2IXEA

Crystal structure of the atpase domain of tap1 with atp (d645n mutant)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
GSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 76
structure length 251
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixeA01
3I8XA 1G17A 4UKDA 5EJEA 1KI6B 1US8A 1OSNA 1W2GA 2FEMA 2GAAA 2FV8A 2ZROA 4JMPA 3EZ6A 5C4MA 4ZIRB 8OHMA 4DXAA 1H8ED 1M6NA 2ZRNA 3MRSA 1YVDA 5FH9A 2JATA 5K8IA 1D8TA 1UM8A 4GZMA 4HLUA 4ITRC 2XTMA 3SJBA 3AVPA 2IW3A 4DLTA 3RRYA 3OIWA 3IHLA 3AF1A 1E79D 3X1ZA 2GNOA 4MRRA 1G3MA 4NZYA 4PQFA 4IVPA 4CDGA 1OB5A 5BN5A 2ZI7A 1ZAKA 3NBFA 1XJ0A 1GFIA 3BB4A 4XOIA 5EP3A 4B33A 3U44A 2GBLA 3VR1A 5SZJA 5TARA 1AS2A 4IOMA 1OIWA 2R65A 4EDHA 1XTKA 5EE3A 1W0KD 5JRZA 5LPNA 1N5KA 4KU4A 3CX8A 3PV0A 2ERXA 3NC1C 3BK7A 2H5EA 4MYCA 1XEXB 4V02A 3C15C 4Q4JB 4QHTA 1RPZA 1SHKA 1CS4C 221PA 2RB4A 1GG2A 3P4XA 3ICEA 3QUSA 1OB2A 1EWQA 3BOSA 4K81B 2YOGA 3JVUA 3O47A 4OL0A 5KSPA 3KTAB 4L5BA 4MQBA 4I4LA 2NO1A 1NN1A 3CRQA 3L43A 5P21A 3W90A 2QSYA 2V6IA 2YNMA 4PAQA 4A2QA 2YKGA 2W58A 4LRWA 2BCGY 2GCPA 3KL4A 4GP6A 1NNEA 4C4PA 4YONB 1MV5A 1GL9B 1CTQA 3OF5A 1XTSA 1G9XA 2H18A 1PUIA 2QRZA 4FCTA 3R8CA 2C03A 1T0HB 1UDXA 2NZJA 3MMPA 3W6PA 3U61B 1CJUC 5KO2A 1UEIA 2KB0A 2OO7A 2IYTA 4OBEA 1RJ9B 5EP1A 1S96A 5J47A 1Q20A 1XP8A 5K8TA 1G291 3C16C 1FQKA 4C3ZA 5KPJA 1OPXA 1W5SA 2EFHB 4PPQA 4KCGA 4BQSA 2BBSA 4EJSB 2GKSA 4M1KA 2K5UA 1HT2E 4KLNA 2IUSA 2C98A 4BFUA 2R6AA 3DL0A 1Z0FA 5ANRB 1Z63A 2OBLA 3JVVA 3GJ3A 1U0JA 1NBMA 4EIWA 3UKDA 3GLIA 4GZLA 1EFHA 1E2HA 4WAUA 1IBRA 2VP4A 421PA 2RHMA 3VU9B 4F4CA 3KQHA 1OFHA 4IHQA 4BUJA 4PSAA 4EAQA 2QP4A 4A1FA 3LA6A 3QXSA 1FW6A 1EK0A 1U9IA 1G4UR 4YLGA 3DKVA 3SR0A 5JEDA 1II9A 2WOOA 4KBGA 2IYUA 1G7TA 2FNAA 1DS6A 1MABB 1X1SA 2OCYC 4WOPA 1M8PA 2FZ4A 3J81k 4B71A 2J7PA 4JVSB 2FF7A 5HCIA 1QBKC 1GL7A 2J59A 1Q44A 2QGNA 3X1YA 1YHNA 4E22A 5JSZA 1YZTA 3T35A 1NJFA 2ZSBA 1HTWA 3WRXC 3LX5A 2UVQA 2JLUA 2ZR9A 2ONJA 2PT5A 1NSFA 2VIIA 3GEEA 2XOKA 2ATXA 4FN5A 1Z0IA 4Q1AA 4BFYA 1OJLA 1FX0B 2FG5A 1U90A 2FPKA 3RSLA 4BECA 2R2AA 1AJEA 3D7MA 4TMXA 5FUXA 4Z54A 3AVQA 3HR7A 3QKSB 4AURA 3ZD7A 4I1VA 3ADKA 2GEDA 2OAP1 3Q9LA 2G0TA 1GITA 3A1VA 3QIAA 4PO1A 3TW8B 1CR1A 1DPFA 3TQCA 3CRRA 1PUJA 4H1VA 3B60A 3CF2A 1KDPA 4O2RA 1GVNB 1KI6A 4XWKA 3M1IA 4A9AA 5JLJA 2G83A 1NBMD 4Q1BA 2GWHA 4JL6A 4MYUA 2E9SA 1JAHA 4TYNA 4ZV4A 1UAAA 1EG7A 1X6VA 1AQUA 4LZZA 2A9KA 1ZUHA 5LB4A 4M1SA 1NVUQ 1YR6A 2CVFA 1GSIA 2CBZA 3NKVA 4Q7KA 4DUGA 1X8LA 5DN6A 1D2EA 5EXXA 2J7PD 1R7RA 3T06B 4ACBA 3VMFA 1S2MA 2IF0A 4RY2A 3RS3A 3SN6A 2UKDA 4IDPA 4AK9A 1JPJA 3UIEA 3GJ0A 2YC2C 4FMCF 1YRAA 2ZSAA 3W8RA 4IOJA 4LC0A 1ZRHA 4Q1DA 5AUOB 3K70D 4IFEA 2XOKD 4JIMA 1E99A 5G3YA 2JLZA 1W7AA 1FP6A 2R9VA 4UXIA 2PEYA 4NKRA 5DLQC 3CONA 1XXHE 2O8BB 3KTAA 1XFAA 3KXLA 4YDSA 5TDHA 3CKLA 3BB1A 4PAOA 1WP9A 3K0AB 1DO2A 3ND9A 5H1YA 2FWRA 3AF4A 3DMDA 3CRVA 1JR3D 2G9NA 5EUMA 1JECA 3T1TA 4BZPA 2ONKA 2O0HA 1KY3A 5C1BA 3EZFA 3JZMA 2ZE8A 1OH7A 2IWRA 4E09A 1SVMA 2D06A 2RGEA 4XVRA 5JS8A 3IBGA 2CEAA 5JECA 2IXGA 2QY9A 2RGGA 3NH6A 4CT4B 5F3WB 1HE1C 3IQXA 4MGIR 1RJ9A 2WKQA 4Q48A 4RFSB 1ZUIA 3TAHA 2ZRMA 1ZYUA 3LXXA 4IXMA 3CX7A 3F0TA 5AJZA 2VP2A 1GKYA 1OXVA 5EP2A 4EJSA 2C9YA 3K0FB 4M9QA 3X2SA 1CJMA 5B58C 2IWHA 2CNWD 2ANCA 3FWYA 2ODEA 3EX7C 4DZZA 3TGPA 2X2EA 5KYKA 4OI0A 2GF9A 1GL6A 2D3WA 2G1KA 3I4LA 5DN6D 1G5RA 1Q3TA 1ZM9A 4EPVA 2J9RA 5KDLA 3VU9A 2QN6A 1OH6A 1Z8FA 1E2NA 2QAGC 3A6PC 3WHLA 1V5WA 5FBLB 2NPIA 4B73A 4CEJB 3WMEA 1N2CE 1FP7A 4JSYA 1SVWA 2ASEA 4JKIA 1TQ6A 5FUWA 3OIVA 2IYSA 1MABA 1E9CA 1OW3B 1RRPA 2VP0A 4CT5A 4NCKA 4NONA 4ZPXA 1Z6AA 1NMXA 1AGPA 3L2OB 1QG2A 1WE2A 4ABYA 1AM4D 2IT1A 4KXFB 5FBRB 4TLCA 1LF0A 2PT7A 2QUZA 2WWHA 2ZYTX 1KI9A 2W83A 1QHNA 3QENA 4EKDA 2OLKA 1X3SA 3NC0C 1KO4A 3QY0A 3K0CA 1I4TD 4PQRA 4TMWA 1IN6A 1IXRC 2F3RA 5FPYA 1T5IA 3Q5EA 1AN0A 5A4JA 5CIQA 1G4AE 4C7OB 3X1DA 2VHQA 1FX0A 1WXQA 1ZCBA 2B21A 2C99A 3NEJA 3I1FA 1DEKA 4ARZB 3IILA 1ZNWA 1F48A 1KO5A 3ZH9B 3B2EA 4G5OA 2ZS7A 1WMSA 1VYTA 2V55B 2PMDA 4HB4A 4JLJA 4Q21A 3FMFA 2QE7D 4LWZA 4AYXA 3VX3A 1VECA 1VG0B 1LFDB 2Z43A 2X2FA 2H92A 1S0UA 3SBDA 3WRYC 3ZIAA 2ZTSA 2OUKA 1OFUX 2ECKA 2TMKA 2W00A 2FFQA 2D7CA 2J5XA 2O8CA 3U4QB 4OK5A 1T3SA 2FEOA 4TQAA 5GVRA 3GJ8A 4TT3A 3U3RA 1WF3A 2FJUA 2KJQA 1N5JA 3K0EA 1E96A 4HUTA 2I1VB 3ZQ6A 4B2LA 4M1MA 1GAJA 1R5NA 3LW7A 4YC7A 2NQ2C 2QI9C 3ASYA 1T8TA 1E2DA 1NKSA 1XTQA 4D0LB 1VHLA 2WJYA 3VQTA 2W6JA 5J4VA 2ZRJA 3PUVA 2ZI4A 1J8YF 4F93B 2VRWA 2PZGA 3CM0A 1H8HA 4GOJA 5EE9A 1G3RA 5FL3A 3A1WA 4A0GA 2ORVA 3JZAA 4QHYA 4NYJR 4LV6A 4LYFA 1WA5A 3PITA 5A5GA 4B75A 2RAPA 3SQXA 3V9PA 2R6FA 4LJ4A 1W4RA 4MGKR 5AJYA 4JLVA 1E9EA 3FOZA 1QHGA 2FZLA 1I2DA 2IXFA 3B13B 3EA0A 1EFTA 4TLDA 3MUFA 5G40A 3GMTA 3FGNA 2PCLA 5ELXA 1YJ5A 3W5JA 3AV0B 2BJVA 2F6RA 3U3JA 1LV7A 1J99A 3FFAA 2O8BA 3IUYA 5BWMA 4GOKA 3RRZA 3VKGA 4NYJQ 4WIAA 3LNCA 4FXPA 3WNCA 2ZAOA 2GXAA 4KYUA 1D9ZA 3I72A 1CF4A 4ESVA 1JPNA 4HUQA 2F43B 1II8B 3OEHA 5FFMA 2AR7A 3GQBA 4O0MA 3SYLA 3W6OA 4BFWA 3UATA 1BYIA 1DAIA 4Q18A 2PZEA 1ZIOA 4JJKA 4BFVA 4LJ8A 1KGDA 2ZETA 2WHXA 2J0QA 4TMVA 2HT1A 5CK5A 5KDDA 5FL7A 3UPUA 2CHVA 1QZXA 4NTZA 2WJIA 3GJ5A 5D3MA 5FR2A 1OXXK 2ZUCA 4OHXA 1COWA 4QGHA 1M1YE 2AXNA 1KK3A 3K0FA 1QHIA 5EE5B 2YWEA 4D80A 2GCOA 3EIQA 2HJVA 1B23P 1DG3A 3REFA 3ZZUA 2A7QA 2KBFA 1G18A 1AQYA 4AD8A 2W6JD 3IDQA 1KDOA 3A4MA 3GLFE 1GIAA 4DLXA 3OE7A 1L2TA 2CVHA 3P32A 1G8PA 1TQ4A 4TZ6A 1YU9A 4XJXA 2GTPA 2GILA 1DAHA 4LC1A 1CU1A 2F1JA 1D6JA 2ZI3A 1C9KA 1IAQA 3NVAA 3BXZA 4RD2A 1IN5A 3GEHA 4OJQA 3FYHA 3BAFA 4QNMA 4DIEA 4HAXA 1KAOA 2WIAA 3LH5A 4Q9JA 1JR6A 2E87A 2ZM5A 2XSZD 4XIGS 4OHZA 1CJTC 2OFWA 1E1QA 5JWOA 4D81A 4ZO4A 3KZ1E 1Z5ZA 3D6TB 3NDPA 4D26A 4Q4LA 4DDUA 2AXPA 4PO9A 1VCIA 4I1UA 4ILEA 4PSKA 2C9OA 2BM0A 2EQBA 1JNYA 1CIPA 1XJQA 3A8TA 3OEHD 4M1OA 2ZRGA 4US0R 5IDVA 5KNDA 4BE7B 1A2KC 1G7RA 3ZLJA 3BERA 4LBYA 1X86B 2FDCA 4C7OA 3PUYA 1LS6A 1BMFA 1G19A 2FSFA 2ZJ8A 2OILA 1MRNA 1IQPA 1F2UA 5FL7D 2GVDC 3IEUA 4UNRA 4L9SA 1N5LA 1COWD 4BRWA 3ADCA 2A78A 3Q3JB 2IUTA 1KJZA 1XXHA 2JLRA 2GEUA 4V0ME 4TYQA 3QF7A 1OYWA 5LD2C 1FUUA 3AVOA 3GP8A 1P7CA 5CJ2A 3W9YA 3C41J 3U44B 4IEIA 1BIFA 2BKUA 2RMKA 5AUPB 4Q1EA 5JJKA 2Z5FA 3FHOA 2ZR7A 2IX3A 3RHFA 3PUZA 3U4QA 1F2TA 4NP6A 3LQQA 4W5WA 5FBWB 1IM2A 3LAWA 3C5CA 3OHMA 5FOVA 3I92A 1T0JB 4LHYA 1JJ7A 2Y8EA 2ODWA 2AX4A 2HXYA 4L8GA 2RH5A 2XB4A 4BLSA 4W5HA 3U60B 1ZIPA 1O3YA 3K0SA 4MGYR 2WOJA 3FHCB 1WRBA 5DIFA 3CWZA 2XB2A 3U6KA 1XTRA 3FFBA 4JVLA 5TV2A 4ERNA 2IS2A 4TL8A 4QBHA 3P20A 4HB2A 1E1QD 5TB5A 3REGA 2CL6X 4K8OA 1Z6TA 2X1VA 2B8WA 3A58B 3MWLA 3VR6A 721PA 4B74A 1JEEA 1C4OA 1A2BA 2MSCB 2GDJA 4R71A 1YRBA 5JWHA 2DFKB 4IFBA 4TTQA 1BMFD 1N0VC 1T3HA 3SFZA 4PZLA 1Q12A 2HV8A 5JWRA 3HWSA 2DWPA 4TMZA 4NCIA 2BM1A 2GZDA 3H1TA 3IIKA 3LLMA 2F55A 5EXTA 3GLGE 2F43A 2HLDA 5CDFE 2GXSA 2ZE7A 1XD2B 1GZSA 5E7IA 4TLEA 5FOXA 2ZRLA 3OFND 4GRAA 4M53A 2FFBA 2VHUA 3PEVA 4ZDKA 2GK7A 4HZIA 4JLBA 4Q4AA 4KFRA 4PSVA 2FH5B 2MSDB 3AKYA 3IGFA 2OCPA 3GLIB 1L4UA 1Z2CA 4PHTA 1X8JA 2JGNA 5DE3A 2XZLA 2GA8A 2QT1A 1T6NA 4KFUA 4TLBA 3TBKA 3WYFA 2ZSEA 5HZKA 5FUVA 4YQFA 4TYYA 2PX3A 3EC2A 4URUR 4C0HA 1J90A 4RKEA 3IO5A 2JLYA 3ASZA 1LB1B 2A5YB 4A8JC 4GT1A 3EWAA 3ZD6A 2QPTA 3AGPA 3A4LA 2IC5A 3EG5A 2ODBA 3KJIA 2ZSDA 4GMXA 2CK3A 3LY5A 1EESA 2FX3A 4R98A 2EWVA 4CW7A 5EUQB 3BFKA 3A4NA 4P4SB 3CF0A 2ZU6A 5JBQA 1MH1A 3ADDA 4U5XA 1NI3A 1WBDA 1FZQA 1ZNZA 1KI8A 1AGRA 4KO8A 4LPSA 4Y0AA 4DLVA 3QBVA 4RD1A 1WBBA 3NBZC 4XVUA 2ZRHA 4M0LA 2OM2A 2YYZA 2V9PA 4LV5B 4LYAA 4M22A 3SFVA 5EXSA 4MRVA 3VNVA 4EPXA 4D82A 3EIHA 3WP1B 3SJCA 2RHDA 3AF3A 4WXPA 2CE7A 1J2JA 2OE2A 2OSBA 4LYHA 4B6FA 4ESHA 1GNRA 3PEUA 2W2VA 4D0GA 2HLDD 3DVLA 1V43A 3VR4A 1Q57A 4D25A 1TQDA 5EE1A 1R5BA 3B1VA 1NLFA 1W4CA 1OLOA 3T5GA 1E2MA 1VPLA 3MD0A 3QSYA 3FKSA 4ON9A 4F7WA 4QNRA 3UMFA 2A5DA 3F8TA 1YZGA 4JKYA 5L3QA 2FU5C 4A36A 2QMHA 5KNCA 1SXJE 2WIBA 4HAVA 5KTYA 1G7CA 1P61B 2Q3FA 3LBNA 5HR5A 3PJRA 1NL3A 5GJCA 2V4ZA 2DY1A 1GTVA 1KJYA 1RW4A 2OG2A 3IPYA 5FI1B 4B76A 2IYRA 4BFZA 2XXAA 5JCPA 3GLGB 1KKMA 2BJWA 4L9WA 2CLSA 4IVRA 3THYA 2C8VA 2CK3D 4B3FX 3QNUA 3Q5DA 1XTJA 2A5JA 4P3YA 1RZ3A 3LO5A 1KZ7B 1TF2A 4TTRA 2CDNA 4DCTA 3TIFA 3EAQA 3W5IA 3THXB 3HPQA 2XZPA 1J7KA 5BYKA 1Z0JA 1W4BA 4AYTA 2VL7A 2DBYA 1GWNA 3AH8A 3BWDD 4DT1B 4P4TA 2WPDA 1M2OB 3ND8A 5DO9A 3F3YA 4QM6A 5SZIA 1OIXA 4JS0A 2ZJYA 4II7A 4B3BA 2IEZA 3CZQA 2QGZA 1YQTA 4IKEA 1FTSA 2EFDB 3DM5A 1MOZA 3FMIA 3NEYA 3KXIA 1WDTA 4ZCIA 2ATVA 1YZUA 3GLFA 1F6BA 1I4DD 2FFHA 3TQFA 3VR3A 4V0LA 2RGXA 1U81A 4DB2A 3L8ZA 4Q19A 1DAMA 4JT2A 1QHHB 4OHWA 4XWAA 1E0JA 1JB1A 4Q7LA 3IO3A 3H0KA 5DHAA 4TZ0A 3IKJA 4QJ4A 5C46F 4NDZA 4RZ2A 3BFVA 3EW9A 3FKSD 4LJ5A 5L3RA 1G8FA 3IPXA 2YINC 1W4AA 3SHFA 5LBIA 1HE8B 4CEHA 1XD2A 2QAGA 4V0NA 3T1OA 2BBOA 3HYRA 3ETLA 4KITB 2ZREA 2GXUA 4NU0A 2RGNC 2QM8A 1MRSA 2OHFA 3AVUA 2KI5A 3UWKA 1E9BA 1SGWA 2QQ0A 4TMKA 3HU1A 5J4YA 2ZRCA 4OI1A 3R7WA 1PJRA 1UADA 2J46A 5DNYB 3K9HA 2FGJA 3KKPA 1XPUA 4PX9A 4PO8A 3B9PA 1G64A 1VCMA 1KAGA 4DHEA 1P6XA 2BMDA 1UKZA 1TMKA 2HF8A 5KSOA 2ZU0C 4XTRA 2YJTD 1H65A 2ZRPA 1M34E 3GFPA 2H7VA 2R6CA 5JHGB 4KHZA 5JS7A 1SXJB 2J0VA 2WPDD 3I62A 3FHTA 3QBTA 2BWJA 1N6HA 4V0MA 1IXSB 4IRUB 4HZUB 1U0HC 2OCBA 3K9NA 2HDNB 3TE6A 3CW2A 5JHHB 4P4SA 1S1MA 2ZE5A 3KJGA 3DPUA 2WTUA 3L0SA 4GNKA 3PG5A 3WBKA 1TF7A 3KUCA 5KHOC 2BCJQ 1F60A 2QPOA 1JI0A 4YXWA 1ZMXA 4HLQB 2ZRAA 2QNRA 5C4GB 3TSWA 1RYHA 3DZDA 4X8HA 3AGQA 4LJ7A 3AVWA 3BORA 3T34A 3IBYA 1JJVA 3U7FB 4JT4A 5LD2B 2DR3A 3E5HA 4KODA 1LTQA 2YZ2A 4TL6A 1AZSC 4BLOA 3V4RA 2J87A 4LDJA 2UZ3A 2CLDX 2WWGA 3GFOA 3E1SA 5IRCD 1PLLA 4B35A 2CCJA 2WJHA 4A92A 3DHWC 3B1WA 2IUUA 4QG7A 4YMUA 1ETUA 5F9FA 2QRNA 4FIDA 1O87A 2CMKA 2EU8A 2ZJAA 3EASA 4DLSA 2VF7A 1W36B 2O8EB 1AS0A 1GKIA 1VTKA 1R0WA 2VP5A 5CLQA 2F1IA 2O8CB 2IYWA 5TMPA 1ZD9A 5FPKA 5DSZA 4MKIA 1IY2A 1UBEA 2ZI9A 4XSGA 5L3VA 2OZEA 2WMOB 2A2ZA 3WYAA 4DLZA 5FOUA 1DAKA 4WXRA 2O5VA 1SVOA 2BVNA 3RRMA 2CJWB 2QAJA 4M8NE 3I73A 5DYGA 5FTNA 1P4SA 2O8DB 1KMQA 2L0XA 2X19A 3RS4A 2JLXA 1RRGA 3PUXA 1NVVR 4TYPA 5CYPA 4Z1MA 3BJIC 1ZM4A 1Q1ZA 3UG7A 1F3OA 3GLGA 2DB3A 1MR3F 5CDFA 2DFTA 4C30A 4B48A 2VQSA 5E95A 4UXHA 2C04A 1YR8A 2BDTA 2B7CA 3QXXA 1RE0A 3SI7A 1RRCA 2FPMA 3BD9A 1YR7A 1VDZA 3SEAA 5B64A 3THXA 1T5LA 1XNJA 2PLRA 3DDCA 1E9AA 4JZKA 5C2JB 1E1RA 1TX4B 1UBFA 2GCNA 4QHSA 3AUYA 4DT1A 3MSXA 4YXWD 1Z0AA 2RGDA 5IHPA 3HU3A 5E3HA 2W0MA 1Z08A 5HE9A 2EVWX 2BV3A 3F5FA 1ZM3A 4A6XA 2IYXA 4Q7MB 3CO5A 1U98A 2QP9X 1E2QA 1IN4A 3AQ4A 4O2LA 2O0JA 1QG4A 1Z6XA 2A5FA 4HUQB 4EFMA 3H84A 2AN9A 1VG9B 3NBXX 3NHBA 1KI2A 2AD5A 4R7ZA 5FOSA 5J4KA 1R6BX 1UF9A 2VHTA 2XNSA 1UEJA 1GOTA 5UKDA 4FWTA 4JLAA 1QHHA 4F92B 2NG1A 2GESA 1HEIA 2WSSA 3MLEA 3RC3A 4A8JB 3D3QA 4JYBA 4O3MA 3QJYA 1QVAA 2CL7X 4PC6A 2D62A 2VBCA 1XBTA 2O8FB 5D3MB 4AY2A 1X8KA 5KDOA 3QPUA 1NG9A 2J41A 3VR2A 2VP6A 1QDEA 2PJZA 2QP3A 2GCOB 4FD2A 2OESA 2REXB 4XTCS 1T8UA 4YMTA 1KK1A 1A4RA 3GJ7A 3MJRA 3UMRA 4AI6A 4KLZA 1DE0A 4DUGD 4A6PA 4Z1MD 3QI2A 3NDBB 1P3JA 3WP0A 2VTKA 1SVKA 2C2HA 2IS1A 5GJBA 1Q1QA 2JASA 3EPKA 2P6NA 4KFSA 3SHWA 3T61A 3BH0A 1VMAA 2F1HA 2PJRA 1Z6GA 5D3QA 4PHGA 3WMGA 1E2EA 1YKSA 2HXSA 2BBWA 1SKYE 1E1RD 3TR0A 4LOAA 2ZJ2A 4TWZA 4ZKDA 3ZVMA 2D2FA 3EPJA 1SXJA 1XZQA 3RLFA 4I81A 3PEWA 1DO0A 4BGDA 4JVMA 4NE2A 4PC3A 4FW9A 4HZUA 4LSGA 5EE0A 3S1AA 3X1XA 2PMKA 2VSXA 4D6PA 2YOFA 1CULC 3FPAA 1VHTA 1PLJA 2F3TA 4FINA 3GJ4A 1FOEB 2P6UA 5EZ5A 3WNBA 1J70A 3WNDA 1MO5A 5H70A 3I8SA 1KY2A 2JDIA 2WSSD 2QENA 1GRRA 4XD7A 1RRFA 4TN1A 4LUCA 2ORIA 3Q85A 4BZXA 3RVBA 1F2UB 3PUWA 4NMMA 3TSZA 2QSZA 1HURA 2GEVA 3B6EA 4IVQA 3VKWA 3OESA 2JJ8A 4WA7A 2XJ9A 1XXHB 2GETA 1P5ZB 3FKQA 2BC9A 3WXMA 1SZPA 1HQYE 4EQ6A 4URVR 1GILA 3W3ZB 3AB3A 2HT6A 2QZ4A 2O8EA 1G1MA 2OBMA 4PZZA 5KNBA 1YZQA 2ZS9A 1E0SA 1OF1A 3QKUA 1TUEA 1MO4A 3MWKA 4OJKA 4BFTA 4TYWA 1EFCA 1F2TB 2NPFA 4JSTA 2VLIA 2EFCB 3VHLB 3Q72A 4D0NA 5HKKA 3K70C 3K53A 2P0EA 3CUEF 2B6HA 2CJWA 1XEWX 3QOFA 2O8DA 4PC2A 5K8LA 1XRJA 4EPRA 2BOVA 4DIDA 2F7SA 1FPMA 3U6BA 2IYQA 2XTNA 4LHXA 4IEEA 4GBMA 1A82A 1SXJD 1WQ1R 5HTKA 1X1RA 4OK3A 4NCHA 2FSGA 4JLDA 5EXPA 3RDPA 1RVDA 1EXMA 3NWJA 4TQUS 2XITA 1TQ2A 3V4FA 2ZUDA 4RCZA 4Q7JB 4YDHB 5G53C 4W7SA 3QEJA 4I1OA 4M9SA 3NTUA 3G0HA 521PA 5CYOA 1NN5A 3TRFA 3GFTA 3AP1A 2ANBA 3EA5A 4XD7D 4EFLA 1G20E 2JDID 3EZ9A 2ZRBA 4CGZA 1RIFA 4O25A 3T1QA 1TUIA 2NO0A 3GCGA 4K46A 2GJ9A 3DO6A 4FCWA 3TK1A 2ZXUA 3IHWA 1LVGA 1S1CA 1XPOA 4QOSA 2VPPA 5TXGA 3CRW1 4CYMA 1E9RA 4OYHA 1JBKA 1R8SA 2H16A 4I99A 3RANA 3O8CA 2XEXA 1DADA 3A1TA 4Q4AB 1W36D 2YV5A 3ZIAD 4A8JA 4OQFA 1IN8A 3THWB 3QEOA 4DEXA 5KOYA 1TEXA 2N1BA 1Y63A 3QF4B 1S3SA 3T12A 2O8FA 1W0JA 4JBWA 2G6BA 4GP7A 4TT3D 2HEIA 4RCYA 2QEQA 4JLOA 5HKKD 4PTLA 3CPEA 2G0NA 3EPLA 1AK2A 1BO6A 3KKMA 3D31A 1E4VA 1ZD8A 3ZS9A 1CRQA 4M1TA 1DOAA 3DZ8A 4C0SA 1H8HD 5G3ZA 3VAAA 4ACAA 4EPWA 2EYQA 1KI1A 1W5TA 4C2UA 1E0AA 4ZCMA 4OI4A 4AYWA 1J8MF 1S9DA 3PQCA 1KOFA 2Z4SA 3KFVA 5HE8A 3C5HA 3U7HB 1KZGB 2H1LA 1N6KA 2DFNA 1OXSC 2QMUA 4H9GA 2DWOA 4PPGA 2VP9A 3KKQA 3TNFA 4PR0A 4Z8YA 1Q0UA 1RKBA 3BC1A 1P9RA 3GPLA 1E2GA 3AEZA 4NCNA 1N5IA 1T3LA 1ZVQA 3K9LA 1Z06A 2R6DA 1ZNYA 1LW7A 4MYHA 4E5UA 3AVXA 1YZNA 3TUIC 1BOFA 2CCKA 4M1YA 5FPTA 4OHYA 1E2KA 2RGAA 2QM7A 4S35A 1VCOA 1E9DA 1SKQA 4QL3A 1TNDA 3U3MA 1OH8A 4Q66C 4BLTA 1W0JD 1Z47A 1DAGA 1NP6A 5L3QB 1AA9A 3QVVA 2WM9B 2WMNB 1K6MA 3BFXA 1KIMA 1ESMA 2DCUA 3Q7QA 1P72A 4CVNA 4NYIR 4QXAA 3O8BA 5FPHA 1E69A 2XXAB 4KV9A 2HCJB 3NXSA 1M7GA 1G3IA 1IN7A 4WVFA 4CZ2A 3THYB 3FTQA 2J0SA 3AM1A 2Q3HA 2NO9A 3OE7D 2Q3MA 4OHVA 2HYDA 3RWMB 821PA 5EZ6B 2P2LA 4HB3A 5DI3B 1KYIA 2C5LA 3W8NA 4DSTA 4RVCA 4BRUA 1IY1A 4BEBA 3B9QA 3SU8A 3SYNA 3UWOA 2REBA 1ZUNB 2YHSA 2NZ8A 3WMFA 1KI7A 1MT0A 2NO6A 1CR4A 1GUAA 2MMCA 2QTFA 2REOA 1ZC3A 2QORA 1R10A 2D4HA 2EFGA 2FSIA 2GJKA 1NLYA 1S3GA 3ONWA 4TLAA 4UJ3A 1E2IA 3MWJA 1YZLA 3QVUA 4PC7A 4CF7A 3V00A 2ZYWX 2QA5A 3TH5A 4HI0E 4M2LA 4M21A 4MKFA 1G16A 5EP4A 3GLFB 4P4UA 2W2XA 4IOLA 2FN4A 3P27A 3ZVLA 3GD7A 3N2IA 3ZS8A 4BLPA 1ESNA 4G5QA 3H2YA 4W5JA 3L0PA 4LY6A 1G8YA 1XTIA 4ZI3A 1U2RA 3BIFA 3DOFA 1NRJB 3ZVRA 2KSQA 2O52A 4C0BA 1JR3E 5FTJA 4QJ3A 5M04A 2RGNA 4U00A 3UANA 1L8QA 1OIVA 1T4GA 2GZHA 5SZKB 1L7VC 1NSTA 2G1JA 2FFAA 4X8OA 5AK0A 2NO7A 4JLKA 3U7GA 4CEHB 3QQ5A 2QAGB 1XWIA 4FWIB 5FOTA 4EUNA 1N0UA 1NJGA 3UK6A 1KMHB 2WJGA 3BBPA 4KSBA 4Q01A 2Q21A 1XJCA 3THWA 1IHUA 1SVSA 2CHGA 3QF4A 6Q21A 1FUKA 3R7WB 1N3BA 1HQCA 4URXR 1DAEA 1GNQA 1KNQA 3CNOA 3ZYCA 1VKJA 1EFRA 4YMWA 4B6EA 2Q0HA 3AKCA 3CBQA 5L8VA 2ZSFA 2V1UA 1N0WA 4UNPA 3VTKA 3QXJA 5JJIA 4HAWA 2YWGA 1II0A 2WJVA 3ECCA 1CEEA 3DOEA 1JQJC 4LJYA 1Z3IX 4JLMA 3K8YA 3A36A 4Q1FA 4Q4HB 1XMJA 3CRMA 1HYQA 2QBYA 4GSYA 3AP3A 1Q1BA 1ZNXA 2NIPA 1DG1G 1VCNA 3H86A 4HDQB 1HV8A 1FMLA 3KQUA 1P60A 4LHVA 1D5CA 3SQWA 2KBEA 4C0JA 4GMDA 5TVKA 2IK8A 4ZDIA 4DCNA 2R8RA 4RD0A 4ZDJA 5DYIA 4TTPA 2CLCX 4MRPA 5AJWA 1G6HA 1MO3A 3TSOA 2QG6A 2Z6VA 3RNLA 2DPXA 2GK6A 5LB2A 3G82C 1QRAA 4S2EA 3EIEA 5HPYB 3N5CA 5KSZA 1K5GA 5GVSA 1AIPA 2H57A 4QC2A 4XH9B 3ICQB 1YE8A 1YR9A 5AJXA 4IOKA 4AIIA 3U2QA 4DCSA 2A5GA 3HDTA 2GHIA 2RGCA 4M1WA 3W3AA 4HEJA 4PC1A 3NHAA 2AK3A 1KTVA 2JIZA 3KB2A 2OXRA 2HUPA 3TMKA 1CKEA 3L8YA 3R9IA 2WVJA 3OIYA 1C1YA 3R20A 1NY6A 3K09C 4IDQA 4B44A 1FTNA 1XZPA 1ZM2A 4RKFA 2J7KA 1NG1A 1M7HA 4WZBE 3FVQA 3ZZTA 4B3CA 1G5TA 1NVXQ 1Z2AA 1EWRA 1IY0A 2WWFA 4N0EA 3KQKA 4R9UC 4D4JA 2IHYA 3K1JA 5BN3A 2J0UA 4L4UA 2P5TB 1VIYA 4UJ5A 5GJWC 5BW8A 5FBVB 5KU1A 2PEZA 2WV9A 1W46A 5DI3A 4Q03A 4QBIA 4B32A 3SJZA 1KI4A 3TKLA 2XTZA 3RRNA 4A0HA 1E4YA 1KSHA 2V8OA 2G3YA 4JVNA 3IEVA 1D2MA 1KNXA 4KSCA 2Z83A 4IDHA 4BWYA 5L3SB 2JLWA 2IYYA 3TJZA 3PEYA 2ZRKA 3CF6R 5JI3E 2YWHA 5AUQA 2JAQA 4HDOB 1XMIA 1KKLA 1Z83A 4PPFA 1FQJA 3IIJA 4PHFA 2ZIAA 4I1SA 4PPNA 4RD6A 2NMVA 3CH5A 1RFLA 3UMSA 2J3EA 4UNQA 3BGWA 2GJSA 4HSEA 4IW3B 2OBNA 2C9CA 3TR5A 4EPTA 1BKDR 4E07A 1Y3AA 2X8AA 1KSJA 2SHKA 1GKUB 1TU3A 1OH5A 1PZNA 4BZQA 1XCMA 4F91B 4NBSA 4AKIA 2F1RA 3VFDA 1F5NA 4DLRA 2MSEB 4DLUA 2YWFA 1G5PA 2JIZD 2HJGA 2PBRA 1ZINA 3AKDA 2PZFA 1FFHA 3KJEA 1G41A 1NKTA 5DHFA 3NH9A 1R8QA 4ASUA 4DCVA 4LI0A 3ZQJA 2AWOA 4G5GA 2BKEA 1FNMA 4RD4A 1TEVA 3GLHE 1KMHA 2VH5R 5CLLA 1A1VA 4POAA 1KHTA 2QMEA 2VA8A 2ZRIA 4V0OA 4QJ5A 5JJLA 2C95A 3KXKA 4AC9A 1UPTA 3CX6A 4U02A 3KFXA 3U7EB 3SNHA 4G5SA 2ZYVX 5EQTA 3KJHA 3KUDA 4X8MA 4KVGA 2VHJA 5HCNA 2ZI5A 3B5JA 1NMYA 4U7DA 3LWNA 4URWR 4DVGA 4KJZA 3OZXA 2CHQA 1PVOA 3C14C 4A15A 1GRQA 5FUYA 3LXRA 1OT3A 2QL6A 2WWIA 3WHKA 1JXMA 3I32A 4MKHA 3Q8XB 5SZHB 1W47A 2JLQA 4Q4HA 2YVUA 4B2PA 4LGMA 5F98A 1VYVA 2ZR0A 1TF5A 4B3XA 3D8BA 4G1UC 3MFYA 3S1AB 4DSUA 1TADA 4PANA 1NN0A 1HUQA 4QRHA 5HZHA 4MDEA 4YMVA 4NCJA 4OKSA 1FMJA 5AR1A 3B7GA 3KKNA 4HYYA 1B0UA 2WWXA 3VKHA 1NY5A 2YC4C 1CRPA 1VIAA 1K5DA 2Z0MA 4DWJA 2IBMA 2ZI6A 1XMVA 4R2HA 2NGRA 1WCV1 2QPAA 5TY0A 4B43A 1DELA 1G7SA 4HLCA 2HCBA 2LWIA 5JI2E 3MCAA 2GXQA 1G3QA 1Z22A 4RFVA 1EX6A 3SJAA 5JCZA 4MDFA 2V7QA 3DMNA 4LCBA 3B1ZA 1E98A 1VG1A 4LHZA 5E7JA 1KO7A 4WZ6A 4EQ6B 4ASUD 4UXJA 1D2NA 3B82A 3RWOA 3AF2A 3TVTA 1NIPA 1P9NA 4DDVA 4HAYA 2XZOA 1XD9A 1CR2A 2KE5A 3TLXA 3KDSE 2OT3B 1D9XA 1GRNA 4RD3A 2VEDA 1G6OA 3CR7A 5CJPA 5CM8B 1GM5A 1FNNA 1Z6YA 1OV4A 1JR3A 1UDWA 2EW1A 3PVSA 4P31A 2JLVA 3G5UA 1SVLA 2IYLD 1BYUA 3NG1A 4UQOA 2R62A 3B85A 4KFTA 1N6LA 2PL3A 4FMDB 1AZTA 4TL7A 5JFGA 1E2JA 2ERYA 3OAAA 4G3XA 4ZIRA 2VHCA 2QMOA 2AKAB 2I4IA 1T9HA 2G88A 4QGGA 5B2ZA 4FMBB 5AUNB 2FA9A 3GLHB 3PENA 4LBVA 4OK6A 2FGKA 4MRNA 5JEEA 1QF9A 2W6IA 1RYFA 3QG5A 2ZRFA 2ZJ5A 4TMTA 2PX0A 2CNWA 3IIMA 3EARA 1Q21A 3LDAA 3QPVA 4RJLA 4XSHA 1R2QA 4BASA 4L16A 1UBCA 3ZGXA 121PA 4QFMA 1TL7C 1DARA 2NTYC 1IJEA 2MMGA 1K8RA 4Q9LA 3E70C 4D4KA 1CR0A 1NVVQ 4MA4A 5L3SA 4HLUC 2ZJZA 3CNLA 2V54A 5KUTA 2AK2A 2WAYA 4MGZR 4EPYA 1W1WA 4JLPA 1PLKA 1E6CA 3RS2A 5E7MA 2V7QD 1OE0A 1Q22A 1IJFA 4B47A 5KPDA 1JALA 2JJ1A 1MKYA 2GBLC 3EWSA 1XEXA 3QG1A 2RCNA 2XAUA 1CJVC 2BMEA 3FMPB 4Q4JA 3M4YA 4H1UA 1ZJ6A 1ZU4A 1AKYA 3QXHA 5CM9C 3W6NA 4AKHA 4PAMA 4DLYA 4D4MA 1CP2A 4OI2A 2OFXA 4V0KA 3FE2A 4JL5A 4DDWA 2JA1A 4US1R 3C8UA 1A7JA 2AL7A 2OFOA 1KSGA 1U94A 1QHXA 3P1JA 4LJAA 3WBJA 1P2SA 3P26A 1NLZA 3CLVA 4F4JA 2N46A 1DBSA 3CPJB 1Q3HA 2AWNA 2ZVPX 1VYUA 3CB4A 3LVQE 1QHSA 3BH7A 3OAAD 4JYCA 2V6JA 3AVVA 3EC1A 1CLUA 1UBGA 5BXQC 5FI0B 4LYJA 4UNNA 2AHOA 3C4JA 4DCUA 2GJ8A 2IS4A 2QE7A 5E4FA 2IL1A 2W6ID 5FTLA 1LY1A 3DEFA 3GJXC 3ZZ0A 1TU4A 4WW0A 1OYYA 4WBSA 2ZQ5A 2VSOA 3LBHA 1UJ2A 2WKRA 4AG5A 3H4MA 1HY3A 2QROA 3QXCA 2ZE6A 4RZ3A 4C0KA 1P2VA 3GJ6A 4KBFA 1G3UA 1E32A 1P75A 3CPHA 1I2MA 2CCGA 3SZRA 1IXZA 5JMTA 4W9MC 2GRJA 4A4DA 1OHHA 2ZPTX 2XX3A 4ZKEA 3RSOA 3GEIA 3MJHA 4BFXA 2JJ1D 2ZJBA 3B8HA 4DRZA 2PLFA 4OQXA 1ODFA 1DTSA 2WICA 4QBFA 1KSFX 2Q6TA 3P4YA 5FR1A 3WY9A 1ELOA 2I1QA 3RYTC 1U9IC 3LD9A 4B34A 2RGBA 3QE0A 5BN4A 2OV2A 1ZC4A 2ZVQX 4R2IA 1JEDA 4NYMR 4LBWA 1P2TA 1N6RA 4DKXA 1EX7A 2IYZA 1MO6A 1OXUA 4JBYA 1XU4A 2JJ2A 3EPHA 2QTHA 3U3KA 4C0LA 1Q1EA 3KKOA 4JBXA 3RAPR 4GPTA 4JJZA 2OCAA 4D4LA 3R9XA 2C78A 3C7KA 3QKSA 4GOXA 1R5OA 5J40A 4Q9KA 2WKPA 1OFTA 5AWFC 2WAXA 3TUJC 1YZKA 4TQ9A 4D2IA 4BPBA 2IYVA 3E2IA 1E0KA 3LV8A 2DHRA 2ZEJA 1P62B 1UKYA 2P65A 1W2HA 4NYMQ 1ANKA 2J1LA 2ZYUX 2QU8A 2LKCA 2OEPA 2P67A 3AUXA 2ZANA 4M9ZA 5FTKA 3BB3A 1R4AA 2AFHE 2I3BA 4DJTA 4TSFA 2C96A 4G5RA 3L0OA 4DLWA 4WZAE 2E1RA 4MITA 1U0LA 4LHWA 1ZP6A 2P6RA 4MRSA 1HH4A 2IEYA 2JCSA 4P33A 4DEYA 2NOAA 3PXGA 3GLHA 2DWQA 4CEIB 4NHOA 3OIUA 3U5ZB 2HF9A 2VYFA 3LLUA 5A0FA 4C0AC 2IS6A 1ZCAA 2GVZC 1OHHD 2ZUBA 2JEOA 2KWIA 4PXAA 3EZ2A 3SC3A 1Z07A 3BH6A 2A30A 4PZYA 1KO8A 2EYUA 3NIBA 1EFUA 2Q9BA 1SKYB 4X8LA 5G41A 5CITA 1NN3A 3PIRA 2F9LA 4US2R 1R0YA 4DC9A 4GFDA 3HYTA 5GADl 2P5SA 2D7DA 1UKVY 3LFUA 4AKGA 2BEJA 3AKEA 1U8YA 2ODNA 3DM9B 4N1AA 2CL0X 3DKPA 2JLSA 3FMOB 4B3DA 3RS7A 4F4IA 1SVIA 1N6OA 5DGXA 3AF0A 4AKEA 3KQNA 1NMZA 5IF9A 4OQNA 1NVWQ 2JJ2D 3QKRB 4EFNA 1S4QA 2XSZA 1R0XA 2R44A 1ZD1A 5DI9A 5IK2A 3O8DA 1W48A 2FMXA 3K0AA 3HR8A 2IXEA 4FCVA 2OAQ1 4YMSA 3RC8A 1L4YA 2EWWA 4A2PA 5J4LA 4RZUA 3LBIA 1XX6A 4DB4A 3AP2A 1P9WA 3FDIA 1EGAA 4MUAA 4TSFD 4IJMA 4C2TA 3N70A 4RSGA 2DFLA 4NPHA 2QBYB 1M7BA 3ZJYA 3BE4A 1XMSA 5IT5A 4GL2A 1A5TA 4CRWB 2H17A 3QKTA 1Z28A 4HLDA 4UNSA 5F2EA 3PR1A 4BLRA 4KI0A 4RFSA 1G8GA 1IONA 1XD8A 3QPWA 4MUBA 1S9HA 1I4LD 4LPKA 4P0TA 3RS0A 5DISB 4DBLC 2IF2A 3KQLA 4B2IA 2W0SA 4QGFA 4C9BA 4BLQA 1DVRA 3T1VA 1OKKA 4DDTA 1Z0KA 2P3SA 1ZW6A 1OFIA 2J45A 1JXOA 1UKEA 1U8ZA 4ZCLA 5FBQB 3ADBA 3ZVNA 4EJSC 3MGCA 2AFIE 1HA3A 3TAUA 3NBYC 5CB6A 2N42A 2BBTA 4OQMA 5J5CA 1BS1A 2ZRDA 2FSHA 4CEJA 2RKOA 1E9FA 3A1SA 4MH0R 4Q9IA 2VF8A 4Z8XA 5FOWA 2PH1A 5B30A 2WWYA 2FE4A 1U8AA 3K09A 4DSNA 4QBGB 2UZIR 3Q7PA 4FI3C 2QQEA 4B3GA 1LF5A 2CXXA 4G01B 2W2TA 4CIDA 3OEEA 3KX2A 2QTVB 1QVRA 3BRWD 3L82B 1ZM7A 4KAXA 3MG9A 4PFSA 3TW4A 3BS4A 5IK2D 2O0KA 3SDZA 1XDBA 4TL9A 1TPZA 3L0IB 1KK0A 2WJJA 4ZDWA 1WB9A 3M6AA 1NBME 3CNNA 2WWWA 4A2WA 3GLIE 4IXNA 4M9XA 1SXJC 4Q47A 4URYR 3VR5A 4A82A 5JRJA 2BMJA 2OLJA 1KO1A 3EXAA 4URZR 4N3NA 4QKQA 1US8B 4HB0A 1SULA 2AKYA 1GDDA 4OQLA 3HP1A 1LNZA 3SS8A 4ARZA 5C18A 1XF9A 1N25A 2J0UB 4L15A 1KI3A 2Q9CA 4E03A 2PCJA 4FMCB 4N0DA 3K0CC 3T5DA 3VNUA 3B1XA 5H68A 3LQRA 1KK2A 4Y0VA 4LBZA 1U99A 4NH0A 4QGAA 4A0RA 5GJVC 3OFNA 4NYIQ 1OKKD 4HAUA 3UXMA 1E2FA 4LV8B 3UG6A 4GI7A 4P32A 4Q1CA 4AWXA 2DYKA 1CBUA 1KJWA 5DH9A 4XVQA 1KDTA 4RZXA 2D2EA 4BFSA 4CEIA 2CE2X 2WSMA 3CWQA 1T91A 3HJNA 1W36C 4ZI2A 1N6PA 4Q5IA 4XWOA 1KDRA 2FOLA 3WYGA 1E2LA 5FTMA 1G21E 3HPRA 4M4SA 5AJVB 3SYKA 1XCGB 3TVDA 1PV4A 2XGJA 4F38A 4GDFA 1GP2A 2GAOA 2F9MA 4DSOA 5BQ5A 2YOHA 3LVRE 3OEED 5J4HA 1XPRA 3LW8A 2A3RA 1P2UA 1TAGA 4FMDF 2XNDA 3KB1A 1LS1A 3RABA 4NL4H 5JZVA 3A37A 1RC8A 3R9WA 4Z51A 4KVAA 3I5XA 1XB2A 1P73A 3B1YA 3I5YA 2LKDA 2VSFA 1JAIA 2B7BA 5CIWA 1CXZA 3PFIA 5BYJA 3RS5A 1NIJA 3IQWA 3U3OA 5CK4A 1NF3A 4PQYA 2XJ4A 3QKRA 1SQ5A 4C0QC 2WBLC 1Z29A 4HATA 1AS3A 4LJ9A 1E9SA 3A1UA 3SOPA 2V1XA 4Q02A 2ZAMA 2GF0A 1G8HA 1XEFA 4PHHA 3MWYW 2H8KA 3B78A 1OXTA 2R6GA 2G77B 3N2EA 3SE0A 1DAFA 2Z4RA 3EZ7A 1II8A 1S8FA 2IHBA 1ONBA 3LX8A 4JL8A 3O8RA 1R0ZA 1ZU5A 1XEWY 3SBEA 1ZBDA 2VO1A 3I61A 1UFQA 1XCPA 1H8EA 3CH4B 1FL9A 4V03A 2IA5A 4IDOA 4Q9HA 5H8WA 2ZITA 1E3MA 2QT0A 1N6IA 2LCFA 2X77A 1E79A 4MYTA 1HT1E 2BEKA 3K9GA 4AG6A 2ZS8A 4KYIB 3TUZC 3VHXA 4G0NA 3AVTA 2BIFA 1TTTA 1AKEA 2BHRA 1JQLB 4LX0A 3CR8A 2ZJOA 2D74A 4MKGA 4A0FA 5B57C 5LDDC 4HDCA 2Q9AA 5KSYA 3LRPA 1W0KA 1GNPA 1N6NA 1M74A 2WZQA 2AD1A 5JSZB 5FPSA 2HYIC 3I3SR 2GZAA 2XNDD 1W49A 5F9HA 3T15A 3CIOA 4HAZA 4QM7A 3FB4A 1IOZA 1SHZA 4BEJA 2BMFA 1QHYA 3K70B 2EFEB 2C77A 3X1WA 4LJ6A 1E94E 4J0QA 2V3CC 1W44A 3VX4A 5K8UA 3AVYA 4IDNA 3HU2A 3W34A 5CB8A 4Q00A 1E2PA 1EFRD 3M0EA 3MAAC 3ZDQA 3THOA 1VG8A 2B92A 1BH2A 2ORWA 4LK2A 1CJKC 3CZPA 1Z0DA 2OXCA 4JLNA 2B8TA 2GJAA 3R8FA 3PCRB 621PA 2FPLA
chains in the Genus database with same CATH superfamily
4CT0A 2ZYDA 3E4CA 4O4IF 3T5AA 3ZG6A 3ZDDA 2ZROA 4K7JA 5LYYA 2FEMA 4Y1GA 2X5XA 1GGJA 4BBPA 3M5CA 1W6UA 2BR3A 2ZIVB 4OMUA 8OHMA 3PS9A 3DHNA 1H8ED 1MX5A 4DXAA 1M6NA 2ZRNA 1XQXA 1MVLA 3ZGVA 5FH9A 1QE5A 3Q0EA 4OCZA 5CCEA 2HRCA 4GZMA 5I9MA 5BR1A 2IW3A 4C3UA 3AF1A 5IKOA 3X1ZA 4BQRA 3TJMA 3NDRA 2GNOA 4NZYA 5A62A 4M38A 1GZ4A 1MOPA 2PANA 3H19A 1OB5A 1N7IA 1A97A 1EVLA 1YB7A 5ICEA 4WK4B 1MXFA 4B33A 1GFIA 3BB4A 2OG1A 5HK9A 1FSZA 1H2BA 2LVBA 3H5TA 2GPSA 5DHPA 3SBOA 1PE0A 5K3FA 1KGSA 2PS1A 1J2TA 2P7IA 1EGMB 4H0FA 4D42A 1KYXA 4IIBA 5BMVA 3ANYB 4KMMA 4LYYA 3F2VA 1XA4A 4RQTA 4KU4A 4A16A 4UBJA 2ZK7A 2P75A 3NC1C 2VOJA 4V39A 3L07A 4JT8A 1C80A 5D51S 4EH1A 1VA5A 4MYCA 3I0NA 1EE2A 1AQLA 3O0TA 2VYCA 1OBHA 3G2QA 2Q99A 3PC8C 221PA 4KPFC 3ICEA 3QUSA 4XDYA 1EWQA 2NAPA 4L7VA 4DADA 5F9MA 3UUGA 4OHUA 4GLJA 3DEYX 1YOVB 5KSPA 4IIXA 1UMKA 2HMSA 1X92A 3KTAB 5CTJA 3QYAA 2ATCA 4MQBA 4BDTA 3FWZA 5DNYB 2VQ3A 3SXJA 4MSUA 1RZUA 1VL6A 5B6JA 4F71A 1Z16A 4CM4A 4WXHA 4A2QA 1NUUA 2W58A 3E0QA 4O1MA 2BCGY 2GCPA 2R5NA 3HKBA 3LLCA 4GP6A 1HKHA 4OOFA 3SXUA 1CTQA 3UY4A 1NM5C 3MS7A 5JSQA 5AW2A 1RXUA 3W06A 1R6XA 4CLRA 4ZYYA 3DLCA 1UDXA 3MMPA 3KEFA 3OCXA 2WIFA 2WWYA 2W6CX 4JK3A 3FA2A 4OXKA 2IYEA 3U61B 4DG5A 1THGA 5I8PA 1UEIA 4N5IX 2KB0A 3NEPX 5DKFA 5KAPA 5K8TA 1S96A 1MA3A 1XP8A 1V5IA 1G291 3AJDA 3U7JA 1C7EA 5GIPE 4MS1A 1FNCA 1GO2A 3AESA 3AFMA 2AEFA 4R0NA 1FQKA 3VNQA 3WMWA 4B9EA 3EVFA 1FYXA 1YOBA 4PPQA 4P92A 4V38A 5TE9A 3UMJA 4BQSA 4CBVA 2HWKA 2OMEA 5JZMA 2FRDC 2GKSA 1EVZA 2K5UA 1U7PA 3GP5A 1T36A 2C98A 3L4EA 4YCLA 4ND7A 4UC0A 2R6AA 4EY5A 2AN1A 3GMDA 1GPDG 2GHQA 2W6OA 2OBLA 2ZXEA 3GJ3A 1TM5E 3JVVA 4FUQA 1HDOA 1YNOA 4V2IA 1LLDA 1K8YB 2EW8A 4WAUA 4MS3A 3IEPA 1IBRA 3UWPA 1QCDA 3VU9B 4F4CA 3STYA 2HDWA 3IUMA 5B4VA 2HU7A 3BPSA 4BUJA 5CGQB 3LA6A 4RF3A 1FW6A 2GRUA 4EHLA 1MC5A 2Q0SA 4YLGA 4G4GA 2WU4A 5B53A 3SR0A 2C07A 2GWRA 3N3AC 4Z4EA 3F8WA 3I4FA 3O75A 1DS6A 2YFKA 1MABB 1FFSA 5I8ZA 3J81k 1M8PA 2FZ4A 3A1NA 3V7WA 2I2FA 5IN5A 2GN8A 3CLHA 3BULA 4ZRMA 5HCIA 3IJPA 2BW0A 1GL7A 5THQA 4DA8A 5AK3A 4FS3A 1IWBB 1YHNA 1E62A 3BSSA 1HFJA 2VK1A 4G5FA 5DM1A 3C3CA 3N2GA 5BN4B 3UT6A 1NJFA 1W76A 2V6GA 3I6MA 5T6MA 1TO6A 3MCZA 3HI6A 1NTOA 1Z0SA 3OF2A 2UVQA 1G2PA 2JLUA 2ZR9A 5IC5A 1NSFA 3EC7A 3LLVA 1U11A 3V55A 1YL5A 3ZQUA 2XW6A 3RH0A 5SICE 1GYQA 1Z0IA 1EK5A 4Q1AA 3SZGA 3WIUA 5JSFA 5CNJA 5AK6A 5H82A 3JZFA 1FX0B 1JBEA 1VHDA 3WX0A 4BECA 3VTFA 2FR0A 1AJEA 2PD4A 3D7MA 3NM5A 5FJIA 2CF5A 3QKSB 3PGLA 4AURA 1NPTO 2FMHA 2IPOA 3MCVA 1EE9A 1VSQA 2B8EA 1E89A 2GEDA 2NLOA 4E4YA 1ZOIA 1XYYA 3NVDA 2I62A 4L4SA 4DG8A 3AFNA 3HO8A 1OZ0A 1JDUA 1UQTA 4AS3A 5L40A 2NM0A 1U3WA 2XADA 3DDNA 1U2DA 3ZIDA 3AFHA 3NJ4A 4F6CA 5IUJC 4H1VA 3B60A 2NW6A 2X0KA 3DHEA 4Z7JA 3C6MA 1LPOA 3OKAA 2DU8A 1GVNB 2WNSA 1NF2A 4KXXA 4M1QA 3M1IA 1MPTA 2EKBA 2CUTA 3FPSA 4A5SA 4D3ZA 1TAUA 2B78A 3M83A 1XCOA 4Q34A 4CE6A 2EBHX 3UWDA 2Z3VA 3KBBA 2EL7A 3OZFA 4ZC1A 1X1EA 2R4UA 4RTPA 3HKEB 3DWIA 3M2PA 3M9XA 4YMIA 1X6VA 3JRXA 3QZUA 1AQUA 4ETIA 2TMDA 3MYYA 1A9XA 3PE6A 3BRSA 4Q9AA 3V8VA 2B3TA 4M1SA 1JHXA 1GGMA 1NVUQ 4L4XA 2CBZA 5JIBA 1JX6A 2P91A 1NE7A 1BE8A 3VSDA 4QUIA 2V4MA 3DMHA 3AO0B 3VH2A 3WGGA 4K0KB 1FLNA 2H54A 3JWGA 2OMKA 3T06B 4QASA 2RB5A 1W94A 1JG4A 2UXCB 3E35A 3UJNA 3SN6A 3AF5A 5FBZA 1R0RE 2UKDA 3D59A 2ROQA 1U0BB 4BB5A 2X0JA 2OQ2A 3OJ0A 4JCOA 4HGZA 4MQFA 4DIOA 4TRRA 5F7ZA 4IHJF 2PRKA 4NS1A 3MILA 2ZSAA 4LC0A 1OZAA 4Q1DA 4RWZA 3K70D 4N7BA 1OAAA 2OVFA 2YMLA 4JIMA 1E99A 3A05A 2IP2A 4G1FA 1FP6A 2ASVA 4J75A 3OUTA 4U2BA 2EJCA 3A3YA 3EXHB 1NFFA 3RUAA 4UMFA 3ZDEA 1XFAA 4YDSA 5HUJA 3UJ3X 3GYGA 3BB1A 2BFDB 1YDWA 1WP9A 1GVHA 1PT5A 5H1YA 3AF4A 3GZJA 3QV2A 4XQCA 2PGXA 2LDBA 3DMDA 4FFVA 1G8JA 2HF7A 1GV1A 2D1SA 3CRVA 3F2IA 3GH3A 4FYWA 4LY9A 4XI9A 4D79A 1TXGA 1YS2X 4BZPA 5IYZA 4O4LB 4DABA 1X1CA 5HMMA 4ZCTA 5GWXA 1OH7A 2EKDA 4E09A 2P8JA 3IELA 1X7GA 3GGGA 5BPFA 4F6RA 2Q5JA 2F8SA 2PQ0A 1I30A 1IQUA 2IXGA 2QY9A 2RGGA 3NH6A 5F3WB 1A9RA 2Z1MA 4MGIR 4ZVRA 1RJ9A 4IGEA 4MP8A 2WKQA 4TV9B 1FMFA 1ZUIA 2G4VA 2GN2A 1QORA 1A04A 2VP2A 1ZITA 2C1EA 4GSLA 2Q2QA 1YGYA 4M9UA 3AVWA 1VPDA 2YW9A 2AJDA 5I48A 3TGPA 2X2EA 4OI0A 3FROA 1U0RA 2EJTA 5KMGB 1PJZA 5HIKA 2D3WA 3G79A 3I4LA 1TZJA 2PM8A 4EMTA 1IC6A 1RTTA 2VQ6A 3D5EA 3SKYA 2DUWA 4K0RA 5KDLA 4CR6A 1K7FB 4NENA 5M34A 5DNCA 3D2AA 4JKOA 1OH6A 5DNUA 1E2NA 1GZHB 1V5WA 3GZNA 2C29D 4O4IB 4S1OA 3ZGOA 1G66A 1DXOA 1SBZA 5ESWA 4BOYA 4HXYA 1YKFA 1NVBA 3LPNA 1AHIA 1ML3A 1FP7A 1C1XB 4JSYA 4OGWA 4OXIA 1B16A 4P54A 1L7RA 1VKHA 5FUWA 3VUEA 1E9CA 1RRPA 1XVIA 2VP0A 2EKZA 4CT5A 4ZPXA 3KE8A 4OSEA 2AR9A 3ACBA 1QG2A 1UFRA 5KIAA 4BO8A 5A7GA 2IT1A 2FQ1A 3B1JA 4LOKA 4KH1A 4KXFB 5FWYB 1BGWA 2IZZA 1R0SA 2H52A 4Q7QA 1C0EA 2ZYTX 4RL4A 4DLNA 1OTHA 1WMFA 1OA1A 1XZCA 1Y81A 5ETJA 3VZCA 4OQDA 1KO4A 2ST1A 3GJRA 3QY0A 4MLCA 1RHUA 1A8IA 3A6ZA 1AUXA 2F3RA 1T5IA 1AN0A 2G6TA 1AB6A 2F4NA 4YB8A 5DYWA 5GONA 4DJJA 4B6EA 2A1IA 4C7OB 1L6IA 3GPDG 3X1DA 1WXQA 1WHTB 3HDYA 2QWXA 1WZ2A 4CM5A 4JJ4A 2X86A 1XRQA 2JRLA 1H69A 4M1ZA 4L5YA 1YT5A 4JLUA 2H4YA 1ZNWA 4ZAVA 1KO5A 5BSMA 3PRYA 3KJXA 2ZS7A 1Z68A 5MFPA 3LZDA 3QLVA 4HB4A 4Q21A 2QE7D 4LWZA 4AYXA 3OJCA 2JCXA 3V1KA 4BU1A 1VG0B 3O21A 4NNJA 4BV8A 1L7PA 4X1KB 3OM0A 1BGVA 2FRVA 2JEZA 1MJ5A 1P74A 4W6QA 3STUA 4ZYTA 1RJFA 4KE9A 2OKCA 3VTZA 2TMKA 3ANMA 1FFBA 1T4DA 1FDUA 2W2MA 1OZHA 2D7CA 3AJAA 1QLHA 4D1YA 3U4QB 4GW3A 1CUYA 2R8BA 4TQAA 4BX8A 3E9RA 5B3JC 5GVRA 3GJ8A 5B1HA 2WMYA 2NTEA 4HPXB 3VYSB 2XOXA 4NPCA 4WINA 1USGA 4HUTA 1JFVA 2ET6A 4M1MA 4FLMA 1PVDA 4YC7A 2QI9C 3ZE1B 3L7MA 3ASYA 3AV3A 1T8TA 3D9QX 4K6FA 3OTGA 4M6WB 2BGKA 3FSGD 4Z9AA 2WJYA 3ETDA 2G71A 1ZBQA 1ID1A 4FYPA 4LNUB 4RDXA 4MR7A 2ZRJA 4EECA 3HVRA 1AQIA 1RSZA 2YJ6A 2ZBRA 3DO8A 3WWYA 5IJZA 2QTWB 1X9GA 3EGDA 2PZGA 1C30B 5EE9A 1Z7WA 2JCBA 5FL3A 4BPRA 2ORVA 3JZAA 4QHYA 4XM2A 4LV6A 3PD1A 4JP1A 1ULTA 1WA5A 2QD4A 3PITA 4K9OA 1PS9A 2RAPA 5PGMA 4AMBA 5KS2A 4R9SA 5FCDA 4LJ4A 1IDN1 5IABA 5K6AC 1A5AB 1X7YA 1BDMA 5KJFA 4OQZA 1I2DA 1NBWB 4P3XA 3T9AA 4IJ5A 3ZY3A 4QUDA 5M2QA 1NQXA 3DFZA 2X40A 1RI3A 3W7BA 3W5BA 1RJGA 5ELXA 3AM4A 3GO4A 1QO0D 3AV0B 3I2IA 5CHEA 5DBFA 5BOSB 3DZBA 4FFDA 3U3JA 3TG2A 3FFAA 5CU7A 2FP3A 1P4GA 3EISA 3JQ9A 4L76A 3HUDA 2J67A 3SIWA 3UVEA 5BWMA 1R18A 2OQRA 3RRZA 1U0OC 3ZW9A 1E8DA 1A5ZA 3KXDA 4KYUA 1CF4A 1JPNA 4KQIA 4M0MA 1U1EA 4KIGA 3BIJA 4KLCA 4TS9A 2QVYX 1BYIA 1DAIA 4Q18A 2PZEA 1CNMA 3OX3A 2HMVA 1M54A 1JHRA 1P9LA 2VJCA 1NGSA 1SZDA 2C54A 2IGBA 2I65A 3DD1A 4OEHA 2FPWA 4TPKA 4WEQA 1GQSA 4IWYA 5AJHA 3WISA 3BUSA 1DRWA 4GGOA 4H17A 4TMVA 5LP6C 5CK5A 2WJIA 4CKBA 2I9KA 2ZUCA 1I8TA 3X1KA 3KVRA 1COWA 1RRKA 2IHTA 2BELA 1J24A 4D4IA 4N7RA 4ER6A 1B15A 5KINB 1LBIA 3ZXYA 1L7XA 4OH7A 2E1PA 3FTPA 4W8HA 2C2BA 4B40A 3DA8A 2GCOA 4V1CB 3SZUA 4D8WA 4EZBA 2I4LA 2XCIA 3R7DA 3REFA 2KBFA 1G18A 3CEMA 4HQFA 4LMBA 2H4JA 3IDQA 1FE8A 1KDOA 1TDJA 3A4MA 1DTWB 1BMDA 3GA5A 1U4NA 2H06A 5LOVA 4P3PA 1H2XA 1JPVA 4V3BA 4JP8A 2CVHA 5EPOA 3P32A 3QA3E 5FV7A 4TZ6A 2MDTA 1PNVA 2GILA 2VT6A 2HU8A 4ZVKA 4EGJA 2VS1A 1K06A 5LUAA 2UAGA 3QFRA 3KPJA 2GD6A 1P5HA 2FEAA 2CW5A 1XQYA 1AA6A 3NVAA 4W1QA 1JEQB 3DHYA 1CUXA 4BYGA 4OJQA 3PQ6A 4D9CA 3GRCA 4QNMA 1ICEA 4GMKA 5IXYA 3N8IA 2C7BA 3FY4A 4KN8A 3V1TC 4X84A 1U7WA 2MSKA 4OHFA 4Q9JA 2CXQA 2E87A 1WPRA 3LO8A 5KNLA 4E0BA 5A7FA 2QK4A 2OHJA 5KJ1A 1ICIA 1M33A 1FSPA 3A1FA 3FGPA 4ZO4A 1TM3E 3NAMA 3NDPA 3DT6A 4FB4A 4RS3A 2J9FA 1J9GA 1VCIA 2IP4A 2IP1A 4I1UA 3R7LA 3SVLA 1SU8A 2R86A 4TVBA 4YV7A 5KYYB 4M1OA 5KNBA 4MGHA 5KNDA 3PEEA 1JDBC 1A2KC 3LHFA 3GLUA 1G7RA 4DM7A 3I58A 3JD2A 4NIMA 1X86B 4RK0A 1OPRA 4I0WB 2JFHA 3NUZA 4YLEA 1BMFA 1Y3CE 5K0NA 4RMHA 2ZJ8A 1HFEL 2WQZA 4ZAYA 3VSBA 4L50A 4HDSB 3UB4A 2OBXA 4H27A 2J3DA 2QRMA 2GN4A 4L9SA 3AI3A 1COWD 1H0KA 1M8GA 3I2JA 3CZAA 4V0ME 3AEQA 3WGVA 2IXBA 3MBKA 1OYWA 3EGIA 3ET4A 3V6LA 4MV1A 1LK0A 4LXQA 2WD7B 3W9YA 3GP8A 1JDNA 1BIFA 3ZWYA 1ND5A 1OFUA 3IVGA 5AUPB 4Q1EA 1B7GO 2NX2A 3E18A 2P62A 2IX3A 1GPWB 4BZZA 5KC8A 1F2TA 5K09A 2BN4A 2Q49A 3C5CA 2VTBA 4Y6QA 5DWDA 3DOOA 3ZUGA 2O23A 1AVTA 1K4YA 4LHYA 1GL3A 4JB8A 2ODWA 5HRUA 1B4DA 2AX4A 3M4JA 3OQ1A 4NBRA 3ZBQA 3KYDB 2B2XA 4RHUA 2PJUA 4R2KA 3MLAA 3NIWA 2VRBA 3K0SA 3HRIA 5DIFA 5HILA 4WUTA 4M36A 1P4AA 3SZMA 2AUMA 1WETA 1XTRA 1P6QA 1U02A 3C5WP 5TV2A 3FZYA 4GR4A 1L7NA 4NXMB 4G23A 3SMQA 5MFZA 1EUCB 4I9GA 3REGA 3V4LA 4BGEA 1UPUA 2CL6X 1OX4B 3F71A 5FKJA 3U09A 2C5AA 1QFMA 2X1VA 3KJNA 3BXGA 3P7MA 1J00A 2JKYA 4FX5A 3L7NA 4KXWA 5BW6B 5U1PA 3U0VA 4CM7A 3EVBA 4IXWA 721PA 4B74A 4UU8A 3CB2A 5CT4A 4XWWA 4NESA 4UTRA 2AG0A 3C0KA 4PYJA 1A27A 1DC3A 2MSCB 5FRDA 5KNDD 3L4JA 2GDJA 4KDRA 4ESOA 1EQAA 5JWHA 1Q0TA 5JNLA 1VMIA 4TTQA 3L6RA 1BMFD 2WUFA 3G23A 4YWJA 3D6HA 1Q12A 1T9CA 3M6UA 4D56A 5KZMB 3OIDA 4NCIA 3VPSA 4YCCA 1UZAA 3GLKA 4U6NA 3DH0A 3H1TA 3R0XA 5JVDF 4Y1RB 1Q0HA 1I36A 2RI0A 3R5JA 1R6VA 2HLDA 1ZUWA 1OILA 2PQMA 3WLKX 2YHUA 2ZE7A 1QRTA 1ONPA 3ID6C 1GZSA 1KBOA 3D2BA 1J5EB 1Q84A 4RPJA 4TLEA 5FOXA 3RNOA 3ETCA 5K0CA 3H2BA 3O4IA 3PEVA 1T2NA 1LWOA 4HZIA 5JZ9A 1PRYA 1C7JA 1PIWA 4RDCA 1P0QA 1FSGA 2OCPA 1L4UA 3GLIB 1Z2CA 4J0CA 2ZCVA 2ODAA 1X8JA 2FPGB 4D46A 4KFUA 2QT1A 3TBKA 3WI7A 3WYFA 3QEMA 4LKOA 2ZSEA 4D8YA 3B53X 3WLEA 1PEDA 1P19A 4J4TA 4A8HA 4BO4A 4KXYA 2O7NA 2PX3A 3H9CA 4URUR 4C0HA 1QG6A 3JPWA 3Q15C 3H4IA 1CQIB 4RKEA 3KWJA 1JEYB 3OBBA 4GT1A 2V7PA 4B4WA 3GEBA 2QPTA 1F8UA 3A4LA 4I55B 1DWOA 3TLGB 3ZD6A 5LBUA 1OA0A 4YAFA 2ODBA 1ISFA 4HX5A 4DWVA 2ESRA 5BSWA 3SLGA 3U4DA 5CH3A 3ZHXA 1CUHA 3UXEA 4GMXA 1PJSA 2CK3A 2QUIA 5CP8A 4KDFA 3QP9A 3IOMA 7REQB 4EGQA 1A8SA 4FILA 3PIDA 3TB4A 2EWVA 4CW7A 4MROA 3AK4A 1ZISA 3K5HA 3ZWBA 1DIGA 4J0DA 1OT5A 1N7GA 1XKTA 2P0AA 4MW2A 4X3OA 4G8DA 4TROA 1Y7TA 5EZYB 3GCWA 4XQ0A 4FVTA 3ADDA 1YONA 5ADHA 1Q19A 4O2BA 1KZ1A 2JVKA 3T52A 2AOTB 5GINE 3ZJVA 3D4LA 1KI8A 1VLLA 3VC2A 3LF2A 3ZTTA 3W7VA 1AGRA 3WA7A 5EMNA 3N8GA 4ZGWA 4M0EA 4NU8X 1SM4A 2DX7A 5EPUA 5IVDA 2I7CA 2ONYA 3S7TA 3KYCB 4LV5B 1XALA 4MVJF 5AVVA 3OMXA 3DYIA 1ZXXA 4J4BA 1U0GA 3EIHA 2ZWVA 3GT4A 3WP1B 3FWPA 3LPAA 3LUPA 2HJ9A 2OE2A 4LYHA 2OSBA 4IXDA 3WSTA 2JCYA 4YYEA 4ESHA 1K5HA 1J2YA 4D0GA 2HLDD 5JBIA 2YIDA 3VR4A 1E2BA 1VL0A 1JQEA 2AV6A 2WAOA 4G4SP 3FUCA 3IBTA 4BV3A 5BW5A 5T41A 1N8KA 2Q5LA 3RS9A 4AMGA 3B1VA 2ZT8A 3JWPA 4RK7A 3S68A 3KKZA 2G5CA 5DN9A 1HDEA 4RQAA 3T5GA 1E2MA 1VPLA 4AJ1A 4CMIA 1ZN9A 2PWPA 3T1NA 1T9GS 4ON9A 4F7WA 1PZHA 2Q6KA 1KVRA 3IKVA 4FFBB 4QNRA 5K2OA 2A5DA 1JKJB 1LNQA 2YWBA 5JDCA 2QMHA 2OO5C 3P97A 3DSRA 4HAVA 5EERA 1R3UA 3QBJA 5GJCA 3T0FA 2V4ZA 5F2KA 2HNKA 1KJYA 1RW4A 2PWYA 3OU2A 2OG2A 4GMGA 4ZHQB 4G2NA 3DULA 2OR3A 2ZWMA 4IGKA 1G59A 1ONNA 2DJ5A 1KKMA 1HWYA 2BJWA 3OLQA 3QMMA 4L9WA 4B1FA 2EHJA 4EGSA 2CK3D 2O2ZA 1BFUA 1FVHA 4R8VA 4Z3KA 1ZLXA 3ZX5A 1EWKA 4P3YA 2P77A 3LE8A 3LT1A 3T5MA 4C4XA 2CVOA 2IIVA 1RZ3A 3LO5A 5GZ3A 1L5OA 1YIAA 2DHQA 2JPDA 2AG5A 2CDNA 5FADA 5C8DA 4LOHA 3HPQA 4KR3A 1USIA 3FGOA 3K20A 5BYKA 2HPVA 5B5SA 3T9CA 2VL7A 4BTLA 2ALJA 2BFOA 1Z4NA 3VZBA 3H9JA 1M2OB 1XMXA 2VTVA 3BHNA 5DO9A 1SIUA 2NADA 1M1YA 3F3YA 1NQAO 1X87A 4F9FA 3UTDA 3C5VA 4B3BA 2IEZA 3MQ4A 4IKEA 3C1UA 3RFXA 1XNRB 1GZUA 1O5OA 1ADCA 2HK8A 4BNLA 4K3UA 4ZCIA 4K1XA 4B5KA 5LP6B 4DV6B 4Y0NA 1B41A 1O9BA 1CE8A 2FFHA 3PR3A 1BH6A 2PWBA 2V3WA 4I4TA 1R4NA 4WLFA 2Q4EA 3L8ZA 1G5HA 2ILVA 1V4NA 3OY2A 3KZKA 3VR4D 2VDUE 4OHWA 1OAOA 3E23A 1XMOB 1JB1A 1K5PA 5F23A 2YVQA 3AHJA 1CDEA 1DNPA 2G1UA 1Z36A 3COVA 3H0KA 4HDNA 4RZIA 5DHAA 3FFTA 3O74A 3FZGA 5C46F 4DV3B 3EW9A 2CWDA 1I5RA 3SNKA 4FNOA 2IOQA 1DKUA 5FD8A 3ZWQA 3N8HA 3MUEA 1X7ZA 3H75A 2P78A 2PUGA 3DLTA 2O2JA 1EM8A 2IPAB 4M55A 4CEHA 2X4IA 4ITVA 2QUAA 4V0NA 4MW7A 4CFYA 3GW8A 5JY1A 2PXAA 4U0KA 4PS1A 1ISIA 3OKCA 2PUAA 1MRSA 2P4QA 4K6MA 3HG7A 3NDJA 1SGWA 2QQ0A 1OBOA 2PMBA 4OI1A 2C2MA 2V7WA 4ZQCB 4ZZ2A 2LBPA 1PGPA 3PQEA 3R3HA 1MQSA 2JL1A 4XRGA 4F46A 1MX9A 1Y9JA 3CUWA 1DC5A 3RVPA 1G64A 1VCMA 1KAGA 4E08A 2R1ZA 4GYYA 3AHIA 3L4BC 1E3WB 2HF8A 3ZWKA 1IDOA 4XM1A 3KSDO 1NQWA 1AMNA 2YJTD 1H65A 2DVMA 1M34E 3GFPA 2H7VA 5JHGB 3I62A 5JS7A 1Z2OX 4JI5B 3LQ2A 3FHTA 2X4LA 1PQ4A 1TVEA 4RIGA 2AZXA 1DDIA 2FSPA 2HD4A 1NHWA 4OL9A 4CLXA 4JB3A 2OCBA 2YXNA 2HDNB 4ZTBA 3SKXA 3WL7A 3V7FA 3LGAA 3KJGA 3DPUA 2WTUA 3L0SA 4JEUA 2A14A 2PTGA 1Q3KA 2Q5IA 2BCJQ 1EEXB 2Y4OA 3DLPX 3KUCA 2JB9A 3OQHA 3L9XA 3A3OA 3BMOA 1FRNA 3CKMA 4J16C 5B3KA 1BRMA 1NUTA 1HDYA 2ZRAA 3K2EA 3VAZA 2QNRA 1HL7A 2GUWA 3L0CA 3OCJA 4UHBA 4ER5A 1J2UA 4HN2A 3UYLA 1F6WA 2VDRB 4LJ7A 3BORA 3T34A 5CXSA 3O9ZA 1KEUA 2DR3A 3OZDA 1IOWA 3WRYA 2I2XB 3FF1A 1SEPA 1WSBA 4I5EA 4OJMX 4TL6A 3ZE7A 3ZKAA 5DP2A 3V4RA 3KUXA 4LDJA 3WIVA 2EAUA 4R3WA 1H1LB 3QTTA 3GHYA 3LK6A 4UPDA 1QNLA 2CCJA 1P5JA 3B1WA 3IOYA 4XYMA 3EASA 3FIJA 1W36B 1K4KA 1U1FA 5D86A 5L45A 2ZP1A 4L0CA 1Z8NA 1CUWA 2NQ8A 4J7CA 2W6MA 3RUFA 3PPYA 2HA6A 1ZD9A 4B7CA 3OJOA 5TMPA 3OOJA 2QXTA 4DV1B 2IOFA 4MKIA 1IY2A 1UBEA 2I9PA 5E1MA 4UU0A 5DT9A 1VJCA 1F17A 2A2ZA 5CYGA 3WYAA 1QFJA 1Z12A 1TJ3A 5FOUA 3BWCA 3NJ8A 3DF7A 2HCFA 3ZK9A 1SVOA 2O5VA 4IH1A 2BVNA 2XMQA 2ZFUA 4IIEA 1VBNA 3MWEA 4MHSA 2IY7A 3I73A 1F9AA 2IOHA 4PYNA 4G4IA 4YVFA 2Q5FA 1PGOA 2JLXA 2D13A 3WO1A 1NVVR 4JJEA 2YJZA 3EJ6A 3W1WA 4PLCA 3T3OA 3TEJA 1WM1A 1Q1ZA 5EWLA 1SELA 1A76A 2A9FA 2O54A 1MR3F 2HSDA 2DFTA 3P9IA 3ZBPA 3NCHA 5HKOA 2RI1A 3TW6A 4JI4B 4UXHA 1XZMA 1YR8A 1Q1GA 1RE0A 3N2KA 2F4VB 4A8TA 4Y2TA 2RHLA 1YUMA 2YJ4A 3SEAA 5ALDA 1T5LA 2PLRA 4NAUA 2NXCA 1GUDA 1T4CA 4HO1X 2DG2A 1JZSA 5HKBA 1E1RA 1G4HA 1TX4B 4JBIA 4QHSA 5JISA 1JAZA 2W6PA 4QUGA 4D3YA 1IQRA 2QVGA 3W6UA 1Z0AA 2RGDA 1XZGA 2XRMA 5TEVA 1JHZA 5K0GA 1N75A 4JITA 3AXTA 4MVXA 1Z08A 5FNVB 5I5EA 4G86A 5HE9A 5I6DA 3CGWA 4R2MA 4LDNA 4YCNA 3IDFA 3MT7A 4M9CA 3DMPA 2HFJA 1U9CA 3F5FA 3OPNA 4A6XA 1LW6E 1VPTA 1M34B 1U98A 4B7ZA 3UHFA 4ZOLB 4O2LA 3AQ4A 3ZCSA 5K0BA 1PWHA 4M8IA 1QG4A 1Z6XA 1HZJA 2A5FA 2NV2B 2O3UA 3EEBA 3GG2A 3H84A 1O57A 3NBXX 5F35A 3ZJTA 5DEOA 1HQDA 4M8LA 4CQNA 2AD5A 2CWWA 2P6PA 5FOSA 4F3TA 5E6RB 2XNSA 4N8SA 3DBVO 5DSXA 1QHHA 2VWPA 2WSSA 2BFFA 5ALWA 3TCXB 4EX7A 3HXMA 3W9BA 3IMCA 2GCEA 4GWLA 3QJYA 1DCTA 1GPKA 4QQKA 4PC6A 1R12A 1IBLB 3PWKA 1J1IA 2VBCA 4JB2A 4PV7A 4UULA 5D3MB 1V3UA 3DEIA 2PAFA 1V41E 3K5IA 1WCXA 5CAEB 4DC1A 3C7CB 3PXUA 4RK4A 4YQEA 1MIOB 1V6CA 4F96A 4JYZA 3ZU5A 4DYVA 5EZQA 2PJZA 5HK8A 3A32A 5AVJA 2NVUB 4UDOA 2BDUA 4OH1A 2REXB 4XTCS 4BVEA 1T8UA 1QH9A 3MRTA 4ZRNA 4YMTA 1YQGA 1A4RA 3MJRA 1AQJA 3AEKA 3BMQA 4NPAA 3U9TA 2I4RA 4DUGD 3FOCA 3KR1A 3JXEA 2BUCA 1D4ZA 1K1EA 1NR7A 3QI2A 1X7XA 4HEQA 4W4TA 1U2ZA 3ETHA 1Q1QA 3L06A 2RHHA 5LNK1 2AF4C 4QLBA 1B0AA 1Q11A 4FYXA 4QQFA 2P6NA 2REQA 3QYJA 3T61A 3BH0A 4IAOA 4RUKA 4X60A 3EPKA 1XA0A 1YDEA 2PJRA 3TSCA 4YYZA 4BNUA 1PFWA 1IM8A 1HLDA 1E2EA 2A0WA 5CVUA 1FYFA 3JTEA 1RWXA 1E1RD 3EE6A 2YRXA 3ABOB 3JQFC 4RA6B 3TR0A 2PIDA 2BGMA 2D2FA 3EPJA 2VPWA 1XZQA 4QX6A 2QYHA 4CM8B 3LUDA 4ZQIA 4JVMA 4NE2A 3MBIA 4YCDA 2NP7A 4YRZA 2HHCA 1QK5A 3QOYA 4HZUA 3V1YA 5I7EA 4LSGA 1Y9ZA 1Z2DA 5IAEA 3S1AA 2DPHA 5A9RA 2RGRA 1RMTA 1T1EA 4BNXA 1UC5B 4D6PA 1VHTA 5BUZA 3I04M 2F3TA 4CTMA 1WY7A 2W7TA 1DTEA 2VDWA 1TMGE 3O1HB 1FOEB 2P6UA 5EZ5A 2MINA 3R0QA 3WNBA 2H1HA 3WNDA 5H70A 3RYIA 3RSZA 3I8SA 1GPMA 1KY2A 2WSSD 2GK3A 2QENA 2ZYSA 3IUBA 3WQBA 4F3NA 1RJDA 3GOHA 4LUCA 1UAYA 2ORIA 4U0JA 5C7YA 5GY7A 3FR8A 1RQXA 3Q3EA 4JXZA 2VDKB 2WF8A 3BAZA 3ITDA 2YCBA 3MWDA 4MMXB 4DWWA 4WA7A 1XXHB 2ACEA 2BSXA 2GETA 4IO1A 5EFOA 1QAMA 1SZPA 2B4QA 2G40A 3WXMA 4YTEA 4C7MA 4E2YA 4URVR 4O8ZA 3EK2A 1RXEA 3AB3A 5F64A 1EJ2A 3GT3A 2DC1A 2QZ4A 1EZ4A 3SP1A 5IN4A 4PZZA 4N4AA 1YZQA 4BMXA 1ABBA 4MO9A 1W96A 1MO4A 4QELA 2IDZA 2RAVA 3CEHA 4WDQA 1EFCA 3C98A 1Y48E 4XGKA 3V8NA 2A58A 1RKXA 4JSTA 1WXHA 5K7SA 3TQTA 1GT6A 4KR0A 5E38A 3V5NA 3D64A 4U2EA 4D0NA 5DB4A 1ITZA 3D4IA 5GOZA 3IAAA 1JDSA 1BVRA 1ZN8A 4B2YA 2QRVB 3QHAA 1VBFA 3CUEF 4UOZA 4TKUB 4IMRA 1XEWX 3QOFA 2CL5A 1A98A 4AUNA 4PC2A 2UZ4A 2O8DA 2BKVA 3FCOA 4I4NA 1MV8A 3S5UA 2BOVA 2QYSA 2F7SA 3AHDA 4HTFB 4EPRA 1G63A 2IYQA 4LHXA 5G1OA 4ROTA 2UUOA 3I6IA 4GBMA 4IEEA 4G0UA 2GRAA 4JI6B 4OK3A 3WWEA 5DTQA 4UVHA 2FSGA 3GFRA 3LX6A 3MGKA 2GZ1A 3OMLA 3ETJA 4DLAA 2PL1A 3PHIA 4X54A 1F1JA 1P5RA 1DRVA 2XITA 2BLNA 3EMDA 2B9VA 4KE7A 4WESA 5LZ4A 4Z53A 4ZANA 4NJEA 3RFCA 2CFOA 1HI9A 4YDHB 4LTMA 2E5LB 4W7SA 1FIUA 4YBZA 3OQBA 3HB7A 4I1OA 1QGYA 3WZ2A 1NN5A 1VPVA 1PZFA 2X9VA 5B2EA 1QK3A 3AP1A 4JEMA 3ORHA 1KAMA 3H0EA 1G20E 1IH8A 2PU7A 5T4BA 1N2CB 2RH9B 2E0IA 4CGZA 1RIFA 3UW1A 3DXFA 4LHSA 3DAPA 1DJMA 5HXAA 3MMXA 4YX9A 2NO0A 2Q8NA 4HQKA 4K46A 1Y37A 4HMPA 1QGOA 1Q6ZA 3DO6A 1UT5A 3ELWA 2ODQA 2Z8YM 2NZVG 3IHWA 1J1ZA 4QD3A 1S1CA 1CJCA 2AMYA 3AR8A 2VPPA 4Q24A 5TXGA 4K6CA 3WIOA 5ER9A 1XWFA 5EKSA 1E9RA 5IAAA 5L4SA 1U7XA 3PGMA 4X41A 2O48X 3O4JA 1EH5A 1Y42X 3LCRA 4P81A 3G7NA 1SUAA 3AL0C 4OPMA 2YV5A 3ZIAD 3MAJA 1KXZA 3L0DA 4FZ3A 3QF4B 3JQ7B 2OCGA 4KW7A 1IMJA 1M2KA 1S3SA 1AV6A 4RHCA 1ES9A 2X6RA 5DNVA 2BUAA 4E13A 3DBRA 1F8FA 2O8FA 2PFKA 2XBMA 1PHRA 2FWJA 4RCYA 1O89A 5LKRA 1AE1A 1O6BA 4U4AA 2NPOA 3ZWDA 5DM2A 2ZKLA 3D0KA 1JLKA 1RHJA 4HNAA 3CPEA 2G0NA 3RBVA 2IYNA 1BO6A 2CF6A 3KKMA 3GDHA 2DFPA 3VVCA 1JIQA 1YJXA 1ZD8A 3GUHA 4AN4A 5GZ1A 4FR2A 3WYNA 2NYUA 16PKA 3MYRA 5DYIA 5EHIA 3VAAA 3I9KA 4PNHA 4BNYA 2EYQA 4N3CA 5ER6A 2NZWA 3QXGA 1KWKA 1SKMA 1UXKA 4C2UA 4FOLA 5IANA 1OLSA 4OI4A 2C94A 3D2LA 3FYUA 3CCBA 3NUGA 1QAOA 1C41A 4NOKA 2GMWA 3CY6A 5JZSA 3U7HB 3NHLA 1KZGB 4X91A 4BBJA 1L5RA 2H1LA 2QD3A 3QGMA 5TQ0A 1DT5A 1PFKA 2QMUA 1WB6A 3HKDB 2DWOA 3GV0A 4FFPA 4Q3LA 2NUAA 4Z8YA 2VEOA 1Q0UA 3ZR4B 3CTPA 4EB8A 3FBGA 3FWNA 2HK9A 4D41A 1ZN2A 4NCNA 1T3LA 5KI6A 1Z56C 1NJ5A 3A1EA 4QYMA 1GPUA 3DBHA 2PZAA 3CCCA 4JBNA 1Z06A 4E7OA 1WZCA 1ZNYA 1XKXA 1PX2A 1G2IA 1WVGA 2H4ZA 5FA5A 1ZMRA 3OY7A 3TUIC 1ZR4A 1IHOA 1CZNA 7GPBA 2J5KA 1SH7A 5FPTA 3FCEA 3LDUA 1J8FA 2R8XA 3M1YA 3BHIA 3I01A 4PICA 4S35A 3RJZA 1VHWA 1DOZA 4YJDA 2C8KA 2SKDA 2PSSA 1W88B 3N28A 3WK4A 3L7YA 1D03A 2W6NA 1PWXA 3LDFA 1Z47A 2Z5GA 4JENA 1K7SN 3AUJB 3BFXA 2HBQA 4NY1A 1S7CA 5GIOE 1ESMA 5BYBA 4Y2XA 3RSHA 4CIWA 1TCAA 2EKLA 1L5HB 3C48A 1WUYA 4NJMB 5D1NA 3VPAA 4BX3A 4BYMA 3TB6A 4NV3A