3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
b'SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX19B
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
2ZTSA 2GCNA 2JLUA 4HUQA 4IKEA 4JLPA 5HCNA 1HT1E 3NXSA 3SJAA 3OEHD 5JSZA 3JZMA 2OT3B 2ZAOA 1KKLA 4IDPA 4MKFA 1YZLA 4HATA 3KTAB 1E2LA 1Y63A 1U0JA 3R9IA 4B43A 3QKSA 4Z1MD 1UBFA 4IOLA 4DCTA 3NBFA 1YU9A 1E79D 1S1MA 2C8VA 2RGNA 5J4YA 4LPSA 1BMFA 4IFBA 1KAGA 1N0VC 3HYTA 2VL7A 2WMOB 1MOZA 1W1WA 3W5JA 3A1TA 2XB2A 2ZRCA 2V7QD 4AI6A 2V9PA 4G5RA 2RGGA 3QXHA 1OFTA 5JJIA 2ZE5A 4LPKA 1YE8A 4R7ZA 1EFUA 1E94E 1RKBA 3TQCA 2ZE6A 1DBSA 5BXQC 3OFNA 4B3XA 3Q85A 1E1QA 4LHYA 2AR7A 4WZBE 4GNKA 2XNDD 2WWFA 4PQRA 3M0EA 2KJQA 4QGFA 2GZHA 4NYIQ 1RYFA 2XSZD 4DSOA 3FMPB 5DH9A 3B1VA 4ON9A 1UEIA 1VCNA 4PZLA 5FTKA 3EPHA 3IO3A 4KVAA 2XZLA 1TU4A 2LWIA 3OEED 2C96A 2BIFA 2G6BA 3THWB 1N5LA 1SZPA 4C0AC 4WXPA 2YWEA 4PX9A 5AK0A 3VHLB 3CZQA 4XWKA 3ZQ6A 1CIPA 4YMSA 3I61A 4XD7A 1XMVA 2Z4SA 3WP0A 8OHMA 4NBSA 4Q4JB 1G5PA 5KPDA 1T3LA 3LA6A 2OBNA 5CM8B 5D3MA 3W90A 4IXNA 3K0AA 5H70A 1JALA 3PV0A 2KB0A 2XJ9A 5HZKA 2NOAA 3Q5DA 1IY0A 3GEIA 1SKYE 2A7QA 4RSGA 4AYTA 5FFMA 5IF9A 3FKQA 1KO4A 1KI3A 4PSVA 1RE0A 5KNDA 2HJGA 1RRFA 3NKVA 2XZPA 5FUVA 4NL4H 1IN8A 2JJ1D 1K5DA 3PENA 1M7GA 3K9GA 3KKQA 4BWYA 3PEUA 1PZNA 4LJ8A 1YZUA 2IS4A 4N0EA 1LB1B 5DE3A 1EFHA 1J2JA 3SI7A 4OI0A 3WMGA 2IT1A 3GJXC 3IPXA 2GJKA 2ZI6A 2HCBA 1SVMA 3KQLA 1P61B 3UKDA 2ZRLA 2JGNA 1AZTA 5JLJA 1U81A 2O5VA 5J40A 4NYMR 5C46F 4MRNA 4LWZA 5JEDA 1MO5A 1VYVA 2H17A 5P21A 3A1SA 1COWA 1GRNA 4YC7A 1N6KA 2NZ8A 1VKJA 2JA1A 2YV5A 4JLAA 1QG4A 3CRVA 4Q4HA 2WIAA 1D2MA 2UKDA 1KAOA 2VHTA 3AKCA 5EUQB 2QE7A 3EAQA 1N25A 2BC9A 3GJ0A 2J3EA 3IO5A 3TIFA 3KQHA 4QHTA 4HLUA 3O8RA 2YC4C 1KYIA 4IDOA 5C1BA 4D0LB 2WJGA 2HV8A 3CUEF 3L0SA 1VIAA 1WA5A 1PUIA 3KL4A 2A5DA 1Q44A 4MKGA 1Z3IX 3TBKA 1MKYA 4MKHA 1QDEA 4JLMA 2K5UA 5CDFA 3ZQJA 2OAP1 5J4KA 4UNPA 5L3VA 4Q03A 1G7TA 2V54A 1Q1ZA 1EWQA 1JB1A 2J45A 2BEJA 3ND9A 2CE7A 2CVFA 3W6NA 1XMJA 3SE0A 2RMKA 1QRAA 1NMZA 4JJKA 1VIYA 2ZRHA 2R6DA 1KJZA 4CRWB 4BFZA 4BRWA 2G88A 2VP4A 1I2DA 2YNMA 4G5GA 5FPHA 3AVTA 3T06B 3K0FB 2BKUA 1NSTA 3LXRA 1CJUC 3BFVA 5AJZA 2VHCA 1GITA 4JLJA 3HR7A 1US8A 2QZ4A 4MYHA 2BM1A 2VSOA 4KCGA 2IWHA 2HYDA 3HWSA 5AJYA 4MRPA 1PLJA 1Q1EA 2F43B 1FZQA 2EU8A 1F2UA 2PH1A 4LZZA 5FOXA 1RYHA 1XCGB 1T3HA 4DIDA 521PA 1QHHA 3PUYA 3TR0A 1RRGA 4TTRA 1R2QA 4FMBB 6Q21A 1NKTA 3P20A 4RCYA 5JS8A 2ANCA 3BS4A 3HYRA 4A4DA 3TGPA 3MJHA 3ASYA 3QUSA 3ZJYA 1KJYA 1R0YA 4KHZA 3D3QA 4DIEA 3W9YA 2X2FA 1KMQA 1V5WA 3GEEA 2ONJA 3DOEA 1U90A 2WZQA 3ZZ0A 1SVSA 2FFQA 4HYYA 5K8LA 3EWSA 4AKHA 2FV8A 2Q3FA 3AKYA 3CWZA 4C2TA 1Y3AA 2Z4RA 4LYAA 4IDQA 1N6LA 1E0JA 2UVQA 3IEUA 4YMTA 2EFCB 3WY9A 1P9RA 4JVNA 3CRW1 3L43A 3ICEA 2GF0A 2Q0HA 2PBRA 4JSTA 4RVCA 3CM0A 2DFNA 4KITB 2WSSA 2D74A 5ANRB 4B33A 3DKPA 4E5UA 1HE8B 2XEXA 3WBJA 4QHSA 2QMEA 1OLOA 3ZZTA 4HAVA 3ND8A 3TAHA 3MWYW 1SVKA 2AXPA 5FL3A 3M1IA 4B71A 4DZZA 3THXB 4P32A 4D82A 3UXMA 3BH6A 1KI4A 3Q5EA 3U5ZB 1J8MF 3LXXA 2GZDA 2CNWA 2AWNA 4FIDA 2O8DB 1Z0JA 4NPHA 1GWNA 3SBDA 1II8A 2HLDA 1KZ7B 1R4AA 2IYWA 2CCJA 2DY1A 4GBMA 1T8TA 1YR6A 3TR5A 2O8FA 2OV2A 3HU2A 1KDRA 5CK5A 4Q9KA 4EJSA 3VU9B 5FTMA 1W36D 1N6HA 2WWWA 2IYQA 1N0WA 2C9OA 2CLCX 5JECA 2W83A 2WPDD 4R9UC 3LRPA 3DOFA 1JJ7A 2EQBA 2ZRKA 1VPLA 1XTQA 1G3RA 1NIJA 2F55A 5KOYA 1IJFA 3LQRA 2DYKA 1XTIA 2IYVA 3CWQA 4A2QA 1Z08A 4LBWA 4L4UA 3LW8A 5G3YA 1BYUA 1OH7A 4CT4B 5JHGB 3AVUA 1GOTA 3AB3A 2FPKA 1UPTA 3HU3A 2GF9A 4WAUA 4B3FX 2GRJA 1KO8A 1G291 4HZIA 5LPNA 4NU0A 1KY2A 3IBYA 5H1YA 3OE7A 3SYLA 2DB3A 4GFDA 3ZLJA 4PXAA 1F60A 2WIBA 1XMIA 2AFHE 1XMSA 2C95A 3FFBA 4WVFA 5SZIA 5DYIA 4JLBA 5CB8A 4XVUA 5FOWA 2PT7A 3ZVMA 4XIGS 2EWVA 4O3MA 3AVYA 4TMXA 4DSNA 1KDOA 1E0AA 2IXEA 1QHIA 4HAXA 4GL2A 5TV2A 3IPYA 5AJXA 1SVIA 3V00A 3SFVA 1SHZA 5CIQA 4HEJA 3GLFE 1V43A 1HE1C 3DEFA 4BRUA 3SHWA 2QTFA 1UKEA 1TAGA 4OQFA 5JEEA 2F9MA 3BD9A 4HDQB 4XWAA 4WBSA 4HB0A 3W34A 3AF0A 2F3RA 4LHZA 3KQNA 1OHHA 5ELXA 3KB2A 2GCOB 1OSNA 4W5HA 2QUZA 2QPTA 4BLOA 5GJCA 4ZIRA 1AJEA 2PJRA 2JEOA 3ZD6A 5JFGA 4XJXA 2OFXA 3ZS9A 2V6IA 4TYQA 3LX5A 3TKLA 4U02A 4E22A 2MSEB 4C0KA 1H8ED 3U7EB 5HKKD 4LY6A 5TDHA 4RKEA 3SBEA 3ADDA 2AK2A 1KO1A 2CHGA 4PC6A 1E2QA 1AS3A 1OB2A 1LS1A 2O0HA 1F2TA 3E70C 4QKQA 2ZE7A 2VHJA 3S1AB 3WMEA 3AP3A 3CNOA 1JEEA 4LYFA 4AIIA 2PX3A 2OCBA 3QKRA 4I1UA 4LC1A 1ZUNB 3U6KA 1GKUB 2ZS9A 3ZS8A 2KWIA 2FGJA 4BFSA 3QPVA 4MH0R 4P4SA 4DUGA 2VP5A 4C7OB 4US2R 4HDCA 3CPEA 4JIMA 5KTYA 1FP6A 2W6JA 3NH6A 5CJPA 3K9NA 4U5XA 4A9AA 4V0ME 1KSFX 4JZKA 3TSZA 4D4JA 3L0IB 1W5TA 1ZNWA 2CMKA 4OK3A 4TMZA 2QQEA 4EUNA 3KUDA 1X8KA 2QRZA 4N3NA 3K8YA 4ZO4A 1T0JB 1P73A 1H8HD 3EZ7A 3GLIB 2ZI7A 1FW6A 2ORWA 4EPRA 1E2JA 2GAAA 1QG2A 3IIKA 2W0SA 5KPJA 1P60A 1IXZA 4IDHA 3R9WA 4AURA 2OCPA 3CF0A 3ZGXA 4WZ6A 1U94A 1GVNB 3AF3A 5E7IA 2IEYA 3X1DA 4YMWA 2QROA 5HPYB 1S0UA 4AKGA 2GETA 1T5LA 2FSFA 4B48A 2ZU6A 4HAYA 3VNUA 5DIFA 3PUVA 1SKQA 3GLHE 3UK6A 1XEFA 2F6RA 2ZSEA 3RRNA 1A2BA 1L4UA 1BYIA 1P3JA 1U2RA 1T0HB 4TLEA 3T1VA 1XZPA 5FTJA 2XOKD 4NTZA 3VAAA 3SYKA 5DYGA 1G5RA 2Z0MA 5C18A 3A8TA 1W36B 1T3SA 5AR1A 5TARA 3EPKA 5LD2C 3VKGA 4KFRA 4HSEA 3KFXA 2AD5A 4U7DA 3GMTA 1KI6A 3UG7A 3T1TA 4EPTA 2QGZA 1AS2A 3RS4A 3KXIA 1Q3HA 1YZKA 1G64A 1VG0B 3AF4A 3K0EA 1IHUA 3RABA 1F5NA 4US1R 4B44A 1CBUA 4AD8A 1YVDA 4M4SA 4DVGA 4JYCA 2FMXA 4CEIB 4ZI3A 2QM8A 3OAAA 2VP6A 1VCMA 3TSWA 1NG1A 2ZI5A 1G19A 3MWLA 1YZGA 4H9GA 4RKFA 2VH5R 2JATA 2E87A 4A0HA 1G8HA 3ZH9B 1Q0UA 1SVWA 4EQ6A 1TEVA 4GPTA 3EW9A 2QA5A 4G3XA 4PSAA 1Z6GA 4E09A 4GOKA 3BXZA 2B8TA 4EKDA 1TF7A 1G8PA 1EXMA 1CKEA 5G53C 5L3QA 2XXAA 4CEJA 3GJ5A 2ZM5A 4C3ZA 1YRAA 3BOSA 1XD8A 1H65A 5JI3E 2IYXA 5EP4A 3H84A 3RANA 1BO6A 4LI0A 3W6PA 3VNVA 1KI9A 2NQ2C 1YHNA 2ZR7A 3T34A 1G20E 2O8CB 1P72A 2AHOA 2H1LA 2V55B 4BFVA 2WM9B 4Q4AB 4ZDJA 5SZJA 4PANA 2QMOA 1ZUHA 3B9QA 1EX7A 2ORIA 3MWKA 4L15A 4V02A 2NPFA 2WVJA 3TK1A 3LNCA 1L2TA 4D81A 2IWRA 4F4CA 2OLJA 4F91B 1XJCA 2J0UB 2J7PA 1BIFA 2QAGB 5IDVA 3TUIC 1BOFA 1JQJC 4PHFA 3BORA 4JKIA 3GJ8A 3X2SA 3KJHA 1CR2A 1PLKA 3KX2A 2PEZA 2WV9A 4RZ3A 3T15A 2KBEA 3DM5A 2CDNA 2JLQA 2A9KA 3GEHA 1Z29A 4BASA 4NMMA 2IYUA 1UADA 3V4FA 1TQ6A 1KZGB 4A2WA 821PA 3B13B 2A30A 1JNYA 1M7BA 2C77A 2F9LA 3RS0A 4DHEA 4TL6A 2FN4A 4B3BA 2VEDA 2VSXA 5CM9C 1EFTA 1Z06A 1XXHE 4BLQA 1LNZA 4ZCLA 3RYTC 1NN5A 2AD1A 2ZJ8A 4LDJA 1E2NA 2NO0A 3JVVA 3SJZA 1J7KA 1MO6A 2FF7A 4IW3B 4KV9A 5L3RA 2DFLA 1NSFA 2BV3A 4F4IA 2YWFA 3DDCA 2O8BA 2NPIA 3T5DA 1N5KA 3ZZUA 3L8YA 1FOEB 4QXAA 4Q1EA 5J4HA 3WRXC 1WQ1R 2P5TB 2DFTA 3U3RA 3QNUA 2ZSAA 3AKDA 3SYNA 3VFDA 5E3HA 3FYHA 3T35A 4BLRA 1SVOA 4B6FA 2QN6A 1N5IA 3RS3A 3KQKA 1WE2A 4ZKDA 4V03A 3OIVA 5EQTA 2PT5A 3K9LA 2J1LA 5BN4A 2O8EB 3ZD7A 2R6GA 1BKDR 3KKPA 4RD1A 2IYYA 1UDWA 2ZRBA 3NG1A 2JAQA 2F1RA 5EP3A 4Z8YA 3T5GA 3PG5A 3VR2A 4ARZB 3GLGB 1G7SA 1G8GA 2AKYA 4QNMA 2GK7A 4Q4JA 4DWJA 1NKSA 5JBQA 1OJLA 3ZVLA 4EFMA 4TYYA 2R6CA 3VX3A 5DGXA 3LWNA 1CP2A 3BE4A 4AK9A 1CTQA 5B57C 2J59A 3SQXA 1II0A 3CZPA 1NVUQ 4M9QA 5JCZA 1XU4A 2EYQA 3QBTA 1FX0B 2HF8A 1L7VC 2RHDA 3E2IA 4LJYA 5DHAA 3NH9A 2GJAA 1Z07A 3GFPA 4JLKA 3C15C 2BCJQ 4QBFA 2N42A 2Y8EA 5EXXA 1AK2A 3UANA 1VYUA 2OCYC 1VG9B 1MABA 2VP0A 1AZSC 2E9SA 3EARA 3FFAA 1ODFA 2QMUA 4OHVA 1IN6A 1XPOA 5F98A 1QHXA 4CF7A 5FOTA 3U7FB 3LW7A 3L0PA 5GVRA 4JLOA 1N6PA 3SN6A 1ZBDA 5JCPA 4HLUC 3HPQA 3AP2A 2VF8A 1X1SA 3MRSA 3Q7PA 1E2FA 3QKTA 3GFOA 2MSCB 4YXWA 5DI3B 5IRCD 1AA9A 3THOA 1KMHA 3HR8A 1C1YA 3QVVA 2QL6A 3U3MA 4WIAA 1S3GA 2Q9CA 2WJJA 2GBLA 4LGMA 4GDFA 1S4QA 2ZPTX 5GADl 3W3AA 4V0MA 1I4LD 2FSGA 4NE2A 1OYWA 3EPJA 4Q4LA 3RC8A 3B1WA 1NF3A 4CVNA 3GP8A 3SNHA 1SHKA 3PR1A 1HQCA 3VR1A 1TPZA 1NN1A 4HB4A 4G5OA 5C2JB 1ZC4A 4C0HA 3BRWD 2XTZA 3HDTA 4DRZA 2EFHB 4EIWA 1DADA 2ZJ2A 1NY6A 4X8MA 1AS0A 4MGZR 2Q6TA 1GIAA 4DLVA 3MCAA 1WB9A 1XBTA 2FH5B 4K81B 2C9CA 1DAGA 4R98A 2H7VA 4DEYA 4AKEA 4II7A 2H8KA 1LS6A 3GLHA 1LF5A 4O0MA 3RDPA 1X8JA 2AX4A 4GP6A 2ZI9A 3CH4B 3SJBA 4ASUA 3SS8A 1AQYA 4IOKA 3KJEA 3MWJA 3QQ5A 2P6NA 5GVSA 4TSFD 5EZ5A 1G21E 4DLUA 1XEXA 4XSGA 2PCLA 1ESNA 3LY5A 1CS4C 3EXAA 2CCGA 4Q21A 4M22A 2CHQA 3KKOA 3RS5A 3MJRA 3CRRA 2CHVA 4FCWA 4Y0VA 2PJZA 2W2VA 2D2FA 2I3BA 4LOAA 4PC2A 2IUTA 2WBLC 3OEHA 4GMXA 3K0FA 1VECA 4HAZA 4ITRC 1E9DA 1GL7A 3ADKA 1KSHA 4H1UA 1YRBA 1MRNA 2QU8A 4YDSA 2IA5A 4Z1MA 2QBYA 2B7BA 3I72A 1FP7A 4N0DA 1E79A 2QQ0A 2BJVA 4QBHA 3DMNA 3QF4B 4PC1A 4KSCA 4IDNA 5JZVA 2WJIA 1XNJA 4JVMA 2NO6A 2W00A 3DZDA 4LHVA 2VA8A 1RW4A 2LKCA 2OLKA 2QTHA 3BAFA 1ZIPA 1CULC 4ESHA 4MKIA 1LY1A 5FL7D 2IS6A 3CR8A 2W6ID 2F1IA 1ZM3A 4I4LA 2YOFA 1SXJD 4I99A 4B2IA 1VMAA 1KNXA 1GNQA 4I1SA 3R9XA 2R62A 4QGHA 4W9MC 2XNDA 1UBGA 2AFIE 3HP1A 4Q18A 4ILEA 3ICQB 1Z6TA 2B6HA 2RCNA 2XSZA 5EP1A 4N1AA 4M1MA 4B76A 1NL3A 1Z0KA 4BGDA 2AKAB 4M1OA 3O8CA 4LBYA 4EPWA 1VDZA 3OEEA 1S3SA 4JT2A 3T12A 3TVTA 1E98A 4D4MA 1XPUA 1D6JA 1T5IA 3MUFA 3OIWA 3BIFA 2RKOA 1GTVA 1KI1A 1UKVY 4LBZA 4LJ4A 3H86A 3K0CA 3ONWA 4NYJR 1XPRA 1ZNYA 2XX3A 3QE0A 2WMNB 1YKSA 3BJIC 3AVPA 2FGKA 3OZXA 4NDZA 5EE1A 4KYIB 4Q19A 1S2MA 1E2HA 1N6IA 3AUXA 4DT1B 3QOFA 1HA3A 5FUWA 3VMFA 2BBOA 2GESA 3WHKA 4EJSC 2OCAA 3CIOA 2Q3HA 3B8HA 2RGDA 1CJKC 3THXA 1E0SA 1R5OA 4F4JA 3K70C 1OW3B 2D62A 2DWPA 2JJ1A 2REOA 4S35A 1IM2A 5F2EA 4HZUB 5FR1A 4O2LA 4QM6A 4L16A 3SDZA 1TF5A 1RJ9B 1M7HA 3FOZA 1E2EA 1YZNA 1XXHA 1E9BA 3EC2A 3KZ1E 5JRJA 1U8YA 2GXSA 1G7CA 4GI7A 3UATA 1E69A 3A1WA 2IW3A 2R9VA 2ZI3A 2CCKA 1TEXA 2O0KA 1W47A 2OAQ1 3E5HA 4HUQB 3G0HA 1KSJA 4CZ2A 3IIMA 3E1SA 1TNDA 1UAAA 4MRVA 2ZYUX 1D2NA 1I4TD 1NBMD 1NI3A 3CX8A 4PHGA 1QBKC 1P7CA 2RGBA 2QP9X 2F1JA 3L82B 1F3OA 2XITA 3QKSB 1E4YA 5EE0A 2PLFA 2R8RA 4D80A 5A4JA 5KUTA 2YWGA 2DPXA 3UWKA 2HDNB 1R10A 3GD7A 4V0LA 4OI4A 1NNEA 3AP1A 1E9EA 4ZI2A 4QG7A 3LD9A 5BW8A 4TWZA 2VP9A 5BN3A 1KHTA 3LO5A 4TLCA 2FX3A 4XTCS 3RNLA 3A4NA 4C30A 3BH0A 1CLUA 1DE0A 1A82A 2O52A 3W8NA 3H1TA 1T6NA 5LB2A 3EZ6A 4Q7LA 4AWXA 2AN9A 4JL8A 1W0JA 5DN6D 1W46A 2FOLA 5E95A 3FKSD 4EFLA 1DS6A 1ZCBA 1Z47A 5DI9A 1KK1A 1XTJA 1Z83A 1YZQA 5KSPA 5F9HA 2R6FA 4LCBA 2ZR0A 4DCNA 1UDXA 1VTKA 4RCZA 5AUPB 3RLFA 3SHFA 2J0SA 1OXVA 2V3CC 2ZRMA 3JVUA 3UMSA 5IK2D 2ZRAA 5D3MB 1NJFA 3EIEA 3K0AB 4NYJQ 2Q9BA 4K46A 2ERYA 1ZM9A 3VR4A 2RH5A 3SC3A 1NLZA 1NY5A 5GJWC 5LB4A 4A8JA 3U4QB 3U6BA 4DCSA 1XB2A 4C2UA 2ZRDA 1NP6A 1JR3D 3THYB 1YJ5A 2JLYA 4Q1FA 4TL9A 1KIMA 1SXJB 5HCIA 421PA 2J9RA 1EX6A 5C4GB 3AVOA 5EXTA 4FMCF 1GSIA 2R44A 4JVSB 3S1AA 5IHPA 4BFWA 2FZ4A 2FPLA 3AEZA 2GILA 2OFOA 1WRBA 2FFHA 2ZE8A 4D26A 5E7JA 4YONB 4QBIA 1E4VA 1TQDA 3WBKA 4DDTA 3RC3A 2WJHA 3A1VA 1RPZA 4TYWA 2VQSA 4NONA 2GA8A 2ORVA 4QOSA 4I81A 3B1XA 4LX0A 3EZFA 1E2GA 2JDID 2WJYA 4Q4HB 1EESA 3D6TB 5K8IA 4UXJA 1S9HA 4FN5A 3ZVRA 3DPUA 3A37A 3QXXA 1Z6AA 2ZUCA 4V0KA 4MGKR 3PJRA 1F6BA 3Q8XB 1N3BA 4TMWA 1OPXA 2VO1A 3AVVA 2HCJB 1Q57A 5CLQA 5H68A 2JJ2D 1W4AA 4OQNA 3CKLA 2GJ9A 4B6EA 1TADA 3IQWA 1HYQA 3K53A 3UMFA 4B3DA 4A15A 1IBRA 1Z28A 4QGGA 3TW4A 3X1XA 1RRCA 2CJWA 1G4UR 1NIPA 2VPPA 3I4LA 1P2SA 4PZYA 4M1TA 3CONA 4M1SA 1CJTC 1FTSA 3PVSA 5JJLA 2NMVA 1KJWA 3U44A 1FFHA 1KTVA 4HLDA 4JVLA 4B3CA 1T4GA 3TUJC 1EK0A 3C5HA 1GL9B 5KHOC 4PAOA 1XJQA 1OV4A 2OZEA 2WPDA 3CF6R 5B30A 1U8AA 3FB4A 1W49A 3SEAA 3CNLA 2BHRA 4OHWA 4D0GA 2OUKA 3REGA 1GRQA 1VHTA 3LLMA 4KFSA 4YLGA 4C0JA 2PLRA 4C4PA 4TZ6A 3EC1A 1E32A 3EIQA 1EFRD 1WP9A 1NG9A 2D7DA 3MGCA 3U3JA 3K9HA 4M8NE 2ZAMA 1F2UB 1TUIA 1X8LA 1LFDB 3LAWA 4M9SA 4CEIA 4URYR 4FWIB 1O87A 2F7SA 4EFNA 1U99A 1JPJA 1QHHB 2QPAA 4MRSA 1OH6A 1YR8A 3PUXA 1IJEA 1G6OA 3QI2A 3RAPR 2IEZA 2OEPA 5FR2A 2KI5A 4OKSA 1G3QA 1E9FA 1YR9A 1FNNA 3MFYA 1DO0A 3KXKA 1E2KA 2GJSA 1X6VA 2YOGA 1E96A 1M34E 1ONBA 2CVHA 4V0OA 2X2EA 2DBYA 4XSHA 2XGJA 1Z0FA 4MUAA 3FHOA 3KJGA 3TLXA 3DL0A 2OESA 4ZCIA 1D5CA 1YR7A 4B3GA 2BBWA 2ZETA 3EZ9A 4M1YA 1E9AA 3DO6A 1GL6A 1NMXA 2WWHA 4DB4A 2H92A 2QSZA 4TT3D 1QVAA 3QENA 3JZAA 2X77A 1XF9A 2QORA 3P4XA 2WSMA 4RZUA 2YZ2A 3PUZA 1C4OA 4A0RA 2JLWA 2C5LA 2O8CA 2FWRA 2VBCA 3U7GA 4XH9B 1WBDA 4Q4AA 1MRSA 5HR5A 2NTYC 4JYBA 2YYZA 3UIEA 1VHLA 1Q3TA 4LJ7A 5CYPA 2ZSBA 4MA4A 3ZIAD 3GQBA 5LDDC 3UG6A 1J70A 3I32A 1UKZA 2FZLA 2J0QA 1QHGA 2ZI4A 2GEVA 2QAGA 3A4MA 2BOVA 4UNSA 3TVDA 5LBIA 4DLWA 3FHCB 1P4SA 3I8XA 1XTSA 4I1VA 2CXXA 3Q9LA 1H8EA 4A1FA 4JKYA 4RD6A 4OI1A 2BMJA 5HKKA 1M2OB 4C0LA 4DLSA 4A36A 2QTVB 1KKMA 4FW9A 2EFDB 3B7GA 4PPGA 1P2VA 4BZPA 1K8RA 2J5XA 3RS7A 4DLXA 1GG2A 1R0XA 2P6RA 5GJBA 3PXGA 4DDUA 3CX7A 4AY2A 3N2EA 4FMDF 1G3MA 4UNNA 4Q00A 4IVQA 4BECA 1S1CA 2GAOA 2QEQA 4YMVA 4PSKA 1M8PA 4MYCA 3NBXX 1UFQA 1ZYUA 4A0GA 3K70B 1UBEA 3WNBA 4QHYA 5BYKA 4GOJA 1ZU5A 4RD2A 4H1VA 4Q1CA 4FWTA 3QXJA 2V4ZA 2BKEA 1XTKA 3VX4A 2CK3D 1Z0AA 5CJ2A 2G1KA 1AM4D 1GUAA 4CEHB 4U00A 3X1WA 4DEXA 3NHBA 2JLZA 4Q9JA 5KSZA 3IIJA 2EWWA 4P0TA 1U9IA 4Q1BA 5DSZA 4Q9HA 5FOSA 2GXAA 3OAAD 2QY9A 1NVVR 2OM2A 5FBQB 5TMPA 1P9NA 5EXSA 4Q01A 2OFWA 4XTRA 1NMYA 5AUQA 2NO7A 1KO5A 2QT0A 1XP8A 3NBZC 2ZJ5A 4JLVA 4RD3A 1FTNA 1XD2A 4X8LA 2XOKA 2C03A 4RY2A 2VTKA 3DHWC 3BB3A 4JLNA 2JLRA 1ZC3A 4LJ6A 1VG1A 1VCOA 2IF2A 2XTNA 2GEDA 4ZPXA 4M21A 3LV8A 1OXSC 1FX0A 3EASA 3NWJA 3TE6A 1J8YF 2YINC 4JLDA 2ODEA 1E1RD 2P2LA 3IBGA 2GBLC 1JI0A 3C41J 1ZD9A 3B2EA 2XJ4A 4Q47A 2IHBA 1G41A 1PV4A 5FPYA 5JWHA 1Z5ZA 3WYFA 4ZIRB 2W2XA 2ZRJA 4BLSA 3N70A 5SZKB 3DMDA 2ZYWX 4R2HA 4KFTA 5JMTA 1N6OA 1CXZA 3HPRA 3UWOA 4PFSA 4BZXA 2ZR9A 4NCJA 4AC9A 1A4RA 3PUWA 4OJKA 1Q21A 1E2DA 2C99A 4KVGA 1RFLA 1SXJE 2JIZD 2W2TA 4OYHA 3QG1A 4TQUS 5TB5A 3AF1A 3REFA 1P9WA 4DB2A 2DWOA 1F2TB 3LH5A 4IVRA 3AV0B 2WAYA 3SU8A 2V6JA 3QIAA 4EPXA 1TQ4A 3QKRB 3LFUA 2QM7A 4NCHA 3B78A 1OT3A 4P4SB 2DFKB 1CR0A 2HYIC 1HT2E 1Z6YA 4TN1A 3QPUA 3EA5A 3KTAA 4BPBA 1I2MA 3NIBA 1FMLA 4AG5A 1IN7A 2FPMA 3IUYA 2ZRFA 1R5NA 2GEUA 1AIPA 4P4UA 5KSOA 3P1JA 3NC1C 4RFSB 2O0JA 1Q22A 4JBXA 2ZUDA 3B5JA 1ZINA 4ZDKA 4B35A 1AN0A 2P3SA 3MG9A 4L5BA 3FMOB 2CBZA 4WZAE 3FE2A 4FXPA 5L8VA 4DC9A 1IY2A 1Z0IA 3QKUA 5EE5B 3AQ4A 2TMKA 1P62B 1R7RA 2QGNA 1NVVQ 1NVWQ 4QNRA 2N46A 4Z54A 1R0ZA 2HUPA 4RD4A 4JJZA 2RGEA 4G5QA 4PPNA 2XTMA 3EZ2A 2OHFA 3CBQA 2G0TA 5FOUA 4NKRA 2H5EA 4TLAA 1P6XA 1R8QA 3THWA 3V9PA 4CW7A 5CIWA 1W0KD 1JPNA 1RIFA 3I73A 4LRWA 2WHXA 4G5SA 1B23P 5B64A 4IOMA 4LHXA 3CRQA 2I4IA 1TL7C 4DDVA 1G16A 4PAQA 2VIIA 5JI2E 1VCIA 2WKRA 1HH4A 2A3RA 1GNPA 3K0CC 1FL9A 3RWOA 1Q1BA 2PZGA 4JL6A 2P65A 4KAXA 4W7SA 1A7JA 1HY3A 4MQBA 4D4KA 3FHTA 2DCUA 3IHLA 2YHSA 4E07A 3K09A 2V1XA 4QBGB 4C0QC 2SHKA 3TUZC 2DWQA 4TYNA 1ZUIA 2GDJA 2GTPA 4FINA 4BFXA 2W0MA 4B34A 4CYMA 2GKSA 3RRZA 3WXMA 4M2LA 2C9YA 4EQ6B 5J47A 3GCGA 1E9SA 721PA 2A5YB 3C7KA 1OKKD 1X1RA 2WWGA 4D2IA 5JJKA 4HB2A 4W5JA 3BC1A 4EPVA 2XXAB 5L3QB 2JASA 4URWR 2Z83A 1ETUA 1X3SA 3B1YA 1EFCA 5FBWB 4EPYA 3W6OA 4AG6A 3TRFA 3F8TA 2ERXA 4POAA 4QFMA 2ZANA 4RD0A 2RB4A 3SQWA 1DAEA 5J4VA 4AYWA 1A5TA 2QMHA 2BBTA 4OJQA 4Q66C 3FPAA 1XZQA 3T1OA 1E2IA 3Q3JB 4B2PA 3I8SA 2KE5A 2KSQA 3GJ4A 1BMFD 2D3WA 3LDAA 4ERNA 3CR7A 1JEDA 1RJ9A 3PFIA 2JLVA 3BB4A 1OIXA 2ZUBA 4JL5A 5C4MA 4MDFA 1P75A 2HF9A 4IEEA 2BCGY 2BMEA 4PO8A 3LBHA 1OIVA 1JR3E 1ELOA 3OFND 1M6NA 5EP2A 1PJRA 2XAUA 4CT5A 4WW0A 1E1QD 5DO9A 1G1MA 3GLIE 2DR3A 4D25A 1E2PA 1G3UA 2B8WA 4ESVA 3CF2A 4M1KA 4QM7A 4PO9A 4D4LA 5L3SB 4DLTA 4BQSA 3DKVA 4KXFB 2C04A 5BN5A 4LV6A 3QXCA 4NZYA 5A0FA 3FGNA 1E0KA 2RGAA 3HJNA 3VR3A 2IXFA 2AWOA 4PPFA 2WJVA 3RVBA 1HTWA 1NJGA 4XD7D 1DPFA 3W5IA 4JBYA 2IUUA 1OFHA 4S2EA 5UKDA 4DCUA 2V1UA 1ZJ6A 2O8BB 4BFUA 1TTTA 1OYYA 5J5CA 2F43A 4Z51A 4MDEA 3VR6A 1ZNXA 1Z0DA 1C9KA 3B85A 3AGQA 3QPWA 3MSXA 1W4BA 4UJ5A 2V7QA 3KFVA 1WCV1 3TMKA 3DZ8A 1PVOA 5KNCA 2YJTD 3OHMA 3NC0C 4TSFA 4G01B 4G0NA 4ZDIA 1UEJA 3R7WB 2KBFA 2E1RA 3RSLA 2ECKA 2GNOA 4UQOA 3WNCA 3MMPA 4XVRA 5FUXA 2REBA 2PCJA 4A8JC 4URVR 3R8CA 4Q7KA 3GLFB 4M1WA 5E7MA 1D2EA 1XCPA 4OL0A 5TXGA 2BMDA 3CH5A 1U0LA 4Z8XA 3CB4A 4MYTA 5FUYA 3NEYA 5LD2B 1IOZA 2CLSA 5M04A 1Z22A 3AVWA 3WHLA 3I92A 2ZJOA 1CR4A 2EYUA 2WWIA 4MYUA 5KDLA 3OF5A 4IRUB 4URXR 3ADCA 1COWD 1ZVQA 1CF4A 3K0SA 3IQXA 4QJ4A 1G17A 3U4QA 4OQLA 5FL7A 3AVXA 2ATVA 2W6IA 5FI1B 4OQMA 1Z2AA 1SVLA 3G5UA 5AJWA 4CIDA 3I3SR 3THYA 2ZS8A 1SXJA 5B58C 3RRMA 2QSYA 1Q1QA 4KO8A 5HE8A 2QE7D 5CB6A 1MABB 3X1ZA 3LBIA 4DLRA 4P4TA 1EWRA 2EFGA 1NRJB 1TMKA 4F38A 1QHNA 2HXSA 3WYGA 3RSOA 1AKEA 2ZYTX 1M74A 5G3ZA 3W8RA 3PEYA 1KK3A 1E2MA 1XJ0A 2JCSA 3CRMA 2HT1A 4LYJA 1DOAA 1RC8A 1K5GA 3NDBB 3UMRA 5BWMA 2VSFA 5JWRA 3PCRB 5BQ5A 2ZRIA 1KMHB 2IYLD 3AGPA 2O8DA 2BMFA 2IYRA 4RZXA 5CYOA 1B0UA 1G3IA 1IN5A 1WF3A 4JMPA 1GILA 3BB1A 4OK5A 1R0WA 2FSIA 1UBCA 1JAHA 4JSYA 3VU9A 3TNFA 1IXSB 3QEOA 1SGWA 2FE4A 2QENA 1P2TA 4TTQA 2BDTA 2OXCA 5G41A 4Q48A 4YDHB 2ODWA 2IS1A 5JSZB 2NGRA 2P0EA 1U0HC 3I5XA 5DISB 2C78A 2XZOA 3LVRE 1OFUX 2J41A 1W36C 2N1BA 4DKXA 4J0QA 4YQFA 1D9XA 2Q3MA 2REXB 2G0NA 3C4JA 4BEJA 3T1QA 4DLYA 3GLHB 3T61A 5AUOB 2QP4A 3EA0A 4BLTA 1XRJA 3Q72A 1Z8FA 4FI3C 3U61B 4I1OA 1CU1A 2LCFA 4IXMA 1XEXB 1XD9A 1KNQA 1W0JD 2AXNA 2OXRA 4KLZA 4KFUA 5FI0B 2ZRGA 2IXGA 2IC5A 3AM1A 1GKIA 2G83A 1OF1A 4XWOA 2OG2A 2QG6A 4NCNA 3FDIA 2CEAA 3CNNA 3PIRA 1NBMA 3RS2A 1KK2A 5FPTA 1XEWY 3KUCA 2VP2A 1DAIA 2NO1A 4MITA 4EAQA 3BH7A 4GP7A 2QBYB 1A2KC 2IF0A 3P32A 1KDPA 3N5CA 3EIHA 4LJ9A 1A1VA 3BK7A 4P3YA 2AK3A 3SR0A 3A58B 3GLGE 2G1JA 1P2UA 3DVLA 4M0LA 1GKYA 1G5TA 4HAUA 2GCOA 4KU4A 1RRPA 1AKYA 2WSSD 4MGYR 5K8UA 1JR6A 1ZIOA 1KI2A 3QBVA 3R8FA 3R20A 3LX8A 1JECA 4FMCB 2NIPA 3LBNA 1FUUA 2Z6VA 3VTKA 5DN6A 2CL6X 3FKSA 2DHRA 4F92B 1J90A 1MV5A 1G7RA 3B82A 1UF9A 2F3TA 1FQKA 3QF7A 2QAGC 4GSYA 1GAJA 4PQYA 1G9XA 2CNWD 1OFIA 1YQTA 2EFEB 4D6PA 1XDBA 1G4AE 1NVXQ 5DHFA 4TYPA 1UJ2A 3B1ZA 2HLDD 3KXLA 2FNAA 5HTKA 3PITA 5SZHB 1TQ2A 4MUBA 2XNSA 1DVRA 4NHOA 4NYMQ 5IK2A 4KBGA 4L8GA 4C7OA 2ONKA 1T91A 1LW7A 1XFAA 2ZVQX 2R2AA 1QVRA 2G9NA 4A82A 4PHHA 1Z63A 1KO7A 2RAPA 1II9A 3K70D 3EX7C 3U2QA 1ESMA 1KSGA 2PX0A 5EE3A 5EZ6B 5KSYA 3BGWA 1JR3A 1HUQA 5IT5A 2GXQA 3ASZA 1GFIA 3ADBA 1ZCAA 4KSBA 4X8OA 3GLIA 2I1VB 2ODBA 1K6MA 1ZP6A 5B2ZA 1NLFA 4PR0A 2FSHA 2D2EA 4Q02A 4QC2A 3NTUA 4P31A 4O2RA 1EG7A 3NDPA 1OB5A 2WKPA 5AJVB 1I4DD 1KI8A 2WWXA 3VR5A 3LQQA 4M9XA 1DELA 4F93B 1W7AA 3MLEA 4LV8B 1XXHB 1DG3A 3SOPA 4B74A 3OE7D 3QSYA 2ZEJA 3L8ZA 4KYUA 1U9IC 2J0VA 1W4CA 1IONA 5KO2A 1E9RA 2BJWA 4KI0A 3QG5A 3KB1A 5H8WA 1HQYE 3MAAC 4OK6A 2X1VA 1CJVC 2IHYA 2HEIA 5JHHB 1DAHA 2JDIA 1AGPA 1J99A 2ZRNA 4PQFA 3SZRA 2WICA 4TL8A 1GP2A 3VQTA 4B32A 1IAQA 1WBBA 2IS2A 2IYSA 5AUNB 2UZ3A 4CEHA 2H16A 1CR1A 4BUJA 3H4MA 3IKJA 2JJ2A 1E6CA 3GJ7A 2RGCA 4CDGA 3QY0A 2A2ZA 4BE7B 1US8B 3VHXA 2RHMA 4OQXA 1OHHD 1W4RA 3DM9B 4B75A 2OO7A 2Z43A 4GMDA 3D31A 4UNQA 1T8UA 4MRRA 4LV5B 2J87A 1XWIA 1LTQA 3FMIA 4Q7JB 4A0FA 5EXPA 5FTNA 4Q1AA 2C2HA 2OILA 3CPHA 5E4FA 1OH8A 4GRAA 4ABYA 2BM0A 1R8SA 2OSBA 621PA 4DSTA 2A78A 3QEJA 4HAWA 4ZKEA 1QHYA 1ANKA 4HI0E 2ZQ5A 2ZXUA 3M4YA 4WA7A 4C9BA 1E9CA 4JBWA 2PZEA 3O47A 2FEOA 3C5CA 2FU5C 2IK8A 3QVUA 1OE0A 2ZROA 3VKHA 3GPLA 1EFRA 4B73A 4DUGD 3BBPA 4WOPA 3NEJA 5FPSA 4ZCMA 2F1HA 3C8UA 2I1QA 3U7HB 1JBKA 3L2OB 4UNRA 2ZIAA 2IYTA 2W6JD 4IHQA 3ETLA 2ODNA 1D8TA 5J4LA 1ZAKA 4OBEA 4UJ3A 4BFTA 3K1JA 4Q1DA 4FCTA 1U8ZA 2FFAA 4HDOB 4A8JB 4BLPA 3EWAA 2GWHA 1ZRHA 2W58A 1G18A 1ZU4A 1YZTA 4KODA 1FQJA 1RZ3A 2IL1A 1CEEA 4EDHA 3SFZA 2ZSFA 5FOVA 3WYAA 4CGZA 4FD2A 4URUR 2RGXA 3D7MA 3B60A 3IDQA 4DSUA 2J0UA 5BYJA 2B92A 3IHWA 1ZM4A 3A36A 4UKDA 2GVDC 2C98A 3B9PA 3EG5A 3IEVA 3GJ6A 4DJTA 4TT3A 3CLVA 4FMDB 1E3MA 3QJYA 2FFBA 1TUEA 2FG5A 3EPLA 3P26A 2QAJA 3CW2A 4OHZA 4Q9IA 4TQAA 1II8B 2ZU0C 2YWHA 4IEIA 1GZSA 4L9WA 3FTQA 4LK2A 1OXXK 2EVWX 2P67A 3SJCA 3WNDA 5HZHA 2O8FB 1KOFA 2YC2C 2PZFA 5D3QA 2OBLA 2IBMA 3A1UA 1XTRA 4EJSB 2Q21A 2IX3A 3I62A 1KGDA 2NO9A 2VF7A 2D4HA 3V4RA 4RFSA 3VKWA 1L4YA 3D8BA 3IGFA 4IOJA 3ZIAA 3P4YA 1JXMA 4TTPA 2ZITA 4QRHA 2CE2X 4P33A 3WP1B 4ACBA 1R6BX 4XOIA 3TW8B 5KDDA 4BZQA 2Q9AA 3C14C 2ZJBA 4DBLC 1H8HA 2J46A 5FTLA 1DO2A 2ATXA 4HLCA 4LUCA 1O3YA 3ZDQA 2ZRPA 2VHUA 2JLSA 4M9ZA 2CJWB 1IQPA 3IILA 1ZD1A 3TSOA 1DG1G 1FNMA 1UKYA 2VYFA 1Q20A 5KYKA 2A5GA 2O8EA 3KKMA 3AVQA 4IJMA 3TQFA 5JS7A 1ZMXA 3U44B 2WKQA 2G77B 3TJZA 1GNRA 2GVZC 2Z5FA 4TLDA 2YOHA 1LVGA 1IXRC 1JAIA 3K09C 1MO3A 5FBVB 4ARZA 5JWOA 3GLGA 4TL7A 3P27A 5FBRB 1G8FA 3Q7QA 5KDOA 2PMDA 4LJ5A 3KJIA 4TQ9A 2HJVA 4QJ5A 4UXIA 3OIYA 3CPJB 1N2CE 1CRQA 5FH9A 3WMFA 1F48A 2EW1A 3NHAA 3PEWA 5F9FA 4A2PA 1MR3F 2PMKA 3LVQE 2L0XA 1KK0A 2MMGA 1WMSA 2CK3A 1SKYB 4E03A 1OXTA 1S9DA 1SQ5A 1FPMA 1W2GA 1AGRA 3F0TA 1QHSA 2X8AA 1IY1A 3FMFA 3LLUA 4NCKA 4LHWA 4B47A 3A6PC 1MH1A 1N6NA 3KKNA 4DDWA 4KLNA 2B21A 1GM5A 1RVDA 4HLQB 4TZ0A 1BH2A 1WDTA 4JT4A 4YMUA 1Q12A 5F3WB 4A92A 1CJMA 3F5FA 2R6AA 3U3OA 2H57A 1SULA 1BS1A 4NH0A 5CK4A 2J7PD 1HEIA 3BWDD 5TVKA 3AH8A 5DI3A 4BEBA 1L8QA 1S8FA 2D7CA 4X8HA 2QP3A 4ZV4A 4G1UC 2FEMA 4FCVA 4DLZA 3H0KA 2WAXA 3BFKA 3F3YA 2ANBA 3FWYA 3WRYC 1E99A 4O25A 2GHIA 4QGAA 3ECCA 1G8YA 3O8BA 3FVQA 1R5BA 2QNRA 2ZYVX 5AWFC 2VHQA 1E1RA 2ZJAA 4W5WA 3A4LA 4KBFA 4PTLA 2ZVPX 1XX6A 2GZAA 4GT1A 1CRPA 4A6PA 5KU1A 3RWMB 4TLBA 4PPQA 4UXHA 4IVPA 4AKIA 3TH5A 2CLDX 1FMJA 1UM8A 4RJLA 3U3KA 1W48A 1AQUA 1WXQA 2ZJYA 4Y0AA 2J7KA 1OIWA 2BEKA 1FUKA 3O8DA 2NG1A 3M6AA 4LC0A 1GRRA 2RGNC 1DARA 2WTUA 4DCVA 4TMKA 3CX6A 4LYHA 4Q7MB 2HT6A 2QRNA 2JIZA 1EGAA 2YVUA 3PQCA 2XB4A 1PLLA 1HURA 2PEYA 4XVQA 1VYTA 4NCIA 1G6HA 2QI9C 3HU1A 5FBLB 2BWJA 4B2LA 4PC3A 1DTSA 4OHYA 4TMVA 4L9SA 5K8TA 5L3SA 4GZMA 3RRYA 2MMCA 2R65A 3OESA 4JS0A 4WXRA 4NP6A 2ASEA 3NBYC 2HXYA 3L0OA 3NVAA 4TMTA 4Q9LA 1MT0A 2P6UA 4IFEA 5A5GA 2IYZA 1P5ZB 4PZZA 3I1FA 1HV8A 1GDDA 4Q5IA 5CDFE 1DAKA 3PEVA 2QPOA 2VRWA 2OBMA 1T9HA 3RHFA 4AYXA 2CL7X 4A6XA 4C0BA 3CO5A 5G40A 3QF4A 2BVNA 5EUMA 3MD0A 1N6RA 3GJ3A 2NZJA 4R2IA 2P5SA 2LKDA 1KI7A 2VLIA 3B6EA 3QXSA 5CLLA 3BFXA 5KNBA 4ACAA 1KY3A 4BFYA 1U98A 4URZR 1KI6B 1NBME 1PUJA 1Z6XA 1DEKA 3G82C 5HE9A 1N5JA 3R7WA 2YKGA 2G3YA 1ZNZA 4NYIR 3KQUA 4GZLA 4RZ2A 2ZS7A 1QF9A 4M53A 1ZM2A 2ZJZA 3GLFA 1S96A 2A5FA 3OIUA 5FPKA 2OE2A 4PO1A 2ZSDA 5EJEA 1SXJC 1IN4A 1TU3A 2CL0X 3AKEA 3C16C 2V8OA 3I5YA 1W5SA 2ZREA 2H18A 4PAMA 1X86B 2WOJA 2B7CA 1XD2B 1ZD8A 5TY0A 121PA 4PHTA 4YXWD 5JRZA 1NN0A 5GJVC 5DNYB 2GXUA 4GOXA 1JQLB 1QZXA 4LJAA 221PA 4K8OA 4LBVA 2WOOA 4V0NA 2JJ8A 3TAUA 4D0NA 1MO4A 5CITA 1NLYA 1W0KA 4OHXA 4QJ3A 4DXAA 2QT1A 4ZDWA 1XEWX 1VG8A 1LV7A 3ZYCA 1JJVA 2WWYA 1KDTA 3ZVNA 2GK6A 2MSDB 1N0UA 4CEJB 1DAFA 3H2YA 1ZW6A 3J81k 2FDCA 1TX4B 4DT1A 1LF0A 1OH5A 4F7WA 3U60B 1NN3A 1M1YE 4HUTA 4MGIR 2GJ8A 4PC7A 4US0R 4QL3A 1W44A 2D06A 4OI2A 1ZM7A 1Z2CA 3GFTA 2X19A 2UZIR 4HZUA 1JXOA 1W2HA 3KDSE 2A5JA 3X1YA 4ASUD 4C0SA 5EE9A 3W3ZB 3UPUA 2FA9A 3AF2A 1XCMA 5DLQC 1DAMA 2FJUA 3N2IA 4HB3A 2JLXA 4LSGA 2PL3A 1OKKA 4R71A 1TF2A 3BERA 3AUYA 2GCPA 2AL7A 2BBSA 2IUSA 1OXUA 1D9ZA 4RFVA 4KJZA
chains in the Genus database with same CATH superfamily
2D0PB 1V16B 2ZTSA 3ME5A 3WGIA 1TVKA 5FRDA 3D54D 4R0NA 3KLNA 3RJTA 5HCNA 1EVQA 1K63A 1WB6A 5ADVA 5JXIA 3NXSA 5MN5A 1IMJA 3OEHD 3ELBA 1KY5A 5FPPA 2OT3B 5KB3A 3D0OA 1E6KA 2OXEA 3OU2A 5JRDS 1E8NA 1YZLA 4HATA 1VA4A 1WHTA 2GCIA 4J7AA 1BXRA 1Y63A 1U0JA 2RJ3A 1UBFA 2VAPA 4IOLA 1UMKA 1SXPA 2XUHA 2XR1A 4G8CA 1EE2A 1YU9A 1N92A 4IJUA 2X1HA 1JU3A 2ID7A 2OHIA 1UMDA 2P41A 1I1QB 2YJ3A 1BMFA 2YZNA 3IAAA 3P71T 5CA0F 1OVGA 4UEJA 5C53B 1B76A 3HYTA 3S7ZA 4L9AA 3GMIA 2AT1A 1QGOA 1H93A 3JR7A 4RF4A 1AZWA 3HJBA 4GM1A 3FAKA 4AI6A 1JXQA 1QZTA 4RH1A 1KVSA 3KSBC 1VPVA 3RHZA 1N2EA 1GA1A 1Q19A 1VLZA 2IIQA 2VHEA 3QXHA 3TAXA 2II6A 5HJ5A 4I8DA 1W35A 4MIEA 1RKBA 4X1IA 2ZE6A 3OFNA 2WLTA 1N0HA 3B8EA 4WZBE 2WMYA 2CNNA 4GNKA 4XFKA 3LIPA 4ZHSA 3NMUF 4MR7B 4PQRA 3DYBA 4YBZA 5AOAA 1Y3FE 2GZHA 1H0KA 4FFOA 5I7RA 3IQFA 4CIAA 1N2CA 1IVNA 3H2BA 3K6SB 4YJ3A 3VXKA 3A7EA 4TKVA 3DGFC 4KAAA 5SYMA 1U3GA 1WSDA 2XZLA 2WEKA 3INNA 3TD2A 2OQ2A 3HCCA 2O3TA 2PH5A 2ZP1A 4YT4A 1RYZA 2G6BA 3AZPA 4HGYA 3TINA 1I7DA 1AUQA 4PX9A 1XLTC 3OX4A 5A1JA 5K20A 3ZQ6A 1CIPA 1V7CA 2C8JA 4GI3A 1S89A 3WP0A 1D2HA 2HPVA 1A27A 4Q4JB 4E5KA 4F8YA 1QS0A 3WSWA 1T3LA 5KPDA 5B36A 4BX9A 1GFSA 3LWDA 5D3MA 5KCMA 1KRWA 3K0AA 5CBPA 2VTBB 3PV0A 3A3NA 2NOAA 4O63O 4XLLA 4IHKA 1IY0A 4ZT7A 4CDRA 5JXJA 1UDRA 4QXRA 3IDAA 1D03A 2GPNA 4JUBA 5ALKA 3O8OB 5ED0A 5FFMA 3JYOA 3FKQA 4OOFA 1KO4A 3BJMA 2V0GA 5JZ9A 3UT5B 2HJGA 4W9NC 2H00A 4DDHA 3HYNA 2XZPA 2OZLB 4TVBA 3G8YA 2O2IA 4GKVA 2RH8A 4NL4H 5FNVA 2JJ1D 1PG5A 3RFCA 1FDVA 1M2EA 2IUYA 3KOWA 3COPA 4LJ8A 3A2KA 1NA5A 1YZUA 4M7RA 2A1TR 3OJOA 1HETA 1FU4A 3G89A 3NTXA 5DASA 3GJXC 3R76A 3MN1A 1H5UA 2ZI6A 3CLUD 3MIIA 1SVMA 2XLBA 5K6AA 4M55A 3KQLA 1P61B 4P5EA 5FP0A 4AT1A 2ID9A 5J40A 4NYMR 1DUVG 1WD7A 3JQAA 4I4IA 1E5TA 4CV1A 2VKTA 1MO5A 4JV5B 1HYGA 2XCTB 2QTAA 4HRAA 4M98A 1I7NA 2ZIVB 5A0VA 2QTNA 3M3HA 3QI7A 4JLAA 1OTXA 2CC2A 4CF6A 2HA4A 1D2MA 3L7MA 5G1OA 2UYCA 5C1DA 2VHTA 4F3KA 2DPMA 5EUQB 1R6XA 2F3UA 4OYLA 1TYCA 1MX5A 2BC9A 3CMMA 3KYJB 1ZXXA 3KYDA 2OXTA 2YC4C 4L5AA 2B37A 5BOSA 5C1BA 2Q7XA 1W0CA 4C43A 2OG1A 2WJGA 4D0LB 4GSLA 1Q50A 2I2CA 1NXVA 1VIAA 4NESA 3BMXA 3KEMA 3VH1A 4K9OA 3P0RA 4PFJA 1Z7WA 3GMSA 1SA0B 4YGYA 3F4KA 3ICCA 4EL0A 1EH5A 4AS2A 1ACMA 1MKYA 2DM6A 2JKYA 1QDEA 1XN1A 4JLMA 5EHNA 1ULTA 5L3VA 4HGQA 3MEQA 1JEYA 4HPXB 4RJJA 1G98A 1Q1ZA 1EWQA 3QVTA 4ZCRA 2QVXX 2JFOA 3ND9A 4YP0A 1ODTC 3HM9A 5CVVA 4CT0A 1JQ3A 2RMKA 3DTYA 5JVDA 2FQXA 4BV3A 1VBMA 1G55A 2R6DA 2B3DA 3O21A 3L40A 4K3UA 1OI2A 4KW7A 3R5XA 4RADA 3VC7A 1W52X 4BRWA 2H2AA 5KNBH 4TTAA 1IJBA 2QRVA 4Z0HO 1UJNA 2YASA 2QF7A 4IIEA 5FPHA 4I46A 3T06B 5I8PA 4ARIA 2PGLA 3HM2A 3UPDA 2W11A 1CJUC 3BFVA 5AJZA 1GITA 4HN2A 3MTJA 1YTLA 1YK0A 2Y0CA 2Y92A 3TD6A 4D6XA 3DHEA 1XVIA 1US8A 3U39A 3EUEA 3S2UA 4KGVA 1XL0A 2IWHA 4QYMA 5CH5A 2HYDA 3EBLA 1SZCA 1MUUA 1GLGA 4MRPA 5AJYA 5HIJA 1RNLA 1FZQA 5L40A 2PH1A 1QF6A 5K3BA 1OC4A 5FOXA 3UJNA 3VR4D 1T3HA 3MUEA 1ZMOA 3FGZA 5FA5A 4XCXA 1QHHA 1RQRA 3PUYA 3H9UA 5LKRA 6Q21A 2PQ6A 4DJAA 1Z3CA 2QI9F 4WFIA 1MX3A 1NKTA 5AHRA 4B4OA 4XX1A 1SD2A 1MXFA 1VE9A 2AI2A 3BS4A 2NT3A 1IFXA 3HYRA 3DMPA 2DLDA 3NS7A 3Q9SA 1U0EA 3QUSA 4ER5A 3STTA 3T9DA 1PYGA 1I8TA 2I4NA 3C3DA 4YAIA 3D3QA 4ND7A 5FBKA 1GFWA 1ND5A 1YE5A 4WH0A 4YP1A 3S40A 1A2OA 3EVCA 1KMQA 5A4MS 1GQSA 3FCXA 3GEEA 2ONJA 4RTLA 3CGGA 2WJWA 1M0SA 1R4ZA 2ZKLA 3I9FA 4RAQA 4M1ZA 4P92A 3CWZA 4B8WA 3HUDA 4TV9A 4DZRA 3BXOA 3N1UA 2CZQA 1I0LA 3DDNA 4N3BA 3PDIA 1DHRA 2DJ5A 1HDOA 4TUYB 1LW6E 1NUAA 2F3QA 3L6OO 3WY9A 2GARA 2Z09A 4JVNA 4AL4A 3L43A 4EEKA 2R8OA 1JEJA 2QL9A 2WFAA 5CD9A 2J48A 2PBRA 2XCUA 2XAAA 4JX8A 4WKOA 3RUAA 2DFNA 1V11A 4B33A 2JG3A 2PUTA 4MS1B 4E5UA 1NATA 3WBJA 4IDAA 3E9QA 2Q45A 2QMEA 4Y1FA 3DMGA 3DNMA 1HZZA 4KWCA 4L8FA 5T5QA 3LUDA 3LGXA 3QMPA 1ABFA 1X9GA 2AXEA 4LG1A 3ND8A 4WCFC 5TF0A 3MWYW 4F4CA 1PQWA 2AXPA 2NUBA 1CDDA 5FL3A 3GFVA 2EF1A 4DZZA 2K7ZA 4B4DA 1A88A 1ZPDA 1KI4A 2PGOA 3F97A 4QNNA 3RTBA 3CZMA 2O2CA 5FULA 4IWYA 4EWLA 3E8SA 1EXWA 5E1OA 3GD5A 2QTVA 1EWYA 2GZMA 4D92A 2WPNA 2O8DB 3Q7IA 1NMEA 1II8A 5IJAA 3ZK9A 4GBMA 2JFGA 3V8RA 4Q16A 4ZYVA 1ZIDA 2A7XA 1MJHA 3HU2A 1OWLA 4P2GA 1QIGA 1E5XA 4FC7A 1JDUA 3S55A 1J5EB 3RJZA 1PD0A 2AG0A 4NF2A 4A6EA 2IYQA 3FRHA 3BXXA 4PYLA 5JECA 1FY2A 4KR9A 2WPDD 2YMMA 2NSYA 3T9BA 3GNLA 5AIAA 4J4HA 1PWHA 3T9CA 2ZRKA 3CHYA 1VPLA 3DZHA 3M6UA 2BHSA 3DWEX 4O29A 4P34A 4S1WA 5LXTB 4HN4B 1G3RA 1HO3A 5HCUA 1NP3A 3AI7A 5BQPA 5KOYA 4YP6A 1PP4A 4MWEA 2BGUA 2P77A 2QR5A 4WJLA 2WMDA 1B3BA 2I22A 4R8MA 3CWQA 3BCUA 1Z08A 3VZBA 4CT4B 2ZDHA 5AJTA 1XCJA 5B3AA 3AB3A 4E21A 4F2GA 5KYWA 4FFSA 3HU3A 2AOWA 4CMEA 3G2LA 4U63A 1JAZA 1GO2A 2GRJA 1BSVA 4BOYA 4R5HA 2WAAA 2Q8NA 1M75A 2HLHA 3GAMA 4NU0A 4DM4A 3IBYA 1NNUA 3ZLJA 4N9WA 3A3YA 3LHFA 4YWJA 1LLQA 1YFLA 4BE9A 5GOTA 1BOOA 4JJ7A 1QH1A 2GWRA 5FOWA 5C8VA 3N2GA 1RQ2A 1ZD2P 3ZVMA 2JL1A 1J2RA 4O3MA 3AVYA 2WY2D 3MYRA 4WN9B 3LCMA 1KDOA 4DSNA 3ZE1B 1XTPA 1W94A 4MA0A 1MQSA 3IPYA 1GNLA 3O8QA 1D0VA 5HFAA 5D3ZA 3UHOA 3R44A 4HXFB 4AN0A 2O19A 4JODA 2G07A 2NO4A 3KR0A 3E3MA 4LXHA 2B0JA 4HEJA 3S6JA 3GLFE 1HE1C 1B8OA 1WDMA 4N3AA 4BRUA 3NGXA 2X13A 3PWTA 4BLUA 5IEJA 2F9MA 5E1BA 2G4VA 2YZMA 3WLIA 2OQVA 2AIRA 1Q0PA 4IIGA 3OG9A 4QQKA 4WBSA 5KNDH 3AF0A 4D79A 2F3RA 1I3MA 4LHZA 3SQDA 4D96A 3KQNA 4BY9E 1OT5A 2CHEA 1R9NA 2SKCA 4U2GA 1OSNA 4FFMA 2QPTA 1C0LA 4ZIRA 3TTSA 1JTEA 4HTAA 1GU7A 8GPBA 3ZIAD 1TRKA 2NP7A 3DL2A 1T1SA 4FLMA 1QH0A 3OC0A 4IJWA 3A9CA 3L0YA 4LI3X 5JFGA 4DR1B 4RTJA 2OFXA 3D59A 5BNWA 2F00A 1ZJ4A 2VAWA 5IFLA 4TYQA 4U02A 1TIBA 3F9IA 1X1TA 1V1MA 2MSEB 3DXYA 3U7EB 4IDFA 4TMYA 3RAEC 4JQSA 4E2XA 3C70A 2ZVDA 4OA8A 5JMWA 5TDHA 5EG5A 3SBEA 4Z4FA 4TS3A 4PC6A 1AS3A 2Y3IA 3WKCA 1QNFA 1LS1A 5CR9A 5KTPA 3E70C 3VV2A 1I30A 3MHTA 2VHJA 3FZGA 1X1BA 5JNVA 1PSDA 3WMEA 2OMKA 2IDJA 3CNOA 2XUGA 2J31A 2PX3A 2ZCVA 3GGDA 4NJEB 3TW6A 3DR5A 1Q0TA 2ZS9A 3ZS8A 2KWIA 4LVCA 3LDHA 4P4SA 2YYAA 4AZVA 1SHJA 4G1BA 4PRZA 2VP5A 4K6KA 1WB4A 2CDRA 4C7OB 1YIDA 3S2ZA 4HDCA 4JIMA 3L0BA 4EENA 4QSHA 5AP9A 4GRIA 4NNOA 5CJPA 4FEGA 3ROKA 2IHUA 3DTTA 3TSZA 1AKNA 3NWPA 4MW0A 4A9AA 1W5TA 1ZNWA 4Z54A 2A33A 1UINA 3ADOA 2PT6A 4OXYA 1JIJA 3L5KA 1X8KA 2QRZA 3FAZA 4BBJA 4P80A 4TWAA 3ZOKA 2Z3ZA 3ZCRA 4FGSA 1GXSB 3NO4A 1T0JB 2ZSJA 3DDSA 3EZ7A 1WMFA 3QOXA 3GLIB 5JH7B 4DM3A 3RVDA 5JCXA 3IIKA 5DOZA 1ZUWA 4OP2A 1X38A 2G4LA 3TN7A 2GK3A 3WA6A 1NQOA 3HXKA 3AF3A 2XCIA 4YMWA 2G06A 4AKGA 3DBLA 1WXEA 3CWCA 1T5LA 1NR5A 1H5NA 3G6KA 2I99A 2CXQA 3PUVA 2I1LA 3GLHE 3DO5A 4FE3A 4H7FA 4ZYYA 4C06A 4M9RA 2P0YA 3AUKA 5D5PA 3RRNA 1P9LA 1UFOA 2P9BA 2DBVO 3H5WA 4KBYA 4NICA 1T0HB 2V6MA 3I0ZA 3JWJA 4EUHA 2P9QA 4JB2A 2XOKD 1X0XA 3Q4GA 3T99A 4ZVPA 1MC4A 5DYGA 1G5RA 3FPHA 2Q0SA 3I1IA 3JQDA 3A8TA 2ZSIA 3N8DA 3UK2A 5AR1A 5K0ZA 4F84A 2I3DA 5BPFA 5C8DA 3EPKA 3NTLA 2GGSA 2Z08A 1ORTA 2EGUA 3JR3A 4XE5A 4Z0TA 3F7OA 3KFXA 3O4GA 3ROQA 4D46A 4U7DA 3BGOS 2RIPA 1V9CA 4L8YA 2FLVA 4EPTA 3SKYA 4MR8B 1AS2A 1ZHHA 3VPFA 5I9IA 3OPYI 3KXIA 3ANSA 1Q3HA 2X8JA 1G64A 1VG0B 3AF4A 4F2WA 3HXQA 1ATIA 2J09A 3DE0X 2JFUA 3WDKA 2LV8A 3EF1A 4QZVA 5IS2A 2CXSA 4AD8A 5F7XA 1TTHA 1YVDA 3AM5A 4IO0A 2R48A 4M4SA 1RIIA 3PC8A 1UBJS 1JG1A 3LC1O 1NUPA 4Q0MA 1B3RA 1QQ5A 3D0RA 4H4CA 4WKCA 4Y2RA 2ACKA 3CLTD 4MA5A 4ZAXA 1L8OA 3DSRA 3DOHA 1QRSA 4XQGA 3TZHA 1YZGA 3G49A 1O03A 4NFLA 4NPCA 3U4GA 1EZZA 3I1JA 2CXNA 4GYYA 3BBLA 4NSNA 4O2AA 4ZRMA 4E11A 2DH5A 1YL5A 1YA6A 2UUPA 4FNMA 4TS9A 2NXWA 4GPTA 1LK7A 1WUTA 2XRMA 1SHUX 2JF0A 5DNCA 1HOTA 2YXNA 4KN5A 2B8TA 4LDQA 4EKDA 1HDXA 1T35A 1G8PA 4RE6A 2JGMA 1V9LA 5AKEA 4RZIA 2OMEA 2XGOA 1VFPA 2VXBA 2V5VA 2PVPA 3PR3A 4Q93A 4PN3A 1N5OX 2GUGA 3P4UA 3BOSA 3UUGA 5JI3E 3GL9A 5EP4A 3RANA 2YVQA 4WUTA 3ZWMA 4LI0A 2PRJA 3VNVA 1KI9A 1C1DA 4GPAA 4F8JA 1Z2EA 1ZCZA 4L4RA 2IZZA 2NVUA 5K4AA 2I6GA 3BX1A 5JW6A 3DVQX 2AHOA 3M5CA 5K5EA 4FMPA 3FA2A 2PXHA 3FUUA 4Q4AB 5SZJA 2QVYX 3UJHA 3UUEA 1XMOB 2O54A 3SEQA 4N39A 4PANA 3H8JA 4I6JA 4V02A 2ORIA 1M6VA 2CFCA 2R00A 2XMZA 4MJLA 5KQRA 2WVJA 1A8SA 4F9EA 4CM7A 5EEGA 3TK1A 4J0IA 1UK6A 3C3BA 2HCRA 2RGUA 4F91B 2J0UB 1BIFA 1S2LA 2QAGB 4OEHA 5H7XA 5DM70 4R4JA 3UFBA 2JVJA 4PHFA 2OORC 4OSPA 4EHJA 3H11A 4JKIA 5TSDA 3X2SA 2X9LA 3ED1A 5LSAA 3WC4A 2OQIA 1CS0B 1PV2A 1VKOA 4YAJA 3T15A 4YMHA 2JLQA 3GBVA 1B8UA 1Y3CE 4BASA 1KXJA 4PZPA 2IYUA 1UADA 4H60A 5AXBA 1TQ6A 3GFGA 3V4FA 1O5TA 1Q77A 4GXNA 3B13B 4RLSA 3ZIUA 1M3SA 3DHNA 1M7BA 1PQUA 1ZLXA 2C77A 3AETB 4AN1A 4OGWA 4GO1A 1QIHA 5CB4B 4B3BA 2H2DA 1Z06A 3IRVA 5C7IO 1LNZA 1XTUA 4R3WA 3GOQA 2AD1A 3GYGA 2W5UA 2TMYA 1W8DA 3K4PA 1TK3A 1GCGA 1J7KA 4IW3B 3LUKA 4KV9A 4XYLA 4HTFA 5J59A 2C7GA 4C21A 4PXSA 2I3AA 3NBUA 4M8KA 3AO0B 4AUEA 4MTLA 2AFHA 1CUCA 3MCUA 2Q5HA 3HRIA 3VFDA 1VCHA 2QVGA 3TTUA 4AMZA 1VBFA 1Z15A 3OMXA 2B1GA 1NHWA 3VPBA 3RS3A 1N5IA 3AFHA 1RE1A 2EERA 4AECA 4NEQA 1QV9A 2GBGA 1P2BA 1G5IA 3JASB 3RFTA 2WNHA 4YDQA 5EJ9A 5EQTA 2BUCA 1VHQA 4GKBA 1RMQA 2K87A 3KKPA 4L7VA 1BEUB 3F5DA 1SWVA 1CF2O 1EFKA 1UDWA 1X42A 2IYYA 3IJPA 3D7LA 1JS1X 2DRIA 1R9MA 2F1RA 1QHFA 4PZ9A 3D1VA 3EOZA 3HB0A 4JLSA 2XOXA 2Z57A 4UOQA 1GCUA 2ENWA 4Z8YA 3RSGA 3W1EA 2VLBA 2PL5A 4HDSA 2WHPB 1Y7TA 3PI6A 3K30A 5T4FA 1TLTA 2AKYA 1PNTA 3MT0A 3VVMA 4DG8A 4J0GA 4Z4GA 3EXEA 4N5LA 3MTDA 1NYQA 1NKSA 3DEAA 3JPWA 4HWGA 5JBQA 2R6CA 3VX3A 3BE4A 4PS0A 1JMKC 5B57C 2J59A 1BCSA 1E66A 3K5HA 1II0A 1ZHOA 1XTTA 3QBTA 2WF9A 1L7VC 3B2NA 2JH8A 1HC7A 4LJYA 1MGOA 3O03A 1QYWA 5DHAA 5I7WA 5LN1A 2GJAA 3VSAA 1TAUA 1CZNA 1P5RA 3C15C 5JXWA 5KYYB 3D3WB 2BCJQ 3DW1X 1D2AA 1MRZA 4QBFA 1I7LA 1WCIB 2N42A 1NM5A 1TB4A 2UVDA 3Q0IA 1OFVA 3HA7A 2GPJA 4U7TB 3ORRA 5HP4A 4E08A 3R40A 2E9SA 1RC0A 3VZCA 2I9KA 3ZJVA 4MUHA 1GVHA 1P0QA 4RK4A 1LC0A 2J6IA 4ZICA 4MXDA 4MVJM 1WVIA 1OTYA 3SN6A 1N6PA 4GGMX 1PJSA 1Y1PA 4HLUC 3SIXA 3AP2A 4JR1A 1X1SA 2QG4A 3C5WP 4G56A 2X0FA 3X2FA 1A1SA 2G71A 4PZEA 1C1YA 1EFPB 1P0IA 3QVVA 2G5PA 5BYBA 2QLMA 4YAWA 1XVTA 1SY7A 1X2EA 2ZSKA 1DQZA 1ADCA 3B89A 2V7WA 3M9XA 3MOIA 1GPAA 2R6HA 3UO8B 5KKNB 3W3AA 1MJFA 1BAPA 3SFTA 2FSGA 5ELLA 3DL4A 4GUAA 4P81A 3B1WA 2UUAB 5ARCA 4ECEA 3UT0A 4MOWA 1CR6A 3SNHA 2FJPA 3IQEA 1BE6A 1TPZA 5IKEA 3LOPA 3S5JA 4DLLA 3F90A 4BNHA 1AHNA 2JGAA 3TDKA 4LS3A 3VR3D 3KUXA 4C0HA 4CI0B 2I2DA 4RS4A 3KBBA 2EFHB 2ZJ2A 1P5HA 1AS0A 3GI1A 2Q6TA 4OLFA 4DLVA 1AH2A 3WL5A 3MCAA 2FZGA 1J5PA 2FH5B 2YZGA 4NHEA 4CG3A 3W2EA 1PT9A 1RWKA 2C9CA 4R98A 2H7VA 2AJ8A 3QMWA 4DEYA 1XVLA 4Q39A 4C4TA 4AKEA 2H8KA 1W88B 1D3AA 4NATA 3WLOA 1PFVA 2AOUA 3C6KA 3KEOA 3PNYA 4QVKA 4XWWA 1MW8X 2QGFA 1PYDA 2BGNA 5IJ0A 2IOFA 1AQYA 2CEKA 1RM0A 1FYWA 2GLUA 1YA8A 4PYIA 1BQEA 3B9RA 1R12A 1G21E 3EISA 1E8MA 4DLUA 1XEXA 1I7SB 2PCLA 1IHOA 3C3XA 2XGMA 1CS4C 3EXAA 2XT9A 4C5AA 4KXMA 2YJNA 2PNFA 1CQWA 2X6RA 3T95A 1F6WA 3E3AA 4LDRA 3I2KA 3NNDA 1JLSA 1UFKA 4Y0VA 5H4GA 2W2VA 1PTKA 3OZEA 4E13A 3LDGA 1N3YA 1TIPA 2WBLC 4ZD6A 1SC4A 5CVTA 3GCDA 1E1NA 1VECA 3K0FA 4HAZA 3WB2A 4DPKA 1E9DA 2Y0PA 1JH9A 4R9VA 4E2ZA 1H4SA 2BI8A 2ZLBA 3HP4A 3LXMA 4YDSA 2B7BA 3I72A 1NNI1 2AFRA 2Q1SA 3VPGA 3NTVA 2QQ0A 3FOWA 4L73A 2BJVA 5IPFA 4QBHA 2HHLA 4KXUA 4M3NA 3ZHBA 3E5NA 3FCOA 1Y82A 1XNJA 3OZVA 2W00A 4G09A 4YV7A 1JHQA 3LY8A 4ZCQA 1OPRA 5D5QA 1RW4A 3QOYA 2JIDA 2QTHA 3BAFA 1CULC 1U0RA 4PYKA 1LY1A 2HLNA 2PK3A 3M70A 4H7PA 2A1UA 3PGLA 3IAM6 5U9CA 1RWWA 2W6ID 5A9SA 5DIZA 4D98A 2O3UA 4UQLA 1NSYA 3ODGA 2YOFA 5K45A 1L7OA 2CLHB 4I99A 1XZLA 4B2IA 5ALEA 3F3KA 1H2RS 4W9MC 4ZWNA 3VPDA 2XNDA 3VUFA 4H0CA 3AIMA 5K0NA 5NLLA 1K88A 1U8XX 2IGTA 3VO9A 2EGHA 3PL1A 1IRIA 1FSFA 1H85A 4N1AA 1YB7A 3LOUA 1NL3A 3GU3A 3GQVA 3QTTA 2ZUWA 4M38A 4B76A 3VI4B 3O8CA 4MO2A 3ANLA 1KPHA 4UHCA 1SD1A 4X64B 1I6MA 1JSRA 1VDZA 2TMDA 4BMZA 3DEYX 3OEEA 3R2JA 1J1UA 1E98A 2NTNA 5CLIA 1W75A 1M1NB 3AUFA 1XPUA 3BZBA 1J00A 2DT8A 2I66A 1C3VA 1GTVA 4UUNA 4C1BA 4DIMA 4LBZA 1YONA 2A88A 3JAKA 3K0CA 2BR4A 1QV7A 4HX9A 4NG4A 3HN7A 4Z2YA 5A71A 2CDBA 4H6PA 1Z4LA 3GDFA 4KKVA 2Q0XA 1FTYA 2HK9A 2WMNB 3KVOA 4IICA 2E7ZA 2HUNA 3AVPA 3VJLA 1FTWA 1QFMA 2VJPA 5KYGA 1S2MA 1E2HA 3OA2A 4DT1B 4EG0A 2DH6A 1HE5A 2VDOB 3UB4A 2AQ8A 1WZUA 3KT0A 4CM4B 2ZIGA 2Q3HA 3B8HA 4B6GA 2IXDA 2RGDA 1PBNA 3MGKA 3THXA 2X6QA 1F8XA 4QBTA 5L53A 1R5OA 4YUYA 4F4JA 3K4HA 3K70C 4S35A 3ROTA 5F2EA 1IM2A 3G2JA 5FR1A 1E5LA 2X40A 3KLPX 5K51A 3SDZA 1UZNA 3HY4A 3RIXA 3OFSA 3QUAA 3RJ9A 4JHLA 2BH2A 4RABA 1A9SA 4KE9A 1XXHA 2QJOA 2Z2XA 4JENA 1L3BA 1U8YA 2V74B 3UATA 3ZTTA 3A1WA 2IW3A 1TVKB 5JY1A 5A7GA 3VU8A 3EPPA 3W8FA 3KM0A 4CZ2A 3OOHA 4HX2A 3TQQA 1TNDA 1UAAA 4MRVA 1QGAA 2ZYUX 2DBQA 2WWRA 4Y2YA 3ZWYA 1VGVA 2J3KA 2L82A 1QRDA 2YWDA 3GRYA 1QBKC 3N0RA 2QXTA 1ES9A 1WHTB 4UTPA 1BXRB 1UIRA 2H4ZA 3G2HA 3HCFA 1Y1TA 2B78A 3F6BX 4JBIA 5FAKA 2VOJA 1K7XB 1DHTA 2LXNA 2R8RA 5HRCA 1QTQA 1I1OA 2DPXA 3UWKA 1UMDB 2JARA 3BG5A 4DR5B 2DR0A 2HDNB 5ECDA 2ARKA 1WSBA 3FW1A 2Q6KA 3HC7A 5FKJA 1VQ1A 1NNEA 4BGIA 2X5KO 3MAGA 2OM6A 1YACA 3L41A 2C54A 1E62A 4MWZA 3IVAA 4OB8A 3VM6A 3TLBA 4I8XA 4IMIB 1CUIA 2FX3A 2Q2WA 4HNQA 1FVFA 3MC1A 4X1IB 5DHQA 4GWLA 2XUKA 3NP7A 3W8NA 1A82A 1IAVA 1KAEA 2O52A 4RPGA 3H1TA 1EK2A 3DVAA 4IM7A 4HQFA 1UXKA 2B5OA 2WI8A 4Q7LA 4QDOA 5T4HA 3VDNB 4DNOA 5BUQA 5B7PA 5I4BA 2QE6A 1N2CB 5DN6D 1ISHA 1U2DC 1G2OA 2GI4A 2AB0A 2FOLA 3H7AA 4J1QA 1AUVA 4TKVB 3FKSD 3ZBQA 1ATZA 3L7CA 2E2WA 2QTLA 4JD5A 1Z47A 4IGFA 5LQCA 4QRIA 1PI3A 2Y6VA 2FWIA 4PG4A 5KOHA 2E1PA 2ZR0A 1AHIA 1JHRA 4DCNA 3WRXA 2X1MA 2ZAGA 3W06A 3SHFA 1R0LA 5LL6P 1EBBA 4B2YA 4JC5A 4IVNA 5A9RA 1EVZA 1OXVA 3ED5A 3LT5A 4RPHA 4CUZA 3HFGA 2ZRMA 5A03A 2JHPA 1YASA 5D3MB 5JV5A 2AOXA 1ULAA 3K0AB 2JLBA 4X54A 1DWOA 5CBPB 1Y0BA 3KHTA 4L3WA 3RRFA 2VQFB 4M0CA 3RO7A 1BRMA 5KYTA 3SBOA 3U09A 1Q0LA 1VSQA 2FMFA 4HGRA 3BSSA 1NY5A 3BWEA 4P58A 5GJWC 4D3SA 4ENWA 5L9AA 4HUJA 2A58A 4XM0A 5LB4A 5AKXA 4DCSA 1U1CA 2IJGX 2VWGA 4P8RA 1VP3A 1QTRA 5LC1A 1UBNA 1JR3D 2XV1A 3QVXA 1YJ5A 2XXJA 5HCIA 3G68A 1G5QA 3AVOA 1KU6A 2VRNA 4D9NA 2OTCA 5FNVB 4EATA 1C0PA 1E4EB 1RZRA 2AI1A 4WASA 2D1TA 3AX6A 4Z0PA 2I4LA 3CUSA 4JEMA 4IIYA 4MB6A 3HABA 4JVSB 2P6MA 5IHPA 2GZ3A 5CG2A 3CVJA 3FY4A 3EGDA 5LNK6 5K3FB 4KC0A 2I71A 1SELA 4I55A 4KAFA 3HCOA 3ACDA 2YVKA 3AJEA 3CZ5A 4LGVA 4LX8A 2OFOA 1WRBA 3EDCA 2FFHA 2ZE8A 4K0RA 2BZGA 5E7JA 4BO3A 4YONB 1RI4A 5KWJA 1E4VA 3E5RA 1EVKA 1TQDA 2GLTA 4G4JA 3C5EA 4Q15A 5BT9A 3A1VA 1NX6A 3RC3A 4RC9A 3RUDA 2HDOA 2WT9A 4I81A 1SOAA 5TS2A 5CYGA 3EZFA 3QTBA 5DBIA 1LQ2A 3OTHA 4I14A 3LU1A 4IIJA 4UU0A 4F4HA 5K8IA 4UXJA 3ZVRA 4FN5A 4GGPA 2OUIA 4BO1A 4R84A 1YQUA 2ZUCA 4J1TC 3RUFA 1B14A 5ESWA 1GGMA 3KYDB 3Q8XB 1ORIA 3VYTB 3LVFO 1YRWA 3AI2A 4TKLA 3I6MA 4RA9B 2O6LA 3BWBA 3GELA 1CDEA 3HKBA 3SD7A 2YIDA 4BJ3A 2PS9A 5C4IA 2X0KA 4UFPA 3AUTA 3DFUA 4WXMA 2JI9A 4I50B 5BNTA 2JIBA 4A15A 3CVOA 5ER9A 1ISRA 2DULA 2IDMA 1IBRA 2XWJI 3X1XA 4QEKA 4E33A 1I6LA 3HFRA 3ROPA 1T25A 1QJ4A 1K7FB 1DJQA 3NETA 3F1KA 3R3UA 4LRUA 1I3LA 2FG6C 1P2SA 3KPVA 3H99A 3V4ZA 1TQHA 3JVIA 1JEYB 3Q6IA 2VPXA 2RHWA 2XDWA 1CJTC 3UM9A 2YXBA 4HNAA 4O1IA 5F2NA 3D02A 1FFHA 5JSFA 2JHCA 1LDGA 2YV3A 4U6SA 4XM2A 2HH9A 3QE4A 5DBOA 3PUKA 5JVDB 4B3CA 1TPYA 1EK0A 1GL9B 3BD8A 4MS4A 1H9AA 2VUIB 4PAOA 1PEDA 2F59A 1OV4A 1PL6A 2HXGA 2OZEA 3OI7A 4DSAA 1V5GA 4HQ0A 2QRVB 4R01A 1ZVVA 4I5DA 3JQ7B 3KT3A 3M7IA 1YB1A 1R0CA 1OZFA 3REGA 3KNZA 3GDGA 4R2KA 4YLGA 1N32B 3EC1A 3CV3A 2NQ8A 5JADA 5CT8A 3RK4A 1POWA 1G8SA 1XZGA 2IEDA 3IT0A 1K7CA 4LMAA 4ZQFA 3NOXA 4BB0A 3TTXA 4FFRA 4M8NE 2HRBA 4M9SA 4CEIA 1O87A 2OCGA 3HJUA 3KD2A 5DF1A 2F7SA 4HG2A 4BMVA 4EFNA 3V55A 1RI1A 5K8VA 1BS9A 4ROTA 1QHHB 4ATNA 4M46A 5EXDA 5I51A 2GPSA 1BXKA 3D2BA 4MRSA 3WLFA 3D6FA 3PUXA 4GOMD 3QI2A 2OEPA 5FR2A 2KI5A 3HO8A 3S28A 1X39A 3HP7A 3NUQA 4W1SA 5B3LA 1MN6A 3UWMA 1E2UA 4GKJB 4FQ7A 4HEA6 1E96A 1M34E 1RQ7A 1XMXA 4MUKA 4XSHA 2XGJA 4FOSA 1FLVA 3CLTC 1IWOA 1C41A 2D5LA 3FHOA 1XZCA 3DL0A 4H08A 1C4WA 4ZCIA 1EIWA 3LPMA 4LRXA 4WBNA 1BRTA 1WX1A 3BEDA 4M1YA 3F2VA 4YHBA 4YT8A 4YI5A 4AJIA 1EBUA 1PFGA 2XBLA 3NBQA 5DLYA 3A3OA 2WWHA 3FMGA 5JQGA 3OCUA 2H92A 1KMNA 1QVAA 5ISMA 1K92A 1IB6A 3Q9NA 5CLHA 3HACA 1BKSB 1N9ZA 1XF9A 4TV9B 3TG8A 2XUIA 2WSMA 3PWZA 8AT1A 3FBWA 3NZEA 2VCHA 1PW7A 4YNBA 1CFZA 2YZ2A 1B00A 3L92A 4OFWA 5SY6A 4EG6A 1M8FA 3KLMX 3OTWA 2FWRA 2ZBDA 4XH9B 4YCSA 1CUWA 4KK4A 5HR5A 4P6VF 4B5LA 5I9MA 2CDCA 2HR1A 4AJJA 4HPWA 1BE1A 1QXSA 5AVWA 1VHLA 4BO2A 5EPEA 3QUTA 1NYRA 1G2QA 1IMOA 1Q3TA 4LJ7A 5CYPA 5J2TF 4CTJA 5B3KA 2ZSBA 5EIEA 1Z2NX 5LDDC 2PGAA 3FWHA 3I32A 1UKZA 3FVTA 3BT7A 2ZI4A 4E7PA 2F1OA 3HFSA 1SPXA 1YRYE 4CIVA 2I8AA 4DLWA 2PD4A 2EL9A 3FHCB 1A95A 2HRDA 4MB0A 1I32A 1P80A 2B1JA 2VJYA 2JGIA 2PY6A 3PGMA 1H8EA 5FHQA 3R7NA 4BKUA 2EWMA 1JDJA 2BMJA 3BXHA 4UUAA 1R0RE 3P52A 2WTEA 3P9ZA 4ETWA 3RHSA 3PDHA 4P7BA 4B4VA 4LHSA 4DLSA 5JC1A 2DF8A 1ODCA 4A36A 2QTVB 1KKMA 2EFDB 5ADUS 5DULA 5EWLA 1LVHA 4FYIA 2J5XA 1HYBA 4OMDA 1KERA 2P6RA 4FT2A 3QBDA 2Q1XA 2C4NA 3HFJA 3OH8A 4FGLA 4IGAA 3UC9A 2JW5A 3IDOA 4FMDF 3C3WA 3IAEA 4F96A 1QP0A 5IUKC 3CX3A 1GAXA 4LK3A 3P45A 4KR0A 4IVQA 3FNRA 4Q00A 3B5IA 1S1CA 2GAOA 2QEQA 3MTBA 5DMXA 4A6DA 4BECA 4YMVA 4LHEA 4AJHA 1P4GA 4E32A 4N01A 3Q8KA 4A0GA 3DB2A 2BT4A 4JYMA 3EQ2A 3OM1A 3SKVA 3RUPA 3UPTA 4QHYA 1PJZA 3PPVA 4WXYB 4GOJA 5F21A 5BYKA 3A0UA 3OU6A 5CDTA 3CSUA 4QGBA 3S8YA 4FWTA 3DQPA 1CC1S 2DSTA 4HKTA 2FEKA 1Z0AA 5B55A 5JAQA 5E2BA 4ND4A 1YMUA 1GUAA 2JRLA 3P0HA 2JLZA 3KQTA 1JU9A 2XCQA 4H1WA 5EHXA 5KYXA 4CEHB 2XUDA 3EVGA 1Y5IA 3LBFA 4Q1BA 1U9IA 4LY0A 4RVSA 4HNTA 3HJFA 1UT8A 3G88A 2E4UA 5IKOA 2EFYA 1IY9A 5TIIA 1YV9A 2NVOA 1XDUA 3PXXA 5EXSA 2WF6A 3DTVA 5AVYA 3GGCA 3Q40A 4HVLA 4Q01A 2OFWA 1NMYA 1DCFA 1SC3A 1UZMA 3CN7A 3H9JA 1A5AB 5DJ5A 1CVIA 1R00A 1QH1B 4I9UA 3RGWS 2ETXA 1FC0A 3TZEA 4ALJA 2I6TA 4QTZA 4G5FA 3O74A 2MWMA 3NBZC 4ZZ1A 5MHTA 2GN2A 4ND3A 1DC6A 4OL9A 1IG3A 3NI2A 4RY2A 4TROA 1LK0A 2VTKA 3QKWA 5D5HA 5DYWA 2YY7A 5IC5A 4JLNA 4UPDA 3EQ7A 4CMJA 4NV3A 1GPLA 4NU8X 1WD5A 1TVCA 3KL2A 2XTNA 4KQIA 1ZXLA 1IHDA 2H51A 2XGGA 3P2IA 4QUEA 3CH6A 3LKVA 1NQUA 1A9ZA 3AW8A 4JLDA 4AY5A 1B41A 5EFOA 3D8SA 4NMHA