3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX19B
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
2DWPA 1XDBA 1KZ7B 1EFTA 4IDPA 1WCV1 4NYJQ 4UXIA 1Q57A 1GP2A 1JEEA 5IHPA 5EZ5A 2Q6TA 1T91A 3CPEA 4JVNA 5G53C 4TN1A 2FGJA 1J90A 2JCSA 3GLGB 2OLJA 1Z47A 3HP1A 1P4SA 2CK3D 1FOEB 1UJ2A 2KWIA 4PQRA 4NCIA 3AM1A 5L3RA 1US8A 1PV4A 1UEJA 1NMYA 4LHXA 2CK3A 4UNQA 2YYZA 1IN7A 2YOHA 4HLUC 4TMZA 3SYNA 2FOLA 2EFGA 4MUBA 1Y3AA 2PL3A 4CEJB 2ZAOA 4PFSA 1E2FA 1E69A 3VAAA 2XB2A 1TQ4A 1W2HA 4QL3A 1W0JD 4X8OA 4Q00A 3KJIA 3CLVA 2V6JA 2QSZA 4LOAA 4EIWA 3AVVA 3THYA 2J3EA 1MT0A 2YWHA 3HR7A 3PENA 3LRPA 3QEJA 5FUXA 1F48A 1W0JA 2UZIR 1NMZA 2QEQA 3ZQ6A 4DSOA 3QOFA 2Y8EA 1GG2A 1GUAA 1UDWA 3Q5DA 2OCAA 4EFMA 3R9WA 3ASYA 4ACBA 1XEFA 3HR8A 2QE7D 3K9LA 4WIAA 3NDPA 1Z6XA 2BC9A 1E2PA 4D0NA 3B1ZA 3CPHA 4KFSA 2QTVB 1G3IA 2IWRA 1GIAA 3FMPB 3CNLA 4JBWA 4DCUA 4A0RA 3WNDA 2QE7A 4GFDA 4OQLA 4YMUA 3W9YA 2ZRNA 1US8B 3KXKA 2F9MA 4X8MA 4R7ZA 2OILA 2ZYUX 3B8HA 4DSTA 3K70D 3SEAA 2DBYA 1EFRD 4NPHA 1OPXA 3ADCA 4IKEA 2XZLA 1KO8A 2GAOA 4OL0A 4JS0A 1E3MA 1E9CA 1EFRA 3E70C 2XITA 1SXJC 2ZI5A 3THYB 4Q19A 2ZQ5A 2J5XA 4IFEA 3VX4A 4RCZA 5CLLA 3W6NA 4TYYA 3TVTA 3ETLA 4FCWA 5TB5A 1X1SA 1KTVA 1RE0A 1KO5A 4MGIR 2WZQA 3WNBA 4D0GA 5FPSA 4N1AA 1II9A 1NRJB 3AVWA 5JJIA 3K0EA 2ZSAA 2PZEA 4QC2A 5F9HA 2FE4A 2ZE7A 3Q9LA 1EXMA 4HYYA 5FTJA 3WYAA 1YJ5A 4LJ9A 1EESA 1VYUA 1P73A 5FBVB 1AKYA 3SC3A 1ZNXA 5TVKA 2JLUA 4RKFA 2WWGA 1E0SA 1ZM2A 1DAGA 1JNYA 4LPSA 4NHOA 4Y0VA 5FTMA 4E09A 3N5CA 4YMWA 3EIEA 2ZPTX 1P2UA 1U9IC 2J0UA 3B1YA 4RD4A 3ZS8A 3AF0A 2EVWX 4FMDB 4EFLA 4OHZA 1GSIA 3BRWD 4A1FA 3U60B 2OCBA 2NZ8A 1L4UA 1DBSA 2Q3HA 3WP1B 2F1IA 4MDFA 2FEOA 3B2EA 4LV6A 3U61B 3K70B 4XIGS 3UK6A 5HKKD 5JI3E 2VIIA 3QUSA 1CJTC 1KKMA 4AYWA 1M6NA 4GZMA 4GP7A 2IWHA 5IDVA 3X1ZA 4R2IA 4BPBA 3EC1A 1Q1BA 5HKKA 3ADBA 4PQYA 4B3BA 1XPOA 2HXSA 3A1WA 2G83A 4TLEA 1A5TA 5AWFC 1O3YA 1J2JA 4YQFA 2R44A 3QBVA 5TMPA 721PA 1NVVR 4B6EA 4IXMA 2GVZC 2WJHA 4N0EA 4QHSA 3ZD7A 1HE8B 4PX9A 3UMSA 1Z0IA 4PAQA 2ZRFA 2AXPA 1E2QA 4BFWA 2ZRLA 1TQ2A 1X6VA 2PCLA 3W5JA 3I5XA 4KJZA 5JWRA 5EE1A 3FDIA 2J0UB 4FN5A 3LV8A 1M34E 4F4CA 4UNPA 1YZQA 1HT1E 5JWHA 1YU9A 2GJ9A 2OCPA 4L8GA 4V0LA 3DZ8A 3QSYA 3ZQJA 1GM5A 3PUWA 3RRYA 3ZYCA 6Q21A 1T3LA 4UNSA 4ARZB 2VLIA 3DHWC 5FL3A 4LPKA 1HQYE 2F9LA 2OEPA 2VPPA 4U00A 4BFXA 2FA9A 4TLCA 2OFXA 2REXB 1XPRA 3FHTA 5CB6A 5EXPA 1FNNA 1G1MA 2R8RA 4A92A 3BFXA 4NCKA 1MV5A 1VG8A 1G3RA 2P6NA 3EASA 2Z43A 4US2R 3RS2A 4WA7A 3A58B 4OK3A 2WJVA 1T6NA 2AWNA 4BEJA 2PZFA 4C0LA 3HWSA 4AG5A 1BO6A 5K8IA 2SHKA 2EFDB 1E0JA 2IYYA 3K09A 1ZJ6A 2ZXUA 1NVUQ 1R8QA 1NG1A 3VKHA 1LFDB 4UJ5A 5C1BA 3FVQA 3C5CA 2OESA 2OHFA 1KGDA 2W0SA 3HU1A 1G8YA 4FI3C 5JHGB 2ZR9A 1ZUHA 4HB0A 8OHMA 2NO1A 3B1VA 3OIUA 4RSGA 1VIYA 2ZE8A 2B92A 4OI4A 3WP0A 5H1YA 4HAVA 1DADA 4TT3D 1OH7A 3TAUA 3F0TA 2J46A 1SGWA 3CZPA 2BMFA 4QJ5A 4B2PA 3SI7A 4BFVA 1HY3A 4EPVA 3CX7A 4JVSB 5FTNA 3TJZA 4TT3A 3GLHE 4K8OA 4GT1A 4MUAA 3RAPR 3DDCA 1WF3A 3I5YA 4MRSA 4URXR 2BBWA 4DVGA 2VHCA 1E9SA 3DZDA 5G3YA 5SZHB 4XJXA 1XXHE 1Z2AA 4Q21A 4B44A 1XTJA 5CM8B 1CXZA 3VR6A 1E1RD 1ZBDA 2ZS8A 3TVDA 2VP0A 2VSFA 2RHDA 1R4AA 1EFCA 4W9MC 3KQHA 4M9XA 2PJZA 1HA3A 2RGDA 2VHTA 2YWFA 5J4YA 3A37A 1E0KA 3FB4A 2FSIA 1E1RA 3REGA 4A0HA 3SJAA 1S4QA 2EWVA 3EWAA 2OV2A 1N2CE 3ECCA 3LLMA 1G6HA 3U3OA 3JVVA 1XPUA 1W5TA 3MRSA 2RH5A 2GJAA 3IIMA 5BXQC 3SHFA 4NBSA 1VHLA 1W47A 4PR0A 2IXGA 1IN5A 821PA 5HPYB 1W7AA 1UM8A 4AKHA 2KBEA 1N0WA 1DO2A 5FBLB 4GOXA 4ILEA 4BLQA 5F98A 4DLTA 1VG0B 1KSGA 5J4HA 1YQTA 3THWA 5JLJA 2WWWA 3MD0A 1RPZA 2AFHE 3AB3A 1UBEA 1ZU5A 4M1SA 5FPHA 5TY0A 3PEUA 1NN0A 1E4VA 3O8DA 4L9WA 1AQYA 3DO6A 3KKMA 3WBJA 4JVLA 2KSQA 3KB1A 1EG7A 2DB3A 2Z6VA 1QRAA 3H0KA 3W6OA 1AQUA 3VMFA 5KDOA 2ZJYA 1HQCA 2BBTA 1SULA 1II0A 4JIMA 5JSZA 2GZHA 4ZDIA 2AXNA 3N2EA 1DS6A 2N1BA 3A6PC 3DEFA 1R10A 4P33A 2CNWD 2OAP1 4GOJA 2JLRA 4XVQA 4QM6A 1G41A 3P26A 1P7CA 2QPOA 1G7RA 5JECA 2X2FA 3GLGE 2C9YA 4OI2A 3SS8A 3L0PA 4URUR 2I1VB 2VP2A 1KI9A 2CNWA 1ZD1A 4KO8A 3SN6A 4TZ6A 2GA8A 4JYCA 2V54A 1EFHA 1WB9A 4QJ3A 2R6GA 5EUQB 3IDQA 3PUXA 2BKUA 1JB1A 4KFUA 2WJIA 1JR3D 2JA1A 4G5RA 4PTLA 3X1WA 2P0EA 2J87A 3TKLA 4H1UA 2G0NA 2VH5R 4V02A 4DUGD 1UKZA 4TL8A 2VSOA 4JJKA 3THWB 3WNCA 1JR3A 1G21E 1U2RA 2J7KA 1GAJA 4KCGA 3TQFA 4B35A 1RRCA 1LS1A 1NBME 1W4CA 2Q0HA 4BLTA 4EPYA 3MWJA 3OF5A 1DAMA 4DUGA 4XVRA 3CNNA 5CYOA 4MGYR 4B34A 3AP2A 1RIFA 4JLOA 3UWOA 4YLGA 2RKOA 4BZQA 5JSZB 2HV8A 1Z29A 2G1JA 1G20E 4HUTA 3CWQA 3IPYA 1DG3A 2IA5A 3B1WA 3FFAA 1XJQA 1CJKC 2EU8A 1MO3A 3I73A 4B76A 4Z1MD 3TSOA 1G4AE 3MG9A 3AP3A 4MGZR 4OHVA 3PR1A 3LAWA 1EGAA 2A5FA 4A82A 1KMHA 4GBMA 3KFXA 1Z6GA 1NJFA 2BJWA 2W58A 2CHVA 2QUZA 2ODNA 4Z1MA 1Z0DA 2C2HA 4LYJA 2P2LA 1CIPA 5CIQA 4IOMA 1UBFA 4OHXA 4OQNA 3ZVMA 3W90A 2ZIAA 3LX5A 5C2JB 1JQLB 4L16A 2QPAA 2GETA 2RGGA 1E2KA 1N6PA 5CYPA 1RZ3A 3AVOA 4KSCA 4Y0AA 3GJ0A 4LY6A 1G8GA 2O5VA 3V4FA 4DIDA 2H7VA 1Q1QA 5FOTA 5DO9A 2CCJA 4IDOA 5HE8A 1DAKA 2ZVQX 4BQSA 4PQFA 1XZQA 2HJGA 5EE9A 5TV2A 1BH2A 1MRNA 1T3HA 4IVPA 3ADKA 2OFWA 4C2TA 4PPGA 1EX7A 2C9CA 3Q7QA 4C3ZA 4EJSC 2QQ0A 1XTQA 4A15A 4G01B 1VECA 1E98A 4I4LA 3WY9A 3VNVA 4ACAA 2VL7A 4NYJR 3K53A 4ESHA 2VP4A 1PZNA 1QVRA 2X8AA 3A1VA 3LX8A 4JSTA 5A4JA 3L0IB 1VMAA 1S0UA 4MQBA 1KMHB 3SYKA 1IXSB 1UBGA 3PEWA 3PITA 1DAEA 3K9GA 4Q02A 4B6FA 2BCJQ 4P4TA 3X1DA 1BYUA 1OFTA 1W2GA 2FFHA 4HEJA 4RVCA 5E7MA 1NN5A 4HDOB 2V4ZA 5FPYA 4HLCA 4DLSA 2C99A 5LD2C 4E22A 4S35A 4QGAA 1ZP6A 2JJ2D 2Z0MA 3LFUA 1A2BA 4B43A 3HDTA 3IBGA 5HZHA 4KLNA 4PHHA 4DXAA 5BN3A 4MDEA 2JEOA 4LBWA 4CIDA 2G77B 2QTHA 2F55A 1SZPA 2PEYA 2F1JA 4DB4A 2JJ2A 1NKSA 4D4LA 4NYIQ 3SBDA 2IYLD 4LBYA 4XSGA 1TAGA 2A5JA 2QY9A 1JAHA 1KDOA 5E4FA 1NN1A 4J0QA 3BFVA 2CL6X 2HUPA 3FKSD 1ELOA 3GLHA 3LY5A 3WHLA 2W83A 3PVSA 3OZXA 1CJUC 2GNOA 4NCHA 5K8TA 4C7OA 1OHHD 4EPXA 4AI6A 1S96A 5M04A 1FPMA 2V55B 2JAQA 3FKSA 4A8JC 2LWIA 1B23P 2ONKA 1OHHA 1AS3A 4I81A 2IHBA 3QENA 5JFGA 2NO9A 3LD9A 4A2PA 4YDSA 3BAFA 1E9FA 3EAQA 3BC1A 1E2GA 2C98A 3WYGA 2MSDB 4DDTA 4DRZA 4Q7LA 1VYVA 5KSZA 1V43A 3ND8A 1E2DA 2IT1A 3QXJA 1D2NA 2AWOA 1VIAA 3GD7A 5FPTA 1AS0A 3IBYA 221PA 1CR2A 3LO5A 4AURA 4DLVA 2GCOA 2ZI9A 4M53A 3B7GA 4D6PA 1KSHA 1LV7A 1J8YF 3MUFA 4PO8A 3MAAC 3T1OA 4AYTA 1GVNB 4M1TA 4JLPA 1FTSA 2PLRA 4TL7A 2AR7A 1Q12A 4YMVA 2PJRA 1Z06A 4TL9A 4M1KA 2E9SA 4AWXA 3QEOA 3GLHB 4YDHB 1GL7A 1RKBA 2ZRMA 3PCRB 1KO7A 4LC1A 5E7JA 1SKQA 1VG9B 4C30A 2ZROA 1JQJC 2WSMA 4C7OB 4F7WA 1XMJA 3AKCA 2CCGA 3EZ9A 5JJKA 4YMSA 1XCPA 2HCBA 1QG4A 3V9PA 4V0NA 3IPXA 1GILA 2A9KA 1JPJA 1KI3A 1LS6A 1C4OA 1R5NA 1P9RA 3M6AA 2R6CA 3RDPA 3EC2A 3RSOA 1U8ZA 4DCSA 5GADl 2CLDX 1G5TA 2W2TA 1VCMA 4LHWA 4A4DA 1CBUA 2BJVA 4LYFA 4D25A 4JLVA 4DSUA 2GCOB 2EFEB 1IJFA 5J4VA 2X19A 4KHZA 4HZUA 1N0VC 5LPNA 1ZM9A 1SVLA 1QF9A 1XJ0A 3QNUA 3NHAA 4LJYA 3GP8A 2B7CA 3QXSA 5DE3A 1U0LA 3U7EB 3PV0A 2C5LA 3R8FA 2BBSA 4IOKA 5HZKA 1F5NA 2RGNC 4NONA 3CF0A 5DNYB 4RZUA 3NDBB 4BWYA 1PVOA 1IJEA 2GEUA 1QHSA 2XOKD 4PANA 3CF2A 3U7FB 1YZNA 3QKTA 2PLFA 1Z6TA 1J99A 1D2MA 4PO9A 1PLJA 1KSFX 2XOKA 4NKRA 3CF6R 4KBGA 2ORIA 3KZ1E 4YXWD 1PUIA 3GEEA 1FP7A 1G7CA 2ZRCA 3U3MA 1NMXA 2QGZA 4BUJA 5CK4A 4HSEA 4JLNA 4KVAA 1WMSA 3ZDQA 5FUWA 2WWXA 4YXWA 4P4SA 4RD6A 3CRVA 2J0SA 1VCIA 4PAMA 2R6AA 2CMKA 5IRCD 2IHYA 4DLYA 4Q1CA 3T1TA 4QBGB 1LF0A 5FI0B 2IYWA 3SFZA 2WM9B 4DCTA 1UKEA 1Z8FA 3LXXA 4HZUB 1T8UA 2BCGY 3E1SA 3VU9A 4O2RA 1OKKD 3ZIAD 1FZQA 3WHKA 2DFKB 3WRXC 4E03A 4Q4JA 4A9AA 1Z3IX 1XP8A 2CE7A 1S8FA 1OKKA 3ZIAA 1VPLA 2AD5A 1Z2CA 1TX4B 4F4IA 3LLUA 1N3BA 3MFYA 1H8HD 1YZUA 2FG5A 2OFOA 5EE0A 1ZYUA 4DEYA 3BB3A 2F7SA 1N0UA 2D7DA 2DFNA 5EXSA 1HTWA 4C2UA 521PA 2EFCB 1JXMA 1XD9A 3BOSA 1ZAKA 1H8HA 1Z5ZA 3Q5EA 3U3RA 2DFLA 1BS1A 1AJEA 2ANBA 3BS4A 1M74A 3BIFA 4JT2A 3AF3A 4P4SB 1YRAA 2J0VA 3NBYC 2W00A 5LB4A 3BH6A 3PIRA 4BE7B 1N6RA 1P2TA 3IIKA 4MRNA 3NHBA 3TE6A 1OB5A 2OO7A 3ZVLA 2O8FA 2D3WA 3KUCA 2IS4A 2V9PA 1MR3F 1P3JA 3VU9B 5IF9A 1E99A 4UKDA 4DJTA 2ZE5A 1SXJD 1BIFA 4Q4JB 4V0OA 2IYSA 5FOSA 3CUEF 2VTKA 1X8KA 4BFZA 3B9QA 4Q4HA 4BLRA 3RS3A 3OAAD 4TTRA 1SXJA 2QPTA 2ERYA 4B3DA 5JEDA 1P60A 2JLXA 1W4BA 3V00A 1E94E 3LWNA 3AVPA 2DYKA 1TUEA 2ZRKA 1JAIA 2ORVA 5CIWA 3GJ3A 3OAAA 1A1VA 3P4YA 1NY5A 3KQKA 3EX7C 2GK7A 3FWYA 2OG2A 2VEDA 4G0NA 2FN4A 1ZNWA 3IUYA 2QP4A 4TYPA 5BN4A 1N6LA 2XZOA 2NGRA 1JEDA 1YVDA 1G9XA 2IUTA 3OFND 4XOIA 2H16A 1W0KD 2AK3A 1UEIA 1U9IA 2O8FB 2WWYA 3ADDA 2CE2X 2ZR0A 2NQ2C 3OFNA 1QHHA 5C4GB 1KMQA 1IY2A 4DLUA 1W0KA 2A30A 2YNMA 2ZANA 2WWIA 2GJKA 3TRFA 1ZC4A 2QAGC 2D74A 4KI0A 3QKUA 4MRRA 4Q18A 3IEUA 3KDSE 3DL0A 3IO3A 4Q4HB 1JR3E 2HXYA 3SBEA 1U98A 1SXJB 2HT6A 5DSZA 4RKEA 3T34A 3VNUA 2IXEA 4ARZA 1WRBA 3PUVA 3CR8A 3D6TB 4PSVA 3W8NA 3H2YA 2ATVA 1RVDA 4A0GA 5FFMA 5AUNB 3K0CA 3VKWA 3KJGA 4W5HA 1I4DD 3QG1A 4G5GA 5ELXA 4II7A 4JLJA 2G6BA 1E2IA 2OM2A 3KQUA 1X1RA 4Q4AB 5FBWB 4B74A 1UPTA 4FINA 4LWZA 3THOA 3FOZA 1CLUA 2J1LA 4MKFA 5DGXA 1GNQA 3C41J 2P5SA 4MYUA 1XMIA 3SJZA 4URZR 2PEZA 2WIBA 4URVR 3HPQA 4RZ3A 3REFA 3KB2A 1R2QA 3AKEA 1Z0KA 4QGHA 4TTQA 3W5IA 2NMVA 2YVUA 4Q9HA 4OHWA 2GAAA 1ESNA 1KJZA 4U5XA 4CYMA 1QHHB 4I1SA 2ZSFA 5B64A 2V7QD 3RS4A 4CDGA 1WE2A 3T5GA 1W48A 2L0XA 2ZEJA 2VP6A 1FW6A 2BWJA 4LX0A 4ZI2A 4DSNA 1JPNA 1OFIA 4B3FX 3CRMA 4GP6A 1MRSA 1IY1A 1UKYA 2V7QA 3CR7A 4LRWA 2C9OA 2ZI7A 1XFAA 4PXAA 1E2JA 3L43A 5FI1B 4D4MA 2W6JD 2WJYA 3SJCA 3WYFA 3C8UA 2HYIC 2WMOB 1ZIPA 4M1WA 2DWOA 3I8SA 3R9IA 2WOOA 1NLFA 1KO4A 1Q21A 1YRBA 2HYDA 5KDDA 4G5QA 3BFKA 5HCIA 2IF2A 2W6JA 2F43A 1P2VA 3FTQA 5GJWC 1XCGB 2AKYA 4OJQA 3RC3A 1OYYA 4K81B 1TU4A 4GI7A 5C46F 1XZPA 4NYMQ 4IOLA 2AL7A 2YWGA 4BGDA 2QT0A 2OT3B 4D4JA 3FHCB 4OKSA 5EP1A 1K8RA 1KKLA 1PUJA 4IDQA 1XCMA 4ON9A 2IYUA 1N5KA 2ATXA 3A1UA 4POAA 4D26A 1KAOA 4MYTA 4TYWA 1OXUA 3K1JA 1S3SA 3SE0A 3TLXA 2GZAA 2ECKA 5EUMA 4BRUA 3M1IA 5KPDA 4LDJA 4ZKDA 4Q1AA 2EYQA 3QG5A 1VTKA 1W44A 1ZUIA 4G5SA 5BYJA 2QSYA 2PX3A 4QBFA 3UANA 5J4KA 5AJZA 1Z63A 2QORA 2HLDD 3AV0B 3BORA 2CBZA 2ZITA 4Q1BA 2Z5FA 2YHSA 2YZ2A 3AF4A 4IDHA 4JLAA 1G64A 1WQ1R 2PBRA 1XEXA 2D7CA 1GTVA 2OXRA 2XTMA 2D06A 1SVKA 2HLDA 2OSBA 4Q7MB 3B78A 3I32A 4JMPA 1JXOA 2GXAA 1JJ7A 2FPLA 5KOYA 2JATA 1IBRA 1T3SA 2F43B 1XJCA 3RWOA 3VHLB 2Q3FA 4FMCB 4Q03A 5JRZA 2CXXA 3ICQB 2AD1A 2ZJAA 1P6XA 1ZINA 3QJYA 1M7HA 1GDDA 2O0JA 5GJVC 5J40A 3HYTA 2RCNA 1G17A 3BWDD 4PO1A 4WAUA 1ZMXA 1KOFA 4PC3A 1DG1G 1QHIA 1TL7C 3PEYA 1ZIOA 2RGEA 4M21A 1XEWX 2OLKA 4DBLC 1H8ED 1DARA 2Q9AA 3H1TA 1F60A 2G0TA 3K9NA 4C4PA 4W5WA 2K5UA 3WMEA 4DDVA 3O8BA 1DTSA 3Q3JB 5TARA 2ZE6A 1KY3A 2FEMA 3UIEA 1Z6AA 2C04A 1GRNA 3ZGXA 3TW8B 1H8EA 3B6EA 2PT5A 2XNDD 4FIDA 3SYLA 1ZD8A 2ZU6A 4E07A 2F1RA 1COWD 5CJPA 2QMEA 3ASZA 3OESA 1Q3HA 1XEXB 2ZJ5A 1X3SA 3BH0A 2ODEA 3GJXC 4Q7KA 2LKCA 2PT7A 2QGNA 4PZZA 1S9HA 4F4JA 2XNDA 2W6ID 3K8YA 3D3QA 1J8MF 4NYIR 3N2IA 1COWA 2ZYTX 2J7PD 1KI1A 2XXAA 3W6PA 1NVXQ 3EA5A 1P62B 2QMHA 4BECA 4OBEA 3QVUA 3ONWA 1FMLA 4H1VA 2W6IA 2ZS7A 3O8RA 2EWWA 2XGJA 4L4UA 3K9HA 2J7PA 4B32A 4P0TA 4C0SA 3DMNA 1D9ZA 1DAFA 1OT3A 1AGPA 2O8CA 3NXSA 4WZAE 2IEYA 1YZLA 4GZLA 3IQWA 4X8HA 3B5JA 3FPAA 4N3NA 2ODWA 2PMDA 2Z4RA 5HE9A 2N46A 3QE0A 2ZS9A 3RS5A 3KQLA 4MH0R 2ZUBA 4JVMA 1QHXA 4QG7A 2V6IA 2ZREA 5CLQA 1IHUA 1U8AA 1GOTA 2VF8A 3LVRE 2MSEB 3A8TA 1M1YE 3GJ7A 3SR0A 3U3JA 1E2MA 1Q22A 3EXAA 1P9NA 5KYKA 1OXTA 2DWQA 2QG6A 4QGGA 2H18A 2JLYA 4GOKA 4PSKA 5FBQB 3CONA 1G7SA 4NCNA 3JVUA 1NJGA 4HDQB 2A3RA 2KJQA 4KYUA 1Q1ZA 3TK1A 1J70A 2XXAB 2OUKA 1SQ5A 4XH9B 2FF7A 1XTSA 3NH6A 3LQRA 4K46A 4O25A 1M7GA 4BLOA 3C5HA 4GRAA 4M8NE 1U8YA 4OQFA 2JASA 2HDNB 1I4LD 1U90A 4HATA 2O8CB 1NN3A 3SQWA 2YC4C 4WXPA 5TXGA 2H57A 1CTQA 2WKPA 1ZUNB 1X8LA 2WAXA 3AKDA 3V4RA 5CJ2A 1P9WA 4KODA 1ZM3A 4NMMA 4BFTA 5L3QA 3O47A 2ZSEA 3AVTA 5ANRB 1W46A 5J4LA 1LY1A 5KU1A 4WZBE 1Z07A 1DVRA 1R0ZA 3QXCA 4DCNA 1EWRA 4ABYA 4TMWA 2QN6A 2R65A 2IL1A 3HJNA 2ZU0C 4FMDF 5BWMA 2GCPA 1M8PA 3LW7A 3MJHA 3AGPA 4B33A 2A7QA 5SZKB 4M1OA 2A5DA 1BOFA 2QA5A 4EPWA 4MYHA 1TF5A 1SHZA 1VKJA 3BD9A 1EK0A 3K0SA 4TMVA 2QM8A 4M22A 1F3OA 2QZ4A 1TQDA 3HPRA 3TAHA 1Q1EA 1FUUA 4JKIA 1D9XA 5H68A 4AIIA 5LDDC 4LV5B 2RHMA 3R7WA 3QF7A 5DI3A 4XTCS 2XB4A 4BFUA 1W36C 1LW7A 4HLDA 4ZKEA 4B73A 4TQUS 3RANA 1OXXK 3NBZC 2O8BA 1G8PA 1Z08A 3GJ5A 1OXSC 2V8OA 5JEEA 3AVYA 4EJSA 2V3CC 4DLZA 1XWIA 3EPLA 1CJVC 1KI7A 4EQ6A 2GILA 2AX4A 3AP1A 2NO0A 1TF7A 2NO7A 4HUQA 4M2LA 4P4UA 4LJ6A 4PC2A 2H8KA 2ZRJA 3R8CA 5L3QB 3CWZA 3GFTA 2P6RA 2KI5A 2ZJOA 3AUXA 4IVQA 4WOPA 2BV3A 4NH0A 1MO4A 1E2EA 4PC7A 3RRNA 4HDCA 1WP9A 4G5OA 4KAXA 5KNBA 1Q20A 2GJSA 1NVWQ 3H4MA 3P1JA 2VRWA 3RRZA 3VX3A 4KV9A 3UMRA 1L2TA 3PQCA 2IC5A 3QPWA 5FOVA 1YE8A 2CL0X 3TR0A 3D7MA 4B71A 4B2LA 4Q9KA 1ONBA 4LSGA 3GCGA 4LK2A 3AVQA 3RS7A 4JBYA 3QXHA 3ZZTA 2C8VA 2A2ZA 3DVLA 4MKIA 1ZNZA 3R7WB 1XTIA 5DI3B 5GJCA 3D31A 4RD2A 1N5LA 3BB1A 1TUIA 4DDWA 2CL7X 2FFAA 1SXJE 4XWAA 3CX8A 2O8BB 2ZRDA 4I99A 3C4JA 3Q85A 4XD7D 4NP6A 1Z0AA 4M1YA 4FXPA 4RD0A 2BKEA 4QNRA 4EJSB 4QKQA 4C0BA 4HB2A 1AZTA 3HU2A 1TQ6A 1KI4A 3CX6A 4WZ6A 4BLPA 4EQ6B 4XD7A 4H9GA 4HUQB 4A8JA 4JSYA 4A0FA 3ZD6A 1QZXA 5FPKA 1Y63A 1XBTA 1JI0A 2B8WA 2KBFA 2D2FA 2QP3A 4M4SA 3PJRA 2GHIA 5JBQA 4C0QC 5CITA 3RVBA 3U44A 3ZLJA 2BHRA 3CPJB 1KHTA 4NCJA 4PHFA 3AF2A 1G19A 5GVRA 1KDTA 1W4RA 3DKPA 4XTRA 2AN9A 4M0LA 2GCNA 3KUDA 2DFTA 1XB2A 2ZVPX 3AEZA 3NBFA 2UKDA 1XTRA 4EDHA 4HAYA 1W1WA 4BZXA 2PMKA 2ZJ8A 3EZFA 5DI9A 3RABA 2C95A 1S1CA 1GL9B 1KO1A 5IT5A 2UVQA 2CDNA 2VYFA 2ZYWX 4ZI3A 2FPMA 1RYHA 3D8BA 4JLDA 2RGBA 3UWKA 5AUOB 5FR2A 3VR1A 2J0QA 1X8JA 1IM2A 4AKGA 2TMKA 3VQTA 4DDUA 4DLWA 2OZEA 3OEHD 1OLOA 2X2EA 1MH1A 2BEJA 4D81A 2HEIA 2WICA 1HE1C 1G8HA 2J45A 4M9QA 4A8JB 2VO1A 1NP6A 1FFHA 2AFIE 2JDID 2YJTD 1RC8A 2I1QA 1T5LA 3CW2A 4IVRA 3OEHA 1ESMA 2FFQA 5JHHB 3TGPA 2CJWA 1QDEA 3MMPA 4FWIB 3U44B 2FDCA 2B6HA 1FL9A 2JGNA 2WPDD 4PC6A 2JDIA 4B2IA 4X8LA 3SDZA 1AKEA 4TQAA 1OF1A 4LI0A 1QG2A 3B82A 3FMFA 4RFVA 1WBDA 4R71A 1HEIA 2WV9A 2WPDA 3SNHA 5HR5A 3A36A 4N0DA 3IEVA 4LUCA 3SOPA 1D2EA 1ZC3A 2C77A 5E95A 3RRMA 1EWQA 3NEJA 1LTQA 2F3RA 4OYHA 4LHZA 1R5BA 2IUSA 3F3YA 3RS0A 4Q1FA 3J81k 3FHOA 1KI6A 2FSHA 4HLQB 3RYTC 3KL4A 3KTAA 3L0OA 2GEDA 3CNOA 2RGNA 3ICEA 1T0JB 4ZDKA 2IK8A 3GLIA 2OXCA 3I4LA 3FYHA 3W3AA 4B47A 3OIVA 2J9RA 1KJWA 1G7TA 4DZZA 1UAAA 4OQMA 4CF7A 1ZNYA 1VG1A 1WDTA 3KKOA 2Q3MA 4YMTA 4QOSA 5EXXA 1N6KA 2EYUA 1TEVA 1IQPA 2A5GA 3BGWA 3C16C 3EWSA 2Z83A 2CJWB 4JYBA 2ZRIA 3NWJA 1G18A 2BMEA 4OQXA 5KNDA 1CRPA 1X86B 3QVVA 4TZ0A 3MJRA 3ZVRA 5DN6D 3JZAA 5L3VA 1K5GA 3IGFA 1AZSC 2D2EA 2NTYC 4V0KA 3PXGA 3B1XA 1CP2A 1U0JA 1VCNA 4IEEA 3TNFA 3LBNA 2JJ1D 5DN6A 1W5SA 3T06B 4MKHA 4S2EA 3KKPA 4CEHA 4JLBA 2QM7A 3DM9B 4GL2A 1JECA 1AGRA 1CJMA 1N6IA 2RGAA 3NC0C 2GWHA 4Q01A 1UF9A 4GNKA 3VFDA 3AVUA 1A2KC 2JJ1A 5D3QA 5AJXA 2GBLC 2ODBA 1KI6B 3OIWA 4NDZA 4NL4H 3SU8A 2IYXA 4QHTA 4YONB 2A78A 1H65A 3KTAB 5AUQA 4HAZA 3GLIB 3TW4A 3UG6A 4QM7A 5G3ZA 4JL8A 4HLUA 5DHAA 3R20A 3QKSA 3I62A 1NLYA 2XNSA 1KJYA 3ZZ0A 2DCUA 4JL6A 4CT4B 3UXMA 1ZW6A 5L3SA 3MWKA 2EW1A 4OHYA 4FD2A 4NYMR 4C0KA 4IEIA 2HCJB 2WKQA 4NTZA 3UATA 3I8XA 1GRRA 1E96A 1M7BA 2ONJA 3AH8A 4CW7A 3P20A 1KZGB 2BM0A 2HF9A 5EP3A 3IHWA 1E9AA 4IDNA 3O8CA 4HB3A 5SZJA 2CLCX 1XD8A 1E32A 1GZSA 1YKSA 4HAWA 4AD8A 3VKGA 1CS4C 4CEHB 1UKVY 1KNXA 3QXXA 2MMGA 5CDFA 4B3GA 4LJAA 1RW4A 5DISB 1IN8A 4TYNA 1S3GA 1PLKA 1XMSA 3A1SA 2PX0A 3DPUA 1WXQA 3NH9A 3CZQA 3EG5A 2IYVA 2VA8A 4P31A 1UBCA 4D2IA 3LBHA 1AS2A 1XU4A 1E79D 4DCVA 1CF4A 1GWNA 4CRWB 5BQ5A 1NSTA 2FGKA 4RD1A 3TUIC 3QKSB 1KDRA 4UXHA 4U7DA 5DLQC 1U94A 3MWYW 1SKYB 2YINC 1E79A 5L3SB 4M9ZA 3MSXA 4D82A 4L5BA 3CRRA 4LGMA 4EAQA 4CZ2A 2N42A 3TBKA 4B3XA 5FTKA 4WVFA 3IILA 2GXUA 2KE5A 4RCYA 2GJ8A 4Z54A 1AK2A 5KTYA 3QF4A 3IQXA 1Q0UA 2XSZD 5A5GA 4QFMA 1KYIA 2GXQA 4UXJA 4Q9LA 4ZDWA 4BLSA 3ZVNA 1GKIA 4P3YA 1JALA 4QGFA 5G41A 4LHVA 4ZCLA 2GVDC 4Q4AA 2VHUA 3IKJA 3NKVA 5J5CA 5BN5A 2X77A 3FE2A 4ERNA 1YR8A 3MGCA 2XSZA 1XRJA 3HYRA 5FTLA 4C9BA 1CU1A 5CM9C 4B48A 4KITB 2W2VA 2H92A 1T4GA 1JJVA 1OV4A 2ZR7A 2CHQA 3GFOA 1KK1A 5KPJA 3TR5A 5KO2A 2QAGA 1OIXA 3L82B 5AJYA 2FSGA 5E7IA 5JCZA 5EE3A 1E2NA 5B2ZA 2ANCA 3JZMA 1ZRHA 1S1MA 4LHYA 4F92B 1NI3A 1ZU4A 3LA6A 2JLSA 1SVIA 3K70C 2QROA 2QTFA 5EZ6B 3A1TA 4PSAA 1AIPA 1Z28A 4HI0E 2XX3A 2B21A 2YV5A 3CO5A 4Q9JA 5FL7D 5JCPA 3H84A 4HAXA 3E5HA 2BOVA 3AF1A 1M2OB 4DC9A 4L15A 3FKQA 5DHFA 3SZRA 4CEIA 1VDZA 1ZD9A 2RB4A 2NPIA 3FMOB 1YHNA 2WWFA 4TQ9A 5FL7A 3LH5A 3QF4B 2WTUA 2GESA 3S1AA 3AQ4A 4AKEA 1I2DA 2VQSA 4LV8B 3PUYA 1YR9A 3I61A 2QU8A 4DB2A 4ZDJA 1RRPA 1YZGA 2QMOA 4KFTA 1U99A 1N5IA 3KKQA 1A82A 1HH4A 2C78A 2FPKA 1AN0A 4CT5A 4LJ8A 5C18A 3GLFA 2WBLC 3PEVA 4AY2A 1KK0A 1ZVQA 4KVGA 3GJ6A 4Q48A 4ZPXA 2Q9BA 1MABA 1VCOA 4DEXA 4TL6A 4B3CA 1EFUA 3U7GA 4DT1A 2WMNB 4QXAA 4BZPA 4D80A 2QAGB 3B60A 4LYHA 3FFBA 3QY0A 1N6NA 1KSJA 5FR1A 2O0KA 1PJRA 2D4HA 2OCYC 3T5DA 3ZS9A 5C4MA 4KXFB 2PZGA 1GFIA 1P61B 4JKYA 3VR2A 4TMXA 4NE2A 4UNNA 3K0CC 4C0JA 4M9SA 5FH9A 4PZYA 3CB4A 1EX6A 1KK2A 1U81A 2XJ9A 2G1KA 2ZRAA 3EPHA 4G3XA 4D4KA 1T8TA 4CEIB 3UPUA 1UDXA 5FOUA 3KJEA 2GTPA 3S1AB 1RYFA 2C96A 421PA 2ZJBA 5CK5A 1KAGA 3F5FA 3U6KA 2HJVA 4RZXA 1YR7A 5DIFA 3TSWA 3KKNA 5B57C 3UKDA 1G6OA 3PG5A 4TLBA 1RFLA 4JL5A 3U2QA 4PZLA 4PPFA 3GLFB 1OH6A 3M0EA 3QBTA 5EP4A 2DR3A 3TUZC 2R62A 1MABB 4TLDA 1TNDA 2KB0A 3UG7A 1LB1B 1G16A 2J59A 4V0MA 2O8EA 1IOZA 4DT1B 1Z0JA 4AG6A 1GKYA 1S9DA 2WKRA 3RLFA 3CRW1 2R9VA 1ODFA 1IXRC 1YZKA 3WMFA 4D0LB 4O3MA 1Z0FA 4LBZA 2XEXA 4E5UA 1KK3A 1E9BA 4EFNA 2Z4SA 4LCBA 1NY6A 4FCVA 3F8TA 4MKGA 1NF3A 3NIBA 1JR6A 3E2IA 3I1FA 2GK6A 3QI2A 1DO0A 1CEEA 4Q66C 4R9UC 2XJ4A 1LVGA 4Q1DA 1KDPA 1KY2A 1P75A 2GEVA 1CRQA 4CVNA 2IUUA 3DOFA 3QQ5A 5FOWA 1OIVA 2I4IA 3WXMA 1DE0A 3C7KA 4L9SA 4LC0A 3OIYA 1E9RA 3QPUA 2JIZD 1QBKC 5LB2A 1Z6YA 2I3BA 1G291 4KYIB 2O0HA 2ERXA 2QRZA 1OFHA 2IS1A 1FQJA 1SHKA 2ZUCA 4QNMA 3K09C 4R2HA 5JMTA 5AUPB 2GZDA 1GRQA 1QHNA 5KHOC 2JIZA 3KX2A 4EPRA 2ZRGA 3X1XA 4QRHA 1NIPA 1RJ9A 2EFHB 4RFSA 4F91B 2WSSD 4DLXA 2F1HA 1GNPA 2J41A 1E6CA 2ZUDA 3B13B 5JS8A 4F38A 2O8EB 1G3QA 2P3SA 1LF5A 2CEAA 2VHQA 2WSSA 3A4NA 4TWZA 1XD2A 2BDTA 1N6OA 1N5JA 3TMKA 5GVSA 5AR1A 3Q72A 3KQNA 2AHOA 1HURA 5A0FA 1AM4D 1B0UA 3DMDA 1BYIA 4Q9IA 1G3MA 4O2LA 4DHEA 4URYR 2PH1A 5HTKA 1TU3A 2IYZA 1DOAA 2H5EA 2QNRA 4ZV4A 5EJEA 1ZCBA 1J7KA 3OHMA 3RHFA 3M4YA 1KI2A 2QRNA 3X1YA 3TH5A 5G40A 2V1UA 5F9FA 4MGKR 2QI9C 4FWTA 2OBNA 1W49A 3AVXA 2O52A 5KDLA 1OFUX 1QHGA 2AK2A 4US1R 3T61A 2DHRA 3K0AA 2YOFA 2OAQ1 5F2EA 1OE0A 5KSPA 3U3KA 1RJ9B 1K5DA 5FBRB 4RFSB 1ETUA 1L8QA 1TPZA 3FGNA 5B58C 3LBIA 4KFRA 1IY0A 2BEKA 2NOAA 2R6DA 3BH7A 3ND9A 5EXTA 1P72A 5UKDA 3BJIC 2WWHA 3NC1C 5JI2E 4WW0A 3GEHA 4JBXA 3BK7A 121PA 1E2LA 2ASEA 2XTNA 3C14C 4TYQA 5D3MA 1XD2B 3IIJA 4U02A 4AYXA 621PA 3L8ZA 1T0HB 2ZI4A 2CVHA 2P65A 4FMBB 1G4UR 1NIJA 2YC2C 4IXNA 4MITA 2WJJA 2E87A 3WBKA 1T9HA 3ZZUA 1OB2A 3SQXA 2GRJA 5K8LA 2QBYA 1U0HC 1A7JA 3ZH9B 1GNRA 5K8UA 2G3YA 2R2AA 2C03A 2FZLA 3EZ6A 4ITRC 3GLIE 4XVUA 2QQEA 4XSHA 2ZRPA 3TUJC 2ZTSA 3IHLA 2ZI6A 1ZM7A 4PHTA 1CR4A 1OYWA 2H17A 2WJGA 4ZIRA 3B85A 1CULC 2V1XA 4TSFD 4DKXA 3MWLA 4NZYA 4BRWA 2CHGA 2ZM5A 2OBMA 4HZIA 2P67A 1I4TD 3K0AB 2HT1A 3G5UA 3A4LA 4V03A 4PHGA 4BASA 3EIHA 2Q21A 4TSFA 1NVVQ 5EE5B 1CR1A 4AK9A 4Z51A 4ASUD 2JLWA 3AGQA 4W7SA 1ZM4A 1V5WA 4I1OA 2JLQA 2GF0A 2VHJA 3I92A 5KSYA 1YZTA 1I2MA 5D3MB 4ASUA 1IN6A 3AUYA 1R7RA 2QP9X 4OJKA 1D5CA 2YKGA 4XWOA 2GF9A 3WMGA 2QT1A 1XEWY 1XTKA 1E9EA 1W36D 3BB4A 2QBYB 4US0R 2R6FA 1OSNA 1HT2E 5H8WA 1VHTA 3MCAA 3W8RA 1F6BA 1HYQA 4QBHA 1L4YA 4Z8XA 3GMTA 5SZIA 1XNJA 1NG9A 4PPNA 2CCKA 4M1MA 2G9NA 1P5ZB 3TQCA 4ZIRB 2FZ4A 3DKVA 1SKYE 1WA5A 3BE4A 5DYGA 3G0HA 4GDFA 1DAIA 1R0WA 3THXA 1II8A 3RNLA 2FU5C 1JBKA 4F93B 2LCFA 1R0YA 3EA0A 5FOXA 4QHYA 2W2XA 2FH5B 3GJ8A 1C9KA 4A6PA 2NPFA 1N25A 4G1UC 2P5TB 3B9PA 3NG1A 4I1UA 4IHQA 1BMFD 1NSFA 1DAHA 1P2SA 1R6BX 1XMVA 2AKAB 4P32A 4PAOA 2BIFA 2XTZA 4OK5A 1C1YA 4JLKA 2DY1A 4DLRA 4AC9A 1UFQA 3U5ZB 4C0HA 5EP2A 4EUNA 1E0AA 1BMFA 5CDFE 3GPLA 2A5YB 5H70A 4O0MA 2FX3A 3U7HB 4R98A 1E4YA 1XF9A 4IOJA 5J47A 3VR4A 4DWJA 2XAUA 4LYAA 2OBLA 4YC7A 3L8YA 2JJ8A 3EARA 3EZ7A 2QAJA 3U4QA 1OIWA 4OI0A 3R9XA 5FUVA 2ORWA 4EKDA 4ZO4A 5GJBA 1R5OA 2WOJA 2REOA 1W36B 2E1RA 3GFPA 2OE2A 2NIPA 2XZPA 5LBIA 2Q9CA 5KNCA 2VBCA 2ZETA 3RSLA 2PCJA 4OK6A 1N6HA 4LJ7A 4KLZA 4A6XA 1OW3B 2BMJA 1E2HA 2WVJA 1GITA 1MO5A 1II8B 1QVAA 2FMXA 2UZ3A 2FFBA 3LQQA 4Q47A 4EPTA 3THXB 1IONA 2X1VA 2RAPA 3DM5A 1G5RA 3DOEA 4MA4A 1G3UA 2FSFA 3NTUA 4LBVA 2ZJ2A 3RC8A 3UMFA 1G8FA 4ZCMA 3T12A 4BEBA 3LVQE 1T5IA 4GPTA 3CIOA 3KJHA 4MYCA 2VP9A 1MKYA 2IEZA 4DIEA 5JWOA 1FQKA 3P4XA 3WRYC 4RD3A 4GSYA 1WBBA 1TMKA 5BYKA 1XX6A 4FCTA 1FP6A 1DEKA 1OH5A 3LW8A 1Z83A 3OEED 3VHXA 3VR3A 5JZVA 1D6JA 1G5PA 3ZJYA 5JRJA 1FNMA 2RMKA 3IO5A 4C0AC 2GKSA 4TLAA 2HF8A 3CM0A 3CKLA 3U4QB 1R0XA 3C15C 1FX0A 2ZRHA 1VYTA 2BMDA 2REBA 1BKDR 1GL6A 3OEEA 5LD2B 3I72A 3U6BA 2FWRA 5AJWA 3NBXX 5DYIA 4CGZA 2MMCA 3P27A 2IX3A 4XWKA 2G88A 3KXIA 2IYTA 4FMCF 3CRQA 2P6UA 4RZ2A 1D8TA 2IYQA 2O8DA 3TSZA 1F2TA 2RGXA 5CB8A 2JLVA 3SHWA 2NG1A 2VF7A 1KNQA 1O87A 1NLZA 4RJLA 1HV8A 1AA9A 1XXHA 3KFVA 4MRPA 2IS6A 1R8SA 4PPQA 1NL3A 1A4RA 1W4AA 2F6RA 3L2OB 4KBFA 2B7BA 2IW3A 3BBPA 3BXZA 5TDHA 2FJUA 3Q7PA 2B8TA 2NO6A 4I1VA 2CLSA 2VP5A 4B75A 2YWEA 3GLFE 1IXZA 4KU4A 3G82C 3GQBA 4OI1A 2QL6A 2FV8A 1SVSA 2IS2A 2ZYVX 2IF0A 1DELA 1Q44A 1SVOA 3FMIA 4GMDA 2ZAMA 4Q1EA 3NVAA 2CVFA 1HUQA 3BERA 3CH4B 1NNEA 2GXSA 3MLEA 3QKRA 4IJMA 1KIMA 1PLLA 3RWMB 2NZJA 1FX0B 2WIAA 1QHYA 2JLZA 1E9DA 3GEIA 3X2SA 3T35A 2VSXA 2MSCB 1F2UA 3EZ2A 4UNRA 4IRUB 3A4MA 5FUYA 3VR5A 1LNZA 1CKEA 1YR6A 1Z22A 4HB4A 3LDAA 5P21A 3TIFA 2EQBA 5B30A 3EPJA 3CBQA 1RRFA 4A36A 3OE7D 5AJVB 1FMJA 3AKYA 3H86A 5DH9A 3PUZA 3QPVA 4LZZA 1MOZA 2FNAA 2O8DB 1ANKA 1F2TB 4W5JA 2ZRBA 4TMTA 4A2QA 3K0FA 5BW8A 3T1QA 1XXHB 2F3TA 2H1LA 3OE7A 4Q4LA 4FW9A 3SFVA 2ZJZA 1K6MA 3HU3A 4IFBA 4BFYA 4WXRA 1TADA 5KSOA 4AKIA 4JZKA 2WHXA 2BM1A 1Q3TA 1IN4A 4JLMA 5AK0A 4A2WA 1TTTA 4GMXA 3QIAA 3SJBA 1GKUB 4HAUA 4IW3B 4QJ4A 1TEXA 5IK2D 4V0ME 3Q8XB 1S2MA 3QKRB 5JS7A 4TMKA 3GLGA 3LNCA 4ZCIA 3T1VA 3N70A 2ZI3A 3KXLA 3W3ZB 1ZCAA 4BFSA 1DPFA 2ZSBA 3LXRA 1KI8A 5IK2A 4URWR 1IAQA 2D62A 2IXFA 3CH5A 4QBIA 1F2UB 5JJLA 2GBLA 3GJ4A 5F3WB 1CR0A 4JT4A 3EPKA 2DPXA 2IYRA 2BVNA 5EQTA 2GDJA 5HCNA 4Q7JB 1OH8A 4Z8YA 4WBSA 1NBMD 2W0MA 2BBOA 4JJZA 4LJ4A 4LJ5A 4CEJA 2YOGA 2RGCA 4Q5IA 3W34A 5KUTA 2QENA 1SVWA 4TTPA 1L7VC 1OXVA 3PFIA 3P32A 1FUKA 3EIQA 5E3HA 2WAYA 2ZSDA 3K0FB 4MRVA 5L8VA 4KSBA 2QMUA 2IBMA 4ESVA 1NBMA 3EW9A 3L0SA 4PC1A 1MO6A 1E1QD 4RY2A 1RRGA 4UQOA 1FTNA 1NKTA 2LKDA 3VTKA 3NEYA 1SVMA 4UJ3A 4NU0A 1TF2A 3T15A 1OJLA 1UADA 3I3SR 1E1QA
chains in the Genus database with same CATH superfamily
3BGIA 4RJ2A 1UWLA 1EFTA 1WPXA 1YV9A 2OZKA 2IV3A 3T0FA 1Q57A 3QFSA 1GP2A 2Z5LA 2Q6TA 4LOHA 1KMCA 3CPEA 3DOOA 1KQGA 1WP4A 1J90A 1KP9A 1T15A 5K01A 4NJEB 2YXDA 1RHMA 1UJ2A 2KWIA 1IK6A 3KEFA 1Z8NA 2FCRA 4NCIA 4PBSA 3TN7A 4AJLA 1US8A 2X23A 1QS0A 3CZ4A 4GXRA 2AI3A 2BKVA 3IJPA 5EIFA 2PUHA 1GGEA 4GMFA 1BMTA 2PLWA 2ZSIA 3RADC 2YYZA 1VLVA 3KYJB 3D0KA 4RA6B 4FZJA 5EFZA 2EFGA 4IWNA 3E9CA 1K75A 2R8XA 1RXUA 4DLBA 4CEJB 13PKA 2C4TA 1E2FA 4HWPA 1E69A 2KX7A 3VAAA 1G21B 4HX5A 4F2GA 5JSFA 4F8YA 1FLDA 3CISA 3QU2A 3QVLA 2FSVC 4RJTA 2XYQA 3AEYA 5E6RB 2LNDA 3TL2A 3DEYX 3TNDA 2YWHA 4RHTA 3LRPA 2P5UA 4EMSA 2I7CA 2O2EA 1NMZA 2CVZA 2QEQA 1I7QB 4M9CA 2IHNA 3LK6A 1CRZA 2D6FA 4JI5B 2QX9A 2Y8EA 4D8UA 4CTOA 4PZDA 2Q6VA 1X39A 1BXKA 4UM8B 2YIVX 3HB5X 4YT8A 3CEPB 2OCAA 1YS1X 2DM6A 5HF8A 3ASYA 2X13A 1MGOA 1L4KA 1Y3FE 2A4MA 2BC9A 1YZ3A 5EJGA 3V4LA 4IV5A 5IKEA 3N75A 1GIAA 2J30A 3LLCA 4QYMA 5CG2A 4I50F 3CNLA 4LZPA 2J3IA 4OMDA 5THXA 1Q7CA 1K92A 2QE7A 4G4SO 4YMUA 3C98A 4B7UA 1US8B 3VSCA 1QS0B 1CFZA 3N28A 1K98A 2AUNA 3BQMB 4II3A 5T3YA 2QN1A 3RVJA 1HE4A 5J43A 1K6IA 2C0QA 3CVUA 1TB4A 2F3QA 4NPHA 4B7ZA 2CBXA 5CTAA 1UZMA 1OPXA 4CIYA 2XUHA 4IKEA 2I4TA 4R84A 3WLTA 1KO8A 3EYWA 4OQEA 4D97A 1VZ2A 3NAGA 1WZ2A 2FEXA 1Z62A 3KSAC 3KWLA 2WKWA 6AT1A 1TOAA 1SIBE 3X1KA 2NACA 1QBGA 1B7GO 2OP1A 3CCBA 4HFJA 5A6VA 1BDHA 1AGXA 5HIJA 3DB2A 4BNYA 3GEPA 3PUKA 3U49A 1GZ4A 5CLLA 3K72B 4PYQA 5CYPA 4QOIA 3G2HA 4I5DA 3VVCA 4FCWA 3UJNA 3E5NA 1G2IA 1IWOA 2P9BA 3IE0A 1Z7WA 2HGSA 4OMCA 2ZWPA 3QLVA 3WBBA 5FPSA 4AULA 4N1AA 4I4TF 3VPFA 3WVNA 1NVGA 3K0EA 4MI6A 4R2MA 1QV9A 2PZEA 4N76A 2X5NA 4OVKA 1EXMA 3L5KA 3BL6A 3HXLA 4L76A 4LJ9A 5LXTF 1P73A 3MGKA 1J49A 3SC3A 2HLPA 4XJTA 2JLUA 3ZJ4A 2PH3A 3OOHA 2H9IA 1GGNA 2D5IA 3SJUA 2WWGA 2EZTA 4IG4A 2Y9PB 1E0SA 5JCJA 1LDBA 1EA5A 3A6LA 2YXPX 2H0RA 3FMGA 3EIEA 2ZPTX 1X77A 2J0UA 4WDQA 2FR8A 4TRNA 1GCOA 1P0QA 3C87A 3U60B 4ZAYA 2CZGA 2QVBA 2RJNA 4BJ6A 4AMZA 4X1OA 4ANFA 1ZR2A 2Z3WA 3ASUA 4MDFA 4P58A 1FSFA 4X65B 1VBNA 3NYQA 1F8UA 1JB9A 4HMPA 4LV6A 3LSYA 3U61B 2XLBA 3UK6A 3UK0A 5T3UA 4EW2A 1PJCA 1JEYA 3CUUA 3IA7A 4U7GA 1SBYA 2YJ6A 1EINA 4JZYA 4OB7A 4UMDA 4RSMA 4KO4S 3IDFA 2OZPA 4ZYYA 4EG6A 3EC1A 1Q1BA 5HS6A 4DADA 1XPOA 1OI3A 3WGKA 3RCBA 3L6BA 5DX0A 4E21A 2I65A 4EI2A 5C1OA 3A3KA 4CI0B 1O3YA 2M6SA 3KR1A 4E5VA 1NDHA 2X6RA 4PM4A 1JYFA 3UCFA 3OE5A 1J00A 2ZTMA 4N3AA 2Q7OE 5BNZA 5HUJA 2ZBPA 3H5NA 2AB0A 2GVZC 4O1MA 5CG1A 1SH7A 1SU7A 4PX9A 2M6RA 1Z0IA 1T3ZA 3D8SA 4F5DA 5E2IA 5JPCA 4PCUA 1PR2A 3AHJA 4PLFA 3DT8A 2AXPA 2C7QA 1LPAB 3BD6A 1X6VA 3QVGA 4UTZA 5FEUA 3I05A 5EE1A 4ZVQA 3FDIA 3K6SA 2J0UB 1M34E 1R5JA 2E1PA 3A9WA 3NW9A 4HWSA 4UNPA 5JAMA 2OCPA 4LNUA 1MENA 1KJ9A 3QSYA 4YPVA 3PUWA 1OBOA 1OTXA 4DQLA 1NXPA 2RHRA 1IMJA 5JYCA 4NZNA 5EQFA 3ZYCA 1T3LA 1VSQA 3NHWA 4HTAA 1FDRA 4ZI7A 4LPKA 5JCOA 2F9LA 2YS7A 2VPPA 2WIKA 2HKIA 2FA9A 4F6LA 4F8EA 4NOMA 3NNSA 4TLCA 4S1WA 1JEYB 1N1DA 2Q2VA 3AV3A 5DTJA 1AF4A 3WLLA 4CKEA 1B73A 4QGBA 2R8RA 5ICFA 1ZIYA 3N6VA 1V2GA 3BTVA 3KVVA 2P69A 3GH3A 1MV5A 2H29A 1G3RA 4BJ5A 1QQBA 4NMLA 1EA7A 4G2TA 1NW8A 5ALTA 1SG0A 4WA7A 2PX4A 4R5HA 2WJVA 1R12A 3LC2O 1IHYA 1BEUB 1U65A 2AWNA 1AX9A 3T7SA 2P75A 1C3EA 4C0LA 2YBEA 3O38A 4AG5A 5K8IA 1T9KA 1XDUA 2OGUA 1CRWG 4J0GA 3AWIA 3M6WA 3ZY5A 5AVXA 2G71A 2YN2A 3CV3A 5FB3A 4H27A 3VJLA 1NVUQ 2A94A 4L07A 4WGGA 3H0EA 2WILA 1HGXA 3V3TA 5DBHX 4KQ6A 2AS0A 3C5CA 3ET5A 2OESA 2OHFA 3ETDA 4BU1A 4FI3C 2JIPA 1PEDA 4UARA 3QMPA 5CDSA 5K6AA 3QVGB 2NO1A 1DIGA 4UOZA 4RSGA 2IZZA 3OIUA 5LNK1 3K6SB 4B45A 1GCUA 3PJEA 2B92A 2P4HX 3OMWA 4G0ZA 4OOFA 4PZ0A 4LNUB 5IVPA 3T3OA 1DPGA 4TT3D 1U2ZA 3ZBTA 4BATA 3F0TA 1V16A 1NOKA 1SGWA 2BMFA 1Y6RA 4QJ5A 1NVBA 4WJKB 4AO7A 3WLOA 4B2PA 4BFVA 1XQVA 4ZI7B 3DOUA 4EPVA 4C7MA 2BFPA 3AR3A 1Z6QA 3NWEA 3W5DA 3NRBA 1NMQA 3GLHE 4GIBA 4CKEB 3ER9A 2BDUA 2MSLA 2KHZA 1X7GA 1Y6ZA 3KEOA 5C3MA 1LVHA 3QGMA 3DDCA 4N3CA 4DIMA 4A6DA 5JC1A 2QDKA 1CW2B 1XZNA 4DVGA 5H80A 1L5SA 3N2LA 1ZN9A 2IPAB 3UKOA 3EDRA 3H5LA 3QX9A 1CF9A 3ZLBA 1MUUA 4MQ5A 2WF9A 2ZSJA 1X15A 1Z2AA 3DTTA 1C0PA 3LP5A 3FMVA 5JQWA 3HJGA 4B44A 1TDJA 3VR6A 1ISHA 1R9JA 4DLAA 1E1RD 1MU0A 1WZEA 3PNBA 3QE3A 4QBTA 4N39A 1AXEA 2RHDA 3RC9A 4W9MC 3KQHA 1E2BA 4M9XA 3AHFA 1T6YA 2YHIA 2VHTA 1OI2A 2OKCA 2IUYA 2GN9A 2VRNA 2WTBA 4GBED 3WGUA 1RYMA 2C57A 5J4YA 1ND5A 1DSSG 3GHHA 1XQXA 1D1TA 2FZKA 4Q05A 1G2PA 3SJAA 1S4QA 2EWVA 2OV2A 2X1HA 2AE2A 2VT2A 3PNKA 4NSNA 3T41A 1CUCA 1EWVA 1V16B 3LLMA 3JVVA 1XPUA 2R6R1 1PSWA 1ULUA 2IOFK 4ISCA 3FCSB 2I62A 3QA3E 4H7HA 4HBZA 5F52A 3VAZA 5L6MB 1AQNA 2XRZA 3JQFA 3IIMA 2HA2A 4E5NA 3IPAA 2O1XA 1W47A 1LI5A 3CZAA 1Y8ZA 2IXGA 5HK9A 1RAHA 2ZDQA 1W7AA 1UM8A 3T9EA 3D02A 3VZCA 3CINA 1DO2A 4NBLA 1HQKA 5LDGA 5F98A 4UFOA 4DLTA 1BFUA 4IYJA 2GFQA 1KSGA 2DPGA 3UJDA 3BRSA 4GZ3A 2FZ5A 2WWWA 5JDIC 3AB3A 5FPHA 4GUDA 4EO7A 5F73A 4RZIA 1VXRA 3PIDA 4QRDA 4BBZA 4CF6A 1GTG1 1E4VA 3EGIA 2NU7A 3O8DA 2PXAA 4L9WA 4TYMA 1F0PA 1M8KA 2J8ZA 4V1CA 2GSWA 4Q7EA 3KB1A 2VBGA 3NCHA 1HKHA 3GPCA 2F8MA 6ABPA 1I4WA 4LF6B 3BQNB 3VMFA 4AN0A 4OH7A 4HC4A 5CVCA 1PFVA 3BDAA 4JI8B 5JSZA 4TZKA 2YHIB 4D56A 1QFJA 2CNLA 4H7JA 5FWYB 3N2EA 1DS6A 2N1BA 2XUGA 3PNVA 5F7JA 1DUSA 3VSBA 4NATA 4NXNB 1R10A 1X80A 4YRJA 4A6EA 2OAP1 4OSPA 5T4HA 4E14A 2DT8A 4XVQA 3U7JA 4QM6A 1ZGBA 3MJVA 3IXMA 1Z39A 3U13A 1M75A 2CHEA 2UZ1A 3Q9NA 3M89A 4KN6A 3SS8A 4URUR 5DNUA 1CQXA 1TZKA 1M6HA 2I1VB 2LTAA 2Y76A 2YQ4A 4FUQA 4W9NA 3LUBA 4LXYA 1ZD1A 4TXNA 3SN6A 3I2YX 5THKA 3TTXA 2XMCA 4PAGA 1FYFA 3QX3A 2C00A 3G2KA 2B5WA 3IDQA 3PUXA 2BKUA 5I51A 3UB3A 4W5NA 4G5RA 3H2IA 4I1IA 3RF7A 4U0JA 3S5JA 4GW3A 5JIBA 2VH5R 2C5SA 1S4MA 2H4HA 3TDMA 1UKZA 4JELA 1H69A 1W93A 4QJIA 2VSOA 3MT0A 3IT1A 1YO6A 1U2RA 4MCJA 1GAJA 4KCGA 1TLFA 3CNBA 3JWGA 1DC8A 4RYLA 2R6ZA 4ZCPA 1NBME 3RIEA 4ZHSA 1I7LA 1Z5OA 1YF3A 2NU7B 3OF5A 3A3OA 1F1BA 1FTGA 4XVRA 3C8DA 3CNNA 1NYLA 4DREA 4V1CB 1ISJA 1K3TA 1L7RA 2QX6A 1WCXA 1RIFA 2JFYA 2Y0BA 4QO7A 4MJ3A 3UWOA 4UREA 4BFCA 4YLGA 2CYCA 1CNFA 1ORHA 4UQPA 2JAOA 5JSZB 4UZSA 2BM9A 2I6GA 3ZV4A 1FFAA 1Y3IA 2B4YA 2G1JA 2YZNA 3VOAA 5ADWA 3BFPA 4CN9A 5HNKA 1V37A 3S1LA 1N9GA 3FFAA 3R44A 1IN1A 1IYZA 5DEOA 1NMSA 1AKQA 1X80B 2HUNA 1CJKC 1TM3E 3I73A 3OG9A 4B76A 4F2PA 4OHVA 1OVMA 1D2HA 1AV6A 2UZ1B 4D5EA 4GBMA 3KFXA 2BJWA 4DQXA 4YN3A 2CHVA 2QUZA 3TLJA 4BO0A 4MDYA 1NHWA 2VRBA 4LYJA 4WEOA 2P2LA 1U2PA 2Q46A 4QO8A 4TWJA 4KVFA 3ZVMA 3V2UA 3G0OA 3BWCA 4LE1A 1XHLA 1W88A 1I3CA 4L16A 3ITKA 2QNIA 3BEOA 4ZOEA 4PLVA 3FGOA 1YI8A 3HGTA 1FFCA 2W4IA 1ONOA 2Z9DA 1MIHA 4PRKA 4EG5A 3VU1A 3GJ0A 2O5VA 1PNTA 2D5LA 1RPNA 5FOTA 4OJTA 4IDOA 4JCOA 5FUMA 1DAKA 2ZVQX 4PQFA 1XZQA 2HJGA 1MRNA 1T3HA 3H3JA 1ESDA 2ZYSA 4LWPA 4C29A 3BZUA 1EX7A 3MAJA 3Q7QA 1NFRA 3U40A 2P2SA 5FX2A 4YASA 3MQ4A 4K0RA 1ZY2A 2AOUA 1Z5GA 2D2VA 1F7VA 2MR6A 4JA0A 3TMAA 1E98A 3BRCA 3LT1A 2I2XB 4ZK2A 4NXMB 1N9GB 1JVNA 3NBKA 1Z5WA 4NV0A 3K53A 3A1NA 4QOGA 2WSIA 3QWBA 1CEQA 2PUTA 4TQGA 1QVRA 1QF7A 1YA4A 3A1VA 3LX8A 5YASA 5A4JA 3L0IB 3RHZA 1CDOA 3F78A 4C76A 3PFKA 1O6GA 1BDBA 4L73A 1G0OA 4M6WA 5JY1A 1QZZA 4IF6A 4ADSG 3A14A 1KOJA 5AXBA 1G0NA 4Q02A 5B55A 1H6CA 1LJLA 3IHKA 1T10A 4P4TA 3X1DA 1NQAO 3I2KA 5TMEA 5I48A 2XRMA 1PGOA 4GRIA 4GR9A 4HDOB 4EITA 1JKFA 4DLSA 2C99A 1KQOA 2G4VA 1W88B 3ND6A 4OA8A 4S35A 5CVTA 5LD2C 2JJ2D 2Z0MA 2P4QA 3W78A 1A2BA 4YY3B 1A9ZA 2RDMA 3O0TA 3IBGA 3VO2A 2QU7A 5FWYA 1R37A 4MDEA 4PHHA 4X7RA 4KACA 2NNWB 4KREA 2G77B 3EDCA 3JQ9A 2X0EA 2F55A 1PEYA 5K09A 4CNBA 1L7XA 5F2NA 3BE6A 2WU8A 5DX1A 3EIOA 1KDOA 2I34A 4J0QA 4OFBA 2Q5EA 3SR3A 1JQAA 1GZDA 2CL6X 3RGWS 1XTUA 1XU7A 4ROTA 2W90A 1CUDA 4HOYA 4DMCA 4JUAA 2G8NA 5K8TA 2AOUB 1SA0A 2P9HA 5F35A 2FWNA 4DAOA 2NT3A 1C7JA 2V55B 2VPQA 3E18A 1UCFA 3VC7A 2JFWA 3UH0A 2R85A 1V9SA 1HDZA 3C8HA 1OHHA 4GVXA 4F9EA 3NCTA 1AS3A 4QRIA 4W63A 3SSMA 5JFGA 5ALIA 4A2PA 4YDSA 4EWLA 3EAQA 4M6WB 1QK5A 2DGDA 5IAEA 1E2GA 1V5IA 1N5DA 2YMLA 4N03A 3SYRA 2ZUTA 1R8YA 4X1YA 3QA9A 4OHRA 5F1OA 4GWLA 1I6MA 2P4SA 3E03A 3QXJA 1WF6A 2E0IA 4WINA 1JXQA 4YP5A 3WFZA 1PX2A 5JS6A 1SCJA 3L41A 4K1XA 3OVMA 221PA 1CR2A 2VHYA 3BN3A 5KWJA 2GCOA 3NTXA 5B1IA 1OX6A 1KSHA 4RF4A 1IHDA 2JFQA 3GZTB 3MUFA 4HP8A 1XO1A 1GVNB 4L8WB 5BYAA 4JLPA 4TL7A 4WY8A 2GBCA 1VFNA 4GQBA 4R8KA 1O03A 3A4VA 5F7XA 1ESEA 3QEOA 3ZHUA 2V5AA 4ZO9A 1Z7EA 1SAYA 3GWGA 3EFOA 1A9XA 4B3RB 2P3LA 1JQJC 2WSMA 1WCIA 1SA0B 4F7WA 1XMJA 3AKCA 16PKA 2CCGA 2NSLA 1MIOA 2ZBRA 4L8VA 3ONDA 1J9EA 4KLCA 1EK2A 2WDPA 5LUBA 4CV2A 3LLSA 2GHQA 4YMSA 1XCPA 2P68A 2AFHA 1LC0A 3O92A 4LDRA 4DJFC 3ZHTA 1GILA 3VNBA 1TKAA 2HIMA 5T6BA 3L7KA 4JI1B 2A9KA 3W2HA 3KLOA 1T8YA 3LRTA 4NRDA 1K3FA 4MQEA 4J0HA 9GPBA 1C0EA 1TE2A 4LZNA 4UTPA 4X1YB 4DCSA 5HJ5A 1NW9B 1XFDA 2IYEA 1V8BA 4BP8A 2CLDX 4P7BA 5TGZA 5LP6B 1NMEA 3E53A 3ZPXA 3BM5A 3F8WA 2BJVA 5FWXA 4C05A 5EWJA 1NM5A 4D25A 1M1YA 2OGWA 2CLLB 2QX8A 2FPWA 2GCOB 3A9VA 3Q1KA 4MIEA 1XWWA 5HGJA 5J4VA 2R4TA 4KK3A 2W9XA 1TT5A 2M6KA 2EBWA 1OREA 4D42A 1SVLA 1QF9A 2BR5A 2AJLI 1J2UA 4NV3A 4PYOA 4BN4A 2B7CA 1JMVA 1ZIXA 2WHRA 2XB8A 3ENVA 5DE3A 5TQ0A 2CVQA 4GLFA 5KYNA 4OIFA 1FZTA 1F5NA 3PQ2A 3RC1A 3EFOB 1T6BY 1A9XB 4TVKA 1IJEA 4NCAA 1WCIB 2GEUA 3JYLA 3OWXA 3B36A 4FZRA 4LNAA 1MIOB 3MK31 3QKTA 2PLFA 2CDAA 1WPGA 3IBCA 1XZFA 2GAJA 3G0CA 1J99A 2CD9A 2XDAA 3MILA 1JHZA 7AT1A 4CIBA 2AFHB 1PLJA 3W1VA 2BLNA 2PR7A 3CX3A 2XOKA 1ZX1A 4YXWD 3CF6R 2ORIA 4JOCA 3PHBE 1NMXA 2QRMA 4JKOA 3F71A 4MQEB 5CK4A 3JQ8A 3VC1A 4LF7B 3HB0A 3FOAA 4LMRA 1IRXA 3EEIA 3HA7A 3IAM1 5I9NA 3GARA 1QP0A 1SG6A 3IAUA 4RD6A 3REQA 4EARA 3V34A 4MWDA 3G0BA 4H3SA 3UUGA 1QYVA 5M34A 5FWXB 5EWJB 4D8WA 2YJ3A 1M1YB 2CMKA 5G0SA 4YALA 2JGKA 1WVIA 3RIGA 3R6GA 4R1TA 1Y89A 1U9ZA 2WM9B 1TT5B 5FNVA 3IFSA 1AK9A 4M0CA 1TK9A 1MDBA 2JHPA 1K6JA 3VAYA 2WU4A 1YBFA 2FPUA 2Q7XA 1OKKD 2QTGA 3ZIAD 4F3NA 4E03A 3HK2A 5TQ0B 3CUSA 4Q4JA 3WGHA 3WQRA 3OC6A 3NJ8A 4D3ZA 2PUAA 3OPYI 3ONVA 3L0CA 1E5XA 2CE7A 3A4TA 3OQVA 4G5YA 4ENSA 2J08A 2WWTA 1ZMOA 4EGFA 1IXYA 4HDAA 3HABA 2FQQA 1ODSA 3GROA 5D7NA 1VPLA 2FSVA 1DBQA 4QPCA 3IC5A 1UFOA 3ZWDA 4EP1A 1A69A 3ELDA 3MFYA 4F4IA 1O0BA 1YZUA 1U0EA 2YXNA 3EIFA 3DP9A 2WTXA 4LVNA 4Y6PA 3ZEIA 5KTKA 1XEAA 3N74A 5EXSA 4CIXA 1ZMTA 521PA 2NW6A 1JXMA 3KB8A 4UVEA 4BQEA 5E0OA 2RARA 5DTIA 1IVNA 1EP2B 4X63A 2R86A 5EERA 1FMFA 1NBAA 2GYYA 1H8HA 3ROPA 3Q5EA 3JQ8B 5DNEA 1CS0A 1BS1A 4O2BA 4FFVA 4WJZA 3BS4A 2GARA 1NBHA 2HV9A 2YXBA 4UHKA 1SQFA 3BGVA 3NBYC 4MICA 5LB4A 2NTVA 2WB4A 4MO9A 3PRKE 5HVNA 4QSMA 4N48A 2J9YB 2P0AA 3IRUA 3NHBA 2O9JA 1TFRA 4H4EA 2B30A 2HX1A 4EG0A 1OB5A 4M37A 2ECPA 5FNVB 1XR3A 1EGVB 2OO7A 2WA1A 2D3WA 3CX4A 1Q74A 3KUCA 3OA2A 4ILKA 4UUMA 2V9PA 1MR3F 1DHRA 1P3JA 1V2HE 3FOBA 3IQGX 1B76A 1GG9A 3DLPX 1P1KA 3F5MA 3TEFA 3NWOA 4JOBA 1SXJD 1BIFA 1K7EB 1LC3A 1IZYA 3E35A 4Q4JB 1Y4ZA 2IYSA 3TOZA 2DY0A 3PICA 5FOSA 4QECA 1DMRA 2B8JA 1X8KA 2QRVA 3IJ5A 3B9QA 3OOJA 2VT3A 1DEAA 4Q4HA 3V2HA 5B2FA 1QQ6A 1JL3A 2UV8A 2WIJA 3OH8A 5BSVA 3W0LB 2Y4NA 4GOMD 4AJHA 4IS3A 2W6QA 3NYRA 4N8EA 5DN9A 5LP6A 2H1OA 3ZGZA 2WJPA 5FOQA 2JLXA 2FKAA 3EHEA 4GGOA 3LHSA 4DUYB 2R7NA 2VOEA 3LWNA 4U63A 1VLZA 2ZRKA 4NCXA 5HKAA 4X3CA 1DBRA 3GJ3A 1RPAA 5JANA 5JAUA 5JXHA 2B61A 2IIBA 5F21A 4ZGBA 3ONEA 1GZHB 1NE2A 4RF2A 4N5LA 3HXQA 4R1NA 3IDSA 3KQKA 3UM9A 3EX7C 2VEDA 1E7RA 1CS0B 4O2BB 3IUYA 1J2RA 2OO3A 2O0LA 5KTSA 1JH9A 2QP4A 3BWMA 3BD7A 3TLAA 4R9NA 3MLBA 2IZ1A 2AYZA 4PNHA 4X85A 4QDXA 5D6OA 2UZ4A 1Q0HA 1UXOA 5DT2A 2HTEA 1PQ4A 1M8GA 3MCWA 1YVDA 3H5WA 3M3PA 4Q1VA 3VU8A 4GX1A 1JXAA 1Y1LA 2QY6A 5B12A 1PTJC 5ECWA 4IXDA 2AOTA 5C4GB 1IY2A 1D1SA 2A30A 2O2XA 1QVZA 2WUEA 2WWIA 1P44A 2JJYA 5IKPA 3KZOA 2F4NA 2WB2A 4YRDA 1JI3A 1HWYA 3DBVO 2QRVB 3IO3A 4Q4HB 1JR3E 3SBEA 2HT6A 4NMHA 1YDWA 5DSZA 5AM3A 1Y1PA 2JB9A 4LGVA 1E61A 3JRNA 3GDGA 3CR8A 1WMAA 2Q6OA 3D6TB 4DV3B 4BJ3A 3PJGA 3A11A 5FFMA 5A5EA 2OWDA 4Q9DA 5AUNB 3CR3C 3K0CA 4MV6A 1I4DD 2CLIB 4YUWA 2H63A 1I94B 1KJIA 1P0IA 4G5GA 1K0UA 4JJEA 1H4VB 2Q2NA 4OH1A 5ELXA 1Z18A 5AOVA 5EMNA 1RP1A 4R6WA 2UAGA 3EUEA 5ALQA 4FINA 5HDBB 4MR7A 1NRXA 4GVPA 4YT5A 1CLUA 1JU9A 3EXG2 2BUBA 4QJBA 2XYVA 1DB3A 1PL8A 3C41J 2P5SA 2C7RA 3L6CA 2VJMA 3QUCA 4URZR 1WD7A 3K1AA 1PYDA 2CJYA 1DZIA 2NXWA 4RZ3A 4BVAA 3SDBA 3FIUA 1XZHA 5B58T 3GG2A 1V6SA 3ESRA 3LGAA 4EG1A 3AKEA 1Z0KA 2F3UA 1DQRA 3PRHA 1G66A 4JT8A 5GV8A 3PA6A 1ESNA 1KJZA 4U5XA 5KTOA 1SUDA 2BD0A 3CZ9A 5F78A 1OWPA 2AOTB 3HZHA 4IQ8A 4JYMA 4K28A 3U3DA 2JH9A 4CDGA 3UJ7A 1QYIA 2ZEJA 4L27A 2P91A 5IUJC 2JF0A 4NF2A 4HNSA 4NJMA 2PKEA 1NUSA 2DMRA 3E9QA 3P0EA 4R7GA 5JVDF 3CRMA 4N5HX 1MRSA 1XKQA 2WAMA 4R69A 2ADFA 1UKYA 3B6MA 2PIAA 2C9OA 3GRZA 4LRWA 2FR0A 1IB6A 3L43A 1M9NA 3VNRA 1R50A 8ADHA 5CH8A 3G2OA 3SJCA 3WYFA 1C7ZA 1LRLA 1MNQA 3BWXA 5BW4A 1J0AA 4WKGA 1HOTA 1XZAA 1WZIA 2DWOA 2ZYGA 1ZK3A 1D2CA 3KFLA 2HYDA 3W5AA 5KDDA 1JFSA 2H6EA 2XRFA 2I6UA 3A25A 2IF2A 1YXMA 2Q9UA 2Q41A 2W6JA 4GICA 4CLEA 1XCGB 4RKRA 4RHXA 3E15A 2XUDA 4OJQA 3UPTA 3M5PA 4K81B 2GGSA 3TM5A 1B0AA 1EXWA 5JAIA 1ADCA 4MR7B 4U9UA 1CZRA 4ZP1A 1NQUA 4BQPA 1P5JA 2N9UA 2AL7A 2G08A 4IOLA 5MFPA 1PFQA 2H7CA 3EGWA 1KKLA 1KZ9A 3ICCA 4DQDA 4DWVA 1W87A 1J42A 2VJMB 4GUAA 3CC8A 3K1AB 1BWQA 4I0WB 3CNQS 4I4CA 4TWAA 1RWNA 3QVJA 1EMDA 1OXUA 5K0EA 1E18A 3PPYA 1FU4A 5EUMA 4LDJA 4RIIA 4G37A 1G2OA 3CRNA 1SFRA 1W44A 2PX3A 4TTTS 5AJZA 2OCKA 4H0CA 4FHDA 2VRCD 2HLDD 1N2XA 3AV0B 3GOQA 3BORA 3MTIA 1GZ3A 4GKAA 3CZ5A 1RLTA 4NJMB 4UCFA 2XHEA 4DYVA 4YV7A 3IQIX 1WQ1R 4XGQA 1I2ZA 4LAFA 1E5QA 1HC7A 4Q3KA 4UPVA 2OXRA 4CKBA 2XTMA 1ZOOA 2D06A 3C6XA 2OSBA 3SR4A 3B78A 3WB0A 4FE4A 5D3KA 2E37A 3LQFA 5HX7A 5LNK6 2DEUA 1JXOA 4O8CA 2GXAA 1OCEA 1JJ7A 1HORA 2I1LA 4Q3NA 5KOYA 1B2LA 2JATA 5CCDA 3MT7A 3WX0A 3RWOA 4FMCB 3FPGA 4K87A 3O31A 4RUKA 4MK4A 3C97A 1P6XA 2GK3A 3DCIA 2HA7A 2VUTA 5IZCC 4QATA 3WLPA 2H5IA 2HK6A 1GDDA 2O0JA 1QVVA 5ALEA 3PU6A 2J6CA 3O9ZA 5L45A 2PMFA 2VDLB 4PWYA 1KEKA 4WAUA 3UAXA 1PR0A 2GB4A 5D7BA 5BNTA 4TS1A 1ZIOA 4BN0A 2DH6A 3DXYA 4J6FA 2XF2A 3UB2A 4C4PA 1RT9A 1Q0SA 3COWA 4KQEA 3IB6A 2K5UA 3BXEA 5D6NA 4DDVA 4MWTA 1DTSA 2JGEA 3Q3JB 1UAGA 2PLAA 3JYNA 3LECA 3U4HA 3BHMA 1DXQA 3ZGXA 4ER5A 3BL5A 4FIDA 4MVJE 2ZJ0A 2C8KA 1W59A 4PCAA 3ZHYA 2F1RA 1COWD 5G4KA 4FHGA 4AJOA 2CXNA 3AR9A 2Y1OA 2EZ8A 1FRQA 4CKBB 1OTHA 2C9MA 3GJXC 2LKCA 1L3IA 2RGWA 3C70A 1MX1A 1LSOA 3FNHA 3GLUA 4NYIR 1J8MF 4BNKA 2IBSA 2J7PD 2VPWA 2WKSA 3L6RA 5EZSA 1NVXQ 5K3OA 5JISA 4BECA 1IB0A 1NW7A 3I83A 1H2ZA 1KIFA 4PTZA 5AI5A 1XF1A 1W19A 2W6IA 2JHFA 1DKQA 3GD5A 3AF6A 1ORTA 1FFEA 1C3XA 2I2FA 3ZXIA 5JFTA 2OD7A 1F5SA 1Z34A 2L42A 2PU5A 2B3DA 4YV0A 1ZOPA 3HUDA 1K06A 4C0SA 5JNWA 1D9ZA 5KKCA 1OT3A 2YX1A 3EJ6A 3NTOA 1AGPA 2QVCA 4NX2A 2O8CA 3H9UA 3NXSA 2XRYA 4CV3A 5AIBA 2PSHA 2XMZA 4KQ2A 2VJCA 4P4NA 4WKBA 2BEUA 4N3NA 5BMOA 2NAFA 4JB2A 2CGEA 3ANTA 3SHTA 3IERA 1HTBA 3WBFA 3ZGYA 4A27A 4UU1A 3TDNA 2VDRB 2ZUBA 1EG2A 1QHXA 4QG7A 4Q3OA 3WLEA 5CLQA 1U8AA 2KLBA 2EJVA 2VF8A 2BCEA 2RJ3A 3SWWA 2XIJA 3GJ7A 3CU5A 3SR0A 3ZHSA 1JVSA 1GHTA 1NYTA 1RRVA 3WLNA 1WMEA 5GIOE 5KTRA 5JNRA 3EXAA 3EVZA 5G4KB 3URMA 1OFGA 4YGYA 3RLIA 3FTPA 1BJKA 2QG6A 4WFQA 3CKMA 2XZTA 1EFDN 2H18A 2JLYA 1A95A 3ROKA 2YYAA 2JCVA 5JARA 1NJGA 1Q95A 1UPCA 2YWXA 3OZUA 3DT9A 4HDQB 4RYDA 5TPZA 1Q1ZA 5JG7A 1THTA 4Z4IA 2OUKA 3WJ2A 4QD3A 3WZMA 4H77A 4XH9B 3ROXA 1OA1A 3F9IA 3GUVA 2YW9A 3W7BA 2CNNA 3T6KA 3HBMA 3WXBA 1M7GA 4H31A 4KOAA 3VV2A 3U62A 3V4PB 4BLOA 10MHA 4OXXA 1X9GA 2X5KO 4OQFA 3NIFB 1I4LD 4GI5A 5EN4A 2G06A 3R7DA 1XK7A 4KXUA 2O8CB 1CDZA 2F62A 2YHBA 1CZNA 1LZLA 4Q9NA 5TXGA 1GTSA 4IHKA 5HDQA 4F84A 1X8LA 4HH1A 3V4RA 2BEUB 3A4IA 3BMQA 1MOQA 1P31A 3LUCA 2NTEA 1RXEA 2C88A 1ULAA 2ZSEA 2W98A 4PX2A 3RE1A 4DDHA 5J4LA 4LDPA 3QLUC 3H5IA 4GYJA 4YRTA 2DKOA 1SUEA 2HFJA 2P9ZA 3GMIA 4WZBE 1UKCA 2WTAA 1UEXC 4RPHA 1V1RA 2PKRA 2GD1O 2QUKA 2QN6A 2FW0A 4DCNA 4IDBA 4H08A 3VYRB 1E5TA 2A7QA 2Z58A 2A5DA 2R1VA 2ZT6A 1FSZA 2QA5A 2XW6A 4MYHA 1SHZA 1SXHA 4K9PA 4HF7A 3TD6A 4K3VA 2W22A 4RS4A 2QZ4A 4O2AA 1T1SA 4U2FA 1Q1EA 2J48A 4JKIA 1MJGM 3SYTA 1D9XA 3PHLA 1EAMA 2B9EA 3T94A 3P4UA 4AIIA 4ZEMA 4LV5B 1ODIA 2RHMA 2TMYA 4R51A 2B4QA 1RWVA 2PPVA 2WG1A 3Q6IA 2ST1A 3KD3A 1W36C 3BJZA 2AG5A 4O29A 4Y6RA 5C1IA 4AO6A 2H59A 1SWVA 1ZH6A 2NYRA 3SKXA 4CM9D 4R16A 5AVKA 5A2GA 5CT5A 2WNSA 3S0JA 1AO3A 2FUCA 2WQ6A 3CUYA 4H3KB 2OXFA 4LQ4A 4KXMA 5EJ7A 3UUEA 4FYIA 2CWDA 1JJAA 1W4LA 3HA2A 3E4DA 3KHSA 3BMQB 4MVJI 5AO9A 4I2VA 4J3NA 4W6ZA 4CCAA 3D2BA 3QWIA 2G4LA 3VVBA 2GBFA 3S99A 3AO0B 4C87A 3WV5A 5KNBD 2ZRJA 3R8CA 3LBAA 2BHLA 3T7EA 3AUXA 3KTFA 4O4HA 2ZJ4A 3KHUA 3LHDA 2WZBA 4KQ9A 2Z6AA 2VXYA 4U9HS 1V1RB 1ZHHA 1QWOA 1KVRA 1Z4NA 2OFPA 2JI8A 3L8MA 4F04A 4C2AA 1N5RA 2GJSA 2A0UA 4Y9RA 1PG2A 3VSEA 4ALNA 1M5RA 4KV9A 3PEEA 3QPWA 3G49A 5FOVA 1V1JA 2R1VB 4DOMA 1RXVA 4KR2A 4FQ5A 4B71A 4H60A 2HSEA 2W37A 1OXMA 1JKMA 3NBQA 4Q9KA 2ZBDA 3HB7A 2H7XA 3GCGA 5I7VA 3W79A 4LF8B 3LKVA 3NETA 2G5GX 3AVQA 4O2AB 2GMWA 2M1ZA 2P2NA 3BD8A 5CFMA 1TPYA 3IVGA 3QXHA 4RPGA 1VKNA 2C83A 3WYNA 5KVVA 3TZEA 1XTIA 1ZCZA 2AVDA 4TOIA 5DKFA 5L4LA 2FRDC 2FFAA 3CX8A 3OCZA 1OJ7A 3GFSA 3EEOA 2EX0A 4NAVA 3FDXA 2WT9A 2I71A 4XD7D 1N9KA 4ALKA 3D5EA 2VDUE 2CF6A 2WQ7A 2BKEA 4JI3B 3EQ9A 5BVGA 4Y9TA 4HB2A 3HU2A 4IDFA 3QW4B 3ROTA 1CUJA 3CX6A 3LCJA 4HHEA 4IAOA 2UUBB 4H9GA 3ILXA 4DZRA 1QZXA 2NUPA 2G17A 4LQDA 4X94A 1YT5A 2B8WA 3CF4A 4NESA 4RTPA 2GHIA 3ENWA 4I8IA 3LSTA 4O4HB 1KOLA 5CITA 4BL5A 5ICGA 3R3UA 1R8JA 3AF2A 4G85A 1GKKA 5K9ZA 1FK8A 3ZWQA 3QH4A 4XYBA 2F8TA 2AN9A 1KAEA 3VXKA 4R3WA 5IC6A 3QVMA 3C8MA 1Q91A 4S3MA 2GEFA 2YWRA 3P45A 2DFTA 4OXKA 2FSSA 3RHSA 4ZI7F 3NBFA 1UC4B 5H83A 2ECQA 2XA2A 3I2HA 3L7IA 1RKXA 2CMGA 1Y6FA 3WIEA 1CF2O 3V33A 3ES9A 3EZFA 4F9TA 4L0DA 3L1HA 4YWJA 2QL7A 3FGPA 1GL9B 4J49A 3AF5A 3D7LA 4PQGA 5IT5A 1A7KA 2OY0A 3DT6A 2APJA 1H6AA 3KXPA 5DCWA 1SHJA 4Q82A 2ZYWX 4HJXA 1XNHA 2RK4A 3IMFA 4WUTA 4JLDA 2AG1A 3LDUA 2ZIEA 3CMMA 4C4YA 5AUOB 5KEIA 3VSDA 2FJ0A 2ILTA 3BHNA 4GM4A 2QUIA 5TQ2A 2J0QA 1P8JA 4QOEA 1PU2A 2EL9A 2Z6QA 4DDUA 2IHKA 5BVGB 1NT4A 1OYOA 4ARAA