3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX19B
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
2YWHA 1R5NA 3SEAA 4ABYA 1G20E 1UJ2A 1YZGA 2VHTA 2P5SA 2ZJZA 1TADA 4GRAA 3WRXC 3D6TB 4ERNA 1K5DA 3LA6A 4B43A 3KQUA 1FP7A 1RC8A 4JKYA 1E94E 2J41A 2IS2A 2BKUA 2CK3A 3VR2A 1ZD9A 3DL0A 4GNKA 3B8HA 4RFSB 2GNOA 3G0HA 2RGCA 1JR6A 2G88A 1G19A 1P73A 2WTUA 2VP4A 4Q7LA 1RKBA 3EAQA 1XJ0A 1RYHA 2NG1A 4HDCA 2WV9A 1P7CA 3H0KA 4QNRA 1W0JA 3QQ5A 5HR5A 4IEEA 3Q85A 1G5TA 4DCVA 1CF4A 4H1VA 4QC2A 1EWRA 5FOSA 4GZMA 3GLHA 3KJHA 1NVVQ 4LYAA 4QNMA 5FH9A 3PFIA 3LD9A 2ZRNA 1WF3A 4TL7A 3PUZA 3U44B 5JJKA 4BQSA 2FSFA 2IHBA 2ZRIA 1XTJA 3AVQA 2FEMA 3IBGA 4BZXA 2IUTA 1MO6A 2OCPA 4L9WA 4WW0A 2GXAA 1KK3A 1X8LA 4C7OB 2OAQ1 2IYUA 2XB4A 4OK3A 4DSUA 5LD2C 4KLZA 3D3QA 1Z6YA 3RVBA 2QP9X 5D3MA 1ZBDA 4OBEA 5DLQC 4A2WA 1R4AA 4B76A 1T9HA 3ZS9A 2ANCA 3RRMA 4KFSA 2YZ2A 5TB5A 3T34A 3SQXA 4QHYA 1OH8A 3JVVA 1WBDA 5BN4A 1XMJA 2A7QA 1L2TA 4B35A 4B32A 5HZKA 1SXJA 1ZMXA 3FKSD 3VKGA 3LW8A 3SBEA 4JT4A 4G5QA 5FPKA 1MO3A 1E79D 2XAUA 5A0FA 2VEDA 3UG6A 4QBIA 3P26A 1CLUA 3G5UA 3C4JA 2WJIA 3MWYW 1HTWA 1NP6A 4G5RA 2RMKA 4JLVA 1R0YA 1TF5A 2F43A 1GAJA 1NMXA 1G7CA 3CF2A 1EFTA 3TUZC 1KJWA 1A2BA 2J1LA 2ZSDA 1D8TA 3T1VA 2X2FA 4ARZB 5KOYA 1DAKA 2ZVQX 4X8OA 4V0ME 1VPLA 2NO9A 2QEQA 3DKVA 3SDZA 3TUJC 4A92A 2DR3A 1OKKD 4WIAA 3VFDA 4US1R 3R9WA 2J0QA 2IXGA 1KDTA 2GETA 3ADDA 2XOKA 4UNRA 621PA 1G3IA 5CK4A 1KI1A 3NVAA 2IW3A 4G0NA 5FBVB 2B92A 4N1AA 2IF2A 3FYHA 4UXJA 3L0IB 1LNZA 4Q01A 3FOZA 2ORWA 5FUWA 2EWVA 2ZJBA 2KE5A 3BOSA 3SBDA 2JATA 2AK3A 4TMWA 5DO9A 5KUTA 3RLFA 4B3DA 1GL6A 2CK3D 2KBFA 1V5WA 1II8A 3PITA 1DTSA 1JI0A 4FI3C 3TMKA 3GFTA 4G3XA 5HCNA 1E9EA 1AJEA 1BO6A 3EA5A 3AM1A 1SVLA 4IDPA 2E1RA 1G1MA 2AFIE 1Z08A 1WCV1 3QG5A 3LBIA 5BN5A 1R2QA 4FMDF 5IDVA 2Q3MA 4HB3A 2JAQA 4ACAA 1W0JD 3VU9B 3GPLA 3KL4A 4PFSA 4AYTA 5B58C 2ZRLA 2GCPA 5EZ5A 3THOA 4BFYA 2XZLA 4HLUA 3TW8B 2CVHA 4FWIB 5DGXA 3UATA 4YQFA 5IF9A 3U6KA 2IYZA 3AEZA 2GKSA 4S35A 2R6GA 3AUXA 2FSIA 1L8QA 2PH1A 1YZLA 2FEOA 3GLGE 3WNBA 2J0UA 1WB9A 3QF4A 2BHRA 3TR5A 3CZPA 3VR1A 2CEAA 2GBLC 1JXMA 5FPSA 3I5XA 4PAMA 3K8YA 3WRYC 2FSHA 4R9UC 1FX0B 4B47A 2H17A 4M1OA 4KXFB 3RRYA 1KI7A 2AKAB 2YOFA 4U02A 5FR1A 4IVQA 4ESHA 2EQBA 3CWQA 1IY0A 2RCNA 3SI7A 4ACBA 1PZNA 2Z4SA 2C5LA 2JLWA 4B3XA 1A4RA 1YRBA 1G41A 1KTVA 1AS3A 1SXJD 3UG7A 5L3QA 3ICEA 4BWYA 4TTPA 3W90A 3MMPA 1Z29A 5CDFE 1IN6A 3I32A 2BMDA 1KOFA 2Q0HA 3M6AA 3IHWA 3CW2A 3U4QB 3C5HA 1D2EA 4YXWA 2WIBA 4GOXA 3IHLA 1IHUA 4KV9A 3A8TA 1W1WA 5JSZB 4XH9B 5HKKA 2OLKA 1FP6A 4DLSA 4URYR 3AF3A 2QMEA 5K8IA 2BMJA 4Q4AA 1KJYA 2IYLD 3QXSA 4IVPA 4LJ4A 1TQ2A 1SULA 3AF2A 4LC1A 3AVOA 4Q1FA 2PMKA 3TVDA 3IUYA 4LYFA 2ZYVX 4EPRA 4M1SA 4ZIRA 5JS8A 2QMUA 1IJFA 3VTKA 2ZITA 4GP6A 2XXAB 3K1JA 3AKDA 2CVFA 3CH4B 4LHWA 1VIYA 1FNNA 1KI3A 2XOKD 3GJ6A 3I61A 1GUAA 1YE8A 1WBBA 3SOPA 4BZPA 1UDXA 2RAPA 5AJXA 1MO5A 3OEHA 5G53C 1QHXA 1RFLA 1JBKA 3BH6A 1G291 3QJYA 4JJKA 4WA7A 1DG3A 2GCOB 4QM6A 4DRZA 4D82A 2PT7A 2VRWA 4DSNA 3DM5A 3LX8A 2FZLA 5AK0A 1XZPA 4RSGA 2VP0A 1F6BA 2QGZA 2WWWA 4XIGS 2J7PA 2DY1A 3I92A 4GMXA 1XRJA 4DUGA 4FINA 4LK2A 3NBYC 4PR0A 1PV4A 2ZUCA 3PUWA 4M9XA 5B64A 4TYPA 3E2IA 1ZCAA 2Q3FA 3BC1A 2H1LA 4QGGA 4TWZA 4TMVA 4AKHA 1G3RA 1Q1EA 1DE0A 3AKYA 1BIFA 2PLRA 4LJAA 3ZD6A 2OBLA 2DPXA 3QENA 4CGZA 2QUZA 3SZRA 2EYUA 4TLCA 3R8FA 1P2TA 1GITA 4PO9A 5SZKB 2ZUDA 3QXCA 3T12A 1NVVR 3NHBA 3IKJA 5DHFA 3ZGXA 3KUDA 4GMDA 2YWGA 4MGIR 2A2ZA 3JZAA 1Q44A 5KYKA 3I1FA 2ZEJA 4V0MA 3RWMB 3AVYA 3LAWA 1S2MA 3NBFA 2PZGA 2ODWA 3K9HA 1NBME 4I1SA 5EE9A 1IM2A 5K8UA 3NEYA 1TUEA 1DG1G 4AI6A 2F1RA 2KBEA 5CLLA 4MQBA 3RAPR 3AH8A 1OFHA 4Q21A 2P6UA 3IPYA 1II0A 5JI2E 4Q9LA 5JCZA 1AKYA 1E9AA 3CPHA 3GLFB 2WSSA 2ZAOA 1GDDA 1T5IA 2XZPA 1AN0A 3B85A 4HUQB 2ZI5A 2PT5A 4IKEA 4OKSA 3PQCA 1T6NA 2HXYA 1GNPA 2REOA 1RJ9A 3IDQA 1XEWX 1E2FA 3LXXA 3MCAA 1XPOA 2JJ2A 1SVWA 1T0HB 2IYQA 4LHXA 1OXVA 1SHKA 4YDHB 1ZU4A 4YMVA 3MWJA 4RY2A 1ZUHA 4AURA 2QTVB 4C2UA 4XTCS 3UWOA 4YXWD 2F3TA 1GFIA 1OW3B 1DBSA 2JJ1A 1P62B 4MA4A 1TEVA 5GJVC 3VMFA 5B57C 5M04A 5HKKD 2ODBA 1TU3A 2BJVA 2WWIA 2YHSA 2R8RA 4Q03A 3SHWA 5C2JB 2ZYTX 3J81k 2UZ3A 2WJVA 4MGZR 3THWA 1YJ5A 3LDAA 3AP2A 3IQWA 2H57A 1FW6A 1F60A 5CB8A 1OPXA 4FMCB 1GL7A 3RRZA 5KDLA 3VX3A 2GESA 2V54A 2ZRHA 1HYQA 3K0AA 2RGDA 5EQTA 1M74A 3AVPA 3T06B 1KO1A 2FDCA 3GLGA 1UKZA 3DPUA 3I3SR 2IK8A 4PSAA 4OHZA 1QDEA 3CIOA 3OEHD 2VF7A 5LBIA 3RNLA 3LH5A 4XOIA 1ZJ6A 3UIEA 1BS1A 2AN9A 2D2FA 5CM9C 1G3QA 3EXAA 2JGNA 2AR7A 2QT1A 4OHWA 5FTLA 3FHCB 4KO8A 1NN5A 4DCTA 1Z83A 2PJZA 1HURA 2QENA 1KNQA 1W4CA 1W44A 1R0ZA 2J7PD 4DUGD 1OYYA 4FWTA 2JIZA 2ZU6A 4P4SB 1MT0A 3C16C 4E22A 4BLTA 3QKSB 4P32A 1SGWA 2H92A 3K09C 4B3GA 5CDFA 1E0AA 4A36A 4HDOB 4TL9A 4TYQA 4HUTA 1CR2A 3H1TA 1X1SA 1GRRA 4B2PA 4JVNA 4Y0AA 1QHHA 3PUVA 4P31A 2GCNA 1QHIA 3EIHA 1Q0UA 1FFHA 4LJYA 3TKLA 3PUXA 4RCYA 1BMFA 1N6OA 1VHLA 2XX3A 1UFQA 1Y3AA 1XXHE 1OHHA 3RANA 3KB1A 2L0XA 2ODNA 3QSYA 2RGNA 4PQYA 4DKXA 3PUYA 3X1DA 1RRPA 1CJVC 1XBTA 3CH5A 1VHTA 2UKDA 3KTAA 4MKIA 5L8VA 4TSFA 4I4LA 4D4KA 2VH5R 2X77A 1N6LA 3TVTA 1E2KA 3SJAA 4LWZA 3N70A 1DAGA 1ZNWA 4RZUA 1O3YA 1CRQA 1RVDA 2ZSAA 2ZRFA 2E87A 2LCFA 1AGPA 1NVWQ 3SQWA 3WYFA 1N25A 5AJZA 2NTYC 2O8EB 2X1VA 1AM4D 4JIMA 2C99A 3DMNA 2RGXA 3TE6A 2GXUA 2WSSD 5BYJA 4HI0E 4KBFA 5LB2A 1U8AA 4KBGA 1W46A 4AG6A 4D4JA 3C41J 4C0QC 3RYTC 1OXSC 1XMVA 5FPHA 2HCBA 2XSZA 1E98A 1R5OA 4ZO4A 1E2DA 2JJ2D 4IFEA 4D25A 4JJZA 2ANBA 2C8VA 2V9PA 4TQAA 3VR5A 4LHZA 3MJRA 2JEOA 4TYWA 1CULC 1NY5A 1Z0KA 1Z6TA 2ZRJA 1UBGA 4BZQA 4RZ2A 3TUIC 3C8UA 4TMZA 4B3FX 3PJRA 2RGBA 5FOXA 3BH7A 2Y8EA 2CL7X 4QBFA 3HU1A 1E2IA 1V43A 2YVUA 2CDNA 1A7JA 3L0OA 3NXSA 4WVFA 2IYWA 3REGA 2OEPA 5DH9A 3ZQJA 1I4TD 1GZSA 3ZVLA 3A6PC 3SFVA 4CT5A 4URXR 1G6OA 1GRNA 3PCRB 4UNNA 1YQTA 3CR8A 2OXCA 3AGPA 3NDBB 2OUKA 2JCSA 4URUR 5FBWB 2ZR0A 1RE0A 3O8RA 3ZJYA 2WKQA 4Z8YA 1VDZA 2YOHA 1NBMA 1G3UA 1XMSA 2FF7A 2ZR7A 3W6NA 2VTKA 1D2MA 4DWJA 4HLQB 1GWNA 4BLQA 4HAYA 2A5DA 2R6DA 1JALA 1F2TA 1UKYA 3B13B 4L15A 1GSIA 1U9IA 3GLIB 3KUCA 4KFRA 2B7BA 4GOJA 1UAAA 4B2IA 4QGHA 4OI4A 3L0SA 4JT2A 4PHFA 1IY2A 5EXTA 2Z6VA 2GHIA 3LY5A 4NZYA 4PANA 2JIZD 4YC7A 3OE7A 3OF5A 3U3OA 2HF9A 2QPOA 2CNWA 2GZDA 2V6JA 1M8PA 5JECA 5E7IA 3LFUA 1NLYA 2OCAA 1P6XA 1KAOA 4D0LB 5C18A 2HJGA 1Z2AA 2JLSA 5E4FA 1D5CA 4PZYA 1S0UA 4JLKA 3VR4A 1NVUQ 3VHLB 1NJFA 2OFOA 1IAQA 1SXJE 1BMFD 1LS1A 3CF0A 3CNOA 2GZHA 2ZU0C 1OHHD 1NN3A 3GJ4A 2EFGA 4BGDA 2NO1A 4RJLA 5IHPA 5DISB 3CRMA 3AQ4A 5LPNA 1XMIA 4IOJA 3ADCA 1TEXA 2G1JA 1XD8A 1G6HA 5L3SB 4J0QA 4TSFD 4TT3A 3D8BA 3FWYA 4AWXA 3HU2A 4DSTA 4DEXA 2AXPA 5EP2A 1KSFX 3U2QA 3MG9A 4F92B 3CRW1 2RHDA 4RD1A 3ZQ6A 1GRQA 1AKEA 1XD2B 3D7MA 4EJSA 4MYUA 5J4HA 1X8KA 3PIRA 2ZSBA 3THXA 3LW7A 2J3EA 5C4MA 1S3GA 1OB2A 2OBNA 4XWOA 1Q3TA 2B7CA 5J47A 4PXAA 1Z3IX 1W4RA 3TJZA 2J46A 1XD9A 4O0MA 2DCUA 5JHGB 1W36D 3QXHA 1VTKA 4Q5IA 2HT6A 3SJZA 2D7CA 721PA 2XSZD 3EARA 2GEUA 5L3RA 4R7ZA 1JJVA 1T0JB 2G6BA 4PSKA 3L82B 1FUKA 4KLNA 3GJ7A 4C0AC 1E96A 4U7DA 1M6NA 1YR8A 3UKDA 1ZINA 3OFNA 2ZI6A 2BBTA 1N2CE 3DHWC 5BYKA 1A5TA 2XJ4A 1G4AE 3WMFA 2VP6A 5FBRB 4A6PA 4B3BA 4I99A 1S4QA 4LPKA 2DFLA 2GJ8A 3PV0A 2PCLA 4Q4JB 2H7VA 3BH0A 1KK2A 1D9ZA 1J70A 3IQXA 4EPXA 1XXHA 2QSZA 4IXMA 4Q9HA 1TTTA 1UKVY 1C9KA 3H4MA 5J5CA 4TMTA 3ADBA 1K6MA 2HYDA 4OQFA 3BE4A 2QAGA 3ICQB 2BM0A 3JZMA 4NHOA 5C1BA 3MGCA 2NOAA 1E2GA 1NBMD 5EE1A 1B0UA 4MUBA 1XCPA 1JAIA 4I81A 4C3ZA 5IT5A 1TPZA 3U3RA 4HB2A 2TMKA 1AS0A 5DI9A 2BEJA 4DJTA 2XGJA 1CP2A 4NP6A 2AFHE 3QOFA 2VHJA 1ODFA 3F3YA 4D81A 221PA 4MKGA 4A15A 4JL5A 5JWHA 2ZRGA 1X3SA 4Q47A 2O8DB 3BJIC 2WMNB 3S1AA 2J45A 2J87A 1SKQA 4FN5A 1KO8A 3SR0A 2ATXA 1E2EA 2N42A 2QM7A 3L0PA 1KO4A 2CCGA 4QHSA 2VHQA 3OE7D 1X1RA 1G7RA 5F9FA 4M1YA 4LYJA 4HAVA 5SZHB 4D2IA 2CNWD 1W49A 2C04A 3LBNA 3KFXA 2QP4A 2WJYA 4LBYA 4M1TA 1PVOA 3TGPA 3H86A 2EVWX 4CRWB 3U3JA 2A5YB 1E0SA 2GVDC 4KYIB 1JJ7A 2BJWA 121PA 3HR7A 2I3BA 4GT1A 5FPTA 4GFDA 3X1WA 4IOLA 5KTYA 4FMBB 3W3AA 3RHFA 2F1HA 1GP2A 2PZFA 3W34A 2DBYA 2QG6A 2WHXA 3LVQE 4MRVA 3AVTA 2QMOA 2O8BA 2VL7A 4EUNA 1KMHA 3P4XA 5FI1B 4PPFA 4JLJA 1KI9A 2BWJA 3EZFA 1ZC3A 4Q9KA 4TT3D 4RVCA 2BCGY 3U7HB 1IONA 1L4YA 3UANA 5GJWC 3BGWA 1KY2A 1MABB 2WIAA 4MKFA 3EA0A 4IFBA 2VPPA 5BXQC 1EG7A 4OHYA 4M1MA 4M9SA 5BWMA 5AUQA 1JR3E 2NZ8A 4Q4HA 1E2JA 1GILA 4PHHA 4LBZA 2O0HA 4Q00A 2RGGA 1G17A 3LQRA 4B48A 1YZNA 2GILA 1Q1BA 1J8YF 2CXXA 3IIKA 4JVMA 2AK2A 1SVMA 3QI2A 4CEJB 2ZRKA 4ZCLA 2W83A 4C4PA 2JLYA 2PLFA 1SHZA 1DS6A 5GADl 5FFMA 1LB1B 4FD2A 4X8MA 1M7GA 1DARA 4WXPA 2H5EA 2QSYA 2BDTA 4QG7A 1Z6GA 2VLIA 1E9BA 3EWAA 3OFND 4AIIA 4OQLA 4Z54A 2W00A 3W5JA 3SHFA 2GTPA 1KKLA 1P4SA 1QRAA 2Z4RA 4L5BA 3G82C 5HTKA 2WOJA 2WJGA 3OZXA 1EFRA 4RD2A 3K70B 2X8AA 3TNFA 4L4UA 3L8YA 4D0NA 3ECCA 4A2QA 4GBMA 4XVQA 2Q21A 3IIJA 1DVRA 1G21E 1PLLA 4QHTA 5EE5B 5EP3A 5JS7A 4EPVA 3RS7A 3RC3A 1YZUA 1I2MA 1U0JA 1KYIA 1HQYE 2BC9A 1YKSA 3MLEA 4Z1MA 3A4NA 1HY3A 1NIJA 1ZYUA 2R2AA 3GJ3A 5FBLB 3EZ9A 1QF9A 2GF9A 1DEKA 3RS2A 3GFPA 1XEXB 2ZE8A 4KFTA 4M53A 1OXTA 4TLBA 4W9MC 1TQ6A 1FL9A 4ZDIA 1IN8A 2IEZA 3BBPA 2MMGA 1DPFA 2A5FA 2GF0A 3SNHA 2VHUA 4G5GA 5ELXA 2OAP1 4DEYA 4HDQB 4A8JB 1KI6A 1HE1C 5EZ6B 1RRCA 3P32A 4DB4A 5A4JA 2VP9A 3ZH9B 4I1VA 4D6PA 4F7WA 1Q12A 1CS4C 2GZAA 3QNUA 4G1UC 1VKJA 4JBWA 2BVNA 3TAHA 5JJLA 1AZSC 3K53A 2JASA 3A37A 4WXRA 2IXFA 5GVSA 1R0WA 2XEXA 2OCYC 1FZQA 1IN4A 1YZTA 3LVRE 4PX9A 4NPHA 3BFKA 4QGAA 1FQKA 1G7SA 1LS6A 3KXKA 4C30A 4FW9A 4JLPA 4CEIB 4HB0A 4Q1BA 4ZKDA 1LFDB 1NG1A 2HEIA 3C14C 1O87A 1TUIA 4PZZA 5JFGA 2C9YA 4Q7JB 1E9CA 1AK2A 4KVGA 1NN0A 2NGRA 4EQ6A 2VSOA 1F2UA 2XNSA 4W5JA 3GJ8A 2CE2X 1Q21A 4FCWA 4NCIA 3IPXA 3CF6R 4MYHA 1NMYA 2JLRA 2IYTA 4PC3A 4XD7A 2O8CB 3SYNA 1US8A 3BB1A 2QPTA 2YYZA 5JMTA 2ZXUA 3FFBA 5KO2A 1VYTA 4M4SA 5JEDA 2IHYA 4K8OA 3B9PA 4QBHA 1SKYE 2AKYA 2IWRA 5K8LA 5F9HA 4TYNA 4D4MA 3QKRA 5JRJA 2GK7A 5GVRA 2HCJB 5AUPB 1BH2A 3VNUA 1XTKA 3CNNA 4MITA 4PPQA 1DADA 1YU9A 2KWIA 2WMOB 4HZIA 4NYMQ 2BBSA 4CEHB 3CWZA 2PX3A 3PR1A 3QIAA 2CLSA 2FGKA 2Q9BA 2I4IA 2AD1A 5C46F 1K8RA 3HDTA 2P6NA 3FVQA 5JEEA 1VECA 3MRSA 5H70A 1KIMA 4TQUS 2FZ4A 2ZRDA 5CLQA 5L3VA 1EFRD 1S8FA 1U0HC 2ZI3A 3U3KA 3D31A 2ZREA 4DLVA 5CITA 2D7DA 4ITRC 4C0LA 3IIMA 2WPDA 2BKEA 1NSTA 4JLOA 1E4YA 1ESMA 5JZVA 4EPWA 3KQKA 2OZEA 2QPAA 1QHGA 1JECA 2GA8A 4O25A 1IXSB 4URWR 3KXLA 4RD0A 4IDOA 1JR3A 2IWHA 1B23P 3FMIA 4Z1MD 3B78A 1W4AA 3BD9A 3GEIA 3QPVA 2HXSA 4JBXA 4D80A 3WHKA 4O2RA 1X6VA 4IOMA 3TW4A 4WOPA 2P65A 1ZM7A 2IYSA 4C0HA 4LJ5A 2QBYA 1ELOA 4HB4A 1E6CA 1G8YA 3VNVA 1XU4A 1BYUA 2GAOA 3DZDA 3LV8A 3ZIAA 2CL0X 1KI4A 2WAYA 5DYGA 1E9SA 3IO3A 1G8PA 4Q66C 4CIDA 2FPMA 1ZM9A 2WICA 3BRWD 4DLXA 3EC1A 5KHOC 3ZZUA 2H8KA 3NH6A 3CRVA 2PCJA 5FUVA 2OT3B 4DLZA 3CB4A 3CZQA 4LPSA 3FMOB 4E03A 3EG5A 3UMFA 2W2XA 4ON9A 1N0UA 8OHMA 1GNQA 4GSYA 4II7A 2FH5B 2R44A 3GLHB 1OLOA 1XDBA 5FUYA 5CYOA 3RDPA 4JSTA 1KDOA 1ZRHA 4Q19A 1KMQA 1Z6XA 3NEJA 3RABA 4W5WA 4DDWA 1KKMA 5DSZA 4DLTA 4LOAA 2Z83A 3AB3A 1KY3A 4BLPA 4IW3B 4KITB 2CCJA 4DT1A 3THYA 4RZ3A 2OHFA 1NJGA 4WBSA 5D3MB 1P9WA 4OHXA 2PL3A 5FBQB 1EK0A 4M8NE 1FMLA 1H65A 1OIVA 3GQBA 4MH0R 4N0EA 1Z28A 2EFEB 4JMPA 2QZ4A 4GOKA 4LJ7A 4B44A 2ZJYA 4LV5B 2GXQA 3BFVA 1XZQA 1SXJB 2A9KA 5J40A 1XJCA 3K0CC 4B34A 4EDHA 2BOVA 4US0R 4DVGA 3TSOA 2XITA 1ZM2A 3KJGA 3HU3A 2FGJA 2RGAA 1VYVA 2NZJA 3BB4A 2P5TB 4RFVA 3X2SA 5AUNB 2W2VA 3K70C 2F43B 4C2TA 3QEJA 4JVSB 2R65A 5DI3A 2OXRA 2G3YA 1W2HA 4LX0A 4XWKA 2WWXA 1IXZA 1IN7A 1ZNYA 1KDPA 3O47A 5D3QA 5G3YA 521PA 1JEEA 1R8SA 2BEKA 4BFTA 1UBCA 2RKOA 4JLDA 4YMUA 3DOEA 4LY6A 3DMDA 1G5PA 1E9FA 4HZUA 2D2EA 2VQSA 3I5YA 2WPDD 1G3MA 2EW1A 1CR4A 1MO4A 2ODEA 1Z63A 3K0SA 2YWFA 1DO2A 1JB1A 2R6FA 3PENA 1BKDR 3W6PA 1CEEA 3ZVRA 4XJXA 1FNMA 3LWNA 2ZE7A 4YMTA 1JR3D 4M1KA 1NL3A 2C77A 3OAAA 4V02A 2GEVA 2G0TA 1HQCA 1KSJA 2FMXA 4PQFA 2FG5A 1Q57A 3UXMA 3FGNA 1N3BA 2YOGA 1OYWA 1KDRA 1ZUNB 1HUQA 4NU0A 1SZPA 3TH5A 1II8B 2G83A 3QBTA 2G9NA 2VBCA 3KQNA 2JLQA 4A8JC 2OILA 1NMZA 1ESNA 1YZKA 2OV2A 3CBQA 4QJ3A 4ESVA 3ZIAD 1FQJA 2P2LA 5J4YA 3QEOA 5HPYB 3KKMA 1G64A 1N6RA 1Q22A 5CJ2A 3ZVMA 3BERA 2VYFA 2YV5A 2CJWA 1FUUA 2EWWA 2FSGA 3R7WA 2GBLA 2DHRA 3CLVA 3K0FA 4HLDA 4M9ZA 5A5GA 1EFUA 4MRRA 1CJMA 2ZROA 3AKCA 4V03A 2VO1A 2ZM5A 1E1RA 2GVZC 1SVOA 1GVNB 2QM8A 5FOWA 5JWOA 1N6PA 3A1SA 4JLMA 4PHTA 5AR1A 3M1IA 3SYLA 2J0UB 4DB2A 2OSBA 3QF4B 4I1OA 5LDDC 4OI1A 1P75A 1G4UR 3UMRA 4JVLA 3K9NA 5FPYA 1E4VA 4C0JA 1J8MF 3SFZA 2ZS7A 4JLNA 4JZKA 3W9YA 4IHQA 3VQTA 1P60A 1X86B 2CLDX 1L7VC 5LB4A 1E2MA 3VHXA 2LKCA 4A2PA 2H16A 3VX4A 3MUFA 2D06A 3U6BA 1DOAA 1JPJA 1OIXA 5L3QB 2CHGA 4MDFA 1IXRC 4NYMR 1DAHA 2ZJ2A 3SJCA 2FPLA 1Z0JA 3BIFA 1R5BA 2Z5FA 1VMAA 2REXB 1G8FA 3H84A 1RZ3A 1YVDA 4RZXA 3SU8A 2ZI4A 5F98A 4Z51A 1D9XA 5K8TA 1Z5ZA 4Q4AB 1GTVA 3L8ZA 4IJMA 5F3WB 1OFUX 1OSNA 2QI9C 4UXHA 1RRFA 1UF9A 4KAXA 1UBEA 4ZIRB 1HE8B 2FE4A 4PHGA 1S96A 1I2DA 1Z0AA 4TMKA 2QRNA 4BEJA 4R2IA 3FKQA 4NH0A 4RFSA 4ZI3A 2BBOA 4RD4A 3B9QA 1KHTA 2JJ1D 4B2LA 3T1TA 1OH7A 2IT1A 3ETLA 3SC3A 4GZLA 4V0LA 2C95A 3A4MA 2ASEA 4LSGA 1QVAA 2FFBA 2IEYA 2VF8A 5JCPA 1U94A 1ZM3A 2AD5A 2ZYUX 3OAAD 5DN6A 1H8HA 3B7GA 4NDZA 4BUJA 5JHHB 1N5KA 1LF5A 2CL6X 5E3HA 4BPBA 1OV4A 2AX4A 1E9RA 4K46A 4LZZA 2A30A 3SS8A 5E95A 1JEDA 1U81A 2BCJQ 3AP3A 3QY0A 4KJZA 2BIFA 4FMDB 1DO0A 1G8GA 4A82A 4DCNA 4EKDA 5BN3A 3SE0A 1F5NA 3O8CA 2FX3A 1TQDA 4EFNA 2OBMA 5IRCD 2X19A 3U44A 1G8HA 1Q1QA 2RH5A 3DVLA 2GXSA 1YZQA 2ZSEA 2QY9A 1P61B 2KB0A 1WDTA 3AF1A 1Z8FA 2E9SA 5EE0A 3WXMA 4C7OA 1T8TA 2WBLC 3GJ5A 3N2EA 3X1ZA 5H1YA 4R2HA 3R9XA 1MOZA 3K0CA 4D26A 1ZAKA 3W6OA 5KDDA 4KU4A 1Q20A 4LJ6A 2XJ9A 3Q5EA 1E1RD 3ZZTA 4OQNA 1ONBA 4UJ3A 1JQLB 1T3SA 4PC1A 2VSXA 5TY0A 3K0EA 3KKPA 2ZRBA 4H1UA 3KXIA 4YMSA 4ILEA 1R6BX 4U5XA 3T15A 1PLJA 1VG9B 2WWYA 1LF0A 4A4DA 5HCIA 3TAUA 4C0SA 2V3CC 2ZJ5A 2JJ8A 1PUJA 2OFXA 2QGNA 3OESA 4Q7KA 2PX0A 2PMDA 4F4CA 3RS0A 3ND8A 3M4YA 1UEIA 3NIBA 4M0LA 2ZSFA 4PAOA 1SXJC 2V55B 2C9OA 4ARZA 4CDGA 1I4LD 4JLBA 4CEJA 2LKDA 4JL6A 4IEIA 2GRJA 2UVQA 1EESA 2QRZA 4PC6A 2QTFA 3WP1B 1XP8A 1RJ9B 1ZW6A 1RYFA 3EASA 2ZUBA 3NC0C 4NL4H 4LV6A 2MSCB 4G5SA 1HEIA 3BWDD 4AYWA 2G1KA 3LNCA 2ZRMA 1GM5A 5EUQB 2QNRA 4UNSA 1KJZA 3C15C 4QL3A 5DNYB 3GLFE 4U00A 1M2OB 5J4LA 1QVRA 1G9XA 1LV7A 4A6XA 3THWB 2IC5A 2ZE6A 2HV8A 1IOZA 3OIVA 4Q1EA 1ZUIA 3IEUA 4R71A 1YR6A 1F48A 1E2PA 3B1XA 4URVR 1XF9A 1ZVQA 3K0AB 2FV8A 5J4VA 3KJEA 4JLAA 1P5ZB 2J0VA 4OK6A 3GLGB 3EX7C 5AWFC 1TU4A 2FOLA 2F7SA 5KPJA 3A58B 2ORIA 1SVSA 3CKLA 4PC7A 4TQ9A 4CF7A 4DDUA 3K09A 3B6EA 1CBUA 2DWQA 4P4UA 5DN6D 1H8HD 3VU9A 1XTRA 5KNCA 3RS4A 4B6EA 1E2QA 1GKUB 1T91A 2V6IA 4Q1AA 4GDFA 2JLVA 4OJKA 1OT3A 1W5TA 3K0FB 4C9BA 3F8TA 1TL7C 3B60A 1OFIA 3MFYA 3R9IA 4Q4LA 4TL8A 3IILA 4XWAA 1MRSA 3QXXA 2EFHB 4YMWA 4XTRA 2Q9AA 1LVGA 2F3RA 1U8ZA 3IO5A 4LGMA 4NE2A 5CJPA 4FIDA 5TXGA 4HLUC 1FX0A 1QHHB 4RD6A 3TBKA 1Z07A 2D4HA 3P20A 4OK5A 3ZZ0A 1C1YA 3PXGA 4YONB 3FDIA 3I8XA 4NYJQ 1XEWY 4V0NA 3ZVNA 1GL9B 4IDHA 1KSGA 3UMSA 2ZR9A 1NIPA 4DXAA 3EPLA 2V4ZA 2ZRPA 4DBLC 2MMCA 2BM1A 4B75A 5KNBA 1U98A 2WWHA 4BFVA 1EFCA 3LO5A 4CVNA 5TV2A 2XTNA 5DIFA 3KTAB 3ONWA 3U61B 1HV8A 3C5CA 2ZS8A 1TNDA 4WZBE 3KFVA 3IEVA 4B33A 3U4QA 1G16A 2R62A 4A0HA 2CE7A 1ANKA 2MSEB 5IK2A 3BFXA 1PJRA 3Q3JB 4D4LA 2VP2A 4AD8A 5JSZA 1VCMA 2C9CA 4NKRA 3ZS8A 3TQFA 4F91B 2YINC 1HT2E 4WAUA 1XWIA 2YC4C 2CCKA 3KJIA 1W36B 1L4UA 2MSDB 3DKPA 4MUAA 3QVVA 5H68A 5JWRA 4QM7A 3PEUA 1AQUA 3BS4A 4UNPA 4WZAE 2XXAA 4ASUA 2VP5A 1SVKA 3KX2A 1YR7A 4HATA 1UM8A 4Z8XA 1FTNA 3AVXA 4FMCF 1VCIA 1FPMA 3Q9LA 4US2R 4BE7B 3N5CA 3QKUA 2W58A 1GKIA 3GJ0A 2GCOA 1IN5A 4N0DA 4NCKA 3TLXA 1T4GA 5TARA 2DFKB 3V00A 1T5LA 3KDSE 2P67A 5DYIA 5EXPA 3HR8A 5KNDA 1RW4A 2C96A 3TSZA 4EFMA 1H8EA 3W3ZB 2QQ0A 2X2EA 1DAEA 1YR9A 2H18A 2P0EA 1XX6A 1E0JA 3ASYA 4DIDA 3FHTA 4P3YA 3PEWA 4QBGB 2F1JA 1W2GA 1N6HA 3EPHA 2CHVA 5F2EA 3AF0A 3CPEA 3EIQA 2VA8A 2FFHA 1ETUA 1GIAA 4MYTA 2FJUA 3QKTA 4G01B 1XEFA 4UKDA 4BLOA 3CX8A 2V1XA 3FE2A 1E1QA 5ANRB 1P9NA 1F2TB 1NN1A 2BV3A 4DC9A 4PQRA 3FFAA 3EPKA 3ZYCA 1HA3A 3GJXC 5B30A 2IXEA 2IS1A 3GFOA 3RSOA 1Z6AA 2Q6TA 1CR1A 2RGEA 1W5SA 2XZOA 2NQ2C 1J2JA 4BFUA 1E0KA 2OE2A 4HLCA 1TX4B 1OFTA 1U8YA 4TL6A 2NPIA 4AKIA 5FTMA 3A4LA 1U2RA 2WJHA 4BFSA 1E3MA 2ONJA 1QG4A 3FPAA 2PEZA 4BEBA 4EIWA 3GLIE 1BYIA 4F4IA 1VIAA 2R6AA 3GLFA 1UBFA 4OYHA 2KJQA 5G3ZA 4TLAA 4HUQA 4HAXA 4DLWA 2W0MA 4B71A 3R20A 4GL2A 2WJJA 3RS3A 4PZLA 2WKRA 4BFZA 2GWHA 1W7AA 3AF4A 1N0VC 4QXAA 3FMFA 2YKGA 5EE3A 5E7MA 1CR0A 4KYUA 4F93B 5IK2D 2RHMA 3W8NA 4EJSB 3THXB 1NKSA 1OIWA 2IBMA 1DAFA 4XSGA 3VR6A 4JBYA 5EUMA 3NKVA 5G40A 5JBQA 1VCNA 2QORA 1JPNA 4MYCA 1C4OA 1J99A 3GP8A 1FTSA 2QA5A 4KHZA 1P9RA 4KFUA 4NCNA 4D0GA 3LX5A 4ASUD 3GD7A 3KKQA 3KB2A 4M21A 3DOFA 4OL0A 5BW8A 4M9QA 2B8WA 1IBRA 1GG2A 1TMKA 5EP1A 5EXSA 1Q1ZA 2WWGA 1CKEA 1MRNA 3NBZC 1N5IA 4GI7A 1UPTA 1HT1E 1WRBA 2A5JA 3VKWA 4A9AA 2GAAA 2ERYA 3KZ1E 5HZHA 3CNLA 4MDEA 1W48A 3NTUA 4KVAA 3HYRA 4MGYR 1E32A 2OCBA 2F55A 2ATVA 3QPUA 1E2HA 4A0GA 1H8ED 1CU1A 1NF3A 1XXHB 2PEYA 1PLKA 1WP9A 1ZNXA 3VKHA 4GPTA 4TMXA 4YLGA 4AYXA 2J59A 4RCZA 1DAIA 5E7JA 5BQ5A 3HYTA 4IXNA 2QAGB 4LHVA 4P4SA 4Q48A 5FR2A 5TMPA 1XPRA 1WE2A 3QKSA 421PA 1T3HA 4NYIQ 3AP1A 1LTQA 1S1MA 1NG9A 1UDWA 2JDIA 3F5FA 3NBXX 3PEYA 4BASA 4ZCIA 3GEHA 2HT1A 1J7KA 1E1QD 3B1VA 2WWFA 4LJ8A 1XPUA 1KI8A 1XJQA 4CW7A 3CPJB 4PSVA 4B6FA 1N5LA 1ZC4A 1TF2A 4BRWA 5AUOB 2DB3A 2CLCX 3S1AB 2B6HA 2NO6A 1R7RA 4LRWA 4OHVA 4DCUA 2YWEA 5JI3E 4UQOA 1W0KA 4LBVA 5CIWA 3WMEA 4TYYA 2C03A 1NI3A 821PA 5UKDA 3A36A 3E70C 2IYRA 2FWRA 3NG1A 3M0EA 4TTRA 3LLMA 3UK6A 1KGDA 4LBWA 1SVIA 4V0OA 1JXOA 5KDOA 1UEJA 4LYHA 4NYJR 3RWOA 2EFDB 2DWPA 3B2EA 4MRSA 4ZI2A 1E9DA 2ZJ8A 3PG5A 2P6RA 1MH1A 2RGNC 2NIPA 4BLRA 4XVRA 1S1CA 2QN6A 2O8EA 4TLEA 3U7GA 4EPTA 1T8UA 1AA9A 4ZCMA 3WYGA 2O8BB 2IX3A 2Z0MA 3A1UA 3U60B 1KMHB 1ZP6A 2ERXA 3GEEA 2ZRCA 3NH9A 3HJNA 3OIUA 2IS4A 2JLUA 4DZZA 4MRPA 2F9MA 2QP3A 1ZD8A 4BECA 1R8QA 1R10A 3MWLA 1AS2A 1Z0DA 1DELA 3AVUA 4FXPA 2IL1A 3Q5DA 1M34E 4L8GA 5FOVA 4Q4HB 2JLZA 1OXUA 2EU8A 2W6JA 5JRZA 1ZCBA 4MRNA 1W36C 3B1ZA 3RS5A 1E69A 3KKOA 4L9SA 4HSEA 3T35A 3NDPA 2FA9A 4EAQA 3AKEA 2ZYWX 4JL8A 3CRRA 4IDNA 3CM0A 4KODA 4A0RA 3LXRA 3T5GA 1TQ4A 1COWA 1XNJA 3FHOA 1VG0B 2AHOA 2ECKA 1SQ5A 1XFAA 4CZ2A 3QXJA 4IRUB 3P4YA 5CIQA 1KO7A 4EPYA 2O52A 3RC8A 1GNRA 1NLFA 3FTQA 3UPUA 1EWQA 4XD7D 1N6IA 2HJVA 1P2VA 4ZKEA 4Q9JA 4A0FA 2FU5C 1M7HA 2GJKA 2HDNB 3GLIA 4QJ4A 1A82A 1OXXK 2WSMA 4AKEA 4Y0VA 1GKYA 3NHAA 5TVKA 3L43A 2F9LA 3WNCA 2HUPA 2SHKA 2R9VA 1Y63A 4WZ6A 4HAZA 2V7QA 4E5UA 2F1IA 2VSFA 4R98A 3O8DA 3BAFA 3EZ6A 3MAAC 3W8RA 1AIPA 1LW7A 2JDID 3PVSA 3FMPB 4P4TA 5GJBA 2W0SA 1CJUC 1QBKC 1U9IC 2FPKA 4QJ5A 1N6KA 2OLJA 2B21A 2QU8A 4IOKA 2Q9CA 2OESA 3WBKA 3IBYA 3T1OA 4TN1A 3O8BA 4ZV4A 3EZ7A 4PPNA 1KZGB 2HLDA 4ZDKA 2BMEA 1KAGA 1W0KD 4LUCA 4XSHA 4BFXA 1KZ7B 2O5VA 2YNMA 3KQLA 2FN4A 2ZQ5A 4TLDA 1PUIA 4LJ9A 5L3SA 4E07A 4DSOA 1E99A 1KNXA 2WOOA 3HPRA 3TK1A 4Q18A 2OM2A 3ASZA 2VIIA 1Z2CA 2ZE5A 3HP1A 4F4JA 4V0KA 1KI6B 1RPZA 5FL3A 3U7EB 3X1YA 4B74A 1XD2A 3U7FB 3R8CA 2O8FA 1S3SA 1WA5A 5FTKA 5AJVB 3OIYA 1NNEA 1YHNA 4M1WA 5CYPA 2QT0A 2EYQA 4W5HA 5FTNA 4BFWA 4UJ5A 4Q7MB 1KK0A 1XCMA 5FOUA 3H2YA 2NPFA 4CYMA 3OEEA 3SJBA 1UADA 3BB3A 1J90A 1EGAA 4Q02A 4TZ6A 4DHEA 1Q3HA 3Q8XB 3TRFA 1QZXA 2UZIR 4MGKR 4PC2A 1M7BA 1U0LA 4EJSC 1QHNA 2Z43A 2FNAA 1YRAA 5H8WA 1OH6A 2ZJOA 1VCOA 2Q3HA 2W6JD 4BRUA 1OH5A 4G5OA 1LY1A 2IYYA 4K81B 3U3MA 1XTIA 3REFA 4EQ6B 3MSXA 2QAJA 2F6RA 2V8OA 3ADKA 5FL7A 4LV8B 1F2UB 4CT4B 1UKEA 3ZLJA 4Q4JA 2QE7A 4M2LA 1R0XA 2CBZA 2XNDA 3AUYA 1COWD 1US8B 2QMHA 3EIEA 5JLJA 3EC2A 2YJTD 3I62A 1E2NA 4W7SA 1Z06A 3DDCA 4X8HA 1RRGA 2VHCA 3LBHA 3CX7A 4RD3A 5EP4A 1BOFA 3QKRB 2PJRA 1IJEA 2ZVPX 4HAUA 3B82A 3WBJA 1AGRA 3LLUA 2REBA 2P3SA 2WVJA 3MD0A 3WHLA 1G5RA 4NTZA 3P1JA 1JQJC 2IUUA 1XCGB 3CO5A 4DLRA 2IS6A 1II9A 1KSHA 3B5JA 4RKEA 2O8DA 2WAXA 1TF7A 3OIWA 1AZTA 4DLUA 5FOTA 5JJIA 2QAGC 4JKIA 4A1FA 1ZIOA 1I4DD 5KSPA 3QUSA 1G18A 3BK7A 1QG2A 4LCBA 4NYIR 3V9PA 2DFNA 5FI0B 2OO7A 2V7QD 4LHYA 2IYXA 3K9LA 5DE3A 1N0WA 4BLSA 2ORVA 1E2LA 1Z0IA 2JLXA 1KO5A 3VR3A 2W6IA 3V4RA 1T3LA 2ZPTX 2ZAMA 4LDJA 1NLZA 4OQMA 2KI5A 4OI0A 3C7KA 4TZ0A 3DO6A 4I1UA 3JVUA 2K5UA 1OE0A 1P2SA 1A2KC 3NC1C 5SZJA 4KCGA 4QKQA 1JAHA 2HLDD 3QG1A 3KQHA 1GOTA 4X8LA 5TDHA 4POAA 2ZTSA 2G77B 3E1SA 3ND9A 4OQXA 4DDVA 3PEVA 2QBYB 3DZ8A 1AQYA 4P0TA 2DWOA 1WMSA 4RKFA 5DHAA 1MKYA 3QE0A 1K5GA 5HE8A 1DAMA 2DFTA 2IA5A 4Q1CA 1MABA 4KI0A 1TAGA 2ZS9A 4Q9IA 1A1VA 4GP7A 1EFHA 3T61A 4B73A 2QQEA 1S9HA 3I8SA 4AY2A 2V1UA 1X8JA 3N2IA 1ZIPA 3E5HA 1OF1A 1IY1A 1FOEB 2ZI9A 2NO7A 3NWJA 5G41A 5LD2B 4N3NA 3B1WA 1MV5A 2FFQA 2J0SA 5KU1A 3OEED 3I73A 2AXNA 2GDJA 1QHYA 3B1YA 2YC2C 3BORA 3BXZA 1Z22A 4HAWA 1EX6A 3DEFA 3P27A 1KI2A 2A5GA 1W47A 1NRJB 2AWOA 2AWNA 5C4GB 4JS0A 4AC9A 1G7TA 1CJKC 1HH4A 2C78A 2GJ9A 4NCJA 2ZIAA 4HEJA 3I4LA 5FUXA 4M22A 4DT1B 3THYB 3UWKA 1VYUA 4AK9A 2ZRAA 1JNYA 2GJAA 4JYBA 2NMVA 5CM8B 5FL7D 2GJSA 3AGQA 3U5ZB 4FCTA 4B3CA 2FFAA 3F0TA 3GLHE 5AJYA 4IVRA 2QE7D 1CRPA 2J5XA 2A3RA 4Q1DA 1XTQA 2XNDD 1D6JA 2PZEA 4MKHA 3FB4A 1RIFA 1U90A 3IGFA 1WQ1R 5B2ZA 1KK1A 1NVXQ 2HF8A 1OB5A 3CRQA 4EFLA 1OJLA 2WKPA 2PBRA 2CHQA 1EXMA 4LC0A 4NMMA 5HE9A 2R6CA 2DYKA 2N1BA 1P72A 2I1VB 4QOSA 3ZDQA 4NCHA 1QHSA 4F38A 3VAAA 3CONA 3Q7PA 5KSZA 2O0KA 4ZPXA 3AVWA 2JA1A 4HYYA 2IYVA 3MJHA 3QVUA 5DI3B 3WNDA 3A1WA 4PTLA 4DCSA 1M1YE 4QFMA 4ZDWA 1ZM4A 4QRHA 1XEXA 3V4FA 4C0KA 3CR7A 4UNQA 3TIFA 1IQPA 3TSWA 1NKTA 4HZUB 2ZETA 3L2OB 2GEDA 2N46A 1CIPA 2W6ID 3MWKA 3SYKA 1ZNZA 3WYAA 1CTQA 4FCVA 2IUSA 1Z0FA 2XTMA 3SN6A 4A8JA 3EZ2A 4UXIA 2NO0A 4L16A 3QPWA 1CXZA 4PAQA 5P21A 1NSFA 5EJEA 6Q21A 2LWIA 2A78A 5GJCA 5CB6A 3QF7A 2CMKA 4PO1A 3X1XA 2AL7A 2O8FB 4NONA 4KSCA 2BMFA 2XB2A 4DDTA 1WXQA 2HYIC 1ZU5A 4S2EA 4XVUA 3T1QA 3KKNA 2WZQA 3EW9A 5CK5A 1D2NA 4OI2A 1CJTC 1SKYB 2ONKA 4CEIA 4JSYA 2QL6A 4P33A 3GCGA 4O2LA 2B8TA 3WY9A 5EXXA 2QROA 2CJWB 1W4BA 4DLYA 3WP0A 2W2TA 1EX7A 3R7WB 4NBSA 3CX6A 1VG1A 3W5IA 2J7KA 3DM9B 4QGFA 3HWSA 1NY6A 1F3OA 2WM9B 1VG8A 4JYCA 4LI0A 1N5JA 2GK6A 2D74A 4IDQA 4PO8A 2O8CA 1P2UA 2C2HA 2G0NA 5SZIA 4H9GA 2C98A 2ZI7A 3T5DA 3TQCA 2I1QA 4TTQA 2D3WA 3FKSA 2OG2A 5AJWA 1FMJA 2RB4A 2XTZA 1P3JA 2ZJAA 4ZDJA 2OFWA 3RRNA 3EPJA 3AV0B 1ZD1A 5KSOA 2EFCB 1E79A 2O0JA 4O3MA 4YDSA 4AG5A 4E09A 3LQQA 2ZANA 4CEHA 3RSLA 3TR0A 2D62A 4C0BA 3HPQA 3AVVA 1Z47A 1XB2A 3EWSA 4DIEA 5KPDA 3Q72A 3I72A 3CUEF 2QTHA 5J4KA 5KSYA 3K9GA 3K70D 3A1VA 3A1TA 3LRPA 3Q7QA 1S9DA 2IF0A 3ZD7A 4AKGA 1OKKA 1U99A 2J9RA 2KSQA 3WMGA 4OJQA 4PPGA 4KSBA 1MR3F 4URZR 1XTSA 5FTJA 3QBVA 2BBWA 1N6NA 3OHMA 3GMTA
chains in the Genus database with same CATH superfamily
1QFSA 4MSUA 2YWHA 1G9TA 2JHCA 3ZXIA 3PIDA 1EP9A 4ABYA 4B6OA 1UJ2A 2K87A 1WOYA 2PUHA 3VO2A 3W2IA 4G4JA 1Q91A 4PINA 3ZCXA 2R48A 1E94E 2CK3A 2BI7A 3O84A 1K0UA 1LRJA 3DL0A 4GNKA 2PSHA 5B58T 3OLYA 5JYEA 3HL0A 3B8HA 4AZTA 3BTSA 5JAZA 5BR1A 3QTLA 2G88A 3UC5A 2WTUA 1IEQA 5HMMA 1ZBQA 2VVTA 4Q7LA 4RH3A 2DUNA 3ILVA 1YTLA 4QUBA 3UYKA 4BWVA 1IOVA 4GPEA 4Z3OA 1EPUA 2C7BA 2NYUA 2WV9A 2PJUA 1NRXA 2XDQA 3HEAA 3ZWAA 1W0JA 5HR5A 5JO9A 4B4UA 4IINA 4DUPA 5LP6B 1CF4A 1AGXA 3F5SA 2GEBA 4H1VA 4ZI5A 3KSZO 4ZVUA 4BWGA 1EWRA 3MGKA 3PYMA 1V11B 3K2QA 5EL0A 4KO1S 3OA2A 3HTXA 1UWLA 2CFIA 1WB5A 3BWVA 2FCRA 1M54A 1TW3A 4KQHA 1DZIA 1OOEA 1I24A 3PFIA 3LD9A 1WF3A 4TL7A 3U44B 2JEZA 4U2DA 1K6IA 3I23A 3TPZA 2EGUA 4M86A 4PU0A 3IBGA 2FEMA 4ED9A 3VNRA 1EQ2A 3PIIA 2IUTA 1A76A 1MO6A 3DVAA 4E4TA 5FX2A 2CYAA 1Z0ZA 4WW0A 4GWGA 5IZCA 4GXRA 2GXAA 4QDXA 1N5DA 3SQDA 2HMTA 1YT5A 4KLZA 3I0NA 2RJ3A 3LECA 1Z6YA 2HHJA 1CUIA 3TGLA 1NUUA 4KXQA 1N2BA 5D3MA 1D0SA 4A27A 1ZGCA 4XDGA 1FMFA 4JKOA 2LIVA 3RRMA 3VPCA 4PLFA 1PV2A 4BCCA 2GO7A 2YZ2A 3KNZA 5TB5A 4QHYA 1ZVKA 3JVVA 3O6VA 4QUIA 4FX5A 1WV0A 1M1YA 1D4FA 1Z26A 2FHPA 2GEFA 3LQKA 4ZVOA 4COKA 4H6VA 3SDBA 1GUDA 3UEOA 1SXJA 2BFCA 1ZMXA 3D4BA 2K2WA 3FKSD 4FS3A 5IM4F 3VKGA 1DRKA 2R1TB 3LW8A 3DDHA 2H1WA 2JRLA 3FLBA 4RYDA 5EZQA 1P77A 3QX3A 3MOSA 3KO8A 3LYHA 4JR2A 3UN1A 3ICOA 1XRRA 2XAUA 2VEDA 3EMKA 4DV7B 2XY4A 4MAFA 2W9XA 2PRJA 3TN7A 2NV0A 4JWTA 4BTLA 2RC5A 3OFSA 3TB6A 2NSYA 3KAQA 3M6UA 2LVBA 1DGQA 4DWVA 2V7WA 1NMXA 2J32A 2CVZA 4IG9A 1ZI9A 2OKGA 3H3XA 3FF4A 1A2BA 5A4AA 4EB8A 2ZSDA 3T1VA 5J23A 2ZUFA 1DAKA 1FYWA 2ZVQX 2WF7A 3TUJC 3BTOA 2QEQA 1FFCA 4KR9A 3SDZA 4G81A 2Q8PA 1L4GA 4IMPA 1TM4E 4TS3A 2DR3A 1LPMA 3R9WA 2J0QA 5D5HA 1V95A 3ES9A 3ER9A 5ALKA 3OURA 4U0JA 1I3LA 4K87A 3G5AA 4UUMA 5HF5A 1ZK1A 4UNRA 1G3IA 4LYDA 2AEFA 4FNMA 3VPSA 4QGSA 5FBVB 3KQQA 2B92A 2WQZA 4ZYWA 5DBOA 1GYQA 1Q7GA 3H5AA 1VLHA 4J9VA 1LNZA 4K03A 1QCYA 2BONA 1ORDA 1RKVA 1WKVA 3EHDA 4J0KA 4GYKA 3MW8A 3VJKA 1GZ4A 3S81A 1EUCA 2WMYA 4C22A 1KA9H 5A7GA 2KE5A 2B2NA 4YTEA 2PO5A 4L8WB 4ZOCA 3AZPA 2FMTA 3DE5X 4AUEA 3EYWA 1XLTA 2QNBA 1WMFA 5CXSA 1PJLA 1TYAE 2ZLBA 4JXJA 1ZUNA 4MYSA 2Y77A 4RPJA 4CCSA 4FI3C 1TUBA 1V5WA 3VR2D 4AVYA 4C08A 3NASA 1MA0A 1Z7GA 1KAHA 3GFTA 3WGNA 5HCNA 5JCOA 3VO8A 3IOYA 4MTLA 5CPFA 4OQEA 4BX2A 5FV7A 4MW9A 4XYMA 2E1RA 4R01A 2AFIE 1Z08A 3DFZA 4F3NA 2PKRA 2V7UA 4HNSA 4ZI7F 2PU5A 5BN5A 1RMTA 5IDVA 5BV7A 1FNCA 1JGTA 1MAVA 2RC6A 3KOZA 3AIIA 1GNLA 4P3XA 4MI6A 3FR7A 3OOEA 2BHNA 3LL7A 2D59A 2NADA 1CETA 5B58C 4R1UA 4DNXA 5EZ5A 4OXYA 4G0OA 1NP3A 2P69A 3GU3A 1E5LA 3IUSA 2XZLA 1USGA 3QOXA 2CVHA 2H5LA 3DG9A 4FWIB 4KKXB 3SS9X 3UATA 3SKVA 2IYZA 3CS3A 2GKSA 3R44A 2FSIA 4D7AA 3Q3CA 4BN5A 4D3SA 3E7WA 3ZHUA 3JQRA 3GLGE 3WNBA 4WY8A 1WB9A 1CUWA 1J42A 2OHGA 4CHTA 4GGPA 1YUNA 3EFOB 3TLGB 5DP2A 2R1ZA 1MGPA 4C4TA 5AXBA 2CNLA 2C1ZA 1XU7A 1VGQA 1FX0B 2OL4A 3BIWA 3I05A 3C6KA 3FPGA 4L3VA 4MO2A 3M3DA 3WVNA 1P6QA 4B47A 5B1YA 4KXFB 1JDZA 1QFYA 1TT7A 2KX7A 2VTEA 3UB4A 1KI7A 2AKAB 2I03A 5IM4A 5BN1A 3LLVA 4HADA 2BM8A 4X92A 4ESHA 2W6OA 3RIMA 2P9EA 3U7QA 3NETA 1P19A 3QYPA 4G84A 4R1NA 2PAFA 5E1DA 1QC5A 2IW1A 1YRBA 2QZJA 3IP9A 4QDKA 1WU8A 1G41A 3VV2A 1AS3A 4ZVRA 3WGQA 3ICEA 1SBHA 3JPYA 1TVMA 3IJPA 5CDFE 1RYNA 5DEOA 3PYLA 1C2TA 4WBXC 1Z68A 1ADCA 4MDHA 1TKRA 2FWPA 4QPDA 4K9NA 3KRTA 3BRCA 5KWEA 5DNWA 1IHUA 1YS7A 3FIUA 4KV9A 2BEWA 3BD8A 4N39A 2QD3A 1XVAA 2D1FA 2OLKA 4J0FA 3FI9A 4YRQA 3V42A 1AXGA 3OICA 3USCS 1KJNA 2JIMA 2CZCA 1RYEA 3KBBA 4IVPA 4LJ4A 4C3OB 3AF2A 4FKBA 3AVOA 1F0KA 4LC1A 1BGXT 1LRLA 2PMKA 2Q4RA 1RPAA 3CZMA 4QBKA 4V3CA 3TVDA 2VP3A 3FDFA 4ZIRA 3FNEA 4PE5B 1Q1NA 4EMTA 4FYXA 2ZITA 3M81A 1WJGA 1GKLA 4NIMA 2XXAB 3K1JA 1AB6A 2CVFA 3ZWNA 1MDBA 2B4QA 2OORC 5DW3A 5CT4A 1VIYA 1P2DA 2I9KA 4M0PA 5C1IA 3G9QA 4A0SA 1CUZA 1W4ZA 2ZVJA 4YRLA 1Y1KE 4R9SA 5BSUA 2J9YB 1DIGA 3FYTA 1KYVA 4BZPA 2FB9A 3OQJA 4ZYXA 2B2XA 3UW3A 5B4TA 2K7FA 3O9VA 2QVGA 4GYWA 4RBNA 4RQBA 1QHXA 1RFLA 1TAHA 1ZJJA 2PUVA 5BR8B 2R4TA 3B53X 1VJCA 1QZUA 3BWBA 2F00A 1TJ3A 3NOXA 5BUCA 1DG3A 2GCOB 4QM6A 1BXKA 4D82A 1FFAA 1N4AA 2MCFA 4B7ZA 1HR0B 1F2DA 3ENVA 1X38A 4PYIA 1GU0A 5EJ9A 2VP0A 3I76A 4DJ5X 1WDLA 2HNAA 1F6BA 4Z4FA 2VA9A 3CT4A 1JLSA 4GMXA 5IARA 4DUGA 1XRJA 4ZI7A 3OP1A 2OP1A 1UODA 3PLNA 3PUWA 4M9XA 4RK5A 4KX3A 3I1JA 3RFUA 3LPLA 2Q3FA 3MWDA 1T6BY 1NJ6A 1GPAA 4YH1A 4PS0A 4AKHA 3IDSA 4UVIA 1I5OA 3KETA 1DE0A 2LTAA 2VHVA 1BIFA 4HGRA 4MVJM 4EQZA 1DO8A 2OBLA 2DPXA 3QENA 4CGZA 2CXOA 4XQEA 1HFJA 5DPMA 2EYUA 3O74A 3R8FA 1P2TA 3ROQA 4OX9Y 2JGKA 4HX2A 2BGWA 2QVZX 2NNWB 4K9KA 3QXCA 2PQ0A 4KREA 1UFKA 3HE3A 5DSTA 4U7FA 1I3OA 1VHDA 2FMUA 2WP0A 4NJEA 3KUDA 4MAAA 5CVEA 5DTJA 3UCXA 4Z4CA 3FDXA 3UPTA 4MGIR 4BV2A 5KYKA 3AHFA 1O1YA 2A0UA 2XUZA 3I1FA 1K97A 3RFXA 2KMLA 2R00A 4GE0A 3NPMA 1SMKA 2QN2A 4V0MA 1MJFA 4CLOA 1IUNA 4FEAA 3PGLA 2GF2A 3K9HA 4J7AA 4ND6A 2O8EB 4N01A 2JPDA 2WTBA 2XT9A 4ETIA 2VDWA 3IA2A 4K9RA 3FSGA 5K8UA 4RSHA 3NEYA 5ALJA 3JQ7A 3PI6A 1CPYA 4UATA 1I5EA 4AI6A 5CLLA 1A5AB 1MQ8B 4MQBA 1LNSA 3ORSA 4YLEA 4ND4A 4BHTA 2D8MA 3MJTA 4Q21A 3WIBA 4H17A 3COWA 1AQ6A 1UZMA 4BAZA 3AEYA 3A31A 3E48A 1IHXA 1VJRA 3NXKA 3AO0B 2WSSA 3WFIA 4Y2YA 3TZ6A 1FUIA 1AN0A 3B85A 3EF3A 3ENKA 2PT5A 4OO3A 5KVVA 5BSWA 1NW8A 3O3CA 1T6NA 3ESZA 3LWZA 3OOWA 3PQCA 1GTJ1 1XEWX 3R77A 4LDRA 1S6YA 1SVWA 2IYQA 4HDRA 1OXVA 4LHXA 1V4VA 2JIDA 2HU7A 2ZYHA 1SQSA 1ZU4A 4UTRA 4YMVA 4RY2A 4F04A 1BA3A 5JMWA 3NTRA 4K88A 5LQMA 4B7CA 4TSKA 4YXWD 3FCUB 2F3TA 3WA7A 1J4AA 1NZFA 1YE3A 3OO0A 5AXAA 3OBIA 4E4YA 4V2IA 4Z5XA 3SMQA 2JJ1A 1P62B 3VMFA 5GJVC 1K6EA 2X0DA 3VNAA 4EFDA 4QYSA 1TU3A 2E7ZA 2YHSA 2RIRA 1ZGGA 3CF4A 1QPGA 4YAUA 1CZNA 2PNFA 4L27A 4O02B 5I7EA 3G6KA 4KR0A 1V8BA 4R1OA 3AP2A 2IYFA 3IQWA 1F60A 3KVVA 2G7ZA 5DTIA 1JFVA 3S8MA 1GL7A 4HBGA 2UYHA 2HHCA 3I53A 3KWFA 5BNWA 5ILOA 2RGDA 1CDEA 2BFAA 2C31A 5FI3A 5HA5A 3QK7A 4GM1A 5CX4A 1NF2A 5BW5A 1T2VA 3DPUA 3ZE6A 4RVFA 3G7UA 4X7RA 2FUG6 1JXAA 3R5JA 1WCIA 4G85A 3DT8A 2VXOA 4ER6A 1QDEA 3OEHD 4B3TB 3L8HA 1KZ9A 2YUTA 4XOIA 4BU0A 3CGWA 1D3AA 1BS1A 2A9FA 2F3QA 1AE1A 2DTXA 4HH0A 5EIHA 4J16A 2QT1A 4OHWA 3UJ6A 1YDFA 1IH8A 3LHIA 5TX7A 1ZD5A 3ZDCA 4QARA 1R6TA 1R0ZA 3WICA 3L1KA 2PHZA 3C3EA 2J7PD 4YB8A 3D6VA 1OYYA 3M9LA 3S6JA 4DZTA 1YH3A 2VDQB 3M6VA 3QHAA 2JIZA 2PMWB 4E22A 4HQ0A 4EY4A 2W6MA 3AFHA 1NC1A 2CKMA 2J5KA 1ISPA 2RAFA 3MT7A 2H92A 4P32A 3K09C 1V4NA 3Q9NA 5JADA 4B3GA 4K2HA 1NYTA 2PKQO 1E0AA 4WZBB 4TL9A 3KV3O 4EHBA 3HM9A 4A36A 2PXHA 4HUTA 4IPTA 1IM8A 1YCHA 2P1RA 3X2EA 2IV7A 1Z35A 4IJUA 3E7XA 2GZRA 4JVNA 4B2PA 1EB8A 1QHHA 2W2KA 2GWRA 4J2TA 2GCNA 1QHIA 5TQ2A 3WQBA 1IOWA 1AD2A 2EJUA 4Q3NA 3AUJB 4GLBA 3M3PA 2TMGA 3MSCA 3ODPA 3VPHA 5JAPA 4CKBB 4WL0A 1YGPA 2ODNA 4I55F 2FOIA 4PQYA 1Q77A 3X1DA 2B82A 3E1KA 4DLAA 4ZWNA 1FU7A 3KTAA 5L8VA 2FQQA 3HR4A 3LG2A 4I4LA 4TSFA 3NEAA 1WPQA 4ZANA 3ESCA 1ID1A 1FFWA 1F1JA 1T24A 4NC9A 2BMVA 3PT5A 1THZA 1P0QA 3N70A 4RZUA 1M1ZA 3VNQA 3RK1A 2ZSAA 2VK1A 5F12A 3RFTA 4YPOA 5G4KA 2Q5IA 4DJEC 2P6PA 1C7EA 5HWSA 3SQWA 1N25A 2QT9A 2H11A 4FVTA 5DWVA 3ZDRA 3BCHA 4JIMA 2YYYA 3DMNA 4IZOA 2NNLD 3OX4A 3QVTA 4HI0E 4RFLA 3KVRA 2P2GA 3GJTA 4HJRA 2JI9A 3OHPA 1GGNA 1CNFA 1JP7A 1W46A 4HL6A 4LMAA 3TCNA 1T3GA 2X4LA 2D2IA 5HBGA 3NBKA 2HCBA 4ZO4A 1R5OA 1L3IA 3ZY3A 4IFEA 3RV4A 5MFPA 3RVKA 4D25A 2ANBA 4JV5B 2ZSHA 3VR5A 3B70A 2E4ZA 3ELUA 5HJ2A 7MHTA 1Z0KA 2UU9B 5ALNA 3K4QA 4XGQA 2FK8A 4TMZA 5D00A 5FOXA 3KZNA 5P8WA 4FHDA 3K0HA 4MWCA 4V1CA 2QRLA 1V43A 2NU6B 3GPDG 3OFJA 1A7JA 4PTYA 3NXSA 2BFEA 2IYWA 1KE2A 1RPJA 2OEPA 2WQ7A 3WGMA 3NS7A 2VT3A 1J2UA 3PA8A 2WHPA 1H1LA 1L4LA 2EWMA 2OGUA 3SFVA 2C7VA 2EF0A 2QE6A 3PCRB 4CT5A 4EH1A 1ZN2A 2QZSA 3CO0S 3LYLA 4DMUB 1GZUA 4AMGA 1KGSA 3CR8A 2CEKA 1P91A 4JT9A 5AVZA 1Y6ZA 2GCIA 2OUKA 3IT2A 4URUR 5A03A 2XDYA 3O8RA 2Z9BA 2IGBA 4DIOA 3JARA 1MW8X 3RVNA 1XTZA 3C8HA 3OU6A 2NUTB 4PYRA 3AIMA 5JE8A 1RLOA 5BQFA 4CG2A 2ZR7A 1LSSA 1AKNA 2ZT8A 3WGGA 5JQGB 1D2MA 1E8NA 2IPXA 5H0IA 4HLQB 1GWNA 5HYVA 5MN5A 2EARA 2OV8A 1GO2A 4ZHSA 4CCYA 3L1VA 2ZIGA 5LBUA 1YA4A 2BHLA 1JJBA 4EUEA 1GSIA 5AO9A 5GIOE 4PBSA 5DSXA 3GLIB 3KUCA 1H9CA 3UOWA 2H6EA 3DAHA 1UBUS 3PJFA 1D2AA 2GNAA 3L0SA 4FLEA 1IY2A 4ZCQA 3RFFA 3X43A 4PANA 2Y1GA 4H08A 4YC7A 4A5OA 4EG8A 3OF5A 3ROEA 4MPPA 5IBPA 1T2FA 3CXRA 1XLUA 3IUBA 2YVQA 3R0XA 3O2NA 1KAOA 4D0LB 3T52A 2JLSA 4YACA 2FPUA 2V5UA 4I55A 3ZY6A 2P8SA 2XHEA 2PL1A 2W11A 1CQWA 3VR4A 1CB0A 1QFXA 1IAQA 1SXJE 5AOAA 1BMFD 1FS6A 4XPIB 1LS1A 2KHZA 3EOBI 3X0DA 8LDHA 1TUGA 1NN3A 3COSA 4QQKA 1OROA 1MPXA 4BC0A 4DR2B 2EJBA 5E9JA 4MCJA 4L5AA 3HSYA 4UQPA 1TXGA 1ZKDA 3FNBA 2WT8A 3AQ4A 4ESOA 3ADCA 1QO0A 4CNBA 3ZCUA 3PC8A 1P0MA 4N65A 2K4MA 2OB1A 3D8BA 1IHYA 4YJ3A 4WK4B 3BTUA 4DSTA 2GEKA 3EDYA 3FWKA 4UOQA 2LCQA 3KYDB 2RHDA 3NGXA 5TJHA 4XQCA 3WKAA 3HVRA 1BU5A 1GRQA 1AU9A 1JEAA 2RKBA 4MYUA 1QRDA 4YQYA 3MBIA 1X8KA 2SKDA 3PIRA 3N39C 5KHLB 1S3GA 5YASA 3CB2A 4XWOA 2B7CA 2Z98A 1TJPB 1W4RA 1R0BA 2A9VA 1LK7A 2QG9A 4WY2A 3NTQA 4NJMA 2J46A 3TJZA 2PH3A 3NWBA 3NBMA 1TLTA 2V74B 1VTKA 3QXHA 2HUNA 4Q5IA 3VH3A 4RVOA 3D9QX 4ROSA 3Q8KA 5CB4F 4RJIA 3P9RA 2O0MA 1JJVA 5TVGA 5EIFA 3UBTA 1ZR4A 1FDSA 4UMEA 1X7XA 1ZRNA 4KLNA 3GJ7A 5BV2P 6REQA 3N3BC 4INJA 2O20A 2I3GA 3W6ZA 5JAUA 3HFRA 1ADFA 1C30B 2HHAA 2ZI6A 1QX3A 1N2CE 1C3OA 2P3LA 1C1DB 1FU8A 1G4AE 3H17A 3OT5A 4RGQA 2QL9A 4IKOA 4D8WA 4B3BA 4BBZA 4GLFA 3MQ4A 4DA9A 5DCWA 1NVKA 1S4QA 4HPJB 5JVDF 2DFLA 2GJ8A 3N5KA 4Q4JB 1PZFA 1A72A 1YKGA 2M6KA 2DKNA 3BH0A 3WGJA 2BLLA 4EPXA 1XXHA 1PDVA 1L8AA 4IXMA 1MB3A 1UKVY 3ET5A 3HA2A 1SBQA 2XOXA 2HYDA 2LXNA 3ADBA 4N82A 3D0KA 5DBGA 4XR9A 1HWYA 3O8QA 5AK3A 1JXQA 3ICQB 3IRUA 4RDIA 1MAUA 2X8JB 3IDAA 3GOHA 3L7AA 2XF2A 1B0UA 1KVTA 1G60A 5DU2A 4IL5A 4L75A 4U7HA 5IT5A 3FROA 2WB2A 3U3RA 1BFDA 2RHRA 2TMKA 1AS0A 3GRZA 4BB5A 3C3DA 4XDZA 1CP2A 2WW8A 4HF7A 2WK1A 2Y2UA 2H1HA 1CUDA 3O82A 1QLJA 2VHJA 2E49A 3LK7A 2EZ9A 4KYVA 3VOTA 2J8ZA 5JWHA 3VYSB 2H5IA 4OSPA 1UDCA 1WUKS 3L1IA 4PSCA 4K7JA 4Z7NB 3ZDDA 1C7QA 3E7DA 4V0RA 3WMRA 2QYSA 4J9UE 2ATXA 2AJCA 1VSQA 3EWNA 4E31A 4BXOB 3H87A 1CS0A 2TMYA 3N6VA 4KH1A 4UPDA 2HO5A 2VHQA 4KVFA 3W9UA 4B6GA 4LJKA 1X1RA 4BV8A 4M1YA 4LYJA 3S4YA 1E6EA 3A3OA 4R1MA 2J30A 3GUUA 2KM1A 2O4CA 1SC9A 3KFXA 4LBYA 3X1KA 2ZW9A 1EE2A 2QX9A 4EA7A 3PL1A 1NUTA 3ABRB 3H86A 1PVOA 3Q87B 4CRWB 1M34B 3U3JA 1U3WA 2Q5LA 2WLTA 3C7AA 1CC1S 1JJ7A 4CTJA 1FFSA 3QJ5A 5KTTA 4G25A 4YUZA 1AQLA 1QORA 4FMBB 1T8RA 5KNBA 3IJEB 4MB6A 3RHFA 2C20A 1F7VA 4UTVA 4F97A 4MRVA 2ZUTA 1WTCA 1YS2X 3ANTA 4NR0A 3GJYA 4A8PA 4HH1A 3P4XA 4NBLA 5AP9A 4PPFA 4LRTB 4EW2A 1EX9A 4PZDA 4JI7B 4EY6A 3AI2A 4RVCA 4TT3D 1PQPA 2HSDA 2ZK7A 4RGYA 3UANA 4Y2VA 5E3IA 3BGWA 2I8CA 3RBXA 3PUHA 4OHYA 1BCSB 1Q6YA 2ASVA 4G5HA 4XX1A 3TZKA 5BWMA 4UUAA 3R5XA 3DEKA 2SCUA 3L4BA 5CB4A 4KPUB 3UWSA 2PJDA 1PR3A 1G17A 1T10A 1GTG1 2DM6A 4RKYA 1YZNA 3BHIA 4CTKA 5LQJA 4GUDA 3HFSA 4D4HA 1JLLB 4RTOA 1M76A 5KJEA 1FSSA 2AK2A 1XN1A 3AUFA 1UJMA 4UCXA 3VZRA 2M2IA 4C4PA 5BMVB 2PLFA 1SHZA 2WF8A 1GNSA 5JD5A 5FFMA 2OYRA 1LB1B 2FLVA 2HREA 4PBTA 4QYWA 5J2UF 3EEIA 3GT3A 3LK6A 3GUHA 3HWRA 1DARA 4U0KA 4WADA 3GUYA 1ZJYA 5JVDA 3O91A 1LDEA 1RRKA 3BIXA 2BDTA 2DUMA 4QG7A 1ES9A 3RUIA 5AW0A 4KQ2A 3LCUA 4GMHA 2W00A 4U2KA 3MRTA 3W5JA 5KQGA 3WAGA 4YT5A 5A05A 4QXPA 1C0KA 1NJ5A 2ILTA 5L7TA 4L8YA 1NBOA 3I6ZA 4EBFA 1WQ3A 4R6WA 3G82C 2LZ0A 4HDAA 3CXUA 1V6SA 2BKAA 1ZWLA 1V25A 4I1PA 3I2YX 4X1IA 3FGPA 2CXHA 2VNKA 3L8YA 4L4UA 3QLJA 5SYNA 2PRYA 3TNFA 3ZG6A 4ROTA 1MORA 4UD2A 4BMDA 5HF6A 3C97A 3L7LA 3KUKA 1ODTC 4XVQA 2HBYA 4PLVA 4K1XA 1DVRA 1G21E 1PLLA 4ND2A 4LC9A 5H81A 3R3VA 4Y2JA 4GI5A 1YZUA 2RD2A 1I2MA 2BE7A 3VBEA 5G4LA 4H60A 2CVQA 2PBFA 1URPA 1Y9EA 1NIJA 4GW3A 2AH5A 1BZYA 2FK7A 3V3KA 3R3SA 4FYJA 4D9FA 4KWTA 1DEKA 2EATA 3Q2IA 3GFPA 4WGGA 3ROMA 3RS2A 5K3EA 5FEMA 4KFTA 3WMXA 4B81A 1C8LA 1L0BA 3OZBA 5ULLA 4G0QA 4BLVA 2QUKA 3D0OA 3M6LA 3A9TA 1WB4A 2AA3A 5DW0A 1K63A 4N76A 1JLHA 3AR5A 2MMGA 2A5FA 1PGOA 2GF0A 3MN1A 5GONB 5C1PA 1RXUA 5ELXA 2YVLA 1OZAA 2OAP1 4FZJA 2SECE 5F52A 4FFRA 1RXYA 3KWJA 2A33A 2ABWA 4ADSG 2R8OA 1RRCA 2GCEA 3RRXA 4D99A 1RHQA 2BFOA 4BYMA 4F7WA 1Q12A 4UBNA 3VYWA 3PNVA 3QNUA 3W3AD 4RA9A 1EDBA 3RKSA 4L9AA 3T7SA 1PJBA 5EIOA 4YJ2A 2C2BA 2BGTA 2FG7C 2LD4A 3AZQA 4MW6A 4WXEA 5F51A 5LCXA 1NI4A 5ITSA 3TW0A 3A37A 1T4CA 1WKBA 2YXBA 3MGAA 4M60A 5GVSA 3OKCA 1R0WA 3IAHA 4QGAA 4ZJUA 2V7PA 2B2CA 1N78A 2EDAA 2VRNA 2YMQA 2BUCA 3O95A 4FW9A 3SQOA 3IJ5A 4PYQA 2OP0A 5KU7A 3L93A 1MQ9A 1Y6RA 4WPGA 3LKBA 4OIMA 4BVBA 2H29A 1NQWA 2ZDGA 3LNTA 4FMPA 1ESEA 5IAGA 4PR3A 3C7DB 4LNHA 5JFGA 1TYCA 2C9YA 4Q7JB 1SEPA 4UCWA 4AP6A 3L6OO 1NN0A 2NGRA 1FQWA 1X1TA 1CIVA 5U4XA 1JEJA 5L4LA 5J2UA 2O7RA 8ATCA 1Q21A 3M6XA 2FW6A 4LG1A 5A1TA 3C0KA 3TR6A 1Z8DA 1BE0A 3DQZA 1L7BA 4RWEA 4XD7A 5D6NA 3X44A 4UTXA 1LV8A 1US8A 3SKXA 3ZY5A 5JMTA 2NTVA 2OTCA 3ZWKA 3JS5A 5JEDA 2ZXUA 5KO2A 4D5GA 2XUHA 1UDAA 3V3TA 3WJ1A 1Z5PA 1XHLA 1YQUA 3EW7A 5LXTF 2IWRA 4I50B 1N9GA 1R0SA 2I2FA 4Q05A 5K8LA 3OQIA 4D4MA 2GK7A 3ROTA 3I5AA 2WSBA 4M36A 4HNRA 1EXVA 3CNNA 2Z1DA 4I9UA 4HZIA 4NYMQ 3DC7A 1KH2A 4XAQA 2ZCUA 2CNDA 1SIBE 1TFUA 3PR1A 3QIAA 3EVEA 2A59A 3DBIA 5K09A 2FGKA 1W25A 2I4IA 3GMDA 4BQOA 1YRQA 3U4DA 3ZWDA 5LA6A 4AP9A 2P6NA 3E1GA 5ADWA 1GPNA 4JCOA 1MFPA 2XVZA 2B9VA 2O3JA 3JQPA 2LP4Y 3QVSA 1F0YA 5H70A 5C8DA 1LDBA 2FZ4A 2ZRDA 5TIIA 1QMGA 1EFRD 2WJ6A 2A7XA 2ZT5A 4EATA 1S8FA 2NYAA 2ZI3A 1BDIA 4S04A 3U3KA 4FFBA 3G9TA 4KVZA 4DLVA 5CITA 2D7DA 4PXSA 1DRUA 1CQJA 4ER3A 5K99A 1NSTA 4JLOA 2PYZA 4TYMA 2F64A 2OZEA 3GBPA 2VBIA 1ZMBA 4UCQA 4WZAA 4QOEA 1IXSB 4RD0A 4UHDA 1PR2A 4IDOA 3UMVA 1JR3A 2X3UA 3CW9A 4B9EA 4YJFA 3IRVA 1ZK3A 4D42A 2QPLA 4AJIA 1X6VA 4HGZA 3TW4A 2QJTA 4NENA 3VTZA 1BA2A 1BE6A 2PKYX 3DOUA 1OLUB 4ZVSA 5C0OE 3IOMA 3QFFA 2PS1A 4D8XA 1UJ6A 4C0HA 4ID9A 3ESQA 1QOPB 5JNSA 2IPOA 1GSAA 4CIYA 1W29A 1XU4A 2G5CA 1AY0A 3OZEA 3ZWBA 4BKPA 3ZIAA 1KI4A 2WAYA 5GPBA 2IFTA 1Q83A 3QQPA 5K0JA 1C8KA 3IO3A 4CIDA 1H5QA 1BHJA 2Z2XA 3BRWD 2XCQA 4N6GA 5KHOC 1D1PA 2EERA 2AI1A 1IHOA 2H8KA 3NH6A 2PCJA 1UMBB 3ZZUA 1HDGO 1JIQA 2CXUA 5D01A 3M2PA 1X2EA 1WSAA 1TZ2A 2C83A 2HPAA 2VJMB 4E03A 4BP3A 1FNBA 4ON9A 3TDNA 1K1EA 4WLUA 1IWPB 1IMOA 4II7A 5FHQA 2FH5B 2YHUA 3HCOA 2OHOA 4BU1A 3AYZB 3ZHZA 1XDBA 1THMA 1JLRA 3G23A 1SCBA 4C7KA 1XQ9A 3KYBA 1J25A 3OJCA 3RSGA 4P3NA 5AW3A 2WPNA 1I1NA 3AG6A 1KU0A 4DRXA 4ARCA 1WNTA 3BKXA 2OZKA 5J58A 1UMCB 1MBZA 1MQAA 3DCJA 3RABA 2H85A 5IFKA 4LOAA 1GEGA 1YDWA 2DLNA 2VPQA 1TFRA 2Z83A 3PHHA 5EWJB 3V8RA 2VDJA 4IW3B 1VFPA 3ZTTA 3HJRA 4YJGB 4IXWA 2IKQA 5EMNA 2YY7A 2PGXA 2AJLI 1KC3A 2RK3A 5I9TA 5LXTA 3NHMA 2PL3A 1IULA 4ENUA 3C7TA 3QBJA 1EK0A 1E8DA 3ZJ4A 2DF8A 1C9DB 1UJBA 3BEDA 1JHUA 3GQBA 4PCLA 4PLTA 1Z28A 4WESA 1X80B 4G24A 4GOKA 5BN4B 5ICGA 3OTQA 1JG6A 3KKKA 1F9AA 2A9KA 4O59O 1XJCA 3RM3A 2BOVA 2WKWA 5KYWA 5FF9A 2Z2JA 2HTEA 1B93A 2NXEA 1E9VA 1JAYA 3ONEA 1PJQA 3ZWYA 4DVGA 1L5SA 2A94A 3HU3A 2FGJA 5DJ5A 1L5GB 5BURA 1RNLA 4DBVO 4V1CI 4LXQA 3ZYZA 1ZFNA 4DPLA 3BB4A 4RFVA 3A32A 4AMZA 4F0JA 3BHNA 2PUEA 3BJRA 1X7YB 1V6AA 4BNKA 5CD1A 3QU5A 1QKIA 3CCFA 2G3YA 2FN8A 3TLCA 4EW3A 1RAGA 3ZQUA 1SBIA 4JI4B 5D3QA 3BIJA 3O47A 3KUUA 5DHRA 3S2ZA 4N8DA 4MPDA 4WECA 3DKKA 1UBCA 2CFCA 3D4PA 4JLDA 2LR0A 3ZW7A 4YMUA 1YJ8A 2C2GA 2PKEA 4M98A 4NWIA 4EF6A 1G5PA 1ZVVA 5CT9A 2D2EA 3RIXA 2JFVA 1G3MA 3SHTA 3LUJA 4E2WA 4JQZA 1KMIY 1PFQA 5ALMA 3TS1A 1YIAA 3H1FA 4ER5A 2QOEA 3OTGA 4IUBS 4A6EA 3A7EA 1JT9A 5LVAA 3ZVRA 1JMYA 3LWNA 5BNTA 1BQEA 3P9CA 3OAAA 5CT8A 1U1FA 3HCWA 5IPFA 4IHAA 2OZVA 2DQYA 2FMXA 4ZAGA 3FRHA 2RARA 3KM0A 1ZMRA 2RI6A 2DUUA 1Q57A 5DGTA 1N3BA 3TH5A 1KDRA 1L7XA 2AHRA 4PIVA 2HRCA 1FSGA 2V45A 5LP6F 1YA8A 2OV2A 1YZKA 4L8FA 2AF4C 5CH8A 1H2FA 2G71A 3OJ0A 2P2LA 4R7TA 5J4YA 4UU0A 5HPYB 3KKMA 4A1OA 3HDVA 1GA4A 1GXSB 4CCWA 2D13A 5CJ2A 1X9IA 4DREA 1HTTA 2GOYA 2ZIFA 2C9MA 3QZUA 3QSGA 3UTCA 2V97A 3ZHTA 1XPJA 2BR3A 2EWWA 1I33A 4AY5A 4B3RB 3R7WA 2GBLA 2DHRA 4OKNA 5AK6A 3G2OA 3MS7A 1K8YB 1QYVA 3F7MA 3G2LA 2FP4A 1N7HA 2ZROA 1MG0A 3KQYA 4MK4A 4TOIA 1DDIA 2GVNA 4M6WA 4V03A 1A5BB 2GVZC 3H75A 1JJAA 3VAYA 4DAEA 5LL6P 4UE2A 1Z39A 5JWOA 3HJCA 4PHTA 2TS1A 1U3FA 4PW0A 4XQ9A 1W87A 5AW7A 3V8BA 5FORA 1GZDA 1XZ8A 1V6CA 3DT9A 1Y1TA 3PX2A 1EWKA 5U1PA 3OI7A 1UDRA 5T67A 4DR6B 1QX4A 4PF1A 4O1IA 5EKXA 1G4UR 1U3TA 1A69A 2D54A 2QK4A 3K9NA 4F71A 1IHPA 5A4DA 2CLEB 4JLNA 3W9YA 2CF5A 1X86B 1IZ0A 2DSNA 3E9QA 4LDQA 4UVHA 4XI9A 4E3ZA 1X3LA 1V5GA 3D5TA 4J1TC 4NFSA 2DSTA 2BZGA 1KYTA 1SKAA 2LKCA 4A2PA 3HVHA 2RHTA 3UK2A 3VJLA 3MLAA 3MUFA 4BB0A 3IEMA 3U6BA 4Q7EA 1OIXA 2VK2A 5L3QB 4MDFA 3OD5A 1IXRC 5AKJA 4NYMR 4CL8A 5HFAA 1RWXA 4KIGA 2ZIXB 2JIOA 1OLSB 3KEFA 5FHRA 1MJGA 4OFXA 2IV2X 2VR1A 4CM6A 4OHOA 3AHEA 5E1BA 4ZK2A 2BFDB 4XDHA 2REXB 3KOYA 5KTNA 4C5AA 1D0IA 4EJFA 5FUMA 2GO1A 2X0JA 3V80A 2ZI4A 4F4DA 1I7QB 3HJFA 4JP3A 4RKRA 2A57A 5BR7A 3SR3A 3NHYA 1FW8A 4IJMA 5F3WB 2QI9C 3ICVA 4ZO8A 4ZU6X 1F38A 1SURA 4XGRA 1UF9A 1U8EA 4KAXA 1UBEA 3GT7A 4AL4A 2WZBA 3JD2A 1HGXA 1O0BA 2CVPA 5GZ1A 3PR3A 4IS3A 3TPCA 5FNVB 3DOOA 3PLAE 3MINB 4NOJA 2IYEA 4UM8B 2EG9A 1E61A 5ETJA 3U16A 1KHTA 3A1EA 5GWXA 4B2LA 3I9V1 4K9SA 3TOXA 5KWJA 4G0MA 4NMHA 4X7BA 1V1RB 1W34A 1QVAA 1XCOA 2FFBA 2Y0EA 4ENRA 1N32B 1I0IA 3AR8A 1L7RA 2NXNA 4OHMA 5IKOA 3WJ7A 5L45A 1Y3CE 2XDWA 1NNUA 1XDWA 7AT1A 5DN6A 3RUPA 3B7GA 5JHHB 3H9EO 1DX6A 5LP6A 2DTEA 1M8GA 2FWMX 4GYYA 5E3HA 1OV4A 1GPH1 4N7JA 1AV6A 1SBNE 1MP0A 2X0RA 4MWZA 1V11A 5AW9A 2VZEA 3A7DA 4LZWA 3AP3A 1LI5A 2BCJQ 3QY0A 4KJZA 4Y1RB 5JCJA 2BIFA 1D7OA 1CX9B 2P0YA 3FZGA 4FMDB 4A82A 3O8CA 4YX9A 1EVLA 2F3UA 1RZRA 4E2XA 1D04A 1DKOA 1U2PA 2GLTA 3DAGA 3HP7A 4XUEA 4YAJA 2RH5A 3U44A 1D07A 3LUGA 4K6OA 5CEFA 2PUAA 5DXFA 2EFYA 4GM4A 4QQ8A 2R86A 3M9WA 5A62A 2ZSEA 4ANFA 1WABA 1LQUA 3WXMA 1LZKA 1Y0BA 1Z8FA 2E9SA 5EE0A 4AN1A 4GXQA 1QIGA 5EVCA 2O5EA 4UUOA 1USUA 3VU8A 1QH8B 4EUFA 4TS4A 1ZAKA 4GKVA 5B1IA 4Q7QA 4TKMA 5DCYA 4LJ6A 2XJ9A 2HMWA 5TQ0A 1P4GA 2R4UA 1E1RD 4F3RA