2IXEA

Crystal structure of the atpase domain of tap1 with atp (d645n mutant)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
b'GSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ANTIGEN PEPTIDE TRANSPORTER 1
publication title Distinct Structural and Functional Properties of the ATPase Sites in an Asymmetric Abc Transporter.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ixeA01
3QF4A 3CF6R 1WCV1 3Q5DA 1P61B 2BOVA 4URWR 2EFDB 3GFPA 1LTQA 5IT5A 1NBME 2XSZD 4YLGA 5EXPA 2D74A 2FF7A 4XWOA 2F1IA 3ZS8A 3NXSA 1XWIA 1KK1A 2WPDA 1W44A 3U6KA 2MMCA 1HQYE 3U7GA 5EXXA 1FW6A 3THXA 4OI1A 2GESA 3AVXA 4UXIA 3BBPA 4V0NA 1U0JA 4F91B 3RLFA 3A4LA 3QKTA 3A1VA 1G7CA 3W6NA 4JLOA 1VYVA 5KDOA 2ZSBA 1RKBA 3L8ZA 5KYKA 1XMIA 1GWNA 1CXZA 3GEEA 3TR5A 1SVOA 3ZQ6A 3CR7A 3QF4B 4ESHA 2KI5A 4NU0A 2ZI9A 2CJWA 4LC0A 2RMKA 3I92A 2CMKA 2J9RA 1HH4A 2ZRBA 1TX4B 2L0XA 1CBUA 2GEUA 3RC3A 3U60B 1E0AA 3TAUA 1P2SA 3QUSA 3C41J 5C4MA 2KJQA 4IOJA 4EJSA 4DRZA 2OG2A 3KQHA 3IIMA 3OE7D 2IF0A 1LF0A 2PEZA 1QG4A 4V03A 3TBKA 4AKHA 3S1AA 4HDQB 1A1VA 3LBNA 2P5TB 1ESMA 4FMBB 3IILA 2VHQA 5TMPA 2X19A 1XTKA 2P67A 3PJRA 3EIEA 4DHEA 5L3SA 2QPAA 3KQNA 2YVUA 3SYLA 2WOJA 2CJWB 2WZQA 3AKEA 1N5LA 3OEHD 3A1SA 4EJSC 1RIFA 4YMWA 5IRCD 1W0KD 3GLGE 1CEEA 1TNDA 1IXSB 2WWIA 1R5BA 3O8CA 1U8AA 4V0LA 3UATA 1VG0B 3H86A 4KFSA 2O8DA 2C8VA 3DO6A 4ZI3A 3LBIA 3AVPA 5J4VA 2EYQA 4JBXA 1IY0A 4DUGD 1FX0A 3TRFA 3AVQA 4ON9A 3VNUA 5KU1A 2D3WA 5KSOA 5CK4A 2A78A 4DKXA 3FFAA 1UKVY 3CWQA 2WJGA 1M74A 2WAXA 4HI0E 3GLFA 4NH0A 3TUZC 5L3SB 3EA5A 1K6MA 2JLVA 3IKJA 4X8MA 4EDHA 1G7RA 4OQMA 2O8BB 3EX7C 1Z63A 3CNNA 4PC7A 3GCGA 1XCGB 3PG5A 4B3CA 1Z2AA 1G18A 5DSZA 1A82A 4LX0A 5GJBA 3RS2A 1DAIA 1MABB 1BO6A 4DIDA 1D8TA 2JDIA 1GITA 4LHVA 4EFMA 4DB2A 1FX0B 3Q3JB 4HB2A 3SDZA 3UK6A 4D2IA 2XZPA 4KVGA 1UDWA 2O8FA 1LV7A 4C0KA 5EP1A 5FL7D 5LB2A 3SJBA 2ZRLA 1E2MA 1QHSA 2QT0A 4LJ8A 2FEMA 4AKGA 2YOHA 2QGNA 1BH2A 3QNUA 1QHHA 2FA9A 1XMJA 3DOEA 3T1OA 3MGCA 5FTJA 5P21A 1XMVA 4FWTA 3GJXC 1W0JA 2VP6A 1UKEA 1HE1C 2VP0A 4BLPA 4Q19A 3QPWA 5AJXA 1SULA 1MH1A 3OIUA 4R2IA 4C9BA 3KZ1E 5GADl 2ZR9A 2WM9B 1E2JA 1G3MA 4Z1MA 1Z2CA 1TEVA 2OLJA 3SS8A 2O8FB 2GXAA 1W48A 2FNAA 3D7MA 4JLMA 4Q4LA 1M7HA 2FU5C 4FMDB 1O3YA 4X8OA 1KMHA 4DCSA 1N6NA 1ZUIA 3LVQE 4BFUA 2C98A 3T5DA 3HU1A 5HPYB 5FI0B 2ZI6A 5KDLA 4UJ3A 2BCJQ 3ZIAA 4GOXA 5FBQB 2Z4SA 4KV9A 3I5XA 5JS7A 4TTPA 1YJ5A 2ZAMA 2PJZA 3QEOA 1AA9A 2JCSA 3QG1A 5ANRB 5FPKA 3NEJA 1A2KC 3TW8B 3I73A 1T91A 4AI6A 2VQSA 4JSYA 3BB1A 5HE8A 1OH6A 3RDPA 2R6CA 2A5YB 1ZYUA 2CK3A 2OEPA 4XSGA 2AKAB 1Z0FA 2DHRA 3X1YA 1E1RD 4DLWA 1U2RA 4FXPA 2H57A 3IGFA 4PSAA 1GRNA 1NIPA 2J3EA 4ZDKA 1W36D 5FTLA 4ESVA 1KMHB 2A2ZA 4RJLA 1ZCAA 2NG1A 4WZ6A 1Z47A 4E5UA 3Q7PA 4YQFA 1R8QA 1TAGA 2ATXA 2GCOB 3OZXA 4V0OA 1KO1A 1KNXA 4DBLC 1T8UA 2IS2A 2A5JA 3QF7A 2YKGA 1KO8A 3FHTA 5KTYA 1XB2A 5KSPA 3R9WA 3ZD6A 4C7OA 2ZETA 2R44A 1UBCA 2BBSA 1G8YA 1YZKA 3FMFA 4DLSA 1NSFA 3MWJA 4Q9IA 4KXFB 4B2LA 1KAGA 1US8A 5L3VA 3MAAC 2LCFA 3K0AA 1CRPA 3GJ6A 3ZVNA 2QENA 4ZDWA 4A9AA 5FOXA 4LBYA 3GLIA 2GK6A 1XXHA 3OFNA 4TMTA 4XVRA 2QY9A 3KB2A 3KTAA 1XZQA 2GJ9A 5H68A 1ZNYA 2D7CA 1IAQA 1ZM9A 2NZ8A 4NCHA 4IXNA 4DJTA 1ZBDA 4GBMA 1JALA 2CCJA 4ACBA 2OFWA 4Z8YA 2Y8EA 1G6HA 3TMKA 2VSXA 3MSXA 3QKUA 2YOGA 1E2IA 2X2EA 3SJZA 5C1BA 4BEBA 3RS7A 3KQLA 4HZUA 4Q9JA 5EE0A 2ZTSA 4KBGA 1KY2A 4LBZA 3GLIB 1NVUQ 3K53A 1I4LD 3CRMA 2AL7A 5AJWA 1EFUA 4WZAE 4JT4A 1RJ9B 3KTAB 4QJ3A 1SVKA 1QZXA 121PA 3VU9B 4AD8A 4PHTA 4ASUD 2F3TA 4KSCA 1MO4A 1ZW6A 2OSBA 4WAUA 3VKWA 3GLHA 1NJFA 2HLDD 4ACAA 1F60A 2I1QA 4PC6A 2H92A 4B3DA 4U7DA 3REFA 1T0JB 1XDBA 2PT5A 2YWGA 4A2WA 4GDFA 1M7BA 2NOAA 2GZDA 4EAQA 2JATA 2GCNA 3C7KA 3TJZA 4LOAA 3U4QA 3J81k 4GP7A 2JLQA 3W3AA 2XJ4A 1WBBA 4KCGA 1G5RA 1MOZA 3BJIC 2WWYA 2WWXA 3CX8A 4A0HA 3GLHB 2WJVA 3C4JA 4V0KA 1VCNA 3PUWA 2J0QA 2ZQ5A 4HLCA 2IYXA 4JBYA 2HF8A 5FTNA 2CHVA 4LHWA 2P3SA 2YWFA 2GHIA 4QBIA 4BFWA 4BRUA 1SZPA 1E2PA 5CIWA 3VQTA 1WA5A 2A5DA 3O47A 1COWA 1QBKC 3NKVA 5H70A 3QBTA 1TQ2A 5FR1A 3LAWA 3NH6A 3QXCA 3GEHA 3AVYA 2KWIA 1JQJC 4ERNA 2QM7A 3MMPA 3U4QB 1Q21A 2BM0A 1KI4A 1F3OA 4BFVA 3A4MA 3QXSA 3IHLA 1QHGA 1NMZA 2QMUA 4A82A 1VG9B 3I5YA 4EPVA 5F9HA 4I99A 2RGNA 4PAQA 4MKFA 1FMLA 4PO1A 4HAYA 4EPRA 4A4DA 2FX3A 2QL6A 3K0CA 3X1ZA 1NLYA 1E69A 1N6OA 2PX3A 2GDJA 2ZITA 4JVLA 3U3JA 4Z54A 3P4XA 2HJVA 4OI0A 2ZSEA 3WMEA 3ZJYA 4A92A 4IFBA 1XEFA 2JGNA 3B85A 4BFTA 1YZQA 1W2GA 3QG5A 3IBYA 3MWLA 1GAJA 1T9HA 2GCPA 3LFUA 4IEIA 3L82B 2AN9A 2FSIA 3T15A 1DARA 4IEEA 3WMFA 4F92B 3EPHA 2CL0X 2OILA 4JMPA 3GEIA 4OQNA 4AC9A 1FQJA 4IKEA 4CIDA 1Y3AA 4D4KA 3KKOA 5LB4A 3DVLA 3K0CC 1E9FA 4GZLA 2JEOA 4P4TA 1G6OA 1OKKD 5A5GA 2FSHA 5AUQA 1E4VA 1YKSA 1G7TA 3NBZC 1YU9A 3O8RA 5KSYA 4PPGA 2QAJA 3GQBA 1LB1B 3BFXA 5SZIA 4CT4B 5EZ5A 3WYGA 3PEWA 4D81A 2ZRIA 2AR7A 4URUR 3GP8A 2SHKA 4WW0A 2ZRKA 1T5LA 2REXB 1T3LA 3AF2A 4BFXA 1ZU4A 1KI9A 1T4GA 3EC2A 4JVMA 3R7WA 4N0DA 5BXQC 2HEIA 2KE5A 4DCVA 1BMFA 1O87A 2HJGA 1CP2A 2XNSA 3B5JA 3NEYA 1T3SA 4BLOA 4KFTA 1L2TA 2R8RA 4NHOA 3EW9A 1PLLA 4IOKA 1YZGA 3THYA 1NKSA 2G88A 3ZS9A 2ANBA 2CNWD 1RRCA 2MMGA 1SVWA 2F7SA 1CJMA 2HXSA 4MGZR 4LSGA 3AUXA 4TLBA 4WZBE 4ABYA 3I61A 1EFRD 3PUZA 4M9SA 2ODBA 2VO1A 2W6IA 2R62A 1N6LA 4KLNA 2IXEA 2IYUA 4DSNA 3ADBA 1Q3HA 4TL6A 4URVR 2XITA 3C8UA 4HDCA 2A9KA 2NQ2C 2FSFA 3B1ZA 1EG7A 1Z0KA 2HF9A 4XTRA 1UPTA 3T12A 5HKKA 3EZFA 2GAAA 1C9KA 1GZSA 3OHMA 2Q0HA 1ZUHA 3AB3A 3THYB 2P5SA 2IBMA 4S2EA 1GKUB 4C0AC 4YXWD 5K8TA 3CW2A 4MUAA 3ADCA 2ONJA 3W6OA 4BZPA 1X8KA 4JYBA 1G9XA 1TQ6A 3ICQB 5UKDA 4ZKDA 4TZ0A 5AUNB 4XD7D 2QE7A 1XBTA 1LVGA 1X8JA 4CW7A 2XTMA 4QM7A 5DISB 5BYKA 1AGRA 2YV5A 1HT2E 3HR7A 2V3CC 3FPAA 3CF2A 4E22A 4HSEA 3GPLA 2G77B 1E9RA 3B9QA 4RZ2A 4G1UC 4Q9LA 4US0R 5FOTA 3W90A 3X1DA 1YR7A 1MT0A 4HB0A 4FCTA 1KZ7B 1MV5A 3RAPR 1KKLA 1FNNA 1GG2A 3HWSA 2ZRNA 3RRZA 2WWGA 4R2HA 4RSGA 5KOYA 1RZ3A 3ZVMA 1V5WA 1Z0JA 2J87A 2W6JA 1NJGA 4ZCLA 1XEXA 5L3QA 3DHWC 1NN1A 4N3NA 4E03A 3KFXA 4PANA 1RVDA 2FJUA 2RGAA 4QBHA 3THWA 3EZ6A 2QI9C 2NO9A 4KAXA 4QC2A 4EKDA 3ZLJA 2NO1A 1GRRA 4RD1A 2NZJA 3CZPA 1OSNA 2J1LA 1P9RA 1RW4A 1EFHA 2WJJA 1LNZA 3SYKA 4FI3C 3GFOA 4DZZA 1J70A 3N70A 4WXRA 1GUAA 2FE4A 4D0NA 4I1UA 5J5CA 4CZ2A 1ZP6A 2P2LA 2FPMA 3BOSA 3EC1A 3ONWA 3FYHA 5EE1A 4A0RA 2BMEA 4YDHB 1JXMA 4CYMA 5F3WB 1F2TB 2NO6A 1E32A 4NCJA 1GOTA 4C0JA 2QEQA 3WYAA 1XEXB 1OPXA 2ZRAA 721PA 5DH9A 5J4LA 1KTVA 4TSFD 1WMSA 3EZ7A 3NC1C 3KKPA 2O0JA 4IDHA 3QQ5A 4BZQA 1E9DA 2CVFA 3VX3A 4OK3A 1ZD1A 1A4RA 1TPZA 2IYWA 2PT7A 4JLNA 2XAUA 4A15A 3U7HB 5FUXA 1E79D 5EQTA 1EWRA 3TAHA 5CDFE 2O52A 2ZJ2A 3ETLA 4CEIB 4G0NA 4N0EA 4A6PA 3ZYCA 1CLUA 5FUYA 2HT1A 2XTNA 1Z28A 4Q1EA 4UNSA 5LPNA 1K5GA 3ADKA 3T61A 2IYSA 4WIAA 3NTUA 4JLJA 1P60A 4AYXA 4DSUA 5JFGA 4BLTA 1P72A 1T6NA 2QN6A 2GETA 1SXJA 4UXJA 2NPFA 1AQUA 3U3KA 1JR3E 3CR8A 4AKIA 3CRQA 3SBEA 2WPDD 3AF0A 1N5IA 2ASEA 3RS0A 3VR5A 3B1XA 1W2HA 2DY1A 2GVDC 8OHMA 3MLEA 2WWWA 4CRWB 4QXAA 4CDGA 3A8TA 4M1TA 3CLVA 5AUOB 2R6DA 4Q1AA 2EYUA 4JL5A 4TYYA 1YZUA 2F43B 3SFVA 1YZTA 1SXJC 4A0GA 2GXUA 1XZPA 4EPTA 1OW3B 3MFYA 4UNQA 2Z0MA 2KBEA 5FTKA 5JSZA 1XTSA 1NVWQ 1XPOA 3FDIA 2QG6A 3I1FA 4D26A 2ONKA 2R6AA 4JLAA 1AKEA 1DAEA 2VBCA 1T5IA 2NTYC 2ERXA 1OV4A 3I4LA 4QL3A 2G9NA 4PQRA 2D62A 4LYFA 1GL9B 3NH9A 5DE3A 3FFBA 5F98A 3QPVA 2X8AA 1E2KA 1SVIA 4W5WA 1E2LA 4UNPA 2DR3A 1UJ2A 2PH1A 2X1VA 1UKYA 4B2IA 3L43A 2QAGA 3MUFA 2YJTD 1GNPA 3CRVA 1H8ED 2ZI4A 3H84A 5FOVA 4Z51A 1HEIA 3C16C 4US2R 2FPKA 1W5SA 5GJWC 5JSZB 4LJYA 3PFIA 4GPTA 5KSZA 1CJVC 1KO5A 4KBFA 4Q4AA 3IPXA 1DELA 4BWYA 2B7CA 4Q4HB 2BHRA 4V0ME 4GI7A 1KI6A 2YOFA 4GP6A 1E2EA 2IYLD 2WMNB 3F0TA 3K9LA 4K81B 4XH9B 1AGPA 1UADA 1KIMA 4OI2A 1JB1A 4ZPXA 2QAGB 4QFMA 4M21A 1I4TD 4B3BA 4C2UA 1JR3D 5BQ5A 3E2IA 3CIOA 2EU8A 4IHQA 1X86B 3LQRA 3UIEA 4A2PA 2XOKA 4POAA 3BERA 2FG5A 4EUNA 4ZO4A 1XEWY 3K9NA 3QXJA 3C5CA 2JDID 4MRVA 1P2UA 4DLRA 2P65A 1IM2A 1KI6B 1NVVR 4DSTA 1EWQA 3ZZTA 5G40A 2OM2A 3EASA 1QHNA 1IONA 2KBFA 3CO5A 1WRBA 3LNCA 3CUEF 4QJ4A 4WBSA 2OUKA 3AGPA 4Q47A 3TVDA 1QVAA 3AVVA 4II7A 4GRAA 2VSFA 5IK2A 4EQ6B 2QP3A 1ZNXA 3K8YA 4NBSA 2QBYA 4IOLA 5CJPA 2QM8A 2OBLA 1VCIA 1ZC4A 1G1MA 2GWHA 4Q9HA 5E4FA 4NYJR 2VF8A 1D5CA 1BOFA 1KSFX 2WJYA 3GMTA 4JLKA 5FFMA 1T8TA 3E1SA 2O5VA 1W0JD 2B8WA 2EWVA 4CEHA 2ANCA 2AK2A 4HAXA 4QGGA 5KDDA 5JJLA 4JLBA 4M1WA 4Z1MD 3D8BA 3AP2A 3K9HA 3CWZA 2R6FA 1E2HA 4K46A 2HXYA 3THXB 3VR3A 2B21A 4ZIRA 5CYOA 5CJ2A 1NIJA 2FFAA 3JZMA 3K0EA 5AK0A 4PQFA 4E07A 4P4SA 3ZIAD 1E4YA 3R9XA 2EFEB 4D80A 1OXTA 4KSBA 2Z6VA 4LRWA 4MA4A 2OZEA 1VECA 5DLQC 4D0GA 1WB9A 1NRJB 3B82A 1ANKA 4B6EA 2OLKA 3K70C 3P1JA 3VR6A 2IYQA 1W4BA 3QEJA 2CK3D 4HLUA 3G0HA 4EJSB 2ZYWX 2ZE5A 4IJMA 1KJWA 2ZE6A 3C14C 4JL8A 4TT3A 1G19A 2IUUA 2H16A 1NL3A 4EPXA 3U44A 4FMDF 1Q1QA 1RE0A 4UKDA 4DC9A 4AURA 4DSOA 3QIAA 3S1AB 1L4UA 2V55B 4BLSA 4U02A 1S96A 1XJCA 3B8HA 5E3HA 4P4SB 3GJ4A 4HLQB 1ODFA 2QUZA 4M0LA 3UMFA 4B73A 3U7FB 2RHMA 3DDCA 3FKQA 2XXAA 3MD0A 4BEJA 4M53A 1YVDA 1U90A 4E09A 4IDPA 3M6AA 4LPSA 5G3YA 1Q57A 3FOZA 4HLUC 3U3OA 2GZHA 1XD8A 3A1UA 1Q0UA 2OO7A 5C4GB 1QG2A 4KFRA 4RZUA 2V8OA 1QVRA 3ND9A 2H5EA 3T5GA 5EE9A 2O8DB 1GTVA 2QTFA 4LWZA 4DLXA 4G5QA 1Q12A 1YZNA 2FH5B 3RRMA 5LD2C 2REBA 3OFND 3LO5A 1MO5A 5G41A 3O8BA 5JWHA 1YQTA 1PZNA 3GLFB 2PCJA 3TKLA 4DDVA 4XWKA 1RC8A 1EFCA 4A1FA 4RD4A 4JKIA 1N2CE 2QZ4A 3GD7A 1J2JA 3EWAA 2CVHA 2IL1A 2RGGA 2XJ9A 5K8LA 4A36A 1AN0A 3UWKA 2V7QA 4W5HA 5GVRA 3VTKA 4LHZA 4ZDIA 821PA 4TLCA 1SVLA 2FN4A 4NKRA 3W34A 3NG1A 3HYRA 4Q9KA 4ZCIA 5KO2A 4WA7A 1E96A 4KITB 1Z6XA 2D4HA 1HUQA 1WBDA 2GXQA 1KDOA 1KO4A 3T35A 2V9PA 4QHYA 4TN1A 4JIMA 4B44A 2FOLA 1KI2A 4Q5IA 1P5ZB 1CJTC 221PA 3OAAA 1HE8B 4BECA 1M34E 3PUXA 1SKQA 3LH5A 2WJIA 2E87A 2N1BA 1QHHB 4IDNA 1S3GA 1RRFA 3KJHA 5AUPB 3FKSA 4HLDA 3ZQJA 4Q18A 3BC1A 1G4UR 1N0UA 2JLRA 4Y0VA 1XRJA 1D9XA 2IS1A 1D2MA 3K9GA 4MGIR 3OE7A 1T3HA 4RKEA 3DM5A 3VHLB 1NN5A 1OYYA 5J4HA 2F1RA 4KJZA 4TQUS 3WNDA 1SVMA 1M6NA 2LKDA 4TL7A 3B78A 5SZHB 2AFIE 2RKOA 3EIQA 4NYMQ 5JMTA 5B57C 1U98A 3AF1A 3PUVA 3QPUA 1GL6A 2FSGA 2A5FA 3OEHA 1IN4A 2ZVPX 4NYIQ 2JAQA 2ZXUA 4C4PA 5AR1A 4Q7LA 5C18A 3FTQA 1COWD 4OKSA 3SE0A 1KK0A 4LYHA 4RY2A 3SJCA 2DFLA 3HU3A 1G8FA 5B58C 2RGCA 1DAFA 3OESA 4LDJA 5KUTA 3I72A 4XWAA 421PA 5F2EA 5AWFC 3AVOA 5KNBA 3W5IA 2WAYA 3M4YA 2P6RA 1NBMA 1W5TA 2Q6TA 3BH7A 2NO7A 2F3RA 1S1MA 2ZUCA 4B6FA 1HV8A 4I1VA 4TWZA 2EW1A 3CNOA 3QKRA 1VHLA 2BKEA 3EIHA 4B75A 5K8UA 1AKYA 1CJUC 2DWPA 3VNVA 1EX6A 5EXSA 2VHJA 2GXSA 1OLOA 5FBRB 2FZLA 3CPHA 3RANA 3FWYA 3A1WA 1WXQA 1P75A 4MKGA 1FUKA 4YC7A 3CX7A 3KQUA 4C7OB 5JJIA 2GVZC 1D2EA 3CZQA 3QKSA 4CGZA 1H8HA 2VA8A 2ZYUX 4OI4A 4PC1A 1US8B 4AKEA 2GAOA 2PMKA 4B34A 3P27A 3K0AB 2ZEJA 4RFSA 5DHFA 2BBWA 1DG1G 2W2XA 1S0UA 3H4MA 1R8SA 2RCNA 4BLRA 5FL7A 4CT5A 3CX6A 1XXHB 3NHBA 4ARZA 1N5KA 1DBSA 5GJVC 2BVNA 1JJVA 3RNLA 1SKYB 1G291 2A5GA 1XTRA 2QT1A 3K1JA 3AKCA 2CLDX 2W00A 4PZYA 2QQ0A 4GSYA 3GJ0A 3RS5A 2OBNA 4ZCMA 1JPJA 3VKHA 5BN3A 4QGFA 3QKSB 2KSQA 2QTVB 1GKYA 1IQPA 5FH9A 4KVAA 3RS4A 1GFIA 2FMXA 2ORVA 1YRAA 3F5FA 3QI2A 4HZUB 1QDEA 4MRPA 1WE2A 4RFSB 1QHXA 2J7KA 3ZVRA 4HAWA 1II0A 4GMXA 4PR0A 4I1SA 2FGJA 4OHZA 4ARZB 4IFEA 4JL6A 4GOKA 4NONA 3GLGA 3M1IA 5FR2A 2BWJA 5JZVA 4UQOA 3GFTA 2ZI3A 1JNYA 5DN6A 4A2QA 1AZSC 1WF3A 3IBGA 1N0VC 2QRNA 2ZS9A 5CIQA 4B43A 5JI2E 2XB4A 4AY2A 1IXRC 2ZE7A 4OJQA 4LY6A 1OH7A 2IUSA 3TLXA 3DMNA 1TL7C 2W6ID 3ICEA 3CM0A 3WMGA 4LI0A 1FFHA 5L3RA 5TVKA 3M0EA 3G82C 1SHZA 1CR1A 4MH0R 1E1RA 5AJYA 1J8YF 1JXOA 4O2RA 3GLGB 4LPKA 4MKHA 1ZMXA 5HKKD 2RGXA 2J46A 2R2AA 4PO8A 5EP4A 3ASYA 4Q03A 1IHUA 3ZD7A 4P4UA 4NCIA 1NLZA 2BDTA 4FN5A 5AJZA 2BBOA 4RKFA 5HCNA 5BYJA 3EXAA 1U8ZA 2QA5A 3LA6A 3A1TA 2AXPA 1YHNA 1DE0A 4TLAA 3AVTA 1E1QD 2JLYA 2QE7D 1OIXA 2JIZA 3PVSA 1U9IC 3C5HA 4LBWA 1W36C 4AWXA 2YWEA 3LY5A 1XJQA 1DTSA 2BKUA 4PHGA 4M4SA 5TXGA 1XP8A 2F1JA 2PEYA 4PAMA 2G83A 4LJ5A 2XZLA 2ZJAA 4DEYA 4ZKEA 1UBGA 2K5UA 4U00A 4BFZA 4AYTA 3QXXA 2GEVA 4KYIB 3TH5A 5CITA 1FTNA 3SOPA 3UMSA 4JJKA 2VF7A 5M04A 1W4RA 3B2EA 1OIVA 2DWOA 3FE2A 1J90A 4HDOB 4QNRA 1S9DA 4MDEA 1ZVQA 5JS8A 2W6JD 3UG6A 3UPUA 3NBFA 3TVTA 3FMOB 2XX3A 4RCYA 1E9SA 2NGRA 2IW3A 1KHTA 2GBLA 2KB0A 5BW8A 1UAAA 2QTHA 2D2EA 2F1HA 4TLEA 1VMAA 1AIPA 3CPEA 2Q9AA 4M1YA 4XIGS 5GVSA 2GRJA 2F9MA 1XD2A 2LKCA 4HB3A 1OT3A 1UEIA 4DLVA 2IYZA 1LS1A 4C2TA 1JEEA 1TQ4A 2VPPA 1NNEA 1E2DA 5TY0A 1EK0A 2X77A 3BRWD 4M22A 4NMMA 1OB5A 3TSZA 3H1TA 2CLSA 3TGPA 1DO0A 1KAOA 1R0XA 3QOFA 4G3XA 4P32A 1N6HA 2OAQ1 2PLRA 1TF2A 2GBLC 1DPFA 3PCRB 1IOZA 2UVQA 1P73A 4FW9A 3A4NA 3R8CA 1XCMA 3T06B 2IS6A 4CEJA 4DCUA 3IO3A 1JEDA 3LWNA 1DS6A 2W58A 3B7GA 3DZDA 3JZAA 4YMSA 2VTKA 4Q1CA 2CDNA 2UZ3A 5FOWA 3R7WB 1VYUA 3L0SA 3CPJB 4LCBA 1LF5A 2RGEA 3NHAA 1G8PA 1ZD9A 4IVRA 3TIFA 5DNYB 4O3MA 1D9ZA 1OXVA 1E9EA 2IUTA 4OHXA 4QBFA 3QXHA 2XGJA 4W9MC 1Q22A 1ZINA 1Q1ZA 2WVJA 1CULC 4B2PA 2EQBA 4B33A 1RRGA 4U5XA 4OHWA 1E2QA 4BUJA 4D82A 1UKZA 3PEUA 4D25A 3R8FA 1OB2A 1OFHA 3IUYA 3T34A 2J7PA 4CEJB 2WOOA 1XF9A 2QPTA 4KFUA 1SXJD 3MWYW 2WHXA 2ZI5A 3CONA 4DB4A 3PEYA 1CR4A 1NSTA 1R2QA 3CB4A 4N1AA 4NCNA 1CU1A 3DZ8A 1V43A 3NDBB 2IEYA 2OBMA 1GIAA 3VX4A 3BAFA 3OEEA 4JJZA 2H18A 3SU8A 3KUDA 3AV0B 2HYDA 1II8A 1Q1EA 1FZQA 1UFQA 3KJIA 1LY1A 4GMDA 1FL9A 1QHYA 2V54A 1R6BX 4JLVA 2XNDA 4NZYA 1M7GA 2ZI7A 3X1WA 1F2UA 4OQXA 1EGAA 2WJHA 3WHLA 2HV8A 4C3ZA 5JEDA 4D4JA 1KGDA 1OE0A 3DKPA 4PHHA 1R5NA 2QQEA 3VR2A 1MRSA 4RCZA 2ECKA 2DB3A 1U0LA 3CF0A 4MYCA 3QE0A 3E5HA 4PZLA 2O0HA 4MUBA 2G1KA 4Q00A 3UWOA 5LDDC 2O8CB 4AK9A 3CRW1 2GK7A 2C95A 2IX3A 3AP1A 1FNMA 5BWMA 4CF7A 3RWMB 4HZIA 1Z3IX 3KJGA 4A6XA 2J59A 2GNOA 1II8B 1MR3F 1OJLA 2WKRA 1M8PA 5FPHA 5EE3A 1G3IA 2QNRA 5FPTA 4MKIA 3N5CA 4PPFA 2IWRA 1F2UB 1G5TA 2V4ZA 3TQCA 5LBIA 2EFGA 3L0PA 3MWKA 3K09A 4QG7A 3SBDA 1N6RA 3DPUA 4PAOA 4UNRA 4FIDA 1RPZA 1L8QA 3VMFA 2C99A 5HTKA 2N46A 3EPJA 4C0LA 5FUVA 4H1VA 1Z22A 2D2FA 1FMJA 1KI3A 2ZSDA 3AF3A 2WMOB 1TQDA 3QENA 4HAVA 3B1VA 4MRSA 5L3QB 1DAMA 4YONB 3RC8A 1DAKA 3THWB 2IYRA 5JHHB 3H2YA 3JVUA 1ZM4A 2OCAA 4RD0A 1NF3A 4R9UC 4FMCB 2O8CA 4OBEA 4Q48A 3RRNA 3K09C 3PEVA 2QU8A 4LBVA 4PTLA 4DLZA 2YHSA 1XD9A 1G5PA 3PXGA 3KXKA 1XTQA 3AKYA 2O8EA 2ZJZA 2QP9X 2Q21A 1DADA 5BN4A 1AS0A 1IXZA 4QBGB 4Q02A 1G16A 1Q1BA 3TQFA 5CM8B 3KUCA 5IF9A 2F6RA 2XOKD 3K0SA 2XB2A 1ZJ6A 2VL7A 3P26A 3QJYA 1Z5ZA 4G5OA 3L2OB 4NPHA 2ZS7A 2W2VA 5SZJA 4JVSB 3GJ5A 3GLFE 3B6EA 2ZJYA 2C77A 3VFDA 3U5ZB 1YE8A 2OE2A 3MG9A 1IN5A 3KX2A 2WIBA 4G5RA 3HPRA 4KU4A 4TL8A 5JECA 3P20A 3GJ8A 4HATA 1ZUNB 4PC2A 1FQKA 3BS4A 3HP1A 5D3QA 3CKLA 1HURA 5IK2D 1KZGB 2RGBA 2O8EB 1W47A 2OAP1 2YZ2A 3N2IA 4B35A 3MRSA 4B76A 4F93B 2GF9A 2UZIR 2ZANA 1P62B 4H1UA 1KK2A 1YZLA 2CBZA 4BQSA 4M9QA 1P9NA 4AIIA 1MKYA 3LQQA 1Z0IA 2PZFA 1SXJB 4Z8XA 1G4AE 3IHWA 4V02A 5EUMA 2XZOA 2ZRHA 3RVBA 5JRZA 2PJRA 3K70D 2E9SA 2OCBA 1YR9A 3WRYC 3CRRA 2IYYA 2GJAA 3PIRA 4G01B 4B71A 1U94A 3HU2A 2JA1A 5JWRA 1I2DA 1PUJA 2Q3MA 2IC5A 3SHWA 2QMOA 4NDZA 2F55A 1BKDR 1NG1A 4PO9A 5KPDA 3W9YA 4B3FX 5DYIA 4DWJA 4OQFA 4XOIA 2LWIA 4XVQA 4RFVA 2FFQA 1VTKA 3SQWA 1JJ7A 1AS3A 1A7JA 1WQ1R 2CCGA 2P0EA 2VYFA 1R7RA 3IO5A 4P0TA 1CKEA 3EPKA 3IEUA 4AYWA 1P6XA 3BXZA 2B8TA 2QPOA 4TT3D 3BFVA 3T1TA 2Z43A 2FGKA 1U0HC 4MQBA 1NVXQ 3VKGA 4L9SA 5CLLA 1NLFA 3R9IA 4OQLA 1ZCBA 4P33A 2GJSA 2ZSAA 4P31A 5FBWB 1XU4A 2VP4A 2HCJB 4DDTA 2ZRJA 4MYUA 2GKSA 5EE5B 1KI1A 3U6BA 4TTRA 1G20E 1II9A 2DFTA 2WSSA 4Q4AB 4W5JA 1WP9A 4MGKR 2BC9A 3EAQA 3SFZA 3A36A 4JYCA 4TYNA 5KPJA 4OHYA 1Z6GA 4M9XA 2G6BA 3BORA 1B23P 2GTPA 3ECCA 4L8GA 1S4QA 3I3SR 3I8XA 2IWHA 4Y0AA 2JJ1A 4HB4A 4O0MA 2ZVQX 3TW4A 2N42A 5FOSA 2Q3HA 3U3RA 1HTWA 4MGYR 3LXXA 4LV5B 5DYGA 4K8OA 3K0FA 4RD3A 5GJCA 2B92A 1GP2A 5J4KA 4NTZA 2ZSFA 2QMHA 3KFVA 4KLZA 2VIIA 3UKDA 5TV2A 2ZAOA 2FEOA 3ZH9B 4LJ6A 3PV0A 3GLIE 1RFLA 3NBYC 2V7QD 5TB5A 3TNFA 5JJKA 2PX0A 1XXHE 2IK8A 2QSYA 3BB3A 3GJ3A 3QVUA 5FL3A 3SQXA 3SHFA 4F38A 3QVVA 2OFOA 1I4DD 3RABA 1VG1A 1SKYE 3KDSE 1XMSA 2H1LA 2B7BA 1Z6TA 3MJRA 5EZ6B 2ZJOA 1MRNA 1NN3A 1KDRA 4HAUA 4CVNA 2HDNB 2MSCB 4FINA 4LZZA 3A6PC 1E9CA 5HZHA 2ZE8A 3FHOA 3K0FB 3LVRE 2JJ2A 4XVUA 1MO6A 3AF4A 1NMXA 1S8FA 3OAAD 2IT1A 3ND8A 1W46A 1RYFA 4BASA 4DVGA 5C2JB 2QBYB 1PUIA 1X3SA 1KYIA 1OFTA 2PLFA 1D6JA 5FOUA 3OIYA 3B1WA 1GILA 2WKQA 3FKSD 3SI7A 3BWDD 1LS6A 2WV9A 2CL6X 4CEHB 3TSOA 4PX9A 5SZKB 4FCVA 1J7KA 2R65A 4JSTA 1I2MA 5KHOC 5J47A 2RH5A 3BH6A 4PPNA 3K70B 4JS0A 3LV8A 2QMEA 3RSLA 2C9CA 3GLHE 3IPYA 2IHBA 4MRNA 2J45A 1TEXA 4Q4JA 3W5JA 2J41A 5DIFA 4ZIRB 2AD1A 3RRYA 2ZM5A 1JPNA 4XTCS 3KXLA 1TTTA 1EESA 1YR8A 4M2LA 4B47A 1H8EA 4J0QA 3U2QA 1HT1E 2WSMA 2FDCA 3Q8XB 1F5NA 1CRQA 2VP5A 2O8BA 1L4YA 2P6UA 4NL4H 4RZXA 1E0JA 2YNMA 1Z06A 5CDFA 1R4AA 5CLQA 2JLWA 4DT1A 1MABA 2FV8A 1E2GA 2QGZA 2YC2C 3SN6A 1VG8A 4Q4JB 1Z0DA 1T0HB 2YYZA 1OHHA 3O8DA 3U44B 1IJFA 1HQCA 2DCUA 1Z07A 5EUQB 3ZZ0A 4GZMA 2IS4A 1NBMD 3IIJA 3LX8A 1JR3A 4KHZA 5EP2A 3W8RA 1DVRA 2PCLA 3SZRA 1SHKA 4LV6A 3WY9A 4DEXA 1DEKA 1SVSA 5LD2B 2AWOA 4MDFA 2XXAB 2C78A 4M8NE 3SJAA 2OXCA 1C4OA 4XSHA 2BM1A 3FMIA 3LW8A 4QOSA 4X8HA 2EFCB 1ZIOA 1OFUX 2AD5A 2GEDA 4DLUA 2C9OA 4DT1B 1H8HD 2XSZA 3PENA 1KDPA 2A30A 1OH8A 1X1RA 1M2OB 2YC4C 1XPUA 2C9YA 3B9PA 1NG9A 1XTIA 2NIPA 2FFBA 1SQ5A 3NBXX 2WIAA 4LC1A 2Q9BA 3VAAA 4P3YA 2XTZA 4QNMA 4C0SA 1F6BA 3UG7A 1AZTA 2C96A 1CIPA 4JVNA 4FWIB 4BFYA 3AVUA 4C30A 6Q21A 4GL2A 1XPRA 5CB8A 3V4RA 3RYTC 2GJ8A 1XEWX 2GZAA 1S3SA 5JRJA 4IXMA 3FMPB 3NDPA 4PC3A 2A3RA 5H8WA 1ZM7A 3CH4B 2BIFA 1ZNWA 4JZKA 1IJEA 4C0BA 3D31A 2ZR7A 2HYIC 1GNRA 4JLPA 4LJ7A 1KOFA 5DN6D 1DG3A 1N6KA 1Z29A 1G7SA 2GCOA 3KKQA 4V0MA 1K5DA 1Z0AA 4LV8B 2JJ8A 1E3MA 1GNQA 4O25A 2IA5A 4Q7KA 5B64A 4BGDA 3W3ZB 2UKDA 2REOA 1UF9A 1W0KA 3F8TA 1XNJA 4JKYA 1VPLA 3W6PA 1Z08A 1IN6A 2Z4RA 3R20A 2BJVA 2Q9CA 1S2MA 2NMVA 1S9HA 2ORWA 3ZZUA 1OXUA 4DUGA 4IDQA 1UDXA 1CR2A 4R71A 1UEJA 4LHXA 1R5OA 1OFIA 4HUTA 3THOA 4F4JA 3KQKA 1TF7A 2WWFA 5JWOA 1N25A 1DAHA 4QM6A 3RS3A 4BPBA 2OHFA 3BGWA 3NVAA 4TMZA 2ZUBA 3Q85A 2CE2X 1H65A 3PR1A 4M9ZA 1ZM3A 1N6IA 1VYTA 1E2NA 2G0TA 1AS2A 1JAHA 2QSZA 1TADA 2VLIA 2TMKA 1A2BA 2DPXA 1Q44A 2ZRGA 1FP7A 5IDVA 3RSOA 2JIZD 5JLJA 4NP6A 4TQ9A 1PVOA 2ODWA 1BIFA 3VR1A 5A0FA 2OT3B 3LXRA 4BZXA 2F9LA 3TSWA 2ZRMA 4D6PA 3L0IB 3ADDA 4Q7MB 4TYPA 2VHCA 4YMTA 1E6CA 2DWQA 4TMXA 5JCZA 1RJ9A 5HZKA 5KNCA 4UXHA 4DXAA 4TMKA 3F3YA 1UBEA 1OYWA 3QKRB 2MSEB 3QBVA 3VU9A 4C0HA 5CK5A 5JBQA 4OK5A 2J0VA 1P9WA 1NI3A 3VR4A 5FI1B 1S1CA 1FP6A 2GJKA 4JT2A 3SC3A 1B0UA 1P4SA 2J0SA 3LLUA 1EFTA 1UM8A 2RB4A 4I1OA 3FGNA 2JLUA 1G3UA 2O0KA 2VEDA 5EXTA 4YDSA 4URYR 2HT6A 3E70C 4L15A 1TMKA 2B6HA 3TUJC 4NCKA 2DYKA 2CHQA 3LBHA 1GRQA 3DL0A 4URXR 2D06A 1P2VA 4PSVA 1E94E 1BMFD 3IDQA 3EARA 4W7SA 5CYPA 3GJ7A 2CL7X 4PPQA 1G3QA 4IDOA 4TQAA 5KNDA 5CB6A 1KJYA 3HPQA 2VH5R 3IQXA 5G3ZA 4LK2A 1KI8A 1KY3A 1ETUA 4MYHA 2BEJA 5C46F 4QHSA 3ZGXA 621PA 4IVPA 3B13B 3P32A 3WHKA 1G64A 1LFDB 2ZRCA 4KI0A 2C5LA 2V6JA 2AXNA 2ZYTX 4Q7JB 2IYTA 2AK3A 3BB4A 4AG6A 2CLCX 4G5GA 1N0WA 2QORA 2Q3FA 5DHAA 5DI3A 1U9IA 1ZD8A 2ORIA 2IXGA 1Z83A 2EFHB 4ILEA 4LJAA 4F7WA 3ZDQA 2V1UA 3T1VA 1P2TA 1OH5A 4IW3B 2H8KA 3N2EA 2NPIA 3HYTA 1NVVQ 3PUYA 2ZPTX 2AKYA 1OF1A 3KKNA 4PZZA 1ESNA 2FFHA 1A5TA 1AM4D 4HEJA 2GA8A 4EIWA 3OIVA 1FUUA 1RRPA 2J7PD 4ZV4A 4M1SA 2W83A 1BS1A 1KDTA 1WDTA 3AGQA 1BYUA 2QP4A 1PV4A 1TUIA 2WKPA 2FZ4A 5DGXA 4Q1DA 4L9WA 4M1KA 2ZJBA 3WBKA 4YMVA 3DMDA 3IEVA 5DI3B 1SGWA 4NYJQ 3BH0A 3OEED 4LUCA 1R10A 4JLDA 3P4YA 4BRWA 1KK3A 1W36B 2RAPA 4Q66C 1E9AA 3CNLA 5TARA 1L7VC 4KYUA 1SXJE 1GDDA 2XNDD 4ZI2A 1NY6A 3HJNA 3BE4A 4OHVA 3RHFA 2BBTA 1FTSA 4UNNA 4A8JA 4LJ4A 4I81A 1X8LA 3G5UA 4WVFA 4BLQA 1IY2A 3Q5EA 2WWHA 2EWWA 5IHPA 5J4YA 2OXRA 1Q20A 3EWSA 1QF9A 1P7CA 2G1JA 4Q1FA 4TMWA 2RGDA 1U81A 1MO3A 4R98A 2RGNC 5EJEA 3TK1A 4TYQA 1JBKA 2FWRA 4TLDA 4D4LA 2AFHE 1NMYA 1Z6AA 3W8NA 4A8JC 1JI0A 1GM5A 3L0OA 1E2FA 3FVQA 4O2LA 3A37A 4A8JB 4ASUA 2H7VA 1W49A 2HCBA 5J40A 3UXMA 2EVWX 4I4LA 5A4JA 2HLDA 1ZNZA 4LHYA 4G5SA 3I62A 5JI3E 2IF2A 5HR5A 4Q21A 1N6PA 3X2SA 4DDUA 3WP1B 3LX5A 4GNKA 5H1YA 3NIBA 5B2ZA 5BN5A 5FPSA 3B60A 3AM1A 1Q3TA 1VIAA 1G8HA 1G41A 3A58B 2A7QA 4MYTA 2ZU0C 5EP3A 1GSIA 4R7ZA 1RYHA 4FD2A 3PITA 2HUPA 2JASA 3DKVA 3U7EB 1ZU5A 4IVQA 4TZ6A 3FB4A 1XD2B 3WRXC 3SNHA 3FHCB 1E98A 3ZVLA 4DDWA 1ELOA 3I8SA 4TMVA 1OXXK 2ZUDA 1KNQA 3VHXA 1XFAA 2NO0A 3LDAA 4URZR 4H9GA 4AG5A 4B48A 2ZJ5A 1XX6A 1EX7A 4MITA 4XJXA 3QSYA 1TU3A 5JEEA 2X2FA 5AJVB 2P6NA 4PQYA 2VP9A 4FMCF 1J8MF 2YINC 4RD6A 3BFKA 3L8YA 1ZC3A 2OV2A 1KSJA 4L4UA 5FTMA 2GF0A 4PXAA 2QROA 1HYQA 2IHYA 1KJZA 2DFNA 2GILA 3SR0A 1VDZA 1XTJA 1KMQA 3EPLA 3IQWA 2Z5FA 5D3MA 1CR0A 4RZ3A 2W0SA 2BMFA 1JAIA 3H0KA 1E1QA 3IIKA 3Q9LA 3WNBA 4RVCA 1QRAA 1FOEB 2E1RA 4QHTA 1NN0A 1LW7A 521PA 3HDTA 2VHTA 5E7JA 1GKIA 1YR6A 3DM9B 2IXFA 1G21E 2WICA 1KI7A 4HUQA 2C2HA 3ASZA 1R0WA 2VRWA 2ZRFA 1IN8A 3KKMA 4DIEA 2AWNA 2ERYA 1JQLB 2ODNA 4JBWA 5E95A 1VCMA 1YRBA 1E0KA 1OKKA 2Z83A 4M1MA 5D3MB 3WNCA 4QKQA 3DOFA 4BFSA 4EPWA 4WXPA 1F2TA 4OK6A 1KSHA 1ZIPA 4D4MA 1W1WA 1HA3A 1IY1A 4GFDA 4M1OA 2BEKA 4US1R 2PZGA 4TYWA 1AJEA 5K8IA 1HY3A 1PJRA 1IN7A 4MRRA 1NY5A 2PMDA 4S35A 2IEZA 2BV3A 4HUQB 1TUEA 3I32A 4ZDJA 2OESA 1ZM2A 2ZYVX 3BIFA 1J99A 3EZ2A 1OXSC 2OFXA 4DLTA 3AVWA 1KKMA 4Q1BA 1VKJA 2BJWA 3EA0A 3TR0A 4L5BA 1W4CA 1ONBA 3JVVA 4CEIA 3TE6A 2OCPA 1VHTA 3AUYA 4WOPA 3REGA 4EFNA 3BK7A 3KJEA 4L16A 3MCAA 2G0NA 2J5XA 2CNWA 1CJKC 2ZREA 2PBRA 2JLZA 1CF4A 3RWOA 4OJKA 1AQYA 1GVNB 1EFRA 3B1YA 2WSSD 1CS4C 1W7AA 1TU4A 3C15C 4RD2A 2ATVA 3V4FA 3EG5A 4B74A 5FBVB 2FPLA 5FUWA 2BMDA 3U3MA 4NYMR 2I1VB 2G3YA 5ELXA 3DEFA 3LLMA 1DAGA 3OF5A 3AEZA 2VSOA 1PLJA 1GL7A 2W2TA 1XCPA 2JJ1D 4NYIR 2ZJ8A 4PHFA 3SYNA 4C0QC 2R9VA 4Q01A 5DI9A 2AHOA 4LJ9A 5B30A 1R0ZA 2ZROA 4OL0A 3KXIA 3QY0A 2F43A 3WXMA 1W4AA 3HR8A 1Z8FA 2JLSA 4YXWA 1Y63A 4PSKA 2AX4A 1DOAA 3MJHA 4DCTA 1ZAKA 2DFKB 3Q72A 1F48A 1D2NA 3CH5A 4TTQA 3WYFA 3LW7A 4F4IA 1QHIA 2CHGA 4QGHA 2H17A 1KSGA 4XD7A 5G53C 1E99A 3PQCA 5E7IA 2ZS8A 5E7MA 4KO8A 4UJ5A 1X6VA 2QRZA 1P3JA 1G3RA 2I4IA 1E9BA 2CXXA 3D6TB 5TDHA 1VCOA 4EFLA 1AK2A 1Z6YA 1K8RA 3NC0C 1JECA 3BD9A 2CEAA 4LYAA 2VP2A 4IOMA 2BCGY 2JJ2D 3OIWA 4QRHA 2JLXA 1X1SA 1TF5A 2IYVA 4IRUB 4D0LB 2V1XA 4DCNA 1IBRA 2DBYA 2PL3A 2CE7A 2ZRDA 2J0UA 3X1XA 3KL4A 4OYHA 1U8YA 2ZIAA 2I3BA 2PZEA 3AKDA 1U99A 2WBLC 1KO7A 2ZRPA 3UMRA 4FCWA 3KB1A 4Q4HA 4F4CA 4TL9A 1DO2A 4KODA 2W0MA 1R0YA 4HAZA 2D7DA 5F9FA 4ITRC 4LYJA 3AH8A 3V9PA 4PFSA 3CBQA 3U61B 4EPYA 1XJ0A 3EZ9A 3UANA 4BE7B 1N3BA 1UBFA 2VHUA 4DLYA 2V6IA 2J0UB 2ODEA 1PLKA 2R6GA 1M1YE 5CM9C 1OIWA 4HYYA 2BMJA 2XEXA 3TUIC 4A0FA 1EXMA 2C04A 3NWJA 1C1YA 2ZR0A 3Q7QA 4QGAA 3T1QA 1E0SA 3WP0A 4B3GA 1ZRHA 5HE9A 4YMUA 4GT1A 4TSFA 5JHGB 1FPMA 2MSDB 2C03A 5L8VA 2CCKA 4GOJA 5HCIA 2OCYC 2QAGC 1OHHD 4LGMA 2RHDA 1G17A 2YWHA 3AP3A 3LRPA 4NE2A 1BYIA 5FPYA 4X8LA 3WBJA 4B3XA 1JR6A 5FBLB 1NKTA 2ZU6A 4B32A 3LD9A 1G8GA 1E79A 4EQ6A 5JCPA 1NP6A 2WTUA 3SEAA 5DO9A 3V00A 1CTQA 3AQ4A 4QJ5A 1N5JA 1VIYA 3D3QA
chains in the Genus database with same CATH superfamily
3JQAD 1DAOA 4YDRA 3N3AC 2WVHA 3QF4A 4P0QB 1PWZA 3WR5A 4NC9A 3SXJA 3Q5DA 4ZREA 4KACA 1KVRA 4CHGA 2W2OA 4RVGA 1UWKA 3U80A 5ICEA 2XSZD 5EXPA 1KXZA 1EVYA 2FF7A 3FYSA 3A1FA 2V3VA 5EGNA 4DBZA 4MUYA 1NBOA 1XWIA 5F3DA 4CIXA 4BVEA 4LC9A 4WFKA 3QM1A 4YDQA 1L4MA 1RXWA 2NM0A 1HTTA 1VE6A 1UPUA 4YK7A 1E7YA 4MEAA 4QYIB 1B4DA 1BCSB 3QVSA 4UXIA 3E7PA 1U6JA 3RIEA 4OQQA 3W6NA 2F17A 1VYVA 3RK1A 2IPMA 5HF8A 1EUCA 5KYKA 3OTOB 2ZIGA 1OJ7A 1GWNA 3H05A 4DEYA 2X5XA 4ESHA 1J21A 2KI5A 4X3OA 3WGHA 2PUFA 3L79A 4FHEA 2ZI9A 2CUZA 2CJWA 4FNAA 1Z7BA 3F6YA 2PPVA 3M8KA 5A6SA 5A0TA 3K6KA 2J9RA 5M3BA 5CA1F 2FW1A 4RVHA 1CBUA 1E0AA 3U60B 1TD9A 1ECFA 2NZWA 1P2SA 1W0CA 2A4MA 2RSLA 3PQ6A 5C4MA 2BFAA 4EJSA 3TOCA 2OV1A 3A6JA 3MTIA 3QYJA 3VSDA 2PS0A 3OE7D 3MMSA 4UVGA 1QG4A 4XDYA 4IX9A 4AKHA 2OGWA 3S1AA 3QGMA 4PM4A 4HDQB 3CUVA 4O4IB 3LBNA 2P5TB 4FNGA 4KIUA 4FMBB 3HTXA 1JFRA 1Z26A 2XLBA 1C4KA 2VHQA 2ZKIA 3AOGA 3CZ5A 1EK1A 3AM3A 1PBTA 4FNOA 1QJ4A 2Q28A 2DPMA 3PQ3A 4DHEA 1GTJ1 1ADBA 3C48A 3DMGA 2WZQA 3ZLUA 4EABA 1JFVA 3EEYA 3A1SA 3EZLA 4YMWA 3SX4A 4IIJA 4EENA 4EJSC 5IRCD 1QRUA 3GLGE 1CEEA 4CM6A 1IXSB 3DZJA 4RC9A 1R5BA 2HA0A 3O4FA 4GR9A 1T36B 3WJ1A 3HXMA 4QAJA 3H86A 4KFSA 4K9LA 2O8DA 5F73A 3KETA 1YIDA 3LBIA 3AVPA 4JBXA 2PKEA 1JEJA 4RTNA 4YCSA 3AVQA 2VYNA 5FADA 3ZHUA 1NVGA 2G06A 4AMGA 2A78A 4DKXA 1NQOA 2KLHA 4UVEA 1Y9AA 2EKPA 2Q1UA 3O4RA 2WAXA 5AVYA 2XXBA 5GGYA 1ZK0A 2NU7A 3R40A 1OLUA 4YP0A 3TNYA 1ZVJA 4MOWA 4BVKA 2JLVA 3N0VA 4HS4A 4Y6SA 2UAGA 2ADOA 4OQMA 2WE8A 3JSAA 2O0MA 1HX7A 3KEFA 1MW9X 1Z68A 4PC7A 3LX4A 4EO7A 4B3CA 1Z2AA 1A82A 4A8HA 5JSKA 3RS9A 2V59A 2PIAA 4PTYA 5AVXA 4HP8A 2JDIA 1GITA 2RH9B 3OQIB 4XAQA 2I6GA 4AJLA 4BO4A 5E1OA 5IANA 1GSAA 1V2GA 2VPTA 3SDZA 5CA1B 3GRZA 4WKOA 4KVGA 4GPD1 5CXUA 1UDWA 4GUDA 1P7WA 3RV4A 4C0KA 5EP1A 1XZGA 3JQ7B 2G9UA 5FL7D 4YNBA 1I3MA 9MHTA 2ZRLA 1HDCA 2AFRA 3I83A 5C8YB 1O58A 4YYEA 2P4SA 2QT0A 1H4QA 1L1QA 2VR1A 3BJRA 1WXGA 3CEHA 1BH2A 2WD7B 3C8ZA 4EKGA 3ESCA 1XMVA 3K94A 3W05A 3DFIA 2QIOA 1W0JA 2J9ZB 1QG0A 1SK9A 2VP6A 1DQNA 4WY8A 5DBOA 2IEAA 3HCCA 5FD8A 4WWHA 1SULA 4R2IA 2IXAA 2WG0A 5GADl 1V3TA 3BRCA 3QFSA 2IBSA 1A98A 1G8AA 2YS7A 3OIFA 4LF5B 1JEOA 1TEVA 1E8DA 2HTFA 3BTUA 1W48A 2FNAA 3CSDA 2LIPA 3DTYA 1GGKA 3B9BA 4X8OA 1R00A 5HPYB 4RK1A 4IPTA 5FI0B 3ZIAA 4UJ3A 2BCJQ 1MAVA 2IHJA 2WJPA 2YZNA 2PSDA 4MW2A 5JS7A 5K8JB 4E2ZA 2XVZA 2BP7A 2DCMA 2MYTA 2VHVA 3QEOA 4WKNA 2I8AA 4MP6A 5FPKA 2HREA 4X7PA 2PLNA 3NEJA 4G0QA 1HT0A 1T91A 2JKVA 2D6FA 3RDPA 2CDBA 2ZTUA 3M4ZA 4NX2A 2WPNA 2YFKA 3LHDA 3VZRA 3ZW9A 3EUAA 5JNWA 5C3UA 2PVSA 2G6TA 3FNQA 1E1RD 3HDGA 4HC4A 4NBLA 4DLWA 1QYVA 4YRNA 1ONNA 4EA6A 2C82A 4U5QA 3RIXA 1THTA 1W36D 3PE4A 5DBIA 2H0QA 1H94A 2DAPA 2C97A 2XDAA 3FI0A 3EXG2 1Z47A 3NNDA 4E5UA 4LHSA 2ATXA 2V5UA 1O4WA 1TM3E 3AY7A 1JJBA 2QZJA 1KNXA 1FJ2A 2BFBB 2WSBA 3DE1X 3LT2A 4YRLA 4AJ1A 2C00A 3NIDB 2V7PA 2UXCB 4RHFA 2A5JA 2YKGA 1ZZGA 3FHTA 4X1OA 2V4UA 5KTYA 5KSPA 5GIOE 4XIJA 2ADMA 2C5EA 3JWPA 3LUDA 2BBSA 3HB5X 4EFKA 4DV3B 4GE0A 3PEFA 4TKZA 1BQ4A 1XZ8A 1XLVA 1JDJA 2VT3A 3MWJA 3FUXA 4K7JA 3P9SA 4DLSA 5L3VA 3K0AA 3AI1A 3NAQA 4BKUA 4MRMB 2J07A 1FJXA 1ECLA 3DE5X 3NX4A 4MIOA 5FOXA 4LJKA 3IDOA 3FUUA 1JWBB 3RSSA 5KZMB 1SG0A 2Z2YA 1CQXA 3MCUA 5H9WA 3RTEA 2EJTA 3T7DA 3LHFA 3GGCA 5T41A 1XZQA 2BY4A 3F9CA 4IX1A 5F2NA 3GEGA 4QUIA 1VBNA 2NZ8A 4OSOA 4DJTA 3VPDA 4G1MB 1KWGA 1JALA 2CCJA 2FWNA 1SUWA 3EE6A 1N2ZA 2VNJA 3I39X 3ANMA 1EX9A 2Y8EA 3I2KA 1G6HA 3ED1A 3QKUA 1QQAA 2YOGA 2GEBA 4XGQA 3M33A 2X2EA 3SJZA 3EGIA 2VRNA 3JATA 1YI1A 4Q9JA 5EE0A 4KBGA 3Q8WA 1KY2A 5H16A 1V5EA 1XROA 2XUQA 2QRQA 3EBLA 1NVUQ 4I50F 1IJKA 1SOWA 2C92A 3K53A 4AZWA 2AL7A 2ZJ1A 3C7AA 1KF0A 1YUBA 5AJWA 3RC9A 5CFRA 2J6CA 3H1GA 2PH3A 2FPPB 3GG2A 2PMCA 4JC8A 1JB9A 1SVKA 1QZXA 3VU9B 5CFPA 3RRXA 4ASUD 2CVQA 1ZW6A 4ZD6A 2YZKA 3VKWA 4IQ4A 4BNZA 5BQXA 5C35A 2ODPA 3NHRA 3DAHA 1Z5NA 2TMDA 4QQFA 5KYTA 2QVXX 4BAGA 4QTUB 3UM9A 5BV0A 2JFBA 2JLBA 1WZNA 2PT5A 3T7EA 2Q2VA 1NU8A 2AN1A 1RM0A 1H6BA 1HZZA 1UK7A 3N9IA 3TXXA 1UUFA 3CEAA 2R00C 2GZDA 4RPJA 2E5WA 2PO5A 1TAUA 1J0EA 3A2KA 1ZSVA 5JXWA 3V33A 4KFCA 5KWVA 1AV6A 3FPHA 2MR5A 4EGSA 1Z17A 1PSDA 4KCGA 1G5RA 4AXBA 5MGNA 3P0EA 1U7HA 2VRBA 4BBJA 2WWYA 4JA2A 1POXA 4ZEXA 3CX8A 4A0HA 2ZJ7A 4L4ZA 1W6RA 1T8PA 1VCNA 3PUWA 4RKYA 3DXFA 4R41A 2J0QA 1QIEA 1HZZC 2OFPA 3H2BA 3MIIA 4MW5A 4A26A 1Z7GA 4JBYA 5FTNA 3WK6A 1PR2A 1VKOA 1XQXA 3ZK9A 3D4BA 2DBRA 2P3SA 4DQDA 1JHVA 2BEUB 3SS7X 4HYQA 1SZPA 4G0ZA 3VQTA 2NXEA 4F5WA 2A5DA 3O47A 1COWA 3P45A 3QEBZ 4K26A 2UYGA 1TQ2A 4DRXA 3ZWNA 3E61A 4DA4A 4ERNA 1L5WA 3D8RA 1RKUA 4O4LB 3ZE0B 4X91A 3WMRA 3H4TA 2BEVA 3RLIA 2CVPA 1AQIA 5GWXA 1DRUA 2UZAA 3WLJA 1L4FA 1VG9B 3CW9A 1R88A 3KQSA 3PZBA 4I99A 4P93A 4TS4A 5AVUA 2IZOA 4M60A 1L4LA 1P4GA 3FCXA 4MKFA 5AT1A 4BZZA 5BNWA 4I50B 1FMLA 1SOAA 1ADFA 3SM3A 1YO6A 5AOCA 4EPRA 3GNTA 3OZUA 1ODLA 3S2ZA 1WXHA 4PFQA 3PXAA 4IJWA 4M0PA 5ADUS 4PLPA 5IULC 1TJ5A 2ID7A 2JHAA 2L82A 4FLFA 1P3DA 4G67A 3ZV4A 1U9YA 4LOJA 3WMWA 2UXDB 4RK0A 2AW5A 1M2KA 1VM6A 2PO7A 2QXUA 3MWLA 3OU7A 4K9OA 4LOHA 1T9HA 4RK7A 4ZTUB 3HQ4O 2JFGA 4N0PA 1DARA 1OAAA 4IEEA 2OILA 1IFXA 3GEIA 4JR2A 4MKZA 4IMJB 2WUGA 4F45A 2W4IA 3KKOA 2I3ZA 4D3DA 4QVGA 2YHIA 3A10A 4EF6A 1D2RA 2Z2IA 3H2GA 9ABPA 1Y6GA 3D6MA 2VNIA 4UTVA 5I7HA 2F4NA 3HABA 3R8XA 1NHWA 1Y33E 3ETEA 3GZ4A 3ZX5A 2CNLA 5TE9A 3RU9A 3OF2A 1A9XB 2XRZA 5ICSA 3ABQB 1U1DA 4RQUA 1JXAA 3KYBA 3WYGA 1R0BA 3LRXA 2ZRIA 1YE5A 3E27A 4K6HA 3GP8A 5H3LA 2YY5A 4WW0A 2ZRKA 4K8RB 2REXB 2Q1SA 3AB8A 1ZU4A 3CLRD 1Z45A 2CUKA 2OVBA 5EWMB 1NXPA 2QRHA 3A6ZA 3X44A 2HEIA 2KE5A 4OHKA 2JH8A 1HDEA 5E1DA 3NHPA 1BVYF 2Q50A 4REQA 2R1VB 1MC4A 3DHEA 4RA6A 2XE8A 2FP4A 3ZK7A 1RMYA 1AKQA 2AB0A 1D4ZA 5I9IA 4X24A 3BHMA 1ZI9A 2FPUA 2GNPA 1YZGA 2IEGA 2MMGA 1B0PA 1SVWA 2JBWA 2Q62A 1Z82A 2VVTA 4F46A 4X90A 1CJMA 2I87A 2I8CA 2GLUA 2GQ0A 4ECAA 2Q1XA 3I8OA 2W6IA 3JQQA 4MHOA 1PFWA 2IXEA 2Q6IA 4HSGA 1N2SA 3ADBA 4JP8A 1DXYA 5BNFA 1Q6YA 5BPFA 3NWEA 2A67A 3W2FA 2MWMA 4Z4FA 3GH1A 5FLEX 2NQ2C 4E5KA 1A71A 2QT9A 2RBGA 1MC8A 2FSFA 2Q4OA 2WHPB 1EG7A 1UEXC 3TYXA 4XTRA 1L4GA 3T12A 2V7TA 2R7NA 5HKKA 1H9BA 2WJ4A 5CVUA 4FFBA 3JV7A 5CD9A 3RYFA 4UDYX 1J5PA 1RI1A 5AHOA 4N8EA 5EZYF 1ZUHA 5LQCA 2B1JA 1MJGM 1MF7A 4RHXA 3FWNA 2H4FA 2MINA 1VLJA 2N1MA 4CMIB 1EUQA 3ZCTA 3LCUA 3W2EA 3CW2A 3DE7X 3W6OA 1CQWA 2DTDA 4EOGA 1JPUA 5C80A 3A9RA 4TZ0A 4MUHA 4HQ0A 1QOQB 1LVGA 4OY3A 2XTMA 4QXQA 4QM7A 3E53A 1SXQA 1O95A 5BYKA 1EIWA 2VHEA 4ZAFA 1QE5A 1XQVA 1L5YA 1ATZA 2QG4A 4HSEA 3TZBA 1U5BB 1SKBA 1HKUA 1KDYA 2G36A 1KVTA 2P7IA 4CV2A 4ENTA 3T3HA 5LOVA 4TZTA 4F5YA 5I7FA 3PTZA 2A1UB 2IRWA 4MVYA 2ZSUA 4Q9LA 4D9IA 1ISMA 5FOTA 3W90A 1UAGA 3GELA 3K73O 1TA4A 1QIGA 3IT3A 1KKLA 2X7JA 3VO8A 1CDEA 5K09A 3UJNA 2GX6A 4JBGA 1QGUB 3ZDBA 3HCBA 2ADFA 3UC5A 1O95C 4MMXB 3F73A 4C29A 2XXJA 4KXXA 2DR2A 3ZVMA 4GMFA 2W6JA 5ALNA 3DBIA 1I1QB 1WVMA 5JALA 4KWCA 4UUNA 3ECSA 5DCLA 1TMOA 4N3NA 5A06A 3LXMA 4YHHB 2RGAA 4I55B 3UAYA 2Y3IA 5AKEA 3KB8A 3ZLJA 3WIVA 2GT1A 4R5MA 1GFWA 1MQSA 3GB9A 4RD1A 1OSNA 1W5EA 2Q5HA 2VQEB 1P9RA 1Q14A 4PIVA 5E1BA 5IABA 2QRUA 3GAMA 3TL2A 1UM9A 3PI6A 4FI3C 4WLOA 1FNDA 5D1HA 2ZSHA 4DZZA 3N70A 3G2HA 1TZBA 4I1UA 5J5CA 4CZ2A 4XDHA 1C3JA 4CKEA 3HKEA 3ONWA 5BVHA 1BXGB 1NBHA 3RU2A 3ND6A 4MUFA 4A0RA 4XQ0A 1PWXA 4TZKA 1V7QA 1DNPA 2X9QA 5E4FA 4NCJA 1XKLA 1YVEI 4LVCA 2I6XA 1RYZA 3FOFC 4OOFA 2O3UA 3T54A 1NATA 4Y6QA 1LCIA 2XUFA 3KCQA 3WLLA 1SZDA 5DH9A 1NRXA 1KTVA 3NOXA 3K6SA 4U4AA 3NC1C 1LKZA 5C53B 5KREA 3KKKA 5KSWB 1XTZA 3ODGA 2J3MA 4G4GA 4RMNA 5KYYB 2CVFA 5BMOA 3JZDA 1XP5A 4OK3A 1USIA 3SF0A 3UK1A 4BMYA 3FZGA 2XAUA 4FT2A 5FUXA 2FQ1A 1HGXA 3TAHA 1TB4A 3ETLA 4KMSA 5FA8A 3IR7A 2PDAA 3HJGA 2VDUE 2X9VA 4MB6A 1CLUA 5FUYA 2XUAA 4RNCA 4IJVA 2YQZA 1VIMA 3ANXA 3KSDO 3NTUA 3PQ7A 1P60A 1JVBA 3R6LA 4DSUA 1YE3A 4BLTA 4FFPA 1QWSA 1C30B 1GNSA 1WVIA 2YY7A 3N6XA 4RX1A 2IYEA 2QYSA 4TLLB 4KWHA 4KPYA 3O0TA 1AHIA 4AKIA 3OIDA 3I05A 2YHBA 3KALA 3FA2A 2HK7A 3SBEA 2WPDD 2ASEA 3VR5A 4RZSA 3B1XA 3HO6A 3B8EA 4I4CA 4CLHA 3C8MA 2WWWA 2DXIA 4YRCA 5E4TA 4E5MA 4QXAA 2I7CA 5DGHA 4CDGA 2ZYRA 1AZLA 2NNLD 3FNGA 4I6JA 4URFA 5DMXA 3UENA 4Q1AA 3RARA 3CGGA 4BDSA 3TX6A 1YASA 3FBGA 1QZZA 2AQKA 3C5VA 2IZ7A 9GPBA 4TUYB 1T5SA 2VJKA 1AKVA 1PW5A 2AFHA 3BTVA 3Q9SA 1OW3B 4RIHA 4WCVA 4FUQA 3QFHA 5J2UF 1H1LB 2R8YA 4FB5A 5JSZA 4FSHA 2FX5A 1XTSA 4W8OA 3OETA 1U0GA 1C0IA 3CXUA 3TEFA 3A7EA 1DHRA 2ERXA 3GIWA 3I4LA 2G4LA 3PLAE 4M9RA 4PQRA 1FDVA 5JNTA 1R9MA 1ZFNA 5DE3A 3H2ZA 4ZYLA 3FFBA 5EQFA 3C98A 2JGAA 2E18A 5B5SA 1PT9A 1E2KA 1SVIA 1ISPA 2XGGA 3FZNA 3MCZA 4W5WA 1E2LA 3T5PA 2DR3A 1UJ2A 2V6BA 1HEUA 1SEVA 3F97A 2IKSA 3I2HA 4BTEA 5KQSA 1E3DA 2C83A 3QX9A 5TQVA 3WKDA 1GD1O 4LQDA 3UCEA 2P3LA 1WZEA 1ZN2A 2YS6A 1PV1A 4ZZ0A 1RI4A 4US2R 3DBLB 1DKLA 2BKVA 4PS0A 3ID6C 5KSZA 1CJVC 1TAHA 1VBMA 1QH8B 5AHXA 2ZYGA 4AZ3B 2BFEA 4DJFC 2YIDA 1U2EA 4O6VA 4MS4B 3E15A 1X1AA 3KC2A 3LYAA 2HIGA 3D4LA 3QVXA 4GO1A 4WH0A 4B5KA 5K20A 2NO4A 1KI6A 4GP6A 2PS9A 4K81B 3TG8A 4R1NA 1OC2A 1LDEA 1AGPA 3QMMA 2CZQA 1UADA 4TKUB 4EG6A 1G38A 4J0CA 1PK8A 2G5TA 2O6HA 2O1XA 1YRHA 3PIIA 4IDDA 1NYLA 4N41A 1GPBA 4MV1A 1QRRA 1I4TD 4M21A 4QFMA 5LA6A 4B3BA 5BQ5A 3BKWA 3UZUA 4B3SB 4P38A 4WXYB 3E2IA 2LD4A 2XT0A 3DV0B 3BSFA 5IP5A 1CZOA 2PTHA 1I7QB 2CJPA 3HYLA 3UIEA 2Y1OA 3UTCA 3K4HA 1VLMA 2INGX 4XIYA 1U2QA 3F9RA 1G2QA 4CTNA 4N9QA 3ZWAA 4KWEA 4ZO4A 1WDKA 3PPVA 3REOA 3D0QA 3QXJA 2R66A 1GHTA 1VSUA 2EQ5A 1JDBC 1L3BA 1M8FA 1GEEA 3BXFA 3PSAA 3P9KA 1AQLA 1P2UA 4IH1A 1IM2A 1S7GA 4LMBA 1XKXA 4ALJA 4DSTA 1FX1A 1QP0A 4LF9B 4G07A 3IP9A 2Y2UA 2BRUA 1O6ZA 5BORA 1WRBA 3GI1A 3CUEF 3L8HA 4KPUB 5HBRA 2IKQA 1WV0A 4E15A 1TA9A 3H2JA 1E6UA 4II7A 4GRAA 5MGBA 1WNFA 5EHGA 5J5AA 3LHKA 1L7XA 2C1ZA 2YV2A 3KV1A 4RF2A 3L7KA 2NSHA 2ZAGA 2HSZA 3JR7A 4OFBA 4YJGA 4GSLA 5A4AA 4YA6A 5KQGA 4XKJA 5DCUA 3EMBA 3H5TA 2WJYA 1KSFX 3GMTA 4KQWA 3P5SA 5FFMA 1SCIA 3A7DA 3UCXA 3N2LA 2JFUA 4D3XA 2HZBA 4OHMA 2V65A 5ECGC 2B8WA 4HVTA 4UATA 3AUSA 1M6EX 2ANCA 5EJGA 1M2FA 1CK4A 3P9CA 1EZZA 3KZVA 4HAXA 3CRNA 4G5YA 4YUVA 3ZDZB 3EXHA 3LYUA 4FE7A 3RM3A 4C6TA 2NU6A 4Z1MD 3K20A 2FCRA 3OLVA 3X2FA 2J3QA 2BISA 3EIFA 5FX2A 2R6FA 2DKFA 3F47A 1YA8A 3JYPA 4G84A 2IYPA 4NR0A 4XYEA 3WGNA 1SURA 1T6XA 3GRUA 4DLBA 4ZIRA 1PL8A 1NIJA 3K0EA 4E07A 3QLUC 3IVCA 4UEOA 4MWCA 3ZI0A 5EJ8A 2FSUA 3KAPA 4DC0A 1E4YA 3VNSA 3R9XA 5BQPA 1OXTA 2W22A 3KM0A 2OCIA 1E3WB 1YS1X 3RSZA 1WB9A 1VECA 2PX2A 3H87A 4FDTA 1NRJB 5IPFA 2BSQA 3UAZA 3EXHC 5BWNA 4B4UA 2EBUA 3IT2A 2OLKA 1ZS9A 5ARCA 2MU1A 2NVOA 4JI2B 1JQBA 5EQJB 1RYBA 3BFJA 3VR6A 2WM3A 3H7AA 1EK6A 1ZIDA 2CXQA 1N9KA 4KMRA 4RA9A 5T8KA 4R40A 1Y3IA 3QPDA 5ITWA 2RH8A 3G0HA 4WK2B 1KJWA 3EDRA 1JPVA 4JL8A 1G19A 1ZRMA 1PEKE 2H16A 4M46A 3UA4A 3R3VA 4JX9A 4B17A 3A2LA 1JZQA 2ZTVA 4FOOA 4OXIA 3EDMA 5KCMA 2P3OA 3HJCA 2VPXA 1MOQA 2LW7A 4RANA 1R4NA 1TM7E 5JY1A 4TVBA 1YFJA 4Y30A 5EKDA 1S96A 1C1DA 3B8HA 4P4SB 3GJ4A 3I1IA 1MLDA 4M0LA 2BM9A 4HDRA 4PWYA 1QAOA 3REQB 3UMFA 2BGNA 3DDCA 4BJ1A 1YFKA 3IV6A 4BEJA 1PFVA 2Y0PA 3W9SA 4PYOA 3Q7IA 1YCFA 5DBEX 1FUEA 3PGXA 1G8KA 2Y77A 1VKRA 4CMCA 5C4GB 3FLAA 1BA2A 2PZ8A 1BVUA 3ZIDA 2V8OA 5DYWA 4AULA 4RZHA 3T5GA 4Y2PA 1GTVA 4HFNA 1QS0A 4TVSA 2PKCA 1BWQA 4HDKB 5JAMA 4BAUA 1NNLA 2G28A 4RF4A 5GONB 1DFIA 1N57A 1QKIA 1ZGZA 1ZGGA 2ZJ6A 4ARBA 2REBA 1Z6QA 1PS9A 5C1IA 3TSCA 5IT0A 2I8LA 4ZJPA 1AF4A 2XQFA 5G41A 3ZE2B 2HX1A 1PZNA 4C87A 3UVEA 3N0WA 5LQAA 3C5EA 4KXYA 2PKYX 4IIDA 5KU7A 4ZPJA 4RD4A 4A1FA 2PHZA 4XIFA 5AMXA 5CB4A 2HM7A 2PRIA 2W8BA 3GD7A 4OQPA 4PTZA 5EMJA 4A73A 3C8HA 4AQYB 2IL1A 3B6MA 4A36A 1AN0A 4MS1B 4R2JA 4W5HA 4JB3A 5GVRA 4DDKA 2Z5GA 4ND1A 3VTKA 2V0GA 4ZDIA 821PA 5I7WA 4NKRA 4QECA 4B9AA 3W34A 2PFGA 4BU1A 4E08A 4ICIA 5CCDA 1ULUA 1C7IA 1QC5A 1Z34A 3AI7A 1LH0A 1B14A 2FUCA 5TX7A 1NE7A 5KO2A 4WA7A 1L5HB 4Y9UA 1J2RA 2JVKA 1UWVA 2D4HA 4H0FA 1RYEA 4UHBA 3WLIA 5FOQA 5IHXA 1KO4A 4KREA 1YDFA 1R66A 1X1EA 1ZN7A 1NPDA 2V9PA 2VTEA 1UINA 3NBMA 4TN1A 5P8WA 3ZTTA 5LL6P 5KNCH 2FOLA 5KNDD 4X93A 4CNQA 4D6PA 3OAAA 4OSEA 5C3MA 5HHTA 5TQ0B 4DYHA 5KNLA 2P2YA 1E7WA 2AI1A 3CG4A 3O75A 5E38A 1MB3A 3JWHA 1RRFA 4LIPD 4A5OA 4RUKA 3VJKA 3VYVA 3ZQJA 1Y7HA 3B12A 1Y8RA 1VJCA 3Q8MA 1W1IA 1CX9B 2JLRA 5DBHX 3N7UA 1C7FA 3MJSA 3AWDA 1D9XA 2OHXA 3PHLA 2ONZA 1M1YA 5MDHA 3COVA 3FPGA 3OE7A 4QDTA 1QX4A 4RKEA 4KHPB 3DM5A 3VHLB 5ALZA 4P7GA 4TQUS 3VRHA 2VJNA 3R3ZA 2OQRA 3RRBA 4QEDA 3W7VA 3STUA 1KZYC 1KEEB 4UHCA 2K6GA 1SKAA 1A96A 2JD1A 2C7BA 2HL6A 2LKDA 4TL7A 3F5QA 4DCPA 1JZTA 4M83A 3RK0A 3EIQA 2RKOA 5KOHA 1B8UA 4NYMQ 4IFTA 5B57C 1SG6A 4WBNF 3HBJA 3O21A 2W2LA 5BOSB 3D43A 4CL3A 1IN4A 4IG4A 4NYIQ 5AJTA 2JAQA 3W1EA 1SOMA 5AR1A 4Q7LA 4X45A 5C18A 3FTQA 4IGEA 5NLLA 3DO8A 4FDMA 2GLXA 4B3RB 3MQ4A 5AKIA 3NAZA 4EEXA 5B7GA 5KUTA 1T5TA 2I4OA 2NUTB 2H54A 2W42A 4EHBA 4MVWA 3DH0A 5EAIA 4Z3OA 5ILGA 3KOOA 1P2FA 4ZTBA 1W5TA 3BH7A 4HVCA 1KAEA 2XUDA 2ZUCA 1BRTA 1YUNA 2V7EA 2CNBA 4TWZA 2X1LA 2JAXA 1U2SA 3WVNA 1VHLA 2BKEA 1HR0B 4IWNA 4E7PA 1H9AA 1Q83A 5EXSA 1LVUA 2GXSA 3GA5A 1QCDA 3FLBA 5FBRB 3TPCA 3OSUA 4BN0A 4YUAA 5HGXA 3CPHA 1Y82A 3VAZA 1SUAA 4G4IA 3N74A 4MKGA 5WRFA 5JJIA 1RM4A 3HCFA 3K8ZA 4P3KA 3KQUA 1D2EA 3ZE6A 2QTVA 1H8HA 1HI9A 2VA8A 4PC1A 4E21A 4YAGA 1JS1X 2GAOA 4CCYB 4LKRA 4B34A 2FG6C 4HNAA 1S0UA 4WJKB 4P08A 3O38A 3TCXB 5LZ2A 2FEAA 2A9FA 2PU7A 3R5SA 4FYVA 1GUBA 1I5EA 5FL7A 2R4QA 1VRVA 4ZVTA 1XXHB 3SFTA 2Q4TA 4P5DA 5I7VA 2WA2A 1UMKA 3KUXA 1LBEA 1XWWA 4I8IA 3UCFA 1JJVA 4E4TA 2EJWA 1CY8A 1SKYB 3FTPA 3BL6A 2VDLB 1XTRA 3P52A 4WLEA 5K8CA 3ZE1B 2NZXA 2D59A 2P7HA 4ERXA 1JAZA 1I32A 3OSZA 1T13A 2M6LA 4WACA 4S05A 3INNA 4QGFA 1JNXX 1V25A 3ZDYB 2ZT8A 2B98A 4GXNA 3QVOA 4IF4A 1EMDA 4H7DA 4CMGA 5D00A 1GFIA 4R8SA 4RPLA 1UR5A 3MBIA 3F5FA 1T25A 3FR8A 1QDEA 1HG1A 1WE2A 3W79A 4I9HA 3OURA 4DLLA 5LQJA 3ZVRA 1E8MA 1YBFA 2KS6A 1XAGA 3HB4X 5L4NA 1H0SA 4JCOA 1JDNA 2BKXA 2FMIA 3MTDA 2YJNA 3E7WA 4ARZB 5FWAA 3PJFA 4M36A 3GLTA 1QZUA 2GAIA 3CFYA 3M1IA 2C9DA 2WZDA 3GH3A 4IHAA 4GXRA 3QHAA 5ALDA 1L9KA 4K2HA 3GN1A 3UUWA 1QTQA 3WYEA 3SBXA 1SKMA 2QRNA 4NJOA 5KYXB 1F4LA 1SBQA 1RP1A 1JT9A 4FGJA 3ABZA 1G2IA 1A9ZA 2XB4A 1D5WA 1DQZA 2IV7A 6REQB 4AY2A 4LY6A 5BN3B 1OH7A 4ZT3A 3CBGA 4ZYXA 2CB9A 4UDNA 3DMNA 1N34B 1AK1A 2NUAB 3WMGA 4LI0A 3M0EA 1TIKA 3HG7A 1Y98A 1ULSA 1CR1A 2GYVA 2X8LA 3EG9A 4H7IA 1E1RA 1FRQA 1CUHA 3BTSA 4L08A 1M2WA 4MW6A 3DNMA 4DHWA 4O2RA 4LPKA 1SA0A 2JCYA 3L7JA 4PO8A 2R2AA 4NAVA 2DKOA 2Q5CA 4PLHA 4WOKA 4N12A 1KZHA 4Q03A 1SY7A 7AT1A 4HNSA 1IHUA 1FTQA 3E48A 3WIDA 3S1SA 1TUGA 2YJZA 5AQEA 2Q4RA 1F3LA 5CNJA 1J0CA 1YBMA 2ZT6A 4FN5A 3Q2IA 4L5YA 5DK6A 5BYJA 2BBOA 4R8MA 2VKQA 3EXAA 1U8ZA 2D2IA 2E4AA 3NCTA 5TQJA 4X64B 1QGDA 1YHNA 3I42A 1APBA 4FOLA 4NJEB 2AHRA 1OWOA 1JHYA 1QJCA 4TLAA 3QZUA 4ZC8A 4AJJA 1YBVA 3G8YA 4E13A 2JIZA 3VPBA 3C5HA 3DVAA 4PZ9A 4U3JA 1W36C 2WIFA 3O94A 2W98A 5JXGA 3ND7A 3LY5A 3WQSB 1HQKA 3PUIA 3RFXA 5TXGA 1XP8A 2BFDB 4MVJI 5KYUA 2VOEA 3F46A 4PG8A 4QNNA 1SCUA 5B1EA 4H7HA 2QWXA 1YVPA 3D6NB 2H1CA 3CLSD 3N8HA 4E5VA 1VMEA 3QXXA 4M7OA 3WWPA 3GBVA 3CS3A 4MW7A 1RJFA 1J0XO 1QKJA 1Z4IA 4FR2A 4JJKA 3SOPA 4AMYA 4MIEA 1P2DA 5CT9A 1W4RA 4MDEA 2DWOA 4UU0A 4XD2A 1V11A 3K05A 1JTFA 5JD5A 1BEUB 3OQ6A 1XVIA 3G5MA 4GC5A 1IBSA 2COEA 3ACDA 1DIOB 3NDIA 3TVTA 4A03A 1V0JA 4DJAA 5JOQA 2HMSA 1FU4A 3FFXA 5ARDA 4RCYA 4U0JA 2BPOA 1XQWA 2H9IA 1AZWA 1KHTA 3R23A 5K0LA 2VK4A 5AW2A 2F1HA 1U3DA 3MNFA 4CE6A 3O91A 4E0BA 2VAVA 2VA9A 2Q9AA 4M1YA 4XIGS 1Q16A 3NHZA 1A97A 4M98A 1HFJA 4RPGA 1YIOA 1ZJJA 5JS1A 5AVKA 4G2TA 4HS9A 1ESCA 2JAWA 3C3KA 3MRVA 5ESDA 5AXDA 3T0GA 1JEEA 3ITEA 5A02A 2Y9MB 3GJYA 1NNEA 1EK0A 1VGRA 1KH3A 5IJXA 3V4ZA 5IAGA 3H1TA 4N9WA 3TGPA 1A4XA 3QOFA 3VOBA 4ZJYA 1M2EA 1VRCA 3H1FA 4G3XA 1N2HA 2PLRA 5KX5B 3GQBB 4O3FA 4XASA 1DPFA 3PCRB 5AM1A 4X1IB 5J58A 1P73A 3R8CA 3A4NA 1XCMA 1AURA 1K7SN 2YBDA 3A3PA 3R6DA 4DCUA 4CEJA 3P0JA 3TNDA 2VTKA 2BFWA 5LNK6 2XDQA 3WL6A 2UZ3A 4XX0A 3H9JA 5AW0A 3R7WB 3HUEA 1VYUA 1I4WA 3RSGA 3O9ZA 3HM9A 4LCBA 1U9CA 3ROFA 5A6VA 5DNYB 4LCEA 2QW0X 5TPZD 5ICCA 1E9EA 4O1MA 1HEYA 4QBFA 3QX3A 3ABRB 2IDZA 2XNKA 4RVSA 4RYLA 3LFTA 3ELBA 1WSBA 2DQKA 2Y1LA 3ABIA 2WVJA 4N40A 4B33A 3HXTA 2EQBA 4DEVA 1NFRA 1KFKB 2ZIEA 1M2GA 1RRGA 4U5XA 3IKTA 4BUJA 1E2QA 5K0GA 3L5KA 4D82A 4ER6A 3IUYA 3G3EA 1XRMA 4RDHA 2WOOA 1K2WA 2QPTA 5F35A 1SXJD 3AFHA 4QXRA 3I9V1 5HJEA 5KVAA 2WHXA 2YFQA 2ZI5A 3ZPXA 3GFSA 2AOTB 2ZK7A 5DN9A 4BX2A 1FF9A 4GX5A 1MX5A 3CB4A 5A7FA 3QA9A 1GR1A 2ETXA 4NCNA 3FVRA 4YX9A 3IUJA 2C29D 1ML4A 2PSEA 2FMKA 3I6YA 1XJ5A 2H18A 2EP5A 3N3BC 3VYWA 3SMQA 3WISA 3AILA 2BGLA 1AO3A 3AV0B 5CLGA 3W5BA 3O92A 3TFWA 1UFQA 1LLQA 1FL9A 1PR9A 4HO1X 1A9TA 2IUYA 1M7GA 2ZI7A 3JX9A 3KYDB 3X1WA 4OQXA 4R9NA 4ER7A 1JA1A 4D4JA 2IH2A 4WA8A 1A04A 3DKPA 1AUPA 4UE6A 4ZOQI 3I6BA 4FW8A 2C8JA 2ECKA 3W7BA 3NV9A 3OQNA 1OTHA 1QYWA 1WW3A 4PRKA 4G8CA 5LDDC 1RXSA 1IUNA 2QYTA 2P9CA 3CRW1 2GK7A 1SMKA 2C95A 3GVPA 4IBOA 4NF2A 4B4WA 3WA7A 2JGEA 4NBVA 1L5ZA 4RPCA 4MRAA 3GRAA 2ZB3A 1II8B 2WKRA 4GAEA 3LNTA 1KVQA 2ZBRA 2HSWA 4UD2A 1H1TA 2QNRA 1IB0A 2OBBA 3AUAA 3AR7A 1X94A 3VVCA 4AN0A 3TQCA 5JCJD 5T3YA 5T4EA 3TZ6A 2EFGA 1RHKA 2YN0A 2YIVX 3IELA 2PNFA 2X40A 3A05A 1N6RA 2VKTA 4RULA 1J24A 4FFNA 1Z38A 4BIMA 3FCSB 5HCUA 3LQ2A 1SBZA 4MV0A 5IKMA 4UDOA 2AX3A 3DDWA 4C0LA 4UFOA 3WLQA 3RNOA 2D2FA 1OTXA 3EGXA 4BBZA 4CLRB 1J2TA 5DHUA 2WMOB 3QENA 5ENDA 1DAMA 1DAKA 3THWB 2XUHA 2OMKA 2WKSA 4MZXA 4YN3A 1LPMA 1K6JA 3JVUA 5CTJA 5JHHB 2VK1A 3GUCA 2OCAA 4RD0A 1NF3A 4R9UC 2VJOA 2O8CA 3H8JA 2XA1A 4LECA 3RASA 3RRNA 4J4TA 4DQLA 1XHEA 2PAAA 2VHWA 2IE0A 2YHSA 4TV8B 1E7MA 1I7PA 3KOWA 5JPDA 3GT4A 1TZJA 2RJOA 4Q3NA 3PNKA 3BQMB 2Q21A 1DADA 2O8EA 3JAKA 1O57A 3EVAA 4C3VA 1IXZA 3NRJA 3CZ9A 5DM0A 1HQDA 3I01M 5CH5A 3TQFA 3IVXA 4AQ7A 5CBPB 2F6RA 1EVIA 3CLRC 1QIJA 1U6IA 2F1OA 2VL7A 2X4DA 3OTHA 1Z5ZA 4C4ZA 3Q6IA 2PXXA 2W2VA 3RJ5A 4NEGA 1ECGA 1QLWA 5EERA 1WIWA 3WIBA 4G0MA 1V16B 5AOVA 2ZJYA 3ZN2A 1EP1B 5B55A 4TS1A 4HNUA 4WNAB 1Z88A 3G23A 4DWOA 4WOJA 1OXBB 3NXKA 3KX2A 2WIBA 4KU4A 1NW6A 4J1QA 1ABBA 3IHKA 2W37A 2IEIA 4HATA 4EDFA 4DQXA