4ZCSA

Crystal structure of the c-terminal catalytic domain of plasmodium falciparum ctp:phosphocholine cytidylyltransferase in complex with cdp-choline
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
141
structure length
141
Chain Sequence
b'KNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Choline-phosphate cytidylyltransferase
publication title Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Transferase
total genus 43
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4zcsA00
3C8ZA 3ZXSA 3MLBA 2QUIA 3IVGA 3ZGZA 2Z3VA 4MQ6A 2X3FA 4NX2A 4ZCTA 3E27A 4Q16A 1M8PA 1O5TA 2D5BA 2YY5A 2QTMA 1GLNA 5KHAA 3ND7A 1OBHA 1GPMA 1NI5A 2E0IA 1T6XA 3SP1A 1RQGA 1T6ZA 3MXTA 1J1UA 5DK4A 3SEQA 2A1TS 1ULHA 1I6MA 1R6TA 2NSYA 3TZLA 1X6VA 3IVCA 3U1VA 1R6UA 1MC1A 2E18A 5H16A 4EG4A 5IHXA 1KQPA 3RBAA 1WXEA 3ZIUA 4MLPA 1QU3A 2BYTA 4PBSA 3PNBA 2A88A 1MB9A 3N8HA 1TYDE 1PG0A 1VBNA 4MUNA 1F7VA 3F3MA 4PBRA 1NYLA 3INNA 3DO8A 1PFUA 3A2KA 1EUYA 1G8GA 2VTBA 3G59A 3LCJA 1OWPA 1YUNA 1XNGA 5BNZA 4ZT7A 2IJGX 4DDKA 3CLRC 1EFVB 3IDFA 5AHWA 1NZJA 4A91A 3ZJUA 3AKZA 1JZSA 4KR7A 2A84A 2PZ8A 4MWBA 3CLSC 4EG8A 4ZT2A 4ARCA 3IMEA 2QUJA 3CLUC 1QQTA 3TNJA 1M8KA 3HV0A 4OUDB 1DNPA 1PFYA 4MUGA 4I6GA 2J5BA 1VBMA 3PRHA 2WB2A 1JGTA 3GMIA 3Q10A 3UY4A 1ZUNA 2H2AA 3CLSD 1F9AA 3N9IA 4ND6A 3SDBA 1U3DA 1ZH6A 1O97C 3LOQA 2PIDA 4ZT5A 3IOBA 1MB2A 3N2YA 4MW9A 4NAUA 4PY2A 3ZUGA 1H3FA 3COVA 1KH3A 3M5WA 2JAXA 1G8FA 1ZH0A 2QJFA 1JEEA 2E89A 2A1UB 3UOWA 4DE5A 3JXEA 3QE4A 2J08A 5LM3A 1XNHA 3FDXA 2OQ2A 4MW4A 2AG6A 4FZJA 4JYZA 2CV2A 1EJ2A 4KPUB 1I6KA 1IQRA 2G36A 1H3NA 3UMVA 3QTBA 3IOEA 5K0TA 1COZA 4H3SA 1IQ0A 2GKSA 4RUKA 3TZEA 2ZUFA 3NV7A 1MOPA 4DDHA 3IODA 1EFPA 1TYCA 1NUPA 1I2DA 3PNVA 5FO0A 3BL5A 3G5AA 1GN8A 3KT3A 3COZA 3GUZA 4MWDA 1F4LA 4EGAA 1WXGA 1MRZA 1ILEA 3FETA 3SZ3A 2X0KA 5FO1A 4DDMA 2CT8A 4UZFA 2X1LA 1JECA 4MUFA 1XJQA 3FI0A 1QRUA 3UC5A 1D2RA 4KR6A 2Z09A 2B7LA 1MAWA 4KKVA 5HUJA 5FNZA 1U3CA 1O96B 4KR9A 1WXHA 4EG7A 1M8GA 3A05A 2DLCX 3TQOA 1JHDA 1QRTA 4J76A 3HZRA 3MMXA 2E21A 2DERA 1MAUA 2R5WA 2CYBA 3FIUA 4AS1A 1NUUA 1VLHA 3IVXA 3CVVA 1Q11A 1YI8A 2XRZA 5JBNA 1LI5A 1JIJA 3IMCA 4JZYA 3IUBA 2J09A 3FOCA 3ZJTA 3G6KA 3KT8A 4L2IA 1OWOA 2QUKA 1BS2A 4MW1A 3CA8A 3DV2A 4ND7A 1M1ZA 1J1ZA 2V0CA 2RE8A 3IUEA 4E1AA 1WQ3A 1P7PA 3CR8A 1IH8A 1EE1A 1N2EA 1N3LA 1KORA 5J58A 2CUZA 2J4DA 2CV0A 3VU8A 3CLTC 1KKUA 4YP5A 4Q93A 4I6JA 1GAXA 4YMIA 3OP1A 3D6UA 1YUMA 3AG5A 2CYAA 2IP1A 1QNFA 3CLRD 3ELBA 3X1JA 3PXUA 3ISJA 1O94C 1KH1A 1K97A 1FFYA 5J59A 4MVYA 3CLTD 1VBKA 3ZJVA 3CLUD 4HK4A 1O96A 3K9WA 3CVUA 2RD2A 5EKDA 1J20A 1Q77A 3HFJA 1Q19A 3VRHA 1IHOA 4MULA 1NUQA 1TQ8A 2EL7A 4U8HA 1GTSA 1N2GA 1NUSA 4HJXA 2WSIA 1J70A 1CT9A 4ZCSA 1O97D 4MW7A 3GLVA 2ZUEA 5DB4A 3P52A 4K0RA 1YULA 1N1DA 2A86A 4GRIA 1V8FA 5KCMA 1OBCA 1N2JA 2HZ7A 3MLAA 1WJGA 4F3RA 3AG6A 1MBZA 4MVCA 4OJMX 1QJCA 4JXZA 3VGJA 1I6LA 1XNJA 2A4MA 1QRSA 3SZGA 4J75A 3COWA 1S4MA 1O0BA 1LW7A 3LE8A 4HJRA 4MWCA 4X0EA 1EFVA 3ILVA 1WY5A 4JFAA 4DLPA 3HMQA 4S1OA 2VXOA 1IVSA 4DNXA 3H9BA 4MWEA 3FY4A 2DETA 3ND6A 1N78A 1KH2A 3FH0A 4OUDA 2EJCA 2O5RA 4ZT4A 4NATA 4YBRA 3RK1A 4DJAA 3X1MA 1IFXA 2DXIA 3MUEA 4MUIA 4EG6A 1Y42X 2HMAA 5J5AA 2X1MA 1U7XA 1NURA 2XRYA 3H9CA 5LFAA 1U7DA 3COYA 1JMVA 4R0NA 3AIIA 4GU5A 1N75A 1OWNA 4ZCPA 1EUQA 1Q15A 3N05A 1KR2A 4TS1A 2OV4A 4ZCQA 1JEDA 2BTEA 4EG3A 2HGZA 3KFLA 4R2MA 3X1KA 1OD6A 1KAQA 3NBKA 1JIKA 4XSVA 4XFDA 2A1UA 5DEOA 2Z08A 2ZP1A 4CQNA 4U7JA 2DEUA 1SURA 1WZ2A 3H97A 1K4MA 2JANA 2YWCA 3PNYA 1PG2A 2WQ7A 2QTRA 4XFJA 4F4HA 4MVWA 4RPIA 1J09A 3K32A 1K4KA 4WSOA 3A4IA 1QTQA 4QBTA 2I1LA 1B6TA 4MUJA 1KP3A 3DLAA 2CFOA 4MAFA 4KPUA 4MW2A 1A8HA 1N2OA 1UFVA 2DUMA 3H05A 2YXNA 3TS1A 5LLTA 3RFFA 3ZXIA 2CV1A 5KWVA 1PFVA 2GOYA 1H1TA 1T6YA 3HGMA 3Q4GA 1HYBA 2J07A 3IOCA 4WNYA 5HUHA 1KQNA 4HPWA 1YIAA 4MW5A 3SYTA 1WXIA 1O95C 2O8VA 1NSYA 5K0SA 2C5SA 3D6VA 2YWBA 3SEZA 2QJOA 3QTTA 3ND5A 4MVXA 1T9GS 4I6EA 4NAHA 3CVWA 2CSXA 4G5YA 2A7XA 4NDAA 1O95D 2PFSA 3AFHA 1N2HA 4CDMA 1O6BA 4JXXA 1OWLA 1IRXA 3L92A 5TS2A 2WQ6A 2AKEA 3KT0A 3IMGA 2PZAA 3FHJA 4G5FA 4NZPA 4MUHA 1N2BA 1O0CA 1EFPB 1MJHA 2V0GA 2PZBA 4R2LA 1YIDA 4QRDA 1TYAE 4MW0A 5IJXA 5TEWA 1O94D 1NUTA 2D13A 3CVYA 4AQ7A 1U0BB 2D54A 4CDNA 3UK2A 2DR2A 3AL0C 1JIIA 3RK0A 2TS1A 3FNRA 1FYDA 4P2BA 4MUEA 1WKBA 4ZT3A 3P0HA 3FWKA 4MUKA 3DPIA 4YP6A 3RJZA 5TEVA 3OTWA 4ARIA 2PG3A 1EXDA 1QU2A 5F23A 4QREA 3RHSA 2QTNA 4G6ZA 4EFKA 2GM3A 4EG5A 1JZQA 1PFWA 1JILA 1N77A 3CVXA 2QUHA 1M8FA 1H3EA 1G8HA 1KQOA 3S3TA 4ZCRA 2A1TR 4ZT6A 2IELA 4BWVA 4MW6A 3I05A 1X8XA 4CT0A 1VL2A 1LI7A 3NBAA 4K03A 1TYBE 1V47A 5H7XA 4EF6A 1GTRA 3IH5A 3Q12A 1KAMA 2QJTA 1F7UA 2AZXA 1OWMA 5TGTA 1M83A 4EG1A 4PBTA 1WOYA 4U63A 2NZ2A 1WQ4A 3HL4A 2DPLA 4L2IB 2CYCA 1WXFA 1GZUA 4YP7A 5HG0A 1TFUA 1J21A 2PXHA 3P0JA 1M8JA 1TEZA 2VTBB 1ZJWA 1NP7A 3H99A 1N2IA 2JA2A 1R6XA 3FG9A 3TQIA 2H29A 1KP2A 1G59A 3L93A 1T9GR 5DASA 3P0IA 4UZEA 3KT6A 1K92A 3A04A 1IQUA
chains in the Genus database with same CATH superfamily
3QXXA 2DQYA 1PX2A 2HF7A 2D2FA 5CA0A 4R54A 4RMNA 1VCMA 4G09A 4KKXB 3G7SA 3GFOA 3GXBA 4O4LA 1B42A 1OXMA 3RBZA 4IYRA 1L4FA 4DLLA 5CA0F 1UP6A 1XVUA 2A67A 3MMNA 4M7OA 1Z15A 3HG7A 4TKZA 4BQQA 2GZ2A 3K0CA 1PLJA 1NY6A 3LRXA 4OXXA 3AF5A 1OBHA 2BKVA 3KQSA 1G21E 1GPMA 1ZLYA 2BUAA 2QLLA 3HYLA 1VJGA 1DEHA 2HA7A 4AG6A 1LI4A 3RTAA 4CRWB 5AKZA 3OOWA 1SCUB 4QOSA 4M1SA 1G8AA 3ORSA 5CFZA 1FBTA 4HWTA 1ULHA 4IDGA 2EQBA 4ND8A 4QHSA 2P9JA 3B48A 5FI3A 1F9EA 3TZLA 2P40A 4Z4GA 1T36A 4QICA 2QT9A 1QONA 1IM8A 5FBQB 1ONPA 1UDBA 1V26A 1X38A 1FFXA 5LQNA 3T5TA 3DTTA 1KI1A 4IMRA 4OX9B 4CTJA 3QVGA 2JIOA 2EFEB 2VJBA 4XYEA 3AB3A 1ADCA 1KQPA 3KQTA 3O4HA 4JJKA 4CQMD 3ADDA 1PT8A 1DRWA 1FRNA 2V3CC 4LWOA 1N2CA 2YWHA 1IN8A 5AESA 3KEFA 1MABB 2SICE 5U4XA 4YCCA 4CMAA 1Q50A 4EFLA 2OCAA 4JQSA 3WL3A 4C9BA 1RQNA 2H2WA 4BKPA 1YIOA 2YASA 4QGFA 4L5CA 2W58A 1GNTA 3H1GA 1RWMA 2FW7A 2R6ZA 1P4RA 2OORA 2BMEA 2ZUDA 5KNDH 3K9LA 3L0PA 5BNZA 1EFHA 3Q9UA 9ATCA 2V8OA 1BHO1 1Z35A 5KWSA 4GPTA 3C3XA 3MK31 5F4BA 5JOQA 1R0XA 2NXEA 5J43A 2PCJA 1NM5C 4KR7A 1YNOA 5JMOA 3CMMA 4IIHA 3W5HA 3Q8XB 4OTZA 4XA8A 5IARA 3T9AA 3WC4A 2OTCA 3EGDA 1JR3A 4HLNA 3ZDAA 1YA4A 1DEKA 4FLFA 1MC5A 1P77A 4QVGA 3TW8B 1U2GC 3O21A 3OG9A 4I6GA 3RTBA 5IJ0A 1NBIA 1S8OA 3ZZ0A 1W0JA 4X1IB 4C7MA 3R4VA 1EXNA 3Q10A 1R6BX 3GU3A 2AYXA 3BCHA 4RVCA 4F93B 2QLFA 1T9HA 1S8FA 2PSHA 1ECGA 4OHPA 4B33A 3V2HA 2C94A 4J4TA 2GR9A 4NPHA 5CCDA 1D6NA 2R6CA 2F3RA 2YFHA 1Z8FA 4G0ZA 3UJCA 1IMOA 2A59A 4C03A 5E7IA 1R4NA 3F8WA 2G9VA 3PPVA 2CCKA 4MOWA 2XXAA 3NHKA 2G5CA 1GKYA 1RJ9B 3EC2A 3NZEA 3EZ2A 4CDRA 1I1OA 3WYEA 2HSZA 3GP3A 4E2FA 2XIJA 3M5WA 1WWKA 3P9IA 5EXTA 3UGTA 3C1UA 1E7SA 1Q0HA 4HRYA 4PWYA 4AROA 4PAWA 1WLYA 4X93A 2WAXA 2QL7A 3QTLA 4DG5A 2PO7A 3MPUA 5F3DA 2DP4E 5A5FA 4YRRA 3WA6A 3R5KA 4Z3KA 4DY4A 1EP3B 2QZZA 4MP6A 1EAMA 2QL9A 1XNHA 1WCXA 5KYYB 2MSDB 1TZCA 4HUQA 4KAAA 5FTMA 7REQB 1GV1A 1DXOA 3PHHA 4Q3CA 1U65A 4FZJA 5DHUA 3RE1A 4FP9A 1LB1B 2RCYA 3A6LA 3NC0C 1GJRA 1EDDA 3IEXA 4W5NA 2V59A 1TU4A 1AT1A 5A6SB 3OQIB 3TE6A 2N9UA 2ECPA 5H9WA 1J49A 2PUCA 4S1WA 3TWOA 2QYOA 3GLRA 3M6FA 3Q2IA 3R3ZA 4UTVA 2I9KA 4RUKA 3N2KB 2Q7OE 5CT6A 3UV6A 5JSUA 1I3CA 2AMJA 4BB9A 5BWLA 1OVGA 1MOPA 3IE2A 3GW8A 3AHHA 3H1TA 4HLUA 1NUPA 1P44A 2YZ2A 4RH3A 3R5FA 1FJXA 1WD5A 1AK2A 1CU1A 3SI7A 5AW0A 2WTAA 3PEEA 3IKLA 3WRWA 5DM4A 1JT9A 1NMEA 4KGDA 4J16A 2XNDD 2CDAA 4X24A 1UC8A 4P3XA 1KTVA 3ABSB 4YO7A 5E9QA 4KO1S 4HQOA 1VG8A 2OHHA 3NHZA 5GJCA 3VKVA 4Q7EA 3GLGE 1IPEA 2BMJA 1CDEA 3HP7A 1NNLA 5BWNA 2X1LA 5JBIA 1TC2A 6ADHA 3BWDD 5ALDA 4OYHA 4RDCA 3E7DA 1BCSA 4H60A 3OCYA 2ONKA 4HAUA 2R7MA 2WWVD 3TB4A 3UHAA 4DR3B 3O8LA 1ADGA 1NW3A 1V7CA 1VOTA 4MKGA 5F7ZA 5DIFA 4E5VA 1PVOA 1XVAA 1HYQA 2G70A 1SCNE 3H1BA 4E94A 1M7BA 4Y8VA 2J33A 4G67A 4JBWA 1Q1NA 1V3VA 2OHOA 4Y2PA 4DUYB 2RG1A 4JR2A 2P6NA 5JASA 1IMJA 2PMDA 5LZ5A 3RDPA 4D0LB 1RYNA 2CNLA 3PLRA 1Z34A 4WZAA 3DLCA 4ZI3A 1P2GA 3SMQA 3D6HA 1XTSA 1RWNA 4CF7A 2KW5A 4W1SA 1N2XA 1XKXA 3M6VA 1EUZA 4DMRA 1T0JB 4NECA 2CXSA 2NTNA 2HQBA 2WE8A 1KAGA 1VI2A 2Q8QA 4FNMA 4UE6A 3VNQA 2IXAA 1GPWB 4I1OA 1DAOA 4TYNA 2IEGA 4WI1A 3FNGA 1P1FA 4ZA2A 3GN2A 1LPSA 2X8JA 3FFXA 3N75A 4JSYA 3QPVA 3MJEA 3AHFA 4TLCA 3J81A 1RPNA 2D06A 1T15A 1IJBA 1EFKA 1I9CA 4TTSA 2CB9A 2X7JA 1DAKA 3WGUA 2IUEA 1QOZA 2Q5JA 2W4MA 4HATA 3GH3A 3PC4A 2R7KA 3EE6A 4OB6A 4Q4AB 4QQRA 4XVQA 5ITSA 1J8MF 4UUBA 4NENA 4M22A 4JBGA 1U8UA 3DWGA 4E1AA 2I29A 4RPHA 1JLMA 3K96A 4ZRDA 3R76A 4R40A 4JNKA 2FPSA 2QN6A 5CJPA 3RT7A 5KSOA 4MGEA 4JU9A 1Y1SA 2HMSA 4OFZA 3TO5A 1Z0IA 4EYEA 1OIVA 4FYVA 1SOWA 4R1MA 1UOQA 3F67A 3USZA 1J5XA 1GG8A 3FSJX 1V48A 3BSFA 1X42A 3EBLA 3OUUA 3RWOA 4HX9A 3A1UA 1A5BB 1J0BA 1VCNA 1LK5A 1XTKA 4P35A 4ARSA 2ZWAA 1W5AA 2QUBA 4AYWA 1KH1A 2W00A 2XKBA 2ZRHA 3THXA 3AL2A 1UFOA 4GMKA 2PUBA 3LTEA 4IKPA 1T4MA 3G02A 3HB7A 1XLTA 2CZCA 3GVXA 3EGCA 1T5DX 2BDUA 2X3YA 4HAIA 4JVNA 2G0AA 4DIUA 1Q77A 1QIIA 3NOOA 4Q48A 3VUFA 1XT6A 1HLDA 4G26A 4BNKA 5IYZA 3EF0A 4Z4IA 5DXAA 3WLMA 4OHYA 4HB3A 4FFMA 3WGLA 4CM9A 4TMWA 4PLTA 1IN1A 3S8MA 3AY3A 4PINA 4G0NA 1EHCA 1I4OA 3OM0A 2E9SA 4ZCSA 3ROGA 3FSEA 2BN4A 3IKMB 3LY9A 3P52A 2R96A 3P45A 2WEKA 4N5HX 5DHRA 1SUAA 1QH8A 4CVNA 1RC1A 4E2XA 2A86A 2B30A 3LKDA 3UB2A 1Q7CA 5K8LA 3MWYW 2ETVA 3MLAA 5TC4A 4D02A 4JBXA 4YMHA 3JWGA 3PQ8A 1X13A 1DDOA 1MB0A 4RCVA 3OPNA 2IGTA 3P19A 1K8YB 8ATCA 1IATA 1C3EA 2HMWA 5DNVA 2AI2A 3EVGA 4UBIA 3RVRA 1C80A 3KDAA 4X85A 1ZM7A 3QW4B 3KKLA 1S3GA 4V2UA 3ZYZA 5JYEA 1HDXA 3KXPA 4Y6GB 3TMKA 1ZO8A 5ENVA 1RLIA 4ZDWA 2W37A 3WRXC 2V96A 3PVSA 5EY5B 1KBQA 3QU2A 3E9ZA 3A9RA 3L04A 3QX7A 1V9CA 3SJUA 4YV0A 3GFGA 4DNXA 4X94A 3SSOA 3HCBA 4LF8B 1P3DA 2VHQA 1DT3A 2RGNC 2DETA 3HDVA 1CUIA 5FWXB 3D59A 3K1AA 3PC7A 1KH2A 1SY7A 1Z62A 1ZEJA 3LBIA 4IR7A 4Q9AA 1OIXA 2PWPA 5AVZA 2O5RA 4W63A 2ZITA 3E0QA 3GZNB 2VDLB 1G5TA 1Z07A 4TXJA 4WESA 4ARZA 2P67A 3GFPA 4M1EA 1QZTA 1SVLA 3QPAA 2W6CX 5CH8A 3SQXA 1A9YA 1U8AA 2QSUA 1ZX1A 4NWIA 1Z73A 2O7RA 1RWWA 1GNLA 4FB4A 2W7TA 1CQPA 4IMIB 2NU7A 2D2VA 5IVDA 4X90A 2W8BA 2HDHA 1VB5A 3G7NA 4ICIA 2Q0XA 4DILA 3B2NA 1SD1A 2I1QA 2IBMA 1BA2A 2H08A 2DHEA 2QVBA 2XNCA 3GDOA 3N2NA 4G4SP 2FRXA 4O4HF 1MCZA 4ZO7A 5HQTA 4DW8A 4F7DA 2ADFA 4RVFA 4AY2A 2LW7A 1OX5A 5LZ8A 2Y1EA 1XAIA 5AHXA 3FFAA 2Z8XA 1JIKA 5E9AA 2OFWA 3O2JA 4KUGA 4F3NA 3VYWA 3FUUA 3U62A 4W1RA 4AF6A 4CCSA 2YV1A 3P2KA 1COWD 3HCNA 5ICSA 5DLDA 4CI9A 1QGUB 2H11A 1V71A 2ZJ4A 3KQOA 4WSOA 3EWSA 1ACMA 2R6AA 1P3Y1 4R9VA 1PS9A 2XQFA 3QLVC 2XJ9A 2P2SA 3AUJB 5FJIA 4KU4A 3CISA 1FU8A 1T0IA 2ZT8A 4V0ME 4S1NA 4DC0A 4A2CA 1V1MA 1UFVA 1L5KA 4ZJZA 2RH4A 5DYIA 3N2GA 3CF2A 1TVMA 2IXDA 2BBWA 2VHWA 3W77A 5T5QA 1M5RA 3HB5X 1WMSA 2PVSA 3EZNA 1K7EB 3N74A 4RIIA 5BSWA 2HR1A 4RA6B 2NVUB 2ZAOA 1EI9A 5F98A 3AQ4A 4W9NC 2C88A 5ESRA 3VX4A 3HCEA 2ZRLA 4RELA 2ZI3A 5REQA 3AB8A 3GRRA 2ISSD 3DTVB 4IH4A 4D9IA 2EL9A 1CCWA 1JQ5A 4JI5B 2BKXA 4CGYA 2R0QC 3MBIA 3GDWA 2GPNA 3I9FA 2R87A 3FJOA 4L78A 3VZCA 4L3OA 4MYCA 2AHOA 4OXYA 3V8VA 4IIJA 3S2IA 1MZPA 2ID9A 5F7JA 2PA0A 1O6ZA 1X7YB 1T9GS 2OK8A 4E13A 3AJ9A 4E08A 4TKVB 3RJMA 3RTEA 1NI4A 5DM0A 4GKAA 2IZ1A 4M2LA 1TUEA 2RC6A 4G5YA 1JE0A 5EJGA 4FFBB 1FJ2A 4R16A 4EGCB 4DLSA 3KZOA 4IJKA 2RHHA 2I2FA 2WUGA 3C24A 2IXTA 1JVSA 4CM3A 2Z4SA 2WQ6A 3RAPR 4AJ9A 2GX6A 2XB9A 1S1CA 2YBEA 3IMGA 3OP4A 4HKTA 4MPTA 4REOA 1O0CA 3IVAA 3M9LA 1ID8A 4KX5A 4XWTA 4XEHA 4KUEA 1PEAA 2IOFK 2EYUA 3ZZUA 4AN1A 2O0MA 4Q24A 5AO9A 2PZGA 1Z33A 1IHXA 1WUJS 3E6AA 2ZCUA 1T2DA 3PB3A 3T7DA 1ZD8A 2IHBA 1U0BB 3DF7A 1XEXB 2NVBA 3LWBA 3RRMA 5TMPA 2AS0A 4DDUA 3FTEA 1ILWA 1CUHA 1RAGA 4TM7A 3RNOA 1QSGA 3EAGA 1RPJA 4Y67A 1DQRA 1WKBA 1CS4C 1SIBE 3A25A 3WGVA 4B3JA 5L7WA 2AIRA 1TUIA 1MDFA 3N53A 2XOKD 2PZMA 5G3ZA 2AZDA 4DLZA 1PNRA 2WUDA 5TEVA 1SK8A 2XDYA 3WLTA 3VNAA 3W2IA 3U26A 4HVCA 1A9XA 5AKJA 4ZVRA 1XA3A 3PRYA 1A04A 4FT2A 1CZNA 1WDTA 2G7ZA 3BWVA 2JF0A 3ETLA 3T6KA 3EMVA 4JOSA 1GHTA 3EOAI 5B7PA 2YHSA 4XUDA 4PIVA 4NZOA 3THRA 5E6RB 1KQOA 1N6PA 1P1CA 4X20B 1VB3A 4Q9IA 5A9TA 4MQFA 1ISMA 3EEBA 2UZ1B 4LHZA 1GTJ1 2QRQA 3NGMA 3DTVD 2IFTA 1SCAA 5DBHX 3S28A 1AGYA 3M3DA 1T9DA 5JO9A 4DSOA 3NUGA 4A15A 2FP4A 4OH1A 1JTFA 1VL6A 4OH7A 1RXSA 3QWAA 3R40A 2JFYA 1A9RA 5B3AA 2GLUA 2PE5A 5IDYA 1VHDA 3TBFA 4XDHA 1Z7YA 3NIBA 5KNDD 2EF0A 1FRQA 1N8TA 2WVGA 1NP7A 3BFXA 3NOVA 1YB5A 3JVEA 4PNZA 4DC9A 1CNMA 3NTUA 2AT1A 5JXJA 1XA4A 2ZPTX 1G42A 5EKSA 4WZBA 3TQIA 3VO8A 1V7PC 3HM2A 1NBOA 1QIGA 4OVKA 3VZSA 1U8EA 1RI2A 4LYHA 2WJ4A 4HBGA 3MGBA 4QIHA 2AFRA 3ZK9A 2B8WA 2FSHA 2ZQYA 3MG9A 3C8ZA 4H1UA 4PAMA 4JLNA 4JXKA 4TXMA 3CF4A 3D02A 2GEUA 3ZVMA 3ER8A 4KDFA 1ECCA 2HJHA 1RMYA 2JATA 3M3PA 2W5UA 1QYDA 2VP0A 1NHGA 1EJ6A 1E69A 5CX1B 1IZ7A 5BRAA 4QELA 1A76A 3PPIA 4HB2A 3SDZA 2C54A 5FOWA 2HV9A 3FB4A 4EJ2A 4MZDA 1NI5A 1G9XA 2JI7A 4XAQA 3FROA 1J00A 5EERA 1EUDA 2W83A 2XH8A 2XR1A 3HBNA 4S1TA 1NYTA 5I5GA 4LTDA 4I50F 2ZB4A 4TVKA 5LQCA 2XZLA 1ADFA 2VDVE 3IHTA 5JT1A 3CTPA 4DCTA 4LQCA 1CDDA 1JNYA 3DJFA 4MYDA 5IBCA 3PYMA 2JGDB 5EXSA 1KMNA 2XEXA 4QRHA 1PJBA 1Q84A 2P5TB 3MRXA 3D1VA 3DNPA 4UCQA 1X94A 1SVIA 3N87A 3RSQA 5BQFA 4MLPA 2GZRA 1ZD3A 5FNVB 4RABA 4AURA 1KIMA 3FTCA 3DC7A 1NNSA 1LLFA 5FUBA 3PV0A 3WO0A 2CBGA 3SEAA 5HK9A 1RKQA 3CVOA 4PGAA 5COAA 3VPFA 1G19A 1PLLA 3QKWA 1SO8A 5KTRA 4PQRA 4RDIA 4E07A 3I37X 3OIUA 3KR0A 1MO5A 2WILA 2V74B 3DO8A 3BREA 4FLEA 3STVA 3P97A 5DT2A 1PFUA 3SQLA 3V1LA 2BM8A 4OQNA 4B6SA 4B3SB 2AB0A 2W2MA 1F1JA 3A28A 3B6ZA 3W06A 1KKLA 3NYIA 3SFVA 1DC4A 3QXSA 4LGMA 2V97A 3LDGA 5A5DA 3UGJA 4BQSA 4DDKA 4XUEA 3W6NA 1IB6A 5BMVF 5FULA 1L5FA 1LPOA 2IYQA 3GP5A 3I2HA 3WYFA 2XCSB 3K2QA 2FWAA 4YJ2F 3FDIA 4U9UA 1PW7A 1J06A 2XGJA 4GF5A 3WQHA 3OZEA 2Q6IA 1FFSA 1C3VA 2FPLA 1ZK3A 3U80A 2X4GA 1UDAA 1V6SA 1W4LA 1DQZA 1J9EA 1Y9JA 2JA1A 3ACBA 1L7NA 2R4QA 1ZI9A 3OLWA 2QRVA 2GK4A 4JL8A 4MI3A 3RBAA 3HU5A 2YHUA 4YLGA 4BN0A 3DLTA 4FCWA 5B12A 1U8YA 4FMCB 2CNNA 3I5YA 1UBFA 1Z38A 1J7KA 2CBZA 2VBFA 4JKIA 3D2LA 4A8HA 3BT7A 2BMDA 4UU1A 1IJKA 1E5QA 1HTWA 2O05A 4C7KA 4E30A 1KK2A 4HNTA 2P2ZA 2QX6A 2B4AA 2GBLA 4FGUA 1G291 1H6CA 5HF9A 1WXDA 3UT5B 2ZR9A 3Q7QA 3MS7A 1HFJA 3X1XA 2ID7A 3A9VA 4ZT5A 3IV7A 3PFGA 2AC4A 3BZWA 3A31A 4F3YA 4WKPA 3CMCO 4AO6A 1MB2A 1CKEA 4E0BA 5JH7A 3TTYA 1E9FA 3F5DA 4RZHA 1H3FA 5B37A 1FYVA 4B84A 2Z2IA 3CUSA 3DWFA 3H17A 3W3AD 4Z54A 3EIHA 4BRWA 4COKA 2GF2A 5A5GA 2ADMA 2WIFA 4DE5A 3C7KA 1ORDA 4LRWA 1Y5RA 1FDTA 1U0NA 4KN5A 5AKIA 1G3MA 4OGLA 4RTNA 2L18A 3EGXB 4DF3A 3T7SA 1ZMTA 4JUDX 4S24A 4W5WA 2CLOB 2A57A 2X5XA 1G16A 2QSYA 5SYMA 1W1WA 1MO2A 1HYHA 1QR2A 1DVRA 1LDMA 2IQIA 3PT9A 1S4QA 4Z1MA 2WY2D 1D2NA 1AN9A 1Q0PA 2NWQA 1LA2A 4V2IA 3BGDA 5FHRA 5J5CA 4D0NA 4NZMA 3H8JA 4DB4A 2PKQO 2XADA 4B8WA 4OD0A 5FI5A 3WLEA 5JNUA 1QYRA 2ZAMA 3TLGA 5EP4A 4BWYA 3V4RA 2VUHB 1KFKB 5AKGA 3LVQE 3UT6A 1DAGA 2GAOA 2PU7A 3I1JA 3W4JA 1C14A 2OBBA 3W5IA 2UDPA 3F9IA 3TEMA 2M9MA 1JXOA 2FPIB 5F9MA 3WLSA 3EPHA 4AECA 4QGSA 1OA0A 3GV0A 1Z5PA 1BJRE 2PEYA 4KQ2A 3HKDA 4Q6BA 3KFXA 4QDZA 4BJ6A 4CMGA 2FRDA 2O2EA 4PLZA 3PUJA 2INGX 1C1XB 2NSHA 2NYVA 3RW9A 1K1EA 3H4TA 1E7WA 5EJ9A 1Q83A 5FBKA 3FNFA 1KEPA 1K4YA 1T1RA 2OCPA 2XNHA 3NCHA 5JDIC 1V8ZA 2QV7A 4OHCA 1PV2A 3IRUA 1ZVVA 1DBRA 4WVLA 1ZMXA 3OM9A 3ONEA 1RC8A 4BDSA 3UVEA 4KK3A 2YVQA 1Y1QA 3CZ4A 5A6VA 5HUJA 4KKVA 3VQTA 2CFRA 1O96B 2PBFA 1E6UA 4R1LA 3QITA 4HWPA 4MUAA 2BMVA 1WXHA 2JK1A 4Y1EA 1OCEA 3AJEA 4NV1A 1GCGA 2C77A 2ZB2A 3DW3X 4UNRA 3VR4A 3H5AA 4EMBA 4DRXB 4Z1OA 2E21A 3SZOA 5B2EA 3T3NA 1CR2A 2VYFA 5DT9A 1VDMA 1KMIY 1QK4A 2ARKA 3K6JA 2H54A 1UQTA 1LJLA 1VIVA 4GMFA 3FIUA 3FF4A 4HZIA 5IVIA 4CQMA 3QSYA 1M67A 2RCNA 1GG5A 3NT5A 1FX1A 2G6BA 1E9CA 1JIJA 1OW3B 5J2TF 4YNBA 4ZZ1A 1DEXA 2D7CA 1FC0A 3EUEA 2IBTA 1KFBB 5C18A 3MIZA 5EL0A 4RKRA 1LFDB 1V43A 5LZ2A 3GMSA 1U80A 4L4SA 1GLVA 1SBNE 2ANCA 3V33A 3TJRA 1X9HA 2EW2A 4P0PB 3DV2A 1XVLA 1Z7BA 1JI3A 3VU0A 1M6HA 1S89A 2OKGA 5LYYA 4G0QA 3ZDBA 4OAQA 3K0AA 3D4BA 4S0XA 2RE8A 1CUYA 4WFKA 3VNBA 1SZPA 3HU1A 1JYEA 5LUBA 5BSMA 5TJHA 3GJTA 2OPBA 2P9FA 1GA6A 2I2CA 3D2CA 3ZN2A 4LFBB 4YT4A 4FHEA 3HYCA 6Q21A 2CV0A 1Y4ZA 3VYRB 1SUIA 4GZMA 3OQHA 2YC2C 4A2WA 3PUYA 4OMFG 1X7XB 3AY0A 1YCGA 3NANA 1GAXA 4HR7A 3OLXA 3U49A 3WV4A 4BNMA 1S8AA 1Z75A 1OF1A 2H3EA 1K97A 1TIPA 2X2FA 2NO9A 2B25A 4TX1A 4WL0A 3HR8A 1FDOA 3RVPA 4UTNA 2BFEB 3LDHA 3RQSA 2XA1A 3VU9B 2C5HA 4BB6A 1V7ZA 4M0CA 2NTVA 3DEIA 4HK4A 5ER9A 1SCUA 5FQNA 3S29A 5C8DA 2O8FB 3CINA 1E3IA 3M49A 3NTLA 3PE3A 4FU0A 5IXSA 4P0QB 2DTEA 1RCTE 1KAOA 1QTIA 5TGDA 5K6RA 1XIVA 2Z9CA 2WINI 3HLTA 1SUFA 3IULA 2VBGA 4IVRA 4TUYA 4X1YA 2J0SA 3MWGA 4QFMA 4X6XA 1LBSA 5C7IO 4Y2JA 3OM8A 3VYTB 5CDFE 4H4DA 5JMTA 4ZOLB 3VGPA 1WV1A 3NHUA 5LVAA 2B2CA 3AGQA 5E1OA 5HKBA 4PXYA 2FGJA 1KARA 5LMUB 4IOLA 4BXOA 2CJPA 1YB7A 5KCMA 4MCJA 1KI2A 2A30A 3GLFE 1MABA 4I8DA 3B3JA 3M4ZA 4A1FA 1T35A 1NXOA 3EDRA 3D7SA 2YYSA 1GSAA 1Z22A 1NXVA 1PDVA 2VRWA 3BBLA 1VLMA 1Z6GA 1Y8QB 3VGJA 5IUJC 3TFOA 4PG5A 2OZLB 1PSZA 3KOYA 1R5OA 2I7XA 1FK8A 1CIJA 3H7AA 3K71B 4MDHA 4QE3A 1ST2A 1USWA 3DFIA 1J22A 2HIMA 3W5VA 3K94A 2ZUSA 1VJ1A 2C97A 3PQ3A 4KMMA 5EE0A 1E9AA 2X1HA 2AVNA 5CB4B 2BGNA 2AJBA 2ZBFA 4B73A 1FVFA 3C8HA 4ZVVA 3BEDA 4XB1A 1M1XB 1EFCA 2I4OA 2VYVD 3P2OA 4DIDA 2B9VA 3CO5A 3ZVLA 1FIUA 1ZJ6A 3EHDA 2HCBA 4YV2A 3FYUB 1JFLA 3DLHA 1YFLA 4NPAA 1D1TA 1NPDA 4F6CA 4EJSA 5BVGB 1JF8A 3TW8A 4NDZA 2JGRA 2XNDA 1OTYA 1JMKC 2EJCA 4HEA6 3KKOA 4ZOQI 3E82A 3ZY3A 5FPQA 1SCKA 4UULA 4ONEA 4X1IA 3E7PA 1E4EB 2P78A 1ORTA 1CIPA 3LVBA 5CFQA 5AW7A 9MHTA 3UT0A 2FG6C 2C3YA 1QO9A 3CW9A 2Y1DA 5KYWB 2DFNA 4MV9A 4I99A 2IW3A 5I8WA 3AIIA 1JSXA 1NJ5A 1YR1A 3D8HA 3KEOA 3B85A 3EXG2 4GKVA 1IOVA 1U1EA 4GU5A 1E99A 2J4CA 5C3UA 1TYEB 2WT4A 1I01A 3WR5A 2PEZA 2I6FA 1OGJA 4DXHA 4M9UA 4C6TA 1R18A 3DLBA 3BTSA 3PDWA 3RFCA 3WLAA 4Q4JA 1C7JA 1J2JA 4O08A 3CX3A 2HJ9A 4JJ4A 1NV8A 2GBGA 2JKVA 4RMIA 4CG2A 5EOVA 3HXQA 3PL5A 3JQ8A 2BBTA 3ANTA 2C5EA 4X8OA 3O9VA 2Z08A 4L7QA 1Z26A 2I22A 3LY8A 3WOHA 5GOTA 4CIWA 5ELXA 1HEUA 4JQZA 4UHHA 2AQKA 4ZANA 5JC1A 3V2GA 4DXDA 2G63A 2WVJA 4R1SA 2WYWA 5AQEA 3L6EA 4GGPA 1AQLA 5KYYA 7REQA 3H5VA 4P6VF 3HJNA 4E46A 1KMCA 3AEQA 5ALNA 3MA0A 3ENKA 4G9GA 2PMEA 2GBPA 5DU2A 3V2UA 4BO4A 4YRZA 5A6SA 1PTJA 5HOQA 5EFZA 3GNLA 3OQIA 3JQFA 3X2EA 5KPDA 1MIHA 2YXNA 1BMDA 2FNAA 4QG7A 2CV1A 1Q6YA 2WHYA 4KPYA 3K0KA 2QDXA 2I34A 3N2KA 3WL8A 4FE4A 2B3TA 1UT5A 1YI0A 2ZJYA 5EE5B 3FPJA 1KQNA 3WJ1A 4BS9A 3FSGD 2B3DA 3L0OA 4H59A 4RDHA 5FA6A 1WDLA 3NLLA 3KG2A 3SYTA 2O4CA 6NULA 3LU1A 3TLCA 2NUBA 1NSYA 4ND3A 4BKMA 1ZZEA 1RABA 3IQGX 1HT3A 1XDGA 2W43A 1S2IA 5HCUA 2EWWA 5BWMA 4HNQA 2ZYRA 3MHTA 4NR0A 4ZAFA 5T7BA 4DNQA 4QNMA 3OETA 2CUKA 5EZYF 4ZOCA 4NS4A 3OFSA 1OC4A 1DUIA 1QE3A 5E2AA 2QAGB 3WYAA 3AVXA 1H2FA 3VSEA 3NDIA 4G5QA 2YXLA 1KL7A 1ZVMA 1L1EA 1FNMA 4KIJA 3WQSB 3KXLA 2DY1A 5P21A 5TSDA 1Q0RA 3FHJA 4QUGA 1JKJB 1QFMA 1CF9A 2YWRA 3P0FA 4LYEA 4BC1A 5LIPA 4P5EA 5AWFC 5AVUA 1IPHA 1NFFA 1E0SA 1O94D 2POCA 2FUEA 3PQEA 4TWAA 2C59A 4IKOA 1DMRA 5T4HA 1E0JA 1NUTA 1VSUA 2GN8A 4AMGA 5K2OA 3IUPA 4AJNA 3ODGA 1SQ5A 4IF4A 1BWPA 2HHCA 3R9XB 1XJ5A 4CDGA 5F73A 5K0FA 4DQKA 3P32A 2GH1A 2YICA 1Z6ZA 2JHGA 3DEYX 3FNRA 3OIDA 4KQFA 5DN9A 2PCLA 4BQEA 5HXAA 4DAEA 1T9BA 1B00A 5TPWB 1YDHA 4C7BA 2R1VB 2ZTVA 4RANA 1DQSA 4S05A 2EFJA 5I4KA 4QULA 1QO7A 4A73A 1RS0A 4BZWA 4GSKA 3RRYA 1Y8ZA 4QPZA 2M6LA 2CL0X 3RHSA 2D1QA 3AVOA 1XLUA 2AEMA 2AYYA 1P0QA 2FW0A 4JLPA 1HBJA 3EW9A 4LZOA 3V7UA 5JD6A 1T0PA 2RH9B 3EGWA 4UVHA 3SVTA 3IESA 3OWOA 4Q4AA 2PJUA 3SM3A 1YJAA 1NN1A 1SQGA 1QK5A 1P7ZA 1RYHA 4MUMA 5J9FA 4X61A 1XHFA 3DQQA 5E9JA 1K5HA 2LDXA 3C16C 2ESRA 5CAEA 5H4HA 4NMHA 4N48A 1SXJC 3DXXA 4LMAA 3CM0A 4MQ5A 4MV1A 2QZSA 4K03A 4CKEB 4QZVA 1GQFA 3A2NA 4WD3A 4EF6A 4PYIA 3JPWA 2YFQA 1KAMA 2AN3A 2QJTA 4CV0A 4EG1A 3ZWKA 2O1EA 3EBPA 5FPKA 4EJ6A 2A3RA 4UJ3A 1KP9A 2SNIE 5GMOA 4OL9A 4QQNA 1JXAA 4MARA 4LXUA 1DCKA 1UDCA 3UBTA 1AS2A 1JB9A 4ZQEA 5ALMA 1TFUA 2P65A 3SLRA 4B6GA 2MWMA 5CCXA 2I3ZA 2Z98A 2P27A 3LXUX 5GOZA 5JJIA 3JYLA 4FJ2A 1ZFNA 1KP2A 4PZPA 1J2YA 2BGMA 1DC8A 2VDMB 4XIFA 3SFZA 4UAUA 2OL4A 5HDBB 1P33A 2AEEA 4RE5A 4OAOA 3GFQA 5EHGA 2G1AA 2ZIWB 5ISMA 4M0KA 2BFAA 2IXBA 3I12A 4H16A 1XELA 4IVNA 4MVJH 3PKIA 3KXKA 3U4MA 4NE9A 3CB4A 4N3CA 2EGGA 5IG2A 3EIQA 3I4LA 3FOFC 2CJYA 4WA7A 4ECEA 1ZY2A 1JIQA 2Q2QA 3R41A 3H2SA 2YY5A 4BO1A 1ZJ4A 5KYUB 4BJHB 1IZZA 4RACA 4XRGA 1SHTX 4KVGA 2XYPA 1COWA 2IOHA 3PDUA 2AN5A 5T3YA 3KM0A 1C7IA 1FTYA 1SUBA 1P91A 2CHEA 1THZA 2QRKA 2QMUA 4I9GA 4R6XA 4AY4A 1YQWA 2X5JO 2JLQA 3ZE6A 1ZNZA 1H23A 3G17A 1KF0A 1QIEA 1A82A 1GQOA 4E5UA 3MYYA 2FN4A 3U9LA 1GZDA 1CRZA 2DFPA 4HGYA 4QBHA 3SKVA 3VDXA 1KKMA 1V6AA 3MCWA 4GH5A 1QE0A 3C3PA 1VMKA 1VYTA 5AD1A 1KEKA 4K6FA 1D6MA 3PFNA 3LX8A 1FLDA 3C6MA 2Z1NA 3MAAC 4QYTA 4UMVA 5B7QA 1Q0TA 1PJSA 3GVHA 1ZN9A 4RH1A 4G2NA 4HGRA 2CMGA 3AJ8A 3QFCA 3EZ6A 1QHFA 3N8HA 2YJZA 3I2YX 4KI7A 3CNOA 4P4NA 1C0IA 3QFTA 5HIJA 2QN1A 1M1YB 1WVGA 2GPAA 2GGSA 2ISQA 2WTUA 5LIRA 3CKKA 2QRZA 4Q7KA 5K01A 1S01A 2Q3LA 5AICA 5AM0A 1OPXA 1RM3A 4ZVUA 1XEWX 3UYKA 1XZHA 1J8YF 1UC4B 5DNAA 4KYVA 3PYXA 1CDZA 1T2VA 3GF4A 2OEPA 1PBNA 3T5AA 3K9HA 1QCZA 3DYIA 2CSUA 3FF1A 5IWAB 3JS5A 5A0TA 5AJZA 3ABIA 3CO0S 1BD3A 3ZDZB 2VZ9A 1LVUA 2VQDA 5CDHA 3BGWA 5KAPA 3CLSC 4UEOA 2CCGA 4EG8A 1R15A 5FA5A 2AJDA 1XN4A 3ECCA 1QFJA 1IUPA 2X58A 5DSXA 2W2XA 2VHCA 3DAFA 3W1EA 4YUYA 5JTTA 4AXXA 2VRBA 1EA7A 1W94A 2WI8A 3NEAA 1Z45A 5L3SB 3OMLA 4YYZA 2DAPA 1SBTA 3DAPA 2OHFA 5ICEA 2IYLD 3FTDA 4FS8A 2RJNA 1PS8A 4KN6A 1DKRA 1J0EA 2ZS9A 4KBFA 4LVNA 5ETJA 1F9AA 1GWNA 1PJCA 4ZJPA 1QGUA 4UBNA 2NG1A 3SDBA 2XOKA 3HZZA 1PJQA 1T6NA 2HBYA 4FDVA 4KN8A 4L95C 4O2AB 5EN4A 3TRDA 5HZMA 1R9JA 4KW7A 3F73A 4DDTA 1OBVA 3IUSA 2ZTUA 3ND8A 5JCOA 1KO7A 4D26A 1ULTA 1KVQA 2BW0A 1UC9A 1N4AA 2Y0DA 1WG8A 4J6FA 4X8MA 1ZVQA 2VS1A 4NL4H 5FD8A 4C7JA 1JWLA 1WVMA 4HFRA 2PYIA 5I7OA 3WGKA 3ROPA 2OGSA 4NV0A 4U6SA 3ZH2A 1S8NA 4AQYB 4RA6A 5FTNA 2FX2A 2GSDA 2NVUA 1JEQB 1ZZGA 2VBCA 3OI7A 3T1YB 2BGKA 5D51S 1SKUA 3GFBA 3UG7A 4IO1A 4LGVA 1TCVA 1N33B 3DTVA 4JBLA 1JHUA 1BG6A 4AJPA 1QIKA 5ALPA 5DNDA 2NUTB 4LNHA 3CZ9A 3U7JA 5HP4A 1LK7A 1FF9A 4IRMA 3VM6A 4P80A 5JZBA 2K7FA 1E0AA 2PGLA 1KI3A 1NW8A 5EGSA 4TKVA 1JTEA 1EJ2A 5JAZA 1FFCA 2D5AA 2P0EA 1F4VA 1WU8A 4RU1A 4EYQA 5IJWA 4QHTA 2V9PA 5KNDA 5A3VA 1W49A 4M7RA 3IIJA 4US2R 4TWRA 1VRWA 5F3WB 3JRXA 4I7EA 3LPAA 4P92A 2GFHA 4M83A 3AP3A 4R9SA 1L5SA 5J1TB 5IANA 2ZUFA 1KBZA 1MLDA 1PX0A 2UYGA 1D2GA 1UXJA 2UUOA 3GDFA 3M6MD 1CYEA 1U8CB 1H4VB 2AWOA 1FMFA 5AW5A 1U0FA 4GYYA 4RD0A 5MN5A 1KRHA 1DTWB 2H48A 1D1SA 2QRGA 1G5IA 3GLSA 2KPOA 2ZS8A 4ZAXA 1QBGA 4NFLA 1QOQB 1WCIB 1ZSVA 1N92A 2ZG6A 1XEXA 2A5DA 2ODEA 1T5HX 4X7MA 4FGJA 1XZJA 1LRLA 3G0OA 3G8AA 3LUDA 4DDMA 2BI4A 4IMJB 2OUKA 2ZQ5A 4NABA 3V2IA 2A14A 4DSZA 3BILA 5AVKA 5FX2A 3RAJA 4BFTA 5FUXA 3N6RA 4D9CA 2XGGA 5BN4B 1UFKA 4FVTA 4Y2VA 1QRUA 2PSDA 4M0DA 2H4JA 1IE3A 2FVYA 5K1ZA 3NNDA 1B76A 2G8NA 5LMNB 2P5YA 3C3BA 5DXFA 4WLNA 1CY7A 1QZ3A 2R25B 4HN4B 4U3JB 4TKUB 4DG8A 2MCFA 3TQOA 3LCVB 3W2GA 1V4NA 4ENUA 5GZ3A 2W2TA 3GJSA 3K0BA 2JGKA 1HO3A 4K9PA 3V4VB 4IZ6A 1T34A 3GB9A 2IUYA 5E6RA 4HNRA 3U7RA 5L3QA 4ALJA 4FWIB 2HUPA 3HFRA 3WLFA 2KBEA 1XDZA 4X20A 5BPFA 1XDWA 5DGXA 1OI7A 1XN1A 1A9QA 2PMWB 4KWIA 3RHFA 1B6SA 1JQKA 2DFKB 3H9JA 3OCZA 2PBZA 3OHPA 4J9VA 4MWTA 3DO6A 2RHJA 4ZTUB 2E4UA 1ZQ9A 3VDNB 3IUBA 2QTAA 5A7FA 3FOCA 3N7UA 4MGIR 1OB2A 3ZD9A 5IAAA 1DQPA 3G0DA 3V1KA 1GZ4A 1MX3A 3MJ4A 5DGDA 1AKVA 3F9CA 2CXPA 5T8KA 4I2NA 3GHHA 4CKCA 5A02A 3H75A 1C5KA 1QRDA 2CXTA 3HDGA 2PRIA 2IXEA 1ISPA 1MXHA 2H17A 3FVQA 4K46A 4YJ3B 4CL8A 3U4QB 3IXMA 4JI0B 2GS9A 3D2BA 2CNBA 2NNWB 4R7GA 4YGYA 2UUBB 1SG9A 4ZAYA 1NVMB 2B1RA 1RWBA 1CUJA 4OO3A 3RSSA 4B76A 3HY6A 4OGFA 1YJXA 1B2LA 1VPLA 3VMMA 4GM0A 1NBME 3AU9A 4PWZA 4Z3DA 2A6PA 4D1YA 1XPUA 3CR8A 1N2EA 4J1TA 4YAOA 4DZTA 3QI2A 2B36A 2O3RA 3ONWA 2QSZA 3ENZA 4IDPA 4YMIA 5D00A 4LOKA 4N47A 4BNNA 4DCUA 3QMMA 2BFBB 2WYUA 3X1JA 2AW5A 5LN1A 1NTOA 1Y3IA 4EVRA 4QU5A 3HUFA 5J59A 1KU0A 4KRFA 1EX1A 1FFDA 3JSXA 1IZYA 1VBKA 4JODA 2PXCA 2J31A 2ATEA 2W11A 3CHYA 3LT2A 4KHZA 4M1WA 4W9RA 1U0GA 4FOLA 3K9WA 1H5QA 2C20A 1SULA 1WZNA 3TKYA 3FGNA 2I55A 4FYHA 1USUA 2X2EA 3GGDA 4I4LA 1Q19A 1GPJA 1TO2E 3LF2A 2ZB7A 3C6BA 1ADYA 3GAAA 1YDFA 1VLQA 2FEAA 4QASA 1P9WA 4U8HA 4C4RA 1N0WA 4H1WA 2FPGB 4U7FA 4JVMA 3OTQA 3OC0A 3W3AA 2ZWMA 2XB8A 4MEBA 3KQLA 5LYJA 4GNKA 4MW7A 5EQJB 2QX7A 5KVAA 3DHEA 3PIRA 3O47A 1H2YA 4R1QA 3T1QA 1ZMRA 1EGQA 3IMFA 3PF8A 3SG0A 1NVUQ 4DM7A 2XD4A 3L9XA 4NCXA 4F3RA 5DOZA 2J4FA 4H4CA 3SD7A 1T5BA 4M9RA 5DTMA 4C29A 3DEJA 4NOMA 5FHQA 1DBVO 2P62A 3PPWA 4GQAA 4TPKA 1YBFA 2V6MA 4IKEA 4J2OA 2CJWB 1XYGA 5DGIA 5DNUA 4NU8X 2NAPA 4BX3A 1CSEE 3QPCA 3QW2A 1Q21A 1SQSA 1JG7A 2WU4A 2PGDA 2ZU6A 1Z0DA 4FYIA 3U0BA 5TNXA 2MSKA 3CEHA 1P2FA 2K5UA 2R4UA 3FLEA 4IHJF 2XVYA 4PZ0A 1T4DA 3OZRA 2P6UA 2WJPA 4IIXA 4BJ3A 1Y8CA 3SJZA 4XLLA 2CD9A 1CY6A 1ZGJA 3FY4A 2ZRNA 3TZ6A 1TTPB 4G1UC 5IM5A 4PPYA 3BXFA 1KRWA 1RDFA 4M54A 4NG5A 3ORYA 4RXUA 2F4VB 2GM9A 2H4YA 3ZZ1A 3HI6A 5EIBD 5I7WA 1J90A 3QM1A 3SLKA 3V80A 3ZE9A 1NW4A 3FGZA 3NFRA 5C7YA 4BIIA 2WD8A 4D3DA 1C8KA 4Q02A 1IHPA 3VSAA 1Z2PX 4F9TA 4KQ9A 1NVVQ 5E7MA 5IAJA 4F7WA 1BVYF 3DJYA 1L4GA 3UT5A 2ZOSA 2G09A 4AUMA 2IS6A 4AI6A 5FOQA 3QVTA 1OBOA 1FTWA 4XIYA 4TSKA 5CBKA 5IK2D 4OLAA 3T34A 4DMGA 1XZDA 3SOPA 1UBSB 1CR4A 4Y9SA 1W0KD 3KYJB 3O4RA 1RW4A 1T1GA 1HL7A 4J8PA 3K9GA 1J33A 3DE3X 3PI6A 1KVRA 1W73A 3GZ4A 1RWQA 2JFFA 2ODAA 4QFDA 2Z2ZA 3VJMA 3RYHA 4CQNA 2E1PA 4MWSA 2ZDGA 5LXTB 3M5CA 4IJ5A 3UWMA 4J43A 2DEUA 2YR0A 3I83A 4K8OA 2ZSFA 3EGXA 1RHJA 2WQ7A 3ELUA 1D04A 2WR8A 4KO8A 2CVOA 2XAAA 3R74A 3QBTA 1US8B 3I0MA 1QTQA 1X1DA 2ZYUX 2V4MA 1BE1A 1U1GA 4L16A 3CWCA 5K3DA 4KO4S 4IFBA 1UF9A 3UXEA 1Y7TA 4MS4B 4PHFA 4F12A 3FNBA 2MYUA 5HTKA 2X0IA 1YGYA 3ADPA 1H1TA 1PZMA 3LMKA 4R3WA 4N7JA 2JNWA 3NHYA 4UBLA 1QC5A 2DTDA 1RQ2A 2XCUA 3QQPA 3ILSA 3SHOA 2COKA 1G1MA 2Y9PB 1C1DB 4RQAA 3DVLA 1NRJB 4P7GA 3VBEA 2I8CA 1I9GA 2IODA 1MX5A 1X0VA 1C1XA 3LP5A 3AHDA 2O6HA 5WRFA 5ECWA 5KTOA 5DP1A 2OHIA 4OMUA 3SXUB 1B0PA 1XXLA 3EDCA 2QW8A 2Y3IA 5ELMA 3GBSA 3VZRA 5E1MA 2QXTA 4C2UA 1ZNWA 3FGOA 4LZLA 1ZM4A 4YIKA 3AFHA 5DX1A 5JR3A 2IEBA 2A0WA 4K88A 4LBWA 4MDYA 3PEWA 4XFKA 4DLVA 3FZYA 5TS2A 4UUNA 4GKKB 3WJAA 3J81k 1BJTA 5EHNA 1S5PA 2XE7A 2IQ5A 1Q1AA 4A6EA 5CDUA 1E3DA 1O4VA 1NY5A 4QRDA 1EK5A 4MW0A 5JDCA 3W7VA 3SS7X 2YYAA 3IC5A 2W2KA 3ZG6A 4TOIA 1XB2A 3K4QA 4DRXA 3HE3A 4JGGA 3ZHTA 4L50A 1YJBA 1FFWA 4OV6B 3C3YA 4YMLA 1DMSA 1NBHA 3E9RA 2QMZA 5B4VA 4RE6A 3PNMA 1A69A 3VR6D 4V1CA 5JMWA 4C7OB 2RHGB 5I48A 2GJAA 2QGNA 2XY4A 4LOJA 3I9NA 3OBIA 3L8DA 3DPIA 3TG8A 4U2KA 2GPSA 2YXPX 3RJZA 2FV8A 3U13A 3V3TA 4EI8A 4CIXA 2B5WA 4MRSA 5CVTA 2PJZA 3AI1A 2FFBA 2RGYA 1IIRA 2REBA 2PS9A 2YQ4A 4QREA 5J2UF 4M1ZA 4LBVA 3UCXA 4BMPB 4NNJA 4R69A 3B36A 4F1KA 4OQLA 4IGFA 5F2NA 1P7WA 2VLIA 4W5JA 3Q3CA 2VWPA 2FEXA 1C2TA 2CC2A 1JILA 3R7AA 2C0QA 4TRNA 3Q3JB 1OAAA 1XPOA 2KSQA 2ZAIA 4FT4A 3LT5A 5E4TA 2D0PB 1UBNA 3LUKA 2A0FA 1MPXA 1N7IA 4RGYA 5CH3A 4UBMA 5DE3A 1RBZA 1S96A 2P4HX 3I05A 3NH6A 4KC0A 4GW3A 3FCSB 4UC0A 3WGYA 3NHFA 2QS9A 4CT0A 4D46A 2VYVA 1E94E 2FSVC 4YQZA 1KBOA 2YW9A 3REFA 2WWXA 4Q37A 4FWTA 5FAXA 4EQ6B 3C3WA 3Q12A 4N0MA 4HCJA 1MGPA 3LOUA 1JHYA 1X7XA 3P9RA 2IZOA 5IH7A 1HE2A 5D85A 3L01A 2OFPA 4KVFA 1E59A 2B4TO 4ZHQF 1O54A 1JHZA 2EJTA 2JFZA 4N41A 1B3RA 5HSGA 5IULC 3FOEC 4KR3A 2IV7A 1U0HC 2OAEA 2QL6A 1GLGA 2ZJ2A 2WJWA 2HJSA 2PXHA 3AEZA 3AR4A 1M8JA 2O7VA 4R71A 4PLWA 4L07A 2BFEA 1Y3HA 4ZGWA 5SZJA 5JS6A 1QAOA 3DBVO 4R81A 1BQ3A 1JR6A 1V5WA 3MS4A 1EGMB 3FMGA 4A10A 1C30A 4WJKB 1F1BA 3RAGA 2O8FA 1JNXX 1LRJA 4C7VA 4ITUA 2VSNA 5J1SB 4B6EA 1NXSA 4PQYA 1AUOA 3GVCA 3CEPB 2HMTA 4OA8A 3A0RB 4HPXB 1H2EA 3TTVA 1I4TD 4BVJA 2IS1A 2C2WA 4K6CA 4D5GA 2WZBA 4H7EA 4KEAA 4D42A 1QVVA 3DCIA 3IVGA 4MWZA 3HCOA 4MP3A 3P4XA 1LLQA 1LDNA 1M2VB 4NX2A 3HEMA 1JDVA 2COEA 5CEJA 3A9WA 5HOEA 4R1PA 1CWUA 2WIJA 3IAM1 3ND7A 3JARB 4LW8A 3LIIA 2K2QB 3TJZA 4KL8S 3SEFA 1AKNA 5DM1A 3BIFA 3H2KA 2QE7D 3OTHA 4NZ9A 2XF8A 3U3MA 1J1UA 1Y8QA 2Z6VA 2EV9A 1LNSA 2AF4C 4A27A 2OZLA 5AOBA 3FE2A 1MU0A 3D3WB 3NBZC 3NEYA 4LNUB 1SA0B 2ODNA 2BRUC 4LWZA 3SGLA 1NA5A 5JIBA 3ZZNA 3ZQKA 4EFDA 4LJ4A 5CB4A 2Z3ZA 5JRDS 4ZOEA 3C3DA 3UMSA 4PGHA 3TNYA 3L4BC 1L4EA 1Z6TA 1V8DA 2TMGA 3R23A 3UTDA 4DA9A 2X0JA 3FSGA 4QFBA 4B31A 4FNAA 1QU3A 4FZRA 1AHNA 5NULA 4CLDA 3IELA 1VBNA 4WOBA 2FW6A 2V5VA 3AR7A 5BVGA 3QX3A 1LTKA 3PTLA 4GLBA 1CFZA 5KQPA 4RZ2A 2I3DA 3RANA 4OQYA 2NZYA 1MVNA 3BJRA 3DTNA 4CLEA 1CUXA 1E4EA 3PQ4A 2HDNB 4U2GA 2V3VA 4B0OA 3V4FA 2GN4A 1L1FA 4U39A 2P9EA 4XCVA 2ZAGA 5KYWA 4JQYA 4KE7A 5DTQA 3B20A 2Q9CA 4XRRA 1CIVA 4ZPJA 4UE3S 3L7KA 2ERXA 3SF8A 3A14A 1OI2A 1WNFA 1BE6A 1K98A 3U3DA 3WRVA 4JQCA 1SG6A 2VNJA 4UQOA 2G1KA 3EVNA 2J6BA 1SC4A 3F9RA 5DBFA 3IMEA 3L8FA 1O94A 1FQJA 3C2QA 1HT1E 4S35A 3T3GA 4LYDA 2VYND 1GCUA 2R6JA 4OY3A 3A6DA 4F5YA 1H6BA 4QQKA 2J5BA 4OBXA 3OKAA 4TL9A 1KHTA 5DRYA 1UKCA 1LSOA 2UZ4A 5J4LA 4ZU3A 2QRUA 1JQ3A 2FJPA 1E2QA 4QVKA 2Z4RA 2Z2YA 3DAHA 5LA6F 1ZH6A 3JYQA 4FE7A 1ZAYA 5FI0B 1D2EA 1QWSA 1P0PA 1O5IA 1XZKA 1R4AA 4YRLA 1POXA 3OOJA 5JBQA 5LQDA 5HFAA 5AVYA 1UIRA 2P9CA 3H6KA 4Y0VA 1DDGA 1N9ZA 3COSA 1B4DA 4MEAA 1NASA 4PNPA 4AIRA 3DV9A 3SJCA 3AIKA 1TPZA 2WJHA 3RUCA 4IX1A 4PY2A 2HN9A 1GZHB 3COVA 2WT8A 4R4JA 5K4AA 4A0QA 2QQ5A 2O8CA 2GWRA 3JD1A 1G8FA 3DFMA 4JC8A 4NYMR 3RKRA 4D8WA 2FW1A 5DP2A 4B85A 2X86A 4ZVKA 3V5NA 3WHIA 5GM2A 1Z9BA 3LPCA 3OOEA 1TQ2A 2JFBA 4COOA 2H65A 1ENPA 4DEXA 2FWIA 5H0IA 4RTQA 1YDGA 4Y98A 1FMTA 2VPQA 3UW3A 1KSJA 3F7NA 5KDOA 3FVTA 3ZWPA 1QIHA 3H9UA 1QGOA 2C5LA 3JQBA 4AJ1A 4BIMA 5CB0A 1K6JA 1UOEA 2YVKA 2CV2A 4R05A 5KJ1A 1QLHA 1QLJA 1AUPA 1H3NA 3UA4A 1DBIA 4KPFC 2H52A 4WBSA 1DJNA 3PQ7A 4ME6A 2QAGA 2VP4A 2X8WA 4RESA 3RJ9A 1RM5A 4FQ8A 4FOPA 3MCVA 4IJWA 4MA4A 5ARDA 5EZ5A 5JV5A 3ICCA 4UD2A 1JKJA 3GOQA 2F43B 1XU4A 4BQPA 3Q8LA 1GGMA 4NJMA 1RKUA 1M1UA 1YE5A 4DMMA 2VP9A 2IS4A 4LPKA 1G7RA 4CM8B 2KX7A 2C07A 3ZGXA 3GUZA 1QKIA 2PXXA 3ILHA 2A8YA 3VNSA 2PT7A 2FB9A 2XYGA 3R9XA 4Q4DA 4XSHA 4Y9RA 4RFVA 1T0HB 3ULKA 1VHLA 1ZOPA 2IF0A 2XYHA 3GDHA 3NFYA 5SY6A 1OX4B 1IUKA 2R1VA 3P2IA 1RAAA 3W04A 2AH5A 1AKRA 1V1RB 2AR9A 1WL8A 2PIAA 3A1DA 4PIPA 3LHDA 4BFCA 1XK6A 2G1JA 2F3UA 1IULA 1JSLA 1HRKA 1G4HA 1IBSA 1XU7A 1BEZA 4R41A 4Z9FA 2PWAA 2PH3A 4OYYA 2ZROA 5T4BA 4REQB 4J76A 4Q03A 5K6AC 4JT4A 2UZ0A 2GHRA 2N46A 3TIVA 5JCPA 4DJDC 2VTVA 2VHYA 4MJXA 4KQMA 2FF7A 4BO7A 2R5WA 3GELA 3TIFA 4AS1A 1GYQA 1V96A 1L7QA 2NYAA 1VLHA 2GEJA 4L9RA 3IVXA 4M36A 2CMHA 4C6SA 4CKEA 1D03A 3FYCA 4G0XA 3VC7A 2GPTA 3F6BX 1M5TA 5A4MS 4P5PA 3IMCA 1P4JA 5IFLA 4B3RB 1XF1A 3ZJTA 1MNQA 2C00A 1XTRA 2N47A 3G6KA 5KQSA 3G9QA 3VPHA 3U7GA 2ZE7A 1R1DA 2QRHA 1CZRA 4KJXA 3D81A 2V8BA 5H5JA 3H9EO 2EKLA 5EPOA 1D7AA 4ENWA 1JEOA 3F3YA 5BT8A 2ACWA 1WUIS 1GCOA 1LDGA 2ZFUA 1K08A 2REQB 3KELA 4GPIB 5GINE 1Z25A 2CXRA 3EZLA 1PZEA 2BL4A 5CGQB 3TDMA 4E5PA 4XPIB 3I6ZA 4KVZA 4I1IA 1P7PA 1P60A 2H6EA 1KJZA 3L8EA 1KI6B 4LECA 4MRNA 1VXRA 3QNUA 4R2KA 2YV2A 1E89A 1P1RA 2IIQA 5CNJA 1HEYA 5IC4A 2GSWA 3K9FC 5KOHB 1A4IA 3DQZA 2QY6A 3BFKA 1E9VA 2DSTA 4HDOB 3QVWA 1OZ0A 4DA8A 2CN1A 5LU8A 1RQXA 2CY0A 3OP1A 1RI3A 1RWKA 2RAVA 3OTGA 1DRUA 1AV7A 4TYMA 5F2KA 5FOSA 5DYGA 5FPYA 4Z49A 2ZT7A 1DTEA 2VUSA 4LYFA 4JD5A 4DM4A 5KYUA 1J2EA 1U8ZA 2XVZA 2Z5GA 3FGPA 1GPNA 4IP0A 2NT3A 3U17A 1E61A 4F2DA 3GJ6A 3UUWA 3A1FA 2QRMA 2YJTD 3R8XA 3ZE7A 4D9EA 3Q88A 4DBZA 3ORRA 3EQ2A 4NC9A 5BN5A 1OYOA 1P4AA 2JRCA 2XAUA 4GWKA 3BMNA 1OT5A 4Q39A 2V7WA 3AOGA 3JAWB 2OBNA 2UZIR 4PHCA 3BF8A 4EJ0A 4ARAA 1CEEA 1RYMA 4Q9HA 3NO4A 2II6A 1ARZA 2E4AA 4DCVA 1CQJB 4DDVA 1FW6A 2W6JD 3GAZA 2AUTA 1GTSA 3FCCA 4GP9A 3ESCA 1J70A 1HLFA 3KLOA 3ZD7A 4W1QA 2Q4EA 2XKAA 4BAUA 1OY1A 3QKTA 1Y1RA 1P9LA 1QVAA 3FOBA 3K30A 1O4WA 1OBCA 1HZZC 1L4MA 5EZQA 4X95A 1I94B 4INAA 5A5EA 3AG6A 4RTPA 2PLRA 1M1YA 1YB2A 1S2NA 3GRZA 4D5EA 3MT7A 4OYLA 1GR1A 1SZJG 2OLEA 2P9QA 4M9ZA 1ODLA 2C2KA 2C84A 3FW1A 3S2EA 3HVKA 3SZGA 2EJUA 1D4AA 1KEEB 3E7WA 3NDPA 5ALIA 3TEFA 4BKRA 2C1ZA 1EZ1A 2X4DA 3PXEA 4NG4A 3ZLVA 1DAHA 1AHHA 1V35A 3DMTC 1H2XA 1NRXA 3DE5X 3LE8A 5BQOA 5T3UA 4D97A 3HI4A 1TA0A 3SY8A 2PX6A 4D0SA 1MD9A 2B7CA 1GNVA 1EQUA 3IAAA 4J90A 2OSBA 3JATB 3KYDB 4R98A 5GY7A 1OU0A 1L4UA 5AIAA 4DQDA 5ADVA 3DZIA 4NCIA 5SZKB 4ETMA 3C3AA 2ACVA 3N86A 4G01B 1IVNA 1QV6A 4ZQIA 3GBVA 4UM5A 4BCDA 4MMXB 4EGQA 1P5RA 1Z56C 5A2GA 3OOSA 4YJGB 3ET4A 5L3SA 2B6NA 3EEQA 2QLBA 2EZ8A 4P31A 4V38A 4G2TA 3GPBA 3X1MA 5KNBA 1IUOA 1ULUA 2B94A 2PQ2A 1KOGA 3CE9A 2E48A 1LH0A 4FEGA 2VK1A 5JSKA 4BVFA 1NPTO 5IN5A 5KHLB 3FCUB 2H63A 2EJBA 1JMVA 5JHHB 4DMFA 4BY9E 1OR8A 1NW6A 3RSZA 1R0YA 2F1IA 2VP3A 3ANLA 3EODA 4BNGA 4U5QA 4ZIRB 3HWRA 3SJAA 4MV0A 3H13A 1Y6ZA 3ROTA 3U81A 2X22A 2V7EA 1T2UA 5CVCA 3E61A 3L8CA 2D5CA 2JAOA 3BDIA 3G2HA 3X1KA 3UPTA 2EP5A 1XKQA 2PSEA 2GRAA 1HLPA 2WYOA 1JEQA 1LJUA 5TF4A 1P1JA 5DEOA 4W5QA 4CU2A 5A06A 2JIBA 2YIDA 5LNK1 3FPLA 2QLTA 4D6PA 3HFGA 4DLAA 5DLEA 3A2MA 2OILA 3P94A 3UJ9A 3IS3A 4E4RA 1SXPA 2VAPA 4UNNA 2EKQA 2VC2B 4IPTA 1K0UA 3PNLA 4JJZA 2PWZA 4QBTA 1JKFA 1WMAA 1NW5A 1E9SA 2YZMA 3WBFA 2XZDA 2E4XA 1KYWA 4DWVA 3B82A 1G21B 1GUDA 1U2ZA 4BP8A 4ZD6A 3P9XA 4O4HA 4P4UA 3QWBA 4BNYA 4G37A 3LUAA 3SBOA 3H0CA 3RT1A 2BONA 2WOJA 1K2VN 4G85A 5HUHA 1XFDA 4MR9B 2GO7A 2YV4A 1YIAA 4I1RA 5CTJA 4Q1FA 1TUGA 2XZTA 1SMKA 1VG0B 1B74A 3E3NA 4N8SA 3D7RA 1VE6A 1OYWA 2GARA 2GA8A 1BWRA 1WCIA 3H4MA 2D4HA 3KKNA 1IXZA 3KFVA 1XL0A 3KOZA 4LSMA 4BPBA 3WQQA 1DZ3A 1F8GA 3A3NA 3ZE2B 1H4QA 3O4JA 5A7HA 3JYNA 3OURA 4UCWA 5KX5B 4FHDA 2OHXA 2WA1A 2FMUA 3A36A 3KOUA 4GEGA 2IZ0A 2OT3B 1GPAA 5IPFA 2XMCA 2PTHA 1W5SA 3MPOA 2D0DA 3AYXB 3MLEA 1UINA 5K3CA 2AOTB 4P5DA 2G6TA 3NTOA 4EY4A 3W8RA 121PA 3ZHQA 3SN6A 5EHXA 1CRWG 3GLHE 2PZAA 4D80A 1DIOB 4U3JA 4X66B 2VJYA 1U2GA 1JLHA 3NALA 4NZYA 4L27A 5EUMA 1RVV1 1JFFB 2D13A 3IGFA 1AB6A 2J85A 2R9VA 4BVLA 5C53B 4E03A 2NO7A 4RLSA 3TNFA 4JLBA 4LSGA 4UMFA 1Q6ZA 2P9ZA 3ASZA 1E3QA 1P7CA 1SQ6A 1N7GA 4EJFA 7ADHA 3ZKWB 3FUCA 1QNLA 4CIYA 2N1MA 4Z0HO 1VKRA 4DV4B 3LC2O 3WMGA 3SVLA 3TQHA 8ABPA 3AHCA 1AX9A 3G0BA 4Y6PA 3V1MA 1REQA 3BXEA 3VHRA 1P19A 4OKSA 4OHZA 2AZTA 3F2VA 4PVCA 3QQ5A 2P6PA 1CE8A 3VPAA 1K66A 1JZQA 1GXSB 2K4MA 4PAGA 3U4QA 3SSMA 4V24A 2AFIB 2LV8A 4GBMA 5AI5A 2C8JA 2F9LA 4BZPA 1ISIA 3MT9A 4CLOB 1NJGA 3HYTA 1MR3F 3GRCA 3VYUB 1TTTA 2GQ0A 3F1KA 4MW6A 3DZ8A 2Z4TA 3RPEA 3M1YA 3ZHOA 2OXRA 5HTOA 4CMEC 5FF9A 1BX3A 1GAWA 5I01A 3KYCB 1E2HA 1EFRD 4QWWA 5TGTA 4PBTA 3ZU3A 1E1QD 2P2LA 3LT4A 5LJIA 4XZ3A 1Z12A 1N32B 2P68A 2ERCA 3ITEA 3KCQA 1TKRA 2ZJ8A 1ISHA 3DF9A 2I1VB 4YDRA 3GT7A 1RPTA 4JSTA 1YR8A 1RYYA 1C3OB 5C37A 5LUAA 1MT0A 5LCXA 2X6RA 4UQPA 1L7EA 3EJ6A 4K1XA 4K2AA 1WY7A 3UFXB 1MQ9A 4GPEA 3ZEIA 1D09A 3P9KA 4ZGGA 4LIPD 5JAHA 1KA9H 2EIHA 1E3TA 2ZJ7A 5IDVA 4CL0A 1DFGA 2JLBA 2R8YA 2ZULA 1H1LB 3BHNA 3QXCA 4LZAA 2OBMA 5D6NA 5KWVA 2OO5A 1E62A 5IK2A 4KO3S 1RWPA 1IQUA 5DNEA 3WQRA 1W0KA 5CK5A 2FPGA 1XKLA 3OLZA 4PC3A 2JH9A 1YL7A 1TM4E 1MEJA 2PRYA 2V7BA 2QLNA 3C7DB 4PM4A 3HN6A 3MJFA 1YACA 5ALJA 5KNCH 3U3KA 1XZMA 4ZCTA 1RYZA 2VF2A 3FSRA 1FZTA 4W7IA 4UPVA 1UWCA 4N49A 1O9BA 3HGTA 5B1EA 3PJEA 2DWUA 4JNCA 1U8FO 2MT9A 1E0DA 4QJ3A 3UUEA 1Z36A 3GLGB 4GYWA 3O8DA 4U5XA 3K2IA 1H9BA 4EEKA 3EUAA 4LOIA 5TS3A 8LDHA 1I6MA 2B5VA 4D92A 2CJWA 5IUNC 3IAS1 3KKPA 5M7EA 1R50A 1QB7A 1Y4AE 4ZO4A 5HX7A 3GVPA 1YB1A 2QF7A 4KLRA 4O3MA 3C15C 4BN4A 2J41A 2M6SA 4N0QA 2OXTA 1S0UA 1OV6A 1UP4A 2N3ZA 2ATXA 5B58C 5DCUA 3WGZA 1WD7A 1DDIA 3DOIA 5TDHA 1J2TA 1MB9A 3HA3A 3QVVA 4Q1DA 5JYBA 3QEBZ 2D6FA 2O0LA 1F7VA 2A0YA 5LQUA 1HORA 4IG4A 2ZRCA 2H8KA 1RYEA 3JWEA 3R7SA 3RIXA 1EJ0A 1XE3A 5JG7A 2R8XA 3JCZA 4F4JA 3K0SA 3E8XA 3G82C 2WBLC 4NK5A 3ADOA 4TTPA 3SJBA 3WHLA 3G59A 4F9EA 2GZSA 4WRRA 4JY7A 4CIDA 2XOXA 3WLRA 1I36A 2J67A 2PKQP 2VSXA 2YMQA 4MR8B 4I50A 4X9XA 5CPBA 4WXHA 3GCGA 1Q12A 1UMDB 1ESDA 2FE1A 3QJYA 4BO3A 1TEHA 2YY6A 3IAEA 2HIGA 2WK1A 4HY3A 4L4XA 2G1PA 4P84A 1OLXA 4LDQA 3OECA 1A8UA 3FN4A 4ESHA 4XWOA 4ZT2A 5D01A 2FTKE 2P5UA 2XGMA 4Q1AA 4W9MC 1IEXA 2ONZA 1EEXB 4WH0A 3ZV5A 4IS2A 4R9UC 5B30A 1WB6A 4X5OA 3GH1A 4R8SA 1JHQA 3T8YA 5LXTA 1JN0A 1TB4A 4M1YA 4LF6B 5JZSA 4RL6A 1KWGA 5CD1A 4N3AA 3LYUA 1E5LA 1N8NA 1YSCA 3SC2B 1XDDA 4ZAZA 4ENVA 2B1QA 1FRVA 4IQ8A 3SHTA 1RHQA 2B78A 2R751 2PS0A 3UKOA 3GRAA 1US8A 1ZJZA 4M3NA 5I7EA 4NBTA 1JFVA 1X7HA 2R84A 4H17A 3ZWVA 2VK8A 4M86A 4L9SA 3GCDA 4WUTA 5J40A 1IN6A 2FMKA 2OB2A 5BMVA 5ARBA 1GILA 2YNMC 1L6IA 2X8BA 3OJLA 2H18A 3PXXA 2JD1A 2RGEA 4R5MA 1U9IA 2C9CA 2FLKA 3IPXA 2WG0A 3MGCA 3E05A 2AFHA 5FFFA 2NU9A 2VEOA 2XZOA 1PQPA 2E89A 3A6GA 4RK5A 1JXQA 3R3VA 1SPXA 4O4JB 2AOVA 4TLDA 4UJ5A 4OI4A 1C1DA 4A9AA 2JLAA 3ZX4A 3HJGA 3HUEA 4QYMA 3HPQA 1R37A 1TQHA 3E8MA 3GZJA 4UXHA 2HNAA 1KS9A 2QP9X 3A58B 3DONA 3WRXA 1LSJA 1YDEA 2P9GA 5FADA 3SXUA 3UWOA 2CE2X 5JD3A 5IDQA 4OK5A 4BMOB 1KI8A 3C6QA 4II7A 1DFIA 3GEPA 1L5QA 2I6GA 4RK1A 1KRXA 2OLJA 2YHBA 5F1YA 2X2PA 1TECE 2WVAA 4RK7A 2DLDA 3KVYA 4EG0A 5A4AA 3EPJA 1P0IA 1E2MA 1HZJA 3JAKA 3NV7A 3MJTA 3O9ZA 2BHTA 2LGJA 3LOPA 1T9ZA 5H80A 2O48X 1I2DA 3I04M 2NQ8A 2GN6A 3UNXA 1ACLA 4WKBA 4EI9A 3RD5A 1Y4SA 4QARA 4YV1A 2G5TA 3WKEA 3HJTA 3WRYC 4AKGA 2B99A 4U1RA 1F8UA 4GRDA 3S40A 3UWDA 3ZX5A 3AHGA 4CCWA 4BPRA 5AFSA 2VJCA 3EA4A 4WTOA 3SQMA 2O7QA 2REXB 3DM5A 4C7OA 3I73A 2JASA 1LNZA 3KJEA 1IWBB 1QHHB 1M1NB 1EBBA 2EYQA 3LL4A 4EHAA 4AJ2A 5B1YA 3G85A 5KI6A 5HFJA 1ZK4A 3BWMA 3TLMA 1DIRA 1Z8HA 2BEWB 2XMZA 3HBFA 1JSRA 3RC7A 2QE7A 2IYUA 3DDZX 1X7WA 2IYZA 3ESZA 3HXTA 1TZBA 1C7FA 2RJ3A 3KCNA 5B3LA 2F8TA 3FYHA 2DLCX 3WK5A 2NV2B 2WAOA 2H5EA 4JMLA 5H70A 2YW2A 4HI0E 1ANKA 3I6IA 2HPZA 2QD4A 1K6MA 4LE2A 1YL6A 4L4YA 5DNWA 2F3TA 4DL9A 5LC1A 4DREA 3C97A 2LRHA 2NQTA 1ODCA 2BWJA 4TTIA 5CDTA 3KQYA 4G9BA 4MCAA 1UBHS 5TRTA 4B2YA 4RIEA 2W8ZA 2ZRPA 1YB4A 3KYIB 3PHJA 4FMPA 3KALA 2XRZA 3L3BA 3C6ZA 1JQEA 1NF3A 4QYIB 3KZMA 4K9NA 4YRIA 1LI5A 4FQ5A 4QQFA 2AX4A 4E14A 1EQ2A 2IH4A 5YASA 2C9YA 3O4GA 2BFWA 4WMLA 2QVYX 1H05A 3BSWA 4UPDA 4KE6A 4ZYWA 1JLLB 2QUKA 3OEED 1JPVA 1ODJA 3QELB 3NEPX 4QBKA 3T7KA 3WIUA 4DVJA 3T1VA 4JI2B 4RD2A 4G1MB 4C4XA 1OI4A 5IT4A 1QDLB 3RU3A 1O6CA 1Y3FE 3DT8A 1EVKA 3MJDA 1B73A 3BF7A 2HI0A 1G5PA 4Y0NA 1XMVA 3RNLA 4DYVA 5K7SA 1FMLA 2IHZA 2XMQA 1J1ZA 3ZCUA 1X80B 1D0VA 3IUEA 4PC2A 2BI7A 4JQOA 4EO9A 3PQFA 1KORA 1ZI8A 2Y27A 3BD6A 2RK3A 1NIJA 5FCDA 3UHFA 3DXFA 3CLTC 1MJGM 1LS1A 3O94A 3KJIA 2J7KA 4QATA 3D31A 4B74A 1R0WA 3V8NA 521PA 2VYNA 4M99A 1NZDA 2P77A 3H5NA 3ELBA 1BHSA 3KR1A 1MO3A 4ER6A 1M2VA 3CH5A 3L7NA 3MHPA 5F1OA 1I4WA 3PXUA 5BNIA 5J2TA 1OI3A 3QF4A 5IF9A 4O3FA 3PJFA 4R8KA 2QPLA 1N6NA 1RAHA 1NF9A 2RHBA 3E3LA 3I04A 3QLTA 1UFQA 3WWCA 2W90A 3RCBA 2FN3A 1TVKA 5K0CA 2RGBA 5GM1A 4EVIA 1KO1A 4IUDS 5HM8A 1G8KA 3HS3A 1HFEL 4QPPA 3D3WA 2CVHA 4LNUA 1SA0A 4AKHA 1IHOA 4H0NA 3KQPA 3TNLA 2FZCA 4U2CA 2CZQA 4I1YA 5E95A 4IGKA 3R44A 2VQEB 5D1NA 1CUDA 1G2PA 3CRVA 3DH0A 3IB6A 1A71A 4GNRA 5HJ7A 5BSTA 2RHTA 4EW3A 3M6XA 2AKAB 4NH0A 4TV9B 1ZISA 2R2AA 4M60A 5DB4A 1YMQA 5LP6C 2BLLA 4EYSA 1DT5A 2CLLB 1XU9A 4FGWA 4MITA 1FW8A 1WMEA 4ZHQB 5A9SB 1WNTA 3K70C 2G9UA 4G3XA 4YUVA 2GETA 1T2CA 3ZOZA 5EC8A 2VNKA 1Q2UA 4O1MA 2Y93A 4JL5A 2E37A 4Y6OA 4RTOA 2Q62A 3PHLA 2Y99A 4K87A 2DCUA 3F74A 1W85A 1IZ8A 4H4EA 5KTNA 3E7FA 4BEWA 4PYOA 1LW7A 1HMYA 4KI0A 3GGOA 1GYRA 1M6NA 2XA2A 2O59A 4LV8B 1TK3A 1DWQA 1NWHA 4RMGA 1W4CA 4IJVA 3SYLA 4DLPA 4NSNA 3LJKA 4URXR 4Q1EA 1NAHA 3JQEA 2J0EA 2WP0A 3S5UA 4A0GA 3G2LA 3H9BA 4KIGA 2JLSA 2NZXA 4TYYA 1Z0ZA 2CHQA 3DOCA 5IAGA 4MS3B 1E9BA 2D3WA 2ENWA 4YCDA 3LBNA 3A11A 3SS9X 1LDYA 1TZMA 5HF5A 2HSJA 4E5SA 1JWBB 2HU5A 4MV7A 4IWNA 4N0PA 1U31A 2LIVA 1TIKA 4E51A 2C7PA 1H93A 3O38A 3F4KA 5J23A 1SU6A 8ADHA 1MRSA 3T35A 5HYVA 1AZTA 2BE9A 3OMXA 4Z0PA 2H9AA 3CH7A 3GQVA 3GX1A 3N0WA 3PDIB 2NXWA 1L2TA 1KYVA 1DO0A 4N0DA 5EQTA 1MOSA 3ON5A 3OCUA 1WXQA 3VC1A 3UXMA 5BWCA 2QIPA 2JDID 3AXTA 3BS4A 5JY1A 2BTEA 1W36C 4R2MA 4HLCA 4N54A 1K8XB 4QU0A 1RE0A 4W82A 4M0UA 5IKPA 3EXAA 1U4NA 1JQAA 1QCYA 3KSDO 3PSHA 2I6SA 5IKEA 1QFZA 1Z18A 2WSMA 4CF4A 5JEDA 4B4DA 2KM1A 3H1AA 5ECGC 4C87A 3H97A 4EUHA 1RM0A 2RJOA 5IJ9A 2J0VA 1B1CA 1KJWA 2VPYA 4F6RA 4QGGA 1AB5A 4LY6A 3UKDA 3QY9A 4CFSA 1NLZA 1VPDA 3HJUA 4PZUA 4I8IA 3OIGA 4I4NA 5CEFA 4AULA 3ENWA 3S2ZA 5B1IA 3HKCA 3NTRA 2TMKA 3DBRB 3MTBA 3V3KA 3H05A 2HMVA 4RZIA 4F8YA 5LLTA 5E3IA 4YQFA 3Q6MA 1P9NA 2D1FA 2ZTLA 2WIKA 1XYYA 4XGIA 4QXRA 5INTA 2F8SA 4J94A 4QG3A 5CIQA 2AXQA 1HYBA 4NE2A 3MJRA 1CD5A 2F43A 1BGVA 2ZJZA 2D2EA 2Y4OA 4NHEA 3HU3A 1Q92A 5KKCA 3H19A 3PX3A 4GGMX 3CBQA 3IAUA 3LD9A 4CM8A 4ZZ3A 4HZUA 4BMXA 1WDWB 5T41A 5AUOB 1HX7A 3ESQA 1P1BA 4E88A 2JLUA 1RR6A 4I9HA 2LCQA 1L7DA 4HADA 4D0RA 1IN7A 1NLFA 4IQFA 1X8KA 1GCAA 5COBA 4F38A 4ERNA 1JU4A 2RDMA 1W581 2EG5A 2RFLA 1OX4A 4Y6SA 4IDNA 3JAMA 3GT0A 1QF9A 1L4BA 2BY4A 1V1RA 2JI9A 4G5GA 4LE0A 4YN3A 3WX0A 4AY3A 4EK9A 1N2SA 1IQPA 2HTFA 4FDMA 3BRCA 1NU8A 1KJNA 4BBJA 2I7CA 5I7HA 1BWSA 2UU9B 1GYPA 4MUHA 4RD3A 1V2GA 2A9VA 3T3DA 4KHPB 1XLWA 2PSSA 4WEQA 1TYAE 5MDHA 2MSEB 1X87A 4REQA 4M37A 4MIYA 2X42A 4O4IB 2W6JA 5SV2A 5KOIA 2UYYA 4ILKA 4DPMA 5KNCD 3NB0A 1JDBC 1GA1A 1AHPA 2ZU0C 1FJHA 4OMCA 3RB8A 3UK2A 5A4JA 1ODSA 1XTPA 3CKYA 3WFIA 2EQ5A 1Q22A 5K8TA 4JENA