2I34A

The crystal structure of class c acid phosphatase from bacillus anthracis with tungstate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
237
structure length
237
Chain Sequence
VKLTDQQLMADLWYQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSIDFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKEKRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDWEGALYDYNFKKSDAEKDKIRHDNLKSFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acid phosphatase
publication title The crystal structure of the class C acid phosphatase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 95
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i34A00
2B8JA 2YMQA 4EEKA 3OCXA 3OCUA 2I54A 4UATA 2WF6A 1PW5A 5AKIA 1XP5A 4B6JA 4Y2XA 4E88A 3K1ZA 4KNVA 4UARA 4HGPA 5ALLA 3ZWDA 2WF8A 4UMVA 4YIKA 3WKEA 4EENA 4FE3A 4HGOA 2B8EA 2AH5A 4UAUA 3MPOA 5AM3A 2NO5A 2G08A 3WGVA 5ALGA 1SWVA 1QQ7A 1RQLA 2YFYA 2IOFA 3B9RA 3QX7A 4UW9A 2P9JA 1NNLA 3AR4A 4AP9A 5AK6A 5ALKA 4BX2A 2R8ZA 3DDHA 2OYCA 2EARA 2YY6A 3ZVLA 1IWOA 1MH9A 1J8DA 2R8XA 1O08A 3TLMA 2YMPA 5ALJA 2X4DA 3KD3A 4EX6A 5T41A 4QJBA 2RARA 4L6AA 5AK4A 2B1QA 1RLMA 1WVIA 1XVIA 2O2XA 1RKUA 2GO7A 2IOHA 4OHFA 2MSNA 3QYPA 4ZEWA 3WKAA 3L1UA 5ALNA 3R9KA 1S8OA 2B0CA 3QU7A 2FPUA 4ZEVA 5ALWA 5AKKA 3U26A 3L0YA 3W5DA 1EK2A 1ZRNA 2WF9A 3DV9A 1WR8A 5AM0A 3RFUA 1QQ5A 4BBJA 3U19A 3WKCA 1JUDA 1S2OA 1J97A 1T5SA 4KN8A 2HDOA 2B82A 2WM8A 3EF1A 4KX3A 2OA0A 3A1EA 4DFDA 3W5BA 2FUCA 1Z4MA 4L6CA 4BNDA 4JDPA 3U7FB 1L7OA 3I1YA 4ZEXA 3FZQA 3L8EA 2IA5A 4XPZA 2JAUA 1YV9A 3SD7A 5AW8A 2G09A 1L8LA 5AM2A 4OCZA 3EF0A 4PNHA 1L6RA 3PGLA 3ZX4A 1ZD5A 5AI8A 2GFHA 2HO4A 5ALHA 2FEAA 3QNMA 3E8MA 4HGQA 3E81A 2W4MA 1VFPA 2ZOSA 5AVQA 2PQ0A 4YGYA 2P27A 5ALSA 4NFLA 1N8NA 3U7EB 2AGVA 3GYGA 4NWIA 3CNHA 1X42A 3AR9A 1Z4NA 3NANA 2FUEA 1L7NA 2DQSA 2GHTA 2ZG6A 5AI4A 1RPZA 2CFSA 2IYEA 2YBDA 1YNSA 3AR7A 2P11A 4EZEA 1NF2A 3L8HA 3UMGA 5ALVA 1VJ5A 5AW3A 5AW4A 4NABA 4J03A 4BYGA 4UM7A 4F72A 3WKDA 3S6JA 2EAUA 5ALZA 1VJRA 2RAVA 4HGNA 3NUQA 5AIBA 5AVVA 4Y2PA 3WGUA 3MC1A 3WK6A 2MU1A 5ALDA 3ZX5A 3B9BA 4Y2RA 5AKZA 2AUTA 3EPRA 5ALPA 5ALOA 2HOQA 3SHQA 3WKBA 5AW2A 4C4RA 1CQZA 2B1RA 3KDPA 5AVRA 5AVSA 2HSZA 3KBBA 5ALXA 5AIAA 3ED5A 3OCZA 3QU2A 5AESA 5AW6A 4XQ0A 4KNWA 2WF7A 3M1YA 2EATA 5AVUA 3W5AA 3SMVA 2C9MA 1T5TA 4BNDB 2G0AA 1SU4A 1Z5GA 4RESA 1Z5UA 5AK3A 3BA6A 5IT0A 2WHEA 4FFDA 2W43A 5AKEA 1SWWA 2JARA 4OFZA 4YH1A 1ZD4A 3E58A 1QYIA 4UMDA 1YDFA 1TA0A 1XPJA 5AVZA 4GXTA 4YCNA 4EX7A 4DWOA 2YMLA 2WFAA 3AR6A 2FPRA 1AQ6A 3ET5A 4MWOA 5ALUA 3ZTWA 5ALTA 4C4TA 5AW9A 2I55A 5A3RA 2HEGA 2O9JA 1RQNA 2HX1A 3L0BA 4L57A 2HCFA 4XE5A 4BEVA 3L0CA 4CF4A 3ZVNA 1RMQA 3QGMA 1ZD2P 4HGRA 3SKXA 3N8GA 2PKEA 2Q4TA 1LVHA 4XOUA 2YMMA 1RLOA 5AVWA 4H1WA 1FEZA 3W5CA 4AS2A 2JGAA 3NAMA 3AR2A 3ZTYA 3N1UA 3N28A 1RKVA 3WK7A 2C88A 1N9KA 3AR8A 4AS3A 1ZOLA 2G1AA 3D6JA 3UM9A 5AI0A 2CFTA 2ODAA 4IFTA 4EELA 3KZXA 3ZI4A 4FYPA 4Y2SA 3M9LA 3ESRA 5AVYA 3I6BA 3PDWA 5ALYA 3IRUA 3J7TA 4CE6A 3U7HB 1ZD3A 1Q92A 2HI0A 3QUQA 3QUCA 2OBBA 4BX3A 3PGVA 4IG4A 5AM1A 5A3SA 3ZU6A 3PCTA 4YCMA 3QU5A 2FPWA 4Y3UA 5AKYA 2R8EA 3N07A 2NO4A 4Y2QA 2FI1A 5ALMA 1Q91A 2G07A 2OM6A 1L8OA 3I28A 2Q4RA 5AVTA 1RKQA 2BDUA 2NYVA 2RBKA 1U7PA 3ZVMA 3NIWA 1WPGA 3I76A 3BWVA 3EWIA 1YS9A 3U13A 3FVVA 3IB6A 1RLTA 4RETA 5ALEA 5AKLA 3IJ5A 3A3YA 2ZBFA 3A1CA 2ZBEA 3L8GA 3VAYA 5IT4A 2I34A 4BKMA 1YMQA 2WF5A 2CFRA 4O8CA 4UMFA 3DAOA 2RB5A 3QU4A 2VKQA 3L7YA 4BEWA 1Z4QA 2I7DA 3SKYA 3A1DA 3L1VA 5E0OA 4UU0A 4DW8A 2W11A 3ZUPA 4CNQA 1Z4LA 1CR6A 1U7OA 2PR7A 2YJ3A 1Z4KA 3AR5A 3MN1A 1RC8A 1U02A 3ESQA 3DNPA 4CF5A 5AKJA 1U2TA 2YN4A 2JAWA 4KYTA 4BX0A 2I6XA 4G63A 1RDFA 2YJ5A 3FPBA 2C8KA 2CN1A 3ET4A 5AHXA 3P96A 2B30A 4KX5A 1QH9A 1Y8AA 3OTQA 1ZS9A 1TJ4A 5AI5A 4I9GA 3HYCA 2HHLA 4GIBA 3R4CA 2ZBDA 3OCYA 1ZRMA 4Y2JA 3WK8A 4MUMA 5AI6A 3KOOA 3FGOA 2HF2A 2YJ6A 5AKXA 1L7PA 2ZBGA 2QLTA 4C4SA 3UMCA 1Z88A 3FM9A 3OCWA 5A3QA 2IOFK 4OD0A 5AM5A 3RF6A 1Z4IA 5AKHA 5AW1A 3NALA 4Y2UA 4HYTA 5AVXA 2JAOA 3L5KA 3CZ4A 2QYHA 4G9BA 1TJ5A 3QU9A 1RRCA 2FDRA 1RMYA 3HLTA 4NAVA 3QLEA 5FP0A 2G06A 3F9RA 1O03A 4YCLA 4I9FA 4CF3A 1Z4JA 4F71A 5AW0A 3WK4A 3NASA 5ALQA 2I33A 3ONNA 2Q5EA 1WZCA 1T9ZA 2ZXEA 1NRWA 2FPXA 3NRJA 4NV0A 3UMBA 4UASA 5AM4A 3N5KA 2AMYA 5AI9A 1Z4OA 3WK5A 3U7GA 5ALFA 4Y2TA 5AICA 1F5SA 5AW5A 3E84A 3MMZA 5AW7A 1L7MA 1KYTA 1ZJJA 3OCVA 3QXGA 1K1EA 4JB3A 2BY4A 4HAIA 3L8FA 4UU1A 2P69A 1Z4PX 2YJ4A 5AK5A 4J2TA 2C4NA 5AKGA 1U2SA 5JJBA 2HF7A 3ZWKA 3KC2A 3FPSA 2BDEA 3QUTA 3ZW7A 5ALIA 2D2VA 4UAVA 1YJ5A 3AR3A 3R09A 1EK1A 3QUBA 1RMTA 2C8LA 4YIHA 3WK9A 4QQFA 1TE2A 2FPSA 4UMEA 3B8EA 5ALRA 5IS2A 4UM5A 2GHQA 3OPXA 1LTQA 2G80A 4DCCA 3SF0A 4Y2VA 3SLRA 2GMWA 1QQ6A 2R8YA 4Y2YA 1TJ3A
chains in the Genus database with same CATH superfamily
1YQ9A 4I4IA 2NXNA 3GN1A 1HK7A 5EJIA 4CM5A 3OCUA 1U3VA 3ZDQA 5IC4A 3NTXA 3Q5EA 2QVZX 3RK4A 1L5ZA 9ABPA 1FS5A 3W06A 3OKAA 1ZXBA 4Y2XA 1J20A 1N6OA 3AF4A 1QXSA 3HDGA 4RHFA 3FSEA 4HGPA 3EGXA 3VH2A 4EY6A 1E7YA 1OBFO 1KKUA 3CYFA 5KYUA 4YT2A 4P36A 5FWXB 5KQPA 1QO0A 5TV2A 3ASYA 4BMVA 1UMDA 1R9GA 2GASA 4X7PA 2H92A 2HWXA 3FNHA 2I7CA 4MZDA 1L4UA 1UEXC 1ZD9A 2FE4A 1Y3BE 1OZ0A 1WV1A 4HNAA 1NE7A 1QVZA 2DLNA 2UYQA 5EWMA 4AKTA 1TDJA 3J81A 3CSDA 1CW2B 2VATA 4XARA 1P5HA 2HF8A 4P81A 4Q82A 3KLPX 5REQA 1QK4A 1SQ6A 4QUGA 3G7UA 1QIMA 4CKCB 4DDTA 5HNKA 4HTAA 3TNLA 1J0CA 1ZRSA 3GIDA 3OT1A 3ZIAD 5JD6A 1N8SA 1U3GA 4CPDA 1MENA 2BVNA 3ZVLA 4WK2B 1CHDA 1OGJA 2R6GA 4LZAA 3SCZA 2DC1A 2M9MA 2Y0BA 3V34A 1EXDA 4K6FA 3NTUA 1QHIA 3HV0A 3S8EA 1JQLB 1GUBA 2B9VA 4AICA 4X3OA 1NC1A 2VDKB 1X1SA 2VHXA 3GVIA 2ORED 4GPEA 4PICA 3K0SA 1WW8A 2Q3MA 5FHQA 1J90A 1IK4A 4AVYA 3QLVA 3DG9A 1K7CA 2J5QA 4KU4A 2CYAA 4WLNA 2XWJI 5HFJA 4K88A 2EFHB 1MP0A 1V4NA 3AXTA 4KP7A 1WOYA 4JLPA 3LF1A 1DINA 1G9SA 3HN2A 2F62A 4LYFA 3QU7A 4N4AA 4RLSA 2FPUA 1AX9A 4KWCA 2IQ5A 1Y9AA 3RG8A 3CO0S 3S27A 2QT0A 4Z53A 2NX2A 1U2RA 3DAPA 1G16A 2G3YA 1VE9A 1NULA 4O4IF 2NVBA 4LDJA 4Q9HA 1C3OA 3BJEA 4L6IA 4NJMB 5BYAA 5IN4A 1HH4A 3T4UA 3Q2OA 2AKAB 1UODA 5AM0A 3R7AA 3GPIA 1BDBA 1BGVA 5BUZA 4HLDA 1ZNQO 1NW7A 1VI5A 4XSGA 1E6MA 1TM5E 2YHBA 1P75A 2B82A 4UCXA 2I6TA 2FWNA 1ETUA 1GZ4A 2FF5A 1Z15A 5CNMA 1R0RE 2VK2A 4RPGA 3SU8A 2ZRCA 1DQRA 4LOIA 1TC1A 4QLAA 3IT3A 2ZT5A 3AJ8A 4YR9A 3QJYA 5HM6A 5KUTA 5LMUB 4AN1A 4GKJB 3VU9A 2VJKA 3AF0A 3DWIA 5A62A 3EF0A 4J43A 5FOUA 3IHLA 2A94A 5JS1A 4IDPA 4M87A 4S24A 1TPZA 4N0QA 1PV2A 5EN4A 4ZDJA 1UPXA 3FSGA 3RU2A 1TTPB 2ATXA 3SQMA 1FB5A 4BRUA 3HZOA 4QQ8A 1RNLA 1E0AA 4FN4A 1IK6A 3DVLA 2OHFA 1OLUA 3LCVB 3NVDA 4GM4A 3V3KA 3E22B 4AO7A 3RS0A 1DEHA 2YW9A 1EUYA 2AWOA 1SXJB 3AOEA 3RFFA 2IUFA 3PDJA 4Q00A 5IDWA 2Y1XA 4LZNA 3ZIDA 2C3PA 3O3OB 4G1UC 4HWKA 2R60A 3OM9A 5TPWB 4DEXA 2ZRHA 1H4VB 5JU6A 4IQGA 5T8KC 3IRVA 1MOSA 4LRWA 1ORTA 2CZCA 4KI7A 5REQB 5LQKA 3NI2A 1WHSB 2Z6AA 1K0FA 3GXOA 4I1IA 3DL0A 1RBYA 1YIDA 2IU6A 4LDPA 3ROQA 3U7JA 1XF9A 1KH1A 1L5HB 4TVSA 1ZHHA 3LDGA 1L1RA 2V7GA 4IDDA 3PXGA 3BHMA 2IFTA 5AW3A 1RWVA 2AN9A 4AECA 2JGFA 3VSBA 1FS4A 1AF4A 5CXQA 4UE2A 3FNQA 3ZHXA 1W2GA 1EVIA 3BQNB 1PLJA 3GP5A 3NUQA 4FR2A 4HGNA 4UVDA 4NCIA 1CUVA 3DUWA 3RVOA 4ZOLB 4C21A 5D3QA 3VOAA 2BM8A 5DTIA 2GLUA 3HGTA 2QAGC 3E6AA 1LBQA 1UFOA 5EJAA 4EPYA 2EJWA 1JHPA 1GDDA 2QL5A 2NXJA 4RTNA 2H18A 2ZUTA 3AHFA 4G5QA 2XUHA 4JLUA 4MR9B 5E6UB 5HFNA 2IYRA 4AG3A 3NU1A 4RZXA 4QGGA 1GHTA 4Y6SA 3FUXA 2HOQA 4OXIA 4BE4A 2F1OA 2RHBA 1TXGA 5E4JA 3GH3A 3VH3A 4P3OA 1WV0A 1SUBA 2PRZA 2YWDA 4E11A 3ITDA 1NRXA 5P8WA 4QATA 5AIAA 3NVMB 3DHVA 2R2GA 4ZVOA 4MVJD 1HDXA 4HLQB 2VT3A 2CZQA 3G79A 2OQIA 5KAPA 1PHPA 1Z16A 4U3JA 3O4HA 3KAPA 2WTUA 3SMVA 3FTNA 4WL0A 1DTSA 2QSYA 4U8HA 4LSMA 1BJTA 3PITA 5LM3A 3COPA 4EHAA 4QASA 4S3MA 4F0JA 1Y8RB 3O94A 5J9FA 1XZLA 3EGCA 4BQOA 1V4BA 2HQOA 4RD3A 1TUGA 4DA6A 4OFZA 4NRDA 3MJCA 3R20A 4IUBS 4O59O 1MC8A 1YRYE 3RVRA 1D5CA 2C2KA 2QTHA 4PRKA 4KUEA 3KO8A 3PHBE 1W34A 3STUA 1PJ2A 3HCEA 3ITNA 4LY0A 2PMEA 1JI0A 2B4KA 5EJ8A 4GMKA 3WLEA 3X1ZA 2OO7A 4MMZB 2ZSKA 3Q2KA 4ZZ3A 1RQNA 1KFCB 1ZUWA 2AXQA 4O33A 2JEOA 4OBXA 2HTFA 3EVGA 2HCFA 1ENYA 5K3CA 1QZXA 3DB2A 4FYMA 4KLZA 4XE5A 1X8KA 4V0RA 2AX4A 4TUYB 3T7EA 4QUAA 2PL3A 5FBHA 4E13A 4N5MA 3DLTA 3TSYA 1V96A 3WGHA 1MV5A 3DZKA 1Z2DA 1LVHA 5HDQA 4LBVA 1SU6A 2VKTA 4HI0E 4MQFA 5G1OA 5B2FA 1HC7A 2ZIZA 3L0ZA 4MRVA 4Q5IA 4V0SA 2BRUA 4CDGA 4YMTA 2FQWA 1DV2A 2ZIUB 4L8VA 3V4FA 1DO2A 2X76A 3O8RA 1WMBA 1ZCFA 2Q3FA 3II6X 4HO1X 1ISFA 1GGNA 1ZCAA 4ES6A 1K3FA 1D07A 2DH5A 2QA5A 1U3TA 1ZOSA 4ID3A 4P80A 3OOWA 5F4BA 1T4MA 2BGNA 2FSGA 3NV9A 2C88A 4TKVA 1JBKA 1T91A 3K9LA 4PZPA 1MO5A 5EQDA 3GDWA 5SICE 3TG8A 1ULZA 2H2FA 3TTUA 2Y0CA 2HIAA 4RXTA 4EK9A 2OCIA 2AFRA 1CBUA 1F7UA 1B0UA 4AXXA 4BLWA 3LUDA 2NZUG 5L4NA 4MIEA 4JXZA 4R54A 1GYPA 1W8IA 5LB2A 5CB4B 5M29A 1AMNA 4WXYB 3PCXA 3V42A 4FFVA 4W5WA 2JH8A 2YRFA 3H5WA 4NHEA 1PE0A 1T4CB 4V0OA 4E30A 2V45A 4AKHA 1QSGA 1R4ZA 1E1RA 3FN4A 3IV6A 4F1WA 1JIVA 3AHEA 2GNOA 1K66A 1QHHB 4KODA 2WG2A 5DNVA 3CNQS 5AUOB 3LBFA 1YA6A 2JCXA 3KVNA 4BJ3A 3V55A 3IBSA 2Z04A 4Y67A 4HDAA 2EV9A 4M1KA 2VDNB 4UHJA 1SBQA 3ESZA 1Z8DA 2J85A 3K20A 5DH9A 2VDJA 1U0TA 1D6JA 2QPOA 3L9XA 4XX0B 4XWTA 3RKSA 3SHTA 3ZQ6A 4CUKA 1R9JA 4TS9A 2G07A 5EXSA 4B71A 1RKQA 1NMXA 1JLSA 1DARA 3PFWO 3PRHA 4YY3B 5FF9A 4OY3A 4Y1GA 1GU7A 2J45A 2PUEA 1GTSA 1DPGA 1HE5A 2JZNA 4QXOA 3U3DA 2J5RA 4HVAA 3CPJB 3LKVA 1EHCA 5C3UA 5TQ2A 3JYQA 2WLSA 4XD2A 1H6CA 1QR6A 1IHYA 2JFYA 5EP4A 4YFVA 4OQXA 1KY5A 5A1TA 5K8JB 5JZOA 2ZBFA 3PQ4A 3CZMA 1DSSG 1AB5A 1T1IA 3VAYA 5IT4A 3E9ZA 1FX0A 3REQA 1L4LA 1V11B 3LCUA 4JBLA 3F0TA 2XTZA 3DL7A 1PVOA 2HN9A 1A9ZA 1POXA 1U7HA 1ZWKA 3DNMA 1PIWA 3O9VA 4TWIA 1M2FA 2OYRA 3MLAA 4ZRDA 4HTFB 2HJRA 3NEJA 3UXEA 2XR1A 3CLUC 3AF1A 1PDWA 1CQPA 2FFHA 4MUGA 4NL4H 5KSYA 4KFCA 4DMGA 3DBRA 3K32A 3VVBA 1BWPA 2X0EA 7MHTA 4QG7A 1SXGA 1OA0A 3SKYA 3IQGX 2VOEA 2GEBA 2REXB 3C3KA 1GNVA 4MTLA 1S3SA 4DV1B 3TNJA 3EZ7A 4DW8A 3ZUPA 3PPIA 4LRQA 2VNJA 4C0SA 1OB2A 4DWVA 1Z4LA 3MJVA 2HJWA 5EJ5A 4MYCA 1SOUA 2WSSD 3MPUA 4M37A 2CKMA 4ODIA 3WQSB 3LY9A 1X77A 1U2TA 4R6WA 3G9TA 1ZR2A 3ZNNA 5BMVA 1ZONA 3PA8A 4UREA 4R98A 2YJ5A 3GZ4A 4PLCA 1B16A 1RCTE 3B2NA 3NHJA 1LLDA 4QXPA 5DSXA 1OE0A 1Q7GA 5E1MA 1ZNYA 1GZUA 3FOEC 1OXVA 3SLKA 4DR2B 3D3KA 4J0FA 4PZDA 2IP1A 3F1LA 1RJWA 2QEQA 2GN2A 1RI1A 4ZARA 2XQKA 1ZRMA 4KXUA 3HJRA 3U37A 5DGTA 1IBLB 3LY8A 1ENPA 4OXNA 4YRPA 1NSFA 4YQFA 2ZCUA 1DJNA 1WUYA 3ABRB 4LTMA 1TUBA 1V5EA 3WLIA 4DZZA 1QDLB 1QWOA 3BFPA 3H8WA 4WCVA 2PFGA 3VU8A 1GAEO 4EAQA 4BZQA 3SEZA 4WXPA 3RF6A 3CLRC 3HA2A 4JR0A 4H7IA 2GAOA 4BFUA 4DIBA 4RTMA 2X5XA 5AVKA 4I5GA 4FLEA 4BUJA 5BSHA 4L08A 4MS3A 3QU9A 1SH7A 4BO2A 2GEUA 3HA5A 4HRVA 3FOCA 4X6XA 3OOSA 4WUTA 1J4AA 3I52A 4KXQA 4EF6A 5C8YA 2E5WA 2VSXA 4LJAA 5B3AA 2XXAA 3EZYA 3NHWA 1PQPA 2FZCA 4G5RA 4QBGB 4G8CA 4KWIA 4CF3A 5F1KA 4PYOA 1RLJA 2H7YA 2NSHA 3RRYA 1S3IA 1RHKA 4S1WA 3UUWA 1Q0TA 1FW8A 4CMIA 4JJFA 2W2NA 3LLMA 1CRWG 4KC0A 4Q1CA 4MJ3A 2Q7DA 3H8SA 1E2EA 5TQ2B 4H0CA 4JS0A 1P8JA 1SZJG 3ASVA 3P9NA 1NQOA 5JFTA 3B1FA 3R5HA 2PL1A 1RKXA 4K28A 3G2JA 2FX2A 1VJ1A 1YH3A 1Y34E 1VSQA 1XEXB 3BRWA 3VRHA 2WFZA 4W6QA 4PSCA 4CZ2A 3AU9A 2CFCA 3HP7A 1BS1A 3FOBA 4PFJA 1KFBB 4N9WA 2WB2A 2E0IA 1J2TA 5EIOA 3E5NA 2IL1A 1AM4D 3OM8A 4M99A 1E3DA 1SA0B 1EVYA 3OETA 4WH0A 1N92A 1OF1A 1U6IA 5IMSA 1PU2A 4IH1A 3OZRA 3WL7A 3IQHX 2OLJA 3DBRB 3CLTC 4KXLA 1JR3A 2P9GA 3HYNA 2BY4A 3HYLA 5JWHA 2IZ7A 2Z4TA 2GUWA 3LKBA 3QX9A 4QICA 2I3DA 2EYQA 2PGIA 4U7HA 1IQRA 3IDFA 4L5JA 1NVAA 2HF7A 2FP4A 3H17A 3E7DA 2F3PA 3TFQA 1E1DA 1K7SN 1EDDA 1TU4A 4TV8F 4PCLA 1H2YA 3DAYA 1Y1TA 1L5VA 3AI1A 5CLJA 4K0RA 2X3UA 1UANA 3GJ0A 4M8LA 2V7VA 1IN7A 4MGEA 1KMCA 1XLTA 4X8LA 1C3XA 4AU1A 4ON9A 3OQ6A 1JNXX 3L46A 4Q0MA 5DULA 1HI9A 5I3ZA 5ELLA 2FRXA 4ENSA 2M6LA 3H7AA 2FSVC 2I4LA 1Z12A 2NSYA 3D0KA 4BNZA 1JKMA 4QT0A 3TW8A 4HH3C 4DJ5X 5CAEB 1PBTA 2F6RA 4ZKEA 3GCZA 1CLUA 4YJKA 2JRCA 3FZGA 1HOTA 3OX2A 3Q85A 1W0KD 3WDLA 1J8YF 3P2IA 3VR1A 4BLOA 4CTMA 1JU3A 1JECA 5K20A 2P6RA 3OZXA 3BJIC 2JATA 1YB2A 4MGYR 4E94A 5ED4A 5CITA 2O1EA 4RDHA 1M2OB 1LVGA 4LHZA 4PYRA 4HEA6 4MUKA 2JEYA 1TJ3A 1TUBB 1X7ZA 4DLNA 1CNFA 2WAYA 4EVQA 3PNKA 3GLIA 1SVMA 2VNHA 3EQ6A 4Q66C 3QBVA 3EA5A 3HB5X 3PXAA 2MSLA 4OIFA 4Y2GA 3T61A 4NS4A 4NOMA 5CH8A 4ZZ2A 2W71A 3VV3A 1W2HA 1TMGE 2OHHA 1EU1A 3L6EA 3MYRA 2XPCA 2IE8A 4B3RB 4WOCA 4O2BA 2RFLA 2VA9A 4RKEA 1W59A 1GTG1 3QBTA 2ZRLA 3GOHA 1EWTA 2IYXA 2PTHA 4KTTE 2IRWA 3SYTA 1NVWQ 3ONVA 3ZJTA 1EB9A 4ZO7A 3PQ7A 2I2WA 1KVUA 4LISA 5DOVA 2WDZA 4M1QA 5LZ5A 4NMWA 4EGSA 1CDEA 3AWDA 5IDQA 5KKNB 5TMPA 3I8XA 1TZJA 2WBLC 3AONB 4HLNA 4ZJZA 1XG5A 2GZMA 2VAXA 3BULA 4BQSA 5A4MS 2I9PA 1TFRA 3W5HA 1CDZA 1TUEA 3AR4A 3O4JA 3QE9Y 2XUKA 2XODA 5IRCD 5AMXA 1UC9A 1E2LA 3BXHA 1KPGA 1KR2A 1XZJA 5CBKA 1VGQA 2LWIA 4TM7A 3WFIA 2VQ6A 2O2DA 3LDHA 3GGPA 3WWZA 1W4LA 3ETGA 1JLKA 3HMKA 3DQQA 4J1TA 2PGAA 4D0RA 1F4LA 1FUKA 4NBUA 2DQZA 4HS4A 3IQXA 2QVGA 2OG1A 2JEZA 1NBAA 3Q6MA 3DOOA 4S12A 1NW5A 2W8BA 4QLOA 3OEHA 3BGSA 4C0QC 3N53A 3UHPA 2O1XA 2Z2ZA 4I55A 3R75A 1BHO1 1PL7A 3CJQA 4CM9D 2ASEA 3QEMA 1UUFA 2DM6A 2R4TA 4JLBA 3EIEA 2V74B 3FOWA 3GZNB 4AS1A 1BRTA 4DLPA 4Q1DA 3MJDA 3SI7A 5DIZA 1IPHA 1NLFA 4R5HA 4BGDA 4MWTA 4HDOB 3H1TA 4Q3NA 4DBLE 3A3PA 4AWBA 4HPXB 4YLGA 10MHA 1I6WA 3FWNA 5HKOA 3GY0A 3WY9A 3I01A 2NWQA 1K4KA 4DM4A 4MRSA 3W2IA 1BMQA 2OB1A 4KACA 3COVA 4UZSA 1M2EA 1G291 1ZIPA 1WL8A 1OFHA 3UAZA 5CA1B 4YRLA 3C8UA 1T9KA 3NH9A 3A9SA 5DHSA 3Q3EA 4MA4A 1YDWA 3RBAA 3VNSA 4DFDA 2E21A 3AEYA 4F4JA 2ARKA 1Q0LA 4RTRA 2XUQA 4DSAA 2SKDA 3W9BA 1BW9B 2P2CA 2JAUA 5LD2C 3EWNA 4GX2A 3GLHA 1DOAA 2ZZKA 1Z62A 2G09A 4J6EA 4PNPA 4JLSA 1VSVA 1A9OA 2A9RA 2A92A 2XD9A 3HFRA 1EP3B 3OLYA 1K5GA 3GAAA 5CFRA 3UG6A 1M2VA 3EIFA 1H8HD 2I2FA 4ZEMA 1A9PA 2YOFA 4MMYB 2R1TA 2TSYB 1K98A 1ZUIA 4EVIA 1BS2A 3A05A 2NU6B 1F2TB 4BBZA 1PYGA 4I1OA 2J33A 3AMVA 2NU8A 2Y4NA 1YR9A 3BKXA 2HPAA 4NY1A 2O1WA 3VZSA 4V2IA 1VFPA 1GCOA 3KEFA 3F4LA 1J5PA 1G1MA 3M1AA 4UOQA 4OQNA 4LC9A 5A0FA 3ZVKA 2CCKA 1ZUHA 1Z3CA 2XHZA 3KB6A 4L5AA 4OQ4A 4YGYA 5HJ5A 1R18A 3IDAA 2CVHA 1E3LA 1SBYA 1XYVA 5BN3B 1YU9A 3CNHA 3UJBA 4EA6A 5JY1A 3H1BA 4JVLA 1LVUA 5LQMA 3KQWA 4XUEA 5K3SA 2I6GA 3DLBA 1CUBA 1NLYA 1TCBA 4M9UA 1QZ3A 5IXSA 3C4JA 1F12A 2Q1WA 1LEHA 4Q9JA 2WUVA 2PD6A 3HO6A 2RGUA 4AIRA 5BXQC 2V6JA 4A5SA 2HV8A 2RAFA 3L49A 1KBOA 3AETA 3MCZA 1JV2B 4DBZA 2QP3A 3IAUA 4L7QA 3GUCA 3UMGA 3O4FA 4OU5A 3ZDZB 1E8MA 1OJLA 4DIOA 4C2TA 4NABA 3NNNA 2Z2JA 4L7VA 4RGVA 5DDIP 3MCUA 1ST2A 1LK0A 1N0WA 1YVEI 5DASA 3RAGA 2A1IA 3T41A 1LBTA 3IALA 1N0HA 4DAEA 4KMSA 3ZXYA 3O92A 3UK6A 5GGXA 5AVVA 1AQIA 2J5KA 3N7AA 1V8FA 4URHA 5F4ZA 4HB2A 2G63A 3WK6A 1N3BA 2R6HA 4FYYA 1QK5A 5CMLA 5EXXA 4KO1S 1Z82A 5FUWA 3SMQA 4EKYA 3MWDB 1BH6A 3CC8A 1O3YA 2WR8A 3K0KA 4KQIA 1MIOB 4BU0A 5EJ7A 5JNVA 4D3FA 1WPRA 1SY7A 2Q5FA 2GYYA 3N8HA 4JL5A 3IKVA 3JYPA 1WJGA 4EL5A 1XKXA 5D86A 2QSZA 4WSOA 1JSLA 4A7PA 1VBFA 2LVBA 1FDUA 4TMWA 3ZV3A 4O2LA 4DL9A 2PMKA 3HVRA 2PZJA 2QUAA 4C7VA 1KMNA 2ZPUA 4QOGA 4M1YA 1AHHA 1YZFA 521PA 3LV8A 5KU1A 5IABA 5BOVA 4MGHA 1VSUA 1TO6A 2OENG 3HM9A 1SIOA 2OGUA 3L8MA 5CA0B 3GQVA 3GRZA 2V97A 4Q1AA 5FLYA 1DFHA 4B7AA 1A88A 1O6BA 2OUIA 4GLBA 1HDOA 4DNQA 1E3WA 4QNMA 4GEGA 3GFGA 4X7MA 2GD2A 4YMIA 5F12A 3ZZMA 4JY7A 3V8NA 4QA9A 2BTEA 1SU7A 2NQ8A 4C7MA 2DF8A 3M89A 1K2WA 4PO1A 1D1TA 1SKAA 3HQ4O 3B3QA 3Q8KA 2BMWA 4E4RA 2D06A 1K08A 1TJPB 4I4CA 4X1KB 4FFDA 3K2IA 4GS5A 1B8PA 1C8BA 1JE1A 2JARA 3M5PA 2B2CA 2G9VA 4MW4A 4NE9A 3TOXA 3K6SB 4KB5A 1HO3A 1EUCB 4XASA 1J5EB 4JV5B 2QL7A 1WB6A 1E9RA 1QAOA 1KHTA 1NVVR 2HV9A 4XIGS 3WLLA 1U2PA 4ZMSA 4EI9A 3AR6A 1A2BA 1MQAA 3EVTA 2FHSA 1SVSA 5JV5A 2ZCJA 2BJVA 3ZG6A 2O20A 3ND7A 2A3RA 5HX7A 2VUIB 4P83A 4C7KA 1FZTA 2HX1A 1GPYA 2Q1YA 5EIFA 2WMNB 5F2EA 1B6GA 4QQRA 4UHEA 4TYQA 5CVUA 2HW8A 1ES9A 1ZK4A 1Y5IA 3DF7A 1ZCBA 4P0TA 2OGSA 4UBMA 2X8JA 1PLKA 3NGXA 1A9YA 2QD3A 3QA3E 3B5IA 4D25A 2C2OA 3QVOA 3IOYA 1JB9A 2A14A 4Q4JB 1SM4A 4ZZIA 1LK7A 1F2DA 1S5PA 2X8LA 3CEHA 1RLOA 3EAFA 3H5OA 1C14A 1VDMA 3KLOA 4RENA 3SKVA 1FEZA 2UZ1B 2IPLA 3HWSA 1NL3A 5A03A 3W5CA 2DT8A 3TUIC 2QTNA 5DHUA 2ZRIA 2VP4A 2HKIA 2Z6QA 1YA4A 3AWIA 3DDWA 5CLLA 1VKJA 1UBGA 3N28A 5CGZA 1RKVA 3EEQA 4M8NE 1NT2A 1ZN9A 5I7AA 1N9KA 1NOKA 2VG8A 4Z51A 3EVEA 3LC1O 3H13A 2H1SA 1HT2E 2WV7A 2IHNA 2ZUVA 1EK0A 2CVOA 3D9QX 1L5OA 1QO0D 3V1MA 4DRYA 2C2HA 3HJFA 1XCLA 1K3TA 1JF8A 2HCRA 4BJ1A 1CUCA 3C7DB 4Y2SA 5J2TF 4AC9A 4A2QA 1Q84A 3TVTA 2ZATA 4TZ0A 1EZ4A 5LVAA 3BN3A 4OHUA 3GCXA 4MXDA 3C7KA 4N0PA 2C83A 4A6DA 4HATA 4B17A 1QFSA 4X97A 4LYGA 1KOFA 5AM1A 4BX3A 3BICA 3DS8A 3LLCA 1SKUA 2CF5A 1ORHA 2ECQA 1PNVA 2R7AA 5F2NA 4Z9AA 2Y93A 2C99A 2V1XA 3DD5A 3HCBA 3W3AH 4LMBA 4IL5A 1RJDA 3LPLA 3ZGYA 2BLLA 4OGFA 4UOZA 3U62A 3SSAA 1UK8A 4EW2A 3HDHA 3IVMA 3INYA 3T12A 2POCA 3K1TA 5LQAA 2I67A 1H6BA 3NHAA 2BSQA 2Z6UA 4LJYA 2F3SA 1Z17A 2GK6A 1AK1A 2I2CA 4WJLA 1H1LB 2FEWB 2IT1A 3BWVA 3OEWA 4G26A 4YFYA 5THXA 5CXXA 5FLEX 3HXQA 1DX9A 1YS9A 4PLWA 3I3OA 2H11A 4AUNA 1JKJA 4C0HA 4DB4A 1KO5A 1E2NA 4M9QA 5FL7A 3RBXA 4W5TA 3I9NA 3B9QA 4B6RA 3LRXA 3IV7A 3QSGA 4UVEA 1IZZA 3NG1A 3ND9A 5JR3A 5FNVA 4F2GA 3GAZA 1NYQA 1GIAA 5KTKA 2P6OA 2P2GA 1NPDA 2ZBEA 3H6GA 2JFHA 5JRDS 5JJIA 3UJDA 1ACLA 5JSQA 4M3NA 2EKPA 4OLHA 3RWOA 2HRCA 5L6MB 2NP7A 2Q1TA 3IVCA 4NNJA 3SC2B 1SQ5A 1NJSA 1ZO8A 4FCTA 4F56A 3UHFA 1E4EB 4N40A 3F6CA 1A9QA 1Q3HA 1Y8QA 3IT1A 4AJLA 2YBEA 1JSXA 3C70A 4HLUC 1U80A 1FP2A 4A0SA 4HXYA 1CE8B 3QU4A 5FEMA 4N3AA 1QGZA 4F60A 2Q99A 1KDVA 4BEWA 3EQ8A 1FL9A 1NVMB 3F6RA 1PR4A 4F6CA 4CKZA 1CULC 1UEIA 3FUUA 1F2UB 5LLDA 3HWX1 1W5EA 4GSLA 4KQXA 1DWPA 1Y82A 4EARA 2C5GA 2JGDB 3DW3X 3ZCVA 1CR6A 1A9TA 1OHHA 3L6CA 3C7AA 4HVCA 2NMVA 3KAQA 4BP8A 1E18A 3QKSB 1RC8A 2DEUA 4X1IA 4P4SA 1DP4A 3WP1B 4OAOA 1UQUA 3ETNA 4C88A 1BA3A 3G49A 2OPHA 2ZZNA 1QG6A 2PSHA 5H83A 1ANKA 3QLTA 1J07A 1I4WA 4G0MA 1Q0PA 1WMAA 3FPJA 4AUKA 3R6WA 1CKEA 2CHVA 1FFYA 4FEYA 1I9GA 1EXWA 3D1VA 3DCJA 1YS2X 2NUPA 3P96A 5KYGA 1A77A 1QH9A 1XGKA 2CUZA 2IXEA 1CPYA 5KEIA 1ETHA 4I9GA 3W04A 1NC3A 2VDMB 3CY6A 3G3EA 1GG5A 3UK1A 1MOQA 5BO5A 4DCOA 3HPRA 5CIYA 5GIOE 3AUAA 2X4IA 2P8SA 3HUUA 4I66A 2WU4A 1Q57A 4G81A 2RC6A 1KDZA 3TL6A 5B64A 2ZM6B 1WHTB 2G7MC 3MINB 3UMCA 3LX4A 2QM7A 3FUCA 4OHWA 1KI3A 1W88A 2BBSA 4DUPA 3ZZ1A 3FNRA 3KTAA 1C0IA 1NQAO 4RE6A 3H2GA 2YV5A 1SVNA 5BVHA 3QF4A 4BVEA 5CFLA 2BWJA 3DLCA 4F38A 1SOWA 3RADC 1E3EA 5FTKA 3K70D 4MIYA 3QFRA 2AF3C 4ZMBA 3I5MA 3H4IA 1TJ5A 3GD7A 4TTQA 3KDSE 3PJGA 1MQSA 3AY0A 4TKMA 4BWVA 1RRCA 1XWFA 2FMTA 1ZH4A 1BCSB 3I92A 3COYA 3CJRA 2O7QA 4KE9A 4U7GA 2CL5A 2ZR9A 3OCCA 5CFQA 3G8CA 4JC8A 4PC3A 3CF4G 2O19A 1GTJ1 3WGIA 4PPGA 1SFRA 1MMFB 2OKCA 1ZM4A 2VBFA 4BVFA 3KYBA 2H48A 2PV0A 2NO7A 4FZRA 4QNRA 1QPGA 3TTSA 1AF7A 4MDEA 1WY7A 4P2GA 3PKIA 1C1HA 3ZLTA 2ZRFA 2O57A 3AF3A 3FNFA 3H5TA 4EVRA 2LNDA 2PBLA 4FX2A 5PNTA 4Q7EA 4B4VA 2ZB7A 1E5DA 5BRAA 1XDZA 1H5QA 1XPUA 4TL7A 1FUYB 3NS7A 1ZU5A 1CV2A 2E2WA 1LFAA 1SIBE 1T2CA 3N7TA 1C1XA 4E4TA 3MFQA 4TL6A 5TX7A 4C6RA 5AI9A 4INPA 1O0BA 3WK5A 3DCYA 2QXYA 1PQYA 2H4ZA 2ZJ8A 3U7GA 2QGFA 2XYGA 1H6AA 3AEQA 1NFFA 1C50A 4HMOA 1I7SB 1NBOA 1YQGA 2BEKA 3BRCA 5C2JB 5H3LA 2Q1XA 2X9GA 3EA0A 1P44A 3VR5A 2ZAGA 4RVNA 2NV2B 5CD9A 5C52B 5HP4A 1PSDA 4L4ZA 3Q3IA 5FI0B 2W83A 5KWJA 2XNDA 3PC8C 4H6PA 2DFNA 5EVJA 5FADA 1ZJWA 1ISIA 1NLUA 1PX0A 2BF7A 4M38A 3KYDA 4MOWA 4N7BA 5AK5A 3WMFA 1U2SA 4GLOA 1QC5B 2W0SA 2W8ZA 4ZHQB 2BZ1A 1PLLA 1G98A 3KC2A 3WLPA 5AHOA 3OUUA 2W93A 4RVCA 1VKOA 2O2GA 4EYGA 1MNQA 4XIJA 4HDNB 5D1HA 3A4LA 6REQB 2IBTA 2FWMX 4TT8A 2C0QA 1ZQ9A 3WTCA 1N5IA 4DMRA 1XTUA 2C98A 4WKBA 5JISA 4H3KB 4NULA 1LSJA 4WIAA 2B5OA 1EAYA 1EM8A 4ILKA 1EEHA 4B76A 4EG5A 4EGAA 1P2BA 3A1FA 4C6TB 3VYWA 1PR2A 1DHTA 3JVEA 4NV1A 1YZQA 3HC7A 5AJXA 1KL7A 2QTAA 3CW2A 2WIGA 4OMCA 1MO6A 3RD5A 4A8JA 5DTMA 1XAIA 2P9FA 1RJGA 4DDHA 5C4IA 5KKCA 2W2OA 3WSVA 2VYND 4P8RA 2R8YA 5JALA 3MTAA 4DA0A 5IHPA 1REQA 4JBWA 2GZHA 1SEVA 1RRVA 3N9IA 4RYDA 4IDHA 1PW5A 2YWHA 4B7UA 1ULTA 4GYJA 2DVMA 4X71A 4YJ3B 5KQMA 4BN4A 3O0TA 2N47A 2IYOA 5BORA 3T3EA 3ZDFA 3KWMA 3NTRA 3UV7A 4EG1A 3JQQA 3I73A 2YWFA 1KAEA 4DF3A 3TPZA 5T5QA 3RAPR 2IV3A 1SQ0A 2CLDX 3TN7A 1E0SA 1DC8A 4MS4A 1P2DA 2VJAA 4K9MA 5JJ5A 3I0ZA 3TUZC 1EGAA 2WHQA 1HFEL 3FFTA 1G8AA 3F3YA 3MQFA 4X9XA 5EQJB 3PXBA 1PYOA 1H93A 1TZMA 3CO5A 4GC9A 3IURA 1U0JA 4Q05A 3DDHA 4BX2A 4CN8A 4EO9A 4HJXA 3M4NA 2QVBA 2RK6A 5JCJA 3NBXX 4RIHA 1FYVA 2A3NA 2O8DB 1IMJA 3FCAA 3VKVA 4EMTA 2QZ9A 3RTBA 1E1RD 4R5MA 3BZBA 3B6MA 3TMKA 2HJ9A 3M3PA 4MKXA 4ZYUA 4HDQB 4WFIA 1X15A 4R2LA 4QJBA 4DCMA 3GQBB 1RM3A 3PUYA 3AF6A 4YEDA 2C3YA 4L6AA 4DCPA 4OYHA 2SNIE 2VWHA 1XROA 3C2QA 4TMFA 3WHPA 5FBWB 4J0GA 1JXOA 2GKGA 4MI1A 2FW7A 1SHJA 3AGPA 1K89A 3UMRA 1I36A 5M34A 2YL2A 3FMPB 3ZYZA 5ECWA 3LNCA 1F8GA 5A5DA 2BTQA 1EFLA 1ZK0A 3WLMA 1Y1SA 1FFEA 2XE4A 3KYDB 4B6SA 5JZSA 4RIFA 3DT6A 4ALNA 5TF0A 2WJPA 3E3NA 1VCIA 3VR4A 1C2TA 5C8VA 1HA3A 4LF8B 2ID9A 3D6MA 4L5IA 3CEJA 3VSCA 4F6RA 4HH4A 3GGOA 4PZLA 4R9NA 3IEXA 1WCIB 3NHKA 5FLXA 4GKBA 2V5AA 1E7MA 3H5AA 2WF9A 4YWHA 1HDCA 2YRWA 4CCYB 4D5EA 3B53X 1T13A 1UMBB 3D5EA 3DMPA 3JD1A 1DVRA 3SQWA 1YRLA 2ZJYA 6Q21A 1JUDA 1UKAA 3S2GA 1G0NA 4EF4A 4ZJYA 4HDMB 4GI2A 1P4SA 4KN8A 2HDOA 4A23A 1NSYA 4ADSG 3K9CA 3EE6A 2AEJA 4R68A 2FUCA 2B69A 4ARCA 1FXUA 1Q3KA 5KNDH 5DN9A 5H80A 5GQSA 1KJ8A 1QP8A 1Z8HA 1J22A 2J5BA 1AXGA 2JAXA 2EXXA 1E5VA 2QRJA 5M04A 2ZJ7A 4S1PA 1L4EA 2RHCA 1TVKA 3TLAA 4EFDA 4UTPA 7REQA 4EHIA 5KTYA 3KHKA 1PV4A 1DCKA 1U3FA 2RHGB 4OP3A 2MSWA 3TZBA 2W6MA 1ISPA 1G41A 4OQYA 5DI3A 4JEIA 5ALHA 1ZI6A 2P2LA 4BVGA 2QTTA 1R0YA 2ZUBA 5KZMB 1C8VB 3EOBI 1PW7A 1WNFA 4M89A 2AR7A 1R8SA 2W4MA 2PO7A 3DOHA 3VISA 2JLZA 1EVQA 2JFWA 2ODTX 3DDZX 3JS5A 5LB4A 3GLFA 2Q9BA 4MPPA 3DMFA 2FRVA 2PUWA 5F35A 2IWHA 5JDIA 1O8CA 3S2ZA 1XCBA 2MSDB 3LD9A 2TMYA 3PRKE 4UBLA 4WJZA 3ZHCA 2PLFA 4AIIA 2ZSBA 1P0CA 3H9CA 4G1MB 3O90A 1GGJA 1SVUA 3KQKA 4J49A 4PVCA 1TVCA 2ABWA 1HT3A 3C15C 4Z7QB 4JI2B 2CFSA 1D7OA 1OR8A 3DEFA 1QRDA 2LDXA 2XD4A 3KTFA 4EKDA 1G60A 2A0KA 1LY1A 5K51A 3E35A 1U6KA 2PKQP 3HJBA 4AN0A 4GC5A 1NN5A 1M7HA 4UQOA 4EMBA 1R0CA 1GEGA 2VTEA 1H9AA 3B2EA 3BEDA 4PZUA 1ESDA 1GR1A 1QHFA 2AJLI 3H4MA 2VIIA 1X13A 3DUFA 1VJRA 1K6XA 4OKNA 4BRSA 4Y9UA 3W5VA 3TAXA 1T8WA 4JKOA 1SD2A 1B14A 3BMQA 5HZKA 1B3RA 3MC1A 4EQ6B 2RKBA 3U0BA 3E0XA 2H0RA 1BFUA 5EZSA 1MAAA 2H9IA 1M8JA 1G9TA 3GFVA 5CYOA 5FBLB 3G8AA 5FKJA 3RVJA 2WM3A 4F5YA 3E7FA 2G0TA 1EA7A 3N8IA 4EB6A 1NAIA 5EHXA 5L51A 2BPOA 4ETWA 5I8ZA 1ZSVA 2HSGA 1HNWB 1F14A 4DADA 2PLAA 4IUCS 2WVHA 1X8LA 4IRUB 4KK4A 4C4RA 1KERA 3DL2A 4IDEA 5BV7A 3TTYA 4PRLA 4C0XA 4RHYA 5BWOA 5ALXA 1I1NA 1KSHA 2OR3A 4X61A 4E33A 2EW2A 2FR8A 3UO8B 3U44A 2XWSA 4B33A 3BRWD 4PC1A 1SN7A 1QH8B 3EBOA 4K9QA 1PR1A 3KUCA 4I5EA 5HF6A 2RHTA 1CYDA 1ZIOA 3LG2A 2EL7A 2FW9A 2L19A 2EP7A 1W0CA 4XRRA 2P9CA 1NI5A 2GB4A 1WKCA 4J7AA 4R2JA 4Q3BA 5K6AC 2GM4A 2AG1A 2BV3A 2K87A 3TDKA 1JR3D 3GO4A 3JATB 3QKWA 1NKTA 2WHEA 3PQEA 3T3GA 4R0MA 3QF7A 4OM8A 3HJGA 4G0NA 1XRNA 2EOAA 2HBRA 4S05A 4BDTA 1QH1A 4PAWA 3U4GA 2E1RA 4EG6A 5DYIA 5BPHA 4CJXA 4HWSA 1XPJA 3ROZA 3KLBA 4GXTA 4MQLA 5KX5A 1D5WA 1Y5NA 1A1SA 2WFAA 3GLSA 2FJUA 3ONEA 3AI3A 4J29A 1W85B 5B55A 1JYSA 2P67A 4N6GA 3LQ2A 5FAXA 5JATA 1BGXT 2ZSIA 2HJSA 4RFSA 5HIIA 3MELA 3A6DA 4MICA 2PL5A 3GUVA 2BDTA 3F3SA 3L0BA 4A26A 4F9FA 2DFLA 2C7BA 3OKPA 3AM1A 1VXRA 3EH1A 3N2KA 4WEQA 4F91B 3DR5A 4ZU1X 1JAXA 4HY3A 4UNNA 3OMXA 1TT5B 4V02A 3ZN2A 4QARA 3NP9A 2C5BA 2DT5A 3OLVA 4YUAA 1O0CA 4ZIRA 1SR8A 4M0CA 4XJVA 5C37A 3NHBA 4V2UA 4B87A 2JLUA 3HU1A 2PD4A 4BO4A 4C14A 2W6CX 3HNPA 4KRGA 1XZPA 3KLNA 1CUYA 1JJ7A 1IVSA 1CR4A 1GQFA 1U1DA 2OAQ1 3V32A 3TD6A 4V1CA 4N03A 1TPYA 5J2UB 3CKYA 2WICA 4CI0B 3CN9A 4P38A 4D3XA 3IGFA 5C35A 4DLAA 5B58T 4P4NA 3RK1A 2FY8A 4D9NA 4DOMA 1L9KA 4EABA 1U5CA 2N75A 3KXPA 4L0DA 3PNBA 1DIAA 1M1YB 3VJMA 1Z36A 3IYLW 2ERXA 2VYCA 2YUTA 2J1LA 4U0KA 3U9LA 3EJ6A 3CINA 2FQ1A 3LW8A 1CX9B 1JDTA 2QP4A 5FI3A 1XXHB 3PQ6A 4FWIB 5BNIA 3TGWA 4WPGA 3BB3A 5DEOA 3EDCA 3U3RA 3FNIA 4AY4A 3K71B 2EX0A 2C31A 4OQPA 3UJAA 3NM4A 1PX2A 1QVWA 4N3CA 2IBMA 3O47A 2V5VA 3FKQA 3R7WA 3O7WA 3JWJA 2Y4OA 4YAFA 1P33A 5B3KA 4QIHA 4AY3A 5A3SA 3ZWPA 3OBIA 2WWRA 4BJHB 3FLMA 4E12A 1TEZA 3HI4A 1KZ9A 5L4SA 3C24A 1OTHA 4YJ2A 5G0TA 1U04A 4IJWA 4YRCA 2HU7A 3G13A 1ZXXA 3EVBA 4BTVA 5JDCA 1KH3A 1QKJA 3I0NA 3KZVA 5A9SA 3AJEA 2GJAA 3VPHA 1L8OA 1KJJA 2ZIGA 3EDOA 4HH1A 4IINA 4KQEA 4DY6A 4ZTZB 4YRQA 1JRLA 3RSOA 4MR8B 2O2HA 2IIQA 3JPWA 4HH0A 3S2UA 3H3JA 4HP8A 4LMRA 1JLMA 2OQRA 2ZVJA 5AVJA 1LI4A 4MV4A 3GDFA 1P3DA 3OEHD 4AYWA 1WB4A 3O1JC 4MAFA 2N0SA 1UBMS 2WD7A 2GZRA 3DAFA 1NV9A 4IDBA 5ALEA 3QVGB 3UAOA 4GZ3A 1QKIA 2YC4C 4HN4B 1O96A 3A9WA 1DC6A 1WTAA 4QJ4A 3EUAA 2PANA 1U2QA 2Y8EA 3A1CA 2C7PA 1FP4B 3DTNA 3V6LA 3DBHB 4BKMA 2J7PD 3EC1A 4D4GA 3H5LA 4PG6A 1DKUA 4BNTA 3ZD9A 4BMSA 3LTNC 3AL2A 3HK2A 821PA 4LZPA 1C7EA 2ZAIA 2GJ8A 4DRZA 4DJFC 2A35A 3MYYA 3BSWA 1GPLA 4ZAFA 1K7YA 2WJGA 3A4YA 3PS9A 4KG7A 4ZWNA 3BTOA 4NIMA 1KEEA 5KSPA 1W4RA 2REQB 3V9AA 1JW9B 1FDTA 2HJVA 4S04A 2IU3A 3F46A 5B7QA 2QQFA 1Z6YA 3P5SA 3TXYA 1NY5A 1I94B 5CFZA 3LUPA 4JGIA 1UBOS 3L06A 3O1HB 5DLQC 1A5ZA 2VNAA 5HJEA 1Y3FE 3VOSA 5KNCH 4MUBA 3AP3A 2Q6IA 2VWPA 4CQLA 4C1NA 2AFIE 1M1XB 1SUCA 2HMAA 2XMCA 1CRPA 4ZVKA 2CDBA 2HT1A 3FBWA 4U2KA 4V0ME 2JAWA 1PK8A 1RDFA 4ROSA 1YGYA 3RHZA 1JIKA 4I9NA 2XIJA 2XCUA 2CCJA 2XRZA 2OXTA 4J16A 3WYDA 2G28A 4CMKA 4ZJPA 4YV1A 5DYNA 1X9IA 2C96A 1K8YB 4KWTA 2OZLA 3FVWA 3P4YA 2EF1A 4K5QA 3ZXSA 1BKYA 3NWJA 1M76A 1XI2A 4IFBA 1I1HA 3TNYA 1EUQA 2BFFA 4MV9A 3G1TA 1SRRA 1VE3A 1DWUA 2CNWA 1LF5A 2PUVA 2H08A 2IHYA 2QTRA 3DM9B 3FM9A 3FYSA 2W6QA 4BV3A 4DV0B 1JEYA 5T64A 3WBBA 1ZEJA 1UP7A 3R3HA 3W9YA 4CM8A 4PHHA 4A6EA 5HF8A 4YRMA 2Q3DA 1FVXA 5AW1A 3DMTC 3BDIA 5IDVA 5CDFA 4IWYA 2KBEA 4YROA 4LC1A 1V1MA 4HUQA 4ZO6A 3ZJ4A 5EJ4A 5HGXA 4RS3A 2W6OA 1QB7A 2JIOA 2W2XA 4C06A 3ZJVA 3ZY6A 1V16A 1C8LA 3CNEA 1LNZA 2W42A 3GA7A 5A9SB 2H1FA 2IW3A 5ADWA 1FRVA 1XZFA 1H85A 4HD8A 4MR7B 4NJEA 3F9RA 1FF9A 1VKRA 5BT9A 3OA2A 4M60A 1FP7A 4RNCA 1W4BA 4YP9A 3E5MA 4B4WA 4G09A 3TRFA 1E3IA 4LPSA 2V3CC 3DT8A 2VJQA 3SM3A 3IR6A 5LDHA 1TLTA 1XCJA 2TS1A 1F2VA 1XLUA 4FJ2A 1Z35A 2Q5EA 1JDNA 4KR7A 1I4LD 3S5JA 1C9EA 3HU5A 3NFYA 2CDNA 3ZBPA 3OECA 2WK1A 1FXWF 4GI7A 4NV0A 4M36A 5D3MA 3UCXA 5SZKB 2PBRA 4N6OA 4TX1A 5TQ0B 3CVXA 2X41A 3RV4A 3V2IA 1D04A 1L5SA 3HG7A 4NX2A 2VQSA 4D02A 1P60A 1FU7A 3TB4A 2W9XA 4YP5A 1ZM7A 4BQNA 1UK6A 1WM1A 1A8HA 2EWVA 1X1QA 2JAPA 2CMDA 4RY8A 1XTRA 2NUAB 1H2RS 1T1EA 3CEAA 4H4EA 4JZKA 4F11A 2BGTA 2UUPA 1J2JA 1WZUA 3P0IA 2YWRA 1KYTA 2DB3A 2FZGA 3EXEA 2WTBA 4NE7A 2W90A 4ZQBA 3QXGA 1U5AA 4H60A 3WIVA 4RTQA 2WQZA 4N41A 3OAAA 3VH1A 1J9ZA 1PR3A 1HLDA 2C4WA 2J0UB 2WAOA 4TV8A 4XVRA 1QMGA 5ETJA 4UNIA 5FB3A 3ZH2A 1JPVA 5B5SA 1J8VA 4GXNA 5LXTB 1WF3A 2WUWE 4MUYA 1DADA 1Q22A 2F43A 1R8JA 4E14A 2BDEA 1Q7TA 4HWGA 4NFHA 4PU0A 2FMFA 1NWCA 4AW9A 1X80A 4HDRB 5FFMA 2QBYB 4D9FA 5JYDA 3TO5A 1OI2A 1DTWA 1M6WA 1DLIA 4C5AA 3H8VA 4M7OA 1A4UA 4MPJA 5IFLA 5E9QA 1Q83A 2BH2A 2OOKA 3OOEA 4A6XA 1XX6A 3RASA 3VYSB 1S4QA 4NHOA 1HTWA 2KM1A 4YR7A 3O8OB 3W0LB 1AKNA 4G4IA 1HEUA 3RS9A 4URWR 1S6YA 4CIXA 5JLAA 4AX8A 3FJOA 1S8NA 3FD8A 2VDOB 5DFAA 3ZU5A 2XMBA 4HSGA 1G8MA 2ORWA 1R4MA 3VC7A 4RVDA 4XW2A 4EYKA 4ZI7F 4PANA 5BP7A 1KS2A 4MRPA 2AHRA 1X19A 5NULA 3U09A 2GK3A 5KVSA 2OHVA 4YJDA 4WBSA 4DG8A 4O4LB 2WF6A 4ND4A 2FFAA 1KMHB 5HFAA 1ZWLA 2PBZA 2BONA 3RVQA 1F48A 1J0BA 4WESB 5KTTA 3C5VA 5FBRB 1R6DA 4UARA 3OZ7A 5ICEA 3LK6A 3MJEA 4WNAA 2EWMA 4PSUA 1T8TA 1YS7A 4GWLA 2QOEA 2R7KA 2VF5X 2NNWB 4QYTA 2N1BA 3G9XA 4XAQA 3T38A 4NJEB 4JJIA 4UAUA 2B21A 3X1XA 4E1VA 5J58A 1P2FA 3PR3A 4JROA 4IX1A 1WSDA 4CKEA 1KI6A 2VHTA 5H16A 4L9AA 5I7VA 1NM5C 2O8VA 2PSEA 3UMSA 2B4TO 1NG1A 3KKLA 3B9RA 3JARA 3OQ1A 3QX7A 4CDRA 1MABB 4P0PB 1VPLA 4A9AA 4YMGA 3W79A 2Y67A 4K9DA 2BT4A 3PGA1 1GRNA 1CJTC 3B6ZA 3OU6A 3IEPA 1HYHA 1KI9A 3FDZA 4G1FA 2CF6A 4M54A 3W3ZB 5BWCA 2V6GA 2CJXA 4A0QA 4D3DA 5LWHA 3FYHA 3LCCA 3LRTA 1B6TA 3TLMA 4ZYZA 1DIOB 2XGOA 2G1PA 1VHDA 3T5MA 2G0NA 1C80A 3N3AC 4EX6A 1TLLA 1JG7A 4D8YA 1Z68A 3HZZA 3UAGA 4G5YA 3ADPA 4C4AA 4DJTA 2R0QC 4ZVUA 2FWRA 2B1QA 3V8VA 4B47A 1VCOA 2PRYA 1UXOA 4Z4FA 4G0OA 1CQJB 1II8A 4CHTA 3BDVA 3FY4A 4J0EA 1V3VA 2K7ZA 4OUDB 3IUPA 4KREA 5CPFA 1IM8A 4MWDA 3CZRA 4ZEWA 1V5FA 4MV8A 3UB4A 1SIWA 3UH1A 4XB1A 1E7WA 3L92A 2RIPA 1IMOA 1AS3A 3P2EA 5FFNA 2Q2OA 2WUEA 3EOZA 4CQMA 1T0BA 4B8WA 1ZHOA 3K70B 1EFDN 3PQ2A 5KHOC 3ZOKA 2IYTA 3IESA 3W9UA 4Q39A 2IX9A 5FL7D 5AKKA 2F43B 3BBLA 5SYAA 3OFNA 3G9ZA 2HHJA 1JSCA 2DY0A 5FT9A 4B6PA 3P0HA 4G5OA 4JUBA 2ALJA 1EK2A 1MU0A 2NZVG 2OBLA 2PBFA 5HZHA 1F8FA 1P9OA 2C2WA 2LCFA 1RABA 3CIOA 4K6GA 5J4KA 1A9SA 2XBMA 1IBSA 1W4ZA 3OT4A 4B3FX 2QMHA 2RGEA 2XAAA 4QFCA 5F7JA 1LFDB 2FU5C 4IDCA 1K9SA 1H2FA 5KYXB 4AQ7A 2QS9A 3PHHA 2JJ2A 1R10A 2FEOA 3CURA 2DFPA 4OJTA 1QV7A 3C3MA 4DCTA 1XCMA 4QPCA 4PV7A 1Z4MA 5FUXA 1QQAA 4DSNA 3O8CA 1HYEA 4DRXB 1UMCA 3LVFO 3I1YA 3OLQA 1XWWA 3GEBA 3N58A 1DFIA 2ZYSA 3RRZA 3EDYA 3LSYA 4BFZA 2XLCA 4XPZA 5A4IS 5KYWA 1TQ6A 3A7DA 2CSUA 2BEJA 4KO4S 1VGVA 3FRIA 3BHIA 1UQTA 3JRXA 2F1KA 5SY6A 4NMHA 4LNUA 3Q40A 4FLFA 3R8CA 2QSUA 3L7DA 3NKLA 2Q8PA 1TYCA 1T1JA 3KJQA 1QVAA 2EHJA 3CXRA 1H9CA 1Z06A 3QPCA 1D0IA 1OH6A 4JUFA 4XJSA 4QUHA 1P45A 2Y66A 3L7MA 3X1DA 1B93A 3YASA 4IKOA 1CZKA 4RC9A 1HZZA 5ECYA 1BN6A 1FTQA 2EZ4A 1Y3CE 4NNOA 4PX3A 1E4YA 3TLXA 1KYZA 2B35A 4B82A 1EA5A 4BVKA 3ZBUA 4B48A 2FMKA 2ZYIA 3QLUA 3MWYW 4UDOA 1Z2EA 2R6R1 3VH4A 3FCYA 3PUWA 4TVOA 4IKPA 1T2FA 3RKRA 3C6KA 5HXAA 1IBMB 1XVAA 4HYEA 2YBDA 2ZTMA 4FBGA 4AO8A 4QUBA 2P11A 2Z3ZA 1CS0B 1H2BA 1I1QB 5CVDA 1FFDA 3A25A 3JRNA 4IVNA 5JMOA 2J3MA 3MQ4A 1ID8A 4A4DA 2Q4OA 4EMSA 5JYCA 4RTSA 5KQRA 1ULSA 3OIFA 3FB4A 1Z6QA 2UKDA 3HY6A 3PTLA 1SBZA 3RC1A 4KWEA 4GVPA 2PRKA 3K0AB 2C7RA 1ENOA 2EDCA 1OFUX 3TTWA 4CM6A 4ZQGA 4K87A 1A5TA 2ATVA 3QUAA 3WGUA 4W1RA 1NIPA 4R1SA 1MEOA 2MU1A 3NYRA 3M9WA 4CIAA 5AT1A 5BT8A 4IHJB 4N65A 1TVEA 5I7EA 2QG4A 1NBIA 5KWIA 1BXKA 1UP6A 4JSRA 4I3HA 1YIAA 4ESVA 3VBEA 1AKEA 1F4PA 2PU5A 4IILA 3FYCA 4UQPA 5AKZA 5AUPB 3UB3A 3EXFA 3KSBC 1Z18A 4X84A 3VZRA 3IUBA 5DLPA 1E64A 2J9FB 1OIXA 1M33A 3D59A 4H27A 4OJMX 1T6NA 4ZODA 5FUQA 5IZCC 1EJBA 2G8LA 2CLIB 2WSYB 3PL1A 4HNRA 1GQSA 4LMAA 4PSVA 4MVJH 2AR0A 1A8UA 1E3JA 4LNAA 1WQ1R 5TXGA 1KTIA 1R00A 1ODLA 2XB8A 4XB6B 3OU7A 4K9KA 2YHIB 1NN3A 3DE2X 4C9BA 4GPIB 4E5DA 4KL8S 2IYPA 3JD3A 4PLTA 5GADl 3EVDA 4X8OA 1S7CA 3M5CA 4KNWA 3WIEA 2WF7A 3U5ZB 4BXOA 2GN6A 4KIFA 1B15A 5MN4A 1MPTA 3FPAA 1J23A 3A1WA 3MUEA 4HB0A 1KIFA 1OIVA 4GZLA 1C30B 1O95A 2FXIA 2PYIA 1OGIA 1S3GA 3LBIA 5DHFA 1NXQA 1Z5GA 3P0RA 4YMWA 2XNDD 1XCGB 1Q1GA 2GA8A 3SZMA 3K0FB 1LLCA 3DV0A 4FFBA 1E2GA 1ZD4A 4WQMA 3F5QA 4UMDA 3PWSA 1W1IA 3QI7A 3ZY4A 2FWIA 4OK6A 3BXGA 4MUFA 3STWA 1X1EA 1XHLA 2QX9A 2YMLA 4FGJA 1NUUA 3QX3A 4BO3A 5L4LA 1N6PA 4BNKA 1SCBA 1I7QB 3TIVA 1HETA 3KOYA 2PX5A 5IW8A 5ELXA 1I7LA 4MIKA 4EHLA 1I7DA 3MOIA 2QD2A 4KN6A 3OLXA 3CX4A 1Q16A 2OXEA 4CG2A 1GLNA 1SCKA 4OJQA 5DXFA 3O8NA 3TW6A 3CJTA 5AR1A 1XPOA 3TZKA 4MLDA 1PGQA 3M33A 1UWLA 2VUUA 4C4SA 1BJKA 3IBCA 3RTCA 3WYGA 3T5AA 1SOVA 3OZVA 1JI3A 4UZFA 4GR4A 3X0DA 3MJSA 2Q4TA 2RKWA 4DNFA 4F3YA 5F3DA 4U7JA 1AZLA 4JI8B 1NOJA 4P5EA 2WTMA 1KO8A 1GSIA 4PF1A 3JQ9C 1ADCA 2PT9A 3HDQA 3LDAA 4Q7MB 4C0LA 4EJSC 1CY7A 3L6DA 2NU7A 2AW3A 4BATA 1Q1QA 3C3XA 3N5CA 4BNGA 4BCCA 1WDWB 3NAMA 1UJBA 2EZ9A 2Z1NA 4I1YA 1GPH1 4IIUA 1HMYA 3ND8A 2IXGA 5JY6A 3JQ8A 3ELDA 4OGGA 4OHKA 2WFLA 4C2BA 5KBYA 4UFOA 2CFTA 3E1SA 3GDHA 2ZITA 3VKFA 4BCDA 2EU8A 2PIAA 1MZVA 5I7WA 2OEPA 4FXOA 2OBXA 4M0EA 2Z43A 3CSUA 1P8AA 4G67A 5ENVA 3VUEA 1IOVA 2HCBA 1NURA 1PKEA 2VCHA 3MUFA 3AYXB 3DFKA 1GXSB 3L4BA 3TPCA 1FUUA 2J3KA 5KIAA 2O3QA 4Z2AA 3ZE1B 4KDRA 5LU9A 3AXSA 2L42A 1GJRA 2W2KB 1C9NA 4G2NA 4MVJF 1AO3A 5ELMA 5DBGA 2ECKA 1P2TA 5I8WA 4CEJB 3EPLA 3MSCA 4XM0A 3QOYA 4QHSA 5HKKA 3QU5A 9MHTA 1WMSA 3E9YA 4IIJF 4OHMA 4P34A 4JXJA 2GK7A 4BKPA 1WXQA 4NZMA 1NNI1 1TQ4A 4XZ3A 2ENWA 3WV5A 1CF9A 3LJKA 3U4DA 2PS3A 3JASB 4Z4EA 3PQ3A 3NYWA 3E7PA 5IFKA 4DR1B 2D0PB 1EVZA 4OLFA 4IJQA 4Y2HA 2ZETA 4OV6B 2AKYA 5IDYA 1UPTA 2XB9A 3IQWA 4G6ZA 4IAOA 4FHDA 3OFKA 4BJ5A 3DB1A 3EWIA 3PFHA 1SHLA 1SUPA 2DPYA 2EEPA 5EA2A 1GVNB 3HEMA 3U9TA 4UTVA 3EULA 1J7JA 3N6RA 5CLHA 5CCBA 2VHYA 4V38A 2I2XB 5UKDA 1LRLA 4CM4A 4ZGGA 1WMFA 3PFCA 1OFVA 2NSLA 1N7JA 5BN4A 2WWHA 2O7VA 4MRMA 2OKGA 4QPZA 5G0VA 3ZD6A 1WBJB 3BWYA 1XCPA 2YRXA 3DONA 4FYKA 1IBKB 4TZ6A 1ZK3A 4CM7A 3VR4D 3TZCA 1T15A 2JCVA 4KKVA 3BS4A 5CR9A 4WBNB 4E4YA 4RULA 3AL3A 621PA 3CPEA 3FWHA 1QF6A 4KO8A 3PGXA 2CFRA 4IGFA 2VDPB 3ZK8A 4GRDA 4UM8B 3EMVA 2EHDA 3A3OA 1R5NA 3E4DA 1F6BA 3DPIA 2D3WA 2XE6A 4AJ1A 4AULA 5E6RA 5LOVF 5I9BA 3CRW1 3RIEA 4BJ6A 1SHTX 3A1DA 3T3MB 1PJQA 3SJBA 4O2AB 3JZDA 1YZTA 2XQIA 5EMJA 1T3ZA 2G5PA 1FYDA 1G9XA 2DWPA 4MB0A 4D4IA 1ZVJA 4LJ7A 5DGCA 3KLMX 3VUFA 1PUJA 2BYTA 3FYUC 3O82A 3EOAI 4B3BA 2NU7B 4OAPA 3X3HA 3A1NA 4B83A 4MV1A 1W47A 2JI6A 1V7CA 4Z2YA 5DF1A 2H1RA 3GVHA 4J91A 4DQLA 1KEKA 3NGMA 3QEKA 3T7JA 2EKDA 2X2FA 2IGTA 3F3MA 4FMCB 4IHAA 4IZHA 3QENA 3HFSA 2AIRA 3RYCB 3QELB 1J9GA 3KQPA 1TJ4A 2NQTA 1ZN2A 3FDFA 3N0TA 4QRHA 4Y9SA 3MUOA 1SQFA 3KKKA 4ZT5A 4YRJA 1YUNA 3LUGA 1VRVA 4ZZ1A 2R751 4LHVA 1Y48E 1JG3A 2JAHA 3PD1A 3IERA 4Y2JA 2I6UA 4EJFA 3RAEC 1U28A 2I8AA 3GP3A 4LHSA 2PGNA 1NDQA 3Q41A 3FYTA 1P3Y1 3K7EA 3O6VA 4FQ7A 4LCBA 4MWBA 2HQRA 4E5KA 4E7OA 3AP2A 1XL1A 2XJ4A 1A8IA 2CNBA 3CKKA 3H65A 1THZA 3TOVA 1E4OA 1YS6A 5FV7A 4OD0A 1KAQA 4LDNA 4BVBA 1J1ZA 4F2PA 2WTXA 4M7WA 3UICA 1R66A 2IUSA 5H1YA 4I4TB 3IIEA 2Z2IA 2FZVA 3NCHA 3E9RA 2RH5A 5CTJA 3FF4A 3W6ZA 1ISJA 4TYWA 4PCAA 5KU7A 5B37A 1RMYA 1Z7WA 3HRIA 4NAVA 3LGSA 4PXAA 1WW3A 4EBFA 1FIUA 4WNYA 3IEVA 2PKRA 3FUTA 1Z0ZA 3EUWA 3TLKA 3LYHA 1BFDA 4O8ZA 1QGUB 4AJPA 4X20A 2YIMA 4DIUA 2FNAA 3EARA 1II0A 3R9IA 1JR6A 4CM1A 1NUHA 1PSZA 3H16A 4EZBA 4YMUA 1FU4A 2A2ZA 1M75A 2JLRA 3MS4A 1WETA 3HUEA 4KO2S 2I6QA 4HPWA 4OMUA 4Z4QA 3R76A 4D8WA 3NVKI 1RHRA 2EW1A 4L95C 4ZTUB 1LF0A 2FPXA 2ZREA 4OP2A 2G72A 2A0YA 3G85A 1IM5A 1UDAA 3OX3A 4DQ0A 2ODEA 3TLCA 3UATA 4EKGA 2OT3B 3QQ5A 4FCWA 1OIWA 1Z7BA 4F3TA 2JKZA 3E5HA 4RVFA 4R7TA 1QGAA 4LW8A 2CUTA 2D8AA 1JDBC 2XE7A 4LHYA 3B1KA 3BVPA 3RVDA 1N6RA 2L18A 4LJSA 1HY3A 4PLHA 2OV4A 3A6JA 1BROA 2YQ4A 3HYRA 1G8YA 2PZLA 3E84A 3WGJA 4B80A 3MGCA 5IWAB 2GPBA 2NYAA 1SC1A 2I3GA 4U8GA 1EK5A 2RGXA 1OTXA 3WYCA 5ISMA 3HYSA 1YC2A 3WRYA 2IGBA 2JI9A 2XF2A 1TVMA 3V8BA 2GBCA 2C4NA 5AKGA 1RYYA 3BE5A 2AFVA 4IJVA 4MQ5A 4PLPA 2PXXA 4YN3A 5JFOA 1E2BA 4FOSA 5J3JA 3KQTA 3RTDA 2OXCA 1MH1A 1E6LA 5FPTA 3U16A 1PZMA 2ZTLA 1RWNA 5HIMA 2MYPA 3JPYA 5F5LA 5TARA 1HFJA 2JBAB 3VM6A 2E89A 3G5UA 1N3IA 3ZKAA 4B74A 4D1YA 1XMOB 3PIIA 1YTUA 4ZVTA 2BGGA 5FAKA 1IG0A 4QQFA 2C59A 4LI0A 2VSQA 1YZKA 1PD0A 1KY2A 4YHBA 2ZUWA 4L73A 4QTYA 3GGDA 4JJAA 1EVKA 3OPXA 3IKTA 3EFOA 3C8MA 2CGEA 2PQ2A 3C43A 3OU2A 1TZBA 1K7XB 3FVQA 3RVBA 3ETHA 1EHIA 4L5BA 5I7OA 4NYJR 2VAPA 4OI1A 1ZGJA 4TTPA 2V8BA 4Q1BA 3GRCA 1MORA 3F6BX 2B8JA 2C97A 3I2KA 1MJ5A 3WGTA 4EEKA 4ZCTA 1JJVA 4Z9YA 3OZFA 3LHDA 3QE3A 2RG7A 1I3OA 1MDBA 2V7PA 2V9CA 1Y7PA 3D54D 4IOJA 3ZGZA 2JGNA 3BMOB 3Q7RA 3RLIA 4RE5A 2XOEA 1EI9A 3IXLA 3GNQA 4LIPD 3T9DA 1F38A 2DG2A 4Y1EA 4C4XA 3ITEA 2GPSA 3HUTA 2OQ2A 4X85A 3RYFB 3BREA 1DAPA 4RF5A 1RIIA 1KMMA 3MUNA 1R37A 2H9AA 1XD9A 3ODPA 4REOA 3DAGA 1PT5A 1TU0A 5YASA 1HQYE 3H1FA 1EDOA 6GPBA 3OESA 3O91A 1QK3A 1ZD1A 3DFZA 5DIFA 5U9CA 3H5RA 1N2CA 4R8KA 1ZA1A 2P2NA 2DULA 2UZAA 1S02A 3DE1X 5ALKA 3SC3A 1AG9A 2GJSA 1SIUA 4FN5A 5LC1A 1IWBB 1IUNA 2GM3A 3ZS8A 3UPUA 2C4TA 4EHFA 4MWEA 5C3MA 2P2SA 4G5XA 2X9LA 4Q18A 2GERA 4TV9A 3ZLJA 2JD1A 5B3LA 1CJUC 1OXBB 5ESXA 3EZNA 2GD1O 4IXMA 3WBKA 3OLWA 1LNSA 2N42A 2DBQA 5J59A 3OJFA 3ZS9A 2GEJA 5LYJB 1RLMA 1QRUA 2B94A 1O4VA 4PHGA 1STOA 1NZFA 3X2FA 3J81k 4M1SA 1VLZA 2FGKA 3F7MA 5HOEA 1VCMA 2QM3A 2V03A 3BK7A 1KP3A 3L1UA 2G4CA 2F00A 4RK5A 4TTRA 5ALNA 3UTDA 1RI2A 3WLTA 2G4VA 5CG2A 5ICCA 3T1TA 2DECA 2B0CA 3ROFA 1S1MA 2VJOA 4HKTA 1JA1A 1Q44A 1W93A 3TJZA 4RHXA 3I72A 1YF3A 1JEAA 3KXKA 5IT5A 4EHHA 3IV9A 5B7PA 2R86A 1VJCA 4QXMA 4C7OB 2G17A 1ZGBA 3E48A 3Q3GE 2YXNA 3KALA 4JLOA 4L8FA 5KS2A 4LOLA 1OBCA 4UEJA 2PXAA 1CR0A 1S9HA 1T8RA 2BKUA 3LY5A 3L1IA 2FPLA 2WYVA 2GHIA 4KFTA 1S2OA 3KG2A 1Z75A 1T3LA 4RPIA 1SKYE 3DE4X 1SCQA 2IYNA 3OO1A 5ARDA 2OA0A 4H08A 3A1EA 3P94A 1EBUA 1KDYA 1FSSA 1I33A 1OMOA 2M98A 4JYZA 3CNOA 1QO7A 4DSOA 3NT5A 2XYRA 1GQOA 3R7BA 1GOTA 1T8YA 5F98A 1OXSC 3WNCA 4QRIA 1UOPA 1TQDA 3BE8A 4WZBE 5C5CA 1BGWA 1RM0A 1FUEA 4ND6A 4O4HF 4C3UA 2MWMA 1BKSB 4CCSA 2H29A 4RPCA 3AVQA 2CXPA 1XNHA 1Z3IX 3KUXA 4RF4A 4XYGA 3OO0A 3SEAA 4F6LA 3IBFA 5BSTA 1E1YA 2WNIA 1PVDA 4XSVA 1ZVKA 3R8XA 3G89A 4MA0A 5D6OA 2ZS9A 3QNMA 1G5HA 1ZUNB 3RANA 1R2QA 2C3MA 3NDJA 3IXQA 3VNAA 4IVPA 1EG7A 4MV7A 4IZOA 4JCOA 4L1KA 3UH0A 3EXAA 3ZZNA 2ZOSA 3CH7A 2IF2A 3C8DA 4MQBA 1CT9A 1G3RA 3IP5A 3ES9A 4HDSA 1G8KA 2QTVA 4CKWA 2PJDA 3H4VA 1HDIA 4N7JA 1NJ6A 2E4VA 3STXA 4PWYA 3OMWA 1QAQA 3N2IA 3E1KA 3V4VB 2PUGA 1X7WB 4ZRMA 1L7NA 2YHAA 4LX8A 3VAZA 1BFKA 2GHTA 2WSLA 2N9UA 3A9RA 5DO9A 3UJ3X 5JI2E 3NGLA 3PWTA 2VHUA 4EA7A 2CFIA 2CNWD 4KQ1A 2AB0A 3C6YA 1NASA 3ND5A 4RMGA 3R6DA 1JJBA 3T7SA 1LJLA 1NOIA 4J7CA 4PGFA 4R40A 5A4JA 4BY9E 1AKVA 1MUUA 4LDAA 4MV3A 5HR5A 1W25A 2AEMA 1ODJA 1VJ5A 3IQIX 4PVDA 4DLTA 5HIAA 4I1UA 3VPFA 4AZ0B 1N75A 4D97A 1RXWA 5DP1A 3MZ0A 3OP1A 3ZV4A 3HU3A 3PEEA 1YJ8A 3QKRB 3E3MA 3UGQA 3BFJA 1YI1A 3OQVA 1L8QA 3F2IA 2PD3A 3LNTA 1ZOPA 5TNXA 4W1SA 1FY2A 4WUVA 1ELOA 3TQCA 2FPGA 3HCPA 2QRQA 2LP4Y 3KJNA 4LUCA 5LDGA 1L5NA 3UYLA 4CKBB 3O4RA 5FOQA 4R1PA 3KEGA 4L3VA 4L51A 1HT0A 2W2TA 3MTQA 4DUGA 2OGWA 1GTMA 3D4PA 2F90A 2R00A 3K5WA 1KQNA 1UPFA 4NPCA 5I5EA 4YAOA 1RJFA 3D3WB 4WLOA 3O8DA 5GGYA 2Q50A 3KKPA 1QIGA 4UDYX 2Q3CA 1XAGA 3OY7A 1KAOA 1EWQA 1OU0A 2Q45A 5EGSA 2WYWA 4JYCA 2PM8A 3WQQA 1J70A 2V4UA 4H7FA 3ZE6A 4EW3A 5DPMA 1CF2O 3JALB 1CY2A 4PAMA 4TQAA 4M7RA 5BYBA 2Y1EA 3HVJA 4YQZA 3BH0A 2AFHE 4YREA 3WNDA 1EUDA 2IPOA 2GVZC 1ECLA 4GMDA 1BE6A 2B4QA 2Y0PA 3M1YA 2O6LA 3R7DA 4DT1B 4TYMA 1MX3A 4EP1A 4LE2A 5LWQA 2Z1MA 2C9MA 4DLVA 1Y3IA 3N0RA 3VKWA 3NNDA 1UP4A 2MDTA 4U7TB 1KJIA 4PGAA 5C8XA 2H5EA 3ROMA 1GPMA 3ORSA 4DCUA 3CUEF 4BN5A 2AF4C 4D9JA 5C51B 1OD6A 3OQPA 4XWOA 3Q12A 2OILA 1H4SA 3KZNA 3MD0A 3OAAD 4CODB 2P7IA 1T36A 1F9EA 1OYVA 3X2SA 1FFXB 1TA0A 5EZQA 1P81A 5AVZA 4DXAA 4EX7A 4TPKA 1XRMA 1KI2A 2ACKA 1Y9ZA 2Q2VA 4TLEA 1JVNA 1SVOA 2YX1A 4OB7A 4OXYA 2GM9A 4Q6BA 3DBIA 2LZ0A 1JB1A 3S1AB 5DGIA 1QWSA 4Y7DA 4PG4A 2C0CA 2C1XA 4PTZA 1ZK1A 4FD2A 4RK1A 2A4MA 3EA4A 2XUZA 3K1AA 1JPNA 1ORWA 5IP5A 4BEVA 4QWWA 4ND7A 3RV3A 3L0CA 2NUTA 1XWIA 2AOUA 3SDBA 5CBPB 2ZIXB 3QVMA 1U3CA 3RRMA 4JYPA 3ZZTA 1G3UA 3WBJA 3OJLA 2VUHB 4XCXA 5E2IA 3O75A 3Q2IA 1JAZA 3Q8MA 2EGHA 4JP1A 2Z4RA 1BWSA 2FPIB 4P35A 2K4MA 2H2GA 2O06A 2X42A 3SEFA 3W7AA 1XQWA 3LYUA 2OUKA 4GLFA 5JQGA 1FYEA 1APBA 1JKXA 4LCEA 4MITA 1O58A 4UD6A 3IO3A 1D0VA 2PK3A 1G5FA 2AN4A 3KQLA 2B61A 2Q3EA 4LG1A 2IPAB 5JASA 1E1NA 1JR2A 4FMPA 1C3VA 1FS6A 5E4FA 4B5LA 5I7SA 1W87A 1ZP6A 5KYVA 1ADJA 4HBZA 3NC4A 1EIZA 2F4NA 2J3QA 3GT7A 4C4OA 3HBJA 3AV3A 3KKQA 5ENZA 1R9NA 4XUCA 2IIBA 3E2MA 1NW9B 3RS2A 4WECA 1EVEA 1XTVA 2FSSA 5ULLA 2HYIC 1EWVA 2CK3A 3OTIA 5HS4A 1B23P 4LZLA 1MZPA 3SR4A 2XNCA 2XSZA 4G5GA 4FYPA 3ZBTA 1U3DA 4DGSA 4GZ5A 3K4PA 4XGRA 3P71T 5IARA 2QUZA 1PG0A 3KV3O 3EX7C 2GXAA 4NPAA 1I3NA 2AZMA 4NF2A 4ZT2A 4ZT4A 4A03A 2QU7A 1CEYA 1BMDA 1I3MA 1TJYA 2RG1A 1IY1A 4EFNA 5JI3E 2HTEA 1YL6A 4YMSA 5FI1B 3WIUA 3NTQA 4DWWA 4MV6A 3PPVA 1F6DA 3I04A 4XQEA 1TKAA 1L5YA 2QROA 2V54A 2WU8A 5KTRA 4DUZB 1OROA 3I2YX 4MGIR 4TWAA 5K6TA 4I50F 1OWMA 3M6MD 3QWAA 4I7EA 3EG9B 1Y9EA 1IDOA 2ZJ4A 1EUDB 3IP6A 4FHGA 1LPOA 1MIHA 2RBKA 3FNGA 3JXEA 4R2WA 5IAGA 5TB5A 3RK0A 4NATA 5LN1A 4QHTA 3DVAB 2ADFA 1WPGA 1QRTA 4WGGA 1NDUA 3LM8A 3H11B 4G5HA 3SQOA 3R44A 4DR6B 2JLAA 3RTGA 1NVXQ 3AQIA 3BD9A 1R5OA 2XVMA 2RJ3A 4XWGA 5JSZA 5EMKA 5CK5A 2C5HA 5LMCA 1HLGA 3R4VA 5FWDA 1A95A 2DPHA 3CR3C 5EIWA 5A2GA 2BJWA 3LP8A 5GP1A 2BW0A 1OWPA 4KE7A 3SC4A 1RR6A 4FYJA 3V7WA 3RT1A 4CQMD 5EZYF 3R40A 5IAOA 1C4OA 1IZYA 2QE6A 3V4PB 5T6MA 1A4IA 5IASA 2WIAA 4D4KA 3CCCA 2VHJA 3FWPA 3LVBA 4HT3B 5DRYA 3ZWYA 4E2WA 1W75A 4KBYA 4ZD6A 5KJCA 4S35A 1YFJA 1RP1A 3ICQB 3PPYA 1ODKA 1GPBA 1HGXA 1SVLA 2R6JA 3KNZA 4D8VA 5LP6A 4UHKA 4UMFA 4AY6A 4RQBA 5KI6A 4EGCB 2WPDA 2DSTA 2VKQA 1CUIA 2BR5A 2AV6A 1CRLA 1Z4QA 4YT4A 1K8ZB 3IVXA 1D9ZA 2W11A 2A5JA 3LO5A 1Q7EA 1PL0A 1Z56C 1SD5A 4GDMA 1A8SA 5TE9A 8GPBA 2ZU0C 3KXDA 3MN1A 3NIGB 4HRYA 2BGJA 4ZI3A 2H06A 1BS9A 4UM9D 3M3DA 3JQAA 3PC2A 5LBTA 3R7FA 1NNSA 4GLJA 4KGXA 3DDSA 5CLQA 5IJAA 4QXQA 1AV6A 1Z73A 1VPEA 1WXEA 4URVR 3ZDRA 4ZA2A 1N6HA 1QH0A 4TMKA 3QK7A 2UYYA 1BXGA 2O3SA 1GFZA 2HHLA 3FMGA 3AVXA 2EGUA 1YOVB 3GFTA 4UNQA 1RJ9B 3R4CA 1L5KA 4G41A 4LXTA 2CHQA 2QAGB 3CX8A 2QMYA 1NAHA 3HHEA 3WK8A 4MUMA 3L79A 2A0WA 3QWBA 2VF4X 1AJEA 2XNKA 3LDUA 2HF2A 3FGOA 3LUAA 4LJ8A 4YP6A 2J9ZB 3L7CA 4LV6A 4F9GA 4JIGA 1MW8X 3CBQA 4JC5A 2A5LA 4CEHB 1MO4A 2FK8A 2H4YA 3NC0C 1VOTA 1N0IA 1YK0A 3GA0A 3OURA 4IZIA 4LJ9A 2IOFK 1RTKA 2FPKA 3F98A 2ZVQX 1RAGA 4NQZA 4WCDA 4FW9A 5FR2A 1NKSA 1NTOA 3QVXA 3Q6NA 3S8YA 4GSYA 1OLXB 4G9BA 2GPTA 1ZC3A 3MRVA 5JOQA 4CGZA 3UMJA 1RYHA 4B75A 4FJ1A 5JAHA 4GBED 5DNCA 5A9RA 4XM1A 2OCBA 1XKQA 1ZX1A 1IN5A 3ZWQA 4HNUA 1Q2X