2I34A

The crystal structure of class c acid phosphatase from bacillus anthracis with tungstate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
237
structure length
237
Chain Sequence
VKLTDQQLMADLWYQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSIDFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKEKRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDWEGALYDYNFKKSDAEKDKIRHDNLKSFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acid phosphatase
publication title The crystal structure of the class C acid phosphatase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 95
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i34A00
4KNWA 4RESA 4Y2QA 3L0CA 1L6RA 3EF0A 2P11A 3QU7A 4I9FA 4YCNA 2I33A 4FE3A 5AK6A 5ALIA 3R09A 5T41A 3WK8A 1SU4A 4BNDA 2WF8A 3ESQA 2ZXEA 3UM9A 2B1RA 3SKYA 4UMVA 1CR6A 4MWOA 2RBKA 2WM8A 4XQ0A 1TJ3A 5IT0A 1ZS9A 3KC2A 2OM6A 2YBDA 2HDOA 3NIWA 3QUTA 4ZEXA 4UMDA 3L5KA 2O9JA 3FM9A 3GYGA 4HYTA 5AW7A 1PW5A 5ALGA 1LTQA 3QX7A 5IS2A 5AM5A 4DWOA 3SHQA 1K1EA 1L7MA 5AI0A 2WF9A 5ALDA 3ESRA 1Z4OA 3NALA 1KYTA 1T9ZA 3ET5A 5AHXA 2B0CA 4Y2XA 4ZEVA 3R9KA 3QNMA 3E84A 1TE2A 5A3RA 1ZRNA 5ALRA 3OCZA 5AW6A 2HX1A 2FPUA 4EENA 3W5AA 5AM0A 2YY6A 3EPRA 1U7PA 3FZQA 3OPXA 1RLTA 2AGVA 3BA6A 4HGPA 4XOUA 2YJ5A 1O08A 2VKQA 3MN1A 3I1YA 1Z4PX 3KZXA 2JAWA 3RFUA 5AW3A 2BDUA 1MH9A 2NO5A 2ZG6A 2OA0A 4E88A 3WKEA 3QU9A 3CNHA 4FFDA 2QLTA 3A3YA 3U7GA 5AI5A 2PQ0A 5ALJA 4UATA 1EK1A 1AQ6A 4NFLA 3OCYA 3WK9A 1ZOLA 2C8LA 2GHQA 4UU1A 2EATA 5AVUA 2Q4TA 4EELA 3OCVA 3QU5A 2YJ3A 1ZRMA 2B8EA 5AM4A 4L6AA 3WK4A 3ET4A 2WF5A 3KBBA 4HGRA 3M9LA 4NABA 3ONNA 3W5BA 4Y2JA 4UU0A 3DV9A 4AS3A 5AM1A 4EX6A 3W5DA 1QQ5A 3L8FA 4UAVA 2HF2A 2OBBA 5AI6A 2ZBDA 4YIKA 2DQSA 4CF4A 1RC8A 1SWWA 4Y2YA 4KNVA 2C88A 5AI8A 3L1UA 1RMQA 3QUCA 3AR8A 5ALPA 2FPSA 3F9RA 5AKHA 4BX3A 3J7TA 4Y2VA 1RDFA 1RKVA 5ALKA 1Z4KA 5AVQA 2X4DA 1VJ5A 3L0BA 5AKLA 2MU1A 5AM2A 1JUDA 1ZD3A 2MSNA 4F72A 3KDPA 2B82A 2C4NA 4C4RA 2FUEA 5AKXA 3NUQA 3DAOA 1RQLA 3B8EA 2YJ4A 4IFTA 3EF1A 3HYCA 5AVTA 5ALUA 2W4MA 1Z5UA 5ALHA 2CFRA 1RMTA 3IJ5A 1SWVA 4HGOA 5AVXA 2NYVA 3ED5A 4OD0A 4XE5A 3OCUA 3QXGA 4FYPA 3SLRA 3AR5A 5ALZA 5AKIA 1L7PA 1Z4JA 1U2TA 1F5SA 4XPZA 3AR4A 2IOFK 3ZVNA 2BY4A 2WFAA 4OFZA 1Z4QA 2C8KA 3ZX5A 1T5SA 3SD7A 1NNLA 2WHEA 3QYPA 2RARA 4BNDB 3ZW7A 4MUMA 3QU2A 3L8HA 4DCCA 3MPOA 5AVSA 3ZVLA 2YN4A 2ZBFA 1Z4NA 4CF5A 3N5KA 3KOOA 3PCTA 1FEZA 5E0OA 5AICA 2I55A 3S6JA 4QJBA 5AKZA 2HF7A 4UM7A 4YCMA 3N8GA 5AI9A 4CF3A 4UASA 4UMEA 1RQNA 1Q91A 2YMLA 4H1WA 3U7FB 3QGMA 2CN1A 2FPWA 3AR6A 3NASA 4OCZA 4QQFA 2JAUA 4UW9A 2PKEA 3AR2A 4HGNA 3FGOA 2HCFA 3R4CA 4HGQA 4UM5A 3E58A 3RF6A 3QLEA 4UARA 4AP9A 3ZVMA 5A3SA 5AI4A 3KD3A 1Z88A 4KYTA 5AIBA 1U7OA 3FVVA 2RB5A 5AW8A 5ALLA 4YGYA 1YJ5A 5JJBA 1QQ6A 2P27A 4CNQA 1XVIA 3BWVA 5ALMA 5AVRA 3ZX4A 3PGVA 1XP5A 2R8YA 1TJ5A 1U2SA 1U02A 1LVHA 2B1QA 4Y3UA 3WKAA 2YMQA 4I9GA 2G06A 2JARA 3UMBA 4GXTA 2WF7A 2I54A 2IOFA 3I28A 3I76A 3N28A 1RLMA 2R8EA 2G0AA 2ZBEA 4Y2TA 5ALFA 5ALWA 4BX2A 3A1CA 3FPSA 4YH1A 3IRUA 2D2VA 1ZD4A 2IYEA 3A1EA 2AH5A 1XPJA 4IG4A 1WZCA 4Y2UA 3U13A 2B8JA 4C4SA 3U19A 2P69A 1RRCA 1J97A 3TLMA 1YMQA 1X42A 3PGLA 2YFYA 3L1VA 1L8LA 1TA0A 5ALOA 4NAVA 2P9JA 4BX0A 2R8XA 5AW4A 2CFTA 2C9MA 3OCWA 4AS2A 2PR7A 5FP0A 5AW9A 1WR8A 2IA5A 2CFSA 2FPXA 4EX7A 4BBJA 3D6JA 3WGUA 2ZBGA 2EARA 1CQZA 2JGAA 2HO4A 2FI1A 5AESA 2W43A 2HI0A 5AKJA 1RKUA 4L6CA 3QUQA 4KX3A 1YNSA 3B9RA 4KN8A 2FUCA 3QU4A 5ALNA 1Z5GA 3AR9A 3ZI4A 1Z4LA 4EZEA 3IB6A 4F71A 3M1YA 3NRJA 4NV0A 1RPZA 3U7HB 1ZD2P 3QUBA 1VJRA 2WF6A 3MC1A 1S2OA 4G9BA 3WK5A 3ZWKA 1T5TA 1N8NA 2I7DA 1RMYA 5AW2A 2YMMA 4YCLA 1EK2A 2ODAA 3P96A 1Z4MA 3ZWDA 3HLTA 1NRWA 4B6JA 2QYHA 4Y2PA 1QH9A 5AVYA 1NF2A 5AK5A 3WKBA 4OHFA 3SKXA 2FEAA 2Q4RA 3SF0A 3E81A 1S8OA 3EWIA 4Y2SA 2IOHA 5AM3A 4BYGA 3WKCA 2G07A 5ALVA 3VAYA 5ALXA 5ALQA 4KX5A 1YDFA 5AKKA 5ALTA 5ALYA 3WKDA 2W11A 4DFDA 1N9KA 1YS9A 1ZD5A 2RAVA 4Y2RA 2G1AA 4J2TA 5ALEA 3WK6A 2EAUA 3I6BA 1Z4IA 2G80A 2R8ZA 3ZTWA 2HHLA 4JB3A 2GHTA 3K1ZA 3FPBA 3NAMA 2AUTA 4BKMA 2O2XA 5AK4A 2OYCA 1L7OA 5AW5A 3L0YA 3ZU6A 5A3QA 5AW1A 2GMWA 4UMFA 4UAUA 2HSZA 1J8DA 2I6XA 3DDHA 2YJ6A 1L7NA 4L57A 2HOQA 1L8OA 3N07A 3N1UA 3DNPA 5AKEA 1WPGA 4DW8A 1YV9A 4BEWA 3PDWA 3U7EB 1VFPA 3UMGA 1O03A 5AVVA 3W5CA 4G63A 3ZTYA 2FPRA 5AKGA 1RKQA 1QQ7A 5IT4A 2Q5EA 5AW0A 2B30A 2JAOA 1WVIA 5ALSA 4GIBA 3L8EA 3OCXA 2YMPA 3L7YA 2AMYA 1IWOA 2BDEA 4PNHA 2ZOSA 4CE6A 1Q92A 3NANA 4JDPA 4O8CA 3U26A 2GFHA 2G08A 3SMVA 1QYIA 3AR7A 4BEVA 2NO4A 1Y8AA 4NWIA 3WGVA 3MMZA 3WK7A 3E8MA 4EEKA 4J03A 4RETA 4C4TA 3L8GA 3CZ4A 1ZJJA 3A1DA 3UMCA 3ZUPA 4YIHA 2GO7A 2FDRA 3B9BA 5AVZA 1RLOA 5AK3A 5AKYA 2I34A 2G09A 5AIAA 1TJ4A 2HEGA 4ZEWA 4HAIA 3OTQA 3AR3A 5AVWA
chains in the Genus database with same CATH superfamily
3HMKA 1T5OA 1XCLA 3NS7A 3KR0A 2D1TA 2FN9A 3QU7A 1TEZA 3CF0A 3DPSA 5JH7B 1UK9A 4M8IA 5CIYA 2O8EA 5EE3A 3HKCB 3U6KA 1L5YA 1NWCA 1D1TA 1FSGA 1YJBA 5IBPA 2C2ZA 4MW7A 4RKQA 4O6VA 3PNOA 2DPYA 4EY4A 1YQUA 3CWCA 2WAOA 3P8ZA 4ESEA 4UMVA 1D9XA 1UBSB 3ROPA 2JPDA 4FGJA 2OXEA 2C4TA 2FQXA 3LSYA 4F56A 1P0QA 4Z51A 4JT8A 3UXEA 3CPSA 5IT0A 1MC8A 3B1KA 3FMOB 1V9CA 1CUWA 1DU4A 1G0OA 1DAPA 2BVNA 3ETNA 3N75A 3NTVA 4PZAA 4UMDA 3L4JA 4MARA 2JD2A 1PW5A 1ACJA 1U3VA 2R85A 1EFPB 1YD7A 4PGFA 1GUDA 2RHGB 4MWSA 2VQ3A 4NVRA 3LX8A 3KDSE 3TTTA 1G19A 2VPWA 5HUQA 2QS9A 1CERA 4E5SA 3BREA 2YXLA 3S2SA 1B93A 3U0BA 1M7GA 3DO5A 1ISSA 1VTKA 2JVIA 1HYHA 3PNBA 3TUZC 5I9SA 3M4JA 4F2PA 3ZCRA 2H1LA 2GZMA 1A8HA 1CY7A 4TYQA 4FM9A 1K7SN 2X15A 2ZYAA 1Q0TA 3QNMA 3I3OA 1GLGA 2ZJ6A 3LNTA 4MV3A 3E9YA 5FAKA 2E21A 3R5SA 3EQ9A 1ABBA 3CKMA 4NU8X 2PM8A 1CUGA 1FRZA 1V8DA 1Z75A 2I6TA 4OTZA 2XBLA 3JY6A 3VVMA 2VXOA 1VE7A 3MD0A 1T9GR 3QG5A 4TKVA 3KB8A 1YVPA 1UKAA 2YY6A 4MAAA 3PPWA 4W1RA 5A3VA 1NQXA 4UNNA 3HL0A 2QRZA 3Q41A 4CDGA 1DC7A 4FHEA 4RJLA 4DCGA 2H18A 2B2XA 5DHAA 4QPZA 1NP6A 1QRRA 3AF4A 4X7RA 4LI0A 5HX7A 2HV9A 5LB4A 1Z0JA 4AM8A 1DAMA 4N41A 3KZXA 3LL7A 5DIZA 4W1QA 3HYNA 4EI7A 4DSAA 4ZK6A 3MAAC 4MRMB 3GCDA 2PH3A 4DUGA 2BEUB 5TS2A 5M29A 4FHFA 4JJ7A 4K28A 1J25A 2YVLA 3FGPA 4JI2B 2CVPA 4E70A 2BP7A 1H22A 3OTWA 4GECA 3QTLA 4YREA 4JUIA 3OTOB 1K4MA 1MABB 2VC2B 2V3CC 1EK1A 4OHWA 2TMDA 3IUMA 5ELXA 1JG1A 1ZL0A 2ZATA 1B6RA 5DBHX 1K5DA 4HQOA 1GL7A 3SQNA 4M21A 1LA2A 3DKRA 1FCJA 3CR8A 4FI3C 4UUQA 3IOEA 4DMMA 4BUZA 4W99A 5EIWA 2CBGA 3QFFA 3JU3A 3MCAA 4WGFA 3WFIA 3D43A 5BSTA 1AA6A 2WOJA 4JNCA 3CF2A 2NQTA 4DZZA 1UBGA 1TKBA 2E48A 4OUDB 3L6EA 2EFJA 5AQ1A 5BVHB 5ICCA 4CEHB 1ADCA 3S2UA 1D4AA 2D2IA 1KERA 1UWLA 4I50A 3JQAB 1V3VA 4V0ME 5LDGA 2CUTA 2FTKE 1N75A 3R0QA 4EX6A 2E37A 3HO8A 4YV2A 1EUCB 3HLKA 5AUNB 4V0QA 5HS4A 3I05A 3MJ4A 5DJ5A 2OBBA 3R7NA 1DIOB 3W5VA 5TJ9A 3FOZA 1GDHA 3H83A 3K5PA 3KJNA 2HLDA 5LA6F 1Z0AA 2P5SA 3VX4A 1Q14A 4L95C 3ZOKA 1J8FA 3C3CA 3PLNA 3NLLA 2B8NA 3ROMA 3BZWA 1P5FA 1V3QE 3H5TA 1CFJA 1NSFA 3RKSA 1E9DA 3R5KA 1KDVA 4C06A 1H4QA 3J7TA 1T35A 1PI3A 3OLVA 1TM5E 4G0XA 4O2AB 2IF2A 4QARA 4LPSA 4DEYA 1JKJA 4TV9B 1JHUA 2BCGY 3NTOA 4XGRA 3OU7A 5AH0A 3Q9UA 3VPAA 5I48A 4EQ6B 5IH3A 1WW2A 2KX7A 2F4VB 5FEUA 1QFXA 2EL7A 5HDQA 2F59A 1IBRA 2MSNA 4KB5A 4RIIA 5CDUA 1Q84A 5JJLA 3W9YA 4BLUA 4TTPA 13PKA 3LIIA 5B3JA 3O92A 3U4AA 2DPHA 2QB5A 3JWEA 4JYMA 2BBTA 2VUTA 4KLCA 3F8WA 2BF7A 4OBXA 4PIPA 1YRWA 3ZV5A 3EARA 1H94A 2C4UA 2K2QB 3FWKA 1HURA 4KDCA 5FLKA 1CVLA 5CBPA 4RNCA 1DBSA 1TLFA 5DKFA 4AN4A 4BVFA 2JBHA 3AKDA 3GMIA 4XASA 2CJXA 1G3UA 4G07A 2P90A 1O6GA 1P9LA 1AGXA 4RHYA 1UQTA 5EIHA 1SOWA 4IDQA 5JS2A 4COKA 3EF1A 4TS3A 4OHVA 2QN1A 3GJ0A 2GN2A 5IJAA 1U63A 4CG0A 3JQGA 1KGDA 2RONA 1G7RA 2GVZC 1YQWA 2QL5A 3RVPA 4E08A 4U7GA 4F2WA 1YQDA 4TLAA 5DWDA 3D3NA 3I9NA 1TM1E 1IEQA 1YCDA 2GEFA 1MAWA 2VA8A 4G09A 1L7BA 2N0SA 1PQUA 3JWPA 3LHSA 4RTQA 2ZAYA 2AKAB 3IJPA 1L7PA 3NT4A 1W4CA 3KYCA 5JFOA 4DKJA 2Z2YA 3QP9A 4FFOA 2Q4EA 2MR6A 5FIUA 2JFUA 2ZIXA 4FX2A 4JP5A 4XYGA 3LKVA 1LSJA 1JHZA 3VYTB 1C0IA 1U0GA 1T5SA 3CNNA 3BTUA 4CEIB 5EP1A 2QLFA 1JR3E 1LV7A 3QYPA 1NFFA 2GLTA 3JS5A 2FETA 4KXLA 1E3IA 3HK2A 1R3DA 1CPYA 1Q83A 3OZXA 4HLUC 5ISMA 4QJ3A 3AJEA 1XMVA 1G4UR 2I8CA 1COZA 4YUWA 2R68A 4G25A 5KSOA 5KYVA 1OLXB 4L0CA 4FHCA 3GHHA 2X3YA 4P4LA 5CXXA 2BCEA 5C53B 1NF8A 3GPIA 2QTNA 3AILA 3C3EA 3RIMA 3UO8B 4W7IA 2XLBA 4CF5A 2BTEA 1CUHA 1SG0A 4MKIA 1IK6A 4AL4A 1RYNA 3GBSA 3C74A 1KI6B 4MRSA 5TF0A 3E4DA 1K8YB 2HIGA 5F98A 2H1CA 1NBHA 1N2IA 5AICA 1FTQA 2WSLA 3HVKA 1Z5VA 2GPTA 1RJWA 5DN6D 3FAKA 1U0RA 3UHOA 3D9QX 1ORIA 2EL9A 4ZYXA 3WIEA 1X7ZB 2BEKA 4R2LA 1KI4A 4BZPA 3S7TA 2IDMA 3LC7O 4CF3A 2YWGA 4C04A 8GPBA 5KIAA 4BP8A 2I66A 1SQ0A 1CJVC 2D3WA 1DELA 1WRBA 5CT5A 2JJ8A 3P32A 4IUDS 5CGQB 3ZBTA 3V4LA 2UDPA 4IP0A 1U8FO 4Z9XA 2LD4A 4HTFB 3U4IA 3G79A 1J0DA 4FFLA 3IPCA 3HA7A 3GLIA 3HNOA 3RYHB 1S8NA 2O7QA 3GLUA 3OQMA 5I9LA 4NDNE 1U2GA 3OH8A 4GEGA 4MDFA 3P9QA 2XB4A 2P67A 3KG2A 1KFBB 5FOTA 3HADA 4UM5A 4X41A 3EZ6A 3QEJA 4X54A 3GN2A 1RYZA 4B7AA 5A1TA 5H83A 5IXSA 2R96A 5LM3A 4GPEA 1JAXA 2JCVA 1OOEA 3LRXA 4I1SA 3GLHA 2Q3LA 1JDJA 3KD3A 1FQWA 4G4SP 4IQ4A 4JLOA 5A6VA 5JD5A 2ZE8A 4PSKA 1NMYA 1NBWB 621PA 2BSAA 3RK4A 1QO9A 2RJOA 4OQEA 3NHYA 2VTKA 3ETGA 1E5QA 4HBZA 1SD5A 2Q3FA 1FIUA 3N2ZB 3KX2A 2HHCA 3BK7A 3JWHA 4J4TA 2G17A 3BWDD 4TWJA 1E2KA 3GRAA 3DFUA 1ZH6A 4ZPXA 3UAOA 1J00A 3H99A 2R8YA 4P4SA 1VKOA 3GJ4A 3UHAA 4EA8A 3PWKA 2X5OA 4IDGA 3TG8A 1I3MA 1KNXA 1LVHA 3EDRA 3F2IA 1UEXC 3GOHA 3WV5A 1SQ5A 1VC2A 3PDIB 4Q7QA 3BWYA 3IDFA 3VAAA 3IRVA 4OAPA 3BWBA 1JFTA 4P22A 3PXGA 2KYRA 1KYYA 4YPVA 4EJFA 1AKQA 2VZ0A 1AB6A 5JNSA 2R11A 5BSWA 1CD5A 4BX2A 1U81A 3HM2A 1ZH2A 1K0UA 1SUBA 4I81A 3DM9B 4MV5A 4AZ3A 4CL0A 2AH5A 1ADJA 4G97A 2Q5IA 3QYAA 4B40A 1YI8A 3BCUA 3WRYC 1N5JA 3U13A 1VP9A 4KVFA 4TZ0A 4PYOA 3WA7A 2HQSA 3AHJA 1EHCA 1Q12A 2JFYA 3TNLA 3I12A 2G9ZA 2FQQA 2XUFA 1L5FA 3H3JA 2O8CA 1YDEA 2QTGA 3I2GA 4DR7B 1COWD 1XLUA 2A5GA 3A1NA 1JG6A 4IO0A 4M49A 5F73A 4TN1A 2CFTA 1Q2UA 5KDOA 4PBTA 3LX6A 5JVDF 4G0QA 3UJ7A 5KWSA 4MB2A 4CKXA 3WBFA 1L5WA 3CO5A 3DV0A 1UWKA 3HA5A 1YRLA 3DVLA 1UPFA 2VZ8A 1T43A 3NNNA 1RAGA 1C4KA 1U5BA 1BWPA 3IPRA 3LAWA 1P8AA 3PEVA 3C5WP 4FW9A 4OQMA 3E9MA 1Z0ZA 4R1LA 2FUCA 1QAMA 3DTVD 1Y4UA 3HSSA 1SOUA 3AFOA 3HUTA 2R00C 4J7AA 4LYYA 1KF0A 4DR3B 1ECPA 1THGA 3I32A 3AT1A 1J0EA 5B3KA 2C5BA 4CWAA 3IIKA 3C3KA 3EOBI 2Q50A 5U9CA 3OKAA 3D8HA 4CF7A 3GRRA 3PC3A 3ZGXA 2WD7B 1SBQA 3MC1A 3E18A 5A05A 4ASUD 1B2RA 2HQOA 4KO2S 1AGPA 1CDDA 2AQ8A 2Z4RA 2FZCA 3WQQA 2FMKA 2JHGA 1B42A 1DBVO 4LXHA 1N8SA 1NHGA 4PRZA 2ACEA 5IJ0A 2V7QA 5DH9A 4JT2A 2JFBA 2W6MA 5I7HA 4OJQA 2D4HA 4QT4A 1NPTO 2JVKA 1EEXB 1Y4ZA 1XL0A 1XXHB 2DBRA 4OQDA 1YJAA 1TD9A 3AKYA 3DL7A 1Z2OX 5SY4A 2PUEA 3ROXA 2XCOA 1M0TA 2VHVA 1CE8B 221PA 3EJ6A 3B1FA 3RQIA 2VYNA 4K03A 2XRYA 3GFGA 3NT2A 2JAHA 4GP7A 3DCIA 1PWYE 1HY3A 4XIFA 5THQA 3R3VA 3RCBA 3UB4A 1H2RS 2J67A 2IOHA 2NPOA 4LF8B 4MKHA 1EYZA 4BYMA 4YCAA 1Z83A 1N7IA 4H27A 3TRKA 4MYCA 1N0WA 4CKCA 3RREA 2BFAA 1KU6A 1EE9A 4GGMX 4RWZA 3UYLA 3WKDA 1RWPA 1VJ1A 2GEVA 3OOEA 4HO1X 4QYMA 2BTQB 2B4YA 3EC7A 2N3ZA 2ZPTX 5FOXA 2XMDA 4NCXA 4AZSA 2AJCA 2G1AA 4L22A 3EIQA 1GNSA 1RYHA 2PWPA 4Z0NA 2EEZA 3UY4A 4BMXA 3IEVA 1O9GA 2BEWB 1D2RA 1G5RA 2W6JD 4L28A 5CT4A 4KOEC 4BCBA 4DUZB 1DAGA 2OGUA 4MWEA 3PFWO 2JI4A 1OLSB 3KXIA 3L0SA 1ISGA 1IG3A 3UK6A 1TMOA 3V2HA 3V4ZA 4CMIB 5CNKA 4ETMA 5J2UB 1KZYC 1R4NB 3IEPA 1C1HA 3CVUA 4XDZA 1Y5MA 3IBSA 5T4EA 3GLVA 3VDXA 2A1TR 2GCPA 4BZXA 5BNWA 3ONFA 1HQKA 2O23A 4WZZA 4PYKA 4U2FA 2Z2JA 5BRAA 1MGPA 1C4WA 1XTZA 1TKAA 2V7PA 3H1PA 5A3QA 5HM6A 2FJUA 1V4VA 1U7DA 1ESEA 4YR9A 3QWAA 1FBTA 3L40A 4S1VA 4R9UC 1EDBA 1WL8A 1YV9A 3G9ZA 2WKWA 1RWQA 1G8GA 3PNQA 1PBNA 4EMSA 4O1MA 2O50A 5A4IS 2QMHA 5KYXB 2ZJ0A 1UMCA 3T4EA 3WGGA 1C2TA 4A0GA 2O1XA 1HRKA 1T13A 4YV1A 8ADHA 3PQEA 5HW0A 4N7RA 4B3GA 3W7VA 3COYA 4BMZA 3ETCA 5E9WA 4GGPA 2C5SA 2HDWA 1O5TA 4PS1A 2WSMA 4RGBA 5AKGA 4DSTA 2FOXA 2PFSA 3DOJA 1IQPA 3A2LA 2UYYA 4GNKA 4M1TA 3RVLA 5KI6A 2P4HX 1ZLXA 4KXYA 1U2RA 5J58A 4R41A 4ZO6A 4O29A 5M5BA 1Y98A 4OATA 1N6HA 2XT0A 3UOAB 1RWVA 1U0FA 3CGGA 3JZFA 2G72A 4KK4A 2P65A 3AI7A 1UOQA 4NCNA 3T1VA 1P2FA 1P81A 1JLLA 1GU0A 2WSYB 3JW8A 4QREA 5SV2A 4EHHA 2PTHA 2ZOSA 4W7HA 2E4YA 3JQ6A 5JISA 5F2KA 2NO4A 2BH2A 4A6EA 2G6TA 3A32A 3JAWA 4LJLA 5EHQA 4CM1A 1PK7A 1VP3A 4HFMA 1Y4DE 3WLTA 3AFGA 4D3SA 1OI7A 2VAMA 3BXGA 3F8TA 4LG1A 3L8GA 2A3RA 3G9QA 4TL7A 3TBFA 1L4FA 1T4BA 2WJPA 2H1RA 1QKKA 3KAJA 3UMCA 4CV1A 3C8ZA 4MLZA 3VTKA 1V1MB 1Y5RA 3PUWA 1A5AB 3L5OA 1VM6A 4NCAA 1MHTA 1TA4A 4I8XA 1H9CA 2ZRGA 4UVHA 1P61B 1QO0D 3LPLA 4FR0A 4MCHA 2PS3A 2WMNB 1ZZEA 4AMUA 1RPJA 5HBGA 4CMKA 1RXCA 4MV9A 1VBFA 4PYMA 2RGGA 2JJMA 3VHXB 2JASA 2CYBA 1E2IA 1U8EA 1CRLA 2NT3A 2B8TA 4HQNA 4W4TA 4HQ6A 1V7CA 4ZO9A 3RRZA 4G5GA 2VJAA 4K6CA 3R9XA 2VXCA 4RTRA 3AKEA 2C3PA 2MSDB 3OOSA 1CQJA 2FAXA 3BQ9A 3IVXA 4CKBB 3PYLA 4C0KA 4F97A 1LU9A 1UPCA 3ZBUA 1NQ5A 2ZZKA 3A36A 3RS4A 3SQMA 4LFAB 2XYHA 5FWXA 3HI4A 5KNCA 3I92A 2XR1A 1S2MA 3OQHA 4HWTA 3EX7C 2EKPA 2HYDA 5HQ3B 1E9CA 3LG2A 4TV8B 1RBZA 2YBDA 3RFFA 2VH1A 4ZEXA 1IZ9A 4EFDA 1I4TD 1U0BB 2E5WA 2VRWA 3AEQB 2LRHA 3ZE8A 2R47A 1PVDA 5E6UB 4LI3X 5AI0A 3F5FA 3Q5DA 1KMCA 4WPGA 2VO1A 3WRVA 4BBPA 4CLOA 3HEBA 5IKEA 3RI3A 5H9VA 5CGZA 4XM0A 2P9CA 3PZBA 4BNJA 1RZVA 2CK3D 4A2WA 1G8MA 4A0FA 4QTXA 2DPLA 2PO5A 1BN7A 3AM4A 4IYJA 4IILA 4WA8A 2NUTB 4MR8A 3SM9A 2GD6A 4L4XA 4B3DA 1IXKA 1P2GA 1E9BA 2W83A 3H9JA 4BPBA 4TMWA 4YDQA 2JH3A 2J9FA 2VPTA 5A3RA 2QENA 4IMRA 5C3UA 2B78A 5LP6B 2RGRA 2AVDA 1CWUA 1CR1A 4IINA 3UT5B 3OCZA 1DBWA 3L0DA 2WJVA 3IS3A 4L5JA 4WUTA 2GN9A 1HETA 3RGGA 2ZAMA 3WB2A 1YS4A 2QE6A 5B7NA 2OL4A 1OIVA 1NXVA 1ZOSA 5E95A 3KTAB 1D0VA 1M7BA 1E9VA 1MJ5A 4K9MA 1BOFA 1PKXA 3VV2A 3ICPA 2OP0A 1N57A 3CN7A 3O8RA 2BHRA 3GROA 4KPUB 3R77A 2YVQA 3EMDA 1YDHA 1QF6A 1PNVA 1E2UA 3KPUA 3PC7A 1XA3A 4IIBA 3GEGA 4IEEA 3S27A 4LX8A 3CZMA 1E63A 1MQAA 2M98A 3BSWA 3QPVA 4GR9A 4QUKA 3LDAA 4E5UA 4FE4A 4DZRA 1HYEA 5IX8A 5IVKA 3O8BA 3ZGZA 1B6TA 2BE9A 1KY4A 3OSUA 4Y1RA 3FJYA 4WJLA 5JV5A 4JBWA 5HKLA 4DB4A 1ZD8A 1G5FA 4LXUA 4WCDA 2NO6A 2ODPA 4H3SA 1ZAKA 5EL0A 3VTZA 4RIFA 3A4TA 2E4WA 4GFDA 1D6MA 1KJYA 4O4LF 5DW0A 1XMOB 1S2NA 3G2NA 3SZGA 2OQVA 2HCBA 3VMFA 2Q5LA 4JUAA 1AQ6A 5DM4A 3THOA 4ZCRA 2IYRA 4M0UA 3A05A 3OCYA 5K8UA 5E3JA 5J1SB 1TUGA 3FUUA 1X7WA 2EATA 3AY6A 3Q7RA 2JIZA 8MHTA 3Q3JB 3PICA 3QU5A 4Z86A 3ZY4A 2QTMA 1XDDA 4RTOA 2I65A 5FNVF 2VJDA 1ZITA 1IHYA 4HVLA 2IPLA 3A27A 4M9CA 4MQ5A 3IAHA 4Q9HA 1TZMA 2WF5A 3ET4A 4GSYA 4GPAA 3RSCA 3IUBA 3TLGB 2H5LA 1FP6A 2C78A 2WT4A 2YHUA 3NH9A 3BHJA 4F6LA 2DUJA 4IEFB 2BFWA 3QLTA 1KZ4A 3G5AA 5I47A 1TZBA 1L7XA 2DCUA 2PMFA 2QUIA 2MYPA 3CH5A 4JLDA 5C34B 4S0ZA 4BIIA 4UTVA 3BGSA 2ZBDA 3GYBA 4GZ5A 4TS4A 4EIWA 1CT9A 5B1DA 2QN6A 2Q46A 1W5EA 1UKYA 3C87A 1W5FA 1A9OA 3R3XA 1E4EA 3AETB 2OUIA 2NU6B 3ZKWB 2RK4A 3NHFA 2ZITA 3DYVA 3NJRA 3KQWA 3F2VA 4FN5A 4JVOA 4F7WA 3AR8A 4MGZR 1U1DA 2FPSA 3TCKA 4HZUA 2Q49A 3DEYX 3MWEA 3U37A 3FR8A 2F17A 4PR0A 3QPWA 4O4JA 1N8TA 2JAXA 5ALKA 4FUTA 5E1MA 4U9IS 2WWIA 3CKYA 1PP4A 1BCSA 1VJ5A 1ZMXA 3PE3A 4PPYA 4UHBA 5FX2A 3HDTA 3AW8A 1X1AA 4JQZA 3OFVA 1Z5OA 3TI9A 5KSWB 5ECWA 3K70B 3QX3A 4EMTA 1RYBA 1NU6A 4WBSA 1NAIA 3AX6A 1UC5B 3FLEA 5BUQA 4MYTA 4C88A 5LMZA 4FJ0A 4XD2A 1C8VB 1JG2A 2P1ZA 2FUEA 1X0XA 4GBGA 1K97A 2C3OA 1A7AA 4R4JA 3P5BA 4AKIA 1HNNA 3L1IA 2ERCA 3MOSA 4ZZ0A 3PKZA 1SXJD 4R7TA 4OJNA 2J41A 3JD0A 3CB4A 2IYWA 5FL7A 1SVWA 2PXCA 4US2R 1JIXA 1E3LA 3Q2OA 3QEBZ 1G59A 3BE4A 1OI4A 3FSJX 4UHJA 3P52A 4Q3EA 1QG2A 1YZKA 5KNBA 5AVTA 1ZN9A 3KYIB 5KOHB 4UNPA 4W5RA 1N0VC 3VKFA 5A0TA 1JHXA 5GTDA 1Q7TA 1AQYA 1POWA 3GB9A 4HGOA 4JL6A 1WQ3A 4KFSA 4FDTA 5ITZB 4BY9E 3WIVA 1WP4A 1KZ9A 1O57A 4ZEOA 1E0DA 5ERXA 3UG6A 3D8UA 2IQIA 3M9WA 3RVDA 4BKOA 2HZBA 2IHBA 3LJKA 1V0JA 2DWUA 3AR4A 3SICE 1PQ4A 4RMNA 4ZDIA 1ZONA 3BMNB 2FG5A 4WASA 1WLYA 1QYRA 1QP0A 4BOYA 4D8WA 2GAJA 2WR8A 3V3TA 4J2HA 4MLDA 1JFVA 3QLVA 4HFJA 2P6MA 3ETDA 1QHXA 3ZW7A 4O02B 4HEQA 3R3ZA 3FSEA 5AJZA 2JFPA 3L8HA 4DLSA 5I4IA 4UCXA 2O2GA 4CL3A 4DR4B 3SK0A 3WY9A 5A3JA 2FWMX 1DWUA 1ZDMA 2ZBFA 4CETA 3K1TA 5I7SA 2V3VA 2F1IA 2K7ZA 3TZKA 5CCBA 3G2MA 2FXVA 3CUKA 4H3VA 4Q4HA 3T0FA 4B5LA 5E0OA 4TVBA 2HWXA 5KWEA 4G8CA 4HUJA 4YGXB 1T8RA 1JE1A 4QJBA 4FFMA 1ZI9A 3OTIA 3PFBA 3R76A 1N0HA 3M5PA 3HCAA 3DP7A 4KIWA 3WTBA 4C89A 1HE1C 4HDQB 5CLIA 1OXXK 2HMYB 2YWCA 3CUVA 1LSUA 3KVNA 4TTAA 4XM1A 3LWZA 2W6ID 3RNOA 4C0LA 3QTBA 1QOZA 1XNHA 4ND8B 5D6NA 2P7HA 3MTIA 1LXCA 3LT2A 5FBKA 3VR5D 3ZXYA 4KXMA 1SN7A 1EIZA 3LUDA 1Q3HA 4X1KA 3FDZB 4R1PA 1G0NA 3TNJA 1GQQA 5K3OA 3QA9A 5AP9A 3S40A 5EKSA 3QK7A 3CE6A 2D1SA 4H4CA 4AVYA 2NU9B 4MQUA 4ENPA 3X1YA 2HKIA 3CRVA 2ORYA 1G8SA 2VHQA 3K2IA 5MFPA 2OTCA 5F2EA 2CW5A 2I9PA 5FR1A 4KMMA 5SY6A 3MVEA 3D3WB 4RZIA 4EQZA 3V1TC 1VJTA 1KOJA 3VZRA 4YQEA 4FD2A 1CDZA 2IP2A 4K0RA 1RWXA 1U7OA 2HWWA 2Y1LA 2KW5A 2M2IA 1SCUB 3FRJA 1W1WA 2B34A 2P9HA 4EYKA 5KBYA 1MR3F 5JSFA 2BYTA 4D0GA 3FWYA 5AO9A 3RC9A 2Z3ZA 2BHLA 2C95A 2QAJA 4TKZA 2VBFA 2PJUA 3DMGA 3MOGA 4K6KA 3WG9A 3ZE0B 3GPBA 2EERA 2H52A 3IHWA 3O73A 5CAEB 1AN9A 2RH8A 4OI0A 1IY1A 1EFTA 1OMOA 4XM2A 1NBME 3N58A 5AVRA 3T7JA 1PHRA 1WO8A 3H8JA 1G55A 1Q57A 3ER6A 3ZLBA 1WW3A 1TD1A 4UTZA 5EP4A 5GV8A 1TECE 2CNLA 1ZK4A 5TEWA 3BS4A 3OOJA 3RVQA 5JMWA 2H11A 2GCEA 2H63A 1A9ZA 4E1AA 2OB1A 4QULA 3RYCA 4PQYA 2QQ5A 1DQRA 3AFHA 4WVFA 2AJ8A 5CB8A 2WQ7A 1X9GA 5EC8A 1QTQA 2VYVD 4KBYA 3DL0A 4F93B 2YIMA 2IYQA 2AG5A 3GLGE 1J1IA 3PGA1 5IKPA 3CUUA 4P92A 2E6KA 2EZ9A 3TLMA 3SIRA 1DEXA 4YDSA 2IE0A 3IESA 5M7EA 3ZZ1A 1BS2A 1Q1NA 4LCJA 2PPVA 2R6DA 3GWGA 3P2IA 5MGNA 1QYDA 3B5EA 5EWJA 1VKJA 2I3GA 4WZAE 1ULHA 4KC0A 3RWBA 3GGOA 2WMDA 3DH0A 3N7UA 3PC4A 5IM4A 1SHJA 2E49A 3DKIA 3PNYA 2ZRPA 2FWRA 4PZ0A 4D9JA 3RLIA 5J43A 4TTSA 4MW4A 3MINB 5C0OE 1BMTA 1JP7A 2JIOA 4HR7A 5FLEX 3ROTA 1KEEB 3U3KA 4XSGA 3GVIA 1AQIA 3NR2A 3R4VA 3UBMA 3ZIAD 1AT1A 1UAGA 1VMKA 3NBYC 2A84A 3OIFA 3OC6A 1XU9A 1JJAA 4CUKA 4MW9A 2R6AA 1U0NA 3PD0A 4B35A 1IY8A 2ILTA 3I83A 3OM0A 4TRJA 1VYHA 1WMFA 1NNI1 3QVMA 2WUEA 2PWZA 3MGCA 1NX6A 3C6BA 4U39A 5CURA 1M6HA 4LJKA 1K92A 3H75A 3T15A 4LSGA 4JGGA 3ASVA 5JS8A 1TVEA 2VJBA 3WK5A 3ZWKA 1HDZA 2JFQA 3HU3A 4FC6A 2I7DA 3ODPA 1A8SA 3IHLA 2WTBA 3HY4A 5KYUA 2GBLA 2XKKA 4TZTA 1ZSVA 1KI6A 2HA2A 4MA0A 1Z13A 1Y6RA 4MVJI 4S12A 4YCLA 1EWRA 5F64A 1ZUD1 3K8ZA 4DNFA 5J4VA 1W46A 3FNFA 3MJSA 1CS4C 2ERXA 2XLCA 2FEOA 4HPJB 1A9XB 1IBLB 4XA8A 4KFUA 4L7QA 4CGYA 1IN1A 1R7RA 2G0TA 2R4UA 4MQLA 4E51A 3WGKA 1RXVA 2OOSA 5TQ0A 1SBIA 1GKIA 2FX2A 3IA7A 4JU8A 5TJHA 4HNAA 5DM0A 4EOGA 3ZCPA 2X2PA 4ZV9A 2R1VB 3TAUA 4C7MA 4ETNA 3U09A 2PNJA 3OM1A 4HTFA 2GYVA 2X8AA 1X9HA 2UUOA 4FFPA 4IHJA 1IL0A 1YWGO 3TR6A 4KQIA 3BE5A 2DG2A 4NCKA 1V11A 4K26A 2GN0A 4QDUA 1I1HA 4MA4A 3VUFA 2YHAA 3W6NA 1JEOA 2XGMA 4OG2A 2FFJA 2GYUA 5EE9A 4W7SA 4FFWA 3T35A 4EFMA 1D4FA 2RHJA 1D6NA 3WNDA 3OIGA 3GO4A 2WQ6A 5DGTA 1QIEA 1QAQA 2ZWVA 3EIXA 1AV7A 3HJNA 3PPVA 2FRDA 4MRPA 4MRVA 2DMRA 2P8JA 3FNGA 2ZSAA 4HT3B 3PB3A 3JWIA 3K9FC 1X1DA 3DBVO 2GBGA 1DBIA 2AS0A 2YZMA 3E9CA 3KR1A 2IW3A 4P8RA 4C6RA 4IDAA 4IPTA 2BKEA 3MHTA 1VFNA 1R3UA 1DO0A 2ZSJA 1JMYA 3OZDA 1U3TA 1H66A 3OPVA 1H2XA 3H2JA 4R8KA 1ML4A 3IAS1 1V5IA 2FJPA 4ZFNA 3M6LA 5B58T 1YVDA 1QHFA 3C43A 5DASA 3MGKA 4NXNB 2A59A 4EPYA 3RC1A 1J8DA 1AD2A 1TO2E 2Q0XA 4YQZA 1JAHA 1OW3B 1CZUA 3OOHA 4Y0AA 3C4JA 1AUVA 2FSUA 4UFPA 2OV1A 2IHYA 4G56A 2HXSA 3GCWA 4CU5A 4ZKDA 4ZMSA 1Y6GA 5FUMA 3FR7A 3HXTA 3VISA 4CLEA 3KLBA 1OI3A 2PGNA 3P26A 5KHLB 4I50F 4BV8A 1HR0B 1U0JA 3K5WA 4F45A 3ZY3A 1Z35A 4IFBA 4BLPA 3F97A 3DBLA 4YUZA 3BICA 3WHPA 1TYBE 2Q5EA 4JLWA 4PQRA 1B8VA 3RSOA 3SP1A 4UM8B 4NDZA 2RGBA 3HN2A 4ZZ3A 2DF8A 3M2TA 2HADA 2VH5R 4RPJA 4A6XA 3B48A 4LJ8A 2NO0A 3GFTA 4WJZA 2ECPA 3UJAA 1M2NA 1RBMA 2ATIA 3GJSA 3OCJA 3RR2A 4K5QA 1E64A 2FWIA 4EY3A 3H13A 4L08A 4Q7LA 4MI9A 3QYJA 4CMBA 5BSGA 2JJ1A 3ILVA 3AB7A 4RX1A 1H4VB 2HU7A 3AHEA 3EEFA 3H11A 2QYTA 1SXJC 3E03A 3KPWA 3MT0A 3WK7A 5IAAA 3QVXA 4BVHA 3ZJVA 3AINA 3MUNA 3ZW9A 1TQ6A 1KK3A 4PINA 3W0LB 2P75A 3R8CA 2VQEB 4QE3A 4MVJF 4JEMA 1THMA 2YW9A 3O6VA 4WY5A 3ZY6A 5EUMA 1IYZA 1P6XA 3SPXA 2I34A 3HVIA 3JARB 5TRTA 3QKUA 4IWNA 4H17A 4A9AA 4LYFA 3UKJA 2GRAA 1SVKA 3GIDA 3GJQA 1I32A 4F4IA 1LPNA 1FRNA 3DDNA 1TEXA 3E9QA 4I55B 3AH8A 1WDWB 5JWOA 4A0HA 1FNBA 1KVTA 1L7VC 3PKIA 1XR3A 4WQMA 5KNLA 2I3BA 1JIVA 1GFIA 4YO7A 4MS1B 4YRMA 1SHLA 4UM9B 2PXAA 4BO5A 2GK7A 4U9UA 1S96A 1RYFA 4BB0A 3QFCA 4F92B 2BFCB 3PXXA 4BQEA 1F6BA 3G9XA 3SCZA 2BMFA 4EJSC 2O4CA 2FG7C 1V8PA 3KC2A 4YCSA 4EUEA 1ZMRA 1SNYA 2P35A 4HVCA 3OJCA 2CVFA 1TADA 2Q6LA 3IQEA 3UUEA 2LIPA 3EISA 4TUYB 2QMUA 4A1OA 2A30A 4YS6A 2JA2A 3E9EA 5AM5A 3LUBA 1BTOA 2R1TB 4GMGA 4N5LA 5DGIA 5A71A 4WBNA 5MHTA 1G8YA 1TRKA 3O3MB 4YRDA 1WHTB 4P31A 1CR0A 1Q6ZA 3AJAA 2ZUCA 4MGEA 2OZLA 3E23A 3HXQA 1NRJB 2ZSEA 1C1DA 4WUVA 4EGJA 3OT1A 4V0MA 1W36B 1WTCA 1YE5A 1FFCA 1C7RA 3CCBA 1VMEA 5JD6A 2V7XA 3S5UA 3ZZUA 2OXRA 5F33A 2ZIGA 2VDMB 4C2BA 1JSLA 2UVPB 3DKKA 2B4RO 1H3NA 1ZICA 2PWAA 3T7AA 4EJ0A 1VL5A 2FFAA 1PGJA 4MB6A 1KIAA 1ZINA 2VF7A 5A02A 1X1TA 4WV3A 1E8DA 2J30A 5DYGA 2HU5A 1Z73A 3C1UA 4FZVA 1OWMA 1R4NA 2PUJA 3KJXA 3HEAA 1W75A 2JFHA 2ADFA 1C81A 2N75A 2QL7A 2YJ5A 3AF3A 3C6MA 3O94A 4YAJA 3SM3A 1YBFA 3R20A 3SBDA 2CXUA 4HRAA 1OROA 1XCMA 4PCVA 3OT5A 3QEOA 3JAKA 1W2HA 2BI4A 3SJBA 1T3TA 4JHXA 3WKEA 4GYYA 4Y0VA 5JBIA 4EKYA 1EMDA 3RH0A 2JD0A 3D7LA 4MVJM 2IUYA 2PH5A 3DHVA 5K0EA 1JEYA 5K03A 3EJWA 1BS1A 1M34B 3VNRA 1K6XA 4EJSB 4Q1EA 1UDRA 3OJLA 4YJHA 3FE2A 4EFLA 1EQ2A 4CTJA 3OQIB 2GHQA 1SOVA 1FZQA 1G5HA 1QPZA 1HKHA 2NNWB 2A5LA 3CLRD 2BFBB 2X41A 1OVMA 5F1YA 1PZHA 4WZAB 4G1FA 3Q1KA 4FT4A 2B6HA 2OCDA 4M76B 2K7FA 4ZYUA 4I7EA 4EGSA 3SLKA 1NBIA 1H9AA 2P9FA 1IZYA 1XCGB 1XD2B 3OZTA 1XQYA 1UBMS 5DLDA 5AI6A 4ESOA 4NPHA 2XXJA 5JCPA 2HQ1A 4P3XA 4HH1A 3KYDA 4FJ2A 1QORA 2VATA 1JHPA 3Q2KA 4RKWA 3RTGA 4AJEA 4IKEA 1I14A 2WUDA 1JR3A 1S2IA 4KR3A 4RABA 1Q2XA 5EHNA 1VIAA 3V9AA 1N2XA 4PNEA 2V8OA 1K3FA 2H4FA 3FCYA 4JU9A 1VOTA 3VHRA 4F12A 2CDAA 2QPLA 3H18A 4C3VA 1PJ4A 4CLXA 3PUVA 1MB0A 4PF1A 5AVQA 3IO3A 2PKXA 4TVOA 5F12A 3SE7A 1NDQA 2IIQA 4WX2B 1R2QA 4MRAA 1JIJA 4G24A 1YS1X 1P2UA 2XUDA 1MRZA 3QFRA 5IKMA 4QTUB 3HG7A 1P5RA 3KDPA 1LDBA 4ITRC 1MIHA 2FKNA 1IK4A 4ZOLB 4CKBA 4XVUA 1K8ZB 4P93A 4ZOQI 2I1QA 2C4NA 3RBZA 1E1YA 4UPVA 3AVYA 1E1QD 1N6NA 1E9SA 4BGDA 2ZULA 1DWOA 1HDOA 3ZVRA 1QCYA 1E7RA 3ANLA 5BOSB 2WVAA 3MM4A 2VSFA 2G04A 3PTZA 4LJ4A 5CM2Z 5HQ3A 4M8KA 5BT9A 2X9QA 5K0TA 4KREA 4TXHA 4X1OA 4LCBA 2YJ4A 1NWHA 3DZHA 5KVSA 4IFTA 4LJ9A 1W9HA 1WD5A 3DQPA 4IJKA 1JHQA 3HN6A 1EFVB 3IP6A 1F51E 2XTNA 4FYHA 4JKYA 1ZNZA 3ZK7A 2XRFA 1YUNA 2OK7A 2XMCA 1PBTA 4A8JB 1Y33E 2W4MA 2GOYA 3D1JA 5K0FA 3QITA 1RMTA 4J0QA 2JKZA 4RZ2A 3MWYW 4MICA 4YAEA 1IB6A 2J5RA 4BL5A 3T5BA 4EATA 2JW5A 4D4HA 3A2KA 1G20E 3K6JA 5KWIA 4QDOA 4XPZA 3BXEA 4EYSA 3LKDA 4IX1A 2G4CA 4QBFA 1ZM2A 2CXTA 1PT8A 4W5TA 4D45A 4DR5B 1MHPA 1G60A 1JJBA 2UKDA 4YECA 4EITA 1OT3A 1QE0A 3CG4A 3CX6A 3PJGA 2O8FA 3ME5A 4YO8A 5DT2A 3EZGA 3KE9A 2UYHA 4GQBA 1R0WA 3LYHA 1UEIA 2B1JA 4HLDA 2LPMA 3UCEA 2IEAA 2FZ4A 4A0QA 3ZHTA 2O8BA 5C4GB 2JNWA 3AVUA 1JWBB 1KEUA 1QJCA 2GAFA 4CIDA 1FFSA 5AOAA 3O03A 3A8TA 2WSSA 4FVTA 3EGEA 1GPAA 2B9VA 3P1JA 3K9WA 3Q0IA 4RD6A 2WLTA 2WZDA 1ZEMA 2UYGA 2YJTD 2NT4A 3R9IA 1GG9A 4EGFA 1GR0A 2VI5A 3TW0A 3N5KA 2VHYA 2XWPA 3ED1A 3PCTA 2RBEA 4ZQGA 4P0QB 1SB8A 2AG8A 4M8NE 2NSHA 5BV7A 2QTLA 3SHTA 5AKZA 3ROZA 3ZXUB 1C41A 1DAFA 1IHOA 1I5RA 4BRZA 1J8YF 1Q19A 2I91A 2CMDA 1J8QA 1T8WA 1WBJB 2OPBA 1JEQA 3EFOB 4RVOA 5AR1A 5AI9A 5E1OA 1TTPB 3TSWA 4BQFA 4WFQA 3JX9A 1HE4A 4IDBA 3PGXA 1C4OA 1CY8A 2H5EA 3FHLA 1LVGA 2W6QA 3G85A 1QIKA 3QGMA 2CXSA 4L02A 3PI7A 4U9HS 2WUGA 3I9KA 1R0CA 3NOOA 2HPAA 4GH5A 2JFOA 2MR5A 2XMBA 1JECA 3RSSA 2A94A 4X8LA 1SRRA 2PRKA 1DO8A 4TSFD 2IYAA 4WEOA 3OOYA 3IVGA 1T6NA 3OE1A 4RSHA 3BJRA 3FOAA 4CW7A 1VCHA 1U1IA 2H2AA 1TQDA 1NKSA 2YS7A 4LV5B 4ND3A 4MWBA 5FTJA 1NLUA 4NYMR 5HS6A 4HMQA 4BLWA 4K9NA 4NBUA 4AP9A 3E3NA 3LOQA 1TTQB 2IIVA 3QX9A 2ID9A 4Q1BA 3ZHVA 3D4NA 3DBRB 1BEEA 4Q03A 1P9RA 4OA8A 2QD5A 3AMVA 4ZVMA 4FFNA 1W6UA 2PMWB 4HAOA 5TQ2A 3O9ZA 2P2GA 2GFIA 3SZRA 1P29A 3TZ6A 4ARZA 2VAPA 2XUGA 3VH4A 3TQTA 4HDNB 2QUAA 3FMPB 1KVQA 4NNOA 1B4DA 2WFMA 3UAWA 4NECA 5CEJA 1OH8A 1XD9A 4JJKA 1HDCA 4ME6A 4DREA 2OGTA 3AHDA 3VQTA 3LXMA 5KEIA 4CNQA 3NWPA 1ZGBA 4LISA 1UAAA 1N0UA 4RD1A 3SHFA 3IKTA 3ECAA 4TZ6A 3D2CA 2FZ5A 2LWIA 3CZ5A 5DCLA 5D2CA 4GRIA 1TCBA 1PTJC 3VPXA 4AQDA 3FYDA 5D01A 4ARAA 1ISPA 1N6RA 2G06A 2JARA 4MKFA 3OQPA 2BFDA 1URPA 1Z45A 2VEDA 5SY9A 3JZAA 3X44A 5CLFA 4PLWA 2FZGA 3E1KA 4H6WA 3JQFA 4DNQA 2R8EA 1MO3A 2G0AA 2ZBEA 1B8UA 1O8BA 4UHFA 5JROA 3UANA 2OE2A 3JQ8B 2WWRA 2EJUA 1CQIB 4K6OA 1T5LA 4TL6A 4MVJD 2C96A 4IIEA 1DRUA 1SD2A 1II0A 4B3HA 3FIJA 1V2GA 3Q3IA 5AFSA 4F4UA 5LZ2A 1JIQA 5EEGA 3FPLA 1ZA2A 2O0JA 2BSXA 1NSTA 3SJUA 4LOKA 1Y3FE 4H1VA 2FSPA 4B6FA 4Q00A 1PU2A 3SR0A 3V4OA 1S4QA 3RSHA 2FEXA 1WU7A 3TNYA 3KWJA 1CQXA 3R7WA 3RAFC 1J0XO 3ADKA 5AJTA 4QOJA 4DIKA 1XFDA 3ABRB 3REGA 3UEOA 3VR4D 1T9CA 4XDHA 3C5VA 2HO5A 1UXJA 3T9BA 4AY3A 4DCSA 4YAIA 4CLHA 1L5ZA 1M75A 1W88B 2B4KA 3AFMA 3CT4A 3NFRA 4OLJA 2VZ9A 3DZBA 1U8UA 1G9SA 2OYRA 2Y05A 2RC6A 2AQIA 2YRWA 3D4OA 2O20A 4LY6A 1TUBB 4URVR 3F5SA 1XLVA 1HDIA 3BMNA 1XAGA 2Y6VA 5AXCA 5IDXA 2WZCA 4Q4JB 1NR5A 5B53A 3FF1A 3SS8A 1OI2A 3DB1A 3FX2A 5ALNA 2IPNA 1A8UA 3BHNA 4EW3A 3O8OB 5EJ2A 2YN2A 5KQRA 4W5QA 4P98A 1OH6A 4PQEA 3UMJA 3O8CA 3FMGA 4EFNA 1PWXA 3QUBA 2ZDGA 3JRXA 1DUVG 2C2BA 4Q1AA 1RRKA 2FMFA 1JYSA 2FFRA 2IEIA 3G5MA 1G2QA 3N70A 5F23A 1T6XA 5HCNA 3J81A 4R1QA 3RVSA 1G5QA 1RRVA 2MOKA 3O8DA 4JC4A 4YALA 3D7NA 4QOGA 4KQGA 2W6ZA 5EMKA 2AN4A 2FZLA 4LZNA 3G7NA 2OFFA 4NH4A 2FMHA 5DSZA 1W4AA 2ZR9A 3FYTA 3P5SA 2YYAA 1R1DA 2BN4A 3OZEA 4L8WB 4S1TA 3C3WA 3JQ7B 1W94A 1T0IA 1LI7A 2IY7A 4WN9A 3ZWDA 4JR2A 5JYBA 3AM1A 3W2IA 3EW7A 3KSZO 4M53A 2FR8A 4O4HB 4G2TA 3WKBA 3G7SA 1YMUA 2X7HA 5F2OA 1GZ7A 4B79A 1HZZA 4E5VA 1D2MA 4JI7B 3M4ZA 2J3HA 2M6LA 4UQLA 5JY6A 3INTA 5L7TA 3DD5A 1VRWA 4BGUA 3FCXA 5I4CA 4BJ5A 5AYVA 4YLYA 3NBUA 3UAZA 3J7AC 4DVJA 1FX0B 3DE3X 1IPFA 3BRWD 5LQUA 1QHNA 1Q0UA 4LYGA 2XGOA 1HTTA 5JW6A 4EHFA 3A1SA 2GJ9A 4KGXA 2G07A 1TZJA 4UCWA 2GCGA 4KRGA 3GL9A 1T15A 2RG7A 1XDUA 1M2VB 3EVBA 2DWPA 5AKKA 1J5EB 4CQMD 1WMEA 1ZNQO 1GCAA 2HAEA 1DKRA 4WLEA 5J63A 1UT5A 4LGMA 4RADA 3CLRC 2P78A 3R41A 4J2TA 1NMSA 2OO5A 5EIBD 4RTNA 4YAWA 3WGHA 4A2QA 3UWMA 2JI8A 1QJ4A 1XALA 4DLWA 4JUDX 3W9UA 1MO2A 4RFSA 4GICA 4LBYA 3GIWA 5CHEA 1SC4A 1UDCA 4BFXA 1NYQA 3O21A 2V74B 3NAMA 5FULA 3EEYA 3IUSA 4EL0A 5DRYA 1MB3A 1DX4A 1W30A 5CCDA 3V8BA 4Y8VA 3OPNA 2AIRA 4GVXA 3WNVA 1DFHA 4BZZA 5JRDS 5AW5A 3CEHA 3THWB 4HH4A 2YS6A 1DJQA 1V2HE 4UMFA 3KZ1E 4OQXA 5KCZA 2PKCA 2JB9A 1PS0A 4JI8B 2C5AA 1FFWA 4AJOA 1VBKA 3OT4A 3DE0X 4GC9A 1Y6FA 3RUDA 3U7EB 2ZPAA 2V65A 4UVIA 4PX2A 4IZOA 4Y0NA 1AY0A 4H35A 3UK2A 1DPFA 1QS0A 4RK1A 1GV1A 5LKRA 4P3NA 5G4LA 3C7CB 1NP3A 1UXGA 4R3WA 2P3OA 4BNGA 2PLWA 4JVNA 4WACA 4ZP1A 2WUWE 1UXOA 3IHTA 3GDOA 4M60A 5L4NA 4FZ3A 2VK2A 3IPAA 4H08A 1I4WA 3ORQA 3SYLA 1MT3A 4HZIA 3X2FA 1ZM3A 1GN9A 4LSZA 4UD6A 2C4VA 2NVOA 5FTLA 2PFKA 3IDSA 3THYB 1ZCAA 4LVCA 1OXUA 3E61A 1FDIA 2FB9A 1YRHA 5HRCA 3PIIA 4Q1VA 1TX4B 1M1YB 4R8MA 5HEKA 3VU8A 1LRJA 3FHOA 1Y8AA 2PGJA 4IZ6A 1NG9A 5GJWC 4ENWA 1J0CA 1G20B 3D4PA 3MMZA 2PN1A 4PIVA 1AK1A 3MTGA 3O4IA 1NUUA 5JDIA 2PZEA 1R18A 2CUKA 2GEDA 3C1AA 5I5GA 4DLYA 5LNK1 4IVQA 5K3EA 2YXPX 1RLOA 4JA2A 2JD1A 1H8ED 1JQKA 4OHPA 2P6OA 4BNYA 2D54A 1Y8QB 3EA0A 4B3XA 4K0KB 1W4RA 3G89A 5C37A 5CXUA 5A03A 4ZCQA 3BXHA 1Z56C 2EZ4A 5B57C 4C03A 2UYQA 5BSRA 4KGZA 5L3RA 1S9DA 1SVSA 3O8NA 1H5QA 1K3UB 3KXKA 3OPQA 3DW3X 2C9BA 3F6YA 3Q2IA 5AK6A 5A6SB 1ZGHA 3AOEC 5AHKA 8ABPA 4U2GA 1U3FA 4S2EA 3NWOA 5T41A 1OXVA 3IPLA 2I29A 4ZVSA 3RC3A 2Z5GA 5HE8A 1GPLA 1YDWA 2QD2A 3A25A 5DU2A 1K86A 1U99A 3M81A 2B1RA 2ZJOA 3R24A 4ZIRA 1L1QA 5DM1A 3NHWA 3ZD6A 3DBHA 2LW7A 3B1XA 3CF6R 3EXHC 4U6SA 4GZ3A 1Q0PA 1JH8A 3ND5A 2GBCA 2E1PA 2VHUA 2ZT7A 1IUOA 3GEDA 2OZPA 4ENRA 1R8YA 1JBKA 1OBFO 2YX1A 4ZODA 4GDFA 5DHSA 4BFCA 1KHTA 4AT1A 1Z62A 3BULA 4B6EA 4OX9B 2OV3A 2H1IA 1LQUA 1I7NA 1MNAA 4PPNA 3QE9Y 1K1EA 3EVNA 4HGYA 4KWTA 2AV6A 2X1MA 3VU1A 2ID4A 1W0KA 3AG5A 3UT0A 1ONNA 1PGOA 3B6IA 3Q8WA 5E2BA 5EHZA 5IWCA 4FN4A 1YF3A 4IR7A 1BCRB 3LLVA 3R3WA 4LQCA 1BA2A 1NASA 1FFXB 1RXUA 4MKRA 3ZHCA 5KPDA 4EA9A 4WJKB 3TZEA 2B0CA 3K4QA 4ZEVA 2GK3A 2QRJA 2RGNA 5L8VA 2C1XA 1N3LA 1JRLA 3EASA 3VSAA 4YNBA 2GA9A 2GKGA 5J4YA 2HSWA 2YVAA 3LDFA 4CI0B 1DB3A 3DYBA 1YR9A 4X85A 3IILA 3ZY5A 4IF4A 2HDNB 4HDMA 1NQVA 1N2EA 1QK3A 4QO7A 1FMFA 3PUZA 3DVQX 2R65A 3CT6A 3GFRA 1F4PA 3FBWA 3KQPA 3R7AA 1KORA 4UAJA 3HLYA 3OX4A 1JS1X 2YH2A 3GFOA 4I14A 4JBIA 5DHPA 5DCYA 1IULA 2C5EA 3S2YA 3ZEAA 5C3MA 3B52X 3PPXA 5KOJA 4X61A 1HDGO 1QR2A 1WPXA 1ICIA 3KUUA 5G0WA 1VB5A 1AQLA 3EYWA 4R8VA 5LQSA 3AWIA 5LUBA 4C7OB 4QIHA 5AWFC 1F20A 2D0IA 4KTVE 5DYWA 4BXOB 2RHLA 4RM2A 1OXKB 2FUNB 1CUCA 2NO5A 2ZG6A 4CV2A 4CKEA 1ORHA 2GQ0A 2PSFA 8AT1A 1IZ7A 1SUIA 1QFSA 4BO8A 5EJIA 4P9NA 4EO4A 2ZB3A 1V26A 1J9ZA 2B37A 3OEEA 2QNIA 1BJKA 2DQKA 5CIWA 5H70A 5K0NA 2O06A 4LWQA 4E03A 4QJ4A 3KSAC 1TU4A 2CEKA 1VKHA 3NVAA 1UBJS 3OKPA 1Z0FA 3OE4A 4IOJA 1QTRA 2CLCX 1XF9A 4U6NA 5G0VA 4HDRA 1KQOA 3KJZA 1GA6A 1NJSA 3UWDA 4DT1B 4FNMA 1KKMA 1WXXA 1IJKA 2HQBA 1MQ9A 1Y37A 1NXPA 1JT9A 1LV8A 4XX1A 2QJFA 5KJEA 4NNPA 1VL8A 2X9GA 2YJ3A 1M5TA 5HFNA 5IUKC 1OFUX 4LXXA 1OJ7A 2WJIA 2QRQA 4FDMA 3HCOA 1Z0IA 1DQNA 3TW8A 4M1ZA 5EE1A 4EB6B 2H3HA 4MPPA 2X0NA 3MUFA 3S1AA 1JB9A 2WDPA 2QZSA 3I58A 4GP9A 2E4UA 1ZK1A 4XCXA 3RG8A 2BFEA 1A50B 2HF9A 4E7OA 3NTLA 5IZ4A 2VJLA 4O5OA 1ZEJA 3EMBA 1NVBA 3VKUA 4O0MA 1A1VA 2DETA 3W3AH 1EPUA 2C03A 2NXEA 1BWRA 2HCRA 4AF8A 2FMUA 3AJRA 2JRLA 4ROSA 4TWZA 1BGWA 5I4BA 4MAFA 2PSJA 1YFJA 2H54A 5JQWA 4YT5A 4REQA 4ZRDA 1IJEA 5T4BA 4U7WA 3I6YA 3IOBA 1PJ2A 3WTCA 1RPAA 3KZVA 3QUCA 4Z2YA 1SQFA 3O47A 2GK6A 1BVYF 2I6SA 2J59A 4PLTA 4ZAXA 4I1VA 3GFQA 4ZVUA 2XE7A 3THXA 4N6NA 1AUXA 3H7IA 2J0UB 1TZ2A 5I7EA 5BUSA 1SKAA 3ZWXA 4OLFA 1KR5A 1UF9A 2OOKA 3QOXA 4LUCA 3G7UA 1QV7A 3LT5A 3R6TA 4DLUA 4B3FX 1JR2A 1U0HC 1PQWA 2F67A 2L2QA 3A9RA 1WKCA 3RT1A 4CCAA 1OH7A 1R50A 1BGXT 1SBCA 3ONEA 1U7XA 2RAUA 3CZ9A 3PT9A 5F3DA 2MSWA 2CLDX 3IIJA 4N0PA 1B8PA 3CUYA 4ZQCB 3WYGA 4LBVA 3WMXA 1W34A 2ONYA 3CG0A 1YUBA 3O74A 3N2GA 4S24A 2WI8A 1G9XA 1R0YA 2XUJA 4D9CA 1XMSA 1W47A 3A9CA 1FF9A 3BIWA 3H9GA 4CHTA 3LY8A 2SCUB 3K15A 3MGBA 3O4HA 4FU0A 1FXWF 2D8MA 1XKXA 2LZ0A 3GFSA 3BIOA 4AJLA 1RP1A 3O2JA 3ZVMA 1H6AA 1IFXA 1CUBA 1Z33A 4C9BA 3PUXA 3IQWA 1XWIA 5DFAA 1NW7A 4F4DA 3WLIA 5IHXA 1KSFX 1HL7A 3LM8A 4LXIA 2FMXA 2GKOA 5FOVA 4PG7A 1WULS 1NXSA 1Z5UA 3BVPA 3IP7A 3VO1A 2EEPA 3SSOA 1NVEA 3LKZA 4YT8A 2Q1SA 1TYEB 2BEVA 3R7LA 1P5JA 1R4MA 4XIIA 3QVGA 4G1BA 7REQB 1PJBA 1LFDB 4AF7A 4QYSA 2QRVB 3GNTA 3BSFA 5GOZA 1XYYA 1Y80A 1YR1A 4B83A 1UM9A 4YYZA 3PC6A 4DV4B 3LCCA 4G1MB 2R7KA 4LYEA 2GDJA 1EFDN 4C0XA 3AY0A 3GLFE 2OV8A 4I5IA 4I9HA 4LVUA 3BAZA 5FYDA 2QYSA 1NKVA 3HVUA 4RMIA 1NC1A 3SD7A 1U65A 1X8KA 3A9VA 4PCUA 3RM3A 3ETHA 4BNDB 3LPAA 4TKUB 3KSDO 4YPFA 4H9GA 4G5YA 3HHEA 3B2EA 1GAJA 3T7RA 4RE6A 1QG0A 1QGDA 1HTBA 3I04M 1NBMA 4ICIA 2QM8A 4NFYA 2I67A 3KVRA 4D0SA 4IO1A 4TLBA 2FFBA 2YUIA 1UP6A 3FYCA 3GRCA 3ORFA 3B20A 1GARA 3GPLA 4MEBA 1KJJA 4YMSA 3EPKA 1UJNA 3EEBA 3KRTA 3LPCA 3S2ZA 2PKYX 3HABA 5COQA 3ONDA 1N2GA 2YBEA 1G2IA 4QX6A 4C0BA 2GTPA 3ELWA 2AUMA 2CSUA 2G7ZA 4Q12A 4UM7A 2VSXA 2RBGA 5AHWA 2ZI7A 5A4MS 4J1SA 2F9LA 3W5IA 1U8AA 2AHRA 2IYZA 3JQCA 2PX8A 1ATZA 3DXYA 4B2LA 1XVLA 1U31A 3GLGA 3TRIA 1PS9A 5LXTA 3NDBB 5C8YB 3CVOA 4U2DA 4ED9A 2O2CA 1X80A 1HQDA 1JXOA 4LRUA 1YFKA 3RYTC 2ZFUA 3NAGA 4BNMA 2ZI6A 2YV3A 4PZCA 3AR2A 5KMGA 3V97A 2MTBA 4R0NA 2AE2A 4G5XA 2X7XA 3MJHA 5FPTA 5E3HA 3GJRA 4V0SA 3MWFA 4NOJA 2ZSBA 1CZHA 1RJGA 5B7PA 2ALJA 2WHYA 1O54A 2HH9A 3QV1A 1MIOA 1E0AA 1ZMOA 1GSAA 4L8YA 3DA8A 1V8FA 3KLPX 3BQNB 3QMVA 1MVLA 1XUOA 4OU4A 2IXEA 5DM70 2VAXA 3ELUA 3FTNA 3ZU6A 6ADHA 3V3KA 3ZE7A 5JASA 2F8LA 4IIYA 3RIGA 1Z8NA 2BE7A 4LMPA 3ROGA 2AN5A 3IDQA 4ZJZA 2CFIA 3SJCA 3RB8A 3BH7A 3BIJA 3KB6A 2AOUA 4HVAA 4XWOA 5DMXA 5KYGA 2UUAB 1JJ7A 3DEZA 1RIFA 4AULA 2B4TO 2V3WA 3E7PA 1U28A 4KPEC 2IPMA 4Q47A 1DCMA 3AFIA 1I3OA 4HWRA 3I0MA 2CJYA 4FTWA 1LWNA 1MZVA 4U02A 5BQ5A 2B1QA 2XQKA 4DMFA 1UZLA 3ZZNA 5CLJA 2M6KA 1ZKMA 4FZ5A 4UOQA 2N47A 4B2PA 2OQIA 2IP1A 3MLAA 4BO6A 5HFJA 3KWMA 1D2AA 1VL1A 2D5CA 3L4BC 4ZOLA 4D3ZA 4N9QA 4OMCA 3EMKA 4B8YA 5K1ZA 2WYIA 2I6GA 3H2GA 4XRGA 4OBEA 4CN8A 4UEKA 2X3UA 3SZUA 1BAPA 1LBTA 1G7TA 3GEIA 4OV6B 4AECA 5IN4A 1WHSB 1EP1B 2OZEA 1WZCA 1XFAA 1FJHA 2CFCA 2P69A 3H8WA 3U19A 1RRCA 4R1MA 1XTPA 2C29D 1OZHA 2OORA 3PGLA 4B3BA 3GY0A 4DIDA 3ZXIA 2P4QA 1P62B 3FMFA 4CMEA 1XNRB 3AIIA 1I0LA 4PYNA 2OZKA 2ZANA 2Z43A 1NW8A 1J2UA 4CLRB 3I4CA 1XEXB 1W2WB 1N25A 3DV2A 2PE5A 4G89A 1VPTA 3CZRA 1PTKA 2PR2A 3MTAA 4V1CI 5FWDA 1U0LA 4YR7A 3PFIA 2Q3BA 4A23A 4OHYA 3ZHQA 1EBUA 3Q7SA 4LOIA 3SSMA 3IL2A 3I1FA 4FCWA 2H4XA 3KB1A 4CEJA 1KK2A 1PT7A 3RROA 1OZGA 2JGAA 4NJMB 1F38A 3QV2A 2F43A 1P1JA 2ZQZA 4UAGA 4QPDA 4BN4A 1O2DA 1MW8X 3TSCA 3HKDB 3U3JA 3PQ5A 3FH0A 1LDMA 2O5VA 2WAMA 3PQ4A 3HXPA 3AVOA 1U0EA 3IA2A 1JTEA 1KDPA 1TVKB 1H85A 1Y7LA 5K0SA 3Q8LA 1G63A 3ZI4A 3C97A 1BXZA 1R00A 2CC2A 3OJXA 1QIGA 2FUG6 4GM4A 1QKJA 1FUKA 4FFVA 1N6LA 1ZD2P 1D8AA 2CV2A 3A6PC 4GL2A 1XK6A 1EG2A 4I8IA 1IPEA 2RGUA 1DKLA 3D81A 4L7VA 3IAM6 1F17A 2XGSA 1T4MA 1R0SA 4JBYA 1XZNA 1RKXA 1XA4A 2X6TA 2RI0A 2CL5A 3AYXB 1IOZA 3G88A 4XQGA 1UPTA 5GJVC 3WWOA 4X97A 2HF8A 4WBNF 2ZROA 1QOQB 5EZQA 4X1YB 3W3AD 2TMGA 1FRQA 1M66A 4N12A 4OQNA 1AKRA 1FX1A 3KHUA 1Z6PA 3DP9A 1V37A 3LS2A 4Z3OA 1FDUA 4KV9A 2E4AA 1E18A 2R79A 2WSBA 2I2AA 1MGOA 1XTVA 2DHDA 4XLLA 1SUCA 3C7KA 2IPXA 2I4IA 1QNLA 3BERA 3HYTA 4QTZA 1D8TA 3E81A 3RJ5A 1OHHA 2QD4A 1RXEA 3B3FA 2QWXA 3VR6A 2DWCA 3FTEA 1WW8A 4HAWA 1M1NB 2P6UA 1N92A 2XPCA 1T8YA 1U2DC 1P33A 3FSRA 4GUDA 1JEAA 1NKTA 4D0LB 4PONA 3LBAA 2TRSB 3KV1A 3VJMA 3I5YA 2ENWA 1YTUA 2PT9A 2DPGA 3OF5A 3SC3A 4WXRA 2NVWA 4IFEA 3HDYA 3W77A 2VSYA 3PJRA 2GR9A 2QSYA 1Z38A 5J2TA 2X9NA 3VOAA 3G3EA 4CLDA 4RF2A 5HIAA 2G7MC 4F1WA 4MS4B 3KQKA 3CVXA 3FZNA 1KZ6A 4XJSA 2PV7A 2CT8A 3K92A 1JDZA 3WO1A 5FFFA 3GT7A 3ENNA 3K0FA 5ALEA 3ETEA 1T5DX 5F3RA 2FPPB 3VC1A 5JS7A 1KH3A 1RYMA 4TRRA 4Z0PA 4I6GA 3H3XA 2EAUA 4HTAA 1H2WA 4ARSA 3UMMA 1CTQA 1W93A 1X7HA 2O3QA 1E2DA 1SXJE 2IWHA 3OEHA 4WLOA 2P3QA 3A4MA 4KWEA 4D9GA 3L7BA 3FPBA 4OB7A 4MUFA 2J0SA 2XUPA 5FUQA 2WQZA 1F0PA 1PR0A 1RRMA 1FNMA 3GLSA 3L0YA 1EHYA 4DMRA 1YFLA 3L9WA 4Y18A 3ZI7A 1NL3A 5HM8A 4OL9A 4JZKA 3SHVA 1PGPA 3P9RA 2C2MA 3D6MA 1C7IA 1L7NA 3N07A 2H85A 2MJLA 3P9KA 3HH8A 4CKYA 1ECLA 1QC5B 4DILA 4HN9A 2GXAA 2CB0A 5G0TA 3ACCA 3UK1A 4IVNA 3UPTA 2W90A 3TSZA 1G98A 2EQBA 2HL6A 3JQ8A 5IW8A 1VMDA 1BXRB 1QPBA 1QYXA 2XWQA 3B1VA 3I53A 4DDTA 4G63A 2NQ8A 1QMGA 4IGFA 4WFKA 4LZOA 5AVKA 2HN9A 3BG5A 1NT4A 4E5DA 2O2YA 2GF2A 2H0AA 1WXIA 5D84A 4Q37A 5FI5A 2P7IA 3VYVA 2I78A 1NLZA 3BBLA 3GGDA 1B41A 1IWOA 1ZM9A 1RQGA 5A4JA 4R8LA 5D7BA 2ZJBA 4WY2A 1K7XB 1KEWA 4ZGWA 3NHBA 1L5HB 3HV2A 4JL8A 4NOLA 3H1TA 4JC8A 2JGLA 1AURA 3PKJA 3KT8A 4DQVA 4WNCA 4PC7A 2O52A 4CCSA 3V6LA 5GWXA 2Q1TA 4C4TA 4HQKA 1ZJJA 2O8DB 3EH2A 4QXQA 3K9GA 1ISJA 4U7PB 3LDUA 5LA6B 4ALJA 1TUBA 1LBSA 1ZIPA 1KDOA 3FB4A 3FBTA 4XFKA 5AK3A 5IANA 1DTWB 1MV8A 1CUJA 4FKMA 2MYTA 4R0VA 4HAIA 1J42A 1PG5A 4RA6A 1U4OA 4OI2A 3AF6A 1SHZA 3M34A 4K3UA 4LE0A 2J6HA 4G6ZA 1L3CA 2AFIB 5JIBA 2P9QA 1ULTA 3B60A 2H65A 3LFUA 3AWDA 4B6SA 5DI3B 4W5JA 2PV0A 2DVMA 1BH6A 3BE8A 3U61B 2QOEA 3ND8A 1TMGE 3S44A 1ZR2A 1UUFA 3EQ6A 3D7MA 5EYPB 4A15A 2ZS9A 1U6IA 5ICSA 4URHA 3B2QA 3KWLA 3GZTB 3FPHA 2V9ZA 1ZLYA 4G4SO 6LDHA 5EWLB 2A0WA 5LR6A 4FFBA 3CLTD 2ZSIA 5H3HA 1M2FA 3P0JA 1YQTA 3RTCA 3UFXA 5L51A 1UFVA 4NZYA 3CVWA 1KO1A 1T9KA 4KCGA 2J6CA 3REQA 5B6IA 3OO1A 1N2BA 2QLMA 3DR5A 3MIIA 3D3EA 1WMAA 2WP0A 2WIFA 3GUCA 3EXG2 3EQ7A 1AS2A 3OQJA 4A92A 4MO2A 5ANRB 3TL2A 5B3AA 1KMQA 3VO2A 5IS2A 1GTJ1 1YIDA 2AC7A 2P6PA 3G5TA 4HD8A 4C78A 5ENZA 2YWJA 2IPAB 1GAWA 1P31A 1AZTA 3P9CA 4YAOA 3EVTA 1STOA 1Z6QA 2DQYA 3OLWA 1WSWA 2YUTA 4KH0A 4O2LA 4Y6QA 4XTCS 1RHKA 1GWNA 3KT6A 3U3DA 2AD1A 4FDAA 1RSZA 1BXKA 2EU8A 2AEFA 2Q6VA 3C5HA 1TFRA 1W48A 2PUHA 3FPJA 1XU4A 4RENA 4E1VA 3RG2A 5HFAA 5LN1A 4CR8A 4L4UA 1TKRA 5EUCA 1A72A 1KP3A 1LW6E 1U98A 4QU8A 5T3YA 4B7CA 4P5DA 3HCEA 2AYXA 1H2AS 4DCJA 3C41J 1XHLA 1XRQA 2B3DA 4HLNA 3RVBA 4JI3B 5A5GA 1U7PA 2HNBA 1L4EA 3BCSA 2FQ1A 1CR4A 1MAVA 2DULA 4CM9D 5KX5F 1WUYA 4EF6A 4D41A 3EEOA 1VI6A 2RDMA 3QXSA 2AGVA 4ZAFA 3E9DA 2V58A 1MXFA 2IEZA 2IIPA 4KN9S 4PAWA 3INYA 4OB8A 1KQNA 3FUCA 3MN1A 2ROQA 3L6OO 4DIOA 2XYVA 1W49A 1ECBA 3QKSB 3THWA 1NHWA 1QH8A 2GD2A 5EPOA 4AJJA 4C4ZA 1F1BA 2OA0A 3B6EA 1USKA 4HLUA 4JI0B 5E6RA 2Y6UA 4TXMA 1EFRA 3O4RA 4XCQA 5FWAA 1FSPA 4AKGA 4KGDA 4MV1A 5CNIA 3NBZC 3CNHA 2IU4A 4N4AA 1V9LA 3LUAA 3WAJA 3EXAA 3GC6A 3H3FA 2YIVX 3QVKA 3CU5A 2EJWA 2JL1A 2QMEA 4MB0A 5EI5A 2PQ0A 4A27A 4DMUB 2EFHB 4ZRNA 3HXKA 3AM3A 1OU4A 2HA3A 2VN8A 3B13B 4PQGA 2EF0A 5LC1A 3WDKA 3PE6A 3BGIA 4MIEA 3MSXA 2OFXA 1I3KA 4GD3Q 4P4GA 2YL2A 2P4UA 2VDKB 2JIQA 4YJKA 4ABTA 3TI7A 1XNQB 4AZ0B 3EVAA 1IBCA 4DSNA 4UCQA 3T4PA 2QDKA 4FCTA 3O9VA 1IQRA 5I7WA 4LDAA 3II6X 1FFYA 3ZN2A 1JKIA 1XELA 3L84A 5AUQA 3GRVA 5E4FA 2FX3A 2FN4A 4DMKA 3TOSA 3WYDA 1MO5A 3AFNA 1FQKA 2WHQA 5CVUA 4BZQA 3Q10A 3W1EA 3Q0TA 2BFNA 1T4CB 3WMGA 4RQTA 4F04A 1LNZA 4CIWA 2BHSA 2I1WA 2X5KO 4LDJA 4IH4A 4NOKA 2GZDA 3FNEA 4KXUA 3TRFA 4WZBB 4KJXA 1KOGA 1W76A 1KYXA 1HYGA 2CJWB 3RHTA 3DL4A 4ETIA 4C20A 4D6PA 2H5IA 2G25A 1O6ZA 1NPYA 2IHVA 1NULA 1R88A 1LDGA 3ESXA 4NBRA 4WNAB 5BWOA 3B7PA 1GNPA 2P0YA 3WYEA 2YZ7A 4AD8A 2FWBA 3ZWBA 4Z3KA 1PG2A 2VRCD 1UFRA 1N36B 5BWMA 3ZV7A 2G1UA 4Z4GA 4GYWA 5K8JB 1U9CA 1XCJA 5AKLA 4I36A 1HO3A 1P4HA 3MG9A 1A5BB 5EIFA 3T1TA 4KHPB 1P18A 1U9ZA 4BNKA 4XPIA 1MJNA 3PD7A 5L6LB 3IVMA 2X5JO 1RZRD 1PS8A 3TTSA 4URYR 4LEIA 3ICVA 1TQ2A 3IUJA 1YHZA 2XECA 1C1XB 3GPCA 3ZU5A 3Q3EA 1RE0A 1XP8A 3SX0A 5C8VA 3IBCA 5JSZA 4RHCA 1F1JA 4MQ6A 4YI3A 3TINA 2JK0A 3HCPA 1O9HA 1FFHA 1MFPA 2W5UA 3EXIA 4DQKA 1MOZA 1N5MA 5JYCA 2VFAA 3D7RA 5KVAA 4B43A 1Y1QA 2Q2VA 1GKUB 1S9HA 1EA7A 2A2ZA 2NPFA 2O2SA 1OWOA 3UJCA 5DIFA 1RC1A 5CFLA 4MHOA 2DJ5A 2FZKA 4OXKA 3V9PA 1I7SB 3MERA 4W5NA 1WZIA 3GCGA 1VL0A 1B1AA 5H02A 3HFGA 3KEQA 3ADCA 3VFDA 4G84A 4NAHA 5LIPA 5CT8A 3D5TA 4FMBB 2OFPA 1P9OA 5EKDA 5JVDB 1R5NA 4QC2A 2W4QA 1M67A 3RS2A 4P7GA 1AKNA 3WRYA 5GJBA 2V1XA 2VDUE 4OJTA 3QXGA 4BP1A 4ZI7B 3T7EA 1E6WA 3ZWPA 4KK3A 4D80A 3IBYA 4PZYA 1SPBS 2IZ5A 3DZJA 2B1GA 1CNEA 3M70A 1XN4A 3O7WA 2F6RA 4J75A 3MCZA 1KZGB 4Q66C 2PIDA 3RJZA 5JLAA 1KFJB 2PXHA 3QF7A 1S3FA 5BNTA 2A0YA 1ZWLA 1UOPA 1GZ3A 1BQ4A 2BRUC 3HB4X 2YHIA 4U3JB 1KJ9A 2RI1A 2VJQA 2GJSA 5COBA 4QGHA 1X8LA 4LWOA 2FZEA 1S2GA 4JVSB 2ZB7A 1A4RA 1T2CA 1VHQA 2R60A 3ZH9B 4BNWA 4EZBA 1TAQA 3HBAA 3M4YA 1H5NA 1JL3A 4PHTA 3HBNA 4HZGA 4TWAA 5BV8A 1Z4NA 5IN5A 2V0GA 4LBZA 4R69A 3D8TA 1EB8A 3CY6A 1P1CA 2BOVA 4BFSA 2EV9A 4X45A 3T54A 3TW4A 1P3Y1 3QBDA 2R00A 4QL3A 4YJ3A 4CJXA 2P9YA 2HQRA 4LZLA 1I2MA 1SURA 1PJ8A 3I62A 3TGLA 1EGAA 2F00A 1M2WA 1QDEA 2Y93A 4ZT6A 5JAPA 3PWSA 4V0OA 3TS1A 1D09A 1XMPA 1W59A 5JD4A 3S1LA 4NZMA 2HEIA 5JI2E 1DEOA 2P9GA 3IQHX 3SYRA 2EJBA 1PR5A 1J0BA 4ERXA 4AJNA 4J0IA 2Q9BA 5KQGA 1FTGA 1Q91A 5CTJA 4MV6A 1PL8A 1C0EA 4OCZA 1PR4A 5D51S 3LYAA 1FJXA 5JSKA 4M98A 1X38A 3G2IA 1RABA 1X13A 2W37A 3Q6NA 4ZTZB 2PMEA 4CG3A 4Q15A 4ZOAA 2DERA 2VT7A 5ECDA 4OGGA 5A62A 2ZTSA 2WW8A 1NPDA 2VJYA 2OGWA 4GYJA 3LUGA 4ZYLA 2XA1A 1N7GA 4Q4AA 2FP3A 1MMFB 3NGLA 5DTQA 2X0KA 1Z88A 4MUXA 3U4DA 2G63A 4YUVA 1MA0A 2PVCA 4JUCA 4Z7JA 2LVBA 1Y81A 2QEQA 1U8TA 4IEIA 4BRUA 1OCEA 5ALLA 4HS9A 2Q8QA 3T0GA 1V7PC 3STUA 1J09A 2GRJA 1JQEA 5ADUS 2CNBA 1RTKA 1EEHA 2ZP1A 3R5XA 2PLFA 4MPJA 4UD2A 1ADBA 5E9AA 5C8XA 4YV0A 5C1DA 3MF4A 4WLUA 2J9ZB 3ZQUA 1MJGM 4ZVVA 3KSMA 4KO3S 2OLJA 2XITA 2BSQA 3BWVA 4F5EA 2HREA 5C1BA 4AIIA 4L5BA 3OPYI 1Y1RA 4HAZA 4D4JA 2WE8A 1M72A 4POOA 2WTAA 2GNOA 1QHSA 3HV0A 3R0XA 1L4KA 4YK7A 2JBWA 1RM5A 4I9GA 3VJLA 1IOVA 4HI0E 2ZCVA 3N05A 1E5XA 1YB4A 2QU7A 3PHIA 4KU4A 3MXOA 2UZAA 3LH5A 4FZJA 5FORA 5K05A 1IN8A 4WCFB 1GNQA 3VI4B 1H5UA 3B3GA 3BD9A 2BDTA 4FSHA 1HOXA 2GYYA 2QAIA 4QUAA 3PQ2A 4MK4A 5HP4A 1MORA 2CZQA 3HGQA 5A5VA 3BBPA 4JSRA 1BX1A 1TTTA 1NGSA 4IG4A 1GZ5A 4HUTA 1CC1S 2LDXA 3E3OA 1XAIA 3G8AA 2VPQA 1ZMTA 1L8LA 2B2CA 5T4FA 1E1LA 2PSHA 1FTSA 4WK6A 1WAMA 1Z6AA 2AYYA 2OPHA 4CTMA 3EY4A 3NBMA 5EA2A 3C3YA 1HTWA 4CT5A 3CLTC 3T5DA 3OKFA 5KUTA 3MRVA 2ZS8A 3WO0A 1DRVA 3KJHA 2CZCA 4JLJA 1H0RA 4F3KA 1KKLA 3GJYA 2IS1A 4MGIR 2CBZA 1BKYA 2PS1A 4PE5B 2Z2IA 3Q5EA 2NUAA 2VP6A 1RXWA 2PUDA 1OASA 1P2DA 2UXCB 3IBGA 2Y71A 4HL6A 4UHDA 4IJMA 4L6CA 1Z0SA 2DWOA 4Y30A 5HIJA 2BI7A 2X6RA 1HXHA 1NN5A 1R0ZA 2QRNA 2XIJA 1A9PA 4J3JA 5JYEA 1XA0A 3NUGA 2C94A 2XCLA 5LQRA 4JT9A 5EQJB 1E4VA 1ZN7A 3HE3A 4MQEB 2NVUB 4YAFA 4ARCA 1PT6A 5TB5A 2RHRA 3DC7A 1GU7A 4LZJA 4YJGA 3PPYA 1YL7A 2PL3A 2VDVE 4H7DA 3EOAI 4KE6A 4P32A 3WMFA 4A26A 2Z8XA 4DBVO 4HFNA 3EGXA 2DJIA 4S0XA 1JDTA 1NI4A 1T3LA 4TMZA 3VC7A 4AY2A 2WA1A 4B4WA 2VCHA 3CLSD 2QAGC 5CITA 3G8YA 5JNWA 4XW2A 3SJZA 3PNLA 3UJNA 1JVSA 4R1NA 4XGIA 5DNEA 1PYDA 3VZDA 3WGYA 2CMHA 3ZWOA 2JBAA 4BLTA 1DP4A 3HDQA 2F9FA 4B6JA 4Z53A 2YN0A 4C76A 4PY2A 5EKUA 1SO8A 3PNSA 1UR5A 3M6UA 4FGUA 1YKSA 4CIAA 1VYTA 3LV8A 3SYM