2IXEA

Crystal structure of the atpase domain of tap1 with atp (d645n mutant)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
GSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
total genus 76
structure length 251
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixeA01
2CJWA 4JBWA 1WDTA 4B74A 4QBGB 3AKYA 1FP6A 3T1TA 5JJIA 1XD9A 2ZRDA 3W6NA 3KQNA 1U99A 4H9GA 4TQ9A 4UNPA 5JSZA 2OLJA 4LK2A 1IXZA 2AXNA 1ELOA 4LHYA 1YZUA 4AC9A 2A7QA 2QU8A 4ZPXA 1VTKA 4QM7A 3CH4B 2QRZA 5EZ5A 3LBNA 3EA5A 2QTHA 1XXHE 4BFZA 2PZGA 3T12A 2VP4A 2CJWB 4BRWA 1E99A 3A8TA 3KXLA 4W5HA 4MUAA 3NH9A 1RZ3A 3BS4A 4BEBA 2V6IA 1NVVQ 4Q00A 2Q6TA 4Q4HB 1W1WA 4KJZA 1QVRA 5GADl 1NJFA 2EYUA 4KVAA 3PG5A 4HDCA 4R2IA 4GFDA 2GILA 3KTAB 2ERYA 2F1RA 2OXCA 1UBCA 3B1YA 4QHTA 1UEIA 4WVFA 4B32A 3ONWA 3UK6A 4A9AA 4A0GA 2OAQ1 2X19A 4MUBA 1KK0A 5KPDA 1G64A 1Q20A 4IXMA 1ZNYA 2ERXA 4L16A 2JJ1D 3U5ZB 3RRNA 3TRFA 2I4IA 3QIAA 1LV7A 2ZJZA 5FTMA 2G6BA 4S2EA 4P33A 3QJYA 4RCZA 1YRBA 1ZD8A 4KXFB 3TH5A 1N5LA 4OYHA 1W48A 4OI0A 1JAIA 3AF1A 3GJ3A 1GILA 3U7EB 5CDFA 1FL9A 1E4YA 2ZQ5A 4FCTA 2D3WA 3ECCA 3TQCA 4KLZA 2ODEA 1NKSA 3NIBA 3VKGA 1NIPA 2HXYA 3W3AA 3V9PA 3GFOA 2OSBA 2O8CB 5DYIA 2XNDA 721PA 3QKUA 2W00A 2AD1A 2RGGA 3SFZA 2OFWA 2IEYA 2VSXA 3B13B 1D9XA 4BEJA 1HH4A 1OFTA 1OXVA 1Q44A 1YHNA 2JLRA 1Q0UA 2LCFA 4ZKEA 1U2RA 1IJFA 2G0TA 4PC3A 5HZKA 3SS8A 1HE1C 2Z6VA 1NMYA 3BB4A 3BIFA 1Z08A 1JEEA 3EIEA 2ZAOA 4IDHA 4B73A 2GDJA 2NO6A 4EKDA 2WPDA 3VMFA 1JB1A 1DG3A 2MMGA 4B76A 2ZPTX 4Q4JB 1LS6A 2QI9C 4Q9JA 2D74A 2PT7A 4X8MA 2FV8A 4GPTA 2RAPA 2BKUA 4M4SA 2WWHA 2HJVA 1NLYA 2KSQA 2ASEA 4KU4A 5J5CA 3TVDA 5L3QA 1WB9A 3EA0A 2IS6A 1E3MA 4KODA 3I3SR 1YR8A 4PQYA 4HB2A 5HKKA 1YR9A 4WZAE 2JJ2A 4UQOA 3ZYCA 3AVXA 2ZI4A 4HI0E 2QE7D 3W9YA 1ZCAA 3QKRA 1OH7A 3X1YA 1PJRA 1US8A 3AEZA 1M34E 3RSOA 3KZ1E 4OHVA 5H8WA 1H65A 3EZ2A 1IXRC 3KQHA 3AVYA 1KSGA 3A58B 1ZC4A 1KAOA 1SXJD 3LLUA 1DVRA 1SVLA 2BBTA 4WOPA 5DLQC 1II8B 3TR0A 4A6XA 4U5XA 1CP2A 4Z54A 1SZPA 1WRBA 4O2RA 1S1CA 3QF7A 5CLQA 5IK2D 3MJRA 3BORA 2CCGA 4DIEA 4DDUA 4MDFA 1KO5A 3TLXA 2N1BA 2ZTSA 3Q85A 1E0KA 2IC5A 1A4RA 2P0EA 1NSTA 1ZUNB 2OAP1 4GMXA 4RKFA 1AIPA 1ONBA 2J1LA 4NYJQ 2A30A 4M1KA 1VHTA 3TIFA 2Z5FA 4US1R 2WPDD 1G3MA 1G8HA 2CCKA 2FFAA 2YOGA 2C78A 3GJ0A 1ZNWA 2VL7A 4NCNA 2XX3A 4IFEA 2WSSD 3NG1A 1DAKA 5C1BA 1QHHB 4DDWA 1UDXA 3TUZC 3PVSA 1DAHA 1EX7A 1T5IA 2QG6A 4A6PA 1W47A 3R8CA 2CCJA 3AUXA 3IQXA 4L8GA 4Q5IA 4RZ3A 3SR0A 1JPJA 4JT4A 1MOZA 2EFCB 2ZE6A 4B3GA 2Z43A 2OCAA 5E95A 3RYTC 3CM0A 5KUTA 1JR3D 2FG5A 1CS4C 5EE1A 1TF7A 2QMOA 4QGAA 3RS4A 3SQWA 1E9FA 1SVOA 1AJEA 1GAJA 2D7CA 1KOFA 2VBCA 3AKDA 3Q5EA 2ZUBA 3CZPA 3H4MA 4LUCA 4OJKA 2OILA 4R2HA 3RHFA 4A15A 3IQWA 3KB1A 4ASUA 2J87A 1KO8A 4PHGA 1TAGA 1K6MA 1T8UA 3BAFA 2NTYC 3VFDA 1VCOA 2UZ3A 4DLTA 2ZRBA 2NO1A 2ZS9A 4S35A 3UPUA 1L2TA 3HJNA 3F0TA 2XNSA 3P26A 2WAYA 5DYGA 4QNRA 2VLIA 2QM7A 4QL3A 3RS7A 2FF7A 5L3SA 3VR6A 3LAWA 4HLDA 5KSOA 4XSGA 2O8EA 3RS5A 2HYIC 3K70D 1QDEA 1E79A 1XMIA 3W6OA 4ABYA 1S3SA 1Z2AA 1E2NA 1R0ZA 2P5TB 4LHXA 4DJTA 4EPWA 4FW9A 3HU1A 3TJZA 2CL6X 4MRRA 2ZI7A 1KZGB 2RHDA 1M8PA 1DE0A 4OBEA 3WMEA 4D0LB 2GCNA 3B1ZA 2IYQA 4L5BA 4ZCMA 1E2GA 3R7WA 3V00A 2ZU6A 3QOFA 5AJYA 2O5VA 2QZ4A 1ZRHA 2BJWA 3KJIA 2CBZA 4G01B 1CEEA 4LYJA 3QPWA 4WA7A 4A82A 4FCWA 3AKCA 4C0SA 5CYOA 4LY6A 3TSWA 5F98A 4TMWA 4BZXA 2QA5A 5EXPA 4CVNA 4LRWA 1TPZA 1MH1A 1G3UA 4TYPA 1C1YA 4JS0A 4MH0R 5EE9A 4DCSA 3KX2A 1SHZA 2W0SA 1G7RA 3AH8A 4JVMA 4LYHA 3SBDA 4TMTA 2QTVB 3U3JA 5BYJA 4UJ3A 3H1TA 5IT5A 2EFEB 2WSMA 4ILEA 1DAFA 3QKTA 4EJSB 3NDBB 3MWJA 1QG4A 5KSPA 2TMKA 2EW1A 3CIOA 1KI2A 1T6NA 1KDOA 1S9HA 2GEVA 2J7PD 2VRWA 4LDJA 2VPPA 4MITA 3R8FA 4BFYA 5J40A 1XJQA 1KSFX 2OFXA 2XEXA 4US0R 4JYCA 1JXOA 3I72A 1G8YA 5D3MA 1NG9A 2PCLA 5FBQB 2G3YA 2EFHB 1WMSA 1G6HA 3WNCA 3U7HB 3WXMA 1NY6A 2QMEA 3QVUA 2ZRKA 3IEVA 1GITA 2X8AA 1UAAA 4G3XA 1X3SA 4D4JA 2R44A 2OCYC 2VHQA 1HURA 4OI2A 2J41A 2FFQA 2QQ0A 3CNLA 1PUJA 1D6JA 4A0RA 2ORIA 4TL9A 4FWTA 3K70B 1HTWA 4LJ7A 1G41A 2CE2X 1GVNB 2KE5A 3OEEA 1A2KC 4Q4JA 2W6ID 3TGPA 3CX6A 4ZIRB 1JAHA 1NP6A 4P3YA 5C4GB 2YV5A 4QC2A 2FX3A 5LD2C 4TT3A 4IDNA 2J0SA 2FH5B 3ADDA 1X8LA 5TXGA 2BBWA 3KFXA 3ZD6A 1OYWA 3H2YA 4OQLA 5J4VA 1TMKA 1E9RA 1GNRA 3T1QA 4OHXA 2VHUA 1A1VA 2J7PA 1W36B 4R98A 5FPKA 1TEXA 3CR7A 3WHLA 1IXSB 2HCJB 2DFTA 1H8EA 4HLQB 4XWAA 2E9SA 3LY5A 2BMFA 4DEXA 4CEJB 4HEJA 4FN5A 4AYTA 3ICQB 2UVQA 4JJZA 2PL3A 3AQ4A 4PZYA 4D0NA 3ADCA 3PR1A 2GVZC 1WE2A 1UEJA 2FGKA 3RRMA 4YMUA 1A2BA 2FWRA 2ZRMA 2WOJA 4KAXA 2ZJYA 3SHWA 2IXGA 3U60B 1KSJA 4ZDJA 3GLIE 1W44A 4GRAA 1NRJB 4NONA 2V6JA 1KKLA 4GT1A 2IHBA 4GP6A 4PZLA 2FJUA 3IHLA 3OESA 1N6KA 3THOA 2EYQA 1GNQA 4E22A 3TSZA 3A1WA 1WBBA 4GDFA 1XD8A 3VHXA 1XCPA 1KK1A 2UZIR 4LJAA 2V7QA 5D3MB 1CU1A 3JVVA 1ZIPA 3MGCA 3MCAA 3OEHA 1W2GA 3TE6A 2C9CA 2DWQA 2A9KA 2C95A 3CB4A 2IS1A 4I1SA 5CIQA 3DMDA 1G18A 3VNUA 3IILA 1XWIA 2D06A 4DT1A 1II8A 3MRSA 4BE7B 4N3NA 4C0QC 2W6JD 4XTCS 1OH8A 2QAGC 4LBWA 4PHHA 1FUKA 4Q9KA 4BASA 1LFDB 1W4CA 4F4IA 1NL3A 4ZV4A 4QXAA 3KQKA 3SEAA 4A0HA 5JMTA 3QKRB 1IN5A 2R6CA 3THYB 1F6BA 1SVKA 3MFYA 4II7A 1OV4A 1Z6TA 4HSEA 1E2FA 4A2PA 4YXWD 4X8HA 1E0JA 2F3RA 4TTRA 3T1OA 1N6HA 1LF0A 4E07A 4A92A 1G1MA 1VHLA 3F3YA 1D2NA 2HF9A 4IHQA 1GRQA 1Z6YA 3GMTA 4JIMA 1G21E 1XZPA 2FSFA 4LPKA 4EPVA 4JLKA 4D6PA 4M22A 1F2TA 2IEZA 2XZPA 1BMFD 2WWIA 2XJ4A 4PR0A 1AKEA 2G0NA 3PEUA 1YZQA 3CRMA 1NKTA 1XP8A 2XSZD 5JRZA 1OKKD 1VG1A 2ZUCA 1D5CA 4TL8A 5DO9A 3L0IB 1GKUB 4ESHA 3NHBA 1CBUA 1NN1A 2QORA 3OAAA 1NBMD 2WWWA 1N25A 4QRHA 5TB5A 3GLFE 4TLBA 2YWGA 2IA5A 3K0CC 2EVWX 4EJSC 1E0SA 2G83A 3GP8A 2K5UA 1MO4A 1KDRA 1YU9A 1CKEA 1P2VA 4D26A 3HP1A 1NLZA 1OIXA 4EPTA 1LNZA 4BLPA 2P6RA 1OB5A 1JJ7A 1ZC3A 2VIIA 1G3QA 1G17A 2ZJBA 2ZJ8A 2GXUA 2R62A 3CPEA 1CRQA 5JWRA 1R5BA 2IL1A 3AF4A 3RVBA 3SJZA 2CLSA 4WBSA 1GOTA 1RKBA 4EPXA 2BMJA 1GKYA 4V0KA 3FMPB 3X1DA 2IYWA 3VAAA 2HYDA 2CVFA 3A36A 2OBLA 4MRPA 1T3SA 5EUQB 3T5DA 4JLAA 2QPOA 5FOXA 3NBFA 1Q3HA 4F4CA 3GFTA 3AVVA 5EE0A 5JHGB 5FL7A 4PSVA 2WJVA 1U0LA 2NIPA 4Q1CA 2MSEB 4P31A 4MQBA 3F5FA 2QAGB 1J8YF 2JDIA 2V8OA 3CLVA 1IOZA 1NBMA 3IPXA 4Y0VA 2D7DA 3TAHA 2FPLA 4KFTA 2B21A 3ZQJA 1G19A 1KKMA 3BH6A 5F9HA 4BZQA 2F9MA 5GVRA 1KI6A 3OHMA 5DI3B 1NVVR 1P60A 4RD1A 1GM5A 4TYWA 5AJZA 4DKXA 1X8KA 3IO5A 3VR3A 1Q57A 5H70A 4JLMA 5FL3A 4IOJA 4LBVA 1Q1BA 1T91A 4TTPA 2O8EB 2JCSA 3EPKA 1U8ZA 5KU1A 4LV6A 4NCJA 1EG7A 4HUQB 3SYNA 2KJQA 4WXPA 2JLZA 1HQCA 1ZNZA 3DOFA 3KB2A 4XD7D 3QF4B 3D3QA 1EK0A 4PPNA 4LJ4A 4TT3D 1I4DD 2VSOA 3K0AB 4C0KA 2O52A 3REGA 1DAGA 1GP2A 3EPHA 5FTKA 4FD2A 2AN9A 3WYGA 5TVKA 4DWJA 2PEZA 2PJZA 2L0XA 4OHZA 5FUWA 1XCMA 4CT4B 2P6NA 2ZSDA 4TN1A 3B9PA 4OQFA 5A0FA 4RSGA 3CR8A 2ZITA 2PBRA 3SJBA 2QGNA 2W58A 1VDZA 2HF8A 1Z06A 2PX3A 2ZYWX 1W7AA 5JLJA 5GJWC 3EASA 1KGDA 1PVOA 3EPLA 1MRNA 1Q3TA 1RIFA 3LD9A 3LNCA 4URZR 4Q9HA 1G5PA 3U6KA 4Q02A 3RWMB 3IKJA 4IXNA 4NL4H 3Q9LA 2DHRA 3I1FA 3WMGA 3FMIA 4MGZR 1AK2A 3FE2A 1E69A 5J4KA 1E2JA 4EQ6B 1HUQA 3TQFA 5JCPA 3EX7C 3FKSD 1IAQA 1GNPA 4PX9A 4KLNA 3WNDA 3ND8A 2XZOA 2GK6A 1P7CA 1OIWA 2PH1A 1XEFA 1WF3A 3QXJA 2H5EA 4B2PA 3K9HA 4BECA 4Q7MB 2FDCA 3U6BA 4P4TA 1ZUIA 3CUEF 4YMSA 1U0HC 2AR7A 2QE7A 1S4QA 5F3WB 5SZKB 4URVR 1CJVC 1TU4A 1Z0JA 2W6JA 2FZ4A 3A1VA 3K0FB 4FWIB 4JLDA 2WBLC 3BBPA 4F38A 3RS2A 1II9A 2MSDB 1M7BA 3QI2A 3OE7D 4PHTA 3CX7A 5GVSA 3UWOA 2F7SA 3DM9B 2A78A 1XEWY 1A7JA 2DWOA 2REOA 5FPTA 2A5YB 3RC8A 3NTUA 2GETA 3DZ8A 2F1HA 1EFRA 1DBSA 4TTQA 1E1QA 5AUOB 1C9KA 2Q3HA 1SQ5A 3L0OA 1I4TD 3OF5A 3VR5A 3OIWA 4PPFA 3LW7A 4MYHA 4DHEA 2PMKA 3VNVA 3HYRA 4JJKA 2O8DA 5EJEA 2DCUA 4MA4A 3ZDQA 4ERNA 1Q12A 2OBNA 5AUPB 5KO2A 4G5OA 3AVTA 2CK3D 1Q21A 3HU3A 3AVWA 3QXSA 1G8FA 3D31A 4EPYA 5DHFA 1FPMA 2EWVA 3FKSA 1SVWA 4CRWB 1VMAA 4OK5A 4LSGA 3V4RA 1OH5A 1E6CA 4HLCA 1N5JA 3NVAA 4URWR 1E1RD 1AZSC 4DRZA 1GUAA 1QRAA 3LVQE 4DLYA 1DS6A 3FTQA 1ZW6A 4OL0A 4KV9A 3AV0B 2ORWA 1NN3A 2X2EA 2BM0A 3GEEA 4JL6A 3T35A 1XMVA 3HU2A 2OBMA 1Z3IX 1DARA 5FR1A 1AS0A 4RZ2A 2XTNA 2ZSEA 1Z29A 1P75A 2J0VA 2ZS8A 4DC9A 1T9HA 1XCGB 2AKAB 1KI7A 4M8NE 1VCIA 1XD2A 4HB3A 5CLLA 3IBGA 5AJWA 1VG0B 4NP6A 5FPHA 1BYIA 1Z0KA 5LB2A 2CNWA 3VQTA 3QNUA 2G88A 2O0HA 3Q5DA 5CJ2A 3SJCA 2BBSA 3CF0A 3C4JA 1T5LA 4A1FA 5KSZA 3PUZA 1N6LA 4O3MA 2ZYVX 4LBZA 1R4AA 5EUMA 1MT0A 1IN8A 3PITA 1FQJA 3THWA 1DTSA 3IIKA 4B34A 4QJ3A 1G16A 2CK3A 3BGWA 1CR2A 3NBXX 3EG5A 3PEWA 1VG9B 4EFLA 2FEMA 1Z0IA 5FUYA 2RHMA 2FSIA 5EP3A 4L9WA 2HLDA 5ANRB 1W36C 4TYQA 1UKVY 1R7RA 3VR2A 1XRJA 2UKDA 1QVAA 4GOKA 4C9BA 2ZUDA 2JGNA 3NWJA 1KIMA 3KJHA 1UKZA 3IPYA 5G41A 2GXSA 4CEIB 2H18A 1SHKA 2FA9A 2JLYA 1J99A 3KKMA 4LX0A 4QJ4A 4EIWA 5ELXA 1GIAA 1COWD 1H8HA 5KHOC 2EFDB 3TVTA 4IVRA 3SOPA 1R0WA 5K8UA 4AY2A 4P32A 3L8ZA 4D25A 1JBKA 3I4LA 4GZLA 5FI0B 1KDPA 4KSBA 3SU8A 3KJEA 4ZDIA 3K09C 1N0VC 1NMXA 3KKNA 1W0KA 3X1ZA 1NY5A 2RGNA 4DDTA 5G3YA 2IK8A 3Q8XB 4BFUA 3K0FA 2YKGA 5HKKD 2GJAA 4MKHA 4A0FA 3UMRA 1XPUA 5FBWB 2XB2A 5DIFA 2QNRA 3SNHA 1E2HA 3HR7A 3ZJYA 5BN4A 3U61B 1R0XA 3O8DA 2ZI3A 4TZ0A 4M0LA 1DAEA 1ZNXA 5CIWA 3L2OB 4TSFA 2FSHA 3GD7A 3W34A 4FCVA 2J0UA 5AWFC 2WWGA 3F8TA 1W5TA 1R5NA 1TL7C 1Z63A 3T61A 2PCJA 5CJPA 4BFXA 4RCYA 1KNXA 1QBKC 4UNSA 3U7GA 2VO1A 3MAAC 1KZ7B 3AUYA 3ZZUA 2GHIA 2GTPA 2AKYA 5JEDA 1NF3A 4HDQB 4DUGA 3ZVRA 5AUNB 1NN0A 4CEHB 3AF3A 1OYYA 5JFGA 4QOSA 3KKQA 3FHCB 1SXJB 1FOEB 4XVUA 1LY1A 2IYYA 3REFA 2Q3FA 4BUJA 1G7TA 3GLHB 2J5XA 1KAGA 4HAXA 4NH0A 3GJ8A 4TMXA 4XVQA 3QKSA 2B92A 1Q1QA 3K9GA 4QHSA 5C46F 3B6EA 1MABA 4YMWA 4G5GA 3GFPA 3R9WA 4LOAA 3ZS8A 1QHXA 2ZVQX 2E1RA 3L43A 1PLKA 2B7CA 4ESVA 1RE0A 4YQFA 2BDTA 1NG1A 2QN6A 1OSNA 1Z6XA 3HYTA 3NHAA 3UMSA 2JAQA 1CJMA 2QROA 1ZYUA 2GF0A 2OG2A 5BW8A 4DVGA 821PA 3FYHA 2C2HA 3W8NA 3K0CA 2BEKA 3ZS9A 1ESMA 2BJVA 2C9YA 3L0SA 3ZIAD 2YWEA 2JIZA 4LHWA 2WWFA 3AKEA 2XITA 5M04A 3UXMA 5SZHB 2NO9A 2AK3A 2PZEA 3QQ5A 1U9IC 3N2EA 3TK1A 4PO8A 3HPRA 3U44B 4DCVA 3WHKA 1W4AA 2DFKB 1A82A 2HJGA 2IYXA 4D2IA 3G82C 3QKSB 3G5UA 2F1JA 4ACBA 4BLTA 5FUVA 4Q7KA 5FL7D 3U7FB 5F9FA 4BFTA 2YOFA 4PSKA 2V7QD 3FPAA 1QF9A 5J4LA 1CIPA 3QXXA 2PEYA 3EC2A 1KY3A 2QPAA 2NZJA 2JDID 3B5JA 1V5WA 1E98A 4KITB 1RVDA 1LF5A 5EXSA 3SYLA 2KWIA 4Q9LA 2IW3A 3FB4A 4N0DA 4PO9A 4TLEA 4FI3C 3KQUA 1ZBDA 4ZI2A 1E9CA 5TDHA 3FVQA 2WHXA 3GJ7A 2O0JA 1EFCA 1ZJ6A 4C30A 5C2JB 1U0JA 3W5JA 2F55A 1J90A 3SHFA 5EE3A 4Q01A 1OXXK 4Q21A 1IN6A 1OFUX 2IBMA 1GTVA 4UNRA 4URUR 1F5NA 2W0MA 4R7ZA 1PV4A 2GKSA 1AA9A 1CULC 4GOXA 5J4YA 2AFIE 4ZKDA 2WTUA 4Q4AB 5L3RA 4GBMA 3GLIA 5HPYB 1IY1A 1HE8B 2ZRGA 3EZ6A 3QF4A 1FUUA 4JKYA 2ZAMA 4D4LA 2CHGA 3THWB 1TU3A 3E5HA 1E2KA 3LLMA 2PJRA 5DI3A 4AD8A 1AGPA 4A36A 3AF0A 5HCIA 4PC7A 3KXKA 3W3ZB 3O47A 5KDOA 2KBFA 6Q21A 2FGJA 2NO7A 1M6NA 2WJHA 1AQYA 4JLOA 2NPFA 4C0LA 2OUKA 5FPSA 3FDIA 4D80A 1A5TA 3GLIB 1N6NA 1KI8A 2ZI5A 1KHTA 5HE8A 3ETLA 2QMUA 4CGZA 3O8CA 3CF2A 2NG1A 3Q7PA 2PX0A 4M1MA 4NBSA 2WAXA 2F43A 2ZSFA 4GZMA 5EQTA 3H84A 4FMCB 4YMVA 3CKLA 1R10A 1N5IA 2ATVA 3K8YA 3CNNA 4JVNA 4F92B 3CONA 1NBME 3CZQA 3E70C 2IWRA 2ZYTX 3BERA 4TQUS 3C5HA 5FBVB 2KBEA 5DH9A 4EFNA 4QM6A 2OM2A 3TBKA 2IS4A 4W7SA 1QHNA 2W2TA 1YZTA 4QBIA 3CRQA 4B6FA 4FMDF 4Q4HA 5C4MA 4RFSB 2XOKD 3ASYA 1HT1E 3ADBA 1S3GA 4I99A 4CEIA 1E94E 3D8BA 2QTFA 3CF6R 3FMFA 5FOSA 3KTAA 4C3ZA 2NQ2C 5G3ZA 2ZEJA 1YVDA 2IUSA 3LFUA 3EIQA 4M9SA 2FNAA 3P20A 4G0NA 4CYMA 1XNJA 1ETUA 1G5RA 3RRZA 2VHTA 3M6AA 4RD3A 4E5UA 1TUEA 3GJ6A 1ZM7A 3AP2A 1KO7A 2NO0A 4IJMA 1Q1EA 3T5GA 4XJXA 5FUXA 1D9ZA 1OB2A 2AWOA 2BMDA 2DWPA 4B35A 1E1QD 3NXSA 5JECA 1F60A 3VTKA 4MYCA 2QM8A 1RJ9A 3LDAA 3UG6A 5EP1A 2VP9A 1WCV1 4BGDA 5LDDC 1XX6A 5JJLA 4V0OA 1BKDR 1I2MA 2J46A 3WY9A 2WICA 1Z07A 2DFLA 2OHFA 3MWYW 3QBTA 1CJTC 1OE0A 3ZVMA 2DYKA 1JR6A 3LW8A 3QSYA 2C8VA 4CEJA 2ZRPA 2V4ZA 5JI3E 3P4YA 2GZAA 4US2R 3MG9A 1W2HA 3L0PA 4NCIA 2REBA 4Q1DA 5DSZA 4Q1EA 3GLGE 1RPZA 1S8FA 1UM8A 2C77A 1G7CA 3OEHD 4A2WA 4NCKA 2ANBA 3FFBA 2IYZA 3TAUA 4IVQA 4R71A 1VYVA 5G40A 4XOIA 2V1XA 2OCPA 3X2SA 4P4UA 4MGYR 1D2MA 3AVPA 4NYIR 4CIDA 3OIYA 1X6VA 3JZAA 1NJGA 2NGRA 3PEVA 3N2IA 1KK3A 2V54A 2A5FA 1E2PA 4AI6A 4AKHA 3BWDD 4KCGA 2R6AA 4N1AA 3AB3A 2IF0A 3PENA 2IHYA 4RZUA 2VEDA 2AWNA 1VG8A 5E7JA 3T15A 1HYQA 2OCBA 3CO5A 2WWYA 4TLDA 4QNMA 5JEEA 4N0EA 4WXRA 1IBRA 2JIZD 4DZZA 4DCNA 2G1KA 1E2MA 4ZO4A 4KFRA 3EW9A 4KI0A 5B2ZA 2P3SA 5LBIA 2ZI9A 1JALA 1ZU4A 4Y0AA 5EP2A 3BB3A 2GCOB 2Z0MA 2RGBA 5FH9A 4OQXA 3RS0A 3NDPA 4NTZA 4MKIA 3KQLA 4E09A 1B23P 1YKSA 3CWQA 1QHGA 1Z47A 4HZIA 4M21A 4TMVA 5JZVA 3EC1A 5GJCA 1OKKA 2V1UA 1S9DA 5HE9A 4V0LA 1AGRA 2B7BA 1DPFA 4TZ6A 1US8B 4OHWA 3H86A 3I92A 3K1JA 4NYMQ 2AK2A 2RGCA 2LWIA 3EWAA 3M1IA 1M2OB 2QAJA 2ATXA 3AP1A 4MRSA 3B7GA 1F2TB 3NEJA 3RNLA 2JLQA 3C41J 3DPUA 2BV3A 1FFHA 2R65A 1XTJA 1QHYA 3G0HA 1H8HD 5JWHA 3FHTA 1Z0AA 3B8HA 1RRPA 2LKDA 4PO1A 1ZM3A 3AVOA 4D82A 1OLOA 2GJ8A 4V03A 1GDDA 4IOMA 1R2QA 2WSSA 1FNMA 3LBHA 4NZYA 1D8TA 3QXCA 2GK7A 1FX0A 1W0KD 1UBGA 3HPQA 2WKQA 3OEED 1VPLA 3MWLA 4HLUA 2QGZA 4CT5A 3THYA 3K09A 4NPHA 4B3XA 2FFBA 1EESA 1IM2A 4KFSA 3D7MA 1W0JA 1N0UA 3KKPA 2ZRNA 3A37A 2O8FB 1W36D 2IYUA 3MLEA 2PMDA 1JEDA 2XNDD 4M1TA 1JJVA 1XXHA 1R8SA 3ZH9B 1W4BA 1G20E 3DVLA 4IRUB 3U44A 3BK7A 2OT3B 2H1LA 1EWRA 1H8ED 1ZP6A 2DY1A 3BXZA 3QPUA 1KJYA 4KHZA 2IYLD 4GP7A 1N6OA 3VHLB 2P67A 3A1TA 2O0KA 4MDEA 2IXEA 3FGNA 3RWOA 1XTIA 3I62A 4NKRA 2MMCA 1NVUQ 2OE2A 2ZRFA 1G8PA 4ACAA 2ZYUX 1IHUA 2RGDA 4FIDA 5DE3A 3VX3A 8OHMA 1NN5A 1I2DA 5FI1B 4QFMA 2BOVA 2Q3MA 2D2FA 1KI3A 2WMOB 2XZLA 4WZBE 1P4SA 2ZS7A 1KMHB 1Z6AA 3PV0A 2BMEA 2FPKA 4CZ2A 2GWHA 4EAQA 3H0KA 4ON9A 2ZIAA 1FTSA 2GZDA 1II0A 1MKYA 3IHWA 5DISB 2AX4A 4OI1A 1U94A 3U2QA 3DMNA 3E1SA 1XXHB 1Y63A 1C4OA 4B75A 2WV9A 3QG5A 1MV5A 1AS2A 1TQ2A 1X8JA 2BC9A 2EQBA 4M1SA 1XPOA 4PAQA 4P4SB 2ODNA 5E3HA 1HQYE 2WJGA 2VHJA 1L8QA 2HXSA 2GF9A 2QT0A 2O8BA 4PC1A 4YDHB 2ODBA 1OH6A 4UXJA 2IWHA 2F3TA 4DLUA 4C2UA 1WQ1R 2F9LA 3B78A 2IYRA 5KTYA 1EGAA 4M1YA 1OFIA 2JASA 4A4DA 1P2TA 2CEAA 5SZIA 3UWKA 4DLXA 3OFND 1XEXA 4HAWA 4PQFA 4Q48A 2QBYA 2D2EA 4KBGA 4YXWA 1P5ZB 4DB4A 5JS7A 4JSTA 5CM9C 3WP1B 4LBYA 2QQEA 2E87A 1XD2B 5TY0A 2YWHA 2OZEA 1KI9A 1WA5A 4LV8B 2RKOA 3KUDA 3MJHA 3RLFA 4BLQA 1BMFA 1CR4A 3BFKA 2C99A 1ZAKA 2AFHE 4B48A 3RC3A 5JSZB 4NDZA 5E7MA 2ZANA 2P2LA 2GA8A 2F6RA 3P27A 5CB6A 2HT1A 1DADA 2HLDD 1P62B 4WAUA 1ZUHA 3ND9A 4LCBA 4Q4LA 1XB2A 3A4NA 2GJ9A 2Q9BA 4X8LA 3UIEA 2IF2A 1DG1G 1DOAA 4KO8A 1ZU5A 2R9VA 5JCZA 4D4MA 2Z83A 1J7KA 4CEHA 3KJGA 2PLRA 3I8XA 1EXMA 2A5GA 1M74A 1J70A 4MRNA 2HCBA 1I4LD 4TSFD 521PA 1ODFA 5LB4A 4C2TA 4LPSA 4QKQA 1GRRA 3GLHA 4JMPA 4BPBA 5B58C 2RGAA 3K9LA 5KOYA 2FMXA 3Q72A 2OLKA 1P61B 2WM9B 2R6FA 2FE4A 2W6IA 3THXB 2CXXA 1YZNA 3Q7QA 2YYZA 4G5SA 5A5GA 3VKHA 1JI0A 3K0AA 4RJLA 3SQXA 1YZKA 1YZGA 3AVUA 3LXRA 5KNBA 1YZLA 5HCNA 1CLUA 2YVUA 1DAIA 1M7HA 1KYIA 2ZI6A 4G1UC 1OW3B 4YMTA 2GJKA 4BWYA 1XTSA 2VP5A 2ZU0C 4RZXA 3U4QB 3MD0A 1NIJA 3T06B 4F91B 5K8LA 1FW6A 5J4HA 4MGIR 5K8IA 4PZZA 4B47A 5CITA 2GBLA 4IDOA 1XTRA 2BBOA 4D0GA 4AKIA 2QT1A 3L82B 2ZR9A 2EWWA 2FN4A 4RD4A 5DN6A 5EZ6B 2VSFA 1ZD9A 2ECKA 3K0EA 4PHFA 2RGEA 1KI1A 3GJXC 1XTKA 3DOEA 4EJSA 2YHSA 1Q22A 4DUGD 2RMKA 3TUIC 2CLCX 4GI7A 2YJTD 1E2LA 5EXXA 2R6DA 2IX3A 4DSNA 2FU5C 2VA8A 1KJWA 3EZ9A 2QBYB 5AJVB 3BD9A 3ZZ0A 3J81k 3UG7A 1S0UA 4FMCF 3WP0A 4BFVA 3KFVA 5B64A 2J0QA 1AZTA 1O87A 2NPIA 4M1OA 3ZQ6A 4B44A 1ANKA 2CL0X 1OXTA 2I1QA 3A6PC 1JQLB 1XMSA 1DO0A 1G9XA 4BQSA 2QEQA 1T3HA 3UKDA 1MABB 2ZJ2A 2JJ2D 3LWNA 2GZHA 4M9ZA 4E03A 2P6UA 4Z51A 2XJ9A 1B0UA 5BYKA 4G5QA 4I1VA 3I32A 2B8TA 3GEIA 2XB4A 2ZJAA 3QY0A 2C04A 4PAMA 1U90A 2XAUA 4IEIA 5FBRB 1SXJA 2KI5A 4DEYA 1MO3A 1SXJC 2FZLA 3B9QA 5HR5A 1L4UA 4JVLA 3WRYC 1M1YE 2VHCA 4LV5B 3WNBA 4M53A 3DHWC 3GJ5A 3QEJA 1KMHA 4I4LA 4IOKA 1IN4A 5KNCA 3VX4A 3BE4A 5IRCD 1U98A 1X86B 1TEVA 3C7KA 3FMOB 2ZR7A 1Y3AA 4C4PA 3QXHA 5P21A 1BO6A 1AS3A 1AKYA 3LQRA 1OFHA 3CBQA 3O8BA 4IFBA 2YC4C 4U02A 4Z8XA 2H8KA 5A4JA 2IUTA 2J59A 4IW3B 4A8JC 1MR3F 1IY2A 3C5CA 2P5SA 3V4FA 2NOAA 3JZMA 2I3BA 5KSYA 5EE5B 3BC1A 2ZE8A 2CMKA 4HAYA 5TV2A 4C0HA 1E9SA 1F3OA 1XBTA 2YWFA 5AR1A 3RANA 4ZDWA 4EQ6A 5KPJA 1G4UR 3OAAD 3BH7A 1SKYE 3IBYA 1CXZA 1R8QA 2YOHA 4DSUA 4Z8YA 4JT2A 4F7WA 1GKIA 1RYHA 4MGKR 1RYFA 2RGXA 2XTZA 4XSHA 2J45A 2WOOA 5CDFE 5HZHA 4TL6A 5SZJA 1SKYB 1F2UB 1TF2A 1Z0DA 3D6TB 4FMBB 4MKFA 3RSLA 4JLPA 2Q0HA 2H57A 2ZRCA 4M2LA 3WBJA 2B8WA 1YJ5A 5IDVA 5JS8A 2RH5A 4HZUA 4PSAA 2JLXA 4ZDKA 1NLFA 2C98A 3B82A 2H92A 2A5DA 1T3LA 2C96A 1SVMA 1T0JB 3GQBA 3P1JA 1RRGA 2ZROA 3B1VA 1KDTA 5KNDA 1G6OA 5EP4A 2BCGY 2O8DB 3OZXA 4U7DA 2XGJA 1VIAA 1XJCA 4L15A 2VH5R 2J3EA 2XXAA 4AYWA 3P32A 1E9BA 2Z4RA 2GESA 4ITRC 2YINC 2ZM5A 2A3RA 1Z6GA 1G3IA 4Q9IA 4IVPA 1FQKA 4QG7A 3S1AB 1J2JA 3PCRB 2B6HA 3PEYA 4FXPA 2OV2A 3U3RA 4KYIB 1E79D 4JLNA 4OKSA 4TYNA 2FFHA 3LRPA 2Q21A 3EIHA 2G1JA 2R6GA 4XWKA 4XIGS 1TUIA 1FMJA 4XH9B 2ZSBA 4QGHA 2WKPA 1Z22A 5CK4A 5H1YA 1NVXQ 2W2XA 3L8YA 1Z2CA 4P0TA 3DM5A 1ZMXA 1E9AA 2BHRA 4LYFA 4OK3A 1G5TA 2H16A 1JR3E 5JBQA 2F1IA 1E0AA 1AQUA 3IDQA 2H17A 2IYVA 2FPMA 3IIMA 1ZVQA 1KI6B 5FTNA 4PAOA 3IO3A 4UJ5A 3PUWA 1GWNA 3PUVA 4PFSA 3TNFA 1EFUA 3K0SA 4ARZB 1ZM2A 4V0MA 2R2AA 3LX8A 5L3QB 4M9XA 2JLWA 4JLBA 3ZIAA 3SJAA 4HB0A 1XEXB 2PLFA 1G3RA 2QP9X 3NKVA 1X1RA 4LJYA 4RY2A 4DLRA 4EUNA 2WIBA 1ZM9A 4M1WA 4POAA 2XOKA 1CF4A 4BZPA 4XD7A 3ZGXA 4D4KA 1KY2A 4C0JA 5B30A 2O8BB 3THXA 2JLVA 1GFIA 3IIJA 4ZIRA 5CM8B 3OIVA 2XTMA 5BN3A 1LTQA 1G8GA 2RGNC 1KO1A 2V9PA 1E32A 2IS2A 4HUQA 4BFWA 1K5DA 4QHYA 1BS1A 1UF9A 2A5JA 2VP0A 4MYUA 2JJ8A 4WW0A 4UXHA 1O3YA 3FHOA 2O8CA 1RC8A 3EZFA 4ARZA 1MRSA 2ZRHA 3T1VA 2C5LA 4RFVA 4DSTA 1VKJA 2AHOA 2GJSA 3UMFA 5IF9A 2WVJA 1Z28A 1T0HB 3LH5A 3TW4A 4V02A 1P2SA 4QBHA 3C8UA 4PQRA 1R6BX 3CW2A 5BN5A 2FOLA 3AVQA 2GVDC 3KKOA 2ZRIA 1U81A 3LVRE 2WJYA 1NVWQ 4A8JB 2H7VA 4B3CA 3B2EA 2AXPA 2OO7A 1PUIA 3SZRA 1JXMA 4OQMA 1RW4A 2ZETA 5C18A 2KB0A 3CPJB 2QAGA 4Q1BA 4NU0A 2BM1A 4DLVA 2OEPA 4YONB 1WBDA 1RRCA 1N6IA 1MO6A 2QY9A 1P9WA 1BYUA 1XF9A 3BB1A 4HATA 3VKWA 4H1UA 2A2ZA 2HT6A 2D62A 5H68A 5K8TA 2N42A 2V3CC 2GXQA 3TW8B 1VYTA 4RKEA 2WKRA 2ZXUA 4TWZA 3PIRA 4TMKA 2I1VB 4DCUA 4J0QA 2FEOA 2QSYA 3B1XA 1RRFA 4UXIA 4DXAA 1G291 1ZD1A 1DAMA 3QE0A 3HWSA 3LX5A 2QMHA 4LHVA 5FOWA 5BQ5A 3MUFA 5GJVC 4PPQA 4KYUA 2JEOA 2PZFA 5J47A 1P73A 1P9RA 1N2CE 1ZCBA 1ZM4A 1LS1A 4IKEA 4QGFA 3SN6A 4Q19A 2GCPA 2VF7A 4HAVA 2YNMA 1EX6A 3HDTA 2VP2A 4AG6A 1DELA 4BLSA 3ICEA 1G7SA 3M4YA 2D4HA 3CRW1 4JKIA 5CB8A 1E1RA 3EAQA 3RAPR 2G77B 1PLJA 4YDSA 4AG5A 3CNOA 2ZJOA 5AJXA 3VU9A 3N70A 3GLFA 1OT3A 1TNDA 3KXIA 3BFVA 1OJLA 3C15C 4DB2A 2QP3A 1XMJA 1T8TA 5JI2E 5JRJA 3U3KA 4B3DA 2GCOA 4HUTA 1XFAA 4B33A 4GL2A 3K9NA 3MWKA 3SYKA 2RCNA 4W5WA 2QP4A 1EWQA 3M0EA 3P4XA 4Q4AA 4HYYA 4RVCA 5KYKA 4M9QA 1UPTA 2JLSA 2X77A 4ZCLA 1JQJC 1TADA 1U9IA 1W5SA 1WXQA 1XEWX 2JATA 4MKGA 1YR6A 1E2IA 1RFLA 4TMZA 3SI7A 4UNQA 1N0WA 3A4MA 1SKQA 4Q03A 1TTTA 2QENA 5FR2A 1YR7A 3MSXA 2ZR0A 1BH2A 5GJBA 3I8SA 2DBYA 3RS3A 3BOSA 2OFOA 2WWXA 1UBEA 2QUZA 4O0MA 2ZRLA 3TR5A 1UBFA 3WMFA 4JYBA 5LD2B 2ZRJA 1FTNA 3LO5A 4KFUA 4JL8A 3JVUA 4V0ME 3B60A 4DCTA 4BFSA 3E2IA 2JA1A 5FOTA 3SDZA 1NMZA 1ZIOA 4H1VA 4Z1MD 1KK2A 4B43A 4C7OA 5DHAA 1KJZA 2AD5A 1JR3A 3ZZTA 1UFQA 2R8RA 1HY3A 4PTLA 5CYPA 2ZE7A 3VR1A 2BVNA 2DB3A 1OF1A 3OE7A 4UKDA 3GLGA 3AGPA 4B6EA 4B3FX 3DO6A 3WYFA 5IHPA 2VF8A 1OXSC 4DLZA 2WMNB 3K53A 1DO2A 4A2QA 1EFRD 3B1WA 3RDPA 1DEKA 2EU8A 4ASUD 3QG1A 2IXFA 2GAAA 1E2QA 3I73A 3GPLA 2GNOA 1XU4A 1UJ2A 2DPXA 1U8AA 5FTJA 1KSHA 3TKLA 5FBLB 1GG2A 4PC6A 4EFMA 4XTRA 4C7OB 3U3OA 1R0YA 1VCMA 3LV8A 5CK5A 4MRVA 1N6PA 1V43A 3Q3JB 3EXAA 3RABA 2XXAB 3DKVA 4W9MC 1AM4D 1GZSA 1W46A 3GEHA 5TARA 2NZ8A 2LKCA 2REXB 3S1AA 1KTVA 4XWOA 4ZI3A 2GXAA 1JECA 5FPYA 1E2DA 1KO4A 1OIVA 5JWOA 2NMVA 1S96A 2J7KA 3GCGA 4Z1MA 4OK6A 3ASZA 4I81A 4Q18A 1IJEA 3DDCA 3QEOA 1NSFA 2CHQA 3R7WB 4KBFA 3C14C 5HTKA 2GBLC 1W4RA 3AM1A 1TX4B 2CHVA 4NCHA 2WZQA 4Q1FA 1XJ0A 3VR4A 1QHSA 4YLGA 3W5IA 3SFVA 4B2IA 2CE7A 3ZD7A 3R9IA 2W83A 2GEDA 1UADA 2ZE5A 2BCJQ 4B2LA 1JPNA 2HEIA 1E96A 2HDNB 4OQNA 4LJ8A 2AL7A 3WYAA 3CPHA 1OPXA 2RB4A 4DLWA 4JVSB 5L3SB 2BIFA 2VP6A 4FINA 1UDWA 1GL9B 1W0JD 4LC1A 4X8OA 4AURA 1L7VC 1TQDA 4ZCIA 3CRVA 1P72A 5JJKA 2VYFA 4O25A 5KDLA 2QSZA 121PA 1CJKC 3I61A 3BRWD 3EZ7A 4LGMA 3GLGB 2ZREA 1UKYA 4IDQA 3FOZA 3TUJC 4V0NA 4F4JA 2DR3A 3CRRA 4L9SA 1QZXA 2YC2C 3TMKA 2JLUA 1FZQA 2ORVA 1FX0B 3T34A 2C9OA 4NYIQ 1VECA 2Y8EA 5TMPA 1IQPA 5B57C 1OXUA 3UANA 3DKPA 4DSOA 1VIYA 4NHOA 4O2LA 2G9NA 3NEYA 5AK0A 3CWZA 1L4YA 2V55B 3NBZC 1YRAA 2IYSA 2BEJA 1CJUC 2MSCB 3DL0A 3LXXA 1YQTA 1K5GA 1SVIA 2IUUA 5KDDA 1COWA 1HEIA 1BOFA 4HLUC 1AN0A 5FFMA 4EDHA 3KUCA 3B85A 4RD0A 4TLCA 4MYTA 4TLAA 4RD6A 3FKQA 4L4UA 4I1UA 4NE2A 1E9DA 3RRYA 4B71A 2XSZA 4NYMR 1WP9A 4JBXA 3EARA 4HB4A 3TSOA 1QG2A 3QENA 4AKGA 4JL5A 3SBEA 1XZQA 3LBIA 3PUXA 4Q7JB 1GL7A 4D81A 1G4AE 1F2UA 4Q1AA 5FTLA 1XPRA 4IOLA 1KMQA 4NYJR 1SGWA 4K81B 2DFNA 4YC7A 5AUQA 5DN6D 1E9EA 2YZ2A 4Q66C 5G53C 3PUYA 1U8YA 3R9XA 4IEEA 4BLRA 4A8JA 3QPVA 3EPJA 1N3BA 2F43B 2JJ1A 2VQSA 4PC2A 2J0UB 3IGFA 5DGXA 3KL4A 3W90A 4CF7A 1IONA 1HA3A 2EFGA 2IT1A 4DDVA 4K46A 1J8MF 1ESNA 1S2MA 4U00A 4LJ9A 2GEUA 1GL6A 3VU9B 2OXRA 4DLSA 5JHHB 3I5YA 3OFNA 3A1SA 1Z5ZA 4TYYA 1F48A 4PPGA 3FFAA 3K70C 4QBFA 1P6XA 1XTQA 3CH5A 1CTQA 1P3JA 4GNKA 5E4FA 3PXGA 3A1UA 1PLLA 4BLOA 4OJQA 4CDGA 421PA 5LPNA 4AK9A 1YE8A 2GRJA 2QPTA 3SE0A 2O8FA 3N5CA 1VCNA 3NC0C 4JBYA 1EFHA 3MMPA 3EWSA 2WJJA 4Q47A 4IDPA 3ZLJA 2WJIA 4URXR 5DNYB 1CR1A 4JSYA 1FMLA 2P65A 3AGQA 4Q7LA 4LWZA 2Z4SA 2W2VA 1Z8FA 1KNQA 4GMDA 1MO5A 1OHHA 1VYUA 3A4LA 3BFXA 4QGGA 3ZVNA 4JLVA 1HT2E 4W5JA 3X1XA 4LJ6A 1D2EA 1NI3A 4K8OA 1CRPA 1QHHA 3GLHE 1JNYA 1E4VA 3ZVLA 4DT1B 4GSYA 1E2EA 2CL7X 2BKEA 1Z0FA 1GRNA 3PFIA 4OI4A 5L8VA 3C16C 1EFTA 1LVGA 1S1MA 5EXTA 4B3BA 4R9UC 4TQAA 1R5OA 2HUPA 3OIUA 4HDOB 4FMDB 4LZZA 5E7IA 4C0AC 2Q9CA 4G5RA 5FOVA 3SC3A 4WIAA 1K8RA 3LA6A 3IEUA 4KSCA 4DIDA 1CR0A 1BIFA 221PA 2ANCA 2CNWD 3AF2A 3DEFA 1SULA 3KDSE 5BXQC 2BWJA 1TQ6A 4LHZA 4LI0A 4AWXA 4QJ5A 2OESA 3IUYA 1Z83A 1FP7A 2IYTA 3I5XA 4C0BA 3AP3A 4NMMA 3WRXC 3PQCA 3CX8A 4HAZA 2N46A 1RJ9B 2GAOA 4WZ6A 1SXJE 3GLFB 5UKDA 4LC0A 2ZRAA 2ZSAA 3QBVA 4OHYA 1OHHD 1M7GA 2C03A 3W8RA 5BWMA 1IN7A 4TL7A 1LW7A 3U4QA 2ONKA 4XVRA 2QRNA 3W6PA 3NH6A 1X1SA 1IY0A 2ODWA 2VTKA 4LYAA 4PANA 4JZKA 1ZINA 4AYXA 4DBLC 5L3VA 2CLDX 3BH0A 4JLJA 5IK2A 1GSIA 1N6RA 1QHIA 4RD2A 5D3QA 3O8RA 2X1VA 4F93B 3NC1C 2ZVPX 5F2EA 2J9RA 4URYR 1XDBA 4PXAA 2PT5A 4UNNA 1W49A 1PZNA 3QVVA 621PA 4GOJA 1Q1ZA 2SHKA 4BRUA 1T4GA 3X1WA 3DZDA 3U3MA 1TQ4A 3LQQA 4LJ5A 3ADKA 2QL6A 4RFSA 1SVSA 1FNNA 4HAUA 2ONJA 3HR8A 3BJIC 3NBYC 4I1OA 3WBKA 1N5KA 1TF5A 2HV8A 3R20A 4HZUB 4AIIA 2CDNA 1LB1B 1HV8A 1UKEA 1KI4A 2ZJ5A 4KVGA 2WIAA 1NNEA 2CVHA 1P9NA 2Q9AA 3QUSA 4P4SA 2FSGA 1P2UA 2X2FA 3GJ4A 3UATA 5DI9A 4AKEA 4CW7A 3PJRA 5FOUA 3FWYA 4EPRA
chains in the Genus database with same CATH superfamily
3UAXA 5A4DA 3BGIA 3ILYA 1JQ3A 5IMBA 1TTHA 4N8EA 3ES9A 2OZVA 4S1WA 1RJGA 1W52X 1R15A 1AQ6A 3B53X 4TQ9A 5JSZA 2I9KA 2OLJA 1E7QA 1IXZA 4AUMA 5ALJA 4LHYA 1B3RA 2XIQA 2BF7A 4JBLA 2F8TA 2C20A 1VTKA 1C4WA 3CCBA 4J0CA 2H7XA 3IOYA 1DJPA 2AYZA 2G9VA 3LBNA 4ZT2A 4QARA 3WOVA 2QTHA 1YU6A 4EI8A 4UBJA 3T12A 1YNSA 2CJWB 3HCDA 5JOQA 3VR3D 3COJA 3MINB 2R87A 1BS2A 3DMRA 2PA3A 4WZZA 1U8XX 2BT4A 1NI4B 4BEBA 2V6IA 3WLOA 2BDUA 3VZDA 4OAOA 3RC2A 4Q00A 5EKDA 2Z08A 2GN0A 1W1WA 1T1RA 3FCSB 1VI6A 4KJZA 1E6UA 5F12A 1A88A 1G9SA 2HPHA 3CBGA 3KLPX 2QM3A 4R2IA 2NW6A 2FPUA 4K0RA 3KTAB 1F2VA 2ERYA 2RFLA 3CZCA 1A5BB 3H0EA 4QYIA 4BNTA 5J1SB 4LY9A 3U56A 5A05A 1WTAA 4LSZA 4B8ZA 3U09A 3WFZA 4BRSA 4KR0A 4WVFA 1DCKA 3U39A 3F3SA 3N3AC 1IL0A 1T2DA 1WG8A 3S99A 3OE4A 4A9AA 1TJ3A 2X19A 3JATA 4TRMA 4HFMA 2X9NA 4LNUB 3Q98A 4L2IB 5ICEA 5KPDA 5KREA 3D6UA 4X62B 4K6MA 1Q20A 1YQXA 3BSFA 3WQQA 2ERXA 2Z6UA 2JJ1D 4FLEA 5BT9A 3U5ZB 2I4IA 1JWBB 1LV7A 1YDMA 2ZJZA 1H0RA 2Y0CA 1H69A 3U81A 2VUUA 4P33A 1CFJA 2Y1KA 1Q11A 3QJYA 3PQ4A 3V32A 5B6JA 1DPGA 1ZWKA 1YRBA 1LZKA 3TH5A 1Y3BE 2Y1LA 3PYLA 4GM4A 1LPNA 3K2IA 4IXDA 3ZHTA 4OYHA 4OI0A 4EDFA 3ZCXA 3U7EB 1VE9A 4QUIA 1FL9A 1A97A 1DXHA 4LYGA 1E4YA 4MKRA 5B58T 4C6TA 1QRSA 3AO0B 3TQCA 2X0RA 3BX1A 5I6DA 4BC1A 1X1TA 1Y7HA 2RC6A 3UJ6A 1WB6A 2XKBA 3K94A 4F4DA 1JZQA 2Y6UA 3V9PA 2WW8A 1CUAA 4XSVA 5DPMA 4XFKA 3X2FA 1NWCA 1T6YA 3O1JC 4Y6QA 3OTOB 1WAMA 3EHEA 1JIVA 1SQ0A 3QKUA 5ECWA 4BQNA 5EIFA 2AD1A 2HU5A 5DHPA 1HFEL 4D3ZA 3OQNA 4KTTE 3AF6A 1P1KA 3UT5B 4AULA 4X1IA 3B13B 1GYRA 2BFDB 2P2GA 3ZG6A 1BDHA 2DKNA 1D9XA 2DU8A 1ZHFA 1H93A 4W8HA 2DBZA 4XVHA 4DFDA 7YASA 1ONSA 3JAKA 1YHNA 1OXVA 5DCYA 3V34A 2JLRA 1A96A 3IKMB 1U2RA 1CUCA 2G0TA 3NBUA 4O63O 4PC3A 5IJ0A 3KYCB 3SS8A 4MA0A 5AW4A 2TSYB 4IDBA 1P5RA 2HA3A 3BB4A 3H5TA 5B7PA 1T4MA 1PK8A 3DV9A 4CUJA 1U2SA 3QLJA 4N01A 3QW2A 1JR2A 2DY0A 3RVLA 4ZMSA 1TM2A 1BN7A 3M9WA 2ZWOA 3HDYA 3F47A 1E92A 5BWLA 4X20B 1NULA 2AVNA 1KJ8A 5TS3A 2JC3A 3F8SA 1G60A 1ODSA 2ZPTX 3B8EA 4JYMA 4OVKA 3WLTA 1LS6A 3H1EA 4D6YA 5BN3B 4X8MA 2BP7A 2FV8A 1ZK2A 2RAPA 1WXWA 2VDRB 5HK8A 2CY0A 2WWHA 1XYGA 4M4SA 1GAWA 3FTFA 1XFDA 4KU4A 1LLFA 1VSVA 1MORA 2AQHA 3AR5A 1WB9A 5IULC 2PDAA 1E3MA 4KODA 4ZHSA 2BGKA 5AVOA 3O73A 1G20B 1YR9A 4D3YA 4ENPA 4UQOA 2QRMA 4UQLA 1E1CB 3OTWA 2ZI4A 3JWEA 1DFGA 2QE7D 2ZATA 3QKRA 2FRXA 1PJRA 1ADYA 1HTBA 2Y99A 3AR6A 4RTSA 4LJKA 1VMEA 5A9SB 3RU2A 1H65A 2WFAA 3L84A 3EZ2A 4UCQA 3G2QA 5JZMA 3G8YA 4CM6A 1SELA 1UFKA 1HYGA 4D9JA 3JARB 2P6OA 2B94A 4A6XA 1GUDA 4KIJA 1CP2A 4U5XA 3DBOB 2FN7A 1SZPA 5TPZA 4LMRA 3RREA 4E2YA 4O2RA 2W93A 2DPMA 4UOZA 2Z8YA 3QF7A 5CLQA 2V7XA 4WLOA 2DBVO 5HDQA 3G68A 5IK2D 3BWYA 2CCGA 4MDFA 3V1NA 1Y6ZA 1H23A 2ZTSA 3Q85A 4Y18A 1FK8A 3UBTA 1A4RA 4GMXA 2G25A 1ZUNB 2OAP1 3Q0TA 2PHZA 4RKFA 1RBMA 2FY8A 4MOWA 4NYJQ 4OFZA 2H3EA 2PMEA 1SBIA 3IDOA 3EVCA 4RIEA 1AF7A 4CLRB 5CBPA 5HKBA 2HJHA 3E4DA 4AUKA 2Q6KA 2XX3A 4AJJA 4MCIA 1Y42X 4IFEA 1WJGA 2DUMA 2QN7A 1DAKA 5C1BA 1F7VA 4F60A 1JPVA 1MCZA 2BGGA 5CLIA 4UDOA 2NUAB 1UUFA 4TKMA 2XE4A 1QVVA 2I2BA 2QG6A 3R3YA 4RSMA 5DXJA 4A6PA 4DV5B 3AUXA 4Q5IA 3IQXA 4L8GA 2A1UA 2CC2A 5BO5A 3ZQKA 1JPJA 4NE9A 1MOZA 1UXGA 3DBLA 4KDFA 4B3GA 1H05A 1P1CA 2WHQA 1ZPDA 5BSFA 3ZBUA 1QU2A 2OGTA 4FFMA 3KEGA 4IGAA 3OZGA 3ZLTA 1JR3D 3GQBB 1LBSA 1CS4C 2EDAA 2QMOA 4JP8A 5JSKA 4B3RB 4W6ZA 5HQ3B 3PT5A 2RHOA 3EVGA 4KQ1A 2HQ1A 2RBGA 1PGPA 3DZJA 5DGHA 1AJEA 2FN9A 2ZUBA 3CZPA 3F5DA 3UO8B 3HVHA 4J0FA 2IQIA 5AW8A 4A15A 3DWEX 3FAZA 1JSCA 2YJ4A 4JEHA 2DQSA 5LBTA 4F8EA 2F62A 4LRSB 4UCWA 1TZBA 3RGWS 3FOWA 5IUNC 3LWBA 3HN2A 1NBOA 3E7DA 4F5DA 3E3LA 4HADA 2ENUA 5DVZA 3VFDA 3GP3A 4RWEA 5HILA 5LQSA 2UZ3A 1RYNA 5B1HA 4S35A 5AFSA 4LF7B 3VHXB 1O0CA 2AOTA 5D5PA 3C5WP 5CB0A 3F0TA 3MLBA 5C3UA 4EZEA 1KU0A 2GPYA 4YCAA 1PQYA 4F6CA 3KTFA 4QL3A 2OQ2A 3IJPA 2AJ8A 3AUAA 2VXYA 3RS7A 2V0NA 1W6UA 3BE5A 2EARA 3LAWA 4HLDA 3H5OA 3HCPA 4IBOA 2CXQA 5E1OA 1UJ6A 1UWLA 3RUAA 2XLCA 1NTOA 1YCGA 2UUOA 3EVTA 4EX6A 1Z2AA 1R0ZA 3W9BA 2P5TB 5EJ4A 1G9TA 2C2ZA 2YNMD 3HU1A 4FNAA 2C59A 4UOEA 4YUAA 1E3LA 3ND7A 1KZGB 4I3HA 3N74A 1EH5A 1DE0A 4OBEA 4DSZA 3P97A 4MS4B 5C1DA 1E5XA 4CV1A 3AK4A 4I2VA 1TEHA 3EIWA 3SJ7A 3ZDYB 3AY3A 2FPPA 1TTQB 3UV7A 3OD1A 4O2BA 5C7IO 4XLZA 1XWFA 3MF4A 4LYJA 4XXHA 2G71A 1Y8RB 5F2KA 4WA7A 4RETA 4BX8A 1E3SA 4C0SA 1DKOA 1UJBA 5CYOA 2X9GA 2R0QC 1O5TA 4BZXA 5JUWA 1E7YA 1RBZA 3DH0A 4FS8A 3U7QA 2ZZMA 1SBQA 4RF2A 1NW3A 1V9SA 1Y8AA 2P6MA 4CVNA 2PAAA 1G3UA 2RAVA 3BCSA 1DX6A 1AMUA 3WLMA 1B73A 3AINA 2K87A 3KX2A 4MS4A 1SHZA 2NLOA 3ZJUA 3QUAA 5AKYA 4TMTA 4AJOA 2M9MA 2RIRA 2ZPUA 1B15A 1SMKA 1AH2A 1YL5A 2FSUA 3PUKA 4OBWA 3IMFA 4B7AA 3GXBA 4G8CA 5IG2A 3OLXA 1T9BA 1K7CA 1U02A 4P35A 2TMKA 1KEPA 3BRWA 1KBZA 3MMXA 1KI2A 2ESRA 4QDKA 1T6NA 3GH1A 3IERA 4E32A 4QOIA 3BE6A 2J09A 1I7PA 2VATA 2YMPA 3JRXA 4M36A 3R8FA 5T41A 2M1ZA 3DAPA 1XJQA 1CY1A 3E8XA 1TLFA 2OFXA 1RBQA 1VI2A 1CF2O 1JXOA 2LDXA 3OIFA 1G8YA 5CXUA 4YY3B 1XZKA 4RCVA 5D3MA 5ES4B 1NG9A 3WKBA 5FBQB 2V97A 2VP3A 5G0SA 5BWOA 3JD0A 1UINA 3VPCA 2QMEA 3ICWA 4QUKA 2QYOA 5HXAA 1EK1A 2ZRKA 3PHJA 1RZUA 1GITA 1V8DA 2VXBA 2X8AA 3DYBA 4G3XA 2BELA 2IYFA 1PK9A 2OCYC 3BPSA 5THXA 3MWEA 4HC4A 2VHQA 3ZD8A 4FBLA 1L5MA 3CEJA 3SIPA 1XRMA 4U5QA 2O7NA 3PRJA 3DYIA 3OWHA 4A0RA 2ORIA 4D1YA 3EDQA 1AUQA 1TCBA 4QTTB 2P91A 5IYZA 4F2GA 4I50F 3C24A 4J1SA 1M6HA 1ZEMA 4LJ7A 5TF0A 3S1LA 1GVNB 1SUIA 2KE5A 3ET5A 3F6YA 2JLBA 3OZRA 1QQ5A 3ANYB 3CX6A 3I6YA 4UTVA 4ZIRB 4V1CA 1GDHA 1AA6A 4QC2A 1PDOA 4TT3A 1GU7A 5T4BA 2FH5B 4EKNB 2A14A 1NW7A 4AO6A 4IF4A 5TXGA 3C0KA 3W05A 4BQPA 4ARAA 2BBWA 2G76A 1Z38A 1RWXA 4NVRA 1OYWA 3H2YA 3KP1A 3R3WA 4FE4A 4I8DA 3GV0A 4OQLA 5J4VA 2BTEA 4OHXA 4PINA 1SU8A 2JW5A 1ZXBA 1IXSB 2HCJB 2QL7A 3T7CA 1J25A 2FWNA 4BMXA 2AF3C 4H08A 4HLQB 1J56A 3K6JA 3R3ZA 1I33A 4V0QA 1FLDA 2B99A 4CIVA 2IDKA 2JPDA 1DKPA 3TZKA 1RWVA 1U2ZA 1A9XB 1PG2A 3Q3VA 4KDRA 4Q82A 3WGJA 2G5TA 1KZHA 4ES6A 5KKCA 2IPNA 1UEJA 3UK0A 3WK4A 3RRMA 4CTOA 4YMUA 2FWRA 5JJBA 2WOJA 4MVJD 3SHWA 2IXGA 1KSJA 1E6MA 1S8OA 4PX2A 1WPGA 5AXAA 1KXJA 1KKLA 1MIOB 4LMBA 1JA1A 3IT2A 1ML4A 1O57A 5C32A 1XZHA 1RIIA 4PZLA 1X80B 1GTG1 3OESA 3IHLA 2G82A 4ZREA 2W6QA 1N6KA 4Q39A 3EQ2A 3THOA 3PNLA 3TSZA 1JUDA 2Q4DA 2DGDA 4K40A 3NIFB 3LHSA 4G41A 1WBBA 4GDFA 1AT1A 1N8SA 2I29A 5GIPE 1XCPA 2IZ7A 2QW1A 3K1TA 1I1NA 2MTBA 4LJAA 2V7QA 5E9AA 5BSTA 3RQIA 3T6KA 2CSXA 4LJLA 1ENYA 4B6OA 1SVNA 1KVUA 4TRJA 4M0FA 2XE7A 3GCXA 4J4HA 3TE6A 2A9KA 2Q9UA 2C95A 4G8DA 3O4RA 1IHDA 4I1SA 2OK7A 1TM5E 1YK0A 3DMDA 1G0NA 5A6VA 2OCDA 1X9HA 2FZVA 2D06A 3JVEA 3QMVA 3MRSA 4YHHB 1G4HA 2B2NA 4FJ0A 2QAGC 4AWBA 3DVRX 4LBWA 1A9XA 3RTEA 1FUKA 2LIVA 3M5WA 2G4CA 1LFDB 2NADA 2H2GA 5AHKA 1P0PA 4ZV4A 4G36A 3LPDA 5JY1A 1AUPA 3FPFA 3QKRB 1KZ4A 3WGVA 3STUA 3SLRA 1YBMA 2CT8A 1JLRA 1MW9X 1MJGM 4DBLE 1L7XA 1PQPA 1XK6A 2BMAA 2GYWA 2MSLA 1E2FA 1WDMA 2FW7A 4YJHA 4LOJA 5KNCD 1XVVA 3LVFO 5AT1A 3IL2A 3PPWA 1DEOA 5DTEA 2YBDA 2YYYA 1CQPA 2AUTA 2LGJA 3IP8A 4IHQA 1Z6YA 2QZJA 4XEUA 1A2QA 4QXRA 5B3JA 1XZPA 3D3KA 4LPKA 3UM9A 1X39A 2PGAA 4EPVA 4JLKA 4D6PA 2BGLA 3HB0A 4WTOA 2XJ4A 1PD1A 2HLNA 4PR0A 2O06A 4AY2A 1SU7A 4G9GA 1UPCA 3AKZA 3CRMA 2G36A 3FLAA 1KP2A 4G86A 2R79A 5J2TA 2J3HA 1IC6A 4DTIA 3DMYA 1MEJA 4DBZA 4OTZA 3FX2A 1ZKDA 3NR2A 5B1IA 3R74A 4CMIA 4ZOAA 4CM9A 3NHBA 1QLWA 1NN1A 4HNUA 3T41A 5BQXA 2YTZA 1C1HA 1N3LA 1U9JA 2HRQA 2WWWA 4QRHA 4X9XA 5A1JA 2RC5A 3TLGA 2II6A 1NRWA 3GLFE 3DP9A 4TLBA 4JR0A 3WRVA 1I3OA 4TLLB 1U7HA 3HO1A 3HKCB 1XA4A 3H9EO 3NYWA 1LVUA 3NNNA 3O7WA 3USCS 3K0CC 1BE0A 1D4AA 1P6UA 2G83A 4I46A 2B8EA 4REMA 3SG0A 1MO4A 5TVGA 5HUJA 1L8LA 1W93A 1P2VA 2Q5CA 1NLZA 5DNEA 1C1DB 4WJZA 1LNZA 5ICFA 2PSEA 1BS9A 1YB1A 4BLPA 2P6RA 1PDVA 3V2HA 2WUVA 1P1RA 2GXUA 4P81A 3F2VA 3I3OA 1Z33A 2IL1A 3AF4A 2O3TA 1NVAA 4GH5A 3W4IA 1YS4A 1NQWA 4WBSA 2NV6A 2P1RA 4DJJA 4H17A 4WX2B 4JH0A 4EPXA 3K8QA 1GKYA 3FMPB 5FBHA 4D5GA 2P90A 1TYDE 2WJ4A 3GRKA 1KEEA 3TTWA 4AJ4A 1QC5A 3KLNA 2CVFA 4U1RA 4ZAYA 1JSXA 1T3SA 1JVBA 2X8JA 1NVTA 3FNRA 5DHQA 4BIMA 4F4CA 4LFCB 5KYYA 4ZOEA 3RFXA 1GTMA 4PSVA 3CQ9A 4JHXA 4AS3A 4IR7A 2XRMA 2NIPA 1WB4A 2B1QA 5K0ZA 2X6QA 1JDBB 4HYTA 5KYXA 4CR7A 4J0JA 4MQBA 3HJBA 3WTBA 3F5FA 1Z26A 4Y0VA 1IOZA 4L07A 4LNUA 4O02B 5TQJA 5GONA 3E4CA 3IKVA 1VP3A 2FPLA 3L8MA 1KKMA 2AOWA 3ONNA 1J07A 2A0FA 4N76A 4BZQA 4YPFA 5JQGF 2F9MA 1GA1A 4HNQA 1F6DA 5GVRA 1ZUD1 2OXFA 3G5LA 5DI3B 1ZJWA 4JWTA 4CN8A 3KJQA 1SUFA 2GN9A 4EHBA 1GM5A 5AJZA 1FNCA 4DKXA 1JTVA 1JLHA 2I4RA 3KD3A 4JUCA 3A70A 5H9WA 1Q57A 3WMWA 5EZQA 3NUGA 3O4JA 4JP2A 2W98A 4IHJA 3HBFA 3T0IA 1JEYA 1C3JA 5FL3A 4IOJA 4MQEA 4G81A 1Z2PX 4F96A 3C45A 4BV2A 5A6SA 1R4MB 2KJQA 2ZYSA 4YAIA 2BN4A 3HYCA 4GGMX 4NXMB 4RZIA 5ULLA 4XDGA 1T5HX 3H4TA 3LC0A 4INJA 4DW8A 1XVTA 1HQCA 2QJOA 1ZNZA 3KLMX 1ONNA 3KB2A 3ANSA 2XUAA 4UMDA 1JHZA 2X15A 4XD7D 1D1TA 3ZR4B 3WLKX 1M1NB 3TI9A 5ELLA 4TT3D 1I4DD 3K0AB 2V9ZA 2J4FA 1UDRA 3HI4A 3WGLA 1U7PA 2FW0A 2GZ1A 2XDQB 3DT8A 1KARA 3EXHB 1K4MA 4J2TA 4R2MA 5L4LA 3HRIA 4PZDA 3PB3A 5LZ7A 2GT1A 1RLTA 2VYCA 1XCMA 1SHTX 4GLJA 3RH0A 4KTVE 4AXBA 2ZSDA 5CXSA 5J2UF 4BNDA 4PZAA 5A0FA 1LDGA 1S7CA 3Q3IA 4DDMA 5K0TA 4YPVA 4KQIA 4O4HA 4X85A 3CLTC 5JS2A 2BGWA 2PBRA 3N8GA 5JRDS 4B81A 1AVTA 2I2WA 3GJSA 2O48X 2W2PA 2DQYA 1CETA 3IR6A 4YJ3B 3AR4A 3ZCRA 3ZTWA 1KGDA 3U0VA 3KKKA 3W3AH 4AFNA 1MN6A 2C5AA 5IWAB 1LBQA 2ZK7A 1RIFA 3JX9A 3M89A 5FNZA 2RE8A 1G5PA 4P7GA 2GQ0A 3GL9A 1AC5A 3Q1KA 2QMYA 2EL9A 4IXNA 2EV9A 4MVJE 3A11A 3KE9A 2DHRA 3I1FA 3Q9LA 3WMGA 3FMIA 2Y9MB 3NWBA 1VJTA 2VH2A 5JY6A 2O2GA 5JVDA 1DTWB 3KPUA 4AUNA 4EF4A 4CETA 1RQ2A 4G26A 3WQRA 2XZOA 1U0NA 4RH3A 1IJKA 3O4GA 1P7CA 2P79A 4OQPA 2V7WA 4HEHA 2CMFA 3K9HA 3LY7A 2XUDA 2FDCA 3U6BA 3OPYA 2O2HA 1L7AA 1PWZA 4P4TA 5AVXA 1HORA 1ONOA 4JEIA 4YRGA 2AR7A 4ZPJA 2QE7A 5KNLA 5EMJA 3G17A 4XFJA 5IAEA 1A50B 3QEAZ 5F3WB 2EJCA 1RMQA 2VQDA 3K0FB 1QYXA 4JJAA 4JLDA 1I80A 4XX0B 2HWXA 5AKIA 3RS2A 4M8LA 3L6EA 4E5MA 2MSDB 3N8HA 3D0RA 3QI2A 2NT3A 3OE7D 3R0XA 3KVYA 4ZARA 2F7SA 1GTZA 2A78A 4I3GA 2EG9A 4KR3A 2M98A 3HN6A 2FB9A 7REQA 2GETA 5IEJA 1Y8QA 2F1HA 2Z95A 1I2BA 3PTLA 4TTQA 4AJ1A 3D1LA 1Z4QA 4EHIA 2ZKIA 2Q3HA 3V1UA 2DPLA 1X7DA 1LXCA 1R6DA 3CR3C 3TW0A 1AD2A 3OIWA 4PPFA 4ZZ3A 4UHJA 1Q16A 2HA2A 4DHEA 3VNVA 2D1YA 2P9GA 3B12A 3C48A 4DNOA 1X15A 2O5EA 1M3SA 1B42A 1RWPA 3E18A 4Z9BA 2PGIA 1PEKE 1UDBA 3GIDA 1ZCFA 4N8DA 5KYVA 1Q12A 2OBNA 3T3MB 2DHQA 1JA0A 1SR8A 3L4SO 4KVZA 5AUPB 5KO2A 3OM9A 1Q21A 1PG0A 3NIWA 2EGHA 4IICA 3AVWA 4EPYA 2OV8A 2XRFA 4U4AA 1FMFA 3UMGA 4F2DA 1DKLA 2HA0A 2VPTA 4MV3A 5DHFA 4RAOA 1HMPA 1CUYA 1F38A 2GYVA 3AIIA 3SMVA 4LSGA 2I4MA 4O3FA 1E6CA 4HLCA 4WKPA 1QPGA 5DCUA 2Y3IA 4ALNA 4URWR 2QMZA 2BW0A 1BFDA 1CP3A 3LVQE 5E6SA 4EUSA 2DHDA 3BMQB 4I4IA 3BD6A 4YYEA 3ZX5A 2AG1A 1TM4E 2P4UA 2NZWA 4K6HA 2OUIA 4XWGA 1DOHA 2FZWA 3T35A 1PYOA 3PSAA 1DARA 5KYUB 1EJBA 3IIIA 3DR5A 4OHMA 2C9MA 2DBQA 1O0SA 4CJXA 2XVXA 5T6BA 4HB3A 1ZG3A 2RARA 3WL5A 4HPXB 4NP6A 3U49A 3HWWA 1E8MA 1BYIA 2CNWA 3ESRA 3QNUA 1XT6A 2FP3A 5KQGA 4KN6A 3H3XA 2Y92A 1CSEE 3A9TA 3D4BA 1NU6A 4J0GA 2BBSA 5KSZA 6ADHA 3PUZA 2ZYVX 5EUMA 3LT1A 2R8XA 4FZ3A 4M3NA 4RPHA 3BJEA 3FUUA 4BIIA 4P98A 1E3TA 2R1ZA 3HXLA 1QZTA 3GCDA 2FUEA 3QVMA 1NJ5A 1NR7A 2AXEA 3EIUA 1J0DA 4JA0A 5E3IA 3SC2A 5BUSA 2JI9A 5FCDA 2GPAA 2WU4A 3NS7A 1J39A 1C8KA 1XSEA 2HTEA 2O2SA 4WKOA 3CO0S 5K0NA 5DRTA 4GMGA 3TRHA 5EP3A 2A5LA 2POCA 3BWBA 4GVPA 4NBNA 1YJBA 3B7PA 2BAGA 5T5QA 5KHAA 1IOWA 4EG6A 3L07A 3PKIA 2Y1XA 1HDYA 4GZ5A 4GOKA 3T7RA 1A04A 3WLRA 4C9BA 3ABOB 3L9WA 1KIMA 2BUAA 3Q5GA 4A27A 2PRYA 4HS9A 4AP5A 3IPYA 4FFRA 5G41A 2BI4A 5L3SA 3E8MA 3LOUA 4OHKA 3IEXA 5DM70 5JSQA 2FA9A 1E5QA 2N0SA 3C6XA 3EZYA 3HUTA 3KKMA 4LX0A 4QJ4A 2ES4A 3DOHA 4EIWA 3KQMA 3RS8A 1QIDA 5H3HA 3KOWA 2EFDB 3KKEA 3CX4A 4BAGA 2XVZA 2AYXA 1N8TA 2C07A 3DHVA 2VYNA 4Z6KA 3ZEAA 1JBKA 1ECJA 1K3TA 3UAYA 3VHRA 4N39A 1O0BA 3SZGA 1DQZA 1ZCZA 1KRXA 3KKNA 2BKVA 1W0KA 5CXXA 3SHTA 4IHJF 4UD6A 4XR9A 4EJ0A 4EVRA 1E7SA 3Q8XB 3ZBPA 5KQRA 4BNXA 4BFUA 4HNTA 1KYXA 2LIPA 1FBNA 5BPFA 1IBKB 1NE2A 1XPUA 5FBWB 5DIFA 2QNRA 4R5MA 5ILQA 3OHPA 1V16A 3LK6A 5JAHA 2B83A 3A9WA 2XEDA 3KCQA 4N4AA 3ZJYA 3HBMA 3TNLA 4EW6A 2ETXA 1KEWA 4OXRA 4M0LA 3T52A 4BLWA 4TSFA 3TQQA 3NDIA 4RTNA 2FSHA 4PWZA 4TS1A 1KOGA 1LK7A 4HG2A 4MVJF 4QO8A 4WERA 3PC4A 1OVMA 4AECA 3BMQA 2CMHA 5CDYA 2Q6OA 3HCBA 4RLFA 1RKXA 1VBMA 4E2XA 2NVUA 2VJKA 5IJ9A 4U6NA 3SSAA 5CAEA 4JV5B 1EWVA 1QBKC 3DBRB 3U7GA 2UYQA 1U2QA 3PF9A 4BJ5A 1J5XA 1E1CA 1PCXA 1RTTA 1YJQA 2XNHA 2Z9CA 4PAGA 2WTMA 3FZEA 3GY0A 2NTNA 5AHOA 3ZVRA 4CEHB 5A4IS 1QV9A 3KZXA 1JMKC 3HFJA 3KYDB 2BFEB 4QOSA 5EFZA 4JELA 3L1VA 1LY1A 1NQAO 3CTMA 2WEKA 3QU2A 4MWZA 4XYBA 5F3DA 5K3SA 2IDMA 2EOAA 2H2HA 4DLPA 1BQEA 1G7TA 3F7TA 1B2LA 3M4NA 4ZU6X 2Y1GA 3COWA 3C1OA 5K3EA 4DA4A 4PSDA 4X6LA 5EY5B 3GJ8A 4BPRA 3ZY3A 4OOEA 2R8PA 4XVQA 4TVBA 4Y2SA 5C46F 3W2TA 1R12A 1WXDA 3B6EA 3SIXA 1LSJA 3PQ6A 1IJBA 4LOAA 3ROPA 1FS4A 3H0CA 3QITA 1ZMBA 2FPGB 3ZS8A 1QHXA 2F2TA 2ZIVB 3AJEA 4LQDA 1SKAA 2OC4A 2E1RA 2KHZA 4MV0A 1R0KA 2IHJA 1NQVA 2Y66A 1IM5A 2J3MA 3G85A 1UOEA 1PJAA 3WSWA 1SZCA 2JIQA 1HDZA 4XDZA 5BVHB 1V1MB 2WJWA 2P7HA 3OMXA 3L7JA 1T1IA 5DM1A 2GF0A 4AZVA 2ID7A 5KKNB 3GAAA 1JAYA 1WNFA 2C2HA 2XQFA 4BJ3A 1YH3A 3SFTA 3ZS9A 4R9NA 2AFHA 4BO6A 2DUJA 2JIDA 1LEHA 2P4QA 2QZ9A 5SZHB 2NO9A 2AK3A 3F8WA 5IM5A 5JALA 3OI7A 3DW3X 3RJ5A 4C29A 1G8JA 3FVWA 3HU5A 4G0VA 4PO8A 4AX8A 3U44B 4DCVA 3WHKA 4RL6A 1V5IA 4E5YA 4CQJA 1YE3A 1DTWA 2HJGA 2IYXA 2CFCA 2QXYA 3G9XA 2VZ9A 4GM0A 4R8KA 1TJPB 5AKEA 4QATA 5E0OA 3ZU2A 1THZA 2PD3A 4K9SA 3A6KA 3K31A 5FUVA 3WK8A 5BORA 4YO8A 5F9FA 4EVIA 1S8AA 3L06A 1OY1A 1EXWA 2V7QD 3OJXA 4RVHA 2UZ1A 4GGOA 1PBTA 3EC2A 3QXXA 4N7RA 1KY3A 4OHBA 4ZRDA 2J9ZB 2NUPA 4G0MA 4UM8B 2NZJA 4EKGA 2WIJA 1UODA 1WZEA 4IDGA 1V5WA 1E98A 1ENPA 4KITB 4MB2A 2Y2UA 3CVVA 3RKSA 1FYDA 3GFVA 1R8YA 4OBBA 4LJRA 3KQUA 4EUHA 2KLBA 4PO9A 4TLEA 2PQ0A 2DLDA 1E9CA 3GK3A 3SXUA 3LA8A 3VV3A 4JVOA 1EFCA 3UT6A 4KQKA 1W19A 3PLNA 4X94A 3SHFA 3W5JA 3E7PA 4E11A 2F55A 3FA2A 1PX0A 1IN6A 1O9HA 2QVYX 3A3NA 2JD1A 3WK9A 4HV4A 1VSUA 4UNRA 5HZGA 4RABA 3R4CA 4URUR 1F5NA 1AUVA 1J7JA 4HDSB 1RI3A 2GKOA 3L7LA 2DUWA 2D4AA 4GOXA 1OA0A 3UTCA 3PVZA 4MI6A 4B8WA 4ZKDA 4Q4AB 2HIAA 4GBMA 3SDSA 3DW1X 1JE0A 1JKIA 4MV9A 1XNGA 1HE8B 3FW1A 3BXOA 5CH5A 1YDWA 1WVGA 1FUUA 4JLWA 2DJIA 1Q5PA 5CRIA 3EFOB 4L08A 3VM6A 3LPMA 1KFBB 1RC1A 3DDNA 3E5HA 4I4TF 4A10A 3D8RA 2YWDA 3FYUB 4XQCA 5DI3A 4AD8A 5CW1A 4UVEA 3AF0A 4FKBA 4FEYA 3G5AA 4G89A 4PYNA 1NXXA 2OKCA 1V2GA 2JFPA 4W5RA 1LZLA 1O94A 1OX4A 1OBCA 3BJZA 2FGJA 2NO7A 1YSCA 3F6BX 3I01A 3W4KA 2WAMA 4GMKA 2ZB2A 4UTPA 4D80A 4F04A 3GLIB 1BW9A 4YI3A 4R3UC 2FEAA 1KI8A 4X0EA 3ZZ1A 2ZI5A 1KHTA 3ZOKA 1MC4A 1YQQA 3ETLA 1JQBA 1AV6A 1RWOA 1CZNA 1RABA 1GPMA 1SUEA 1T0PA 1U2PA 1YBHA 2BM9A 2N9UA 2O0MA 2QMUA 5LA6A 3VNQA 5KTKA 4M1MA 1W1UA 1Q84A 4NEQA 4X95A 2F43A 3PVCA 5EQTA 1NW6A 3DTYA 4P38A 1SWVA 2YY5A 3K8YA 1WV1A 4I50B 3JZDA 3MS7A 4Q3DA 2NYUA 4W1SA 4JVNA 4ER6A 4OGGA 1HE4A 2DWCA 4FW8A 3TO5A 2OORA 5BV0A 5AVWA 1Y7IA 4X1OA 1V47A 5I9NA 4GX0A 3C98A 4X92A 1Q6YA 4XQEA 4IIUA 1X7YA 3GWGA 3ONDA 3P0JA 5J2TF 2DQZA 2HHJA 3TBKA 3CZ9A 2UZ1B 3EDRA 1J1UA 4MS3B 1XZDA 1YZTA 1Z37A 3D8SA 1DNPA 2ZUWA 3F74A 4IV5A 4QBIA 3RSGA 3LXMA 4AZ0B 1EQ2A 4B6FA 5LR6A 5CB4B 2OA0A 4BE4A 1Z7EA 1WNTA 5JSFA 4ZRNA 1T5DX 3VAYA 4U9UA 4CEIA 3OPNA 4OXQA 5H83A 2TMDA 4H59A 1PGJA 4PNPA 3QVXA 4LAFA 5FOSA 2ZT6A 4XGIA 2YWCA 1SQ6A 1ZX1A 1JQEA 3EEFA 3DEIA 2ZEJA 1O4WA 4QELA 5FULA 3OX1A 5G3ZA 3TNJA 2FNAA 4G0NA 1EK6A 1Z5GA 2MR6A 4G1FA 3RRZA 4E5UA 3DLHA 2VHTA 3TOSA 4XQGA 2UXBB 2NP6A 5LYJA 3GJ6A 1K75A 1ZM7A 1C8VB 4ZT3A 1A8UA 2BH2A 1Q1EA 4A73A 1FFGA 1G55A 3MFQA 5E3JA 1HDEA 2A0XA 5FUXA 1SIUA 1GGKA 1OLSB 3F4BA 5HKAA 4FFLA 1DJLA 1I36A 5IAAA 2BMDA 1MJHA 1YI1A 2P77A 3QU5A 1FTQA 4LY0A 5AKZA 4WASA 4LYEA 1T5SA 3LDHA 4N6GA 4L5IA 1IIBA 1WXGA 3SLGA 5JCOC 3O3MB 4GVXA 1RQPA 5EP1A 1WCV1 4BGDA 3KZOA 3B3FA 3FNBA 2F00A 2CXSA 2EG5A 5DYNA 5KWVA 3P9PA 4WSOA 4G84A 1NJ8A 1VL6A 2AN5A 2BPOA 3MWYW 4MEJA 1IEWA 3EMVA 3L8CA 3RU9A 1OE0A 4RZQA 1GNTA 4JA2A 4M83A 4UARA 3LW8A 5GTDA 3M6VA 3PE6A 4HVTA 5FORA 1ESEA 2C8VA 5ESRA 1V37A 3S5JA 3I12A 4D9GA 2W4QA 2HWYA 3DVQX 3T3EA 3LKBA 3JYNA 5KTMA 4Q1DA 3AOEA 4TKLA 2JBAA 3GLGE 4A2WA 4CHGA 5EMKA 4PBRA 2F3QA 2RHWA 3FKJA 3FVTA 4N9WA 1VYVA 3H2JA 1UEXC 2J5BA 2CJXA 3JRNA 3KKLA 4XIJA 2SKEA 4XOIA 5LMUB 1HLFA 1ULAA 1KVTA 1XA0A 2OCPA 4IL5A 2GM9A 2B36A 3D6VA 1GG8A 1S2IA 3EK2A 3HDJA 4NYIR 4XCVA 2VQFB 1X6VA 1O8CA 1JBEA 3JZAA 3WJ1A 4OX9Y 2H1RA 3E7WA 2NVUB 1RXYA 2A5FA 5IJ9B 2C7QA 1JIJA 3BWDD 3O21A 2R6AA 4KCGA 3UW1A 2HSDA 4DV1B 3WO0A 1MA3A 1XHLA 3PENA 2YIMA 2L69A 2VEDA 4X6UA 2Q3LA 1HYQA 2R2GA 1H9AA 3ZDRA 3QZUA 5JEEA 4QNMA 4WXRA 4IRMA 3LT0A 4YCDA 4AICA 1AUXA 1E2MA 3EH1A 4ZJZA 4KFRA 1JHOA 5L53A 4YJ2A 4KI0A 3VNRA 2E37A 3V8VA 4LZAA 5LBIA 2ZI9A 2UXCB 5EP2A 1YDHA 5LP6C 3EVNA 2NVOA 1CIJA 2G0AA 4L57A 3WBBA 2Z0MA 4AJIA 1A9TA 3D2CA 4R7GA 4ZVPA 1ZY2A 4KREA 1FU8A 2C7OA 1YKSA 1I2AA 2JANA 4J07A 4QA9A 4TMVA 3QOXA 3EC1A 3CZ5A 5GJCA 2NP7A 3ADOA 1OLSA 2O50A 4R81A 2BLLA 2B7BA 3EN0A 4LF5B 5EIAA 3RUHA 1FYVA 1US8B 1CUFA 3H4VA 4OHWA 4QQ8A 3H86A 4D3DA 4UEWA 2A7XA 2NV2B 1I32A 1TK2A 4NYMQ 3B6IA 2V5UA 2AK2A 4OY3A 1E0DA 1Z2DA 2LWIA 4QQNA 3GUYA 4RM2A 1A3CA 5DNUA 2QAJA 1Z6QA 1K2VN 2ATXA 2BGNA 3ETCA 1T6ZA 3Q88A 3BRSA 4YWJA 2BSAA 4FOSA 1FFHA 2R65A 3OKPA 3Q3GE 4HXFB 1QHYA 5A3VA 3TW6A 5JWHA 4AX4A 3FHTA 5ALIA 1JL3A 2ZWAA 3D9QX 1T2CA 3E5NA 4EAAA 4DR1B 1W5FA 2V9CA 1KDVA 4TYMA 2QD2A 3OX2A 3WLFA 1FVXA 4V03A 1U31A 1J8FA 3ORHA 2PK3A 4NZYA 1ISJA 1O1YA 1OZGA 3LBHA 3N2LA 3NWEA 2GK7A 2AN1A 4TUYF 1N8KA 1D6MA 4C0WA 2HJRA 2JBHA 2Q2QA 4BY9E 3OEED 3I34X 5ES3A 2EL7A 3GRFA 3SBXA 4E5VA 2A67A 4K1LA 4FEGA 4HXGA 3FUCA 2FFBA 5JU6A 5T4EA 4D3FA 3HJHA 4BMDA 5U1PA 3D7MA 1W0JA 1YDFA 1N0UA 2PFSA 2SBTA 2VDWA 3HUDA 4KC0A 3RTBA 3KYJB 4B6PA 5FWDA 2PVCA 3MLEA 1GPDG 2ZJ3A 3KG2A 2YS6A 1R8SA 5ENZA 1YXMA 2VOJA 1K3UB 3ANNA 3WLNA 4CN9A 1U7UA 4FSXA 1CVRA 4CLOA 5F4BA 2OT3B 3F7MA 7MDHA 7ABPA 1KEKA 4OB8A 5ALDA 3WRXA 5DWQA 4KRYA <