5CFRA

Crystal structure of anemone sting (nematostella vectensis) in apo 'unrotated' closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
172
Chain Sequence
b'KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 43
structure length 172
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfrA02
4F5EA 5BQXA 5CFRA 4QXPA 4LOHA 5CFPA 4JC5A 5CFLA 4LOLA 5CFMA 4F9GA 4F9EA 4KSYA 4F5YA 5CFQA 4KC0A 4QXOA 5CFNA 4EF5A 4EMTA 4LOJA 4LOKA 4EMUA 5CFOA 4QXRA 4F5DA 4QXQA 4F5WA 4LOIA 4EF4A 4KBYA 4YP1A
chains in the Genus database with same CATH superfamily
1WCXA 4J9VA 2I87A 2ZZNA 1YTLA 5CPBA 2OD2A 5A4JA 2CDBA 1IZ0A 5D5QA 5I7FA 1K5HA 2XF8A 2XWSA 3TR5A 2Q9UA 2CWDA 4G8BA 3WXBA 3FPAA 3L0ZA 1NPYA 3FE2A 3G82C 4RPIA 4UKDA 1U5AA 1MW9X 2X5XA 4Z53A 1NDUA 4P9NA 1JU3A 1NUPA 1ZJ4A 1EXMA 3KHTA 1NF3A 2WG1A 4QYTA 5T8KA 3ST7A 1D07A 1G20B 3PUZA 3AL0C 1MAAA 4ZYXA 4AZVA 3A70A 2KBFA 4IFIA 3IKJA 1DQSA 2I8CA 3WNBA 2L19A 2XMPA 2ZSIA 3QHQA 3WLHA 4DS3A 4G9GA 5J4VA 5KQRA 1ZZGA 2X41A 4ASUD 2HJGA 2XB6A 3WLKX 2JFUA 2PAAA 3V8NA 4ZDIA 3ROEA 1OFUA 1TF5A 3MWGA 1M1NB 1RRKA 4FKBA 3CM0A 3IUMA 2HDHA 1BYUA 2JJYA 2ZKIA 1OUMA 1D3AA 3LUPA 2IF2A 3JQ6A 3KQVA 3PXAA 4XYEA 3PLAE 4PYKA 2UXBB 2P9HA 1YBMA 3LAWA 5DLDA 2Z43A 3PUXA 3KSRA 1MD9A 1JR3A 4MGZR 1JZQA 2I4IA 3M89A 1E3WB 1NXQA 3RUHA 1JQJC 3L8YA 5ES4B 2VSYA 2AUNA 4M8IA 1SQSA 2VDMB 5JTTA 4HDRB 2MR5A 4C0KA 1MJNA 5INTA 3G5MA 4BFLA 4G5YA 1S02A 1PS8A 3LT5A 1U2GA 3C8HA 4L4YA 1CHNA 5CX1B 4CNQA 4YCLA 2ZUEA 3I9MA 3PD1A 1JALA 1V2HE 1WPXA 4CMIA 3BXHA 1RQ7A 2PS0A 3COYA 1G4AE 3EGDB 1SHUX 1YO6A 3RQSA 3Q2OA 1JSCA 1ZAKA 4O2AA 5B2FA 4II7A 1H4VB 1AF4A 5IF9A 2HMVA 3HUFA 2P2GA 3PJRA 1PT6A 1OC4A 2DQSA 5BWNA 1GVNB 1OBOA 1AKWA 4YR9A 1VZ2A 1T25A 2ZYWX 1OXMA 2OK7A 3JZMA 5KMGA 4UTNA 5A0VA 1J8YF 2WD7A 3O4FA 2ZM6B 1M2VB 4ML3A 3SXUB 4C78A 1Q84A 2VJAA 4MZDA 3SJUA 2RHJA 1KY3A 4G67A 3ZCTA 2JD1A 4BMCA 2I4RA 2B36A 2XF2A 5DM1A 1DO0A 4DA7A 3A1NA 2PQ2A 3DP9A 3GJYA 3FGOA 2IEDA 2WQZA 3JPWA 3ZDZB 3H17A 4RSGA 1CIJA 1J0EA 2PM8A 1T6ZA 3IODA 3JQAA 4NF2A 5JD5A 5DBOA 5A5DA 3SEFA 2BGLA 4Z1MD 4ZA2A 5CDFA 2P78A 4MV9A 4D9FA 4L4ZA 1JA1A 4B9AA 4LEIA 1XIVA 1QE5A 4K9RA 4NFHA 4BDSA 2PUAA 4U6NA 4RY0A 1N0UA 4A15A 1PJ4A 1LF5A 2P5SA 2Q9CA 3UO8B 2IODA 4DYDA 2W2KA 3V32A 3W6ZA 5I9NA 3W8EA 1QWOA 4MUJA 5J1SB 5JSQA 3ABIA 3F78A 4MGEA 5AVTA 2E4YA 1P45A 4H9GA 3W9BA 4D98A 3K0AA 1RBZA 2J33A 5ALMA 1VI5A 2HHAA 2RCNA 1V2GA 2CZCA 1LW6E 3KLOA 3U3XA 4A0QA 5KYWA 1AXGA 3IJ5A 4MDHA 1J0AA 3D7SA 2QR2A 4DLKA 4JELA 1RJWA 4HV4A 1NZDA 4RVHA 5CVUA 3O9ZA 2XTAA 1FPMA 5KYXB 3HXOA 1TL7C 3N3AC 3M34A 3G2IA 3JYLA 4CYMA 4L75A 1QE0A 2O2EA 4ZO8A 4W5NA 4XYMA 4LTDA 4O5OA 3OTOB 3G0GA 4D9JA 1NQTA 3L6EA 5H70A 1B6RA 3EXG2 5FT9A 2PUEA 2Q6TA 2W0MA 4MRVA 1J24A 2DFTA 4JVNA 2HA7A 2Q6IA 3TTYA 2QBYA 1Y81A 1PEAA 4KOAA 1W44A 2NTYC 2OV8A 3AFOA 1NQOA 2H4YA 1GPJA 1KAEA 3HKBB 2WM8A 3EEFA 1MGPA 1N0WA 4WMLA 4GKKB 3VBCA 3WGQA 4Q1VA 3PUKA 2ZYVX 5EE0A 2DBVO 2XLCA 2XUKA 2QROA 1PGOA 4EQ6A 2FQQA 2X7JA 3E9NA 3OSZA 4O2LA 3RT7A 3IALA 4HB4A 1KJWA 2XCQA 4MQEB 1OBVA 3CG0A 3VSBA 1NUQA 1P7ZA 3OZXA 3HEMA 3SKVA 2NSJA 2GXQA 2IZ0A 3D1JA 3GV0A 1W5AA 4D6XA 1KRWA 2C59A 3UKOA 4JDPA 3OOJA 1K6XA 2QKYA 3WLJA 2Z8YA 4HN9A 1NE7A 3BIXA 1GZ4A 4YIKA 4F8JA 1E9AA 1JX6A 5I48A 1YZNA 4YWJA 5HM6A 1E9RA 2J45A 4IZOA 5KNBA 3UA4A 3F73A 4P3OA 4Y2XA 4JKYA 2FWRA 4OJMX 1LSOA 2QL5A 4X1YB 4U7JA 2FSVA 2PCLA 4DZTA 3KYJB 5DEIA 3PF9A 2AC4A 2XOEA 3CZAA 2NU6B 3FYUC 1P61B 3QKSA 4R8KA 4RPCA 3GPCA 1J70A 2POCA 1OLSA 3CURA 3P5SA 4R1LA 4BDTA 3ABSB 3H42B 2WJVA 2QJRA 1OPRA 3IVRA 5EA2A 2IT1A 2WJ6A 1GKIA 1V45E 1RHJA 2ZCUA 3CE6A 4I4IA 4PPQA 5C1DA 4BNNA 2O8EB 1UOQA 4KIWA 3AY6A 1ISPA 2A30A 2EGUA 2JAUA 2LDBA 4JJ7A 4QIHA 3T1NA 4HEA6 4X92A 2GWHA 1T8UA 4WN9B 3QV1A 1XNGA 3T9CA 2V55B 4AZ3B 2JHFA 2Y0DA 4UHFA 4DWOA 5A3QA 2G17A 3IELA 5M29A 2HD4A 2CMHA 4ZIRB 2C95A 4BL5A 1GGKA 5EJMA 4DMGA 2R5NA 2IDKA 1O77A 2VJNA 3IV7A 4OU4A 2OXTA 4BC0A 1I32A 5AH0A 4CN8A 2EKZA 1MAWA 5AWFC 3ENQA 3PC2A 2J1LA 3A2NA 4KP7A 3AHFA 3DLCA 2JFQA 4MP3A 4P36A 4F91B 1RABA 1VKZA 1WTAA 2FPSA 1EFKA 2EP7A 1KJQA 1TIPA 2VL7A 5FYQA 3SFTA 4BECA 1WIWA 2POQX 2B98A 1MA3A 3WJAA 3CR7A 1TJ4A 3GOQA 1CFJA 3VPCA 4GLOA 2NVWA 4NMMA 1LLDA 2ASVA 2OBXA 4EKEA 2DCUA 3AYXB 1TADA 4WPGA 5JT1A 4JA0A 3NHUA 3OCXA 4XUDA 2FPLA 4OXNA 2IW1A 3QLTA 3OJEA 3DO5A 4YNBA 5B6IA 3PDWA 3MPUA 2AQKA 1U0JA 3IBSA 3QLVA 4IEIA 3IRVA 3RV3A 4J4HA 4INAA 4LA4A 4TV8F 3HK2A 3NNDA 3H2HA 3IR5A 5HGXA 1UDCA 4PFJA 5JVDB 3ZWWA 4LC9A 2AMJA 2EG5A 4F6CA 2AUTA 1A97A 2XUOA 4AJIA 2G40A 1M34B 1J6UA 1VE6A 2XYVA 3QWFA 4IP0A 4NU8X 2ZBDA 3LCCA 3DMHA 3HRHA 3MK31 1I5EA 1Q5PA 3A05A 4ACBA 4EPTA 1A2BA 1NZFA 1F8UA 2GFQA 1ORVA 3UFXB 2PSFA 4M99A 3FRHA 5J5CA 4B46A 2Z6UA 1KTVA 4GL2A 4ZCPA 2Q1SA 3USES 1VHDA 3ANYB 4RTKA 2GXAA 1Y7HA 3D0QA 1J07A 2PT5A 3H3XA 3ZNNA 1PUJA 4CLRA 1MG5A 3LYUA 4FMPA 4W99A 2HY7A 4EFKA 2CNNA 4H7KA 3EVEA 4A0RA 1LJ8A 5IT9A 2R84A 3EW9A 1AHNA 1E2IA 2Q21A 4NBSA 4W5HA 4I6EA 3T99A 2WHPA 2E4WA 3KUUA 1DHTA 3PJEA 2XCRB 4F2PA 5LD2C 1D1TA 3ESRA 2IUSA 1R4ZA 1AS0A 3GCZA 3TQSA 4C4TA 3ZJTA 1V35A 1JIJA 1DOZA 1YAHA 4Z0TA 5JADA 5BY2A 1AKYA 5AK6A 3KJXA 2WT8A 3KELA 3WIDA 2P35A 2C2BA 1O95A 3L3BA 4BP3A 4ZQCB 6REQA 3W9YA 5HPYB 4MGKR 4IQ4A 3UMGA 2Q3DA 3KR9A 2FPPB 1W76A 2QAGB 3GC6A 4BU0A 1NUUA 2W58A 1CR2A 1MB9A 2AEEA 1MX3A 1T2AA 1CUYA 1QS0B 1FDSA 2FYTA 3P2EA 2V1UA 3LPDA 3QMWA 1AN9A 1NG1A 1SBCA 1V1JA 4JBHA 4EEZA 2I3DA 1R6DA 4MA0A 2FZKA 4EUSA 4WL0A 1LI4A 1XC7A 3L6RA 3DB1A 5HG0A 2G4CA 1OLXB 3NH6A 1CJCA 5DGDA 3O93A 3S29A 5JALA 3DOUA 2NOAA 4RPLA 4PINA 5DYGA 4HDNB 3C6XA 1PFYA 1PL8A 2X6QA 1ECFA 1G4UR 2QX7A 2OGUA 3KJZA 2BFEA 4CIXA 5TPWA 3IUPA 4YRNA 3VSDA 1MOPA 4C14A 3FHLA 4MS3B 2JI9A 3ORHA 1T9AA 1XZAA 2FLWA 5EYPB 4UTOA 4OL0A 2YMMA 5DWDA 2OXCA 4KFSA 1BEZA 2V7UA 5BRAA 1AH2A 1PFUA 4AY2A 2D1QA 4QPNA 3S28A 4Z4IA 3W1VA 2GSWA 2WI8A 4OX9B 4TROA 2VCEA 5K45A 1LB1B 2Q1UA 4B1FA 1ULSA 3NTVA 1LFAA 1Q15A 2ISSD 4NRDA 2ZYGA 3OX2A 5BV2P 4ZYLA 5FBZA 1TDJA 2R6AA 1KFJB 1DLIA 4YRPA 3BB4A 1YK1A 3EHEA 5JATA 1GKLA 2YCLA 4IHQA 2A0FA 2CKDA 2YW9A 3PPWA 2R4UA 1IFXA 1IZYA 2AOVA 2CLCX 2XVZA 2A9FA 3GW8A 1F2DA 4ECAA 5FUMA 4D3YA 1ZKDA 3ENZA 4FD2A 2GCPA 2Z08A 3U0VA 3UGTA 3GLFA 2PVSA 1SZJG 1QP8A 2QT1A 2BSAA 1NBMD 3DJFA 3TVTA 5H68A 4JENA 5HM8A 2AH5A 4L74A 1WCIA 4BAGA 1T34A 1XL0A 4FPXA 5E2IA 4BFZA 1UCFA 2DTEA 4KTVE 1RRMA 2VWPA 3VOSA 4FFSA 5E1BA 3HRKA 2VQDA 4XSGA 4UM9B 5JEEA 2GEJA 4XQEA 4PNEA 2C78A 4MA4A 1USWA 1L4BA 1E1RD 2IYQA 3OPYB 4ZD6A 2GO1A 3P96A 2C7QA 1J1UA 1E3QA 5CB4B 2ASEA 4KITB 1K92A 3NW9A 3REFA 1DS6A 4EHLA 3IQHX 3FCYA 3TQHA 3CLHA 5K3OA 4M0UA 2PBZA 1X15A 5C8XA 2HT1A 4UHHA 4YP9A 1DLJA 3A9UA 4ERNA 4BTVA 5A71A 5MFPA 4UDNA 3AVYA 4KAFA 3V4PB 4X1KB 5BW8A 1F9AA 2A0KA 2VK1A 2FSHA 1CUAA 5CRIA 3ABQB 1W52X 3FPGA 2Z09A 1V5FA 4C08A 3ZQUA 2N46A 4NAUA 3VX4A 2QMHA 2H1SA 5K8LA 4KQ2A 3WB0A 1GPLA 2RK3A 1T9GR 2XIJA 2IYUA 3L46A 1NVWQ 1U2SA 1NR1A 4RD3A 4UASA 5E1OA 5HGJA 3TD2A 4D43A 1QO9A 3FX2A 4U3JA 4G01B 3I23A 4AZTA 2O8DA 1LPOA 2R87A 2D54A 3L06A 5A9TA 3DPUA 4GSYA 3C7KA 3COWA 4R1OA 4IHJF 3TQCA 3W6PA 2JGKA 3EXFA 2GLUA 1VPDA 5DMXA 4QQFA 4YFYA 2BEUA 1Z4OA 2OPHA 2BF4A 3PXUA 1Z4NA 2EW1A 1NVBA 1N2SA 3G5LA 4M8LA 4D9CA 5ICGA 5JCOC 3LFUA 4J9UE 1W85B 2O1WA 2R5FA 2WPDD 1KL7A 1N0VC 1HE8B 1QYVA 2V7WA 3VPGA 4EG0A 1OB2A 2ORWA 2VHYA 1U63A 4F97A 3OZEA 4BNGA 3UT5B 1D04A 5L4NA 3CWQA 4BQEA 2QD1A 4CJXA 2XQVA 4TYWA 4US1R 1CR6A 1KXZA 2M6KA 3WKEA 3WFZA 1FTSA 1ZVQA 1DMSA 3INTA 3WMRA 2EAUA 1Z2AA 4Z6KA 3JU3A 3O8DA 3C39A 2H4ZA 2IYSA 3ELWA 5LB2A 1UODA 2NYUA 2ZJAA 3W6UA 2A4MA 7REQA 1MBZA 1P9LA 3L0PA 2CXUA 3FYCA 2I8LA 2BMVA 2PX3A 4BVHA 2HK9A 3KR1A 2B3DA 4G9BA 4HNAA 4I55F 4O2BF 5K3SA 2A92A 4CIAA 4GZ3A 3CC8A 3F74A 4PLZA 5AYVA 4JLAA 2I33A 4IIGA 3LW8A 1U7OA 1OIWA 1UINA 1BC5A 3ZHVA 1QH1A 1P9OA 5CLGA 4MHTA 4UM7A 1UZAA 5DI9A 3M4YA 1U1FA 4DLRA 3B9PA 4XPZA 4B3JA 1M2EA 4H15A 4D4KA 4W5RA 1NSTA 1T9KA 2WBLC 3R76A 3VOBA 2Q41A 5HEKA 1I4OA 3SBXA 3CLSC 3IUQA 5H83A 3JSXA 3TW0A 4LYFA 4GQIA 3CCBA 1EFDN 4G5SA 5BV1A 3AHIA 4AJKA 1OXSC 3QE0A 4U0KA 4EF4A 1RE1A 5JO0A 2YJTD 3HA3A 4RF4A 4XGIA 4C7KA 5KNBH 4WBNF 4UUMA 3AIKA 2D1FA 2HREA 5J2UB 3MJHA 3SC2A 3ILVA 4BVGA 1T2EA 5I51A 4UHEA 1HBJA 2EIHA 4CEJB 3DXZA 4IXDA 5F3RA 1AS2A 1NC3A 3M8KA 5IVPA 3BTVA 3O4RA 3DUFB 4PF1A 4C5BA 4JVOA 2FV8A 1CE8A 3MTBA 3H75A 4GW3A 2CSXA 1OX4A 4EKDA 2J4DA 4K9SA 2R60A 4XX1A 3W7AA 3WNVA 1N32B 2C57A 4WZZA 4HQKA 2DPLA 1JJVA 4ZGGA 2KSQA 4I1SA 3T35A 4TRRA 3LK7A 4DSUA 4PY2A 4RTRA 3WB9A 4B84A 4UU8A 1LSSA 1F9EA 3BHMA 3ZHUA 1FP7A 1R0CA 3DDOA 3SYMA 4MUEA 3TRFA 4Y18A 2EP8A 4D9GA 1FNCA 2R6HA 2BBSA 4PG7A 2QENA 4PO9A 2JGDA 3KT0A 1ORRA 2CL6X 2NZJA 3G0IA 1E2MA 3LKBA 3O3NB 4MWDA 3MIZA 4OGWA 3C3DA 3HV2A 1QIIA 3C5EA 3N2EA 4E5YA 4EJFA 1ECPA 1RPNA 2PZJA 4OAQA 2QRVB 3KQPA 2IU0A 1G8PA 5TPZD 1Y9DA 4DSZA 2I66A 2IQ5A 2P9BA 2XB4A 5F21A 1L7PA 2GYWA 1YA4A 2IDJA 2QHXA 4XTCS 2C5HA 1S3GA 1XQ9A 4TYQA 1ZCZA 1Y4SA 1ZESA 1XROA 4ZEMA 1P6UA 1P5FA 2WF5A 4JC4A 2JLUA 4BMVA 2JATA 4G0XA 4CE6A 3SLRA 3EUEA 3DWGA 3ETNA 1OGJA 1T6XA 3T4PA 1QOQB 2C9MA 3DMNA 5H59A 3PNBA 2ECFA 4ZRNA 1JWLA 5DBGA 1ORHA 2H31A 1K8QA 3GEGA 3OQBA 5D1HA 3D4IA 4ZVLA 3HBFA 2BI4A 2V96A 1QHFA 4ALNA 3W9UA 3AVVA 3T3PB 4J0CA 3IE2A 1IZ9A 3AR7A 4GKAA 4RORA 4RJIA 3G7NA 4WFJA 4B83A 1IXKA 1TT5A 4XJVA 3DKVA 1S3IA 3JPYA 3Q8MA 4Y6RA 3R7WA 5KYKA 1XQVA 1Q7TA 4F11A 4OYRA 2LBPA 1P3DA 1K8YB 2PJRA 2JFVA 3EVZA 2AF4C 2J5RA 1H6BA 4N18A 1DEXA 1NVVR 2HLPA 4QE3A 1FTGA 1LBEA 3FWYA 5K8VA 4B7CA 1PF7E 2ZSKA 2XQJA 4HSEA 5FQNA 2C4WA 1H5UA 5HHTA 1DKPA 5JPIA 1QRAA 3IO5A 4C0JA 2NACA 4PGHA 1QDEA 2R65A 2DB3A 4KAXA 3E0QA 4KZKA 1DWOA 4NNJA 4MUMA 3VZRA 1PRYA 4F8EA 1U9IA 4WT7A 4UOQA 3RSHA 4P7FA 4UPVA 4V24A 3TTUA 4MMZB 2E85A 2QU7A 2OC4A 1L8AA 3BS4A 3N75A 1V5GA 3FMIA 4GXQA 4EMBA 2NLOA 3D64A 4JBGA 4ON9A 4FEEA 4BO1A 2W6ZA 1UH5A 4ZMBA 2XYHA 1Y6FA 3A6PC 1Y5MA 1FFYA 4HSGA 2AQ8A 2J3QA 1HZJA 2CCJA 4M83A 3DGEC 3JAKA 4QYIA 4GE0A 1BMQA 1GITA 3H2BA 4LF7B 2GPAA 2CCKA 2FEXA 1E2DA 1GUBA 2IIQA 4QUJA 3GLHA 3WV5A 2GJ9A 1E20A 2DULA 2XSZA 1NJFA 3CX6A 3L7OA 2GEFA 2D3WA 5ANRB 1Z3CA 4ZZ3A 2XT0A 4OSPA 1B8UA 3JQGA 4PG4A 5EUBA 4BQOA 3L18A 4C29A 5B1HA 1BA3A 1DQYA 1I1NA 3B2EA 1PK7A 3L8MA 2BOVA 4MP6A 2YVKA 5DBEX 5F7JA 4ZCTA 4F4FA 3VYSB 2VDWB 1NKTA 3RV4A 1KO1A 1LNQA 2AYZA 3FYDA 1YMQA 4IIBA 1PR2A 1M6NA 2A1UB 1YB2A 1IHXA 1XYYA 3BMOA 1G9TA 3O2SB 2VUHB 2XUAA 4WBXC 4X8LA 1OU0A 3KRTA 2V6IA 3GGDA 1YQQA 3GCGA 1UWKA 1LU9A 4YJ2F 3KZ1E 5CLHA 3PPYA 1WX1A 2VHQA 4PZYA 5H02A 2Q29A 3Q3CA 4DQKA 1F2TB 3SXJA 1DV1A 1ODKA 3Q7TA 3HH8A 4IHAA 2D7JA 3CYFA 1M8FA 3OTIA 2BH9A 4LHYA 3GRPA 4LMBA 3V34A 5H4GA 1ODLA 1YS1X 1IVYA 1CDDA 3MGKA 4JC5A 3L8DA 5JHHB 2CD7A 1F3LA 4KQJA 2D5AA 5DMHA 1R0KA 3QKIA 3OIGA 4N39A 1U6IA 5SYAA 1H2HA 5EC8A 3FSRA 2SCUB 1GXSB 4BO4A 3L6OO 3E48A 3IYLW 1VPLA 1J21A 1CQPA 4L07A 3SZRA 2NZ8A 5K0GA 4FIZA 3OF5A 4K6OA 5CITA 2C4MA 2GCOB 1JDTA 3L7BA 3V80A 1L6IA 5KQGA 2XODA 1DJLA 2P65A 4JBIA 3FMVA 2G63A 4WEOA 5CDGA 1QPGA 4IXMA 4NOJA 4RKQA 2A57A 4V0LA 5EESA 5FI3A 4KV9A 1Z4MA 1N5OX 3D81A 4DGQA 1TFRA 4DSOA 4WXRA 5KTKA 1F2UB 2GH1A 4KMOA 1SEPA 2NSDA 4GH5A 4LSWA 3RUPA 1QO0D 4UBOA 1G20A 4CT5A 4D5EA 5IMSA 1XO1A 3IAM1 4GX0A 3E9QA 4MV7A 4CQMD 2BMWA 3LRTA 1WDTA 5F7ZA 3NT2A 3C6QA 2WWVD 4C03A 3K5WA 2VQFB 1Z29A 1WUKS 3BHIA 3H65A 3K1TA 2XE8A 4LXTA 1JPVA 4MJ7A 3SEZA 1L5OA 3AEQB 1M1NA 1B8PA 2QLBA 4RZHA 2RI1A 1GT91 4K9MA 4W7SA 2WUEA 3UF0A 5JNTA 3TTWA 5IANA 1SQ0A 4RLQA 3S2GA 1R3UA 3UMRA 1HX7A 1M66A 2OMEA 1ML4A 4NCHA 2FK8A 5JMTA 2CLMB 2K2WA 1EP3B 3C8UA 4WK6A 1E3WA 3GB9A 4Q4HB 1S7GA 1IBKB 5BN4B 2DX7A 5JD6A 3X1ZA 2ORED 4GKJB 2WNIA 1CWUA 3FWKA 4V1CB 2ZIUB 4HDRA 3RVBA 1ATIA 2V7EA 1SXGA 3VNQA 1H94A 4RTQA 2UXDB 3W04A 1JAHA 2YH2A 2IXDA 5CX1A 3ZXXA 4A03A 3OF2A 4G4SP 2P9YA 2EWMA 1VOTA 1W5FA 3LGXA 3O91A 1W48A 4TTAA 1VPEA 1PBTA 3EGVA 3L1HA 3OZ7A 3EGDA 4NS1A 4PGFA 4CL0A 2OV6A 3AM1A 3TZ6A 3VA7A 3FMGA 2PX8A 4PZEA 2GBFA 2PUJA 3KJFA 1NNUA 1D0SA 4CG3A 1OI2A 3C41J 1HZZA 2FPOA 4RTLA 1JLLB 3PGA1 1G0NA 5JI2E 2J9FA 5CCBA 4HUQB 3W2HA 4R2HA 3U7QB 1L7XA 1MXHA 4UHKA 3E3NA 4ZP1A 1N6OA 3ZS8A 2UZ3A 4NOMA 3VR5D 4JEHA 1M2VA 1NJGA 1F60A 4O4JF 1ZM2A 1YFKA 3SXUA 1SHTX 1D2GA 4NPAA 4TWAA 3D43A 4CM1A 3HDTA 1AKTA 2VP2A 1JQAA 2C2HA 2OGTA 3OZRA 2CVZA 3QVVA 2K6GA 4QICA 2GAOA 2Z2ZA 2ZXFA 3EH1A 5L7YA 1AQJA 1BNCA 2D5BA 3JZAA 1C8VB 3L7AA 2BELA 2FFBA 5EXSA 1I3LA 1V47A 2FUNB 1IXSB 1G21E 4YTEA 3WBFA 2XGJA 4LDJA 4DN6A 4L51A 3SQDA 2VPYA 2WJJA 3W6NA 5HP4A 1ZJJA 5DN6A 1FUUA 1LJUA 2JAQA 3K9WA 3HFGA 4MQ5A 3UJPA 1ORIA 5ESDA 2AFHB 4NBUA 3O8LA 4MQFB 4RIGA 3CEMA 1RQXA 4R98A 3QM1A 5DRYA 4G89A 4FB5A 1X7HA 3J7TA 4OQDA 3K6SB 4DBLE 2PU7A 5JZBA 3T4EA 4FWTA 2VHEA 1X2EA 2IYZA 1HYBA 4PYOA 1H4QA 1QRUA 5K0BA 4CM7A 5AW1A 4RDXA 1XUOA 5DP1A 2ERYA 4JT9A 3NDBB 4NDAA 1GGFA 3TMYA 1SC4A 2YXLA 3WLQA 4PIVA 5CXSA 1NRJB 1NW3A 2V74B 2O2HA 2ZDQA 3V2HA 1XAGA 4U9UA 1Z6QA 3WDKA 2DR3A 4JBWA 4UDXX 4X84A 4ZVUA 1C29B 3PA6A 4Y9TA 5KYXA 1ILEA 1BHJA 4IX1A 1UXKA 4R81A 5CR9A 2GN8A 3PQCA 3W79A 4FFLA 3QYJA 4CT4B 4KYTA 2VRBA 4HAZA 3AKYA 2CLLB 3LT4A 1M54A 4PAGA 2ZOSA 4OQYA 1QXSA 3GRAA 4BVJA 5I7RA 4U9HS 1G7CA 5BUCA 2XBMA 1RI1A 5CCDA 3HU2A 1E7RA 3H5TA 3W2TA 4KQFA 1GTSA 2A3NA 1H8EA 4JLVA 1LDYA 1QFYA 4E15A 3EAGA 1J7KA 1LDEA 1NJ5A 1U8CB 3Q7PA 2I6XA 5G1NA 4QT4A 2IWHA 1DJMA 2P0EA 1FVOA 4KQHA 1OVMA 5F4BA 4Q1AA 3HZHA 3B1FA 3AIIA 5FORA 3DCIA 3TMAA 2GUGA 2QI9F 4MQEA 1N5RA 2Z95A 3B3GA 4OJTA 5CM8B 3ZKWB 3L01A 4RHTA 3NC4A 1JPJA 5T4FA 4CKYA 2I4LA 4HWGA 4KDCA 1P9NA 3RYCB 4I5IA 2C3YA 2F90A 3ZGYA 1JHRA 1UEJA 4XD7D 4EP1A 6LDHA 1BWSA 1QNFA 3IXLA 1OXKB 3L4EA 2Q8QA 3B8EA 3BXEA 1TQ4A 1QCZA 1UBSB 4G3XA 3I28A 1VHTA 2W98A 2ODAA 4TS3A 3BIJA 4XWTA 1BRTA 1H9BA 3LPMA 4Q3CA 3ZJVA 2P27A 4FYJA 4X1YA 4RFSB 4JQSA 4TLCA 3N5CA 3OM0A 4QU9A 3UQYS 2NU6A 1HWYA 3LQRA 4LY6A 5TF4A 3TXYA 2IP1A 5DNWA 4UXJA 4A0FA 2CMKA 4JJEA 5D7NA 4Z3DA 3SX0A 3T0GA 3X1YA 4OM8A 1EVZA 3GLGA 1W94A 2YWRA 2O8EA 3M6LA 5IRCD 5U4QA 2NN3C 4BAZA 1NUHA 5CGZA 1ZMBA 2KQUA 5CYFA 5JCXA 2WWYA 4TL9A 2BBOA 4WN9A 3BF8A 4UQPA 4RMJA 3WGHA 4BB6A 4OEHA 2PGXA 4QYWA 2PZMA 4N5HX 2EQAA 4TV8B 5J9FA 4AZ3A 3AZOA 3IAXA 1HKUA 1EXNA 5JYBA 2H1RA 1Z0FA 4LDQA 2BLLA 4ZIRA 3TM5A 5HKBA 2IQIA 4L8VA 2JGLA 1NTOA 2W5UA 3WL4A 1VSUA 1TA9A 2F3UA 4QODA 1EK2A 5H3CA 3G5TA 3IP7A 4TQ9A 2IDZA 3UG6A 4D41A 2FU5C 1K9SA 1QIFA 5AQ1A 4UVIA 4H3KB 4O5AA 2FVXA 5EERA 2P1RA 3WDSA 3OE5A 1K3UB 3HNPA 3TEJA 3PQ4A 5D1NA 2WJIA 3KZOA 3GR6A 3BXOA 3LP8A 3W06A 1V11B 2NUTB 4PPYA 2NU7B 1Y82A 2G28A 1HG1A 3MTQA 2P7IA 1ZH6A 5ALXA 3KALA 2WTAA 1UF9A 3TQQA 4YECA 1JLHA 3PJGA 5EVCA 3SOZA 3TE7A 4YRIA 5L3SB 1JZSA 2DUMA 3MCWA 1T4GA 4XB1A 1TYDE 1QZXA 2W83A 5CXUA 1X8XA 5B2EA 4DCCA 1GTG1 2XUDA 4LTNA 3U3JA 4YJFB 2HA6A 1MB2A 3BD6A 1MVLA 3URKA 5HKOA 2VA9A 2I91A 2VPXA 2JVJA 4A6XA 4BFCA 4JZYA 2H2AA 4D25A 3ZX4A 1ZINA 2C8JA 3TZEA 2F64A 1ADYA 1QO7A 3CMMA 5DF1A 5JVDA 5CYPA 2FFJA 2QUIA 3WLPA 3S2FA 1M34A 3RGWS 3TLGA 4ZYWA 1V95A 3BCUA 4JJZA 1ADFA 4Z9BA 5IDWA 2OXFA 2DKOA 4G37A 3T41A 1YZFA 3A25A 3C5VA 4U2GA 1LWOA 3KVOA 3K94A 3GWZA 3FUTA 5FTJA 4KOEC 3UFXA 5LKRA 3JD2A 2ZE7A 1RDFA 1VJRA 3TBHA 4RABA 3UCEA 4R05A 4ZRMA 5TB5A 2CXHA 1LPSA 4KDFA 1KI6B 1SCNE 2H06A 1EJ0A 5IU6A 5DCUA 4H3HB 1GGNA 5F2EA 1A4XA 3QBTA 1BAPA 3ETEA 2FPIB 3VZDA 7MDHA 3V8PA 4X6YA 1YBHA 2J0SA 4NESA 5L7WA 3PEVA 5C37A 2WFLB 4C21A 1Z7BA 2JFGA 2OZKA 2YN4A 4Y2YA 2HWXA 5H4HA 3T0IA 3BE6A 3V4LA 2XNDA 1E9CA 3PU6A 4E5DA 5BSVA 5K4GA 1BXRB 3FWZA 3LPCA 4OA8A 4KMSA 1WA5A 2XDAA 1RWMA 4KLNA 5EP3A 1E3TA 3IILA 3QOWA 1C2YA 3F3SA 2YVQA 3RE1A 3I9KA 3RU9A 4M0LA 4CN9A 1XEFA 3BMQB 5L6LB 1R3DA 3GRKA 3NWEA 3TDKA 4Q4DA 2ZBEA 1EBBA 5CJ2A 5IWAB 1L7BA 2RHTA 1UJ5A 1NW4A 3KDSE 1G98A 1VXRA 1H2RS 1M5TA 1W0JD 2GZSA 3AUYA 4ITUA 1Y3CE 2AS0A 2FPPA 2RAUA 1VL6A 2QAGA 4NZZA 3ZE2B 1P5JA 3D2AA 3TR6A 2YWXA 2VTBB 3IA2A 2HL6A 4LKRA 2DQYA 2VNJA 3RVPA 1QS0A 2C9OA 2J7PA 4NARA 1AU9A 4UXHA 2BFDB 4JR0A 3DEJA 5L3ZA 3VTZA 1IUOA 4BJ1A 5IULC 1OLXA 3BWYA 5KU1A 1QWSA 4TSFA 5ALUA 6PFKA 5EIEA 3LHKA 1XDDA 4OP2A 5AOAA 4MRPA 5EHQA 2A35A 2ZT8A 1HYGA 2PSSA 4UZFA 1L9XA 4HDNA 1Q2XA 2FRXA 5HBRA 4DLBA 2ZRMA 3PRKE 5JYDA 1BRMA 2ATXA 1E2BA 4FU0A 3ZCRA 4BZPA 4WKBA 3FCCA 1SCDA 3KU1A 3IMGA 1DEHA 4MS3A 2VHTA 4DDUA 1JT9A 1OFUX 1OYWA 3A14A 5EYPA 4ZT6A 1L5LA 4MROA 4JH0A 2A5YB 5JNRA 2WSSD 3B5JA 1LPNA 1MEEA 1Y4AE 3MRXA 2VPQA 2ZB4A 5KYVA 3UK1A 3ZBQA 5J47A 2YIMA 1MH1A 4KIGA 2QNRA 1E32A 3G2PA 3JV7A 1P9WA 3ITNA 3K9HA 2VG8A 2ZEJA 4G0VA 1TK2A 1E62A 2C9DA 2CFRA 3LOQA 5GV7A 1XK6A 3A1UA 2CVOA 3EODA 2CDAA 3TR0A 5DN9A 1E3SA 1U28A 1UJ4A 1VHLA 2AMLA 4UNQA 3V55A 5ITZB 4E88A 2C5AA 1DC3A 1E0KA 3GGPA 3QE2A 2PRKA 4ND4A 3WIEA 1SUAA 2XGMA 3B1ZA 3E61A 3VDQA 2H3HA 5T4HA 3UXHA 5F1KA 1Q0LA 2C42A 1C0PA 3AJAA 4NHEA 3WSTA 4WEQA 3ZNOA 1KQOA 2VEDA 3L93A 4WE3A 1XTZA 4DL9A 2C29D 3NHKA 3KC2A 1EZ4A 4CCYB 1R74A 2CDNA 3D8NA 2VJQA 3DYVA 3F6CA 3JRWA 4IHJB 1D5WA 1FF9A 4L02A 5HF6A 2QTRA 4X62B 3CLTD 2XE6A 5HKLA 2W2LA 4PLTA 5AVSA 1MJGA 4YI5A 1RMQA 1KDTA 3G8AA 1LC3A 4OH1A 5C9ZA 3OPYA 3DQQA 2WNHA 2CYCA 3NX4A 2FZWA 1Y9JA 5CB4A 4UUPA 3FLEA 4DUGD 4HGNA 4EG6A 4I9NA 4J07A 3MHTA 4ALKA 1G3QA 1U5BB 2P79A 4FEGA 3P4UA 1BQEA 2VDLB 3FR7A 4TLMB 4B2YA 1XTQA 4BYMA 3LX4A 3KQNA 2ZLBA 3OZDA 2I6FA 4BCCA 2ZTMA 1F6BA 2FN9A 3CZ4A 4PX3A 1PD0A 4X1KA 1DTWB 2W2TA 5ALVA 3LCVB 2HK7A 2ZDHA 1VL1A 3WQRA 1XJCA 4JB0A 2VDUE 3FJ1A 3B8HA 4DIDA 5LOVB 3RS2A 3WWDA 4F4CA 4IS2A 2HHHB 1VIMA 2X3YA 4NBVA 2Q6KA 1RLUA 2EFEB 2PNFA 4LBYA 1WU7A 2OQ2A 3OBBA 3QTBA 3O73A 1KDRA 2BFNA 3QPBA 4HGYA 2OBBA 1XNHA 4OBWA 4KDRA 5E6UB 3M81A 3VO2A 2IEGA 1J39A 4KMRA 4O2BB 5DSXA 1E3DA 1SG6A 4FMDF 2ZYSA 4RKEA 5EWMB 2G77B 1VL0A 1RADA 4Q3DA 4CI0B 5HQJA 4EELA 3NEAA 1W88B 3E4CA 4I50F 3V7YA 4JI8B 5FBQB 2HR1A 3EDRA 3IULA 4RMNA 4MP8A 3FOFC 4FFRA 13PKA 4ESVA 2ZIWB 3MCUA 1RS0A 4DV3B 3VR4A 2PWBA 3KR0A 2JFNA 2W6NA 3ABOB 3I30X 4IM7A 1PVVA 1M1XB 4WBSA 4ZI7A 3GO4A 2JCBA 2YJ4A 1DAFA 2XJ4A 1YE8A 3UT5A 4UHBA 1P0CA 1XI2A 2NT3A 4WBNB 1WBBA 3FGNA 2YJNA 2V3CC 1RPZA 1BZYA 3K6KA 2FSPA 4O25A 2OBYA 1H1DA 1Y1PA 3LQ1A 3W8DA 3ABRB 3BE4A 5BWOA 3OPQA 2O3SA 3ROPA 1HEUA 3EAQA 4S0ZA 2VK2A 4RIEA 3AHCA 4YT4A 5C3UA 4B5KA 1RC1A 4XCXA 4ZVTA 3GJ0A 2R8XA 4W63A 3L4KA 1A8SA 1K5PA 2GCNA 3BC1A 2ZJ1A 4IDPA 2VF5X 1P2GA 1A5SB 5F7OA 3NHAA 1TI7A 3DTTA 4TTTS 2I1WA 5IDYA 5BNZA 1KI3A 5KEIA 2EKQA 2QTFA 4RZIA 5HIMA 1BW9B 3JRNA 3U3ZA 4BNHA 1SBTA 5JHGB 3EQ2A 3HVHA 5IJXA 3RS3A 4TS9A 2DTDA 5DHTA 4DLZA 3WLOA 2DFVA 2DWCA 3D2LA 3BQNB 5PGMA 1HDZA 2OHFA 1XLWA 3A06A 3F71A 3ZI7A 4B44A 1M1YE 1R9GA 3H7AA 2AR0A 2HWKA 5CUQA 5EIAA 5CBPB 3RC3A 221PA 2FW1A 3PNSA 4H17A 2GBLC 5J2UA 5IASA 1WDMA 1P19A 4JODA 4CW7A 2EJBA 2P5TB 3FDFA 5KTPA 4JI2B 4CEJA 3LBHA 5AXCA 4UU7A 3BORA 5CG2A 5KVAA 2R751 3D0KA 1VCOA 1XZMA 1O58A 1CF2O 2GXUA 1N5LA 1C3XA 3DUFA 3E2PA 4GMKA 4YRFA 1TXGA 2YNMA 3GA7A 3R8FA 1Z2EA 4YUAA 2ISCA 6GPBA 2C4UA 2MJLA 2R79A 1C5KA 2RAFA 3QXSA 3SS8A 1SCUB 2JIZA 3CNQS 2DXIA 1JAXA 4JUDX 4YMVA 1VL2A 3SZLA 2YYYA 5C8YF 1CLEA 5KSZA 2PUDA 3LLSA 2DBZA 2GBLA 1XLTA 3ZE7A 1H6DA 2JAWA 4W9MC 2NZWA 4L2IA 3OHMA 2Q5QA 2C7RA 3IT1A 1FP1D 3CLKA 3YASA 1J9ZA 3LKZA 4D42A 2D1RA 4DMFA 2G1JA 4NE9A 4MTCA 3F8WA 2X1MA 3BFXA 1VBFA 3GARA 1AGPA 1Q92A 3OQHA 2QRVA 3LCJA 3HCBA 2Q7OE 2EFDB 4G0NA 4TXHA 1JHYA 4F2WA 4FDAA 2I2CA 3ZLVA 3NGMA 4HYYA 2ZQZA 2QJTA 4K8RB 2PFGA 5K8UA 5GOZA 2Y1LA 4JFRA 3KSZO 4AURA 4C3UA 4HH4A 4KWEA 5E4FA 3Q9UA 3VO1A 1OFTA 1W93A 4BNWA 2UYCA 2F3QA 3E15A 1YV9A 3PQ3A 1GCGA 1TCCA 1HTBA 4EI8A 4I9HA 3EVNA 2PE5A 1UIMA 1UM8A 2BKEA 1NVEA 3R40A 2I80A 4FYYA 5CEEA 1ODFA 5H0IA 1R6AA 3W5BA 2XBUA 3RIYA 2CNWD 3N8NA 1R4NB 4LF4B 1IIBA 1XEAA 4QFCA 4PANA 4EKYA 3G9QA 4LNUB 3NEJA 1CUFA 2G88A 3SDSA 3BD8A 5SY6A 3NT5A 2ZJ5A 1OYYA 4X71A 1SU7A 2YQZA 4RD2A 4F3RA 4B4VA 5IBPA 2H1HA 4OUDB 4UBMA 4AS3A 4IO0A 5IEBA 3BD9A 4FGSA 4QGAA 1BE6A 4UFOA 1XNQB 3O74A 2I3BA 4NEQA 2B37A 1VDZA 1YHYA 2G6BA 1YU6A 1HDCA 1UBFA 1X38A 3AF5A 2B6NA 7MHTA 3CZRA 4M1KA 4YXWD 1KGSA 3ERCA 1IU9A 4NK4A 1YULA 4LGYA 1E60A 1IOVA 2JCSA 4PZDA 3HA2A 4TTPA 4EFDA 5F5XA 4AVYA 3IUNA 1OH8A 2QV0A 4PCVA 2VXBA 4YJ2B 1Q20A 3HDJA 1N2BA 4BNFA 2VKQA 3NDRA 3ZGNA 3QYAA 4H35A 2QD5A 4QJIA 4HDAA 3QEBZ 3IAHA 4KSBA 2UVPB 1Q1NA 3BSSA 5TQ0B 3U17A 2AT1A 3N74A 5ALJA 2Q1WA 2UXCB 3N70A 4NU5A 3M6UA 3P94A 1F20A 2W71A 3QNMA 2R6CA 2CF6A 1SK8A 1FOEB 1OBFO 1YMUA 4AROA 2NYAA 5CYOA 1K8ZB 3QXHA 5JJIA 3KSMA 1L5QA 1EZ1A 1FP6A 1GRNA 3R3WA 4HDKB 3NHWA 4MQMA 2IH2A 2OAEA 2Q4DA 2V3VA 2YWJA 4Q82A 1BDMA 2QYHA 4LY0A 1CCWA 3OU6A 2VDWA 1J8FA 4DR7B 2RGGA 1ZXLA 1L7AA 1U3WA 2QM7A 5LZ7A 3R0IA 3KXKA 1QYIA 3LUGA 1DRVA 3MCVA 4KEAA 1VKRA 2A1UA 5DHQA 4W1SA 2Y1OA 4AK9A 4FHEA 1A2KC 1IN1A 1O87A 4I5GA 3OA2A 4HBZA 3B82A 3LT1A 5M2QA 5M34A 4Q18A 2ZREA 4ER7A 4F2DA 1DRUA 1F2TA 3GT3A 2BDUA 2GF2A 1PFWA 5FRDA 3K0EA 4RVSA 4BO9A 2NO1A 3IVCA 1DO2A 2ZYDA 1XQWA 5HZMA 1LX6A 4JKOA 2O2DA 1PQWA 1T2VA 1Z0IA 2FSGA 1FB5A 2FMHA 3P32A 4KFUA 1PJSA 5L3VA 1KR2A 1IOZA 3DT9A 3OE4A 4RY9A 3TPZA 4BUZA 5LP6F 1NBME 2PXAA 2JLRA 3ND8A 2QDXA 4FNMA 1JLSA 3FXAA 1ZCFA 4NENB 4XM1A 4AAYA 4ETMA 5HDQA 3LTNC 1PGPA 1ZWLA 1MVOA 2MSKA 2JLVA 2SCUA 1GXSA 1MCZA 2PJUA 3GELA 3Q2IA 4A9AA 1ZNYA 3DQZA 4OMUA 3WS7A 4LFCB 4NOKA 1RXWA 1NF8A 1O9GA 2GEUA 3CX3A 3L7LA 2PKXA 3LXMA 4OI1A 2GCOA 4IYRA 2NAPA 3R7NA 4ZEWA 5TGZA 1JFVA 2NU8B 5LA6A 4DA9A 1NMXA 1KVUA 3HI4A 2BE7A 3H5RA 4HLUA 1S2GA 1CC1S 3FOZA 4E4TA 1F2UA 2Y9PB 5FOWA 1NM5A 3OJWA 3LECA 4YCJA 2W7TA 2VT6A 5TGDA 1VA5A 3T34A 3KKLA 2VJOA 4YRRA 1ZD9A 3BTUA 1B2LA 1GFWA 2IZZA 4LDRA 4FYPA 4AMVA 1H69A 1WEKA 3LFTA 4BATA 3TUZC 2AL7A 2R4QA 2YWEA 4K1XA 2X0DA 2PFSA 4FS8A 1TEZA 3DDCA 2PVPA 2B7LA 3GBVA 2GCEA 4DA6A 1F38A 1W1IA 4AQYB 3B6JA 4UE3S 3AEQA 1XZEA 4ZV4A 3AKZA 1Y63A 2AOXA 2VUIB 3M9LA 4P35A 2VJKA 5FFFA 2HU2A 4O4JB 4U1RA 1Z4QA 1TYCA 3AJRA 3CNNA 4Q66C 2C4NA 4Q9HA 5JQWA 2ZSDA 2YIVX 4DYVA 5JOQA 3N05A 5T64A 1J9EA 1QIMA 2IPOA 1T2DA 3A31A 3BJIC 2Z3VA 4ND1A 2C7BA 4Q4HA 3TZCA 3WOHA 1XWWA 3V6MA 1JZTA 4IGKA 1OTHA 3TEFA 1CZLA 3MVEA 5H7XA 1ZAYA 4V1CA 1RXIA 3ZV6A 2XMCA 3TSWA 3V1YA 3PV0A 2B99A 2I99A 2BMEA 2PSJA 5DNEA 2O7RA 4RV9A 1LVHA 3HUTA 2OESA 5EHNA 1V8ZA 4IMPA 4E08A 1TE2A 4ARUA 4YX9A 1N2ZA 1UKCA 5GADl 3VAAA 3EZFA 5COQA 2QLJA 1TOAA 3BH7A 1ADGA 2HHJA 3EVBA 3OQOA 3LKVA 4HWTA 1XD9A 5JEDA 1T5DX 4UTXA 3RU7A 4M1SA 2CJWB 4ZC1A 4PIMA 3MLEA 1KETA 2FOLA 2Z5LA 5FOQA 3CPHA 3NFYA 5AVVA 2I9PA 2X8LA 4PE5B 5I6DA 1E1LA 3V6LA 2P4QA 4HNRA 3VH1A 1JLLA 2QIOA 2RHHA 1V3QE 4EHDA 2EGHA 3GHHA 4HUQA 4HQOA 3EOAI 4I8DA 3SZUA 1O9BA 3U7QA 3WGIA 1MW8X 1L9KA 4G0WA 4WINA 2QYTA 3QUAA 4AJOA 1C4WA 2HMAA 4IOLA 4C7JA 3IKTA 3PEWA 4JLUA 4RA6B 3HY3A 1O97C 1WVIA 4FFOA 3NI2A 1P4HA 1C1XB 4NATA 3NV7A 3WWZA 4Z8YA 3MERA 2C7PA 3D8SA 1KAQA 4AT1A 3D3NA 1UOPA 3ZCPA 4UQLA 1WXFA 3JY6A 1C80A 3NKFA 1JR3D 3D5EA 4OXYA 1Z17A 1JYFA 2CFSA 4H7DA 4YMUA 3WNCA 3B9BA 1T8WA 4HWSA 3RFTA 3S1AB 5IPFA 1Y7PA 2CXNA 4P34A 1JXMA 2WYVA 3S8MA 4D4LA 4ZAWA 5LUBA 2OA0A 5DHUA 4DNPA 1C2TA 1RHUA 3WK4A 4QGSA 2OY0A 3IAUA 1ML3A 4HL6A 4YT8A 2AFHA 4WKNA 4MQFA 1H1LB 3X1XA 5LL6P 3EQ8A 4TSRA 5IXJA 5E7QA 4L16A 3VNVA 1GYQA 4LBWA 3RC7A 2FMFA 1VE1A 3UANA 2NV2B 3OKAA 2DLNA 3NG1A 3H2YA 3QP9A 1QR6A 3K6SA 1RWWA 2Q7DA 1TYEB 1Z73A 2JEYA 1E9SA 4FFPA 2Q46A 3C24A 4LHWA 4X3CA 5DYIA 4BLWA 1XHFA 3EGCA 3HCDA 3IKVA 1FFEA 1UPCA 3H86A 4LHEA 5DLQC 1SOUA 4RA9B 5GAJA 3W1WA 2FP3A 3LVBA 3BL5A 3LZCA 4KODA 5FOVA 2HSGA 3WLAA 3H05A 4B3DA 1HL3A 3B7WA 4MKGA 1O4WA 2GPTA 1N1EA 1EMDA 4QYSA 2Z5GA 4IJ6A 1GZUA 2AOUB 4RDIA 2P68A 3AI3A 3HDQA 1JSLA 4C1NA 1CEYA 4DLNA 3CH7A 5JE8A 4URFA 1DIBA 4NPCA 1J20A 3KETA 1LTQA 1R0YA 1TGYA 2INGX 3H9GA 1Y3IA 5B1EA 4IDNA 2QTZA 4NCAA 5AVXA 1NNSA 5KDDA 5B4TA 2AZDA 4BIIA 1J0CA 1G6Q1 2HRBA 3K05A 3KVRA 3JYNA 4A5SA 2WAXA 1U4SA 1SA0B 4BMXA 4G1BA 2DY1A 1JE1A 2AVNA 3CY6A 4DLWA 1JQLB 3K70B 3C3AA 2OVFA 4C4YA 4GX2A 4PC3A 3FFBA 4TZKA 5BSUA 3GLGB 2ZROA 3C6YA 5G4KA 3ZPXA 1G3RA 5A05A 1RWVA 1I2MA 1P1IA 1OI7A 3AR9A 2WV9A 4EG5A 5NULA 2BL4A 4I99A 5KDLA 3RC1A 3SC4A 3RAEC 4J7CA 4YUWA 2Q5FA 3AOEC 4CF6A 5HJ2A 3ZKWA 1KC3A 3KKNA 3I62A 1HETA 5C8ZA 2EWVA 1LKZA 1NHWA 1DC8A 2XYPA 3JQRA 3KZXA 5DJ5A 1EFUA 3TDMA 3G7SA 3WB2A 4Q9NA 1JVBA 3RYCA 3H2SA 1XVIA 2CV0A 1ORWA 3SFVA 3VMFA 4V0QA 3KD2A 4ARIA 1L8QA 1R7RA 2QX9A 3ET5A 4WIAA 4BFSA 4RZ3A 1KA9H 3MJVA 3RBZA 1DBPA 1G5FA 4XLLA 3GFGA 2OP0A 5EI5A 5BUQA 2F9FA 1M2OB 3SQWA 1XG5A 1T0HB 4RFSA 4E1BA 2XUIA 4OLAA 2NPOA 4B09A 2AGVA 4LDNA 3OT5A 1LH0A 1P7VA 2PL3A 3BBPA 3TOVA 3V7FA 1RIIA 1X7XB 1L1EA 3EVCA 1OT3A 3W2EA 3A6KA 3EGEA 1RU3A 2WFAA 1XHLA 1AKRA 1MC8A 5J2TF 4Y1FA 4FYXA 4W1RA 4H08A 1O97D 7GPBA 3GAFA 5JDCC 1WUTA 4CR8A 5K2OA 3SJ7A 1VE3A 1D2NA 3AR6A 2PQMA 4K05A 3WADA 2HYDA 4CCWA 1E3IA 4KFRA 4KN9S 1DRWA 4TV8A 4CM9A 4WRRA 4YQFA 3KSUA 5B36A 1UP7A 2WR8A 5CDUA 4K46A 1JMYA 2B92A 1G5PA 1SC3A 3IQWA 2IE8A 3FTDA 1NBWB 3D8BA 3MTJA 4OY3A 2JJMA 2QZPA 3CZ5A 1P91A 2CUNA 3HWSA 4W6QA 3MQFA 4G56A 3E35A 3ZNPA 5CDTA 4LJKA 5A1JA 1F1BA 1TZCA 4GZ5A 3TFQA 3U3RA 2L42A 4M7OA 3VSEA 3P5BA 3REQB 5B58T 1TLLA 1GSIA 2AHRA 3B3JA 3DDSA 1W0KA 1M67A 2R00C 4FFVA 1V11A 3Q7EA 2NUTA 2A2ZA 1X8JA 2NU7A 3HPQA 4KACA 5KNBD 3VJRA 7YASA 1IG3A 4NBTA 4B82A 3PENA 3ZZ0A 3IUJA 4QBHA 4FGLA 3H2ZA 1G5IA 1M2FA 1TJ5A 1V9SA 2QN8A 2VT3A 3VISA 2V6GA 3EXAA 4E12A 4J0EA 5L3SA 1DC5A 2X0RA 1MORA 5IDVA 4L9WA 4KQWA 1LDMA 3KLMX 4YCCA 3WYNA 1KVQA 4YJFA 2YHBA 4IKEA 4OJYA 3LBIA 4H1UA 3CISA 4ZRDA 4KR0A 4PSCA 1KY4A 1QHXA 4HOYA 4GSLA 1QGZA 1RXEA 1QV9A 2R97A 5CG1A 1LW7A 1JKFA 2AI3A 2XUHA 3QVTA 4P5PA 3T7SA 1L5MA 5B58C 2EW8A 2PL5A 5FI1B 1NBEA 2TECE 4G0MA 1ZN2A 2RGDA 2VA8A 4FXPA 3K09C 1RYBA 5F98A 1J56A 5L4SA 5TVKA 2VCHA 2OSBA 2EX1A 1MABB 4GM4A 4D45A 1N2CE 4E5PA 3W8RA 1T2NA 1KI6A 1VMIA 2O05A 1Z4LA 2N9UA 1SXJC 5EMMA 5AM0A 3UJCA 1CEQA 5GJCA 3BTSA 1G41A 4RF2A 2FPIA 1VLQA 3ZWOA 1OKKD 1FVXA 2OFOA 3ZU6A 4A6DA 4NIMA 2V9ZA 2BBTA 4PZ9A 1EWTA 1V7QA 2WFLA 2XCOA 4J76A 2OV4A 3EDMA 4HZUB 1A69A 4PLFA 3C14C 2UU9B 3OIFA 1BXRA 4IGEA 1ZD1A 4XE5A 4YV2A 3CLUD 3Q7RA 3IP9A 4XYGA 4F46A 4OQFA 3AVTA 1W7AA 4QD3A 1E6MA 2YYZA 1TQ8A 3FOBA 2FI1A 3BMQA 4TYMA 1OY1A 5U1PA 2JCXA 3H1EA 3AWIA 4KI7A 3TH5A 4DOMA 1U2RA 4LWZA 1GU0A 1U8TA 1XQYA 4J7UA 2HMWA 2EU8A 1YR3A 2J3MA 3A32A 3IHLA 1J2TA 2WSLA 1S3SA 3H6GA 3IP5A 2OFPA 4EZIA 2VTBA 2Y93A 1GP2A 1Z2OX 4X85A 4XR4A 1HQYE 2X9GA 4UDOA 2COUA 2B83A 1ZP6A 4UU0A 2BFDA 1R5OA 1R4MB 4A8JB 5CEJA 5K8CA 3KFXA 3CJRA 3H5OA 4OATA 1ODSA 1P33A 3T3MB 4PYMA 1IG0A 3M9XA 5JRJA 4ZXFA 4P4UA 4HH1A 3UG7A 1ONPA 1RRCA 4DTCA 1P4AA 3QQPA 3SY8A 1G18A 2PZFA 2AWOA 1QQTA 4IL5A 1A72A 4Z4EA 1QGYA 3QTTA 4CDRA 3UPDA 3G1UA 3ESXA 1TQDA 1YZTA 3GCWA 3ISJA 3NANA 1A98A 1CY8A 5FL3A 3V2IA 4C43A 3OLVA 5KBYA 4X60A 1Y48E 4ZYTA 1YR1A 1G17A 3SJAA 3ILSA 2Y9MB 2AR9A 2YUIA 3PHIA 5T6MA 4YAGA 2XA2A 4CM5A 1QGED 2I67A 5BMVF 3WZLA 4FE4A 4LOKA 4X90A 1X19A 4MWZA 1KYTA 2XITA 4JIMA 3V7UA 3S8EA 3EVTA 2FR8A 1W4LA 1FBTA 4HPWA 3AI7A 3I09A 2IU4A 1Z0UA 4KUGA 3TXXA 3W34A 5C1OA 5ITZA 1U0HC 4INZA 4JI4B 4LJ4A 3F1LA 1TPYA 1E1DA 4YCBA 5KZMB 1OZFA 2O5CA 2VF8A 1S3FA 5CJJA 4YMIA 2J3IA 4RJKA 3PUIA 3D2BA 3LLVA 3UWPA 1J42A 2A6PA 3LRPA 4TMVA 1W19A 2Y05A 5HZGA 1Z6PA 2QVYX 1UM9B 1WRBA 3MUFA 3I39X 4FMDB 4CCYA 3N0XA 4IHJA 1EB8A 2KM1A 4BWYA 2YJ6A 1I10A 1YCDA 1SVKA 3VJKA 4I50B 1RWPA 2DBQA 4XIIA 1OSNA 2QEQA 2RKWA 2UZ0A 4XZ3A 4DLVA 4RACA 5ED0A 3UAXA 8MHTA 1QORA 3ZCSA 3Q88A 3ETDA 3I6BA 5K8IA 2AG8A 1XMQB 5KTYA 2XLBA 1P72A 1U5BA 2VI5A 1SAYA 2YS7A 1N3IA 4IICA 3GZNB 5I7EA 1PQPA 1E0AA 2VH1A 4FSHA 1TO1E 2JJQA 2H18A 4IR7A 4LQDA 2IS2A 1QG0A 1DTWA 1XCBA 2Y1WA 3MOGA 4L78A 4QU0A 1G8FA 3A6FA 5SV2A 1KRHA 3RG2A 3T06B 2I6UA 1C7ZA 2YWFA 5F1YA 2RH5A 3QEKA 2WDPA 2CB9A 2JFZA 3DEYX 3MUNA 3HSYA 1Z82A 4GBED 4N3AA 4KGVA 3UJHA 4F2GA 4IEFB 4W9NC 4YHBA 4AW9A 4KLCA 1S96A 2P9ZA 3ROQA 2X76A 5E6UA 4ANFA 5IVIA 3AL3A 1TB4A 3EFBA 1SKYE 2V9PA 3H4TA 1RT9A 4G1UC 4O2BA 5EWMA 5FWNA 1GQQA 5E9QA 3V1NA 1JJAA 4AZ0B 2H29A 2I7VA 1TKAA 3UMJA 1U1EA 1W88A 3ZGLA 2B5WA 2Y2VA 1XZKA 3O4HA 1KJ9A 3NWPA 4KE9A 1EBUA 1KYWA 3K53A 1PWXA 5JAUA 4JYAB 3QOYA 5IWCA 1MAHA 4HGRA 4W8OA 1GZ6A 1YDWA 2ZRHA 4OQXA 2QLLA 4ILEA 1TCUA 4FZ5A 1A5BB 2A5DA 5BT9A 3RUAA 3HKEB 4EKNB 2H2GA 3PITA 1RWOA 4WBNA 3RIEA 3E9RA 5KO2A 2O07A 3GEHA 1RHKA 1Z5ZA 3WVNA 2QRJA 1PK8A 3QX3A 1BQ4A 5DHAA 1PKXA 2B7BA 3I2HA 3TZBA 1W2WB 4GO1A 2H07A 3OZFA 2JGNA 5GWXA 3TCXB 2A14A 2B4AA 2DFKB 2QUBA 4P0PB 5FLYA 3HDHA 2HMSA 1GA1A 5EZ5A 2Q28A 1A8HA 3I2KA 5DBIA 5IBRA 3BXPA 4IVQA 1F7VA 1KH1A 2N0SA 3HBAA 2C97A 3QPWA 1QAMA 1L3BA 4ZT5A 5HIKA 4FD3A 5I8PA 1JYEA 5C8YB 3JYQA 2CL7X 1D8AA 1L5ZA 2CDRA 1EKXA 3FNBA 3H99A 1BW9A 3T52A 3UFBA 3U16A 2YV5A 4MOWA 2DFLA 2PKQP 3GEBA 4IOKA 3RGGA 2J46A 1PGJA 2H1FA 2GX6A 3GMIA 1ZN8A 3GGOA 4B4UA 4WVLA 1QP4A 3RWBA 2PMFA 2JGRA 3W7VA 4C2UA 3OWOA 3GD7A 3QVWA 5ICFA 1ZU5A 2C2KA 1ZGHA 4GPAA 5CBPA 1V5WA 1KJJA 2GVDC 5DTJA 5I9SA 4AJJA 4Y7DA 5KJEA 4BRSA 4N76A 2WIJA 3D54D 4F5ZA 1OROA 2XA1A 4AIIA 3HVUA 1XKTA 3U1TA 1OW3B 1C3OB 2ZZKA 5KNDA 3M6WA 3D4PA 2PGDA 2XVYA 4GGPA 2RHWA 1L4FA 2AC2A 5AK3A 1Y9ZA 5DFAA 2AJLI 2LIVA 2RHDA 1SCUA 3KAKA 2YRFA 3M83A 4GR9A 4EPWA 4RTSA 4EAAA 2DH5A 1VG8A 3MMXA 5JY6A 3H1FA 4WECA 1AZLA 3JVDA 4XUEA 4GLBA 1SUDA 4L6CA 2BM8A 2D8MA 2HLDA 3D8HA 4KDEA 4LJ8A 3A0UA 5SY4A 5CEFA 3E03A 5JTUA 4CBVA 2PT7A 3MQ2A 4A2PA 1PTJA 2CLFB 1X7ZB 2R1TB 2B8NA 1PI3A 3LP5A 2ZRLA 3DV9A 4ME6A 3STHA 3TECE 1CJVC 3WR5A 2FQYA 4K6GA 1X9IA 5GZ6A 4G41A 1R6UA 1NKSA 1W1WA 3MCAA 4O63O 2IH5A 2VTEA 5I4BA 3ICPA 1FXWA 1XZDA 2XTNA 4CU2A 3FF1A 4D5GA 1ZU4A 4C2AA 3HDYA 4CLDA 5JG7A 2D4AA 1ULBA 5IW8A 4PLVA 3KWMA 2F1JA 3WHKA 2GB4A 3U48A 1CNFA 4J90A 3SKXA 3LU1A 1I7SB 3QG5A 3KHUA 3IEMA 2A0YA 2BTQB 3KWJA 4NY1A 1R4NA 1G291 5DGCA 2OCAA 1CY1A 3E3LA 1MH9A 3MFYA 1EJBA 4QO8A 2DFDA 2QTAA 1RP1A 4LNUA 4FP9A 1MB4A 3E3OA 3QWAA 3JD0A 3R5HA 4UAJA 5ETJA 3WK7A 2W4MA 3SICE 4O2RA 4PBSA 2QN7A 4TYPA 1V71A 3ITKA 4OAOA 3COJA 5F9FA 3ZDAA 4OUDA 1WXQA 1L4NA 2ZJYA 2WAAA 3SP1A 3ZWNA 4PN3A 3BE8A 4DR3B 2HN9A 4WJZA 4OKSA 2F00A 1C1DB 4RD0A 4ZV9A 4LJSA 4F7DA 5HRAA 3B3QA 1P39A 1F17A 3OF3A 3IR7A 3T12A 2FJUA 4B6RA 3MXTA 3WJ1A 2RAPA 2H2HA 2LTAA 5T7BA 2ONJA 3NM5A 3MBOA 4MCJA 4GPIB 4B81A 3JQ7B 4EFMA 3UH0A 1T8SA 2HRRA 1H42A 3AF4A 3VZCA 4N40A 4RK0A 2GVZC 1WMEA 2EFJA 2C5EA 4OX9Y 5JSYA 3R6TA 1KHTA 1QC5B 3UMBA 4YUYA 4YJ2A 2UUBB 1CRQA 4ZEXA 1L1QA 1G60A 3RS7A 5C80A 3DHYA 4PO8A 1FU7A 2PZKA 4HYEA 1UKYA 4K9PA 2ZRGA 1TEVA 2X3FA 4Z86A 3E9YA 4P33A 1ZRHA 3VVCA 4KW7A 2YVAA 4P0TA 1H2YA 1Z5NA 2UVPA 2XKJE 1DIRA 5TQ0A 5FNVF 3RLIA 3ZWDA 5I7UA 1S0UA 4GG1A 5ENZA 1WNTA 4P0QB 2O5RA 4KR7A 1GV1A 2RGXA 2ZIVB 1GAWA 4ZHQB 1A0OA 2M1XA 3B1KA 4G0PA 1YONA 3OH8A 4PXSA 3I9V1 2OHVA 4FZJA 3NBFA 1IL0A 1O7JA 3CIOA 4HDKA 4WZAB 5LMZA 1WV0A 2MINB 4F1JA 3IOMA 1DADA 4QEKA 1KYIA 2NZUG 4UULA 3IMKA 1KJIA 4I3FA 4IDHA 4J0FA 3BXFA 5IM5A 3TI9A 4LOAA 2DRIA 3FA2A 3I6ZA 4ZCQA 1HE1C 2DQKA 1S1MA 3E5RA 5CNMA 3BBLA 3SK0A 5LQAA 2HB6A 3X1DA 3ZQKA 1NIJA 1VCHA 4N12A 5E4JA 2FPGB 4JNCA 4AN1A 2PX0A 2C9YA 5JBIA 4BGDA 4YH1A 3PNLA 4MVXA 1CYEA 5J4HA 4A73A 3KSBC 5C4GB 4R2KA 1XTPA 3CZPA 3PDIB 2WM3A 4D3FA 3TOCA 4L85A 3D3QA 4XWAA 2PX4A 3S70A 4Z7OB 4N03A 2X86A 1BWQA 5JSKA 1TGVA 1N2HA 3RSGA 3TLKA 1ESZA 4EHHA 3TE6A 4DRYA 1TVMA 3QVXA 3JYOA 2EV9A 2WF9A 1C41A 2HK6A 1QK4A 3Q3VA 4NENA 3K4PA 4JWKA 3CU5A 4QBKA 3H87A 4UJ3A 2ZBRA 3BD7A 4LC1A 1I5OA 3AJDA 3RVNA 1LTHR 1XKQA 1FE8A 1UBEA 3L02A 4L4SA 5BYJA 4AWAA 3UHPA 2IEYA 4LQCA 4RD6A 1F0NA 3RARA 2QT0A 5ARBA 3W5AA 4IIXA 4AUMA 4WUTA 3DLBA 2H5LA 4BXOB 3RSOA 1NLZA 1U04A 4P80A 3D4BA 4RHEA 2G4LA 3GNLA 4MLCA 3F90A 3MF4A 1XMOB 1U7PA 4DCGA 2APJA 2B61A 1YCFA 2QMYA 3VQTA 3C8MA 2VP6A 3FBWA 4QNNA 3UB2A 4RK1A 2ZTHA 4RHCA 2W9XA 4A7PA 2EG9A 3WRYA 7AT1A 3EIHA 4B8YA 1BYIA 3SFZA 1PL7A 1ABEA 1L8LA 4KQ1A 1N3BA 2YDXA 2ICAA 5FPQA 4RTNA 1U1CA 4QDUA 4N7MA 2PVCA 1PX2A 4P31A 3EWNA 1UKZA 4J03A 4RHFA 5TIIA 1GZSA 4CLXA 1IJEA 1JKIA 2OLJA 2QE7A 2CHFA 3CWCA 3HQ4O 1T1IA 1XWIA 4ZZIA 4O4JA 1XXHE 4MW2A 5CT9A 3Q8WA 1X7YB 1U0TA 1Y5IA 2PS3A 1QF9A 5AJHA 3O0TA 3WRWA 1GAJA 4BGUA 3L1JA 3GT4A 3PFFA 1RJGA 4G5XA 1NQUA 1JJBA 2D1SA 3JCZA 4NH0A 3Q8KA 1CB0A 3W5VA 3JZIA 1K98A 1GUAA 2YV4A 2YZNA 2PT6A 5BYKA 2Y2UA 4ARCA 1RM5A 3D4NA 4N0DA 1EE9A 2WSIA 5JANA 1A95A 4H59A 4WY2A 3PDHA 3THRA 3EEYA 2XXJA 2ZRFA 5C5DA 2IX9A 2QX6A 5EGSA 2ZJFA 3GROA 2PXHA 3MTGA 3OMWA 5GP1A 3WGZA 4DLXA 4E51A 1OR8A 1V43A 4M1OA 3VKWA 3HVRA 1TTTA 1A1SA 2CJWA 1K86A 4ZOLA 2O8CB 2XPCA 3D4LA 2E5LB 3HP1A 1D2EA 3I04M 4R3UC 4RXMA 2N75A 2V7BA 3CZQA 2YJ3A 2VDOB 1WJGA 3UJBA 5DRTA 1NZJA 1T8RA 3CX4A 3GLTA 5FBVB 5L3QB 3I1FA 3U37A 4A2QA 1D4ZA 2XH8A 3STXA 4RS4A 3D5TA 2XRYA 3AUUA 2P4SA 5EJ4A 4R8VA 4QGGA 3K2BA 4QU8A 3UV7A 5A3RA 3GK3A 4QHYA 1YVUA 5KYNA 1HURA 2W8ZA 4HADA 4RA6A 5I7OA 4B40A 1X8KA 3I42A 4AY6A 3DWEX 2VSXA 2W43A 1C1XA 3BIOA 3MD0A 1E89A 1PJQA 4Q4AB 2O14A 1R9NA 4U7GA 5AKHA 5SZIA 2GHIA 5ALQA 1L5HB 3SE0A 3CUYA 1J8VA 3S1AA 3MUEA 4XGQA 1TW2A 5A9SB 4PXAA 3B6IA 5BQOA 4A0HA 1NPTO 2VP0A 3L9WA 4RJJA 1V7ZA 5K8JB 1KY5A 5B7QA 1H1LA 1SJ9A 1B93A 1ES9A 1MB0A 4XFKA 1E6KA 3GLQA 2YYSA 4EEXA 4P82A 1I7QB 3HB1A 3L0YA 3WWYA 1I4LD 4CG1A 1IZZA 5FO0A 2G9UA 3B13B 2OZLB 3G02A 4IZHA 5IVDA 2OFFA 1P6QA 3KCQA 1P81A 1MV8A 2JFHA 1E2UA 3HJGA 4TUYF 1Z37A 4RA9A 5I9TA 3SIPA 1GNQA 2GDZA 1V37A 4O4IB 3AUKA 4JQYA 2BFMA 3F97A 2P3LA 5FV4A 3H8SA 4FFNA 5DT9A 3QA9A 2CBXA 3OETA 2Q0QA 5H8WA 1EA5A 3VYRB 2QRUA 2AOUA 3U4IA 3SU8A 2OZEA 4OI4A 3TIGA 2HRQA 5A04A 4IGIA 4GYWA 3K2EA 3IEXA 2VYCA 3BF7A 4L3VA 1MRSA 1R8XA 3EZXA 1KEKA 2RE8A 3AY7A 4LZZA 1MMFB 3WYGA 4BO8A 3RFXA 3WA7A 3U19A 1ZA1A 1SNYA 2C4TA 1UDBA 2WE8A 1ZRSA 3TW8B 2O0LA 3T3EA 3N0TA 4PQEA 4D99A 3TL2A 5CH5A 4ZYYA 5KNDH 1GVHA 3GLSA 3TZQA 3IOCA 1SA0A 1V7CA 4FW8A 1Z8HA 2ZCJA 3GH3A 3KKMA 2BHRA 4K9DA 4ZHSA 5J2TB 2OE2A 5IVHA 2I3ZA 4DCOA 3KAJA 2FPMA 3ASZA 4DWVA 3ZY2A 4D26A 4RXUA 1OBHA 1ZM3A 3LI2A 1OLUB 1QFXA 1XLUA 1D5CA 4H31A 5E3HA 4A3SA 1YE3A 5JW6A 3LH5A 3QA3E 4YAJA 1UBRS 1Q12A 3ND7A 4MUHA 1EK1A 4LV6A 3AXTA 2C83A 3HBNA 4GOOD 3R5XA 1Y1KE 3L4JA 1MGOA 3EDCA 1II8B 3PDJA 3E5HA 4K6KA 1IY1A 3EF3A 4G5QA 4Y6GB 3TG2A 2YZGA 4ENRA 3N5KA 1Z28A 4HD8A 1JXQA 2DHRA 3BULA 3HSKA 3JTMA 3RB8A 4ENPA 5JZSA 2IV7A 1H8HA 2X8AA 1M2OA 2WIFA 1OHHA 3IBGA 3HWX1 4EQZA 3NPMA 3OJXA 1Q7BA 2HDOA 4BOYA 3IBYA 4RVOA 3P7MA 4KO2S 1X7XA 1MJFA 1YDGA 3D7NA 3IESA 1T0IA 1BIFA 3QMPA 1B2RA 1M0EA 5D00A 4R5MA 1LI5A 1ZIDA 4YDRA 1YUBA 3BWXA 1NV9A 4X3PA 5JMOA 3C7AA 3UMSA 3TB6A 3JTEA 5GONF 2IH4A 1P8AA 2LR0A 4CMAA 2JGAA 4UUOA 4ZYZA 2CVHA 1G63A 1H8ED 2PK3A 3Q0IA 4P83A 1JEYB 3WGTA 5LUAA 2ODWA 2VS1A 3L7MA 4AO8A 4KGDA 5LIRA 2BEKA 1ZJWA 4F0JA 1V8FA 1OZHA 1QV7A 3N59A 2E4AA 2N1BA 3IQIX 1BU8A 1EFCA 1L7OA 5I7AA 2F8TA 2B8WA 4IDCA 2FW9A 3Q7SA 3ZEAA 5I7SA 1FJGB 3UJ9A 4BNIA 4R8SA 3GFRA 1ZNWA 1Z2CA 3REQA 4JROA 1MJ5A 3SYLA 3OX4A 2ZXUA 2XA9A 4BTEA 1S4QA 1XRLA 5KYTA 5FHRA 4MKXA 2WZCA 5D5HA 1FFHA 1Y1QA 4NAHA 1ZJ6A 2Q5OA 2WFZA 5F64A 1KFKB 3AW8A 1KVSA 1DIOB 2F1RA 4CTOA 1QX4A 4Z7QB 3IIJA 2C96A 3AVXA 4JHLA 1BTOA 5DX0A 4K3VA 1BWRA 3D6VA 2B30A 2O7QA 1T1EA 3K71B 1JHPA 2D13A 3F5FA 4IS3A 4JUFA 4RH1A 3GP8A 4UEQA 3CRMA 4X65B 3LT2A 1ISGA 4YRCA 4EZBA 1QH9A 3OIYA 1M7GA 3PWKA 2D62A 4OLBA 2BH2A 4KI0A 1NJ8A 3WLFA 1KE1A 1QFZA 1PL0A 2NO0A 3DE3X 5C3MA 3IO3A 3VI4B 3OCJA 1HOXA 2DYKA 1E7WA 1IN7A 1P2DA 1B14A 3G0BA 4POOA 5C46F 1RVDA 1D7OA 1T5LA 3R7AA 1YZVA 5HBGA 2J0UB 2ZJ2A 1F3OA 4WSOA 4F4JA 1MABA 2H1VA 3V4ZA 4EOGA 3IVAA 2FRDC 2FSSA 2XUQA 2Y68A 1BU5A 4YP0A 1USIA 2IOHA 2R3SA 3HL0A 4GYYA 3D5QA 1XTVA 4GBMA 4JGIA 4NCKA 4BLTA 1OREA 4HNSA 1D4OA 3OUTA 4PRZA 5TEWA 1KERA 1MRZA 1ZOPA 5CFZA 5FLXA 4JJGA 4TT3A 3KOYA 4FBLA 2VYFA 2ZE6A 1NOKA 2CJPA 4MNTA 4ZJPA 5L45A 2G0AA 1XNJA 4J4TA 4Y7CA 2VAWA 2FCAA 2YC4C 4QTTB 4RKYA 1XTBA 3T54A 2UKDA 4FR5A 3UXEA 1JQ5A 2M1ZA 2YW2A 2ZI9A 3R9XB 1FS5A 3LNCA 5DVZA 4D4MA 5BMVB 2JI4A 2XB9A 2IHVA 4PYNA 1IWOA 3BGWA 2TYSB 3ZQ4A 1DKMA 5CNIA 3DMRA 2C5BA 2I3GA 5LP6C 3NWBA 2QRHA 2VF2A 3CIFA 1ZUIA 3CKYA 4N0QA 3U81A 4E5KA 4ECEA 1W9HA 4OIMA 2GSDA 1OLOA 2E4XA 5DYWA 4ZVPA 3D1VA 4DLSA 3A2KA 2WA1A 3I83A 3T4UA 3KTAB 4UHCA 4JDUA 3V1KA 2FQ1A 2V0CA 4PCLA 1DX6A 4GOMD 4A8JA 1R4MA 2NTEA 2QIPA 3OOEA 5IZCC 4F5YA 5K6AC 1RZRD 4DDHA 3T6KA 2RGWA 1E1MA 2QAJA 1WBJB 1GFSA 3MHPA 1YRBA 4OSEA 4PCAA 4U9IS 5CAEB 4P5EA 4DLLA 3PR2B 1KJZA 2J6BA 1OAOC 3FPEA 4LJLA 5CURA 3T94A 4DLYA 1DQZA 4RVUA 2PO7A 3LWBA 4Z0HO 4NPHA 2PRZA 1PNQA 2NTVA 4EYEA 3PX7A 2Q1TA 1JHVA 4Q21A 3PSAA 2G5PA 4LK2A 3HHEA 5G0TA 5IABA 4K2HA 3C4JA 1U2EA 2GYYA 4DDTA 1TUBB 4MO2A 1MTOA 2RGNC 4OHXA 4TMWA 4X0EA 3ND6A 4HY3A 2CLSA 3KUDA 1YIAA 4BFVA 1RP7A 1T36B 2ZJ4A 3SZMA 3GLIB 1NNI1 2CXOA 2G72A 1DAKA 1I36A 1XJ0A 2YCBA 3NBYC 3O4GA 2Y1KA 4GC5A 3A2LA 4URWR 4UNIA 1XSEA 3CF2A 3NIWA 1HLFA 5FPYA 4ZGWA 5LA6F 5E1DA 4NXMB 4MKZA 3GMSA 4TM7A 1E3JA 2AEJA 2OO5C 4ZMRA 2Z9CA 2XMDA 1NRWA 4TRNA 1UQTA 3VZSA 3MWEB 16PKA 3N0VA 4PC2A 2B2XA 2DQ4A 2OECA 4RVDA 5TJHA 1M83A 3JQBC 2JGMA 2J7PD 2RGNA 2AG6A 2W6PA 3AJ8A 1OV4A 5F76A 3SZ3A 3T5MA 3W4JA 1H4SA 1JR3E 3D3JA 4CMBA 4NZ9A 3FZGA 2V58A 2ID7A 3NBQA 1UM9A 4KIUA 4RTMA 3PZBA 3GVHA 4DCTA 2V54A 1WP4A 4PQFA 1THMA 2ZRCA 3ZV5A 4TSFD 3ZHQA 4BJ6A 1HOTA 2D0DA 3FHJA 3ZI4A 4F93B 3VNRA 4I50A 3OURA 1ZS9A 2EX0A 2R44A 1FCJA 4MWTA 2H4JA 3QMVA 5ILOA 1DAHA 5IKEA 2NZYA 3OFVA 1GTRA 1Y5RA 1GFIA 1V96A 2AJCA 3I01A 1AJEA 1Z34A 4BV8A 5IKXA 1JVSA 3GZNA 1PR0A 2D2EA 2F1HA 4MEBA 5CTJA 4YP7A 2H1WA 2XYRA 3F9CA 1JTEA 4Q19A 5DBHX 4WXPA 1X2BA 1B74A 2PZ8A 2C2MA 2IXAA 1I0IA 2RGCA 1RYFA 3FDZB 1P2UA 1XMVA 4ZAFA 1VYTA 4F3YA 4KX5A 3K4QA 3OI7A 3BDVA 2PZEA 2HJ9A 2YINC 2VCYA 3FLBA 4I1OA 5SY9A 1JLRA 1WAMA 1WUHS 1KKMA 1N6LA 4CCAA 1ZEJA 2IRWA 1CY4A 1NP6A 2LCFA 2OYRA 3O1HB 4H7EA 1DZ3A 1DNPA 1FRVA 1S9DA 2ZANA 3G88A 3IS3A 4XFDA 1XDWA 4EJMA 4YV0A 1R10A 1M6YA 5GOTA 4N5MA 2IITA 3E70C 4AZ0A 1IAQA 3QE3A 1ZBDA 3HFJA 5CDHA 5HF9A 4LJYA 1I2CA 4Y9DA 4PCUA 4UEWA 4RIFA 3RIXA 1CD5A 1GPUA 1Z36A 3C48A 3V8QA 3BAZA 2RI0A 2XECA 3IUSA 4ZVMA 2PUHA 3HO6A 1GQYA 2OB1A 1WSDA 4G0ZA 3K0BA 3LUCA 4JOQA 3DZCA 4E32A 3H7IA 2W2LD 1KQFA 4UM9D 1WU8A 1EK6A 2A9OA 5BWMA 1J2JA 421PA 2QUAA 1Y3FE 1E2FA 5DYNA 4E46A 3L7JA 1K89A 2G09A 1TZ2A 2OORC 4KAAA 4QTXA 1D03A 2E48A 3Q5EA 3E6AA 4EEKA 2YKGA 3L7KA 2O4CA 1WHTB 2ACKA 1CS0B 1T1RA 2GD0A 3CF0A 3WMFA 4L6AA 4A23A 5CA0F 2G67A 5D6OA 4D7AA 1ZM9A 1E1YA 3DV0B 3UWSA 1CUWA 4K40A 1MOQA 2FE4A 2IWRA 3WLIA 1GZDA 2IYVA 2C84A 5J63A 1OA1A 1B6GA 1SIBE 2HCJB 1TA0A 2PWZA 2R86A 2H4FA 3QMMA 3ZWCA 2FKAA 3KB2A 4KSCA 1SKAA 1EE2A 2LKCA 3L92A 4GOND 4KH0A 4JKIA 1YQEA 4ENWA 1GYPA 2HF9A 5JISA 1R50A 5JO9A 5C8YA 3R8CA 3L7NA 3UN1A 4RLFA 3NM6B 3AWDA 3P2YA 3WRVA 1CFZA 3OG9A 2Y99A 1W46A 2BONA 5HF5A 3TX6A 1YS9A 2IOFK 1D09A 2BF7A 3GN2A 1U7TA 4QKQA 4DADA 4RESA 1A2QA 5TMPA 4J16C 1DOHA 1E0DA 1DJNA 1M6VB 4LXIA 4FUQA 5EN4A 2NP6A 4PRYA 1MHPA 5BRJA 4V0ME 4DIBA 3TVYA 4DV4B 3G3EA 1ICEA 1QTRA 3OEYA 5M7EA 1U2PA 3AT1A 4PFSA 2RG1A 4XWKA 3HCFA 1TVEA 2H2DA 3OCWA 4LX8A 2GAAA 3VR4D 4E07A 1U3DA 3EPLA 1NQ5A 4HQRA 5EPEA 1ZUWA 3S55A 1HEIA 2DHQA 1IE3A 1K6EA 2CXXA 1LPAB 2IBSA 1DXHA 1VKJA 1DCKA 1XAJA 4MWOA 1II9A 3KSDO 1PQUA 2Q5JA 5DI3A 2QPLA 3G1WA 2MWMA 5JXIA 2HIHA 5TQVA 4ZU3A 4XUGB 4J16A 4YY3B 4QM7A 1M8PA 4LHSA 3FVVA 1KZYC 4D3SA 1HDOA 5FUYA 3TD6A 3AUFA 3G17A 4MVYA 1OXXK 4Y2GA 5EIOA 1R1DA 2ZGVA 1IDN1 3B53X 3TRDA 4FX5A 4LDAA 1BOOA 3AFMA 3V00A 3NHPA 1AT1A 4QTYA 1XL1A 4JAVC 1L7NA 2DE0X 4LSMA 4NBNA 2CLIB 3O92A 2JARA 5KWJA 4YJDA 1DRJA 3E27A 3NOQA 2CE2X 1JKXA 5C53B 3GUCA 3IP1A 2OQVA 3ZH9B 1X7ZA 2R1TA 1JDNA 4UD6A 5D7BA 5FLKA 3I4LA 3T5BA 2J87A 2AD1A 3E1GA 3SBEA 4BO6A 4HRAA 4IRMA 1I1HA 2M32A 1BMDA 4MK4A 3VH4A 1LZLA 1UPTA 3DUWA 3CTMA 2I2BA 3LXXA 3U3KA 4KFCA 1H6AA 4H4DA 1NP7A 4OGGA 5ESWA 3RM3A 1DRKA 2HM7A 2XMZA 2QJFA 4X91A 3NV9A 1Y8ZA 5K1ZA 1AD2A 4NHOA 1RQNA 2QTNA 4WUVA 3CCFA 2BKAA 1NXOA 2UUOA 4DC1A 3I34X 4UTPA 2HPHA 2BTQA 4ARZB 4JJIA 3H9CA 2FN4A 1S5PA 3SHQA 1S2OA 3C3CA 2FR1A 2HU5A 2YNMD 1SBQA 5KC8A 1XTUA 4RD1A 3QE9Y 2G3YA 1RC0A 3GJ8A 2FUG6 3BTOA 2JIZD 4QUHA 2HWWA 4ZOAA 3DFMA 4GQAA 3SD7A 3U13A 5MN6A 3D31A 1VA4A 2JEOA 1IY9A 2XD4A 3DA8A 5DCWA 1XZLA 5IC6A 4FN5A 3W2GA 4FKMA 1SURA 1NN1A 2KYRA 1FJXA 5JDIA 2CJFA 3HEAA 3BWEA 3ZVRA 1EIZA 4ED9A 2HDNB 4IF6A 4YV7A 1YDFA 2B94A 1CQIB 2MOKA 4WZBE 2WWWA 4BMNA 2VPZA 3ZWBA 3F4BA 4DHWA 4LJRA 1E98A 3DCNA 4HAYA 1I80A 1NUTA 4PHCA 1D0IA 2I54A 3JQ7A 4B7UA 1AXRA 5LU8A 2VHXA 5AHOA 3NHSA 2MYNA 2P30A 2LCQA 4DFDA 3SZGA 4AULA 2VO1A 1ZGJA 3KAQA 1J5PA 4LNHA 2VK4A 3PTZA 1K3FA 1KTIA 1QC5A 1LDBA 2HUPA 1QHIA 2IIPA 3I1YA 4IG4A 1WXWA 5FTKA 3UJAA 5LZ2A 4LXHA 2W48A 4N3GA 3M6IA 4N4AA 2ONKA 4RWEA 3RYHB 4CM8B 1JS1X 3T5CA 4AF6A 3KCNA 2HOQA 5KHLB 4ZTUB 3IPLA 3K9GA 1KSGA 2GARA 3B89A 5IAAA 1N2JA 1TT7A 3OZTA 1O5OA 4KQCA 4ZQFA 2QUKA 3OTGA 5DIFA 4YRSA 1R5NA 1ZIPA 1K75A 5JS2A 2DLDA 3FPLA 3R44A 1E8MA 4M89A 4FEYA 1ZC4A 3B36A 4BX3A 2B0JA 1A50B 1KEVA 1QANA 1UOEA 4R7ZA 1Z45A 2H1IA 4N01A 3LD9A 5J59A 4WZAA 3ULKA 5JPDA 1WW8A 1YRWA 2MINA 3NBAA 4JC8A 3ZV4A 5LQDA 3DW1X 3Q85A 2C20A 1TEXA 2G8LA 1I5RA 2J4FA 3BXGA 1W8DA 1FMCA 3U7IA 2Z9BA 1N7JA 3C5WP 5B4UA 4PTLA 4IIHA 2ODPA 3EIQA 3EARA 5IAOA 2FPGA 3KXIA 3EEOA 2HJWA 2VYND 4XGKA 1I7DA 4ZZ0A 1WO8A 1DG9A 2P91A 1MX9A 1TCAA