3SQDA

Crystal structure of human ptip brct5/6-gamma h2ax complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
211
structure length
211
Chain Sequence
MKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords PAX-interacting protein 1
publication title Crystal structure of human PTIP BRCT5/6-gamma H2AX
rcsb
source organism Homo sapiens
total genus 69
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3sqdA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3sqdA02
2K7FA 3II6X 2EBWA 4U4AA 3HUFA 3UEOA 4BU0A 2COKA 1L7BA 4IGKA 1KZYC 1T15A 3EF0A 4IFIA 3PXEA 3T1NA 1Z56C 4BMCA 4BU1A 3I0MA 2COUA 3K15A 4ID3A 2NTEA 3QVGA 2M2IA 3L41A 3COJA 3PXDA 3T7IA 1IN1A 2WT8A 1T29A 4Y2GA 3K0KA 1JNXX 2EBUA 4XQ0A 4Y18A 2L42A 3HUEA 1WF6A 3JVEA 3EF1A 1GZHB 2ADOA 3PXAA 3PC8A 3L40A 2JW5A 1CDZA 3K05A 3QVGB 2VXCA 1N5OX 3PXCX 2EP8A 3K16A 1OQAA 3AL2A 3PC7A 5ECGC 2XNHA 3FA2A 2XNKA 2E2WA 4JLUA 3UENA 3K0HA 2INGX 4OFBA 2D8MA 2HTFA 4N40A 2VXBA 3SZMA 3AL3A 2LE0A 3OLCX 2ETXA 2R1ZA 2DUNA 3PC6A 3PD7A 3SHVA 1Y98A 3I0NA 3SHTA 4XPZA 2K6GA 3L46A 1L0BA 3U3ZA 3KTFA 1T2UA 3SQDA 3PC8C 1IMOA 1T2VA 3PXBA 4BMDA 3PA6A 3T7JA 2COEA 2AZMA 3T7KA
chains in the Genus database with same CATH superfamily
1PW5A 1BU5A 2CLHB 1M6VA 2R85A 3WWCA 1W9HA 4MXDA 1HC7A 1I4EB 4YJHA 2HU2A 4YJFA 5C4GB 4ZYLA 2QX8A 3QVTA 4PLGA 2OZVA 5T57A 3TNLA 2O8FA 1BCSA 2BE7A 3K0AB 1CJVC 1Z0ZA 1UXIA 4KSCA 2QRKA 2F1RA 4QU8A 2GJKA 3LA6A 2ZRDA 3IUSA 5EZ5A 4ZAZA 4LVOA 2O3SA 3H4MA 2WJGA 3WR5A 5LCXA 2F3UA 2CLCX 3R0XA 4UHEA 3BWYA 3VYRB 4PCVA 5D6NA 2IHKA 3AY7A 1M2OB 5TF0A 5D8DA 5J2TA 4BWGA 5ITWA 3ZV7A 1NQWA 1BEUB 1NW5A 1QH8B 4UOQA 4HQ0A 1YZKA 3OO0A 4MKFA 2HU7A 2WJVA 4ND4A 4UM9D 5FBZA 3RI3A 1N1MA 4ARBA 1RYDA 2CJFA 4AUMA 2RHMA 5FYDA 1R0BA 5HSGA 2BEVA 5I7UA 3JTEA 2VH5R 4Q4JB 3OPYA 2VWPA 3V00A 4LJKA 1J0AA 1JSZA 5TRTA 4GX0A 3I2HA 4QQNA 5A4DA 2BMAA 1ZL0A 1IL0A 3C45A 4U0JA 1UCFA 4Y18A 5BYBA 2J9RA 1E3WB 4NL4H 1KK1A 3T94A 4EMUA 5JS1A 5AOAA 1UFVA 3SC4A 2VPWA 2E37A 4V03A 2SBTA 1DEHA 3BRWD 2JEYA 3SE7A 2O20A 2XE6A 3ZX5A 1U3VA 2XNCA 5EC8A 1T9GS 3AHGA 3IO5A 1DAOA 4JIGA 4CKBA 2VDWB 2FWNA 4TV9A 3DE0X 1I2CA 3HCRA 4V3BA 3CPHA 4KFCA 1RPZA 1MXFA 1CUVA 3V32A 4EHNA 3QTBA 4PTLA 4CEHA 5A4MS 2PUJA 3IA2A 3WIBA 2YC2C 4LISA 4ZZIA 1VL0A 1Q7EA 1L5LA 2ZZNA 3PC7A 5BQ5A 3TTSA 4ACAA 1XNJA 1M8JA 4LDPA 2IXAA 3L0DA 1ZVMA 2XMGA 3OEHD 1HT0A 1QANA 3K2IA 5ALFA 2QUHA 5DLQC 5C4IA 1ULBA 2HEGA 1VRVA 5B5SA 5L3RA 1Y1RA 2IPLA 3KQWA 1BOOA 2IIVA 3IAM6 2VAVA 1FNDA 5CNMA 5DNDA 1QO0A 2I1WA 2UAGA 2ZYSA 2INGX 4P86A 5CP8A 1XVAA 4ETMA 5EMMA 2WKWA 5AW7A 3HVRA 3DFZA 4I1PA 1NZJA 2KI5A 3I01A 4RLFA 2QVLA 3VHXA 1CZRA 1KDYA 1YDEA 3BKXA 3OZRA 2Y6VA 4BP8A 4B6QA 1AKUA 1YTUA 3HDTA 4HLNA 2MOKA 3JRNA 2QUJA 3HKDB 4YDHB 5J2UB 4FKMA 2WA1A 2R1UA 3IO3A 1JYSA 2XDYA 1RMYA 1PS9A 3E6AA 3EOZA 3Q3CA 4R98A 2GWHA 1JEQA 4QTTB 4F12A 9ABPA 1SUFA 4IGIA 4OL9A 3QW4B 3BT7A 1X7YA 1MFZA 1TK2A 2ISCA 3ONEA 5B12A 1RYHA 4KI0A 3KZOA 4F1KA 1NW7A 3QA9A 3PRKE 3ELDA 5TF4A 1HQDA 5LSAA 4W5NA 4K6HA 2AGVA 2L2QA 2RGCA 3E9DA 5KOJB 2W8BA 1DLJA 1VDZA 1YGYA 2B3DA 4KIJA 4MI3A 2BR3A 5EN4A 2EG5A 3D0RA 2X8JB 3MWEB 1X39A 2NVUB 4XYLA 4Z4EA 1Y82A 4HDMB 4BLRA 3TG2A 1UAYA 2ZYUX 1GRNA 1ZRNA 1EXVA 3E23A 1WXGA 4JUDX 2O2SA 1IK4A 2AF4C 2CEAA 4GM1A 4PC1A 5KTKA 1IJBA 1SQ6A 1XEWX 1CP3A 1KO8A 2XUDA 3AIKA 3CRRA 3FX2A 4KO2S 2H5JA 1ZN8A 3DBLA 2YXEA 2IE0A 3DTNA 2WNSA 4KH1A 2HCRA 2P0YA 2R00A 4HTFB 3WYAA 3KQKA 5EJFA 5IP5A 2O59A 3EEQA 3VZBA 4GOJA 4G9EA 2XQIA 4P5DA 3ZTTA 4JUIA 5EJ5A 1W44A 1ETHA 4D8WA 1HI9A 2CLOB 1NNLA 4J03A 3RSCA 3BCRA 1HE5A 5E95A 3W90A 2R5NA 4AY5A 4I50B 4CL3A 3HTXA 3K9LA 4DCJA 3DMTC 1OHHA 1XXLA 3A28A 5AXAA 1PG0A 4I55F 4L8VA 3MBOA 2QI9C 2VJBA 3D5EA 1LNSA 4IVPA 1T36A 4TQAA 5KHOC 1ZUD1 1T8YA 2OLEA 3GYBA 1C9MA 4WWHA 5A02A 3SYTA 2OM2A 3DXFA 2WF5A 3B20A 2YWRA 3ZGLA 5EPEA 1WD5A 2X1MA 2X1LA 2YVQA 3CLSC 1WNFA 1CULC 2W6IA 1C3LA 3MEQA 3N8NA 2WKQA 2ZBUA 3GLFB 1EEXB 4Z4HA 8MHTA 4MIKA 4BX8A 3J80A 1Q0TA 4DGQA 1MQSA 4KVGA 3H9BA 1XLVA 3EE6A 1KTIA 1YHNA 4QEDA 4WZZA 3RVKA 2O54A 4DMMA 1YFLA 3BBPA 1B15A 1W0JD 1TYBE 3KLOA 3PXAA 4YCMA 1KI1A 2HA3A 2CXXA 1J8VA 4N6GA 3S28A 2CLFB 2HMUA 4ZCSA 4XM2A 2JEOA 2J08A 2JW5A 3EOAI 5DK4A 4A2CA 3WGYA 2J0VA 5J2TF 3W1VA 4O2AA 4QBFA 5EHNA 2F3PA 3LLMA 4IP0A 3VZQA 3QKWA 3F71A 4Z9YA 3ZDQA 3KT0A 3KZXA 2BISA 2FFBA 3R24A 4OMFG 2YHSA 1LPPA 3W78A 1LDBA 3ZE9A 2P9YA 1ZQ1A 2I67A 1DOZA 1CB0A 1UPUA 3A14A 1E6EA 1L4UA 2JBWA 3HNRA 4TKUA 5DBOA 5G0VA 3DAOA 2OFFA 3WIEA 4BTEA 1E1RD 3GLHA 1IIBA 1D3AA 2BBOA 1N2ZA 1C9YA 2GF2A 2RK4A 4KJZA 2HJVA 3TEJA 5JQGA 2A0FA 1QZXA 2XUOA 1JHYA 4HUQB 2VYQA 1LY1A 4OLFA 1MC4A 2XBUA 2OOKA 2X58A 3GY0A 3OLCX 4MR7B 1DQRA 3LUFA 4RIIA 2GILA 1VCIA 1I3OA 4U8GA 4YO8A 4FDAA 3W3AD 4TPKA 3I9LA 2P6RA 2I2CA 2M1XA 2P3QA 1PU2A 4TSRA 4WJKB 3GLKA 3R0QA 3U4HA 3W2TA 4BX3A 2B1GA 2EBHX 5B6JA 2PX2A 1ZI8A 3DYBA 4N7BA 2ACVA 1U9JA 2C1EA 2IXBA 3HYRA 4MOWA 1H5UA 1C7RA 4DLYA 3FETA 3IQHX 3WHPA 5AD1A 5CVTA 2XUJA 4UTNA 2HWWA 4NDZA 2I7CA 3SFZA 2NP6A 2QZSA 5ED4A 1BKDR 4JEHA 4HGZA 5T7BA 2XA9A 1EI9A 4JLVA 5FR1A 4F7DA 4DQ0A 1L4MA 5DH9A 1FJHA 4PLHA 4XYMA 1NHWA 5EVJA 4R8MA 1IBKB 1MO5A 3KOUA 5EZ6B 2N3ZA 3ABIA 5DGCA 3LP8A 3R5XA 2PX8A 2OCDA 5K3DA 4OQMA 5DGXA 3FPGA 1FBTA 4U7DA 2BBTA 2VSYA 1JLHA 1YA8A 2Z6AA 3JALA 4D3ZA 1NFQA 3L8MA 2H6EA 4RENA 3OESA 1NGSA 2XWSA 4GG1A 4C1NA 2MHCA 4AJIA 3D6MA 4EUEA 4OA5A 2QLTA 5DSZA 1FSFA 2FQQA 1COZA 1ZAKA 3LUKA 3QBEA 1RYZA 1H3EA 3GGJA 1J2JA 3S3TA 5D85A 2HHJA 5DEOA 3UPDA 3M89A 3U62A 4PG6A 1MO4A 4FCVA 1EX1A 4M9QA 2FF7A 3KBOA 2GPJA 3B1JA 4DSZA 2NT4A 1U0HC 4MRVA 3B2EA 1ZONA 2VF8A 2D06A 3H9CA 3U4CA 2B1IA 4ZDKA 3A7DA 4JBYA 3E5HA 2HMVA 4R7TA 1RQXA 4QPPA 3PC2A 5A3QA 3GJ0A 1JYEA 1J25A 4P58A 1CJSA 3S27A 5BV7A 2ZRKA 3LF1A 3NGLA 4OQEA 3AF6A 4KYVA 1JT9A 4REQA 2WVHA 4HNUA 4A7PA 2I2AA 4Z1OA 4IHJA 1RHUA 4TMFA 1XK7A 4JCCA 3KQNA 1QKKA 4PSUA 5L6LB 5CJ2A 3GNSA 3E4DA 4YAIA 3GH1A 1R74A 2P9QA 4YAGA 4DNOA 1R7RA 1ULUA 2P9CA 1PNQA 4KAXA 2DT8A 1UDWA 5IDWA 3GLTA 3QG1A 5HEKA 1U3UA 5JHGB 2QBYB 2O4UX 2F1JA 1L9XA 4RHYA 3DT9A 1P18A 3B1KA 2NU8A 3QX3A 3O3OB 2CK3D 3EH1A 3F4LA 5BVGA 5JJLA 5K03A 1NW4A 1Y3DE 2A5DA 3CVYA 1OE0A 4C21A 2JHPA 4ZVNA 3MUOA 5AHRA 1YQ9A 1TQ4A 1JNYA 5T6BA 3JXEA 4Y2JA 4EPWA 1U28C 3IKMB 4W1PA 2LP4Y 4Y6PA 5BUSA 4G24A 4M9UA 5AOBA 3QV2A 3VR5D 1Z8NA 3TAHA 4A92A 5JCOC 3P96A 3BXZA 2C58A 1Y34E 3M4JA 3UMSA 4RHCA 2I2WA 5ENVA 2BEUA 1DVRA 2BIFA 2HWYA 3OIGA 1P0CA 2OHOA 5DRYA 4I1UA 1K98A 5CB6A 1TNDA 2CJWA 4CQMD 5EJ6A 2WD7A 3H4VA 2I7TA 4CR6A 5AK0A 1WX1A 2W4MA 3MWJA 4AJEA 1UPBA 3N2GA 2VNAA 2P5UA 1HKUA 2BFDA 4TZ6A 3HWX1 5C7YA 3I5AA 1ULSA 2J6HA 3KTFA 1TIKA 4WK6A 1W46A 4I5GA 1HE3A 1GU0A 1KI6A 4EELA 2HCFA 4YHHB 4PSVA 1VJ0A 4FX2A 1OBOA 2X5NA 3FPBA 1RAGA 1YR7A 3E9QA 3ND5A 2WA2A 2Q5EA 4PSCA 4F1JA 5JQGF 3NDRA 5A4FS 3WLLA 5EIEA 4OJTA 1PZNA 1ZGJA 1TKRA 3Q0IA 5JSUA 1Y48E 4HNAB 2PUGA 3TQRA 1RQ7A 4BLUA 1E4OA 1VKHA 1TPYA 2JAPA 3A8TA 1FNNA 2ZOSA 1XTQA 2XA1A 3DMRA 1H2FA 1QOQB 4L02A 4Q4LA 1POWA 1C1YA 1MD9A 2ZRMA 3DR3A 3PFWO 1UBUS 2WIKA 1V5FA 2VYND 1GFZA 4OGWA 3UJNA 2JKYA 4ZAWA 1LBHA 1ZESA 1PK7A 2IP1A 2J5RA 1Y6GA 2J67A 1NYLA 3NBQA 1JH9A 2F8SA 4ZEVA 1XMIA 4GT1A 4R7ZA 1RHKA 4KDCA 4HN2A 4ZOCA 4F56A 4BMZA 1UBRS 3MBKA 4LV6A 3HS3A 4OYHA 1TM7E 4WVFA 1IHOA 3FJ1A 5DTMA 1G7RA 1NJSA 2CFCA 3R6TA 4G9GA 2KJQA 2RH8A 1P77A 3NHBA 3ZDEA 2C59A 3DL2A 3JWGA 4UEJA 2VQ6A 3TZLA 2DAPA 3L8CA 1YIAA 2V6BA 4BPRA 5DDIP 2FE1A 1XF1A 3HB9A 3INYA 2C84A 2Q2VA 2OFPA 3GUVA 1WBBA 3NH9A 2OHGA 2WV7A 2AZXA 1CQXA 4YMUA 4Z7JA 3H65A 5FOVA 2CFIA 3VC3A 3H8VA 4J6FA 1ENPA 3O1LA 4JI6B 5CB0A 3IPRA 1QGUB 3FW1A 3CUVA 3H1EA 2GFQA 5BMVA 1VQ1A 2WP8J 3TLAA 3OLVA 1Z16A 3NBFA 1YU6A 1VIDA 2O3QA 2RHGB 3A4MA 3PQCA 4FFSA 1DKOA 4P3YA 3IAS1 4R5HA 3SKXA 2V7QA 4NJEA 3RTGA 3X43A 1ZNYA 4AZTA 5HQTA 2B0CA 2IOFA 2AQHA 1JLLA 1FUYB 1GL9B 2Q5FA 4IGFA 4MW9A 1DXQA 1EWQA 2O8DB 3VR6H 3I5UA 2OVBA 1UBCA 1Z26A 3BZUA 4S35A 5HIIA 4LJ7A 2C97A 2R6ZA 4HNVA 5KWSA 1P80A 3PUZA 1LQ2A 5DXJA 4OF4A 3VR1A 1Q5PA 2QTRA 2PLRA 1WMBA 5CW1A 2BH9A 3HP1A 1B8UA 4B80A 1OROA 4DXAA 4XGIA 1CUIA 2ZB8A 1HQCA 4KYUA 4YI3A 3CB4A 2J33A 2Z6UA 5AK6A 5G02A 5HDBB 2C7PA 3WGKA 5CLJA 1Z45A 3OCXA 4QWMA 2IWRA 2YV5A 5A5GA 2FMUA 3AERB 5F1OA 4BGDA 3QI7A 3SEQA 5JCJD 2X3FA 2IXDA 3JZIA 1V47A 4E7OA 2E6UX 2WU8A 2BFWA 5UKDA 1QGOA 4E30A 3C41J 3OD5A 4HCJA 4TSFD 2IQIA 3FWPA 1KO1A 4JLDA 5DSTA 2WTAA 2WDPA 4FYXA 3L7IA 1G8HA 5K2OA 5BOSB 1ELOA 3E7FA 2REOA 2QE6A 3E5MA 2WM9B 4QUIA 1WEHA 1Y7PA 3L1KA 3KM0A 3NWOA 2HJGA 3OTGA 4LJ5A 3D2BA 4MIOA 4MPPA 5M5BA 3M7IA 3T41A 3I45A 5FI3A 4QDKA 1O54A 1ZD4A 3KCQA 3DLCA 4I4IA 4OH1A 1AS3A 3AFGA 4YRLA 1DEOA 5IKMA 5JMWA 4AD8A 3L43A 5IASA 3ABQB 3FPJA 1G19A 2WTNA 4C3ZA 2DLNA 1ZN2A 3CZ5A 4WESB 4LMAA 5J40A 1TQ6A 1W87A 5HK8A 4IDBA 4IV5A 1I4LD 3CWQA 3I5XA 1N6NA 4PIMA 2P4EA 4MS4A 1OVGA 3DT8A 1CEYA 4CMEC 1DMRA 1SCKA 4ZVQA 5KYWB 5IJ9A 1QR2A 4NICA 1Y8QB 1XHEA 4YJ3A 3AINA 5GTDA 1G3IA 2BHRA 1NRXA 3KUKA 1G21E 1SA0B 2WWHA 2PR2A 2Q6VA 2P65A 3IYLW 4ZQFA 4EMTA 2XE7A 2OCIA 3JSAA 3VHRA 1RZUA 3TW8A 1UK6A 3DVSX 3VVBA 2O57A 4KQHA 3UGQA 2AVNA 3GJ7A 3KOXA 4JVNA 4LZPA 2QX6A 5LD2C 3FDXA 3VKHA 2V6IA 1WLSA 3KU1A 1VCNA 3LS2A 4BE4A 4DT1B 3RAEC 3AEKA 5CH8A 4F3TA 4KW7A 3IXLA 2QD5A 1Z4JA 3WLPA 2VBCA 1U0TA 3AGPA 4F3YA 1PZHA 3NHMA 4X71A 3VJLA 1E6LA 2P8JA 3R44A 1T9AA 1XTSA 3TQCA 3EJ6A 4E3ZA 4GPIB 2VAXA 1I8TA 4KXWA 4C78A 1EVQA 4MS3A 4P7JA 5HJ2A 1AF7A 2XWJI 3DTVD 3LUGA 4HDCA 5ES3A 4H3VA 3I8OA 1RZRD 1C30B 4JI0B 2XLCA 3UBMA 2CXPA 4PZDA 5G4LA 1XYVA 2ABWA 3M9WA 1VLJA 4H7EA 4TT3A 3ID6C 5E7JA 1E20A 1ZRHA 3ZZ1A 4D9HA 2UUBB 5DN9A 3NHKA 2RAFA 4LK3A 2O4CA 2FSGA 1AQIA 1FFWA 3AR2A 3DXXA 4XW2A 3C8UA 3OEWA 2QENA 4MPJA 3NHFA 1S2DA 1JIVA 1V3TA 3G7UA 1R5JA 3IBYA 2J3QA 3UFBA 2XGJA 3D1LA 3G2IA 4RS3A 4YUYA 3JARA 1U5BA 1Z6YA 4P0TA 1HEUA 3RT7A 2WZBA 2QTHA 4FFBB 4ICIA 4J3JA 5EPUA 1KC3A 3NRJA 3DC2A 4ZU6X 3H5OA 4AICA 2KBEA 4YAUA 2BRUA 1A88A 2AJTA 1BIFA 5BSMA 1RJ9A 3HSSA 3KKKA 1AXRA 1Z15A 3LA8A 3F3SA 2R6CA 1A8HA 1Z73A 1F0PA 1WP4A 1IZ9A 2I8AA 4V02A 1EBBA 3LT2A 4H7PA 2YIJA 2WF7A 3LDHA 1QK5A 2ZWMA 1XXHB 1XPRA 3TCXB 4PYNA 1U0OC 2JATA 2Q7XA 2PRYA 2BGTA 1JDBB 2QL6A 2W11A 4I1RA 4NEQA 4BVFA 3N2NA 4YGYA 2P6OA 3ZV3A 4B71A 2GJ4A 2IV2X 3QXSA 1WA5A 2OB1A 3WIUA 5H5JA 1TVKB 1CYDA 5JU6A 1WVMA 4UC0A 5K3SA 5ALPA 1OIWA 3G82C 3L9XA 3DEAA 3IIKA 1E6UA 1N0IA 5DP2A 1M10A 3ZJTA 5KSWB 1ZM3A 4C0BA 5MN4A 4YUXA 1IEWA 1ORDA 5KVVA 4MW4A 4GNRA 3BXFA 2JBAA 4I9UA 4NYIR 4OQQA 1XJWA 4PQFA 2HGSA 3TXAA 1KAMA 2IUUA 1KOGA 1T4BA 3MJEA 2BFOA 3BM5A 4Q3LA 1JDBC 4X1IA 4PS1A 3FNIA 2HCTA 5BV1A 4A6EA 3UHJA 3E3OA 2NO0A 3U7GA 3TD9A 3EA0A 2CXRA 5DULA 3IEUA 3RF6A 4BNXA 1EIZA 2W5UA 5TQ2A 5H70A 2V4MA 2V65A 4I3HA 4YV0A 2IYSA 3GARA 5HF6A 3ESCA 4GKBA 4L75A 2AHRA 1L5GB 3FCOA 4FCCA 5BYJA 5EA2A 5F7XA 3B78A 4U4AA 4WSOA 4DQDA 4YEDA 2YIDA 3U4QB 3F90A 2JFGA 2X77A 1Y3CE 4ZXFA 4TXJA 3UV7A 2ZR0A 1YVEI 3ZU4A 1L7BA 4R71A 1SG6A 3OJEA 3WRYA 3K70B 3DM5A 3EW7A 3QYAA 1CUJA 3W9BA 4D99A 2GMWA 5AW4A 1DFGA 4O25A 2RG1A 1PVDA 3QPVA 4MV0A 1KZHA 3PLRA 4RZQA 2QRZA 4FW9A 4E1AA 2E7ZA 4S24A 5SZIA 3GLSA 5IARA 2DFVA 1NQVA 3NTVA 4R1TA 3SF0A 4B3HA 1I3LA 1XTTA 5INTA 1WF3A 1X86B 3PEWA 1KEEB 2AH5A 3NKVA 3HDHA 5HS6A 1MX9A 2FPIA 4CG0A 2CNDA 2H4JA 2O1WA 1BMFD 3WGIA 2CMHA 2BKUA 1SXJA 5HVNA 4L28A 4NEGA 3NUZA 3WSTA 5JXHA 3RAPR 4K87A 4R2HA 3K70C 4YJ3F 4M7RA 3RANA 3KVNA 2FEWB 3Q0EA 3VMFA 3WZLA 1DC5A 1HE4A 1LBSA 3ENVA 4TT8A 3L6BA 5IHXA 3ZI7A 1QO9A 3PR1A 1WZCA 3M49A 1FQWA 4MS1B 1O6FA 3T9CA 2BTEA 1RZ3A 1WF6A 2JJ2D 3CEAA 2W58A 1G6HA 5LUAA 2M6RA 3E3NA 3M9XA 4MJXA 4Z4QA 2JFFA 5GMOA 3PX3A 4HEA6 1HE1C 3U1VA 4AWXA 2XOKA 4AUEA 4ZYUA 3FVQA 4L8LA 1BQEA 3FUTA 3KQYA 5JJ5A 2AJCA 3FD8A 3H97A 1IG0A 1G8SA 1UKZA 2ET6A 1NU8A 1YRBA 3VHLB 2DTDA 4KUHA 1UBMS 4JOQA 1JSCA 1ZCBA 5KTPA 1DKQA 3KB6A 4F5EA 3D4IA 5BR4A 4I1OA 5DHQA 1N0VC 1H8HD 2FOLA 3H5AA 3SS7X 3IIMA 2ZUTA 1JQKA 3H83A 2W43A 4J1SA 4XEUA 1Z68A 3DE4X 1CE8B 1Z0FA 4GBED 1MHTA 2X9LA 3NORA 4ZV7A 4JC0A 1RQNA 2G5GX 1XDGA 2TMGA 4K05A 4PQYA 5DNAA 3SQOA 3VOSA 2WMYA 3CUWA 3I0ZA 3ZU3A 4BNUA 3ESRA 3OQNA 3U09A 1HMPA 2XT6A 4H27A 3JYNA 4P3OA 3PHGA 1LQUA 3SF8A 4P3PA 1N8KA 1XZHA 2CNOA 4FINA 1WB9A 3K73O 2Q46A 1L4NA 2CB0A 2XE4A 3I1JA 3DEIA 3ETCA 4FFMA 1GPH1 3K0HA 1NL3A 2DUJA 4C7VA 5I7RA 5IABA 4MKXA 1YQEA 1FS6A 3DV9A 4Z0HO 1VHWA 3NT5A 3W9UA 2J7KA 4EG1A 1XRSB 2O0MA 3F8TA 3O4GA 2VT3A 2F8MA 5FPPA 3IKTA 3B3GA 3PC6A 4UDNA 1T4DA 1E1QA 1HETA 3RK1A 3RBVA 1ODTC 1H2HA 4MUIA 5D1NA 3I9JA 2NSJA 3FCCA 4QTUB 1RWKA 4BKRA 3IJRA 4IQ0A 3C87A 3KUXA 4CYMA 4EHKA 1QF9A 3A1WA 5E1MA 4AP9A 4V0MA 1QU3A 5JG7A 5FBLB 3LQYA 4F9FA 3B8EA 3CW9A 2ZUBA 3E81A 2HQOA 2EDCA 4RVOA 3CZRA 1EA7A 4RBNA 4Y1RA 3OOHA 2HSDA 2ZPUA 4DLBA 5ITSA 1NOJA 1TZ2A 5E0KB 4KLZA 4QJ5A 3OSZA 1M1YB 3D0KA 3G68A 3CG4A 4UHJA 5JATA 1ESDA 3QVXA 1U2EA 2H52A 1HG0A 1SXHA 3LPDA 3ELWA 5JS8A 1Q0PA 5BN5B 4L0MA 3VAZA 2XD9A 1Z6AA 1Q1QA 4B9AA 4DSOA 5KOHB 4BVJA 5HIAA 5JSYA 3AG5A 2DPYA 1W0KA 3IQWA 1OC4A 4FIDA 4L3OA 4OP3A 4PLYA 4WEOA 2TECE 1A9XB 2MU1A 3LHFA 4OFXA 3ZXUB 2ZTSA 3UJ8A 4WADA 2C2OA 1KU0A 2D7CA 4A8PA 2IIBA 3PRHA 1YJAA 4HR7A 3AVYA 1OXKB 2OM6A 4D1YA 1RC0A 1VYTA 2CFTA 2H4YA 1J09A 3UAVA 1V25A 3C6BA 4CKEA 3V7WA 1XHLA 3F2IA 4X20B 2XEDA 2QVBA 3DGEC 3DMGA 3ESBA 1C8LA 3BA6A 3QU5A 4DE5A 4CMKA 4BKMA 1OXVA 3GHYA 1YRHA 1GRRA 1O9HA 4R0VA 4CDMA 4FUQA 4YPOA 1DTSA 3HBAA 3LZCA 4U5XA 2HLNA 3LT4A 2GZ2A 4PO1A 4BLOA 4CMHA 2QD3A 1YVPA 1ZGZA 3D3NA 1V8PA 4I1IA 5CITA 4CLDA 5HQ3A 3I9V1 2R8RA 1C7JA 3QNUA 3X1JA 4AZ0A 3JAMA 2OO5A 4TVSA 1DT5A 3ADDA 1MRSA 2HU8A 3KEFA 1QSGA 1XELA 3ETJA 3KALA 3AI7A 2DH5A 2ZAGA 3JR7A 1ZOSA 3KOZA 1BQ4A 4JSRA 2J07A 4D92A 5GINE 2KHZA 1OLUB 4W5QA 3KQUA 1I24A 3DE7X 4HXYA 1KSGA 4MQ4A 3B6MA 2RHTA 5H0IA 3D8SA 4CFSA 1KI9A 1LJLA 2RGUA 2W42A 2XKJE 1DCTA 1H3NA 3UG7A 1V4BA 3QEMB 4X95A 3UN1A 4ZGGA 3NIDB 1U0GA 5F9FA 1N6HA 1BROA 4WQMA 2I62A 4ARZB 3BGOS 4KR6A 5AOCA 1PG5A 3ADPA 3KJQA 2UKDA 3NV7A 3QWHA 5SY6A 2M6LA 1ZJ4A 2WU3A 3IAM1 5CVDA 4DIEA 4RTKA 3DKKA 3KZVA 3A9CA 2NXCA 4O8CA 3FGZA 4MP8A 4DSAA 3M6IA 1VSTA 2BOVA 2YV2A 4Y2PA 3A9WA 1E5XA 1HKHA 3N8KA 3PR3A 3Q8XB 3PQ2A 3PUJA 5EGSA 3TAXA 3WBFA 4ATNA 1JHOA 1UMBA 3B5IA 4WNAB 5I3ZA 4TS4A 1D4FA 3UCFA 3S1SA 4H4DA 1JB1A 4ZANA 1KDOA 3OFNA 3FDIA 3GJRA 3ZHTA 1QJ4A 3LPMA 1UANA 1BU8A 3QKSA 1I6LA 1WQ1R 2IL1A 3KE8A 4WUVA 5LXTB 2GDZA 3PXGA 3EGWA 4CV0A 4CMJA 1E2JA 1H69A 2XF2A 1ZI6A 3CJQA 2C83A 1M6NA 3ROMA 4RZHA 4U5QA 4JJ7A 2H7XA 5T5QA 1NVFA 3F7MA 2OWEA 1XAGA 2V3WA 5JNLA 3LLCA 2OORA 3VMMA 4JDPA 2FVYA 1YE8A 3NP9A 1VJ5A 1Q3HA 2VRNA 3TPFA 5CCXA 1PRYA 4EEZA 3JD0A 4DL9A 2CNKA 3DMYA 4IDAA 3E35A 2EP7A 3N53A 3IP3A 2VZ0A 1TUBA 2F4VB 1L3CA 1WIWA 4DDUA 5HRCA 2H1WA 4JZKA 2GZMA 3F6BX 3U6KA 2DFNA 3PKZA 1HDOA 1XMOB 4DAEA 1JQJC 2O5VA 3EZ7A 1YS7A 3E8SA 2QZ4A 1HRKA 3DFUA 2W6MA 4FLEA 4GLBA 4ZQBA 3SC6A 4LY3A 3O8BA 4LGMA 1DXYA 2P2LA 3L0PA 1T0IA 2OCXA 3LT1A 2ETVA 4MROA 4AO8A 5C7IO 3KEGA 3ZBQA 4OQPA 2C2YA 2X0KA 4OLHA 3EG9A 1ND5A 5FWAA 3VZPA 2WF8A 2ROQA 3BWDD 5EE3A 4MQLA 5IEBA 1HA3A 2W2KB 1TCVA 1T3TA 4MGZR 3M70A 4GIBA 1T4CB 4TM7A 4RELA 4ZI5A 1XUOA 1XA4A 3FTCA 4GZMA 2NUTB 3RFVA 3E7PA 2HSJA 5LP6A 3ZHRA 1W5AA 3GUHA 5JBQA 1WUIS 2GPAA 3FDZB 3N87A 3PIDA 1KI8A 5TPZA 4CHGA 4AF7A 1TO2E 2X42A 3HJGA 5TQJA 4ALNA 2AX4A 1QE5A 2PTHA 2R97A 2VUUA 3R5HA 4FILA 4M87A 4QX6A 2P90A 4HN4B 4HTAA 5J43A 2B4KA 3EXFB 3AR7A 4A2WA 1Z88A 2WJAA 3IHLA 1ZW1A 2XTNA 2PFGA 3VSCA 4US2R 3ORHA 4KMMA 1BFDA 2P41A 1KJNA 3FKQA 4LW8A 3IP6A 4MVJP 3ZVNA 3FPAA 2EJVA 2C20A 4LHEA 3ZVMA 3A4NA 1N5OX 1UKBA 2B4YA 5JNWA 1UXOA 2HFJA 2IYNA 3HJUA 3FMPB 5IC6A 2ATCA 4OPMA 4RWEA 2BC9A 4QOGA 4R4JA 2OV1A 3D7NA 2GM5A 2HAEA 1AN0A 1P4SA 3IR5A 3D43A 4JJ4A 1KFJB 5G0SA 3LTEA 1G4UR 1R8YA 1O95A 5FNVA 4LF5B 3QP9A 2JCSA 5U4XA 5CUQA 5IJ0A 3DBHB 1XVLA 2JZOA 4H3KB 4NECA 1E0AA 2CDCA 2QLFA 5B1HA 3PCTA 2VRBA 4X94A 3ZY3A 4Y2UA 3RRYA 2B21A 4HDRA 1I1NA 4OIMA 5DNCA 3H6HA 3MAJA 5LM3A 2HMYB 1WS6A 2PKWA 2RDMA 1E6KA 1U1EA 1SUBA 3EVBA 4N1AA 1C7ZA 1T3HA 4D8TA 2A3RA 1NBHA 4DUGD 1MJ5A 2OAP1 4ISBA 5J63A 1DWOA 1FZQA 4JC4A 1DS6A 1GNRA 1P7VA 1RRKA 1NJ2A 3PHBE 3INRA 4JT4A 3RUHA 3OWOA 3STTA 1GAXA 3LY7A 4DNQA 2Z58A 4XWWA 4P38A 4EBFA 1Z2PX 4UXHA 5FUXA 4ZI7B 1N3LA 3L8YA 1AJEA 1FX0A 1G2OA 2IEYA 5C5CA 3Q8LA 1SVWA 4BL5A 2J9FB 2PMBA 3V9PA 2ZUEA 4A1OA 4RTRA 4QRHA 3L5OA 4RVGA 4GDMA 1E9VA 2VI5A 1IMOA 1W85A 4ODIA 1U2QA 3IQXA 3V42A 1GM5A 4I1SA 4IIXA 4M1TA 4QO7A 3OHPA 1BX0A 3L5KA 3UJAA 4YYEA 1VJGA 2I3BA 2ZS7A 3DF9A 5FIUA 5GVSA 4IEFB 2Y71A 1L2TA 4YLEA 2WAYA 3RSGA 3AUYA 4Z4GA 1JKIA 3GZ4A 1FB5A 3N28A 2RBKA 2A5GA 4LRUA 1U0FA 3GDFA 5E9AA 3F2VA 5K3CA 4A2PA 3SI7A 1WDTA 1IZ0A 3EIXA 3O8QA 1YK0A 1TF7A 3PL5A 4OFWA 3HUTA 2QYOA 3MAGA 2OENG 4ZEMA 5MF6A 3R5SA 1KPGA 4L07A 2XQVA 2ZE8A 3SOZA 2R2AA 5BR8B 1NM5C 2VJLA 3Q41A 4QFCA 3FHCB 2WM3A 2X7JA 1NKTA 3MWKA 4YFVA 3SZOA 1R8SA 3ZKWB 4CV1A 2LCFA 3LBFA 1CUZA 3JQPA 3PRYA 1MCZA 1G8AA 2NTVA 1T8PA 2UZ1A 4GX5A 2RB4A 3AZQA 3HA3A 3O1IC 4NONA 3V7NA 1X7XB 3LPNA 3KS9A 4G1CA 4OK6A 2C8KA 2OT3B 1Z33A 4EHIA 2UXCB 4N8EA 4OHVA 3WA6A 4EB6A 5J4KA 2IY9A 1V16A 3K6JA 2B1JA 1NVUQ 3V7UA 4YCCA 4BN4A 4QDJA 2QMUA 4ENTA 4BCBA 1YZ3A 5KJ6A 3JRXA 1W94A 1WXQA 3JVEA 1TA4A 2X7XA 5E7MA 2IRWA 4LCBA 4IKEA 4ZEOA 1YI1A 1H8EA 4OSPA 1RWXA 3KO8A 4YRSA 4KIFA 5I7FA 4YMIA 3AY0A 5CDSA 1ZG3A 1LTKA 1TM3E 1F60A 4IJ5A 1U2PA 4EKGA 2G8LA 3FROA 1IHYA 3H86A 4QIHA 1X13A 1WPXA 3RRFA 2WZQA 5DMHA 1NTRA 5EIOA 3WRWA 4EHLA 4S05A 4KR0A 5F3DA 3KQVA 4JDUA 3TWOA 3AETA 3A37A 4MMZB 3VJKA 1WM1A 1YUMA 3ZCUA 2AYZA 1T9DA 3CF4G 1L6RA 3GH3A 1AXEA 4V1CB 3UKOA 2YHAA 2PH7A 5AI6A 4YS6A 2ZCVA 3FHJA 5LP6F 4TRNA 2PZFA 3BH6A 5BSVA 2O7QA 4NPAA 4Q66C 3H11B 4RL6A 1V1RA 3EXEA 2PUAA 3G49A 3QBDA 1P19A 3JQ6A 1N2CB 4OGFA 3WK4A 1HRDA 1LWNA 2A9VA 4PZPA 2GTIA 2C7OA 4HWPA 3JD2A 5JJKA 5BV0A 1XB2A 1ACLA 3R20A 3F8WA 2YFQA 1KYYA 2FWPA 3WL5A 1GSOA 4JXZA 2C4MA 2J9XB 5KYYA 4F86A 1DIAA 3QPDA 2XAAA 5CTJA 4HLCA 3L1VA 4M89A 5CDGA 3MWDA 3ES9A 4D97A 1EK2A 3CKMA 4Y2RA 1N9GB 4L73A 2ZP1A 3IULA 5LNK6 1XTPA 1W34A 2W6NA 3NNNA 4KIUA 2UZAA 3PC8C 1EYZA 3GCGA 5FNVF 1GGNA 6NULA 3VDRA 3QVLA 3U44B 4J16A 4F4HA 2PXAA 2PR7A 1PHRA 2XYPA 3D8HA 3C4QA 4X7BA 3UH1A 1DELA 1VP9A 5JYEA 5HRUA 2B8JA 2NTYC 2ZULA 5ICCA 1UDAA 2DRIA 2IYXA 3ELBA 1OTHA 3JQFC 2Z5GA 1KE2A 2FRDC 3L1IA 1K63A 1WCV1 3SXUB 5TGTA 2PSEA 3RFXA 3DAHA 3FHLA 3WGNA 2XZOA 4OBEA 4RVDA 1STOA 3LC2O 1H6AA 1XHFA 3VC1A 4OH7A 4KITB 2PX6A 2A78A 4KPFC 3LDFA 1ML4A 2YS6A 3N0VA 1QP0A 2NNLD 3HCOA 3ZH9B 3OA2A 4RTSA 3A6DA 2ZUUA 4WUTA 4WK2B 4BO8A 4CF6A 3IT2A 3BXXA 3AW8A 5JY1A 2JJYA 1USUA 3GT0A 3R4CA 5BW6B 5CTAA 1U1GA 4ZREA 2R5FA 3I2GA 1ZO8A 4M98A 2ZR9A 2WE7A 1I14A 1R64A 1IN1A 2QB5A 1KY2A 3Q7PA 3ENKA 3FYUA 4RHUA 3WC4A 3RCBA 4B73A 4OI1A 3ANLA 3FVWA 4P3XA 3PWKA 4GLFA 1YB6A 1XAJA 1I6KA 2QOEA 2E85A 2QPOA 1PF7E 5BRJA 2VH2A 4R1PA 4KE7A 4XVRA 5IYZA 3OQOA 3N0WA 3H2HA 3HP4A 3Q98A 1OIXA 3TL3A 1YU9A 1OA0A 1OZHA 1YQDA 3PQDA 2QRHA 1QG2A 4IVRA 1ZOIA 3O8LA 3HYTA 1MZVA 3EX7C 2AFHA 3C15C 3QEOA 1IXSB 5GY7A 1TF5A 4M9CA 3WLOA 4PHTA 3H4IA 1H4SA 2CXOA 1GCOA 2GBPA 1SOAA 2WJ6A 2ZUDA 3C1TA 4O4JB 4RF5A 1MB9A 2V0NA 3HG7A 4FI3C 1MNAA 3IMCA 2NZUG 1N9KA 4J0JA 4CTKA 4FE7A 1JN0A 2REXB 1ZR2A 4H35A 4K86A 4DGSA 1N7HA 3S2SA 3I8XA 1GLNA 3NZEA 3QMPA 2JH3A 5J3JA 1U63A 3I8SA 4LWOA 3S2YA 5HOQA 3CLSD 3KHUA 3AFOA 1THMA 3IPCA 4J49A 3ZY6A 3ZIAA 4IDOA 2F1IA 2J3KA 1CR6A 2VKQA 1UKCA 3EMKA 3PD0A 1O6CA 1UFQA 1RLIA 4BLWA 1QC5A 1R6BX 4G01B 4G1VA 5HW0A 3PZRA 1UFRA 2ZYHA 2XV1A 5EP3A 4GPEA 4DCSA 1VXOA 4YRZA 1Z3CA 1ZK1A 4YCAA 4F4JA 3WGQA 4QSMA 4TWAA 1UM9B 3F74A 4RKYA 2B92A 4BE7B 4YRGA 2VCHA 2ZYIA 2YFHA 1U2DC 3B1YA 1OXXK 3NGMA 2BTQA 4WZBB 4YECA 3CRVA 3VC2A 5KOIA 1QHGA 1MT3A 3SX0A 1T5TA 1E4VA 1NLZA 2X0IA 3KJIA 4MA4A 1SZDA 1A98A 2VJNA 4KWCA 3N7TA 2JAXA 3F73A 2PUDA 1TJNA 2YWJA 2GCGA 3DL7A 3IMEA 4HGNA 2R84A 4MA5A 3RRNA 4OMDA 2X8LA 3DDWA 3TX2A 3WJAA 2D6FA 2HV8A 4G5GA 5LMNB 1LLFA 4FFDA 4QYWA 1RPTA 4QKQA 2V8BA 5L6MB 4Y2HA 1XN4A 4DYVA 1P9RA 3MAAC 1SUWA 2OFXA 3OFJA 4LVCA 5DK6A 5A5EA 3B52X 3JZFA 3PA6A 4HGRA 4PPNA 3QXCA 3NG1A 1HSOA 1EXNA 3A36A 1O94C 1XZEA 4L5YA 1KDTA 1YB7A 2VUHB 1XZPA 4PANA 3WHIA 3RJ9A 5TIIA 1DC4A 4MDHA 1SKUA 1AA9A 5BWMA 1YFKA 1OZAA 2RGXA 2HCJB 1H2ZA 4G37A 5EJIA 5CLFA 5TR9A 1NJGA 4JBIA 1J06A 4KGXA 3LUBA 4W8HA 3T3PB 1Y0BA 4BNFA 1NBIA 2EDAA 3CUSA 3ZHUA 4B40A 2ZXFA 2Q7OE 5ABPA 1RS0A 3OMWA 2VPPA 4G0UA 2SECE 1UR5A 4ID3A 1T1GA 2W7TA 4NDAA 3CH7A 4R40A 1CU1A 1YR1A 2C5LA 2PKQO 2NIPA 2AFIE 1TM2A 2QVXX 2GCIA 3HY3A 3PPXA 3CO0S 4WJZA 4BMOB 1PLJA 4TYYA 1X1RA 2B35A 1QIFA 2GAJA 2R8BA 3DE2X 4JL5A 2DP4E 2X5OA 4CQNA 4ISCA 2Y1KA 3BIFA 4KZKA 4L0DA 5CYGA 2PS0A 3RVMA 2HCBA 4WRRA 3WISA 5ELLA 1X8JA 4XRGA 4TTAA 5F3WB 1CS0B 4V0SA 3NWBA 2Q41A 3DF7A 2RGAA 1WO8A 2PMDA 4KDFA 1TQHA 2VJDA 2YCLA 3GP8A 1QB8A 3REQA 5AM0A 3DWGA 3MD9A 1JEYB 4B35A 4P33A 1TO6A 4ZDIA 2OCKA 1LXCA 3ZCRA 1ZD9A 4B87A 3IEKA 3ODPA 5ALWA 5JD6A 3CNQS 4W5RA 1OPXA 1GAQA 3EDMA 4YCBA 1YACA 4D43A 521PA 2XVYA 2PSSA 4FD2A 3WKDA 1KHHA 2OCYC 4TM8A 3ZKAA 1UOPA 1H1LB 3VKGA 5D3MB 2RFLA 2H0AA 4O0LA 2FMFA 2IYEA 2EP5A 2CL0X 4RV5A 4JHXA 5EWMB 2G4VA 4YJ2B 3U7QB 3VH2A 1ZUNA 5JWHA 4ANFA 1RXUA 2QRPA 1ZITA 1N3YA 2GHRA 1EVYA 2GCOA 3ABZA 3AYXB 3QU2A 4NCHA 3T7AA 3W8FA 1KJ8A 2HXYA 4RM3A 1I0IA 4AJOA 1Q92A 3VU9B 4ZI3A 2FSFA 4JQSA 5DW0A 1JFRA 3OZAA 4UBKA 2A7XA 2B0JA 1H2XA 2HNKA 2XCLA 3KLBA 4R1OA 4ZOLB 5IYZF 4CM9D 3CURA 2J59A 1TT5B 1U5CA 3HBFA 3E84A 3GLFE 3ZLBA 1Z2AA 2Y9PB 3ER8A 2RI0A 2F4NA 1M7BA 1R66A 1MABA 1BJTA 1K3UB 2GB4A 2PKYX 2R751 3IUQA 2LBPA 3E0XA 3LY5A 1YR8A 3OEED 4OFBA 4BQNA 3WP1B 8ATCA 3L4JA 2G7ZA 2LXNA 4HKTA 1J8MF 4K9QA 1M5UA 1Y1KE 5DNWA 5BOSA 4D26A 2CW5A 1PQYA 1CJUC 3F0TA 5AKXA 1XQWA 5AQEA 3ZOKA 2ZIXA 2FX5A 1TQ2A 1M2EA 2YCBA 3VZCA 2IYRA 4QUHA 2P4UA 4X7PA 4WH0A 4ZYYA 1NBMD 3BTSA 5C2JB 3F7OA 2AG8A 3CJTA 1HDZA 5ALOA 2EJWA 3LX4A 3ZOZA 5D87A 5ILOA 2K6GA 3R9WA 1HY3A 1IDN1 3ZDDA 2XH8A 2ZRJA 2FSVA 3BD7A 3VSDA 3A04A 4ED9A 4J7CA 3IE1A 3ICOA 5LQSA 2IU0A 3JYPA 3CNNA 3Q72A 3G13A 3NV9A 1J0CA 2J0UA 2YZ7A 3LX8A 2XCOA 3MQFA 4D4LA 4DJ5X 1SVLA 1UZLA 3C1AA 3FLMA 3L4SO 5KYTA 1YONA 3EJWA 2DH6A 1KR2A 1H2YA 1EFDN 5D6OA 3UIEA 3H2SA 1NNI1 1X7WA 2CBXA 2ZJOA 4HL6A 5LYJA 2VQ3A 2XQGA 4QU9A 1XRQA 1KNQA 1V5WA 2JK1A 2G04A 4IDCA 4NCBA 2HD4A 1ACMA 2O0HA 3HLYA 3BGIA 1FTGA 3SIRA 5KJFA 1QUFA 3DPIA 2ZUFA 2YXNA 4K03A 3C70A 1SZCA 3EZGA 1JAYA 4BJHB 3SBOA 3GLGB 4UE6A 5KMGA 2F48A 3QFTA 3V6MA 1Y6FA 2JGFA 3N7UA 3PDUA 3RS3A 4WZ6A 4DM7A 3ZDBA 4CQLB 1TMYA 3WNVA 1EJ6A 1UWKA 2LIVA 1WKCA 2HQ1A 2Q4RA 1RYBA 3H05A 3PXDA 4INJA 4JEUA 1NQXA 1OX4A 3HCFA 4IQ4A 4M54A 4DYHA 3L6CA 3ESQA 2C7RA 5KS2A 2QDKA 1NBAA 3EXG2 1P7ZA 3EQZA 2EWVA 4K6FA 3RG2A 4Q02A 1XRRA 3OZEA 1NU6A 1ODIA 4A15A 2BDEA 3PQ7A 5JAMA 5L3QA 2RK6A 1DPGA 5GJBA 3DB2A 3KWJA 5FXMA 1ZCAA 2QSYA 4MWTA 3FNRA 5EHGA 4ZCQA 3W4KA 2V98A 4HNSA 1KJWA 1MJHA 3D0OA 1XV5A 2VDRB 3I2KA 4HEA1 3RE1A 3ZN2A 1QXSA 4HDKA 4BNIA 4IIBA 4DJJA 2PT7A 1Y37A 4F2WA 1JR3A 3PDJA 4OI4A 3ZEIA 3I6ZA 1TADA 5AKZA 3K8OE 5K6AA 2QU8A 1L1FA 4DCCA 1KJQA 2PIDA 2WC1A 2WD8A 1KTVA 1RCUA 1TCAA 3DP9A 1UJ4A 5HXAA 4CI0B 3K1AA 1CR0A 3A3OA 4OP1A 1FTNA 5DBFA 1BDBA 3LRTA 1U3WA 1OWNA 1QAOA 3UC9A 1KJZA 4E4YA 2WSLA 1I4OA 4XIFA 1Z5VA 2AXQA 3SC2A 4F2PA 1DU4A 3DXYA 4TLMB 1JUDA 3EULA 3D3QA 4O1HA 1JHAA 3IIEA 1JEAA 3F1LA 1O4WA 1XG5A 3GVXA 3N2KA 1GZ3A 5I5GA 2JFBA 1NJ5A 4K5QA 3TTUA 3FR7A 3AVVA 1Q95A 4Z1MA 2OTCA 3R5KA 4XOUA 3CN7A 4G25A 1GP2A 4NK5A 1NF8A 2F43A 3G0OA 4HB3A 5GIOE 3BJZA 1E7RA 1E2LA 2YJ6A 1E4EA 2E5WA 2YH2A 3AYZB 3DFIA 2V4ZA 4XR9A 1U3CA 1M8KA 3C98A 1NBME 3MFQA 3QUTA 3U48A 1H3FA 4MRSA 1B0PA 3HHPA 4LGVA 4L4XA 4KSBA 3UV6A 1EHYA 2M6SA 4ACBA 2ZATA 4O29A 2BGUA 3W9SA 1X1CA 5B58T 1LSSA 2FU5C 2VAMA 4PIVA 1CQIB 1LI5A 3T4EA 1YNSA 2C4NA 3SKYA 3SZGA 3TINA 4EUNA 1E1CA 1N2BA 1JG7A 1THZA 2MMCA 2DUUA 2P77A 3GPDG 1T24A 2AG6A 4EG3A 1NQTA 3B6IA 4LHYA 4X1YA 4EHFA 1E61A 1WUKS 2ZSAA 1PLLA 4WOPA 4EW6A 4ZI2A 2JCXA 4M21A 3IKVA 3A70A 4XD7A 4W4TA 3SSAA 1UADA 5K6RA 3W5CA 2DFDA 2DM6A 1MW9X 5GJWC 4L22A 4YMHA 3AZOA 5K0FA 3RT9A 5AJWA 5EE9A 4K9SA 3RVBA 2V1XA 5ITZB 2F17A 1VSUA 2B2CA 4RL4A 4ZHQF 4Q1VA 1FTSA 4IICA 1SNYA 3LQ1A 5HR5A 3URMA 3RADC 1IM8A 1LPSA 4N0MA 3QBJA 2F00A 2OCPA 3ESAA 1V3UA 3JVUA 1QMGA 2K7FA 1M6WA 4R2XA 1XDDA 1F4LA 1R37A 2JVIA 5GZ6A 3S2FA 4TMTA 3WLMA 2CSUA 4DLSA 4PYQA 2PWBA 2PGNA 5BP7A 4BNMA 1Q0QA 1C50A 3AM4A 1MC8A 2VJMB 3HB1A 4IGKA 4MR8A 3TTTA 4AJ1A 4LYYA 3K94A 3DMFA 2PH5A 2I2FA 1E1MA 4GLJA 1OWOA 4NH4A 2CFSA 2K87A 3ZHXA 1NE7A 4IMPA 5ALEA 5DCLA 4B4KA 1I4WA 5TGZA 1RWVA 2OBYA 4ML3A 4LC9A 1GTVA 2PX0A 3BMNA 3LHIA 1PL0A 1TD1A 2AN5A 3FZEA 3HCCA 1ZSYA 3PXUA 2DCMA 1NT4A 1JT2A 3GRPA 2YWFA 1M66A 3OF5A 2O5CA 3PVSA 4RHFA 4Q3AA 4PBSA 1MO6A 1RXIA 1DRKA 2YHIB 3BHIA 3WNCA 4BEBA 1SCJA 4E5SA 4QATA 3MCTA 1XQ6A 1I3KA 1B6RA 1XZLA 5LMCA 2E87A 4NYMR 4DB4A 4M6WA 1VE3A 2Q8QA 4HWOA 3NBYC 5HA5A 4LZAA 1Q6YA 3IQEA 3O73A 2FH5B 1KGDA 4FP9A 4N3GA 4QYIB 5I9BA 5FEUA 3SE0A 5LYJF 1ZLYA 5CCBA 4TYNA 1NFRA 3GRZA 2ERYA 2GYWA 2RG7A 3GGPA 1QUEA 1J0XO 3LX6A 4K9OA 3ZWQA 1LSOA 2H3HA 3OCZA 4ZZ3A 5H3CA 5E6UA 2FR8C 2QY6A 4MKGA 3WMEA 3VQTA 1JPUA 1Z12A 3KXPA 2UUOA 5HKKD 1KMIY 5TMBA 1SU7A 5BV8A 1PZFA 1UC9A 2QX9A 3B7GA 4XUCA 1Z6PA 1UPAA 5EE0A 3IAAA 2AQKA 3ANXA 2P27A 4YR7A 5C4MA 4Q21A 2BBSA 1HGXA 3G2HA 1U3GA 1E69A 4QLOA 3TLGA 4JJEA 4CM8A 3OQVA 3RBZA 3ZQ6A 2VXCA 5I8WA 2LDBA 3MTDA 1PLKA 2HF8A 1OV4A 4FNGA 5TQ0B 1U4NA 4H1UA 3ITNA 2QR2A 2C96A 4RGVA 5CB4B 3EEFA 3KZMA 4ZHSA 5JYDA 1XZKA 2UV8A 3BMOA 1K6XA 4GBGA 2YWDA 1PX2A 3TEMA 3WNBA 4YJHB 2QZPA 2X0EA 4WXPA 2KW5A 4PZ9A 5DI9A 2B8NA 2Z98A 1SCDA 4UASA 5FTJA 5ADVA 4E5VA 1AVTA 1FFHA 2NOAA 2X4IA 3MINB 5TEVA 3VR0A 5B7GA 5KNCD 4LV8B 4N8DA 4UNSA 3HJTA 1SEPA 1FRNA 1BXKA 4LF7B 3DEHA 4DWWA 2JRLA 1DKMA 4AMUA 4BRWA 1L5SA 2GHTA 3PWTA 4G5YA 5BQ3A 3QLVC 4LE2A 5LQJA 1FY2A 1IQ0A 1HWYA 4IV0A 4EB3A 2WTEA 2C8JA 3FCUB 4FJ2A 4E09A 2X5KO 2CSXA 2QD2A 3VSAA 1V0JA 3ONVA 4IS3A 2ZUSA 2PFSA 4MQEA 1RXCA 1ZXLA 2BEVB 3BFJA 3CSSA 4UFNA 3SBEA 1Z74A 1U7XA 2RCNA 3PUVA 3B3FA 4IRUB 4MRRA 2EJCA 4XVQA 4ZVOA 3CQ9A 3S1AA 2HX1A 1Q44A 5KNLA 3LI2A 1EK6A 4MLDA 3PT5A 1JLRA 1ZJ6A 3DCYA 3C48A 1VL8A 1VA5A 4ZO7A 5F98A 1SB9A 2YZKA 1T13A 3ESZA 4IVNA 5FYQA 3UT6A 3WGHA 3ZI0A 3C0KA 4NAVA 4DSTA 5IN5A 3ZZTA 3ZDZB 4CV2A 3DS8A 1L4LA 1NI5A 4BZPA 4EJSA 1R0XA 3BB4A 3ROKA 5KWIA 4EAAA 1NPYA 2HLPA 4BAGA 4AUKA 4E5UA 4UVEA 3AEZA 1VMDA 2BJWA 1GUFA 3A1TA 1P6XA 4EUHA 1N32B 1Y7HA 2O8VA 5FAKA 1R50A 3VR2D 4CCYA 3DL4A 4XAQA 3IJPA 2AF3C 2HK7A 3WHKA 1JDPA 3GHHA 3W6NA 3T5PA 1ONNA 2OCGA 1R6XA 3C1OA 3LQ2A 1W2GA 1ENYA 4EJFA 5FI5A 2M2IA 1VBFA 2VG8A 5IC4A 5DBGA 2PRKA 2D54A 1GGMA 1JJBA 2RI1A 3W6PA 3WMXA 3LHKA 2BKVA 1NVDA 3LSTA 1QVWA 1ZHFA 4XLTA 3ZJ5A 2GN1A 5EYPA 3AVUA 1NVBA 1NLYA 5EUQB 3LKZA 1C4KA 1EUZA 1JNXX 4D4JA 4EMSA 1R8XA 3L82B 1F51E 3IERA 4XXHA 5A62A 1J8YF 5AVWA 2QRMA 4TLEA 1CF2O 2OPHA 2NZJA 1U9CA 1JEQB 1QHSA 1XZDA 3UMYA 1WXFA 2N0SA 1P4AA 3GJ3A 1SU6A 3ED1A 1U8AA 2JCBA 3KQQA 2Y68A 5FBKA 3UT5B 5LQNA 2BBWA 2GNAA 3INNA 4J0KA 3I04M 4TWZA 2CKDA 2FVXA 4P0PB 3ZZNA 1C9NA 3HL4A 3KXLA 3COPA 4DJFC 5EHZA 1XD2B 1YZYA 5EXXA 4FPXA 2V7EA 3K05A 1AB5A 1S1CA 3E27A 4PSKA 3ZZ0A 3GQVA 3PU6A 2YTZA 4BEJA 3T5TA 3GJZA 2VYVD 4TZTA 1PR9A 3RYTC 1TU4A 1Z06A 3K70D 1E6CA 1E64A 3IS3A 1ONPA 3PD1A 3ZU5A 3EPJA 1JTVA 2FG6C 2UU9B 2VUIB 5G41A 5JUWA 1SOWA 4WBNA 5EJAA 2ZKIA 3AL2A 3EA5A 1SVIA 1P5ZB 2R1TB 1PQ4A 1D6MA 4H7DA 3ER9A 2FEOA 1G0NA 4RF3A 1SK9A 1Z6TA 2AKYA 4JITA 4XSVA 4AM8A 1N0HA 5THXA 3PV0A 2IYFA 1URPA 4KQWA 1OXSC 2VPYA 1RM5A 2XX3A 3IAUA 5KSZA 1P1KA 1VRWA 4MEJA 2VP9A 1CR4A 2XHEA 4TV8B 3V3KA 4HNRA 1NW9B 3UGJA 2W22A 2M32A 4LGCA 4V0QA 1DL5A 4XDZA 4P1ZA 4EA7A 4EIWA 3H3XA 1CUGA 3ACDA 2B1RA 3P2YA 5CVVA 5JZ9A 1RWWA 2WIBA 2P69A 3D3KA 5EFOA 5KUTA 2I4TA 5BN3A 5C8YB 1WP9A 2J3JA 4ERNA 1JQDA 3QJ5A 3MB8A 5AHOA 4ARIA 4D82A 3RABA 5C8XA 2FEKA 4PWYA 3UV3A 3I1YA 3OT1B 4KI7A 1IJKA 4TMWA 2VNSA 3K1YA 1KZ9A 1BYIA 2OHFA 2Z56A 1RKUA 1EXWA 5GJVC 2MSCB 1M34A 1DC7A 3QKRA 3OM0A 3QUBA 4MMYB 1K5HA 3HA7A 3UYKA 5B1SA 3HEAA 4JB2A 1CHDA 2O3JA 1EFHA 2C57A 1FP7A 2PH3A 1PIWA 1YQTA 1GZ5A 4JQYA 4W7SA 2LZ0A 2BN4A 1XXHE 1KS9A 4XTRA 5FA5A 1OPRA 3WJ2A 1GG8A 1E62A 1R0WA 4JH0A 4Y30A 1TXGA 4O2AB 1Z7GA 5ECDA 1VP3A 4HDNB 5K0EA 4FX5A 5KYKA 1MIHA 3AUXA 3EUAA 3I23A 3NT4A 4RESA 3AKZA 3CPJB 1WBJB 3DNPA 3TB6A 1U9IA 2B5VA 5DISB 1LLDA 1QQAA 2YOFA 3PDIA 3I9FA 3JZDA 3QVWA 3RVRA 2Z8ZA 4Q4HA 1OI7A 2VP6A 3E9NA 2GEVA 3LBNA 4KXMA 4WDQA 4BFVA 3MHTA 1DG9A 3I2FA 3UXMA 1W2HA 2IHVA 1OZFA 3R7WB 3S68A 1WMDA 3EVNA 5BSGA 1HQKA 4XCQA 1RR6A 5E6SB 3GAZA 3EPPA 2FWAA 2FHSA 1JE0A 1OX5A 2UZIR 4HYTA 1O77A 3Q6IA 1F6DA 4L5AA 2HLDD 4HQLA 5AR1A 3E05A 2HWXA 3FPSA 3CVVA 3G0GA 4H7KA 4LI0A 3TI9A 3JCZA 3M6FA 3D1VA 3HABA 3HWSA 3OZWA 5FOXA 3CWZA 4AG6A 5KHLB 3U7EB 1PTKA 1EAYA 2G1PA 2QP3A 4XX1A 4QNRA 1FLNA 2IEGA 1J8FA 4F06A 1DAEA 4IX1A 4QBHA 2GRUA 1FYVA 2PGJA 3Q3IA 3UAOA 1ZJYA 4LAFA 1MQ8B 3RLFA 1H2EA 1ULHA 3GRYA 3E9CA 3BC1A 3OJXA 3VNSA 4LJ4A 1Z4OA 3NWJA 1RJDA 2FK8A 4U6SA 1EZ4A 1UDXA 4JASB 5GJCA 4HWKA 3WDMA 1ZYUA 3WZ2A 2CMKA 4KB5A 3EVDA 2NW6A 4RNDB 1AV6A 1F38A 4I2NA 5EXSA 4XPIB 1OZ0A 2DHDA 4PU0A 4WKNA 4FFLA 3PEEA 1R9JA 5JXWA 1PFQA 3AFIA 1YHYA 3K0CA 2P9GA 5AKJA 5FO1A 2CT8A 1KZ6A 4Q01A 2O8BA 2Y1OA 4NS4A 1QDLB 4DMLA 3B3QA 4DNXA 1WUYA 4XVCA 4Y98A 1P33A 3K9CA 1LU9A 4WI1A 1GCIA 1QIDA 4DLVA 4C08A 1VHTA 4C4SA 3TSZA 4CG3A 1C8KA 2Q4EA 3PFFA 1R6AA 2IQ5A 4BNDB 1R5NA 3JQBC 4ZP1A 2QXYA 4A4DA 4BB5A 2XEXA 1NOIA 2I3AA 4FNMA 5FLEX 1WWKA 1SCBA 4YV7A 3G1UA 3GCWA 4RDIA 1DBIA 2LVBA 1W5EA 2H29A 1V8FA 4XVUA 1JALA 4PZAA 4KNYA 1K7CA 1NXPA 1WL8A 3HCBA 5IBPA 2ECPA 3VA7A 2OQIA 1TRKA 3GD7A 1TLLA 4NX2A 1BA3A 1THGA 4F7WA 4GP7A 2YJ4A 3EFOA 3H5VA 3WKCA 1PJQA 1G5RA 1P5RA 4C4OA 2JGRA 2BR5A 5LNK1 3I64A 1KJIA 3PFNA 4RMIA 5ICFA 3AVTA 2D7JA 5IUJC 3V1MA 2JI7A 3U3ZA 1LDMA 3RS0A 4X54A 3LC1O 3L84A 1GTMA 1JR4A 1OLXB 2KQUA 3MTAA 1J6UA 5JCXA 2VXYA 4TUYF 3V8NA 1P5FA 4F92B 3C7CB 5IRCD 1Q19A 4JL8A 5BO5A 1I0ZA 2PCJA 1ABBA 5C51B 4FEAA 4AJNA 3HKEA 10MHA 2AIRA 5BT8A 3BH0A 5K0NA 2VTBA 1E96A 2VF2A 2YVLA 5ENZA 4IWXA 1BXRB 5C7OO 3GA0A 3NKFA 4MAFA 5HPYB 2P7IA 1EFRA 2VDMB 3AJAA 5E4JA 3R9IA 2DR0A 4JA0A 2O1XA 4RADA 5TY0A 2CFRA 4JZYA 4OVKA 5D5QA 1E79D 1QX4A 1XYYA 2QTFA 4G0XA 4L9SA 1EB8A 4MGYR 4NULA 2QIOA 1KI7A 3L7CA 3T1QA 2DOKA 4QZVA 2ZSEA 3RS9A 3K4HA 3QPCA 2GLUA 2W0MA 4BVAA 3OLZA 1XLTA 1L5MA 4BFCA 2VA8A 2EKQA 1GDHA 5C37A 4M83A 3WWEA 3OKPA 2D5AA 4DPLA 5THKA 2H8GA 3IHTA 3Q9SA 4M1WA 4EM6A 4ZJZA 1TK3A 5FDFA 1W1UA 2RMKA 2OP1A 2EU8A 1JE1A 1WOYA 2FN9A 3N6VA 4TTVA 2ID8A 4MW7A 4BV3A 3S5JA 4C2UA 1UXKA 5I45A 1QHIA 1EPUA 1O7JA 2QVYX 5FLKA 3TW6A 3JYLA 4M0EA 4BFYA 5AIBA 5KWEA 3AI1A 3REOA 2HA5A 4JAVC 2WF9A 4K40A 1I5OA 2ODEA 4LXXA 1ZL2A 2WZCA 5DWDA 2RCYA 4L0QA 4TKVA 1M1YE 3M5PA 5LBUA 2P9FA 2I8CA 1OLOA 4YLGA 3WLIA 4KNVA 1TZBA 3S2IA 1EP3B 3KIPA 1EK1A 3F4BA 4I8IA 5DGDA 2D62A 3QEAZ 3KSZO 1RLTA 3L9WA 4W6ZA 1DX9A 1JEOA 3I05A 4UTOA 3TR6A 1L5NA 2WB2A 3O9VA 4BTVA 3AONB 1O96B 3KUUA 3MA0A 2FUG1 1Q22A 3BL8A 2SICE 4YAOA 3U1TA 4RE5A 4DZRA 5EZSA 2BY4A 2EW2A 1Q0UA 2YUIA 3JWPA 3L7AA 3U19A 2FZKA 4WD3A 1NI4B 2FSSA 5EXEA 4S0ZA 2XODA 4MLPA 4RA6A 3CZ4A 5AK4A 4YASA 3VGJA 4S2UA 1G98A 3PQ4A 2I4RA 2JHCA 2DB3A 4P9NA 1B1AA 3A4IA 2D5IA 1N57A 4OQZA 3OLXA 1WMFA 4OOEA 5JRJA 1Q83A 2FXVA 2P78A 1II0A 2YZMA 3ND6A 4G67A 3D81A 4KAAA 4PYRA 4RMGA 3V46A 4YN3A 4AN1A 3DPUA 1LPAB 4UNIA 5AXBA 2PMWB 1T9KA 3IUJA 4UEKA 4X45A 2GD1O 2I4LA 5E38A 1KQ3A 1G38A 3TMYA 3WNZA 4Q4DA 4IIJA 4NVRA 3SYMA 3TNDA 3ME5A 4JT2A 3L8HA 3FVTA 1L5VA 3FMOB 1P91A 2VXBA 4NPHA 3FOCA 4B7XA 4P2BA 1INLA 2BGJA 3GGDA 5AM4A 2JCVA 4OXIA 4E0BA 1B2LA 2B37A 4Q1FA 5BN4B 3LQQA 1YBAA 1SBHA 2C0QA 4DR6B 1TM4E 3ZNNA 3U16A 3EAGA 4QTYA 2NPIA 4U2GA 3ZCPA 2IBSA 1GCUA 1XJCA 1HK7A 2CMFA 3NRCA 2WZDA 3FRJA 3VPGA 3W4IA 4NZYA 3KJXA 2ZYWX 4OBXA 4L4RA 4M49A 3JD4A 2BI4A 3DVQX 1DKPA 3LK6A 4PNPA 5F7JA 5P21A 3BK2A 5EUCA 4MUEA 3WGGA 4F91B 1Y6ZA 2FPKA 3GFPA 5DYWA 1ICIA 3U7JA 3QFHA 3OLQA 2V7TA 2EIHA 1N5MA 5K3AA 621PA 5AVUA 3W5AA 4OX9B 4KFUA 1Z4PX 3GJ4A 1EFAA 2PQ0A 3JASA 4R01A 4EW1A 1S96A 4LNUB 4W7IA 5HF8A 1W49A 3QGMA 2I1VB 2W90A 4YACA 4YDRA 3BD9A 5DYIA 1G17A 3OP4A 2WJWA 3UB4A 4AIIA 4EF4A 4EPVA 3F7TA 4TWBA 1XZGA 3HUDA 3BA1A 4K1LA 4JWKA 4QL3A 1J5EB 1U0LA 2QRVB 1G5QA 1YQXA 1L8OA 2DFPA 1BDMA 1GPLA 3DVLA 3GFRA 3KELA 1O87A 5CRIA 4JP1A 2PL9A 1MAUA 1EWTA 5LUBA 2ZRLA 4YT4A 1RKVA 3ZE0B 3ILVA 2EF1A 2P2NA 3EGIA 3GCXA 1L5OA 5D00A 2B30A 1QDUA 2IF0A 2WFZA 2DG2A 3S0JA 2FPPA 3N2ZB 2ATVA 3ISVA 3PGVA 4HDSB 4HNHA 1NN5A 2XUKA 3F5QA 3FF1A 3QVGA 3GFOA 4WXHA 1UKEA 2ACWA 2A9RA 4WNCA 4XQGA 5AMXA 5GOTA 4P5PA 3KTDA 3WSWA 1PJAA 1W4AA 1COWA 2HSGA 3TXYA 1WXEA 2W2MA 4QBGB 4D44A 2P3LA 4UE3S 3LKDA 2JI8A 1U0BB 1VGRA 3D31A 4AWBA 3V4RA 3H8WA 4TMYA 4URHA 3O5AA 2OYCA 4G0WA 1CV2A 5G53C 1JG4A 2FOIA 1Z7YA 2RC5A 1U4OA 3JQ8A 3K20A 1G41A 2QAGB 2MYUA 4PZYA 4URZR 3JQGB 1GT6A 2Q5QA 2J8ZA 3G59A 3WYBA 2JAOA 5DTJA 4QVIA 3AU8A 1NY5A 1YCHA 1D2CA 1JQ5A 2IYPA 2Q3EA 1OJLA 4LNAA 4CM4B 4D6PA 3ACCA 1MOSA 4EI9A 4YT2A 5H3HA 2SHKA 1JKJB 2W2QA 3EISA 3I2IA 1WHTA 3V8QA 2F90A 2G09A 3IPXA 1T2EA 2FFAA 5HGJA 5IU6A 1MMFB 1WOMA 2RSLA 3LT0A 4NG4A 4MHSA 1LNZA 2BWJA 2PBRA 2FRXA 1S2MA 1CDEA 1XGKA 4QE3A 4WE3A 5CD9A 3EWNA 3CJRA 3NVDA 3RTDA 1BGXT 4RABA 3ZCQA 2UYHA 1D7AA 1JHZA 2XW6A 1KHTA 2C5BA 2QAGC 3R0JA 4RA9B 1E98A 1RIFA 3IUEA 2PV7A 4JFRA 3P2IA 5JH7B 3DZBA 1JIXA 1KERA 4HJRA 1S8OA 3WLKX 4IXMA 3TW8B 2IIPA 5IXYA 1TJYA 2D8AA 3ZW8A 3FMVA 3GJTA 4M9RA 3P2MA 2QZ9A 1C3OA 2EQ5A 1N2OA 3QW2A 4F4IA 5COAA 4JI1B 4RULA 3FE2A 2NLOA 4HQKA 1XE3A 4Y2VA 3RM3A 1N0WA 1E6WA 2VT7A 5A5DA 4HVCA 4PTYA 1WY7A 1KDRA 1JQLB 1PTJA 3BSYA 1DUVG 5I6DA 2OCLA 4FDLA 4I36A 4HDQB 1VSVA 4P81A 4PLTA 1RU3A 1X7ZB 2E82A 5EIAA 1U11A 4XJVA 2B4RO 1ISMA 2B25A 2CVFA 3DZDA 1HDCA 2IX9A 3QF4B 4TVOA 2ZYTX 3HJFA 4ADSG 4FBLA 5HNKA 3QXXA 4GUDA 4Z8YA 3R5JA 3KE9A 2V6JA 1M2VA 1E3IA 2O8CB 2OLJA 1LW6E 1U6IA 1GGJA 1U7ZA 3E1KA 4YRCA 1J22A 5ALNA 1E9BA 1SG0A 3CLHA 2XDQA 3EIUA 4BNNA 1CF9A 3R41A 1LPMA 3JPYA 1YDMA 1PT8A 3RTEA 1M9NA 3AJRA 3GVIA 4BZZA 5K0TA 5BQOA 4Q16A 1FVFA 2H57A 1SY7A 3L8EA 4MIEA 3AF4A 5LQRA 1GTL1 4OAOA 3RJTA 1U1DA 3RU3A 1MO2A 2GI4A 1U5BB 5TGDA 5AJVB 3STHA 3WXBA 2FW8A 2WAOA 5L3SA 4II7A 5PNTA 3HKCB 4PSDA 2HF2A 3O03A 4F46A 2GBLA 3ZZMA 1D6JA 4R2LA 5DCWA 2XUZA 1LLQA 1Y6RA 1ZRSA 2ZRIA 3E9MA 3R7DA 1RJ9B 1PO7A 1DINA 1TLFA 3ICPA 3MRSA 2ISSD 3P7MA 4W9MC 4EWLA 2VZLA 2ZJBA 4PFJA 3V1YA 1R0YA 1CUWA 3ZK7A 3PQ3A 3PA8A 3STUA 3DEYX 1II8B 1TKBA 3B2NA 3CR3C 1GR1A 1Z25A 3EVFA 1LS6A 1P75A 3H99A 2HY7A 1YK1A 4XARA 1VI2A 3IEMA 2BM0A 2HDOA 1J1UA 2ZE7A 4TVBA 3VV2A 4EB8A 2WFLB 2XF8A 1MPTA 3X1ZA 1MOZA 2YASA 1FRZA 1GZVA 4OHUA 5EZYB 2A35A 4C06A 3TLJA 1FQOA 4M1YA 4KK3A 3MM4A 3ADCA 1IN4A 3RQIA 5JMOA 4XSGA 3W5DA 1GRCA 2EHJA 4RU1A 4ZTUB 4EATA 1I1HA 1Y5RA 3C6ZA 3FCEA 3GAMA 5CM8B 3CW2A 2IEZA 4ZKEA 4UTXA 2C2WA 2CC2A 3QOWA 2IY8A 1Q74A 3IJEB 3PUYA 1KH2A 1ISRA 1MH1A 4XX0B 3UJ3X 2P0EA 2HA4A 4D57A 3SQMA 3FOWA 1DWPA 4G89A 4HX2A 3TQIA 1FSGA 1ZMTA 4I8XA 5KTSA 1CEEA 1QCYA 1JKMA 2ZWIA 3K0BA 4CVNA 3RC7A 4M0MA 3EUWA 1XQVA 2OGTA 5AUNB 5JD5A 3ZCSA 1QQ7A 3VI3B 2X86A 1YR3A 3KHKA 1XOIA 3P32A 3RVQA 4YIKA 5JJIA 2IS4A 2AXPA 4LOAA 2YL2A 3I9KA 2OEPA 4E07A 2J7PD 6LDHA 1W0JA 2HA2A 3I09A 3VTFA 4MWSA 6AT1A 1R8JA 3C8MA 4K7JA 1TEHA 2FPSA 3P19A 5IDYA 1KWGA 2P9HA 4DQUA 1N9ZA 3GXBA 3QKTA 3E9YA 1L5HA 1IVYA 2A5JA 2FUKA 3M6UA 3ZE6A 4DV7B 2XECA 1F3LA 1ORIA 3WE7A 3QY9A 1KO5A 1C9DB 1G8GA 1AKTA 4BNKA 3H1TA 5K05A 4A8HA 2RGEA 1OU4A 2FPIB 4GPAA 1U0NA 4Y6SA 4YUVA 4ENQA 1C8BA 4KU4A 2ZDQA 4Q05A 1Y98A 1IAQA 2PMKA 4YVFA 1D2HA 5L7WA 4M0DA 5CG2A 4TWRA 3G89A 5HM6A 2R7AA 4N47A 2P91A 3L06A 4ZCLA 4H1HA 3WRYC 5E9WA 1L8LA 1E1RA 2X6RA 1KI3A 4A0SA 2DEUA 4K6MA 2EBFX 4Q93A 4CM1A 2W98A 3G9ZA 4J6EA 1C41A 1NMSA 3TZBA 2W71A 3WWDA 3OM1A 5M29A 4AQDA 4BMDA 1FDRA 1QX3A 4OL0A 2XCTB 3UH0A 4ME6A 2KX7A 1SURA 1U7OA 1DG3A 5JVDB 4XASA 2OKGA 5DASA 3W3AA 5KX5B 1BN6A 4TKZA 3T5BA 4C2AA 1N2CE 2PX4A 4MCJA 3NB0A 1CRZA 4OX9Y 3LVQE 4EGQA 2O19A 3U9SA 1E2UA 2I4MA 3FB1A 2AJ8A 4OB7A 4GYWA 5KNBA 1HDEA 2WR8A 1KO4A 3J7TA 4IDPA 3CF2A 4Z3DA 5IF9A 2I4IA 2JGEA 5DBHX 4RDCA 1JFFA 1ZCZA 2AMFA 2CUNA 3FPFA 5CA1A 5FNZA 4B85A 4JY7A 1Z75A 3OQBA 2D3TA 1DV1A 5TQVA 2WWYA 4MV9A 4EFMA 1WHSB 1ZS9A 3B1ZA 3OSUA 2ICAA 3Q0TA 3QIVA 4LMRA 5F9MA 2XUHA 1E2MA 1E3SA 1LDEA 3I62A 3A4TA 4YT5A 4KPUA 2B4QA 1O94D 2AZDA 4KBGA 1YR6A 2PZBA 5FOTA 2Q0QA 1KIMA 5ALZA 1GITA 2FI1A 2WUVA 5CK4A 2ZBDA 2AEFA 2YFKA 4OYYA 4ZFNA 1NURA 2BGKA 1UT6A 3KQSA 4Y7CA 2E3JA 3GLQA 2VWHA 1USVA 1DT3A 1ECPA 3D6FA 1D03A 4UTZA 3DMPA 4HAIA 1KORA 5LLSA 3RUEA 3PCRB 1ETUA 3DBRB 3IOEA 1IPFA 1XU9A 3HJCA 4YO7A 5ARDA 4E2FA 5HM8A 3JZAA 2AT1A 3HVJA 4PHCA 4ZMSA 3FCAA 5KIAA 4C20A 1KQOA 4DDWA 2H1SA 3KJFA 2BPOA 4U9HS 1UQUA 3OOJA 1N2IA 3AHDA 4PCLA 3NPMA 1K3FA 2VJOA 4GOND 4RJKA 1K08A 3PE4A 3FUCA 1S89A 2A67A 4MWGA 3RFFA 1A5SB 1NDQA 1KMQA 3UNXA 2UYCA 4I9HA 1L7MA 1VL6A 4LZOA 1OFTA 4RSGA 3RFUA 1XU4A 2QVGA 2LRHA 4QGSA 3LUJA 1SVNA 3HADA 1BVRA 2FKNA 2VF5X 2W9XA 5EIHA 1L7EA 3SYLA 3ZWBA 2HMSA 1KETA 4DV5B 2EFHB 2PRIA 2GYVA 3UUGA 5JHHB 2P5SA 4KAFA 3TFOA 5EEGA 2H00A 4TS9A 1U7HA 4BJ3A 1IK6A 4TXHA 4I4TA 4JBNA 5FHQA 5JAQA 4YX9A 5CEFA 1EUYA 4JLUA 1WG8A 1MT0A 2JGNA 2OGUA 1A9RA 3GFGA 3ZQJA 4IDDA 3AHEA 1AGXA 1ZR4A 5DXAA 1B23P 5K4HA 1G9SA 4I5DA 4QBTA 1FFDA 3AI3A 3A3NA 1Y8CA 2FPOA 4LYDA 1L5ZA 2DHQA 3V7FA 3V7YA 5I7OA 2PRSA 1BXGA 1F2UB 3T9FA 1QVAA 3DB1A 1WUJS 3KYDA 3OX1A 1E9CA 5JSFA 1E92A 1JMYA 2CK3A 4B33A 1EQ2A 2EJBA 5AQ1A 3BH7A 5KYGA 4LXHA 1PT9A 2EEZA 2XXJA 3PDCA 3DA8A 3ROPA 4BB9A 1SU8A 4HQFA 4W7HA 2Y2UA 3WV4A 4IJUA 1FXWA 4MRMA 4YYZA 1OC2A 3KJNA 4JT9A 2HNBA 2QP9X 1MPXA 1SUIA 2QQFA 2YWGA 4KVAA 4MR9A 4MW0A 4Q39A 3VR5A 2AOTB 1O57A 1JIUA 2GTHA 5DNUA 1PR2A 1UWCA 3OTIA 4OB6A 5JZVA 3EG5A 2PMCA 3C5VA 3HPQA 5AXDA 1NE2A 4KN8A 5AVOA 1DRJA 3OURA 3OG9A 2WMNB 1WY5A 3BHNA 1DBRA 2PQMA 4R0NA 3EVTA 4Y0VA 4CQMA 1XDZA 3Q2IA 4J7UA 3ZU2A 3NGXA 1Y1LA 5KOYA 1T0JB 3VDMA 2P11A 3U2QA 1FSPA 4WK4B 2FLWA 1NVAA 3DOCA 3LBYA 4FNAA 4K2AA 5KAPA 4QJ3A 5GZ3A 4FHZA 4WZBE 3ADBA 2HQSA 4TVKA 2AUMA 2Q3HA 1NX9A 1L7QA 1KVSA 2GUGA 3ILHA 3SVTA 1FSSA 3THYA 1FDVA 1XNRB 3FTPA 2OO5C 2QN2A 3P9NA 3RYCA 3PIRA 4Q1CA 1QYXA 4G1EB 1M7HA 5G3ZA 2UUPA 4KPGA 3S2UA 4BO5A 2Z6VA 4QOIA 1V1MB 1K75A 4ZQGA 3L7BA 1OKKD 3VZRA 5K8JB 3G79A 2QJRA 3DO6A 5CPBA 4G41A 4NWIA 1AMUA 1JSLA 4B6RA 1H22A 5F1YA 1C1HA 4RK4A 4IKPA 1JDUA 1B73A 2V96A 4IIUA 2VYNA 1J4AA 3N39C 5F2EA 2WIFA 2GA8A 1G21A 2AXNA 1GQSA 3ET4A 1T5LA 3WRXA 4INAA 4KFTA 3WI7A 5E3HA 3I4FA 5KB3A 3B60A 1QGED 4RKWA 4UHKA 1XRPA 4B74A 3T1VA 2ID7A 4DA6A 4JXKA 2CV2A 5LQDA 3ETDA 5LDDC 4RV4A 1GU7A 1QCDA 1CTQA 2ZI6A 4PLZA 2W2PA 4X6UA 2BMFA 3HI6A 1KVQA 3JS5A 3WTCA 1QQTA 3N58A 4PGHA 2JFXA 2QQGA 5JO0A 4D0SA 2FPRA 4BO1A 3KL4A 4GR4A 3AUTA 5C31A 4AN0A 4L2IA 2YWBA 5KQLA 5IANA 4HUTA 4QC2A 1K4YA 1DAHA 3EGDA 3GU3A 1B14A 4D9NA 3EVGA 2G5PA 4OYLA 2XVXA 4CIVA 2OZEA 3NIGB 3M33A 3PB3A 4K6KA 1TZMA 3AZPA 4J7XA 1H9AA 3LYHA 3TN7A 4RK1A 4NR0A 2FW6A 3QELB 2ORVA 1V11A 2QZZA 3I72A 3AGQA 1HYBA 4GF5A 4EW3A 2GA9A 2V5AA 4G4JA 2YXDA 1TX4B 2PRZA 1YZTA 2XBLA 4NC9A 4PM4A 2OORC 2GHIA 3USZA 5AVTA 3G2QA 1IY8A 2YY6A 1XQYA 3WGLA 2TYSB 4BNWA 1C9JA 3OEYA 1VE6A 1SC3A 2FGJA 2PUTA 2VVTA 4I9NA 4BOYA 2ZCJA 1WUTA 5A9SA 3MRVA 3RKSA 3G2NA 2OVFA 2VBIA 3GAAA 1DO2A 2ZYGA 4FGLA 2PUCA 2ZIVB 2C95A 3I1IA 1CZHA 1ZLXA 3D8RA 4MYHA 4YRBA 5A06A 2O7RA 4M0KA 3V2UA 2PKEA 3JQAB 1TVMA 3NJ8A 5FA6A 4BGUA 2E5FA 2Y92A 5JS6A 4R84A 3F9RA 1MJGA 2TRSB 3C7KA 1P4GA 2GCEA 5HOEA 1CEXA 2QG6A 4CMAA 3FAKA 1JSRA 4C14A 4R05A 5JYCA 4UHCA 3HXQA 4BVHA 1HO3A 4A8JA 4BE9A 2ZJ8A 4GD3Q 3JYHA 4NENA 4JC8A 5JCJA 1T5BA 4JOBA 1RBZA 1MGOA 1TCCA 3Q85A 5F12A 2YDXA 2GPTA 3D7MA 5IG2A 2JGJA 2PGIA 2HADA 3KR9A 4I4TF 5H16A 1XEWY 3N1UA 4YRJA 3AHCA 3WBBA 1JI3A 2OHIA 2HK6A 4ZTZB 1ILWA 5HDQA 4K6OA 4LWPA 4EK9A 4ERXA 2XCRB 2BSQA 4B3TB 4MWEA 3VJRA 1Y63A 2BFBB 2GLXA 3D8NA 1BE6A 1FMTA 2IYZA 1MRZA 3PNLA 3EVEA 4UCWA 3IBGA 1IM2A 1HZJA 2Z3ZA 3L04A 3OOWA 3R3XA 2CVOA 2DECA 3EBPA 4DDVA 3O0DA 2E49A 3AC0A 8ADHA 1QVZA 4DG5A 1NYQA 1OA1A 3NHJA 3PUXA 4PO9A 4P82A 5SYNA 2M1ZA 1XTRA 3CR7A 3HXTA 3F6CA 1UDBA 3BORA 2QXUA 1TYZA 1OF1A 3DE6X 3ZHYA 3UB3A 1EGHA 2B61A 4WTOA 1FXWF 2AA3A 2PS9A 1ZJWA 3KYIB 4W5OA 2J32A 3E1SA 2CLEB 2CJXA 5AW6A 5I4CA 1K5DA 2AKEA 3NTRA 1GL7A 2QGFA 3AM5A 2SKEA 3H16A 3HVHA 1W88B 5IAOA 1LV8A 1QPBA 3FSRA 2YXBA 5JSQA 2ZI4A 4O63O 5L8VA 1RT9A 3R77A 2XVZA 2WB4A 3MQ2A 1P0FA 3DLTA 4Q7JB 4YONB 1LCIA 5DM70 2CB9A 1R4MA 3G0CA 3W5SA 4NHOA 1C0PA 1W581 1YS2X 3OU2A 4D8VA 1O95C 3QJGA 4GZLA 2N1BA 1VYVA 2O1SA 3LIPA 1ODSA 2ZI3A 4B3CA 4JB8A 1BWPA 2XI4A 5FO0A 1XCLA 1YMQA 1DCFA 1ZCJA 1X92A 2O05A 5CT9A 4QYXA 1YA6A 4O59O 1LBQA 1W85B 4KXLA 3TR5A 3GLGE 1XKXA 1MP0A 2OMEA 3MGAA 4PR0A 3W5HA 4EJ6A 2YWCA 4CEIA 4E2ZA 1WMSA 3DTVA 1L3BA 1Z22A 2FW9A 2FY8A 1TQDA 1MDFA 1E1NA 4XFJA 5IXJA 3LE8A 4RUKA 2WUDA 4MULA 4ZEWA 3S44A 3ZWMA 4O1IA 1SFRA 4C4TA 1IUKA 5C35A 3GJSA 2Q9AA 4IZOA 1YF3A 1RRCA 3K2BA 1FQKA 5TMEA 1L5RA 4DVJA 2O2JA 4WPGA 4FS8A 3CEMA 3BICA 4G4SP 1TUIA 4ECAA 5T41A 2FPUA 1CHNA 2QGZA 3A6JA 4JKIA 5IWAB 1VYUA 2J46A 4NXNB 2G83A 3E3LA 1SPXA 1W8IA 2QNIA 5CX4A 3E0QA 2OPBA 1X1TA 3ED5A 2IELA 5E0OA 2A86A