KDPA 1O95A 3CNOA 2GKSA 1FYVA 4BMYA 1OZAA 4YJGB 1RI1A 1QIGA 4KCGA 3Q2KA 3MT7A 1S1CA 4LE1A 1DUSA 4LX0A 3OEWA 2ZR0A 4TXNA 3FCUB 5CVUA 5E9WA 3RFVA 2YASA 3WKBA 5H9VA 3SR3A 3O94A 4CM5A 5CB4B 4J16C 1PFYA 1Y9AA 5TSDA 3Q0IA 1OSNA 2JLSA 1L1QA 1ACJA 3S8EA 2BD0A 2X2EA 4RDCA 2P41A 1Z3CA 5EPUA 3U80A 1E3WB 4K9PA 4KWHA 5K51A 3P9CA 5ERYA 4V0LA 1GUZA 4X3OA 5DYYA 1BMFD 1VSBA 2ODPA 3C48A 4QYIB 1G8KA 3C6XA 2CLHB 4P0QB 3H2JA 3LKDA 3ZS8A 3EQ7A 2C5AA 5LP6F 3AM5A 3A25A 2XGOA 3JYPA 2NTNA 3B9QA 1L5LA 3PIRA 2VUIB 1IQRA 1RRVA 4DWVA 3DH0A 1CQJA 2VJPA 1Y9ZA 3EOAI 2IOQA 2OP0A 2XAAA 5FAXA 2JLZA 1Z6YA 3HP7A 3Q8XB 4FD3A 5DLYA 3T7SA 2N9UA 4LJAA 4HWKA 1JH9A 1BQ4A 1W93A 3K0AB 5F12A 2CF5A 2PO5A 3E5NA 2XGMA 2HUNA 4YR7A 3TVTA 5KOYA 2YV4A 3WL4A 2HV8A 4XDGA 2JI4A 5F23A 1VMEA 4CTMA 1HZZA 2WYOA 3AI2A 3WWEA 1ONPA 4F11A 1A0OA 2VAPA 5J58A 2WYIA 2E49A 2E4WA 1Z18A 2JLRA 1X7ZA 4QPCA 4AMBA 5MGBA 1BMFA 1C1XB 1DS6A 1IBMB 3PQ7A 3E35A 3MMZA 3OMWA 4MWCA 2LV8A 1XZJA 5J4HA 3SS8A 3PSAA 4G5QA 2H5EA 4K9RA 1MG5A 2Z2ZA 1DB3A 3G3EA 3NC1C 4M0KA 5DM0A 3WK7A 5HUQA 2IXAA 3AQIA 4Q02A 2JGDB 2ZUWA 4BB9A 4G0XA 4H6WA 1G8PA 4KR0A 1RWNA 1N78A 1Z0DA 1K5GA 2RARA 4EW2A 3E22B 2VO1A 1G0OA 2F1OA 1FDVA 2VP5A 8GPBA 3TDNA 4RADA 2CLSA 3HBAA 3UWPA 1R9NA 4YAIA 1LLUA 3G9UA 1HI9A 3LXXA 4WTOA 1HL7A 1NKSA 4L8YA 4CN8A 1XI2A 4PX2A 2FN7A 4X54A 5DJ5A 1R3UA 2ZRPA 4X1KB 1IG3A 3UT5A 2Y0BA 1ZK0A 2ZYAA 4HAIA 2W48A 5JATA 3QQPA 3I04A 4LC9A 1VBMA 3D5TA 3TQIA 4Z9XA 1P0FA 3AO0B 3CNBA 4ZRDA 4C6TA 1QWOA 2Q4TA 3PNLA 4XD7A 5HZHA 2GAJA 4OFXA 1OWNA 2ADOA 4OPMA 1FTNA 3DEAA 2R87A 4IGIA 5HK8A 2GTPA 4A8JA 2QJOA 2COEA 2GBLA 1PF7E 2ZRLA 1QO0A 1O58A 1SKAA 3AUSA 3PD7A 4ZOEA 2NNLD 5DWVA 4Z7JA 5KHOC 1OLSB 4HYYA 1BFKA 3F3YA 2JLAA 2VCYA 1MOZA 5A2QA 4O8ZA 4ZEXA 2BIFA 1LRKA 1ZOOA 2CFCA 4R7ZA 5ARBA 1P7VA 4YJ3A 1KO1A 1VLQA 4ZDKA 3OT5A 2P0AA 1XFAA 1TC2A 5GP1A 1T8PA 2NUBA 3GGCA 3W2IA 2I87A 2R6R1 3A9UA 3Q7RA 1PD0A 2EKDA 5LA6A 1L7OA 1E0KA 4LF5B 5IT0A 1CY1A 4JLSA 3MWDB 3WLLA 3PR1A 4RF4A 1CUVA 3NDJA 1BKSB 1BWQA 1ACMA 1N3IA 4IFTA 1ORRA 4IZIA 2QZ9A 3K0AA 4KRGA 1N9GA 1Q1QA 1Y6FA 1ZVQA 4JI6B 4DUPA 1BXZA 2MR6A 3KZMA 2QMOA 1R0ZA 4BU1A 1T6XA 3IA2A 4XA8A 3O03A 1JEQA 1RPAA 2JFOA 5EZYA 3ZKWB 3P0IA 4D57A 4KVZA 5BQ3A 4Z49A 1EJ6A 2QN6A 4BFSA 1CY4A 1Q95A 3L7AA 5HF6A 3T3HA 2JFYA 4JK3A 4P7KA 4UNNA 2CF6A 4AS3A 4HXYA 1NNEA 3QELB 2FUCA 1GZ3A 3PWSA 2ZAIA 2GD6A 1QHYA 2ZWIA 2BAGA 3IALA 4H6VA 3VYWA 2FN8A 3ND5A 4URHA 1RJDA 4IV8A 3W8EA 3TLAA 1KMHA 2JA2A 3EQ6A 1EUDB 1SBTA 4GUDA 3LQ1A 4J07A 4TQ9A 3X1XA 4A0FA 1Z4NA 3B7GA 2VA8A 4UUOA 3E9MA 4IEFB 2N0SA 5HUHA 2G71A 4FNAA 2R1TA 5FR2A 2WSMA 5ERXA 3REQB 1IOZA 4LYJA 2C2HA 3COZA 4ZVMA 3UUEA 4DA7A 2PZGA 2AKYA 5EEGA 1C3JA 1CJTC 1U28A 4BMPB 2BUCA 3KOOA 3IAS1 4B46A 3WISA 1IBLB 1ISMA 2VSOA 4X6UA 3RSLA 5BUCA 2PL5A 4CM4A 5T8KC 5I8WA 1TE2A 3RC2A 2XXJA 4L4YA 3PDJA 4RD0A 1L7MA 2VNAA 4C30A 2XSZA 2F55A 3KPYA 3KKOA 1JHVA 1G5FA 4MQUA 1WA5A 2WLSA 4KN5A 3TNYA 2I78A 4XYBA 2BTEA 3K16A 1H6AA 2V7VA 1H9AA 4Y1EA 2ZBFA 1ZN7A 1B23P 4QGGA 1GRNA 4MINA 1H8HD 2CDNA 1V1JA 5TR9A 4Z7OB 5KC9A 1YR2A 4EKYA 1TAUA 3VNBA 4RHUA 4F3RA 1IMOA 3E8MA 4ENSA 4C6TB 3NHWA 3D43A 3ZXSA 3MSXA 1ISPA 3ZJ4A 4NYIQ 4YVFA 4M0FA 4LVCA 2DPYA 1PW7A 2YWHA 2AG1A 2OV3A 4X90A 5CB4F 3ADKA 3F98A 1O97D 3ZN2A 4A03A 4BIIA 2GEVA 4MVWA 4L0CA 1O94C 4C87A 4EPTA 2P4EA 2FMKA 3ZDYB 1RM3A 5KOIA 1NDHA 2YXLA 3GLQA 4I2NA 1UMBA 1XPRA 4I3HA 2AZMA 1MQ8B 4XTCS 1U7ZA 3NPMA 1OKKD 1BRMA 1NJSA 1NUHA 4NJEA 2Y68A 3C15C 4RHYA 2XUIA 3QXGA 2AJCA 5F2EA 5JSFA 3EEIA 2FX5A 3FIUA 4O4HB 1EDBA 4JR0A 3H1EA 4D0RA 1X7ZB 2I3ZA 2PVSA 1E2UA 4NZZA 4XR9A 3RODA 5DNDA 4EG1A 3ZD7A 2QF7A 3H5RA 1KDVA 2FFQA 3EB9A 2Q0SA 3B3FA 1UUFA 1W8IA 1WR8A 4CLRA 1F2UA 2IIQA 7ADHA 2KPOA 4M1MA 2R8XA 4C5CA 1YJCA 1N8NA 4R05A 1PNVA 2Q6LA 1DPGA 3L46A 3AZQA 3H8JA 1YK0A 1B6GA 1KAEA 3GD5A 1ZNQO 2QRQA 5EKXA 1Y5MA 1L5OA 2F7SA 3CF6R 3GWGA 3HGQA 5FI1B 3I9FA 1QOPB 2YS6A 1GL6A 2XA1A 3AFOA 2XYRA 2OBFA 2O8VA 1VP9A 5KTKA 2B4TO 3QMWA 3TW4A 4DUYB 1J00A 1QPBA 2GJ8A 1GLGA 1Z25A 2Q5IA 1J5PA 4HZUB 3SNHA 3FTCA 4QOFA 5CG1A 4ZKEA 1G4AE 2GD0A 4BCCA 1ZIOA 4R2KA 1NMSA 2FW1A 1BWRA 4ZVSA 2R5WA 2PX2A 1QQTA 2B8NA 2J5XA 4L72A 4BO8A 1LDBA 3KRTA 5LU9A 3E22A 4MPTA 2C83A 5EQFA 1T3ZA 4MOWA 3SN6A 1B3BA 1NP3A 1CIPA 2C3PA 3I4LA 4FOLA 1N2CE 1QAOA 4TS4A 5FWAA 3VJKA 4Q7QA 5JSUA 2ZJ3A 3CLKA 3DS8A 5E2BA 3OKCA 4AQDA 4QC2A 4YV2A 3O8QB 2VQFB 2WUDA 4BMVA 4L9AA 3GVPA 1GNQA 1RRGA 2PL9A 2CW5A 5KNDA 3WXBA 3X3HA 1ZS9A 1CUIA 1Z7GA 2HL6A 3TMAA 5JO0A 4DCGA 2WP8J 1U0HC 3OI7A 1E9BA 3A27A 3NHLA 1XTIA 1Z12A 3CNQS 5FD8A 4DCNA 4KYVA 1EQUA 7REQA 5DM1A 2CVFA 2JFUA 3H99A 2GM3A 2OORA 1J06A 3L6DA 1RJWA 3GHHA 2COUA 4WIAA 1IBKB 1KPGA 1R16A 1RJ9A 3OTIA 4NMLA 4RHTA 3E48A 4OSEA 3BC1A 4HFRA 3JQDA 1QK3A 4MUAA 3ZK7A 5KBYA 4H7PA 3AUTA 2BM1A 4Y6GB 3UJHA 3PKZA 3QFSA 1XZFA 3UQZA 3DTVA 4D0LB 1A8SA 1T91A 5A02A 1YU9A 4YJFA 2CLDX 4ZEOA 4DG8A 2BLLA 1CB7A 4ZDJA 5DHFA 5E3HA 4LRWA 2AYYA 3IBFA 4XUGB 1U7XA 3RCBA 4ZCTA 4ZQFA 3BX1A 3SCZA 2FQQA 4A6PA 5LLTA 5C1IA 2HA4A 4QTXA 4RJJA 3TZLA 3L02A 4QUJA 1P4HA 4YMUA 1S7CA 1WY7A 1A96A 3ODPA 4XQEA 4B3RB 1JHOA 3DKRA 5KB3A 2ATEA 1Z6XA 2XWQA 3B3QA 3TE6A 1S2LA 3F2IA 2DQSA 4PX5A 5IDVA 3J81k 4DR2B 4WGGA 4KXQA 5MDHA 5I3ZA 2N3ZA 5C3UA 5A9TA 3WNQA 1EK0A 1TGVA 4Q3OA 3WLTA 4I8XA 1YA6A 2ZYHA 4KQHA 3SZUA 1A82A 4K6FA 3UQYS 2X8WA 2ZRKA 3RC3A 3Q3JB 2OXEA 3ZE0B 4DMMA 2PUTA 1GG5A 3MUNA 3OF3A 5DGTA 2FE1A 4PCLA 1L7NA 1S8NA 4RSGA 3FIJA 3MWKA 2HIHA 4FJ2A 4KI7A 4D9BA 5CA0B 2R4TA 2XMGA 4YJHA 1X7WB 3KTDA 2ZT5A 3WBBA 4NOKA 4U2BA 4UW9A 1TF5A 2GN2A 4GPZA 5FPHA 3KJXA 1TQ4A 2BOVA 1NLFA 3NBYC 2FW0A 5AM1A 1EB8A 2Y1KA 4PPYA 3MT0A 1QC5B 3FUWA 5JNRA 3A6EA 2NXCA 2Y1EA 4XFDA 2ORWA 1R50A 3C8UA 5C1OA 3JQ9A 5AVUA 1RAEA 1E5LA 3OKPA 4HWSA 4HTFA 4L8VA 5HTOA 4D9GA 1G3MA 3PFCA 2NU8A 4RTLA 3DNMA 2GEKA 2PJDA 3NJRA 4NECA 1JGTA 2PGAA 4INAA 1N2ZA 1MFZA 3FHCB 1XU4A 3FBTA 2DY1A 4URYR 3ZZMA 3PUWA 2AWNA 3RIGA 2RJNA 1E2PA 2GLUA 1PNRA 1GEEA 2CK3A 4OBWA 5HJ5A 1JS1X 1PGPA 2OO7A 1UC4B 4Y2PA 5D51S 5JXGA 2C7OA 4B3DA 5E9AA 1WHSA 3M70A 3I3SR 4MHSA 3NXKA 4PFKA 1VBKA 3RKUA 5CVTA 1TRHA 2HFKA 4B2YA 2FOIA 3NP9A 5FHQA 4PNEA 2GGSA 2VXOA 1SBIA 1GTSA 1RNLA 5CXXA 2PD4A 3VRHA 1JEQB 3ZKWA 1T9CA 3KT3A 1K6XA 3DZJA 2INGX 4L2IA 2OCIA 3CX4A 1MW8X 3QVLA 1N9ZA 3GFOA 5F21A 5FEMA 5G1PA 4U2EA 2IY8A 1Z5GA 3WSWA 2R47A 1QYRA 2H06A 2W6ID 2YNMA 4XIGS 4I3GA 5KSPA 4B8YA 2Z30A 4G25A 4XZ3A 4CLRB 5K7SA 1HYGA 2G5TA 2XVAA 4EY8A 1GGKA 3HGMA 1K8YB 2JW5A 3LYHA 3F96A 5LDDC 2GPTA 1JI3A 2CK3D 1P77A 1K68A 3AERB 4X0EA 1IVYA 1XJ0A 4QXMA 4V0MA 1W5FA 1YH3A 1JPUA 5JANA 1M6HA 1SXPA 2O2JA 4N5DA 1JT2A 1YAJA 2ZRCA 4NBWA 1XQXA 3LP5A 4V39A 1C3OB 1I3OA 1VL0A 2HHAA 3LP8A 4MB2A 3H6KA 1SIBE 3SK0A 1GFSA 1O5TA 2PS9A 5B4VA 4KR6A 5HHTA 3OCWA 4DXHA 1KH1A 4DV3B 1LWNA 5CVEA 2HREA 2DVMA 5F7JA 5HS4A 1U3VA 1NU8A 3EQZA 4Y2UA 4BFYA 1GRRA 2HZBA 2J6CA 2O8BB 4B87A 1SURA 1C0EA 3O84A 1CDDA 1F8FA 3BH0A 3RT9A 2QTBA 5GJVC 1N77A 2PDAA 4L8WB 1VL6A 4PRKA 3RARA 1YBVA 3VU1A 3CRZA 1X80A 2I34A 4KUHA 4LJLA 2XZPA 5CRIA 3LLMA 3KQKA 1FC0A 1EGHA 1II8B 3V4OA 3MCUA 4ZV4A 4R7GA 3TBFA 2C57A 3ISVA 3QY9A 4PPFA 1JFVA 1PQPA 5JFGA 3HSYA 4CEIA 2BGMA 1D9ZA 2B83A 3MMPA 1M73E 2PPVA 2O54A 1Z0UA 3AR2A 4EDFA 1MLDA 1COZA 2G8NA 4PQYA 2CWDA 3ZK8A 4C3OB 3GGJA 2FLVA 4BDTA 1YB6A 1I14A 2HTFA 5JYEA 4DPLA 3OURA 4URVR 5IAAA 2A1UA 5HEKA 4CT0A 1I3NA 4W5NA 3OM8A 3NIWA 3EXIB 3RIMA 3CS3A 2MMGA 1M1YB 1CQIA 3J7TA 1EVZA 2AYZA 4RJ2A 2VPYA 4QDOA 2IXTA 5JD5A 1T5IA 3AHFA 4I1PA 1W4RA 2QMUA 2Y1DA 1U2SA 2VJLA 3ZE9A 4OJNA 4DGSA 5I4KA 3EZ2A 5CIQA 2Z8XA 5KAMA 4OMUA 2BEJA 3OIYA 2CL5A 2VOEA 3HXKA 2BSQA 2FG5A 2E2WA 2ORYA 1QVWA 4QEZA 3LPAA 4FMCB 1EG2A 3AEQA 3ZIAD 4F38A 3H2ZA 1AK2A 3CZQA 1M2VA 2YYAA 3L06A 3R0JA 1Z2NX 3BJIC 4J0JA 3DO8A 2QUJA 1NJ6A 2DUWA 3E84A 3A04A 3T06B 1XJWA 1XZAA 4N8EA 4AJNA 4EYOA 2BMFA 1EMDA 3ZVKA 1B8OA 1PT8A 3Q2IA 4RIEA 3G0CA 1G21A 1Y63A 4MS3B 3I76A 4AW9A 4KX5A 1GPJA 1EFCA 3WQQA 4A27A 4DUGD 4YV7A 3IODA 4J6EA 4MJXA 1FUEA 5E4FA 1XPOA 1WQ3A 1YJXA 2WAXA 5DISB 1JNYA 1UFKA 4XDYA 3PQ3A 3MJEA 4MXDA 4RZIA 3ZTYA 5EJ4A 2RGNA 1UC5B 1DBVO 1MO4A 4YJGA 1F0KA 1NQ5A 2R1TB 2AH5A 2I54A 4BJHB 1XTRA 2ONYA 2WE8A 3LT2A 4HATA 4P5DA 2GCIA 4MVJP 1EFVB 4D44A 1EXNA 2IEGA 4B4UA 5AVXA 3SC4A 4ER3A 1Z39A 2D0DA 4QDJA 4RUKA 3PPXA 3OVMA 4G0QA 4HLNA 5AJVB 4ZIRB 2ODNA 4KMSA 3KR2A 1C9JA 3P9YA 4UM8B 1MBZA 4ERXA 1PWYE 4DLYA 4FSDA 4KTVE 3PLNA 1ECFA 4FCCA 4MCJA 3ANNA 4RV4A 3V4PB 1Y8QB 2NW6A 3I5MA 1IZZA 1M2FA 4EIWA 1Q83A 4BEBA 4DIMA 4UCXA 1BZYA 4HQ0A 4DUGA 1XYVA 2ZBVA 4TUYB 2I6GA 1VIYA 3LFUA 2OK8A 5FUBA 4UHKA 3D6NB 3DZBA 3E7DA 2XLCA 3ZWBA 1I1NA 3SZOA 2TMKA 1HBJA 1E3EA 4KAJA 1SOUA 5B4UA 3IOEA 3AR9A 3K0FA 4MW1A 3I72A 3BEDA 1EP9A 4AUNA 4ILEA 3EF1A 4A26A 2JKYA