5CFRA

Crystal structure of anemone sting (nematostella vectensis) in apo 'unrotated' closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
172
Chain Sequence
b'KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
molecule tags Immune system
source organism Nematostella vectensis
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
total genus 43
structure length 172
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfrA02
5CFMA 4YP1A 4KBYA 4KSYA 5BQXA 5CFRA 4F9EA 5CFNA 4EMUA 4EF4A 4F5YA 4QXPA 5CFQA 5CFOA 4KC0A 4LOHA 4JC5A 4QXRA 4QXOA 4EMTA 4F9GA 5CFLA 4LOJA 4LOKA 4EF5A 4F5WA 4LOIA 4F5DA 4LOLA 4QXQA 5CFPA 4F5EA
chains in the Genus database with same CATH superfamily
5DHAA 1VA4A 3C4JA 4HDKA 4EPRA 4A3SA 3WBFA 1KAGA 1VKNA 3LZDA 3N0XA 2G9NA 2P6RA 3WVNA 4IUDS 2XF8A 1A0OA 1SB8A 2Q2QA 2GARA 4Q3DA 1Z0KA 3I30X 4KWEA 1CRLA 3UJ7A 4R9RA 2GVDC 3GW8A 1X2EA 1XRPA 4B4DA 1ELOA 3UHOA 1N6KA 3EPLA 5IJWA 2P9GA 3N7UA 1HOTA 1ISPA 1VGVA 3BE4A 4TVKA 4WERA 2P40A 1AKUA 3C45A 3QEBZ 4U8GA 4NKRA 4BVHA 1HTTA 1JH8A 3QOWA 1WMBA 2CUNA 2QRNA 1PKXA 4M1SA 4IH1A 2JBAA 3OIWA 1CLUA 4UUAA 1L3BA 4ZQIA 2ID7A 4LK2A 5CVJA 3K6SB 3U44B 2HR1A 1BDBA 1TTTA 4C3VA 1KS9A 4XASA 4INJA 1GNPA 5CLJA 5IDYA 5THKA 2JIQA 3FKSD 4NTZA 4RKQA 3I12A 1MO3A 4O2AA 5TLSA 1KEZA 4UDXX 1Y6FA 1C9NA 1H2ZA 3SR0A 4PZAA 2F1RA 3HXLA 3EEFA 5KVCA 4KR9A 1VA5A 5ES4B 1OXSC 3D4LA 4PLTA 3MSCA 1KAQA 3SEQA 1HX7A 1U7TA 2OO5A 1NYLA 4MS1B 5AW4A 1XBTA 1U9IC 3ESYA 2JAWA 1FS4A 2GNAA 3AVPA 5HUQA 1ZCJA 4CM8A 4Q5IA 1DCKA 4QPPA 4DAEA 2G3YA 4IIHA 1VHJA 4LF7B 1B3RA 1GNVA 4CLHA 3A9VA 5CITA 1Z6ZA 3L43A 5EGSA 2A2ZA 1FMCA 1XO1A 4Y1EA 3LQ1A 1NQTA 2D8AA 2HH9A 3HYCA 4K05A 1I7QB 1OX5A 5CR9A 3ZR4B 3F4BA 4XDZA 3CCBA 3R44A 2W93A 1JB9A 1UDRA 1LJLA 3OM9A 1ECBA 1QLHA 3HR7A 4WSOA 4BU1A 3ER6A 5DN9A 1Y6RA 2BRUC 2V8BA 4G2NA 2TS1A 3UB2A 3FFBA 4CCAA 3U44A 4QJ4A 4DZZA 3LRTA 3Q1KA 5AI8A 4EY3A 1U1CA 3QXCA 1T2NA 1Q3HA 5EMJA 2B8NA 1Y8QB 4TRMA 4V0KA 4UM5A 3T6KA 3WKDA 3UT0A 2CMKA 5THXA 2BTQB 2PUCA 1X19A 5FTMA 2WJ4A 2YMLA 3QBTA 1TQ4A 4DEVA 4DYHA 1TYCA 4QG3A 5AW0A 3LQFA 3PT9A 4MHSA 4PGHA 3W79A 4B40A 2ZSBA 4ZI7F 2PRIA 2PMDA 3PC7A 4I9FA 4ZVRA 2ZW9A 1B73A 1YUBA 2OG1A 1UODA 2ZRDA 3EHDA 4OJMX 1FP7A 3AUTA 2NO0A 1CRPA 5FPSA 1Z3IX 2J0UB 4B44A 1UXOA 3ADBA 1X1QA 1XDWA 1TCUA 2Q5QA 4WUVA 4BE4A 3S81A 1S5PA 3PE6A 4K1XA 4N47A 5F64A 5AHRA 5LQKA 3NFRA 1MJHA 3DEIA 2H1CA 2CVOA 1H4TA 1OFTA 2I6XA 4J4HA 3CIOA 3GP5A 2I22A 4B6OA 3L1JA 4KQHA 3YASA 3GFOA 5HF9A 1JYSA 1BHO1 2B5OA 1XMOB 3K92A 4PU0A 1ZMBA 5K99A 5BV1A 4CVNA 4NK5A 3UGJA 2WRZA 2YJ4A 4YRZA 3AJRA 3MT7A 1BXRB 5KHAA 3GDFA 2HF8A 3GV0A 3KKLA 4DQLA 1PZMA 3O4IA 3IPCA 3ND9A 2OVBA 4F9TA 3CMMA 3U16A 4OLBA 5L53A 2ZSKA 4D4HA 2Q45A 2OCYC 3BKXA 4JCOA 2HO4A 1YACA 4O4HB 4ENQA 1UJ5A 1B76A 1PZXA 1ZZEA 1AZSC 2WW8A 5JD3A 2OV1A 4KMRA 2HF7A 1UOPA 3FI9A 4NMHA 4YAWA 1ESNA 1EVYA 2QRMA 3LL7A 2EWWA 4PXYA 5TGZA 5D7BA 3BL8A 2ZYIA 1N2GA 4NATA 1ZK4A 1TJ4A 3WLAA 3D64A 4H1WA 1GAEO 3BB3A 1PDOA 3OETA 1Y1TA 1UIMA 5MFPA 1DXYA 2WI8A 3R20A 1KFJB 5CB6A 2HK9A 1Z0FA 1IVYA 5EMHA 3D7NA 5KKAA 3Q3EA 4LDZA 3RBVA 3G9ZA 1YTLA 4BXOB 1GCIA 3UENA 3CNLA 1JVSA 1N2ZA 4XD7A 5GQSA 1Y81A 5EMKA 3BIOA 4NEGA 4DR2B 3WB9A 1NTOA 1AQNA 2IP2A 1BKYA 2FSVA 4KQ1A 2FR8C 3SCZA 2AG8A 5IEJA 1KJZA 3V34A 1X8KA 3O1LA 4IW3B 1Z25A 1POXA 1U2GA 4HQKA 2QRGA 1EXVA 1X94A 5IKEA 2Q9AA 1QB7A 3KSBC 2ZZNA 1IJFA 1Z2CA 1KH2A 2ORVA 4IFTA 4M3NA 5EJIA 3VHQA 1U80A 1ZK2A 2GJ9A 2I2CA 5JPDA 1M1UA 4I1UA 1Y5IA 2HCJB 1X7YB 1N2IA 1NLMA 4OU4A 5KQGA 2PSSA 3FGPA 4JUBA 2P69A 1MX5A 3MILA 5IFLA 3TZCA 1QIKA 2X8AA 1YS9A 5AW1A 3FDJA 1PV4A 3TFQA 1Q7GA 2AG0A 1FSFA 3VGPA 3IQDB 3PHBE 2QJRA 2XJ4A 3EBLA 3QWBA 2DH5A 4TXJA 3TH5A 5ADHA 1EIWA 5GP1A 3P4UA 2EGGA 5J5VA 5FH9A 3MYRA 1KFEB 3TCXB 4RSMA 4QVGA 1VBMA 3EF0A 5FWYB 2EL9A 1ZDMA 2A9JA 1YQTA 2HB6A 2IOFA 2PY6A 2XODA 3C6KA 4HGZA 3THWB 1SHZA 2FQQA 3IP6A 3G2PA 5DLEA 3S99A 4BO2A 2F59A 1ONPA 2R6FA 3FRIA 1CF9A 4TS4A 2ZUFA 2OMEA 4QHYA 3S2ZA 1GEGA 3TFOA 4W8HA 1MJNA 3ZKWA 2PUBA 1BQEA 4B47A 1Y9EA 1YFKA 3JARB 4OHOA 4EATA 5EE0A 7MDHA 5EJ6A 1C8LA 2GGSA 3NHKA 1I1QB 5FV4A 3MJ4A 1U8FO 3ODPA 1JEAA 2ZVDA 4BFCA 4D4KA 4ZYTA 1W36B 2I78A 4JP3A 1M2OB 3KV1A 4RIEA 4CJXA 4FFBB 1TQ8A 2F6RA 1FZTA 3PP8A 1BS9A 3RVQA 4D9CA 3IQFA 1VE9A 2JBWA 2O9JA 3PGXA 4Q1DA 4W5QA 3HO1A 3MQFA 3QBVA 4B6FA 2VZ8A 5IT4A 4C3OB 1LBEA 1DC3A 3O2SB 4B48A 1NNUA 4AO8A 5AJYA 5CCEA 3FM9A 4OH7A 4PSUA 2GEVA 2ADFA 5KAPA 3L5KA 3GT3A 4OQMA 5FL3A 4Z4HA 1JA9A 5JADA 4BN5A 3CG4A 2J85A 1PL0A 2WUFA 1NMSA 4XIJA 2NVWA 2JATA 4KK3A 4XFJA 3EXAA 3A2NA 3NOQA 4MS3B 2C2YA 1WY5A 1OTXA 1P4HA 1OF1A 4OKIA 521PA 2C07A 1O7JA 1XV5A 1NOIA 2VJAA 1B3BA 1TJ5A 4LW8A 5TNXA 1NUUA 2QVGA 1U0JA 2BW0A 1D1SA 3FCAA 3LSYA 1SHLA 2X1HA 3EQZA 4JJEA 4PYRA 2A0XA 3F2VA 3AEXA 4AG3A 4DR4B 2CKMA 2XOXA 3SHVA 3NIBA 3BYZA 5ALZA 1XZIA 3MD9A 2PUGA 3T4EA 1WPXA 1U8CB 3KUCA 2CSXA 1RWBA 2WOJA 3NV9A 1O9BA 5BN1A 3RVNA 4NG5A 4NDAA 3K1JA 1ZRMA 3QXSA 4GZ3A 3SS9X 4DSNA 2GAJA 1H3FA 2P9JA 2ZTHA 4PZ0A 1PD0A 3H5VA 4OJQA 1ZI9A 4JGIA 3HS3A 3T99A 2O8BB 3WGYA 4CL8A 4ZCSA 1JI3A 1M34B 4NEQA 1BFKA 1HLFA 2Q8NA 1OE0A 2ZSEA 4AYXA 1X38A 2VHQA 3OIYA 3P52A 4ALNA 4DJTA 3AESB 3FNGA 1FSSA 3CE6A 4MUXA 4PWZA 2ZTSA 3KPJA 2D62A 2E4ZA 2DHDA 1IL0A 2H11A 2QUKA 5JC8A 1ZESA 4CEIB 5A04A 1NNSA 1XJCA 1XNRB 3AF2A 5HSGA 1YZKA 1X1RA 3RRJA 3TZKA 2BR3A 5DYGA 2H1SA 2NVUB 3R9WA 1Z18A 4OXNA 1Y34E 1Z13A 5HDBB 4ZJUA 1E1RA 3DTVA 2GEBA 2PCLA 3CN9A 1UDCA 4RF4A 2RHJA 4LZJA 1YULA 4F9GA 5AMXA 5ICEA 2NSYA 2QRUA 1UT8A 2FWRA 4FFDA 3TLBA 1XEWY 2YY6A 1IOZA 4FU0A 1JDPA 2A1TS 5BUZA 3L7LA 2WSYB 3DPIA 4L8GA 2VPIA 4HNRA 1CQIB 3WRXC 3K1YA 4TL9A 4F60A 4AROA 4C78A 4IHQA 1MT0A 1E8MA 2VG8A 5C8YF 7GPBA 4J7XA 1T5OA 4FWIB 1IHPA 3WIUA 1FK8A 1Y42X 2JIPA 3G8DA 2CDNA 4TKUB 1YT5A 2PBFA 3SZRA 3KKMA 5K6AA 1QMGA 5HPYB 2EP7A 1JA0A 4HDNA 1GQOA 3T4PA 1TYBE 2I8CA 2RARA 1QG4A 4L8WB 4PAMA 1UMDA 3W5JA 4AY4A 4EGAA 5CA1A 3H86A 3JQPA 1H8HA 5JAPA 3COZA 4DG9A 4DQ0A 3L7AA 1JBEA 4KOAA 4HSEA 5DSZA 4IDCA 2VK2A 1EFPB 2Q27A 2WV7A 2ZAOA 2ZTUA 4KTTE 5F21A 3V8NA 4D9KA 1YJAA 2EXXA 2XUAA 4Z0PA 1HEIA 4MA5A 3ULKA 3RWBA 3ZY4A 1NSTA 2HAEA 4BX8A 1RJDA 4UJ5A 3PF8A 2G7ZA 5BSTA 3QITA 1EVIA 1RMQA 2QRKA 4WZAB 5C5IA 1H1DA 2DPLA 1OZFA 1ZWKA 2H59A 5K6AC 2YIJA 1WKVA 3BD6A 3N2EA 3Q8WA 1YHZA 3QY9A 3R6WA 4EYOA 4MTLA 2G71A 3D7LA 2Z8YM 1HTWA 3DV0B 1B16A 4MEBA 1Y3DE 3ICVA 4OQYA 4EHFA 1L5YA 1QK5A 2BUCA 1JQAA 2AUMA 3I6ZA 3HR4A 5EAIA 4KQIA 2AOUA 4MQEB 4CIDA 1CULC 1OXXK 1L5HA 4MJ3A 4RTPA 4YCJA 5F5XA 2E6KA 3ZBQA 1RJ9B 3KOOA 5BRJA 3B38A 2PWAA 5AHKA 3SYLA 4C76A 1ILWA 1CDOA 2PFGA 1YGYA 2QRLA 2TECE 1A97A 5EE9A 2ZAMA 3RFXA 3ZBTA 4OB8A 3VDRA 1Y8ZA 1TEHA 3OP1A 1XD2B 4NCHA 5C1OA 2JGKA 3DXFA 2JDIA 4NYJR 2GT1A 2XDQA 1DVRA 2G08A 2I4MA 3JS5A 3PQ4A 1FFSA 4M7RA 2ZIZA 1DWQA 1H2XA 3A31A 3F4KA 1JRLA 1YASA 3MJFA 3O4FA 4EHBA 3KJNA 5CBPB 3OLCX 4FXPA 4DMUB 2W42A 3K1AA 4I9GA 1EFAA 1AGPA 1O94D 1TQ6A 1QCDA 1Y0BA 2EKDA 2QVXX 2FLWA 2BI8A 2WJ3A 3PK0A 3R7SA 2WTNA 4DA4A 1CR1A 2Q4OA 3FFWA 1C3OB 4QWMA 4IJMA 5A02A 2PH7A 1E0DA 2XZOA 2KX7A 1PJTA 4Z5XA 3GLFA 2WIAA 3PLAE 1D0IA 2ZYUX 1QQTA 3VAYA 2K87A 1YRYE 2ZT8A 2Z2YA 4PLZA 4RIFA 2YJ6A 3KL2A 3UT6A 3FVWA 1U63A 2D6FA 2QXTA 4K6KA 4LMRA 4P82A 2B37A 2EZ9A 2H0QA 1DRJA 4RD0A 2BLNA 1N1MA 5ALKA 3DAHA 2OBBA 1RAAA 4RS3A 1MX1A 2FUNB 4PSVA 5FCDA 3REQA 4QM6A 1E5DA 3BQNB 1WCIA 2VHEA 4DLWA 2NNLD 4UDNA 4E31A 3OOHA 2BGGA 1GRRA 1KORA 4N5LA 3V2IA 3SBEA 4GMGA 4HLQB 2WIFA 4JQSA 3WLMA 3J7AC 5K45A 1RPZA 1P2SA 1HPLA 2HBYA 2X5OA 5JZ9A 1OLXB 2K4MA 4XARA 3Q9NA 2RKWA 1UEIA 2QRPA 3AEQA 5F23A 4UBKA 1QH1A 4LRSB 1M5RA 1QYVA 2XA9A 3RC8A 1JIVA 3CTPA 3D7SA 1I8TA 2HBRA 4ICIA 1XDSA 3WLQA 4D4IA 4EB6B 1O1YA 3PNOA 3AG5A 4L6CA 1OYWA 4A2WA 3A1NA 2ECOA 2NUPB 4MVJH 3A3PA 4O1MA 2PUHA 2VJDA 2DKFA 2I1WA 3UICA 3PX7A 4FQ7A 3HK2A 4MP3A 4MB6A 4KMSA 2D06A 2GM3A 2Q46A 3DKRA 2C94A 1LK0A 4Z1MD 5H3HA 1RTKA 2OM6A 1C4XA 1SKQA 3GA5A 3IH5A 4IIYA 4KX3A 4MI6A 4RM3A 2Z3VA 4ZC1A 5H3LA 4FR0A 2H00A 4BB9A 3OIGA 2JCYA 1SUBA 1R6XA 4EJSA 4XM1A 5DI3A 3DZFA 1GKLA 4EY7A 3ZDQA 4D3SA 5L8VA 4LJ5A 1KKUA 3MG9A 3M6AA 1KYZA 4B7AA 4LFBB 1ZC3A 5ALWA 5EMNA 1U0NA 2Q4TA 4FR2A 4LBVA 1EJ6A 4WZ6A 4XWTA 2V8OA 3F90A 4LNHA 5F33A 2ZBQA 4OP1A 1M7GA 5E3HA 4ARIA 2AN4A 4O8CA 2O05A 1ONBA 1U7PA 3R6DA 3QFFA 3H1BA 2JD1A 1JAIA 4K6GA 4QGHA 1K7FB 4GX1A 4IMIB 4OLAA 4EGCB 4G0NA 3W34A 2YV3A 3ZVNA 4K9NA 3O3NB 1XN4A 5F7OA 4HJXA 4F5ZA 2UZ1B 5FUBA 4G86A 1RE1A 2CLLB 4N7BA 3UYLA 1M67A 1P91A 3G79A 4LJ6A 1WDLA 4IQ8A 4ADSG 3PYXA 4BBPA 3ZDDA 5FYQA 1D4AA 2D0IA 4QGSA 4RULA 2DC1A 3PXGA 1K6XA 2XWJI 1NQXA 2J3KA 4WPGA 3K0AB 4PONA 1EUYA 4EKYA 3LP6A 4QM7A 1IBCA 3PX2A 1OWLA 4B8WA 3DZ8A 4X61A 3LW8A 4DCGA 1H5NA 1ID8A 1MC1A 5B4UA 3TIIA 5KSYA 2AF3C 1UJNA 3GLIB 1CIPA 1MO2A 2BHLA 1PL7A 3L79A 4IX9A 3O8QA 5AVOA 4ZAXA 4B4OA 3ZCUA 5LQDA 1GL3A 4IICA 1VRCA 4OSEA 1P4AA 4I1YA 1ZGBA 5I9LA 1VSVA 3PUVA 3A6GA 1T4GA 4J03A 2FZLA 1THGA 1VKJA 4WK0B 4YC7A 4Z0HO 5IARA 1MRSA 3OLZA 1F5SA 3A1TA 1O95C 2VT6A 3S44A 5K05A 3BRCA 2ZITA 1PQPA 3UNXA 1VP3A 3VV3A 2BISA 4KIGA 5H81A 1TYDE 5AOAA 5KTTA 5K8JB 3AL3A 3RC9A 4N1AA 1XJWA 3WL7A 2PVSA 3EC7A 4EEXA 2KPOA 2MU1A 1N32B 2R751 3DZGA 3WI7A 1QUFA 2ZJ4A 3V7UA 1DBRA 2X0RA 4FNMA 4GL2A 4TTTS 3SF0A 1S0UA 3ZD8A 4EGQA 5IKXA 1Z45A 2QY9A 2XSZD 1DAHA 2YV4A 3AWIA 4DLKA 2I2WA 1BEZA 3MLAA 4Y9DA 5ARDA 1OXMA 2I62A 3BS4A 3SVZA 2C98A 3C5HA 2VJCA 4GLJA 3GPDG 2XTJA 3MCVA 5A0VA 5DNVA 1V0JA 3BCSA 4QYIA 4XX0A 3HN6A 4MW2A 4Y2SA 2V6MA 3CVJA 1L4KA 1W1IA 2BP7A 2BFDA 3REFA 2CYCA 3EWNA 3WXBA 2ZJYA 1GNTA 4F84A 3TAUA 5FX2A 1YCDA 4IH9A 2FN8A 4KREA 3AIMA 4OM7A 1C0EA 1W4RA 2VTBB 3X2SA 4EIWA 3ZVMA 3AF1A 1WD5A 2BY4A 2Y77A 1KAHA 4B2LA 2G4CA 1DKPA 4PNHA 2BFWA 2PQ0A 1J06A 1T5SA 4BX0A 4EDHA 3G13A 1W0KD 2X4LA 3NBXX 4XDYA 2FUKA 5COAA 5LNK1 1ECGA 2BH9A 3L84A 1LPNA 2YX1A 3QTBA 1GNRA 4OFXA 4CIBA 2BFPA 1B0UA 4JX8A 4MYHA 1UXHA 4XYLA 4UNSA 1OZGA 2FJPA 2OCPA 4V38A 4JITA 2JKYA 1IZ7A 4C0WA 2F00A 3MT8A 3C2QA 3WHIA 3ZD6A 2JK0A 3A32A 1ECPA 4UHDA 1IIRA 4BGDA 4CLOA 1T3HA 3IV7A 2G5TA 2ZT7A 4I2NA 2FXVA 4E3WA 4AC9A 4ZICA 5HIIA 2JW5A 1PWYE 3B53X 1A7UA 2XPCA 1VHTA 2W6ID 3UT5B 4RE6A 5DGCA 3SYMA 1C9DB 4LOAA 4BGEA 4OXXA 1ADBA 3RV3A 3RVKA 4BZQA 4JP5A 1Q44A 2XE6A 4WCDA 3MUFA 1YE8A 2C61A 3QU9A 5DW0A 1QC5B 4Q1AA 3L7DA 4RQAA 5ALJA 5AW3A 3RYCB 2FMHA 1AVTA 1KI8A 3SC6A 2C9CA 3GCWA 5L3SA 4MHOA 4ZVMA 4G0VA 4ECAA 2C77A 1VFPA 3MGGA 5IDWA 1NWHA 2VP9A 5AKJA 1E3WB 2ZWOA 4DR1B 5F1YA 4HVTA 4D99A 3RF7A 2P90A 2ANBA 3G7UA 3ZQJA 3O8CA 4RD2A 4TROA 3PPWA 2IHZA 4O5OA 1PR1A 4PC7A 4PIMA 4Y6PA 2YWRA 3RR2A 3D6FA 3OIVA 4X62B 4DT1A 2IEGA 3F5MA 2JI4A 1KIFA 1VSUA 1GTVA 5SY6A 2OAGA 5LMCA 1Z56C 1XD8A 4DEYA 4HLDA 2JIBA 2QM8A 1MVLA 1XP5A 3B3GA 5J43A 3JRXA 4DRYA 3LT5A 1OW3B 2AXQA 4HB2A 1EFTA 1P2FA 4K87A 4R83A 2O8DB 3AFGA 4B3RB 3LUGA 3HC7A 3RS7A 2C3UA 3ZH9B 5M34A 1DT5A 1NXTA 4KAAA 4Q01A 4AWBA 1PYOA 3UK1A 2OVFA 4BKUA 2XD4A 4H6PA 1RYNA 1D1PA 3HFSA 4DJEC 2XWQA 5A4JA 4CQLA 4ZP1A 5EZYB 1VI2A 4BNNA 3C8DA 4BO9A 1YJXA 2C20A 2EX0A 1QHSA 1EFKA 1OI7A 1W75A 1Y9DA 4JLPA 4FZVA 1WXGA 2O2EA 3QBEA 3DPUA 5LDDC 3LM8A 3TYXA 2ZWAA 2WLSA 1MUUA 4JL8A 3ICEA 3IVRA 4JBNA 4JKIA 1KKMA 4BJ5A 5F73A 3UV7A 3LPLA 3K0CA 4DIKA 4NV3A 2J9FA 2ZIUB 1A2OA 2VXCA 1X1CA 3IILA 5FOVA 1MH9A 3OH8A 1TKAA 1X1SA 2XB8A 4MRPA 5CGQB 4GWGA 3M8KA 5DN6D 4PLHA 4YECA 5LU9A 3MJDA 3JQRA 2RGGA 3OZXA 1DMSA 2EARA 2E21A 1I1HA 1L4YA 2X2PA 3N8KA 2XV1A 1EFDN 1XRSB 1F1BA 1NN1A 3M1YA 5KTYA 4FDVA 1G8FA 2H4XA 3O93A 3FVTA 2W90A 3FVVA 3OQMA 2CL7X 2RKOA 1VIAA 2WAOA 3KT6A 3FOFC 4OX9B 3AP2A 3E3NA 3E48A 4EJMA 2JGFA 1AKRA 5JSFA 2Z5GA 2IZ0A 2CDCA 4WNYA 3ZPXA 4E94A 5AW2A 3D3KA 1EK5A 5HCNA 3EXEB 2BI7A 2GBIA 3ESCA 3EUAA 3NAGA 4R3NA 1XLTC 2HBQA 4O4JA 4UASA 2HHAA 1KDPA 4N6NA 1UZUA 4AULA 1HE3A 1I7LA 2XKKA 2BBOA 1AKQA 1L5RA 4NBWA 3QVMA 3UMYA 3WNBA 3L8FA 2WEKA 4IIUA 2DUJA 2AQHA 1H85A 1K4KA 2AFHA 3LX5A 4PCUA 3C5CA 3CZPA 3FTEA 1IXSB 2ZE5A 3ETJA 4LYHA 1ST3A 2H2DA 4RA9B 3V7WA 1OJLA 1ZVKA 3ANNA 3I1IA 3PBKA 3IKJA 1KO1A 2CHEA 2PSHA 2Q0HA 1FFGA 4KFSA 4QBHA 4O25A 3G9XA 3IPYA 4XIGS 3S2EA 2V1XA 2DJIA 4MVJF 3QV1A 4CLEA 3AUXA 4RXMA 5L3VA 2EKQA 5AUPB 2QLFA 4OFZA 1EKXA 3OPVA 4WJLA 1MNAA 3TQOA 2O3SA 3ML1A 3V2GA 4QYTA 4PCLA 2D00A 2OZKA 1ICEA 2Q2NA 3BBPA 3AUFA 4MULA 5KOHB 4JYAB 2ORYA 3GFFA 2NZXA 3F8TA 1P9LA 3Q3IA 5FBHA 5BN5B 5L7TA 2M2IA 1SCUA 4BMXA 5IJ0B 4PFSA 5NULA 2E37A 3ZCQA 5M3BA 3P0FA 4W9MC 2B2CA 1ZN8A 5JXJA 1JDSA 4COKA 4M89A 1OB5A 1Q16A 2HDOA 3HCAA 4HZIA 1GITA 2RJNA 3SBXA 2XDWA 2H31A 4AM8A 1V9CA 1XAJA 1H65A 2FMXA 3FYUB 5JUWA 1DC5A 3X1YA 4PX5A 1CIJA 4FUTA 2OQ2A 5CG2A 1ULSA 4JB8A 5TQ0A 4EB0A 4ENVA 4W8OA 5AVSA 4TXNA 1B15A 2QAGB 3DNFA 4R9VA 4AMBA 3VNBA 4X8OA 4YJGA 3KALA 4W6ZA 2B61A 1JSXA 2I6FA 3PFKA 4ZOQI 3VR4H 1S3IA 2ATVA 4US0R 1O5IA 2JJ2A 3FZEA 4CKCA 2JLXA 1C41A 2EZ4A 3L2OB 2XYQA 2J9XB 3QJ5A 1KI9A 1XCBA 2RDMA 3CNOA 5FLYA 3AFNA 3UK2A 3WG9A 4IHJB 1GU0A 1ZQ1A 2ESRA 3D2CA 2XQFA 1B8NA 3G0BA 4WINA 5FORA 1WMFA 5F9FA 1D07A 3R3ZA 1IU9A 3D5EA 4UXHA 2X9QA 3B2NA 1P9NA 1NRWA 3OPYB 2OXEA 4ZQFA 4BFVA 1ZUNA 5E1OA 5I6DA 3KELA 3DE0X 3Q11A 1PZFA 1JIJA 2JIZA 1KOGA 1DEAA 5DEOA 4BNLA 1THZA 3N1UA 1OAOC 3FNHA 3GT0A 1KY2A 4CTJA 3GRFA 3GROA 3W90A 4C21A 3G8AA 1NN0A 1QSGA 4MVWA 2H1LA 3HNRA 4F6CA 3KETA 4Z53A 3ZDAA 1NDHA 3ZZMA 4AKEA 4X5OA 1JAXA 3QWAA 5H82A 4ZU6X 1RFLA 4R5MA 1SU8A 2W6NA 3QM1A 1Y4SA 3R0XA 4MVJP 3PNLA 2WHQA 4P9NA 4E30A 3H3FA 4M1QA 2AMJA 2BEVA 5F4ZA 5CCXA 2EJWA 1V26A 1Y8CA 2PWYA 5BOSA 1N92A 1NR7A 3O95A 3TXAA 1MIOA 1KA9H 1JEYA 3C6MA 2UYQA 2ZXEA 4AECA 1RJGA 1P7WA 4YQEA 2GKSA 1ZMOA 3KSRA 3HV2A 4DDTA 3ZS8A 1RWMA 4GH5A 1KRWA 2XUZA 4BKMA 3GLFE 3PGVA 4Y2TA 3B6JA 3A9WA 2I6UA 4PPQA 4X0EA 2FZ5A 5T4EA 3L0ZA 3V4PB 4UFPA 1U4OA 2LCFA 3IEPA 3Q0TA 4M0PA 3TQTA 2CF6A 2GFIA 4KH1A 5C4IA 5H02A 3OLXA 5H59A 2QUBA 5JNTA 1IPEA 1WETA 2FA9A 3GT4A 1ZU4A 3KOMA 1I30A 5CNKA 1RP1A 3PXEA 3CZ5A 3KR1A 1PTJA 4JI4B 1T0BA 3WLLA 2AEJA 2D5IA 3IEKA 2A58A 3W04A 1WTAA 2RKBA 3UCXA 1M5UA 5DT9A 3PR1A 5CA0A 4RTOA 1IHUA 2A3RA 3D3JA 3EAQA 5AOCA 4TZ0A 3MWEA 1I3OA 2DQYA 2YINC 4H08A 4LJSA 5DWDA 1YQDA 2V7WA 1XRRA 3R5SA 3X2FA 1RZ3A 1A1VA 5PNTA 3C6YA 4M1YA 4IGAA 2VDJA 3HBLA 2JCBA 3H2YA 1PEYA 1UBNA 1F6WA 1T8SA 3G2QA 1S3SA 3IOCA 1XKXA 5D01A 4J0HA 3TKLA 3O8OA 2X9NA 3QUTA 3NM6B 4B5LA 4G0UA 1XA3A 1CK4A 2YVLA 2C4WA 3CUTA 4JT9A 3NTUA 2W0SA 2ZTMA 2BBSA 3EWSA 3IFSA 1FYDA 3LK6A 4MR9B 1Z6AA 2A88A 4PAGA 3A4TA 2E4XA 5G0TA 2B8TA 3W2HA 5HGXA 1Y98A 1OWMA 2E6UX 1QHFA 4Q1EA 2HCBA 1I4OA 3TVDA 2B0CA 3HJAA 1GA6A 4KTVE 4X60A 1FFHA 1B2LA 2REXB 1E66A 4CKWB 1GNQA 5A2QA 1DB3A 1VMIA 3PUZA 4FX5A 3PQ8A 3WAGA 2D7DA 1E77A 1D5WA 4M87A 2JC3A 4DR5B 4KI0A 1FC0A 2IDJA 1NPYA 3LHDA 3MS7A 2MYPA 1GGEA 4LOKA 2PMKA 3QU5A 2JFPA 3RBXA 5ICCA 2HA6A 3NWPA 2HLPA 1PJ3A 1XZMA 5BWMA 1H0HA 4MV6A 4ZO9A 3N8NA 5DU2A 4WCFA 1S2DA 2FSFA 2ATXA 2BKUA 4MV0A 2BCJQ 1O94C 1UT5A 1PJAA 1XTZA 2ALJA 3R1IA 3CRRA 4R05A 5FHRA 1KBOA 1NW4A 2ZBDA 3LX8A 4W5TA 4F56A 2WFMA 1KU0A 1M8FA 1J1IA 2Z8XA 2QTWB 4OGGA 4YREA 1MVNA 1YR1A 3IULA 1X7XA 3MW8A 2DKOA 2WF6A 3GEHA 2YJ3A 4DUGD 1B00A 5LP6F 3SXUB 1B8UA 1Q0UA 3KE8A 2CMDA 1GQ2A 9LDBA 4WLUA 3OLQA 4GSLA 4M8LA 5HGJA 4HQOA 5JYEA 4DR3B 4NXNB 2C5SA 3QEMA 4JLDA 2VPTA 5J2TB 4N8EA 4WA8A 3U60B 1NJ6A 2Z0MA 4FWBA 1V1MB 2F62A 4N3CA 1P29A 2VXOA 1PSDA 5ALQA 2XCSB 3NVAA 1TTHA 5AHXA 4RORA 1FW6A 5EVJA 2ZU6A 3WLIA 5JNWA 1I4TD 2HHJA 5DTIA 3S68A 1G21B 4R1LA 4LNAA 3I72A 1UKYA 3SKXA 4P31A 3TOXA 2WPDA 3KVNA 4KXWA 1YR8A 4GPD1 4NYIQ 4Q9KA 3UO8B 5KDLA 4DJFC 3HXMA 2PJDA 3REGA 2PAAA 2FLVA 2XT9A 3HR8A 3KYJB 4QU8A 3SJZA 1FB5A 2X23A 5JS6A 2PUWA 3S29A 5A4KA 9LDTA 4QUKA 4O4IA 4QRDA 3U6KA 1UMCA 5ALHA 4MV4A 3OT1B 1U2DA 2VDWB 2VNKA 5CM9C 3I0NA 2V7QA 4WK6A 3WWCA 1JWLA 3NH9A 1OI3A 3JQEA 1NHGA 1Q7RA 3NHLA 2WWYA 1FP4A 2IYAA 4MQBA 4AZ3B 1LH0A 3FSJX 2H54A 1O0SA 1WB4A 4B87A 3I37X 1ABFA 3G1UA 1XMXA 2WWVD 1WW8A 4ZYYA 3D2BA 2ZAGA 4MR9A 2X5KO 2Q3DA 3G2OA 2UVPB 3VYSB 1NR5A 3OCYA 3AKCA 4OUDA 5FYDA 5FT9A 4E5KA 3ISJA 4N0PA 1U2PA 4RPIA 3T1TA 1VBNA 5EZ5A 2F3PA 1JEQB 2OILA 1R37A 2ONYA 4KO3S 5JDCA 1Q0HA 1ZOIA 2PIAA 4JGGA 5BUSA 4MW0A 2CYAA 4FJ2A 3TK1A 5EJ5A 2JLUA 4I9UA 3ZE9A 1T8UA 4W5HA 2OV4A 3H4IA 1FMLA 4FE4A 1DMRA 2C4HA 4KPFC 1AKNA 2RGXA 4LBZA 1UWLA 1T1GA 1P1IA 1R6UA 3BXHA 1Y7IA 2W6MA 5B1DA 3TOZA 3PQ6A 4WVLA 4CYMA 3RSGA 3EVCA 4ZDIA 2EZTA 4Z9XA 1RJEA 3E3OA 2I7VA 4KVZA 1V8BA 1U2ZA 3TWOA 2GN2A 4BNGA 4EABA 3R5TA 1T2AA 2FR8A 4HAUA 4QQNA 3PUXA 3HGQA 4L3OA 3RVRA 3U6BA 1KXJA 4OP2A 1HE4A 4NECA 3QELA 1CRZA 1SJ9A 1X7XB 2OGTA 4TTQA 4DA0A 3KBOA 5HIAA 4E0BA 1Z7BA 5HVNA 4ALLA 2O5CA 4B6PA 1EE2A 3C3MA 4QVKA 2QYSA 2DR2A 2BC9A 4UCFA 4E7OA 1RS0A 1VJ1A 4K1LA 1KAEA 4D2IA 4YWHA 3FSRA 3HCOA 5ELLA 3DVQX 1UWVA 5B3JA 1UL1X 5KOJA 4JSYA 1M10A 3K6KA 3VDQA 1VPDA 1BJKA 2OLEA 4ITVA 2FU5C 3H6GA 3IELA 3MIZA 4JYMA 5C3UA 1G21E 4HDNB 4ZK2A 2Q6IA 2NIPA 2H16A 2J1LA 1BDJA 3FLBA 5A05A 1JKIA 5A3QA 1APBA 1P4GA 1G1MA 1GZ7A 2HQRA 5IVKA 3PPIA 4RGQA 2PSDA 1MQSA 2VNIA 3IURA 4PNZA 4C20A 2PH5A 1PT8A 1T8YA 3LKBA 1FSPA 5TARA 3UGTA 4TUYF 4W4TA 1L7OA 1BU5A 1UJBA 3RANA 3E3AA 1EDOA 4NV1A 3T38A 4BP8A 5CJPA 3VBEA 1N0UA 1PJBA 2XT6A 4YTEA 1ORWA 2H2AA 3ZXXA 3WLOA 3P9SA 3BTOA 4DFDA 3MTQA 1ZI8A 1BA3A 2ZBVA 3EG5A 2A7QA 2ZI4A 2WAXA 2XT0A 1OIWA 3AX6A 4OQPA 1ODLA 4JK3A 4YMIA 1TMGE 5EWMA 4JIGA 4QREA 5BMVB 1FUKA 2GLTA 1MAAA 1H0SA 2GD2A 3L8EA 4F3YA 5AUNB 1V6SA 1H8EA 1K97A 4D9GA 5HOQA 3CNHA 4BEWA 3BK2A 3C3YA 3P9KA 4XTCS 1L7RA 2NYUA 3VHXA 4NBUA 1QIDA 3AEYA 3ETGA 2XIQA 4IWNA 3TW0A 2N0SA 5DMHA 3VO9A 5FR2A 1NLFA 1ZJWA 3OEHA 2ROQA 5E0OA 1XELA 5JSUA 2VWHA 3EAFA 1R6VA 4OJNA 2FHPA 1UBMS 1ANKA 2JL1A 2ZUSA 1G8MA 4OMDA 3GA0A 1P0FA 4WVFA 4RU1A 4AO7A 4M6WB 1SU6A 4CN9A 2I1QA 1QV9A 1XP8A 1IY2A 4JODA 2VHXA 3BREA 4FHDA 3NVMB 4RKFA 1Z5PA 4EF4A 1JJBA 1NM5A 2N3ZA 5G0UA 5JYCA 4MROA 4IIJF 1A04A 2IXFA 5A5DA 3VZDA 5HJ7A 4M9QA 1SCBA 3NHSA 4FB5A 3QKSA 2HMYB 4RGYA 4L8YA 1GZ6A 3FH0A 4X94A 3ZLJA 2QX8A 2CVFA 2XA1A 3T52A 3PFGA 3LT2A 2Q2VA 3HB0A 3DBHB 4H0FA 4PFQA 2JCXA 2Z2ZA 2FN4A 3AUUA 2YZ7A 4N7MA 3WP1B 1C8BA 3PJRA 5BR8B 4R1OA 4PANA 3B9RA 3RIHA 1EFVB 1GAQA 4UULA 4JH0A 3WK7A 3BRSA 2AG5A 1I4LD 2JGEA 3WRXA 1MVOA 2ZS8A 4E22A 4ESOA 3SR4A 1M8JA 4Z7OB 3DDSA 4ZI5A 3MELA 2OCXA 2ZE7A 1AX9A 2QROA 1OIVA 4FN4A 4XYBA 3TD2A 4DSTA 2K5UA 4D9FA 1QBKC 3R4CA 3TBFA 2QI9C 1J56A 3UFXB 3OCZA 4CEJB 1DAOA 1OKKA 4UVHA 3ZHRA 3FF1A 3AM1A 1RHQA 4XB6B 5BW5A 3D5TA 3GVPA 5KJ1A 1NSYA 4WAUA 1JZTA 2JFVA 4CUJA 1SK8A 4RH1A 1VCIA 1XVAA 2WPDD 1ORDA 4JP1A 1ZH2A 1Y89A 5MHTA 2YS7A 4JDUA 2X5XA 1P17A 1ZUHA 3RGGA 4J4BA 4ABTA 3I8XA 2PD6A 4A9AA 1QHXA 4AKHA 5K3DA 1NI4B 4BEVA 1FCJA 3T5AA 2DZDA 1FF9A 1M1XB 4FTWA 2QN9A 4LGYA 5GOTA 3FOCA 5JS2A 1BGXT 1U5BB 3V1MA 5CDGA 4B3MB 1W5TA 1UDAA 3RUAA 2HSZA 2QMHA 4RVNA 4B9EA 1REQB 2J3HA 1AF7A 3QOXA 3IUJA 1OV6A 3K2IA 1F2VA 3H8JA 3HDJA 2FQYA 4RCYA 1TD9A 4IXMA 4ALJA 4DDMA 4D4LA 5T57A 2QJOA 2Q50A 3GFVA 1FU7A 4NS4A 1KMQA 3AINA 4YJ3F 2ZULA 1DV2A 1VL0A 2BZ0A 2QHXA 3EDYA 3GJ7A 3IMGA 5T4HA 3TVTA 3W3AA 1W85A 1RM5A 2XNJA 4HMPA 4P84A 4QA9A 3QEAZ 3HHEA 3KQWA 3AY0A 5D5PA 5EIOA 3VKHA 1JX6A 4ZAGA 4GQBA 1VYTA 2C00A 4NHOA 4YS6A 5I7FA 2VWQA 4EHDA 1HE8B 1E3SA 2XOEA 3S40A 2EX1A 4BZZA 2DPXA 2JLAA 2PLAA 2PT5A 4MRVA 2PV7A 2H2HA 3NH6A 2HGSA 2VAXA 1EGMB 4ZI7B 7YASA 3HXQA 4JXXA 1M1YB 2WT4A 5HG0A 1PGOA 3A9TA 1QAQA 4R54A 2FVYA 2RB5A 3MHTA 4CLRA 1VGRA 4E70A 2XB9A 3AI7A 1T36A 4NWIA 3VNRA 3N2GB 1ND6A 1DC8A 1VLJA 4R8MA 5C7OO 2H7YA 1CJMA 1DQZA 1NMZA 2FP4B 3OIFA 3CG0A 3L8HA 1AHNA 3D8UA 4M36A 1E3LA 2KJQA 1ZAYA 3H42B 4F3CA 2XTNA 4F3KA 3OI7A 1NSFA 1WY7A 3LW7A 3W5BA 1IZ8A 5DHFA 1DJMA 3MUOA 1NIJA 3LBHA 3M4NA 1TECE 1YVUA 4ZDKA 4IZIA 3CX6A 1J9EA 2GCNA 3CH6A 3U1VA 3ADKA 1J2JA 2QTNA 1G6Q1 3VSDA 1Z15A 3NCHA 3WDSA 5K3CA 2WM2A 2BBWA 1SEPA 2AMYA 1SELA 4BMOB 4IIBA 3Q2KA 4OAQA 2O3JA 2GOYA 4PTYA 2EF1A 3ZLVA 1II0A 2SHKA 4X3PA 2ZIAA 1AZWA 2NYAA 4A16A 4HV4A 2JARA 4Q16A 2OZPA 4UD6A 3QKUA 1YZUA 4HZUA 2DQSA 2GYWA 2VT3A 2QWXA 4E5YA 1MZPA 3EARA 2R85A 4AZ0B 3KYIB 1WCYA 2W2TA 4JI7B 4L0CA 2MYUA 4R81A 4EGSA 3A3NA 1G16A 1S8NA 3HFGA 2KBEA 4Q05A 3PXAA 2ADOA 4Z0NA 1X86B 4W5NA 3K5IA 4KDFA 3FOAA 2I76A 3HKDB 1CDEA 1B14A 3V4RA 4B17A 1TM2A 3L1VA 3I53A 4TV8A 2G17A 3EIQA 2BGRA 5CXQA 4WXHA 3DVAB 1QRSA 1Y5NA 3AEUB 2IITA 4GG1A 1II8A 1DX9A 4IRMA 3JVEA 4MI1A 5AVTA 1Z8NA 3B1KA 4H4CA 2NVOA 4IDFA 4XWWA 3GJ4A 1R8JA 4UPEA 2QE7D 3HZRA 1WL8A 1E79A 4L5AA 4AT1A 1A1SA 2GUGA 3QEMB 4FT2A 1DLJA 3B3AA 4C7MA 1XCLA 4JJ6A 2PS9A 3T1HB 1NF8A 1M34A 2WFLB 3WNVA 3CJTA 5L3ZA 2D0DA 4PZLA 2P9YA 5KTKA 4YUXA 1JSLA 3WMXA 2XUDA 3JSAA 1JPVA 2VYQA 1BXKA 2IU0A 4LGMA 4BTVA 1RCTE 2JVJA 3E3MA 3HVUA 5CJJA 1RZRD 2DG2A 2VNJA 4C1BA 2ZB2A 4JI2B 1FPQA 3QWIA 2D8MA 2KQUA 1D9ZA 1VJDA 4TTVA 2C29D 5F78A 4GRAA 1W8IA 3GLRA 3EBPA 3A14A 1AS0A 4GOMD 4GZ5A 2YY7A 4RL4A 4RSGA 3KWJA 4BQSA 3EIWA 2WTBA 1U8EA 2NZ8A 3R3XA 1ZJZA 2R5FA 3IBSA 3IMCA 3PWZA 3FMIA 3GGJA 4GSKA 1X39A 4HDMB 4P92A 5CLLA 5JSQA 2PRYA 5B53A 2ZBEA 5LOVA 1A7AA 1SKYB 1U98A 4M8IA 5LYYA 2IYUA 3II6X 4HFRA 4P38A 5H83A 4KP7A 2ZJ7A 1RWKA 1FP4B 8AT1A 4O4HF 1EG7A 3DAFA 2P5SA 3L7CA 5I7EA 2OB1A 3DR3A 3VKWA 3AKYA 4YYZA 2B6NA 5IBPA 4YUWA 3AKDA 1XAIA 3HCCA 2C83A 4QX6A 3HWX1 4JHLA 5F7JA 1QWOA 3BJEA 4OH1A 1G3UA 2C97A 2XNHA 3NHMA 4U0KA 1HC7A 2WSLA 1T6XA 1XNHA 2Q7XA 4ZI2A 3V3TA 3RIXA 3BORA 5KC9A 4QPCA 2OBMA 1JNXX 3MGBA 2ZETA 2O2SA 2PUTA 4HNAB 1FS5A 4KDEA 1X7WA 4PX9A 4JZKA 4LXQA 5LXTF 1V7CA 3B3FA 2UYHA 2PUAA 1E2PA 2OY0A 4QLBA 5HFNA 4BFZA 1OASA 4B7UA 5DI3B 2Q9BA 3ZV5A 1UT6A 2F8SA 4YJHA 3GDGA 3UBMA 2R1ZA 3L9XA 1UQRA 2GAOA 3HWRA 3MOGA 3R0JA 3NC1C 4MQMA 4RGVA 3E0XA 4MPRA 2EW1A 2ZRFA 4KMOA 1AA9A 2CNLA 4MINA 5CFMA 4EVRA 1NFFA 2CMFA 1NI5A 2IHUA 2JH8A 5JVDB 1D1TA 1T0JB 1UBJS 2NXJA 5JFTA 1F3LA 3KWMA 3A6HA 4MYCA 2J59A 2G5PA 3X1ZA 4Q02A 1R4AA 3UAZA 1P4SA 1VLZA 4J7UA 5KVQA 4BDTA 4AXBA 2XEDA 5FWAA 4JLBA 2DWPA 4ZAWA 1NZDA 4YRCA 3ZYZA 4LTNA 5DISB 4XB2A 2CL0X 1DEOA 2J6CA 4B3JA 5B55A 4R6WA 2GYYA 3PPYA 5CLIA 3NZEA 3WGJA 3ZDFA 5G1OA 1VPTA 1AS2A 3GGPA 1EP3B 2CL5A 2P9EA 4NMMA 1PEDA 3TRKA 5C5DA 2A1IA 2YMQA 5CX1B 3VSBA 3K09A 1R0YA 4GMKA 4D9MA 5FF9A 4U9HS 3IR5A 4UUBA 1FOEB 4ND3A 2ZTLA 5AK5A 3REQB 3A4MA 4MRAA 2HWWA 3BQMB 1DZIA 4RTRA 3QKRB 2V6IA 5IYZB 2YHUA 3LRPA 1C80A 1H3NA 2JDID 4XVHA 4GDFA 3PNSA 2F8LA 4L08A 2YN4A 4W7SA 2I3GA 1USIA 5LA6A 4RTNA 2AE1A 2Y0EA 3UJCA 1ESEA 2FP4A 1LF0A 3M33A 4TKVB 4C87A 5KINB 4LOLA 4XQ0A 4NCXA 1NW9B 2FGKA 5DULA 3EIXA 1ESZA 2O5RA 2YFYA 3GVCA 3QA3E 3I6BA 4JB0A 5ALLA 3TIFA 4EA6A 2K7FA 4D8UA 4DC9A 1WWKA 3GELA 4Q9LA 4ZMBA 4UJ3A 4Q7EA 1ISJA 3RLIA 3CKMA 2GJKA 5AJUA 3VZSA 1GPWB 4II3A 2EKZA 2VYNA 2WKRA 3FHTA 1H0RA 3MAGA 3B12A 4KLZA 5BSGA 3HZZA 1RKVA 1ZH0A 4H4DA 4JVMA 1H5UA 4YDRA 1FQKA 3WE7A 4EHNA 5BW4A 5AH0A 2NQ8A 4KLRA 3GPBA 3FVQA 2OT3B 2QAIA 1HBJA 2ZB4A 2C2HA 4LXYA 3T3MB 2YW9A 3PZRA 5GY7A 3SQXA 3IXMA 1IYZA 2MYNA 3BE8A 3FLEA 1EA5A 1DX6A 2J87A 3LKDA 4QUJA 3SOZA 1JMKC 1HYBA 1TGYA 5FQNA 4MP8A 3N9IA 4P98A 4TOIA 2RGNA 2VP0A 4H59A 4JQYA 4OVKA 2WAAA 2HHLA 1OLXA 3P71T 3DL0A 1E99A 4ZALA 2IVZA 4DUGA 4YCCA 5CD9A 2GRAA 5DK4A 1VLMA 2IV3A 1SB9A 3FTPA 1QKJA 2B2XA 4FDLA 5DW3A 1QIGA 3ZUPA 2D1YA 1G63A 1KJYA 4G24A 5BNZA 1C7ZA 2AXEA 4IJVA 3TPZA 1F3OA 2M6RA 2WVAA 2PZMA 1QO9A 1H93A 3GI1A 1Y80A 1UOQA 4LZWA 4PYIA 4MW4A 4HXGA 1DFHA 1Z4LA 2FVXA 2N1MA 2FRXA 4OQFA 2LCQA 4M83A 4LZZA 5HQJA 1XJQA 3F96A 3ZU3A 5B4TA 2AOTA 1BVYF 2I66A 1PR5A 1V5EA 3C0KA 1LZKA 3OIDA 5CRIA 4F21A 2A3NA 4A8JB 1JDVA 4HRAA 3UFXA 4DBLE 8ABPA 2R48A 4M0KA 5ARBA 5JSZB 2UVDA 2OBYA 2QLLA 1SULA 4I4TB 4RZIA 5D3KA 1IFXA 3UV6A 2PT9A 2J45A 4OO3A 1YQEA 2VJOA 5KSOA 2IHKA 9GPBA 1YDMA 1ZD4A 2R6R1 1NUAA 2YJTD 2GZRA 2WD9A 3GHHA 1GG5A 2J08A 1CUXA 4U7WA 2D4HA 4FMDF 4ZEMA 2J5KA 1PV1A 1HZZA 1KVSA 4D8YA 1NJSA 3BHMA 2YXLA 4F4IA 3CCFA 3ZIUA 1WBJB 4I36A 1EUDA 2BGJA 1D0VA 4WY5A 5M2QA 4PGGA 4TLCA 1M2WA 5C1IA 1H2WA 2B34A 1J9ZA 1F2TA 4V03A 4XSHA 4CNBA 1ZSNA 3MF4A 2CXTA 4WFQA 4AZSA 2I33A 1OY1A 2IYSA 2PJZA 5L3RA 2GHRA 4E6PA 2GAFA 4AKGA 4G1CA 2QMOA 2C5AA 2H52A 1W0JD 3DE6X 2OESA 4E11A 3RJZA 1ZC4A 5DBIA 3TQHA 3VPSA 3J81A 3FIJA 3OTQA 4IXDA 1GL6A 1DAKA 5ALXA 4UOZA 1XOIA 2XHEA 3CWCA 3GFBA 3ND8A 3EZ2A 4CETA 2H4YA 1RWPA 2Q2OA 4XOUA 4CM5A 1H94A 2FUCA 4MPPA 3RUPA 2CSUA 3U40A 2VSXA 4RZ2A 4FINA 4IDEA 1PJ4A 2OCGA 3FUCA 3NP9A 5IUJC 1MB0A 1P2BA 2Y4NA 4O02B 1NLZA 1PLJA 4XJXA 2CFTA 3NU1A 1JLLA 2BJVA 2AOXA 3COPA 1Y1LA 4MRMB 4OSOA 5IVPA 4QSMA 3T35A 5GM2A 2FPPB 1O6BA 4GBGA 1L8QA 4XUDA 3WTCA 2I5PO 4EX7A 3DYIA 4QEKA 1LSOA 2GH1A 2SBTA 1T5BA 4F4UA 1O6ZA 1EVEA 2NTYC 4CRWB 5FBVB 2A14A 1ISMA 1GKIA 1Q17A 2O4CA 3A28A 5AOBA 4AICA 1C0LA 4CFSA 4EHLA 6CHYA 1V5WA 1HFWA 3L7OA 4ZREA 2ICAA 1SUAA 3JASA 2R6ZA 5DASA 4ZANA 5A9SB 4I6JA 3DLAA 2XCUA 1WP4A 4IIGA 4EHIA 5DHTA 1H1LB 4LVOA 1PNTA 4ZZIA 1KTVA 1SKAA 3BB1A 1R00A 7ABPA 4EJ2A 5CCBA 5BXYA 4KFRA 2BEVB 2E82A 3FFXA 3ERCA 4QXQA 2QQ0A 4JC8A 2BELA 1RHJA 3RT9A 1E2BA 3HCFA 1W46A 3T7RA 3W5UA 4YK7A 2ODTX 1YA8A 5FA8A 721PA 4EMSA 3P19A 4FLMA 3WWZA 3E22B 3SC2B 1MC5A 4DNXA 5BSKA 1C9KA 1HT2E 3U4IA 4QFBA 3F7MA 4MWOA 4C4TA 1M3SA 1QX4A 1HMPA 4MRMA 4OXIA 4OD0A 4LEIA 4PM4A 4D82A 5ABPA 3ZLTA 4S1PA 5FWXB 3GFTA 1K9SA 2CXXA 5KX5B 2VP4A 4ZOLB 3WHPA 4OHBA 4FHFA 1CS0B 1M7BA 1WF6A 1E0KA 2BBTA 3ZY3A 5FTJA 4GPTA 1DAIA 3JARA 4IYJA 1QE3A 1QAOA 4GU5A 4KXFB 3QA9A 2O3UA 3ZZ1A 1A8QA 3DCNA 3A2MA 3NM5A 1F0NA 5HZHA 3EB9A 2RBGA 1SUPA 1M2OA 2OOSA 4WN9A 2HWYA 4PYQA 1BKSB 2C4TA 1P1BA 1XMIA 5LWHA 3I64A 4D74A 3E2IA 4RHXA 3OX3A 2JA1A 4G0PA 4IDGA 1RWNA 3R40A 4ZHQB 3MWYW 1U8UA 3DZJA 3JWHA 3G82C 3DEKA 4H1TA 1XLUA 4LJAA 3RS8A 3UMJA 2M1ZA 4C0KA 1DRKA 1ES9A 3TSCA 1ZR2A 3GAMA 3HTXA 1TOAA 4X92A 4N9WA 1MDFA 1C0PA 2M6KA 4TKLA 2DH6A 2Y1XA 4FZ3A 4Y7DA 4C6RA 1EUQA 4WEQA 1EWTA 4PQRA 3L01A 4TKUA 3ZZTA 1GG8A 5K20A 1FIUA 1XLWA 5EQJB 1RXYA 3VDMA 1WX1A 3VSAA 3JQGB 2IYXA 3HXTA 5EHIA 1CLEA 1GL7A 3VX4A 3H5AA 4RZHA 2FWNA 4MS3A 5CAEB 2HFKA 4NS1A 1MHTA 2PE5A 4HX9A 3O83A 2I99A 4YRFA 5DRYA 2BFCA 3B70A 3P0EA 3UG6A 4NNOA 3K2BA 1KBZA 1Z75A 3RASA 3NTRA 1M7HA 1JSCA 1XUOA 3ABQB 3DEJA 3O4RA 5FNVB 3KU4A 3NGMA 3V5NA 2I7CA 3V4SA 3T9BA 2F90A 4BVGA 1F8UA 1ZICA 2Q3JA 2Z5LA 4K9DA 1P5FA 2ZRPA 2GERA 4E5NA 1HDEA 4QOJA 4S1TA 1XLVA 1MJ5A 3E27A 3FUXA 4NHEA 2R6GA 3AV3A 2XBMA 1PIWA 4BAZA 3ZIAA 1GAWA 1U7DA 1MQAA 5IZCC 1JPNA 2OB2A 3Q98A 3GLGB 4ZOCA 2YC2C 4JBIA 3GUHA 1X42A 1SCJA 3MBKA 3N6XA 1R4NA 3EIFA 1DOHA 4XD2A 1XWIA 4IIJB 5AOVA 3GDWA 3JWEA 4FE3A 1TK2A 4JR2A 5HBRA 5JE8A 1NI3A 5HOEA 1SR8A 4JENA 4TPKA 4EB3A 3ZE2B 3V55A 2IHVA 2QQFA 2ZI7A 4KR2A 1N3BA 5AK6A 5LOVF 4QXRA 2PZ8A 3BVPA 3T7EA 2VRCA 1F0PA 1FNNA 1PG0A 1SRRA 4JN6B 1VPEA 4OA8A 2P6NA 5K3AA 1T2DA 1F8GA 1D7OA 2RSLA 2Z04A 2Z83A 4EYKA 1H22A 4IG4A 3GCGA 1S2GA 3O7MA 1LCIA 5E9JA 2EJVA 1ZHFA 3C1UA 3LF1A 2Y1WA 1VE7A 4G07A 1JG3A 1HORA 2GN0A 4BPBA 3AGPA 3NR2A 3GGCA 2VP6A 2C3MA 3TW6A 1XRJA 4C6TB 3C3DA 3SBDA 2UU9B 3OEED 3CPHA 2MTBA 4L76A 4RFSA 1WDKA 4TN1A 1JFSA 3N53A 4LMBA 1IC6A 4FYKA 4CXMA 2XE8A 1SXJA 1A95A 3A37A 3NDPA 1AHIA 1H9BA 1UOEA 2JAQA 3AY6A 3K30A 4J07A 3RUFA 4HOYA 3OZFA 2D1RA 1QRDA 3HUEA 4Q3AA 4OMUA 3K05A 3Q85A 3OT1A 3NTLA 4C0SA 4QTZA 2YNMA 4DPMA 1HNNA 2HDHA 1E2HA 3IL2A 4E2XA 4AQDA 2HHHB 2WFZA 2XKAA 2YXEA 4K2AA 4XKJA 3RIGA 4FGKA 5CIQA 2HSEA 2ZDHA 2AIRA 2DY1A 4EHAA 1HSZA 2HLNA 2VQ3A 3C3EA 1NX9A 1ORRA 2IKQA 3RVJA 4F1KA 5JHGB 3CW8X 1JV2B 2VL7A 3CZMA 4RL6A 4FMCF 4FIDA 1QH9A 3PFWO 1RXWA 1BDHA 4H3VA 2G83A 4XX0B 5BVHB 5TX7A 5JLAA 1GFZA 3AVVA 2X7JA 1QHYA 4QOSA 4TGLA 3TO5A 1T29A 4U9IS 2WYUA 3I76A 1UKAA 4MGYR 3UJHA 1LNZA 2QF7A 2H1OA 1YMQA 1RLJA 2L18A 3B8EA 2YDXA 2ZI6A 1U1FA 3IHTA 3PGJA 4FNOA 3E7PA 4B43A 3GQBB 4M4SA 1Z4NA 2RHMA 2REQA 3CKLA 3ZK8A 3MJTA 3V48A 3QQPA 4B9AA 1AUQA 3EF1A 1FVFA 1PJZA 3QVWA 5K8UA 1N2CA 4ZVQA 3E18A 3OOWA 1JR3D 4GI3A 4XW2A 3WKEA 2AG1A 2HQOA 1SXGA 4NBSA 1JDNA 5DNWA 2XQKA 3HV0A 3TCKA 4BNXA 1V6AA 3G2JA 4UM8B 2H08A 1E32A 1ETHA 1XZHA 3M4ZA 2FOLA 1U3TA 3KB1A 4HAYA 1OVMA 3EJWA 4OY3A 4QRHA 4DDKA 3EXFB 2CFIA 4YRKA 3N2YA 4D81A 4DGSA 1E2FA 1I3KA 2Z1MA 1VBFA 4LHWA 3BTUA 5DJ5A 4DLUA 1IY9A 2FK7A 1PL6A 1QGAA 5C80A 2H5JA 3A04A 3EG9A 3LXUX 3DLIA 3EFOB 5E7IA 2X0EA 2FPSA 4DNOA 4LF9B 3LNTA 1LY1A 3MLBA 4DV3B 1OXBB 3QX8A 2A1UA 2R9VA 3PVSA 2AR7A 4R51A 1KEWA 4TXHA 5EPEA 3RYFA 2NN3C 2O6LA 4BB0A 1JE1A 3STYA 4QQ8A 3FPBA 2DJ5A 3INYA 2NXWA 1D2RA 2GK7A 1MABB 1W96A 1UCFA 4TMTA 2QSJA 4WCVA 1F4VA 3LVQE 3WX0A 2GPNA 3KTFA 1H2RS 3DW1X 1SUIA 2GCIA 4RPHA 2FSPA 3I3OA 4RZQA 4R8VA 5PGMA 3Q5DA 3EY9A 3OBBA 3ZDEA 3EHEA 1G59A 1KGDA 4KIJA 4DC1A 3ZV6A 3ST7A 3JD2A 4E2ZA 1C3OA 2DR3A 2FN7A 1FPMA 1QV7A 5EIFA 3T5BA 5KU7A 3E61A 1C7EA 3R5KA 3TFWA 5THQA 1EAYA 4DT1B 5HF8A 1MN6A 4L0QA 1KHTA 1E2DA 1ZCZA 4MIYA 4I3HA 3R5FA 5LYJB 3ROPA 1SOVA 2NZ2A 2PUJA 5K3FA 1JAYA 1UINA 3DFFA 2HFJA 3HDTA 1YS6A 1L4MA 3JAWA 4KHZA 3ILHA 4QYIB 5CVUA 3RJTA 2SKCA 5KQSA 4UVEA 5MGBA 3RK1A 5FI1B 1Y1QA 4LRQA 1OZAA 3H84A 1DIHA 1XSEA 4HATA 3V8EA 2C8VA 3PNPA 5BY2A 4LYJA 3RS2A 3BD9A 3CLTC 3B5JA 2QMQA 1VIYA 1XNJA 4P7FA 5JNUA 3KJGA 1Z8FA 1K08A 4FEEA 2NU6B 3DZIA 3I2GA 4HEA1 1U2EA 4LDPA 1OA0A 1UQUA 4CMEA 4YT2A 5CYFA 3IUSA 2BF4A 2XGOA 3DCYA 4LSZA 1YKFA 5CEFA 4HB0A 5LLTA 3F6BX 3EFEA 5CA0B 1KI6B 1ZL2A 1HR0B 4JB2A 3ABZA 4U7PB 1M33A 4V0RA 5K1ZA 2N1BA 4L0MA 3ZVLA 2APJA 4C0BA 5EJEA 5KNLA 4GE3A 4ZT6A 1VL2A 2G0NA 1I7DA 3OZRA 1BFDA 2ZSIA 1GGHA 1Z0JA 1RKXA 1ZXLA 4JJ8A 4JUIA 5CA0F 1PWHA 1G5QA 1UDWA 3QPVA 4JGBA 5FL7D 2AJBA 1AKYA 1ND5A 4UBNA 1AD2A 5BV2P 1TZBA 2GBPA 1QCCA 2JFFA 3UJ8A 3DXYA 3HB1A 5AI9A 4CG1A 5JZSA 1WOYA 1QG2A 1N8KA 2PQ2A 4QC2A 3KXDA 4QIHA 3Q9UA 2HLDA 4JEIA 5C8ZA 2OYCA 1RIIA 1GZHB 3A1SA 3RC3A 4BMNA 5CNJA 4GLLA 1DBSA 2EAUA 5DYWA 4WOPA 4P3OA 1Y82A 2X42A 1OLSB 4H17A 4OI2A 3S1LA 4YO8A 1BW9B 1C1YA 4NQRA 2YXBA 5E2AA 3P32A 3IOEA 4S1OA 4DCNA 1KMCA 2P27A 3RREA 3X0DA 3EC1A 5F3RA 1M8KA 2P0EA 5KTSA 1VB3A 1ARZA 3HKEB 4PVCA 4Z9AA 2UKDA 3ZHQA 5JAHA 3OU2A 5BURA 4LBYA 4FQ8A 4UBJA 3KB2A 1AE1A 2IRWA 3C8MA 3UN1A 2FQXA 1TK9A 4M53A 1I9CA 2ATIA 3OHSX 4EO9A 5EHGA 5I4KA 4LRUA 3PITA 1PNQA 3JASB 3PS9A 4BJ6A 5A9SA 3VNUA 5CPBA 2WHXA 3EAGA 3F8SA 3HJNA 4EI9A 5DNAA 3GJQA 4QU5A 1FDOA 1H69A 3MMZA 2QAGC 2OTCA 1PEAA 5J47A 2FPIB 1DHRA 3NV7A 1DUSA 3EFBA 1HWYA 3HYSA 3LD9A 4PZYA 1Q22A 3UXMA 3OLYA 2E89A 2IKSA 3O9MA 3HWWA 3WZMA 1JAHA 1SBCA 3X44A 1STOA 3H0CA 5I7OA 2VRWA 2NO4A 4TWIA 3G0OA 4H6WA 3D4IA 3IAM1 3KEOA 3F1LA 4AF7A 1V71A 1HDZA 3E5NA 5AJXA 5KWIA 1AJEA 1K89A 3EVTA 4IIDA 1IQRA 4LRYA 3NDJA 3NBMA 3U4GA 1QTQA 5I7UA 2CFSA 4BKPA 1N1EA 4HDSA 3OPQA 3CLVA 4URHA 2R44A 3CWQA 4IOMA 2JHGA 4J7AA 1OXTA 2J3MA 2WNIA 4FGSA 4LISA 3W9SA 3PXDA 4H7HA 2V7GA 1UBSB 1S3FA 1LKZA 1YDHA 4IDQA 4U5QA 3FTCA 5IK2A 1JJFA 1Q1EA 2C9BA 1RRVA 2HRCA 5DM0A 4BB6A 3CVUA 1X15A 1RXCA 2WHRA 2XCLA 3GYBA 3H1AA 3ID6C 1ZW1A 1GT6A 1Z2AA 5D00A 2Y66A 2IPAB 3L0DA 1ZSYA 2FEPA 1JHQA 4YEDA 2COEA 4BVEA 1LRKA 4XIIA 2BGTA 3U0VA 1MIHA 3JAKB 3T5MA 3I05A 4KODA 1W5AA 1J20A 2ZYAA 4U6NA 5AP9A 2EFCB 2V7PA 4H1VA 3F4LA 3AB3A 3T3NA 1E2IA 2PD3A 1RADA 4RWEA 4LVNA 1SHUX 5E6RB 4D5EA 2G1PA 1BDMA 3S70A 4E4TA 4ZV4A 1YOVB 1YE5A 2FNAA 2B1GA 3HADA 3UFBA 4P3YA 1G3IA 5EWLB 1GLVA 2QX4A 4MS4B 3I9V1 4GI5A 5B37A 1ZJ4A 3I45A 3URKA 3I9MA 5JJCA 1Z2EA 5HQTA 1OBCA 1CEQA 1GZ4A 3HSSA 3NRCA 1SG6A 2PPVA 3CSDA 3IMFA 3ZJ5A 4DIBA 5JHHB 5SYNA 4AXXA 3BIWA 3GPLA 1Z07A 3M6WA 4NR0A 1MO5A 3TLKA 3FD8A 1ZUNB 2O3QA 5FBLB 1RC8A 2FB9A 1XZAA 3IT0A 3P2OA 4XGRA 1I51A 3DCJA 5TMDA 1ODFA 2EYUA 3BA6A 2PGAA 1W4BA 4QO7A 3VU1A 4CT0A 1WBBA 3K1ZA 1E92A 1CNEA 1U65A 2DAPA 2P65A 2ZRHA 3P8ZA 2O2YA 4GOKA 4QUHA 4WLOA 1U3VA 5DE3A 3AP3A 4MZXA 5AIAA 2XOKD 1HRDA 3MWEB 1MO6A 3RUEA 2WB2A 3VUEA 3B20A 3H7AA 4RA9A 1E5QA 2WHEA 3DWIA 3VI4B 4MLDA 4OTZA 5IS2A 2QU8A 5HDQA 1Z6YA 3JPYA 4EVSA 3U7FB 2HPVA 4LUCA 3WLHA 2X4DA 1CB0A 4EJ0A 1IONA 1FMJA 4RJLA 4BO5A 2RH5A 4JYZA 1BYIA 1VE1A 2MSNA 4DXAA 1RRMA 5JTUA 3MNFA 4JBHA 2QY6A 3HB7A 5H9WA 4FFPA 1P2DA 2HF9A 1W0KA 3EGDB 3N8IA 3ZG6A 4D57A 1FMFA 1P45A 4CMEC 2Y1DA 2H85A 1K5HA 4J9VA 1PW5A 5CCDA 3W4KA 3BXGA 3MERA 3NTVA 5A5FA 1QC5A 3EUEA 2NX2A 3HMQA 4Q0MA 5IBQA 4XWKA 1SCKA 1X1AA 1Z37A 2XMCA 2KB0A 4S3MA 4D0RA 1NRXA 1WF3A 2JCSA 2YQ5A 3IAUA 3Q7EA 4HDSB 4HNSA 3RI3A 4LWQA 4V2UA 1EVKA 1QLWA 5ICFA 2QN8A 2LCIA 3EK2A 1XPRA 3HN7A 3CH4B 3HNOA 4HUTA 1I32A 3WO1A 3L8GA 5BNFA 2QRJA 1W25A 1PT5A 4IKPA 5SZJA 3EODA 5REQA 3S1AB 3DW3X 1OVGA 4FC7A 4DLAA 3P1JA 4K8OA 4MV1A 5EE3A 2BEUA 3V1NA 3KQPA 3L1KA 2NUBA 2JK1A 3DZBA 3SDZA 5DM1A 2J07A 3VZPA 1DIGA 4YMSA 1NJGA 1PU2A 2QP9X 2OSBA 4FCTA 1CJUC 2QL7A 1LB1B 1N2CE 3UC9A 4DVJA 5KYNA 4WLEA 2NU8A 1SXPA 4KQXA 5A9TA 3TZEA 2Q28A 4WWHA 1C7FA 3LT0A 1BKDR 4RIIA 3NWOA 1PQ4A 4GQAA 2HRBA 4M7WA 1O95D 5BN3B 4YNBA 1DE0A 3RSCA 4YPOA 5FFFA 3WIBA 2ZYVX 4G37A 1E1MA 2DXIA 5HP4A 3OZBA 4LZPA 2J32A 3RARA 2AGVA 1OCEA 1U3UA 1U8ZA 2F48A 3CR7A 4NL4H 1CR4A 4QD3A 3FA2A 4BQNA 3EXHC 5E6UB 3I58A 4UU1A 3JWJA 4C03A 4DLTA 4RANA 2NNWB 2QZZA 4R3UC 3EH1A 3FFTA 3R75A 3F49S 4FFLA 5LP6B 1CZUA 6ABPA 2IA5A 3W5IA 2G6TA 4LGCA 2AFRA 3LQQA 4JS0A 4BNDB 1T8WA 2PZLA 5JD6A 3LVBA 1W88B 2A9KA 1AQLA 4OFBA 3KQQA 5J2TF 5JECA 3CW9A 3O47A 4KB5A 4NJOA 1L7QA 1HM5A 4G5QA 5H16A 2WVJA 1YDEA 4EBFA 4AKIA 1S6YA 4Q4AB 4R3WA 2RC6A 3K4HA 4EGFA 2IS2A 1M1YA 5AWFC 4BNYA 1OTYA 2SCUA 3OPYI 3ZWQA 3D3WA 1EX7A 4N3NA 1YZHA 5TQ0B 1CEXA 3NRBA 3B9QA 1V39A 3PHLA 4GBMA 4HGNA 4MWTA 4E21A 3G1WA 4NF2A 3ZGNA 1MIOB 2Q5IA 3QU2A 2ZT6A 3WGTA 3N74A 4PXSA 3TF5A 1Q74A 2WAYA 3HUUA 1PFUA 2FN3A 4DLXA 3EA5A 4JBXA 2GO7A 1B0PA 3EVBA 4N8DA 4X1KA 4RZ3A 1F1JA 2FJ0A 2UDPA 3PF9A 1Z73A 4LQDA 1TRKA 4CTKA 4D56A 5JXGA 2VTDA 2ZJ6A 3KEMA 1N75A 3EOAI 3MBIA 4JEUA 3GEEA 3ORFA 3WB2A 2XNKA 4ARZA 1E0SA 1KYTA 2XMBA 3KVRA 4BN4A 5HKKA 5EJFA 4FKMA 1JBKA 1PR4A 1S7GA 2IBMA 5JRJA 1FFXB 2FEWB 2MSDB 3SJ7A 3WA7A 2UUBB 5IXSA 1JEQA 5JTTA 5FO1A 3WADA 3FYSA 2C95A 3SDSA 3HG7A 2E85A 2PX3A 1DDGA 5ITZB 4H7KA 1Z36A 3WK4A 2QUJA 3DFMA 3EPRA 1UPFA 3FWYA 3MINB 3HBAA 1AK1A 4D45A 3OE4A 1NAIA 1FVHA 1GTG1 2PKWA 5IVHA 4WOJA 3KAKA 1TUGA 4DSAA 1RI4A 4AW9A 2O2GA 1NW7A 4MWGA 4JC5A 4NU6A 3SG0A 3RNLA 2VK8A 1XL1A 1G6OA 4INPA 1UMCB 3EUFA 3KYCA 4NEHB 4YRSA 4FNAA 1L4GA 2DWUA 4C43A 4R9UC 3DBVO 4G1BA 2R8YA 1SA0A 2ZDGA 4YR7A 3U5TA 1LW6E 1RABA 2JGLA 2NTNA 2X0NA 3CHYA 1JZSA 1O96A 3KPUA 4OGWA 2HXGA 5F3DA 4BNWA 5KYUB 1XEXB 3CVXA 1GQFA 2YZNA 1XXHB 3L6DA 2X3UA 2EDCA 3MUNA 3VVLA 3PI7A 4QLAA 4DILA 1Q0QA 2YVKA 1AQIA 1PJQA 2C9ZA 3NEAA 1JKFA 4WZAE 1ODTC 3M83A 5COQA 5KC8A 1P73A 1Z5NA 1PS8A 2OP0A 3OFSA 4KR3A 1NRIA 5HQ3A 1X6VA 1OX6A 2Y8EA 2EW8A 2AI3A 2OXFA 1G8JA 3UTDA 3VH1A 5HS4A 5JAMA 2NQ2C 3DEAA 4HEJA 1R16A 3SNKA 4GBJA 1Z6XA 3RBZA 1BX1A 1F5NA 3GH3A 3MAAC 3KT0A 4B81A 1L8LA 3SIRA 3PVZA 2B94A 2JPDA 2W2KA 1SU4A 4EQ6A 3L0BA 3U13A 3U31A 1A3CA 1PGJA 1U9CA 2FFRA 2Z9DA 2R8PA 2Z3ZA 2AYZA 3B9BA 3IJ5A 4XYGA 3UA3A 4C7VA 1VG1A 3H2HA 5LM3A 2AMVA 1VYHA 1I3LA 4L4SA 4BQPA 3DHNA 4S0ZA 3D3WB 4C7XA 1T1IA 5ETJA 2XYHA 3A4VA 3L7IA 2ZJZA 1W2WB 4W6QA 3NOVA 4Y0AA 5KJEA 4ACAA 4F9FA 2FXIA 3UCEA 2F4VB 3ZHCA 1GLNA 1N7IA 3N59A 1NUSA 3H17A 2VBIA 1BH2A 4X3CA 1IM5A 5BQ3A 2P91A 2O48X 3OT5A 2AQ8A 4AF6A 2Y99A 2R66A 2H63A 3BC1A 2GFHA 4QG7A 2I0FA 2WKSA 1KIAA 2O1WA 3A7DA 3LUFA 3ER8A 4GOOD 3PTAA 1MJGM 1V2GA 2VFAA 1GPJA 1EQUA 4U7JA 4AVYA 3LHFA 1QFJA 1T6YA 2GEJA 1YK0A 3O82A 4HZUB 3ADDA 5K9ZA 3NYWA 4LF8B 4I6EA 1SKMA 4F11A 1I2ZA 2WTUA 4PSDA 4ZGGA 2KE5A 1CJTC 1Y4AE 4U0JA 4NMXB 3HPQA 4RLHA 4H1HA 1KZ6A 2EQAA 2A5GA 3BMNA 1MT3A 4F2PA 1ZU5A 4BL5A 1PLKA 1CUZA 2XUPA 4CZ2A 1XTUA 4CFYA 1I5RA 4E51A 2ZKLA 1OX4B 2VDWA 3B3QA 1Y5RA 4P08A 1N1GA 3O7WA 3DKKA 3OA0A 4P33A 4XM2A 4ZHQF 3ZCRA 4Z4GA 3QPAA 3LUPA 1CZKA 2J5QA 2ZRIA 1GYQA 4HVAA 2H1IA 4REQB 3R0QA 4IDPA 1L5NA 1VJ5A 2J3QA 2VJQA 4F8EA 3OESA 1PHPA 4P0QB 3JQBC 4RESA 2EJUA 5J40A 2W2LD 3L9WA 3K72B 2AC4A 2OFOA 1R8YA 1T9HA 3BZWA 2HQ1A 4OBXA 2HIHA 1SD5A 2DCUA 4HB3A 4PO1A 1FRFS 1G20E 2RJ3A 1TKBA 3OFKA 5KNCH 3I9NA 1W29A 2FW1A 4NY1A 3K0FB 1OFUA 2OGSA 3SJUA 3QZUA 4NBVA 3DDWA 4YRJA 2Z9CA 3SX4A 1RHKA 3FDZA 4IZOA 4KDCA 4QDTA 3OM1A 5GZ1A 1XQ1A 3LDAA 5JNSA 4TMXA 4KUGA 1KERA 2PXCA 5LN1A 4QBGB 1ONNA 2CCKA 2ID8A 3NHRA 4L7VA 1T6BY 4TKMA 1ZD3A 4X8LA 2GAIA 3UWKA 2WD7A 1RR6A 3V1KA 3C1TA 3H11A 3MB5A 4YAKA 621PA 3BK7A 5I4CA 5MFZA 5KYYB 2DYKA 7REQB 4M1OA 4RQUA 1VCNA 2GTIA 2HK6A 4PCAA 5TQ2B 4BPRA 4E88A 5FUQA 3ED5A 2GHTA 3L3BA 5BWBA 1M1YE 4GPAA 2CHUA 2Q5CA 2FEAA 3KT3A 3UANA 2C8KA 3WRYA 1XZBA 2O3RA 3NALA 4PAQA 1M76A 4Q82A 5DH9A 1CSEE 5IMBA 4BNTA 1M2VB 2ISQA 2R8BA 4OI1A 1PDWA 2ANCA 3OQJA 3WO0A 1X70A 3AR3A 4H7FA 4J2OA 1BROA 1YRBA 3NWBA 4H15A 3T3EA 5I9IA 1V48A 5TMBA 2J4DA 5LD2B 2OHFA 4EYQA 4P5DA 3PG5A 1P5JA 3U5ZB 1BDIA 1QWSA 4EUEA 4LHSA 4O6VA 4L73A 2FWPA 3HZOA 5LQMA 5JI2E 4NV0A 3K32A 3LT1A 2GD0A 1WUIS 2JFBA 5ITVA 3A11A 4O63O 4HWSA 3T54A 1GQSA 4MGHA 4AWXA 2C88A 3DWFA 1K4MA 4UOQA 3GZ4A 1WB9A 3O1IC 1HRKA 4NLLA 5FBZA 4ZARA 2QW8A 4KXQA 2OP1A 1DQSA 1OXVA 4U3JA 4DJAA 5HHTA 5HKKD 4LX8A 4N3BA 1NJFA 4R7TA 5BP7A 5KEIA 3D6TB 3OD5A 5TV2A 1WOMA 4NICA 2PH1A 2YJZA 5DO9A 3WYAA 3MD0A 3EMBA 1XPJA 4JWTA 3PQFA 5FPQA 1TJNA 2PZAA 5HWSA 5KBYA 5KTOA 5ITWA 3HRKA 4KNYA 1DQRA 3LBAA 5D86A 5G3ZA 1COZA 4FILA 4A2QA 2O0HA 4DDHA 2HK8A 4KBYA 4FHCA 4XTRA 1FDVA 2IZ1A 2P7IA 3G2LA 4H16A 4HBGA 5F52A 3S8EA 5GINE 4Y2HA 5LMNB 2O8BA 5K5EA 1T9CA 3B85A 2Y68A 3Q6IA 3ZLBA 1OIXA 3VHXB 3S2UA 2HLHA 4Z4CA 1OU0A 4HPJB 3RU7A 1G41A 4BQOA 3CLSC 4D92A 1GGFA 3NVDA 4UUOA 1H2EA 4DWWA 2E2WA 3EA4A 1YZ3A 3D81A 3O38A 4N65A 3AZOA 3H9JA 3SIWA 3GD7A 3TLGA 4I4TA 1WPQA 1J0DA 1XL0A 4PS0A 4D8TA 4KFTA 4UVGA 2R4UA 4WFJA 1CQJB 4KN8A 2ZUBA 1TLTA 4ZO4A 2ACVA 2O7QA 2P2GA 5DZSA 3GHYA 3KZMA 3RFVA 1PSWA 2HL6A 2PCJA 3MJHA 2VDNB 3TRJA 1QS0B 1I2CA 1Y63A 1GPAA 2IHYA 3CUWA 3IALA 3SF8A 3F74A 4BFUA 4CM9D 5G0VA 1RXSA 2JAOA 1EB8A 1GRVA 1G3RA 3CURA 3HA3A 3IERA 4Y30A 5LDGA 3V6LA 4DCUA 1ZINA 2IUUA 3U3OA 1E3IA 4Q4HB 5TEWA 4Y1GA 3DE2X 4CM3A 2QUIA 5CVVA 2WG1A 4U2FA 4NI5A 2VJPA 3INNA 5B2ZA 1P9RA 5DM60 2VP2A 3ACCA 3MCUA 3IE2A 4UE2A 3ZY2A 1MXFA 1J8QA 2PUFA 3VPCA 1TIPA 2ODWA 3GN2A 5LBIA 2V6BA 5AM0A 3NATA 4AJIA 2EHJA 2AUNA 1GZUA 2OSVA 1SFRA 3FG9A 2IEIA 3RVPA 2DBYA 4GKAA 1M72A 4BAUA 4E14A 5LJLA 3O1JC 1M2FA 4XGQA 2XSZA 4LV8B 1SGWA 3LU1A 3T7JA 5K0FA 4DCJA 2X8JA 1TC1A 1YRLA 4GM0A 1DP4A 4EITA 2H07A 4BKQA 2PX6A 2VDRB 4A91A 1RBQA 2FMKA 3RIYA 3LWZA 1T9ZA 4X71A 3ABSB 4G5YA 5CB8A 3OM0A 3NC4A 2FOIA 2CEAA 2G5CA 4A8JC 3HY3A 4MKGA 3CUEF 5F7ZA 5B6IA 4WFIA 1YFJA 2XZDA 3L6CA 4UNIA 2CXPA 1M75A 1TF5A 2P8JA 2PZJA 4LRXA 1USGA 4OP3A 4D3YA 1SD2A 1KMMA 4RY9A 1HEUA 2AB0A 4M1ZA 4OQQA 2AK2A 3SSNA 3V32A 3QFCA 4FR5A 3TZHA 4PBTA 1LS6A 1W7AA 2ZJ0A 3MS4A 1RMTA 4R2IA 1E2EA 1EJBA 1MO4A 1PRYA 4RFSB 5D1NA 3GARA 3HDQA 4DWOA 1BCRA 1U4SA 2JAHA 2O23A 3FUWA 4TWBA 3RV4A 1G6HA 1RBYA 3BERA 4LSGA 3C3KA 1JXMA 1KYVA 1KAMA 2HJVA 4KBGA 1IOWA 5BRNA 4CNQA 2X19A 4LWZA 5DLYA 2PPLA 1LDYA 1MF7A 4DWJA 5JXHA 4DARA 1QZ3A 1BMFD 1RRKA 3VPGA 3NNSA 1I0IA 1ISHA 7ADHA 1B6SA 1QHGA 4YCDA 4AG5A 1EFHA 2P9CA 3AR7A 4W7HA 1U0FA 4WGGA 3HXOA 3DT9A 3AESA 4M54A 4RJJA 3EPPA 3R8XA 1T9GS 1V4VA 4YI5A 2R4QA 2CVHA 3VJLA 4Q7JB 4FVTA 2VLBA 1O77A 3MN1A 3L1IA 3O9VA 1V47A 5GONA 4LSWA 4Y2JA 1NXPA 4EG5A 5CH5A 2Q0XA 1KVRA 3KOXA 2Y93A 3AZPA 4EG1A 4ROTA 4B3HA 4WCFB 4BWFB 1I3MA 3N28A 2P30A 1KZ7B 3IUPA 3DMRA 4GF5A 4MW9A 3RYTC 3ZDZB 3WAJA 5JWOA 3L4BA 1RFGE 2X0JA 1K75A 3EGOA 3SZGA 3SF8B 4OQDA 3R76A 3CUUA 1DELA 2ZRCA 3KYCB 1E1RD 1ZOLA 3IUMA 1DKNA 4L3WA 1I6MA 1EDZA 3WJAA 3B9PA 4RC9A 4MITA 4QZVA 4WMLA 3MWJA 4M9CA 4QBIA 3CX4A 2QTAA 5K8LA 1WDTA 1ORIA 3FPCA 3FNFA 2HT1A 1JIUA 1IATA 3ELBA 3H1EA 5ALMA 1YDGA 4P5PA 4GR9A 4D44A 2W70A 5ADUS 3H5WA 4C2BA 3WGLA 3T9CA 1ZKMA 4FFMA 5INTA 3LY8A 2PHZA 4EYSA 4YLEA 4ZEWA 3TQSA 4IHKA 1XI2A 3AW9A 3NXKA 1Y6JA 3Q0IA 3GJRA 4BU0A 3QUCA 2X8JB 2Q7OE 5DKFA 5I7RA 3Q8LA 4U6QA 3MLEA 3VNQA 1YU6A 4QELA 3JRWA 4FUQA 5EHNA 1GQYA 1MENA 1R3DA 3IVAA 1GU1A 1VHWA 1XVLA 4HWRA 4LY3A 3ES9A 4C4SA 1C7RA 3ONDA 1FYWA 3FHCB 4C9BA 3IDFA 4RK0A 2H57A 2X0DA 5LA6B 4DANA 1ADYA 4HTAA 3ICPA 1Z22A 3GLSA 2W48A 3IX7A 1U9ZA 3HKDA 4C4XA 4FMPA 3U4MA 4AZWA 4RHCA 3FTDA 3A2LA 2JVKA 2II6A 4D46A 4TLAA 4OK5A 2YHBA 3O3MB 3X1WA 1UP6A 4B4UA 3UGKA 3H8VA 1EXDA 5HCIA 4B3FX 2FUG1 1V3TA 2Q9CA 3DV2A 3HGTA 3G7SA 1PJCA 2C8LA 3O6VA 3KJHA 3PDUA 3VO2A 4CKEA 2KHZA 3A1DA 1ISIA 3QXJA 1UKBA 4JEMA 4P2GA 2H65A 2EV9A 1QGED 4H6VA 3NLLA 2ZYDA 1N9GA 4RK7A 3L6OO 3CH5A 1NQAO 1JHXA 5E6SB 2R00A 4DB4A 1B8PA 2EFEB 2KW5A 4R2JA 4W1RA 3WV4A 2YWHA 1QVVA 2VDKB 4QUDA 3RC2A 2JI8A 3OG9A 4OHZA 2WU0A 4D9NA 1PG5A 2JIOA 2YCBA 4XGIA 1W59A 2DFTA 1Z5ZA 3FBGA 3MJRA 4XXHA 3T3DA 2ENUA 2IYZA 5BV7A 1H2AS 1L6RA 1G55A 1AGNA 1GTMA 4MICA 4JUCA 4KPUB 1VPWA 5GONB 1F2UA 2EFHB 2ODQA 1T3LA 1YL7A 1KFBB 1EE9A 3I52A 5ERYA 3SDBA 1QR6A 1ISFA 1O6GA 5IAKA 2PX0A 2CEKA 1QGUB 1A8SA 2XZPA 3T7SA 2IH4A 1M0EA 3P26A 4Z8YA 1YC2A 2W00A 2BE7A 3ECCA 3E5MA 2F55A 4ZYUA 1GIAA 4I81A 4NDZA 2VP3A 4B75A 4ARCA 1K8YB 3ZHOA 4DUYB 2JJQA 4CKEB 3LDFA 2Q0SA 1CJBA 2WUVA 3GVIA 3M6MD 1QRAA 4MEAA 4OQZA 3TIXB 1L5FA 1EXMA 2UYOA 2HMVA 3JQAB 2VUUA 1QNFA 2WUWE 2BJHA 3C7KA 5C1PA 1W85B 5C5EA 4NMLA 4O5AA 2H29A 3ONWA 4WECA 1H6DA 4H0CA 1ZGZA 3GAZA 3RS3A 2XDAA 2PEZA 1MTZA 3LLUA 2WMDA 3Q7RA 1D6MA 1RXUA 4MQ4A 4GYKA 4RYLA 2NTVA 3T12A 4RDCA 3AVXA 5T8KC 4EW3A 3LKVA 3AY3A 4MXDA 4OUKX 1HFJA 3NS7A 5KX5A