3SQDA

Crystal structure of human ptip brct5/6-gamma h2ax complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
211
structure length
211
Chain Sequence
b'MKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PAX-interacting protein 1
publication title Crystal structure of human PTIP BRCT5/6-gamma H2AX
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 69
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3sqdA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3sqdA02
1GZHB 4BMDA 3K16A 1T2UA 2L42A 3COJA 2XNKA 1JNXX 3SHTA 3SQDA 2R1ZA 3QVGB 3K15A 4Y18A 2WT8A 3PXAA 1Z56C 2ADOA 3T7KA 3U3ZA 1T29A 3L41A 2AZMA 2VXBA 3KTFA 3PC6A 3T1NA 3PXCX 5ECGC 3EF1A 3OLCX 2E2WA 3K0KA 2LE0A 2JW5A 3JVEA 3HUEA 2COUA 3EF0A 4BU1A 2D8MA 4BMCA 3FA2A 1T2VA 2INGX 2K6GA 1N5OX 4Y2GA 4OFBA 3PXDA 3PA6A 4BU0A 4N40A 1T15A 4XQ0A 4U4AA 3L40A 3SZMA 1OQAA 1IN1A 3PC8A 1CDZA 4IFIA 3QVGA 2M2IA 4IGKA 2COEA 2K7FA 4JLUA 1Y98A 3PXEA 2XNHA 2COKA 3AL2A 3PXBA 3I0NA 3T7IA 2EP8A 2VXCA 3PC8C 3K05A 3PC7A 3HUFA 1WF6A 3PD7A 2HTFA 3UENA 2EBUA 2ETXA 2NTEA 4XPZA 3AL3A 3L46A 2DUNA 2EBWA 4ID3A 3I0MA 1L0BA 1L7BA 1KZYC 3K0HA 3T7JA 1IMOA 3SHVA 3II6X 3UEOA
chains in the Genus database with same CATH superfamily
2IHTA 4CLRB 1V3VA 1Z47A 5I9IA 5LDDC 2V6GA 2AH5A 2O3QA 3A14A 4XFKA 3K9HA 2Q6TA 4DNPA 1M9NA 2VPTA 4KXNA 1GRNA 1U2DA 1CUZA 1FPQA 1T4CB 1IAVA 1E18A 1OCEA 1ZD3A 2OHVA 1W93A 4J1SA 3WZ2A 3VO2A 4KXFB 2AR0A 3RU7A 1KC1A 4I5EA 4XSVA 2Q49A 3L4KA 2YZ2A 4HAZA 1ZQ9A 2I4MA 3OQJA 1Y7TA 2AEFA 4II7A 2C4WA 3N2KA 1IPEA 4JB0A 2XXAA 3LQQA 4JELA 4GNKA 4RNCA 5BV8A 2Q1TA 3Q5DA 4G1CA 3X44A 1IZZA 5LQJA 1Z4JA 2FMIA 1R2QA 1QRTA 4G56A 5DV9A 1WJGA 4IDDA 2NXJA 5A5VA 2BFCA 3EFHA 7MDHA 1Q20A 1SCNE 4M38A 2ZAMA 1XTPA 3MB5A 4M60A 3UJ8A 4Z9XA 1TFUA 1E4OA 1YB4A 3IPXA 3KUDA 1VKNA 2C9DA 1H0SA 1IL0A 2ZUBA 3A6HA 2FAXA 5BOVA 2DSTA 5E9JA 3WGQA 4IJKA 2ZYVX 5HBRA 3EXIA 2Q0HA 1SZPA 3KETA 5LKAA 4PX3A 2EJCA 2QR3A 3IDQA 5DW3A 3UWMA 4PVDA 2V9CA 2SBTA 3FCOA 5EP2A 3TBKA 5BN4B 3BWVA 3FFAA 1LC3A 2YZNA 3FYSA 4DQLA 5L3VA 1VSTA 3S3TA 3B38A 4PLHA 3V4PB 1BA3A 1DNPA 1SKUA 4G8CA 2Q4OA 4LFBB 3K71B 5I3CA 4MIYA 4WCFB 1YFJA 1RR6A 1JBKA 3D81A 4JFAA 4C7VA 5KSWB 2Z3ZA 3HDHA 4F1KA 4Z7QB 3F9RA 1JDZA 3NM4A 5C3UA 2NU9B 4P3XA 4DNQA 4UTPA 1ZH0A 1H6DA 5DHPA 2P1ZA 3GD7A 1T6BY 3X1WA 3P0RA 1AB6A 1I9GA 1TZ2A 3HHEA 4XCQA 2P78A 5A05A 4M1WA 1H69A 2BV3A 4TLMB 4ZVOA 2X0FA 1XVTA 1V16A 4D6PA 5JARA 1XB2A 1NVDA 1VP9A 3MJ4A 1HL7A 1KU6A 1Z3IX 5AMXA 1VI2A 2AZ4A 3BEDA 3CCBA 4IJUA 3HP7A 1IY2A 4FFMA 1R0SA 4FCTA 1YK1A 4YONB 1NBMD 3NGLA 5E7QA 2COKA 2J48A 3AI7A 1PGJA 3LZCA 1N25A 3IUMA 2CNKA 1TUBA 2ZU6A 3KQYA 1PJ8A 3H11A 3OIFA 3ZY6A 2H1VA 3CN7A 1IOWA 3EUFA 3EZLA 4WY5A 3ANSA 2P90A 3JQFA 4HQLA 1J99A 2CCKA 4JLKA 2WU3A 3NDJA 5TT0A 1GEEA 1W9HA 4XM2A 3AHFA 1UKYA 4YT8A 2C3YA 4FE3A 3BN3A 5K3FA 4B6GA 3SQXA 1KYXA 2UYHA 3U1TA 4UKDA 1PBTA 7GPBA 1FDOA 2E4UA 3OZAA 3Q40A 1DAFA 4EYQA 1KP2A 4UMFA 1T8PA 3OC6A 1SXJC 4C4TA 4EB6A 3THWB 1DELA 1NDQA 4EGFA 4K9MA 2F6RA 2FPPB 1YFLA 4EW6A 1CTQA 2ZM5A 4WNAA 2AN3A 1KRHA 1G5PA 3QG5A 3QPDA 3DZKA 4PLWA 1A7UA 3ZD9A 1E1DA 1KFEB 1SHUX 2A8YA 3DMRA 1SUWA 4DCJA 4US2R 2NAPA 2AI2A 2OILA 3U4QA 4MKHA 3ZQUA 4LQDA 5KTTA 2RK6A 3NBZC 3OCJA 3PSAA 4CW7A 1NE2A 2G09A 4DRYA 4ZJUA 5B3JC 1JDBC 1SUBA 3G2OA 1OZGA 2KBEA 3USZA 5A3QA 4HNTA 3W3AH 4N8DA 2ZG6A 3FI9A 1ML4A 1BXZA 3LU1A 1R4NA 1USGA 2ZSFA 3UCXA 3WJAA 4A2WA 4E6PA 2W0MA 2B7LA 4ZOAA 1NVWQ 2FVYA 5DYGA 1XKTA 3DEFA 5C53B 2FZGA 1LW6E 1TKCA 4EW3A 4ZO6A 4JGGA 1K8YB 4UTXA 4I9NA 5CVEA 1KEEB 3QG1A 4E5VA 3EJWA 1QS0A 1UDBA 1YTLA 1WLYA 2ZRJA 3WK8A 3ZHSA 3BGOS 5JISA 1EHIA 1Q44A 1CKEA 2LE0A 3KTAA 4G0VA 4GKVA 1FTSA 2Q8PA 5FNVA 1D4ZA 4OJTA 4KWTA 2A5LA 1FP6A 3KT8A 4NBRA 2IIQA 1C1XB 5HKKA 1Y34E 1ZN2A 1Y4ZA 3NU1A 5K45A 1FTGA 4RV5A 3HI6A 4ZT7A 4RESA 2R1VB 3GJ8A 3DXXA 1PCXA 4GPD1 2PZGA 3PIRA 3WB1A 3ZDAA 3F49S 3KPVA 5LKRA 4Q3CA 2G5TA 4PG8A 5K8LA 4GOLD 1P5FA 1ZUD1 4Z49A 4E4RA 1BWSA 1WZIA 2D1SA 2FHPA 4HDCA 2HU7A 3EISA 1DC8A 2AOUA 3TVTA 1PNVA 2NOAA 1DJOA 2ZT6A 3LUJA 5LYJA 5CAEA 1NGSA 1MRZA 3QU9A 4KQGA 4N5DA 4QXOA 2YL2A 1VCMA 1PG5A 1TA9A 2ZXEA 4FGWA 3JTEA 3N05A 4J3FA 1W8IA 5G0WA 2FHSA 3UC5A 4U2CA 5KYYB 1G3UA 2I1LA 4NZ9A 5K3BA 1YD7A 1G7CA 1UMDA 4L8WB 4G97A 2JZCA 2CXNA 4KR9A 4GW3A 3GD5A 2YJ4A 3W78A 3LYAA 1M6VB 3QPWA 1KORA 1ZXXA 3LZDA 3MWGA 4NU6A 5ALRA 2X5KO 1HFWA 3PLRA 2IXGA 3C8ZA 3GBVA 3ZGOA 2YHIA 2QSUA 1FZQA 2XDAA 5DO9A 2HC9A 4EJ0A 4MYDA 1WW2A 5CPBA 2RAFA 3L93A 4BP8A 4F3RA 2XSZA 1E2LA 5EWLB 1X2EA 4DA0A 3EAGA 2J5XA 4L7VA 1PHPA 2EP5A 2PAAA 2UYOA 3EEQA 4XDGA 1U1IA 3VPGA 1MA3A 3OCCA 1X7GA 1ONBA 4M1KA 2BGJA 2KI5A 1RYHA 4BJ6A 4YRKA 2QK4A 4OQMA 1S3IA 3E4DA 3JD1A 4I5FA 3TUIC 4AJOA 1M2WA 1U9YA 4FSHA 1QVVA 5J2UA 4E2FA 4OTZA 2WR8A 1PZEA 2LDBA 5HK9A 1J9GA 1CSEE 1J33A 4F92B 3C7TA 3CZPA 3Q98A 1PD0A 4K87A 3P9PA 4MVWA 1MJ5A 3O8DA 1P6UA 3JYQA 1YJ5A 4B8WA 5KOHA 1NXPA 1SKMA 4J0HA 1B93A 4D8VA 3BERA 5LB2A 5LB4A 3GNQA 2Q7OE 2XB9A 3SC2B 3FCAA 4K26A 1P1KA 2Q29A 4BATA 2O1SA 1KEKA 4RULA 3TJRA 4DR3B 3LJKA 1N5RA 1YCDA 3RFUA 5HIKA 4I1PA 3ZH9B 2XSZD 2VP9A 2AK2A 4J43A 4BMPB 1WS6A 3Q7PA 1CJKC 3I1YA 3G2MA 3OIGA 4V0QA 3L79A 2HIMA 3Q3JB 1W35A 3EGWA 4GZMA 4CKXA 3LHIA 4KN5A 2VSNA 1V9SA 2H17A 4UHFA 1PTJA 2FMHA 4RAOA 1ADGA 3HRIA 4P2GA 2W6OA 5TMPA 4E5NA 1EIZA 3CPJB 2W2TA 2A0UA 1XZMA 3IV7A 2WJWA 3CLUC 2OP1A 4X8OA 4ZAZA 3KTFA 1YA8A 4C7BA 3ICOA 3KCNA 3D3WA 1IJKA 3ENKA 2JARA 3H5IA 3UTCA 5J1SB 121PA 3HGMA 1VSVA 3CJTA 3MOGA 4HRVA 4MDYA 1QGOA 1HRKA 3GJZA 3L77A 4B6FA 3NTVA 1XEAA 2XV1A 3FFTA 1WMSA 3PHHA 5GM2A 1BDMA 3F47A 4RJKA 1YJ8A 3IEPA 3ILHA 4A9AA 2CHQA 4IF4A 3X43A 3WQBA 3QMMA 2WWVD 5EZYA 4R69A 3TUJC 4LGMA 3TL2A 3AONB 4ILKA 1WW8A 4PR3A 2VJMA 5F2EA 4A4DA 1O94A 3L1HA 3H5LA 2JLBA 3O74A 3NAZA 1KYVA 3Q7IA 1T5SA 3D5QA 4Q05A 3BFXA 2ARKA 2G9UA 2LZ0A 3A1UA 4P0QB 1F0KA 2OFOA 2IP4A 4KVFA 1UAAA 4J2HA 3P9QA 3KSBC 3L1IA 4W6ZA 2SKCA 1F8XA 4FYIA 2GA8A 2NTYC 1P0MA 2O8VA 1TOAA 2PH5A 2J9GA 3NYIA 5TR9A 1VSBA 5FL3A 2WUWE 5KQSA 2MR6A 3KOYA 3OQ1A 1RWBA 4J8PA 4JJFA 4JNCA 3ZU5A 3T0FA 1XTZA 1EWQA 1AUXA 1FTQA 2PXCA 2VBIA 4YCSA 4K1LA 2TYSB 3JX9A 2XXAB 2P0YA 2R5NA 3E7XA 3N2KB 3N8IA 1L5LA 3RIXA 4DAOA 3WLEA 5CB8A 1XZAA 4DEYA 5ENZA 2XTMA 2XOEA 5B1EA 1U3GA 3A1DA 3M1LA 1OV6A 4BEVA 1T5HX 1C7RA 2BFCB 2O9JA 3Q0TA 1XYVA 3SXJA 1W52X 5B5SA 3LVRE 5LLDA 3W8DA 4RE6A 1YVPA 3RC7A 4E88A 2ZJOA 2X1HA 5KKNB 5TPWA 3A9RA 2WHPA 3ANXA 3KKPA 3B78A 1CRZA 1QV6A 4G65A 3LCCA 4RDIA 3EXIB 3RT9A 2VJLA 3EUWA 4GI5A 3WLKX 1KMQA 1ZP6A 3ZX5A 1VKHA 2MDTA 3Q7RA 4EY5A 2IU6A 1UQUA 1J0BA 4IH1A 5DIFA 5TGDA 3VSEA 2JVKA 4XJXA 1I5EA 2DUNA 5FBZA 3ECAA 3WLNA 1LF0A 2YV4A 1M83A 2ZSDA 3IOYA 4MUYA 4CNBA 3DWGA 3H6KA 5KQPA 4CIDA 3KZXA 2HDWA 3AM4A 4I1VA 1RCTE 2CV0A 4MV8A 1HYEA 5KQGA 3DKKA 2O52A 1MAUA 2YJ5A 3CNLA 2Q0XA 3TTUA 3BGVA 3CVWA 4YJGA 3VNBA 2O54A 4PHTA 4M0LA 4AUNA 3LF2A 3LRXA 5H1YA 5G4KA 3AFHA 3WGLA 3JD3A 2CFTA 2H5LA 4YDQA 1N5LA 3L8HA 3V7FA 1CY1A 1NVGA 1PL0A 3VPXA 4DQKA 1MT0A 3W7VA 4U0JA 2Q0QA 1Z7YA 4U2KA 4RKRA 3GWZA 3PDHA 1UK7A 1TUIA 1AQUA 4L15A 4PWYA 1V16B 4RHEA 2AEJA 3ROEA 4QBHA 4UFPA 3K15A 2X6TA 3I4LA 1PFUA 4EFKA 5K2MA 1LGYA 4TL6A 4Z9AA 4DWVA 2WM9B 1F38A 1PFVA 1Z56C 3AR3A 1J06A 3OQNA 1P1HA 2WZQA 2FFHA 1XUOA 4FOLA 4PX2A 4TSKA 4M87A 2Q6OA 1EZZA 1NBHA 2R6CA 3NV7A 3PQ3A 2P5SA 3H11B 1COWD 2XF2A 3AIMA 3HVJA 2AXPA 3L2OB 1TM4E 1X0VA 2C7VA 1J70A 3IKLA 3SCZA 3TZQA 4Q4LA 1H1TA 1I2AA 2XVYA 1NLUA 1ZUIA 3ABQB 1SBIA 1J8MF 1XDWA 2JS7A 3A3YA 3E1SA 3H2ZA 4KE8A 3K72B 4PC3A 5K3FB 4AMZA 5F1YA 2A0WA 1DZ3A 4HI0E 1R6UA 2B5OA 1K5GA 2JFPA 3WGNA 5NLLA 2GKGA 2VH1A 4EB6B 1CPYA 1PQUA 1Z7WA 3MRTA 2FZ5A 1BEZA 3VR4A 3M6FA 4BZQA 2PUAA 4PLYA 5HMLA 3QVUA 3QYJA 4WNAB 2E5LB 3VU8A 3PFFA 1FSSA 2ZUUA 5FKJA 5PNTA 1KJ9A 1OU0A 2PWAA 4IIVA 5AP9A 3OZIA 3TBFA 1OZFA 5IMBA 2JIZA 1KY4A 3UPTA 1F6WA 4X1IA 2IRWA 4MYCA 5TPZA 2XVMA 3SF8A 4UM9B 2AE1A 5ESXA 3U4QB 2GM4A 4HS9A 1J8YF 2GDJA 3VH4A 4AF8A 3TOVA 2QT1A 2VKQA 1EVLA 3O9ZA 1Z22A 3P9IA 2J45A 4L85A 5KHAA 5DBEX 1NZDA 2J6HA 3V46A 4EW1A 2XVZA 2V4ZA 4TSFD 3I1FA 1Q83A 3CXUA 3PT9A 4MCAA 1R4NB 4EJ2A 1CULC 1LPSA 2VHXA 1IYZA 1WUTA 4CZ2A 4CIAA 2QP9X 3VSAA 1G7RA 2Z6QA 3MWKA 2YXLA 2Y77A 4EPYA 2QR5A 4QTZA 4WBXC 3CLKA 2XZDA 3GXBA 2CUZA 1OFTA 3PQDA 5IKPA 5LJIA 1QS0B 2IGBA 4PNHA 3X1MA 4EA9A 1G41A 2GQ0A 3G8YA 2Z98A 1R0CA 4EP1A 1CJVC 3F8TA 1KIFA 1KJYA 4KFSA 2H54A 2W2LD 4HYEA 3FTCA 4V0KA 1OX4A 2NXEA 2BZ0A 2V3WA 3C8UA 1Z5VA 3KTAB 3B1WA 4QEKA 1M1ZA 1PJ2A 4JUDX 3GUCA 4PVCA 3L0OA 2RHGB 5FNVB 1S2IA 4UUMA 1T0BA 1R5JA 2JIDA 4KDCA 1VJCA 4BX9A 1ZGCA 2XGJA 2QW0X 4JJAA 3TYXA 5DHTA 3BSSA 2LTAA 1IZ8A 4HT3B 3IE1A 1NXTA 2JIZD 4RHCA 3VSDA 5AW2A 3P1JA 5IG2A 2VAXA 1Z0ZA 3T3GA 2K5UA 4L9WA 3AO0B 3VAAA 3COZA 4HDOB 1OTXA 4MEJA 2HWYA 2PL5A 3T9CA 4BVEA 5BQFA 2GZAA 1IHUA 4MA5A 4MW2A 4Y2UA 5J58A 3KE8A 1JTEA 1XP5A 1JHMA 2QTBA 2QMQA 4UAGA 4MW5A 2AOUB 3P0EA 1RU3A 1W0JD 1WNTA 5LYJB 3OA0A 4OUDA 3C87A 5CAEB 4C30A 3HPQA 3LQYA 1V26A 3OP4A 2UYYA 5JTTA 4N9QA 4N76A 4ZVSA 3VC7A 1YZVA 1T9DA 2O06A 2X2PA 1T2UA 5KNCA 2OD9A 2PX2A 2QN3A 2A9RA 3D5EA 3DE1X 4OK6A 4X91A 2J3KA 1UMDB 2RBGA 2G07A 4HFNA 3SQLA 5IF9A 4IIXA 2ODNA 3TEJA 2JI7A 2WG2A 3QXHA 4R54A 4IRMA 4PAOA 4D79A 5KX5F 3ADOA 2BDTA 3KDAA 4PRZA 3TPCA 2WF8A 1T2FA 1OIVA 2PGOA 2YHIB 3AEQA 1W2GA 3L7CA 2OZEA 1K06A 1L7EA 4RL4A 5CFPA 3IILA 4Q4HA 1A04A 1JEEA 1K4YA 1O5OA 1R6VA 1T5IA 3FWZA 4O5AA 3HCAA 3AIIA 3R24A 2NPOA 3PNYA 3RU9A 3LP8A 4IEIA 1OXXK 2A67A 3AEYA 3BRQA 2NM0A 3D2BA 4XYBA 4QQNA 2J87A 2BM1A 3PE6A 1XTUA 4V0NA 1VFPA 5K01A 4F0JA 3VC3A 1DQNA 4OHVA 3OJEA 5J2UB 2NZWA 1K66A 3GBPA 1MQ8B 4TYWA 1ZCJA 3FSRA 4KFRA 4RZ2A 4FWTA 2R96A 4GZ6A 4BQPA 1U3UA 4OIMA 1EP9A 2AFVA 2NG1A 2A3NA 2KW5A 3RRJA 5KOHB 3WFJA 3HJCA 2ZYHA 4CEJA 1PR6A 2Q3MA 2WHQA 3QEOA 4OHOA 4FN5A 4TL9A 3TQQA 4W7IA 3FJ1A 5KOIA 4J0GA 2DUMA 4X97A 3U26A 4WERA 2GYWA 8AT1A 1UJBA 2ZVJA 1BQ3A 3CUSA 3WNQA 3C5VA 4UZEA 4IL5A 2JAHA 3HYCA 3LLSA 3OUUA 3WBKA 3QJGA 4X71A 3JZDA 2OK7A 1Z17A 1UT5A 5DRTA 5GP1A 4NBTA 1T2NA 1UIMA 4AJNA 5EIBD 1H66A 2JIOA 3GQBA 1LA2A 4H7IA 5CVJA 2GZ1A 3AJDA 4BO6A 3D3WB 4RKEA 4IGAA 1YJCA 3TX2A 1T1GA 5AOBA 1IUOA 4OJQA 3ZPXA 4RHTA 4M9SA 2B6HA 1SPXA 2VT2A 3DG9A 3FX2A 1F06A 3H9UA 4JLPA 1RM4A 3P20A 3VC2A 1E3SA 3E9NA 3NASA 4QWWA 4LOLA 1IDOA 5FUVA 1C9MA 5AHOA 5EZYB 3P5BA 5DM60 3CEAA 2BISA 1FX0A 4CI9A 1SCKA 4FMDB 2VJMB 2CLKB 1FNDA 3PHBE 3PUZA 2X9NA 1L5MA 1NVBA 3G6KA 4LJKA 1TEXA 4ZO7A 3TAHA 3O26A 1L5YA 3G9TA 4YI5A 2DHCA 4BB6A 3N59A 5I45A 1C0PA 1SBCA 3ETNA 3H42B 1PJCA 2IYLD 2A2ZA 4KRGA 5HCNA 1JPJA 1P5ZB 2VEOA 2ZJAA 1ZHOA 4KR6A 2W2MA 1YULA 1RAIA 1YL7A 3ZWCA 3EZGA 3OT1A 3C97A 3T06B 1G3IA 4ZVLA 2O1WA 1PW5A 2JLXA 2FETA 2WE8A 2H07A 2O8NA 2QRKA 3EEIA 2Z5GA 2D00A 3N3AC 4RGVA 4JI3B 4AN4A 1T25A 3LW7A 1AMUA 2G82A 4X61A 1C2TA 2XLCA 1CQPA 1YBHA 4DMRA 4ZKEA 2C8KA 1WXFA 4WK0B 1F5SA 4WOPA 3C43A 3TL6A 5K3OA 2CW5A 2XVAA 1XDZA 3IHLA 4JBNA 1YVUA 3UANA 3UK0A 3MGKA 1I4WA 3ESCA 4M9UA 4ZYXA 1D0SA 4TUYF 4FZ3A 4WRRA 3RUHA 1ZMTA 5HUJA 3EVBA 3RODA 3P2YA 4K2AA 3HLKA 5TPWB 1G6Q1 1YR3A 2WHPB 3V4OA 3WR5A 4C7KA 3HO1A 3KVYA 2DFPA 4BC0A 1Q1GA 4EMSA 2QEQA 2IIPA 1Z4KA 2UXBB 1OLOA 3VZDA 3HA2A 4NFHA 4BDTA 4ESHA 1VJ1A 4EX6A 1GFWA 2CFCA 5IVIA 3ROZA 1UJ5A 1X38A 4L27A 3VR6A 1MX5A 3HGQA 2OMKA 3ZQ4A 4UC0A 3WAGA 1PUJA 5F76A 4YJGB 1U3FA 1RC0A 3H1GA 4XOUA 4H9GA 3AM3A 1VL5A 1XAIA 3QVMA 5G4KB 1GRCA 5ED4A 4JLWA 3K30A 3BIWA 1DPGA 3FDIA 1CR2A 4QUEA 4LTNA 4ZMBA 4AZTA 1K0FA 4KI7A 1BE0A 2QENA 1OILA 4BMYA 1TCCA 5DX1A 1VZ3A 4PQGA 5CB6A 2B5VA 3K0EA 3WHLA 2QQ5A 2R00A 4MPRA 3WK4A 1XD2A 2A4KA 2BMAA 5LZ9A 1QH1A 3K2QA 3K53A 3QUBA 1M66A 2H3HA 1CQIA 1E6WA 1K1EA 1M8JA 2V7EA 4DJ5X 1QP7A 2XA9A 4E09A 3IR6A 3IAXA 3ROTA 3UJ6A 3OO0A 3TVDA 1I13A 1J0AA 3KLBA 2IZ1A 1P0PA 3T34A 4D4LA 4YV1A 1PZMA 4XYMA 2CV2A 3KVNA 3U0VA 2Z3WA 4RD2A 4WGFA 1RJEA 2VDQB 1XTQA 2HJGA 2Z43A 5GOTA 4TXNA 4DMFA 3ISJA 1QAMA 4DDMA 3ZXYA 4O08A 1K2VN 2X76A 3EY9A 3BCHA 4NDAA 5EJGA 1W85A 4LF4B 3R9WA 2NO4A 4YQYA 3ET4A 4PW0A 4RWEA 1KIMA 4MQ6A 4O1HA 4CODB 1EDZA 3EAQA 1Z2PX 2K2QB 3FAKA 3MJTA 4KXQA 2RJNA 3P9CA 4LZAA 4YRAA 1Z38A 1XCMA 2WB2A 3BK2A 1Z35A 1TCVA 4RETA 4FT4A 2GDZA 4TVOA 2B78A 3WRWA 4G0YA 4G07A 4MITA 4OAPA 5DTQA 3KB6A 4IDQA 3ZE2B 4H7FA 2HRRA 4FNMA 4UTZA 1G38A 3P4UA 4M0FA 3GGPA 1Z6QA 4X1IB 2AC2A 3IP9A 3SF8B 1WDMA 3ZBUA 2V97A 5KTKA 2BFAA 3DVAA 4DSTA 1XRNA 3QVLA 4HJXA 4PY2A 3E22A 2I8CA 4N1AA 2GRAA 1AQJA 1RM3A 3HWRA 3I6YA 1W6UA 4P3KA 4PSKA 4RK0A 4JUFA 4CQLA 1O77A 1Y4AE 2G77B 4HQKA 2LKDA 3GB9A 5SY6A 1CWUA 4ZEMA 3TJMA 1CHDA 2I2CA 4U39A 3BFVA 3LUAA 3RC3A 3IQEA 3I01M 4ALNA 2I3ZA 5JAQA 3VFDA 4KR2A 3ZOKA 2QROA 1UIRA 2WT8A 3ZTWA 2R1UA 2C1EA 4V0ME 3RU2A 2F8TA 3M9WA 4K3UA 1ISIA 4Z86A 4UAJA 1C3OA 3DM9B 3WFIA 4EYSA 4Q00A 2XXJA 4WACA 1U8UA 3E5HA 3FWKA 1OX4B 2CZCA 1JJIA 2P5UA 2GH1A 2HLHA 4BE7B 1YZUA 4KXMA 2GEDA 2Q4RA 2GLXA 5LA6F 2XODA 1NNUA 2FE4A 3L8YA 5F73A 4B34A 1ABFA 5KX5A 1E59A 1A72A 2CB0A 2H4FA 3CYFA 2YFKA 3IL2A 1TAGA 2OC4A 1QQBA 5DCWA 2QZPA 4TLDA 2HUPA 4A16A 3HM2A 4HXGA 5IVPA 821PA 1SCJA 1EIWA 1PEYA 1ETUA 4LHWA 4AK9A 3ELUA 1LCIA 2RJOA 1FDUA 3WV4A 1ECPA 2FY8A 3DV2A 2Q5CA 1HZZC 1T9ZA 2BFMA 3VHXA 4R1LA 4AY4A 1C3XA 4A03A 1EVYA 4R1OA 3KSMA 1Z74A 4KQ9A 1KYYA 4OUDB 5AWFC 2PLNA 3BQ9A 1NSTA 2AVNA 2BFPA 2RGUA 3R7LA 3SPXA 2E0IA 2C7BA 3TSWA 5DDIP 3FLAA 3UCEA 3WGJA 1K0UA 1Z6XA 3L0CA 2Q5LA 2J30A 4Q02A 1HT3A 3UXMA 3SQMA 2DBZA 4AG3A 3FMIA 3SZMA 4QLAA 4A3SA 4OX9B 4I1YA 2Q5OA 2ACEA 1X1QA 4H1TA 4OQQA 3RARA 3TM5A 1PX2A 2JBHA 3EBOA 3HYTA 4CTOA 3AEQB 3AKCA 3WLOA 1JWLA 5DGXA 1VI5A 3ZE8A 1AF7A 5BMOA 1WKBA 1PSZA 2R2GA 2XQKA 1MIOA 4Q4HB 1I4DD 4TTPA 1A8QA 1LK5A 1M74A 2MYPA 2J9ZB 3AR9A 3NT2A 4B3RB 3AHEA 1NYTA 2EFGA 1TAUA 1W34A 3RVDA 1PL8A 3S2EA 1QZTA 2QZZA 2E55A 3S55A 1JB9A 2XNJA 4BWGA 3WMEA 2GJAA 4LCBA 4W5HA 1AU9A 3FSEA 4XCXA 2C97A 2EHJA 1QAOA 2Q6VA 4YNBA 3C2QA 5ALXA 3EWSA 2BKEA 2GPAA 3IQGX 3LVFO 3RE1A 4G0OA 3HKEA 5EE9A 4QJ5A 3AHCA 3HCPA 5EGNA 3OF5A 1B0PA 4KUEA 2HU5A 2SKDA 4C5BA 1NSYA 1Z82A 4CV3A 2D0OB 1DWQA 2BY4A 2NO5A 3KSRA 4L4UA 1W5FA 2X9GA 5MDHA 1PBNA 2AS0A 4N18A 4CEJB 3BF7A 1BDBA 1KY2A 1RW4A 2LUOA 3DVLA 3JQ9A 3D8NA 2IELA 3E9RA 3HBNA 5KTSA 1MGPA 2ZS8A 2X23A 3F4BA 5AVVA 2QKYA 3KOUA 2W98A 4UHKA 2ZIFA 4ETIA 2VJNA 2XUGA 3ST7A 2BHRA 2BKVA 2H5IA 3M6IA 1JR3A 4XRGA 1O6GA 1D07A 1EGHA 2WNSA 3HCCA 4UNSA 3TMYA 2A9KA 2JFUA 3OZVA 2VF4X 3ER6A 2Z4TA 3CLTD 4RFLA 1F2UA 1E9BA 2BR4A 3GQBB 5EQJB 2OB2A 5FR1A 1BQ4A 4JH0A 1WUJS 2X7JA 5ALNA 5TARA 5B2FA 1LTHR 1M0TA 2GLUA 3A70A 4BL5A 1RWQA 3B6KA 3TAUA 1OW3B 3CUUA 4DR4B 1XD8A 1ZOIA 3T4XA 4HCJA 3U4DA 3PWKA 3ZWKA 4M3NA 4R9UC 5JD3A 3FBWA 4I08A 2ERXA 2QRNA 3UMVA 5K5EA 2GXQA 4RXMA 5IHPA 1DSSG 4Z53A 1CP3A 3FHLA 2G6TA 2XRMA 5HIIA 4KFUA 2G08A 1FX0B 3QFCA 2BHNA 3D4NA 1W0CA 3SQOA 5A6SA 1V11A 1EHYA 4BN4A 5D1HA 2C94A 3LM8A 4MYSA 3TEFA 2HZBA 1TLLA 3LPCA 1CRPA 2VP2A 3GA5A 4LY3A 4RORA 2AG0A 4TUYA 5DNDA 1QK5A 4Y1EA 4TN5A 4BO3A 2POQX 2HBRA 1HLPA 3T5AA 5CIWA 4DDTA 1XXHA 3OG9A 2HPAA 3BEOA 2K6GA 5JEEA 2YVAA 1KQFA 1OBOA 4Y9RA 4DM7A 5EE5B 2YWGA 4WKGA 3HCFA 4Y2YA 4F5YA 1B76A 5CYPA 3AVTA 1VRVA 3OT1B 2C92A 3N5KA 3NTUA 2E89A 4UE3S 1MB3A 1YOBA 1XEFA 2FV8A 5ILGA 3VTAA 4DIOA 2AUTA 2FEWB 3PNQA 5ANRB 4IRXA 2BHTA 3ZU2A 4EY8A 4ABTA 4EI8A 1Y9ZA 3G2QA 2Z58A 4CIVA 3RBVA 4YO8A 3A37A 2QT9A 5TEWA 1U0JA 5FTNA 4E4TA 3SDSA 3WO1A 2XUDA 5GZ1A 4Y1RA 4H4CA 1P0QA 2O6LA 3L4BA 3K0SA 4Y3UA 1W76A 2FOLA 3DLCA 3GEHA 3VYTB 5JMTA 3B5EA 4KAXA 5KYWA 2J1LA 3HP4A 5DHSA 3UOAB 2Q4BA 3B3QA 4JYCA 4J75A 3EASA 2FPWA 5AK5A 5CTJA 1RYDA 3GIWA 1MUUA 1VKOA 4MGIR 4I1SA 2I6QA 3SBEA 1XA0A 4GXRA 3T1HB 1O9BA 4ZI5A 3N8NA 3Q0IA 1ODKA 3K9LA 3Q8WA 4YQEA 3U1VA 2KSQA 1M0EA 4G0UA 4AP5A 4BNVA 4BKMA 4RADA 1X42A 1NUAA 3HFSA 2VRBA 4EAAA 3DHVA 4RD4A 3DF9A 4ZN6A 4Z0TA 3TXAA 5AW1A 2CXTA 3GO4A 4YXWD 1E20A 4M83A 3WLSA 4BZXA 1RQ7A 2BE9A 4FNOA 4BNZA 4D92A 4KDRA 5KJFA 1BRTA 4E15A 4H0NA 4OQPA 5B7NA 4A8HA 3RW9A 3ER9A 1OFIA 4KGVA 3IESA 3DDHA 1UJCA 1NQVA 2JL1A 2O0JA 3L8EA 3FMOB 2JGMA 1JB1A 1H2BA 4JYBA 5LC1A 3VVBA 3VKGA 3ORHA 3CR8A 2P9FA 5DBOA 3O8LA 4M37A 4ZEWA 2XOKD 3N8DA 4ENRA 4A5SA 4DLBA 3UH1A 3OE4A 3Q87B 1ADCA 4ZRNA 3PJRA 5FNZA 2J0VA 1XD2B 1O4WA 1QH1B 4QOGA 3IQXA 1CQIB 1FFEA 1DZIA 2VL7A 4CV2A 4QYXA 2J3EA 3NORA 2P9JA 5GZ6A 2WHRA 1LZLA 1RXUA 4MIEA 5FEUA 4OD0A 5B64A 3AEUA 5IU6A 3EPKA 1I36A 1KS2A 2OQRA 5B55A 3ASZA 3C3DA 2WY2D 1Y63A 5HPYB 3E2PA 4MQBA 2IVFA 2WOJA 1YRLA 2ZYDA 3IBGA 4YRCA 1A9YA 4OKNA 4PG5A 3SQNA 2L18A 3DXFA 1GG2A 3CJRA 3DFFA 1W85B 3I0ZA 4Q4AA 5FORA 3HFRA 1ATIA 4Q6WA 4X5OA 4Z0HO 9LDBA 1DWPA 2OENG 3ABOB 4K3VA 1WY5A 3R6GA 1HDRA 2XUHA 5AHXA 2X7XA 4C88A 1Q7BA 2W6ID 2PX0A 4HDSA 1WCXA 2ZE5A 4MUMA 3WZLA 3MPOA 4YR9A 4K8RB 3UCFA 1W46A 3I9V6 2WSLA 3CGGA 1JAHA 1U4OA 1LLDA 1ENOA 5AM2A 2W4IA 3BF8A 3R0QA 4QQRA 1P1BA 3R0ZA 4XH9B 3AFOA 4QFCA 3BHJA 1JH8A 3O8RA 1IBKB 4BNYA 3ZCRA 4WCDA 1RZRA 3DVAB 4WA7A 5KPDA 1NT2A 4E07A 2DFLA 4NU8X 3C6BA 3PYMA 1GQFA 4GFDA 3E22B 2QBYA 3ABIA 1PVDA 3I9FA 1X9IA 3NYWA 1SB9A 1Y37A 1PJ4A 2A4MA 2OORC 1AS2A 2W6QA 3MTEA 4Q7LA 1C9KA 2EL7A 4CQLB 1KQGA 3AUUA 5BSVA 1NR1A 2ZT8A 1LPAB 1RM5A 5HBGA 1YV9A 5HGJA 3NVKI 4DLKA 4MB0A 3ESYA 5FJIA 1ISFA 1WHSA 3EDCA 4ARVA 1GUYA 4HAWA 5H4GA 3QVGA 1GL6A 2RSLA 5HHTA 1ZG3A 1AK9A 5HJEA 1E63A 3KHUA 4PS0A 3SIXA 2AUMA 1C3OB 4B0OA 1TLTA 4CM4A 2ZJZA 2B69A 4XWGA 3P2KA 4Y2RA 3K70D 2FSPA 2E4VA 1DJLA 2ZJBA 3I61A 3EFBA 1PNRA 4Z1MA 2BR5A 3NM5A 3U4GA 1IY9A 2F1RA 2X77A 3ZWMA 5IRCD 4TLLB 4W5OA 1DAGA 3GX1A 4EOGA 4IDOA 1XTIA 1M1YA 2HSZA 1QIEA 2JA1A 3AXTA 4WXRA 1AXRA 5KX5B 1A8SA 4EH1A 2GEFA 4S2EA 1T4MA 3DO8A 1HYBA 1QG4A 5IDXA 1LC0A 4ARUA 2IIVA 2QMOA 2X5XA 4B47A 1V47A 4DG9A 5F2KA 3G2JA 2ZBGA 2V55B 5FFMA 1M0SA 1WX1A 1Z13A 3OZUA 2AXQA 5AKXA 4V1CA 4IINA 2X5JO 3VHXB 5GJVC 3CMCO 1FP2A 4TRNA 3CUTA 3AVUA 4EG0A 1G1AA 2IOHA 3VOSA 5KVSA 2CF6A 3SN6A 4JQCA 3RCBA 1B6RA 1D8TA 2PKQP 3RLIA 1DPFA 3VC1A 3DOEA 4KE9A 3U16A 4AQ7A 5IC6A 4Z4EA 4O2AA 1OLUB 4P4LA 3BIXA 4GWLA 1P9WA 3ZS9A 1C3EA 2ZJ4A 1UC8A 4M0DA 2XUFA 4UATA 4XAQA 3VV2A 3TMAA 2VDKB 4FHCA 4DOMA 2IS6A 4JCCA 1BYIA 1NKSA 1DHRA 5LP1A 3DS8A 3JARA 3TLBA 3VO9A 1XLTC 2FZVA 3BZBA 3PJEA 3UT5A 3A0UA 4B7AA 4EAQA 1MU0A 4Z1MD 1ETHA 5KYUA 3I2HA 4EO7A 5SV2A 5ESRA 5FA6A 3VA7A 3Q12A 5A3SA 1J25A 2Q07A 1HG0A 3AHDA 4NTZA 4PSUA 4JHXA 1IN5A 1SXJE 1MIOB 2VSQA 5IWAB 3JD2A 3HUUA 4P9NA 1NN0A 4PX9A 1IUPA 3VPDA 2XMQA 4BFLA 2ZRQA 4KI0A 4YI3A 4C6HA 3MCVA 1PWHA 2B1QA 3N8GA 2Q45A 1AQYA 2GCOA 3NNNA 4O4IA 4UQPA 4IP0A 5CJPA 3VOBA 4CKEB 2J3MA 3GDOA 3S2UA 1JHOA 1M1UA 1KO8A 1WW3A 3RSHA 3VO1A 1N5IA 4H77A 1YB2A 3UHJA 3M5CA 2WJ3A 3P26A 3T4UA 2ZKIA 1TTTA 4D0LB 1U2GA 3KLPX 3NETA 1P2GA 5EMNA 3LK6A 4U2EA 4YJ3F 1IXYA 3KQOA 2PLAA 3PPWA 4RD6A 3UN1A 2GZ2A 2ZYRA 4XIIA 1QMGA 3HKEB 3R5JA 4UBKA 5CNJA 1QHIA 1KVRA 3L02A 4G09A 3WNBA 2VYNA 2R68A 4YASA 3USES 3AM1A 4X3PA 3W3ZB 3WXMA 5AKLA 4K28A 3BTSA 3H75A 1P1RA 1UMCA 4W8HA 5AI8A 3FD8A 4HH1A 2ZROA 1SRRA 4HX5A 4PQRA 5HIMA 2NT4A 2AXNA 2OZPA 3OEHD 3NBMA 1WMFA 3DAFA 3G1WA 3H9GA 4AG6A 3IE2A 1HA3A 4S1NA 5E2IA 1RC1A 2IP2A 2VOJA 2XJ9A 4JU9A 3UJDA 1PHRA 3GN1A 5F12A 4NRDA 5EUCA 1F8FA 3IB6A 3SI7A 3G5UA 1T6YA 4K9SA 5G40A 5FOVA 4OXKA 5JNUA 3ET5A 3OM9A 5H3HA 3SS9X 4IOMA 3WRXC 7MHTA 5BYBA 4M46A 4RDXA 4JITA 1U94A 3MJVA 1GL9B 4OK5A 4UD2A 3C3MA 4C4XA 1F2UB 1AHHA 1W2HA 3HADA 1C4KA 2IE8A 4RACA 1HRDA 1VCIA 1XU4A 3DE4X 4GUDA 4NCIA 4UDNA 4M8KA 2I9KA 1LBEA 1NBOA 2K87A 1Z8HA 4P7GA 1KYZA 3NATA 3DDUA 4KRFA 2Q7DA 5LLTA 2G7ZA 3F4LA 3I52A 3OCZA 4XUDA 1U7WA 5KNDH 1UH5A 2A1TS 1BNCA 2XUKA 4YQFA 4P58A 5C51B 1Y80A 5CVVA 3I4FA 3HLTA 4FQ8A 2PSDA 2GCIA 3INNA 5A6SB 4G0PA 4XIGS 3S1LA 4EHAA 1V11B 2QWXA 1XEWX 1RRKA 1Y48E 2YNMA 3C3YA 2RHMA 3FN4A 3ORSA 2OWEA 1ZITA 2QGZA 4IH9A 4JC8A 4OOFA 4PBSA 4BNIA 3V1LA 4D43A 2MSDB 2OGTA 3T9EA 2R751 4TUYB 3AUAA 3OEED 5DWVA 3UYKA 4LNUA 4BFUA 2PR2A 1QHSA 2VT3A 5CM8B 3RB8A 1XXHB 1HLGA 2G9RA 4LYFA 4C4ZA 4DZTA 4E1AA 1K9SA 3ZXSA 5IM4F 5G41A 2G80A 1VRWA 1RFGE 1DG3A 1WDWB 2IOFA 2RGCA 3S8EA 3EODA 2IPMA 2P2LA 2J0EA 4IEFB 4N5LA 2AMJA 3ONVA 1L7VC 4HN2A 4JX9A 1JZSA 2ZE7A 5K4AA 1YCHA 3DFMA 3N53A 5JNTA 1E61A 1OH5A 3EGVA 4F2GA 3QU7A 3N0VA 3PQ5A 4ZC8A 5JS7A 1O1YA 2VWGA 4MRVA 4NU0A 2EL9A 1HEUA 3M81A 1GIAA 4EF5A 3HN6A 2VYQA 3IP6A 5A7HA 2ZSKA 4RD3A 2BGNA 1LDMA 1VPTA 4B09A 3M4NA 1JSZA 3H1TA 4JJKA 4N7RA 3DB1A 4Y1RB 4PNEA 1RLUA 1GNVA 5KYWB 4HH4A 4YPFA 3VKWA 1XEXA 3TG2A 4B3IA 5E2AA 1XVAA 3K3PA 4FINA 1QYDA 1NW8A 4QOHA 4B7XA 4PU0A 4YXFA 1O96A 2Y9MB 1F48A 3W1EA 2UUPA 2CHFA 4BKUA 2I4NA 5KWIA 1QH8A 3ZXIA 3MILA 2XCIA 4WFQA 4MMXB 1LS1A 3FOAA 1KJ8A 2XPCA 3VUEA 4GX0A 3K6JA 1NQOA 3KFVA 3WLQA 4NJEA 3QY9A 1V5FA 4GBJA 4PYJA 5JRDS 1NW6A 1FBNA 1ZVJA 2AQIA 2EAUA 3H2BA 4N5NA 3QE3A 4DW8A 1QF9A 4MW1A 1G8FA 4RE5A 4ARSA 2JVIA 4KQJA 2WP8J 1SEVA 4QDJA 2IH5A 3N1UA 4UHEA 5D86A 2VZ9A 1C41A 4HB3A 3FB4A 4M98A 4ZVVA 2HM7A 2VR1A 2C2OA 3U09A 1PTKA 3FTFA 4BO2A 1CV2A 3CWQA 5EHIA 1NSFA 2UKDA 1GFZA 3H5NA 5THQA 5F1KA 1WUIS 2UU9B 2PA0A 4UCWA 4OMUA 2X1LA 4ANFA 2HWXA 3D6TB 1TJNA 3JALA 3ASUA 1U02A 4OH7A 2QRQA 4G1VA 1MIHA 2G0NA 2QVYX 1JG1A 1RJWA 4XWWA 3CF0A 3CW9A 3D6MA 1YB1A 5B4VA 2ZRDA 4NSNA 2R6AA 4GI7A 4JJ4A 3W8NA 4PYIA 2NSDA 3AEUB 3TB4A 5BURA 3MUNA 3A7EA 1D2CA 4BV9A 1K3FA 1BX0A 1OB2A 3CVYA 2IXAA 4Y1FA 3OFJA 1SK8A 1SH7A 3PC4A 4JP8A 1D0IA 2D59A 3FZYA 5CVUA 5ALGA 1NX9A 4EM6A 3RSGA 2QSZA 3E9DA 5H4HA 3WQSB 4TOIA 3AVXA 2DERA 4R71A 3B9BA 2Y4NA 5F1PA 4NS1A 4C6SA 1TU3A 3P2MA 4OGFA 3PHCA 3VI4B 1NONA 5AVQA 3Q10A 4JWKA 1UWVA 5HILA 3ZKWA 3ZJTA 1ODIA 4BQNA 5BWBA 2CJWA 2V58A 1DB3A 1M2KA 5D5QA 3QVWA 5B1IA 2NO7A 3DMFA 4PZEA 3KD2A 4D8TA 2NMVA 2CV1A 2FSVC 3QFFA 4LJ9A 2WBLC 2QQEA 2QF7A 4RU1A 2ZR8A 1VL2A 3NX4A 1K3TA 5IT0A 1UKCA 1ECJA 2IYFA 5AICA 4OI4A 3WGHA 3A28A 1GTSA 3ZCTA 1ST3A 3TCXB 1NLFA 2DQKA 3VDNB 2QBYB 1J97A 4H1HA 3I37X 2ECKA 3AUYA 3QBVA 5B2ZA 1Y1QA 3CKKA 3U7JA 1QVAA 4R2MA 1JI3A 3ZLUA 2ZZNA 1XQYA 3BOSA 3EXG1 4HGRA 3P0JA 4D25A 3EIWA 1Q0PA 2O8BA 5ULLA 1PUIA 1QTNA 4AMUA 1N6HA 4CTJA 5JJBA 1WHSB 4O0MA 4EVQA 1FFCA 2ZULA 3QVGB 2PLFA 1ZGZA 2EX0A 2WNHA 3BA6A 3PPIA 4YAFA 3G5LA 3RVNA 3TI7A 4UQLA 1USVA 5HRCA 1AV6A 3OU7A 2BP7A 3WL3A 3AKEA 4ZO4A 3FGPA 4DUGD 1U0SY 5KUTA 4P4SB 5M7EA 1XA3A 3D4OA 4F1JA 1NBAA 1HFEL 1XQVA 2Y76A 5DCUA 4AP6A 3T0IA 1N77A 4Q1VA 4K6KA 4MINA 5K51A 1T91A 5J63A 4EYOA 2PTGA 4B7CA 1M1YB 2GS9A 2OECA 4V0RA 3B60A 1YZNA 3HYRA 1R16A 4Z3KA 4BNMA 2BM8A 3V80A 3VR2A 1XMPA 2QR2A 1Z5OA 2R11A 3STVA 3NQ41 3NXSA 1CQJB 3HDQA 3I92A 3GG9A 4OHWA 3QWBA 5AKIA 4YY3B 4RSRA 1U04A 4URXR 3HZRA 3VDQA 4V1CB 3UJCA 3IB3A 3W34A 1P62B 3PT5A 4A6XA 3T3HA 2OESA 3RABA 1KAGA 1NZJA 1U7UA 4NPCA 5BORA 1ZUHA 3VYUB 2B25A 3IR7A 3CWCA 1F51E 5UKDA 621PA 4O2AB 1UPCA 1J20A 4DBVO 1NW7A 2GJ9A 4ZYZA 2GTIA 4GI3A 5CH5A 3RJ9A 1GPLA 2ZYIA 3L7OA 3X1XA 3GCXA 3GUVA 1FPMA 2I6UA 2JJ2A 3U9SA 3JARB 3EPHA 3JZMA 3JWIA 3UT5B 1A9XA 2NYVA 5KU7A 1ESMA 3K1ZA 3SZUA 4WN3A 3UMCA 2Q3EA 4MCIA 5KYUB 5F9FA 5A9RA 3OFVA 4NZOA 4JR0A 5I4BA 2BEWA 2KE5A 2P30A 2FOIA 4TZ0A 5GADl 4QOEA 3RSZA 4ZO8A 3GV0A 5G02A 1R0ZA 1I8TA 2LIPA 3EIUA 4JS0A 2OO7A 1P2SA 1IOZA 3Q3IA 4NMMA 3VGPA 1OB5A 2FK7A 2XVXA 4CKBA 4QFDA 4O4IB 3E84A 4KMRA 2GCOB 1EX6A 2JF0A 2XE8A 4LJ7A 4POAA 2J6BA 1RMTA 4FMBB 4L8YA 3ZZ0A 3NP7A 3CZMA 4CLEA 1SD2A 3DZFA 3PQFA 4OM7A 1E0DA 1FBTA 1L8XA 1UXOA 1IXZA 3JVUA 5IK2A 3PXBA 3ZE9A 1NVFA 1WMEA 4U5XA 4DA4A 4MP6A 1JILA 1WSDA 2IYTA 4H31A 3K4HA 3OICA 2OFFA 5H0IA 1NYLA 1JMVA 5HZGA 1GP2A 4K6HA 2C9OA 2C78A 4NV0A 4UE6A 1QQTA 2KHZA 3ZXXA 4E7PA 3Q7TA 4IGFA 4IYRA 3T9DA 1GKLA 1ORDA 2VP4A 1H6BA 4J6FA 4QL3A 4QDZA 3RT7A 4TYQA 1TA4A 1UMCB 4BVJA 4DQ0A 1TNDA 3EOZA 4B4VA 4KR7A 1G8PA 4IDGA 1JVBA 1PQWA 4F6RA 2ZDHA 3I2GA 5E4TA 3SHQA 1GHTA 3LPDA 4MHTA 3CX3A 1EX7A 1UQRA 2BPOA 2QG6A 3OSUA 4JSRA 4UHHA 3O5AA 2ZYGA 1JEAA 3KUUA 4NNJA 5EXSA 4Z0PA 3GPDG 4EGJA 3DMNA 4G0NA 4IXNA 4FM9A 1NHGA 1O0CA 3WIDA 3OIUA 4UFNA 1EA7A 3KX2A 2V6JA 2EZ8A 3O9VA 4GPAA 4ZRDA 5JANA 3KKLA 3NOOA 5MN4A 3F1KA 2ZT5A 1JQ5A 2Y8EA 5GGXA 1N5JA 1CUJA 4TTVA 4HXYA 1J09A 2PD6A 5TV2A 4ENVA 5IK2D 4HLQB 4FUTA 4IHJA 5IM4A 3I01A 3UW3A 5IN4A 1XWFA 1V8DA 3TQFA 4ZKDA 2WJZB 2QXUA 2WQ7A 1KPGA 1Y6ZA 3FCCA 3O3OB 4U7WA 1R8XA 4B33A 4NNOA 1A5ZA 5T4BA 2H65A 2JA2A 2HA2A 2X86A 1G8HA 3TXXA 2QMYA 3ZZTA 1KAHA 3NBQA 3VR5A 2PVPA 5AVTA 4GIBA 1LLQA 2OGZA 2QTMA 3QE4A 4L5JA 3CH7A 4P84A 2GK4A 3TIGA 1V8BA 4M9XA 3UM9A 3AOEA 5MGBA 2LVBA 3GJ4A 1FDRA 3K0BA 3R77A 4NBKA 4NE2A 1BWQA 1G16A 1T0PA 1E1CA 4GHWA 1Q74A 1YXMA 1HEYA 2CB9A 2IIBA 2ZJ3A 1ULHA 2YZGA 2O7NA 1GZDA 4J90A 4KQWA 4LCJA 2HREA 3WQRA 5CLJA 1UC5B 3EZYA 5MN6A 5TF4A 4YV0A 3D31A 3DV9A 1FFSA 4LNUB 3TZHA 1E6MA 3FNQA 4MV3A 4AY2A 1IXSB 1ZXBA 2C3MA 1IG3A 4H15A 3V4LA 2CMGA 4EDFA 3PGMA 2XDWA 4WKBA 1NVXQ 2YMLA 3JPWA 3LRPA 1PL7A 4X9XA 3EIXA 1TZBA 3DEHA 2EG9A 3ME5A 8ATCA 5H16A 3ZLBA 2QRMA 4HB4A 3DEZA 4I4CA 1QTIA 2JJ8A 1HWYA 1XJ5A 1VBFA 2BRUC 3JZFA 5IKEA 1JE1A 4QATA 4H27A 1JF8A 2ZJ1A 2B8NA 3TPFA 3FCYA 3TD2A 3ZI0A 4N7MA 3FNFA 1MVLA 1LSSA 1HUQA 2FMKA 3WNCA 1OSNA 3TLMA 1OC2A 2Z2ZA 5GPBA 1BDJA 1XEXB 5H9WA 5AFSA 1NF9A 4AO7A 5FPYA 1N33B 4UPVA 4BIIA 4OLFA 2APJA 3RTCA 3NFRA 4G81A 5AUNB 3KJNA 4E5SA 1O96B 3SOZA 1ESEA 2OV6A 1RAHA 2D8AA 1TIKA 1I9CA 2ZYSA 1CZRA 3HCEA 1ZMOA 2C5HA 2ZI9A 1QH8B 3E6AA 3PDJA 4FEEA 5AXCA 3V8BA 4C3VA 3SSOA 3BSYA 1E79A 3TZCA 3ONEA 2ON6A 6ABPA 1TU4A 1GQYA 4IPTA 1JAZA 5LMZA 2H1LA 3X1JA 5A2QA 4NJEB 4YDRA 4PHGA 2DT8A 2OY0A 3P4YA 3NHSA 3HV0A 4WZZA 4HNVA 2R8ZA 4E3ZA 1XMXA 3O8OA 5EINA 5BP7A 4YJ2A 2J7KA 4IJMA 5EQTA 1U81A 4NYIQ 3FYHA 5LP6C 2YCBA 3KXKA 3BIJA 3CNNA 2X4GA 3L1JA 3IR5A 4P98A 4UJ3A 4YCNA 1SHTX 1G4AE 1T0JB 3KLOA 2HMVA 4QARA 3D3JA 3S7TA 2QD4A 2ES4A 3CNQS 2X4DA 5JYBA 2VSXA 4H4EA 1T6NA 3E9CA 4MUAA 4B7ZA 4BTVA 1M7GA 1S3SA 2ZBDA 3UWKA 2HA7A 1ZFNA 2QVXX 1Q1BA 2G72A 2VF7A 4WKCA 2V1UA 1JHRA 5ICFA 1J2RA 2GYUA 1HNZB 2VDMB 1KQPA 4IFBA 1V9LA 4QDUA 1TF5A 3DUFA 3MGAA 2ASVA 3MJRA 1FXUA 3N0WA 3IBFA 3JALB 1ILWA 4IIUA 1ZSVA 2R65A 1ZUNA 3KZKA 2G1JA 2YN4A 3PX2A 3IOBA 1S2LA 2FGJA 1L4LA 1ZINA 1YFZA 3Q2IA 3GLSA 4M1YA 4FSXA 3S40A 1G98A 5KYXA 4N0PA 4RTPA 1B0AA 1GQQA 1HZJA 4OV6B 2FWNA 4LRUA 4P38A 4EG3A 1QWOA 4ND4A 3FOZA 4ENUA 5EP1A 3BWMA 4ZYYA 1YR8A 3BPSA 2VDNB 2HK7A 3IOMA 1XV5A 1ZGBA 4R2HA 1NC1A 4U6NA 5K0FA 4INPA 4LF6B 1TQ4A 3PFIA 1HK7A 2HYDA 2W6PA 3SX4A 3C85A 3PTZA 1BTOA 2PFSA 3DXYA 4IIHA 1IOVA 2ZIAA 5ALKA 5IJ9A 2JH9A 1FP1D 1UQTA 3GJYA 3OQHA 3DVQX 1JG6A 1WXXA 3QXGA 1ATZA 1QPZA 1B6GA 1CUCA 1M2NA 5EUQB 2OUKA 1OYOA 1EVKA 1VPLA 1W5AA 2AX4A 2EQBA 2IITA 2ZWVA 3RREA 1UKZA 4S1TA 3LP5A 3ZKWB 3B1XA 1YNOA 1F9EA 2Q2OA 3QLTA 2CJWB 1T36A 1IM8A 1L5GB 3OE5A 5AKHA 3AIKA 1KA9H 2VBGA 1BX1A 2FR8C 1COZA 4E11A 5EJ4A 5EHZA 3DNPA 2CNDA 3EXG2 1ZRNA 3OHSX 5BW5A 1AKEA 3KP1A 4UZFA 2I4RA 2RHOA 4I3GA 1YUNA 4L8GA 4BMCA 1JLHA 3R4CA 4DJDC 3SS7X 4LF7B 1UL1X 1TD1A 3IURA 4GM1A 4F91B 1VE9A 3KOMA 3NWBA 3RAJA 1VCHA 3HWSA 2Q2WA 2W7TA 4KIJA 1WQ4A 4XJVA 4R8SA 4YP1A 4TZTA 1W8DA 4HEQA 2B21A 4S24A 4XKJA 4WN9A 1U8CB 1UBFA 4R01A 4W5RA 3PDIA 2O8BB 4G63A 2NPFA 2J85A 1L3IA 5EQFA 2Q62A 2H1SA 3I2IA 2IWHA 5BNFA 2F3SA 4DLLA 4JI4B 4EVRA 4MA0A 1XLWA 2JGKA 5HWSA 3BZWA 3FWPA 4YT4A 2BP7B 2J6CA 5CVTA 2R48A 1YZGA 1RBQA 4LRQA 1R9MA 3VRHA 3SM9A 4WESA 2F4NA 3HV2A 4TZKA 3W9UA 4CR6A 4B17A 3OTWA 1R0WA 2R97A 4MI9A 2G1UA 2GHRA 2YQ5A 3BSFA 5BPFA 2SKEA 3MELA 4JGIA 3VR4H 2EJTA 1IY8A 1P2BA 3FBTA 4PSAA 3X1KA 5EN4A 1FNCA 4GOOD 5CDTA 5C3MA 1KE1A 3IEUA 4JMLA 5TVKA 1UFRA 3MTBA 5JPIA 1T9GR 5CR9A 1HFKA 4Y30A 1WUYA 2IW1A 2YWJA 3BORA 1JHYA 3OY7A 1DAHA 1XLUA 3F5MA 4V0MA 1KFJB 2OQVA 5HM6A 2J3JA 5EI5A 1G0NA 1OHHA 3GLHE 1P18A 3PGA1 2CL5A 4GE3A 4YRLA 5CBKA 1HM5A 3AL3A 3RVLA 1M6YA 4NQZA 1JFLA 4J7XA 1DP4A 2QNIA 4JOCA 4K88A 4Q3DA 3TRHA 1XAHA 2JHPA 3HY6A 4I55F 4WY8A 4KPYA 1K4KA 2DX7A 3RRMA 3BQNB 4DDVA 1M8KA 1Q2XA 4AF6A 5LU9A 3TGLA 1PV1A 2GKOA 4XQGA 1A9XB 1PDOA 1UK9A 1FQOA 2VYVA 1M8GA 2GEJA 1IG0A 4DWJA 1UWKA 2HMYB 2YWBA 1FX1A 2B20A 3EXAA 3GJ6A 5E8JA 1GU0A 2BEWB 2YIDA 4QDTA 2PSJA 2NQ8A 3GGDA 5BR8B 3R5TA 5FUMA 1Q1EA 1ULSA 2OCGA 1UZAA 1MEOA 3KCQA 4MI1A 2Y1WA 4RXUA 2RKOA 4XYGA 3D8UA 2O7RA 3GRCA 4CKBB 2CXPA 3ZW8A 4OY3A 1FDWA 2BGLA 5IULC 2WTXA 4G2NA 3ZK8A 4ZDJA 4RZHA 5KOJA 3Q6MA 2MSCB 1EUYA 3A27A 3GH1A 4NS4A 5AJHA 2Q1SA 4F2HA 3DOOA 4D8WA 2CLMB 4HH3C 2W4MA 4YMHA 3LI2A 2DTDA 3QBJA 3R5XA 1Y3CE 5C7OO 3NIDB 3ONDA 4AZWA 4ZAYA 4EYKA 2J3DA 1P2DA 5JXIA 3CZ4A 4MS4A 3SK0A 1O0BA 4GS5A 3N6VA 1X74A 4I4TF 4RF4A 2YVUA 4BV3A 2UDPA 4JVOA 3S27A 3NP9A 2E21A 2HSDA 2WMDA 3HH8A 3QFRA 4TTAA 5BN1A 2R2AA 5KNCH 1H6AA 3M33A 4NV3A 1O6CA 1WXDA 4RVUA 4F6RB 2GK7A 2HBZA 3A25A 5TQ0A 1HDIA 5FBHA 1Q7TA 3NT5A 4XZ3A 1JUDA 3M5WA 2WT4A 3PKJA 2H2FA 3HJBA 4F4CA 4AWAA 3PUVA 2VNSA 3PVZA 1OH7A 3GFPA 3YASA 1SUAA 2CDRA 4M76B 1G55A 4RHFA 3W06A 3I05A 1OLSA 3OFKA 2OHJA 2E1RA 3Q1LA 2IYSA 3IH5A 2JRCA 1R00A 1XHFA 2GSWA 3PUIA 3PWZA 3QXCA 4J0EA 3ZY3A 5LIRA 5JQWA 3IXLA 4HO1X 1M10A 4IHJB 1VM6A 4JBLA 1HQKA 1JLLA 2HLNA 3PI7A 5K0SA 4M1ZA 2EZ4A 2HSGA 2X9LA 2P6PA 4P22A 4UASA 4J9UE 4UD6A 1QOQB 3WNZA 1OIWA 1SGWA 2OXTA 2Z09A 3C15C 3JATA 1B8VA 4EMBA 4ZDKA 4KQXA 3RI3A 4LDPA 4IGKA 4D1YA 1NWCA 4PPQA 1T10A 2Z4RA 2IEDA 2BFEA 3LPMA 5ICMA 4TKMA 5IXJA 1DJNA 4HRYA 4H1UA 1SM4A 2P2CA 3DOCA 1I7LA 1GN9A 4ZYUA 3PXEA 3OJ0A 2Q2QA 2AR7A 3K0CA 1E1CB 2PRKA 3VNSA 2BBWA 1OXMA 3TXYA 2LWIA 3SEAA 1VYUA 4REOA 1NQAO 4X1OA 5DBGA 1HNNA 2C61A 1JHQA 5EIOA 1RWVA 1QP0A 2II6A 2XAAA 3IP7A 3ITEA 2ZLBA 1DQYA 2BVNA 1ZEJA 3DE6X 2GM9A 4ZQHA 2R0QC 4PZ0A 2B98A 2ZGVA 2H0QA 2YFHA 3C3JA 4KWCA 2PMKA 4KV9A 3DP7A 3FBGA 5CM2Z 2QNRA 3QVSA 2NZ2A 2XUIA 3UICA 2BL4A 1EDOA 4NHEA 5CJ2A 3CLSC 3R74A 1HY3A 1P80A 2R79A 1CEXA 4FHDA 3RR2A 3EVCA 1R4MA 3T5BA 2PUDA 5A0VA 5IT9A 4ZODA 5T3YA 2ZETA 1ZJZA 4L4ZA 1G7SA 1H8HA 3TINA 1RYYA 4G67A 5CT6A 4QG3A 3OZWA 1VLLA 3F6EX 3LX6A 3ISTA 4LYDA 5HF9A 3DMGA 3W05A 3L7AA 4DFDA 1R1DA 2VTBA 4DLPA 2VWQA 2PGLA 1ZN8A 4XCVA 3RJZA 2XGOA 3K09A 5JY6A 3GVIA 1E3QA 2VG8A 1KS9A 2IYXA 1TMYA 4FE4A 4I81A 2O3SA 4DBLC 5LNK6 1NV8A 3HZHA 1PJSA 1UINA 1UFKA 2CHGA 2X5OA 1R8QA 3DT6A 4IV0A 3DW1X 1NVTA 3BJIC 5KS2A 3E53A 1E9VA 3VPAA 5WRFA 3TZEA 2HIAA 4ZPXA 3FGZA 3KZOA 4F5ZA 4Z3OA 1NAIA 3A4YA 1WXHA 3ONFA 5DGIA 2PRIA 2N75A 5L53A 4N48A 4MOWA 2QL5A 3PDCA 1T4DA 3H9CA 2REOA 3CZAA 3O4IA 1JJ7A 4GGPA 4HNRA 3W1WA 2JB9A 2EQAA 5HQTA 3PE4A 2V59A 4JBXA 5JWHA 4A6EA 4B6QA 4W9MC 1IBLB 1NMZA 2SICE 4LZLA 2ZSUA 3CU5A 4YAKA 3RLFA 2F43A 2QRPA 3DQPA 2LCQA 3RFXA 2CLEB 3PXCX 5LD2C 4GP9A 4YJ2B 3O0DA 3O8OB 4GP7A 1H8HD 1WD7A 5FWDA 4ASUA 3DZIA 4N3GA 3FIUA 3OSZA 2ZM6B 3H6GA 2G67A 3K5HA 2IJGX 1RWPA 1AKVA 1ZNWA 1RACA 2HNKA 2VJAA 4YDSA 1HH4A 2CY0A 4HBGA 1KMNA 4MUNA 4JSYA 4JVNA 3WA6A 1IZ9A 1JXQA 4EJSB 1KARA 2UUBB 1SQGA 4Q4CA 4M1MA 3KIPA 3T1TA 4INAA 4Q3NA 4CF7A 1MZPA 5IJWA 1KGDA 1U0FA 2A9VA 3U4IA 4F8EA 3RVMA 5K8TA 3WGIA 1KQNA 3KOXA 4EDHA 1EXMA 2ZIXA 4MQ5A 3QEKA 3Q3EA 2EBHX 5AKGA 4HNHA 2Q4DA 4JT8A 1UODA 1VIVA 2NX2A 1OI7A 4MDHA 5AHKA 3DUFB 3EQ7A 4DMMA 1KR2A 4NXMB 2Q1XA 1A88A 2J9RA 2WF6A 1ZUNB 2NUTB 2Y92A 2PANA 2YMPA 4RH3A 3LECA 1CRQA 2QX4A 4QXAA 5KYXB 1QORA 1XHLA 3FTEA 2AB0A 5IF3A 3AVYA 2NP7A 1RAGA 4IF6A 4E2YA 2PMBA 2V0CA 2GFQA 4D9BA 4LJSA 3VH3A 1NU6A 1XQ6A 3WNVA 4ER3A 4Q1DA 3FRHA 1ZOPA 4ASUD 4AL4A 2I6GA 1E2HA 1V5WA 1WZUA 4EATA 4UNPA 2NXWA 5IJ9B 2QTVA 2COEA 4NOKA 2WF7A 3FPSA 3VR6H 2I2WA 3IPLA 4PICA 1A9RA 3I9OA 1CK4A 3C4VA 1U80A 4JQYA 4RA6A 4RZIA 3BE8A 4DLAA 5DNYB 1F2VA 1KXZA 3FPGA 3OKCA 3ICEA 5JC8A 4LXQA 1U3WA 2FN8A 3F74A 2LP4Y 2QE6A 4WXPA 3LXRA 1LBQA 3WBBA 3NKFA 1RCFA 3DCJA 3ENVA 4NZMA 1WSBA 2BBOA 2CDCA 4X20A 5CGZA 3P27A 5ITZA 2HHAA 5JS8A 2JEOA 1T36B 4ZU3A 2ZSHA 1R50A 1GPYA 2ZUEA 4W5NA 1I10A 1W2WB 2ZANA 3QLJA 1U2TA 4GMFA 5K6AA 2IW3A 1UBNA 3G49A 4KL8S 1AF4A 4GPBA 4E5KA 3TB6A 4U8HA 2RGGA 5JYEA 3R5KA 3PFKA 5BO5A 3A4LA 4IJ5A 2WYHA 1GGHA 4GEKA 3P96A 3SD7A 2DFDA 4I5IA 1IXRC 2QAGC 2WZBA 4E1VA 3CW2A 3VTZA 1MOZA 4RHYA 1JEOA 3A1SA 1RRCA 4WN9B 1OXVA 4JJEA 1OX5A 2IHUA 4WEOA 1V45E 4AYTA 3PDIB 1Z0IA 3UEOA 3ZIDA 2ZKLA 1PS8A 2WB4A 5FD8A 2FMFA 4ZIRA 1IIRA 1U6KA 4Q9KA 3I2YX 4LSGA 2GR9A 1NHWA 1NRIA 1IE3A 1IB0A 2NQ2C 3UAYA 4FWBA 1ZD5A 1I3OA 1CEEA 1EK0A 3A36A 4I55A 3DWFA 4CF4A 1KF0A 4NEHB 4XE5A 3CSUA 3NIBA 1AKUA 2DSNA 1NIJA 5DTJA 4JI0B 3N6XA 1S2OA 4E70A 4EHDA 4BHTA 2LRHA 2ZUWA 4GLBA 4FZRA 4LOIA 3WRYA 4JC5A 4L72A 4OHFA 3D7SA 4B6OA 2H16A 1KH1A 2Q41A 2MYTA 2VNHA 4XQEA 2D1RA 4EPTA 3DGEC 2QORA 1V3UA 5FIUA 2R66A 3U3KA 3NH6A 1LUAA 2CE7A 5LQMA 4Q7EA 2IPOA 4W9NA 3PEVA 5EG5A 2AOWA 5FWXA 1SKYE 4ONEA 4ENQA 5AI5A 3RTGA 5J4KA 2DBRA 5IN5A 3ZWPA 2VQFB 1ZK4A 4HRAA 3SEQA 3K9FC 3R6DA 1JSCA 4LOHA 3HTXA 2OLJA 3PFCA 4I2NA 3ZHRA 4J1NA 4J1TC 3FTQA 4FGLA 3PWSA 4IVPA 2OBBA 4BNTA 4HNGA 1QX4A 1G59A 3FNGA 4JA2A 3R7SA 2V8BA 4COKA 3D6UA 3P9RA 1HE1C 1ZESA 2FQXA 4Q0MA 3B82A 3D64A 1MEJA 1QCDA 1V2HE 2AOXA 4I4TA 3DBRA 3RHFA 3EPJA 2WD9A 2I76A 3MC1A 4P0TA 2Q6KA 2DFKB 2HPZA 1RNLA 1FMTA 4F8JA 2VA8A 3SVLA 1G7TA 2HT6A 3IE0A 3PEEA 5E0OA 4GH5A 4OQLA 1T5OA 1U5CA 1YHNA 3I9MA 3ZE0B 5KOJB 5F2NA 4C4RA 5KTYA 3DXZA 1M1XB 2Z3VA 3DZBA 1KFCB 3FNRA 4N8SA 3WL8A 4C07A 2HRDA 1R3UA 3EA4A 3O2JA 2YOHA 3QVXA 3UJ7A 4EZIA 3A3PA 1G60A 2P2DA 2OA0A 2P1RA 1SD1A 4M36A 4I6GA 4AS2A 1DTEA 1LRKA 5J2TF 1M6WA 5CHYA 4IZOA 4MS4B 3PNMA 1ZL0A 1XR3A 3ITKA 5AW6A 4XTCS 1KK0A 3OKAA 2JJ1D 4IWXA 4UHCA 1SXJA 5H9VA 1XSEA 5K6RA 4WZ6A 2AOVA 3HB4X 2AOTA 3SICE 3OT4A 1JG3A 5TQ0B 1A98A 3OIVA 4GKBA 5ALIA 4R1MA 1W73A 5FWAA 2NU8A 4D9FA 4DNOA 1B8OA 5H5JA 3F5SA 4Q03A 1OE0A 3VTKA 2H7CA 4C0BA 3GDHA 1U8XX 4CTNA 4UBMA 2OAEA 3AKYA 1FLNA 3HBLA 1OLSB 3A1TA 2AQ8A 4F3CA 1XNQB 3J81A 1J1UA 2Q5IA 4TYNA 1ZCAA 5F52A 5DYTA 1SO8A 2YJZA 5AVWA 1AK2A 4QPDA 1B0UA 3LWZA 2GF2A 1JLLB 1SFRA 2FWPA 1G3QA 2QUIA 2W11A 5ICSA 1I1NA 1JIQA 4ED9A 1UBRS 3FPHA 1MC8A 3D0RA 3M0EA 1YBVA 2WWIA 3JATB 1GAEO 2XCTB 1YVRA 3HSKA 4J91A 4R5MA 3PGLA 3WI7A 5IDWA 1EVQA 4MIKA 1NG9A 2NVOA 4ML3A 3E35A 1EBFA 1P4HA 2BFEB 4E12A 2TSYB 2CE2X 4HX2A 4TQ9A 4UEQA 2PZMA 4PFKA 5EP3A 2JCSA 2C5GA 4LE1A 4RVOA 5C81A 2OE2A 4R68A 4GVXA 4YAOA 4UDOA 5BV0A 1SCQA 3O47A 4WINA 1E9DA 2P9TA 2PGNA 4AWXA 2XBLA 3NHUA 3UJBA 1VB5A 4BECA 3A9TA 3V1KA 2ZVPX 5KWJA 4QM6A 5HJ2A 1GITA 4BJ3A 1B3BA 4JT4A 4OL0A 1TRHA 4PGMA 1BHO1 2XD4A 1UR5A 1PP4A 2OV2A 2IV7A 4Q4DA 4QOIA 1S01A 2O2SA 1UZMA 2ZRPA 4R2LA 2PTHA 5BNWA 4P5EA 3RKRA 1R4MB 1TJ5A 5EXEA 3WSWA 4LBVA 4V38A 3EGDA 4AZSA 5CFQA 3FZNA 5E3HA 1XMVA 2SHKA 2EHDA 2YWCA 3IUYA 4E22A 1J49A 4LY6A 2VTVA 1BGVA 4ZV7A 1AZLA 4QNMA 2VTBB 2TMDA 4HLDA 3DA8A 1I7DA 3FLMA 3WGOA 3JR3A 4D81A 5C5CA 4LQ4A 4PAQA 3T3MB 1YNSA 2B8WA 3NFYA 4M0UA 4FOOA 1X1BA 3NXKA 5TMEA 4K9KA 3AG5A 3OCWA 4XXHA 2D2FA 2C5SA 4HDKA 2BGIA 3NEJA 3WDKA 1AD2A 5TMDA 3TMKA 4NNPA 1B16A 3VKUA 2NVUA 3OO1A 4GLJA 1URPA 1S0UA 3JQQA 4KRXA 4Z8YA 5TMBA 3TSAA 1T9BA 1XG5A 2R9VA 1T2AA 2PR7A 4ZGBA 2K7FA 3OZ7A 3QPUA 4GYKA 2X3FA 3CCCA 2PRYA 1OWNA 2P9YA 3PHLA 2P6RA 4FI3C 3DWIA 3EMBA 2WRZA 1EI9A 3JWJA 3LY7A 4I9GA 4K46A 4O4LA 3SC6A 2ZRKA 3RIYA 2F43B 3ZOZA 6NULA 1U65A 5A3JA 3KEFA 3VAYA 4B85A 4DL9A 2XBMA 3LYHA 5C9ZA 4CU5A 3R9XA 2X3YA 3KELA 4J29A 2CVOA 3ICPA 1FRFS 4RZ3A 4DJTA 1Y9DA 3L5KA 4YLYA 4OU5A 4JBHA 2O8FB 4IMPA 2IZ6A 1SRQA 2NO9A 4R3UC 1N1GA 3UMRA 1I3MA 2W6NA 4RVNA 2MWMA 3C3BA 1X1DA 3GOHA 1WMDA 3IPYA 4KPUA 3NC4A 4N6NA 2EBUA 4QUDA 4YB8A 5EVJA 9LDTA 3H65A 5C5IA 1JJBA 3KJFA 2GZMA 2JK0A 3BJMA 4EIWA 2FEXA 2G04A 2ZIXB 4MRSA 1QE0A 4PIMA 2A0YA 3I6ZA 4QLOA 4CMEC 3C0KA 1SNYA 3W3AD 1DINA 4RVCA 4CTMA 2KLHA 5CXQA 1EAMA 4L57A 3PC3A 4KAAA 1CUYA 3SHVA 1DEXA 5CLFA 4G1FA 5FLKA 1Z4NA 3GUYA 1W5TA 1NXOA 1DRWA 5KSYA 4RD0A 5AVUA 3H8WA 1VHQA 5T3UA 1E0KA 2LIVA 2WD8A 4TMYA 2ORVA 3ABSB 3HPRA 5DMHA 2CWDA 1DMSA 4KQ2A 6LDHA 3UUGA 2QTVB 4TQUS 1GVNB 1QK3A 1SBQA 2PKXA 2JNWA 3KZMA 1ZHHA 3ZV6A 3O38A 3OZEA 2M98A 4RA6B 3SVZA 4IEEA 2P2SA 4MQ4A 4XLLA 2QNBA 1A8HA 3F9IA 4LYEA 3C39A 3W5UA 4AZVA 5HNKA 4AULA 2NV6A 2VAPA 3ANNA 3F8WA 4KNWA 3ZIUA 3ITNA 3PP8A 4D9NA 4JY7A 5IWCA 3SIWA 3PUXA 4X20B 5ITZB 3KQUA 1IQ0A 1SUSA 3HNRA 2JLQA 1U8YA 3NG1A 4WH0A 1Q15A 1G2IA 2AD1A 1L7AA 1RKVA 2NT3A 3O3MB 4FS3A 4H08A 3R9KA 3RFVA 4B4UA 3WAJA 3VBCA 4FFLA 2QN8A 1T8UA 4QA9A 4NL4H 3BM5A 2CN1A 1PJLA 5TT1A 1IK4A 1EG2A 3B12A 4KO8A 2FWAA 4O2RA 4GLFA 4EHBA 4CN9A 2HF9A 4IOKA 1UK8A 3QE2A 3NALA 1J56A 2B37A 3HYSA 1FRVA 3UAVA 3NTXA 1XNGA 2OR3A 3UHOA 4R8KA 2XUQA 4C5CA 1N6LA 1LH0A 1ULAA 3B9PA 5FLXA 3E7DA 5JV5A 1ACMA 1XIVA 2Q1WA 4H59A 1NX6A 1KY3A 3MCTA 3EUAA 1GNTA 5U4XA 3SX2A 1UANA 4MRPA 1AVTA 2TECE 4TKLA 4B45A 4ZIRB 1THZA 3CUWA 2PUJA 2PV0A 1BVYF 1LPOA 1H0RA 4NY1A 4UCXA 3CRQA 1QHYA 3Q3HA 5LZ8A 2VQEB 1KSHA 2F9FA 3I8XA 5KYVA 1E92A 5MGNA 4OBBA 3HA3A 1D7AA 2X1VA 2HCJB 3L6BA 3OQIA 4I55B 4XSGA 3LT1A 1O89A 2NYAA 5A62A 4Q01A 4PLPA 4WDRA 2YRFA 5HMMA 1KBQA 1R0RE 3H4TA 1LI7A 2XMGA 4AW9A 4EKIA 3RS4A 1N1EA 2PMWB 3PX7A 3U4CA 2PWZA 1RRVA 4QUHA 1ZN9A 5L8VA 1W88A 3DE7X 1KEPA 4WKNA 3UHFA 4R3WA 4A8JC 3C8HA 2Z6UA 3NW9A 3RKSA 5AT1A 1MJNA 5BMVF 5DIZA 1RKUA 3RWBA 2ADMA 2PLRA 2D74A 4XPIA 4WZAA 2PRJA 1XWIA 2I2BA 3MTIA 4MYRA 2ZR7A 5A9TA 5JE8A 1ZGHA 3GL9A 1T3GA 3MS7A 1IN6A 5LLSA 2Y93A 3JCZA 2I5PO 5FWXB 2BF4A 2FPXA 2QM3A 3KQTA 3PC8C 1NYRA 1QIJA 3RUCA 4LWPA 2D0IA 1V7PC 4W4TA 2CXXA 2HI0A 2V3VA 3S1SA 2AWNA 4JVLA 3EQZA 1D2HA 2BLLA 1VJTA 2B35A 1Q57A 4UJ5A 2XHEA 3F71A 4DR1B 5J2TA 1Q3KA 4LI3X 3UBTA 2Q8QA 3AIOA 4LDJA 3L0BA 4LBZA 4MCJA 1Z6PA 2DBVO 1MOPA 2P62A 4ITUA 4R2JA 2DHRA 5DW0A 1XU9A 1J5PA 4I4TB 4NIMA 1VJ0A 3R7NA 2QG9A 3DBRB 2BSXA 3MK31 3T9BA 5GZ3A 5CA1F 4ER5A 4D0GA 3ILXA 3JQ7A 4C22A 3WJ2A 3LIIA 4A0SA 1FEZA 3TNFA 1H1DA 1M67A 1XKQA 2CDBA 2OL4A 4EHHA 5JEDA 4OSOA 2R7NA 2VJQA 4ZHQF 2HCBA 4KKVA 3NC1C 3QW4B 2FLVA 1X39A 4BGIA 3MS4A 4R9SA 3G9QA 2KM1A 1KTIA 1J07A 2Y0EA 4IYJA 3NBYC 2Y1OA 4ZQIA 1TKRA 2RI6A 3PFBA 2F4VB 1CB7A 1WO8A 4JMPA 1KSFX 1QB8A 5E7MA 5CDHA 2GASA 3QFHA 1C30A 3QBTA 1JV2B 1N1MA 1YIDA 2PT5A 3GJ5A 2ORWA 1JWBB 3I28A 3KFXA 3OX1A 3P7MA 4MW6A 4QTYA 4HN9A 5IVHA 5T67A 1YS9A 1XQWA 1SXJB 3W7AA 2DPYA 2FDCA 1ZA2A 4ZT3A 3S7ZA 3H9BA 3OQVA 2D1YA 4I9UA 4EELA 1WVGA 2AOTB 4GMDA 1ZW1A 1E7WA 2HMAA 3DFKA 1B43A 3IJ5A 2RFLA 1MVNA 5LQDA 2ECOA 1XVLA 3SBXA 4N01A 1I0LA 1TYAE 4OXIA 4Y2SA 2NU8B 4PC2A 4URFA 4QOFA 4ZD6A 3RWMB 5JNWA 4B4KA 3HCDA 3IGFA 1DBVO 2GRUA 3PV0A 1DWUA 5LZ5A 1KEVA 4BX0A 3G7NA 5I7VA 5JDIA 3NBXX 3TNDA 3IT3A 2G1KA 2C7PA 3UFBA 3O9MA 3TTVA 2H0AA 6GPBA 2D8MA 2JJMA 2I34A 3S8MA 4K7JA 3JWHA 1A5SB 4LJYA 1UBSB 2OHHA 3IT0A 2QDXA 1AUQA 1LDGA 4BDSA 1JDBB 3V00A 4RJIA 4ROSA 5LXTF 2YYYA 5BSHA 3PXDA 4JA0A 1WZ2A 1G8SA 3LLCA 4LDNA 1J23A 3OHPA 1ZU5A 2YWEA 4G4SP 3QHAA 1WBBA 1H9CA 4ZAGA 1EUZA 4ZU6X 2H4JA 2IBMA 3MN1A 3I5UA 1R6BX 1W94A 4H6PA 1QG6A 4DA9A 5CDSA 3B70A 1Z5PA 5SYNA 5AJWA 2CYCA 2ZI7A 3ZUGA 4B43A 4YMWA 1ISSA 1FC0A 1CB0A 1I2CA 1R4AA 1P3Y1 2QUBA 3LGAA 4JOBA 1F14A 2BR3A 3BDVA 3C5HA 3IMKA 1GKYA 3IQIX 2FCAA 2OOSA 4LE2A 5G4LA 4BLOA 2H2AA 4FFSA 4X24A 3QMWA 4B3SB 3FYCA 2R87A 2G25A 4H16A 5ER9A 4LX8A 4CCAA 4NULA 4N49A 1JLRA 2VK2A 3RVRA 1YC2A 5BV1A 3C7KA 3LHFA 3A8TA 1P1FA 2J7PA 4CR7A 4D9EA 1LI4A 1MFPA 1RHQA 2IUTA 1EGQA 1E5QA 5HRAA 5EHXA 3IVXA 1B1AA 2ZRHA 1ZH4A 2VC2B 1FMFA 3LIPA 3SVTA 3E7WA 1K98A 3K05A 4JQSA 4I4NA 4OHXA 4ZEXA 2JFYA 1DKRA 1SUCA 3HE3A 5D00A 4DUPA 1QFMA 1LLUA 3BAZA 3GFBA 1MPTA 3GIDA 1QO0D 1YI0A 4UEJA 5IVDA 4NBUA 3EGDB 1HPLA 2HRCA 3UJ3X 4A5OA 3UWDA 1I7SB 2FRXA 1TYDE 3WKEA 4DQVA 1YMVA 3Q9LA 2V4UA 1VMDA 5LZ2A 5KJEA 3BICA 3S2SA 221PA 4F45A 2PZBA 2QM8A 2W6JA 1OVMA 521PA 4O4JF 4OGLA 3ELDA 2WINI 2V9ZA 2VTEA 3AG6A 3ZCVA 1E0SA 1DX9A 5HTKA 4UUNA 3HCBA 5FPQA 4YHBA 3EE6A 4C1NA 2IYZA 4ZVPA 2IPXA 4DC0A 3MBKA 4HDKB 1LJ8A 2R4UA 3RSCA 4BC1A 4Z4FA 2PZEA 3AR7A 1FRNA 3F3MA 3NB0A 1NF8A 2J7PD 3NCTA 3PR2B 1NY6A 5AJXA 2YV1A 2NVUB 2AKYA 3LQ4A 4MYTA 4P8RA 1MLDA 3I9LA 3V2HA 4DLSA 1Y1LA 2P91A 2BUBA 3R7DA 3ACDA 2O7VA 4GOXA 4JEUA 4DJAA 4DB2A 2JATA 3AFGA 4MEAA 4M53A 1U2GC 5CPFA 1ECGA 5DI3A 2RB4A 1QYXA 1ZI9A 4HLCA 1BWRA 4O4LB 1ONNA 4RZUA 3DAHA 3R9XB 4KZKA 1C0LA 1LK7A 3GR6A 1T0IA 5C1PA 1I6MA 1SU7A 1YQGA 1KP9A 1PK9A 4K9DA 1G8AA 2EZ9A 1UDCA 2FR1A 3ZY5A 3GLUA 5F98A 2W6JD 1WD5A 2DPXA 5JFTA 3IO3A 5B1DA 1JDPA 3BH6A 4AJ9A 4HWSA 1YQTA 1Y8QA 4KPUB 4CWAA 2FXVA 1SU4A 2R7MA 2AKEA 2A5YB 4PLZA 5A2GA 3OHMA 1P17A 2RGYA 1UJNA 4GDFA 1N7HA 4LY0A 4DV6B 3PC2A 1XO1A 3OZRA 1KDPA 3BRCA 4BU1A 3ZQ6A 3U61B 1C8BA 4BO5A 1DTSA 1X92A 1FUIA 1P2UA 2FCRA 2ID4A 1A7KA 5CFZA 1RE0A 4MUFA 4RS3A 2G5GX 4OA5A 1UFVA 4LVNA 5ARBA 5BN3A 1EH5A 2OG1A 2Q3JA 4D3ZA 1KJJA 3QJ5A 4R83A 5GONA 4F11A 4DM4A 1VLVA 2H2DA 3OY2A 1NOIA 4Q3OA 3CEHA 4FYPA 4GXNA 4AM8A 4WUVA 4B32A 4MWDA 3AU9A 2JCYA 3IUEA 3LPAA 3H84A 1T8RA 3M70A 3NZEA 5T41A 1P2VA 2Y1LA 5JXWA 2GWRA 4GOMD 1PF7E 4EA7A 2NV0A 3BL5A 3GAMA 4IDNA 3AL0C 3C3KA 1M0WA 2FSGA 5ILOA 3ZI4A 4D3DA 3AY7A 4HNUA 1O97C 2VEDA 2HLPA 3I45A 3MLBA 3OIDA 1JN0A 3BXXA 4TWJA 2DKOA 4UNRA 4XVCA 1F17A 5K9ZA 1U0RA 4S1PA 5DOVA 2XH8A 4FYYA 2YV2A 3HXLA 2RGXA 2V03A 4C0KA 3KHTA 1Z0JA 5KTOA 1MQ9A 1P6QA 3QGMA 2WKSA 5EXPA 2DXIA 2G8LA 1P6XA 4KRYA 3T95A 4DV3B 3ID6C 1IATA 2ZJ7A 1THGA 5IXYA 5LR6A 2WAOA 2PUTA 3K8ZA 1PJ3A 3UB4A 2W2VA 4TXHA 3DYVA 5LM3A 1CZOA 3B53X 4D97A 4RDCA 1XF9A 1V9CA 1PD1A 2G63A 1GV1A 4QQ8A 4G0QA 1I5RA 3RIEA 2Q5FA 3KTDA 1GOTA 2G4CA 2I3BA 1RDFA 5LQRA 4P2BA 4LHXA 2UZ4A 1M5TA 1VMIA 5BMVA 3KE9A 2FPOA 3R6TA 3L0YA 3O2SB 1C7IA 1BMDA 2Q3HA 4BNHA 1TCUA 3QTLA 2HK6A 1USIA 2J3HA