3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DDX19B
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
1II8A 2ORWA 4RZUA 2OAQ1 4L16A 1HT2E 4GFDA 1QF9A 2ZYUX 4PO8A 1IQPA 1QBKC 2GXUA 4D81A 2OCBA 4GSYA 2IYXA 3DZ8A 3X2SA 4G01B 2REXB 1IXSB 3ZJYA 2F1JA 3H0KA 2QP4A 5EP3A 3ZVMA 1PZNA 2PT5A 1ZYUA 1UDWA 2C9OA 1F6BA 1ZP6A 3QPWA 4LWZA 5LB2A 3SE0A 1Z6YA 4EJSA 1VKJA 2XTMA 1J90A 4F91B 4O2LA 4YQFA 2QP9X 1VG0B 4K46A 3KB1A 4QG7A 1IY1A 4WZBE 2HF8A 5FI0B 4BWYA 3RRNA 4QKQA 1PLKA 4R2HA 1DOAA 2AK3A 3DHWC 4LHYA 1U0HC 1LVGA 4Q4AB 1S2MA 2LKDA 5GJBA 1XTQA 3WRXC 4FI3C 4NYMR 4JLVA 1MABB 2ZRKA 4KITB 1MO3A 1ETUA 1KDPA 1RJ9B 1Z07A 2V8OA 1IXZA 5JEDA 2VP4A 1E0AA 3GLFB 3QKUA 1IOZA 1GITA 4JLAA 3REFA 4Z54A 1T3LA 2BV3A 2ZSEA 3P1JA 1RPZA 4FCTA 1J8MF 1HT1E 2OLJA 3W8RA 5K8UA 3WHLA 2REBA 3AH8A 1T0HB 3PUYA 3T1QA 1WE2A 2Z4RA 4ITRC 1OH5A 5BQ5A 1JPJA 3OAAD 5HPYB 3X1ZA 2BOVA 2W0MA 2DWQA 2REOA 2F9LA 1OV4A 4HAWA 4Q1AA 3TIFA 1CR4A 3G82C 2ZUBA 3T1OA 5CLQA 2QBYA 1S3SA 2FF7A 3CR8A 2KI5A 1VYUA 3PVSA 2RGNA 1PUIA 1P4SA 4O3MA 5KPJA 4PC7A 3VX4A 2J59A 2ZSBA 4QNRA 3SN6A 1YZGA 4AC9A 5JFGA 3DL0A 4OI1A 4RD4A 4CVNA 1KY2A 1Z0DA 1U90A 3ETLA 5DHAA 4KV9A 4M1WA 5AJXA 3V9PA 2RAPA 1VMAA 1ZMXA 3SHWA 2ATVA 3P4YA 1PUJA 1SGWA 5KUTA 2EFDB 2EYQA 1NJGA 2O8FB 4G5GA 4I1OA 2ZSDA 5IDVA 1Z8FA 2WKQA 4S2EA 2J46A 3WYAA 3D8BA 3HYRA 4DLYA 1Z0JA 4BLRA 2PZFA 3T5DA 5JRJA 1E2QA 3CWZA 4ASUA 3X1DA 1QHGA 1RRFA 2A2ZA 2D06A 4OQLA 2QTHA 2EWVA 5FOUA 5B58C 3PJRA 2OCYC 2LKCA 2JJ2D 4UNPA 2AHOA 2QRNA 3BB4A 3IBYA 4FCWA 3T15A 1OIVA 4ZDKA 1NSTA 3LXXA 1G291 2AKAB 2P2LA 3MWLA 2F55A 3B13B 1LF0A 3ZIAD 5DLQC 3U3MA 1IXRC 3FMIA 3EPJA 1Z6AA 2WAXA 4XIGS 4XWAA 3TLXA 4ESVA 1DO0A 4MGKR 3BBPA 1GRNA 2ZRMA 4BFVA 1TF5A 1JJVA 4UQOA 4TYQA 1GZSA 2W6ID 4P31A 1M8PA 4KAXA 2HYIC 1N6NA 1X1RA 1MRNA 3VHXA 4LJ9A 4Z1MA 1E2HA 2OBLA 2D62A 2D4HA 4CYMA 4EPXA 2QQEA 4EPTA 3BH6A 5AK0A 1SULA 3L0SA 3P26A 2ODEA 1VYVA 4AD8A 1Z0IA 2JLRA 2QMHA 2FFBA 4RZ3A 1N6PA 4XWOA 4HLDA 3CH4B 4TMVA 1A4RA 5FL7A 4WOPA 4A0FA 2WIBA 3CR7A 3KQHA 1KI4A 4NBSA 4NYIR 4E5UA 2LWIA 5FTNA 2I1QA 4M1KA 2ZI3A 3LVRE 4NYMQ 4U02A 4BGDA 1G8GA 1MO5A 1N5KA 3ZS8A 1PV4A 3WP1B 1US8B 1BMFD 2XJ4A 1ANKA 4H1UA 3GEIA 3A4LA 4KYIB 1RZ3A 4JT4A 2OILA 1GUAA 3QXXA 1P60A 1M1YE 1NVVQ 5J4LA 2AWOA 4RD6A 4IKEA 4R9UC 3EZ9A 4ACBA 1ELOA 1GRQA 3NDPA 2IYVA 3KX2A 3FKQA 4XD7A 2RCNA 2YZ2A 2ZJZA 4IVRA 1KK2A 4MH0R 2VL7A 3UATA 1F5NA 1LS1A 4KSCA 1XJ0A 4M1YA 1CJTC 1U8YA 2WBLC 4I81A 1XXHB 5CIQA 4EFNA 2AR7A 5JSZB 4QGFA 3AKDA 1JJ7A 3LLUA 2IUUA 4LK2A 3KKOA 1GP2A 1R5NA 4G5RA 4YMUA 3CW2A 3CNNA 1Q3HA 2Z4SA 2OZEA 4JKYA 2C98A 3Q3JB 3QF7A 3KTAB 2F43A 5FTKA 4F4CA 4Q1DA 3K0AA 2CBZA 4JLJA 5C2JB 5H68A 3Q5DA 2PEYA 4AY2A 1XDBA 2VHQA 2X2FA 4ZI2A 3X1YA 1TQ2A 5JLJA 3CRMA 4RZXA 1JEDA 2MSEB 4NE2A 3W90A 3WNDA 2NTYC 3IHLA 5HTKA 4PPNA 3ZVRA 4QRHA 4URXR 3I61A 3R7WB 2A5YB 2F1HA 4I99A 1E0KA 1NN0A 3QI2A 2O8BA 3EARA 1HTWA 4OK3A 2ERXA 2HF9A 2ZIAA 1G8PA 3IIKA 2SHKA 2WWFA 3KTAA 2PCLA 5L3VA 4UNSA 1NLFA 2QT0A 1YR6A 1SXJC 2PH1A 1YR8A 3W9YA 4V0NA 2QNRA 3H4MA 1MT0A 4Q02A 5FTJA 2BM1A 3BGWA 1CEEA 3KKPA 4LJ5A 3SHFA 1XRJA 2W2XA 1U81A 3EZ7A 3OEED 4LYAA 4W9MC 3ND9A 2HCJB 3MWYW 1KI3A 1G17A 1SQ5A 2IWRA 4DLUA 1NMXA 1ZM9A 4V0OA 5JBQA 2XSZD 2NOAA 4G3XA 1COWA 3DVLA 1EESA 5FUVA 4C0QC 3EZ2A 4MDFA 4TWZA 3AP1A 2QMEA 3EAQA 1CKEA 3OE7A 4ZO4A 2H1LA 2YV5A 4EKDA 1JR3D 4TMWA 3NC1C 4Q7MB 3DZDA 4B71A 3ZD7A 4TL6A 3A36A 1P6XA 3ASZA 1A82A 1T5IA 4DDVA 4FWTA 2JLYA 2BBTA 1XCGB 2Q0HA 1OXSC 4M2LA 3EIHA 1OIXA 4B48A 5A5GA 2YWHA 2VO1A 2HCBA 3P27A 5AJZA 3W6NA 3QKSB 3KFVA 1BYIA 3U7EB 2XOKA 2KWIA 2YNMA 4DB4A 3KJEA 3REGA 1G6OA 1OSNA 2QZ4A 3KL4A 3VR1A 4RSGA 4TLDA 3EZFA 4KHZA 1KI1A 1VCIA 2BMEA 5JWHA 1FX0A 4KLNA 4YC7A 1E99A 4A4DA 4C30A 2GJAA 1KKLA 1N6HA 1G3UA 2GCOB 3EW9A 4IEIA 1EWQA 5LPNA 2BKEA 5TVKA 3RABA 4AKGA 4H1VA 4NCKA 1Q57A 4NP6A 3KJGA 4K8OA 1CJKC 2IL1A 2V7QD 1T9HA 1OH7A 5FPTA 3ZH9B 1KI2A 2J0VA 1W36C 1M34E 4CW7A 3VX3A 1YKSA 3A4MA 4LV5B 3WRYC 1E4YA 5KDDA 3AVWA 2OFXA 1CJVC 2WAYA 4C0SA 4BZQA 1K5GA 2UKDA 2JA1A 2IEZA 3R8CA 1T91A 2GJSA 1T6NA 1OFHA 4LBYA 4D0LB 5HCNA 5CDFA 2WWXA 4B2LA 4O0MA 1QHHA 2JLUA 2XJ9A 2Z43A 1MRSA 4NZYA 2ZJ5A 3QIAA 5JI3E 1F3OA 2A5DA 3EASA 1JBKA 1XXHA 2IS4A 3WBKA 4Q1BA 2VHJA 3RVBA 1C9KA 1MR3F 2AD1A 3K0CA 3C5CA 5TMPA 3GLFE 1CULC 2XTNA 3W5IA 4FMCB 4L4UA 4BZXA 5F98A 1XJQA 4QC2A 4C0LA 3GLGA 4P3YA 4BLOA 4IFEA 4YDSA 4WXPA 2RHMA 4X8HA 2C78A 3H86A 1R8SA 2WMNB 1IHUA 3NH6A 3LQQA 1B0UA 4PHFA 4Q66C 1Z3IX 3HU3A 3HPQA 1UBCA 3CUEF 4KYUA 1E9RA 3KZ1E 2XX3A 4D82A 6Q21A 4ZKEA 1N0WA 4TSFA 5JJLA 3TH5A 2PLFA 2HDNB 3C7KA 3SBDA 5CDFE 1E6CA 3AGPA 1W2HA 3LWNA 1QHYA 3EA5A 3B78A 2FN4A 5KO2A 1YQTA 1VTKA 1E0JA 2H18A 3K9LA 4Q9KA 4JBWA 4IHQA 4L9SA 2CLCX 3I62A 2WJIA 3PEVA 1KSJA 2I1VB 3EC1A 3P20A 3TGPA 2CJWB 4LDJA 1IN4A 2IW3A 2CMKA 1GKUB 1UKZA 2ZE7A 5J4YA 1U94A 5AJWA 4NMMA 3ZQ6A 1G3RA 4LV6A 4UJ5A 5DSZA 3QXJA 2JDID 1IY0A 2IHBA 1E2DA 1TUIA 2G9NA 5EJEA 2FEOA 1BOFA 2QSYA 4B32A 1EK0A 2RGCA 3GLHA 4HZUA 1KZ7B 3H84A 2QY9A 3MGCA 4MRVA 4OL0A 3VNUA 2J9RA 1TUEA 4MRSA 5BN4A 3W6PA 1LW7A 1NBMD 2OE2A 3Q9LA 4TL9A 2V1UA 3BE4A 1GILA 1XTRA 4P4UA 1AZTA 4CEIB 4DJTA 4QBGB 3QF4A 1UBGA 3RSLA 1XD8A 4DLZA 1ZC4A 3TVDA 1G1MA 3I5YA 2C2HA 1COWD 2H16A 5CK4A 4OJKA 3TW8B 4BFZA 3GLIB 1US8A 2ANCA 3SJBA 521PA 3WMFA 5K8LA 4LJ6A 3OEEA 4MKGA 2QQ0A 3MG9A 2JJ1A 3CPEA 221PA 4JVSB 3CONA 4NYJQ 3EX7C 1YZLA 2V3CC 1HV8A 3RS7A 4NCJA 4EQ6B 5FOSA 4PPQA 3KKNA 5E4FA 1NVXQ 4HEJA 1P72A 2BHRA 4M21A 4F4IA 5FR2A 2AXNA 4OQMA 2XEXA 3AUYA 3LBIA 1SKQA 1KJYA 3ECCA 3OHMA 4XVUA 2ZRCA 2WJGA 1XZQA 4ERNA 3PEUA 3ZD6A 4MYUA 2NG1A 3BERA 2XOKD 3T1VA 4P0TA 4AYXA 3RRZA 4LBWA 3I8SA 2ZRJA 1II0A 2GHIA 4KODA 4WZAE 1P9RA 4XH9B 3R9WA 1S96A 1DG1G 4MGZR 2RGAA 2KBFA 1VYTA 4A2QA 4PZZA 4KFTA 5IHPA 1U2RA 1G5PA 2FFHA 3QPUA 2GF9A 2BBOA 2VA8A 5DI3A 3K70D 1Q1EA 3M0EA 2ASEA 4AWXA 3LQRA 2JCSA 2QMOA 4DDTA 3CX6A 4EJSC 1SVIA 4QHYA 1G7TA 3L82B 2JIZD 2Q9CA 2WZQA 1OYWA 2J5XA 3TUIC 4BPBA 1E2JA 2IA5A 2ZAOA 3GLFA 1OE0A 4GPTA 1G7CA 2OFOA 2W0SA 4I4LA 2W2TA 3F5FA 1AQUA 1HE1C 1W4CA 4FMDB 2PJRA 3NVAA 2IWHA 4MKHA 1G20E 4HAXA 1KO1A 1NBME 1ESNA 4BQSA 3SJCA 4V0KA 4DIDA 2KE5A 1VPLA 4KXFB 4TTQA 5F2EA 2IT1A 4YXWD 3SBEA 1F2UB 1XB2A 3KB2A 1XEXB 4B3DA 4WA7A 3A1VA 5DE3A 5HZKA 1KI6A 3CRVA 3FWYA 4GNKA 4FINA 5DH9A 1ZNYA 3S1AA 1Z2AA 4EDHA 5M04A 2CNWD 3D31A 1R0XA 2Q9AA 1IONA 3NH9A 2QENA 2WV9A 5TB5A 4AG6A 4BECA 1HQYE 3MRSA 4JYBA 2ZUDA 2XTZA 3QKRA 2DCUA 4D0NA 1ZM3A 2WIAA 4F92B 3AVPA 4N1AA 3UPUA 3U3KA 1S4QA 1CR2A 1NSFA 1NY6A 4JSTA 4TLAA 2XZOA 1E2LA 3SDZA 4LI0A 1C1YA 5EXXA 2Z6VA 2ONKA 3K9HA 2R8RA 3L0PA 1FNNA 3V4FA 2CK3A 2J87A 1X8KA 3QG5A 1W5SA 4DEYA 1MH1A 1RE0A 4HZIA 4JS0A 5LBIA 4BUJA 4P33A 1NKTA 2WJVA 2WTUA 2QI9C 3KJHA 4NCHA 3W3AA 4DLXA 3N2EA 4MKFA 1CU1A 2A30A 1YRAA 1Z6GA 4Q47A 3M6AA 2ZR0A 5DYIA 3I1FA 1DEKA 4MYTA 4OBEA 2J1LA 4AG5A 3AF3A 3B60A 3RAPR 3V4RA 1XU4A 2FWRA 3CNLA 3C16C 1E32A 2O5VA 2WKRA 2OLKA 5FBQB 2FX3A 2JDIA 4IDHA 3AKCA 5FPKA 2GBLC 4MKIA 2ATXA 2B6HA 4R98A 3RC3A 2W58A 3AP3A 1XWIA 1DAHA 1OB5A 2B21A 3GJ6A 5FL3A 3QXCA 1S3GA 3GCGA 5P21A 1TF2A 3O47A 5CLLA 5JZVA 1CIPA 3VU9A 1KJWA 1W4RA 1TADA 4TT3A 1G41A 2HYDA 1RYFA 2VP5A 2DBYA 3LBHA 1DADA 4BLQA 1KSGA 3PEWA 4NONA 3B5JA 1R6BX 4M9QA 5DNYB 2JAQA 4JVNA 5L3RA 3L0OA 4TQAA 2OCAA 4B44A 4DZZA 3O8RA 2IYRA 2Z0MA 1GNPA 4PQRA 5D3MB 3QKSA 1F48A 1KMQA 3SJZA 1L8QA 3LXRA 3W8NA 2N42A 2UVQA 2ZVQX 3CLVA 4UNNA 3SYNA 1XEFA 1Z63A 1CR1A 1YZUA 1FMLA 1G4AE 2R6FA 4A36A 3FVQA 3VNVA 3Q8XB 4RD0A 1R4AA 5FUYA 2ZPTX 4OQXA 1DAIA 2GXSA 1T8UA 4POAA 4PTLA 3T61A 721PA 2QEQA 4U5XA 2H57A 2VEDA 1N2CE 4LJYA 4C7OB 1E9AA 4C3ZA 2JLSA 3C15C 2NMVA 5GJVC 2YHSA 1P61B 4HDQB 4LHWA 4W5HA 4PAQA 2P5TB 1XX6A 1JR3E 5EXTA 2FPKA 3KQUA 1RRPA 1ESMA 3N5CA 4LSGA 2RKOA 2CLSA 3GEHA 2UZ3A 1JAHA 1F2TA 3PUXA 1Y63A 2B8TA 1BO6A 3EIQA 5EP1A 1GNQA 1WF3A 1DAKA 1KTVA 2GEVA 1PLJA 2ZR9A 2A5JA 2BBWA 2QAGB 5CK5A 2PL3A 3I92A 1G8FA 4WVFA 2QPAA 4HDCA 3CRQA 4IW3B 2EU8A 1WBDA 3Q7QA 4HAVA 1JEEA 2G3YA 2AL7A 1TEXA 3SR0A 1W49A 2YC2C 2ZSFA 2FOLA 5ANRB 5GJCA 2HJGA 5E95A 3UWKA 4DCVA 4QBIA 3VQTA 4A92A 4GI7A 2BIFA 1OFTA 2JGNA 2BJWA 3HR8A 3VR2A 5BWMA 4JVMA 1E9BA 2C77A 3BXZA 3GLHE 2DWPA 1J7KA 2WM9B 5CM8B 4DLTA 2GXQA 4DXAA 1P2UA 2AKYA 3GJ3A 1ODFA 4ZIRB 2QPTA 2QAGA 2KB0A 2H8KA 4M22A 4M9XA 5JWRA 4HAZA 2FMXA 1KY3A 2ZE8A 4S35A 3GJ0A 3KFXA 5FOVA 2BBSA 1J99A 3BH7A 3U7FB 3VFDA 4KJZA 1KO7A 4CEJA 2ZU0C 2J41A 3LFUA 4PAMA 3GLIA 1XP8A 2GTPA 2NO0A 4PAOA 2OUKA 1N6IA 2PLRA 1WXQA 1NN3A 4GBMA 2QSZA 3PG5A 4C9BA 4QBFA 3BD9A 4CGZA 3KKQA 1W0JD 1FQJA 1N5IA 1AA9A 3IQWA 1QHXA 1OF1A 3LVQE 2GILA 2ZE6A 4BZPA 3B9PA 3WNCA 1BIFA 1N5LA 1Z0AA 1D2EA 4ZIRA 1TF7A 8OHMA 4HUQB 3B1VA 2HT1A 4M1MA 3VR5A 4URVR 3FTQA 1KJZA 2G1JA 1CJUC 3CRRA 3BJIC 1Q21A 3THYB 5BN3A 3FHTA 3ICQB 3NEYA 1DTSA 1KO5A 4Z8YA 3IHWA 4DCSA 4CT5A 1DPFA 2R6CA 2YYZA 2DPXA 4OI4A 3HU2A 5H1YA 4PXAA 1XMIA 2B7CA 2W6JA 4JLNA 2ZRGA 2YINC 1PJRA 2Y8EA 3GJ7A 4AKHA 1W48A 4LJ4A 3ZZUA 2IXFA 2JJ1D 2CL6X 2ZR7A 4GZMA 4IDQA 1TTTA 2CCJA 4TYPA 5CITA 2DFTA 3DKVA 5JHGB 2ODNA 3IIMA 1LY1A 5KSOA 1YZNA 3CM0A 1YVDA 4BLTA 3A1TA 3K0CC 4ZDIA 5EE0A 1OIWA 4HAYA 4KBFA 1OXXK 1SHKA 1M7GA 2X2EA 3D6TB 1E1QA 4D4LA 2GAAA 2F1RA 3OIVA 4DCUA 4UJ3A 1OH8A 1CLUA 2PT7A 3AF2A 3HWSA 4HLCA 3TSZA 4ZV4A 5JHHB 5K8TA 1GL6A 2Q21A 3OEHD 5JS8A 2VHTA 1CP2A 4B3GA 4US2R 1SVLA 2ZANA 3LY5A 4N0EA 4DHEA 2EWWA 3VKHA 4PR0A 2HEIA 1G9XA 5FOTA 1R8QA 2EW1A 3F0TA 3OEHA 1N3BA 1RJ9A 3QEJA 1AS2A 3ADBA 1F60A 2OT3B 3P32A 1XMVA 1ZD9A 1E2IA 3LDAA 3THXB 5F9FA 4URYR 5SZKB 4AURA 3KKMA 2VSFA 1D6JA 1G3QA 2BJVA 2P5SA 3OAAA 3TVTA 4MYHA 4ASUD 2IUTA 1OLOA 2DYKA 4OI2A 5JJKA 2OO7A 3O8BA 3AUXA 3RRMA 1Z28A 4TZ0A 4EFLA 3OIUA 4HLUA 3SQWA 1A7JA 3DM9B 1FL9A 4EIWA 1AJEA 1W0KA 3A1SA 1G7RA 1KGDA 3DEFA 1SVOA 1GWNA 4US0R 4ZDWA 5DISB 3U2QA 5EXPA 2H5EA 4C0JA 4HYYA 1CRPA 4UNRA 1M7BA 2ZI5A 1D2MA 1GOTA 1TPZA 2IF0A 3THWA 2ZRBA 2FZ4A 2ZROA 1K8RA 3DM5A 1CS4C 1RW4A 3R20A 3PENA 2OSBA 4RKEA 1GG2A 1WQ1R 1B23P 2ZTSA 2CL0X 4DSNA 2FSHA 3BC1A 2JJ8A 2FSIA 3C8UA 2D7CA 1UKVY 2IYYA 3LNCA 4Q4LA 3C4JA 3I8XA 4IOLA 4RCYA 3ONWA 5L3SA 1NKSA 5GADl 1KZGB 3NKVA 2TMKA 1XEWY 1KKMA 1ZU4A 2QGZA 1OFIA 3K0FA 1Z5ZA 2VP9A 3JVVA 4C2UA 4U7DA 1MOZA 1Q20A 2V1XA 2FSFA 4DBLC 1KI9A 5FBRB 3VMFA 3U44A 2QRZA 4IOKA 3E5HA 3AGQA 1HURA 4BFWA 1TU4A 3RS3A 2JLQA 5FPYA 3GFPA 1G8HA 5EE1A 2IK8A 4LX0A 1PLLA 1Z06A 3GEEA 4NDZA 2GKSA 1N25A 2WVJA 3TRFA 4DUGA 1A5TA 2D3WA 1R0ZA 4UNQA 4Q18A 4US1R 3T12A 1NMZA 1R0YA 2A5GA 2GA8A 2WHXA 4LBVA 4NYIQ 2IYZA 1AN0A 1L2TA 1GIAA 2CCKA 2GRJA 1Q0UA 4N3NA 1G8YA 4B75A 3JZAA 1E2KA 1E2NA 3ASYA 1P75A 2XNSA 3RS4A 3KXIA 3SYKA 1BS1A 3BH0A 4L9WA 4CF7A 1IBRA 3RYTC 1IY2A 4NCNA 1AQYA 2ZU6A 1D9ZA 2H7VA 2HV8A 1ZAKA 3C14C 1U98A 2B92A 4HB2A 3QSYA 4DC9A 1WRBA 5KNBA 2ZRAA 1I2DA 2ZQ5A 2DFKB 4WW0A 5JCZA 1NVVR 3B2EA 2PJZA 4IDPA 1D5CA 3HYTA 4OKSA 2PX0A 4RFVA 1XPUA 1MABA 3L8ZA 4Q21A 2G77B 1Z6XA 2QAJA 3NHBA 1SVWA 5GVSA 3ICEA 3RDPA 4B33A 2F3TA 4LPKA 2WJHA 2WOOA 4OJQA 4XD7D 3ZVLA 4Q1FA 5DI9A 2GEUA 4X8LA 4PFSA 1E2MA 1RIFA 5DI3B 1FOEB 3R8FA 4MRRA 4L8GA 5GVRA 2AK2A 4JL5A 1E2PA 3RANA 1UEJA 1M7HA 5EZ5A 3UIEA 5DO9A 4GMXA 2EFCB 3GMTA 1LF5A 5SZIA 4RD2A 1V43A 4M1SA 4DLSA 5FOWA 1GSIA 4MUBA 2EFEB 3T35A 4BRUA 2IYTA 3HJNA 1GVNB 1IN7A 1TAGA 5KDOA 5FUXA 3IEUA 4LYJA 5KTYA 3C5HA 1G19A 4R7ZA 4FN5A 1G3IA 1NN1A 1Q44A 4MYCA 3U6KA 2CJWA 2O0JA 1A1VA 2VP2A 4PPGA 2ODBA 2G0TA 4A15A 1XEXA 1N6RA 1OPXA 2RGGA 4OQNA 2ZAMA 4PC3A 2P6UA 4JBYA 2ONJA 4PC6A 1DAFA 2P0EA 1JXOA 5E3HA 3O8CA 5CB8A 4V0ME 4XOIA 2B7BA 4TMTA 5IF9A 4LRWA 1G16A 1J2JA 2QE7D 3NIBA 5A0FA 4RFSA 1DAGA 1F2TB 3L8YA 4EPYA 3IILA 1KHTA 4RKFA 3T06B 1XCMA 3AVTA 1EFUA 2VTKA 4W5WA 3E2IA 4AIIA 3QUSA 4RVCA 1NNEA 4A9AA 4WAUA 4OHWA 3BFVA 1Q1QA 4G0NA 3QF4B 4PZLA 5B64A 2BMJA 3F8TA 4BASA 3EXAA 4OQFA 5FPSA 2V54A 1IN6A 1N6KA 1TX4B 4PQYA 1A2KC 2WSSD 4FCVA 1Y3AA 1OW3B 4K81B 4MRPA 3PV0A 4Q00A 3W6OA 2XB4A 4MUAA 1R5OA 2N1BA 5K8IA 3U7HB 4A0GA 2GVDC 2ZJAA 5G3ZA 1X8LA 2IXGA 2W6IA 1XFAA 3OESA 4PHTA 2ZRIA 1G5TA 2NPIA 3OE7D 1J70A 4JT2A 2OEPA 3O8DA 3MJHA 1KDTA 4KI0A 2ZJ2A 3BB3A 4Q19A 4TYWA 4WZ6A 1ZVQA 2ODWA 1N0VC 2DHRA 4GRAA 4P4SB 5DIFA 3TE6A 1KAGA 1X1SA 3BAFA 3LA6A 4JJKA 4TYYA 3TQCA 2QT1A 2E9SA 2GK7A 4HAUA 3VAAA 4LYHA 3WP0A 2C8VA 4NTZA 1DELA 4GZLA 4BFYA 5FBVB 2ORIA 4NH0A 2FGKA 1XTJA 1NLZA 1GTVA 4LJAA 1RC8A 1QG4A 3ZLJA 2AWNA 3MCAA 3A1WA 4AYTA 1FUUA 4XSGA 2R44A 5J4HA 2ZS9A 5DN6D 1II9A 1S0UA 4A8JB 4JBXA 3CKLA 5CJ2A 1FTNA 2BVNA 2HT6A 1WCV1 1KDRA 3ZVNA 4NYJR 4TSFD 2YKGA 3Q85A 2AXPA 3LAWA 1JQJC 2DWOA 2O8DB 1FX0B 3LLMA 1UAAA 2QORA 1KMHA 2C99A 2PMKA 1UADA 3LH5A 4BLPA 4FMDF 4EJSB 1G4UR 2GBLA 4ZKDA 1N6LA 1NVUQ 3E1SA 2FV8A 2IXEA 5EE9A 5EUMA 2FGJA 3FFAA 2MMGA 4XSHA 2IF2A 4HLQB 2R2AA 1XNJA 3CZQA 2GF0A 3SU8A 1YHNA 3CBQA 2CXXA 4YXWA 4IOMA 5BYKA 2MSCB 1ZNWA 3JZMA 5JSZA 2XITA 3TR0A 5EP4A 2OAP1 3IBGA 2ANBA 4NPHA 3FHOA 3S1AB 1E1QD 4M53A 5KSYA 1U9IA 3D3QA 1Z22A 3GJ8A 2WOJA 4HATA 4JL8A 5AUQA 3R9XA 4EUNA 4WBSA 1P5ZB 5KNCA 3MFYA 1VG1A 3GFTA 4JIMA 4Q1CA 4PPFA 1DAEA 3QKRB 1E3MA 4DVGA 1AM4D 4RCZA 3HPRA 4ZCMA 4UXJA 1SVKA 1ZIOA 2CLDX 3GFOA 3NBZC 4DDUA 2VQSA 1DVRA 3ADCA 4V0MA 4A6XA 2CCGA 2WKPA 3TUJC 2IEYA 2PCJA 4IXMA 4B35A 5CJPA 2QP3A 5L8VA 4TL7A 3THXA 2HXSA 1ZRHA 4AK9A 2EFHB 1BYUA 5AUNB 1NIJA 4JZKA 3B6EA 2ORVA 2ZS7A 4JLBA 1AS3A 2MMCA 4Y0AA 2GZHA 1CF4A 1EFHA 1G21E 4WIAA 1W44A 1XZPA 3CIOA 2R9VA 1XTIA 5FI1B 1Z08A 1CTQA 2QMUA 1FUKA 4D25A 4Q4HA 2AN9A 4ESHA 4QJ3A 3AM1A 4ILEA 2V6IA 4TQ9A 3TAUA 3SJAA 4GT1A 5C1BA 4I1SA 1VHTA 2BCGY 2PZGA 3NBXX 5AWFC 4D2IA 1M74A 1Q1BA 1T3HA 3N2IA 4DLWA 1EFRD 3LW7A 2GXAA 1KAOA 3U3OA 1FFHA 4F38A 2GJKA 2CHQA 3GD7A 2EFGA 1NL3A 2XNDD 3MD0A 1GKYA 2XGJA 3QVVA 2VHUA 2YWEA 5CB6A 1HEIA 3IQXA 2GCNA 4GOXA 3EPLA 4GP6A 2Q3FA 5TARA 4CIDA 3D7MA 5G41A 3IGFA 1GFIA 3KXLA 4QL3A 2WJJA 3VU9B 5L3SB 5KNDA 1VECA 2FPLA 2QU8A 3GLHB 4H9GA 4HZUB 3UG7A 3L43A 1KO8A 3IO3A 3K0FB 2O52A 3KDSE 2OHFA 1SZPA 2G83A 1LV7A 3EG5A 2ERYA 1QHSA 4Q01A 1SXJA 1LB1B 1JB1A 2WSSA 4QFMA 4CEIA 4IFBA 1GM5A 1XD9A 4HUQA 3WBJA 3TJZA 1NF3A 1TU3A 4XTCS 2YOFA 4NHOA 4U00A 3DKPA 2HXYA 3X1WA 1K6MA 3GQBA 4GL2A 4DSUA 1E4VA 1DG3A 4LGMA 1E1RD 5J40A 4R71A 5F3WB 4X8MA 3MSXA 5JI2E 1XBTA 5HKKD 2W83A 3WMEA 1ZC3A 4PHGA 4TN1A 3FDIA 1GAJA 2G88A 4ZCIA 3EWAA 1QZXA 3EZ6A 3LW8A 3VKWA 2HJVA 4TMXA 1ZBDA 4JSYA 4YMTA 3I3SR 4C7OA 2QAGC 4C4PA 1UEIA 1Q22A 2Q6TA 2XAUA 4UXHA 2O8CA 2WWHA 3PUVA 3ZS9A 1Z47A 2FG5A 2O8DA 1UFQA 3PFIA 5E7MA 5DHFA 4D4MA 1UBFA 2J0UB 4MITA 3RC8A 4KCGA 3UXMA 4D4JA 3KXKA 2CE7A 4FD2A 2W2VA 5SZHB 1JR6A 2VHCA 4I1VA 3NXSA 3GJ4A 1Z2CA 2FDCA 1YU9A 4IVQA 4HDOB 3WMGA 1FMJA 2ZEJA 5JCPA 2D2EA 1VCNA 2CHVA 3QPVA 4IDNA 2J7PD 3UKDA 4M1OA 2JIZA 4DT1A 2V4ZA 4D26A 3NTUA 2FNAA 3PCRB 4C0KA 4GOKA 4OYHA 4HB0A 1HYQA 5IRCD 5EE3A 4BLSA 4Q7JB 2YWFA 3K53A 3IO5A 4O25A 5JJIA 2OXRA 1OH6A 5KDLA 1UF9A 3NEJA 3W5JA 2IYLD 4RFSB 3QG1A 3BFXA 2CK3D 2ECKA 3DDCA 3HDTA 2RGNC 1Z83A 3BS4A 2OBMA 2GZDA 3KJIA 2F43B 2VLIA 2R6GA 3K0AB 1TQDA 3FHCB 5FTLA 4YMWA 1S1CA 1YZTA 2FU5C 2W00A 2XZPA 4IJMA 4P32A 1DS6A 5DYGA 2ZSAA 1EWRA 2V55B 1XEWX 1K5DA 1QHNA 1I4DD 1KI6B 2WJYA 3FE2A 4IOJA 3IPXA 4GDFA 4QJ5A 5EQTA 1YZKA 3R7WA 2WMOB 3MUFA 4B47A 1FZQA 1T5LA 1A2BA 4J0QA 3P4XA 1N6OA 4C0BA 4Z8XA 4BEJA 2NQ2C 2VIIA 3AQ4A 1OB2A 3FYHA 1KI7A 1SKYE 4Q4HB 4LJ7A 3ZGXA 4ARZB 4M1TA 3DOFA 3PUWA 1XD2A 1QHIA 2YVUA 4P4SA 5SZJA 3KUCA 1W7AA 4JLMA 2P6RA 2OM2A 3ADKA 1M2OB 2ZXUA 3ZIAA 4BFTA 2ZRDA 2FJUA 3IUYA 3WY9A 1NBMA 2QTVB 4N0DA 4LOAA 1X86B 1P62B 1TQ4A 1JECA 1CRQA 1RRGA 2BDTA 2H17A 2VF8A 3B1WA 3LBNA 4JKIA 3CH5A 3A4NA 4FWIB 3ZDQA 5D3QA 3HR7A 4URUR 1N0UA 3MLEA 1P7CA 4G5OA 1ZUNB 4URWR 3K09C 4LHZA 3Q5EA 4FW9A 2RHDA 1LFDB 2PMDA 1U0LA 3CWQA 3SYLA 1BH2A 2XNDA 2GDJA 5JECA 2VBCA 3U6BA 1J8YF 4DSOA 3B7GA 2D74A 4A82A 3VR6A 1GL9B 1CR0A 4PQFA 1G64A 3AKYA 1KMHB 2AD5A 2J0QA 3B82A 1ZNZA 2F9MA 1EFRA 2WWWA 2AFHE 3IIJA 1SXJB 5FUWA 4KBGA 1S1MA 1MO4A 1S9DA 1SKYB 2BCJQ 4DSTA 2J0SA 4P4TA 3PEYA 1TNDA 1YE8A 1UPTA 1H8EA 4W7SA 4BFXA 3RNLA 3K0EA 5IT5A 1ZM2A 3EA0A 3FB4A 4JJZA 1E98A 3L2OB 4KVGA 4DLRA 1HY3A 3AF1A 5BW8A 1T0JB 2C03A 3CPJB 3I72A 1DARA 5E7IA 4QGAA 4PSKA 4MQBA 2NO1A 4QGGA 3V00A 4C0HA 1Q12A 4JLKA 4A6PA 5KSZA 3VR4A 2AX4A 2OFWA 4QXAA 1KSFX 1NRJB 3A8TA 3NBFA 4CRWB 3AP2A 2RH5A 4Q9JA 5C4GB 4Z51A 5D3MA 2BKUA 1R5BA 3L0IB 4LCBA 3SOPA 1TEVA 5H8WA 1TL7C 4A8JA 4RZ2A 4QOSA 1SVSA 3HP1A 2LCFA 2NO6A 3CF6R 2GESA 2ZRFA 3NHAA 3OFND 5BN5A 4QGHA 2NZ8A 4V0LA 3RWMB 4TLEA 2V9PA 1WDTA 1ZNXA 3LV8A 1HQCA 4LHXA 1OYYA 1ZUIA 3H2YA 3QNUA 5JRZA 1W36D 5F9HA 4Q9HA 3CNOA 4URZR 1EXMA 3GJ5A 4MDEA 1JI0A 1F2UA 4Q03A 4Q4AA 5FOXA 3UWOA 4B3FX 3I5XA 4ABYA 4YONB 5FTMA 3ZQJA 2J45A 421PA 2QM7A 2ZVPX 2BMFA 1Z0FA 4TTRA 3UMRA 1GNRA 4RD1A 2O8BB 5CIWA 3VKGA 3U60B 3ND8A 3NBYC 4V02A 2R6AA 3AEZA 3MWJA 5FL7D 4DCNA 5L3QB 3AVXA 1KK0A 3PR1A 3PXGA 3KQKA 1VDZA 2QG6A 3IKJA 1AIPA 4B3XA 1I4TD 4NU0A 5J4VA 4QJ4A 2DFLA 4GOJA 5C46F 3G5UA 3I4LA 1HH4A 3ZZTA 5C4MA 4PO9A 3W34A 1UKEA 4EAQA 4L5BA 1X6VA 3EPHA 2W6JD 5AUOB 4YMVA 4LV8B 3RWOA 4D4KA 1ZJ6A 3CF2A 3EWSA 1GKIA 4OK6A 3RS2A 2A78A 3AF0A 5JWOA 1ZD1A 1VCMA 4PC1A 2GNOA 3IEVA 1XTSA 1O3YA 2P6NA 1N5JA 4BFUA 1P2SA 1UM8A 1WB9A 5TXGA 3E70C 4LUCA 2ZUCA 3W3ZB 1RYHA 5CM9C 1LTQA 5UKDA 3RSOA 4DKXA 4KSBA 1SXJE 2O8FA 4RY2A 4E22A 3TMKA 4B2IA 1ZD8A 4W5JA 3RS5A 2IYUA 4OHXA 1NMYA 4LY6A 1JR3A 4LYFA 2P3SA 1OHHD 2FPMA 3IDQA 4E03A 1IN8A 4PHHA 2GZAA 1U8AA 1RVDA 3K09A 2GJ8A 2C04A 1YJ5A 3SC3A 1UDXA 1ZCAA 2JEOA 1C4OA 1AZSC 5C18A 4Q4JA 2C95A 4X8OA 3TSOA 4FIDA 4KFUA 2CE2X 1E79A 3LD9A 1IJFA 4HLUC 3OF5A 3TW4A 2C9CA 4LPSA 4XVRA 3TK1A 4FXPA 3NG1A 5JEEA 4Q7LA 2DFNA 1IJEA 1P73A 4KFRA 1DAMA 1HE8B 4TZ6A 3Q7PA 5G40A 4Q7KA 3R9IA 3QBVA 2CEAA 2ZRHA 3A37A 2O8EB 3BRWD 3GJXC 1P2VA 1MKYA 4EQ6A 3X1XA 3WNBA 4B3CA 3K1JA 3C41J 4XVQA 3K9GA 3ZYCA 3QXHA 4EPWA 4QBHA 1Z0KA 4FMBB 2BMDA 5LD2C 1U99A 4B34A 4B2PA 4Q9LA 3IPYA 3WHKA 5FR1A 4C0AC 2Q3HA 2Q9BA 3B8HA 1H8HD 4AKIA 2GK6A 1LNZA 1NG9A 5EUQB 1OT3A 5DGXA 4JLOA 3J81k 3EC2A 3PIRA 1E9FA 2YC4C 2FFQA 3SNHA 2RGEA 1KIMA 1OKKA 2NGRA 4D80A 2ZREA 3PITA 3NDBB 2J7KA 3BOSA 5KPDA 2G6BA 1IAQA 2WPDD 2YOGA 3EIEA 3SEAA 2JATA 1Q1ZA 3BWDD 3AV0B 4UKDA 3U3JA 2NZJA 1BMFA 3Q72A 2O8CB 1UJ2A 2A7QA 4OHZA 2VPPA 2IS6A 1V5WA 2PX3A 3BFKA 1OJLA 1E0SA 3MWKA 1NN5A 1ZCBA 1VHLA 5CYPA 2C96A 3SS8A 4B6EA 4I1UA 5H70A 2XB2A 821PA 2DB3A 2IYSA 3CRW1 3AVVA 1NJFA 1P2TA 2EQBA 1E2GA 3M1IA 3M4YA 2VH5R 4RD3A 4D0GA 2QA5A 3LO5A 2ZETA 3TQFA 1ONBA 3UMFA 1NVWQ 3H1TA 2CNWA 2VP6A 4DB2A 2GJ9A 1KK1A 1KNQA 3CB4A 2WWGA 4AKEA 5KSPA 5B57C 2AFIE 2CDNA 3DPUA 4KO8A 4JL6A 4Q5IA 2QTFA 3ZZ0A 2EVWX 4D6PA 2F6RA 4M4SA 2OESA 121PA 2YOHA 2QGNA 5HKKA 5JMTA 1L4YA 3KQLA 2BEJA 4DRZA 4UXIA 2PZEA 1EFTA 1KO4A 2RGXA 1ZM4A 2FE4A 4CEJB 2C9YA 1P9NA 5EP2A 4PC2A 4B74A 3TKLA 2ZM5A 3VR3A 1HUQA 2WWIA 4PSVA 1EGAA 3VHLB 2DR3A 1XJCA 4DDWA 3DMNA 3FKSA 3RLFA 1JALA 1ZU5A 3GLGE 2WWYA 3I73A 4R2IA 1NG1A 5IK2A 1S8FA 3FKSD 2ZJYA 3ADDA 2ZI6A 4DLVA 2VF7A 2ZITA 1LS6A 2ZJ8A 2XXAB 5KU1A 3THYA 1EX7A 1XD2B 2ZI7A 4YMSA 2GAOA 2CVFA 1G7SA 4Q1EA 4KU4A 1FTSA 2FFAA 1R10A 1AKEA 4OK5A 2IC5A 2IYWA 2RGDA 1Z6TA 4O2RA 2XSZA 3TAHA 3THOA 1UBEA 4AYWA 4QM6A 4LZZA 3BB1A 1IM2A 2QM8A 2YJTD 4G5QA 1W1WA 4CEHB 3TBKA 3QEOA 5FFMA 2IX3A 4ACAA 2X77A 3T1TA 2NIPA 4MGYR 3QJYA 2ZS8A 1I4LD 1R0WA 2G1KA 3QXSA 2KJQA 2XXAA 1JNYA 2GEDA 5B30A 5HZHA 1JPNA 3TR5A 1T8TA 5HE9A 1E79D 1QRAA 1XF9A 4BEBA 3GP8A 3G0HA 1ZUHA 4HSEA 4LC1A 4ZDJA 4Q48A 4TT3D 1H8ED 2FEMA 2K5UA 3MAAC 1R2QA 2BEKA 3SQXA 1FNMA 1KSHA 4V03A 1G6HA 4A2WA 4DIEA 4CEHA 4A2PA 1OXTA 1FP6A 3OZXA 2FA9A 4LHVA 1GL7A 1X3SA 1SXJD 3QY0A 1VG8A 3QKTA 2R62A 3VTKA 4ON9A 2RMKA 3EPKA 2NO7A 3LX8A 4KFSA 5FBLB 2ZI9A 4QNMA 3B1XA 4RJLA 3SFZA 5AUPB 4TMKA 5BYJA 3AVQA 4L15A 2X1VA 1G5RA 4KVAA 3AB3A 2Z5FA 3K9NA 4PANA 1AS0A 1JQLB 2F7SA 2RGBA 1NLYA 1H8HA 2ZYTX 3GPLA 1CJMA 2V7QA 2JLVA 4GMDA 1YR7A 2V6JA 3MJRA 4HUTA 1D2NA 5L3QA 2F1IA 3U7GA 3CPHA 1ZINA 2JLWA 2IYQA 4Y0VA 2H92A 2NO9A 1T3SA 2IS2A 2A9KA 5FH9A 3OFNA 4B3BA 4DT1B 5HCIA 621PA 4MRNA 5AJVB 1Z29A 3FOZA 3UK6A 3RS0A 2DY1A 1H65A 4YDHB 4PO1A 4NKRA 3RHFA 4M9SA 2JLXA 1NIPA 1QDEA 3U5ZB 2NPFA 1E94E 4M8NE 3F3YA 3THWB 3QOFA 2ZRPA 5EE5B 2CL7X 1G3MA 1DBSA 2OXCA 1VG9B 1QVAA 1VCOA 1EFCA 1RRCA 3GLIE 4G5SA 4NL4H 5G53C 2A3RA 3LRPA 1L4UA 4GP7A 5J5CA 3K8YA 1MV5A 1UKYA 4M0LA 2QBYB 2JLZA 1E9CA 4MA4A 2C5LA 3UG6A 5B2ZA 1WA5A 3JVUA 1W2GA 4EPVA 1MO6A 1P9WA 3GLGB 3I32A 2KBEA 3DMDA 4B6FA 3U4QB 3KUDA 4XJXA 4ZCLA 1E96A 3K70C 2OBNA 5A4JA 2HUPA 5AR1A 1XCPA 5IK2D 3TUZC 1R7RA 1GRRA 2X8AA 3FFBA 3TNFA 4CZ2A 2ZYWX 2GWHA 4HB3A 5LB4A 1D8TA 4IVPA 4M9ZA 4CDGA 5AJYA 1M6NA 2OG2A 1W46A 1OFUX 1RKBA 4XWKA 1QVRA 3QQ5A 2QUZA 4F7WA 1E2EA 1TQ6A 1HA3A 1KOFA 3CF0A 2ZJBA 4LBZA 4Q9IA 2GETA 3FMFA 4DUGD 2D7DA 3MMPA 4HI0E 5EZ6B 4E09A 2XZLA 4G1UC 3NWJA 1NP6A 4IDOA 1W0JA 3SI7A 2ZRNA 2Q3MA 3AVUA 2O8EA 1W47A 4OI0A 5TDHA 3WXMA 1EG7A 2EYUA 3QENA 3SZRA 2VSOA 4DEXA 1E2FA 4TQUS 1ZM7A 5KYKA 1XMSA 3QBTA 3CX7A 3OIWA 4EFMA 5G3YA 1W4AA 1WMSA 3AF4A 4IRUB 3RRYA 3NC0C 4E07A 1VIAA 5LD2B 2HLDA 2ZE5A 4LC0A 5HE8A 2E1RA 2ZYVX 5BXQC 1VIYA 2FSGA 1XPRA 1JAIA 3PUZA 2J0UA 2GCOA 4F93B 2HLDD 3DO6A 2IUSA 3FPAA 4TMZA 4JVLA 4AI6A 1OXUA 4PZYA 4MGIR 5CYOA 2GCPA 5DN6A 4Q4JB 2BWJA 4WXRA 1KI8A 3TSWA 5FPHA 4F4JA 3A6PC 4EPRA 2MSDB 2P67A 5KHOC 1FQKA 2J3EA 1XTKA 2X19A 4TYNA 1W36B 3CZPA 2IHYA 5HR5A 1CBUA 1KNXA 2O0KA 2OV2A 3HU1A 4IXNA 1U8ZA 2I3BA 1OHHA 2D2FA 1RFLA 2E87A 1BKDR 1NY5A 2QPOA 2R6DA 2VYFA 1EX6A 1L7VC 1QHHB 2FZLA 1XPOA 4A1FA 1AGPA 3QE0A 3T34A 3K70B 2UZIR 1GDDA 4BRWA 1DE0A 4LJ8A 1NI3A 1U9IC 1PVOA 2F3RA 5J47A 4A0RA 2P65A 4TTPA 4C2TA 1P3JA 1KYIA 2PBRA 4JMPA 2L0XA 1E9EA 2JASA 2VSXA 1OKKD 5J4KA 2IS1A 1D9XA 3B1YA 4FMCF 1X8JA 2IBMA 2VRWA 4JYCA 4XTRA 3BK7A 3A58B 3BORA 1I2MA 1KDOA 1TMKA 1ZW6A 2JJ2A 2RB4A 1U0JA 1T4GA 2QE7A 5JS7A 5ELXA 1KK3A 2CHGA 4DWJA 4PX9A 4ZI3A 2G0NA 4II7A 1DO2A 4ZPXA 4IEEA 4TLBA 2ZI4A 4TL8A 3QVUA 3SFVA 4ARZA 1S9HA 5GJWC 3U61B 2KSQA 2YWGA 1SVMA 3B9QA 5KOYA 4B43A 1Q3TA 2I4IA 2ZRLA 1CXZA 2PEZA 2CVHA 3N70A 3B1ZA 3WYFA 2GVZC 1FP7A 1FPMA 3DOEA 1YR9A 1FW6A 4NCIA 4OHYA 1AGRA 2N46A 3B85A 2A5FA 1W0KD 3K0SA 4OHVA 2BC9A 5TV2A 5E7JA 1E1RA 1WP9A 2B8WA 3PQCA 4PSAA 2QL6A 3AKEA 1E9SA 3FMPB 1OXVA 1O87A 1YZQA 1ZIPA 4BE7B 1XMJA 1AKYA 4A8JC 3WYGA 1W4BA 1XXHE 3T5GA 1W5TA 4JLDA 4DCTA 3U3RA 3U4QA 3KQNA 1IN5A 2BM0A 4QHSA 2FH5B 4Z1MD 1E9DA 1QG2A 3CX8A 4B73A 3BIFA 2QN6A 1AK2A 1II8B 1SHZA 2VP0A 2R65A 2ZJOA 2QROA 4KLZA 4A0HA 4QHTA 4YLGA 3U44B 3OIYA 3UANA 1JXMA 3FMOB 5FBWB 4QM7A 2OCPA 3LX5A 2WICA 2J7PA 4CT4B 5LDDC 3AVYA 3UMSA 3AVOA 1G18A 4JLPA 4BFSA 1WBBA 2O0HA 5EXSA 2WPDA 3CO5A 4B76A 3A1UA 2WSMA 4HB4A 3FGNA 1YRBA 5TY0A 2Z83A 1E69A 4TLCA
chains in the Genus database with same CATH superfamily
1BQ3A 1T8RA 1NM5A 5EMNA 5JYDA 1QLHA 3QUCA 2JFZA 4GBJA 2AYZA 2HQBA 4PO8A 2PPVA 3D64A 3RVSA 3ER9A 1DEAA 5KNBH 4M0CA 3Q8KA 2VHXA 1X38A 1FFCA 3L8GA 4CM5A 3BTSA 1VBKA 1JXQA 3DOJA 1ZYUA 4WACA 1UDWA 1NR7A 1ZP6A 2C9OA 5LB2A 4KOEC 5KC9A 1H1DA 2HRDA 1Z6YA 3JQGA 4EJSA 4D9MA 2XTMA 3UH1A 1IPFA 3B3FA 5C52B 2X0IA 1J90A 1RHQA 1NPYA 4EK9A 1U0RA 4OMUA 5L4LA 1EDBA 3BIOA 4OLJA 4WZBE 3SS9X 3UXHA 3VR5D 2PZBA 1A96A 4E1VA 4Y1RB 1QP7A 3NDRA 4FIZA 1CY8A 1SG6A 2ZAIA 1U0HC 3CLUC 1S2MA 4D02A 5GJBA 2DBVO 3F7OA 2ZXEA 4QRIA 4FHEA 4NYMR 3ICCA 4JLVA 1MABB 4Q3CA 4BEVA 2GDZA 3TOXA 2GPTA 4XWGA 1OYVA 2CLIB 2VP4A 2X9QA 5JEDA 2VN8A 3QKUA 4Q37A 1IOZA 1E0AA 4YAWA 1TJ4A 5HZGA 2BV3A 4UUOA 5K2OA 3A6HA 3ZHOA 1J8MF 5K8UA 5LZ4A 5ED0A 4ZQFA 2REBA 3AH8A 1T0HB 1VJDA 3T1QA 4CN9A 4ITRC 1WCWA 2Z4RA 1OH5A 2BH9A 2JIOA 4ZEXA 5DU2A 5B6JA 4QUGA 1QAQA 3OCUA 1AKNA 4BCDA 2XVAA 3WLNA 2OGZA 3NIFB 5REQA 4D4HA 5HPYB 2G80A 4MGHA 4HAWA 2F9LA 4RM2A 4XB6B 2GLUA 3JAMA 3AERA 4NRDA 2ZUBA 2QXYA 3Q3EA 5CLQA 5DASA 3CR8A 2Y1LA 1VYUA 1JDBB 1JI3A 2BF7A 2W6NA 2XUAA 5AICA 1EXNA 2RGNA 1PUIA 10MHA 1P4SA 3PU6A 5KPJA 1TKBA 3HWRA 3N59A 3BWBA 4I9UA 4TOIA 1YZGA 1JLLA 3R0VA 5JFGA 4OTZA 5J2UA 1UBOS 4MVXA 5JSHA 2CVQA 3KXPA 4RD4A 4QJBA 1FTQA 1Z0DA 3ETLA 5GOZA 3LGXA 4UBNA 4JI6B 5F77A 5J5AA 5JDIC 3WKBA 1R16A 5JTUA 2P1RA 2LXNA 4FFBA 1VMAA 5FPPA 4MQ5A 4RAOA 2JPDA 2D1RA 2FR8A 1YTLA 4QECA 4HWOA 4ROTA 3JCZA 5PNTA 2AQKA 4DRXB 4QXQA 1JKXA 3CUUA 3V55A 1U28C 3WYAA 4Q05A 4D4GA 3H6HA 1ABBA 3NW9A 4FHFA 2OBXA 3EXEB 1XZDA 4EM6A 5FV4A 5JRJA 4MW6A 3RYHA 1MIOB 3ANYB 1XMOB 2A2ZA 2PGDA 5B5SA 1NYLA 2EWVA 1YB1A 1I1QB 3VAYA 1SY7A 4UNPA 2AHOA 3BB4A 3K1AB 3FOFC 3OZRA 1XZBA 4FCWA 4LN1A 3T15A 1PKXA 1N5OX 2HJWA 3E9ZA 4L0QA 4MKZA 2CL5A 3E15A 4K6GA 4UZSA 4Q4DA 1NSTA 3LXXA 4M1EA 2UVPB 2HA4A 3BTUA 1H2RS 2ZB4A 3NB0A 3PDIA 4KIJA 5CT4A 5CD1A 3ZIAD 2VUTA 1DB3A 3QYFA 4PICA 5IKMA 4YUYA 4ZVSA 4CKBA 4EY8A 2OGWA 1SXGA 4QYSA 3NP9A 2CLKB 3NHKA 3TLXA 2ZRMA 2PGJA 3VSBA 1H22A 3H17A 3I9KA 1UBLS 2X5KO 3T7SA 3FF4A 3W2FA 1WULS 1JJVA 1LJLA 1X7GA 3FBTA 1M8PA 4KAXA 3H3XA 2Z1NA 1NZJA 1N6NA 3VR4D 5IN4A 3A9SA 1X1RA 1YE5A 2RHBA 1MRNA 2QZPA 3LUKA 5GGYA 4EY3A 4DV2B 4OGWA 3TLCA 5JQGA 2UXDB 1ISRA 3AY6A 1V8FA 1W75A 1NVTA 3Q87B 3WNQA 5LM3A 1CPYA 3IX7A 3SR4A 4IXWA 7REQA 2Q4OA 1KYXA 4HN2A 2NM0A 2P79A 1FJGB 1M2GA 2A35A 3IVMA 4HY3A 4TXNA 3O9MA 4LY9A 1Z0IA 4WBNB 2ZWOA 1L4LA 1GY8A 4LMBA 4LYYA 3IXLA 2Y1CA 4YUAA 5JC8A 3JASB 3CH4B 3PE3A 3L7OA 5FL7A 4WOPA 4A0FA 2WIBA 1C0IA 3OBIA 4NBSA 3KQHA 2I1QA 2SNIE 4L7VA 4M1KA 2Q6VA 4S2UA 4XYMA 4AZ3B 4YCSA 1AUOA 2HQ1A 4PZAA 4RJKA 4O4LB 2B2XA 1ESCA 2AG0A 5EL0A 1BDJA 2WABA 4MVJA 2X0EA 4LJSA 1GRCA 1MO5A 3ZS8A 1U0EA 2CXSA 1GUBA 4K9PA 2Z2JA 1US8B 1BMFD 1BW9A 2XJ4A 1ANKA 2IHNA 1PV2A 1AXGA 4B7CA 3ZU2A 1WX1A 4HFJA 1NQWA 4JT4A 4XWTA 2OILA 3QXXA 1P60A 5K4GA 4KAFA 5JC1A 3T3PB 4DCCA 1XTZA 3DH0A 1RHJA 1NI5A 4RD6A 4QG3A 1ZGAA 4IKEA 3F46A 1NAIA 2CZGA 1H2XA 1CWUA 1XAGA 2LNDA 3NDPA 3DMHA 4ISBA 3PFGA 3IYLW 5A9SB 2CLEB 1NM5C 3QE3A 2ZJZA 4YECA 1VFPA 1TVMA 4NATA 2Y66A 2Z8YM 3RF6A 1TLTA 2EHDA 2VL7A 1Y7PA 1F5NA 4DV0B 1GGNA 3LCRA 4YTEA 5KVSA 3ZZMA 3LA8A 2XAAA 5DVZA 1HXHA 3H13A 1TB4A 3LPNA 4O63O 3WK8A 4B4WA 4R9RA 2IUUA 4MWZA 1JDJA 5CP8A 4J94A 1C7QA 3QA3E 5AHRA 4IILA 1BE8A 2C4NA 4R68A 4EI9A 5KVCA 3EVGA 4YIHA 5LDHA 4NBUA 5AM0A 1QDUA 2WA1A 3S81A 3ZDXB 3OPMA 1RLIA 4JLJA 3DAGA 4N01A 4N3BA 1R5JA 2GAJA 3T9EA 3CIFA 1ACJA 3FYUA 1WR8A 2VK2A 1PT6A 4AY2A 1XDBA 1DJQA 1TQ2A 2P1ZA 2TECE 3A3NA 1OLUB 3FBWA 2NTYC 3GEPA 4UTXA 1DXYA 3OCYA 3R7WB 2F1HA 4R81A 3EARA 5J2UB 4YRFA 3CRNA 3SX2A 5KYYB 1EUQA 3BUSA 2DR2A 4LC9A 1NQOA 1HE2A 2ZIAA 3QE4A 1GTL1 3KTAA 1AVTA 2HC9A 5HW0A 3EODA 4HVCA 1WKVA 2RHOA 1FSPA 4CODB 3EFOA 4AP9A 1NW6A 1S7GA 4Z9XA 1EK5A 4ZN6A 1LCIA 1QQ7A 1YR6A 5CXUA 2CNKA 1SXJC 4AWAA 3U4MA 2LUOA 2QNRA 3H4MA 4R1MA 4Q02A 1UBUS 1PJSA 3UPTA 2CT8A 1P7YA 4I8DA 4UEWA 3FCUB 2PUEA 2PKQP 4MW4A 5E1DA 5C5DA 5G4LA 4QTXA 4AFNA 3EZ7A 1CZUA 3OEED 4R6XA 5ALRA 4G37A 5C7LO 3MWYW 1KI3A 1ZZEA 4RE6A 3KL2A 1MIOA 1A9SA 3DTNA 4OH7A 4DLUA 3JALA 4V0OA 3DDOA 2XSZD 2GWRA 2B9EA 2NOAA 2M1XA 3GCZA 4CTJA 2PMFA 3H11A 4YROA 2HRRA 3IAM1 5FUVA 4R69A 3WWEA 4ZD6A 4XOUA 2J30A 3HB4X 4KQKA 4UFOA 4X7RA 1EFKA 1N32B 1ODKA 1V16B 1VL8A 1T0BA 4IMIB 1P5HA 1WHTA 2H1LA 5G4KB 1JR3D 2NUAB 1TA0A 3PT9A 1XWWA 4OBXA 5K05A 5LZ9A 1F4LA 4DS3A 2F67A 3FPFA 1G8SA 3OFKA 5EXDA 3R41A 4J3NA 4I8XA 3B51X 3H6GA 1X1QA 3MQFA 4L72A 5ECDA 4B71A 3ZD7A 4IYRA 2M6SA 3AHCA 1A82A 4ZQIA 4FWTA 1Z25A 3W8DA 4C5BA 2Q0HA 2OHXA 2VSQA 3E61A 1QIMA 2X2PA 4X6XA 1T43A 1QF7A 1CERA 4U7WA 4AMYA 5F5LA 3EQ7A 3ZCVA 2EBFX 1KJ8A 4B48A 5A5GA 2CHFA 2FW9A 3UT5B 1W5AA 5ERGB 3QKSB 5E2IA 4HHEA 5HEKA 1JIQA 2ZUUA 2XCQA 3BN3A 1CDOA 3U7EB 2AJDA 3LOUA 4FP9A 2QWXA 4UHJA 3EVAA 3ELBA 3M4NA 4KXWA 3ACBA 4L0MA 3K9WA 5H5JA 5IC6A 2GA9A 4C5AA 3F7NA 3GY0A 4RIIA 3OKAA 3I01M 2Y1OA 5KYXB 1FEZA 2EP8A 4J49A 1LD3A 1KETA 1KI1A 2BMEA 2I2AA 1ND5A 2FPPA 3FXAA 3G2QA 2Q29A 3LRTA 4KLNA 2ZBPA 4M89A 4ETWA 4BNZA 4TKMA 2HA5A 2JFUA 4PLYA 1UDRA 3CISA 5I7WA 3NPAA 3EW9A 1C3XA 5LP1A 2YS6A 2HSJA 1EJBA 3BGSA 2CB0A 3KR1A 2HHLA 1VRWA 3U26A 3V1MA 3RABA 5CG2A 5LPNA 1I30A 4GVLA 1NJ6A 4AKGA 1Y7LA 1L5OA 3IH5A 1Q7CA 1CJKC 1U04A 4K8OA 5JQGF 1T9HA 1XKXA 3G0DA 4EYOA 4RXUA 5FQOA 4AZ3A 1RYEA 4PG5A 3VXKA 4PU0A 3L9XA 3KKEA 4PWZA 5DWVA 3VX3A 3U37A 3F96A 5CX1A 3WRYC 1TE2A 5KDDA 4MVJE 1ZJ4A 4K6OA 5LP6F 3AVWA 1PFGA 1R3UA 2P91A 3F7MA 4R1TA 2WAYA 2FYTA 5D7NA 3AOGA 5JNRA 3DS8A 1AB5A 1ULTA 3KVYA 4OHRA 3RKSA 2JCYA 4QT4A 2IPMA 2UKDA 3G59A 3MWDB 1Q95A 1J0EA 2Z1MA 1VBNA 5SV2A 2A94A 2WM3A 3QFTA 4GWGA 5DLYA 1DMRA 4HOYA 1YRWA 4IZ6A 1RAGA 4KWTA 4U2EA 4B2LA 2IV7A 2RGUA 1SB9A 1U80A 2NTVA 5EWMB 1TVEA 2Z43A 2JLUA 4NZYA 2XBUA 4CLRB 4TXLA 4EGCB 1UBMS 3GNSA 3HUTA 1F3OA 2A5DA 3W5VA 1BHQ1 4R1NA 1JBKA 4QYMA 1JKIA 1XZGA 3JZIA 1H2HA 4IHJF 2C00A 2HJSA 5TMBA 4YJFB 4COKA 4RTQA 4Q1BA 2VHJA 4J8PA 3IKVA 4L51A 4WLNA 4QGSA 3GIWA 1B3BA 3K0CA 4YH1A 3ZLTA 2WHQA 1ORHA 1PFQA 4MJ3A 1YKGA 4P3YA 3W7BA 2JZNA 3L7KA 1ODCA 1W34A 5EFZA 3TLZA 1KHHA 3QUTA 1IHUA 3EMKA 4Q66C 4PHFA 4RIEA 2EP5A 3HU3A 3FYUB 4XFKA 3L7JA 2E85A 4D5EA 3HPQA 1E58A 5CU7A 1NYRA 3IJPA 2FQYA 3UO8B 1I10A 2ST1A 1OBHA 3EUFA 2GD2A 4MEBA 4ZOEA 4D82A 4BMOB 3GBPA 2DSTA 3M3PA 3GNTA 1KJIA 2DQSA 2YJGA 4MP8A 2HDNB 3PRHA 3SBDA 1ZEJA 4XI9A 3FZQA 1JYSA 1GTMA 3V7YA 2QD1A 4X41A 2FN4A 2TYSB 4JR1A 5KO2A 3OURA 3PIDA 1GDTA 2H18A 4UAUA 2X9LA 4EUSA 2ZJ3A 3PEVA 2I1VB 2VDMB 3ILHA 4OO3A 1E1DA 1J42A 1QKJA 3IPRA 3K20A 3OZVA 4LE1A 4S12A 3R0JA 2X1HA 4MYSA 4B17A 4E5MA 2IW3A 1GRVA 2CMKA 1XL0A 2OAGA 3AUJB 5CVJA 3A2KA 2G07A 2XMZA 5BR7A 3SK0A 4CM9A 3BMNB 4Z4EA 3OLVA 3OICA 4FDLA 1M6WA 4NH4A 7GPBA 4PYNA 2NYAA 2F59A 4DMLA 1EI9A 2W2KA 4LV6A 4P7GA 4WK4B 3QXJA 2JDID 4MO9A 1E2DA 1TUIA 4GP9A 1BOFA 2XUOA 2EF0A 1XZ8A 4YRRA 1JPUA 2RGCA 1MFZA 5F76A 5F23A 3I6ZA 1H3NA 4N8DA 3VNUA 4XM2A 2ODQA 3ND6A 4MRSA 2ZIUB 1EVJA 4YRCA 3W6PA 5BN4A 1I2ZA 2QYHA 4BVJA 2IH4A 1NBMD 2FN7A 3N2GA 1LI4A 1H5QA 1GILA 2WP0A 1NE7A 3FTCA 2Y1FA 4DJTA 3O8QB 4HD8A 4TMFA 4QBGB 1UKCA 1DZIA 1XD8A 3ANMA 1ZC4A 5DV9A 3KYIB 2CYAA 2O7VA 4AJEA 3DEZA 4XLLA 2C2HA 1KOLA 3ANXA 3DP9A 1KMNA 5CK4A 5KQMA 4I2NA 1LDGA 3GQBB 4BFZA 2BRUC 4E12A 5LKAA 3SJBA 2RONA 1ZCFA 3A1NA 4WE3A 3WMFA 4CM6A 3DWIA 4LJ6A 2CJFA 3FHLA 1TZKA 2J5BA 3N74A 1L7QA 3BSSA 2JJ1A 3M6WA 3MG9A 3RT9A 1XQXA 2H2WA 1L5FA 3RTEA 2PIDA 4H31A 1YZLA 3PYXA 2G71A 2PRSA 2FRVA 2G08A 5FOSA 3A9RA 3BTVA 2ZYIA 4GPBA 4HEJA 2PRZA 1P72A 1XNHA 1WTAA 2JAHA 1HFJA 2BEWA 1FMCA 4M21A 4YUVA 5CFLA 5FR2A 2WG0A 4NZNA 4OKIA 4TQGA 3M6LA 2KHZA 2BGJA 3VR6D 1VXRA 2QRVA 3LBIA 1DQNA 2RH4A 1SKQA 1J09A 3KQVA 3WBBA 2OV1A 2ZRCA 3MSCA 2WJGA 1XZQA 5BN3B 5IXSA 3ZD6A 5EPOA 5CB0A 2Q3CA 1HNZB 3M4JA 5AM1A 3T1VA 2C29D 4P0TA 1MW9X 3OI7A 1XT6A 1D1PA 3QM1A 3FI0A 1JW9B 4H3KB 1DC3A 5C8XA 1JSLA 1LZKA 2R1TA 4J7CA 4UMDA 4LWPA 4RELA 4MGZR 1AY0A 3FSGA 1QIEA 4FX2A 3HA2A 5B7NA 1MX1A 3R5KA 4C7JA 1FUEA 1O95A 4L8VA 4AJLA 3K70D 3FWKA 1UCFA 3IHKA 4CF3A 4AIRA 2RHLA 4LVCA 4EHHA 2HQRA 2ORED 3T9FA 3OZSA 2ONZA 3DCYA 1V6SA 1N5RA 1TMGE 3FGOA 4G1VA 4JCOA 4DDTA 5DTJA 1OI3A 1RJGA 4AO7A 1C4KA 2YQ5A 4Y9RA 2RGWA 5TJHA 1JHQA 1OE0A 3W6UA 3I64A 1JLMA 5TT1A 4I4LA 5FBHA 2B4QA 3V4LA 4MROA 3F5FA 1AQUA 1G2PA 4MS1A 3I53A 4PZCA 2PJRA 3QMWA 3NVAA 3LC2O 2GF2A 4MKHA 4HAXA 5JR3A 2WYWA 2Q0SA 4YB8A 1NBME 2Q3DA 3IOYA 1HDGO 1R00A 3AFNA 4AAYA 4ZICA 1UPCA 3H2BA 4V0KA 4IGKA 3GGCA 4DIDA 3THRA 5AW8A 3ZDRA 1SB8A 1X0XA 2C4HA 3AUAA 4HH3C 2VZ8A 4YXWD 5JAZA 2EKQA 3N87A 1ECJA 5DBHX 2OG1A 1WDWB 4I50B 3NTRA 3QJGA 3HO1A 3FWYA 4GNKA 4TN5A 4KUHA 3S1AA 4Z7QB 2DKNA 3WLRA 1JFLA 1Q84A 4MQLA 1NTOA 2VR1A 3D6MA 3EW7A 2Q9AA 1IONA 1RWNA 5BSMA 1FP4B 3N39C 5AVXA 1AQNA 3BRQA 3OKCA 2WG1A 4KR7A 4IINA 5IAKA 1GGEA 4WPGA 4AJKA 3MRSA 1O6GA 5YASA 5M34A 2ZUDA 3OVMA 1AKMA 3KPYA 4GI1A 2A4KA 1RS0A 3LC0A 1ZM3A 3IP8A 3WYBA 4C6TA 1ADFA 3KR2A 3DVRX 2QUAA 4P3NA 3GDHA 1S4QA 1IHOA 1CR2A 4OA8A 1ZXXA 1NY6A 4PG7A 4YUZA 4TLAA 4FFWA 2MU1A 1E2LA 3SDZA 2VTVA 1C1YA 4JP8A 2XZOA 4F12A 2G40A 3GW8A 3L01A 4M60A 1TYAE 3V6MA 1P7VA 2OK8A 2WMYA 4MKRA 1WSBA 4E88A 2IODA 1X8KA 2PR2A 2QQ5A 3B3GA 5JH7A 3P9CA 5CIYA 3K8QA 3PDJA 3M9XA 3PNMA 4YO7A 1GPKA 2FMTA 1CK4A 4FE3A 4HZIA 1FDIA 4JS0A 3IBCA 3S68A 1J5XA 5LBIA 3FM9A 3PC2A 3LT4A 4G0OA 4Q3AA 3TL2A 1MIHA 2WTUA 4KR6A 5KREA 1HF3A 3KJHA 1P19A 4CKEA 1O6FA 2QLTA 4GOMD 2PMCA 3ZDDA 3TMAA 1RKVA 4MKFA 1C7FA 2GHQA 3RKUA 1CU1A 1JVNA 1W6UA 1RP7A 2A30A 2YVKA 3AHDA 3BMNA 4NEQA 4MZDA 3WGKA 4R6WA 1X1EA 2HZBA 2E2WA 3M6AA 4IQ0A 3O4RA 3OIGA 3KQSA 1USGA 3NS7A 1ECGA 4IHKA 3B60A 3BWMA 5ISMA 4WINA 2VNAA 4X5OA 3HY3A 1U5BA 5B3AA 1XRQA 4ZANA 1F8GA 3RAPR 3VNRA 2YZNA 3TZKA 4CIXA 2FWNA 1IM8A 1ISGA 2J6HA 1SVUA 2XMGA 2F00A 2JDIA 3FYUC 3S2GA 2GBLC 4HRYA 4R98A 3TXYA 4GC5A 3AP3A 4J2HA 4EG7A 4M7PA 4WJZA 4M7RA 5HJ2A 1PT8A 2XUHA 3QXCA 3FVWA 3JW8A 4L50A 4V38A 5CNKA 5IARA 2QAIA 5P21A 4D9GA 3Q8LA 4LKRA 3VU9A 5KYTA 2A3NA 2A0FA 3MTEA 3RSZA 2GLXA 1TZ2A 2YYSA 2C7RA 2X0RA 2HYDA 3VPBA 1K9SA 1RYFA 1XRLA 3OH8A 2VP5A 3ELWA 3HA7A 4GL4A 1Q1GA 1ESZA 1I1HA 1DJNA 1KSGA 4XIJA 5EZSA 3B5JA 3GDWA 2ZTHA 3O2SB 1R12A 4C4XA 3L0OA 4TQAA 1H1LB 2RI0A 2Z0MA 2C1ZA 3TXAA 1YB7A 1VJGA 1RLUA 1F48A 1Z39A 2HQOA 3EIUA 3HEBA 2IITA 2BLLA 2N42A 5KOIA 1MUUA 3IL2A 1U0SY 4Z6KA 4JUIA 4YR9A 1N33B 2IHUA 2VPIA 5A5EA 1ISPA 3I2JA 3CLSC 1Z63A 5E3IA 4KTVE 1CR1A 1YZHA 1FMLA 1G4AE 3JPWA 4MQ4A 1P1CA 1EP2B 3R3SA 2IV2X 4CG3A 4Y2UA 5BOSA 3VU0A 3WLHA 5FUYA 1UJ6A 4PYJA 1AQ6A 1DAIA 2I5PO 2GXSA 4IVNA 4POAA 4LDRA 2BMVA 3B6KA 5LDGA 2RKBA 2QR3A 2XB8A 3K94A 1TU0A 3ITNA 2QEQA 2WC1A 1S8AA 3DZJA 4GGMX 1JNXX 2B5OA 1KP3A 1NW8A 2H57A 2ZT5A 3D7RA 1N2CE 4LJYA 3H9QA 5J2TA 3UWMA 1CQZA 2NMVA 4GR5A 3WOHA 2YHSA 1O77A 5HK9A 3P9ZA 3RTDA 1J33A 5JD3A 1JR3E 2XW6A 1ESMA 1WL8A 2OZVA 2YWBA 3HRIA 4LSGA 2C9DA 4YGXB 3VZRA 2WD7A 1UJNA 3FWNA 1E63A 1J9GA 1WWKA 2P2CA 1WF3A 3I6MA 1MB4A 1P0IA 1DAKA 1XNGA 2CFCA 1PLJA 2JZOA 2A5JA 2DKFA 2IKQA 2ZR9A 3C48A 1H0RA 5BW4A 3S8MA 1CZKA 1NQVA 2B7LA 4D6YA 1DCFA 5KHLB 1B74A 1JB9A 2CXOA 4INZA 3TRHA 2QPAA 3VSEA 4DIUA 3CRQA 4I4TB 2RE8A 4BNJA 1J8QA 1HYHA 3AUUA 1NLUA 2G3YA 3WWYA 4JOQA 2H0QA 4XSVA 5CLGA 4P54A 2D5LA 4GKVA 4F97A 5GJCA 4B5KA 1O2DA 1U1IA 3BZBA 3QU5A 2EEZA 3AY3A 1FP4A 4TV9F 3WLAA 2B37A 2QW0X 4MW7A 4YRTA 3SJUA 4B87A 1N57A 3GCDA 4CKBB 2ONYA 1J25A 1OFTA 2J9XB 3W06A 2WVGA 1ADYA 2HZ7A 4G0PA 4JVMA 3RT1A 3TRJA 2D1YA 4QXOA 1J24A 1J7KA 5CM8B 4DXAA 1WCYA 3TFWA 1P2UA 1J8FA 1MVLA 3CX3A 3GJ3A 2FPRA 4YI3A 3UGKA 4J43A 1IHYA 1WU7A 4M22A 4HAZA 1Y9AA 2ZPAA 4S35A 1YA4A 3QFFA 3D9QX 2PWZA 2BBSA 1WMFA 1J99A 1X0VA 1SCIA 3LDFA 3VVBA 3WJ2A 2FW8A 4F2WA 5GZ3A 2UYHA 4CIBA 3U7FB 3QVGA 2GUGA 5TPZD 1NF2A 2VJQA 3NOVA 4GX1A 4PAMA 3AUFA 5DEOA 7REQB 2NO0A 3URMA 2UAGA 1IHXA 2OUKA 1N6IA 1NN3A 4JBLA 4C9BA 2C92A 3V8MA 4CGZA 2R00A 1DHTA 2R4UA 2XB6A 1PZGA 3IQWA 1QHXA 3LVQE 4BC1A 4KSYA 4PN7A 1H6DA 5ED4A 3KJQA 3VM6A 2FOIA 4JT9A 5IXJA 5DCLA 1U8EA 1CVIA 2HT1A 1NNSA 2FZGA 4YMIA 3FTQA 1YVPA 3LXUX 1UPUA 3I6YA 3M1YA 1A8UA 1TK2A 3EVFA 5F4ZA 3OZBA 3BJIC 1IBLB 2OV6A 3FHTA 2WF5A 3C3CA 3QX9A 4HNSA 1DRKA 1KO5A 4QQRA 4LRSB 5L9AA 3ZV7A 5TR9A 4JBHA 2WHPB 3IB6A 4C88A 5J23A 4CCYB 4JJAA 3WL5A 5AW1A 4YAUA 3KE9A 1Y48E 3KNZA 3LMKA 1GO2A 2OQRA 1FRFS 4HT3B 2B7CA 5LLSA 4JLWA 4PX5A 4ZMRA 1UAYA 2YINC 5A4KA 1GEEA 4AKHA 1BRTA 3RIYA 5LOVB 4H0FA 4NK5A 4LJ4A 1YBMA 5IVHA 4ZA2A 1QJ4A 2IXFA 5B7GA 3D6VA 2RH8A 2JHPA 1F2DA 2HF7A 1YQDA 1XRPA 4TYPA 1E66A 3RBAA 4KAJA 1YZNA 1KP9A 3IESA 2GEJA 4MWDA 3LUDA 5L40A 4BLTA 3A1TA 2V9ZA 3H65A 3WKCA 2H63A 3PEFA 4B8WA 2FUNB 1YB2A 3EH2A 2PU7A 2H5LA 4NBTA 4MI9A 2YRXA 2R8YA 1S4MA 2OD2A 1RWPA 1YIDA 1UKBA 2GAAA 2F1RA 2Q4EA 5CMLA 4DCUA 3LP8A 5JHHB 3AF2A 2YHIA 3TSZA 4RTSA 3NT4A 4OXNA 1GL6A 1FFSA 2Q21A 4JQYA 4B40A 2VHTA 4PCLA 1USUA 2CJPA 1QQAA 2BI4A 1SVLA 2ZANA 2WU8A 4N0EA 4PVDA 5E38A 5LYYA 2FMKA 4QOFA 4ZJUA 1L5WA 4PSDA 5BSEA 5FOTA 3L8DA 4GEGA 1M1XB 3OEHA 1RJ9A 2YXEA 1W96A 3P32A 5EPEA 1HOXA 2GSDA 3I04A 5CNIA 2JBHA 5DK6A 4UBJA 2P6OA 1D09A 3VRHA 4YXFA 4AMZA 2E18A 2P5SA 3VBEA 3OAAA 5KYYA 3WDSA 5FXMA 4ZI7F 2V8BA 3DT8A 2NVUA 2ECQA 4KO3S 4MV5A 3JQCA 1MG0A 4LSMA 3LLVA 3DNPA 4L5YA 5L7TA 1U6JA 1H69A 3O6VA 4J29A 3ROGA 4HLUA 3DM9B 3IUNA 4FGJA 4YQZA 2C5AA 2CLLB 4MIEA 3G5LA 2V3WA 1EGQA 2V97A 3DEFA 4JEUA 2Z6UA 3U2QA 3TOVA 2CDCA 1G66A 4ZV9A 1QP4A 5CVVA 2H5EA 1T4MA 3EE6A 4MW5A 2R85A 1CDDA 5BWOA 1K97A 4YASA 4ZALA 4AN4A 2X1MA 1TPZA 3CS3A 4PYOA 5EYPA 2PX8A 3UCEA 2IF0A 1L7DA 5J3JA 5FUMA 5AXDA 1S2OA 3L1HA 2I8AA 3DOHA 3EHDA 2HWKA 3DM5A 1FA9A 4NBLA 1RW4A 3R20A 4J0IA 1GZ6A 1TIBA 1XHLA 5FYDA 2IHJA 4DYVA 5SYAA 1B23P 2ZTSA 3QHAA 3WBFA 2YXDA 2CUNA 3DE0X 4DA4A 2E4WA 3EG9A 1NUSA 4TYMA 4DSNA 2JJ8A 2JLAA 2D7CA 2JJMA 3KOYA 1JLRA 4XPIA 2J07A 3TSAA 3I8XA 3FPGA 3ILXA 4MAFA 4R0VA 4YJ2A 1T3TA 4IOLA 4UTPA 5IDWA 1S89A 2O3TA 4TX1A 4G8JA 2E4AA 4D9KA 4YAFA 2ID9A 4FOTA 1NQAO 5TEVA 1P5FA 3NKVA 5EERA 5GONA 4YWHA 4EG5A 2O3JA 1A9ZA 2BHSA 2AH5A 1YNOA 3JVVA 5KMGB 1BXRB 2C9ZA 3WIOA 3WQHA 4ENVA 2OA0A 1Q0PA 2ZJ6A 3P2JA 2K87A 4KWCA 1J8VA 3TTVA 4OGFA 3SP1A 4M83A 3U17A 1SBTA 1GNLA 1EUZA 3DTVB 3RJ5A 2WB2A 3PQ8A 2A1UA 1NV8A 1HURA 1P5JA 3CZ9A 1YK1A 2HSGA 5MN5A 1PJLA 4QYIA 1G8HA 4UUNA 2JGDA 5TRTA 4P36A 1RNLA 1BXKA 1PW7A 5JBIA 3WKAA 1PLLA 3W3AD 3WGVA 2GKSA 4NAHA 5L45A 1LDYA 1UMDA 1DSSG 3KEFA 1QPBA 4KZPA 4EJMA 1LJ8A 2AW3A 3JRXA 3OCJA 3Q8MA 1MHPA 1R0YA 2WHXA 3QKWA 1RLMA 1X9HA 3N58A 4F6LA 1IZ0A 2IYZA 5A02A 1BHSA 1L2TA 2EIXA 2E1PA 3MJSA 3RUIA 4JA0A 1ZWLA 3G85A 4G97A 1Q0UA 4C07A 2VPXA 3FNBA 3EDMA 3LF2A 1XZKA 1NDUA 1EPUA 1E2KA 2IEBA 3GU3A 1P81A 3DFUA 3I30X 3NHYA 4JB2A 4XYBA 4URFA 5HQJA 4YRSA 1GNVA 3L0ZA 5F7XA 4UVGA 1M6HA 2D54A 1JDBC 1BS1A 4BO7A 4CF7A 1ZGZA 3DFZA 3K5PA 4NCNA 4BQFA 1PG0A 1QAOA 1FLVA 1VIDA 2HV8A 4YACA 1ZAKA 2AI3A 5GV7A 4M7WA 2RHCA 3LOPA 2WILA 1WRBA 5TX7A 1PZEA 3ETDA 5FF9A 4DC9A 2CV2A 1OBCA 2ZQ5A 2DFKB 4OY3A 3RVQA 4M9CA 4U3JA 1J5EB 4QQFA 1Q0LA 3QOXA 2HRQA 4LXQA 4IDPA 5LWQA 2ZM6B 3JARB 1FRZA 2D7JA 2I3ZA 2PX0A 2QM3A 4GOLD 5U9CA 1MABA 1CE8B 4E21A 5L3ZA 4FYVA 4R54A 4KVFA 1U8UA 2GPSA 2Z5LA 3G9ZA 1JDTA 1NJ5A 2OK7A 2AYXA 4G4SO 4G5YA 4I7EA 4MIKA 4XDZA 2IEGA 4ARCA 3ICEA 4W5QA 2ZTUA 4YHHB 2F3TA 2H3HA 4B3SB 5ALDA 2WOOA 4HNHA 1JFVA 4Y0NA 2EKBA 3MNFA 5IJ9A 4XCXA 4KNYA 3DBLB 4GICA 1E2MA 1RIFA 1V5IA 1ZI6A 3FB1A 1FOEB 3HLTA 3IEKA 4ND2A 4OXYA 2P4QA 1W9MA 1DBQA 4N18A 2EP7A 2CZQA 5KJEA 1SC9A 3M6UA 3UIEA 1GPUA 2YZMA 2XQJA 1CY0A 1VE6A 4H4EA 1ZKDA 2EFCB 4HPXB 3O73A 1NVEA 5I6DA 1H1TA 1IBCA 4RD2A 4M1SA 1HZZA 2WFLA 4YAJA 1IEVA 4DLSA 2VJMA 2DVMA 3IV6A 1P1JA 2O2XA 1GSIA 2I4OA 4MUBA 4MHOA 2EFEB 4XQGA 5ARCA 2IYTA 2OORA 3HJNA 4ZXPA 3E2MA 4Q15A 2PZMA 3IEUA 1V2GA 4LYJA 2H4YA 3KHSA 4FN5A 4O4IA 2QN9A 1MOSA 1C0KA 4LOKA 2YJ3A 4D0SA 2NXJA 2BFWA 1EJ6A 4YPFA 2X5XA 3VDNB 3DEKA 1W4LA 2JEZA 3MOGA 2GTHA 5T6BA 3U49A 4DRXA 1N6RA 3RAFC 3S2EA 4F6RA 4PC3A 2P6UA 4HWTA 2NSJA 4B9EA 1SUDA 2EQ5A 3BHMA 4MQFB 1JXOA 4KIGA 3TCXB 4V0ME 4XOIA 2Z2YA 2B7BA 5EWJB 2ODPA 4HRVA 5IN5A 4LRWA 3NWEA 1UZMA 2C2MA 3LUAA 4JA2A 3WA7A 1L4MA 2Q5LA 1UOOA 5AIBA 1GPAA 3AJ9A 2IVFA 1WHSA 5BR1A 2VH2A 3SLGA 2G4CA 3OP4A 4CWAA 1IWPB 4W5WA 3QUSA 1M3SA 3HL0A 4GM4A 4G0MA 1YR2A 1JR4A 1P7PA 3EG9B 6GPBA 4KGZA 3IPLA 1CZNA 4BASA 2QL7A 3UW3A 1CC1S 3EXAA 4XYEA 1EB9A 3KYCA 2O1WA 2ISQA 1Y8RA 2J9FB 1X19A 2VF4X 1Z4OA 4C4RA 3HDVA 1JDUA 3BYZA 1A2KC 2DXIA 3RB8A 4FCVA 1Y3AA 4MRPA 4K81B 3RODA 1L7MA 2XB4A 3OWXA 2CEKA 4GW3A 3K16A 5EHQA 4A0GA 2GVDC 1ZH4A 4FUQA 1RQRA 2ZJAA 4LZAA 1KC3A 2BCEA 3L1VA 1VJTA 4QEZA 4QOJA 2NSYA 4PHTA 3OE7D 2QD4A 2WAOA 2WU3A 1XDWA 3HDYA 4RH3A 3KQMA 4KI0A 5DM1A 2ZJ2A 3BB3A 4Q19A 1DJPA 4BO0A 3CNBA 2HMUA 1KZ1A 2Z8YA 4AMGA 1N0VC 3QEMA 3Q6NA 3P97A 1P7WA 5IJ0B 1CNMA 1KAGA 1MD9A 1X1SA 4B5LA 3DZBA 4RF5A 4UC0A 2AMFA 3R0XA 4LTMA 1JGTA 1I7NA 1UFKA 2YWXA 1YASA 4Q1VA 3T3OA 1USIA 1MEJA 2E9SA 1NKVA 1OWLA 2GK7A 4WTOA 3EOZA 4EVQA 3WP0A 4WKBA 4BJHB 1YQ9A 4GZLA 2QRHA 4A23A 1Y8ZA 2FGKA 5B3JC 1GTVA 2FWAA 3D8TA 1PR9A 5KQPA 4AYTA 1ULBA 1T35A 2M1ZA 1P33A 2ZS9A 4CT0A 1V35A 3FLAA 3BFPA 2VKTA 1REQA 1AUVA 4HH0A 3VZCA 2HHCA 3RYIA 4FBMA 1NW3A 2VZ9A 3RFXA 5B6PA 1PGOA 2Z8ZA 1B76A 1K0FA 3LAWA 3L7MA 2EJTA 3N8KA 3NHLA 4ZEWA 1FX0B 3LLMA 4FNGA 2QORA 1BFDA 5DT2A 2AVNA 2P2SA 1XLUA 3UUGA 3E3MA 3GZ4A 3E8XA 3ES9A 3W04A 4ZKDA 4JAVC 4JIGA 2FV8A 4TM7A 4F4FA 1IOVA 4TGLA 2FGJA 3FFAA 4XSHA 1H85A 1HE5A 2IF2A 2VXOA 2EX4A 3ZCPA 2QTLA 2JH8A 3G0HA 4NCXA 4ZYVA 2GF0A 5LVAA 1Q7EA 1GPLA 5BV0A 1OXMA 4EY5A 2MSCB 1EDDA 4QUJA 3ZDCA 4WCFC 2E6KA 1JMKC 5CBPA 1OLXB 1Q14A 1QORA 3O3MB 1ODIA 1BGXT 2ANBA 3S1AB 3SIPA 4RTNA 1PAUA 4HNGA 3GWGA 2QL5A 4JR0A 1XMQB 1ONNA 3D3QA 1QWSA 4X63A 5AT1A 3L4SO 1Z22A 5BNFA 3WWOA 5DRYA 1DJLA 3DXXA 1DV1A 4WECA 3LUCA 3BIJA 3HLKA 5IJ9B 3K2EA 4W5OA 1T9DA 3LS2A 4NU5A 1DAEA 1QV9A 2P90A 1EX9A 2W48A 2VCEA 3HPRA 4AZWA 3PC6A 1XVUA 3U16A 4HWPA 3S5JA 1ZQ9A 4RIHA 1ULZA 5E6UB 2YHBA 5J43A 3AV3A 3BWEA 4PHCA 4UW9A 3JPYA 1SZJG 1Z0ZA 1VJCA 2J8ZA 2VQSA 2VWHA 3A0RB