3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DDX19B
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
2BVNA 1M2OB 4D0GA 1KI2A 3GLFA 2Z43A 1BYUA 1JXMA 2F1JA 4BZPA 3RVBA 2NOAA 1R4AA 1QBKC 2FU5C 2Q0HA 4A9AA 5AJYA 5JHGB 4RCYA 3TAHA 4LYHA 2EYUA 4MKHA 3EA5A 4N0EA 5EJEA 4D4MA 2F3RA 2XJ9A 5CIWA 1A7JA 2EFDB 2ERYA 3GLHE 1E9DA 4Q7LA 2PCLA 1G7RA 2HLDA 1GFIA 2FG5A 4LWZA 3IDQA 2REXB 2C9OA 3IILA 3H4MA 1FP6A 1JPNA 1C1YA 1CR0A 4HDQB 1UBCA 4BFTA 5FOWA 1GP2A 5AR1A 2QP9X 4B3BA 4I1VA 4Q4AA 1EESA 1AGPA 5DHAA 1CXZA 1BOFA 3W6PA 3EG5A 2PJZA 4ARZA 1TX4B 1DG3A 1N6IA 2ASEA 1NI3A 5J4KA 4U02A 2RGNA 1XPUA 1FNNA 2CL6X 2VQSA 2VH5R 1XTIA 2DFLA 3VKGA 1XJCA 1EFHA 4DJTA 1E9AA 1VIAA 5KU1A 1VG0B 4ITRC 4DCVA 4LSGA 2H17A 3QJYA 1OH8A 1SXJC 3VU9B 3MWYW 4C0KA 4Q4AB 4YMVA 4TMVA 2J0UB 2DFKB 1WBDA 1DARA 4POAA 2YWFA 3VX3A 5KNBA 4LHXA 2QE7D 1AA9A 4BRWA 4OI2A 3W9YA 4MRRA 1OXSC 1OLOA 1OE0A 2IS4A 2J45A 2CHGA 3KQNA 4P31A 3P27A 4DLWA 4GI7A 4QNMA 1Z47A 4BLSA 2JJ8A 2V7QD 2ZE8A 3OFND 3PCRB 2XNDA 3QNUA 2VP9A 3FMIA 4JLOA 1RRCA 2PH1A 4QHTA 1K8RA 4TYYA 3LV8A 4A2PA 2GCNA 3B1XA 1MV5A 3EW9A 3HU3A 4BASA 1U8ZA 1G3UA 1HH4A 3TUIC 2GEDA 5JEDA 3RS2A 5DNYB 2F1RA 4JLPA 2DB3A 1X86B 3KL4A 1OH6A 2KSQA 2JAQA 4QJ3A 1JR6A 3EPKA 4DLZA 1XTKA 1ZNWA 5K8TA 3QOFA 1YHNA 3DZ8A 2FZ4A 3GFOA 1N6OA 3K0CA 2ECKA 2WPDA 5SZKB 2IYWA 3T06B 5FUXA 3ZIAD 3LRPA 1A82A 4B2IA 4JSTA 3VNUA 1Q21A 2ZS7A 1LFDB 1QHGA 4NONA 2YOHA 1ETUA 1VKJA 2X2FA 4LDJA 3WMFA 2CK3D 2GXSA 4DRZA 2Q9AA 1XCGB 5FOUA 2ZI6A 4V02A 2YVUA 2XX3A 5HKKA 1YRBA 5DO9A 2C99A 2O5VA 5CM9C 2LKDA 4KBGA 2FPLA 4HLUA 2EFCB 3LQQA 4QBHA 1COWD 4ZCIA 5IHPA 3K70C 2XXAA 1DVRA 2XOKD 3W3ZB 2JEOA 2ZETA 1N6KA 2A78A 4O2RA 4P0TA 4A8JA 3B1ZA 4HZUA 4JVSB 4MYHA 2YJTD 3GLIB 5ELXA 4GFDA 1DAFA 4NPHA 3V9PA 1MOZA 4B73A 3GMTA 1UKVY 3CF2A 2X77A 2V6JA 3L0OA 2GJAA 1FW6A 2O8BA 1G5PA 4Q03A 4TT3D 4KSCA 3X1WA 2XGJA 1HEIA 5KOYA 1JBKA 5DGXA 4DSOA 1XP8A 4YMSA 2LKCA 5JMTA 4JBXA 2JIZA 1E0AA 3SJZA 2BKUA 4KFUA 1GNQA 2NO1A 2EWWA 2VP0A 3P26A 4CT5A 3IHWA 1NSFA 4IOKA 5HCNA 1D2EA 4PSKA 1Z28A 3UK6A 2WSSD 3KJGA 1GRNA 3QBVA 3W6OA 2J7PD 2BBWA 2VF8A 4DDUA 1XZQA 3IEUA 2P6RA 5JWHA 5CM8B 2QZ4A 4MGZR 3GLIE 5LPNA 2C8VA 3BB1A 1L8QA 3FKQA 1EFCA 3EIQA 1YR6A 2D06A 4NYIQ 1Y63A 4XWAA 1KAGA 3O8DA 3MWKA 3HPRA 3QEJA 4TTPA 4C9BA 4BFXA 3WYGA 2P6UA 5EXPA 4ZKEA 1R0XA 2ZYUX 1OIXA 4HLQB 2PEYA 5LDDC 3AVQA 4M4SA 2FZLA 3NTUA 4M22A 2ZE7A 4X8HA 3VR5A 3LBNA 4URUR 1XMJA 3BORA 2FSHA 1IQPA 2ZRPA 4V0KA 5GADl 4AIIA 2FFHA 3F3YA 5CDFA 5F9HA 2DFNA 4QXAA 2PZEA 4Q1EA 5J4YA 2XITA 5G3ZA 3SC3A 5E7IA 4HB4A 4JVNA 2QL6A 3OEED 1EFRA 3KQLA 4U7DA 1RIFA 3I8XA 5AWFC 5GJCA 4B3FX 3DOEA 1ZIOA 3ND9A 2WJHA 4WZ6A 1G8HA 1TL7C 4D26A 3QKRB 1S3SA 5KSPA 2OILA 5EE3A 4A0HA 3QE0A 1W7AA 2EFHB 2ZJ5A 3LDAA 3GCGA 4I4LA 3WHKA 3GLGA 3A6PC 5GVSA 2C5LA 3TW8B 3DEFA 4KVGA 1DAKA 3RS7A 2J1LA 2G83A 4BFWA 3PJRA 5LB2A 3G0HA 2N46A 2QQEA 5FI1B 3KQUA 2FH5B 4BLRA 5IK2D 4PHTA 3MFYA 1Q1QA 3E70C 2BCJQ 1T3LA 4FCTA 3OIWA 1G4UR 5EUMA 4Q21A 3K70D 3IBYA 4LPSA 3VR4A 2WVJA 3LO5A 2IF2A 4TWZA 4HDCA 5HE8A 1E2HA 4US2R 2ZE6A 2DY1A 2P65A 2VA8A 3OFNA 4TZ0A 2HJGA 4US1R 5EE5B 1IOZA 4IVQA 2G0TA 4V0MA 1CLUA 4PC2A 1LF0A 5AJZA 2CK3A 2OT3B 2GK7A 1YZUA 2BJWA 4KFSA 4MKIA 3AGPA 4YDSA 1BMFD 3QXCA 5JI2E 4QBIA 3AVXA 1X1SA 1OXVA 4BZXA 4M0LA 4AKEA 3NHAA 2GILA 2JJ1D 3O8BA 4Q4JB 2I3BA 1NMZA 4GRAA 5KNCA 1E32A 3LQRA 4GL2A 1QVAA 1KKMA 2OXCA 2WWYA 3PEVA 421PA 4Z51A 2GJ9A 4PO1A 1T8UA 2WTUA 4A15A 3CF0A 3F0TA 3WMEA 2RGGA 2H16A 4F4JA 2ZUBA 1P2SA 1AK2A 4LJ9A 1AS0A 2RGEA 2IBMA 1RYFA 2WAYA 4LJ5A 1MABA 2L0XA 4GDFA 3FTQA 2IC5A 3K0SA 4IRUB 4AI6A 5DN6D 1G291 2GZHA 2VEDA 4DSNA 4LBVA 2CJWB 4AKGA 4M1MA 2BIFA 2F43B 3CZQA 4NU0A 2ONKA 1Z22A 4ZIRA 1KMHB 4A0FA 5AJWA 1E99A 1R8SA 1DEKA 2AK3A 3V00A 4LYAA 3ZQ6A 4NYJR 1KO8A 1NF3A 4US0R 4XD7A 5EZ6B 3V4FA 1XRJA 4N3NA 1W5SA 1Z07A 2CVFA 4C0BA 1KK0A 3FPAA 3A36A 4QOSA 1ZRHA 3ZVRA 5KYKA 4L9SA 2FPKA 1W49A 1Z8FA 1KI6A 3FMPB 2RHMA 2FFQA 2PZFA 3ZZ0A 5AK0A 2NMVA 4L15A 1JEDA 2QMUA 5DH9A 1QHHA 4NCIA 3RLFA 3CBQA 1YZNA 2EU8A 4FMCF 3TE6A 2CEAA 4MKFA 1G1MA 3L0SA 5FPHA 1VPLA 1GKIA 3IPYA 5IRCD 5L3VA 1W0JA 4AK9A 3MCAA 3QVVA 1GDDA 4M1KA 2JLUA 3AVUA 3U7HB 4DZZA 3AF2A 1KI8A 1HYQA 2VSXA 4OK5A 4RSGA 3OEHA 1FX0B 3ND8A 1W46A 3KJHA 1G20E 4FINA 4OHWA 3DKPA 3TSOA 2WIBA 5FL7D 1U99A 4MYCA 1QVRA 2DCUA 2V4ZA 1XZPA 3ICQB 1NBMD 2R8RA 2MMGA 1G3QA 3A1SA 4TQAA 4DLYA 3RHFA 3GLGE 1OFHA 4PR0A 1SKYE 2CLDX 1IXSB 3P4YA 2V6IA 2XTZA 4LYFA 4QL3A 1S9HA 3FGNA 4Q9IA 3U44B 1KMQA 3LFUA 5AUPB 4CZ2A 1Q22A 3W3AA 4ASUD 3IEVA 1TQ4A 4TN1A 3Q5DA 3KFXA 1SHZA 4JT2A 4PHGA 4UNRA 2OUKA 5JRJA 4ZV4A 3KTAB 2O0KA 4JYCA 3R9IA 5M04A 5EP2A 2H7VA 3GD7A 1T3HA 3LVQE 3VFDA 4D0LB 4JJKA 4Q19A 4MA4A 5LB4A 1Z0FA 3UIEA 1VDZA 5TV2A 4Q7MB 1Z06A 3WHLA 4B2LA 5FTLA 5KTYA 3C7KA 4JVMA 5L3RA 2FFBA 3RWOA 3ZJYA 4IDNA 1UF9A 2UVQA 2WAXA 1ZNYA 4F38A 1W47A 4Z8YA 1ZM3A 2ZVPX 3PFIA 2ZRCA 4MGYR 2FGJA 3K0FA 2HCBA 2N42A 4JBWA 2FWRA 3LA6A 4TQUS 2GKSA 1P2TA 1SVOA 2ODWA 3QPWA 4EFMA 2W6IA 3NC1C 4XWOA 2AFIE 3KKQA 3U5ZB 1NVXQ 1W0KA 4V0LA 1RKBA 1NMXA 3EA0A 1E9EA 1T3SA 3QPUA 3W5JA 4PO8A 2ONJA 4HZIA 3TSZA 1F2TA 1VCMA 4AKIA 4NL4H 4DB2A 4XTCS 4DLSA 5J47A 2ZRFA 3DDCA 2ZRDA 4Q9KA 1JXOA 1DAMA 2OXRA 3SBDA 4TL8A 5EXTA 4G5QA 2ZSEA 3FYHA 1NNEA 4KVAA 4RKEA 3KXIA 5DE3A 4IFEA 2O8DA 1FOEB 4A0RA 4Z1MD 4ZDWA 1OIWA 1JR3E 1XMVA 2IXEA 2ZRHA 4DUGA 2TMKA 1M8PA 5ANRB 3IKJA 3B82A 2F1IA 3THXB 3AF1A 1QG2A 3BH7A 1EWRA 3PV0A 4YXWA 1JQJC 3EX7C 3AB3A 4XVUA 2IEYA 3KZ1E 3WRYC 2O8DB 1AQUA 3CUEF 4ILEA 1K6MA 4WIAA 3BRWD 3B1VA 4NTZA 3KQKA 1LVGA 3SYNA 2Z0MA 2JATA 1EXMA 3D3QA 4AC9A 3H1TA 1N5JA 4B74A 5EP3A 5SZJA 3TR5A 2O52A 3WMGA 4B76A 1DELA 1ZNZA 1OSNA 1SGWA 2WJIA 3KKOA 1OH7A 1SQ5A 4C0LA 3RRNA 2XJ4A 3I61A 4DEYA 4FMBB 4R9UC 5FL7A 4QGAA 1W4AA 2CHVA 5TY0A 1XXHE 4FWTA 3ETLA 2QN6A 3KQHA 2H92A 3T5GA 2ZIAA 3SNHA 3GJ3A 4FIDA 3THYA 1GILA 2ZJ8A 3MJRA 2IYQA 1VCNA 2QGZA 2XEXA 5EE0A 3VQTA 2QY9A 3N70A 2QTFA 2OFXA 4BFSA 5JSZB 4M21A 4A1FA 1G16A 5CB8A 1NVVQ 3TR0A 1VYVA 3BIFA 1MRSA 4ON9A 4IDPA 4Y0AA 2O8CA 5F98A 1BIFA 4GOXA 1E2DA 2IWHA 4H9GA 1NG1A 3QF4A 1S0UA 4Q18A 4X8LA 4EFLA 1ZYUA 2V7QA 3KXLA 1Z3IX 4B48A 4B71A 1KMHA 1E69A 3AF3A 1M1YE 3DO6A 4PANA 1JB1A 1M7BA 1XD8A 3FHCB 5CK5A 2Z83A 1YQTA 3ZS9A 2P67A 2JIZD 4N1AA 4ESVA 4KO8A 2FMXA 2VYFA 1KIMA 2A3RA 3WNBA 4BEBA 2V1XA 3LVRE 2CDNA 1E1QA 2C9YA 2WWHA 2WWIA 4GZMA 1P4SA 1HQYE 3DM5A 1G64A 4DUGD 2JJ2D 2RKOA 3LNCA 4GOJA 1E2GA 3RABA 2AXNA 4JMPA 4NP6A 2ZJ2A 2AD5A 5AJXA 2D7CA 1L7VC 3E2IA 1Z0DA 1IN4A 3SN6A 1L2TA 1P60A 2Q9CA 3B9QA 2DYKA 5AJVB 2IYRA 3IO5A 2C77A 3L0IB 2O8FB 3IHLA 2A5GA 3BE4A 3FDIA 2ZANA 3HU2A 1TEVA 721PA 4II7A 3AF0A 1I2MA 4A6XA 4A2WA 2AKAB 1AGRA 1ZUNB 1FTSA 1HY3A 2Q3HA 4ZDKA 1CR4A 4BRUA 2MMCA 3A37A 2XZLA 1S2MA 2F1HA 2GCOA 3THWB 5J4HA 1NJFA 3A1TA 3MRSA 5BQ5A 2OHFA 3LAWA 1E9BA 4FCVA 2G6BA 1S8FA 1IY2A 1N6LA 2OSBA 4WA7A 4JIMA 2UZ3A 4EUNA 5BYJA 1X3SA 3K1JA 3PQCA 5IT5A 4KU4A 4V03A 3JVVA 1MO3A 4N0DA 1XMIA 5L8VA 1IHUA 1KGDA 4GBMA 2BM1A 1SVIA 2F55A 4R2HA 1MH1A 3X1YA 1II0A 3F5FA 1N0UA 3FMFA 5JRZA 1PLKA 4HATA 3TLXA 3GLFE 5EE1A 1QHIA 1HA3A 4NYMQ 2FDCA 1GITA 2OV2A 2QI9C 1JAHA 4RJLA 1GL7A 3U3KA 4GMXA 1E2EA 2VHCA 4KLNA 3R7WB 3X1ZA 2WWWA 2GBLA 4G5OA 4G5RA 1U8AA 2EQBA 4JT4A 3ZD7A 2Y8EA 2ZE5A 3PEUA 2LWIA 4XD7D 2CCJA 4Z8XA 1DE0A 3SR0A 3TVTA 4QG7A 1MT0A 3D6TB 3PIRA 4DCSA 3ADCA 2G3YA 1E9CA 5E95A 2W0MA 4BPBA 3E1SA 3CX6A 3THOA 2WV9A 4WAUA 2HT6A 1KO4A 3QXSA 2OESA 4TYQA 1CP2A 1KK1A 1Q3TA 2J0UA 4G0NA 3RS0A 3U3RA 4C0JA 3GPLA 4C7OA 2VTKA 3BFXA 2W6ID 4Z54A 1T5IA 3CF6R 4MGKR 1AZTA 5AUQA 2QPOA 2PCJA 3ZQJA 4G5GA 2QBYB 3CPEA 4GP6A 2BOVA 1G8FA 4DLVA 3W90A 2H5EA 4OQXA 3W34A 2YKGA 2PT5A 2RMKA 3AGQA 4RCZA 3C5HA 4D4KA 1CJKC 4P4TA 4LCBA 1WA5A 5JWOA 1VHLA 4YDHB 3BBPA 3DHWC 1W0KD 3EC1A 1ZM9A 2HLDD 2QAGC 3LH5A 4OHZA 1ZJ6A 2J0QA 3BJIC 1OFUX 3K70B 1KDPA 3RANA 4QC2A 2OZEA 3IGFA 4B3XA 1KSGA 1XXHB 4DEXA 3PUXA 4M9QA 2RH5A 1E6CA 1ZIPA 4ZI2A 1W2HA 3CRVA 1I4DD 1X8KA 2BBSA 4DC9A 4Q01A 1G17A 3MSXA 2QPAA 4OK3A 2HV8A 4S2EA 4BECA 5JCPA 3ZZUA 4EPTA 3WBJA 5EP4A 3TMKA 1AQYA 1QZXA 3QUSA 3W6NA 3BH0A 2GCOB 1KK3A 4IFBA 5G3YA 4WXRA 3MUFA 4HAYA 3MJHA 4I1SA 1NBMA 3F8TA 1FQKA 2Q21A 3QSYA 5KDOA 2G1KA 2A5YB 3VHLB 3T61A 1TADA 3O8CA 1PZNA 1QHNA 5GJWC 1W1WA 3K0EA 3Q8XB 1G18A 1X1RA 3AKCA 3EZ2A 3QY0A 3AUXA 2YHSA 4KXFB 1WP9A 1KY3A 2R6FA 4EDHA 4UJ3A 3EARA 1EFUA 1P9WA 2ZREA 4PHHA 3V4RA 1Q12A 4QNRA 1OKKA 3DL0A 4MITA 3QVUA 1LY1A 3ONWA 4DLXA 2O8CB 5J4VA 2ANCA 1X8JA 2QMOA 1RE0A 3TBKA 5D3QA 3U60B 4BZQA 1E9SA 2YWEA 1G21E 4O25A 1W4BA 2AL7A 4TTRA 2IYTA 3L43A 3ZLJA 3SFZA 2H57A 3GLHA 2ZVQX 3S1AB 1E2PA 3TIFA 2VP4A 4P32A 1UKYA 1RJ9A 4XTRA 4AYXA 1HT1E 3AVTA 3CPHA 3TNFA 4TYNA 1ZM4A 2ORVA 3TGPA 3PUZA 2NO9A 4HYYA 4BLQA 3I4LA 2PL3A 4JSYA 1XBTA 4G01B 2NG1A 5BYKA 4B32A 3A1VA 3NWJA 4NDZA 3KFVA 4XOIA 1SXJB 2F43A 2IA5A 2N1BA 5DI9A 4CYMA 2AWNA 1N5LA 4IDQA 1CJMA 4D4LA 2HUPA 5KSYA 5B2ZA 3B78A 1MKYA 1KAOA 1R2QA 1VG8A 4ZPXA 2VP2A 4AYTA 1RRPA 2Q3MA 1TUIA 3O47A 4IVPA 3U3JA 5A0FA 3GJ5A 5EE9A 4IXMA 3FHTA 3AUYA 4LV5B 5G41A 2WKPA 3Q7QA 4IJMA 4MDFA 4F91B 4TYWA 4LBYA 4KITB 1KI4A 4MRPA 1XF9A 1E2JA 3B2EA 2QROA 1XNJA 1IONA 1SVSA 2D2FA 1FMJA 2ZRIA 4LBWA 4Z1MA 2WJJA 2GAOA 1LV7A 4TMXA 2ZQ5A 3K8YA 2PX0A 2ZRGA 2H18A 2YV5A 2OBNA 1XU4A 3SQXA 2GDJA 1Z2CA 3CRMA 2YZ2A 2VRWA 1LB1B 1XEFA 3CM0A 1E1QD 3THWA 2IS6A 1X8LA 1YKSA 1AKYA 2V1UA 2O0JA 5CLLA 1G7CA 1KDOA 1U0LA 2VP5A 2DBYA 3BB4A 2WWGA 3GEEA 3KDSE 4NKRA 4QHYA 2F7SA 1XPOA 4V0OA 2R44A 5GJVC 1HQCA 4R7ZA 2JJ2A 3RWMB 4O3MA 2XAUA 5AUNB 4V0NA 4BFYA 1UM8A 1NMYA 3GJXC 5FBWB 1SULA 4QKQA 2JJ1A 3U2QA 1J99A 4CF7A 1B23P 3GFPA 2ZJZA 4KYUA 1E79A 1TQ2A 4RD2A 4Q4JA 1KI9A 1FP7A 3M1IA 2RHDA 1P61B 3H86A 1TF5A 1XTRA 1U9IA 3GJ0A 3OAAA 4HUTA 1H8HA 3ZVMA 1CTQA 4ACBA 1RPZA 4DDWA 2W83A 5JCZA 1RRFA 2IEZA 3IIJA 2ODEA 4PTLA 3R9XA 4RFVA 2FSIA 4HLUC 3PUWA 2XB4A 3HYTA 1A2BA 1UEIA 4KFTA 1G19A 4PQYA 3MGCA 1VMAA 4R71A 4LV8B 1AS2A 1XD2A 2J3EA 1D9XA 4TMKA 2P5TB 1P5ZB 1E2IA 3IPXA 1N5IA 3CKLA 4B6FA 3AVPA 1AKEA 4TL7A 4B35A 4BQSA 3CRQA 2OCYC 1S3GA 4TQ9A 4GNKA 1GG2A 2PMKA 3BK7A 1Z6TA 3B1WA 3QBTA 2ZSAA 1L4UA 1KNQA 1QHHB 2PLFA 3C14C 3LBIA 2DPXA 3DMNA 2RGNC 4WW0A 3VNVA 3I1FA 1US8B 1WDTA 3SU8A 1V5WA 3NEJA 5DLQC 1PVOA 3U3OA 3LY5A 1P2UA 3OZXA 4RFSB 5F3WB 3IQXA 3VR1A 1F2TB 3E5HA 1CR2A 4L16A 4NYIR 1EWQA 4RZ3A 4RKFA 4UNSA 4DIDA 1KHTA 2EFGA 4NZYA 2UKDA 1Q0UA 4PZYA 1JJ7A 4LJ8A 4ZIRB 1IJEA 3C16C 1EGAA 4LPKA 2BEJA 4C30A 4MRNA 4Q1BA 3AVWA 1E9FA 2FA9A 4IKEA 5K8IA 1P7CA 3BH6A 3MWLA 1PUJA 4PC6A 4XVQA 4W7SA 3OE7D 3FHOA 4P33A 4A6PA 1G6HA 3FVQA 2ZI3A 1J8YF 2ZR0A 4JZKA 4TLAA 4NCKA 4MKGA 2CL0X 1E2QA 1F6BA 3WXMA 2CCKA 5P21A 1QF9A 5FUWA 3CNOA 2YNMA 2QEQA 1D2NA 3UMSA 4LHWA 1G9XA 2AN9A 4P3YA 5EXSA 3GLFB 2HJVA 5J40A 1I2DA 1RVDA 3QXJA 1UDXA 3ZH9B 2ZRMA 1SXJA 3FB4A 1EFTA 3CR8A 1BS1A 2CCGA 1TEXA 2G88A 4H1UA 4KI0A 1OIVA 5CJ2A 3W5IA 3I32A 4YMTA 1OFTA 3AF4A 1DO0A 1N0WA 4YLGA 4YMUA 2OE2A 3AV0B 3X1XA 1CEEA 1G8GA 4I99A 4TMWA 5HTKA 2FSFA 2R62A 3HPQA 5DYIA 1Z2AA 1W36C 1MO4A 2VBCA 3RC8A 2AWOA 4Q5IA 1SZPA 3SEAA 1XFAA 1Z5ZA 1F48A 1ZAKA 3H2YA 1FMLA 4Q02A 2ZU0C 4WVFA 2R2AA 1Z6GA 3T34A 1R0WA 1WMSA 5JI3E 3BERA 5KDDA 5LD2B 2QG6A 3GLHB 4LHZA 2JCSA 3PXGA 3SOPA 4V0ME 4EPXA 1KI1A 2BMEA 2SHKA 4M1WA 2GCPA 1P62B 1Z6YA 1YE8A 3LX5A 3FFBA 2GJKA 5B30A 1OJLA 4L4UA 2KBEA 5GVRA 4LY6A 5DHFA 1AJEA 1DG1G 2IUTA 1VTKA 2I1QA 2HF9A 3CX8A 4PC3A 3X2SA 2IXFA 3QF4B 1W36D 1NL3A 4EJSC 2F9MA 3WY9A 1YZKA 2IHYA 3VR3A 3ZS8A 4OQFA 1OV4A 4QHSA 5FUVA 2BHRA 1F5NA 5C18A 4WOPA 1NIJA 2D7DA 4AD8A 4XH9B 1NN0A 4RD0A 1XCMA 4CEHA 5FOVA 3L2OB 1MABB 4OBEA 3KTAA 3A1WA 1IAQA 5H68A 3AKEA 2XTMA 3T1OA 1QDEA 4U5XA 3H0KA 3K0AA 2YOGA 5L3QB 1WB9A 2QAGA 3ZDQA 1S96A 2ZR9A 3Q7PA 3OESA 4DWJA 2DHRA 5BN4A 2PJRA 3NBXX 4JLNA 1ZC4A 2WMOB 1YZGA 2XNSA 5KNDA 4QJ4A 1Z0JA 5TXGA 2RGDA 3CW2A 1GRQA 1HTWA 3QIAA 1OH5A 4U00A 4NHOA 3LD9A 2P6NA 3UWOA 5IK2A 1EFRD 4W5HA 3RC3A 1M7GA 2W2TA 1IXZA 2QAGB 4XWKA 3LXXA 3SJCA 4K81B 3VU9A 5E3HA 2GZAA 3CIOA 3U6BA 3KXKA 1ZU4A 2YOFA 3QG5A 3I8SA 2Q3FA 3KB1A 2O8BB 4JLMA 2QM8A 1KDTA 1N6PA 1WCV1 1T8TA 5BWMA 1NVVR 5C1BA 3D31A 5J5CA 2J7KA 3BFKA 3RSLA 4EPRA 1Z6AA 4C0HA 1P9RA 2KJQA 1NN3A 2HYIC 1D6JA 2IL1A 1KK2A 3CNNA 2C78A 1R8QA 1T0HB 1N6HA 2ZYWX 2Z4RA 4IOLA 2NO7A 4MRVA 4BGDA 4JBYA 1E4YA 4GPTA 1JECA 1OW3B 1G7SA 1OXXK 1UADA 2ZTSA 4LJ4A 4Q4HB 2KWIA 1NSTA 3BC1A 5JBQA 5HKKD 2MSDB 4RZUA 1U8YA 2DWPA 1P73A 2WKRA 3AEZA 3IUYA 4MUAA 4DCUA 2DWQA 3UXMA 4EFNA 5C46F 1XJ0A 4L8GA 4D0NA 4IEEA 4I81A 3DM9B 3OAAD 4QGFA 3ZVNA 2B21A 2ATXA 1JALA 2QMEA 4FW9A 3PUYA 1UKEA 3NXSA 1IN6A 4LYJA 1TAGA 3ZZTA 1TTTA 2X2EA 5IDVA 4DSUA 2A2ZA 3BFVA 3FOZA 2QNRA 4A2QA 5C4GB 2C95A 3AH8A 4MQBA 1WBBA 1KTVA 4LJ6A 1KOFA 1GSIA 1XEWY 3SYKA 2R6DA 1PV4A 4NCJA 3CLVA 1XX6A 2F9LA 3DPUA 4UXJA 5CK4A 5FH9A 2RGCA 2IT1A 2GK6A 3DMDA 4KBFA 1GOTA 4C2UA 1NVUQ 2IUSA 1H8EA 3BGWA 4C0SA 3HDTA 3QKRA 4WZAE 2RB4A 4QFMA 1IXRC 1FPMA 2VHJA 4PSAA 5DYGA 4PHFA 1IY1A 3HYRA 4NCNA 1OYWA 2VSOA 3AVYA 4M9XA 5BN3A 4HDOB 5FFMA 5JSZA 3KX2A 1EG7A 3SHFA 3TQCA 4GMDA 2BWJA 2WJVA 3NIBA 3H84A 4Q48A 4NYJQ 1EX6A 3NDPA 3RNLA 3OIVA 2GVZC 2O8FA 1XD2B 5FBVB 3Q5EA 3U4QA 2RGAA 3KJEA 4DXAA 2QP3A 2ZJYA 2OFOA 2WWXA 1G3IA 3QF7A 3I5XA 1M7HA 3R20A 2J0VA 4IDOA 4KCGA 2ZXUA 5C4MA 2IYZA 1E79D 2X8AA 5KDLA 2PX3A 1UBEA 1EX7A 2ODNA 4DDVA 2ATVA 1O87A 3MMPA 2ZUDA 4Q4LA 4S35A 2WIAA 4NMMA 1GRRA 5FBRB 5FPTA 4ZCLA 3TW4A 4IHQA 4ERNA 2H8KA 1N6NA 2YC2C 4TMZA 5HPYB 2GJ8A 1CJUC 1LF5A 2FN4A 4MGIR 2CLSA 1OT3A 2CL7X 2KB0A 4PQFA 4HAUA 3ZVLA 2CNWD 2XSZA 5FTNA 2RCNA 4XVRA 3D8BA 4PFSA 4OK6A 2G0NA 2IX3A 3D7MA 4AY2A 5CLQA 4DLUA 4R98A 1R5OA 4UKDA 1U90A 1CU1A 2GHIA 1E2NA 4UNNA 3SJAA 2BMJA 1R10A 4AYWA 4BFUA 1N5KA 4EPVA 3ASZA 3EPLA 1ELOA 1TU4A 1DADA 4WXPA 4QGGA 1N6RA 4PPQA 1T4GA 2F3TA 4JL6A 4E03A 1GKYA 1A2KC 1N25A 1ZUIA 1CS4C 3CNLA 3P20A 4OJQA 1VECA 1SVLA 3AKYA 1RW4A 1SVKA 1GNPA 2AD1A 3EAQA 2CJWA 4UQOA 5DN6A 1XCPA 4RD4A 1DO2A 1QRAA 4B2PA 4LZZA 2W00A 1UAAA 4PX9A 3THYB 1S9DA 3CRW1 1J90A 3PG5A 4D6PA 1NY6A 2X19A 4EIWA 4R2IA 2V8OA 3CZPA 3BOSA 1OXUA 3Q72A 3U44A 2FGKA 4CEHB 5C2JB 4M8NE 1XTJA 3ICEA 2BC9A 2VP6A 4JS0A 1F2UB 3QEOA 3WYAA 1TF2A 5SZHB 4EQ6B 1CR1A 4Q9JA 2XOKA 3TJZA 4OJKA 1H8HD 1T5LA 2XTNA 3U6KA 2WBLC 3SDZA 3DKVA 1ONBA 4BWYA 1KSFX 2PEZA 4BE7B 3M0EA 1XXHA 3NH6A 4AG5A 4BFZA 3AP2A 4A82A 3IIKA 3NBFA 2E9SA 3T15A 1VYUA 2R9VA 3B8HA 1ZC3A 3T35A 2VHTA 1W4CA 4JL5A 2ZU6A 1N2CE 2CHQA 1FL9A 2QTHA 1U2RA 4TL6A 4W5WA 1XEXB 4G1UC 4LI0A 3ZD6A 3NBZC 3HJNA 5CYOA 3RSOA 2O0HA 1BYIA 1KZ7B 1PLJA 4B6EA 2OG2A 4M53A 5EXXA 3WNCA 2C2HA 3NBYC 3A4NA 2HXSA 2CVHA 3RRYA 2IHBA 1KI6B 3MG9A 2ANBA 1Q3HA 3PVSA 4A8JC 1Z0IA 2GXUA 2C03A 1KKLA 1J70A 4ACAA 4DT1A 1Z6XA 5G40A 2B7BA 2VPPA 3DOFA 1OHHA 4LHVA 2IS1A 4LOAA 2ZJBA 1G8PA 4QM7A 3IQWA 2ZSFA 4C0QC 2IS2A 2FOLA 4CIDA 5JS8A 3I72A 3LXRA 1MRNA 3W8NA 4ESHA 3Q3JB 3U3MA 2NO0A 3U7EB 5J4LA 1FUKA 1KO1A 5H1YA 121PA 1PJRA 1F3OA 1YRAA 1JR3D 5DI3B 3QPVA 1Q44A 1VG9B 4M1YA 5FBQB 5CIQA 4FI3C 4QBGB 2K5UA 4E07A 2E1RA 5AUOB 5TMPA 3B6EA 1Q1BA 3CX7A 3B9PA 2J0SA 4IDHA 2CE7A 4D80A 3GEIA 2JGNA 1U94A 3MLEA 3U4QB 3FWYA 3CH5A 4PC7A 1T6NA 1YR7A 3LWNA 3FKSA 5A4JA 3T12A 3K0CC 1G3RA 3BXZA 4Q1AA 5D3MA 3VAAA 2D4HA 4OI1A 4MRSA 4AG6A 1KSJA 3K9LA 4JVLA 4I1UA 1XD9A 4EJSB 1CRQA 3ZYCA 1I4TD 4M9SA 3X1DA 2FV8A 2P2LA 1Y3AA 1DS6A 3TKLA 2BV3A 4GZLA 2UZIR 2B8WA 1TMKA 3LW7A 3ADDA 2OBMA 1G6OA 3I3SR 3OIYA 2ORIA 2ZAMA 4YONB 2NTYC 2KI5A 1GL6A 2P5SA 2ZJOA 4URXR 5D3MB 3DZDA 1JJVA 1SHKA 3T1TA 4TLCA 4WBSA 2QUZA 4F93B 2BKEA 5LD2C 3R7WA 2GNOA 5HR5A 2WPDD 2ERXA 2OBLA 1ZNXA 2J9RA 1SVWA 2ZEJA 3HU1A 3I73A 1U9IC 2CE2X 1B0UA 2J59A 1BO6A 2J7PA 1WQ1R 4UXHA 1CBUA 3K53A 3N2EA 3BB3A 5FL3A 1G4AE 1GAJA 3PEYA 1TPZA 1ZD8A 3K09A 3PITA 3TVDA 3NC0C 1LNZA 3JVUA 1KI7A 1U0JA 4X8OA 1KO7A 5L3SA 3UKDA 2WZQA 2WJYA 4TYPA 4TT3A 4BLPA 2IYVA 3VR6A 4D4JA 3C15C 4OQNA 3TRFA 2JA1A 2J46A 2R6AA 2OCAA 3CO5A 1ZD9A 4B75A 5JLJA 2C96A 3VTKA 2QT1A 2W6JD 3WP1B 2QT0A 2O8EA 2ODBA 2AX4A 3NVAA 2WICA 3OIUA 2ZYTX 3PUVA 4RVCA 1ESMA 4B3CA 1LS6A 1E0JA 3MAAC 4LRWA 5L3SB 4RY2A 1AZSC 1UDWA 2MSEB 2Z4SA 3EZFA 1R6BX 4C7OB 4PPNA 2REBA 4DVGA 2AR7A 3WP0A 4HLCA 1E3MA 3IO3A 2GXQA 4QM6A 2ZS8A 2QRNA 4ZDJA 1GM5A 4K46A 4IVRA 3I92A 4F4CA 2JDIA 2ZRLA 3K09C 1E0SA 4KYIB 3KB2A 2RGXA 5CB6A 4IXNA 4XSHA 4G3XA 1KYIA 1UPTA 3N2IA 3RS4A 1LTQA 3CONA 2ZSDA 5FPKA 1R0YA 1YU9A 3B5JA 1E9RA 1ODFA 4Q9LA 4DB4A 4E09A 3B13B 1C9KA 4KFRA 3J81k 4JLDA 4HB0A 4RD3A 5CDFE 2QSYA 1NLYA 3KJIA 2W2VA 4ZO4A 1FUUA 3CR7A 1DAHA 3GJ8A 4CVNA 3G5UA 1XDBA 2BCGY 1DOAA 1E4VA 1E0KA 5FR1A 1FFHA 3M6AA 4LJYA 2XZOA 4CGZA 1EK0A 2XB2A 2J5XA 3EXAA 1CF4A 2GESA 1VCIA 1HT2E 2OAQ1 1CKEA 1IY0A 2VHUA 3QKUA 3UG7A 1GNRA 1GTVA 1UKZA 2NO6A 1ZINA 4FMDF 4RZ2A 3REFA 5BXQC 1KJZA 3SI7A 3NDBB 2IF0A 1LW7A 4D81A 2ZI5A 1N0VC 1IJFA 3ZGXA 2HXYA 4MH0R 4LBZA 2ZR7A 3EZ9A 1WE2A 3R8FA 2B92A 1ANKA 2JLVA 1NLFA 1KJYA 3G82C 4UNPA 4YC7A 4C4PA 4EAQA 2Q9BA 1KY2A 1W0JD 2GEVA 1FX0A 1AS3A 3ADBA 4HZUB 3HWSA 1CJVC 3PEWA 4KSBA 3T5DA 1E98A 4HB3A 1DTSA 1COWA 1VG1A 1W4RA 2QQ0A 1E2FA 2V55B 2KBFA 2CLCX 3GJ4A 4P4SB 4QGHA 3SS8A 1HUQA 3GJ7A 2BBOA 2JASA 2NZ8A 3BAFA 5L3QA 4A8JB 4O2LA 4UNQA 3QKSA 3GLIA 3OEHD 4L9WA 1A5TA 1YZTA 1E1RA 4OHXA 3A8TA 2GWHA 2ZJAA 4B33A 2NGRA 3IBGA 1HV8A 1SVMA 5KPJA 2OCBA 1XB2A 2GZDA 4IW3B 1DBSA 4IOMA 2EFEB 2ORWA 3A4LA 1GL9B 1G8YA 5KO2A 4CDGA 3GFTA 2FNAA 3MWJA 1D5CA 4URYR 1US8A 1TUEA 4IOJA 2GF9A 2W2XA 1TQ6A 2A5FA 3N5CA 4RD1A 2FPMA 5HCIA 4DLRA 1ZU5A 3LLMA 1A4RA 1U0HC 2ZAOA 5E7JA 4M9ZA 2A30A 2QAJA 1UBGA 3BS4A 2IYYA 1I4LD 5FUYA 4YQFA 5UKDA 4HAVA 1NLZA 5FPYA 4BUJA 2AHOA 3EPHA 4DIEA 5JJIA 2BEKA 3RS3A 4NCHA 1XTQA 2G1JA 4LUCA 3HR7A 4PZZA 2ZSBA 1NN1A 2QRZA 3MD0A 4M2LA 4KODA 3NKVA 821PA 4LC0A 5TARA 1J7KA 4P4UA 4KV9A 1HE8B 3VKWA 2IYLD 2YYZA 5JWRA 5BN5A 3HP1A 4D25A 2FEOA 3LLUA 1M34E 3UMRA 2GETA 1XEXA 2QP4A 3ECCA 4PO9A 3O8RA 5FTMA 1GWNA 3KKMA 2WJGA 4M1OA 1XWIA 3FMOB 1BMFA 2A5DA 2FFAA 2GBLC 3C8UA 1FTNA 1NKTA 1SXJD 4FN5A 3I62A 2HEIA 4EJSA 4DKXA 1K5GA 2ZS9A 2GRJA 2G9NA 2ZRNA 2WHXA 2ZI9A 3M4YA 3EASA 4DT1B 4FXPA 2VO1A 3REGA 3GP8A 1QHYA 5E7MA 5H70A 4QRHA 5EP1A 3QXHA 2REOA 3ASYA 5JS7A 3RDPA 2I4IA 3ADKA 4ZDIA 4A36A 3PENA 221PA 1NP6A 2AXPA 1N3BA 1GZSA 2IXGA 3U7GA 3SJBA 2ZRBA 4NE2A 4EPYA 2JLSA 1TNDA 2OFWA 3SZRA 4DSTA 4YMWA 3L0PA 1OKKD 3GLGB 3EPJA 3K0AB 2WSMA 1YZQA 4KHZA 2JLZA 2YINC 1M74A 1YZLA 4HAWA 4TTQA 2JLRA 3L8YA 4JKYA 4XIGS 1E1RD 1P75A 2LCFA 3CWZA 521PA 1PLLA 4Q47A 1OB5A 4JJZA 3BWDD 3WRXC 1BH2A 1SXJE 1NKSA 4DLTA 2YWGA 4WZBE 4TZ6A 5F9FA 1ZBDA 3WBKA 4PPFA 2VF7A 4PAMA 4B43A 2F6RA 4TL9A 5JZVA 1S1CA 4O0MA 4LX0A 1VCOA 3VR2A 2GJSA 4TLEA 4QJ5A 4HB2A 1RZ3A 2JDID 4MYUA 1Q57A 1YR9A 3UPUA 1ZCAA 3AVOA 3U61B 1MO6A 4JLAA 5DIFA 4OI4A 2DR3A 4FCWA 2V9PA 5BW8A 5H8WA 3K9HA 1T9HA 3VMFA 5FTKA 3HR8A 3B85A 1NVWQ 1D2MA 3A1UA 3Q85A 1E2MA 4Q66C 4TSFD 5EQTA 1TQDA 4G5SA 4HI0E 1R7RA 2G77B 4OQLA 4W9MC 3TQFA 2FE4A 1A1VA 1VHTA 3AM1A 1UBFA 5JHHB 2CBZA 3VHXA 1Q1EA 5KHOC 3L82B 4LHYA 3SFVA 3UATA 3OF5A 1RFLA 4PPGA 1PUIA 4X8MA 4GSYA 1FNMA 2WMNB 2JLXA 1KI3A 4GP7A 5KSOA 2BJVA 2NQ2C 2ZM5A 1G41A 2BMFA 2YWHA 5FPSA 5A5GA 4ZI3A 3C5CA 3EZ7A 5LBIA 4A92A 3OE7A 2QTVB 1YJ5A 5FBLB 2W0SA 3FKSD 3SYLA 5CYPA 5K8LA 4CEIA 2O8EB 3EWSA 1IN5A 1JAIA 3IIMA 2A9KA 2ZRJA 3NEYA 5IF9A 2FX3A 3AP1A 4LGMA 3W8RA 4QBFA 1P2VA 3KKNA 2QGNA 5FR2A 2PZGA 3K9NA 1OYYA 2FJUA 2OAP1 5B64A 1C4OA 3C4JA 3QG1A 2EW1A 2WWFA 1OB2A 1Z0KA 2OLJA 1JNYA 4CW7A 1CIPA 1KSHA 1SKYB 2VLIA 5B58C 1II8A 2GA8A 5TVKA 4W5JA 1W48A 1H8ED 3QQ5A 3A58B 2D2EA 4MDEA 1R5BA 1P6XA 3P1JA 4DCNA 1P9NA 4K8OA 1HE1C 1QHSA 2P0EA 3QI2A 2IWRA 1F60A 1D9ZA 3SBEA 3UMFA 4C2TA 4OI0A 3T1VA 3UWKA 1CULC 4GOKA 4FWIB 1WXQA 4MUBA 1E2KA 1Z0AA 3AKDA 3GEHA 4JL8A 2VSFA 4LK2A 2NPFA 4B34A 2ZRKA 2HT1A 4BFVA 1NRJB 1Z29A 2QA5A 1JR3A 1RRGA 4PZLA 4D82A 2C98A 2PLRA 2NPIA 4Q7JB 1JEEA 4OHYA 2HF8A 1O3YA 4B44A 1H65A 4CRWB 1HURA 3QKSB 1NY5A 1UEJA 4E22A 2PMDA 1J2JA 5EZ5A 4OQMA 1FQJA 3THXA 1W2GA 1ZD1A 3B60A 4UXIA 4TLDA 3K0FB 4Q00A 4F92B 2DWOA 5KSZA 3RS5A 1KNXA 5JJKA 1OF1A 1QG4A 1QHXA 2HYDA 4URZR 5TB5A 4HUQB 2WM9B 1NIPA 3ZIAA 2GF0A 1ZM2A 2EVWX 1OXTA 4EPWA 1AIPA 1RYHA 1MR3F 4BLTA 4URWR 4NH0A 3RYTC 3SE0A 621PA 1IN7A 4TSFA 2PT7A 4Q4HA 1R5NA 1YVDA 2P3SA 2VIIA 3KKPA 4LC1A 4A4DA 3SHWA 2ZITA 1ZUHA 3PR1A 4AWXA 1ZP6A 3GQBA 4C0AC 2GEUA 1G3MA 1K5DA 2ZROA 1WRBA 4ASUA 4MYTA 5JFGA 1MO5A 1LS1A 3TUZC 1AM4D 4F7WA 2KE5A 1Q20A 2D3WA 2QMHA 4P4SA 3L8ZA 5JECA 1R0ZA 5HE9A 2R65A 1U81A 4YXWD 1IM2A 2ZYVX 2IYUA 1V43A 1ESNA 2JLQA 2XNDD 1S4QA 1IBRA 4DBLC 4EQ6A 4TLBA 2AFHE 5JJLA 2EWVA 3OHMA 1OHHD 3S1AA 1G7TA 2RGBA 5EUQB 4TMTA 3WYFA 4DDTA 5DISB 4ARZB 2GTPA 3EC2A 3JZAA 1ZW6A 2DFTA 4IEIA 3EWAA 2E87A 4HLDA 2OO7A 1M6NA 2FEMA 2QORA 3B7GA 4DCTA 4E5UA 2H1LA 4F4IA 4HEJA 1T91A 4OHVA 1S1MA 3VKHA 2W6JA 4JKIA 1ZVQA 2C9CA 5SZIA 4EKDA 4URVR 1G5RA 1Q1ZA 1U98A 3LBHA 2ZI4A 2ZRAA 4PXAA 2IUUA 3RRZA 4CEJB 4ABYA 1ZCBA 2VL7A 5CJPA 1E94E 2WSSA 2R6GA 5F2EA 1KZGB 3P4XA 4PAQA 2GAAA 2IYXA 4ZCMA 3TK1A 2NZJA 5FTJA 4BLOA 2B6HA 1ZM7A 2Q6TA 1Z08A 2IW3A 2QE7A 2A7QA 1F2UA 4XSGA 1IN8A 4RZXA 1CJTC 4HAZA 2BM0A 3T1QA 5KPDA 4Q1FA 1W36B 4LV6A 3QXXA 4I1OA 4KJZA 2WOJA 1ZMXA 1DAIA 3B1YA 3DVLA 1OFIA 1SKQA 4FMCB 5HZKA 3CPJB 4L5BA 4KAXA 3SQWA 4LJAA 2X1VA 3R9WA 3AVVA 1BKDR 4Q7KA 2BMDA 2NIPA 3FE2A 2WOOA 2Z6VA 1P3JA 1G5TA 1NJGA 3FFAA 3GJ6A 5FOSA 4CEIB 2OCPA 3C41J 3WNDA 3NH9A 3R8CA 2QPTA 3K9GA 2QENA 2B7CA 1W44A 1XJQA 2OEPA 3EIEA 3BD9A 1T0JB 3LX8A 1TF7A 4HUQA 5FOXA 2CXXA 2QSZA 2FF7A 4Q1CA 3RAPR 2BDTA 4OYHA 1XPRA 2HCJB 1KJWA 2D74A 2C04A 2CMKA 4PC1A 3QKTA 4Y0VA 5G53C 3TAUA 3VX4A 2AKYA 4KLZA 2MSCB 3CB4A 4NBSA 3KUCA 5DSZA 2A5JA 2QM7A 8OHMA 1L4YA 4DHEA 1JPJA 1JI0A 2IK8A 2XXAB 2Z5FA 3U7FB 1XEWX 4JLJA 4M1SA 1GKUB 2QU8A 5GJBA 2D62A 3TH5A 2FSGA 4GT1A 4HSEA 2PBRA 4BEJA 4D2IA 4B3GA 2BBTA 4H1VA 1RJ9B 4AURA 1AN0A 2R6CA 2XZPA 2RAPA 1VIYA 2HDNB 3CRRA 1W5TA 3AQ4A 4RD6A 2GVDC 4OKSA 1VYTA 3Q9LA 1GUAA 2I1VB 1RC8A 1Z83A 4JLVA 1E2LA 3TSWA 2J41A 5FOTA 3NG1A 4ZKDA 2ZPTX 3P32A 5KUTA 2J87A 2JLWA 3CH4B 4C3ZA 2YC4C 4HAXA 4M1TA 2V54A 3AP3A 3RRMA 1JQLB 1KO5A 4JLBA 3A4MA 4B3DA 1XMSA 2OLKA 5E4FA 4FMDB 1OPXA 2EYQA 3TUJC 1GVNB 4FD2A 1KDRA 4PAOA 4UJ5A 5TDHA 1II8B 3UANA 5B57C 5HZHA 4CEJA 4XJXA 1XTSA 1P72A 3I5YA 6Q21A 1E96A 3QENA 3CWQA 2GXAA 2CNWA 2XSZD 2VHQA 2W58A 1UJ2A 4A0GA 4B47A 1DAGA 4PQRA 1YR8A 1WF3A 1X6VA 1NN5A 3EIHA 3JZMA 4RFSA 4JYBA 1UFQA 1NG9A 2JLYA 1Z63A 5FI0B 2QBYA 3LW8A 5DI3A 4PSVA 5K8UA 2WKQA 4J0QA 4Q1DA 1CRPA 1TU3A 4JLKA 4LJ7A 4Q9HA 5JEEA 4NYMR 3UG6A 1DPFA 4OL0A 2ZI7A 2ZUCA 1NBME 3OEEA 3KUDA 2IYSA 5CITA 1DAEA 3NHBA 4CT4B 1D8TA 1II9A 1FZQA 3EZ6A 4AKHA 2OM2A 1GIAA 1J8MF 2AK2A 2B8TA 2V3CC
chains in the Genus database with same CATH superfamily
4BP1A 2GLXA 5EJIA 5DGCA 2E4WA 1VFPA 1NATA 3UA4A 1C9EA 1JXMA 4CM7A 6NULA 1UC9A 3C8DA 2YCLA 5AK5A 4ZU3A 2UUCB 2CLOB 1JU3A 1UDRA 2ID8A 2QMYA 3ILXA 4NOKA 2J4FA 4C14A 1O0CA 2JCYA 2X86A 3MJCA 1EINA 4MKHA 3EF0A 2CNNA 5FYQA 4NCAA 5JO0A 1X94A 3UXYA 2XE8A 3KYDA 4B3JA 1PFVA 3HRIA 1E9DA 1WOMA 2G09A 3VHRA 3ADPA 3TG8A 1RZRD 4LWZA 3IDQA 5KMGB 1MDBA 2FEXA 2ECPA 2MCFA 3DNPA 3UYLA 1U7HA 5FF9A 5F5XA 4HQ0A 5E6SB 4HDQB 3VNSA 4YAEA 1DT3A 5ALXA 1MB3A 1GP2A 3DUFA 2QP9X 4QU0A 2IBTA 1J6UA 4D9CA 2YN0A 4GR4A 1AGPA 5ADHA 1XDSA 1GGNA 1PTKA 3W6PA 1R5JA 4F0JA 4BB0A 3OPQA 5LM3A 5IVKA 3AINA 1MX9A 3TLZA 3RAJA 1FNNA 2CL6X 1T9CA 3FBWA 3N05A 3C74A 1VIAA 2V74B 2JFXA 5KU1A 1L4MA 4Z7NB 4ITRC 3LSYA 4DB4A 2NUPA 3E82A 4UEQA 1M1XB 3QJYA 1W9HA 1OH8A 1UP4A 4ZCTA 5GONB 1VMKA 2QN1A 5E8JA 2Z4TA 2ZBPA 2DFKB 3WWOA 1AMOA 2HCRA 4MV3A 5H3CA 1HDIA 3VX3A 4XFDA 2HUNA 4LHXA 4HMPA 4OHFA 4MTLA 2AXEA 4TV8B 4L6IA 2GKOA 2QI9F 3I9MA 4LECA 4OI2A 5TT0A 1YUNA 2QY6A 3FOCA 2YJ5A 5AI0A 5TX7A 3WB0A 5IYZB 5LMUB 3DHYA 3K1AA 3RFCA 4KOAA 3QM1A 2QV7A 5AVWA 1FW8A 1OI7A 2J45A 5K3DA 4OYLA 1SC1A 4TKVA 3IYLW 5BWBA 4MVYA 3KQNA 5HK9A 4QNMA 2BR5A 2Y1WA 2VR1A 3BIWA 3NTQA 1H2BA 3BHNA 3QNUA 1NQAO 2IFTA 5AVQA 5JZ9A 1Q5PA 1RRCA 1FDTA 3NVDA 4H6VA 2X0IA 4QHTA 5I7EA 1GGFA 2H1OA 4FD3A 4GZ6A 4WSOA 4D7AA 3UEOA 4UASA 1U8ZA 4MRMA 1JHUA 1HH4A 2JD1A 3PWKA 4IEFB 3TUIC 4TKLA 3DT9A 4Q4DA 2P2CA 3RS2A 5HWSA 3G9UA 4HPWA 2F64A 5CB0A 3ER6A 3HNPA 4ZVLA 4A7PA 2V3VA 4BTVA 4D9KA 2G4LA 5ER6A 2OZPA 5T67A 1YVPA 5TJHA 2KPOA 1H42A 3KL4A 2DB3A 2NUTB 2HWYA 1W5FA 3PNLA 1B26A 1DEXA 3PPIA 2VHEA 1ZSVA 4GE3A 1YHNA 1CZUA 1T10A 2RI1A 3H2BA 1FBNA 2ECKA 3CLRC 2IYWA 3PUHA 4FNMA 3NS7A 3WGTA 4B2IA 3QTBA 4OXRA 2QDKA 1JKFA 3EGCA 4DNQA 1JRLA 1Q21A 3PD1A 2ZS7A 4A03A 1QHGA 4NONA 5DBOA 2NQ8A 1YVRA 5LN1A 1KVSA 1VKJA 4LDJA 3LHKA 1NYTA 1EDDA 1PWHA 2IODA 4HNUA 1G6KA 2WFLB 3E1KA 1I3OA 4BX0A 1IZ9A 4XARA 3IV7A 3TRKA 1CZHA 1X7YB 1JDNA 1YL6A 3FCUB 1W19A 3EVZA 4FGLA 1VMIA 4FK8A 4MAAA 4AXXA 4DUPA 1YRBA 5HKKA 3CN9A 1WZIA 3HUUA 3UCXA 3GFGA 4KQWA 2FUKA 4K3UA 4JHXA 1ZQ9A 2PO7A 2I80A 1COWD 1E6WA 4QBHA 1NF8A 4M87A 1L5QA 4ZCIA 2OQIA 2JEOA 2ZETA 5ESRA 2WJZB 5EPEA 1T26A 3TS1A 1GCGA 4DDKA 1DT5A 4P0TA 2H65A 4M46A 5DNAA 1A72A 5DTRA 3TB4A 5ELXA 4HZUA 3MTJA 4NPHA 1DAFA 3ANYB 5FFNA 2R00A 4G0XA 4L1KA 1Q0RA 1UKVY 3A1FA 3CF2A 4OAOA 1L8LA 1E64A 2A9QA 1VRCA 2GJAA 2V6JA 1IB6A 2X77A 3ZBUA 4C4OA 2IZ0A 1QRUA 1FW6A 1G5PA 4MJLA 3MTQA 5IC6A 2Q41A 3RC9A 2IE0A 3V34A 5JNLA 5JADA 3E53A 2C2ZA 4R8SA 2Q6OA 1LDYA 4DSOA 4N48A 1EUCB 4N40A 2JIZA 3HSSA 1ID1A 3SJZA 1FFBA 2BKUA 2NU6B 2VP0A 3P26A 4F85A 1X1DA 2DOKA 2HDWA 3IHWA 2W42A 4F6CA 3CLTD 3TXYA 2XF2A 1D2EA 1W581 3FLBA 5H16A 4LZLA 4O3FA 4DG9A 4WZBB 2X42A 4PPYA 3HY3A 4DDUA 3IEUA 1R4NB 1KZHA 4EHFA 5AIBA 3JX9A 5CM8B 4EW6A 2QZ4A 4HDKA 2HLHA 3GJYA 4RCVA 3GP5A 4BQIA 5LPNA 3BB1A 5HQ3A 3FKQA 1EFCA 2Q3EA 2XD4A 1Y8QA 3A4YA 1CEXA 4BAZA 4MMYB 4BVJA 1XTUA 2XR1A 3M6LA 1NDQA 4HNRA 5DLDA 5DCWA 4B09A 3HPRA 2YNMD 3QEJA 1EFVB 4PFQA 3E8XA 3IX7A 2HQRA 3MM4A 4RE5A 4ZOBA 3P9QA 5KNBD 2QAIA 4X7RA 4LJSA 2P6UA 4WY5A 4OOFA 4WH0A 4GXQA 3THSA 1ZDMA 2EW8A 4E33A 1ZCJA 1G9SA 3ELBA 2PEYA 3B52X 3QUTA 4HLQB 4EVIA 1B4DA 2FZLA 3BWVA 2ZE7A 2YWJA 4A3SA 1P17A 4URUR 1XMJA 3H9JA 2ZRPA 4V0KA 5D3KA 3DUFB 4X62B 5AVKA 4R5HA 2FFHA 2RK6A 5CDFA 4F1JA 5B36A 2LR0A 2X5JO 3OTIA 2HSJA 1GGEA 1ZH4A 3IR5A 3Q6MA 5G3ZA 3SR3A 2QTBA 3H1EA 4PGGA 5E7IA 5EHZA 4B9EA 5JRDS 4M38A 4B79A 3KQLA 1GFZA 1JZQA 4FE7A 1BXGB 1ZR2A 4N5NA 4EY8A 2R7AA 5GJCA 2DHCA 4O4JB 2HQ1A 3RVLA 1AUPA 1Z4QA 3ND9A 1G8HA 4L75A 2ABWA 4NU5A 3RVJA 3WIVA 5CDYA 2Y1FA 3GLRA 2ZTVA 5DEOA 1A96A 3UJ6A 3FNBA 1W7AA 2CLKB 1XZHA 2HDHA 3JRWA 1UOPA 5JAZA 1BGXT 4WNIA 1A69A 3DEFA 5HZGA 3ZNNA 3O8OA 3GRPA 2F1OA 1DC8A 1YQGA 3P9RA 1DAKA 2E7ZA 5I3CA 4TKZA 5LQDA 1VDMA 2RH4A 2XXJA 2X5KO 2AE1A 4RX1A 3VZBA 3G0HA 1TFUA 2N46A 2QQEA 4RH0A 5FI1B 1E63A 3MFYA 3CA8A 1GD1O 3FTNA 2FW1A 1UEXC 2Y6VA 1U8XX 1BZYA 3JYHA 5MN4A 5K0EA 1HG0A 3GRZA 1I80A 3IBYA 2Q07A 3COWA 4MUIA 1F4PA 1MF7A 3O4IA 4P3NA 4RACA 2JK0A 2IIQA 2PYIA 5HE8A 4Y98A 1E2HA 3QX9A 1O6GA 4US2R 5KQLA 2AS0A 3EWNA 1CQIB 2DY1A 3HB4X 3F4BA 1R0SA 2P9ZA 2YDXA 3R7DA 3N9IA 3GDHA 3OFNA 4J1NA 4LRSB 5EWLA 1ZSYA 4TZ0A 4RPHA 1GQQA 2HMSA 3I1YA 3ETNA 1OAAA 2JEYA 5GZ6A 4O6VA 4QX6A 1B0ZA 2EW2A 4V0MA 1D1SA 2GUWA 2QTCA 1CLUA 4XGRA 4PC2A 1LF0A 2ZKIA 2FRDA 4UQLA 2CK3A 2OBBA 1QLHA 2BJWA 2F00A 1UPFA 1AY0A 1EP2B 3HR4A 3G9TA 1BMFD 3H2GA 4BNLA 1AQNA 3IOEA 2UYCA 2PGNA 3CEMA 3ZE6A 4OLAA 3PDHA 3ZE1B 1X1SA 4OP3A 2PUBA 5AW3A 1GQFA 1MT3A 3EJWA 4RD2A 1SM4A 1QRRA 1X39A 4MZXA 2IU6A 2DTXA 3IESA 3M6XA 4G1BA 5FT9A 4Q4JB 5JO9A 3VBCA 2ORED 2VF5X 5KNCA 3LQRA 4YPOA 3O8LA 2OXCA 3GYGA 5DNEA 3PEVA 2Q1XA 1ZFNA 1U1IA 2GJ9A 4OLJA 5CIYA 3ZTTA 4FSHA 2ZPAA 3F0TA 4D4IA 2JHCA 2V98A 1KA9H 3P2YA 4HFRA 2RGGA 5CVEA 4F2PA 4RTNA 2UU9B 3ZDZB 1A9TA 2FUEA 1J1IA 3CLUD 3NOVA 1CE8A 2IUYA 3MWDA 4FKZA 1RJDA 3D59A 3PF8A 4GBGA 3FPCA 4OQZA 3UJ9A 1GAXA 4GDFA 3FTQA 4FGWA 2IC5A 3WK6A 1R3DA 5DN6D 1G291 4D4GA 3GBSA 2W71A 2VEDA 3IKLA 4DSNA 4KPUB 4WUTA 5BNTA 4M1MA 1KGSA 3ENNA 2BFOA 1Z22A 2QWXA 3TQQA 3SVZA 5CHEA 3UO8B 2IPMA 1YUBA 1R8SA 1DEKA 3OWOA 1YAJA 3ELDA 2OYSA 4EHDA 1JDPA 1PT8A 3HSYA 3NX4A 3O90A 4QQRA 2XGGA 3VBEA 2Y1XA 1F6DA 1MXHA 3R24A 4ZZ1A 2OCDA 1XRJA 4IX1A 5DEIA 3TFWA 4BMDA 1Z5PA 4N3NA 1W5SA 5B3AA 3IPLA 4L02A 1P1FA 3FPAA 2CKMA 3A36A 3H3XA 1AB5A 4N3CA 2C42A 5HFNA 2Q4BA 3OI7A 4FHEA 1Q95A 3EA4A 5LR6A 4I1IA 3OZIA 2ZUWA 2PUCA 2FFQA 1Z7BA 2XDYA 2YY6A 3QLEA 5AK0A 4Y6QA 3QUCA 3DYVA 4L15A 1F4VA 2R1VA 4ZV9A 3W7AA 1TMOA 3RLFA 3CBQA 1JG7A 4ISCA 3UQZA 1ABBA 1PTJA 4FDAA 1PV1A 5HIMA 1FRVA 1G1MA 5FPHA 4F5DA 1VPLA 3HLKA 3N28A 4QXRA 1GKIA 2CF6A 5G0SA 2QDXA 5IRCD 1ULBA 2Q8QA 4ZQFA 5F76A 1FBTA 1M76A 4AK9A 3H8VA 3OZRA 4Y2YA 1ADCA 2WW8A 2RDMA 1JHDA 2GPSA 1ICIA 3AV3A 3O95A 3OLVA 1I6LA 1XT6A 4PYIA 2FPXA 2QJTA 3FWHA 3I83A 2BMAA 2IJGX 1E8DA 2FPGB 4R7TA 1H5NA 1ZWKA 3IV9A 1W46A 2H3HA 4RJ2A 3S6JA 3KAKA 1CIJA 1G9TA 2WIBA 1HX7A 1SD5A 3V7FA 4UUPA 4W8OA 3DP7A 2AR0A 2R8RA 1G3QA 3QFSA 3GLGE 1OFHA 3QX7A 1PQYA 3QU7A 4LFAB 5M5BA 1HYEA 2V6IA 3P5BA 4LYFA 1BN6A 1JFVA 3MT0A 4RDIA 3UHJA 1J9ZA 1K98A 1KMQA 5AUPB 3ZQKA 3ZDRA 5B6IA 3W3AA 5JV5A 3ANSA 2A9OA 3IEVA 3DKKA 5LQAA 1Y5IA 2ZRQA 4TN1A 2CSUA 3I12A 3SZUA 2ES4A 3ZNQA 2NQTA 4JT2A 5A7HA 5CVUA 3U81A 5JPDA 2PIAA 3FCEA 5JRJA 2P11A 5J3JA 2B82A 1H2RS 4EUKA 4GC5A 4HADA 2ZTMA 4B3IA 2DKNA 3R9XB 1NXQA 3LUJA 3VFDA 4D0LB 1K68A 5T5QA 1IBCA 1FUIA 3CTMA 4LFCB 8ATCA 1Z0FA 1BD3A 3VC7A 5K0CA 5BN4B 3MINB 3ND5A 4Q7MB 3WHLA 5FTLA 2KS6A 2VOEA 4Y9SA 1NV9A 4NULA 1Z6ZA 4POOA 4PR3A 1BHSA 5F3DA 1A8QA 3AR3A 1U28A 2FFBA 1CT9A 3RWOA 3ZJYA 4IDNA 5DTQA 2ZSJA 4XCQA 3RSFA 4DIOA 4QT4A 4XE5A 4LTNA 4HEA1 5TPZA 3WJ1A 1IVYA 2OOSA 3K0FA 1SAYA 1LBHA 1IBMB 4J3NA 3RSHA 4EFMA 1J0CA 3QPWA 4IJWA 1O9HA 1Q0SA 3AM4A 4OQEA 2V45A 2KMLA 1YJ8A 4P81A 1P80A 4MMZB 5CD9A 2OM6A 4AJOA 2X3FA 3ODGA 1E9EA 1K88A 1M1YB 1T3SA 2AIRA 2RG7A 3W5JA 1GPKA 3WB9A 1CJCA 3DFMA 4LXTA 5ECDA 3VPBA 1X1BA 2ONJA 2B2CA 2Q50A 2X4GA 5FV4A 3MWGA 1WY5A 2XUJA 1D4AA 4GR9A 5AOCA 1C1XA 4XTCS 1MAVA 2I2BA 1EVIA 3MTAA 1FJ2A 4IR7A 1V11A 2OXRA 2RONA 3F4LA 5EXTA 3RTDA 4BIMA 3FYHA 5C3MA 1NNEA 3EGOA 4KK4A 3R5FA 1E2BA 2XBLA 4IFEA 5IC4A 1FOEB 2C1ZA 2FRDC 4ZDWA 2Q8PA 2X13A 1OIWA 3EBLA 3ET5A 5AHRA 1WW2A 4AXBA 4KE8A 1SCQA 1W30A 4PONA 1Z45A 4LK3A 1ZGBA 4P53A 5EA2A 4BCBA 2F1IA 1XK6A 1I4WA 2HGZA 4UARA 5EJ2A 3KEOA 3PV0A 4NU8X 4AMUA 3VZPA 4HF7A 3RRXA 3EX7C 3AB3A 2EX4A 4WK0B 2IEYA 1OMOA 3KZ1E 1JIXA 5LQKA 1WAMA 2QRHA 4N5MA 4EB0A 3ETGA 1D4ZA 2VYQA 2C3OA 5CGQB 2ZIVB 3EGEA 2EZ9A 3BRWD 2X0KA 4IHJB 4ZVSA 3LP6A 4WZAA 3ET4A 3SYNA 1E1MA 5ALOA 3D3QA 1A1SA 2IW1A 3IULA 3DONA 4AC9A 5EP3A 1SKBA 1ZK2A 3L7JA 5E6UA 1R18A 2O52A 1JSCA 2I2XB 2TECE 3PFWO 3WMGA 1SGWA 5KYGA 1O5OA 1PR6A 1UWKA 1DOZA 3JQCA 3L9XA 4O1IA 5LQSA 2GCIA 1DKPA 3DFZA 2WLTA 3OBBA 4CF6A 2XJ4A 3DAHA 5BRAA 5DMHA 4ZT4A 3RVMA 1C9JA 5ALDA 2NAFA 3EQ9A 3F3KA 1QGZA 4WKNA 5FL7A 4OBWA 1A95A 4FWTA 3EFEA 3ETLA 2QN6A 3O1JC 3OFSA 3KQHA 2NP6A 2CHEA 2QN7A 3L18A 2PKEA 1RM5A 5FADA 2Z2XA 2ZJ8A 4ZYVA 4QKQA 3OCXA 5BT9A 4JENA 1WW8A 2P77A 5D1NA 1WJGA 3UHPA 2XEXA 3ZKAA 2O59A 2WYOA 2QY9A 5JDIC 1AURA 3OVMA 5TQ0B 3IUNA 4M21A 3VR2A 3ZUGA 1ZN9A 3WLLA 1IWBB 3GGJA 1VYVA 1N0IA 1VE1A 4KQKA 5LMZA 1SKAA 3B3FA 4AL4A 3VI4B 1I2ZA 4IDGA 4UBNA 4FS8A 4TS9A 4RSHA 2JC3A 1Z7YA 1YDHA 1OAOA 4H9GA 1NUQA 2D3TA 2VYVA 1ZYUA 4B48A 3KXLA 2P9QA 4CLHA 2B1IA 4EFLA 5J5VA 5JXWA 1CY4A 3QJGA 3HFSA 1E69A 3AF3A 3E18A 5TQ2A 1JB1A 1M7BA 1XD8A 1OZHA 2NTJA 3HKEA 3RJTA 5CK5A 1KVQA 2W2NA 3AYZB 2H08A 3VH1A 3MYYA 4EG7A 4XIJA 4E11A 1WPXA 2FMXA 4JOBA 5C80A 1KIMA 4G4JA 4ERXA 1RXEA 3EXHB 1EE2A 3BWBA 6REQA 1E1QA 4I08A 1T9AA 4DBLE 5I4IA 3EFOB 3G1TA 2ZM6B 2C9YA 2P0YA 4X85A 4KFCA 3IDSA 3DM5A 1TE2A 1LLFA 2ODTX 2ZWMA 5K3FA 3RUEA 3RVSA 4JI1B 1VPVA 2IOFK 4AMBA 2JJ2D 2RKOA 3N2ZB 4GOJA 4N9WA 1I7NA 1SR8A 2VZ0A 1VLZA 2QMQA 4CQNA 2VHYA 1LQTA 2ZJ2A 3G68A 4A10A 3IB3A 3PRHA 3S70A 1KDVA 1UJBA 4MV8A 4DMCA 3E2IA 1Z0DA 1IN4A 4X6UA 1RQ2A 3T54A 3SN6A 2GDZA 3ZWNA 2EP8A 2Q9CA 3E15A 2H06A 3DLAA 2DYKA 5EUCA 5AJVB 1DIOB 3IO5A 3QEKA 1JKMA 2ZIZA 4IIFA 3VJLA 3KEFA 5K4GA 1SELA 4WNYA 3BE4A 3EVFA 4UEKA 3TIIA 3FDIA 1GADO 1QG0A 4P7BA 3OWXA 3LUKA 5T4EA 1RSZA 3AF0A 3D6UA 4X6YA 4EGFA 1I2MA 3U62A 4RM2A 2C9MA 3CVOA 1VP3A 4LDPA 4B81A 4E5SA 1W5BA 2YRFA 3BJMA 3N2KB 4BRUA 1S2MA 2F1HA 1JHXA 3O7WA 4QXMA 1NJFA 1Z6QA 3QTTA 1N8KA 1ILEA 3THWB 1FDVA 1SBIA 1PNOA 3MRSA 3LAWA 2C9BA 1V16A 4LYYA 2RH9B 3PC3A 3N59A 3WA7A 5EFOA 1Y3CE 1KFEB 3K1JA 1TUBA 4DNFA 1YONA 2G04A 2BGTA 3TEFA 2GD2A 3JVVA 4J1TC 4XWGA 4EFDA 1IHUA 3ZDFA 4CV1A 5BNIA 1UXJA 1FSZA 4YRFA 1MB4A 1SVIA 3G17A 3SZOA 4R2HA 3GDFA 4MUNA 5E6SA 1W59A 3OHSX 3VC2A 3X1YA 4RQUA 1LVUA 1N0UA 4F11A 1P45A 2VA9A 3TLXA 3ZWXA 5KX5A 3JASA 1SOAA 2HJ9A 1UP6A 3AW8A 2BEWB 1JFLA 4OAPA 3K9BA 1DDGA 1FLDA 3QFFA 4JC0A 5K6AC 1Q0PA 3U3KA 3NHFA 4KO3S 3DTTA 3PL1A 3X1ZA 3C48A 5CA0B 3VKVA 1U8AA 2JFNA 1Q7GA 4XAQA 2Y8EA 3PEUA 4JI4B 4FBMA 1I14A 2LWIA 4YRQA 3VSAA 3A4TA 4Y6RA 1K6IA 1MORA 2CCJA 4Z8XA 1DE0A 3ORSA 2M9MA 3JWHA 2GX6A 3PIRA 2WG1A 3V7UA 4O5OA 3OOJA 5E95A 4RHYA 1DRJA 4OHUA 1O8CA 4BPBA 4UAJA 2WV9A 3ZNOA 5JJ5A 2G7ZA 1EK2A 1C3OA 1ZBQA 4KP7A 2J0UA 4P5EA 1HI9A 3RS0A 3EXG2 4G23A 1EQAA 5E6UB 1AZTA 4RIHA 2PCJA 4IJKA 3ZQJA 1OUMA 4G5GA 4NRDA 1E0DA 3CUSA 1X80B 5K9ZA 1X7XA 2GPJA 2UUBB 1V1RB 1DQPA 1GNSA 5IKEA 2YKGA 4RCZA 3AGQA 1CJKC 1TM3E 5HW0A 2UZ4A 1L5MA 5JDCC 5JWOA 3M1AA 1VHLA 4RY9A 1SURA 3HXKA 1W76A 4R83A 2PFGA 4AQ7A 2HLDD 3UPTA 3TTUA 4OHZA 4CCYB 3LKVA 1OFUX 2I8CA 4QC2A 1DIAA 3DTNA 5CNIA 1A8PA 9MHTA 4D1YA 4FI3F 4NU6A 3CUUA 4CU5A 4EEZA 3VOTA 2PR2A 1ZN2A 5JYCA 4DEXA 1VMEA 3PU6A 3BRQA 4H3HB 2IIPA 1A9OA 5GV7A 1RYEA 1UPBA 1X1TA 3CRVA 1OX4B 1AKMA 4QPZA 4DC9A 3EPRA 1P31A 5B3KA 3EEIA 1UXOA 4CUZA 2JIPA 2QPAA 1QCYA 3JSXA 5ARDA 3WHPA 1DXHA 3GBPA 1RADA 4S2EA 4BECA 2V7XA 1TC1A 2XNCA 4QEZA 1QZXA 1UJ5A 2GBGA 4HZGA 1UUFA 1RWMA 1M83A 2PR7A 1U63A 2GCOB 2P68A 5DHUA 3VVCA 2JZOA 3AFGA 4JLWA 1Q84A 5FA8A 5IJWA 2Q21A 2CXHA 4XUCA 3P9KA 3E9CA 4I7EA 1KEEA 2A5YB 5B2FA 1IN1A 4MUMA 4D9NA 3OQOA 2QN2A 1GXSA 1QHNA 1W1WA 5GJWC 3U4AA 3ZZMA 1D0SA 2X5XA 3AKCA 1EVKA 2V7UA 4QEDA 3D9QX 2OFFA 2YHSA 4KIUA 4KXFB 3AETA 3JALB 3NNDA 4W1SA 5LJIA 1Y9DA 1GUFA 2ZREA 3ND7A 3QWBA 3K9WA 2NXWA 1AO0A 3CT6A 4BDSA 4KQ9A 4QNRA 1OKKA 4RLSA 3CMMA 3EDQA 2ENWA 3BMNA 1TM2A 3QNWA 2VFAA 1T0UA 3L07A 4LDQA 4LWQA 3ZXUB 3K4PA 1H22A 1WZEA 4HDMB 4ED9A 4F3RA 2UDPA 4CLRB 3TBKA 1RAGA 1RE0A 5JQGA 1IY9A 1FPQA 3QFHA 5D3QA 3NHSA 5C37A 4BZQA 1SUSA 4EDFA 1REQB 1QH8A 1ZN7A 5CP8A 4LXXA 1G21E 3BK1A 4TTRA 3KVOA 1KEKA 1N1GA 3WDKA 1JLLB 2GH1A 3HN6A 1E59A 4GBJA 3FAZA 4ZRDA 4RH3A 3GLHA 2ZVQX 5LNK6 2X4LA 2FUCA 2HYIC 5K0ZA 4JXJA 1WPGA 5BY2A 1QRTA 2VP4A 1PG5A 4XTRA 4R0VA 1H2YA 2PSDA 4TUYA 1ZM4A 2ORVA 4WNAB 2A1IA 3TGPA 3PUZA 2NO9A 2YR0A 4RADA 2PL3A 1FA9A 1XBTA 4UAVA 3MNFA 4G01B 4MQ4A 4O0LA 5BYKA 3A1VA 5KHLB 4Y9TA 1RMYA 1XVVA 2WU3A 2WABA 3CBGA 1K4YA 2Q49A 4MQFB 4YXFA 2N1BA 5DI9A 5IYZF 1CJMA 2VUUA 4D9IA 2HUPA 1EVYA 3B78A 1MKYA 1R2QA 1VG8A 2B20A 3TNLA 4AYTA 3R3HA 2B9VA 3D6FA 3ORYA 4HG2A 4U1RA 2UVPA 1FSSA 1YSCA 4GYJA 4MI1A 1YVEI 4BN4A 4U7HA 3AEUB 1ZIXA 5A6SB 3SF0A 4YRNA 3K73O 1KPHA 1P91A 3IB6A 1QPBA 1PSDA 3NBQA 4R2XA 4LBYA 2C4UA 2NM0A 4GO1A 4HNSA 1PGQA 3O4FA 4KITB 5P8WA 3B20A 5JNSA 2PZ8A 5ECYA 3L01A 1EXDA 2MWMA 3WLEA 3ZGVA 1XNJA 1VJ0A 3Q11A 2D2FA 2ZRIA 4LBWA 4H2DA 4Z1MA 5MFPA 3ZK8A 2GAOA 2H2HA 2Y67A 4TMXA 3D7LA 1UJ4A 1DWQA 4UC0A 3W8DA 2VZEA 4A26A 1NI4A 3IUPA 1EE1A 5JD4A 2H18A 2K7FA 1P0QA 2YV5A 2GDJA 3LYLA 3ZDBA 3CRMA 3PDUA 2YZ2A 2C2XA 3TOXA 3CM0A 4DREA 4YLYA 1E1QD 2X9GA 4DXHA 3CVJA 3I2IA 1AKYA 1OBFO 1PGJA 1GTL1 4P4GA 3WNVA 3LRXA 4L5YA 3ZGYA 4NOMA 1Y1RA 2F7SA 2FUNB 3LCJA 1Y6JA 2H0RA 3C4VA 4LMBA 5GJVC 3JD2A 4MW0A 3ACCA 1QIDA 2WVGA 1JAYA 5LNK1 2NYAA 2LXNA 2YICA 3L02A 4ZAWA 1K3TA 3SZGA 1UC8A 2LIVA 3VH3A 1QDUA 1CY1A 2P7IA 1E1KA 4N5HX 5FBWB 1N2HA 3ZBQA 1Y37A 1YJCA 2ZB2A 2I9PA 1WKBA 1KI9A 3QVOA 2VHWA 5IP5A 4IIGA 3QVSA 5BQ3A 4QPNA 3K5IA 3PI7A 3OP1A 1WXGA 3H86A 3HKBB 5I9LA 1L4HA 1AQJA 3U1BA 3H11B 1W5EA 3N8IA 3T38A 3AFMA 5HF8A 2A4MA 4GU5A 5E2BA 4UHEA 1ULAA 1RQPA 1CTQA 1J09A 1NW5A 4ACBA 3MWDB 1GLVA 1EI9A 3IMEA 2XRFA 1SUCA 1TA0A 1RRFA 1V37A 2NU6A 3IVAA 4PTLA 2VUHB 1PKEA 4PYOA 4RFVA 2AOTA 2OYCA 2APJA 2I67A 2WWVD 4FSXA 4HLUC 4U7TB 2XB4A 3HYTA 3U13A 3F7OA 3MGCA 3RUCA 4R71A 2C9DA 1AS2A 5JE8A 3CUTA 1XD2A 3WDMA 5A5DA 3CE9A 5F5NA 3D5EA 4CT0A 4ND6A 4ZU1X 4PLVA 1MEJA 3IPXA 2H2GA 3I2HA 1G8JA 4G26A 4K9QA 2R0QC 3H97A 1AKEA 3GHHA 4B35A 1SU7A 2J85A 1F7VA 2IYPA 1RFGE 4TQ9A 4HGNA 4WCFB 1B76A 1YULA 4PZUA 4E15A 1RJWA 2HMUA 2VJMA 3NC4A 3SHVA 1B15A 1NOKA 4ND8B 2GYWA 3CUWA 3GVPA 2DMRA 2P9YA 2ZIXA 3M1YA 5HF5A 4RW0A 5FNZA 4NR0A 7GPBA 3I1FA 4R2WA 5I7OA 1WDTA 3FDZA 4QA9A 3LY5A 5BP7A 4OXKA 4RFSB 4LZAA 4Y7CA 3IQXA 1EWKA 3AETB 1HDYA 3JALA 3OECA 1FU4A 3ZD8A 4F5ZA 5C5IA 1U31A 4NYIR 5A02A 2FY8A 3AYXB 2M6SA 2QK4A 3HM2A 1JS1X 4IHJF 2WTXA 3KT8A 2YXNA 2B7LA 1PHPA 2UKDA 3D3NA 3GOQA 4PZYA 4IWXA 4INJA 5GPBA 1F17A 2HIAA 3O9MA 1MVLA 1GGMA 4LPKA 3NHPA 4JP2A 3SJUA 5DT9A 5DBFA 4IKEA 1QRDA 3B9RA 4DQVA 4F21A 3D8SA 1DQSA 1TYZA 4KUGA 3VKUA 4EABA 4P33A 5DWQA 3FVQA 4G5XA 1J8YF 4JZKA 4EHBA 4DZRA 2Z57A 3GGPA 5A3VA 1F6BA 5I3ZA 4MHOA 3LHFA 5DTJA 3EMBA 3WKBA 3BXFA 3M4NA 2GN1A 4UD2A 2YRWA 2R8BA 3CNOA 1V8FA 3UMSA 2ILVA 4L8LA 4LHWA 2FR0A 3L1HA 3D7SA 3F74A 1AQ6A 1RVDA 1Z12A 3BTUA 3FCXA 1UDXA 2CZQA 2C1EA 5FEUA 2VHVA 2AQKA 2ZRMA 3U9TA 2GJ4A 3E4CA 4UAGA 4KI0A 3OCCA 1RXWA 3BYZA 4ZGGA 2H1IA 4EMBA 3DTVB 1HL3A 1KVTA 3AF4A 1CQPA 4K6OA 3RTAA 4YLGA 3GMDA 4PAWA 2OE2A 4CHGA 3TDMA 2CB0A 3AV0B 2IU4A 3P94A 4NC9A 2JG3A 1CEEA 2QTTA 5HTKA 3M9WA 4IJVA 1V5EA 3N3AC 2FW6A 2H1HA 1RYZA 1Y6ZA 5DYIA 1Z4PX 5LL6P 2AWOA 2ZCVA 1XFAA 5PGMA 4BFCA 4ZYYA 1KYQA 1B1AA 4OUDA 4Q02A 2R2AA 2NTVA 1WMSA 3VA7A 3BERA 3PPVA 1U3WA 3GLHB 2JCSA 5FV7A 3SGLA 4Y1GA 1WCIB 5BOSB 5KQGA 2BHNA 2RSLA 3OP4A 3WKAA 4YRKA 5ICGA 4V24A 4M1WA 4BNFA 3UJ7A 2GCPA 2IY7A 4DCGA 2D0DA 4R2LA 3LX5A 3OTWA 3VAYA 3EFBA 3OMWA 2PUFA 2XY4A 4JR0A 3SS7X 3I9JA 1SHJA 5B30A 1OJLA 1F9AA 3AJDA 4L4UA 1NYRA 1G5IA 1K7YA 5GVRA 4Z6KA 3JAWA 2PKWA 3ICCA 1QCDA 2I1QA 3X2SA 4ZHQB 2V96A 2EP5A 4UDXX 3U7QB 3ZU3A 4J1TA 2BI8A 1L7MA 4FOTA 4GI2A 3A10A 3LIPA 3AJAA 3DZKA 3II6X 4WERA 2PVSA 2V6BA 3COSA 5HYVA 3BMQB 3ZS8A 1BOOA 2OO5C 3DJYA 3HN7A 4OQFA 5EQJB 5ERYA 3OH8A 3DOCA 4QHSA 4LJRA 3F5DA 3KYIB 5U9CA 1NIJA 1KZ9A 4ZAGA 1O6BA 1W35A 3GFSA 1NN0A 2VPXA 1XCMA 3HU5A 4OQQA 4QYTA 4OX9Y 3MINA 3KZOA 3JQ7A 2WHEA 3KTAA 1D07A 2QVYX 5H68A 2CUZA 3FZGA 1N1EA 1GU7A 2PUEA 2I2FA 2YOGA 4HWKA 5IARA 3UC9A 4AJ9A 3D7KA 5L3QB 1LA2A 1S96A 1WPQA 2WVAA 3NONA 4GL4A 4HQFA 4QOFA 1QF7A 5EGNA 3HEAA 4GQBA 4QTXA 3NBXX 4JLNA 1ZC4A 2XNSA 1YZGA 5DB4A 1PR2A 1POXA 2WF7A 2JGDB 4QJ4A 4S0XA 4Z7JA 1UFOA 1Z0JA 3V46A 2ECQA 5KTOA 4BNZA 3CW2A 4XD2A 3P45A 3WGIA 1HTWA 1SQSA 5DZSA 1OH5A 2V7EA 4NHOA 1FFWA 1CFJA 1NVDA 1LRLA 3GJQA 1FMCA 1K8ZB 3AILA 4IUYA 1QYWA 4ZT7A 5IK2A 2L17A 4GPZA 5IMSA 1U0FA 2ORYA 4JEMA 2VWHA 3LXXA 1UBKS 4K81B 1T3TA 2CUNA 5JCJA 3VU9A 3PSAA 1U1EA 3UK1A 4A73A 3U6BA 2UUAB 1NX6A 1E62A 2H1VA 1VHDA 3DB2A 3QKIA 3QG5A 2YV1A 3R7SA 4CQMD 3M6IA 1LI7A 3WXBA 4CJXA 2W8BB 3BJZA 2J5RA 3NRCA 4B6GA 4IH1A 5BWMA 3NHUA 3LLCA 1SUDA 3WLTA 3D31A 4Q9NA 3E3OA 3ZXXA 4BMZA 3SQNA 2J30A 5BVGB 2G72A 2KJQA 4FEAA 2NUBA 4QUHA 4OFWA 4BNUA 1D6JA 3DXXA 1KK2A 3KLOA 4J0DA 4D9MA 2C78A 1SCIA 1E89A 4R3UC 4IQGA 2Z4RA 4AZ3B 1ZZGA 5K0NA 3R4CA 5IVDA 1E4YA 4LJ4A 2BLLA 2ZTSA 2C84A 1G7SA 1MB9A 3DE1X 3WL8A 4G0MA 2KWIA 3OCZA 4DQ0A 1I7QB 1SN7A 5IKPA 4CQLA 2DWPA 1JHAA 2KW5A 4PCAA 1D03A 4MHTA 1WY7A 3D8RA 5ARBA 1X9IA 3AL3A 3UOAB 1XJ0A 4TT8A 3SYRA 1UWCA 4IEEA 3C1OA 4OIFA 3LUFA 5G4LA 1J06A 1MZVA 3H1PA 2C5EA 3GNTA 4EHLA 2OHVA 2ODQA 4M6WB 4DQXA 1TLLA 2VUTA 2E1PA 4G56A 4RTQA 1IHDA 2ATXA 2QMEA 2H1RA 1ILWA 1W87A 4OL9A 1WXWA 4EBBA 4LC9A 2FG6C 5A03A 2VJOA 1TAGA 4LYJA 4MQLA 5CBPA 4JUCA 5T3UA 1EHCA 1W94A 4FEEA 4HAIA 1CS0A 2MT9A 3GHYA 4MQBA 4OA5A 1XDDA 4LJ6A 1KOFA 1SQ6A 4R9VA 4ROSA 1I01A 1JT2A 2CDAA 1KYYA 5ES3A 3P2EA 3WS7A 1XX6A 1ORIA 2F9LA 4JX9A 1PI3A 3DZBA 4WDRA 4KRGA 1Y3DE 1JXQA 2RGCA 2VSQA 3EDCA 3LPCA 3HK2A 1NUAA 2HV9A 3I2YX 1NVUQ 4YMIA 5IJ0A 1JHOA 4LDRA 1PNRA 4NFSA 3ZY5A 1H4QA 5KNDD 5C0OE 2HO5A 4L5IA 5J9FA 2WZDA 4K3VA 2CYBA 1RI2A 1GN9A 2ATIA 2UYOA 2JBAB 3IDFA 4WZAE 1JFTA 1IXRC 5IT9A 3ABSB 1F14A 4NCNA 2VSOA 1U9YA 3BXPA 1O94C 1QJ4A 1N9KA 4MK4A 4NICA 5FFMA 4RNDB 3CVYA 1L5VA 1NWHA 3SHFA 4ZWNA 1J4AA 3TQCA 2BWJA 2FQXA 2QXYA 2WJVA 4GPEA 4HRXA 3ZXYA 2IP2A 4J4HA 3DC2A 3T0FA 1B3RA 4J2OA 2GVZC 3S55A 2J4CA 3V4LA 4TS1A 3WYBA 3N6XA 4P83A 1O95A 2QTNA 3UUEA 2PRSA 1Z2PX 1QM5A 2WWXA 1E3TA 1T5TA 1DGQA 2J0VA 2WYUA 2XT9A 2FF5A 5AW8A 3JSAA 2X8AA 5KDLA 2RIRA 3KOYA 4X20B 3DGFC 1EA5A 1QGOA 1NF9A 2B4RO 3IJRA 4XGQA 4DDVA 2P4QA 3ISJA 3WLQA 3U9LA 3RHTA 4M0DA 3WQQA 3UUWA 1VIDA 3BILA 4ZCLA 3TW4A 1RP1A 1YFKA