2I34A

The crystal structure of class c acid phosphatase from bacillus anthracis with tungstate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
237
structure length
237
Chain Sequence
VKLTDQQLMADLWYQTAGEMKALYYQGYNTGQLKLDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSIDFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKEKRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDWEGALYDYNFKKSDAEKDKIRHDNLKSFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords acid phosphatase
publication title The crystal structure of the class C acid phosphatase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 95
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2i34A00
5AK4A 1Z4PX 2YMPA 1T5TA 3DNPA 3AR5A 1RLTA 1EK2A 2P27A 3QYPA 1TJ4A 3WK5A 5AICA 2IOHA 2YBDA 5ALGA 2IOFA 2B1RA 2HSZA 2RB5A 2YJ3A 2QYHA 4HGRA 3SMVA 1RC8A 4L57A 5ALOA 3QU4A 4UARA 4BX0A 4EELA 3A1DA 3DAOA 3B8EA 4Y2RA 3AR4A 3AR6A 1XP5A 2HI0A 2Q4TA 3ZI4A 4KNVA 1Z4NA 3SF0A 3U13A 3WK9A 4DW8A 2IA5A 3QXGA 2MU1A 4UM7A 4XQ0A 3ZVLA 2NO5A 5ALIA 3R4CA 1YV9A 3FM9A 3OCXA 3R09A 1QQ7A 2B8EA 2WF9A 3QLEA 3ZVNA 2WHEA 2AGVA 3MPOA 4BKMA 4EZEA 3L8EA 1SWVA 1ZJJA 4YCLA 2OA0A 3A3YA 5ALKA 4UU1A 4HGNA 5AI9A 5ALVA 1Z4IA 1ZRNA 3UMBA 3EPRA 2B82A 1LVHA 1QQ5A 1NF2A 1CR6A 5ALDA 3MMZA 3N5KA 2I6XA 1K1EA 5AW1A 3SLRA 1L6RA 1L7NA 3PGVA 3IB6A 4YCMA 3NASA 5ALWA 5AM3A 2JAWA 3I1YA 4OD0A 2QLTA 2R8ZA 5IS2A 5AHXA 1Z4JA 1QYIA 2ZXEA 5ALTA 4HGPA 1U2TA 3ZX5A 5AI0A 3OPXA 3W5CA 3L0YA 4YCNA 2HO4A 4UMFA 3UMGA 4YIHA 4HYTA 4Y2XA 2G08A 2R8XA 3M1YA 4YH1A 5AI4A 5AVUA 1YNSA 3TLMA 1RMQA 4FE3A 3QUCA 2W43A 1Q91A 5ALEA 1SWWA 3L0CA 1Q92A 1SU4A 5ALMA 4Y2UA 1RQLA 2FI1A 2G07A 3E81A 1Z4LA 1RLMA 2AUTA 4HGQA 3SD7A 4MWOA 1RQNA 4JB3A 2OYCA 4DWOA 4Y2VA 2GHQA 2FPWA 3EWIA 2IOFK 1F5SA 1Y8AA 1VJ5A 2CFTA 2I54A 2HX1A 2I7DA 4NAVA 4BYGA 3ZVMA 2RBKA 2C8KA 4QQFA 3BWVA 4I9GA 5AW3A 2ZOSA 1Z4QA 3KOOA 3ET5A 1AQ6A 3QU7A 5AESA 3CNHA 3ZWKA 3L1VA 4XOUA 2HOQA 2NYVA 2GHTA 4YGYA 4BX2A 4BNDB 1RKQA 5AVRA 4IFTA 3CZ4A 5AK5A 3QU2A 5FP0A 1RKVA 5AKZA 1U7OA 1S2OA 4EX7A 3U19A 4UMVA 2Q4RA 3KD3A 2YMQA 3OCUA 3OCVA 2BY4A 2VKQA 3PDWA 5AVTA 4UW9A 4UU0A 2NO4A 3ZX4A 4NABA 4NWIA 4EENA 2YMMA 4RETA 1RKUA 5AKXA 5AVSA 4UASA 2G1AA 3W5BA 3ZTYA 4KNWA 3L0BA 2B1QA 3PGLA 3WKBA 2RARA 2FUCA 3AR9A 1YDFA 2ODAA 2FPXA 3M9LA 1NNLA 4I9FA 4Y2TA 5ALNA 4AP9A 4UMEA 4B6JA 2JAUA 2B0CA 2D2VA 3HLTA 4C4SA 3W5DA 5ALZA 2FEAA 4J2TA 2HDOA 3P96A 2PKEA 3NANA 3RFUA 2WF6A 3WKCA 4OFZA 3FZQA 4J03A 4UATA 3B9RA 4XE5A 2YJ4A 1LTQA 2WF5A 1WPGA 2YY6A 2MSNA 2C9MA 5AIAA 2DQSA 1QH9A 2ZBDA 3ZTWA 5AM1A 5AW7A 1TJ3A 2WF7A 2P9JA 5AVVA 1Z4OA 3W5AA 3ESRA 3RF6A 2R8YA 3D6JA 5AVXA 5JJBA 1ZS9A 4JDPA 3KDPA 5A3SA 1QQ6A 4BEWA 3E84A 4UAUA 4H1WA 1YJ5A 1J8DA 5E0OA 4E88A 4KX5A 3K1ZA 3QUBA 2HHLA 1U7PA 3QX7A 3DV9A 2B30A 4QJBA 2G06A 1IWOA 2BDUA 4KN8A 5ALUA 2I55A 3U7HB 3AR2A 4FYPA 4KX3A 1ZD3A 3L8GA 2G80A 3IJ5A 2GO7A 1U2SA 2AMYA 4MUMA 1Z5UA 4F71A 3N07A 3WGUA 1WVIA 4BX3A 2OBBA 1U02A 4Y3UA 2CFSA 1EK1A 1JUDA 1T9ZA 1XVIA 1ZRMA 3OCZA 2WFAA 1RRCA 2GMWA 3WGVA 2PR7A 5ALHA 3L1UA 2P11A 4HAIA 1FEZA 4DCCA 3A1CA 3IRUA 5AK6A 3ZU6A 2HF7A 3L5KA 1RPZA 4NFLA 5IT4A 3J7TA 2CN1A 3WK4A 2HF2A 3PCTA 4BEVA 4O8CA 1KYTA 4CF5A 1L7MA 1NRWA 3UM9A 3BA6A 5ALPA 4PNHA 3FPBA 1RDFA 4OCZA 4DFDA 1N9KA 3I6BA 4CE6A 2JARA 2WM8A 4OHFA 2ZBEA 5ALYA 1ZD4A 2FPRA 1MH9A 2HCFA 3ZW7A 5AM2A 2BDEA 4L6AA 3FVVA 3ET4A 1O03A 5AW5A 3WK8A 1VJRA 2JAOA 5A3RA 1ZD5A 1N8NA 4ZEXA 4EEKA 1RMTA 1L7PA 4Y2JA 5AKKA 3NIWA 1YS9A 5AI8A 3L7YA 1TE2A 5ALXA 2O9JA 5AW0A 2EARA 3R9KA 5AM4A 1CQZA 5AI5A 5AVWA 3ONNA 3I28A 3QUTA 5ALSA 5AM5A 3N28A 2CFRA 3A1EA 3MC1A 4Y2SA 3SKXA 3U26A 3SHQA 1O08A 5ALJA 3NRJA 1WR8A 2YN4A 3QU5A 3MN1A 4FFDA 2YMLA 1WZCA 5ALQA 2PQ0A 1L8LA 4Y2QA 4Y2YA 5AVZA 2FUEA 4L6CA 1RMYA 4AS3A 3L8FA 3S6JA 1ZD2P 5T41A 4CF3A 3WKAA 3NAMA 5AW4A 4GIBA 1J97A 4RESA 3NUQA 4BNDA 3WKDA 2EATA 5AKJA 1L8OA 2C4NA 3ZWDA 2P69A 4CNQA 1Z5GA 1Z4KA 4EX6A 5ALRA 5AI6A 2AH5A 3QU9A 3U7GA 5AM0A 2FPSA 3FPSA 2I34A 3ESQA 4NV0A 2FPUA 3GYGA 4Y2PA 3U7EB 4ZEWA 3ZUPA 4C4RA 1TJ5A 2ZG6A 3OCWA 5AKIA 5AW9A 5AKLA 3AR8A 4BBJA 3I76A 3QGMA 2W4MA 3SKYA 1Z88A 2ZBGA 2YFYA 3N8GA 5AVQA 4UMDA 3ED5A 4HGOA 2O2XA 4F72A 2YJ6A 3F9RA 4GXTA 3OTQA 3VAYA 2HEGA 3E58A 3FGOA 2WF8A 2X4DA 3B9BA 3KZXA 3EF1A 1PW5A 1VFPA 2G09A 2OM6A 3QNMA 1TA0A 4CF4A 5AW8A 4ZEVA 1S8OA 4AS2A 3NALA 5AIBA 2C88A 2ZBFA 2EAUA 1YMQA 2R8EA 1L7OA 4G63A 4G9BA 4UM5A 5IT0A 1XPJA 5ALFA 1T5SA 5AKEA 5AKHA 3WK6A 2FDRA 2Q5EA 2I33A 5AKYA 1ZOLA 3AR3A 5A3QA 1RLOA 2YJ5A 3UMCA 1X42A 1Z4MA 5AKGA 3OCYA 4C4TA 4UAVA 2RAVA 5AVYA 3E8MA 3EF0A 4IG4A 3QUQA 4XPZA 4YIKA 3WKEA 5AW2A 5ALLA 5AK3A 3AR7A 2W11A 3U7FB 2C8LA 3L8HA 5AW6A 3HYCA 3KBBA 3N1UA 3WK7A 2GFHA 3DDHA 2B8JA 2IYEA 2JGAA 3KC2A 2G0AA 4KYTA
chains in the Genus database with same CATH superfamily
1JFTA 3RKRA 1XTSA 4LVNA 4UE3S 1G8KA 3A6FA 3VH3A 4ARIA 3NM4A 3IPAA 1V2GA 1TJ4A 1IN4A 1AZLA 2IOHA 2QAJA 5EPOA 5EI5A 5EJMA 3WK5A 3AF1A 4KRFA 2YOHA 4BWYA 1W94A 4ZEOA 1FVOA 2R85A 3EK2A 5HM6A 4EHKA 2VDLB 1FTWA 5BSGA 3U44A 2GT1A 3S8MA 2I78A 1AN9A 4CVNA 3RWBA 3X1KA 5A4JA 3PC4A 3KVVA 1HRDA 5ALOA 1Z0JA 3PFHA 4XFJA 3EDCA 1R6AA 4FGKA 4N8SA 2BFPA 3OQIB 2RKBA 2V9PA 3A58B 3ZI4A 1SUEA 4YRFA 4M7WA 4NF2A 1M9NA 5NLLA 3WGQA 1LF5A 4UVIA 1PYDA 3GMDA 3ENVA 3R0XA 2YWXA 1KIAA 4CV2A 3ZCXA 1OVGA 2QUHA 1ZU4A 2VTEA 4QOEA 3OQMA 2CD9A 1U9CA 1R10A 4I1PA 1XMIA 4BNUA 2B8EA 4G67A 5EIFA 1E20A 3KUCA 3X1DA 4DPLA 4XD2A 4RY2A 3O47A 1EJ0A 1PYGA 3D2BA 4OBBA 4HB2A 3VU1A 4EY6A 4UVGA 2H17A 2P4HX 3DM5A 1CR1A 1WB6A 1EWQA 3VI3B 5LYJF 1RP7A 4A0FA 4FYVA 5P8WA 2WWGA 1BGWA 3G17A 2ATEA 3UNXA 2OWDA 1W36D 2Q2NA 4MYRA 1SQ5A 1Y4AE 2B82A 3D6TB 3E9ZA 3T15A 2BHTA 3PNBA 4TZTA 4CMCA 4KI0A 1YJAA 1KAOA 1PWYE 2B7BA 3WGLA 4W4TA 2CXTA 2CNDA 5B4TA 1XDUA 5M29A 5LMUB 3RC2A 4FSDA 4IWNA 4CKXA 5ELXA 1ULBA 1SBIA 4BGVA 3AW9A 5I5EA 1L6RA 1J5EB 2PIDA 2QLTA 2R60A 3K1JA 2CHGA 3VKGA 1CQJA 1F20A 2QD5A 2WICA 4UZEA 1FU7A 4BNWA 3VPXA 3GLFB 3G82C 2JLCA 5BQ5A 1E5DA 3W5CA 4YCNA 3TOXA 4K40A 3DVAA 3FUCA 1AS2A 2E2WA 5BW4A 1KMHA 4MR9B 1T3LA 2GAAA 4AJPA 3LUDA 3MOSA 1Z63A 4ZQHA 4Y6SA 2BEVA 1M2NA 1JR2A 5DTEA 5H82A 4D9IA 1BOFA 2G08A 3EPPA 1UC9A 1WCV1 4FE3A 1JXMA 1SD1A 4AKIA 2FMKA 4JENA 3UJ8A 4UBNA 1MV5A 5D3MB 3WGIA 2BKEA 1UZUA 3IRVA 2FKAA 1I6KA 2VBFA 3RB8A 4D45A 4CM1A 4Y2UA 3MJ4A 1RQLA 4YASA 3N2KA 1FYDA 2YIMA 4EJFA 3NUZA 4G0OA 5JYEA 4RJKA 3WLJA 4UKDA 1QVRA 3B2EA 4H3VA 2IHYA 2VTVA 1AKUA 2ZJAA 3HV0A 4Q3CA 3TB6A 2ZI3A 3O3MB 2IOFK 2NG1A 4ZOCA 1ZIDA 1L5VA 2R11A 4D3SA 3K05A 3IKTA 2I6FA 3GP8A 1UJ5A 2GETA 2MSCB 3CH5A 4YAUA 1Y3IA 2PGAA 3ZVMA 4RZUA 2PM8A 5DTMA 2PZ8A 2Q6KA 1EHIA 3GA0A 3GGDA 1CRWG 4I55A 3V1KA 1Z4QA 3FUXA 3I2KA 4A92A 1BS1A 1DS6A 3R40A 2ID7A 4PO1A 1RCTE 3VAAA 5FLEX 2P9HA 3DM9B 2RE8A 3WWCA 4G1FA 4S1OA 5EE3A 3S40A 1ODIA 1LD3A 3FUWA 2ZTVA 5DLQC 1N5JA 1FL9A 3HJCA 3SYNA 1M0TA 4D57A 2HWUA 4JBNA 4RD2A 4LGVA 4LSGA 1OBCA 4V2IA 1B26A 1FTNA 4PS0A 2LDBA 5CA1B 1CW2B 2B20A 1P5ZB 5BQXA 3QU2A 5FP0A 1FP2A 5TEVA 4MW9A 3K1AA 5E9JA 4A6XA 1KJ8A 5K0NA 3ZGZA 1ONPA 3A4NA 2Q4RA 1T36B 4LZZA 4X20B 3VTZA 3AJEA 3K09A 4FGSA 1QV6A 3KD3A 2Z3WA 4TVOA 4A9AA 4DEXA 4US2R 4Q05A 1KI4A 4PTYA 4U5XA 1JDBB 1Q7GA 4REQB 5IFKA 3GFQA 2H2FA 1EUQA 2PL3A 5GM2A 4GZLA 1L3IA 2DSTA 3RYIA 3TG2A 1VYUA 2ZYWX 1P7PA 1G21E 3AEZA 4RTRA 2HXSA 1GNQA 2BR4A 1QIMA 1DBPA 1E1QD 2V0GA 4Q5IA 2MR5A 3B3FA 3NV7A 5AVSA 2VJNA 2FF7A 3ANYB 4LYFA 3T3EA 1TADA 3ROKA 1NVFA 3UEOA 4KV9A 1JHRA 4I3FA 1E6EA 1Z12A 4XFKA 5BR7A 2C94A 3FVWA 4UU8A 4B47A 3X43A 5KDOA 3RUHA 4GVXA 2J31A 1YULA 2QMYA 3B1WA 4HQRA 1RSZA 3FRHA 2Q21A 4TKVA 5AXDA 3S70A 2ETVA 2XUKA 3HL0A 4QBHA 4ETNA 1I3CA 2FFRA 2RHWA 3S29A 1H9CA 1ZH6A 5LB4A 2OHOA 1OFHA 5JNRA 2FUNB 4K3UA 1V7CA 4NC9A 1VHQA 3H84A 3CUEF 3C1OA 1SB9A 2E18A 1L4MA 3TMYA 2ZBQA 2HDOA 4BE7B 2WT8A 4QU5A 2V96A 1ACMA 2W2XA 2ZTSA 1D7OA 3M4ZA 3NHUA 4HZUA 5DRTA 1KZHA 1SCIA 3NANA 2JFQA 1W5FA 2ZPTX 5BV1A 4TMTA 1VDZA 3K2BA 3K1YA 1WXIA 4J03A 3T9DA 1HE5A 4XE5A 3ABOB 1MFZA 3QEAZ 4GI7A 4RH0A 1WPGA 1XEWY 3K70C 2AVDA 3CGWA 1IPFA 1QC5B 2XUPA 3FPKA 5JAUA 2GYVA 2QPAA 1K6IA 5EPUA 5JCOC 4ZVQA 3VKUA 1HDEA 2L17A 5CDHA 1ONSA 3C8UA 3GCWA 4TV8F 4ZALA 1JKJB 3QW2A 2R96A 4P3KA 4AYXA 4XIFA 1K4YA 5JS7A 2ZYAA 1ARZA 2I3GA 4D3ZA 2FSVA 4ONEA 4MV5A 2N3ZA 2OB2A 2WZBA 5FADA 2W8ZA 4ND3A 3UN1A 3ER9A 4LYDA 2RKOA 5I7WA 4RCYA 2IYYA 4EARA 3QUSA 2YXNA 4KXFB 1RVV1 1DJPA 1RZ3A 2FQWA 2YC4C 3FNBA 4EAAA 3C43A 3SZOA 4U8HA 4GR9A 4O4LF 3ZXUB 1B6GA 1Z39A 5HVNA 4OGKA 4BMNA 4KX5A 4KE7A 5E3JA 3KU4A 2E0IA 3B5EA 1GNLA 4HNAA 3FFXA 5HSGA 2PYDA 2ZWVA 4GLJA 4K6FA 5F21A 1U7PA 1GU1A 3DV9A 3PX7A 3S2SA 1Z6XA 4EW3A 4R1LA 3M5WA 3NP9A 5EQFA 1BXGA 1ZN8A 2EJBA 1IWOA 3F5QA 3K2IA 4LJLA 4WY2A 1DLJA 4EPRA 3Q6IA 2GDZA 2MSLA 5EZ5A 5KHAA 3U7HB 3GEDA 4PYKA 1T1GA 3SZRA 4ZHQB 4ZI7F 1MPXA 2NXCA 2VHUA 2PSFA 2AG6A 1UBKS 4IHJF 4ME6A 4MEAA 5KTSA 4B6EA 5BSRA 2V4MA 2GCPA 2FSSA 3ZJUA 2AI2A 1RYFA 3EZXA 2YYZA 3T1OA 3HPQA 4GC9A 4OBXA 3ZGVA 4BAGA 2EHDA 1XQXA 2E5WA 1FDIA 2CUTA 5JI3E 1IBCA 1JHUA 3GNQA 1M8KA 3H5VA 4FM9A 4S12A 4G56A 1OBVA 2AZMA 2EX1A 3ZHQA 2CGEA 1JHQA 4BU1A 1JUDA 3OCZA 5F35A 3EEOA 1F2TB 1NVUQ 1O58A 2VLIA 4LOKA 4AP5A 4F7DA 3PXBA 5EXDA 1ZAYA 2EW8A 3L01A 4UFNA 1KSGA 3P0RA 4FYIA 4RQAA 4ER3A 4AYWA 5U9CA 4XD7D 3ZQ4A 4C08A 5LQMA 1DAFA 3KXKA 4R0NA 4MV1A 1Q0RA 4OL0A 2WABA 3WLOA 3V4SA 3KYCA 2AFRA 2GEUA 5KTTA 1TW2A 1PR4A 3BUSA 3QG1A 4A8TA 1M1UA 3PT5A 4PY2A 5COAA 2VCEA 3ZIUA 3ASZA 2YHAA 2DWOA 1JIQA 3ZHXA 4AMVA 1HZJA 4GDMA 3KAQA 4XI9A 3LGAA 2RHDA 4MV9A 4HDNB 5J43A 4B87A 3PVZA 2ZSBA 5L3QA 2LKDA 3E22A 4ZQBA 4F4HA 1QHHA 4NJEB 3UM9A 3UFBA 4F5ZA 5BYKA 1FP6A 5D3KA 3WGJA 1G8FA 3FPBA 2C5BA 2P9QA 1UM9B 2Z8YM 3IOEA 1W5TA 1T8YA 3NONA 3GLVA 4R6WA 3V4PB 4G1UC 4JEIA 4LPKA 1M0EA 1QH1B 3CYFA 1NHWA 1J21A 1A3CA 2JG3A 2XB6A 3QLTA 4H3HB 2OB1A 1UWKA 4R16A 2NPOA 2J6IA 1RZRD 1FFEA 3H42B 1IHYA 4XUDA 3SI7A 1B6RA 4BN5A 3A6LA 1FYFA 2B8WA 3LXUX 2GYWA 4G0MA 4RDIA 3RAGA 4QZVA 3X2FA 4MVJA 3G23A 3QUAA 4L8FA 1AZTA 2WWWA 3DS8A 4YT2A 5IG2A 4RK7A 3FWKA 3HABA 4ZU1X 4IF6A 5FLXA 2ZS8A 3QE2A 3WLHA 4GDFA 1J2EA 2W22A 3ZW8A 4EA6A 1LBQA 4DM7A 3D9QX 5BSWA 1AQYA 1Y8RA 4BFTA 1X7XA 2O0MA 4KWEA 4OYRA 4RACA 4HBGA 4EO9A 1O08A 4AJEA 1D4OA 2JK1A 2I3AA 3KPVA 3NU1A 1Z8NA 4DMRA 1CHDA 4D0NA 5IAOA 1QXSA 2ACEA 1BWSA 1DDGA 4Y2QA 4B46A 3R74A 5LOVF 2H11A 4J07A 3UPUA 2B83A 4RFVA 1FE8A 1RMYA 1RJDA 1TZCA 2CMGA 3AM4A 3DF7A 4Q7LA 4R9NA 3RHSA 3L8FA 4GZ3A 2B4AA 1PR5A 4YJ3F 5C32A 2JVIA 2ZJZA 1K4KA 1JIVA 2Q5IA 3IP6A 4MB6A 5DIFA 4EFNA 2GPSA 1V71A 3THYB 2W4IA 1BMDA 1PZFA 1H2RS 4E70A 2W48A 3ZK8A 1Y8QA 2CXPA 2D1YA 2GHIA 3M33A 5EWJA 3PNVA 3IOCA 4Q34A 4ZP1A 3ORQA 3PFFA 1DJLA 1KQPA 1Z6YA 3IQGX 4BNDA 2YV1A 3QWFA 4Q3BA 3E2IA 4EBBA 5CGZA 2FR8C 4B83A 5GZ3A 2GGSA 4C0WA 5CA0B 1D1TA 3CZCA 1LDEA 1YI0A 3HYLA 4BQQA 3QE9Y 1GRVA 2GBFA 2QIOA 4ISCA 4IDHA 3T5GA 3LPLA 3CQ9A 1NVTA 3J7AC 1ONBA 3LSYA 3E1KA 5HJ5A 4G41A 2H9AA 3WRXA 1QF6A 4HGZA 3U7EB 4BLQA 1SCUA 1A72A 1TM4E 2H5LA 4QBTA 1Z5PA 4QGAA 3T0GA 3VUFA 4RDXA 3PQDA 3W04A 5HOQA 1ZGBA 1G2QA 4KE8A 4M1WA 3ZUPA 1SH7A 2CHUA 2GPAA 1B76A 4OO3A 1DKQA 1YS1X 3RAJA 3JVIA 2FWAA 4R1TA 3TLGA 1K7EB 1LEHA 1B8VA 5KTOA 1OLXA 5C1BA 3UGQA 5CDTA 1IIBA 1TDJA 2NVWA 4ERXA 1GXSB 1OKKD 2Q9UA 4LJ6A 2EFHB 2OUKA 2FH5B 1GDDA 4YUXA 4IKOA 2L19A 2QT9A 2FPPA 4C0HA 4RU1A 1E0AA 1NQXA 1D03A 1V48A 2BM1A 2WLSA 2GYUA 3OE7D 5IVIA 2GKOA 4OM8A 4ZO9A 5C7LO 2DLDA 4DV4B 3B3QA 2JRLA 1SHZA 1A7JA 4IEIA 4EGFA 5C4GB 4WDQA 5K8VA 3ZWWA 1LW6E 3ANLA 3B9BA 4PHGA 4ASUA 1E18A 2RHLA 1YMVA 4FQ8A 4OJQA 4WKGA 1L4UA 3JXEA 5SY9A 4ZCTA 3ESCA 4JGIA 4N49A 3AHCA 3B9PA 1QKJA 3W2GA 1FX1A 5JD6A 3U4QB 3NHAA 2GZRA 2WJYA 4G97A 4WBNA 4PV7A 1N9GB 4R1UA 1H6AA 1P4SA 4XTRA 3U1VA 1MP0A 2GESA 3DQQA 5HDBB 1THMA 1JSRA 1XRLA 2PXAA 3OCJA 4KJZA 2EZ9A 1PX2A 1M54A 2CE2X 4G9BA 4WPGA 3D7KA 4HRYA 2OQVA 1Y9AA 4R1PA 3HA5A 3IULA 4WESB 4ZJYA 3A9TA 3RANA 3GDWA 2CLLB 2GJAA 3DVSX 4P80A 1BXZA 2Q5EA 1RTKA 2PMBA 3GH3A 4JOBA 4ZODA 2XVXA 5EUMA 3WIOA 3VBEA 4BV9A 5ARCA 3OPYB 3H7AA 4BS9A 4PAMA 1YJQA 1ZD9A 1GPDG 2PKCA 2BD0A 1QAMA 4L1KA 2XF8A 2D5AA 2J6HA 3BMCA 5JMPA 4C4TA 5CITA 1M3SA 3QBJA 4Q3KA 3GT0A 2O4UX 2PZEA 3KSRA 4I50F 1KEEA 1MZVA 4UFPA 4JT2A 1F6BA 3GY0A 4J0CA 3BGWA 1JAYA 3MYYA 3OQPA 4IG4A 2HLPA 4YGXB 3RODA 2ORWA 3LI2A 1Q44A 1M2OA 3FF4A 1NN1A 1FW6A 2OCLA 2X8LA 2H29A 2QLLA 3HEAA 3MB5A 2O3JA 4KKXB 1F2VA 1LJLA 4I1OA 1XEFA 2VZ0A 2ZRLA 1D8TA 4IJKA 1H6BA 2PGLA 4ZU3A 3RASA 3RG2A 3HCDA 3JQRA 2HHJA 1KI9A 2PXCA 1H1LA 2NV6A 1QONA 2Y0PA 4L75A 4O59O 5AK4A 5FBRB 1P3JA 1UMCB 2VHCA 2YMPA 3MLBA 5B5SA 1JMYA 5F4BA 3NM5A 1EK2A 1UC5B 1PJSA 3JS5A 3LJKA 5EJIA 4I1UA 3HCBA 1UAAA 2K87A 4J0JA 2JH3A 1UBLS 1J1ZA 4B4DA 1XTJA 1NATA 2DTXA 4ZOQI 2H4HA 5DGDA 1KO7A 1XZBA 3ESXA 3T1VA 3KQNA 1M1NA 5FBHA 2WI8A 4LQLA 4L8VA 1KKLA 4RL4A 1GR0A 1KBZA 3SMVA 3SSMA 1SOUA 3VR4H 4AIIA 5DNVA 2Q45A 3ADOA 1G38A 3EVNA 3N2GA 3ZGYA 2BYTA 5EMLA 4G5QA 1YBVA 4TM8A 4AZ3A 4YRNA 1LLUA 1R5JA 1Y98A 2R7LA 3C3YA 4QTZA 4Z0PA 1M73E 4Y2RA 2FOLA 3E3OA 1XTKA 1FYXA 2Z5FA 4D4LA 4DILA 4KNVA 2WWVD 4EFDA 3QXGA 4YCBA 4QYSA 5JNVA 3MPUA 3F2VA 2A88A 5LBUA 3NBXX 4FEGA 1QQ7A 3F67A 3MGBA 2Z2IA 4ILEA 1Z13A 2C2ZA 3OZBA 4TV9A 2OV6A 3GUYA 1YB7A 3PA6A 2XIQA 2EP8A 4X66B 3FYCA 1NYRA 3CPHA 3IA7A 1XCGB 1XU7A 2JLBA 3JWGA 3YASA 4HGNA 3HHEA 2R3SA 3FYUB 2YCLA 1QYRA 1IYZA 1TQ4A 1YGPA 2RGXA 4KGZA 1MRSA 1KQFA 2M6RA 3BHJA 3UMBA 1JZSA 3X1XA 1EFHA 1M2GA 2PGNA 1K4MA 1L4EA 2Z3VA 4G85A 4M49A 3Q12A 4D26A 2XT9A 4U2GA 3IUYA 5FAKA 3PD7A 1QUFA 4JUDX 4AICA 4QSHA 4G8JA 4I2NA 2JIZA 4JUFA 3DKPA 3GLIB 3H11B 1XAHA 1QG2A 5IAJA 5C0OE 5LJIA 5AHXA 2QR3A 1Q6YA 3GEEA 2ZXEA 3BTOA 4Y1FA 4EMSA 1HFEL 1RWPA 2H9IA 4L0MA 1NVBA 3QX8A 4NYIR 4QECA 3KKZA 1Y34E 1XD2A 5CB6A 3NBFA 3H9QA 5I4BA 2VXOA 3QVGA 2Q1YA 3B70A 3L6UA 4IY1A 2D74A 4LY6A 3WL6A 3TGPA 3T4UA 1ZM9A 4GYKA 4DJ5X 5CYFA 1JR3D 1DQSA 121PA 3HKEB 4NMMA 4C0KA 1FX0B 1RMQA 1ADYA 2HYIC 2W43A 3K8QA 1DI0A 2GNAA 3TQRA 3DE2X 4PTLA 3W8RA 5DGCA 4YDQA 2QUAA 3L0CA 1A1VA 3DWGA 3WBKA 3FFBA 2HUPA 5BVHA 1F48A 3BF8A 5K0FA 2XD4A 1JDBC 1TMGE 1DL5A 3PDJA 3IQWA 3K0AB 3VPGA 4AD8A 1FNNA 1Y1RA 3EZ2A 4A2QA 4Y9TA 2H65A 2P6OA 2QL9A 1QGUA 4IMRA 3FLBA 3PWTA 3ENQA 5IYZB 4UHJA 4CKBA 2I8AA 3LUJA 1DJNA 1SVSA 4FBGA 4Y2VA 1LK7A 1SXJB 1ICEA 2LRHA 3QTTA 3SHWA 3W2HA 3K92A 4K9MA 3GLGE 1N1EA 1G1AA 3AB3A 3FI9A 1VJ5A 4KEAA 1CUFA 1T5HX 1WUHS 2RFLA 4LECA 4YBRA 3EXHB 3OKPA 3GROA 2WEKA 4OB7A 3A6HA 4AZVA 1SHTX 5IABA 1ZQ1A 3D7SA 3SYLA 3G8CA 3WMEA 3ZEAA 2YS6A 1TLTA 2D4AA 3HKBA 3ESBA 3PEVA 1Q84A 3UVEA 4GYYA 2A3RA 1QFJA 2ENWA 3N3BC 5BNWA 2VUHB 3CF4A 3IT1A 1GILA 1WHTB 1ISMA 2KMLA 4XGQA 4YACA 4YJ2F 5FI0B 4AKTA 5KDDA 3F7OA 1UK6A 5H9WA 3PNSA 4QAJA 3TVYA 2EZTA 2QTFA 2J41A 9ABPA 4UEJA 3QX3A 2GPNA 4KWCA 4P08A 4FYYA 4YQEA 3R7WA 1G5TA 3R0JA 2IWHA 3CZ4A 3RVPA 4ZGWA 2BFBB 2O2IA 4HH1A 4LC0A 5CFNA 5ADHA 1R3DA 3RHFA 2PUAA 4GXRA 3A10A 4UFOA 4MPDA 1X13A 3H8WA 3IDOA 5TSDA 3JQEA 4ZVTA 2JEYA 2EC5A 2QTHA 4XM2A 3QWIA 2KE5A 2QTVA 5BN3A 2YMQA 3OCUA 4JJZA 1TU3A 3ZWOA 4JBIA 2P90A 1LBEA 1P0MA 2WHXA 4KR9A 3RFCA 4F38A 2NXWA 3EGIA 1TMYA 4NABA 3VQTA 5JQGB 2Q9BA 5BY2A 1QK3A 3BGSA 1DKNA 3X1YA 1S01A 3I3SR 3GJ0A 1NYTA 4PM4A 1OV6A 4EFKA 4KACA 4V24A 3RR2A 1KZ6A 3G6KA 4U0JA 2E89A 3GFRA 2GXUA 2PX8A 5T5QA 3VYVA 3WYGA 1AH2A 2RARA 2EERA 1HMYA 4IUDS 1FA9A 1OASA 3OU2A 4JH0A 2VVTA 2OAEA 1TMOA 4ZCSA 3ECAA 3M1AA 3PIRA 2BELA 4UCXA 2PD6A 3Q6NA 1G8YA 1RFLA 2Q99A 3EDYA 3JSAA 1E6UA 3W7VA 2AFHA 4HSEA 2C83A 1FDVA 1Y7IA 2VKTA 3MG9A 4V0OA 5IUKC 1ZPDA 4B45A 4JI4B 2QORA 4MSUA 3U4GA 4CIYA 3SJUA 2PKRA 3OLVA 1AB6A 3JARB 3WBJA 4D42A 4UNQA 5HYVA 2XE7A 1WMEA 4W63A 3VDNB 2PKQP 2FN4A 3HYNA 2WNHA 3O2QB 4Q03A 5SY6A 3UENA 2D4HA 3JD2A 4TOIA 1YZKA 4F6LA 3LCVB 5HTKA 5FJIA 1H65A 2COEA 3G5MA 2Q9AA 2CZQA 2R8PA 4OP1A 1W35A 2QEQA 4IH1A 2PPLA 2WV7A 4CLHA 1WETA 4I5IA 4JELA 3ZWNA 2L18A 1ZUNA 2GBIA 1GEGA 4KIWA 3GJQA 3L7LA 5IDYA 3UA3A 3E3MA 3ULKA 4M0EA 4QQ8A 2RDMA 3AJRA 3D4BA 4AQYB 4FEAA 4HTAA 2Z2ZA 1T4DA 3B60A 1YQEA 1ECCA 3MJTA 4HDRB 1QAQA 3FWZA 3IKLA 4AKSA 1GJRA 4UXIA 4RK5A 5T67A 4W5QA 3A25A 4G0NA 1KI6B 1DBIA 2P3SA 4DM3A 2D1QA 4RPHA 2ODEA 1EU1A 3DHVA 2RHTA 2XKAA 3L0PA 3QOWA 2NQ8A 3RF6A 2BFNA 3K16A 4F4JA 5ES3A 4RO0A 3NJ8A 1G5IA 1LSOA 2B4QA 3QJ5A 4HWSA 4KPYA 3VJMA 4QOFA 2E4VA 3S68A 1Z22A 4EDFA 4DKJA 2PBZA 1NW7A 1ZCAA 1IC6A 4G5RA 2IQIA 4GC5A 3ZK9A 1N3YA 1XKLA 5EUCA 4EL5A 3OTWA 4UAUA 1X9HA 2OTCA 4D8XA 2D5LA 2GCIA 3PICA 4Q12A 4Q00A 3OZFA 3VH2A 1X3SA 4D4IA 3G5LA 2AG1A 1MX9A 1WB4A 4FFBB 5J4YA 2C5HA 1JDUA 1Y3AA 4Q4DA 2FSGA 2GR9A 5TGTA 4F3CA 1IN1A 1USWA 3QX7A 4KPFC 3GPIA 3TR0A 3T5AA 3ZKWA 3PC2A 1OU4A 1N2GA 4FILA 4IIDA 1R9MA 1UIMA 3HRIA 4HFMA 1CV2A 3LCUA 3PI6A 3TRIA 4KNYA 1OZ0A 2VDJA 4FYPA 5CHEA 1T2VA 1BKDR 5T3YA 2QXYA 2DE0X 2FZ5A 2Q29A 4IXMA 3RK1A 4UZFA 1JLMA 2I4MA 4JNCA 1MO5A 1SY7A 2OGZA 4CZ2A 1BMQA 2MSKA 2FHSA 3TBKA 5ABPA 5DIZA 3S44A 1JG6A 3EA0A 3ZE7A 5IU6A 3ZIAD 5ECDA 4BAUA 4PFJA 5HKKD 3TG8A 4PAOA 3U39A 3L0IB 3KCNA 4GE3A 5KS2A 1O5TA 2GRAA 4MRPA 2NU8B 1YUBA 3MTGA 4KR2A 4O2BB 3V1LA 3IJPA 4RA9A 1RACA 2PR7A 1KNXA 2R1ZA 1VHDA 2ZB2A 1JHVA 2WKSA 3Q9NA 2K4MA 3RC1A 2UZIR 4Q66C 5IZCA 3UMYA 3KWJA 1K75A 4TMVA 3OURA 2DETA 4HVAA 5JRZA 3Q8XB 5BMVF 2X76A 3I64A 4BO5A 4NFLA 1H4SA 3F4BA 3TRHA 1YFZA 2WA1A 3P0FA 3W8EA 4OP3A 1YQWA 4PLCA 4QUJA 5F7XA 1AKMA 1ZQ9A 2HF2A 2IIQA 1L8XA 3UB3A 4AKGA 3FTCA 1ZG3A 2P1RA 3IQZA 3NXSA 1LQ2A 4L22A 3D3NA 5ECWA 1D4FA 2QUKA 1YRLA 3CJRA 5IJ0A 4P5PA 3AUJB 5GONA 4PNHA 3RUCA 3O5AA 4DVGA 9LDBA 4OCZA 1FW8A 2NU9A 1CE8A 1N9KA 3EVAA 3IOMA 1PFQA 3PE4A 3Q7SA 5BN5B 2DXIA 1TD9A 2PGOA 3K73O 3Q0EA 3KT8A 4LGMA 1AUQA 4KQ9A 3X1JA 1YZ3A 4FFVA 1IY9A 1TZKA 4Q4HA 1IL0A 5AT1A 1UDWA 1E5LA 1TU4A 1CQIA 3E3AA 4EIWA 1Q15A 1W7AA 5JIBA 1IZZA 4EG8A 2GUWA 1BHQ1 3BK2A 4Y2JA 1OLUA 5K45A 1Y5LA 4EATA 2PVCA 5F52A 1E2HA 5MN5A 1VPEA 2ACVA 4P3OA 1ORWA 3JX9A 4PLFA 2F43A 4UTRA 1KBOA 4LXHA 2G0NA 2V4UA 1DG9A 3LVBA 5DW0A 3V80A 4IDCA 4W5TA 4XGRA 4Y6LA 5GWXA 5KCMA 3R9KA 5EE0A 4PYIA 2CKDA 4FWBA 1YASA 4YUZA 4CEJA 3DDSA 1QHXA 2AI3A 2XQIA 1SVIA 5KSYA 3U26A 3TVDA 1S02A 4RVOA 2JCVA 1QE0A 2Q1SA 4C0LA 1KE1A 4HQFA 4HLNA 4ZYVA 4XDYA 4YAWA 5DBOA 4XQCA 1ISSA 4RCZA 5DCUA 1THTA 4FHCA 2IEDA 4LJ4A 3NOQA 1CJKC 3FOCA 4P82A 1LI5A 1R4NA 1C0LA 1LNZA 4QJIA 1KDZA 4NONA 5ALQA 2XUDA 2J67A 2YHBA 1WCXA 1M10A 4OATA 4ROTA 5K0TA 1GGJA 3SJBA 2RGWA 2FNAA 5AXBA 3N0WA 1QE3A 4U7TB 3KSBC 4OXKA 3CRW1 4KBYA 3HZOA 3L04A 5DM4A 4ZO6A 3QBTA 4Z4HA 4KPUB 1J07A 4GWKA 1LSSA 1RCUA 1XZAA 2GILA 2WT4A 3CKKA 3H3FA 4IDPA 2I4RA 1WV1A 3A27A 3F6CA 3LKDA 4KWIA 3SXUA 3VJKA 4RJTA 5H4GA 4YRAA 1SMKA 2PRIA 3GJ4A 2WYIA 1W4AA 1HQYE 1R9JA 3IX7A 5LR6A 5KQRA 3MVEA 3HP1A 2NV0A 4ZYTA 5TMBA 2JGRA 3RAEC 1I3NA 4R83A 4OI4A 4RXTA 4CNQA 3CEPB 3TUIC 2WD8A 3QHQA 3A1SA 4UUPA 1Z4KA 3T3DA 3OZXA 3FKSD 3LC1O 3K53A 7ADHA 5EIXA 1VCHA 1OJLA 1A9YA 5IJXA 3DHEA 3IEMA 1HOXA 3GUZA 2VEDA 1ZVVA 4V39A 1OYVA 2N46A 2QPTA 1Z9BA 1F14A 3MUFA 4RX1A 2PEYA 3EHEA 1XV5A 1SCAA 5JSUA 1R9NA 4EHNA 3AR8A 2A1TR 1QPZA 2WQZA 4M9RA 1GV1A 3C2QA 4EGCB 1DQYA 2UU9B 1DT5A 3S8EA 2QN3A 1SZCA 2C7GA 1KMQA 3K9LA 2VXCA 4KDRA 4ABTA 4PG5A 4DRXB 1Q0SA 5AVQA 2J0UA 4HB4A 1E8NA 1ZHHA 1VLQA 2KX7A 3EODA 4DLZA 2NU6A 4KAAA 3AU8A 5KQGA 2AG8A 3N2NA 4F93B 5IAAA 3T35A 2J9FB 4NCKA 2WFLB 3LLSA 1WV0A 3KK0A 1I9GA 1VFPA 3DEZA 1EG7A 3W9SA 4BUJA 4WA8A 4W9NC 4J1SA 4MHOA 2AT1A 1MKYA 3H13A 1GPLA 2J8ZA 2B1JA 3L6BA 3P2MA 3U7QA 3N87A 2XTNA 1MVOA 3U3MA 4O2AB 3I73A 1R9GA 3EZNA 3RC8A 1I5EA 1QBKC 221PA 1EE1A 3BBLA 1N5RA 1OE0A 1WB5A 3A3OA 1KRHA 2F3RA 2PH7A 3AF5A 3CA8A 3MWDA 5TR9A 1NQOA 1SHLA 5AIBA 4MS1A 3GLSA 5EZYF 3AWDA 3RADC 1A9QA 3T4XA 3SR3A 4QELA 5EXXA 2YC2C 1Y81A 2W8BB 2O2HA 5KVSA 2PRYA 1AS0A 1AXGA 2R7KA 1P9RA 2E55A 4WD3A 4D9FA 4EYSA 4U4AA 1JJ7A 3ELBA 1A5SB 1PV1A 1RXCA 5AUPB 4KRYA 4WJKB 1CSEE 1AGPA 1UUFA 1RLOA 3TX6A 5A04A 1S2IA 3D7LA 1ECBA 1OPXA 1QX4A 3OCYA 1RAFA 5B12A 3P19A 3FOAA 3USES 1PWXA 4XX1A 3GQBA 4XIJA 1JLLB 1XAIA 5F1OA 2Q5HA 2FFHA 3NC0C 4NYMQ 2IKSA 4ZZIA 2QD3A 3NHLA 3PKIA 4KQEA 1OAAA 1B1AA 4UUNA 3WRWA 3G88A 5CCXA 1QVVA 4GG1A 5TQ0A 2JHGA 1MQ8B 3AOGA 3ESYA 1NBME 1Y8ZA 3U7FB 1TEVA 3GDFA 3NFRA 4MJ7A 1X70A 1LF0A 4BNIA 2CDAA 3IQXA 1KQ3A 2O2YA 2IYWA 3PFCA 5GADl 1EWRA 3A37A 4KHPB 4RQUA 3H3JA 3DKVA 4FGWA 4Y6OA 1BHSA 1KMCA 2VCYA 5EFZA 1W1WA 1JHXA 4Q9IA 3M3DA 3IT3A 3HADA 7MDHA 5SYAA 4YVFA 1MC8A 5AICA 1QYDA 1J33A 4RKYA 3JY6A 4J43A 3VO8A 3L4KA 4KQ2A 4ENRA 4UQLA 3DMHA 1C1HA 1TK3A 4KZPA 4Q7JB 2J45A 2YJ3A 4JXKA 3QTLA 3N8IA 2V7GA 4BWVA 3D6NB 5HIJA 3VO2A 5IKXA 1Z0ZA 4V1CI 1IJFA 1EXWA 3RVDA 2ZLBA 3ETGA 1NPTO 1YVDA 2C4KA 4H6WA 1T9GR 4I36A 3RUAA 3W1VA 3AR4A 1NUAA 4X8LA 1G20E 2Q2VA 4L8LA 4EK9A 2Q4TA 3ER8A 1CRZA 3VR4D 3H4VA 1Z4NA 4PLVA 3O95A 1VLVA 3U13A 2ISSD 4LZJA 2FMIA 4F3RA 4HMQA 4WBXC 3UAGA 2HMSA 3JWHA 5JYCA 1ZP6A 1KS9A 2FMFA 3PK0A 4B7CA 4FWTA 1CUWA 3C85A 2BE7A 1Z2PX 2WMOB 4HAYA 3S5JA 3WP1B 5F7JA 3N7TA 4LDQA 3EIUA 1W19A 3RIYA 2LKCA 5DU2A 4BKPA 3IS3A 4GP6A 3Q3CA 3QA3E 1SXJC 3VHRA 3SS9X 3JAKA 2ZUDA 3WLSA 5JLJA 2B92A 4F56A 2BCJQ 3OTOB 1LA2A 3LCCA 1G8JA 3RBZA 2YHIA 3VZSA 1N6IA 4QUBA 3CO0S 3QELA 4LCBA 2JLAA 3DV0B 2R1VB 2GLUA 3F0TA 4AL4A 6LDHA 3RV3A 4QQNA 5CDFE 2VUIB 1Z2CA 3STXA 4S1VA 2NVUB 4TZ0A 1XJCA 3RU2A 1IULA 3W5JA 4A8HA 4JB8A 1OI2A 1SXJD 2EEZA 1JSZA 2Q6OA 3N6RA 3RWOA 3IAXA 3W5IA 1M34B 3RUDA 2WHPA 3KXDA 2BE9A 2JFVA 5KYNA 4D97A 2GJSA 5KOHB 4RXMA 3L8MA 2UYYA 4WY5A 3RU7A 2IXBA 4J4BA 4KGVA 4B2IA 3A1UA 1R5BA 4UUMA 1YTUA 4RIHA 4QBIA 2D5IA 1OTXA 1XLWA 1YNSA 3N7AA 4N6NA 1WMSA 5AI4A 4LQCA 4ZOBA 1NMQA 1Z0KA 1B43A 2C4WA 2PKQO 1QNLA 4IIGA 1ZGAA 1DUVG 2ZUSA 2ZYHA 4WXPA 4NE9A 5SICE 2FPIB 4OX9Y 3UT5B 4ENWA 1JX6A 1G7RA 2HXYA 1TEXA 2AIRA 4Z2YA 1TQDA 2C1XA 2VRCD 4IMJB 4MQEB 1AHIA 1VHWA 3WIEA 5LU8A 2R5WA 4XA8A 2XUJA 3O75A 1NSYA 3IMEA 3SD7A 3AF2A 4LJKA 3TZBA 3VX4A 1SVKA 4DF3A 3OQVA 1X1AA 3BWDD 4RY0A 2JGDA 3GWZA 5L3SB 1CUIA 1LC0A 4QXOA 3GW8A 2A33A 1E94E 3D1JA 3MCVA 2BMJA 3HKDA 5G3ZA 5IULC 1ACJA 5U4XA 3L0ZA 4JVNA 3AV3A 2VDWB 3LYUA 3OICA 4FP9A 3VNRA 2E5LB 3VYSB 2G70A 3CF2A 2OZLA 1QH8B 4LMBA 4MMYB 2WJIA 3QLVC 5K4HA 1NJ1A 1CDZA 2EG5A 3H83A 4Q01A 3ORHA 2FEPA 2P78A 3B13B 3FPEA 3EGDA 2HIGA 1NVXQ 1E5TA 5AXAA 3VJRA 3FN4A 3U80A 1Y1QA 3O9ZA 3OE4A 4JHXA 2HJRA 3ZWKA 2PGIA 1AHPA 3A1NA 3R8XA 3EUWA 2W42A 3WTBA 1HNZB 2IYXA 3MOGA 4C3OB 1YBHA 1TZBA 5A7GA 4O33A 4DC9A 1GVNB 1XVVA 5B1IA 1Z6QA 2LNDA 2GHTA 1KS2A 4QX6A 4Z9FA 5AVRA 2PVPA 1YRYE 1Z68A 2GM9A 1HDGO 2R1TA 3MGCA 4U7WA 5E8RA 5TVKA 1J2UA 2OQIA 2QJOA 4M53A 2PWPA 3FYTA 1PZGA 3UZUA 2QYSA 4CLXA 5A7HA 3LHFA 5LNK6 4QGFA 3UWSA 3T3MB 3VMMA 3I0NA 2FZKA 3KWFA 2PT6A 5MGBA 3SEQA 5CHYA 3HN7A 2ZRNA 2AX3A 3TS1A 2VKQA 2OWEA 2W6NA 2QW1A 3S7ZA 5EA2A 1Y4ZA 3GA7A 3L02A 2WWXA 3V8PA 4DREA 2ZUTA 2QN7A 4LRQA 1TVKB 4PSAA 2GBPA 4G1CA 1AQNA 4B3TB 3IT0A 4R3WA 3SEAA 1E3TA 4YEDA 4DS3A 1NP3A 3D5QA 4RZ2A 3ECSA 3R5KA 5ED0A 2PXHA 2XHZA 3QF7A 2PX2A 5AKXA 5JG7A 3S5UA 1Y9JA 2C5FA 5CYGA 5LQDA 4GPEA 5B4VA 1SC9A 4OUDA 3ZDDA 1E6WA 1KK1A 1VMEA 2KM1A 5DBFA 2O7QA 5GTDA 1Q7EA 1O4VA 2CMDA 3E9NA 3M9LA 4MIKA 1G63A 4PZYA 1C1YA 5E1BA 1FQJA 4I9FA 5JROA 3HXOA 3RS8A 4LZLA 5JCOA 3U1BA 3K2QA 4II2A 5HCIA 3M7IA 1ZK3A 1T0UA 4IVQA 1PNTA 5GIPE 1U65A 1K8XB 1G8MA 3LOPA 4AF6A 4CWAA 2ZJBA 1HT2E 2WTAA 1YQ9A 5ESDA 3QFHA 4P0TA 1V4NA 2GS9A 4IJVA 2R00A 4HAXA 4K9NA 5A6SB 4MLPA 5KBYA 3K9QO 1DV1A 2BKXA 5E0KB 5HKBA 2ZJ2A 5IMSA 2J6CA 2IZ0A 3BMQA 4LUCA 3C3MA 1JU3A 3WKCA 2HCBA 3IUSA 4QM6A 4RZHA 4M0UA 3C7DB 5EJ9A 3S2YA 1X9IA 3F7TA 3L7JA 1RD4A 5F1YA 3V4OA 2J9YB 4BCDA 1LTQA 2UAGA 1TEZA 1SXPA 4CMBA 5KYTA 2FEKA 3BERA 5ILGA 5K8JB 4C4YA 2JL1A 4I08A 2DQSA 1A88A 5F3RA 4OQMA 1P8JA 3BKXA 4EHHA 4FC6A 3I30X 1DDOA 2NZVG 1YFJA 5FAXA 3HP7A 1LS1A 5HJ2A 1Z4OA 2ZBVA 2R6DA 5GV7A 4ARSA 2F64A 1Y1LA 3HFRA 4B79A 1CD5A 1K2WA 1OGYA 4HEQA 4KIFA 4PFKA 4AJIA 2O8EA 1QB8A 3DSRA 1FFGA 1TTHA 2ANBA 1UKCA 1T15A 4Q3NA 2GTIA 2IDMA 5BVGA 5JNSA 1P1IA 1FJ2A 2ZRKA 1JXQA 5BWNA 2GX6A 5AHOA 2NSJA 2ZR8A 3D2CA 1X87A 3E2PA 4JZYA 2V45A 3DDCA 4E7PA 3NKVA 3U9SA 3DMFA 4H1WA 3W06A 5BYAA 1RLIA 1CT9A 4MJXA 2IFTA 5L9AA 3P45A 2G63A 2Z1MA 4RFLA 5DYNA 5FBLB 2NQ2C 5JJCA 2EFJA 1TF5A 2VH5R 2XZTA 1G3RA 1T2FA 4M1OA 4ZVPA 4HN9A 2LUOA 4D46A 1TKRA 3FDZB 3VISA 3ZV6A 2B30A 4TUYA 3WGNA 1WQ4A 1UKAA 5IJ9A 3TCNA 3D6AA 2HBYA 1GQOA 2Q1UA 1MMFB 2FP4A 3LUGA 4Z1OA 3TFOA 4QREA 1RNLA 3JQDA 2UZ3A 1IRIA 4RS3A 3F90A 5EP3A 2AUMA 1SVMA 3TLCA 3ZS8A 3PXUA 1SVUA 1XR3A 3ND5A 2PCJA 3LC7O 1KAMA 2BHRA 3PENA 1P0FA 2D3WA 3DOIA 1R74A 3DHWC 4KV7A 4PG4A 2PUFA 1IBLB 2BLNA 1UXKA 1V3UA 2AZDA 4J91A 2H85A 4PZUA 1HDRA 4OHMA 2JCSA 1E96A 4DIOA 2GJ8A 5GM1A 1EK1A 1OIWA 5F73A 4MCAA 2VHVA 3FTPA 5TB5A 2PU5A 2W2LA 4N4AA 3TLKA 1JU9A 1OWLA 1M2JA 2NTNA 3K9CA 4GX0A 4WZAB 3FSGD 4FCCA 4DABA 1UWLA 4GPD1 2X9GA 4X1OA 3NBQA 4D0SA 2H1WA 2H5EA 1E8MA 2VDVE 2WC1A 5A2QA 1Q0TA 3N8KA 5EXSA 4XQGA 3CTPA 3N05A 4ZAWA 5G0VA 3UTCA 2I2WA 4ND8B 2AF4C 2E37A 3EF3A 5JZOA 3EA5A 3FYDA 4CMGA 5HNKA 1NXQA 5EKDA 1SBHA 4OHUA 3PITA 5FBVB 2FEMA 3KSDO 1MEOA 1GD1O 1GL7A 2GEFA 3C16C 3PF8A 4ZOAA 4CT0A 3P0EA 1J0BA 1C1DB 1PP4A 1XTRA 1NRWA 1CY1A 3AGQA 3A6PC 2VF7A 2FQ1A 1E2BA 2PEZA 5KMGA 1RBZA 4EGQA 1MRZA 2QP3A 3DC7A 4HMOA 5KQMA 2C5SA 3C8DA 3HFGA 3WLLA 4MUBA 1JR3E 3QOFA 4G4IA 1T0PA 2XQFA 2OGSA 3PNQA 5DNCA 2HCRA 4HRAA 1SKYB 3BH0A 1ZO8A 4FW9A 4MHSA 1J7JA 3GU3A 3PB3A 5DASA 2IV3A 2H18A 4GM4A 4D92A 1QKIA 4LDNA 3W77A 3B3AA 4Z7NB 3Q3EA 2OR3A 3I52A 4D0GA 1MDBA 2B9VA 2WJHA 5AKKA 4NAHA 4IJ5A 3GBSA 2NUTB 1NX6A 4RGYA 1TW3A 4DMMA 4K6KA 4JI1B 1TUIA 2H51A 1A4XA 2RK3A 2XMCA 3BL8A 2WIDA 3Q15C 3QMPA 4NDZA 5AW0A 2Q50A 5CBKA 1VG8A 3CLSC 4NFSA 5K0ZA 3I42A 3A4LA 1XQVA 1GZ4A 1EGQA 5ALSA 1JJAA 1RWXA 3F49S 3HBMA 3LW8A 4Q1AA 2CFRA 3NKFA 4EJ0A 4EW6A 3HGMA 4HEJA 5CIYA 1PDWA 1XTBA 1CDEA 1FSFA 4GMKA 4B3XA 3TQOA 2FR8A 2IYAA 1II0A 3WG9A 3OQ6A 3QQPA 2AFIE 1ZX1A 2JIOA 4XSVA 2YN4A 1P5HA 5HE9A 4YPOA 1SKQA 3BGDA 3MT7A 1CJUC 2OGTA 2ZWOA 3AVWA 4EHBA 4L0DA 4L3VA 4B7AA 1IN7A 4TL7A 1C0EA 2CLSA 4O4HB 5ENVA 2XJ9A 4I9NA 4YT4A 4UHBA 5G1NA 3HBAA 3N39C 3OJLA 4O1MA 4BN4A 1GUDA 7REQB 3JATA 2HQ1A 3OE7A 3VU8A 3ANMA 3DLHA 3R3XA 2HQRA 1EE2A 2GN2A 2B8NA 5I48A 2ZE7A 1GGVA 1W0JA 3D0RA 4OKIA 5JJ5A 1YL7A 3K6SB 1W85A 4B3SB 1YQXA 1P19A 3EXIB 1W59A 2Z9CA 4HEA1 5FRDA 4WK4B 4YMGA 1C0PA 1XZLA 5K2MA 5FPPA 1B0AA 1KPIA 2AA3A 2AMLA 2HHCA 3WKDA 5K6TA 1U8ZA 3C24A 2AW5A 2Z2KA 3CGGA 2W6ID 4RCVA 1J56A 1W2HA 2XKBA 3W6ZA 1WXFA 1L4KA 2PWBA 4XUEA 3HCNA 3W0LB 3WDSA 3ZQJA 2A92A 2JBHA 3M6VA 3NATA 1XJQA 3OFKA 3DOHA 1SZPA 3EFBA 3QQ5A 2WU0A 4QOSA 5HS4A 1EEHA 3HCOA 1EXVA 3EVGA 1X14A 5JCJD 3WIUA 3O7MA 2NZ8A 4Q4AA 1T8PA 4TWIA 2WIBA 3P52A 2LCFA 4RMIA 5SV2A 1RPAA 2O23A 3BIFA 1V95A 1Y33E 4FS8A 4D2IA 1IU9A 5BURA 2G7ZA 1JA1A 2GK7A 4EHAA 4BATA 2VQ6A 4MAAA 2VCHA 5DJ5A 3TKAA 2JS7A 1O2DA 2ZFUA 4Y1RA 1LXCA 1NIPA 1FVFA 1REQB 1S8NA 2RHMA 2VJAA 4BFSA 5H59A 3WJ2A 3QXXA 4ZPJA 1F9AA 5DX8A 5EY5B 5BT9A 4F72A 3FMPB 2C9CA 2D06A 2JAPA 1CQWA 1U8AA 1UPFA 3TMAA 1HT0A 2VPXA 2DFLA 4RSRA 2B4YA 1O1YA 3OQIA 5DT9A 2N9UA 3F74A 3KKMA 1P33A 4KLNA 1A4RA 3D3JA 4ZAYA 4RTMA 1DXHA 1EXDA 4IDQA 5C8ZA 3ELYA 4CEIA 2BWJA 2HBQA 3DXXA 4RSGA 1NUPA 3G2QA 4UE2A 3C3DA 2DUJA 3OX1A 1T5IA 1O0SA 2C00A 5H0IA 3VKVA 4D9EA 3DVRX 4DCSA 3DJYA 3LS2A 4HS9A 4V03A 2VDUE 3ZVKA 4B44A 2A14A 4JBYA 4QGGA 1JR4A 1Z3CA 4CR7A 1SUBA 2XCOA 3R3VA 3JASA 2Z8XA 4CMHA 4IKEA 1NWCA 1ZXXA 3F5MA 3ZV7A 3P4YA 2GN6A 2ZBFA 1KJJA 1O94C 4F4DA 5FTLA 2VDQB 3V2GA 1YR6A 1BMTA 4Q9KA 3H4MA 2HGSA 3PQ6A 2C4HA 2BISA 1HG0A 2O0LA 1LLQA 3AG5A 4IRUB 4OGFA 2W2VA 1MF7A 3VHXA 2JJYA 1V5WA 3WNBA 1UFQA 1T4CB 1K6MA 4XYBA 5FOSA 2XWQA 3CINA 4M86A 1GY8A 3KLMX 4MV8A 3NHFA 7YASA 3HNPA 4QLOA 1WZIA 3ZBTA 5LQJA 3SYTA 1W5SA 1BS9A 2Z3ZA 3LLMA 4I4NA 4ARUA 3D8TA 4IUCS 1K63A 5G1OA 1BH2A 1XN1A 3MS2A 1E2EA 1TJNA 3D43A 2XT6A 2XSZD 4YQFA 3FKJA 3E8MA 2H7YA 1K0FA 2QN8A 3HSYA 2C2KA 1IUOA 1DX6A 2R4QA 1P60A 3KS9A 2BFAA 3IVCA 1C9KA 3EZ9A 3MAGA 4MR9A 3U4AA 4H60A 2UYHA 1KY3A 2XMRA 3K4PA 1BD3A 1WHSB 3BKWA 1D4AA 2XMBA 2ZWIA 5I7OA 2J0QA 4DB2A 2EW1A 2BBOA 4JC4A 4YP1A 3T5DA 4B0OA 3CRRA 3KQMA 4DJAA 2WKWA 3UJDA 5D3MA 3A3KA 1VJ1A 1OWNA 5IH3A 3DXZA 4ZO4A 1E59A 4LVUA 1QDEA 4IWXA 2JLQA 4CCSA 4MDYA 2GZAA 4HMPA 3WL5A 1E8DA 3QYPA 4TTJA 3I5XA 3JVEA 4U7DA 3EFOA 4G5OA 1ITZA 1U8YA 2GD2A 5HQ3A 3ZJYA 5I45A 4G0WA 3FZYA 1ZVKA 1U3GA 4JBGA 4UUAA 4NMLA 3P20A 4XDZA 5LMNB 1AF7A 2Q07A 3PXGA 1FP1D 2DKFA 3ROMA 1Y5MA 2PUBA 3I2GA 5GAJA 1AM4D 3BFVA 1GITA 2IS1A 1T0IA 4J76A 1FUEA 1H22A 3B7WA 3JYPA 4L15A 4NS4A 4KOAA 1U1FA 4XEHA 4RBNA 1ORVA 3OC6A 4W5NA 2PLNA 2GJ9A 3BHMA 4DSNA 1U0SY 2FPLA 4MKGA 3EOBI 1E3MA 3AZOA 4G0QA 3QMMA 1P91A 2ZYUX 2ZR9A 4OXQA 1GZVA 3K20A 2BT4A 5LQRA 2EFGA 1YIDA 1GCUA 1RWOA 4RK0A 3TO5A 3DGFC 3R4CA 1XLTC 2OMKA 3UB2A 3OCXA 5DLDA 5FV7A 1MIOA 1CXZA 1IHOA 1IZYA 2XDQB 3E4DA 3GDGA 3AEKA 3G79A 3PDIB 4L8WB 5LYJB 1NM5A 2WF9A 3INYA 5TLSA 1ZH0A 3E18A 2OILA 2VRNA 3CEAA 3IBYA 2IJGX 5DLYA 2P9EA 5I01A 4LFBB 4EZIA 1JHPA 3UUEA 3VSAA 2WE7A 3RFFA 4QM7A 2FWBA 1D6NA 2QX7A 1DINA 3BD6A 1ZRNA 4OK3A 5I8ZA 4AXBA 5C81A 3P32A 2D6FA 1L7XA 4RADA 1T36A 3KSMA 1GTJ1 1KK2A 1QHEA 1J09A 2HAEA 4S2UA 5IAKA 4RPCA 4L7VA 3SS8A 1U31A 5LXTF 3BREA 1MPTA 3OPYI 4CQMA 3CX6A 5BSKA 1R37A 3C74A 1IXYA 3KEOA 5JDIC 1EIWA 3KTFA 1J22A 2BKVA 4QFBA 4LISA 4CN8A 2HHAA 1XFDA 1PL6A 2CFCA 1S7CA 3DE3X 4H7DA 4K2HA 2ILVA 4M38A 4RL6A 1MAWA 2I9PA 5CX1A 5AQEA 4DE5A 4ZIRA 4LTNA 2QTCA 3R7NA 2OCPA 4RTQA 2NMVA 4Y1GA 1QGOA 2PX3A 3AC0A 1PO7A 2R8XA 4FDLA 3Q0IA 4QG7A 2NO7A 1CPYA 3QH4A 3IPLA 4RZIA 3HJRA 2BDTA 4UHDA 3QKSB 5ER9A 2VAPA 3R2JA 4JLNA 1T5OA 2RJOA 4AZ0A 1PSWA 2FHPA 5BNFA 1Q92A 4WKOA 4E03A 1XRSB 2FCAA 5G0SA 1EM6A 5ITVA 1GGKA 2IXAA 1FLDA 3DMDA 521PA 5JAOA 4CIDA 2CSUA 2QLBA 4F2HA 2EOAA 5EKTA 1USGA 1XG5A 5B1EA 4EB6A 4DRYA 1NZJA 2F8SA 1TKCA 1MNQA 1G9XA 1L9KA 1JWBB 3TSAA 1MT3A 2BFEB 5DWDA 4FFNA 4NH4A 3NWOA 2VYCA 3QBEA 2ZJ1A 2J07A 4GBED 5IFLA 2SHKA 4BMYA 2NO6A 4GU5A 4AC9A 4YFVA 3BHIA 1E62A 1QC5A 2INGX 3IP7A 4WW0A 1YQTA 1D8AA 1OHHA 3DBHA 3ELUA 3MYRA 2PDAA 3FF1A 4Q15A 3U3XA 3ZH2A 3KETA 2C7VA 1C9MA 5DISB 1W0CA 1JKJA 5BR8B 2RJ3A 3DD5A 4NX2A 4QEKA 3O4JA 1E0JA 4R8VA 3AUTA 4DV7B 4JMLA 1YMUA 4XOUA 2GBLC 2GAOA 1T91A 1RHJA 1T6NA 3CIFA 1ULAA 4BV3A 2YJZA 4PYLA 3G0CA 2A9PA 2CXQA 4X1IA 3SICE 4GO1A 2VRBA 4LOIA 4M9XA 4QUEA 2FMHA 1FPMA 2J6BA 1I2DA 1KDOA 1QRRA 2QUZA 1W49A 3DNFA 3I9NA 2A9QA 3PBKA 4CKWB 3KKOA 1RRKA 1FNCA 3PHBE 4Y8VA 4D8VA 5KWEA 5M04A 1BO6A 3HRKA 3U4IA 4FJ1A 2H4FA 1OLSA 3KSAC 3U6BA 4L6IA 1CLUA 3MUEA 3N0TA 5A71A 3LO5A 1M1YB 2IZOA 3FR7A 2IWRA 2DQZA 5L6LB 3KVYA 3J81A 1HE2A 1A98A 3PDWA 4A8JB 4BE4A 2FDCA 1FY2A 3HA3A 3EIXA 4AG6A 2YUIA 1JQKA 4NWIA 3G49A 1JKFA 4UEOA 4CNBA 2GWRA 4EENA 1A1SA 1QIFA 2QV0A 5ECGC 4YV1A 3B53X 4O3MA 2EKZA 3H04A 5EINA 3PSHA 3FXAA 3A31A 4ITRC 2BGMA 4YMHA 4H6PA 1Q1NA 3FOBA 2BKLA 3M3HA 4P2GA 4RABA 5DDIP 5I9TA 4JI7B 4KNWA 3ZG6A 3G9TA 5D87A 3AR9A 4B3JA 5L4NA 1PWHA 5CPFA 1NNLA 1IBMB 3WICA 1YHYA 3NH9A 4R51A 4XB2A 1O96B 2PCLA 2DSNA 2AOTB 1PJBA 2ZAYA 2JGFA 1GRNA 1D9ZA 1VG1A 4QULA 3LD9A 4EHJA 4ICIA 4LXQA 4F12A 3C7AA 3F9CA 1F2TA 3OEEA 3QK7A 4WERA 3VR2D 3CIOA 1DZIA 3Q1LA 1H9BA 4BGDA 2V5VA 2B1IA 4ENSA 3FYHA 1XRRA 2WVGA 3LPCA 2GEJA 4HF7A 1WY5A 1F0NA 2ZKLA 3JTEA 3HO6A 2H2IA 2G17A 2AUNA 4C1BA 4L02A 3W8FA 3ICVA 2HA0A 4OFZA 4CCYA 1MN6A 3E7XA 3ORYA 3A05A 5LBTA 3UUFA 4MV0A 2L2QA 4KQHA 1SPBS 1WG8A 1NVVQ 3GV0A 2WP8J 5KI6A 5BSMA 1VPTA 1IM8A 1T1RA 3DOCA 3GZTB 4PGHA 2O2JA 4TV8B 5D5PA 1QH9A 5DULA 2HMAA 2H48A 5J40A 2F2TA 2FVXA 4NJEA 1W4BA 1YZVA 2XOKD 2HMWA 3BBPA 3FSJX 1TJ3A 3JCZA 3LPNA 2H59A 3RVQA 4I3GA 1DKLA 1I8TA 3QVXA 4ZQIA 4DMGA 3LQ2A 1E4YA 3KJFA 3ZIAA 3F8WA 2XGOA 5KYWA 1MW9X 2XYHA 1LRJA 1SNYA 4NENB 1CG6A 3PXAA 4MX8A 2AOXA 1A9ZA 2GARA 1DKMA 2IUEA 1FUUA 3HR8A 5EZQA 1LFAA 4O4LB 5KWJA 1M6NA 3QEBZ 4KGXA 3B8HA 2CLHB 4I4LA 1TKAA 4Z4IA 3DL0A 2IDJA 4LAFA 5K0GA 3E8XA 2X6TA 4RM2A 5D86A 4ZCMA 2VTBB 2YXLA 2ZJOA 1CK4A 3IVAA 3UXYA 2P77A 2W7TA 2IOQA 3F73A 1KXJA 4LXIA 3F6EX 3NOVA 2FE4A 1TM1E 3H3XA 2XZPA 1U0EA 4CEHB 3SNHA 4QU9A 2HT1A 3I6YA 1TNDA 2GA9A 4P33A 4IHJB 1RI4A 5E3HA 4RMHA 1ANKA 3GLIE 1KAGA 1MOPA 4ZT2A 1HETA 2I55A 2PT9A 3COWA 1QHFA 4L50A 4DJEC 5EL0A 4EHIA 3GX1A 2I0FA 1I1QB 1F8GA 2QD1A 3FWHA 1JFSA 4QDUA 2QN1A 3AKCA 1UBEA 3IJ5A 4K1XA 4U3JB 5IPFA 5HW0A 4M55A 5KKNB 3UMSA 1Z5UA 3A36A 3MAAC 1RPTA 3DE7X 3STTA 2SKCA 3OD1A 5LFAA 2OBMA 4C78A 3ABQB 3WYAA 2DLCX 5CM2Z 4ALLA 3THYA 2A0WA 4J2OA 1WXWA 3EXEA 3JZFA 3CEHA 3D7RA 1BU5A 4AMZA 3BXEA 1L5KA 3TX2A 4BXOB 5AJWA 4PO3X 2VFAA 3V8NA 2AL7A 1U0TA 1K5GA 1YDMA 2IXGA 3JD3A 1DTEA 4RFSA 2YQ4A 3A9CA 2JKVA 2HJHA 3L1UA 2FUKA 2VAWA 1XWIA 1IOVA 1C14A 2A5JA 2QVLA 4CG2A 3NHMA 4U2DA 1Y5NA 3T7AA 4H3KB 3WL8A 2XAAA 3ZU6A 5CFZA 2CFIA 1JLKA 3KUUA 1Q1ZA 1X2BA 3BICA 1U8CB 4DPMA 4X45A 4AX4A 2JLWA 5DM1A 5IC4A 1KYIA 3GD7A 1MX3A 3MD0A 3PFBA 4FI3F 3QSYA 1ZITA 1LPAB 4CHGA 2YRFA 6PFKA 2B35A 1KYTA 4FUQA 4Z1MD 4INAA 1P1JA 1DV2A 2JBAB 2C9BA 1DIGA 2BRUC 5G3YA 4JV5B 2IHUA 3IP8A 1CEEA 5A02A 1WZUA 4RZSA 4TYNA 3UK2A 4IYRA 3LDGA 3ICEA 4V0NA 1MA0A 1P73A 3N2LA 4L27A 1RM3A 3SYKA 1P7WA 1Y6RA 4MWDA 2QGFA 2OD2A 4HRVA 5EIAA 4L6AA 4L4YA 3KHSA 2QQFA 2BF4A 1P9NA 3V46A 3TOCA 3WMFA 4EEKA 2UDPA 1XEAA 4OXXA 5HPYB 1Y7TA 1NE7A 3ZQKA 2QI9F 4TT3D 3GPCA 4KUGA 3G2HA 1SURA 2Y71A 3MTBA 2YV4A 3I4CA 3AYXB 1WDLA 3A7DA 4S0ZA 2XYVA 2XTMA 4X63A 5AM5A 3U4QA 1H23A 4BIMA 1PQUA 4XYEA 4YR9A 2HLDD 3L18A 3HDVA 1U8UA 2R5NA 3INNA 5LOVB 1ZUWA 3EMDA 2GOYA 4FJ2A 3FBTA 4BMDA 4F2DA 5C4MA 3G02A 4RV5A 4C30A 3ZLBA 3WWYA 2PWAA 1XRJA 3CEJA 4RS4A 3G5UA 5H80A 3EUAA 4BX9A 1WZCA 4A3SA 1GIAA 1U2GC 2PQ0A 2XV1A 4N9QA 3V9PA 1WO8A 4C3ZA 3BK1A 4L6CA 1KK3A 3IUBA 2OLEA 1WCIB 4MA4A 4UXHA 4QYMA 1U1CA 2REQA 4NP6A 1E6KA 4HLQB 4JAVC 1NXWA 1VSQA 4ALIA 4DXDA 1HSOA 1YHZA 3FCUB 1UC8A 3M4JA 1GM5A 4XZ3A 1WABA 2KWIA 3FG9A 2JFNA 3MFYA 2FN7A 3QJGA 3NAMA 5B1HA 3UBMA 5IT5A 1T8SA 4L3WA 4HAOA 4AY4A 1UBRS 4OIFA 1W88B 3MHTA 2XRMA 2MYTA 4I55F 1JPVA 1ULSA 2QJWA 3O9VA 3W05A 4XWOA 1A5BB 3IR5A 1KJZA 2BH2A 1DKUA 2EATA 4TQUS 5LZ8A 4HATA 3VVCA 2P6RA 1JDJA 2A86A 2D5CA 3H86A 4AY5A 1NIJA 1Y5RA 1ZJWA 2PGDA 3DFFA 1RADA 2PS1A 3CX7A 1CFZA 1R3UA 1M8PA 1V11B 3GXOA 4QUIA 4YK7A 4D3XA 1X7YB 1N2CA 1EJBA 2CLMB 3B1FA 3KE8A 4PZPA 4AK9A 3ILVA 4CKCB 4RHYA 1A69A 1T8TA 1W2GA 1VCMA 4DSAA 2QR2A 3PQ4A 5HF8A 5EMHA 3SHVA 2YN0A 1LV7A 5AKLA 4EY4A 1F2DA 3I05A 4P7KA 1E2NA 4U00A 5LU9A 1I5RA 3DLAA 3H1BA 2ZQ5A 3DMTC 3OLXA 4FR2A 5L7TA 2QAIA 3NTRA 1V5EA 4F9EA 1CUSA 1CJVC 2J5XA 2KBEA 3EE6A 5DK4A 1VE5A 4JODA 4K26A 4EOGA 1HE1C 4EI8A 2B69A 2ZDGA 4EPXA 1XT6A 3PJDA 4F8YA 3ZE0B 2OT3B 5ADUS 3KEQA 1RXYA 1AX9A 2D1SA 1W0KD 5HS6A 5K0BA 1L5GB 1EK6A 3WV5A 1XUOA 3LQFA 4IDDA 2XVYA 3LBHA 3EXFB 1WUKS 2AXNA 2MTBA 4WHMA 5BNTA 2A1UB 2BONA 4PLGA 3VKFA 2VTKA 4S24A 3H4IA 3RC7A 3RRFA 1JAIA 3M1IA 4G5HA 1K8YB 1R0CA 2MYUA 2E4UA 2R68A 2O8DA 1POXA 3H0CA 4YJGB 5CNJA 2V4ZA 3N58A 2BSQA 2ZXUA 3HS3A 3H18A 1GL3A 1J00A 2ZTHA 3KDSE 4EGAA 2O8BA 4MKFA 4MWSA 4KR7A 2A9JA 1XRNA 4D9CA 4UM5A 2Y1GA 3IAFA 4UM9B 4FW8A 1Z6PA 3N6XA 4N5MA 2IEBA 3GUVA 2NYRA 4XARA 4D9JA 3V3TA 5EYPA 2R6GA 1Z8DA 4UEKA 3CVOA 5AKYA 1JEOA 3IBCA 4RSMA 4I50B 4ZANA 2WIFA 4R84A 4AY3A 3CFYA 3SP1A 3OZUA 3BXXA 5A3QA 1Z4MA 3H11A 5BWMA 5BWBA 5AKGA 1RZUA 3BD8A 4QFMA 5DEIA 3QLUC 2JGMA 2ZXFA 4TKUB 3AJ8A 3FFWA 5EAIA 2EP7A 3CCCA 2EKBA 2VH1A 4NE7A 2X3UA 1N8KA 3O4IA 1FQOA 4GR5A 4PXAA 1E7WA 4IVPA 4EJSB 3FOZA 4GYWA 4MQFB 5AK3A 1QYVA 4IIYA 4RIGA 1M5TA 5HF9A 1V35A 3GEPA 4HV4A 1UJ6A 2ZETA 2XLCA 1WEHA 4MDHA 4QQKA 5AO9A 3RNLA 1PJRA 3CS3A 4GE0A 3FWNA 5FNVA 3QPCA 4O4JB 3O4VA 1GN9A 3LC2O 1YA8A 5C5CA 3JQ6A 2IXEA 3K0AA 4D8WA 1KI8A 3FJYA 5CFLA 1H6DA 3GEMA 3M6FA 3N0VA 5DB4A 5BRAA 5CEJA 3TWOA 1KSHA 2PMWB 3OF5A 4H16A 4JYCA 4I0WB 3TGWA 2BOVA 3L7AA 5IYZA 4YV0A 2C54A 2IPAB 3W4KA 5A0VA 2R6ZA 3JYNA 3LW7A 1AK9A 5DHPA 2V8BA 4OHXA 4XSGA 2VQFB 4PGAA 1PZXA 2JB9A 3CZPA 1YQQA 5JOQA 3JVDA 3WQBA 2IE8A 4OQ4A 1B8UA 2WUDA 3DR3A 4BX0A 4CM4A 2Z4RA 2BV3A 2E1RA 2PL9A 4M54A 4O02B 3Q7IA 1E6CA 1FRVA 1L4YA 1P2UA 3CPEA 3IB3A 3VNSA 2Y4OA 4E5NA 1BXRA 2W4QA 1TQ8A 3CISA 1OX4A 4MWEA 1TYCA 1V1MB 2WNSA 5ALIA 5REQB 3FMVA 2XCTB 1A9OA 1WHTA 4H27A 1DKRA 3QOYA 5BYBA 2XCSB 3OZRA 4KRGA 1F06A 2E21A 4B3IA 5LD2B 4IGKA 4TLDA 1EVYA 2V9ZA 4P3PA 4WZBB 5DHTA 3ABSB 5FOTA 2HEIA 4C29A 5BORA 4DIEA 3A9VA 1EFRD 3B1YA 2I4LA 3A3YA 3EVTA 1Q7RA 2C98A 1NVEA 1YB4A 3AIOA 3MJFA 4KH1A 4UOQA 2CK3D 3TSOA 4BFUA 4HDMB 2X42A 3DBLB 3CLKA 5CLHA 3FZEA 4DY4A 2ISQA 3ID6C 3ZJTA 1WXDA 3ZHUA 4Z4FA 4M1YA 2YINC 3BQMB 4OIMA 1NF2A 4DUGA 1PEDA 3HWRA 3DF9A 3NW9A 4CBVA 5FX2A 3R1IA 2AR0A 5DO9A 1FYVA 2AJ8A 1U7DA 3DP7A 4AP6A 4TS1A 3TNFA 1YVPA 3FUVA 4LC9A 3GBPA 1K5HA 2W6PA 3NDIA 3ZY4A 2KJQA 3F96A 5IARA 5BRNA 1EVQA 4HJRA 3TUJC 1RAAA 3BE8A 3SOZA 3EULA 4NNPA 1M1XB 3UKOA 2WRZA 5I7RA 3DEFA 2ZIXB 1Q17A 3IUPA 1Y9ZA 4YDHB 4B75A 3UMGA 3TRKA 5JQWA 3UMVA 1E4EA 2R84A 4Y2XA 1I7DA 5F64A 1OZAA 3QLVA 3M1YA 3EPHA 2QTRA 1JFLA 1GG8A 4XWKA 3MXTA 3M34A 4X3OA 5ELLA 1PD0A 4W8OA 3W90A 3D81A 1JJIA 4YCJA 3A1FA 3SDZA 1SBTA 3AVVA 3RAFC 1GG2A 2V6FA 1M2WA 3AQIA 3I1FA 4DLTA 5D1HA 2AKAB 2V6MA 2OLKA 3JARA 4JWTA 1IM5A 4MVJF 4KN5A 1A4UA 4A8JC 4HGQA 3RI3A 3TGLA 1BKYA 1N6PA 1GGMA 2ADOA 1ZUD1 3OTGA 4JBLA 2ZZNA 1U0JA 2YV3A 5K2OA 2R7MA 3PC7A 5I3ZA 1JW9B 4L4SA 3TL2A 2JI8A 2XAUA 1L7BA 2Y0EA 3DT8A 4PXSA 3M4XA 4R98A 2ISCA 4NDAA 3RS5A 5JS1A 2W2PA 4IHAA 1YNOA 4KBGA 4ZVSA 2WHQA 2EFCB 4ZRDA 1XZNA 1WE2A 3ASUA 5FPQA 5JPCA 4YJ2B 5L3ZA 2ZBPA 1AQ6A 3AOEA 2AJBA 1H4TA 4I1SA 2ZQZA 3HCAA 1KYZA 2BMAA 2X4IA 2YASA 3JU3A 3LDHA 3TINA 4AB1A 4C01A 2EX4A 4OQXA 4YMTA 3PZBA 1H8HA 1V4VA 3L1VA 5HZMA 1EUCA 4TT8A 2ID8A 2J7PD 4L8GA 2JDID 5K0LA 3R75A 2XVAA 1ZSVA 1VKRA 4FCWA 4P32A 4PU0A 4AKEA 2UZ4A 1JXOA 4DQLA 4LDAA 2QG4A 1A5ZA 3OESA 3L2OB 4ZKDA 4UCFA 4LRXA 2H4YA 4YRGA 3LPMA 2G67A 1JQAA 1HC7A 1KWGA 4PLHA 2Q4BA 1P3DA 4KK3A 2A8YA 1XA3A 2HCTA 4RJIA 4DZTA 1H3EA 3KUKA 1VIYA 1Z2AA 3TW4A 4P4SB 1MHTA 4UUOA 4ZT4A 1DKPA 2F6RA 3RHTA 1GFWA 2BFDA 2H1VA 4TMKA 4WN9B 1Y3FE 1YR2A 3K30A 2FWNA 5JCZA 3OCVA 1IN5A 2NQTA 3QA9A 4UULA 1L4NA 5AVTA 4PG6A 3RH0A 3COSA 3BWCA 3LH5A 1L3CA 2AD5A 3ZHBA 1QX3A 1XZHA 3ZX4A 3OQBA 5D2CA 4CG3A 1N78A 4RTKA 2P2SA 3WADA 3DBRA 2A9VA 1OXKB 2CXSA 3I9OA 2XMGA 3SZGA 3KZVA 4Q4CA 1K3UB 2A0UA 2BL4A 4J3JA 4D79A 4L0QA 4C2UA 2ADFA 4LRYA 1FYWA 4D0LB 3JQAB 3ZTYA 4FS3A 1N8SA 1EB8A 4ER7A 1B0UA 4D44A 1C7RA 1X8JA 3NR2A 1AUXA 1N2SA 2VWHA 3FSRA 4TS3A 3V2HA 4C03A 3DTVA 3OTHA 1DT3A 3NHPA 4ZDWA 4ESHA 4C7VA 3E0QA 1A5TA 1P45A 1Z0AA 2NU8A 3RRYA 1UJ2A 2NVOA 4NV3A 3QVLA 3MQFA 3QKWA 1Z25A 5SYNA 5KJ6A 1K7YA 3ZDXB 3P9NA 4QDTA 3T7JA 1Q3TA 2QMUA 1NNEA 4P4NA 4MDFA 4LWOA 5A3JA 3UJAA 4TS4A 5DF1A 4L74A 3KLPX 3RFUA 4UBKA 4U02A 3U4DA 3JQ9C 4WBNF 1PJCA 1Z8HA 4BGEA 1VE7A 5AK0A 2W98A 2HFKA 3NVDA 1XXLA 5AVJA 5M34A 1LBHA 3AIMA 1RI5A 4I46A 5K0SA 1D2EA 1MEEA 4FHDA 1SD5A 1XZJA 4TRNA 5G2OA 1OXSC 3KSUA 4QPJC 3UF0A 1FFXB 2AB0A 3ENZA 1SU8A 3GC6A 2C3YA 3DKIA 1DDIA 3AVPA 4HX2A 3BIOA 3NHBA 2H2WA 4I9UA 3KQKA 4J0EA 2EIHA 4X91A 4N5DA 4R9RA 1A4IA 5CYPA 3EDOA 4S3MA 1FRFS 3G0DA 4PLTA 4UEWA 2RGRA 1AHHA 3C70A 2XXAA 5TDHA 2OG1A 4MOWA 5BNZA 1HI9A 2C5EA 3I0MA 2ZANA 2VF8A 3WNDA 4ALNA 4TSFA 3O26A 4ARBA 1TYAE 1ZJ6A 1MORA 4MVJM 2ZYRA 4J1QA 4B7XA 1SD2A 3BSFA 1Z73A 4YQYA 4LE2A 3E7WA 3K1ZA 4Q6WA 4UJ3A 4ZCLA 4K6HA 3H6HA 2REBA 1P7CA 1GPUA 4QOGA 4HNUA 4MHTA 1JEDA 1B23P 2DFNA 2BHSA 4R1MA 3W5UA 4NG5A 4WUVA 3EPLA 1LSJA 1G5HA 1X7GA 4KKVA 2RCNA 4RZQA 1M34E 1CR2A 5KVAA 3MBOA 4PRYA 4BKUA 2J5BA 4PS1A 3L7IA 3A4YA 3FETA 4TWAA 2FKNA 4YMLA 5T4EA 4JJEA 4D25A 5KPJA 3STVA 3RYFB 2QJRA 3PR2B 4KPUA 1CEYA 1C30A 1JJFA 1UODA 1WOYA 3L8YA 1Y1SA 2VS1A 4YJFB 5T7BA 4GOXA 2DHEA 2JLUA 4M0FA 5AXCA 4E3WA 3H65A 2IV7A 3L1IA 1FJHA 1KHTA 3C45A 4J3FA 4KYVA 4DWVA 1T13A 5EEGA 3LPAA 3FNEA 3LFUA 4X3PA 2CT8A 2P2ZA 4G86A 5EJGA 3ZC3A 5BMVB 1B41A 5TJHA 3ROGA 1RABA 2Z5VA 1FEZA 3L3BA 3QKRA 3IRUA 1UT6A 4TQGA 4DLPA 5FA5A 3SYRA 4F92B 2O57A 2YWEA 1I4DD 4JVLA 3JVVA 4TV9F 1PCXA 3VDMA 2I1LA 1NKVA 3SC2A 1VYTA 4D6YA 1BMFD 4XVCA 1DMRA 4RVNA 3SE7A 1YI8A 4RORA 3TR6A 2JIMA 1GAXA 1CRPA 3ACCA 2FQXA 4M1MA 3EIHA 4Q3DA 1V16A 1EBBA 3S2EA 3FOEC 3L8DA 2F1OA 4GLBA 4HQLA 1L2TA 4CE6A 4P6VF 1PR1A 5AJUA 3KKNA 5I7VA 4J49A 2ZBEA 2OZPA 1W47A 1YZTA 1YJCA 3FHLA 3W7BA 4KIUA 3DD1A 4B8YA 4TPKA 3P2IA 5IKOA 3FUUA 3NHZA 4BMSA 4WJLA 1ZRSA 3SG0A 3H1FA 4JKOA 3RIEA 1GCIA 2OY0A 3WK8A 1VMIA 3NEYA 1JLHA 1KY5A 2FXVA 2PZAA 4QG3A 1E9BA 4BVGA 1NVWQ 1J90A 4L9RA 2UUPA 4ZTZB 2J9FA 4BNGA 3JQGB 1HLFA 1SCBA 1YQUA 2EKPA 3F8SA 3LQYA 4M83A 3D7MA 2VDPB 2WFLA 3DBVO 4M9QA 4CU2A 4JS0A 2P5TB 2QZZA 3WRYC 4I4IA 4Q16A 3D54D 1PD1A 3C14C 1MGPA 3LBNA 3SBDA 1SKMA 1CUXA 1RKBA 2GKGA 4B2YA 3GGSA 3I1IA 5TMDA 2C0QA 4XVHA 5IXYA 4NYMR 1RR6A 4MKRA 1BXKA 1Q3KA 2B3DA 1C0KA 3RSSA 1I7NA 4OF4A 3KFLA 2NTYC 2VJMB 1EBUA 3JAWB 4O8ZA 5ALJA 1EZ1A 4ZVNA 1XNQB 1LVGA 2EXXA 4JXXA 3ITEA 3H9UA 4WOCA 1DWOA 5CB4A 1I3LA 1K8QA 2A2ZA 2XYQA 1RAIA 3HU5A 3P2EA 1ZVMA 1W52X 2JATA 1B74A 1BJTA 1IOWA 3UHPA 4TLAA 1X1TA 4XWTA 1KP9A 1Z33A 3V7YA 1UPXA 3O31A 3O9MA 1TM3E 5J2UA 2NZXA 1WDTA 1DNPA 1S2MA 3KVOA 1SXIA 3NJ4A 5EE5B 5I4KA 4Q9LA 1GQ2A 1JZQA 4OAQA 3WKAA 4X71A 1JI3A 4TTIA 5A5VA 1HNXB 1TYDE 1B93A 1DPFA 3TCXB 1R50A 3MIIA 3OQHA 4LIPD 3NBAA 1JLLA 3DWFA 3GJ5A 2DT5A 4KAFA 1Y9EA 3IP5A 1EQAA 5FL7D 1W1UA 3BH6A 4WFKA 2M2IA 5B6JA 3CNBA 2F1HA 2P9GA 3F6PA 4IX1A 3V00A 5U1PA 2BMFA 3WHPA 3FPFA 3OSZA 4MUAA 2VNJA 3L06A 3W4IA 1CUEA 1KEZA 2CBXA 4TWRA