5CFRA

Crystal structure of anemone sting (nematostella vectensis) in apo 'unrotated' closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
172
Chain Sequence
KNVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stimulator of Interferon Genes
publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
total genus 43
structure length 172
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfrA02
4LOIA 5CFNA 5CFRA 4LOKA 4LOJA 5CFLA 4YP1A 4JC5A 4LOHA 4EF4A 4QXOA 4F5WA 4F9GA 4QXPA 5CFQA 4EMTA 4LOLA 4F5YA 4F5EA 5BQXA 4EF5A 4F9EA 5CFOA 4KC0A 5CFPA 4EMUA 4F5DA 5CFMA 4KSYA 4QXQA 4QXRA 4KBYA
chains in the Genus database with same CATH superfamily
4LSZA 3U17A 3ETHA 3AZPA 2WJ6A 3JTEA 4DG8A 3ZKWA 4OHKA 5K4AA 1V1MA 2WTNA 2BFBB 5FD8A 2VVTA 4HF7A 4NJEB 5DIFA 2WUGA 5EWMB 3A3PA 1KOGA 2GUWA 5F51A 4OI1A 1BFUA 3K72B 2XKJE 4K9NA 3CWQA 1DAFA 2D0OB 1YNOA 4UAJA 3R75A 2VYVD 4BJ1A 5BW8A 3CRRA 4G0YA 4F9FA 1RHRA 2ZB3A 2X4LA 3M83A 4FR2A 3LVFO 4YFVA 4TKZA 1LKZA 4KXNA 4KO4S 4WXMA 5DGTA 2GETA 5DXJA 1JEQA 3WZ2A 2VXOA 1GD1O 2H9AA 2WFAA 3H1PA 3OPYI 2YV4A 5J4LA 2DFVA 4JBHA 3FLBA 5EWJA 5FTJA 3UV6A 2DFTA 1AH2A 3SHVA 3FUWA 1GYPA 3D6MA 3MD9A 1RTTA 1SBNE 3I0MA 2R0QC 2OSVA 4A91A 1VBFA 1OT5A 5DH9A 5I51A 1RXYA 4GS5A 4Y2TA 5JCZA 2ODEA 2P27A 1G5FA 3D8SA 1CQZA 4HVAA 3G6WA 3ZDAA 2R6HA 5HMMA 2J30A 2NSYA 3IOYA 1Q92A 4TKUB 4WEOA 1G5QA 4LSWA 5KWVA 2IZ7A 2PL3A 2ZVDA 3KDPA 7REQB 1R8JA 1Q21A 2PVCA 3TSWA 1ZJWA 2X7XA 1T2DA 4AN4A 4B6OA 2IH5A 1KY3A 3T0GA 5BN4A 2ZANA 5KOJA 3CNQS 2V9PA 3F74A 4LTMA 3T7RA 3TLMA 5KMGB 4PS0A 3FWZA 5B7GA 1O54A 2BEVA 2RG1A 1Z5UA 5C7YA 3LC7O 2HYIC 1MVOA 1Q17A 3HV0A 1KWGA 2H4YA 4BE4A 1K8RA 4KOAA 2QP3A 1RCUA 2UUAB 1MMFB 1T0PA 3VZBA 3D59A 3FDFA 5ANRB 1WXQA 6ABPA 3I6MA 2ZB7A 3JQDA 1AT1A 1DEXA 5EVCA 5L3QB 3OOHA 1MG5A 1OTXA 3E4DA 4FBMA 4HBZA 4HC4A 3BXHA 4H3HB 2KLBA 5B7QA 1BA2A 4YS6A 1VCIA 3LV8A 3L41A 3FVVA 4V0QA 2HSGA 3L8MA 2PO5A 1VSUA 4L4SA 5FPSA 3VO8A 3DSRA 1XQ6A 4YB8A 1DJLA 2JI8A 3PA6A 4HQLA 2OV4A 3IMFA 2AC7A 2ZJ7A 4DRZA 1CR1A 2SKEA 2XODA 5DBFA 2O1WA 1XQ1A 3F8SA 3CUUA 4ZT5A 4QYMA 4MPRA 3UH1A 4CL3A 1IEQA 1G6Q1 3BMQB 3T52A 1I2BA 4DR7B 2IH4A 3OLYA 4F9GA 2AUMA 4A1OA 2JLUA 2CJYA 2GESA 2PUCA 5HTKA 1UOEA 4F72A 5AJHA 3A1VA 3NYWA 4NULA 1UMDA 3NBMA 2XRMA 1U1FA 3L9WA 3EW9A 4L8YA 2MCFA 4DCVA 1NPDA 3QXJA 4L75A 3F73A 2JDID 3N6RA 1AMOA 1KI2A 4DOMA 3VAZA 2JLCA 1D6MA 1ZOOA 2P2CA 3WGKA 2PZGA 4RH3A 2QI9F 1PD1A 1GYQA 4XLLA 3VUEA 1DAOA 4GC9A 3LNCA 4RK7A 2A0UA 4LXQA 4LJ6A 4DZRA 4FYIA 3PTLA 1L7MA 3KXLA 4L28A 4MR9A 1A5BB 3GGGA 4MLDA 4CDRA 4RKEA 1EVYA 4RA6A 3ZHBA 5GP1A 1N34B 1N1MA 1VMIA 1LV8A 2VSNA 3RKSA 2AEMA 1CR6A 3QKUA 2FW9A 4Y2HA 5AUQA 4G0WA 3K0HA 5JBIA 3OJEA 3R40A 3K1JA 3FHJA 3OKAA 3LY9A 1E7SA 5E0KB 5FHRA 4MUYA 2X7JA 5HZMA 5A1TA 3QPBA 4G23A 4GWLA 4PLHA 4KH0A 4MGIR 4YMLA 2B8WA 1SQ5A 4LW8A 4OHWA 1L3IA 2PYDA 2XKAA 2Z3ZA 4YCBA 4KREA 2D59A 1CQJB 2NO4A 4DA6A 4H17A 1I0ZA 1NYTA 3PEWA 1T6YA 4I50F 2XNHA 3B1WA 5TT1A 3PWSA 1OI7A 1BCRA 4JT8A 3BE5A 3CN7A 3ZWWA 1ZAKA 4PC1A 3VHRA 3ZZTA 2B8EA 4J16A 4CR6A 2O6HA 4JBGA 3KR9A 4IMIB 3FA2A 3CLSC 2LCQA 2WF9A 3ZZMA 3L5OA 3ON5A 3M4ZA 4GRIA 2C9BA 2FPMA 3W5JA 2VJBA 2EWVA 3LF2A 1WD5A 1RJFA 3FOWA 4HS9A 1VJ5A 3W8DA 4JYBA 2HR1A 2IYZA 3CZMA 4N01A 521PA 3EVBA 3QXHA 1ZZGA 1QQBA 1UJMA 1QMGA 4Q3EA 2MWMA 4R71A 1O0BA 1XLTA 5DHQA 2C7BA 5TPWB 4BQOA 1Y7TA 2VNSA 2WWIA 5B5SA 2XI4A 4IUYA 4K7JA 2IQ5A 4GE0A 2JCGA 2PX5A 3F5SA 3LRTA 1MJ5A 1Q83A 1PN3A 3IA7A 4BIMA 1FP4A 2EX4A 3BSYA 4Z49A 3SP1A 1RLOA 2ZJBA 3UK2A 2NVOA 3VTKA 4Y9DA 1U5CA 5DOVA 3WQBA 2HJWA 1RRKA 1UK9A 1RAFA 2IE8A 1J2RA 1L3BA 2GN9A 1WZEA 2O7QA 3Q9SA 1YRWA 4G4SP 1G8AA 2HSZA 5LP6F 4IKEA 3H97A 4PBRA 2IYUA 4E2XA 2AW3A 2DQSA 3WIEA 4O2RA 3I01M 5F64A 2HWWA 2B34A 4ACBA 3M82A 2D5IA 3IJ5A 4A92A 2O0KA 3ZU2A 1YUNA 3PRJA 3WDSA 4KH1A 1B93A 1L5KA 2Q0QA 5LNK1 2J6IA 3EDMA 3EWSA 4C89A 2CCJA 3AUKA 4M53A 4YREA 4QT4A 1E7MA 3S2FA 4FYJA 1KMMA 3W6UA 2Z8ZA 4O25A 3KKMA 1GXSB 3U7GA 4MCJA 4FDLA 2NUAA 4FD2A 4MVYA 3GCGA 2VJAA 1Y4UA 3RSGA 2DHEA 1U6KA 2JEZA 3QENA 3AL0C 2VDNB 4MIEA 4OGGA 5JNVA 1NG1A 2A9OA 2O2GA 4ZA2A 2P9EA 3DL2A 1WCYA 4M0FA 4B3XA 2WYIA 3T5AA 1YQWA 1W46A 1V4VA 2V6IA 3HI6A 4LJ9A 4CHGA 2WSSA 4DQLA 1RWWA 3JQ9A 1K5PA 3DEZA 4MINA 2ID4A 3K5HA 2OBLA 1E9EA 1WUIS 2X2FA 1KERA 1O96B 3MOIA 2ZE6A 4L9AA 1E5QA 2R4TA 2QLJA 4PE5B 4CU2A 1Y34E 1YBVA 5KKCA 4JI7B 1U7XA 3FFBA 1RBMA 2O8BA 1U7PA 5JADA 1ULHA 1WO8A 1S96A 4JXJA 2X5OA 1R6DA 1A1VA 4B6JA 2D74A 1SUAA 1GDHA 5B3AA 4FIZA 4IDDA 3PHIA 4A1FA 1U3TA 3AM4A 4DR5B 2O8FA 4AY2A 1I36A 2VTEA 2XQJA 3W2HA 4C01A 1ZRHA 2W6ZA 3IAFA 1JPUA 2OZPA 2P9GA 2YBDA 3K8ZA 4GMXA 4QVGA 3O8LA 1CIJA 1MB4A 1BYUA 1UJ6A 3NG1A 4GI3A 5KDOA 4GYJA 5DASA 3H2KA 2GTIA 1UDBA 1FFGA 2NVWA 3PDHA 4YLEA 2RE8A 2WHPA 4DBLC 3PNPA 4DLYA 1XZQA 4OAOA 2VHQA 4PNZA 1EPUA 1JR6A 2ZBGA 3A6KA 2ENWA 3K32A 4RL6A 1X7YB 1GRQA 3B7WA 1NN5A 4DJ5X 2OCXA 1E4YA 4ND3A 1SHTX 5L3VA 1EUQA 3R76A 3BGWA 4G2TA 1CRQA 3WWEA 2HMWA 1YMUA 4KXYA 4QYWA 5T64A 4A0SA 3RRZA 3RVPA 3B3QA 3FPHA 3QM1A 4NL4H 2XDQB 4ZVQA 4S1PA 3UTDA 3WKCA 2WDPA 4P2BA 3CRNA 4MK4A 5BN5B 3W6OA 1XHEA 5ICCA 1YDEA 1CQWA 4MZXA 4LY0A 4WZAA 4HYYA 1M8PA 4JUDX 4TLEA 2AOUB 1SFRA 1GY8A 4TT3D 3VPHA 3QNMA 2IOFK 4KN9S 1NTRA 4MP8A 4UQOA 5F1PA 3UT5A 3V7NA 1WUHS 4P5DA 4UDXX 2AYZA 4HEA6 4AQDA 2FQ1A 1X77A 2YV2A 3HJHA 4MW6A 4ER0A 2H1LA 4Y6PA 5MN5A 4N39A 2OHXA 4LC0A 4Q18A 3I2KA 4JC4A 4HH4A 3N8IA 4YV7A 2IIPA 1D0SA 1AS0A 4PGMA 2Y92A 4ZHQA 1YR8A 5CA0B 3FZEA 3SEAA 1SXJB 1P80A 5F5XA 2ZUCA 2A9VA 2O07A 3L4EA 2W43A 4PICA 1I7NA 3FGOA 1TC2A 4ZAGA 2X3YA 1JMYA 3KEFA 4D97A 4M7RA 5IPFA 1E2IA 3H3XA 4D9BA 4EJSA 4YRSA 1V95A 2JGDB 1WHTA 5D7NA 1YFZA 1SB8A 2YFHA 4QQRA 4NI5A 3DE3X 3GGOA 2BGNA 3V1KA 1VQ1A 1MOQA 1SAYA 3QLJA 4RS3A 3A2KA 1XJQA 3JASA 5JXHA 2J8ZA 3EK2A 5IBQA 1FSGA 5ALGA 4N3CA 3JXEA 1B26A 2IS2A 3I61A 2QD5A 1F2DA 1VJGA 4QQ8A 2CCKA 4DMUB 1MAVA 5K20A 3OTWA 4QM6A 1XZJA 2CLFB 3EUEA 2CMDA 3I5MA 4QU9A 5COAA 3AKYA 5DOZA 4XW2A 4P3XA 4Z86A 4C4OA 1QTIA 5A4FS 2WSBA 1SQGA 1YFJA 4HGRA 3KM0A 5ITWA 4E6PA 4MPPA 2GO7A 2A86A 2X4GA 1KAGA 5DHPA 1G8HA 3ZDBA 3AR4A 2P2SA 4GE3A 5FPQA 4W9MC 4A0FA 5ER6A 3P7MA 4YCSA 2VP2A 1QIFA 3QZUA 4JGGA 4LJLA 3BGSA 4RGVA 2X0NA 4JJ4A 4WDRA 4IICA 3MWLA 4CMIB 5ALMA 4V39A 3LD9A 2DETA 2M1XA 2A8YA 5CLGA 4L3VA 5TPZD 4BGDA 1SHKA 1MENA 4QPDA 1GPYA 3CFYA 1E1DA 2Q27A 3OT5A 4B4DA 5AI6A 2KQUA 3OY2A 1PEAA 3B5JA 3PVZA 2BTOA 4AY4A 5D3KA 1SK8A 4NMHA 4OLHA 1EFRD 2CUKA 3PDIA 3RD5A 3QXCA 1X7XB 4Q4JB 4X6LA 3MIZA 1JGTA 2H7VA 1E0AA 2W00A 1F9AA 4QVKA 5DULA 1MHTA 2E48A 5KX5F 5C32A 1ZN8A 3ESYA 3K0AA 1JIUA 4B09A 4QDZA 3PEUA 4C5CA 1O08A 3IMCA 3IBFA 3QKIA 1NR7A 5CP8A 5AO9A 1NT4A 1YC2A 3UW1A 3MT0A 2REBA 5JXJA 4WX2B 5DPMA 2EZ8A 1Y82A 2CDBA 3NOXA 2CEAA 3A6PC 1LTHR 1IPHA 2IDKA 2YZKA 3MWYW 3ZD8A 3LT1A 3GV0A 4EHBA 1DAEA 4Z4EA 1KAMA 3I6ZA 1ZJ6A 1GAWA 5CDFE 3L6DA 1S7CA 2HA7A 2MT9A 3V42A 3VHXA 4UTPA 3BMXA 2VHXA 2H06A 3CLUC 4HJXA 3E3OA 1MEEA 4TLMB 4F93B 1WMFA 1ZLYA 4RDHA 5E0OA 3IP6A 1ABEA 5B58C 2YFYA 3X1MA 4QSMA 4RDIA 3F1KA 5AJVB 3RS9A 4YAGA 3AY0A 2XYRA 4UVIA 5ALLA 4FNGA 3VGPA 2H51A 2Z04A 2ZG6A 3GRRA 1GGFA 4FS3A 2XEXA 3BWDD 4N47A 1G19A 3RHSA 3OF3A 4KNVA 3WWOA 3HNPA 3FRHA 4LZPA 3SX2A 5EPOA 3VH1A 3WKAA 4JIGA 5BUQA 3HCRA 1AXEA 4E2WA 1P19A 2IFTA 2PX6A 1NKSA 4D9IA 5KINB 2CBXA 2J4FA 3IQIX 4ICIA 4PQFA 3T7KA 2H52A 2GBLA 3VJMA 5FPYA 4KQ2A 4Z1MD 1NQOA 4KFUA 1OB2A 1BHO1 3PUXA 1HI9A 1Z2CA 3H2GA 5E2BA 2JKYA 3C39A 4YDQA 2JAWA 1I01A 1VLLA 4CL0A 5FH9A 4XCVA 1A69A 2MSNA 2O8DA 3K53A 4M22A 3USES 3I73A 4A7PA 2HL6A 3IB3A 4R69A 5TV2A 5M29A 3OQHA 4LJ4A 1CBUA 3EVFA 4MGKR 4OYLA 5EP1A 4D9NA 1YOVA 4I4TA 4MVJF 2FEPA 3TAHA 1UDXA 3EXIB 3OCWA 2XSZD 2Z2KA 4FZ3A 3SYRA 4DIDA 1ESCA 2CJPA 2QGNA 2XE4A 1UJ4A 2IKQA 1I51A 2HH9A 3ZIUA 3WRVA 4A27A 5JRDS 1DWPA 2PX0A 1RE1A 2CVPA 2HHAA 3VU9A 2XMSA 3VRHA 2YV5A 3R0JA 3Q0IA 1AHPA 5HIKA 4TLDA 2Y1EA 1OFUX 1WZUA 1HFKA 2V45A 3EC1A 3ME5A 2J3JA 5GZ3A 3NHAA 4CM7A 5C5CA 1WEHA 4JHXA 4GLLA 2F67A 3D7NA 1QCYA 4M99A 1FXSA 2Y71A 1T6BY 4AZ3B 5LZ2A 2J9XB 1N5IA 2GEKA 3OZVA 1QHFA 4MPTA 1UT5A 3A9UA 1WMEA 3BG5A 2W83A 2QM3A 2XTAA 4TTRA 2AA3A 1W2HA 2AEEA 2E89A 2ODTX 2Z43A 3AFMA 3OQ1A 1XOIA 3RVMA 1N5MA 3D4OA 4BO4A 5B36A 1GUFA 3HK2A 2OZEA 2PD4A 2RKOA 4TS4A 5KTSA 3ZE2B 5E7JA 1PO7A 2HAEA 3A1WA 3RC3A 5CR9A 2CXHA 2GKSA 3K0EA 4R81A 2AKYA 1JLMA 5IKXA 2JVKA 4KRGA 1EFUA 3CT6A 1JV2B 1J0AA 2PJRA 4XVUA 1ST3A 1Y8QA 2H8KA 1LDGA 4EG7A 2WWFA 2HPHA 5TF4A 2C8KA 1V8FA 5CM9C 4PVDA 3M4JA 2Q7DA 2XUIA 4GYWA 4D4MA 4V0MA 3HVKA 4ISCA 3C7AA 4WBSA 1R8SA 1AB6A 1JQEA 4YLGA 2VJOA 1EXWA 1QIDA 4JNCA 4XWOA 2G6TA 2W6OA 3I53A 1HTTA 2Q7OE 3T9DA 2XGOA 5GOZA 5BNTA 4OX9Y 5C34B 1B3RA 3W7AA 2A9RA 4XYBA 4PPNA 4MYDA 2JAOA 2GILA 1AGRA 1ZCFA 1XTSA 3FCUB 3FKSA 3HH8A 2JC3A 3N2EA 4QJ4A 2HQSA 4H4CA 4CKXA 4D8XA 1NVMB 3GIDA 5E4TA 3BD6A 4RU1A 1NBAA 2FJUA 3B3FA 2J41A 4RPHA 1LVUA 2QN2A 3FWKA 3KKKA 3RVLA 3TQIA 1EJ6A 4CNQA 1OBCA 4QQFA 4EQ6A 1P0MA 3A31A 1B3BA 1TO1E 4NV1A 4U7HA 4XGIA 3K31A 5BW6B 1PSZA 4C22A 2NQ8A 2VHUA 2CMFA 3D0RA 3LFUA 4O8ZA 5ARCA 3LSYA 5H3CA 4B79A 1WZCA 3K96A 1E1CA 3W8RA 4D57A 2AJBA 4FCCA 3FTDA 4HEJA 3SLGA 5DEOA 3PI7A 4FHEA 3ROEA 2H1IA 3AI7A 2PXCA 3DBRA 3I04A 4RE5A 4EUSA 4JODA 1DJMA 2JGEA 1M1YB 1T1EA 2COEA 1JG7A 2Q41A 3DLAA 3WE7A 3K73O 1P1KA 4IX1A 4RLSA 3W1WA 1ZBDA 4TMTA 4R7GA 3JVVA 1KEPA 2B3TA 4KDEA 1RCTE 4Q9JA 3WYDA 1NMXA 2NV6A 2O2IA 1N2EA 3S2GA 3UUWA 2WAYA 3WNBA 1L1EA 1NC3A 3QX3A 1AO3A 1GAQA 4PYMA 3U4GA 2TMYA 1HLDA 1YQ9A 2GQ0A 3S3TA 4ARBA 4YV1A 4J2HA 5FFFA 3G8BA 2JEOA 2VQEB 4V0LA 3SS7X 4HG2A 2WJGA 4BNUA 5BOSA 1YCHA 5LKRA 3OMLA 1L5SA 2HFKA 3C87A 1IH8A 4JROA 4YP7A 3ZCUA 3MJVA 4GP6A 1UKYA 2FEKA 3OQOA 1UFVA 5IBRA 4RF3A 1DG9A 1CJBA 4A3SA 2W2PA 4G2NA 2DUMA 4FC7A 3K9LA 1FFWA 3E9QA 3JSXA 2GD2A 3QKWA 5KEIA 2QROA 5HZGA 3QUCA 2JVIA 4X97A 2I4LA 1TEHA 4F04A 2L42A 3H6HA 3TQQA 2SCUB 1J5EB 1OC2A 2XOXA 4JSTA 2Q0SA 3TZKA 4R84A 1SHZA 4FLMA 4IO1A 2W2OA 2W6CX 3L0ZA 3OQVA 4E70A 3ZGLA 1C7ZA 2ZBPA 4CCYB 4INOA 3WWCA 2FZGA 1AGPA 1N2SA 2VPYA 2JW5A 4RS4A 1OROA 3EIEA 4B2PA 3T3GA 3A05A 3ADCA 2PL1A 3AOEC 2DHDA 5HG0A 4WECA 3E8SA 3WP0A 2I2XB 1L0BA 5AIAA 5IVDA 5CFPA 3V2HA 4TWIA 5LZ9A 3MSCA 4TSRA 3WHKA 5E95A 4C3ZA 1TD1A 2EZ4A 3C45A 3B5EA 2FFRA 1C3XA 4LSGA 5CT5A 3OPNA 5JWOA 4M0CA 4PZEA 1XD2A 3U09A 3R44A 1RU3A 3KVNA 3RAPR 1XNRB 4NCHA 3UXHA 1XQ9A 1JWLA 4HQ6A 1AIPA 4DNQA 1Z35A 4LOHA 4RTRA 1I3OA 3AVWA 2RD2A 5JISA 3L0BA 2XXJA 3KCNA 2R4QA 2OY0A 4A6PA 4F85A 3SLKA 1CUVA 3EPRA 3HCWA 1BE1A 4KAFA 2GCOB 2QTBA 4CF5A 1A9PA 4NARA 4EG5A 1IVYA 1XTPA 1MN6A 2WKPA 3IKJA 3MMZA 3WLSA 1C41A 1RQXA 1CUDA 2JCBA 3I6BA 1XDUA 2A5GA 1FRFS 3GNQA 2OE2A 2Z9CA 3B6EA 1WB9A 2PZBA 4KQKA 5FA6A 1A9QA 3K9NA 5CT4A 1Z6GA 1KKUA 1P9OA 3ONFA 3UGQA 1KIAA 3AEYA 4FKBA 4EJFA 2QJRA 4CI0B 1M6WA 1KMCA 2PY6A 1BSVA 5DGCA 1C4OA 1RJ9B 5JCJD 2WD7B 2EHDA 2H7CA 1BH6A 2AXPA 2B82A 4LJ7A 3REQB 4Z3KA 1R3UA 4WW0A 1N3IA 4P0TA 5BSUA 4YEDA 2OAQ1 3ESZA 2Q28A 3VC2A 1GNLA 2EFYA 1SPBS 1QB8A 3X1ZA 3BDIA 3ROQA 4JVLA 1PW5A 3I6QA 4HXFB 4MJ7A 3OX3A 3ASZA 3F3KA 4ZI3A 3DMDA 3PX7A 5J3JA 3DH0A 4W4TA 2QSZA 3WDLA 1LA2A 5F23A 2I1LA 1Z18A 3S99A 4QJIA 3OZFA 1RRGA 2V1UA 1DU4A 1UP4A 3EVAA 5ICFA 2Z56A 4DBVO 3IJEB 4X71A 1YFKA 2DG2A 3TTXA 1L4EA 4IDBA 3RYFB 4B73A 2Q4RA 2Z6VA 3MJDA 1S1CA 2R3SA 3P9QA 3TH5A 4BNLA 1VLQA 5B3LA 5DTQA 5A6SB 1CY4A 1Z5VA 2JHPA 2KE5A 2A59A 4NMLA 5LQSA 2WJIA 3VH4A 2QZ9A 4XGQA 4IP0A 4LPSA 4L02A 1N33B 2PSEA 3AB7A 4IZ6A 5KYNA 2Z09A 3BSSA 3EMBA 1Y7HA 3IAM1 4DQXA 3DEJA 3C0KA 2XVAA 3BH6A 1OFTA 4M46A 4DW8A 1T2UA 3BE6A 2HWKA 2FG6C 1SGWA 4YRKA 1M1NB 3T4PA 1GUYA 3L8DA 3OQIB 5DM1A 1KSGA 4QT0A 3Q8MA 3MA0A 1F8GA 4QATA 2ZIEA 4PHTA 5IULC 5IT9A 4AMGA 3LM8A 1G17A 1V8OA 2Q3FA 3DKRA 3GJ7A 4XEUA 4ZC1A 3N8NA 5GONB 3SHQA 1U28A 3WZMA 1ECCA 1YDHA 3KOOA 3S28A 3E5RA 3GLRA 1FB5A 2DM6A 3P5BA 4MVJP 1XWIA 1G3QA 4JA0A 4KX3A 5DJ5A 5BNFA 1A8UA 3WWDA 2C7RA 4K87A 2XT6A 3UAZA 2ZTMA 4WV3A 3H1AA 3TR6A 1I30A 2RGWA 5J5VA 1K8QA 3GJ0A 5SZIA 4LZAA 1DB3A 2DTEA 4TV8F 2BAGA 4C0XA 3HO1A 1GLGA 5IEBA 4GMGA 4NU8X 1A5AB 3AVXA 3HXQA 3PUIA 3KZKA 3DDNA 1SBCA 1XWFA 4UPVA 1YHZA 2JFXA 2ZRFA 3I39X 4NJMB 2DY0A 2FPPB 4XVRA 3ZHZA 3THXA 3OIGA 3O1IC 4HDKA 2NTNA 4LMBA 3GCWA 2ZCUA 5BSMA 3L92A 2E4AA 1BX3A 3R9WA 1JX6A 2GI4A 3QLUA 3NUGA 3R6GA 4JFAA 3MYRA 5HPYB 3WMXA 5FTNA 1P61B 5FQOA 3HB1A 3ZG6A 4RIHA 4HQOA 5D87A 5IBPA 3SC4A 4BNHA 3BUSA 2BGJA 1Z34A 1W4AA 2ZIVB 2GK7A 1ZIXA 3OQPA 2ZTHA 5G0SA 2ZYIA 1V5GA 1C9YA 3IVRA 3NGLA 2FN7A 3NIGB 1PK9A 5FP0A 3E2IA 1XE3A 2JJ1A 3SQNA 5TIIA 2ACEA 1T9GR 5F52A 1SZPA 1DS6A 4FNMA 4RPKA 5I45A 2F9MA 4OXIA 4XVHA 3VAAA 4JN6B 1WP4A 4EZIA 1K88A 3H5NA 5B6JA 1UDCA 1HR0B 4D45A 2OK7A 3BOSA 2PR7A 3T9BA 3PL1A 4BN5A 4JIMA 3AJEA 3KOZA 3Q9NA 1QU3A 1WVGA 1FDVA 2FWPA 2FG5A 3U1VA 2LTAA 3O8OB 4G9EA 4HDCA 4Y98A 2YOFA 1S4MA 5AVOA 2D6FA 2PK3A 1KAQA 3PSAA 3P1JA 1LC3A 3S40A 1AUVA 1LJLA 4ID3A 4NIMA 4U02A 2EBWA 4TTPA 4BEWA 2GZHA 1R16A 1WCIA 3FTPA 1ZM4A 1RIFA 4CZ2A 3NV7A 4ND8B 3M3DA 4MKZA 2JRCA 4FEEA 1A9XB 5HS4A 3QPAA 5JDIC 3QVUA 1W5AA 4RM2A 4V24A 4C7XA 1LSUA 1W5BA 3JQRA 4FEGA 2DKFA 2OXIA 5JOQA 1I94B 4LAFA 1SXJD 2GPWA 1E3MA 4JLJA 2CNLA 3JYNA 1I80A 2PMWB 3MUOA 3HBJA 5FI5A 1R0WA 1XRPA 2DFPA 2WSLA 1TW2A 2RDMA 4TMKA 1JT9A 4UHDA 4EENA 2W7TA 1KEVA 4O2BB 5AVQA 1HMPA 4MV8A 4K9RA 1FEZA 4TS3A 2I34A 4KIGA 5K1ZA 4CCAA 2DH6A 4YO8A 2F00A 1WW3A 1U9YA 2WZDA 2FZWA 3FOCA 4XQ0A 5EZYA 1TAUA 1KJQA 1O8CA 5L7YA 3B2QA 4YAKA 3L77A 2BH9A 4PR0A 1FFSA 1RRVA 1JZQA 1GUZA 3BMNB 3PX2A 4LNUB 5I9SA 3V1TC 1W5SA 2BPOA 1UJ2A 2WM8A 1YONA 4X6XA 1YBMA 3ZK8A 3FLEA 1ULZA 2DWQA 1NQUA 1CVLA 2PKWA 4PXSA 3RFVA 3BQNB 1NLFA 3CR3C 3MD0A 1Z26A 1WWKA 1ISGA 1EG7A 2YHSA 3DMTA 5JCOA 3WWYA 4U7DA 1RWOA 1HNNA 2CNDA 2QE6A 2ZR9A 3PHHA 4OHBA 3T7EA 4BC1A 4GKJB 1SOMA 3BTSA 1VECA 1G55A 1ODKA 2DUWA 1VGQA 2WKQA 4QOFA 4ASUA 2NUTB 3DD1A 3IULA 2YWXA 5T4FA 3ZCPA 4MLCA 3GUCA 1WULS 2BHTA 4P54A 2REOA 2BKLA 2UZ4A 2AYYA 2ZUDA 4TMWA 1NWCA 1E2GA 1N7IA 1TJ3A 1R0XA 3DKPA 4Q3LA 4DQ0A 4QPCA 4PN3A 1MIOB 1OLXB 4PPQA 1CJCA 2ACWA 3EY9A 1MJHA 2CFRA 4YRZA 2RG7A 4P34A 2HWUA 4DNPA 1J9EA 4D0SA 1IEVA 4PLVA 3BFVA 4J6FA 1X38A 1VFPA 1K3TA 1QUFA 1LNZA 1YRYE 2FX2A 2KM1A 5D3MA 4D6XA 1Z7EA 2R68A 1W4LA 2BLNA 2YJNA 1C29B 4ZANA 5SYMA 4B4WA 1O5IA 1E3DA 2B1GA 3E4CA 3IMKA 4A2CA 2PQ6A 1EGMB 1GVHA 3AF5A 4PO9A 5EHGA 3SSNA 4D8VA 1HUQA 1U31A 4H0NA 1WUTA 3TZEA 1NNUA 2E4ZA 1RTKA 1T3ZA 3A6EA 3B7GA 1HSZA 3KUKA 1XKTA 2VP3A 2AWNA 1T5DX 3T4EA 1ZVVA 4HAOA 3KR2A 5LLSA 3TFWA 3L8YA 5JD5A 4EY6A 5HKAA 3IOBA 2FEAA 2AMVA 2D5BA 2EP7A 1NF3A 5ED0A 4AQ7A 1W4RA 2P3OA 1LV7A 3ZBTA 2ZDQA 1F38A 2GN0A 5JXWA 1CE8B 3KUCA 4Q7JB 3CUTA 1LUAA 1KQ3A 3BIXA 2HJSA 3STXA 3BCUA 2P1DA 2NP7A 2CJFA 4ERXA 4REQB 3LHDA 4CMBA 4PLWA 3JD2A 4UU0A 2ICAA 2C5LA 3PKZA 1OU0A 1N2CB 1UFQA 1QIMA 5BWMA 3M4NA 1GU7A 4N3AA 2EARA 3DNMA 4DV5B 4QWMA 2H1RA 4KJXA 4QYIB 1G20B 5EC8A 4EBBA 4F6CA 1E6MA 1KAOA 2JF0A 2XAAA 2OL4A 2JFFA 5KVSA 1GZ3A 3HSYA 3LUGA 5CW2A 1O6ZA 2FKNA 2KBEA 3JYOA 2QX4A 3FSGA 4MKXA 1RXWA 4EY7A 1LWOA 3TOXA 3GVHA 3R5HA 5JEEA 3OFND 4K1XA 4BTVA 1NVVR 5CEFA 2AFIB 4W5RA 3O26A 1JR3D 2JJYA 2IXEA 4I3HA 3VYTB 3UWSA 4H1HA 3FWNA 2A9PA 1H5NA 4RMHA 3BCSA 3SSMA 1WMSA 2Z4TA 1QV6A 3L4BA 5DI9A 4UULA 5AKLA 3AY6A 4M21A 2Q3BA 4HDRB 1RNLA 4WK0B 2R7NA 3SQMA 1IZ9A 3NVMB 1EWRA 2PT5A 4QDOA 1ZGGA 5FWAA 5BV0A 2Z5VA 3C8DA 4MV5A 4PQRA 1KZ1A 4LXIA 4HDOB 1ZMBA 3H1BA 3IP9A 4JAVC 5IG2A 2QTAA 4HT3B 4KB5A 4Y2UA 1VKHA 1MQ9A 3ET4A 2IXAA 1QBKC 4EF5A 2I2BA 3CU5A 3UJ9A 2YVUA 4B6PA 5FTLA 4P2GA 2GZ3A 2BONA 3AR6A 3QYJA 1JEDA 4QREA 1FSPA 3G7NA 4YJGA 1JHZA 1I7PA 2PWZA 4L3WA 2B25A 1D9XA 3C85A 1WEKA 2CLCX 1CEXA 3JQQA 3LP6A 1Z4QA 2ILVA 4Q66C 4W5JA 1DCTA 1Z3CA 4RNDB 4ZAZA 4EZBA 3KAJA 3T3NA 3LKZA 1GG9A 1YNSA 2RBKA 4LF9B 4F4DA 2P9HA 2JGFA 1QQ7A 3VDQA 3GU3A 3D2AA 2R48A 3JWIA 1EX1A 5IWAB 2WF8A 5ESWA 4I5FA 1YZQA 4ZOQI 1YQQA 5C52B 5DNAA 1E63A 1K0UA 4FI3C 3RIGA 1P2GA 3TKAA 3HJUA 1OYOA 1QX4A 4FJ1A 4RIIA 3RVDA 1ZA1A 2D8MA 3I34X 2VTDA 4ZOAA 4G8JA 3ELUA 4RH1A 1ZRSA 1XTZA 3S1AA 5EKTA 4A6XA 5BSFA 3AK4A 4HHEA 4O29A 1KOLA 5FUQA 1U3UA 2GD6A 1I6MA 3I72A 3TFOA 2BFDA 2QQGA 5HP4A 1CWUA 2RAFA 1LXCA 4GKAA 3TTWA 4R40A 3SQWA 3HKBA 4IIXA 4D0NA 4OLBA 3GJTA 2XQVA 4QOGA 3RTEA 4BX8A 2CK3A 3R0ZA 4D3SA 4D9JA 1EK2A 5DBHX 4DJJA 4R1QA 2B7CA 3P2MA 1X2BA 1DX4A 1QZTA 4R8SA 2OB2A 3ZDEA 1V2GA 1M7BA 1ECBA 4DARA 1QG4A 3TKLA 5A4IS 1DOZA 3DMFA 3E53A 1E6KA 2Y6VA 3AJ8A 3MERA 3RR2A 1A7UA 2BY4A 5DGHA 4BNNA 1FMLA 1KI4A 4EY5A 1ICIA 1M6EX 1L5HB 3LDFA 1B8VA 1WMDA 4XWKA 4ZI7B 3R5TA 1WS6A 5GONF 1GCGA 4NOLA 3D0QA 2C4UA 1D4OA 1EJ2A 1W9MA 2ISCA 2QW1A 2QY9A 4KQIA 1KEWA 2FRDA 3FPGA 2GARA 3OETA 4PHFA 4UASA 1FVHA 4MX8A 4QBKA 3S81A 1LBQA 2VYFA 1Z16A 2IYAA 1NJ5A 5DF1A 4ZDWA 4QM7A 3MJ4A 2PKXA 4EGJA 5BNIA 1CUYA 3U4MA 3JD0A 3VHQA 3OC6A 4HAWA 1PRYA 1K7YA 5L3RA 4OQLA 2W90A 3CBGA 3OIFA 1FX0B 4GLFA 4K28A 4GP7A 3ZR4B 3TL2A 3TRHA 5E8JA 1H4QA 1R1DA 2GJAA 3SS8A 4EY3A 4RVDA 3TSOA 4K6HA 1JA9A 3L1UA 1G7CA 2ZJ1A 4MUJA 5BUZA 2YN4A 5HHTA 3OZIA 2EJBA 4JYPA 2A9QA 4HEQA 1R8QA 4LE1A 5CLFA 2D06A 4ZO7A 2OYRA 1NW5A 2P69A 3A7EA 3ZEIA 2FTKE 3A6ZA 1C30B 4X24A 2R8OA 1XMSA 4MV0A 3W5DA 1QGDA 2YHUA 4MICA 2FHSA 1L4KA 1VG1A 1G3RA 1SEVA 4P53A 4BVFA 3L7IA 2H1OA 2ZRGA 3AI2A 2GRJA 4PQEA 4F8EA 2NU7B 2HUNA 4OM8A 3ONEA 1HDEA 2GLXA 3IUQA 2CT8A 2WV9A 3PPIA 1D03A 1XK6A 2QVYX 4B4VA 1VBNA 3C3DA 3OSZA 2OP1A 2QL5A 3MWDA 3OU7A 1EVKA 4WXRA 5BO5A 4JEHA 3X1KA 3ZJTA 2EFEB 3KWMA 1MABB 2PBLA 1MOSA 3DVAB 1RHKA 3N8GA 2C0QA 4RPLA 1FPQA 1I13A 1FQWA 2YXLA 4IF4A 1VLMA 4AF7A 2YJ3A 4TT8A 2Z2XA 4M9QA 5DIZA 3PUHA 3EUWA 1N9ZA 1DELA 1X1BA 4DWOA 1WTCA 1YS6A 3BCRA 3G49A 1SO8A 4IIJF 5CFMA 1HDRA 3DXYA 3E6AA 3FNBA 3HGMA 5E7MA 2H2DA 1Q0LA 2YMQA 3ABQB 5HQTA 5LQMA 2Z6QA 1AHHA 4LRXA 3C5CA 2J3EA 5DMXA 4UUMA 5SYNA 3W5IA 3EG5A 3BZUA 3HZHA 5K8IA 1LZKA 3QY0A 4F96A 2XNDA 5E6RA 3DNFA 3FVRA 4U2KA 4R3NA 2VZEA 4EVIA 5FBWB 4PPFA 2IDJA 3N2YA 2WY2D 3V8RA 3R0XA 4ZJZA 1U9IA 3C8UA 4ZU1X 1LTQA 2PO7A 2A78A 4O4IF 2BFEB 2W6MA 3BF8A 5F5LA 3NT5A 4ZWNA 4OOEA 1G16A 1YHYA 5DTEA 2F8TA 2OFWA 1C2TA 1V7CA 1E2LA 2PXAA 2QZZA 2XZPA 2YIVX 3WV4A 3OM0A 4Q02A 3RYCA 2CLSA 4ZAVA 1D7OA 1DBIA 1TMOA 3IVCA 2C4HA 1OE0A 3FG9A 4RBNA 3OZBA 3LH5A 5EHIA 4NY1A 3IEKA 3BIWA 4QBTA 4RAOA 3IOCA 3MJSA 2WNIA 2ROQA 3AF3A 1NQ5A 5IJAA 3EIUA 1Y7PA 1Q1AA 1UM9A 1F20A 2AVNA 2CLLB 4XCQA 3CS3A 4F84A 1TVKB 4MQBA 2Y2UA 4LJSA 4EHJA 1F7VA 1XXHB 3IXMA 4DDUA 4LWOA 5LA6F 2OKCA 1QLJA 1JXMA 5KHAA 1M2OB 1KI1A 1TE2A 1TX4B 1G1AA 2VC2B 3KLOA 3AR9A 4WJKB 4KWHA 2PJUA 3OIUA 1V48A 2H16A 4EO7A 1KQPA 2ZK7A 3UMYA 4G5RA 4R1LA 3KC2A 3S55A 1U0JA 3ES9A 3FMGA 4JMPA 4RLFA 3SJ7A 2TSYB 1T5LA 4ZZ1A 5AW2A 4OHXA 2O5CA 4IDFA 2QU8A 1LX6A 1GGJA 5HBRA 3MTDA 4JD5A 5HFAA 4EPTA 4EUFA 3C1TA 3U4CA 1DARA 1UPFA 3PDWA 2G5CA 3JRXA 1KGDA 3JALB 4B33A 3V9PA 5K09A 3KO8A 4Z2AA 4R3UC 4MVJE 1BQ3A 2GFQA 2ONKA 2YWHA 4HMPA 2HHCA 4K2AA 3U80A 4UBNA 3HP7A 4CM4B 5K4HA 4OXQA 4RY9A 1V5IA 1YD7A 1V5WA 4DWWA 2G8NA 1FXUA 3EYWA 1U04A 4DNOA 5JYBA 1A4XA 3IPXA 4Q1EA 2C9OA 5CNJA 3AUTA 5T7BA 1VL0A 2JFWA 2BGMA 4WNAB 3IKVA 3DOUA 2Q7XA 5JNLA 5H02A 1SWWA 4J7CA 4DKJA 1GTJ1 1A98A 4JLBA 3QEBZ 1G7SA 1I10A 4ODIA 1DAPA 2YZNA 5CTAA 1YZTA 4NCKA 2LV8A 2QZ4A 1XJCA 1UM8A 3LUFA 1OD6A 1ZXBA 3KLMX 4JEMA 1J24A 4NYIQ 4D7AA 2ZTSA 5A0FA 1C50A 4DIBA 1XNHA 5D5HA 4BNXA 4PZAA 4ROTA 2HSWA 4JLVA 6PFKA 3U4HA 4Q03A 4D8UA 4ZV9A 3TQCA 3HN7A 1MTZA 1Y3IA 4Y9SA 3TRIA 1K7SN 5K3FA 1Z07A 3HDYA 3OKCA 1NM5C 1J56A 4DHEA 3O75A 4EDFA 4OJTA 4EB3A 4UUPA 5EJ8A 2O3TA 3LL4A 2RONA 1IQUA 2XWJI 1YE5A 1U2GA 4IDOA 4FT4A 4AM8A 2WLTA 1GR0A 1P39A 2EFJA 1WZIA 4GVXA 3F9IA 1FYXA 3I9JA 1Z88A 2C1EA 1NW7A 1LDYA 1I4LD 4QXQA 4WN3A 4BNDA 4KGZA 4WUVA 4YALA 1PGJA 2HKIA 1UKVY 3EGVA 1QHNA 4KLCA 1I33A 4OIFA 5B2FA 5LJLA 2ZPUA 5CFRA 4A0GA 4GKVA 1KJIA 3IUEA 3Q7QA 5L4NA 2QZPA 2G8LA 1HRKA 2A0FA 2XAUA 3BULA 3QPCA 1T8TA 4CEIB 4CLDA 4TZKA 3T7AA 4HNUA 3UK6A 1T6XA 4P6VF 3WG9A 1XD9A 2E6UX 4WSOA 4BYGA 3T7DA 5C4MA 1VCMA 2VPTA 4RANA 4V1CA 5LFAA 3KJEA 1J0BA 4IJKA 2HJHA 4C4XA 4QRIA 4RD1A 2WU3A 2XCOA 1EB8A 1N2GA 2EQAA 3M81A 5B30A 2I5PO 4JFRA 4CWAA 2YN0A 2XXBA 5FTWA 2NO7A 5EL0A 3J81A 1H22A 2Y76A 4LDQA 4BFYA 4PIPA 1K7CA 4HB4A 1LDMA 3C74A 3OQBA 3MJFA 1CSEE 1SRQA 1WSAA 3C5HA 5JSYA 1K2WA 3P0FA 2HBQA 3GLHB 4JP2A 4YRRA 1AZWA 4AP6A 5DCUA 4F06A 4W1PA 6ADHA 5H7XA 1Q50A 4M7PA 2YHIA 1Y6ZA 3GA7A 3NXKA 4BTLA 5C2JB 1HYBA 5EGNA 4B8WA 2J9ZB 2JGNA 1SBQA 3C6YA 3QNWA 4G81A 4EKNB 3PTAA 1PJ3A 4D5EA 5G53C 3RK4A 4B7UA 2KI5A 3NAMA 2FOIA 3NVAA 4R2HA 1OAAA 1TYCA 2PA3A 4BNZA 4CDGA 3GVPA 4R0NA 1CHNA 1KO1A 4QECA 5DBOA 1PR6A 1DC6A 5D01A 1JWBB 3GRPA 1O95A 1G8MA 1SXHA 2WM9B 1QOQB 3CJTA 2ZU0C 3AG5A 5TMDA 1N92A 2GN8A 2G82A 3VHLB 5L3ZA 3GRVA 5EE5B 5CB4B 1W36C 5HILA 4Z9AA 3TTTA 3TLZA 1XU7A 1UFRA 1M76A 1EUYA 3WISA 4MR7A 1T4CA 3BRQA 4HSGA 4X7PA 3BX1A 2BKVA 4PTLA 3CLSD 1OXTA 3H5RA 4LVNA 2A9KA 3HGTA 1JHXA 2B37A 5E38A 4TKLA 4TUYB 3RC2A 1U2SA 2E87A 4R8VA 5IYZA 2HGZA 5AM5A 4NK4A 4AZ0A 1IVNA 2CXTA 2FPKA 4CEIA 2TMKA 1BDBA 2I29A 3LGSA 3OEHA 4KIWA 3G8CA 1KH2A 3LDUA 3QEMB 5JJCA 5JQGA 4TZ6A 2O2DA 4OHVA 5LMNB 3DWIA 1S2MA 1SVWA 5TPZA 4WBNF 3MILA 4TKMA 3UJNA 4DT1A 1DZIA 1VP3A 3O91A 3ABZA 4IHAA 4LJAA 1N25A 2GWHA 4O2LA 1BJRE 3K70C 1U9CA 4QOSA 5JVDF 4WINA 3RVSA 3ZY5A 3CKMA 3H9GA 1PHRA 1XAIA 2C99A 4BP1A 3SF0A 2EZ9A 4D02A 2VRCD 1UDRA 4AKGA 3ANXA 1XMJA 3Q5EA 4N5HX 5B4UA 2BZGA 1T5SA 2Q5FA 3KJQA 1PS8A 1FFAA 3VOAA 3NFRA 3D4NA 5B4TA 3E9MA 1UODA 2C00A 2Q4BA 5FB3A 4ZI7F 3GVCA 3BWYA 1V7PC 4J76A 4RTLA 2PPVA 1FS5A 1GNRA 2ZWAA 5DBEX 3Q8LA 3DZGA 3CUYA 2OV3A 4BQFA 1U8FO 1KOFA 2IBMA 4DCGA 4BBZA 1XKLA 3WMFA 1K4MA 1Q1BA 1CUEA 2W11A 1JPVA 1EBBA 1PUXA 1VHDA 1USUA 1FDWA 1YSCA 3DV2A 3HACA 4N7RA 5B1SA 3T94A 1VL6A 1B15A 3V48A 2RHRA 4ZYUA 2CNNA 2AFHB 4P35A 3NDIA 3CCCA 5AKEA 1AHIA 3GFSA 2QLNA 5FF9A 3SKVA 2DPLA 4II7A 3FPSA 2I3ZA 1WCV1 1N78A 4FXOA 3VSEA 4IFBA 4OB6A 3ZBQA 3BMCB 2Y66A 1KIFA 3GPIA 3LXMA 1YB5A 1R88A 2QN8A 5JR3A 8AT1A 1A50B 2X0FA 2NYUA 3FDIA 1F4PA 2JGAA 2JGLA 3FPFA 5LMUB 2FRXA 3S2ZA 1O6FA 2ZS9A 4L74A 5JC1A 3V8QA 4DLXA 2HK6A 5CAEA 3C3BA 1WAMA 2YW9A 2GCNA 1G9XA 2RAUA 4HLQB 3HHPA 5AK4A 2X3UA 1JQ3A 3PQ6A 4CIVA 2W0MA 4XFKA 3BJEA 3JS5A 2A6PA 2QAGC 1YZVA 3WGUA 2FMTA 1RM0A 2B2XA 1WDTA 1ESDA 4OL0A 4IY1A 4R8MA 3C7CB 3FI0A 4P3NA 3TPCA 3UKDA 4D9HA 2WOOA 2P1RA 4B74A 1NJ2A 2FZ5A 4P4SB 4MPJA 1CQXA 5D3QA 1PAUA 1ZVKA 1Z4OA 3RT1A 4D2IA 2C61A 4RZQA 2OO5A 1EUZA 3DONA 4RIEA 5I8WA 3B9QA 4TSKA 1Z82A 4IW3B 4CM8A 1MZPA 1XX6A 4KQWA 3KEGA 3IIIA 3H17A 4ZVOA 1P7ZA 4ZOBA 4RTMA 1PEKE 4HYQA 1FRZA 2VLBA 2OXCA 1BNCA 1ZI6A 1LS6A 3PUWA 3U9TA 3QYFA 2HHLA 4G0ZA 5LU9A 3K6SB 3WB0A 5HJ2A 4IG4A 1GLVA 5CH8A 1YGYA 2PT6A 4B4UA 1NBOA 4QJ5A 1A76A 3P26A 3QJ5A 5AXDA 1QYDA 1EZZA 3LL7A 1PG2A 3M1AA 1IQRA 4F46A 1LQUA 1KU0A 1UIMA 4F4CA 5EIEA 1BDJA 2C42A 1AUPA 2JK0A 2DJ5A 2Q1UA 4KZPA 2NU8A 3CUWA 5LP1A 2Q1YA 4WE3A 3EC7A 4J2TA 4UCWA 1IZ0A 1K5GA 2J5XA 2PU5A 3OVMA 4RV4A 4LRSB 1BGWA 1Y3HA 4WZBE 1DRWA 2ZQZA 4YCJA 4CKYA 2FSHA 2C3PA 1A04A 2PFGA 2VAXA 1LSSA 4HO1X 1XN4A 2NGRA 1NUTA 4KW7A 4KSBA 1DRJA 1PFWA 2ERXA 2IHZA 3AR8A 2BN4A 3GT4A 1Z0IA 2V96A 4AUMA 2RGRA 2J46A 3Q2OA 1IJFA 4YRTA 3T1TA 2GF2A 3E7WA 2YYZA 2J5KA 4FYYA 2V6MA 1TCBA 1PKEA 3EZYA 2DERA 3PIIA 1ACJA 3VBCA 1FIUA 4CQMB 2EKPA 2F3RA 2PUJA 1SEPA 2VYND 1JA1A 2UXDB 5LDGA 5A3JA 3K2EA 3N0VA 4KACA 4P4GA 5KNCH 2ZJ0A 1UAAA 2FFHA 1EGVB 1BYIA 1TT5A 3TINA 3Q12A 4JHLA 1YS9A 3TNJA 1DQNA 2P4SA 2X86A 3J80A 4LGCA 3V8VA 4XYGA 2DEUA 3B2EA 1ISPA 1NN3A 1PNTA 3HB7A 1XDGA 4JU8A 4KRYA 1BXZA 1SCIA 3H3JA 3MGKA 4J16C 4M88A 4PPYA 2CWDA 2QP4A 5JNWA 4MCAA 1SRRA 1U0BB 3PQ4A 2JI7A 2R7LA 4ZRDA 1E2NA 5CVEA 2RGDA 3G9TA 3HFRA 3O8NA 1BCSA 2G63A 2L2QA 2Q5EA 3CF4G 3BXEA 4FJ0A 4Z0PA 3NRBA 1GGEA 3TB6A 4D4JA 3CQ9A 1NVBA 1H23A 2FPIA 2IHJA 5I01A 3BTUA 2HF8A 4BQEA 3LKVA 4TYYA 2LP4Y 1Z7WA 4BX9A 3M9LA 1NVXQ 1VKOA 1XLTC 1GQOA 3S6JA 4E88A 3G0CA 1FBTA 4C4RA 1Z0AA 1U8ZA 2BSXA 3P2EA 4BP9A 4UUNA 4GQIA 3I05A 3U7EB 3B6IA 4P31A 1XYVA 1NIPA 4V2UA 4K46A 5FAXA 1NWHA 1E92A 3ZY6A 3ASVA 2DU8A 4BWVA 2PKQP 1P5ZB 3N2GA 5JD4A 2OV8A 3RSFA 2VT7A 3EFOA 3LBFA 5JMPA 3GR6A 3KKZA 3HU5A 4PNHA 1I6KA 3UMBA 3ZC3A 2V7QA 2WZBA 2X9LA 3PGJA 3RYIB 4D6YA 1OXMA 5CITA 4BLSA 1C4WA 2B8TA 3K8QA 3UW3A 4LNAA 5AVZA 2H29A 2R5NA 3B9PA 3DKKA 3N3BC 2O2SA 3OT1A 5DE3A 2AXNA 3LGXA 4DADA 4UNQA 3FMPB 4K86A 4CN8A 1DAKA 5F1YA 1KDOA 4UDNA 4EHHA 5A62A 4Q3KA 1E4EA 1ZJZA 4KPUA 3RC7A 2FUEA 3FCCA 4GX5A 4ND5A 3WSWA 4D9CA 4ACAA 4B6GA 2GZ2A 3MCWA 4LXYA 4UHEA 4N7JA 3UBMA 5GV7A 1L4UA 3DE5X 3A4LA 3W3AA 5AKYA 3RIMA 3SSOA 5IABA 2AX3A 4BDTA 3IE2A 1RQNA 3GD5A 5L3SB 4KRXA 3WAJA 2K5UA 2PT7A 4DIFA 1PV4A 4X44A 3CLUD 3LNTA 1Y3DE 2CDRA 4C6TB 1IHOA 3TLAA 1L4NA 3VPSA 3WLEA 4DN6A 1G21B 2HMTA 3GGSA 3H4IA 1T0HB 2RCYA 3JQ9C 4JC8A 4JXKA 4Y30A 2JLXA 4ZIRB 3CGWA 3L0CA 1QVRA 2COKA 1ZN2A 5KTTA 2H4HA 3A14A 3ABOB 3H2ZA 4UQLA 4TTIA 3ENZA 3Q3VA 1ZINA 2C84A 1RLJA 4NP6A 1IONA 1WU7A 4FIDA 5FEMA 4S05A 2X7HA 4J4HA 2FJPA 4P7GA 1KPHA 2W71A 3OE5A 4NKRA 2ATCA 2HSDA 1OZ0A 1BU5A 5L40A 2ZI4A 1M1XB 3ILVA 5H3LA 3QEJA 3IUNA 4L2IB 1X3LA 3TOZA 3VDXA 4BKRA 2PZFA 1I7QB 2UV8A 4GLOA 2J09A 3GJ8A 4BMOB 5HOEA 4L0CA 2GK4A 4WUTA 2J3KA 3RARA 4XPIA 5TARA 5IU6A 2WNHA 4EZEA 2CKMA 1EVZA 4PFSA 1LLCA 2QVXX 1OAOA 3D31A 1SC4A 2ZYVX 5TC4A 3OZCA 3PUYA 4JELA 4E94A 2OPBA 1GT6A 2ZXUA 1JNXX 4ARVA 1FP2A 2SECE 1D2NA 4KAAA 4ENRA 3AJRA 3LX6A 4WCFC 3AEUB 3VSAA 3F78A 3PFCA 5FV7A 3K8YA 5T4HA 4YV2A 1ZO8A 3ISVA 3VMMA 5C7IO 1U80A 3U0BA 1WCWA 4YUWA 4WFIA 4O4JB 1Z7BA 4Q3DA 5FXMA 1U02A 4CI9A 3LLMA 4NFSA 5CB4F 2XGJA 1G41A 1XTUA 3GDGA 4X6YA 1S2DA 3EGOA 1WXDA 3AB8A 1SIBE 1X39A 3NHBA 4F71A 5CDUA 3U7FB 4Q5IA 4JB8A 4HDSA 3AVTA 5IZCA 3D81A 1QYXA 1P9WA 3BKXA 5FFNA 3TSYA 3WGNA 3M3PA 1X9HA 3B9BA 1MO6A 4BQIA 2HF2A 3GF4A 1OWLA 4F8JA 3EVCA 4MR8A 1SUEA 3DDUA 3IVXA 1UBCA 4JUIA 3WGMA 4DSOA 4OA8A 1DIRA 1E99A 2H2GA 4MJ3A 3DV0B 3ELWA 1JLRA 3LHIA 3NXSA 4PWYA 5SZJA 3T9CA 4BYMA 4D46A 4ETNA 3GA5A 3HCBA 3INRA 2KW5A 2FE4A 4TMFA 1E3WA 1PJ8A 2DRIA 1A5SB 1PR1A 1Y48E 1U11A 3HQ4O 1E20A 2W2NA 4DLKA 3Q7IA 2OFFA 4EJSC 2W6PA 3QOFA 3JYLA 1E69A 4EKEA 1GPDG 1M6HA 3EDRA 3P52A 4NSNA 4AO7A 4F4JA 2X0IA 2FZCA 2TRSB 5KCMA 2R5WA 3GY0A 3M34A 3NORA 1XSEA 4KR2A 4W82A 2AJTA 2I3BA 5BYAA 1CW2B 1J2TA 4RETA 2BGUA 3L6BA 3HM9A 3QEKA 7MHTA 4JR2A 4M4SA 4MCIA 5GJBA 3GVIA 1V35A 3C97A 1N5OX 1TRHA 4PHCA 5LXTB 2QJWA 2VCEA 5CLIA 5EE3A 4RJ2A 5KNDH 2F1JA 3JCZA 1QHHB 2IW1A 1DIGA 3WOVA 4E2ZA 1POXA 1T4MA 4NBUA 3CZPA 1B0PA 1VXOA 1NDQA 4JITA 4X1OA 5BSRA 3SPXA 2GZRA 2VSQA 3ER6A 3RJZA 4F9TA 5B1EA 4UE2A 1LF5A 4D80A 4F2HA 4GBMA 1ORVA 3KV3O 2Y1DA 2OBXA 3RCBA 3OZTA 3GLGA 3WL4A 4YMVA 4QHTA 1Z25A 4RK1A 4CTNA 4KEAA 3WK4A 1MFPA 5IMSA 3QEAZ 2PRKA 2H8GA 4B3JA 2B6HA 2OAP1 1RAAA 1SOWA 1E1RD 2JATA 3AW8A 3SHOA 4EB8A 1Z0DA 2PLNA 4QUDA 4ZEOA 4A5OA 5C8DA 4Q7MB 3EIOA 5BNWA 2V4UA 3WJ1A 1BQ4A 1N7HA 1X42A 3OEEA 3IEIA 4TV9B 1PL7A 1KNXA 5FUMA 1FE8A 1J7JA 2HCJB 3ISJA 3BSFA 4Q3CA 5CM2Z 1CQPA 4DQUA 3LYAA 4N8DA 1ESNA 1GKKA 1DO8A 3H4MA 1FVXA 1KVUA 2IYLD 4E2YA 3RKUA 3W1EA 1G9SA 3SXUA 2AVDA 4GG1A 2G76A 3L7MA 3PDCA 4PZCA 3SEFA 2IBSA 5G1PA 2B35A 3IEPA 1WXWA 3GQVA 5FJIA 1F4VA 4B34A 4Y1GA 1X7WB 4MWZA 1ESEA 5EKSA 5K3SA 4PX2A 1DBWA 1YR1A 4NBLA 4N18A 2QWXA 3WL7A 1T3HA 3VU3A 1GQ2A 3HE3A 4CR8A 3R9IA 4EGAA 4DDKA 2NUPB 4X7BA 3QW2A 4E0BA 3JRWA 5AHWA 5J23A 4ZEWA 3PEFA 5HUHA 4ESEA 2ZTUA 2HIMA 4HZGA 1U0OC 4D41A 1RHJA 3ZGVA 4NOMA 3O4JA 5I6DA 3KYDA 1NYRA 4LEIA 4ZVNA 5L7WA 1NXQA 3V3KA 2WPNA 2PVPA 4R9RA 3B1ZA 1ZUHA 4UEJA 4BLWA 1M0EA 4G5XA 1XVUA 1MEJA 1KMHA 3OTIA 5FLEX 1L5ZA 2FPGB 4N5IX 2YWFA 2GBLC 1RXVA 2OQ2A 1VA5A 4K9KA 2PYIA 2P3SA 3NT4A 1HDOA 4DPKA 4RPIA 3Q0EA 2L69A 1MHPA 3TKYA 1BIFA 1Z5ZA 3WB9A 1FZQA 1N2XA 4DNXA 3VYRB 1HG1A 1ZY2A 3L18A 2IHTA 5K3CA 5BN3A 3ONDA 2WWVD 3VKUA 4OD0A 3IBTA 3H19A 1SVUA 3QHPA 3R3XA 1L7XA 2OV6A 1KHHA 2Y68A 2YASA 2WTUA 5EMKA 3S44A 2BJVA 1FJXA 3CT4A 2IHVA 4WERA 3K35A 4PLYA 4QODA 2FOXA 5EMMA 2OXRA 1RC8A 1KTVA 2X5NA 3HDHA 1GL7A 2C7VA 2QMOA 4MVJH 4URUR 4WJZA 2DWUA 1NOKA 3K1ZA 5AJYA 2FWMX 4H7FA 3SZ3A 4OQ4A 821PA 2P3QA 2XVXA 4C2UA 1B2LA 1ML3A 1STOA 4PZ9A 3LCRA 4O2AA 1JB1A 1KARA 3DBHA 5EMNA 1P5FA 2DB3A 5DDIP 3TLBA 3ILHA 1P1CA 3SKYA 1R4NA 3N2ZB 4O3FA 1JALA 1CUAA 2QT1A 1M3SA 3EAQA 4WVFA 4IHJB 3CX7A 5C37A 4GO1A 1P73A 1T34A 2JGIA 4MI6A 3MPUA 4G8DA 1CP2A 4IXTA 4U6SA 1Q1QA 1W6RA 3WAKA 2WIJA 1YU9A 4UFPA 5JDIA 1LU9A 1Q44A 2I1VB 4LE0A 5LOVF 3OQ6A 3OZRA 3LLUA 5BVHA 4JR0A 4NOKA 1JIIA 1ADJA 2EFHB 2F43B 3BMOA 1ODSA 3VVCA 3H6GA 2PIAA 1JAYA 4JCOA 1FJ2A 1F8UA 3R20A 3U0VA 3F97A 4CQNA 4L6IA 5AOAA 3ENQA 2GR9A 2ZSIA 3HCDA 1ZK1A 3ZE7A 4CKWB 3RRYA 4XUGB 3AUFA 3LC0A 3GEPA 3NLLA 3ETDA 3QOXA 3QUQA 1YL6A 1RFGE 1P9RA 5EYPB 4ZTBA 3MINA 2YXPX 1M10A 5BURA 3PHGA 3HO8A 3CVYA 3FZGA 4E7OA 3L0YA 3TG2A 1JHDA 1PNRA 4ZT3A 2QAJA 3DTVD 1D1TA 4N49A 3B89A 3FYSA 4RD0A 1C14A 1AF4A 2X0JA 1X8KA 1CJMA 1JDJA 2WAXA 3H9BA 3KVYA 4OOFA 1CRLA 1E0KA 4TL6A 5BSWA 4DR3B 4E13A 4QPJC 2W6ID 3PXXA 3GRCA 2PEYA 2OEPA 5JAHA 1FC0A 4UBKA 3WWPA 5T4EA 4ZYVA 4UEOA 4F2PA 5A1JA 1GGMA 1T8PA 2I87A 2ODBA 1XXLA 4J1TA 3CMCO 2PSDA 2FR0A 4IR7A 4J7AA 1GN9A 4R2JA 3DZIA 4EJ0A 1ODJA 3SDBA 2WNSA 3LQRA 3CKYA 3QWFA 1ZGCA 2ATIA 3NWPA 1UC9A 3KR1A 1B74A 1BHJA 4OQFA 2RFLA 4XDHA 1VRCA 3WHPA 2OCIA 2BCGY 2HV9A 5FI0B 3WNDA 3L84A 3S0JA 3HKDB 2SBTA 2DCUA 4G0QA 3WYAA 1R12A 1BE8A 3F2VA 1T2VA 1FU8A 2NYRA 4EK9A 3ETLA 2GJ9A 1UOPA 2F59A 1UBSB 1I2MA 1N3YA 1SA0A 2JD1A 2NZUG 2DHQA 4TTTS 3V97A 5CFLA 1UK6A 3Q72A 5ALZA 4G4JA 4U5XA 3DZFA 3ZBUA 2Z8XA 4BJ3A 1DBRA 4RJIA 4UHJA 4DCCA 1P1IA 2FQXA 2Q6KA 3NASA 5EMLA 1Y37A 1YRBA 1SCUA 2BEKA 4FMCB 3ELDA 4ZREA 3U44B 2HA6A 4GUAA 4R8RA 4J0KA 3ONVA 4GUDA 3RUIA 3UFXB 1U63A 4LC9A 2OG1A 8ATCA 3HYTA 5LUBA 2I71A 3T1HB 2Y27A 1ATZA 1Q7CA 1WOMA 3H2IA 3O4GA 3P97A 1FLVA 4JVNA 1HTWA 2V4ZA 3Q15C 1MC4A 3A1FA 4LV8B 1HDGO 1GVNB 1H6AA 4G8CA 4CT5A 4E1AA 3MTAA 1Q84A 1DXOA 3L43A 2ZUUA 4L5YA 1Q1NA 3WLAA 4O33A 4CKCB 2ZRBA 1Z7YA 1EFVA 5CDGA 1WL8A 3EMKA 1NF8A 4JLSA 4P22A 5ENZA 3NMUF 4BNGA 1ILEA 5CA1B 4L5IA 5FLXA 3VKGA 2CVOA 2JI4A 3SJCA 4J2OA 3SBEA 1Z4LA 2Q6VA 5F3WB 3NAZA 4EVRA 4KYIB 4IS2A 3W2FA 3ZTYA 1VI2A 4DYDA 2J5QA 5JH7A 3NAQA 2WR8A 4GL4A 4PZYA 4YCMA 2QQFA 4AP9A 1Z4IA 3A0RB 1MV5A 5SY6A 2FPXA 2HBZA 5EP2A 3W8EA 3WLKX 5HVNA 1CFJA 3JQAA 5ER9A 5KI6A 3V1UA 2PU7A 2REXB 2VXCA 5IHXA 1UPTA 1M54A 3KB8A 3GB9A 4LFBB 2HRQA 2C2ZA 1C0IA 3KNZA 3Q6MA 4Y0NA 5AQEA 5AJTA 4CTOA 4TQUS 2IPNA 1AS2A 4KLRA 4ZQEA 2Z1DA 3VJKA 4BRUA 3ZV4A 4YRBA 1BGVA 1UMKA 2OMKA 2PZ8A 4X1YA 1W36B 3DZJA 5IK2A 4I55B 4NBKA 1J5XA 3HBMA 3EVDA 2VF8A 4B75A 4NYIR 4DEXA 1IXYA 3KZOA 4NZMA 2XV1A 4ZI2A 2DWOA 3BICA 3NBYC 2KWIA 3TVTA 2O54A 1G3IA 4YAWA 5DCYA 4B8ZA 5AW1A 3KT6A 4C06A 5EHNA 1ITZA 4JBXA 4FMBB 4FI3F 4I1IA 2NM0A 3K5PA 1EM8A 1GFZA 4B3FX 2XWBF 3ZD6A 3GNTA 3ZKWB 5JAQA 1V1MB 2C4NA 1ECLA 1RD4A 3O4IA 4UUAA 1W0JD 3W90A 1K6EA 2IJGX 2QPOA 2AJCA 3ZHSA 5DNVA 3OP1A 1WA5A 3CB4A 1UP6A 3I9MA 3EF3A 5KWEA 3UWKA 1QGAA 1V4BA 4LI0A 4DLZA 3A3OA 4AJ9A 1CR4A 3MB8A 2Q21A 1ISIA 3AHCA 3B7PA 1NJGA 3C1UA 3L06A 2BOVA 3UJ3X 1QO7A 1C7IA 2YYAA 4DA9A 3K70B 3A9VA 3C6QA 3OE7D 3Q40A 1CC1S 1JUDA 1KZGB 3ID6C 3QU7A 2AFIE 3R6TA 1W88A 3ZXSA 2P6PA 2BM0A 5TJ9A 4A6DA 4WZ6A 2L0XA 1QNLA 3MWEA 3GXOA 3ZWPA 1DKUA 2DUNA 5FWYB 4COOA 5EWJB 4N6OA 1KFCB 2HUPA 2RI6A 3SFZA 1VSBA 1JSZA 4Q9KA 1GGKA 3HVJA 3L07A 2O9JA 3EA4A 1N6OA 1ZMRA 5DLDA 2J7KA 2PTHA 3NJ8A 1DIAA 2R6CA 3CEMA 4H3VA 4LYEA 2AMLA 5BW4A 1M7HA 1DHTA 1JDVA 1X8LA 3OP4A 2HCBA 4I5DA 2QN6A 1TJPB 4OHMA 4UD6A 2GZMA 2H2WA 2RAPA 3AETA 3MCVA 5F2KA 2QRMA 2XD9A 3DAOA 3P45A 2BFMA 1KP2A 1XDSA 3WLQA 4N6NA 2WJ4A 1KYVA 1IG0A 3B36A 4Q01A 5D6OA 3ZXIA 3OHSX 2AHRA 5KOJB 2PUWA 4E32A 3S1LA 5JFOA 1MX3A 2X0DA 4CGYA 1IY2A 4TSFD 2BEVB 3P9RA 2J4CA 1UADA 3AT1A 1WXFA 5AKKA 4E1VA 5BR8B 2CZCA 4OMCA 2ZM6B 1QP4A 3AF1A 1ZAYA 1SNYA 3NTXA 4PPGA 5CXXA 1V11A 2XNJA 4PVCA 2IYTA 4S04A 2BZSA 3HWX1 2FNAA 2VPPA 3HYNA 3WHIA 1T2CA 5H70A 1N7JA 4HFJA 4AXBA 3T6KA 5A9RA 2CD7A 5HEKA 5EJFA 3EZ7A 3WMEA 1EXVA 5KYYB 2NXNA 3VNSA 3KETA 2A35A 1BWSA 2IUFA 1CUGA 1ZHFA 2QM7A 2XD4A 4JP3A 3TQOA 3ZGYA 3ICCA 3PE3A 2FU5C 3RANA 2PSHA 4RESA 2Y4NA 4YY3B 2XVYA 2QAGB 1E58A 1ZJ4A 3BH0A 3UO8B 1OU4A 1NW9B 1A4UA 2J0EA 5AR1A 1D6NA 1JJAA 1CB0A 3BVPA 4Y1EA 3TXAA 2DBQA 4WFKA 1QRRA 2AZDA 4HNVA 1Y6FA 5DYNA 4GM4A 1TA4A 4Q1CA 3CNOA 2WUEA 4FOOA 4O5AA 4BQNA 1XU9A 3CH5A 3RUPA 1B4DA 1P6UA 4DGSA 2WUDA 3SE0A 2FFBA 2GGSA 5A0TA 3KTDA 3WFZA 1UP7A 1MBZA 1HEIA 2A1IA 5F9FA 2VHCA 1PFGA 2A5YB 3E8MA 4C7VA 1UMDB 2K2QB 3VV2A 1FXWF 5BMOA 4DG9A 3QE4A 3QLUC 4AKTA 4MH0R 3R1IA 1X7HA 3KYIB 4GI7A 4PY2A 1Q12A 2PXHA 3VH2A 5KHOC 4G3XA 2GPAA 2RK6A 1PCXA 3KL4A 5FPHA 2ZIXA 3HXLA 4RPJA 1K6MA 3C43A 3MN1A 3OOWA 1PZGA 4FWIB 3TOCA 2VDVE 3PC7A 4JJEA 3F46A 1II8A 4FM9A 2C59A 2AR9A 4X90A 5IDWA 3IRUA 2HWYA 4KC0A 1O4VA 2C9DA 4K81B 1DKQA 4MR9B 1IB6A 1NV9A 1VYTA 1FQOA 3JWEA 3MHPA 4FBLA 4RA6B 2QVBA 3S2YA 4DC9A 3K4QA 2R1TA 1IOWA 1Y5RA 3AHJA 1LBSA 4HDNA 3I2YX 4OI0A 4JJ6A 1ZCZA 3CX8A 4MXDA 1NF9A 4EKYA 3RT9A 2H0QA 4UHBA 1GFWA 4KO8A 2ZZKA 1ZUNB 2R6DA 3DB2A 4RJJA 1OASA 3MLBA 4R5HA 2JHAA 4BDSA 2H2FA 4HRYA 3NEYA 4MULA 3V33A 1RWBA 2PZKA 1OKKA 5FNVA 1D2CA 1WIWA 3AINA 3L82B 1K06A 2P4HX 1OFVA 3E7DA 4YAFA 1UBOS 1Z33A 3U60B 1DUVG 5AUPB 2WB4A 3MT8A 4FYKA 4QDUA 4MQLA 1U1EA 2KJQA 3GCXA 1ZW1A 2DY1A 5FL7A 3W2GA 1BCRB 3TQSA 1X70A 4LYHA 2DR0A 4CKZA 4ND7A 1L5MA 2XIQA 3MSXA 1F7UA 3VPGA 2QN3A 1UPAA 1M6NA 2A84A 1RZ3A 2HW8A 1CR2A 4NBTA 2HJVA 3HCNA 4NFYA 1JYEA 2CGEA 1UFOA 4IOJA 4B3MB 4JT4A 5KSZA 5AK3A 5FO1A 5CW1A 2HREA 4BQPA 1H2AS 1OFHA 2ZYUX 3QSGA 1IN4A 1IHPA 4ABTA 2PKEA 1ISHA 2VFAA 3IHTA 3R77A 4CODB 5JJBA 4TXNA 1U1CA 4XSHA 1YGPA 3RTAA 1EM6A 1PGNA 3A9CA 3GEDA 3FCOA 4C43A 3PJFA 1IN7A 1KTIA 1MG0A 4PAGA 3A4NA 3BL5A 1DI0A 1FP4B 4A8TA 5JY1A 1RLMA 1ECJA 2Q1TA 1YVRA 3PL5A 4LRQA 2GF9A 3B85A 5CDFA 1LRLA 4ZDIA 2DE0X 1J2UA 3OWXA 4M8LA 5JCOC 1YJBA 5GJVC 2R47A 3BBPA 1D1PA 5DK6A 2OECA 2PUEA 2ZQYA 4K8OA 2OHGA 1HDCA 3DKVA 4Q1VA 1DT5A 3CR7A 4P9NA 2V6BA 2F64A 2H1HA 4FN4A 5EIOA 2AOWA 1SCKA 1CXZA 2HA0A 2ZITA 3DAFA 3EGIA 4EGCB 1YV9A 1NG9A 2NUAB 2AF4C 4GBGA 3RQIA 2H9IA 2D2FA 1QYVA 3P20A 2EP5A 2DUJA 2X6QA 3OPMA 3PNLA 3QA3E 1R18A 4FILA 3V4OA 4HQRA 5B3JC 1R0YA 3QEOA 3P2IA 2HZ7A 1XBTA 3PF8A 2EF0A 2Q0HA 1PJSA 3R41A 5AW8A 3ZK7A 3H86A 3A3NA 3ZWDA 5IUNC 3IQDB 3KKLA 2DR2A 1J0XO 1XL0A 2Z58A 3QYPA 2ZBRA 4W7SA 4BO1A 1B2RA 1JIXA 1JSLA 4BNWA 2Q2OA 4CLXA 3GEHA 2X8JA 3DMYA 3WWZA 5GIPE 1CRPA 4GX1A 5LB4A 2VHWA 5FBRB 1U0EA 4UXJA 2YX1A 3BL8A 3OOJA 4MVCA 4E03A 1LF0A 3OIWA 1TIKA 1LVHA 4AVYA 5E2IA 3AESA 2VOEA 2OPHA 1CD5A 2O8FB 1W0KA 1XFDA 4UTRA 4KVGA 2QTVA 2WHRA 5JNUA 4PR3A 1XZCA 4BCCA 4NZOA 3SIRA 4EG3A 1VYHA 2UU9B 2EW1A 1CTQA 2J67A 4GXNA 4ZYYA 5AHXA 3HB4X 3A7DA 4OHOA 1OHHA 1CZHA 4IOKA 1QGOA 4KCGA 5CA1F 1JFTA 2GTPA 2DLNA 2P6UA 1XCOA 3BILA 4Z4FA 2WHPB 3QPWA 2ZB4A 3PGXA 5DLEA 4I0WB 3SHTA 5EGSA 4CG1A 3DGFC 5F7ZA 1K63A 1WUYA 2CMHA 2HMAA 3BFXA 4WCFB 3KHKA 3PC2A 1TXGA 3EPPA 1SZDA 3P9XA 5ALNA 4IJMA 2PT9A 3OJWA 2B1QA 3EZNA 3TQFA 3ZXXA 4EUHA 3ST7A 1FDUA 4FP9A 2QLFA 1F0YA 4OK3A 1QCCA 1Y1TA 5DBGA 2D0DA 4HATA 5LZ7A 3TLCA 1A1SA 1WLSA 5A0VA 5ILOA 1QGUA 2Q49A 3AR5A 3O03A 4I55F 3E3AA 4FCTA 3WYBA 1F3LA 1JFSA 1I1QB 1T3TA 1A77A 1K3UB 3CY6A 3RTDA 3TE6A 1JEAA 3H4VA 3IBGA 4Y3UA 5EPUA 2Z9BA 3I5UA 2P30A 3BHJA 4FOSA 5CIYA 4M3NA 3UT5B 2CLHB 5FULA 3S4YA 4B3HA 4ESVA 2ZBDA 3M6LA 3E1KA 4IX9A 3LQYA 1FTWA 1YA4A 2DC1A 2OBBA 3TIIA 3DO6A 4B3DA 4LBYA 3PGMA 3AVPA 1AU9A 2ASVA 3B2NA 4BEBA 2FWRA 4MS1B 1JS1X 3IEXA 1IPEA 2OG2A 3N0TA 1NSYA 2PJZA 3CLRD 4QXRA 3VKFA 4QXAA 2IT1A 4W7HA 1GA1A 2RGGA 3KOWA 4IIBA 1MDBA 1D8TA 1HLGA 4GPTA 4MWDA 4YRNA 3VU1A 2OD9A 4F4HA 1FNMA 1YS2X 1XTQA 1FU4A 3HP4A 4ADSG 4J3JA 4AY3A 4EJSB 4KNWA 4WHMA 1LC0A 2VDRB 3W9BA 5A5DA 5JV5A 3W4IA 5KYUA 5KQPA 2YXBA 5LVAA 1GQYA 4IIVA 3JASB 4QXPA 3D9QX 3LYHA 3RADC 1KK1A 5B37A 4BMNA 3GLHE 3ZNPA 5CBPA 2VPQA 4YJ2F 3VR5D 3V34A 4GXTA 4Z7JA 1W29A 4I1VA 1F2UB 1XTJA 1UC8A 4PAMA 3IR6A 2IW3A 3VISA 2VK2A 3HN2A 1LPBB 3EHEA 2Q5JA 1NBMD 1VCNA 1YE8A 2QD2A 1V9SA 4G6ZA 1ZD8A 4ZT4A 5HE8A 3SKXA 3I9NA 3NOOA 4JKIA 1NFQA 3AEZA 4GR4A 4XWGA 1LW6E 5KDDA 4U0KA 1NMQA 1YDWA 1XEXB 4RMGA 2VDWA 4L9RA 5ABPA 5C8YA 4F60A 3VU9B 2W4QA 2PD3A 4XAQA 5A2QA 3WGHA 3QFSA 1D8AA 1FLDA 2BW0A 2MMGA 4PONA 1FW6A 1NKVA 4KX5A 3Q0TA 4U0JA 3IAS1 2Y9PB 1R27A 5HXAA 1GPKA 1TGYA 1UBRS 1NAHA 2ASEA 3NAGA 1O97D 1OUMA 3QE0A 3NGXA 2C3UA 4Q24A 3WK5A 3WQSB 5LJIA 1N5DA 4FFOA 3E22A 4P81A 3WOHA 3PDIB 3EZFA 3G2HA 4XD7A 4E4TA 4Z0NA 2ZSEA 2QUBA 3ZWQA 4GI5A 3FOZA 3DHEA 3NYQA 4ZKEA 1Q77A 1QKIA 3ENVA 1QCDA 2C94A 2PQ2A 4OREX 5ICGA 3K0AB 1TAQA 1KRXA 2I78A 2FRDC 4UVGA 1I14A 4PO3X 3F5QA 4EYGA 2C9YA 2GZAA 1FLNA 3OZWA 3FWHA 1LSJA 4KG7A 3CPEA 5CXSA 1E0SA 2LXNA 1W581 3UA4A 1VLHA 1QRSA 1HZJA 4CF7A 3R4VA 3OMWA 2ZRLA 2QIOA 5JXIA 2E49A 4BX0A 3NT2A 2VHZA 5BQOA 3TRFA 2FLVA 3Q8WA 5ICMA 1YR6A 5LM3A 2ECOA 4QOHA 1NBHA 3FZYA 4ZK6A 2CHQA 1ZEMA 4R05A 1XVLA 3VYWA 4YP5A 4E12A 3VH3A 4YCNA 4K1LA 2C2GA 4PRLA 4E6EA 1FF9A 1D09A 2WT4A 4LWQA 4BKPA 5DO9A 2G72A 2BJHA 1R4MB 4RKWA 1NRJB 3BHMA 2B9EA 1Z8HA 2IOQA 1DX9A 4KAXA 5AKZA 2O23A 4HN9A 3ZDYB 2W70A 5ITZA 2LBPA 2Y1XA 3K1AA 3OURA 4I6EA 3B70A 2F1IA 3NIWA 5BSVA 3UA3A 1BMFA 1QM5A 4H7KA 1QS0A 1ZD4A 4KJZA 3ZE6A 3U3OA 4X1KA 3WYEA 2YRFA 1Y7IA 2G67A 3AFHA 4LVOA 1CERA 3ZBPA 4EEKA 3DZKA 1H8ED 3ICOA 4ZVKA 4EMBA 2I8CA 2ZB2A 5GGXA 3H65A 4LFCB 3NRJA 3TXXA 1CNMA 2JIZA 3N2IA 3FDXA 1YVUA 3U49A 3TUJC 1XELA 3D8NA 4L16A 4M0LA 1Q1GA 1DC3A 2IUTA 5IANA 1CX9B 3NNSA 3LHFA 4ZGGA 2QG4A 2WYVA 4ND2A 2LDXA 4ZVUA 4HXYA 3SIXA 2O8DB 2HO4A 3W6ZA 3GEMA 2BLLA 4NC9A 1UZLA 5DN6D 2RH9B 1YOVB 2VYNA 4I4TB 3SQXA 1JFFA 1GU1A 2X2PA 1TM2A 2RBGA 4FD3A 3V4ZA 4P3KA 4QTTB 1Y8RA 4ZCMA 3LJKA 1NURA 1CF2O 2BF4A 2G0AA 3DC7A 3GJQA 3KBOA 4RVHA 4TS9A 3PCXA 5FYQA 4LYAA 5LPNA 3NZEA 4BIIA 2AOTA 4X45A 1U9IC 1W36D 1VE9A 2OM2A 3Q1KA 3O73A 5I9IA 1IATA 2VP5A 1VLVA 4UDOA 4XUEA 1HURA 3TZ6A 2HTFA 2DPMA 4W1RA 1FTYA 3GYGA 2WJ3A 3HZRA 4MYCA 5BOVA 2BSQA 16PKA 2ATVA 4YR7A 3WK7A 4CG2A 4B7AA 3WVNA 2GHQA 2Q4TA 3EY4A 4HRAA 1BDHA 1MJFA 1SUFA 4GU5A 1KYTA 4NBWA 1QMPA 1GTVA 3LBYA 4QDTA 2WVHA 5B53A 5TVKA 5J40A 2NPIA 1GITA 2PGJA 3OTHA 2DULA 3ND8A 4DG5A 4OP1A 1HLFA 3DMRA 1UAYA 3RLIA 2Q3CA 1IM8A 1Z63A 4Y0VA 2CLOB 2OBYA 3W9SA 1QORA 3TUIC 3K2QA 3OM8A 4IEFB 5DHSA 3UANA 1TT7A 5HCUA 1Y8QB 1KVQA 4QQKA 2OWDA 1RHMA 1MAWA 5GQSA 1N4DA 2WC1A 1E3LA 3EQ9A 3HJFA 1NLUA 2ZGVA 4G89A 5K0GA 2C20A 1C8KA 3EXFA 1J0EA 3FPEA 1GCAA 2Q9BA 2EW2A 3DL0A 1Z6QA 1P2UA 5K9ZA 4Q48A 5AD1A 1C9EA 1L5WA 5ADUS 2IDMA 1VL2A 4DABA 4Z4CA 1CUUA 1UBKS 1SUDA 2ZRAA 4CMGA 1O77A 1KDRA 4KFCA 4GQAA 2H54A 3OJFA 2JZCA 3SE7A 4ZCIA 5HKBA 3EULA 3C7DB 5FPTA 4O02B 1PYOA 2JFNA 3A58B 3E7FA 5CT6A 3TX2A 5K0EA 5CGQB 4KQCA 1QFYA 2C3OA 3D3KA 4OXXA 3L1KA 2PIDA 4E5PA 1YT5A 4ZC8A 1KZHA 4O4HF 4L07A 2ZM5A 1VIAA 1L4BA 4LMPA 4CIDA 1VCOA 4U2DA 4Q4AB 2V65A 2WYUA 1ZR2A 2IBTA 3H3FA 4KODA 1FU7A 1Z6PA 2ZZMA 4RJTA 1CV2A 3G2OA 1CETA 4R6XA 1E1CB 3VNQA 1GO2A 1ZUIA 2JHGA 3DBRB 4NBRA 4HVTA 3IQGX 1ZD5A 5GMOA 3LQ2A 2JAUA 1BD4A 1A4RA 2F9FA 3A32A 2O5VA 4R1TA 4W7IA 1U5AA 1LD3A 2FCAA 4NCAA 3K9BA 5A4MS 2JKVA 5ERYA 1SWVA 1ETHA 2C2HA 3D7RA 3HJCA 1U8YA 3NHKA 4C3UA 2IEIA 4KN8A 1N8SA 3NP7A 3NALA 2E37A 3HJNA 1D1SA 3V8MA 3MUFA 3VBEA 3E82A 1E60A 1PJBA 1U2GC 1H4TA 3C15C 3QV2A 3FGZA 1YWGO 5JPIA 2OD2A 5ICEA 4G26A 1SQ6A 5DEIA 2A0KA 1UQRA 1WSWA 2WHYA 3CPJB 4OYHA 5J63A 3VVLA 3ZU6A 4CLOB 5BOSB 4TYNA 1ZD9A 4UBLA 2Y1FA 2M9MA 4Y9RA 1T8WA 1E2EA 4NV3A 3A4YA 2JARA 4DREA 1IUPA 3BGVA 4L5JA 1Q1EA 1P4JA 4MQ6A 1NXXA 1X0VA 3PFNA 4DEVA 1ISSA 5JAZA 3IC5A 4D9KA 1M2GA 4KE7A 2Z1NA 5DGXA 3E48A 5C0OE 2CFOA 4EUNA 4JOCA 1AKUA 2WIAA 5I7SA 1Z5WA 2YC2C 1N8TA 3IAAA 2P11A 1OTYA 4EWLA 3DPSA 4YCAA 3QVTA 4JNKA 2BUAA 5FYDA 3ZLBA 2WVJA 4KVFA 4ZALA 1CVIA 2GMWA 2PUBA 1BMTA 1EDOA 3TI7A 2I7XA 4GD3Q 2R4UA 4GSYA 4ZPJA 4BAZA 5JVDA 4AKIA 1QYIA 1QVWA 2I0FA 4YJHA 1NONA 3FAZA 4BE7B 3PQCA 1JQAA 4MITA 2ZR8A 2ZCVA 3T5CA 3ESAA 2Q8NA 3HEBA 2JLYA 3SN6A 2V9ZA 3CG0A 3KQKA 1KY4A 4YRLA 1IWPB 2GSDA 3U7JA 2AF3C 3O31A 4GT1A 4RSRA 1OZGA 1XD2B 5KU1A 1KBOA 2ZT5A 2LW7A 3IHLA 4WCVA 4MW1A 3BHNA 1D2GA 1EX6A 3DT8A 5JSZB 1Q7RA 1ZKDA 3VX3A 4BJ6A 3EQ2A 3QXSA 1M66A 4W6ZA 3TAXA 1N0UA 1I0LA 2G5PA 4XWTA 2HDOA 3GVXA 4UM5A 5HWSA 5JCXA 4ZDKA 1H65A 2XGGA 1U7ZA 4V38A 4Q4CA 1O95C 2CUZA 4HQNA 1W1UA 5TT0A 3WB1A 2QG9A 4JP8A 3R5SA 4P7BA 1IBSA 1ZD2P 3TL6A 5AHKA 2XMGA 3BC1A 1KJZA 1EK6A 3ETEA 4Q7EA 2LVBA 1GGVA 3MMSA 4IIHA 4ZT7A 3LBHA 5DW0A 1Z29A 1Z5NA 5AKJA 2W2XA 5KNCA 3TD2A 1U7WA 4HMQA 2DYKA 1J33A 3SM9A 2FQYA 5E6SA 5F2NA 4ZKDA 4B6SA 1IJBA 2WMNB 3GP3A 2XXAA 1QNFA 2JRLA 4TL7A 4I50A 2J0UA 3AFNA 3H9JA 4K3UA 3BGIA 2FMHA 3EARA 4KWIA 4KYTA 9LDTA 1EFPA 1R15A 2OXEA 4AZWA 2VZ0A 3MCTA 4RYLA 3RTCA 1V2HE 1IXSB 4F3KA 1D7AA 3P9SA 4LHEA 4XIYA 4CTKA 4JLUA 1TYZA 2JFGA 5CG2A 2QDKA 1XFAA 1B76A 5CIWA 1QHSA 1BOFA 1H0SA 2OLJA 5IN4A 4NCIA 2HPZA 3GCZA 2ZJ2A 4ALIA 1YC5A 1I1OA 2FP4A 4LDPA 4KBGA 4QUHA 2CL0X 3Q41A 4KFTA 1J6UA 1M34A 2QT0A 3GI1A 3MQFA 4ZOEA 1CDEA 4JLPA 1N9GA 3ZV3A 1KFKB 2WI8A 1KY5A 3L1VA 1OOEA 2TMGA 2PD6A 1N5LA 4MROA 1F06A 3RB8A 2P5UA 1GN8A 4IVNA 2P78A 4QBHA 4GEKA 2WYWA 3AONB 3B12A 3VPFA 4EF6A 3GN2A