2IXEA

Crystal structure of the atpase domain of tap1 with atp (d645n mutant)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
b'GSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixeA01
2ZRFA 1CEEA 1N5LA 5FR1A 4LV5B 2VP4A 4Q18A 1WXQA 2FPMA 4EKDA 3T5DA 2BEKA 4URXR 4HUTA 2BEJA 1GFIA 3PG5A 4LC1A 4XWKA 3V4RA 1TQ2A 2DFNA 1OXUA 2ASEA 3V00A 2IEYA 1RE0A 2FZ4A 2GTPA 1RJ9A 1E99A 2IS4A 4H1UA 3ICEA 4GSYA 4ZKEA 2FV8A 4X8OA 2CHGA 4LYJA 4DRZA 2V55B 2O8EA 1RJ9B 1G6OA 1GNPA 2BMEA 2P3SA 1CJTC 2TMKA 3GLFA 3GMTA 4EJSA 4TYQA 1ZNYA 4NZYA 2K5UA 3B1XA 4B6FA 2ZXUA 4AK9A 3CF2A 1NSTA 2I3BA 4A4DA 4P3YA 3W6OA 4EJSB 1SXJD 1AKEA 1FP6A 1UKEA 3PENA 4LHVA 5EXXA 4B74A 3EG5A 1KDRA 4AKIA 3C8UA 2GESA 2XTZA 1A82A 4LHWA 1G17A 5E7JA 1W4BA 2ZYWX 4C0JA 1DE0A 2FMXA 4D0LB 1CRPA 4C0AC 4FXPA 1LFDB 3P32A 3RS0A 2YOHA 3AVTA 4TYYA 4JBWA 5AJXA 2WMOB 2JEOA 1E0AA 1NBMA 5DIFA 2IS2A 1R5OA 2NO1A 1GNQA 1M7BA 3WYFA 4IDQA 2F43A 1IXSB 1DELA 2BCJQ 4MGZR 1LB1B 1LTQA 1NJGA 2ZRIA 3AP1A 4PQFA 4PZYA 4C0BA 2F55A 2BBSA 3RLFA 1E2IA 1W36B 1UBEA 5FUWA 3OHMA 3RC8A 4HYYA 2ZI3A 1GL6A 2G0NA 2P5TB 1A2KC 1NKSA 1NJFA 1E1QD 1GVNB 4G5QA 3SJAA 1AS2A 4HI0E 4KLNA 1W47A 2OCBA 2QN6A 4O2LA 3E2IA 2ODWA 3EC2A 1I4TD 2J46A 2CCJA 2IXGA 4D26A 5FOUA 2CBZA 4Q7JB 2ZIAA 1EK0A 2IYWA 2YNMA 3RNLA 3VR5A 5HE8A 4J0QA 3KQKA 3AP2A 3NWJA 4Q4LA 5BXQC 4QGAA 4FI3C 2FEMA 5GJBA 1D9XA 2W0MA 3LQQA 3U7FB 2D7DA 2OESA 2KBEA 3C5CA 3GEIA 5JWRA 4RFSA 1NN5A 1UDXA 3SBEA 1XXHA 1N6LA 2QMEA 2DB3A 5F98A 5F9FA 3GJXC 1UPTA 5KOYA 4UNQA 4UNPA 3T12A 2BMDA 3HU1A 2J0VA 4D4LA 4RFSB 1O87A 4MGKR 1P9RA 2JLUA 5JEEA 4PO8A 4M1WA 1HTWA 1KGDA 3FE2A 4C2TA 3F3YA 2ZRBA 3VX4A 3LBIA 3U44A 3GP8A 2A5FA 2H5EA 2VBCA 4DXAA 4EFMA 4XSGA 4DSNA 1YZKA 2QQEA 4MKGA 5B58C 4QRHA 1XF9A 4XTRA 3GFTA 4C0SA 1ZMXA 2V54A 3KQHA 4V0NA 3U44B 3EARA 3C16C 2JDIA 3U60B 2I4IA 2YWEA 2GCOA 3P26A 1Z29A 2ODNA 1OJLA 2ZSAA 1KO7A 1OXXK 3CH4B 2IBMA 2WJGA 3T06B 5L3SA 2GCNA 1NVXQ 2QQ0A 3CPEA 2GXAA 4NCNA 2C95A 2ZJZA 2GCOB 4B3BA 1GKUB 1WCV1 2HF9A 3LVQE 4KFUA 1N6OA 3HU3A 4LRWA 4PSAA 4MDEA 3DOEA 3I8SA 5CJPA 4UJ5A 5L3SB 4TMVA 1SXJC 1OIXA 2D2FA 1JEEA 1R0YA 2QTVB 5CDFE 4BUJA 3QPUA 4DSOA 2D74A 1VG9B 1NLFA 1TPZA 3IEUA 1P7CA 3K0CC 4QHSA 4DIEA 4BLRA 3HR8A 1N0WA 1I2MA 1E2LA 2ZRPA 1N6IA 4QBFA 5GADl 4IDHA 4IRUB 3LXRA 4JL5A 3EPLA 3CPJB 1XCMA 3THOA 4TMXA 1NG1A 2IX3A 2FJUA 1NMYA 121PA 4Q01A 5L8VA 1VCMA 4TZ6A 1N6KA 3X1WA 2NQ2C 1ZM3A 2QBYB 4GMDA 1E0KA 3LLMA 3K53A 1IAQA 3DEFA 2QMUA 3ND8A 4Q47A 3EZ6A 3EA0A 4XWOA 1Y3AA 2HXSA 3R20A 3I1FA 2FFHA 4B76A 2GJ8A 1RPZA 3FTQA 3Q3JB 1YJ5A 1GOTA 2UKDA 5GVRA 3TUJC 1C4OA 1FL9A 4LYFA 4DSUA 4D0NA 2PZFA 4PC2A 2FNAA 3U6BA 3LXXA 4RZ2A 2E1RA 4US1R 1DTSA 1E2NA 1YR7A 2FG5A 5E7IA 2RMKA 1RKBA 2PX0A 4FMBB 2F1HA 4JLKA 3C14C 3TH5A 1W44A 2IF2A 4Q66C 1DVRA 2EFHB 2NO7A 5AK0A 1GWNA 1T3LA 2GEDA 4PAOA 3BD9A 5DE3A 1GL9B 1Q12A 5GVSA 1U8AA 2BMJA 4DHEA 1J2JA 5LPNA 3MMPA 3CF0A 2XJ9A 3KX2A 1T5IA 3D7MA 2C98A 5JI2E 1G3RA 2C03A 1QHHA 2C8VA 3MAAC 3TKLA 1K6MA 2IT1A 5FBVB 2J0QA 3RYTC 4OK5A 5BYKA 1E9BA 1CJMA 3KKOA 3NH6A 2GXQA 2IWHA 1QHHB 3K70B 4ACAA 2Q3FA 3S1AA 4NYJR 2IF0A 3NKVA 3E5HA 4X8LA 1EXMA 1U98A 3QE0A 5AUPB 1E4VA 4FMDB 1KNQA 4XOIA 1GUAA 2BJWA 2VYFA 1CJKC 5CLQA 2YINC 1EX7A 3S1AB 4TMTA 2ZR0A 5FOSA 1U2RA 2OAP1 1JQJC 1KSGA 2ZRNA 1R0XA 4CDGA 1J70A 4NE2A 5EZ5A 2YYZA 3SC3A 1XTRA 3KKQA 2ZRDA 4IXNA 4Q19A 4PANA 5EXTA 2ERXA 1NVVR 4M1YA 3FVQA 2IEZA 4JJKA 4TYPA 2UZIR 3T1TA 1S1CA 5CM9C 2AD1A 3FB4A 3X1ZA 1P9NA 2R6CA 4Q1FA 2W6ID 2ZJYA 5P21A 3WP1B 2IYUA 5CB6A 1XBTA 1G5PA 3HWSA 2ATXA 1NNEA 2R6AA 1Q1BA 5KSZA 2OBMA 1XP8A 3WRYC 1T6NA 2BIFA 4LJ9A 3ZVLA 2DWQA 3CX8A 2YHSA 3AKCA 3MWKA 1D2NA 3PV0A 5HKKA 1UKYA 2GCPA 1F2TA 4PHTA 1W5SA 5K8UA 2F6RA 1U8YA 4LBYA 4XD7D 2AKAB 5KYKA 3VTKA 2XB4A 3PEVA 5DHAA 2GBLA 3DM9B 4KFRA 4EJSC 1BH2A 3LX5A 4HATA 1F2TB 3FKSD 1OKKA 1P2VA 4G5OA 4CIDA 1U8ZA 2FFQA 4OQLA 1GL7A 2G6BA 4OQFA 3DPUA 1N6HA 1F60A 1X8JA 1HEIA 4P4UA 1ODFA 3TNFA 4EPWA 4D2IA 2W83A 2JA1A 4JLOA 4B3XA 4KSBA 4RKFA 1UKZA 3PR1A 3Q7PA 3H4MA 4RVCA 3BIFA 4O2RA 4A1FA 2BKEA 1OT3A 4ESVA 2ZROA 3MUFA 3VKGA 2WMNB 2VP9A 2NGRA 2ZJAA 1BO6A 3BRWD 4FCWA 5SZKB 4DBLC 1UBGA 1OE0A 4IEIA 4TQAA 3ASZA 1NVUQ 1Q20A 1G7CA 3QXCA 4LJ6A 4NH0A 5DO9A 1FW6A 5JFGA 2LKDA 3QI2A 2EWWA 2G88A 3B60A 3KJGA 2WKRA 3LAWA 1ZC4A 2WAXA 3LLUA 1MOZA 4GI7A 1ESMA 4AG5A 3HR7A 3EASA 3SI7A 2WBLC 1XEFA 2ZEJA 5IK2D 4MRSA 3KKNA 3PUYA 1A5TA 1W5TA 1E2KA 1VG1A 3QKUA 4ZDIA 2J3EA 1YVDA 2B7BA 3B2EA 4TLEA 2Z5FA 3GEEA 5EZ6B 1Z63A 2MSCB 2Q0HA 1EG7A 4L5BA 2O0JA 4DZZA 1T3HA 3H84A 5J4YA 4B71A 1E3MA 2IYLD 2AR7A 3PEWA 5EP1A 4QM6A 1XEWY 1QBKC 1MRSA 1QHIA 1XMJA 4HAYA 3KXLA 3QY0A 2ZU0C 2GHIA 4LHZA 2ZRGA 3SHWA 1E1RD 3UMSA 2JLZA 1ZU4A 4LHXA 1NP6A 3EZ7A 1NIJA 2QAGA 2QU8A 3T15A 5F3WB 1YKSA 3K70D 1RW4A 2DFTA 4L8GA 4NKRA 3BB1A 2P0EA 3MJHA 2QAGB 1Z0AA 2JIZD 3AF0A 3FFAA 3RS3A 2H18A 2JLWA 3W6PA 5H70A 4HLDA 2BCGY 5CDFA 4DLTA 4OI0A 2WWIA 4NYMQ 1YRBA 4KJZA 2IL1A 5JJLA 1KY2A 2P65A 4OHWA 4A2QA 4WA7A 4L4UA 1JJ7A 3VR2A 1XZQA 4G1UC 3X2SA 4AKEA 1TMKA 4M21A 4JLJA 4AWXA 1ZCBA 2QM7A 1U90A 1SVSA 3IO3A 3SEAA 1X8KA 2EVWX 1KNXA 4JSYA 4HSEA 4B2PA 2VP5A 1T5LA 1P62B 1KK2A 1V43A 3C41J 2X19A 5K8IA 4C7OA 3EWSA 3P20A 4C9BA 5EP3A 2WKPA 2HEIA 1P2SA 4MUAA 4YXWD 4C7OB 4P32A 5B30A 3T1QA 1F2UA 4N0DA 1HURA 1E0SA 1ZW6A 3NDBB 1S8FA 5ANRB 5H8WA 4A8JA 1G5RA 2DFKB 3EC1A 4RY2A 1U9IC 2HCJB 3CX6A 4US2R 1OH5A 1F2UB 2XOKD 4GNKA 4KFSA 5DLQC 4Q9JA 5EUMA 3X1XA 2ORIA 2Z83A 3AF3A 2FF7A 1GKIA 5FPKA 4A8JB 1XEWX 2QORA 4OQMA 4LHYA 4RKEA 2PCLA 3RRZA 4YMVA 1CP2A 5JWHA 4BRWA 3QOFA 1JXMA 4DSTA 4IOKA 3AVPA 1OB5A 5JEDA 1FUKA 3PEYA 1CBUA 3REGA 2F9LA 1EFRD 2F1IA 2VHQA 5JECA 2BBOA 1ZUNB 4IDNA 3MSXA 3NHBA 5CIQA 3X1YA 4CEHA 3GQBA 4JLNA 3I92A 1OPXA 1E79A 1VYUA 1D5CA 3ETLA 3AKYA 3NEJA 2IK8A 3BFKA 1FTSA 4KHZA 1SULA 3QPWA 4YONB 1SGWA 3HPRA 4CEHB 3RC3A 3SOPA 1TNDA 2ATVA 1R10A 1TADA 1QRAA 2FH5B 1Z6YA 3B85A 3CM0A 5KPDA 1FNNA 1YQTA 5KDLA 5KDOA 2RGAA 3ZIAD 4OI4A 2ZAOA 1P4SA 2WHXA 3OIYA 5SZHB 1HE1C 1E69A 3BE4A 4TT3A 1N5IA 2OCYC 2X1VA 1N0UA 1WP9A 2XNDA 4K46A 4DCVA 4UXJA 2FE4A 1OHHA 1JECA 3BB3A 1X1SA 2JLXA 3GD7A 4QNMA 2JJ2D 5EE5B 2QEQA 5EJEA 4O3MA 5JWOA 4X8MA 2HLDD 4RJLA 4Y0AA 1N25A 5LD2B 4TLCA 1OW3B 3MWJA 4M9QA 3K70C 5KHOC 3O8RA 2V1XA 1WQ1R 1VDZA 4IFEA 3LW7A 1NMXA 5EQTA 2BDTA 3BS4A 1XFAA 3ZZUA 2X77A 1CU1A 4KI0A 2BV3A 4DKXA 3BERA 4TL7A 3WNCA 2YKGA 1M6NA 4PHFA 2BJVA 3M4YA 3W90A 4A2PA 2Z0MA 4B3DA 1ZIPA 1Z83A 1EX6A 2G83A 1Z0JA 5JS7A 2PH1A 3SJCA 1Q1QA 3LBHA 4R2IA 4RSGA 1JR3A 4V0OA 4E22A 4CW7A 1ZM9A 2WPDA 3GJ5A 4HB2A 4PAQA 1U94A 1LF0A 5H1YA 2Q21A 1C9KA 5LB2A 3BK7A 2ZRHA 3Q72A 4XVQA 1FFHA 1R8QA 2FGKA 2GEVA 3IPYA 1P72A 2WICA 3IILA 4KU4A 3MLEA 4NP6A 1SKYB 1P75A 5CYPA 3UIEA 1P6XA 4ITRC 1RIFA 1HUQA 4OHZA 5AWFC 4TL8A 1LY1A 4JVNA 3SJBA 3CF6R 4AYTA 4UKDA 3CWQA 1HA3A 4TTRA 2QUZA 3NHAA 5B2ZA 3NBYC 3H1TA 4YQFA 3NTUA 4IOJA 1UEJA 3ECCA 2A78A 2HT6A 3DZDA 3LNCA 3QVVA 1UADA 1VHTA 3NVAA 2C78A 2GBLC 2OZEA 3WYGA 1IY1A 1G8FA 1YR9A 3RRMA 4LUCA 1IXZA 3GFOA 2HYIC 4GL2A 4Q7LA 1OFIA 3DO6A 2ZU6A 1FZQA 2W2TA 4Q9HA 2ZE6A 2VP2A 4R71A 3R8FA 5KPJA 3IIMA 2IYSA 2ZJ5A 5AJZA 1ZM2A 3V4FA 1XDBA 1Z47A 3L8ZA 1LS1A 3CUEF 2HYDA 2OXRA 2QENA 5JCZA 1CKEA 1TX4B 4B32A 4EPRA 2C9OA 3Q85A 2JASA 1W0KA 4BFZA 5HR5A 3Q5EA 3B82A 5EP2A 4HZIA 1JPJA 1ZD8A 1MKYA 5JBQA 1UBCA 1G16A 5AR1A 5CK5A 3ZDQA 2B7CA 5LB4A 2G3YA 1HT2E 4F4CA 1KTVA 3TAUA 1OF1A 1CF4A 2OAQ1 1H65A 2I1QA 1DG3A 2GVDC 2WOJA 4KO8A 4MYUA 4NYIR 5HCIA 2QL6A 1CR4A 2CK3D 1VIYA 2OBLA 3U3MA 4PZZA 4I99A 2ZUBA 5BWMA 4HAVA 1FX0A 4BE7B 4NCKA 2W2XA 4JLDA 1IY2A 3KL4A 1WBBA 5TY0A 1IN7A 4IFBA 4B6EA 3MG9A 2WV9A 1M74A 1FX0B 1VCIA 2JCSA 2PBRA 4V0LA 3N2EA 3P27A 3CRVA 2H57A 1IXRC 3CZPA 4XH9B 4QNRA 2VSXA 2REBA 3OE7A 3OEHD 3MGCA 5J4VA 1RVDA 4GP6A 3RDPA 5B64A 3HYRA 4DEYA 2B6HA 4P0TA 2PEYA 3HDTA 2IUUA 4B43A 1Z2CA 4NONA 4BLTA 2QI9C 2QAGC 3IIJA 3M1IA 3ZVNA 1Q57A 1F6BA 3G5UA 3W5JA 3QKRA 1ANKA 5G3YA 3Q8XB 1Z6AA 2CXXA 4AC9A 2QNRA 5KNCA 1W7AA 1N3BA 2ZE7A 2R62A 4YDHB 1U81A 2YOFA 2IHYA 1G8PA 2ZANA 2WZQA 1QVRA 3EA5A 3QKRB 4W7SA 1H8ED 1H8HA 4Z54A 4DCUA 2ZM5A 4Q9IA 1WRBA 2GZAA 3OZXA 4WZ6A 1PVOA 2O8EB 1JEDA 3ADDA 3PFIA 2QE7A 2QP3A 3GLFB 3N5CA 4Q03A 2CLCX 1YZNA 4LWZA 2FN4A 1ZBDA 4M4SA 3KDSE 1NVVQ 4DUGD 2ONKA 2FOLA 5F2EA 1AJEA 3REFA 4ZDKA 2PT5A 4ZDWA 4XVRA 3OFND 3SYNA 3KUCA 4LY6A 2RGNC 3R9IA 1GKYA 3MD0A 1KJWA 1N0VC 4PPFA 4QOSA 5UKDA 1UBFA 3BORA 2ZAMA 3EW9A 5EUQB 4GRAA 3WNBA 4WZAE 2ZUDA 4LJ8A 1M2OB 2GJSA 3PXGA 1CXZA 1OH6A 4UJ3A 1E9AA 4DDWA 3WMGA 5FUYA 1KYIA 1OXSC 4S2EA 4W5JA 2CNWD 4D4MA 4A8JC 2QP4A 3I62A 2EWVA 2F43B 3AUYA 2ONJA 3A1VA 1ZVQA 3KXKA 3JVUA 2R9VA 1DBSA 3QKTA 5G53C 3ZZTA 2H16A 4L16A 2L0XA 2GA8A 3CR7A 1NN0A 2WAYA 2YOGA 5FPTA 2IWRA 3OEED 1G8GA 2WKQA 2N1BA 1YZGA 3CRQA 2JLVA 3DOFA 4ON9A 1ZYUA 4Z1MA 2H8KA 5TMPA 2XITA 5JJKA 1AIPA 4GZLA 1LS6A 1LV7A 4DEXA 4ZCIA 4Q1DA 4QBIA 1KI8A 1N5JA 1E9DA 3KJIA 5FL7D 5KUTA 2XZOA 3A1UA 4TWZA 3KB2A 2FFAA 3SHFA 1QVAA 4YMTA 2V6IA 4DC9A 2VHUA 2KSQA 1T9HA 4ASUA 3B9QA 3RRYA 4K8OA 2QGZA 4OHXA 3BFVA 2VA8A 4QBHA 5CYOA 2V7QA 2B92A 4OYHA 2BKUA 2GAOA 2GRJA 2WWHA 1DS6A 1LNZA 2W00A 3EIEA 3LWNA 2N46A 4C3ZA 5JJIA 2G77B 1IM2A 2GWHA 3A1WA 2QMOA 721PA 5KU1A 3TW4A 1KAOA 4H1VA 4KVGA 1J8YF 1VYVA 4Y0VA 2FSGA 2VTKA 3LFUA 2NMVA 1XXHB 1E2QA 2ZREA 3DHWC 4A6XA 1KSFX 1R7RA 4EDHA 2BBWA 1ZIOA 3GJ6A 2MSDB 3LW8A 4OBEA 3PITA 4Q4JA 3T5GA 5D3QA 4PSKA 4DLYA 1JAHA 4OQXA 5KNBA 3MFYA 3QUSA 2ZS7A 3L43A 4QG7A 2ANCA 2QSZA 3CNNA 2NTYC 3B6EA 3K9GA 2Q3HA 4Q4JB 5JZVA 2GJKA 1NY6A 1VCOA 3BXZA 4IVRA 2FSFA 4IDOA 1OB2A 4M1TA 4PQRA 4US0R 1NG9A 3B9PA 2A5JA 1E2HA 2GKSA 4QKQA 1CR1A 1HE8B 1Z08A 4PHGA 3W3AA 3TAHA 1G8HA 3PCRB 2WSMA 3QJYA 4JYBA 1G7RA 3QNUA 3K0EA 3WMEA 4DDVA 1TTTA 3AF1A 2RH5A 3GEHA 4JJZA 3QXHA 4HLUA 4NU0A 1I2DA 1VKJA 2R6FA 2XNSA 5FUVA 3RABA 1W49A 2CVHA 1AKYA 2O0KA 2NPIA 2Z43A 2HV8A 5GJCA 4RD1A 4JVSB 3AB3A 3BBPA 1GDDA 1TUEA 4JLVA 3U3OA 5D3MA 3WBKA 3AUXA 4C0HA 4KITB 1G18A 3AVXA 4TSFA 1A7JA 2ODEA 1T3SA 3SR0A 1L4YA 1FUUA 4EPXA 2ORWA 4HDCA 1E94E 5D3MB 4G5SA 1Z8FA 2YVUA 4HDOB 5JI3E 2SHKA 2NZJA 2OEPA 3QEJA 3TQCA 1MT0A 4Q7MB 4LSGA 3U4QA 2IYRA 1E98A 1FQJA 2A3RA 2QM8A 1KMQA 2AK3A 5L3VA 1QHGA 1E32A 4AKGA 3OAAA 3SDZA 1WBDA 4WZBE 3U4QB 2PLRA 2ZI9A 3KZ1E 3DM5A 3IO5A 4TMKA 1IN4A 3JZMA 4NL4H 2QRZA 2QTHA 3K1JA 1NBMD 1YZLA 1D2EA 2ZE5A 3LY5A 3NH9A 4LBVA 3RHFA 4E5UA 1W36D 2JJ1A 4O0MA 4DIDA 4ZIRA 1KI3A 2OE2A 3FHCB 2B8WA 2IYTA 2QPTA 4K81B 3P1JA 1PUIA 3B1ZA 3W8RA 2OT3B 1HYQA 3B1WA 2V1UA 4ZIRB 1OFHA 1GTVA 4JZKA 1W4CA 4Q21A 3QXSA 4BQSA 2Q9BA 3C5HA 3LA6A 4BFYA 3I3SR 4KYIB 2FPKA 4FCVA 1BYUA 4NDZA 1UF9A 4S35A 2B21A 3KUDA 1GP2A 1L4UA 2A5GA 4OK3A 1YHNA 4NHOA 3RWMB 4A0HA 5J4HA 2QPOA 3CW2A 2VEDA 2YWGA 2GZHA 4MQBA 4ZV4A 1MRNA 2XGJA 2OM2A 2WWYA 4FIDA 4GP7A 2AK2A 5FTMA 3DL0A 2CDNA 2PEZA 1E2DA 3CLVA 4LYHA 1HQYE 3D8BA 3PVSA 4PTLA 1XTSA 4MUBA 2BOVA 2GK7A 2W0SA 1Z07A 4RFVA 3RS4A 3T61A 1G3IA 2ERYA 4LDJA 1A1VA 1G3QA 1PV4A 5AJWA 1Q0UA 4LGMA 2Z4RA 3SNHA 4A92A 3EIQA 3EPJA 3J81k 5BQ5A 1JB1A 5DN6A 1JPNA 1QZXA 4IXMA 2ZSFA 3A58B 3I4LA 3QEOA 3RSLA 2D4HA 3O8CA 4PC6A 2J41A 4B35A 1E9RA 2BVNA 3L0PA 1R8SA 3ASYA 4PPGA 1HV8A 4Q9KA 4D4JA 2XAUA 2ZRLA 1O3YA 1ZM7A 2GETA 5KSYA 1XRJA 2WJJA 3T1VA 3SQWA 2WIAA 3ZYCA 4MYCA 3ICQB 4U00A 4WIAA 4G01B 5TVKA 3UWKA 2VP6A 1KMHA 4B33A 5C18A 2BBTA 4GZMA 4O25A 1M1YE 4ZI2A 2O8FA 2AXPA 1GNRA 4N3NA 4BEJA 3GLGE 4KFTA 1KMHB 1SVIA 2JDID 5JLJA 2QAJA 4Q48A 4AI6A 4V0KA 4YMWA 1US8A 4B3FX 3GLIE 2O8FB 4IW3B 4LPSA 2FEOA 4TYWA 4FW9A 2XSZA 4HLCA 8OHMA 1CULC 1XTJA 2FSIA 4HUQA 4AYWA 5DYIA 4BLQA 4DCNA 1UAAA 4D0GA 3LD9A 3W6NA 2GJAA 1US8B 1ZRHA 4ACBA 2AN9A 3CBQA 4HDQB 3F0TA 1U0HC 3PUZA 2VO1A 1RFLA 2BM1A 2H7VA 4Q7KA 2ZS8A 3FWYA 1CJUC 2PT7A 4MITA 1Q3TA 2QTFA 1BOFA 4GMXA 3ZGXA 1R4AA 3ZS8A 5KNDA 4QBGB 2W2VA 4CZ2A 3BH6A 4F93B 3K9NA 4ERNA 1SXJE 3CWZA 1ZUIA 1K8RA 1PZNA 2BHRA 3L0IB 4RD2A 1XPUA 2Q3MA 2F3RA 1W36C 3SU8A 1KK3A 3UXMA 1GRQA 4XSHA 5JHGB 4LI0A 2AFIE 1PLLA 1N6RA 2J0SA 2OCAA 4FMCF 2ZR9A 2RAPA 4OI1A 3RS5A 1G7TA 2NO6A 2PMDA 4FN5A 2GXSA 2QZ4A 4MGIR 2ZETA 3B78A 4ZI3A 3G0HA 3Q9LA 1E2EA 4DLSA 4PX9A 3HU2A 2RGXA 2G1JA 2O5VA 4EUNA 2MMGA 1AZSC 1ZC3A 5BYJA 1AZTA 2UZ3A 3VNUA 1W1WA 2Q9AA 1GRNA 2WJVA 1ZAKA 3HPQA 3QENA 1DAEA 2IYXA 5IF9A 1X3SA 4ZCMA 1NI3A 3ONWA 2A5YB 1M7GA 1S0UA 2C96A 5LBIA 4AIIA 1KI7A 2CE2X 2FA9A 2CVFA 2FX3A 3MCAA 2CHQA 1MO3A 4LX0A 5SZJA 3CIOA 5H68A 4A9AA 3TIFA 4WBSA 5HE9A 3ZVRA 2D7CA 3I61A 3MWLA 4ILEA 4B75A 5C4GB 5A5GA 1WMSA 3VAAA 3LRPA 4TLBA 4NYIQ 3U3KA 3EPHA 2ZQ5A 1GSIA 2QY9A 1E9EA 5FTNA 3UATA 2J7PA 1KI2A 4C4PA 1BIFA 3LV8A 4MKIA 4Q4HA 4UQOA 4B47A 5CJ2A 4BLPA 3B13B 3U61B 3AP3A 3GLHE 2KE5A 1COWA 3QKSA 2NO0A 3WY9A 1DAMA 1ZD9A 1E6CA 3AM1A 3DMDA 4DDTA 2PLFA 1KI4A 1E96A 4RZ3A 3SYKA 3ZVMA 2VPPA 1U0LA 1HQCA 1W4RA 2CCGA 3QKSB 1VIAA 5DHFA 3T1OA 5IT5A 1YU9A 3K9HA 1X6VA 4L9SA 3LX8A 2EFDB 4TN1A 3EIHA 1RYHA 3EWAA 1AN0A 4IDPA 1ZNXA 3NBZC 5JRZA 4U7DA 2C9YA 3BFXA 1PLKA 5FOXA 4TTPA 3KTAA 2N42A 3FMIA 1LW7A 2G1KA 1QG2A 4M2LA 4ZDJA 1ZNWA 1FMLA 2CLSA 2QPAA 4MYHA 2GK6A 4ZCLA 3UANA 4NTZA 2NO9A 3CB4A 1U99A 3OIWA 5DH9A 2C5LA 4HLUC 4XJXA 5C2JB 1T8TA 2YC2C 5HKKD 1E2JA 3EZ9A 4OKSA 4G5RA 2WSSA 1TF7A 2A9KA 4GPTA 2DHRA 2Y8EA 3LVRE 1IBRA 621PA 3AV0B 1XWIA 4TL9A 4V02A 1OKKD 2NPFA 3A37A 4V03A 4IOMA 2AD5A 3W9YA 4KBGA 4WVFA 4BFVA 5GJVC 1BMFA 1XPRA 2XB2A 2VLIA 1JAIA 5GJWC 1KKMA 3W5IA 1Z3IX 3OIVA 5E7MA 2ZI6A 2ZTSA 2WJIA 2KWIA 3JZAA 821PA 3U6KA 3I5XA 3IDQA 4BFUA 1KK1A 4AURA 4BFTA 2DWOA 1N5KA 3IQXA 5L3QA 1D9ZA 5AUOB 3IHWA 3U3RA 1G4UR 2PZEA 1TQDA 2NOAA 1TF5A 2ZVQX 2O8DA 5L3QB 2IA5A 4R7ZA 1QHNA 3K0SA 2W6JA 3ZS9A 1YZQA 3CRW1 4E09A 1V5WA 4IOLA 1XD2A 2O8DB 1NBME 4TLAA 1KKLA 3R9XA 4WW0A 1W0JA 4P33A 1OH8A 4JLBA 1IONA 1F5NA 3FKQA 1XD2B 3QF4A 3TK1A 3GJ8A 2VHCA 2NZ8A 2VP0A 1S2MA 4M22A 3WP0A 4LYAA 3Q5DA 4PC7A 4MRNA 4C0KA 4PC1A 3B7GA 5FPHA 4N1AA 4CGZA 1B0UA 3SFZA 1E9SA 2Z4SA 3QF4B 1NF3A 3GJ7A 1E0JA 1T91A 2IYZA 4CRWB 2V8OA 3TGPA 5JMTA 1YE8A 4JLMA 4HAUA 3QSYA 3R8CA 2WM9B 2ZYUX 3BJIC 3W8NA 2WWGA 1G20E 1P9WA 2A7QA 4IJMA 1X8LA 3WRXC 1Z6XA 1MV5A 1KI9A 3G82C 2PCJA 1QHXA 1RRFA 1OH7A 1DARA 3BB4A 3V9PA 1P5ZB 4C0QC 1PLJA 4F4IA 1AK2A 2XZPA 4GOKA 1OV4A 2PJZA 2AX4A 1J7KA 2A30A 2GXUA 1Z5ZA 4EPYA 3C15C 3K0AA 1IN8A 1SXJA 2P2LA 4MRVA 5FI0B 3RS7A 3I32A 4POAA 2KBFA 4BZPA 2FWRA 1SVKA 3TRFA 4CT4B 4E03A 4WXPA 3D6TB 4W5HA 3ZLJA 3E1SA 2BM0A 1KHTA 3K0AB 5DSZA 5J40A 2DR3A 1G41A 2WJYA 4QC2A 1SXJB 4Q5IA 4LCBA 1Z6GA 2WJHA 1GG2A 1JNYA 4HLQB 4HB0A 3BH0A 1KO4A 4Z51A 2WVJA 1DG1G 4JSTA 3Q7QA 1G291 4V0ME 3VHLB 4D82A 2FDCA 3THXA 1NN1A 4TL6A 2FU5C 1BS1A 1JBKA 4II7A 1AQYA 1ZNZA 2ZSDA 1VG8A 3D31A 1XJQA 1NKTA 2HDNB 4MKFA 3ZJYA 5E3HA 4UXIA 2DFLA 3THXB 2AXNA 2G9NA 3FGNA 1SVLA 2DCUA 4QJ5A 3RVBA 2DY1A 2C77A 3O8DA 4HB3A 2GDJA 1E1QA 2ZITA 2RGEA 4JBXA 4F92B 1DAHA 1FPMA 1NL3A 3ZH9B 5AUQA 3CZQA 4TMWA 1CIPA 2AWNA 4OK6A 4QHYA 5FH9A 3MWYW 3TR5A 2RGBA 2ORVA 3C7KA 2HF8A 3PUWA 2ZRAA 4B3GA 2REOA 1JR6A 1GAJA 1R0ZA 1E79D 4NMMA 4URZR 5FTLA 4I1SA 3EPKA 1Y63A 4MRRA 2FGJA 5A0FA 1GRRA 1XD8A 4PHHA 4PQYA 4BLSA 2O8CA 4B34A 4Q9LA 3PEUA 221PA 5G3ZA 2OILA 1II9A 1Z0IA 4Z8YA 4A0GA 2JGNA 2O8CB 4M1OA 4KSCA 1R5BA 4BRUA 3DDCA 4JLPA 1EFUA 4UNSA 2JAQA 3IKJA 4PC3A 4TT3D 4TLDA 2XNDD 4AG6A 3IIKA 3SN6A 3AKEA 2VSFA 4OJKA 1OHHD 2HUPA 2IUSA 3CX7A 4KV9A 1Z0KA 4N0EA 5BW8A 5KSOA 1EFHA 1KDTA 2VRWA 2ZRMA 3DMNA 2HT1A 3B1VA 1ZCAA 2GVZC 2V3CC 5DNYB 3MRSA 2EW1A 3B5JA 3GJ0A 2O8BA 5FPSA 4NYJQ 1IJEA 5TB5A 4FD2A 4CEIA 4M9ZA 1JQLB 1YZTA 3CO5A 2V4ZA 1UJ2A 4Q4AA 5TV2A 3RSOA 3N2IA 5KDDA 1VCNA 2O8BB 4TZ0A 2IHBA 1DAGA 2XX3A 4CEIB 5LDDC 3A4MA 4DLUA 2FPLA 5CITA 1R0WA 4Q4AB 5CLLA 4NBSA 4LJ5A 2IXEA 2WWXA 3LQRA 3VHXA 3NBFA 1GZSA 3H86A 2X8AA 3NXSA 4I1VA 5AJVB 2JLQA 3U7EB 1UM8A 3WXMA 3L82B 2RHMA 3A1TA 1IQPA 3VR1A 2R2AA 5JS8A 1JR3D 4MH0R 2WPDD 3VR4A 2J87A 1VG0B 4PAMA 1KZ7B 3DZ8A 3NEYA 4QM7A 2WIBA 2BC9A 2IS6A 4A2WA 2GJ9A 3VR6A 4LJAA 2FFBA 1T4GA 1KDOA 5FPYA 3U7HB 3QQ5A 1YRAA 4JBYA 2GF9A 3BAFA 4DB2A 3FDIA 1II8A 2P6UA 1MH1A 1KO1A 2O0HA 2VF8A 3RS2A 3IQWA 5HTKA 4B3CA 2OLJA 1XJ0A 4DJTA 1E2FA 1XNJA 4P4SA 1MR3F 1R6BX 1II8B 3B1YA 4I1UA 5HZHA 2F3TA 3R7WA 2CL6X 1ZUHA 4P4SB 2R8RA 4GOJA 2GEUA 3NBXX 1SVMA 4KAXA 3AQ4A 3VQTA 4I4LA 3TR0A 2PJRA 3R7WB 5FBQB 2OFOA 4Z8XA 1XEXA 2EFGA 1XTKA 2IW3A 3B8HA 3PUXA 1M7HA 1W46A 2VF7A 1S3SA 4Q00A 2GF0A 5G40A 1L8QA 4GT1A 2CMKA 5BN4A 1XEXB 4QXAA 4JL6A 1CR0A 1GIAA 4B44A 3T35A 4JVMA 1TEXA 2YWHA 4JLAA 2BMFA 4EFNA 1MO5A 1IY0A 1FMJA 2JLSA 3UPUA 1E4YA 1W0KD 4NPHA 1TU3A 2RGGA 2DYKA 4BFSA 2OG2A 5FTKA 3SYLA 1U0JA 5HCNA 1L7VC 1XCGB 1UKVY 4A15A 5LD2C 2RGDA 1DOAA 1EGAA 4I1OA 2C04A 4IVQA 4BPBA 4MRPA 1G3UA 1FNMA 1KSHA 2FSHA 2VH5R 2VIIA 1P60A 4DLRA 4IHQA 2D06A 3BOSA 3ZD6A 1P2UA 3NG1A 1E9FA 2D62A 4X8HA 1HY3A 3AVVA 5CIWA 2OSBA 3TW8B 1VPLA 3KJEA 4HAZA 3IPXA 4F7WA 2CL0X 3AGQA 4UXHA 4HB4A 4B2LA 3QBVA 4DLWA 4NCHA 1B23P 4Q1AA 4YDSA 2W6IA 3QXXA 5TDHA 1NRJB 4M9XA 1KAGA 4U02A 4Q02A 4PPQA 3IBYA 3OE7D 4LK2A 5IHPA 1XJCA 2A2ZA 1XB2A 4V0MA 5J47A 1DAKA 1QHYA 1UFQA 2EQBA 4FMDF 2RCNA 2V9PA 4D25A 1DAIA 4XIGS 3KQNA 4NCJA 1L2TA 1OLOA 1NLZA 2MMCA 1T8UA 3GJ4A 1QHSA 4XD7A 1E2MA 1UEIA 1AGRA 2E87A 4OQNA 3TVDA 2UVQA 4U5XA 1RRCA 2QRNA 4RD3A 3UMFA 1S96A 3LDAA 5BN3A 1VTKA 2BWJA 3FKSA 3VMFA 1H8HD 2ZRJA 3QBTA 4EPVA 4G3XA 3KXIA 3PUVA 1E9CA 2F9MA 4QJ4A 4KVAA 2D3WA 2WWWA 1ZU5A 5CK4A 2QE7D 1U9IA 5FUXA 5JSZA 3WYAA 4B48A 3GFPA 4EPTA 2QP9X 2F7SA 4JL8A 5JSZB 1QF9A 1SVOA 4CYMA 2XJ4A 1WDTA 4XVUA 2QBYA 1NLYA 5EP4A 3AVYA 1QG4A 4OJQA 2A5DA 2NIPA 1CRQA 2CCKA 2GILA 2PZGA 4ARZA 2QG6A 4AYXA 4AY2A 2OO7A 1D6JA 4JYCA 1KIMA 1AGPA 1Z0FA 1X86B 3TE6A 2P6RA 4CT5A 4QL3A 2DPXA 4ARZB 2WOOA 4QGGA 5FOTA 4WXRA 4DWJA 4HAWA 3SE0A 1QDEA 2WWFA 1KY3A 2ZYVX 5A4JA 3EX7C 4FWTA 3IHLA 5IK2A 4BFXA 4L15A 3AF2A 3E70C 5EE0A 2XEXA 3WNDA 1SKQA 3U5ZB 1GM5A 2ZPTX 4TYNA 3C4JA 1MO6A 1KI6A 4R2HA 1TU4A 1XX6A 1AA9A 1P73A 4EIWA 3AEZA 4Z1MD 4M1KA 4JVLA 3LO5A 1X1RA 3D3QA 2EYUA 3VR3A 1TQ4A 2ZJBA 4A0RA 1XZPA 2R44A 1KI6B 2R6DA 1Q22A 2RHDA 4G0NA 4DLZA 1E1RA 1W2HA 1BYIA 1XMSA 1XTIA 4QFMA 4D4KA 1LVGA 2PL3A 4ASUD 4JT2A 4CVNA 2VL7A 3EXAA 4GBMA 4PXAA 2P5SA 3I73A 4URVR 4EFLA 3ADCA 4BEBA 2VQSA 1CJVC 2V7QD 2QROA 2ZJOA 3FHOA 4OI2A 1D8TA 2JIZA 1OYYA 1DO2A 2KB0A 4PO9A 5B57C 1FOEB 1FTNA 1SVWA 3M0EA 4LPKA 3UK6A 5FI1B 2VHTA 2NG1A 4ESHA 3A6PC 5C46F 1OYWA 1Z0DA 2EFEB 2KI5A 3TJZA 2C2HA 4MKHA 2IXFA 421PA 3CRMA 3TQFA 3L8YA 2J1LA 3HP1A 5J5CA 4EQ6A 1BKDR 3K09A 4KXFB 2VHJA 4HAXA 1YR6A 1ZP6A 1CS4C 3QF7A 2G0TA 3NC1C 5EE1A 1KDPA 3EAQA 1K5DA 4LZZA 1R5NA 4EQ6B 4DLXA 3THYA 5FFMA 1AQUA 2JJ8A 4YXWA 1GILA 1OFUX 1KZGB 4BZXA 4MYTA 5DISB 3AGPA 3CKLA 2F1JA 1MO4A 5JRJA 5K8LA 4F4JA 1P3JA 4JIMA 3THYB 3QIAA 1R2QA 4QHTA 3I5YA 1Q1ZA 4YC7A 1AM4D 1AS0A 4IKEA 1ZM4A 2XOKA 2EYQA 3FMPB 4HUQB 1GITA 1YZUA 2ZI7A 1S3GA 2OBNA 4LC0A 2AWOA 3QPVA 3N70A 1TUIA 1YR8A 4B2IA 2H92A 3TSWA 2HCBA 4QJ3A 5TXGA 3BGWA 5FBWB 2ZRKA 3TBKA 1M8PA 3H2YA 2IC5A 2B8TA 5DGXA 1EFRA 2ZR7A 4MDFA 2OFWA 2V6JA 1W2GA 4LV6A 1FP7A 1VHLA 3VKHA 4LBWA 1JR3E 3A1SA 4TSFD 1CTQA 3ND9A 1SHZA 1XU4A 2LWIA 3LH5A 4G5GA 1Z6TA 4M1SA 2J0UA 3ZQ6A 1SKYE 5KTYA 5BN5A 1HH4A 4AD8A 4Q1CA 3VFDA 4FCTA 4IEEA 4B73A 4NCIA 2RB4A 1IN6A 1KSJA 3W34A 5AUNB 2XTMA 2J0UB 3THWA 3UWOA 4BWYA 4R98A 4TQUS 4FINA 2R6GA 3SBDA 2RKOA 1SZPA 3ZIAA 3W3ZB 4PO1A 5DYGA 3OAAD 3HYTA 4RCYA 1JJVA 3THWB 2HXYA 3IBGA 1RRGA 1IJFA 3L0SA 3KQLA 1KJZA 2WTUA 3GJ3A 4LJYA 3FFBA 3RANA 1VYTA 1EFTA 3QVUA 2JJ1D 3P4YA 1SQ5A 2D2EA 2GAAA 2JJ2A 1PUJA 3L0OA 2QGNA 2HLDA 5E4FA 4F38A 5DI3A 2P6NA 3KJHA 2LKCA 4PZLA 3I8XA 4Q1BA 2EU8A 1EWRA 2O52A 1IN5A 2QA5A 2X2FA 2Q9CA 5F9HA 3L2OB 4JMPA 2AKYA 5DI3B 4KYUA 3WBJA 3FMFA 3F5FA 1NMZA 1G1MA 5L3RA 4URUR 5FBRB 5C4MA 3GPLA 4DLVA 3DKVA 2XZLA 4KBFA 3NC0C 3VKWA 5C1BA 1CLUA 2QMHA 3OESA 5FR2A 4DT1A 2J7KA 5EXSA 1VMAA 3QXJA 1J8MF 4QGHA 4DVGA 4A36A 3TVTA 4TMZA 1G64A 3CPHA 5E95A 4XTCS 4URYR 3SS8A 2ZI4A 4JT4A 4DT1B 2CHVA 3ADBA 4Q4HB 4AKHA 5FTJA 4URWR 5AJYA 2LCFA 2CE7A 1NY5A 2IUTA 1MABA 3KB1A 1ONBA 2PX3A 5J4KA 1HT1E 4GFDA 4TTQA 5DN6D 3ZD7A 2J45A 3FMOB 1NN3A 4BASA 1P2TA 5EXPA 2J9RA 2R65A 1WE2A 4M0LA 3WHKA 3OIUA 1MABB 4OHVA 2GZDA 3TUZC 3AVUA 4DDUA 1RYFA 2OXCA 3EZ2A 1ESNA 1Q3HA 2DWPA 3H0KA 3KFXA 2ZJ8A 2VSOA 4KLZA 3CH5A 1ELOA 1NVWQ 3MJRA 3KTAB 3RRNA 4BECA 3WMFA 1K5GA 4PR0A 2RGNA 3ZZ0A 2IS1A 3GCGA 1G21E 2ANBA 3NDPA 4EAQA 4RD6A 2FZLA 3I72A 3VU9A 4YMUA 2OCPA 2ZVPX 3F8TA 4TQ9A 1Q44A 2AL7A 2YWFA 4FMCB 3T34A 2XSZD 4YLGA 1A4RA 2CEAA 4P31A 5FL3A 1OXTA 1WA5A 2ZE8A 1JALA 2RGCA 1IHUA 3FYHA 3VU9B 4ZKDA 1NSFA 2GNOA 1EESA 1XMVA 2REXB 2ZSBA 4PPNA 2YV5A 1Z28A 2F1RA 5FOWA 3GLFE 1XTQA 1EWQA 1KO5A 1Z2AA 5EE3A 1DEKA 1G4AE 3CNLA 2ECKA 1OIVA 1A2BA 2E9SA 4KODA 1KO8A 1XMIA 4W5WA 3VX3A 4MA4A 5HZKA 4F91B 1Q21A 2XTNA 3ADKA 3K8YA 1OXVA 1M34E 1ZJ6A 3UKDA 3IUYA 1IOZA 1RC8A 2AHOA 3BC1A 521PA 1N2CE 2HJGA 3UG7A 2QT1A 5IDVA 1W4AA 1J99A 2PMKA 2H1LA 3RAPR 1KOFA 2ZRCA 4I81A 4PFSA 1S1MA 2CK3A 1T0HB 3SFVA 4UNNA 1SHKA 4RZUA 1TQ6A 5FOVA 2H17A 2QT0A 3SZRA 4L9WA 2J5XA 2W58A 3O8BA 1JI0A 1KK0A 2HJVA 3SJZA 4D80A 1CR2A 5CB8A 3KKMA 3KQUA 4C0LA 1DAFA 1S4QA 2ZYTX 2C99A 2YC4C 1D2MA 3FPAA 2Z6VA 4QGFA 1N6NA 1FQKA 3EZFA 4DCTA 1G19A 4PSVA 2JLRA 3PQCA 3TUIC 3AVQA 3GLGA 2C9CA 3QG1A 4BFWA 3K0FA 1UDWA 3OEHA 1J90A 1G6HA 3VNVA 1TF2A 1DO0A 3AH8A 2IYVA 4GDFA 3SQXA 2AFHE 3RWOA 4DCSA 2CJWA 3GLIA 4JS0A 4HZUA 5JHHB 4C2UA 5EE9A 3GLGB 2J59A 3CNOA 3K0FB 2ZSEA 4LBZA 4OHYA 1TL7C 2ZUCA 4MGYR 4E07A 2CJWB 3GLIB 3A4NA 4HZUB 3OF5A 3AKDA 1DADA 2OLKA 4H9GA 4HEJA 4WAUA 3BH7A 4IVPA 5HPYB 1H8EA 4ABYA 3CRRA 1PJRA 4OL0A 2CLDX 2MSEB 3NIBA 2J7PD 4JKIA 4LV8B 1XXHE 1T0JB 1AS3A 3KFVA 4A82A 3O47A 2OFXA 5FBLB 4LOAA 1XCPA 4LJ7A 1COWD 3CR8A 2ZJ2A 1S9HA 1TEVA 4DUGA 2CL7X 1Z06A 1F3OA 1RZ3A 3K09C 3ZQJA 3OFNA 2XXAA 3CONA 1S9DA 3K0CA 4WOPA 4Q1EA 4A6PA 4W9MC 3U7GA 1OIWA 4ZO4A 4A0FA 2JATA 1Q1EA 4JKYA 1Z22A 2XXAB 4D81A 4BLOA 3X1DA 3AVOA 1EFCA 1W48A 3JVVA 1G8YA 2ODBA 3A8TA 4BGDA 5TARA 2CNWA 3KKPA 3A4LA 5M04A 2OV2A 4LJ4A 4UNRA 1C1YA 1XPOA 2YJTD 3QG5A 4GOXA 2QSYA 1WB9A 3AVWA 3LBNA 1F48A 4RZXA 3UMRA 3TSZA 3PIRA 1E2PA 2DBYA 4R9UC 3IGFA 4RD0A 5ELXA 3HJNA 3OEEA 2I1VB 4KCGA 2OUKA 2WSSD 2OHFA 1KJYA 2ZS9A 3K9LA 3U2QA 1I4LD 1E2GA 2KJQA 4XWAA 5FL7A 3A36A 1ETUA 4M9SA 1LF5A 2IYQA 5DI9A 4P4TA 3IEVA 1OSNA 1NIPA 4RD4A 4C30A 1XD9A 5K8TA 1BMFD 3P4XA 3DVLA 5KSPA 5SZIA 3TSOA 4CEJA 4M8NE 5JCPA 2IYYA 3M6AA 3WHLA 1OFTA 1N6PA 5J4LA 5KO2A 4CEJB 3U3JA 1JXOA 4YMSA 3R9WA 1G5TA 1II0A 1RRPA 5CM8B 4CF7A 3GLHA 3UG6A 1ZINA 4ZPXA 4BZQA 2YZ2A 3FOZA 3FHTA 4DB4A 1G3MA 1ZD1A 3GLHB 1TAGA 3TLXA 4FWIB 4M1MA 2W6JD 1G7SA 1VECA 2X2EA 3AF4A 2EFCB 2ZI5A 1DPFA 3DKPA 3TMKA 1KI1A 4NYMR 6Q21A 1G9XA 1P61B 1WF3A 3BWDD 4D6PA 5IRCD 1I4DD 1W0JD 4M53A 4RCZA 2P67A 5G41A 3PJRA 2Q6TA 2JLYA
chains in the Genus database with same CATH superfamily
2EJBA 4FZVA 1JGTA 3QVXA 4YJKA 4LV5B 4CMHA 3Q5GA 4C3UA 4Q18A 2FPMA 4EKDA 2UXCB 3IQHX 2ZSHA 1RJWA 4URXR 3NV7A 1SK9A 2XCRB 2Z6AA 1V4NA 3E5RA 1U28A 4LFAB 2WHQA 4XWKA 2YHAA 1TQ2A 3IUNA 2I66A 1YACA 2XUGA 2WT8A 3A7EA 1OXUA 2ASEA 4PCAA 3RTGA 2FW6A 3T3MB 3PJFA 2QYSA 3QE4A 1X9IA 2GTPA 4F8JA 5TQ0A 1RJ9A 3WRYA 3FWNA 4KXQA 4AUMA 2VR1A 3NYIA 3GVPA 2YXBA 3HLKA 4QDZA 5DP1A 3FWKA 4Y2UA 3IVXA 3BGOS 1EQAA 2FV8A 2V7WA 4NWIA 3HTXA 3F5DA 2V55B 2QF7A 1G6OA 2P1DA 3HCCA 3O3CA 4D57A 1NOJA 2XVMA 2BMEA 1PR4A 4XX0B 4JJEA 3TRHA 3GMTA 5EQFA 4MRAA 2QLBA 4NZYA 3HACA 3B1XA 3TNDA 4ALMA 1UDRA 3CISA 1QGYA 4CMJA 1YUMA 2IX9A 1T2EA 3LX6A 4Q9DA 4P3XA 4EJSB 5JNSA 1J07A 1SXJD 1AKEA 3C3YA 3EGCA 5HSGA 4LHVA 3U80A 4B74A 2EP5A 5DNAA 4AP5A 1BMTA 4FEEA 1T1RA 2VUUA 3TZBA 5KKNB 4AKTA 2WB4A 5E7JA 1BDIA 1DE0A 2WJPA 5E7QA 3ZDXB 4C0AC 2V9ZA 3ZNNA 3W1VA 1WABA 2G9QA 3PI7A 5AI0A 1TM2A 4E1AA 3QMWA 2E18A 3RS0A 5CH5A 2FKNA 1QGOA 2I2AA 3HB5X 2XE8A 3DDUA 4M0DA 1BW9B 1ZN7A 2UDPA 2IS2A 1OGJA 5JS1A 5K3FB 3MS2A 3CZ4A 2XNCA 5FBHA 2P1ZA 1K4KA 1RKQA 1IXSB 2C88A 1AT1A 1BRTA 3DV9A 4QUEA 3UY4A 1FVFA 1XQVA 2ACEA 2XBLA 2F55A 2ECQA 3IIEA 3OHMA 3RC8A 5HA5A 1X14A 1Z0UA 3PWKA 4TTTS 2QUBA 1GL6A 2G0NA 3SZ3A 1TT5A 4GR5A 3L41A 5ALUA 1JW9B 4CG2A 1CUVA 4JQYA 1NJFA 3PGMA 1QK5A 2FSSA 4INJA 1LD3A 2PSEA 1GVNB 2FMTA 4ETWA 4HC4A 3SJAA 1HT3A 5SV2A 2P4HX 2YZKA 2WTXA 1W47A 1CHNA 2OCBA 2QN6A 2QN1A 3ILXA 4G0YA 3O4VA 4BQPA 2PUGA 3KT6A 1L4HA 2IXGA 4RPGA 4D26A 3K2IA 5FOUA 1G8JA 1PWXA 4FJ2A 1TFUA 3RIEA 4MZDA 4BAGA 1SBTA 4CKCA 3ZE6A 4FKMA 1ZXXA 3K4HA 3R3UA 3R7SA 2XYRA 4GDFA 4B3SB 4FNOA 2CLMB 1SCAA 3AP2A 3NWJA 4MKXA 4N65A 2G5GX 1SVNA 2CWWA 4QGAA 4LQLA 2F90A 4S24A 2FEMA 5GJBA 2VSQA 1D9XA 1OI7A 1HE5A 1VFNA 3O4HA 2O2HA 1VA5A 3OJ0A 2D7DA 1BCSB 3I5UA 3GEIA 2JI7A 4RFSA 5DHTA 1TJ3A 1XXHA 2PH7A 3R77A 1N6LA 4Z4IA 2QMEA 3HK2A 3VU1A 1UANA 3TX6A 1V35A 5DM60 1NZFA 3ETGA 5AW8A 5F98A 2ZTHA 5HMLA 2ATEA 5KOYA 3FSJX 4EAAA 3HU1A 4YALA 2C0QA 4G5FA 4MGKR 1P9RA 2JFZA 5JEEA 1XDSA 3FXAA 1B42A 1DRWA 1MXFA 1S89A 3C7CB 1U3VA 3KCNA 3MGBA 5F23A 4ETMA 2Y1FA 2WYIA 5KYVA 1KGDA 2ZCJA 4PZDA 5J5AA 2DH6A 3F3YA 2ZRBA 3PF9A 1RSZA 1V1RA 2WSIA 1CUWA 5ILOA 4EFMA 2ZSJA 3EZNA 1U5BA 1EPUA 1MB9A 4XSGA 4DSNA 1YZKA 2VYVD 3ZY5A 1F3LA 4FEYA 4XCXA 3VO8A 4BJHB 4QA9A 4MIOA 3CH7A 1KJQA 3KQHA 5I3CA 3C16C 1K0FA 2JDIA 2WWTA 3UCFA 2YWEA 1L5SA 3HP7A 3MCWA 2ODNA 3DG9A 3P26A 1NRIA 3IAM6 3W5SA 4O4JA 2BSQA 2WU3A 3H8JA 1OT5A 3CU5A 4LMBA 4L0MA 2HXGA 2QQ0A 4I4TA 1NM5C 2ZJZA 1XHEA 2SCUA 2Q7DA 3SAJA 1XKLA 4OHCA 3I64A 4MDEA 4MVWA 5AD1A 3U13A 4HY3A 2CFSA 4UJ5A 3RBAA 5L3SB 3OOWA 3ZWPA 1ZJJA 1IBKB 2AOUA 5CR9A 1H94A 1Z75A 2XWJI 1JEEA 2NZUG 1HWYA 2QTVB 3CW8X 4S1OA 3TRIA 3O2NA 1Q0PA 4UBOA 2D74A 1VG9B 1GKKA 5CVTA 2E1PA 3ILHA 1P7CA 3AIIA 3D8TA 3FMVA 3JWJA 4DIEA 1T9CA 3B2QA 1N0WA 3HR8A 3L8DA 2ZRPA 3NORA 4QBFA 1K6XA 5K3EA 4NH4A 1RLTA 5IBRA 3OZAA 1OV6A 3QA9A 4D43A 2IX3A 1FSSA 2FJUA 4BUZA 1DB3A 4H3KB 1AKWA 5L8VA 1VCMA 1QIJA 3X1WA 3E3LA 1EDBA 1ZM3A 4GMDA 3S6JA 2BKVA 3V2HA 2QBYB 2LRHA 4E6EA 3EZ6A 3EA0A 1F0YA 4XWOA 3CQ9A 2RAFA 3F74A 4KH1A 5JAUA 4Q3NA 3R20A 4RENA 3I1FA 3OTQA 1SWVA 2GJ8A 1X38A 1YJ5A 1GOTA 2FWBA 3TKYA 1IK6A 1DRKA 1Y42X 1IM5A 3HEAA 4BNJA 1M2VB 4DSUA 4EZBA 2PZFA 3HZOA 1POWA 4Y7DA 4ABTA 3TRKA 1KFCB 4KREA 3BPSA 1F8YA 3DBHA 3OZDA 5JMWA 1C3OB 4GS5A 3P0IA 2PX0A 2D59A 4JROA 4Y1RB 4IAOA 5BWOA 2G9ZA 4PGGA 5AVVA 3TJMA 1K63A 1FYDA 4Q66C 3UV6A 2EFHB 2NU7A 2JI8A 1TQHA 3FPEA 1OTXA 3NATA 1ZGJA 4MIKA 2Q1WA 3BD9A 3L5KA 3GIWA 3OETA 3ZI7A 3GRCA 5K45A 2ZIVB 1SXGA 3EZXA 1J2JA 3OCUA 4O2BB 2IXTA 5LPNA 5KI6A 3AG5A 5K20A 2XJ9A 1EXDA 4NATA 5DGDA 3D7MA 1IUPA 4LWPA 4U2CA 5IWAB 3F9RA 1AG9A 4AS3A 1WP4A 1G3RA 3QUBA 4QVKA 2YJ3A 3QGMA 3PPYA 2C8VA 3A1EA 1M73E 4XDGA 4EH1A 5FBVB 1KEWA 3JAKB 3SWWA 3RYTC 4QNNA 1W1IA 1AC5A 3HVIA 4WTOA 3KNZA 1UZLA 1WEKA 4EW3A 1A50B 3UPDA 4MCIA 1DEHA 1XNGA 3EB9A 1UJ5A 2Q3FA 4HQFA 2DLNA 2J3MA 2X9NA 4NYJR 5EGNA 5YASA 1WM1A 4G1EB 4OAOA 5LYJB 3E5HA 2UUBB 5J9FA 1ZNQO 2QVCA 1E4VA 3UJ9A 4ZVMA 4JWKA 4B4WA 2WP0A 1DWOA 1PNOA 3JV7A 1CJKC 1J2TA 1EX7A 2XDQA 3S1AB 1K8YB 2NSYA 4UAGA 3FNIA 5FOSA 4V2IA 4PN7A 2PL1A 4OHMA 3HEMA 3KOUA 1X92A 2AZDA 2ZLBA 1R0XA 1UZAA 3GCZA 1KWKA 3PFKA 1GU0A 3FPFA 2W71A 4LXGA 3S2EA 4BVAA 2FPXA 3KKQA 1HSZA 3ROEA 2ZRDA 2JL1A 4IXNA 3W6UA 1EP3B 1N8SA 7YASA 4ADSG 4FVTA 5EXTA 1E6WA 1DZIA 2VNIA 4IIXA 2ERXA 1NVVR 3K96A 2QV0A 3FVQA 4JJKA 3H7IA 2CL5A 3T1TA 4UMDA 1LSSA 1EB9A 1A4IA 1WU7A 2CLKB 2VPXA 2XCLA 3KVYA 4GOMD 3JQ7B 4YRDA 4YCMA 2R6CA 2O54A 1KAEA 1XWWA 4MWDA 1L5KA 3SEQA 4CV0A 1Y1SA 3ELWA 5HRCA 2WUWE 2VTBA 2WR8A 2DPMA 3HWSA 3SC4A 1NNEA 1RR6A 2YV2A 2R6AA 3DAYA 4PLGA 1OX4B 3SDBA 3QJGA 1T6NA 2LD4A 3GRPA 1F14A 3H05A 3CE6A 1QO9A 2OGWA 1JHXA 4DMKA 1I33A 2YHSA 3AKCA 5GGXA 4EK9A 3PV0A 4IFIA 2JI9A 4RJIA 3DYVA 4P6VF 1UKYA 4PHTA 2KLHA 3EDOA 3TQOA 3ROTA 1K08A 3DW3X 3JQQA 1U8YA 2XB4A 2RJNA 5DHAA 4XQ0A 4CR8A 1HTBA 4DV2B 3I83A 5A1JA 3SVLA 1XQ1A 1N33B 3S8MA 3VPCA 4HATA 4KIFA 4KQFA 1KU0A 3LQ4A 5CDTA 1P2VA 1JLHA 1KF0A 3LPMA 4L3OA 3TG2A 1YJ8A 2O8VA 1D4FA 3MELA 2RHJA 1NW6A 3A6EA 3HO6A 2G5PA 5AQ1A 4YIHA 5HX7A 5KMGB 3DPUA 1RI4A 1HEIA 1BFDA 1P7PA 3TNFA 2CSUA 3F8SA 3C7AA 3I4CA 2W83A 2Z8ZA 3TZEA 3A14A 4KSBA 1U6IA 1O0SA 1YUBA 2FWAA 1EM8A 4ND8A 4XYBA 2DCMA 1CY7A 1QQ5A 1ZVJA 1TW3A 2BKEA 2W9XA 3RJTA 4G2NA 5ADHA 3WS7A 1NX9A 3ZNQA 4ESVA 4KUHA 3T7KA 2WMNB 5FQOA 2QD1A 4ZXPA 3UTDA 5TPZD 1C9YA 3BRWD 1FDTA 4FCWA 5IXYA 1Z5PA 4DPMA 3QLEA 1EFLA 4KQGA 4RVFA 3OBIA 5CDSA 2H2AA 1OE0A 3TM5A 4HQ0A 4YRIA 1NVUQ 1Q20A 1WEHA 1G7CA 2G4LA 4JBIA 4TS3A 2AN5A 3KFLA 3TD2A 4LMRA 1PGQA 2G88A 3DO8A 3B60A 4L8LA 4W7HA 3KJGA 3ZY2A 3OM9A 3STUA 2XCSB 4KE9A 1ESMA 1WMEA 3HR7A 3EASA 3HDQA 3EEIA 3H99A 3Q6MA 1ZMRA 3QLUA 3SI7A 5KQGA 1FMTA 3BGIA 4Z1OA 2X1LA 3KKZA 1I5RA 3OU6A 1B6GA 4MB2A 2WTBA 1A5TA 2CB9A 4OL9A 4OQYA 3RO7A 1EHIA 3QKUA 1N3LA 4Q7EA 2Z98A 3IPLA 3FBGA 3O0DA 4YV1A 1TVKA 3ZCXA 5BOSA 3B2EA 3CV3A 3GEEA 5C8XA 3ICWA 2Q0HA 1P0MA 2ACKA 2O0JA 2ZFUA 2VZLA 1T3HA 3H84A 3HRKA 4ZVPA 3STTA 6PFKA 4ZTZB 4G67A 1DEXA 2YNMC 1PX0A 3IBSA 2AR7A 5HNKA 1RI3A 5EP1A 4O4HF 4QM6A 1MRSA 3KYBA 3L0YA 4TXMA 2ZPUA 1F8GA 2ZU0C 3QY0A 4MYDA 5CCBA 4BNHA 3MFQA 4EY3A 1E1RD 2V96A 2IV7A 1UKBA 4N0MA 3RUDA 1A8IA 5ALQA 1KBZA 3W4JA 1FXWA 4WLVA 5FT9A 1OTYA 1H2RS 2FZWA 2PN1A 2EF0A 5SYMA 1T8RA 1U2PA 1I80A 4TRRA 3T15A 1YKSA 4WNYA 1RW4A 2XUKA 4L8GA 6AT1A 2P0EA 4R51A 5FBKA 2JGDB 1R3DA 1B1AA 1FQOA 1Z0AA 3LL4A 4Q9AA 3R8XA 1KRHA 3RS3A 3W4KA 4F71A 2LCIA 4PLWA 3ZQKA 4BNFA 4DLTA 4OI0A 2FEWB 4DR7B 1SUSA 1TCAA 5K7SA 2Q50A 4KJZA 1A77A 1SEPA 2P65A 4CCAA 1C7IA 1KP9A 1LRJA 4L4UA 3VR2A 3IVGA 1E58A 1HNNA 3RVKA 2NM0A 4FEGA 4B3MB 4AKEA 1TMKA 4XRGA 1JKJB 1Z4MA 3BTUA 4JLJA 1LLCA 2QM7A 3K9BA 1U90A 1VCHA 2MSKA 1ZOSA 3BFJA 3C74A 3IO3A 2BFDA 4F3KA 2EVWX 1T8YA 4EJMA 4B2PA 1QR6A 3OMWA 4G0PA 1B6RA 1P62B 1UP4A 4C7OA 2FJPA 2WHRA 3EWSA 1CE8A 1T6ZA 4KMOA 3ONVA 3HXQA 3D02A 3L6BA 2EJWA 3PD7A 2JZNA 1KHHA 3PJDA 1P2SA 1VLHA 4LFCB 5BMVF 4BNZA 4YXWD 1YOVB 2TMGA 5IC5A 2JIOA 5B30A 3T1QA 3RAGA 4N0DA 1ZW6A 6ADHA 3NDBB 5H8WA 3RVQA 4A8JA 2QTTA 4MROA 2A84A 1GXSB 1NT2A 2DFKB 3T1NA 3W2EA 1YRYE 1F2UB 1YE3A 4KFSA 3ZJ4A 3X1XA 2ORIA 1CETA 1YBVA 3P9PA 4JR2A 3RTDA 2FF7A 5B6IA 1GKIA 3DLPX 4X94A 5LSAA 5KQPA 1JPVA 1WBJB 5LXTF 4RKEA 4LDRA 1IWBB 3RRZA 1CP2A 3COZA 4NFLA 5AI9A 3QOFA 5JWHA 1RD4A 4ZT6A 3KLBA 2XGSA 2OECA 3L7CA 4RMIA 3KQSA 4C6SA 4OMCA 3KSUA 3PEYA 3ZXSA 4FFRA 3H1BA 1JMYA 5F1KA 2H51A 3FUUA 3GQVA 3REGA 4B6QA 5JXWA 2VHQA 5C8ZA 1ZUNB 3PXXA 3K92A 3D54D 3X1YA 4CEHA 3D4BA 3GQBA 4JLNA 3EOBI 1OPXA 1VYUA 1D5CA 2HRDA 2GLTA 4N76A 3FDZB 1K66A 1EUDA 1V48A 3AKYA 2V7XA 3ZCUA 1FA9A 1FC0A 1W6UA 4L3WA 1B0PA 2HPAA 1W34A 4OH7A 3TLGA 1T6XA 1ISGA 2NYUA 3HXOA 3HPRA 5EYPA 2ASVA 4RE6A 3SOPA 1TNDA 1K6EA 1QRAA 2CZGA 4B87A 4ZJZA 2CWDA 5KPDA 4EELA 1GZUA 3ZIAD 1MQAA 1KMNA 1ODLA 2JNWA 2PBLA 4NEQA 2IXAA 5I7HA 2W8BB 4YP9A 1O2DA 5AKHA 5CA0B 1HE1C 4QOEA 3BE4A 4WXEA 3D5TA 1BZYA 4QT0A 1QAQA 2YY6A 4TT3A 4UU7A 4LTDA 1OA1A 2OXIA 1T36A 4DQ0A 1QR2A 2UUOA 1NDUA 1F0NA 1UUFA 5A6SB 1X1SA 2R6HA 4YDQA 2LV8A 2JJ2D 3CT4A 2QEQA 1Y5LA 1UM9A 3CWCA 4KI7A 1E3SA 4O3MA 1PFYA 3H2KA 4FNGA 5KWEA 1MB2A 4BMOB 1R6VA 4MEBA 5U4QA 2QM3A 1DFIA 4TLCA 3FGOA 5BNWA 4M9QA 2JFXA 1XUOA 1Z88A 4FNMA 3BJMA 3V80A 2BELA 1RMTA 3K70C 4EMSA 3O8RA 3WIEA 1Z35A 4UUQA 4ATNA 3G7UA 4KTVE 4S12A 3LW7A 4DUGA 1WSDA 2GPBA 4H7KA 1RQRA 2BDTA 2MINA 3F47A 4YQYA 5KREA 3BS4A 2WHYA 1XFAA 2X77A 5I7UA 1JFSA 3UNXA 3WOVA 2TYSB 5DBEX 3FLAA 1E6LA 4YPOA 2NVOA 1KIFA 3HH8A 5ALTA 1CYDA 3WRVA 1PE0A 3T0GA 4WBNF 4JEMA 1QFZA 3T7RA 1Q0QA 1U3CA 2IYNA 3MRXA 2G83A 4RNDB 2SNIE 3CLTC 2YFYA 3OQVA 1EA7A 2OYCA 3SJCA 4QUJA 4K9MA 1KVSA 4V0OA 1JR3A 3ORRA 2L2QA 4TMFA 3S4YA 1H22A 4MR8B 2UVDA 4OREX 4B7AA 3BL8A 5E9WA 3FFTA 5CFMA 1NW9B 3L18A 1C9KA 2FW0A 4FUQA 1FFHA 1R8QA 2FWPA 3BJRA 4Q4DA 4EYSA 2ODPA 2FGKA 5C4IA 3C6QA 4RQUA 4KU4A 2HJRA 2VQ3A 3MLEA 4HK4A 1ITZA 1R0LA 1RM4A 1SKYB 1YS7A 1PIWA 5CT9A 5CYPA 3T4PA 1C0KA 2RKWA 2WJ6A 3E1GA 3I0NA 4ITRC 3X44A 3ZV7A 2IYAA 4OHZA 1I0IA 5AWFC 4E5SA 3HI4A 1R0RE 3V7YA 1LY1A 3SJBA 4UKDA 3EULA 1OREA 1HA3A 1PJBA 4FYMA 5B2ZA 4E33A 5AOCA 3B3FA 3HFSA 1K7CA 3H1TA 1KFJB 2HNBA 3LKDA 4DGSA 4YQFA 3T1YB 4DR1B 1D2CA 4OAPA 3QKWA 1CLEA 2V0CA 1T26A 3IXMA 2GLUA 2HT6A 3LKBA 2X6QA 3NVAA 5I6DA 2JGEA 2GBLC 2OZEA 2WF8A 3AU8A 3FD8A 1IY1A 3H1PA 5IJAA 3DFZA 2OGTA 1IXZA 1PEKE 2QZ9A 3ZY3A 2HYIC 4Q7LA 1LRLA 1MVLA 1HZZA 2ZJFA 3E3AA 2B1RA 1OVGA 2NU9A 1NONA 3DO6A 1R4MA 3PHCA 2ZU6A 4OATA 4XYLA 5JDIC 1FP4A 3AJ8A 1BDJA 4O4LF 1OX6A 5EJFA 5KPJA 3DEKA 1L4FA 2FHPA 5EINA 4ZN6A 3DOOA 4UOEA 4R6WA 3BWVA 3LLSA 3OT1B 4P35A 1QH1B 1CKEA 3G6WA 2C9OA 4B83A 1DKRA 3Q85A 2WIJA 4RPCA 1UBJS 1CS0A 5EP2A 1JPJA 2DFPA 4TRJA 4U2EA 1HZJA 1MP0A 2FZKA 4MULA 4JB2A 3R7DA 3BRCA 4MUIA 4W9RA 4TXNA 1TTQB 1DQZA 4G1FA 5F2NA 2XKBA 2E55A 1CEYA 4WLFA 1HT2E 3G5LA 4F4CA 1TK9A 3TAUA 4NESA 1Q14A 3SSNA 1B41A 3DFMA 1QRUA 4KO8A 4ZI7A 4NYIR 4PICA 4FD3A 3DWFA 3FFXA 5I01A 3WRWA 2GF2A 1NC1A 2J09A 5KVVA 2RDMA 3U3MA 1QKIA 1CDOA 1XKXA 2EJUA 4I99A 3ICOA 2PG3A 4JUIA 5DWQA 3TLAA 2ZUEA 4O2AF 3AEQB 1L5NA 1TM7E 2WD7A 4A23A 5I7SA 1ZR2A 1UC9A 2P4EA 5AVJA 1WBBA 3P9NA 1GTG1 2AN4A 4Q05A 4B6EA 3IS3A 4U7HA 1JQ5A 3E7DA 1VIVA 1D1TA 1C30B 1SPBS 1TCBA 3KQYA 2B0JA 4V0LA 2YBEA 1PEAA 3P19A 3GMIA 4LMPA 4YO7A 3EXHC 3T3IA 2REBA 4HAIA 4K88A 4E03A 3UTCA 2R8PA 1RVDA 4GP6A 2B6HA 1PCXA 4P0TA 5JZSA 1U7TA 1K3TA 1Z2CA 3SLGA 5KOHA 4BLTA 2QI9C 5J2TF 2PQ6A 3QEAZ 3N8IA 4L5JA 1G21B 4YFVA 3ZVNA 1Q57A 5AK3A 3EAFA 4X1OA 3GA0A 3PWSA 3QKRA 4XIFA 3E8XA 1NJSA 1QZTA 2C0PA 2CXXA 2GK3A 3KAQA 2XPCA 3Q8XB 4Z0NA 1V71A 5I8ZA 2J08A 1NR7A 4Z6KA 3DW1X 5KNCA 1W7AA 2ET6A 3MBOA 3F1KA 4YDHB 4EI7A 5IVPA 2YOFA 3M81A 3UJAA 2WZQA 2QLTA 2Y0BA 3EA5A 1LGYA 1DUVG 3EXEA 3OPYB 1PQ4A 3MM4A 1YMQA 2FLVA 2NO5A 2NZYA 1F1BA 4WQMA 5JCJA 2GZAA 3RFTA 4BTLA 2ZDGA 4I08A 1H4VB 2YASA 1JEDA 4DCMA 3PWZA 3L7JA 3PUHA 3NX4A 4KC0A 4L5CA 2Q07A 3DZGA 2FPSA 1U2ZA 4LZPA 2CLCX 3WMXA 4RMNA 4MS1A 2IU6A 1YR2A 3KDSE 5HGXA 5IULC 4YRFA 1Q2UA 1AJEA 1V6CA 3KZVA 1M5UA 1XVAA 1M75A 2VNHA 4J1NA 2PT5A 4ZDKA 4XVRA 3OFND 3KUCA 1MIOB 3MD0A 5LZ2A 4L8VA 3W0LB 3IL2A 1I7NA 3V42A 2ZAMA 3T52A 1R0CA 1GQSA 5LZ7A 1I10A 4WZAE 5IUKC 2HX1A 2B3TA 4V3CA 3V4ZA 2XE6A 1EVJA 1Y5IA 5DYTA 2AZXA 3PXGA 1G9SA 1CXZA 2HREA 3MOGA 4ZO8A 4BMPB 4ER5A 2FXIA 1OH6A 2UXDB 3WMGA 3AEKA 3ZG6A 5FUYA 4R1QA 4W5JA 1RYMA 3OPXA 2UZ0A 3JTEA 3TQSA 3H1AA 4OFXA 1W2WB 3L8CA 2EOAA 3EC7A 2BFCA 1TYAE 3D6MA 1PG2A 5EESA 5ALIA 3AUYA 4XLTA 3CTMA 2Y4NA 2BE9A 4ENTA 5A5VA 3KXKA 4R1LA 4RDCA 1OLXA 4IKOA 1DBSA 3N0VA 4G09A 1GUFA 4J8PA 5J63A 3ZZTA 4LRXA 4G85A 2Z1NA 1IL0A 5C8YF 3CR7A 2WAYA 1F4VA 2FDRA 1SKAA 2PGLA 4UVGA 4EJ6A 4EUEA 1U2EA 3PQ7A 3WAKA 2O7RA 2J9GA 3DOFA 2IQIA 3K8ZA 4FIZA 4W7IA 5I9TA 2AQIA 1XVUA 4NBKA 5FO0A 3A7DA 4GZLA 1SO8A 4M6WA 3LQKA 4ZDIA 5HK9A 5KUTA 4B9EA 2A4KA 2Q5LA 1KI8A 1Z7BA 1BKSB 1EH5A 2AFHB 2BF4A 3GPBA 3RYHA 3D4IA 3DBLA 3GPDG 3SHFA 1QF7A 4YJHA 2VHUA 3F67A 3MCUA 1IE3A 3P0JA 4ASUA 1DC8A 3RRYA 4K8OA 2QGZA 1RJEA 5IKPA 5ENZA 4C7KA 4DLAA 1ADYA 1JFVA 3DDNA 4RKWA 2H1IA 5EG5A 3ZHQA 4OKNA 5JCOA 3ELDA 3S5UA 1A9PA 2GRJA 2WWHA 2W00A 1T9GR 4RA9A 4C3ZA 4EHDA 2G77B 1IM2A 2WYVA 2QMOA 3BXHA 4PZAA 4M9RA 5JNUA 3EFHA 4FOOA 4KVGA 3NIGB 2D0OB 2FUNB 2FSGA 3CEAA 4GF5A 4NLLA 4RXTA 3U4DA 1IPEA 4DHWA 1XXHB 1ZK4A 2B4KA 5F12A 1GLGA 1E2QA 1I13A 4ZEMA 3DHWC 1KSFX 5L6LB 2ZWOA 3NOQA 1ZIOA 2O1XA 1X80B 2PR2A 2MSDB 2WJWA 1QLJA 2EW8A 1T15A 3DJFA 3LW8A 3PITA 4OXQA 2H7XA 5KTRA 2X9GA 3A0UA 3QLTA 4DLYA 5BVHA 4IICA 4OQXA 2RHWA 4R8LA 2CDAA 3IAFA 3QUSA 2NZVG 3H9UA 4GG1A 3SX2A 4QG7A 4F5WA 4EJFA 3IUBA 2HCFA 3CNNA 2NTYC 1I7QB 3U9LA 1YL7A 2GJKA 5I7VA 1IVSA 3GJTA 4D42A 2FSFA 4PQRA 5K99A 3ZHTA 4ZALA 5A06A 5ADUS 3B9PA 2XUIA 4XPIB 2ZUTA 1NG9A 1MUUA 1E2HA 1CR1A 3RRXA 1UJBA 1WO8A 2DGDA 3FSEA 1NQVA 3W3AA 3W8FA 3WYDA 3CLUC 3TAHA 2IPMA 2R00A 2WSMA 3QJYA 2J67A 1G7RA 1JKXA 1XZ8A 1TTTA 3DEYX 5GWXA 1EFVA 2KPOA 3AXSA 4JJZA 3QXHA 4HLUA 4NU0A 4XJSA 3RK4A 1VKJA 1QDLB 4EHNA 3N2GB 1L5HA 3VGPA 5IT4A 1SKMA 1GR0A 2GB4A 1FW8A 1W49A 2ACWA 3F98A 3HVKA 5FJJA 1OAOA 1IATA 5IAJA 4DZTA 3NHPA 2Z43A 1OBCA 3AB3A 3GLTA 3RVNA 1EFAA 3UWSA 4BKMA 5D3MA 3WBKA 4U7JA 5ENDA 1G18A 2DF8A 1A7JA 4D9NA 4PAGA 2FUKA 3E15A 3OPYI 1G6KA 1VOTA 1E94E 1ETHA 2IE8A 4J7CA 4YN3A 3ANMA 1L1FA 4HDOB 1LPMA 3BRSA 3IMCA 3VGJA 2GZ2A 4B4KA 1T0PA 1P8AA 2B5WA 2OOSA 1RI2A 2GCEA 3LVBA 3W06A 1SQFA 3NNNA 2H9IA 3DL4A 3ZU5A 1VL8A 4LY3A 3RQIA 1FQJA 2QM8A 3M5WA 3PNVA 4OB7A 3DXXA 3OAAA 3H4IA 1NF8A 1NVEA 5HILA 3WL8A 4H1HA 3AF6A 1IMJA 2PLRA 2V4MA 2V5UA 3AC0A 3ESAA 2OD7A 3OECA 1AO0A 2D2IA 1GAQA 3DM5A 1VE5A 3LI2A 4E1BA 1HDGO 3HNPA 3KVRA 2QYTA 1YZLA 3HVHA 3ORFA 4FFMA 2REQB 1W36D 5CFPA 2AC4A 4O0MA 1IOLA 5L95A 2OCDA 3P0FA 4YAGA 1JSLA 2BR4A 2QPTA 4E5KA 1PBTA 4HTAA 4E94A 1Y80A 1EI9A 2PFKA 4Y9TA 4ARSA 1B93A 1HYQA 2AS0A 2V1UA 2HH9A 1ZN9A 4ZIRB 1QE0A 4G2TA 1LBQA 4TRMA 4DA0A 4JUFA 1XJWA 3PHGA 4BQSA 4X62B 1WKCA 4EP1A 3M3PA 4NZ9A 4FCVA 3PICA 4QTUB 1BYUA 2AEEA 3VU8A 2B21A 3UQZA 5E9JA 3WGLA 2L69A 4PLFA 2QPOA 2IUYA 5KTNA 2YWGA 4MQBA 1YRLA 2E4AA 1OASA 1Z6ZA 3TZQA 1U1IA 2OM2A 4YJ2F 4FIDA 2WWYA 2XGJA 1PJ4A 5FTMA 3D7KA 2CDNA 5ALOA 1UIRA 3CVOA 2QB5A 3CLVA 3G5AA 3MLAA 4L74A 1QU3A 3PVSA 5AVKA 1U9YA 1X7WA 4MUBA 4O8CA 4DV0B 4UAJA 2C8LA 1RYEA 2W0SA 1FS6A 1W29A 4RFVA 3ZLJA 1UXHA 1Q0LA 4IGAA 3AW9A 2DH5A 2JCBA 4WLEA 3AESB 2I2DA 4IDDA 3ZKWB 3ZBTA 5CX1A 2W7TA 4JGBA 3ETJA 5I9IA 1PQPA 4BNTA 4DJEC 3J81k 4LS3A 3NHJA 4U9UA 2YZMA 5ILGA 4DY6A 5DN6A 1FRFS 1JPNA 2V7UA 3L6DA 2FKAA 3P2YA 4LXHA 1OCEA 1PG0A 3VI4B 2FDCA 1YTUA 5DM1A 2I9PA 3I4LA 3QEOA 1MQ8B 3AHCA 2CFTA 4ILKA 4PC6A 5K3SA 1E9RA 2OP0A 1T4MA 3L0PA 4B35A 1HV8A 3C5EA 2Q4BA 3QX3A 3E84A 1O3YA 1ZM7A 4NDNE 4JMLA 3T1VA 2CXHA 2WIAA 1RACA 3VH1A 4WSOA 1JF8A 3NEPX 2PQMA 2CLIB 1YU6A 2ZVJA 1QOPB 4PYJA 2XAAA 4WIAA 4XYGA 4MR9B 3EEYA 1JEYB 1KMHA 2GUWA 1X74A 2BBTA 1CUJA 3OTWA 4O25A 3S29A 3ZNOA 2V3WA 5K03A 1WHTA 2O8FA 5HMMA 3NHYA 2C61A 1QVVA 3ZHXA 1MDBA 2H1VA 3QU4A 1M1NB 1GTRA 1UBKS 1ZUWA 2E89A 2JDID 2ZUVA 5DK6A 2QAJA 5JLJA 4AI6A 4V0KA 4OHRA 2OAEA 3H2JA 1XZIA 5CJJA 2EBHX 2FEOA 2YFHA 3IB3A 4FW9A 2Z08A 1WULS 4BLQA 2FSIA 4DCNA 4DMUB 4AYWA 5DYIA 3KYJB 1XMQB 4LDPA 2XUZA 3HRIA 1RCTE 2FUCA 3IURA 2GJAA 3ANSA 1US8B 1ZRHA 5G4KA 2EXXA 2PUVA 3U4AA 4Q6BA 1HX7A 1U0HC 4WD3A 2B25A 1O5IA 5I8WA 1WQ3A 3PNOA 4IG4A 3G8AA 3L46A 3LUCA 3T7JA 2PT7A 1E59A 3BSYA 3FYCA 1VIDA 4MITA 1LJ8A 1H5NA 4B8WA 4GMXA 3CG4A 2Z8YA 1BA3A 3MTAA 2W2VA 2GPJA 4WN9B 1S7CA 3GG2A 4CZ2A 4Z86A 5HJEA 4R01A 2DQKA 2YMPA 1SXJE 3CWZA 1Y3BE 2OC9A 4WOKA 1GTMA 1ZUIA 4XLZA 3L0IB 1XPUA 1JIVA 1CY2A 1QBGA 3WLLA 2UV8A 3HHEA 4BVFA 2HSEA 4QU0A 1TYBE 1GRQA 4XWTA 4M55A 4LI0A 1BU8A 2CBGA 1ADBA 1SUPA 5D87A 4KVZA 5D6NA 4P84A 2VG8A 4FMCF 3CBGA 2B1IA 4OI1A 3QBJA 1YDGA 2UUPA 1T9GS 3HQ4O 2IU4A 2V7BA 2AR9A 2QZ4A 4TSKA 3TSYA 2ZETA 5C5EA 2IW1A 4UAUA 5FPPA 4EB0A 3KO8A 3AR4A 3Q9LA 4FHGA 4JOBA 4TKZA 3E9YA 4PX9A 1PJSA 3F7TA 1BHJA 3OKFA 4WKBA 2HA5A 4HPXB 3NUQA 2FQWA 3QSYA 4N3CA 4ZHQF 1TVEA 2QR2A 1AZTA 4RAQA 1YIAA 1O7JA 1T8SA 2XA1A 1TM4E 5CAEA 5HVNA 2HBQA 1A9SA 2IYXA 5KAPA 3ZHVA 2UAGA 1PQWA 3IVRA 1NI3A 3ONWA 4ZCMA 5IWCA 1S0UA 2QZSA 1ZD5A 3KYDA 3LZ6A 2CE2X 4H3SA 5LZ8A 1XA3A 2FX3A 4D3DA 3FPBA 1KRXA 4Q15A 4JV5B 4LX0A 4CGYA 3FCYA 1FBTA 4A9AA 1C7ZA 2V6GA 3CJTA 4Y6QA 3IERA 5HF8A 3G13A 3KIPA 2NADA 3ZVRA 3L7OA 1KQGA 3MHTA 3I61A 2Y71A 1X13A 1L5GB 5M5BA 4Q3BA 4J7XA 1H1TA 1JIJA 4JR0A 4QU5A 3AIOA 3HB4X 2ZQ5A 1GSIA 4B6JA 1SXQA 1YL5A 3I9KA 4ML3A 1ZGCA 2ZIWB 2AEFA 3UATA 2J7PA 1MPTA 2BFPA 1XZGA 1VSTA 2WM2A 3UHOA 2IXBA 4AF8A 4C4PA 1A9XA 2CUZA 4UQOA 4B47A 3HI6A 3RVRA 5CNMA 3U61B 1GTL1 3WY9A 1COWA 2C7QA 3BDVA 1ZD9A 2P4SA 4GX2A 4ALIA 2F67A 3D2BA 3DMDA 2H29A 4L9AA 1YZYA 1E96A 2D1RA 3H9EO 3ZVMA 2DX7A 3L7YA 1GGMA 4BFLA 3D6VA 4FNAA 1U0LA 1HQCA 3RYFA 1UT5A 4QVGA 1VIAA 5U9CA 5IT5A 3C3JA 4CTNA 5DYWA 3HCDA 3V8MA 3LX8A 4EYQA 3QX7A 5BR7A 2OORC 2P6PA 5KX5B 3AHFA 1AN0A 4IDPA 4QDOA 2C9YA 4S05A 5AI4A 1HEUA 1PLKA 2PXXA 3CGWA 3OKCA 2CYBA 1FF9A 5H3LA 3VDQA 2R6JA 2NU8A 3KTAA 2N1MA 2N42A 3N6VA 1ORTA 1C0EA 4B8YA 1IQRA 4ZDJA 3E9DA 5FWAA 1RZVA 4IYJA 4N48A 3HMQA 2QJFA 4HS9A 4N8EA 2GK6A 2PGIA 3M5DA 3L07A 1PZGA 3Q40A 4L07A 4NZNA 3VSCA 4ZZ2A 4DXHA 5ITSA 1P1RA 5JC1A 3HA7A 3ZWXA 4IQGA 2AG8A 1U99A 3CB4A 5K0GA 2C5LA 2FUEA 1Z34A 4L7QA 3ODPA 5ETJA 4WZBB 3BVPA 3T7TA 1P81A 2C3YA 1UOEA 3EZ9A 3K6RA 2GO7A 3NWEA 3HCNA 3VSDA 2IIBA 4G5RA 5DIZA 3WWPA 1RJFA 1TF7A 5AOVA 3WGNA 3H3FA 2JIDA 3N0WA 4GPTA 4LJSA 4P4LA 2DHRA 4MAMA 4MV0A 3RARA 3U7RA 3V7FA 4V02A 3KHKA 3A37A 3OQ1A 2C92A 3FUTA 3Q0EA 3R44A 1ZJZA 1ZG3A 3KPUA 3KQPA 4FOLA 4HYTA 1BMFA 3DSRA 5IZCC 3ICCA 4G9EA 4JJ6A 5HF6A 1A76A 4IDFA 1JAIA 1WZIA 4G6ZA 5GJWC 1WXEA 5EZYA 2AW3A 3W5IA 3OIVA 1A97A 3GQBB 5E7MA 3UEOA 1QK4A 3V4PB 1F9EA 3GROA 1ILEA 2ZTSA 2WJIA 3JZAA 4IV8A 5CM2Z 3UK7A 3HBLA 3G59A 3IDQA 5CIYA 4YJGA 3ST7A 3RSGA 4YUAA 2TSYB 4E2XA 2C2ZA 4JJ4A 5K6AC 4NJMA 1OXMA 2DWOA 1CUEA 2OPBA 3IQXA 3MSCA 1J24A 5DW0A 4PYIA 2RHRA 1QLHA 3U3RA 2ZYGA 2WTNA 4N5DA 4K6FA 4KXYA 3K30A 4XDZA