3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DDX19B
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
4CEIA 1GG2A 1NP6A 1NN0A 2J45A 1T9HA 2PZEA 3NH6A 3FWYA 1EX6A 3X1XA 4PZLA 2B92A 2JAQA 1NVVR 4JL6A 3TIFA 3Q3JB 4KSBA 1AA9A 2D74A 3ADKA 1II8B 2XZOA 2JEOA 1JI0A 3CX6A 2Z5FA 5EE9A 1GFIA 1UEJA 3KXIA 5EP3A 1VIAA 2QSZA 3NWJA 3ND8A 1MH1A 3PUYA 3PEYA 4KJZA 4DT1B 4ABYA 2QMUA 3TVDA 2PEZA 3EPKA 1J90A 1GIAA 4PQFA 1JEDA 2FMXA 2QM8A 3RAPR 2OE2A 3VU9A 5JI3E 4U7DA 4V0ME 1KJWA 1WBDA 5KOYA 3PUVA 5C1BA 2XXAB 1CJKC 4AC9A 1WMSA 4PO9A 3WNDA 2J9RA 2YV5A 4LJ6A 3QQ5A 1DG3A 2JLZA 2BVNA 3WNBA 1FPMA 1EWQA 5LDDC 5FFMA 2FSFA 2ZUBA 5CITA 5SZJA 1SQ5A 4CEHB 3GLHE 4NCHA 5CLLA 2HLDA 3THYA 4Q9JA 4NYJQ 4IXNA 2EFHB 2MSCB 1HQYE 4FW9A 1TQ2A 3FFAA 4GZLA 3TSWA 1LFDB 1CIPA 4URUR 3AF3A 5EP1A 3TMKA 1VYTA 4EPYA 5CLQA 3U7FB 2X77A 2VH5R 3CRRA 3IQXA 4KU4A 5AJZA 3TRFA 2XNSA 2ZYWX 5CB6A 4JLVA 3FMIA 1VG0B 5BYJA 5HPYB 3IUYA 1VYUA 2R44A 4YMVA 1GL9B 2VP2A 3CZPA 1WA5A 2QSYA 2WHXA 2VL7A 5AUQA 4XWAA 1R0YA 3KFXA 2JDID 5IHPA 1GDDA 2GAAA 3C16C 1IHUA 1D9XA 2CMKA 2QUZA 4BLQA 3PEUA 3SEAA 3KKMA 2QP3A 3MWKA 1OT3A 2H1LA 4UNPA 4YMUA 2FSGA 2RGCA 5KSOA 4EPRA 1KI8A 4Q5IA 5AUOB 4Q1FA 4A4DA 4B75A 1NMYA 1I4DD 1RIFA 3GLGE 4FMBB 3E1SA 4DIDA 5FH9A 4HAWA 3AKCA 5UKDA 1II9A 4HB0A 4A2WA 3T1TA 2GZDA 2WSMA 1S9DA 1IN6A 3E2IA 2JLYA 3CR7A 4HAZA 4IRUB 1T0JB 5AUPB 1E2IA 2YHSA 1JALA 3RNLA 1G5RA 3V9PA 2A3RA 1XJQA 2VF7A 3DL0A 5EXXA 4U00A 2EFGA 4OQMA 1II0A 3TSZA 2DY1A 4KXFB 1FX0A 2CCKA 1Q3HA 2IYXA 1OLOA 3IBGA 1RZ3A 2FZ4A 2PLFA 4M2LA 2KB0A 2O8BA 2OG2A 3QKSB 4EFNA 3QBTA 4CYMA 2G0NA 3D7MA 4X8HA 3FTQA 4ZCLA 3AVVA 3AGPA 4W5JA 4PC2A 3LAWA 2JJ2A 1NI3A 2VSXA 3Q7PA 2AK3A 2BV3A 5AJVB 4BLRA 1XX6A 2OXCA 5BN4A 3DO6A 2OUKA 4HDQB 3DEFA 5EE1A 4WA7A 4AY2A 1XJ0A 3B9QA 2Q3HA 2D7CA 3KZ1E 2QTHA 2ZE7A 4R2IA 3SR0A 2GBLA 1UBGA 4HEJA 1F2TA 4UXIA 3O8CA 3UXMA 1G7RA 3A1SA 4DSTA 4RZ2A 4LHXA 4CEIB 1LS1A 1FP7A 1ZRHA 4IOLA 2DCUA 3T1VA 2JIZD 3RRNA 1E6CA 2KSQA 3QENA 4HLDA 4D80A 2FPLA 3VR1A 4V03A 3MCAA 2CXXA 5LD2B 1XEXA 3FE2A 2CK3A 3E5HA 3A36A 3TH5A 2CL6X 1ZW6A 3WP0A 4D82A 3K70C 2QN6A 5A5GA 3RWOA 1IJEA 2C96A 1ZM9A 3KQNA 2AKYA 2ZI3A 1OIXA 3X2SA 1G5PA 2XNDD 3R7WB 5TVKA 5B58C 4F92B 4TZ0A 5JJIA 4PQRA 1Z07A 2JJ1D 1W47A 2A30A 2FF7A 4OHVA 3VFDA 4O0MA 3IO3A 5H8WA 3MRSA 1GSIA 3NHBA 5AWFC 3TK1A 1I4TD 2H18A 3ND9A 4LC0A 2QBYA 1YR6A 2ZS7A 1ANKA 1LTQA 1QHNA 1S3GA 3EC2A 1UKYA 4Q9HA 3A1VA 4FMCF 1HY3A 1AJEA 2W6ID 3SI7A 2HJGA 3QF4B 1YKSA 2RAPA 4D26A 5SZIA 2GK7A 2JLRA 3TVTA 5CIWA 3KQHA 4POAA 4ZV4A 3BXZA 2C78A 1K5DA 1XPOA 5H70A 1Z08A 1ZNWA 2GCOA 5KDOA 4QGGA 3EPHA 3A37A 3U44B 1A7JA 4V0KA 4QOSA 2W83A 3P20A 1US8A 4RJLA 3QKRB 3CRQA 1X8LA 4B3GA 4M9ZA 3GD7A 4IDNA 4LGMA 3T61A 3LRPA 2IS2A 4E22A 3I62A 5LD2C 3BRWD 1UFQA 5J4KA 1VECA 1OFIA 3K0SA 2OCBA 3LO5A 1TQDA 2RGAA 2WAYA 4HI0E 1XF9A 4BUJA 1H8HD 4D4MA 4ZCMA 4Q21A 2QAGC 3C15C 2W2VA 4TQAA 5JRZA 1P5ZB 1ZCAA 3BC1A 1AZSC 1N2CE 3LVQE 1R7RA 4KO8A 4PZZA 2DBYA 3CWZA 2YVUA 5FR1A 1EFRA 3CZQA 2GCPA 1R0XA 2PJZA 4BPBA 2ZAMA 1XJCA 1QVRA 2FFBA 1IAQA 2ODBA 3CO5A 1ZU4A 3K0FB 3RYTC 4LRWA 2BCGY 4KFSA 5FR2A 1MO3A 1K5GA 1NKTA 1N6IA 5FBRB 1XPUA 2Q9BA 4HDOB 3CH5A 3FKQA 4JT2A 2ASEA 2FV8A 1FL9A 2C03A 4DIEA 1MV5A 4PXAA 1HT1E 4YMSA 3H4MA 3GEHA 4V02A 1GUAA 1MKYA 2IS6A 2GXQA 1T3HA 2OILA 1MO4A 2AXNA 1OFUX 2WMOB 2JLQA 4Z8XA 1GRRA 5AK0A 3U3OA 4MGIR 5DSZA 3W34A 4WZBE 3T35A 2GTPA 2EQBA 3NXSA 3I5XA 1CXZA 1U0HC 3RABA 1N6OA 2ZI5A 1Z06A 3FPAA 1R5BA 2NPFA 2CCGA 1P73A 1BKDR 4IOJA 1YZNA 5KUTA 4PZYA 5ANRB 3AEZA 3OEED 1E79D 3DZ8A 4ON9A 2OEPA 4B2LA 1COWD 1A5TA 4OI0A 3QPVA 3ONWA 4QGHA 1E1QA 1W5SA 4CEJA 3SYLA 2DFNA 1RC8A 3NDBB 3MGCA 3PQCA 2VQSA 3EIEA 3CWQA 2P2LA 3GJ0A 4LJYA 1E0SA 3ZIAD 4NYMQ 4DKXA 4PC1A 1ESMA 4BLSA 2L0XA 2WJYA 3I72A 3DOFA 5LPNA 3U3RA 1UBCA 2D2EA 3OESA 2P6UA 2HT6A 1GP2A 2IYSA 3IBYA 1U8AA 2I1QA 4IJMA 5GJVC 4IVPA 1E9FA 2J0SA 1Q1ZA 5JJLA 2V6IA 2QORA 2J5XA 1BIFA 4UJ5A 4QFMA 1GNRA 4OHXA 3AVOA 1LS6A 1U9IC 1WE2A 4M1WA 1G18A 3GJ8A 3WY9A 3R7WA 1P9NA 3ASYA 1FZQA 3L0OA 4EKDA 1OXVA 4MQBA 2A9KA 5F3WB 3U3KA 4RZ3A 3DPUA 1DAHA 1SULA 1X3SA 3QKUA 4Q7MB 3SJAA 5KU1A 3I8SA 5L3VA 4M1YA 4OBEA 4L9WA 2OO7A 4BEJA 3LH5A 2HYDA 4B3XA 4GT1A 4A0RA 4EQ6B 2RGDA 5K8IA 1U0LA 2KE5A 4JKYA 4RD0A 4G5OA 2G83A 2EU8A 5CYOA 3B82A 2FE4A 1G8PA 4XWKA 4HSEA 1R8SA 3PR1A 4EPXA 1KO1A 1Z6TA 1CJVC 3C7KA 3IDQA 4M1KA 1XXHB 4CEHA 4Q18A 1SXJD 3U60B 3AVTA 1ZIPA 2ZRHA 4FIDA 3ZGXA 1W0JA 3C5HA 3U7HB 2CLSA 1OH6A 2FU5C 2WSSD 3OAAD 1QHHB 1Q12A 3FKSA 1D9ZA 4PANA 4OHYA 3Q5DA 1Q21A 1Z29A 2BBWA 4CRWB 5CM8B 4G3XA 2NZJA 3X1DA 3LW8A 4KODA 4DLUA 1U8YA 3BH6A 2QQEA 1OKKD 5GJWC 1BYUA 1SVIA 3MWJA 2GF9A 3AVXA 4N0DA 4LUCA 4PSVA 3QXXA 1Q1QA 1UKVY 4KFUA 5FPHA 3WNCA 4DLZA 4HDCA 1N5KA 2JDIA 1Z0IA 1G6OA 1JEEA 2DYKA 4EPWA 5DE3A 4TMXA 3IO5A 5D3MB 5L3SB 2OCAA 1Q0UA 2ZYTX 1OB2A 1J8YF 2ZI6A 1ZNYA 1G3IA 2JLUA 1GM5A 4NZYA 1RRFA 1KGDA 1DG1G 4B73A 3O8BA 5FTNA 2WPDD 2XNDA 2WJJA 4CT4B 2HDNB 1G64A 4FXPA 2PZFA 2AKAB 3LFUA 3D6TB 5K8LA 1IN7A 4TYQA 4RKFA 4WW0A 1P61B 3U6KA 3HPQA 3OIWA 3PUZA 3WBKA 3THWA 1P62B 2CL7X 2DB3A 4LI0A 2FFAA 2WBLC 3CUEF 3IILA 4F4CA 2XX3A 1X8KA 1Z3IX 4TSFD 5HE9A 1IN8A 5IRCD 2DFKB 2GXUA 3V4FA 4EJSA 3GLFE 2WWWA 2B7BA 4ACAA 1S0UA 1GKUB 3KKQA 3VR6A 3RRYA 4YDHB 2ZI4A 3THOA 3KKNA 1OKKA 2AD5A 2ZITA 3DKVA 4GOXA 2WKRA 1VIYA 4K81B 1PJRA 4DSUA 2P5SA 2GJ9A 4QC2A 4FWTA 4A8JB 5FUWA 3BGWA 4H9GA 1OW3B 3AVYA 3G82C 4GOJA 3DVLA 1XDBA 2OCYC 1JR3D 3K0EA 3MUFA 3JVUA 1Q44A 2JA1A 4I1OA 1Z83A 2E9SA 2EFEB 4M9QA 5DI3A 1W36D 3GJ5A 1HA3A 4JMPA 4US1R 3AF1A 4C0HA 1D2EA 1F2UA 3W3ZB 1N6NA 1XXHA 3DMDA 2D06A 1KZ7B 4JIMA 2P65A 4MYTA 1AM4D 1PLKA 3SU8A 2KBFA 2C95A 1AK2A 2A5JA 1JR3A 3FHTA 1OSNA 2QGZA 3LW7A 4PX9A 3W5IA 2OFOA 2ZJYA 4M8NE 5FL7D 1UM8A 4P0TA 1DAEA 3W8RA 4NYMR 2EWVA 4F93B 3K70D 2OZEA 3QG1A 3ZS8A 3K09C 2WJIA 4QJ5A 3GFTA 2Q3MA 3O8DA 2XGJA 5FPTA 1AGRA 4N0EA 3EA5A 4EFLA 4TYPA 2PJRA 1H65A 4I99A 4GMXA 4JSTA 5F9FA 1FOEB 4OQFA 4MRPA 1XEWX 2A2ZA 1LVGA 2AFHE 4I4LA 4U02A 5F2EA 1E94E 4DCVA 4M1OA 2ZRBA 4BLPA 2DR3A 2QZ4A 2N46A 3CX8A 2F1RA 5JCZA 2NO7A 3V00A 1NVUQ 1FTNA 3CKLA 5CK5A 4BRWA 3MSXA 4NP6A 3THXA 4AKIA 3LQQA 4LY6A 2ZJBA 3T12A 5FTMA 4KAXA 3GEIA 4WOPA 4CW7A 1AN0A 4CEJB 4OHZA 4LYJA 1SXJB 3QEJA 1P75A 5JHHB 1U94A 3GJXC 2CK3D 3VR2A 5IK2D 2GJKA 4IKEA 4D2IA 4M22A 2IW3A 3P4YA 2FDCA 4KFRA 1T5LA 1NBME 1YU9A 2FPMA 2DPXA 2O8EA 4TMTA 3UANA 2AL7A 3K09A 1E2DA 3BIFA 1NNEA 1TUEA 3AF2A 2XB2A 1XCGB 3ADBA 5EQTA 3LLUA 4LHVA 4BWYA 2FEMA 3KQUA 3U5ZB 2IUUA 1XFAA 3OIVA 1S2MA 5JSZB 1OXXK 2Z4SA 1QBKC 1KI7A 3IPXA 3R9WA 3IGFA 4R9UC 1JB1A 3ZQ6A 2OT3B 1QG2A 4QGFA 4KYUA 2H17A 1Z0JA 4TTRA 5EXTA 5JWRA 3BBPA 3BORA 2QP4A 4M21A 3IHWA 1HUQA 3C4JA 2PT5A 3FMPB 4PHHA 4ERNA 2ZRIA 2ZSEA 3RSLA 4DBLC 5E7MA 2KWIA 3WHKA 1MR3F 3LXXA 2R8RA 1E96A 1A4RA 1E2MA 2ODNA 2ZAOA 1T4GA 4YXWA 4NYIQ 4MKFA 1VCNA 3PJRA 1FFHA 2VRWA 2YWFA 2WWXA 5DN6D 1XD9A 4N1AA 1QHIA 1F6BA 4B33A 5L3QA 1XEXB 1DAKA 2G1KA 3F3YA 2QGNA 4GRAA 1EFTA 1JR3E 4J0QA 2OXRA 1QHYA 3TR0A 1CJMA 1G5TA 3EAQA 1N6RA 1ONBA 3PFIA 4B74A 3SQWA 5AJWA 4UJ3A 1EESA 2ZJ8A 2V54A 3NBZC 4D0LB 1XEFA 3BOSA 1DAIA 1TF2A 4EAQA 3TE6A 1L2TA 1ZYUA 4MDEA 4PO1A 4Q19A 1S4QA 2ZVQX 2IC5A 5EP2A 2FNAA 2VSFA 1U8ZA 2OAQ1 3B85A 1SZPA 1Z2CA 3TQFA 1GL6A 4URVR 1UBFA 4BLOA 3I32A 1Z0FA 4DB4A 3AVPA 1KOFA 1KKLA 1VCIA 4QHSA 2YJTD 2AK2A 3C8UA 4RSGA 3U44A 5GJBA 1NY5A 1ZM3A 3GJ6A 4BFWA 2QEQA 2ZI7A 3ADDA 2XJ4A 2V3CC 2WWIA 4DEYA 3BB3A 1SKQA 5JS7A 3PVSA 2VP0A 4LV8B 2QNRA 4Q9LA 4XIGS 1GWNA 1G20E 3RS7A 3QXSA 2GKSA 4DLSA 4JBWA 4HUTA 4B3BA 1GL7A 4B47A 2PT7A 5EE5B 3BFXA 1XTKA 4B3CA 4GSYA 2JJ1A 3ZYCA 3O47A 4QRHA 4DCTA 1OHHD 1XD2A 2ZR0A 3PCRB 4F38A 3I73A 2JIZA 4MRSA 1JR6A 5SZKB 5FI0B 3VX4A 5KO2A 2NMVA 3R20A 2ZU0C 4OK3A 4Z1MA 1E79A 2IL1A 2RHDA 1YR7A 3Q85A 4MGYR 5TXGA 3LDAA 4XSGA 3LQRA 1AZTA 3E70C 3ZVNA 3TQCA 1FUUA 3FB4A 2XITA 1RE0A 1DO2A 3CNLA 5EZ6B 4R71A 1TPZA 4RY2A 4IOKA 4A82A 2C9OA 1ZMXA 3FHOA 1JJVA 1YQTA 1U90A 1EGAA 3AKYA 4W5WA 3Q9LA 3CX7A 4P4SB 4TWZA 4C0JA 4Z1MD 2IXGA 1G8HA 1KO7A 2ZE5A 4LSGA 4HAVA 4A9AA 4I81A 4L9SA 3TR5A 4TTPA 2FN4A 4NCIA 5TY0A 2BC9A 2GAOA 4GP7A 3AP3A 1DADA 2W6JA 3GEEA 2IEZA 4D0GA 1AS3A 1G19A 4OK5A 3T5GA 4LPKA 1C4OA 3FHCB 2QY9A 2P5TB 4BLTA 2Q0HA 2J87A 3KXLA 4NONA 3WYFA 1VCMA 4Q4AA 4TMKA 2BOVA 3K0AA 1MT0A 1W44A 2GESA 1LF5A 3R8FA 3QKSA 5JS8A 2CLDX 2DHRA 1UJ2A 2NG1A 4F7WA 1Z28A 3QJYA 1NKSA 1JXMA 2QT0A 2Y8EA 3BJIC 4IVRA 4JL5A 4P31A 4PAQA 4BFYA 3TW4A 1JQJC 4EIWA 2FSHA 3GJ7A 2GDJA 2VBCA 1YHNA 4TLDA 1QHSA 2BKUA 1KSFX 1TADA 3KKOA 3PG5A 4LJ7A 4TLCA 5FBLB 4MGKR 3S1AB 3I8XA 4B2PA 1RPZA 4A36A 2B7CA 1DVRA 5EE0A 1CJTC 2D7DA 4A1FA 5KPDA 1ZNXA 2EFDB 2LKDA 2BJVA 1E9DA 2OBNA 2WV9A 4MYCA 4DSNA 3QPUA 4ESHA 1ZJ6A 1A2KC 1NY6A 5IK2A 3BFVA 4C7OA 1G8YA 3CNOA 3OE7A 1R10A 2REBA 3LWNA 3HJNA 4DLXA 2IUTA 3QXJA 4HLUC 2R6GA 1D8TA 2OFXA 2KBEA 4I1SA 1GITA 3RS3A 3OZXA 5B64A 1N6LA 1W46A 4KCGA 4AURA 4CGZA 3UMSA 4PSKA 4LJ9A 4QBIA 2JLXA 3SJCA 4JVSB 2JLWA 4URXR 3GLGA 4MUBA 1E9RA 2PLRA 2VEDA 1E1RA 1L7VC 1N6KA 4RZUA 3KTAB 4ZI2A 4NHOA 1VHTA 4E5UA 3PIRA 4G5SA 5JMTA 2G6BA 3FFBA 3GLGB 5CM9C 2ZRNA 1P2VA 1U99A 4RFVA 3A4MA 1KDPA 4TT3A 4LBVA 3THXB 3SJZA 2GVDC 4DCSA 4AWXA 2VHJA 1SVLA 2GJSA 4ARZB 3SBDA 2AWNA 2V55B 2OFWA 5KPJA 4JS0A 1M1YE 4ILEA 1YJ5A 2C77A 3LA6A 1IY0A 2HEIA 1DS6A 3PUXA 5JEEA 1WQ1R 4NH0A 1R5OA 3ZS9A 2EVWX 3ZD6A 2ZRDA 1HTWA 1KJYA 3IQWA 4LJ5A 4MA4A 5J4LA 2BWJA 4V0MA 1J2JA 2A5FA 1S8FA 4LBWA 2N42A 2ANCA 2QPTA 3ZZTA 4EFMA 1SKYB 4QNMA 1TNDA 4M0LA 4AI6A 2ZE8A 1GVNB 3F0TA 2HCJB 1PUJA 4FCTA 4MYUA 4DT1A 3CRMA 2R2AA 2D2FA 1KZGB 3LD9A 4D4LA 2ZSDA 3W90A 3T1OA 2VP6A 3F8TA 2ORIA 1NN1A 4C0BA 4NMMA 5E3HA 3KJIA 3QUSA 3I61A 2XSZD 3A6PC 2ZTSA 4LJAA 3DM5A 3K9HA 3WYAA 1NMZA 1HYQA 1TQ6A 2ORVA 4NCNA 2ZSFA 1S3SA 1J70A 1Z5ZA 3GFOA 3K9NA 1W1WA 2VHTA 3VHLB 5L3QB 2C5LA 4AYTA 4Q03A 1OE0A 2N1BA 4TL7A 5DGXA 3VAAA 2GK6A 1PUIA 2IHYA 5EE3A 5C2JB 1P3JA 1QDEA 2YOHA 4TMWA 3T15A 4DHEA 4TZ6A 2F43A 3SHWA 3ZZ0A 1X1SA 4BFVA 4FN5A 3T5DA 3A4NA 3J81k 3B1WA 5DI9A 3REFA 4EQ6A 3BS4A 4ZIRA 2WIBA 2YC2C 3SFZA 1KMQA 1LV7A 1VG8A 4R7ZA 3GLIB 1N0VC 3A4LA 1P72A 2PMDA 3Q72A 3LNCA 5FOTA 4JVNA 4C0QC 1P7CA 1QRAA 1N5JA 2V6JA 1XP8A 1NBMD 2WKQA 1P60A 4LBYA 4QM6A 4E03A 5IDVA 3NBFA 3WMFA 1DARA 1NLFA 2ZVPX 1G16A 1AKEA 5LBIA 2PCJA 4TMVA 1YVDA 4D4KA 2QBYB 2CEAA 2O8BB 1E2NA 4JLAA 2MSEB 4HZUA 4OQNA 1XWIA 2FH5B 2OM2A 1CTQA 4ITRC 4TLEA 2BBOA 2G77B 1KI9A 4QG7A 4EJSB 4US2R 1G21E 3U4QA 4O2LA 2H5EA 4W5HA 3AVQA 2JJ2D 1KY2A 3W3AA 1E9EA 1Z63A 4MRRA 2W00A 2XJ9A 3A8TA 4RD2A 1QZXA 1R2QA 4I1VA 2QTVB 3AVWA 2NQ2C 3TNFA 1IONA 4PPQA 2W2TA 3QG5A 3M4YA 2F1IA 1F5NA 1Q57A 2EYQA 3AP1A 1Q22A 4NYIR 2QMEA 3KQLA 1TF5A 1X86B 2PEYA 4UNNA 3RHFA 2ZPTX 3BK7A 4WBSA 4B3FX 3NC0C 5J5CA 2GILA 1UAAA 2ZRGA 4CVNA 2R62A 4LZZA 3L82B 2RHMA 5FTKA 1IOZA 1VTKA 1FMJA 3W6NA 2IUSA 1NMXA 3A58B 5BW8A 1F2TB 5L3SA 4BFXA 4JSYA 3ZZUA 1CP2A 1W48A 1TEVA 3WMGA 4KVAA 4ZKEA 1RRPA 5JCPA 1ZD8A 2PCLA 3N2IA 1KSHA 1VCOA 3Q7QA 1HEIA 4B32A 1R0ZA 4Q4LA 5FBQB 2WMNB 5G40A 3UK6A 4O25A 2CBZA 4Q7LA 3KTAA 3K0CA 3H86A 1GAJA 1KAGA 1W4CA 2JGNA 2QT1A 4Q1DA 4PHTA 4DZZA 4TQUS 1Y3AA 1O3YA 1ZM7A 1KJZA 2GEUA 3D8BA 4HAXA 1FNMA 4NCJA 3EX7C 4IDHA 3B78A 5EJEA 2I3BA 4TMZA 4IEIA 1ODFA 5KDDA 4HB3A 4X8LA 5B57C 3I5YA 4Q1EA 4RD1A 4AKGA 3I1FA 4PPGA 4KBFA 1YR9A 3VU9B 3IHLA 4WZAE 4M4SA 1Z0AA 3GQBA 1J7KA 1JPNA 2NO0A 3BERA 4OQLA 1XMSA 2VF8A 4KYIB 1XBTA 4MH0R 4XVRA 1KO8A 2AFIE 1T8TA 3VKHA 2IXEA 3M6AA 3CM0A 1W2GA 4S35A 4CIDA 3KB2A 4RFSB 1C9KA 1E32A 1JXOA 2IWHA 4WIAA 1Z6AA 2ZJAA 1B0UA 4K8OA 4TL6A 3SS8A 4Q47A 1U0JA 5JWOA 3B5JA 3CF0A 3AUYA 4GNKA 121PA 2WWHA 4LOAA 3GLIA 2F55A 2F1JA 4AIIA 2GXAA 3R9XA 3QNUA 2RMKA 1MOZA 2HJVA 2ZRFA 5JZVA 721PA 4BGDA 2QL6A 1XNJA 2YWHA 5K8UA 1RYFA 3SBEA 1W0KD 2A5YB 2Q9AA 4DXAA 1DO0A 1LW7A 2DFTA 4QHTA 2ZR7A 1NIJA 2QI9C 4PHGA 4XJXA 4U5XA 1ZVQA 3SOPA 2ZRJA 2V7QD 1N5IA 3AUXA 6Q21A 1SHZA 4KVGA 3ZJYA 4QGAA 221PA 1YRAA 2IYWA 3GJ3A 2O0JA 2BDTA 4MKHA 2WAXA 5HKKA 1SHKA 1J8MF 4UNRA 1KK2A 1KSJA 4QKQA 1COWA 2WJHA 4M1MA 2ZETA 3KUDA 1P9WA 2GXSA 1QG4A 4HLUA 2GETA 4TYYA 3SJBA 3NC1C 1CS4C 2UKDA 4IDOA 1I4LD 1X8JA 4OI4A 1W49A 5F9HA 3I92A 5FUVA 4XVQA 1Y63A 4HUQB 4HYYA 3UKDA 4YQFA 1T6NA 4B3DA 3U6BA 1KIMA 1KI6A 2O52A 1MRSA 4GOKA 3BD9A 4QNRA 5IF9A 4RD3A 2GJAA 5AUNB 3H1TA 1KNQA 3LXRA 5KSZA 2O8DB 3K1JA 1NSTA 4C2TA 4JVMA 2QE7A 3CBQA 4O2RA 3FVQA 1EFHA 1TU4A 2PH1A 4ZDWA 3U2QA 2GJ8A 1JAHA 1RJ9A 3X1ZA 3KDSE 4LHZA 4A0FA 1CJUC 2GBLC 2XOKA 3RANA 4IW3B 1IBRA 2RCNA 5DN6A 3EA0A 2QRNA 3PITA 1G4AE 3AF0A 3BB1A 4Q7KA 2YINC 4O3MA 1U98A 5L8VA 1E99A 1F2UB 2ZI9A 2FEOA 4FD2A 2GRJA 2AN9A 2F9MA 2HCBA 3ZVRA 3R9IA 2GHIA 1M34E 3U3MA 3RDPA 1ZAKA 2QENA 2I4IA 1I2MA 1DEKA 2ZUCA 2CHVA 2REOA 3PV0A 5J4HA 5J47A 2W0SA 1KHTA 4Q02A 2W58A 1TF7A 5FL3A 1CULC 4KLZA 4Q7JB 1R4AA 3ZH9B 1DOAA 4V0LA 4KITB 3RS2A 2BMEA 3L0IB 1E0JA 2ONJA 1E2HA 5EXPA 2IYYA 3AQ4A 4KLNA 3TBKA 1EFUA 3RWMB 3GJ4A 1E98A 2O8DA 1E2FA 5CJ2A 4MGZR 4A8JA 4HAYA 3CPJB 3WYGA 3P4XA 4LV5B 2LWIA 2WSSA 3OAAA 4D25A 1G3MA 1HH4A 1TUIA 4PSAA 2XB4A 5DO9A 3B1VA 1UF9A 2GCOB 1G17A 2GF0A 4TQ9A 1EXMA 4DRZA 4NKRA 3AM1A 3KUCA 1E2JA 5TARA 1GNPA 5FTJA 5HTKA 3U3JA 1G7CA 3V4RA 1BS1A 3GLFB 4Z54A 2FSIA 4C30A 3IEVA 2HYIC 1L4YA 4B6EA 5TMPA 4JJZA 1T3LA 2O8EB 5GJCA 1VMAA 3AGQA 1RRGA 2MMCA 5EUMA 4GDFA 2XTZA 4OL0A 2ZQ5A 5JJKA 1R0WA 4JLKA 4OKSA 3SYNA 5M04A 5F98A 2REXB 2BHRA 2IYZA 3RS4A 4A2QA 4JLPA 3CH4B 3QKRA 2Q6TA 2CNWA 2YNMA 3LBNA 4Q4JA 2OESA 3HR8A 1VG9B 4C3ZA 2J41A 3SDZA 5C18A 3GMTA 1Z6YA 4OYHA 4P33A 1WB9A 2VHUA 2V8OA 3HR7A 4XSHA 5FOWA 1OHHA 3MJHA 2IS1A 1E1RD 4G1UC 3TUIC 1E2GA 1GRQA 2ZRCA 2BBSA 4IVQA 4H1UA 1T8UA 2ONKA 3GLHA 4M1TA 2B6HA 2JCSA 1NSFA 2FWRA 2W6IA 4X8OA 1UKZA 2FX3A 4IEEA 5DYIA 1U9IA 4P32A 1EWRA 1W36C 1BO6A 3P1JA 2IWRA 2VTKA 3FKSD 2CLCX 2O0HA 4JBYA 1TTTA 4AKHA 3I4LA 2XXAA 1GILA 5EP4A 2NO1A 3EIHA 2FA9A 3EARA 1NLZA 2WM9B 2GZHA 1ZD1A 3T06B 2G1JA 1DTSA 2SHKA 1G7TA 1OFTA 1QHHA 2GA8A 4US0R 4Q01A 1SVSA 2X2FA 3GCGA 4WAUA 4URYR 4G5GA 3EZ9A 3EZ7A 3CIOA 2G3YA 1G8FA 4GPTA 4KV9A 3AVUA 4NCKA 3OEEA 2IEYA 5G41A 2R9VA 1A82A 2ZROA 4EPTA 2NGRA 4LV6A 4Q66C 5L3RA 2WZQA 3OIUA 2Z0MA 3VR3A 4GZMA 1P2UA 2C99A 4P3YA 3HYRA 4D81A 521PA 4L5BA 1W4RA 3SC3A 2J0QA 2ECKA 1G3QA 4L4UA 1D5CA 3TUJC 4RZXA 2BIFA 1NJGA 2WVJA 3KXKA 3AKDA 3RVBA 2UZIR 5BQ5A 3L0PA 3P27A 4MYHA 3EASA 2CE2X 2QG6A 3SZRA 4PC7A 3FYHA 3OIYA 3K9LA 5DI3B 4BASA 1WRBA 2BKEA 4L15A 1YE8A 1MO6A 1XTJA 1A1VA 5J40A 2HLDD 1R8QA 4DLTA 4UKDA 2OV2A 3Q5EA 4IXMA 1NG1A 1W36B 1T91A 4FMDB 2A78A 5DIFA 3DMNA 1XCMA 1II8A 3CONA 1ZM4A 4HB4A 2JATA 1P2SA 3VR4A 1P2TA 2ZJ2A 3EWSA 4DCUA 2CVHA 2RGEA 1ZP6A 4WXPA 1NLYA 2FGJA 2FGKA 1ESNA 3AH8A 3PEVA 3QXCA 2V1XA 3BH7A 1P6XA 4A8JC 3ZIAA 4BECA 3ZVMA 1E4VA 2W2XA 4ASUA 3W9YA 4NYJR 1FW6A 1FX0B 1FQJA 3C14C 1C1YA 3HDTA 5H68A 4FWIB 5KNCA 3ZQJA 2OAP1 1BOFA 4TYNA 2IT1A 1AQYA 2ZRAA 2D3WA 2OLKA 2EFCB 1YZKA 2J0UA 2WWGA 4Q4HA 5TB5A 4JZKA 2Z43A 4UNSA 2AD1A 4Q9KA 3TKLA 1XMJA 5BWMA 4GFDA 4TT3D 3BAFA 4OHWA 1LNZA 1JECA 1Z0DA 1E0AA 3QE0A 1RW4A 2CCJA 3PXGA 3CPEA 4JLNA 2EW1A 2PBRA 3EC1A 2CJWB 3KJHA 1OPXA 4MUAA 1CKEA 1W7AA 1G1MA 4LYAA 1E9SA 3K8YA 1JJ7A 2P3SA 1JQLB 2RGGA 3BE4A 4HATA 3KX2A 2WIAA 1Z6GA 1S1MA 1ZC3A 2BBTA 1Z2AA 1E9CA 2XAUA 3B2EA 1GRNA 2GWHA 5GADl 3HPRA 2FFQA 3NTUA 3C41J 1KI6B 2H92A 4II7A 1ZM2A 1V5WA 3TAUA 4A0GA 1F60A 4ESVA 1Z8FA 2FOLA 1CRQA 2P6NA 4GBMA 1CF4A 1NVWQ 2MMGA 3DZDA 3IIMA 3H2YA 2AX4A 3K0FA 3ZVLA 2P6RA 4G01B 2VP4A 5HZKA 1K6MA 2E87A 1PVOA 4DLVA 1QVAA 4Q9IA 5A0FA 5KHOC 1G6HA 2ZE6A 1NJFA 4GL2A 2GVZC 3BFKA 3KFVA 4MRNA 3DDCA 4QBGB 2QPOA 4KSCA 421PA 1AS0A 4Q48A 4WVFA 4DSOA 2W6JD 4WZ6A 3CNNA 2ZRLA 1DAMA 3FDIA 1NIPA 1KO5A 1E2EA 1N0WA 2IF0A 2Q9CA 1QHXA 4FCVA 4JLOA 1E1QD 1E2PA 1Q20A 3IIKA 1OF1A 4AYXA 1R5NA 2A5GA 3H0KA 4M53A 1FP6A 4PAOA 4F4JA 4DUGA 3K53A 2DWOA 1S9HA 3LX5A 2YZ2A 4PTLA 3QY0A 1YZGA 2F3TA 5DNYB 2YOFA 3B13B 1OFHA 4CDGA 1DAGA 4ZCIA 4DDUA 4LYFA 1E2QA 1HT2E 5AR1A 4MITA 1XTQA 2QMOA 2BCJQ 3SN6A 2ZREA 4BQSA 1ZC4A 4DVGA 1I2DA 2JJ8A 2ZSAA 5JBQA 4LK2A 1N5LA 3RRZA 4BFUA 4ZIRB 3EZ6A 1UKEA 1RVDA 1TMKA 2V1UA 1YZLA 4DWJA 4QJ4A 5ELXA 2H57A 4JLMA 2F43B 4MDFA 1OH7A 3MAAC 1QHGA 2YWGA 1G7SA 1WP9A 1F3OA 3EZ2A 2J0VA 3TJZA 4BRUA 3LLMA 3LY5A 1OYWA 1IXRC 1GKYA 1TAGA 2ZANA 3B7GA 3QVUA 1VYVA 3QXHA 1CEEA 1DAFA 3MMPA 2R65A 3MLEA 3NVAA 2P67A 4BZQA 1HE8B 1OH5A 3HU2A 5KSYA 5JLJA 5AJYA 4OJKA 1MO5A 1KI2A 1ZINA 3G5UA 4P4SA 4PC6A 5B2ZA 2WWYA 3U4QB 1OJLA 4BFSA 2ZIAA 3TW8B 2F3RA 2BJWA 3KJEA 4OQXA 5KDLA 4DJTA 4AKEA 5LB4A 3O8RA 1NBMA 2R6DA 1N0UA 1JBKA 4LPSA 2NPIA 5FUYA 1DELA 1WBBA 1M74A 1ELOA 4PPFA 4I1UA 3RC3A 4OI2A 1Q1BA 4TLBA 4P4TA 1DBSA 1GOTA 1XTIA 4RD6A 1K8RA 3WRYC 2RGNC 1G3UA 1SVMA 2F1HA 3U7EB 3DKPA 1XRJA 4PQYA 3H84A 4EUNA 4EDHA 1B23P 2ODWA 4PR0A 2H8KA 4PPNA 3FOZA 1KTVA 4M9SA 4A15A 4G5RA 4UNQA 3L8ZA 4LHYA 3KL4A 4KFTA 5J4VA 5G53C 2A5DA 2WICA 1ZUIA 3QKTA 3B1YA 4B48A 3BB4A 3UPUA 1TL7C 2TMKA 1TX4B 3AKEA 4ACBA 2PZGA 1GKIA 3QPWA 3ZDQA 3NBXX 3AV0B 4BFZA 4TL9A 1IM2A 3L0SA 5D3QA 2WTUA 1MRNA 1N6PA 2BM0A 3LBHA 4UQOA 2C98A 2J3EA 4FMCB 3R8CA 1XEWY 4A6XA 4C0KA 1CR0A 1XZQA 5IT5A 4KI0A 4TL8A 4YONB 2IX3A 3ECCA 2J7PA 5DLQC 4MKIA 1XTSA 4QBFA 2JLVA 2CVFA 2QPAA 3GFPA 3B8HA 5BYKA 2VYFA 2IYLD 1AGPA 2OHFA 4AG6A 5KYKA 4HZUB 2KI5A 1CRPA 2B8TA 1JAIA 1RKBA 1KO4A 2IYTA 2F9LA 1G9XA 3ETLA 1PZNA 2ZU6A 3UWOA 3QBVA 1ZBDA 1AS2A 2G88A 3MD0A 3MWLA 3U61B 5CDFE 1Q1EA 1US8B 5DISB 3RSOA 3NBYC 4LYHA 4OI1A 3RS5A 4IDPA 2QE7D 3KB1A 3UMFA 4QJ3A 1M7GA 3UMRA 4ZI3A 1SGWA 4B71A 5HZHA 1R6BX 3K9GA 5FOVA 3QSYA 4D6PA 4RD4A 2NZ8A 4HLQB 4JVLA 4L8GA 4MKGA 4NTZA 1KI3A 1TQ4A 2O8FB 2Z4RA 2W0MA 2RB4A 1T0HB 2X1VA 3OEHA 4NU0A 3WHLA 4TTQA 5FBWB 1D6JA 2V7QA 2IYVA 2J1LA 5SZHB 4ZDJA 3N70A 1UPTA 5J4YA 3EXAA 3M1IA 4PO8A 1F48A 2WWFA 3HWSA 5E4FA 2XTMA 1EG7A 2C04A 5G3ZA 3RC8A 4H1VA 3TLXA 3QIAA 1OXSC 1SKYE 4DDVA 3T1QA 4AD8A 1SXJA 1KKMA 4R2HA 2LCFA 2J7PD 3ADCA 2IYRA 2YWEA 2BEKA 3OFND 4HLCA 3QOFA 3VR5A 1VHLA 3ASZA 2R6FA 4LDJA 2R6AA 1HV8A 5FPKA 1UDWA 1OYYA 3W6PA 3HYTA 2O8FA 2NIPA 3D31A 2NO6A 4Q00A 1M7HA 4Q4HB 1FNNA 3NEJA 3A1UA 3B60A 1YZUA 4AK9A 2VP9A 2GZAA 1LF0A 2Z83A 1WDTA 1NRJB 3CF2A 4NBSA 2QAGA 5FOUA 2O5VA 2Q21A 4XTCS 2WOOA 5C4GB 2C9YA 2ZJ5A 2HF8A 1FQKA 4EJSC 1E2LA 4F91B 1T3SA 1N3BA 3QF7A 2VSOA 3Q8XB 1M2OB 4Z51A 2ATVA 2AXPA 1VKJA 2A7QA 4XD7A 2H7VA 2LKCA 3GLIE 4C9BA 4JYCA 3N2EA 3VNVA 4DCNA 3NIBA 5FUXA 3EPJA 1DE0A 1EFCA 1Z6XA 4F4IA 1X6VA 2BMDA 3HU3A 3W5JA 1ZUNB 5B30A 4A92A 4URWR 2QA5A 1KNXA 3U7GA 1GZSA 2JLSA 4QHYA 4GP6A 4LJ8A 8OHMA 2PL3A 3IIJA 3NG1A 1CR4A 4D0NA 4L16A 2QQ0A 2VA8A 2YC4C 2QMHA 2BM1A 2VLIA 3VNUA 4TN1A 4Q1AA 4B76A 3UWKA 4X8MA 3EIQA 2MSDB 3CF6R 3EW9A 1SVWA 621PA 2HV8A 3RS0A 3EZFA 3OEHD 2IBMA 1U81A 2ZYUX 3LVRE 3VQTA 1Z0KA 3BH0A 1XTRA 4QXAA 3N5CA 2V4ZA 2UZ3A 1OXUA 4NE2A 5CK4A 3RLFA 5JSZA 4DLYA 3QF4A 4Y0VA 3CRW1 5FTLA 1W0JD 4DEXA 2AR7A 2G9NA 3W8NA 4GI7A 2X8AA 3L8YA 1KK3A 2C9CA 1CLUA 5FBVB 4URZR 2H16A 4AG5A 1IN5A 1ZIOA 1XXHE 2FJUA 1KI4A 4BE7B 2QAGB 5DHAA 1FTSA 2ATXA 4Q1CA 5EZ5A 2C2HA 2ZRKA 1XCPA 4HZIA 2VHCA 2FG5A 1KSGA 1MABB 1SVKA 3NH9A 1X1RA 1H8EA 1YZQA 1BMFD 4ZPXA 4QBHA 1V43A 1WF3A 4ARZA 2XZLA 4Q4AB 1CBUA 1TEXA 1KDOA 2WKPA 2IHBA 1E2KA 3OFNA 821PA 5CYPA 1XU4A 5A4JA 4DB2A 3TUZC 1HURA 5CJPA 1KK1A 4XVUA 2QRZA 4BZXA 5BXQC 1SXJC 1IXZA 4IOMA 5DYGA 2DFLA 3BWDD 2VIIA 4XH9B 5FOSA 5H1YA 1T5IA 4P4UA 5CB8A 1H8ED 1NVVQ 3P32A 2D62A 3WMEA 1NVXQ 2ZS8A 1MABA 1UADA 3B1XA 4TLAA 3GLFA 2XOKD 1AQUA 2QTFA 5D3MA 5HR5A 1GNQA 1FUKA 1NF3A 4C0SA 2F7SA 1W5TA 2ZR9A 4YMWA 3KJGA 3PUWA 4B6FA 4NDZA 4PHFA 4IFBA 2FFHA 4HUQA 3OE7D 2OCPA 1O87A 4DUGD 3B9PA 5TDHA 2I1VB 1P9RA 3B6EA 3MFYA 4RCZA 4C7OB 2OSBA 3ZLJA 4ZO4A 2BMFA 2QROA 2RKOA 1YR8A 2WJGA 3LX8A 2NTYC 5CDFA 1E9AA 1IY1A 2B8WA 1U2RA 1ZNZA 2IYQA 2O0KA 3EG5A 1H8HA 4B35A 3ICQB 2GEDA 4CZ2A 3VMFA 2QAJA 4UXJA 2P0EA 3WP1B 5BN3A 1BMFA 2RGBA 3S1AA 3VHXA 3THYB 1ZCBA 4LWZA 1E9BA 1N6HA 2CDNA 1GTVA 1Q3TA 1OXTA 2NO9A 2ERXA 1BH2A 1XD2B 4LCBA 5TV2A 4V0OA 1M8PA 5DH9A 3ZD7A 3CPHA 1E4YA 3T34A 3NKVA 1LY1A 2JASA 2ODEA 3B1ZA 4XD7D 3K70B 4HB2A 1CR1A 1KYIA 1ZUHA 4JLBA 5FI1B 2V9PA 1E0KA 2HUPA 2IYUA 5C4MA 1SVOA 4C0LA 2RH5A 1JPJA 3SHFA 4C4PA 1JNYA 3CLVA 4OK6A 4JBXA 4KHZA 1Z47A 3HP1A 3MG9A 5FOXA 3NHAA 4JYBA 1NN3A 2HXSA 1W0KA 1S96A 2O8CA 5GVSA 2GCNA 3X1WA 1EK0A 4A0HA 2IF2A 1XMVA 4W9MC 4QL3A 2EYUA 4B43A 3DOEA 2O8CB 5DHFA 4YMTA 4FINA 4LC1A 3A1TA 5BN5A 4FCWA 1D2NA 5G3YA 3IKJA 4DLRA 4IFEA 4RKEA 2IA5A 2QP9X 3WRXC 3VKWA 3DM9B 2CJWA 2J7KA 1W2HA 3W6OA 2HT1A 1ZU5A 1NN5A 2UVQA 1IJFA 3I3SR 4M1SA 5EUQB 3UIEA 3UG6A 3CR8A 1EFRD 1HE1C 2OBMA 2ZYVX 4LJ4A 3SYKA 5KNBA 1NG9A 3NEYA 3TSOA 5LB2A 3X1YA 1KI1A 1S1CA 2KJQA 2XTNA 4YLGA 4E09A 3FMFA 1P4SA 4YC7A 1DPFA 5FPSA 2ZRMA 4C2UA 4KBGA 4CF7A 2VP5A 3KKPA 5KNDA 3F5FA 5JI2E 3OF5A 5K8TA 2ZUDA 4GMDA 4DDTA 4V0NA 4PC3A 1UDXA 3WXMA 3QEOA 5E7IA 1EX7A 4ASUD 1BYIA 1D2MA 1PLJA 1OIWA 4B2IA 2VO1A 4Q1BA 3UG7A 4IHQA 2AHOA 1VG1A 4TYWA 3K0CC 1IY2A 3IEUA 4EPVA 5HCNA 2VHQA 4PAMA 1G291 2B21A 3DHWC 4Q4JB 3SQXA 4IDQA 1FMLA 4R98A 1SXJE 4RFSA 5FL7A 1KAOA 1OIVA 4G0NA 3EPLA 2BMJA 3IPYA 3L43A 3P26A 2E1RA 3EWAA 2G0TA 4WXRA 1Z22A 1OH8A 5HCIA 5JECA 2PX0A 1IQPA 2GNOA 1XPRA 5KSPA 4OJQA 3AB3A 4RVCA 4CT5A 1M7BA 4DC9A 5KTYA 1AKYA 1CR2A 2CNWD 2CHGA 4ZDKA 3TGPA 1G3RA 1M6NA 2WJVA 2YYZA 1XMIA 3RRMA 4NPHA 2ORWA 3QI2A 4A6PA 1G8GA 2CL0X 4M9XA 2FPKA 5JEDA 2OBLA 1W4BA 3OHMA 4PFSA 2J59A 2X2EA 4JKIA 2EWWA 4JLJA 4YDSA 2HF9A 1KMHB 2ANBA 1RJ9B 5CIQA 2ZM5A 4B34A 4HAUA 3A1WA 1HQCA 4XWOA 1UEIA 2WOJA 1YRBA 4W7SA 2BEJA 3MWYW 4N3NA 1XB2A 4D4JA 2ZRPA 3GLHB 3WBJA 2C8VA 1N25A 4ZKDA 3KQKA 3ICEA 1XZPA 2F6RA 4A2PA 1AIPA 1IXSB 1J99A 2ZJZA 4RCYA 4BEBA 2DWPA 4LBZA 1KDRA 1YZTA 3HU1A 5AJXA 3VKGA 3AF4A 4AYWA 4XOIA 2ZS9A 3C5CA 3LV8A 5JRJA 4BZPA 5JHGB 1G4UR 2XSZA 4NL4H 1LB1B 4DDWA 1OV4A 3JZMA 4JL8A 1IN4A 2VPPA 3JZAA 4MRVA 4UXHA 4LHWA 4B44A 3QVVA 3D3QA 2FZLA 2X19A 2K5UA 3FGNA 1OB5A 4ZDIA 2CHQA 1W4AA 4E07A 1ZD9A 5FPYA 2ZXUA 3GPLA 4DLWA 1KK0A 1UBEA 3VTKA 3JVVA 4C0AC 4JT4A 1WCV1 2R6CA 1KY3A 2Q3FA 3SFVA 3PEWA 1RFLA 2NOAA 3CRVA 2RGNA 2ZEJA 1RYHA 2OLJA 4YXWD 1NL3A 3CW2A 5GVRA 1ETUA 2YOGA 1L8QA 1E69A 4XTRA 1VPLA 3AP2A 4Z8YA 3SE0A 1G41A 2RGXA 2AWOA 2HXYA 2GEVA 4TSFA 4Y0AA 3LBIA 3L2OB 5JFGA 4JLDA 1L4UA 3M0EA 4FI3C 1KMHA 2IXFA 4JJKA 3TAHA 4BFTA 3GP8A 3CB4A 1CU1A 3REGA 1VDZA 4QM7A 3PENA 4S2EA 1KDTA 2PMKA 5HKKD 2Z6VA 4G5QA 1PLLA 2D4HA 3FMOB 5E7JA 2J46A 2ZSBA 1TU3A 4FMDF 3VX3A 2WPDA 3NDPA 2IS4A 2QM7A 2QU8A 3SNHA 3THWB 3UATA 2ERYA 2CE7A 2DWQA 1RRCA 5P21A 2PX3A 5E95A 1QF9A 2J0UB 1PV4A 5HE8A 2YKGA 5JWHA 1A2BA 2ZJOA 4LX0A 1E3MA 4K46A 3MJRA 2IK8A 3K0AB 5EXSA 5C46F 2XEXA 1XD8A 2XZPA 3G0HA 1WXQA
chains in the Genus database with same CATH superfamily
4MVJG 4QQFA 2BI8A 2Q3DA 2I80A 1Y9EA 4ODIA 2GN6A 3AC0A 1HBJA 4KIFA 1EGVB 2CVPA 4ZAYA 3NH6A 4IG9A 2HCTA 5IVIA 3EMBA 1JQ3A 1MC5A 4KWHA 4CV1A 9ABPA 5HZGA 5KNLA 1XVUA 2HD4A 2YVAA 3EXHB 3EXIA 4G0PA 3DAFA 4PZLA 1NVVR 4WN3A 4ZZ2A 5TIIA 3AK4A 5DNWA 3TIFA 1DQYA 3Q3JB 4YP0A 1AY0A 4KSBA 2DTEA 2K2WA 2E48A 2ZAGA 1II8B 1RJEA 1R4ZA 2C2KA 4MSUA 4JGIA 4WY5A 1JI0A 5J5VA 4CMHA 4E4YA 1X7WA 5FWXB 4PIMA 5IUNC 1UEJA 4REMA 2IKQA 3RADC 2YWDA 3IIIA 3QTBA 4OBBA 4CLRA 2W8ZA 3E1GA 3BSYA 5JDIA 4JOBA 4QLBA 2ZZNA 4MW2A 3SC6A 3CTPA 1T1GA 2C29D 4ZU1X 4B5KA 1MDBA 4UOEA 2QMUA 3FLBA 3G2KA 2B3DA 2PEZA 4ZQFA 4P82A 4NC9A 3O1JC 3OQNA 1D5WA 2X3FA 1GDHA 1GIAA 5JI3E 3G3EA 3RAPR 1MH9A 3A4IA 4Y6QA 4B80A 1SBZA 2PAFA 5KOYA 2BMAA 3IBTA 2RHTA 1EJ2A 1WMSA 4KVZA 5KKCA 2J9RA 4JI7B 1EH5A 2E7ZA 1P5HA 3GP3A 5BR1A 4G2TA 5FEMA 3O93A 4PICA 5FFMA 2POQX 4LZNA 3Q8LA 1SQ5A 2UUAB 2VHZA 3GLHE 4ETMA 1JDSA 3NKFA 3THYA 4PIVA 5BWOA 3ELWA 3P97A 3VYWA 1JYSA 4GS5A 3U3XA 3DSRA 1HQYE 1T35A 3C7DB 1TQ2A 4GZLA 3DTVD 3FYCA 2O05A 4J0JA 4OEHA 3VR5D 2JAUA 4XWWA 3AU8A 3MYYA 1GN9A 3FF4A 5FUBA 4LISA 3S2FA 3H42B 1VYTA 2CGEA 2R79A 2QN9A 4REOA 3W4JA 1ZZGA 3U7FB 1RXIA 3IQXA 4KU4A 2DT5A 3DGFC 5CB6A 2ZYWX 3WYEA 3L41A 2I6SA 3PRHA 3OJCA 1X7YA 4JB3A 4YCAA 2F64A 5TNXA 4Z5XA 5A0VA 3OCXA 1A69A 3ND6A 3LT4A 4HLNA 3IUYA 1VYUA 2H4JA 2R44A 3CZPA 4DR5B 1OZ0A 3BF8A 1UBRS 3UHAA 5AUQA 3GA5A 4DIBA 3TECE 3KFXA 2JDID 3KAQA 3WRXA 4NBVA 1SBHA 2O2SA 3HJTA 3ZQKA 2IYOA 3BT7A 1ND5A 5ALMA 3VBCA 1CUVA 4BLQA 3W8DA 3PEUA 3DZHA 4NESA 1OT3A 2I3AA 1FMTA 3IPRA 5KSOA 4X60A 3FA2A 4KB5A 1TZMA 4EKIA 1A5BB 1A95A 4LX8A 1VFNA 4YQYA 2DBQA 3E1SA 4DPLA 3DDZX 2RHJA 3IBSA 4H2DA 4HAWA 4OGWA 1E2BA 3A2MA 4H0CA 1V9SA 1H9CA 1R4MB 1TRKA 2GAFA 1IXYA 1YDEA 3RS8A 2R1UA 1QGAA 1LLFA 5A4MS 4N40A 4ARIA 3L8CA 3I9MA 2OTCA 1L7XA 4ZHQB 4RMNA 3WLNA 3PLRA 3MQ2A 3C6ZA 5CX4A 4D92A 1EK1A 1OBHA 1XJQA 2IV3A 3RUAA 5EXXA 3GT7A 4U00A 2J3HA 5HM6A 4MUIA 2AQIA 5DBEX 3IBGA 1Q3HA 4JBNA 1OLOA 1Z18A 2X22A 3R3HA 5AIAA 3A27A 3RYFA 2O8BA 5ALSA 1U0TA 4EFNA 1TTQB 4YH1A 1Z36A 1ZOSA 2DOKA 4RJKA 1JLRA 3HSSA 3FTQA 3F96A 4TWBA 5IANA 3MWDA 3T4EA 4UHKA 5KTMA 2JJ2A 4YEDA 2M6LA 1GL3A 2AK3A 4F2HA 1L9XA 1UOQA 2ZBGA 4PZAA 2NM0A 2VRCD 1WV0A 4MMZB 2WE8A 1L5HA 5EPUA 1K75A 5EE1A 4P3OA 4WA7A 1MJGM 1RBMA 1NUAA 1XJ0A 2D7CA 3SSNA 3AHEA 5IVKA 2O3UA 4CIWA 5BN4B 4Y30A 3FWPA 2G07A 4K9LA 1UBGA 2OXEA 3GGGA 4Y2SA 4DPMA 4BO8A 5ITZB 3OM9A 3OWOA 2XUAA 4FX2A 3VXKA 1CD5A 4NENA 3I9V6 4E5KA 5LQJA 1DAOA 1WMEA 4CEIB 3I9FA 4ZTUB 4RLQA 3L7NA 5AI9A 5HDQA 2PMWB 4GC9A 4RPCA 4DG5A 1O97D 3ZWMA 3B7WA 1V5IA 1RWXA 3VR3D 3I58A 4ZREA 3QENA 4HLDA 4UAUA 2ZWOA 4D80A 4KUGA 2RIRA 3LRXA 3HYLA 1R16A 3MCAA 2FETA 1XEXA 2Q0QA 4PGGA 2JFFA 1LRJA 4G9EA 5AM1A 4MEBA 2ZTHA 5DMHA 5BUQA 3DMPA 4NAHA 2R11A 1A1SA 1EUDB 2QN6A 4X1YA 4WQMA 1QIHA 1U63A 2XYHA 1I7LA 1RPAA 4RSMA 3UB2A 4Z86A 3L05A 5IXYA 3NTVA 2FKNA 3TIIA 3JV7A 1WW2A 2C3YA 3R9KA 2DFDA 4PQRA 3MCUA 4G1BA 1W47A 1OAOA 3HY4A 5H8WA 3ZV7A 1Y37A 3NHBA 5AWFC 2BGJA 3DE4X 5HKBA 4S04A 4XLTA 3ZNPA 1ZOIA 3TNLA 4B85A 3ND9A 5HQJA 2IEAA 4FFDA 5DNCA 2QBYA 2ZS7A 1K4KA 1LTQA 1YOVA 1YQEA 4IHJA 4KO4S 4HQLA 3A1VA 4OU5A 1UXOA 4W6QA 3W9UA 3SI7A 1D3AA 3JRXA 3OI7A 1E6EA 1OZGA 4UPEA 2JLRA 3FGPA 4RMIA 4RF5A 4LXXA 3OLCX 3VYVA 4ZV4A 3BXZA 2C78A 5BQOA 5M34A 2JD2A 4LY0A 3SCZA 5KDOA 1IEVA 4Z99A 1QR2A 4F4DA 4QGGA 2XGGA 4KNVA 4BRZA 4MI1A 4YJKA 4MV9A 2RGRA 4QFCA 1A7JA 1F1BA 5DM1A 4DARA 5C1IA 2W83A 3OZUA 4P7BA 4QUIA 4MS4B 4O2AB 4ZVUA 1BFKA 1IU9A 2ZWPA 3BTSA 3H1AA 3Q7RA 4LHSA 4MWBA 1N78A 1X8LA 4YRAA 3NASA 1JI3A 3H2JA 4UMVA 1HG0A 4WLVA 4D41A 3VUEA 2VQFB 2GZRA 3LRPA 1M6HA 4NRDA 2IS2A 1U1DA 4OU4A 1WDLA 2QD4A 3ZG6A 4E22A 5LD2C 4RAQA 3TXXA 5J4KA 3I62A 4LYDA 5FJIA 1LZKA 2RGAA 4EA9A 4HI0E 3WL7A 1XF9A 1I7SB 2P90A 3FBTA 4NCXA 4ZCMA 1P4GA 3LNTA 1ZICA 3N0TA 1CUYA 3COYA 2CB9A 3L9WA 4OOEA 4TMYA 5B1EA 2DBYA 3HYCA 3UGJA 3PNMA 2YVUA 3ZHQA 2CYBA 1UFVA 3ESBA 1Y1SA 1NVEA 1R0XA 2GCPA 2YDXA 4BPBA 1FJGB 4WD3A 4UVDA 3BIOA 1M0TA 1XZLA 3AILA 3CO5A 3VJKA 1ZU4A 4YWHA 4LRWA 5TMDA 5H02A 4KFSA 3BGIA 1DBVO 3DQQA 1MO3A 2CZGA 4CPDA 1K5GA 4R8LA 2IFTA 3QE9Y 2X4LA 4CL2A 4HDOB 1XPUA 2XA9A 2EL9A 2H2HA 5KQPA 3Q9SA 1WDWB 2FV8A 1FL9A 2C03A 3C7TA 4PXAA 4D8TA 4YMSA 1Z33A 5BV8A 7ADHA 3F6YA 3GEHA 4D3XA 3AESA 2HSZA 2XUFA 5G1PA 1TVEA 1ZGCA 2IS6A 3BRQA 2J6HA 2XGSA 1Q6YA 2JLQA 1FFCA 3GNLA 1EFKA 1PNQA 3U3OA 3LQ2A 5JJ5A 1X7YB 4J4HA 3OM1A 2X0NA 3REOA 1BVUA 4AUMA 4JV5B 4WZBE 3WSWA 2GTPA 1U0HC 3BREA 4NMHA 2NAPA 2J5RA 3RABA 2ZUVA 3KSBC 1YONA 1Z06A 2EJUA 2HA6A 4MVXA 2NPFA 1EXWA 5HKOA 2AE1A 4IOJA 4NI5A 1R0RE 1RKVA 1UFKA 2WD8A 2AFIB 1GU1A 4PZYA 1ZJJA 3OEED 3TW8A 1E79D 3EWIA 1Z34A 2OEPA 1RE1A 2XLCA 3JQRA 4RABA 3SQNA 4B2LA 1A5TA 4EF6A 2FN7A 3ONWA 4KIJA 5EUBA 1O5TA 1E1CB 3GRUA 2IIQA 1YU6A 1WHTB 2H7XA 5C51B 3PQCA 1ISSA 2YY6A 2FW7A 3FG9A 3CWQA 4ZRNA 4L0CA 1SJ9A 3MFQA 5K2OA 4NYMQ 2AFRA 1WD7A 2QS9A 3KBBA 1ESMA 4BLSA 5JY6A 5F2KA 5LPNA 1J8FA 1BHJA 4DNPA 5K0CA 4JC8A 1ISRA 4TYMA 3U3RA 1IVNA 2PZMA 3EGOA 4O29A 3UF0A 4DV2B 1UBCA 3A3YA 4MUXA 1L7DA 1WB4A 5BW4A 2XWJI 2PU5A 5AW7A 3CLKA 3K5PA 4IHJB 2Q27A 4F04A 4RETA 1GP2A 4EG7A 2ET6A 2WYHA 1YHZA 2FPIA 2I1QA 5EY5B 5KB3A 3BMXA 4IJMA 2PS1A 2QRJA 3BHJA 1GUZA 3E5NA 2ACKA 4WLEA 5GJVC 1QLJA 2J5XA 2W5UA 3U0BA 2ZZMA 4KRFA 3O4JA 4QFMA 1WE2A 4GXQA 3Q12A 2EQ5A 1QTQA 2QVCA 4GIBA 1ZI8A 3QFSA 3W2HA 2ZIEA 1P9NA 4HV4A 4E15A 3EODA 3KKZA 1XDGA 5KVCA 4CQJA 5AKYA 2FRXA 4L95C 4G8DA 4GWLA 1X3SA 2EBWA 3I8SA 2PNFA 1WVMA 1ZD5A 2JIDA 4DKJA 1ZJ4A 5AKZA 3UAVA 4BEJA 2PJUA 4JJ7A 4B3XA 1W5BA 2V7VA 3OOWA 5EIAA 1GPKA 3Q98A 3V34A 2FFJA 4A0RA 4F9TA 4EJFA 2G83A 2EU8A 4FFOA 4QLAA 5CYOA 2FE4A 2WLTA 4XWKA 3DCIA 1R8SA 2XCRB 1Z6TA 1NYLA 3A31A 3VR3A 1GGVA 1QYDA 4KUHA 3DYIA 3H11A 4QGBA 1TZKA 3ZWNA 1XZIA 5H4HA 3U60B 1ZIPA 1THMA 1W0JA 1Y48E 3K1AA 2XWQA 2Z1MA 1WW8A 4BX2A 4MW9A 2BFDB 4PN3A 5JSFA 2HA7A 4TKUB 4U5QA 3U7HB 2WSSD 5ETJA 1N3YA 3OZEA 3Q5DA 1OU0A 2Q5HA 4EKEA 4ZK2A 4FR2A 5DCYA 1YS9A 3TD2A 2NZJA 2BT4A 2EWMA 1B74A 2A9RA 1UDBA 3EVZA 1GA4A 2I71A 3PJDA 1PU2A 2HF7A 4KODA 3WTBA 1P4AA 2OA0A 2I03A 1U8YA 3BH6A 1IWPB 2QQEA 4YRTA 1Q16A 3GT3A 3ZKAA 1HR0B 2ZWMA 3HTXA 5ESXA 2VPZA 3AVXA 1OBFO 4K5QA 2IPMA 4LUCA 4N8DA 4Q3KA 4LW8A 4RHCA 1CQZA 4KFUA 3WNCA 2E5FA 2EJTA 4HDCA 2WSLA 2CC2A 1CRWG 2R5WA 2YXEA 3HDHA 4WCFC 2JDIA 4TKLA 4YUWA 1U7PA 3NHFA 4LMPA 2X3UA 1DJLA 3DEHA 4HSGA 1Q0UA 4RA6B 1J8YF 3MJ4A 3NIFB 1ZY2A 1UPAA 1O95A 1ZNYA 2AZ4A 2X5NA 4ZVSA 4F6LA 4WBNB 1D0IA 1OGJA 1H1LB 2G4LA 2Q6VA 5MFPA 2D7JA 3NALA 3SJ7A 3PKIA 2V7XA 1JG4A 4G25A 3T0GA 1TZ2A 3CE9A 4MAFA 4ZQGA 2NZVG 3GRYA 3O8BA 4D44A 4RKWA 2ZG6A 4A0QA 2WJJA 4LWOA 3ZU3A 1GAQA 4DWOA 3OZIA 3MT8A 4EB6B 1P80A 4JJAA 1N0IA 3G68A 3A14A 5K8LA 3R3VA 1A2OA 4GRDA 4J76A 1MJFA 1B6SA 2RAUA 4IZ6A 2CL7X 5IABA 1TYAE 2DB3A 2FFAA 2GZSA 5T3UA 1ODTC 1L5LA 3EQ2A 3R3WA 1NJ6A 1SOVA 3REQB 2VSYA 1X8KA 1Z3IX 3N8KA 1M3SA 3BWCA 5IRCD 1FUYB 1XTBA 4JWKA 1Y5MA 3ABRB 5DRTA 2QLJA 3G7UA 5CCXA 2QV7A 2I87A 2CXHA 1G1AA 3EY9A 5C53B 2ZI4A 5F7JA 3MOIA 3KKNA 3RBXA 4P80A 5KMGB 4OXYA 1M2FA 1V96A 4GOXA 5AOVA 3SNKA 2JFHA 1T6BY 4OHUA 3DHYA 2AC2A 5J2UF 4YPVA 3SGLA 4IILA 4QC2A 5JIBA 3UHJA 5LU9A 5FUWA 3ZBTA 2B1JA 1IEXA 3R7FA 4Z9BA 1FNBA 4DMHA 2HH9A 3MXTA 3G82C 4GOJA 2C2GA 2PUFA 2N3ZA 1PT9A 1A3CA 3PHLA 3WMXA 4C2AA 2E3JA 1JR3D 3AY3A 3K0EA 2YJGA 3MUFA 3R6WA 3JVUA 1E3LA 1GLGA 4I1OA 1O7JA 1Z83A 2EV9A 3CQ9A 1N5OX 3G02A 3A32A 4YRLA 3RIXA 3GJ5A 4I0WB 1HA3A 4JMPA 3AEYA 1SM4A 3AF1A 1KJQA 1N2BA 2GKGA 2FN8A 2W43A 4Q37A 3AFIA 2JIBA 2WM2A 4JIMA 2FPPA 4ARCA 4NBWA 4L51A 2WYWA 5T8KA 3UAYA 4ETIA 4HNAA 1A9XA 1U1FA 1U8EA 3EZXA 2KBFA 4EHFA 4E1AA 1AK2A 4MW7A 2VJMA 1L7OA 2Q3EA 2PX5A 3KPWA 3E9CA 1ZCFA 1XYVA 5ENZA 1XT6A 2QGZA 2LE0A 1EVLA 2ZJYA 4WNCA 2JS7A 4RL4A 3HP4A 1JDBC 3LZCA 1ONOA 5EJ7A 5K45A 3R3XA 5B2FA 4GLLA 3EISA 4HQNA 1QFZA 1XZNA 2EWVA 1OWLA 1Y4UA 1XRNA 3ZS8A 2GSDA 3HBLA 2YFYA 4QJ5A 4Z2AA 3O8DA 1H42A 4JELA 5FPTA 1CUCA 1PSWA 1FLAA 2EX4A 2PJRA 1RHKA 2PPLA 1L3CA 3EFBA 3RTGA 3AJEA 3B1KA 3P94A 4ZALA 5F9FA 4JBGA 3TX2A 3UKJA 4RIGA 2BP7A 4OQFA 1GXSB 2I2XB 3HVIA 3CVVA 3ESDA 1C0IA 1VPEA 2H31A 4CMEC 1DFIA 3WFZA 1P7ZA 2AFHE 1H2EA 4FJ0A 5F2EA 1JTEA 3HSKA 2GO1A 3DZKA 2UYYA 4N0MA 4Z0NA 3BD6A 3CW8X 3AHGA 3KCQA 3VJMA 3GXBA 2XF2A 4EW2A 3LCJA 2WY2D 2A3NA 2PTHA 2QX6A 2A94A 3CKLA 4NY1A 5DWDA 4YRBA 4IYJA 5ADVA 1AUPA 1XHLA 3CPSA 2JIQA 3NT4A 4H4EA 4NP6A 5GONA 4BAUA 4JXXA 3WC4A 4B17A 2GUWA 4LY6A 3GG2A 4OHCA 2PXCA 3UHPA 1Y3HA 3GEIA 1TKBA 3M2PA 4LRUA 4WOPA 2W2NA 2GPNA 1F17A 1P75A 1P4JA 4N3GA 5DBHX 2CK3D 3G9TA 3ZC3A 4ALKA 2GJKA 1FP2A 3EDQA 4D2IA 4M22A 2IW3A 3I6MA 2BFBA 2FEXA 4Q3OA 1U02A 2PWZA 4HGRA 4QLOA 3ZJ5A 1PGNA 1U6IA 3ZR4B 2O8EA 1JQDA 3K09A 2Y6VA 1J20A 3MTIA 3SQLA 1MAHA 3BE8A 2FEWB 4CG3A 5ARBA 3AF2A 4MVJP 1IVYA 1CVRA 1YO6A 5EQTA 2G71A 3LLUA 3KQUA 2FEMA 3U5ZB 4B4WA 5E38A 1O6GA 3IV7A 3DF7A 3OIVA 2GEKA 3QYPA 4KI7A 4YUZA 1QX3A 1KI7A 3VKFA 3R9WA 5B7PA 4Q7QA 3I5UA 4PLGA 4TTRA 5DLDA 5EXTA 3SG0A 4AJHA 1Z45A 3KQYA 4YAGA 4ZJZA 5JWRA 1K5PA 1RM4A 2QP4A 4YIHA 1XVVA 4B5LA 1CDZA 3C4JA 4A3SA 1EYZA 3PUJA 3QJGA 4D56A 4E94A 2E4YA 3L7OA 3IR6A 3O1LA 1XMQB 2CXPA 3OF2A 2ZBRA 2IHZA 4AZSA 2RAVA 5IW8A 5AKGA 4IY1A 3RSLA 4DBLC 5E7MA 4I50B 3UJDA 3RF6A 3AOEA 3WHKA 2ZKLA 3N75A 3LZDA 3LXXA 3R24A 3PX7A 1A4RA 1TW2A 2ODNA 2ZIZA 1T4GA 4YXWA 3ROZA 3I1YA 3IDOA 1AU9A 4X6YA 3UEOA 3GQVA 3ZDCA 1FFHA 2VRWA 4XIYA 7MHTA 5I4IA 3H1EA 2Y27A 3ACDA 3JU3A 3WRVA 2Q6KA 3ER6A 3BGSA 4C07A 1N0HA 2Y0DA 4IHJF 5AOAA 5LXTB 1F51E 1OX4B 1WDKA 4FUTA 4PV7A 4F4UA 3TR0A 1Z4LA 2OWEA 1WKVA 3I05A 2EP5A 4YCJA 4I8DA 4JGGA 4N65A 2IQIA 1I01A 3G8DA 1NPDA 3GFGA 1KFKB 3PRJA 1B6GA 1A7KA 4D0LB 5I7OA 1RVV1 2WWTA 1TF2A 4Y6OA 3ILYA 5ECGC 3JQGB 4PO1A 4Q19A 1S4QA 2NW6A 1YRYE 3R5FA 2YRXA 4Y2HA 4FPXA 2YZMA 1ABEA 1AD2A 4R2XA 3QMVA 1SD2A 4N4AA 1Z2CA 2ATEA 2A57A 2X13A 4URVR 4IS3A 1K4YA 2ODQA 3OX1A 4RIFA 3M5WA 4HXFB 1KKLA 2YJTD 1VE9A 1ZGHA 3C8UA 3KC2A 1ZOLA 5DULA 4I7EA 4TWAA 1TK3A 3DMHA 3HJFA 4KKXB 1KQ3A 5ES4B 1QB7A 4Q15A 3WJAA 1NXSA 1GZVA 2ZI7A 4L9RA 3RVDA 5JALA 1P5RA 1XCLA 1ES9A 2GN0A 3FBWA 4DEYA 1M1XB 3BB3A 4HXGA 4MVJA 1NUQA 3HDVA 5LM3A 5AI8A 3QXSA 4JBWA 1YZFA 4X3OA 2CFCA 5B3AA 3ZLTA 3BFXA 1XTKA 3VAZA 3IJ5A 5GINE 2IGBA 1GD1O 1ZUWA 1CQXA 4I5GA 4QRHA 2XYRA 3LVBA 2Y0PA 1F3LA 3ABQB 1DXHA 2ZR0A 2COKA 3NEPX 4FQ7A 4L7QA 5LZ9A 1KBOA 3SFTA 2JIZA 2B5OA 2PXHA 4EMTA 2EEPA 2OSVA 1NXWA 2DHEA 3JWEA 5TRTA 1MQ8B 4MRSA 1C8LA 4WESB 4BMCA 4XWGA 4ER0A 5LQNA 5LWHA 2QUKA 1YACA 2FX5A 5E6SB 3R20A 2NMVA 2GN8A 1XROA 4HNQA 1RMYA 1I9CA 2VBGA 4O4IF 3OOJA 4XFDA 3NOXA 2FWIA 2HK9A 1P9LA 4DAEA 4KQ6A 3SSMA 2HRZA 4L85A 1YR7A 2O3JA 1A2QA 3Q85A 3LDAA 4LXUA 4MGYR 5TXGA 3R7BA 2WD9A 5CTAA 1JU4A 1NFRA 4XSGA 1Y5IA 3OFJA 1TMOA 4P2BA 3LF2A 3LQRA 4O59O 3LTNC 2C7VA 1FUUA 5FBZA 4PLWA 4R71A 5ICCA 2ZGVA 3O4HA 1FVHA 1YR1A 4A82A 5AHXA 1C30B 5DWVA 1O95C 1L1RA 1ORDA 4D9MA 2JIRA 1M5TA 3WQBA 1W29A 1QO0D 3V8VA 5TVGA 3EXHC 5CT8A 2ZE5A 4A9AA 4F5DA 1U7XA 2DHCA 4KDEA 4MRMA 1NW5A 2HI0A 5KHAA 2FN4A 1WKBA 4AP6A 4YYEA 4BMYA 4BUCA 3BL5A 1IPEA 1BAPA 1DADA 4BZZA 1PNVA 3PFWO 5GQSA 3DLHA 3HH8A 1UXHA 3FHCB 3NCTA 2Q0HA 4YJFA 1FFGA 3R0ZA 3GVXA 3KXLA 4K2AA 2A4MA 4WJLA 4RY8A 1KU6A 1W44A 2GESA 3EF0A 3PCTA 1FVFA 2CLDX 3K94A 2DHRA 1UJ2A 3MYRA 1IEQA 5TGDA 2E37A 2Q4TA 2VDJA 3OCZA 1DT5A 2EGUA 2P7IA 2QR2A 2NLOA 3BJIC 4HR7A 4P31A 2IYEA 3QUBA 4EIWA 1H9BA 4Z7QB 2HU5A 2XMSA 3EMVA 5EMKA 3L8DA 1YHNA 3QPCA 1QHSA 3G23A 2GNPA 4KO3S 5CXUA 3QEMB 4NPAA 3WKAA 3S1AB 4Y9UA 1QU2A 5ARCA 3FXAA 1DVRA 2M6SA 5D7NA 1CZNA 4LOLA 3ZIUA 4UMEA 5K8CA 1JLHA 1Y3DE 1Z4QA 1MCZA 2D7DA 1J25A 2W37A 1ZNXA 1XDWA 1OXBB 3F90A 2LKDA 3I0MA 3ONEA 3OZVA 4B4OA 4MYCA 3HJUA 2HPAA 4LQLA 2PK3A 2H59A 3QPUA 5H3LA 4DSNA 5I7FA 1A2KC 1QIKA 4NMWA 5IK2A 1W34A 4PVDA 4C7OA 1G8YA 5AVZA 1YDHA 3BHIA 1VI2A 5BMVA 1R10A 4J8PA 3LWNA 5MHTA 5ILGA 4DLXA 5A4FS 5AFSA 1WETA 4Y8VA 1SCUB 4QYXA 4I1SA 4NQRA 4MXDA 3IVXA 4GPD1 1GKKA 4BTVA 4E5YA 5IFKA 1M2WA 2WKSA 3PGMA 1EP3B 4URXR 4OMUA 2PLRA 3A6ZA 1SU7A 2I76A 3DD5A 4LF6B 4NHOA 3OTQA 1MTZA 3HYSA 3M5DA 3RTEA 1PQUA 4UQPA 3HMKA 5KKNB 1C3OB 3KAJA 1YRHA 5BV2P 2BYTA 2O19A 3FBGA 2NAFA 1B2RA 4WPGA 1XL0A 3JQFA 3NKLA 1A8SA 1NOKA 1C0LA 1CZLA 1EFPA 1KDPA 1T6YA 4MHOA 4QDKA 5EI5A 3U48A 3BBLA 3THXB 2VA9A 3G7NA 1QWOA 4DSAA 3DBRA 2OOKA 4AP5A 3W5UA 5I3CA 5F73A 5BMVF 2YBEA 2DQKA 2ZULA 5B1SA 4URHA 1O58A 5KYUA 1RZRA 4JYPA 3R74A 5KPJA 3DLIA 3T9CA 5LQDA 4YCLA 1H2WA 5U4XA 3PUXA 3TIXB 2JAHA 1IY0A 1PV1A 2HEIA 5C7LO 4OP2A 5JEEA 2NSDA 1CLEA 1WQ1R 1NC3A 3BICA 4B6QA 1R74A 2ZRDA 2DHDA 3EF1A 2JBHA 3OLQA 4LJ5A 4UVHA 4HS9A 4AJEA 1DRUA 2ECPA 1ABBA 5U9CA 1VBFA 1WXIA 2BAGA 2N42A 5DNDA 5JNTA 3IP1A 3E27A 2OFPA 4G81A 1IK6A 1DDOA 3UT5B 4QNMA 1E6WA 1ZSNA 2FVXA 2YNMC 2ZE8A 4QU5A 1GVNB 4JOSA 3F0TA 4R1SA 1PUJA 3ZOKA 2I33A 3AG6A 1KZGB 1KVRA 4B31A 1ZIXA 1JKJA 1HXHA 4X3CA 3GRPA 3GHYA 4NATA 3RCBA 2Q6IA 3T1OA 1PG5A 4GBGA 5CNIA 3WDSA 2ORIA 4OXXA 3WMWA 1D8AA 1NUHA 2F59A 3IUSA 4V3CA 2XSZD 1ECLA 1FRNA 2Z2IA 2ZTSA 3DM5A 3IOBA 2QJOA 3IVGA 3H7AA 5K8VA 2EZ8A 1TQ6A 1GPAA 1HYQA 3C0KA 4ZT2A 4C88A 5L3QB 2VHTA 4PNZA 1X70A 4LOJA 4Q03A 4QO7A 4BJ3A 1QM5A 3DMTA 2XQJA 5HMMA 4KXNA 2RJOA 2VDNB 5CVTA 1XL1A 1SBNE 2H1OA 1P3JA 3K20A 3CF4G 5KBYA 4TMWA 3TLJA 3EDYA 3FMGA 3O4GA 1LI5A 4U7HA 3SHWA 2HPHA 1X1SA 1X80A 4BFVA 4ND6A 4L75A 1DWUA 2KW5A 2PSHA 4GI5A 5ALXA 4C4AA 3QBJA 1T9AA 1K8ZB 3Q6IA 2UZAA 4ZIRA 3UBMA 1SIWA 4QDOA 3MUNA 3NEAA 2J6CA 1E89A 4ZOAA 3L1KA 5AESA 4JHXA 2H2FA 3Q72A 2LP4Y 4JVNA 3T0IA 4TUYF 1OA1A 1J49A 3AF6A 1K4MA 3L77A 2R60A 3HY3A 2R7LA 4CF5A 1NBMD 4YY3B 4MRMB 1OU4A 1XVIA 3WICA 3JQ9C 4LXIA 2FPUA 4ZYWA 2HQ1A 1DARA 2VPXA 4LI3X 1T5SA 1JUDA 1Q0SA 5LBIA 3S2IA 3SPXA 3ZHVA 3WGIA 2PUDA 1E2NA 2Q62A 1W75A 3GD5A 3ZDFA 4F4HA 5KJ6A 4OQNA 5E2BA 1IZ8A 1XWIA 1FDUA 4YASA 3FETA 3OBIA 3PGXA 4EFKA 1XKQA 1UMCB 1K5HA 2MOKA 4QG7A 4EJSB 1G21E 4LDZA 1DU4A 2PUTA 4O2LA 2PA3A 4W5HA 3AVQA 2M32A 1TIBA 3BCSA 1E9EA 3QU5A 3QFFA 4HX5A 3ZK9A 1V4VA 1Y9AA 2WF5A 3QWFA 5M7EA 5AVWA 1FYDA 1M54A 2ZUWA 1QYXA 3VOSA 2I9PA 3BCHA 4Q6WA 1UAGA 4GUAA 3GVHA 4Q39A 2QMEA 3CO0S 1X8XA 1DMSA 1X86B 2H00A 3KQLA 4FSDA 3OE5A 2ZPTX 2JKZA 3BF7A 3BK7A 4WBSA 5EJIA 2P1DA 2WINI 4L27A 5J5CA 3HS3A 3V33A 3HFSA 2G4CA 3ZY3A 2WUGA 3PDHA 4E46A 2AI2A 4D0RA 5FTKA 4D8XA 2XOXA 3CLTC 1E77A 2XMPA 2B4RO 1SCBA 5TQ2B 2YJ4A 2P9BA 1F2TB 1SRRA 2L2QA 3IOYA 2AMFA 4JSYA 1SXQA 1L7BA 2H06A 1S2IA 4WK0B 5LQMA 1KPHA 3HA3A 5K3EA 4MUNA 2ID9A 3WMGA 1JYFA 2Y1OA 1GGKA 1M1YB 2BF4A 1XKLA 3H2SA 4X61A 3UQZA 1RRPA 1NATA 3QH4A 3AEKA 3TMAA 5JCPA 3RYHB 5I4BA 1E62A 2ZCVA 2AI3A 1UOPA 1HYBA 1X13A 2QLTA 4OTZA 1KSHA 4NFYA 4PVCA 1VKRA 1U5BA 3KU1A 4B32A 5FD8A 3CURA 4Q4LA 5TPWB 3O7MA 3UK6A 1TJYA 2CBZA 4G65A 2IU6A 1Q83A 3KLPX 5DCWA 3W2EA 5I47A 2XVAA 4Q1DA 3IJEB 4JAVC 1D0SA 2P6PA 3LLCA 3K31A 5LVAA 2QM3A 1O3YA 4JWTA 1RQ7A 4NCJA 3QPAA 2Y6UA 4L3WA 2FRVA 4RA6A 3I37X 4IDHA 2GYYA 2FPOA 4HMQA 4FZ3A 1UMKA 4AKGA 1QH1A 5DW3A 3H19A 1Y4DE 4RLFA 3QX9A 4ZFNA 3QZUA 3EVFA 2OORA 4H7FA 4KVFA 4DJ5X 1HQKA 1KP9A 1OREA 1E58A 3CLSD 3DEKA 4GLFA 1J7KA 2EW8A 1F12A 3V1NA 2BR4A 2RC5A 2CXSA 4GQIA 3BGDA 3FW1A 1XBTA 2FZWA 2X5XA 1UC9A 4KYIB 3AHFA 2ZB4A 2FCRA 1PDVA 1T8TA 3DV9A 4PW0A 1BZYA 2UZ0A 3M6AA 2NTJA 3RQIA 4ZOQI 1U2EA 1PL6A 4RFSB 1BVHA 3RYIA 2CWWA 5C5DA 2AW3A 2IWHA 4WIAA 5IAKA 1UBSB 3C7AA 3H5LA 4Q47A 5C1OA 5K6AC 5JWOA 4J16A 3CF0A 4WRRA 3AUYA 121PA 4CV0A 4BO6A 5LQRA 3R9XA 2PGNA 5IBPA 3QNUA 4LY9A 1C9JA 4E11A 1IHDA 5K0JA 2KM1A 2VUSA 1FK8A 4HDNA 1MOQA 2WQ7A 2QL6A 1XNJA 2YWHA 5EMMA 2B0JA 1LW7A 1PBNA 3I4FA 1BTOA 4ALNA 4M49A 4RL6A 3C3YA 5K0LA 4BNNA 2PGAA 4JFRA 1UXIA 3EGIA 3P2KA 2XCLA 3RVMA 1PBTA 1QE3A 3SF8A 3SOPA 4A8TA 1Y1QA 3PHCA 3GCXA 2PY6A 1Y8AA 4L3OA 2J9ZB 3L0BA 2EKDA 4KVGA 3ZJYA 3AI2A 5E6SA 1XLTA 1SUCA 4GAEA 5C5EA 2IYWA 3GJ3A 1OAOC 5HS6A 1VLLA 2AN3A 1KS9A 1ORHA 1GPMA 1J8MF 4UNRA 1H0SA 4FTWA 1KK2A 2XCOA 3UC9A 5KWIA 3FUWA 2R7MA 3FVRA 2EKQA 4RTNA 4M1MA 5TE9A 1EAMA 4KE9A 1ISMA 1C4XA 3KUDA 1P9WA 1Q1NA 3W6ZA 4RPIA 3V1TC 2UVPB 3UQYS 1H3FA 4HLUA 3WK5A 1X39A 2OCIA 4IO0A 3SJBA 1WZEA 1V1RB 2FWAA 1RAHA 3DMGA 5FP0A 3KEFA 1I4LD 1OILA 3RHZA 4MQFA 4OI4A 3GXOA 3TO5A 3I92A 1N92A 4XVQA 1Y63A 3BM5A 3WLLA 4EHIA 1SQSA 1KIMA 3JQBC 5KYXA 3TDKA 3EUFA 4P3KA 1G8MA 3VVBA 1UZLA 1NTOA 3GO4A 4EH1A 2MSLA 3H1TA 1DV1A 1KEEB 1W5AA 1Y8CA 4WK6A 5KSZA 1JSLA 1NSTA 4WJZA 4HDSA 2H48A 2O8DB 1J7JA 2F62A 4L8YA 1I0IA 4DIFA 2PH1A 4KN8A 3JAMA 4RTKA 3N05A 2GJ8A 1JAHA 1ZQ9A 3HFGA 3SKXA 4HWGA 2B2XA 5JUWA 2XOKA 1O4VA 4IW3B 1J6UA 1IBRA 3UJ3X 2XRZA 1Z12A 5KWSA 3EA0A 1QYRA 2P6MA 5AI5A 3G0OA 3AF0A 3L5OA 4KN9S 2YINC 1U98A 3N2GB 4UFPA 4D02A 5T3YA 2FEOA 4EJ0A 2V6MA 3WLOA 5JPCA 2OHIA 3ZVRA 3R9IA 4R6WA 4U3JA 3U3MA 1JZTA 1ZAKA 3RDPA 1YXMA 3B70A 3B5EA 2R6HA 1RHMA 4GKBA 2CHVA 5IAJA 5J4HA 5KQRA 1M1NB 1I14A 1P7VA 2LD4A 4I1YA 2N1MA 4MCHA 4BGVA 1KHTA 5J47A 2W58A 2AF3C 1TF7A 3CS3A 1CULC 1L5MA 2X0FA 2OHOA 4KITB 5CA1B 1W8IA 3L0IB 3VOTA 1NRXA 2ONJA 4KN5A 2B9EA 2QV0A 4I4IA 5EXPA 2IYYA 3AQ4A 5B7QA 3TBKA 3RWMB 2XUJA 4CCWA 1E2FA 5CJ2A 3AIKA 4DWVA 3BILA 3D6FA 4A8JA 5IKXA 1Q84A 3STXA 2QGFA 3OAAA 4JENA 3WK9A 1ADGA 2X1HA 4RK6A 1TUIA 4PSAA 2XB4A 3KYIB 1PFKA 3H0CA 1TYCA 1UF9A 1P1KA 1KP2A 1K0UA 2GM9A 2WWVD 3CUKA 5DPMA 1P5FA 3KUCA 4JT8A 5LOVA 5TARA 5FTJA 3EGVA 3WFJA 4A8PA 2A0XA 2CUKA 2A35A 1C7IA 2X23A 3OZTA 1XSEA 3SIRA 1Z7EA 1PR4A 3GLFB 1XAIA 1HDGO 3A70A 2E4ZA 4QQ8A 5KKAA 4AJ2A 4BX8A 5TMPA 1PGOA 2IDKA 2JBAB 4LG1A 5GJCA 3MMZA 3AGQA 2VPWA 4OL0A 2VUUA 4ZV9A 3SYNA 1SCQA 4QEKA 3T0FA 3TZCA 2REXB 4HYQA 3KOWA 2VHVA 2CNWA 3LBNA 5F3RA 2XUQA 4AF6A 1TECE 4JBHA 4KRXA 2Y4NA 5C52B 3FROA 4CI9A 4Y0NA 1YFJA 2DE0X 4R7GA 1JB9A 4JP5A 3MPOA 7YASA 1I7PA 2DQZA 2V8OA 5LN1A 3HR7A 4XSHA 5P8WA 2QRQA 4ZJYA 3KZKA 1OHHA 2DSNA 2XV1A 1FYWA 3MJHA 3TUIC 1B1AA 2AG8A 1E2GA 2ZRCA 5AP9A 2BBSA 1QJ4A 3FRJA 1RNLA 4FKZA 4H1UA 5LU8A 3CSDA 4M1TA 3OTHA 2JCSA 1NSFA 2W6IA 2OHJA 3I2JA 1UKZA 1JFFB 1RMQA 1Y42X 2PBZA 3ABOB 4KTTE 5DYIA 1TJ4A 4FQ8A 3OCVA