3G0HA

Human dead-box rna helicase ddx19, in complex with an atp-analogue and rna
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
408
structure length
408
Chain Sequence
SLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DDX19B
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 150
structure length 408
sequence length 408
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3g0hA02
4LYFA 3K0AA 3TUJC 3K8YA 2ZJOA 1KK1A 3QOFA 5DN6D 4JVNA 4PO1A 1YR7A 2WTUA 3FE2A 1FQKA 4JBXA 1Z0DA 2CK3A 2NO0A 1R10A 4KU4A 3GEIA 4IOKA 1TQ2A 1G18A 2J41A 2J0UB 3IKJA 3LDAA 1G8HA 3BERA 3RYTC 4Q1DA 1XD9A 3B1XA 3TSOA 3HJNA 1YR9A 4A6XA 3SZRA 3K70C 2C99A 2EQBA 3WHKA 1XDBA 2XJ4A 2FN4A 2RGBA 3CPJB 4Q9LA 1TU4A 2QMHA 4OK5A 3V9PA 3EC2A 1W2GA 4JT2A 4MKFA 5BW8A 2HV8A 4V0MA 3REFA 1RE0A 4PPFA 3IQWA 1TQDA 1X3SA 2OLKA 3MUFA 3UANA 1W0KA 2F1RA 2QP3A 3J81k 3L43A 1DEKA 4YXWA 3QVVA 3BC1A 2R6DA 3N2EA 4MDEA 4HDOB 3I73A 421PA 2ZI3A 3QY0A 1BH2A 4EPYA 4WZ6A 4AD8A 2IYQA 2VPPA 1RJ9A 1QVRA 1UBGA 2ZANA 1VYUA 3EARA 2FPLA 1Z08A 3NC1C 4TMWA 2QL6A 3DDCA 3B85A 1YR8A 2ODNA 1H8EA 4K46A 1ONBA 4W5WA 3A1WA 3OZXA 3U3MA 2F1IA 1XPUA 1SXJA 5A0FA 4LJ8A 1KKLA 1NLYA 1T3HA 1CR0A 3Q7PA 4HAVA 5IT5A 4M1OA 4JJZA 4QGGA 4Z1MA 2JATA 1COWA 3AF2A 2FMXA 4IOMA 3DO6A 3V00A 4BASA 4CEIB 4QGFA 4D26A 3BFVA 1TF7A 3WYGA 5JHGB 2NPFA 4MUAA 2KBEA 2XNDA 3R7WB 2O8EA 1IM2A 4D6PA 3CWQA 2VSOA 1XJ0A 4DT1B 5CYPA 3U44A 4NCHA 3UMSA 4HAWA 121PA 1MH1A 1TNDA 1KZGB 2JDID 1G64A 4GRAA 5FOUA 3QKUA 5KHOC 3LXXA 2RGAA 4C30A 4MGIR 4A8JC 2Q9BA 1W1WA 2YC4C 3U4QA 2RMKA 2WZQA 5GADl 3OIWA 5FUXA 2OBLA 1L2TA 1Q44A 2ZSFA 1OH6A 2GBLC 4AG5A 2CL0X 3U6BA 4NBSA 2IL1A 3E2IA 3GD7A 4HYYA 1UDWA 4GT1A 1IY2A 2FSHA 3P4YA 3W6NA 3NWJA 2CE7A 2EWVA 2V1XA 4A0FA 3PUWA 3C7KA 5FBVB 4NU0A 3EPLA 4FINA 5K8IA 3FKQA 3CRW1 5DO9A 2P5TB 4EQ6B 1W4CA 3WP0A 4U00A 2PX0A 2WWGA 4B3FX 2A3RA 3CLVA 5TMPA 2EWWA 4TZ0A 2GCOA 4GOJA 4WOPA 2V7QA 2DWPA 1KO8A 2I4IA 4HEJA 2HT6A 1GSIA 3ETLA 3TGPA 3GEHA 1DAKA 2ZS8A 2CCGA 2EYUA 3CR8A 1Z28A 3R8CA 4NCIA 2G88A 1PZNA 2JIZA 1W36C 4PX9A 3VX3A 4IFEA 4C0LA 1QHXA 5JI2E 3EC1A 3SYKA 5FTKA 1II0A 4IVPA 4LJ6A 1LFDB 1PLJA 2J1LA 4P31A 5KSPA 4I1UA 1W0JA 4X8MA 2QGNA 2QMOA 3FHOA 4L9SA 2R6AA 1KNXA 4TTPA 2C98A 2PX3A 5E7IA 5LD2C 3F8TA 4F4JA 2FEMA 4BFVA 5C2JB 4DEYA 1DAGA 3QF4A 2O8CA 5HCNA 3OEHA 2R6FA 3U7HB 4OK3A 1RVDA 2R44A 2JLQA 5FBQB 2CXXA 3MGCA 4UJ5A 3AKYA 4ITRC 2JLWA 2CDNA 2NO9A 3OEED 4JIMA 3ZGXA 5JWOA 3THYB 3PEWA 3TR0A 1KOFA 2X19A 3GLFA 3UMFA 4NP6A 4QJ3A 1RJ9B 1NJFA 2VP4A 3MJHA 1DO0A 1G41A 3PVSA 2Q3MA 1TUEA 3EW9A 4HI0E 5EZ6B 4XOIA 2FPMA 2J87A 3M6AA 4B6FA 2P0EA 4RCZA 4A8JA 3MJRA 2VSXA 2W6IA 5JS7A 2ZVPX 2J0VA 1ZIPA 1E9EA 2ZETA 4TYQA 4DVGA 4DLVA 5FBLB 5KNBA 1Y3AA 4O25A 3HR7A 5UKDA 1NBMD 1W48A 4HAXA 3GFPA 2W0SA 1GZSA 2VP6A 2O8EB 1G3QA 1KDRA 1SKQA 2R62A 4DZZA 4RJLA 3EX7C 5LPNA 4RZ2A 1S1CA 2CBZA 2QTHA 2YOFA 1KI6A 2DPXA 3LLMA 3B78A 4I1OA 4TQ9A 4PQYA 1GKIA 4DLTA 1VKJA 2QU8A 4O0MA 3ZVRA 5A5GA 1OH7A 3ADKA 2OO7A 1E3MA 2YHSA 1VG9B 1GWNA 1PLLA 2BEJA 4GMDA 4OI4A 2D7DA 3GCGA 1N6RA 3RAPR 1JXMA 1GDDA 1HUQA 3MWKA 4URUR 1XBTA 4GNKA 1ZCAA 2Q21A 3THWB 1Z0FA 2Q9AA 3RS0A 3GJ7A 1BS1A 4JBYA 4LJ5A 5FPTA 3RSOA 2P65A 4MGKR 1T4GA 3SN6A 4U5XA 4ON9A 1U0LA 1E2MA 3PR1A 4RKFA 3KXKA 2F43A 5JRJA 3A1VA 5FL7D 2OHFA 2OFWA 2IUUA 2NO1A 3FYHA 5HKKD 1P3JA 4JS0A 4DCUA 4MRVA 2DYKA 2PZFA 2GESA 4MA4A 3TVTA 1FW6A 3W6PA 3RS5A 2GCOB 1XZPA 2IYYA 1G16A 2QQEA 1M8PA 1M7GA 2AHOA 1TX4B 4UNQA 5EE3A 3TUIC 4B3XA 2FEOA 4B47A 1OV4A 1E32A 4DLSA 2AR7A 2Q9CA 1JQJC 1IQPA 2ZU0C 2SHKA 4PAOA 3QF7A 4XWOA 1NIPA 4NYJQ 5EXPA 3VHLB 2XAUA 1XTJA 3SHWA 2D2FA 3PENA 4GBMA 4PO8A 5DNYB 1US8A 4CT4B 1YJ5A 3TQCA 4NCKA 4ZV4A 3VR4A 1UKEA 2XOKA 4GOKA 4QKQA 2BBTA 5LDDC 4D0LB 1MO5A 2FZLA 3TBKA 1KZ7B 2WMOB 3U60B 3OE7D 3RVBA 2P6RA 2WIAA 1F2TA 1XFAA 3CIOA 4XD7A 5FTLA 4BZXA 2ZE7A 5J40A 3NG1A 4EJSC 1G291 3EPHA 4QHTA 1DPFA 4EKDA 3KQUA 4YDHB 2GHIA 3VTKA 2RGEA 5AJXA 2VA8A 1FNMA 2V1UA 3DMNA 1HURA 1TADA 2O8BB 4I1VA 1E4VA 2Z83A 3AVPA 4B48A 4TSFD 4F91B 2IX3A 2JCSA 1XXHB 5EP1A 3NTUA 4E5UA 5J4YA 1W47A 2VH5R 4FN5A 4R2HA 3EZ7A 3H1TA 4TWZA 4BLRA 2O8FB 1OXTA 1YZKA 4HLUC 4FXPA 5EQTA 1WF3A 1U8ZA 1DOAA 2G1KA 1VG0B 1T91A 4M4SA 4M53A 3VR3A 1VDZA 2HXSA 3RS4A 4ZI2A 4JLVA 4NHOA 3GLGE 4BE7B 1N6NA 1R8QA 3RRZA 1CKEA 2R6CA 1AS3A 4MYTA 1E99A 2BOVA 3AGQA 3D31A 1Q12A 2BBOA 4FD2A 4D80A 4YMUA 3K0FA 4RSGA 3ZVLA 2WWHA 4BLQA 1FFHA 1NI3A 5F2EA 2DR3A 3B1YA 1KI3A 3DL0A 3U6KA 1DG3A 1XCGB 1HYQA 2AX4A 1GNQA 4NYJR 1E0SA 1XMIA 3HU2A 1OKKA 1PV4A 4M1YA 4JYCA 1QVAA 4MGYR 1ZW6A 1ZUIA 4B3DA 1J8YF 3M1IA 4LYAA 3TQFA 4LX0A 2QAGB 4EFLA 2JLZA 1ZVQA 4DUGD 2W6JA 2KI5A 1LTQA 3NKVA 3H2YA 5FOXA 2BMJA 5BQ5A 2IYRA 2GNOA 4C0QC 4TMZA 5C1BA 3KL4A 1Q57A 2GK7A 2VRWA 2XITA 1TUIA 1R0XA 4NMMA 1S9DA 5DE3A 2ZRKA 4DDTA 1KY2A 3OAAD 3ASZA 4GPTA 4EPVA 1A82A 5JLJA 1DBSA 4KLNA 3TH5A 1EFRD 4WZAE 3GJ8A 1HT2E 2WJJA 5IK2A 5FBWB 4Z54A 2JJ2D 4CEJA 2EU8A 1Z6XA 5IRCD 4Q66C 5TXGA 1U81A 3IILA 4QXAA 2XGJA 1DARA 3KXIA 3EWAA 2XXAB 2P67A 5FFMA 2HF9A 3A8TA 5DISB 1G3IA 3GJ0A 4Q9KA 1G5RA 1W0KD 1G8GA 1N2CE 4KLZA 721PA 5FUYA 2BBWA 3SYNA 1G4AE 1MOZA 3BIFA 2RKOA 1RYHA 1GNPA 4QHSA 1IN7A 1TEVA 3C16C 4IXNA 2YOGA 3QXHA 2D3WA 3BH7A 4EJSA 2GF0A 5FI1B 3KJHA 1WB9A 2ZEJA 3SQWA 4YMVA 2CHQA 5TDHA 1Q20A 5EXTA 3RSLA 1H8ED 1XWIA 2AL7A 4LUCA 3K0EA 4GL2A 1KSHA 2C5LA 4LBVA 5JECA 3KKQA 1J90A 1XTKA 2OXRA 3B9QA 5AWFC 3MCAA 2PEYA 4D0GA 1KJZA 1US8B 1NVUQ 1E9CA 2OAQ1 2WM9B 3UATA 4Z1MD 4PQRA 3SDZA 2C03A 3LXRA 4HDQB 4PPNA 2IS1A 1COWD 3BE4A 3PFIA 4HLUA 3NHAA 2BWJA 2J45A 1DAHA 3ZQ6A 1PVOA 3ND9A 2BJVA 2W00A 4B75A 3H86A 2OUKA 2XNDD 1GAJA 4MRNA 3N5CA 3QG1A 2ANBA 1ZU5A 3AEZA 2W2TA 1LS1A 3IHLA 1IXZA 1Z2CA 3QXSA 1JJVA 5DI3B 1E2PA 4DLZA 5EXXA 4YQFA 4WA7A 4W5JA 3ECCA 4TQUS 1RKBA 2QORA 1XB2A 2AK2A 3OESA 1JI0A 5ELXA 2J5XA 5JCPA 2ODEA 4KSBA 5IHPA 5JWRA 3PCRB 4US1R 1SVSA 5F9HA 5F98A 1VIAA 1FNNA 4RD4A 4W7SA 2J7PA 1N6KA 4JLOA 5B30A 1BKDR 2F9MA 4JLDA 1E79A 1HTWA 2WOOA 3W5JA 4OKSA 1KDTA 1WCV1 3GMTA 2WJYA 3L0IB 4F93B 3D6TB 4B2PA 5JRZA 2B21A 3K0FB 1NSTA 3DKPA 4D4KA 2HJGA 2F6RA 1GTVA 3F0TA 2CLCX 2WOJA 4BLOA 1JALA 2ZREA 2EW1A 3QPVA 4QC2A 1G7SA 2FJUA 2QBYB 4BFXA 1SZPA 4HZUA 1T3SA 2FZ4A 2X77A 4EIWA 2V7QD 4LOAA 3WYAA 3KKMA 2GF9A 5EUQB 2D62A 3PEYA 2CJWA 3IEVA 4QGAA 1J8MF 1G8YA 4C4PA 2PMKA 4HZIA 1GUAA 1XMJA 4M9XA 4ESHA 3U7FB 1RYFA 1T6NA 5FPYA 4GP7A 2ZJZA 2G0TA 4HSEA 4WBSA 3PEUA 1KY3A 4PC3A 4OI0A 4PSKA 2FNAA 4ZDWA 3SJAA 5L3SA 2WPDA 1KYIA 1E9AA 5JS8A 2DWQA 3NBYC 3VQTA 1T5LA 1II8B 4KJZA 3QQ5A 1OIVA 2ZSEA 4TL6A 4IDHA 1Z6YA 1U8YA 2KE5A 4Q9HA 2ZE8A 1M7BA 1VCNA 1XEXA 5H1YA 2EFHB 2NIPA 1ZP6A 1UEJA 1XZQA 3W3AA 2ZYUX 4DLYA 1QG2A 2AKYA 5SZIA 2WHXA 1YR6A 2A5GA 4A6PA 3TIFA 1VHTA 4TYWA 3Q3JB 4OHZA 3W8RA 4WIAA 4JLNA 3RLFA 2GILA 4CIDA 2IXGA 4D4MA 1ZIOA 2D7CA 1KO7A 2A5YB 3I4LA 1N25A 2GEDA 3QI2A 5J4KA 1KMHA 1H8HA 4II7A 2JJ1D 3QG5A 5AUOB 4UNSA 4WW0A 2VHUA 2PLFA 1CIPA 2V9PA 5H68A 4D2IA 2J59A 4CF7A 1HT1E 1TL7C 1TPZA 1ZNYA 3GJ4A 2ZYTX 3HDTA 5DYIA 3A1SA 1AQUA 1P2UA 4OHXA 4RKEA 3WMGA 2OCBA 2CMKA 3EZ9A 1Z6AA 3O47A 2OSBA 5HE9A 5DSZA 2DFLA 3FVQA 4QL3A 1G6OA 3T12A 3C8UA 4TLCA 2Z4RA 4QBIA 1U99A 1F60A 1N5LA 4BFYA 3TE6A 2DWOA 4DSOA 3TAUA 5JI3E 3BBPA 3GP8A 1XPOA 1G21E 2QM7A 3S1AA 1R0WA 4LV5B 2ZJ5A 4JL8A 4D0NA 3EIHA 4Q01A 2GZAA 4G5GA 1EG7A 4LBWA 2MMGA 1DADA 1M7HA 2VHTA 3OF5A 2ZI4A 4Q4JB 1U90A 3BORA 2G0NA 4EPTA 4CVNA 4PC7A 4UKDA 4LHWA 5DHAA 5HR5A 2ZRAA 1LY1A 2YINC 4WAUA 1FTNA 2GA8A 4DRZA 1DAEA 3BD9A 3PV0A 2WV9A 1LW7A 2ZI9A 5CM9C 5G40A 1XJCA 5K8UA 1BMFD 4EPXA 4FMBB 4M1SA 2ZS9A 3LA6A 1ZC3A 4DLXA 5CDFE 3FKSA 2OFOA 3REGA 1AN0A 4UNNA 5L3VA 2YVUA 4Q9JA 3T34A 3SS8A 1P72A 1S3GA 2BBSA 1AIPA 1EX6A 2HLDA 4I4LA 3QXCA 4NCNA 4DDVA 3V4FA 1E0AA 1E2NA 1W4RA 4ASUA 2WJIA 4B3CA 1ZBDA 3UK6A 3WY9A 3BH6A 1D5CA 3PXGA 2J7KA 4DB2A 4KAXA 5JJKA 3WNCA 4A9AA 3O8DA 5C4GB 3G5UA 3W3ZB 3FPAA 1D2MA 1E94E 4IOJA 3F5FA 3GEEA 1E9SA 4RD1A 4E03A 1QRAA 4Z8YA 5GVSA 3E5HA 1SVWA 3AF0A 2FPKA 4DSUA 4B35A 5KTYA 1WRBA 2D2EA 3TSWA 2PT7A 2H18A 2XTMA 4KO8A 2XSZD 1FMLA 2Y8EA 4JLJA 4ZO4A 3AVQA 3EG5A 3KJEA 2O0KA 4YMSA 5AUPB 2IBMA 2W0MA 3ZLJA 1P7CA 2UZIR 4RZUA 1OW3B 1G19A 2CHGA 2ZR7A 4ZCIA 1XCPA 3ICEA 2L0XA 5FL3A 4Q1EA 1CJTC 5EJEA 2V4ZA 4MITA 4HATA 2FFAA 4RVCA 1XEXB 2FA9A 1OT3A 3LQQA 3CRVA 4XIGS 3WHLA 3T15A 3ZD7A 3BOSA 3VHXA 1Z6TA 3AP2A 1VYTA 5CK5A 1F2UA 3THXA 1IOZA 4DCTA 2DB3A 5E3HA 2AXPA 2QN6A 3DPUA 2WKRA 2OV2A 1RRPA 5TVKA 1CRPA 2GWHA 1KI7A 3QKTA 3B5JA 1GRNA 3SJCA 2AWNA 1E98A 3SYLA 2JLYA 2RHDA 4JMPA 4JLKA 1GRRA 3VR6A 4C7OB 1XTRA 1T3LA 1WXQA 3TW8B 2IS4A 1WMSA 5GVRA 3X1WA 2FFBA 3QKRB 4K8OA 2F3RA 1KJWA 1Q1ZA 2WSSD 2ZRCA 1GVNB 1KMQA 4PHFA 4G01B 3MSXA 2I3BA 1D9XA 3FGNA 5SZJA 5GJCA 4YMTA 3GLGA 3SBDA 1G9XA 3H84A 1E96A 1IY1A 4H1UA 4M2LA 4MYUA 1T5IA 3PQCA 4FMCF 1E2JA 2D06A 5FR2A 2PT5A 2HUPA 2V54A 5CIQA 1YZQA 2IHBA 1KSGA 3P32A 2EFDB 2H92A 3LX8A 5D3QA 1OKKD 4A4DA 2QQ0A 3SOPA 5EE1A 2GJ9A 3KKOA 1A2KC 4Q7KA 3OFNA 4QG7A 4O2LA 2WWYA 2Z4SA 2ZUCA 4RZ3A 4IOLA 1NMZA 2H7VA 4HUTA 2EFGA 1MRSA 2D74A 3EIEA 1B0UA 4LV8B 3M0EA 1NL3A 1I2MA 2ECKA 2JAQA 3BRWD 3SU8A 4RFVA 4EFNA 1DAIA 2QG6A 2ZIAA 3KFVA 1BIFA 3HWSA 3MFYA 5J47A 3LVQE 1P5ZB 1YRBA 5ANRB 4F7WA 3SFZA 3B1WA 1KI9A 1X8LA 2NO7A 4BEBA 4OJQA 2IUTA 3IO5A 3RS7A 1CJVC 4CGZA 1RIFA 1TU3A 5H70A 1XX6A 4JJKA 1T8UA 3CH4B 4L4UA 1Z0JA 3C14C 1R4AA 1I4LD 2JLRA 1NBME 4G3XA 3ONWA 1S9HA 4L9WA 3HPRA 3EXAA 1KKMA 4JL5A 1GOTA 2YJTD 1ZU4A 4ACBA 2KB0A 4DDUA 3I1FA 4P3YA 1G7TA 4PQFA 5CJ2A 4Q1FA 2FFHA 4RZXA 3KZ1E 4HUQA 3L0PA 3DVLA 1KK2A 2QAGC 1OHHD 4KI0A 2O8DB 1QHGA 3A4NA 4A92A 3CPEA 4C3ZA 3LRPA 3K0AB 3MG9A 1ZD9A 3TLXA 4UQOA 2A5DA 1ZM2A 2DFKB 1FQJA 4OL0A 3CX8A 3LX5A 4IKEA 4GI7A 5J5CA 1HA3A 1IXRC 3Q7QA 5FUVA 3QPWA 3CPHA 3T5DA 3PIRA 4L8GA 2QSZA 4XSGA 2NOAA 4MKGA 4LSGA 2CVHA 3JZAA 2JLXA 2XTZA 5DH9A 2F3TA 1FUKA 3OIVA 3PG5A 2P2LA 5FOTA 1KI4A 3FHCB 4PZLA 1YZGA 2KBFA 3AB3A 4E07A 3FMIA 2JLUA 3TSZA 4RY2A 2HCJB 4LYHA 3LBHA 2JGNA 1ZM3A 4GDFA 5L3QA 4OYHA 2HDNB 1ZD1A 1ZUNB 5JBQA 2LKDA 3GJXC 4WXPA 3CNOA 2WIBA 2GZHA 2ATVA 4Q48A 3BFKA 1CP2A 4V03A 4DCVA 3QEJA 2OXCA 3R8FA 1T9HA 4QBGB 1Z5ZA 1ESMA 4AYXA 4Q03A 1ZJ6A 3SJBA 4LJ4A 5HZKA 1A2BA 1ZUHA 2REOA 3IIMA 5CLLA 4B2LA 3WP1B 1R5NA 2ERXA 3P20A 1F2UB 4MQBA 3THXB 1G1MA 2QP9X 1R2QA 2C96A 1VCIA 2VLIA 4HB4A 4KHZA 1SULA 4KFSA 4L16A 1SXJB 4NDZA 1LVGA 1XCMA 5AJWA 2LKCA 3CR7A 3T1VA 4MDFA 1QHHA 2QRZA 3QBVA 3B60A 3FMOB 2QE7A 2VQSA 3AVTA 4IDPA 2GBLA 3RRMA 1KO4A 1YHNA 5E4FA 4R7ZA 3ZIAD 3I5YA 2J7PD 1JECA 3RHFA 1PLKA 2WICA 1GILA 3GLHA 5BWMA 1E1QD 1YZNA 4P4SA 1OH8A 3IEUA 1ZM9A 2H1LA 3H0KA 1JNYA 1Q3HA 3DEFA 1KI8A 4ESVA 3CM0A 2HJVA 3CX6A 4MRPA 4S35A 3T35A 3U44B 2IS6A 2NTYC 2HF8A 2H8KA 3KQLA 1UBEA 3ASYA 3EWSA 4Q9IA 5FUWA 3U4QB 4MH0R 3B7GA 1FP7A 1I4TD 1KSFX 1MABA 2PJZA 3L8ZA 1AKYA 5DYGA 2GETA 2CL6X 4KBFA 4HB3A 1JR3D 4LJAA 1SVKA 1AGPA 2HXYA 3AGPA 2FF7A 3BB3A 3QE0A 4CRWB 4TTQA 4TT3A 3R9XA 2XZPA 1HV8A 2WPDD 1T8TA 3ZZTA 3NIBA 1DVRA 2C9YA 3W8NA 4OQLA 3LY5A 2NO6A 3DZDA 1G8PA 2GXQA 2B7CA 2VP0A 4Q4AA 1CR4A 5FTNA 2RGCA 3TRFA 2IYXA 5JEEA 3IGFA 4M9ZA 1Z6GA 2V6IA 4KVGA 3U3OA 4QBHA 1G4UR 3LW8A 1ZRHA 2OLJA 3K9GA 2WJHA 4FMDF 1NMYA 4QNRA 3GPLA 4TYYA 3K1JA 4N0DA 1VPLA 2F1JA 3KUCA 4POAA 2VSFA 3B1ZA 5G3ZA 5A4JA 2IK8A 4NPHA 4M9SA 3DHWC 3MLEA 4NCJA 1Q3TA 4Q7JB 5D3MA 1KGDA 4WZBE 2J9RA 4LY6A 1M2OB 4AYWA 4L15A 3GFOA 4M1WA 2IXFA 3AVVA 2P5SA 3AQ4A 4P0TA 1KK3A 3D7MA 4AYTA 1NVVQ 1Q21A 1ODFA 4OQMA 1YKSA 2GXUA 5JCZA 3IBGA 4ZI3A 5AUNB 3VNVA 1NLZA 2IA5A 2KWIA 4IEEA 4Q18A 4PSVA 4V0KA 4V0ME 2ZI5A 5KSOA 3WRXC 2ORVA 4Q1CA 4TLBA 3GLIA 2FGJA 4AIIA 2XX3A 2CNWD 1TAGA 3K9NA 5JEDA 4LCBA 2GJSA 5AJYA 3BGWA 3HYTA 5JWHA 4LGMA 3LQRA 1UPTA 2GAAA 3QF4B 2CLDX 4Q00A 2O8CB 2DBYA 2CE2X 3AVYA 1G17A 1YZLA 4Q4HA 3TR5A 4C0JA 4LZZA 4NKRA 3RNLA 4TTRA 3ZH9B 2ANCA 3LD9A 2YC2C 5EP2A 3IQXA 4IW3B 4QRHA 1MT0A 3SEAA 4W9MC 1I4DD 1OFHA 5CB8A 1TQ4A 2ZE5A 4JVSB 1P6XA 3CWZA 4JLMA 4P32A 3GLFB 4AKGA 1MR3F 3QEOA 2EVWX 2R2AA 2VF8A 4D81A 5F3WB 3VAAA 2C77A 4GP6A 3JVVA 3U5ZB 1M34E 1SQ5A 4NTZA 2LWIA 3KXLA 1E1RD 1KDPA 2ZAOA 3CZQA 4XTCS 4A8JB 1K5DA 1N5IA 2BDTA 4Y0AA 3W34A 4Y0VA 3ZVMA 3KJIA 1GITA 1NLFA 4DIEA 3KB1A 2DCUA 2RGNC 3ICQB 3TAHA 2FDCA 1QDEA 3FKSD 3IBYA 2Z6VA 5AJVB 5TY0A 2GDJA 1E9DA 2GEUA 2O0JA 5CDFA 1NKSA 2H57A 1NVVR 4RFSA 5HPYB 1NMXA 3G0HA 2QT1A 1M6NA 3T1TA 3IHWA 1X86B 3N70A 1A1VA 3I62A 4B76A 1KI6B 4B3BA 4FCWA 4LPKA 1JPNA 4BGDA 1L7VC 1GL7A 2C8VA 5KSYA 1XRJA 3X1XA 2CK3D 1DAMA 3R9WA 3LAWA 1G5PA 2NQ2C 4TMTA 2EFEB 1KNQA 2ODWA 5C4MA 2G77B 3U3JA 1QHIA 2ASEA 3FTQA 1DAFA 1LV7A 1N0VC 2O5VA 4UNRA 8OHMA 1P9NA 5FR1A 4F92B 2OZEA 4IDOA 1Q1QA 2A2ZA 4EUNA 2BHRA 1NSFA 1UBCA 3NVAA 1W36B 5JHHB 2GCNA 4TMKA 3L82B 3U7EB 2F43B 4DHEA 2OESA 3AUXA 3QKSA 3ZYCA 4IDQA 1MO6A 2QSYA 1D2NA 2WAYA 2CCKA 1XPRA 1LS6A 4MKHA 2JLSA 4YXWD 3M4YA 2ZYVX 5C18A 4LHXA 3WMEA 2GJ8A 3I72A 4RD6A 2ZRNA 1GM5A 2WWXA 5LB4A 2VTKA 2IEYA 3X1ZA 1G6HA 4C9BA 2NG1A 2WJGA 3Q8XB 2UKDA 2ZRDA 1B23P 5M04A 1YZTA 3PUVA 1CR1A 1GKYA 1UF9A 5JZVA 2BEKA 5LD2B 1J7KA 1Z0AA 2W58A 2FOLA 2ONJA 4NYIQ 3U2QA 3T1OA 1SXJD 3O8RA 3UWOA 1TMKA 2OCPA 2Z0MA 3VU9A 3CZPA 5FOSA 2ORWA 4JBWA 4AK9A 3QENA 3ADCA 4A2PA 2QY9A 3TW4A 5BN4A 1IN8A 1S96A 2MSCB 1C4OA 1FL9A 3BJIC 4HLQB 4DWJA 4KFRA 4KV9A 1MRNA 2N42A 2G1JA 3NXSA 4H1VA 4PR0A 1NN0A 5EE5B 3P4XA 2G9NA 1F2TB 3L8YA 3X1DA 5CIWA 1EX7A 1D6JA 1XD8A 4GSYA 1WDTA 3GLIB 2GAOA 4KYIB 1XXHE 1RC8A 3K09C 4PO9A 1MV5A 5GJWC 4EPRA 3CBQA 4HB2A 4QM6A 3JVUA 4QNMA 3DOEA 4Z8XA 1VG8A 3AKCA 4BFWA 1OIWA 4EAQA 4Q47A 4ARZA 2ONKA 5JJIA 5E95A 2R65A 1QHYA 2G83A 4HAYA 5EUMA 5B64A 4I99A 1X8JA 2A30A 2OT3B 4UJ3A 4CEHA 3LO5A 3SBEA 1S8FA 1XNJA 2O0HA 4M8NE 3SNHA 1E2HA 4IVRA 4MRSA 1KO1A 4KODA 4RD0A 1T0HB 2RGDA 1FZQA 2XJ9A 3IPXA 4LI0A 2CHVA 3W5IA 4LJ7A 3EZ6A 1KSJA 3UKDA 2CEAA 4H9GA 1HY3A 1R6BX 4B2IA 2AN9A 4BFTA 4IVQA 2OE2A 3SHFA 1P4SA 1F6BA 1A4RA 2QTFA 1DELA 1NVWQ 5FPHA 4BLTA 5JSZA 4ZCLA 3KTAA 1Z07A 2K5UA 2VEDA 1NG1A 4C0KA 1E2DA 4NYIR 5SZKB 3K70D 1OPXA 1G3RA 4DCSA 1KK0A 4QBFA 1G7RA 1HE8B 4YMWA 5IDVA 5FH9A 1KAOA 3KQHA 3BAFA 2VHCA 2WWIA 3FOZA 2IYVA 2CLSA 1AGRA 4QHYA 1E2QA 2JIZD 3AF3A 821PA 1SHZA 2QA5A 4GMXA 3TVDA 4PTLA 1AKEA 4ZDJA 2B8WA 2J0UA 1E69A 5CK4A 1VCMA 3VFDA 3Q5EA 4JYBA 1ZNWA 2FE4A 3KFXA 4DCNA 4F4IA 2OAP1 3VR1A 1XF9A 1W0JD 4BEJA 1ZCBA 2VBCA 3P26A 3UMRA 1WBDA 3UIEA 4CEJB 4JSTA 1FOEB 4ACAA 3A37A 5C46F 1L8QA 5GJVC 1SGWA 2RCNA 4G0NA 4WVFA 4X8HA 4YLGA 1RPZA 3NDPA 3MMPA 2ODBA 3OEHD 5FL7A 2QT0A 1DS6A 1FP6A 2YWEA 1QG4A 2B6HA 1XD2A 1IBRA 4M22A 2C9CA 4IEIA 4A0RA 4B74A 2DY1A 1S2MA 4JLBA 3I5XA 2QPAA 4DLWA 2GZDA 2WVJA 1OFIA 2GTPA 1EESA 1YZUA 3ZZUA 5KPJA 3RRNA 1OFUX 1NY5A 4EJSB 2H17A 2HCBA 2QPTA 2AD1A 4Q1AA 2C04A 5AR1A 2E87A 2IYSA 4DKXA 2RH5A 2FV8A 1SVMA 1N5JA 3PUZA 5EP3A 3W90A 3PEVA 4LV6A 4XH9B 3AM1A 5HCIA 3T5GA 4CZ2A 3A6PC 2IHYA 3X2SA 2QEQA 4FWIB 3RC8A 2W6ID 2OG2A 4PSAA 2A7QA 5KOYA 4G5SA 1FUUA 1BYUA 1JAIA 1VYVA 3NH9A 4CEIA 3OE7A 1G20E 2OBNA 4RD2A 3SFVA 3LH5A 4BFUA 2XZLA 1N0WA 3AKEA 4KXFB 1GFIA 2ZU6A 3KDSE 4L5BA 2PL3A 3NBXX 3WYFA 3CH5A 5KPDA 3EPJA 4BLSA 4N1AA 4DT1A 5HTKA 4CW7A 2ZM5A 1ETUA 3FMPB 4TMVA 4V0OA 2VIIA 3ZQJA 2ZITA 3FB4A 1E4YA 2ATXA 1M74A 4K81B 2PLRA 4TSFA 1ZMXA 3U7GA 1P9RA 4FCTA 4HAUA 4DDWA 3AVXA 1Z47A 4JT4A 3CUEF 5FBRB 2YWHA 3TJZA 2OFXA 4U7DA 2J46A 2REBA 2ZRLA 4UXHA 1N6PA 2BIFA 2WKQA 4W5HA 4OHYA 1OB2A 2X8AA 3ZS8A 2KSQA 1IJEA 4QFMA 3FFAA 3CRQA 3SQXA 1NVXQ 3IO3A 5L8VA 1W36D 2C95A 4TT3D 3EIQA 3EAQA 4C0AC 1II9A 2QGZA 4PHGA 4MYCA 4EQ6A 1AS2A 3HP1A 1R5OA 3ND8A 4XWKA 1VG1A 3ZZ0A 2IT1A 4PPQA 3P1JA 4JLAA 1KTVA 2IUSA 1NIJA 1CF4A 1AA9A 5JSZB 4QGHA 2BMFA 1Q0UA 4G5OA 4HZUB 1C1YA 4LHVA 3NDBB 1G8FA 2ZJAA 1NNEA 2ZAMA 1NN1A 2CJWB 3LBIA 1EFUA 5LBIA 2IYTA 4NL4H 3V4RA 5CITA 5KU1A 3TNFA 1FX0A 4DUGA 1R8SA 2GJAA 1W44A 4XVUA 3LVRE 4GOXA 3AUYA 2GXSA 2VP5A 1VTKA 2FFQA 1WP9A 4FCVA 5L3SB 1JQLB 3C15C 2ZSDA 3CKLA 5IF9A 1N6IA 2XOKD 4DSNA 1OXVA 4IRUB 3BFXA 2IEZA 3FMFA 1Z22A 4NYMQ 2ZVQX 4BRWA 4U02A 3OAAA 4JLPA 4XD7D 3L2OB 4Q4LA 1OXXK 1CLUA 1IN4A 1EFRA 3DMDA 4OHVA 4KITB 2CL7X 3DZ8A 1VECA 2BM0A 4PAMA 3T61A 2JJ2A 1CTQA 1J2JA 4URVR 2ZRGA 4F4CA 3CF0A 3B9PA 1ZINA 2WKPA 4BFZA 4BRUA 1U98A 2ZS7A 2QTVB 3I3SR 2OBMA 4EDHA 2OM2A 5EE0A 3BK7A 4E09A 2VP2A 1XD2B 4PC1A 4XJXA 1UKYA 4OJKA 3THYA 4QJ4A 4OQNA 1KMHB 1M1YE 4AKEA 2ZYWX 3RABA 2J0QA 1OFTA 3CO5A 621PA 3E70C 1RFLA 3MAAC 1KAGA 2JASA 3HU3A 1W5TA 3I8SA 1HH4A 4G5QA 4D4JA 1CU1A 1E9BA 4A2QA 1IHUA 2W2XA 2ZUDA 4ABYA 2QRNA 3BH0A 1NF3A 3IIKA 4FW9A 1E0KA 2ZJYA 4LJ9A 1AM4D 4AWXA 1OLOA 1SVIA 1E2EA 4UXIA 2YNMA 1RRFA 2V3CC 2WWWA 2ERYA 2F1HA 2X2FA 3GJ6A 4AY2A 1GL6A 1P73A 3MWYW 4ILEA 4NE2A 3W9YA 1HE1C 1W46A 1XTQA 4P4TA 3W6OA 3CONA 1ZNXA 3S1AB 4TYPA 3ZJYA 6Q21A 5H8WA 4B32A 2N46A 2W6JD 4LBYA 4NYMR 2DHRA 4DIDA 1SHKA 3AVOA 2YKGA 3OIUA 3EA0A 3PUXA 1X1SA 2V55B 4US2R 1DTSA 5K8TA 3R20A 4O3MA 2ZQ5A 4PAQA 1BOFA 3FWYA 4IDNA 4IJMA 1P9WA 2REXB 2RHMA 2MSDB 2VO1A 2NGRA 2P3SA 1UJ2A 3UPUA 3N2IA 5AJZA 3THWA 2OCAA 2AWOA 2YV5A 1OXSC 1R0ZA 5IK2D 3FHTA 3QSYA 3A4MA 4LBZA 2ZRMA 1ZC4A 3LFUA 5J4HA 4KFTA 2IF0A 3KJGA 4M21A 1XMSA 5KDLA 4JZKA 1NN3A 1AZSC 1WA5A 4N3NA 4G5RA 1ZNZA 2ZSAA 4Q7MB 4TLDA 4DEXA 2WWFA 3GJ5A 3I32A 4TL7A 1SKYB 3TK1A 1SVLA 3NBZC 2C78A 5FTMA 2RGGA 2FH5B 4JSYA 1JR3E 4AKIA 2PZEA 3B82A 5EP4A 1OB5A 5F9FA 1DG1G 1EFHA 2EYQA 2ORIA 1OYYA 3E1SA 2IS2A 3BWDD 1R7RA 1V43A 3IUYA 2A9KA 1FX0B 3LWNA 2ZRIA 1X8KA 3QIAA 4LC0A 1CJUC 3F3YA 3KQNA 4PC6A 4KYUA 1Z0IA 5BYJA 4A0HA 2FU5C 4PZYA 5KSZA 1YQTA 1P60A 4P4UA 3GJ3A 3PUYA 1GNRA 2HEIA 3UG7A 1P2SA 1AQYA 1JBKA 1OJLA 4LPSA 2FSGA 3NHBA 2GKSA 3A58B 1P2VA 3VMFA 4OI2A 3G82C 4HAZA 1XTSA 1HQCA 1ZAKA 1OIXA 2V8OA 2VP9A 1UDXA 3IPYA 3RC3A 2XTNA 1N6HA 1GL9B 1NY6A 2O8BA 2GCPA 1A5TA 2ZRPA 2OEPA 3L0SA 1JEDA 1UAAA 1XXHA 3UG6A 2F7SA 4XTRA 1W2HA 3QVUA 2XNSA 3AP3A 4FIDA 5SZHB 2ZTSA 4AI6A 2FG5A 2PEZA 3AF4A 2O8FA 3WXMA 3D8BA 1W4AA 3NBFA 5KO2A 3C41J 2JJ1A 5LB2A 1GKUB 3GQBA 1XMVA 1KO5A 2H16A 1E79D 4OQXA 2AXNA 1E0JA 4MUBA 4OI1A 4P33A 3SI7A 5E7JA 4F38A 3TUZC 4A2WA 1IN6A 3B1VA 1VIYA 4XVRA 3O8BA 3U3RA 1W4BA 1K5GA 3DM5A 3GLGB 1UFQA 3IIJA 4FMCB 1XJQA 2BJWA 4D25A 4C0HA 2QI9C 1HEIA 2X2EA 1CEEA 1NP6A 2RAPA 4UXJA 2J3EA 5B2ZA 1VCOA 3O8CA 1KDOA 2I1QA 5FI0B 2BKUA 2IXEA 2IF2A 3KQKA 5BN5A 1EFCA 2QAGA 4N0EA 5DLQC 1E2FA 2NZJA 2YOHA 4A1FA 1A7JA 4M0LA 1RRCA 4HLDA 2ZJ2A 1EK0A 1U8AA 5AUQA 1TEXA 2IYLD 2C2HA 1MO3A 2E9SA 3B6EA 1U2RA 1KHTA 1UKZA 4PZZA 4PPGA 5JMTA 3OIYA 1EWQA 4Q02A 1BMFA 1HQYE 3ADBA 2QM8A 4UNPA 2FGKA 4KSCA 1XEWX 2JEOA 3K70B 3RDPA 1EWRA 3K53A 1GIAA 2F9LA 3NEYA 1FPMA 4J0QA 1NJGA 4M1KA 4CYMA 3VR2A 3QUSA 1WBBA 4HUQB 2XXAA 4I81A 1SKYE 1UM8A 1K6MA 1LB1B 3AP1A 2ZROA 5G41A 4B73A 5DN6A 3WNDA 3EA5A 4NH0A 4PHHA 2OCYC 4BZQA 4TZ6A 2GEVA 2NMVA 3B2EA 1KJYA 2QROA 5FTJA 3I61A 2G3YA 3FDIA 4URYR 4BUJA 1IN5A 4EFMA 1Z83A 2PCLA 2Q3FA 1H8HD 3AVWA 2LCFA 3D3QA 2QENA 3FFBA 3H4MA 2BC9A 2GRJA 221PA 3A36A 4C2TA 2AK3A 3WMFA 2NPIA 1ANKA 1OXUA 2ZJ8A 3CNNA 3SE0A 4R98A 4KVAA 1RW4A 3VNUA 2GJKA 1G3UA 3AH8A 2ZPTX 4AC9A 4NZYA 2ZXUA 4AKHA 3PJRA 3I92A 2MSEB 2XSZA 1Y63A 2BKEA 3CB4A 3U61B 3K0CC 4YC7A 1OYWA 5TARA 4ZPXA 3TMKA 1X6VA 1AS0A 2HT1A 4B3GA 1E2IA 4C0SA 1W49A 5L3QB 1L4YA 4R2IA 5FPSA 5HZHA 1N6OA 1ZM7A 3KX2A 4V02A 4ZDKA 4MYHA 5CB6A 1Z3IX 1UKVY 1UBFA 3LW7A 4IHQA 3NH6A 2NZ8A 2XB2A 2P6NA 2B92A 5HE8A 4B33A 3KKPA 1NKTA 5CYOA 1SXJE 2FSIA 4G1UC 2CVFA 5DI3A 3NEJA 3Q9LA 3K9HA 3RANA 2BCJQ 2AD5A 2QUZA 1AK2A 4AURA 2O52A 1E2KA 2GVZC 4JKYA 3ADDA 2OILA 2GXAA 3Q5DA 2PZGA 2IW3A 2ZI6A 1G3MA 3LLUA 4M1MA 5FOVA 3ZD6A 1QHHB 4I1SA 3AVUA 4HDCA 4GZLA 4Q7LA 2KJQA 3A4LA 2C9OA 3ZVNA 4C2UA 4QM7A 4ERNA 1EFTA 1FMJA 5KYKA 5EE9A 1N6LA 3GLHB 5K8LA 4P4SB 3CW2A 4QJ5A 2WSSA 1MO4A 1N0UA 1ESNA 1XU4A 4DBLC 2FWRA 3C5HA 1OF1A 4A36A 2HLDD 1IONA 1YVDA 4QOSA 2ZR0A 4YONB 3QXJA 4ASUD 3WNBA 5DGXA 2G6BA 3Q85A 4XWAA 1W5SA 2JDIA 4LJYA 1Z2AA 3WRYC 3R9IA 4B34A 2CCJA 3QBTA 1N5KA 1S1MA 2Q3HA 2QBYA 4S2EA 3VKWA 2QAJA 1X1RA 4JVLA 5BN3A 1XP8A 2IYZA 1CBUA 1D2EA 4TLEA 2ZRFA 3PITA 1MABB 2A5JA 3AF1A 2Z43A 5CM8B 1QF9A 3THOA 2W2VA 4US0R 3MRSA 5P21A 4LC1A 4IFBA 3T06B 4KCGA 3CF2A 4YDSA 2BMDA 3MWLA 4HLCA 1W7AA 1C9KA 5CJPA 2PCJA 1LF5A 1II8A 4URWR 2IWHA 1P75A 5DIFA 5J4LA 2R9VA 2Q6TA 2H5EA 3X1YA 1E2LA 4Q4AB 4TYNA 1S0UA 4URZR 1JEEA 4ZIRA 2B8TA 4FMDB 4KFUA 1L4UA 2XB4A 5AK0A 4TL9A 2JJ8A 3MWJA 2RGXA 4PXAA 1G5TA 1CR2A 1OHHA 2WSMA 1Q1BA 2VHJA 4DXAA 2JLVA 5JJLA 5BYKA 4DLUA 3WBJA 3K0CA 3RRYA 1IXSB 2A5FA 5D3MB 2VHQA 3LBNA 4C0BA 1Q22A 3ZDQA 3Q72A 4FWTA 3GFTA 1R5BA 5G3YA 5FPKA 4TLAA 2QPOA 1CULC 1Z8FA 3K0SA 2IYWA 1K8RA 1QBKC 4Q1BA 2XEXA 3EASA 4IXMA 1U9IC 3DOFA 5DI9A 4X8LA 1VHLA 4PHTA 4TN1A 4DC9A 1NRJB 2F55A 4WXRA 2ZE6A 4XSHA 5KUTA 2WJVA 1RRGA 2IYUA 2I1VB 1TF5A 3K9LA 4URXR 1O87A 1U0JA 1RZ3A 1OE0A 4LDJA 2GVDC 2GK6A 1KI2A 1OH5A 4Q4HB 3GLFE 1F48A 2Q0HA 2YWFA 2VYFA 2ZJBA 2RGNA 2ZRBA 1F5NA 3L0OA 3OEEA 3OFND 3RWMB 4E22A 1GRQA 4D82A 1JR6A 4B6EA 5FOWA 1T0JB 4X8OA 1QHNA 4Q4JA 2RB4A 5L3RA 1Z0KA 1XEFA 1P2TA 3BB4A 4Q21A 2VF7A 4JVMA 1JAHA 1IY0A 1N3BA 1OSNA 3AV0B 3P27A 2ZI7A 1YU9A 3VX4A 1QHSA 3MD0A 3RS3A 3CX7A 1LF0A 4LYJA 3VKGA 3BS4A 4ZKDA 4TMXA 5BXQC 3GLHE 2BV3A 2PMDA 3EZ2A 3ZIAA 2BVNA 3T1QA 1NG9A 1DO2A 1SVOA 2IWRA 1Q1EA 1E9FA 1CJKC 1U0HC 1E1QA 4JL6A 1I2DA 1NBMA 2WAXA 2JA1A 3WBKA 1D9ZA 4XVQA 4BZPA 1S3SA 4Q19A 1IJFA 1JXOA 4RD3A 3U3KA 4B71A 4RFSB 4LHYA 4Q5IA 4DJTA 4D4LA 1P62B 3QJYA 4B44A 4BECA 1ZYUA 1VMAA 2E1RA 5KNCA 1GP2A 3RS2A 5J4VA 521PA 1JJ7A 2P6UA 5KNDA 2Z5FA 1V5WA 4ZDIA 2BCGY 1LNZA 1KIMA 2QNRA 3A1TA 1CRQA 1PUIA 2UZ3A 3B13B 4BPBA 1JR3A 4HB0A 3ZS9A 4M1TA 2WBLC 1Z63A 1NN5A 4DB4A 4FI3C 1TTTA 1XEWY 4RCYA 5TB5A 1BYIA 5DHFA 2BMEA 3SC3A 1E9RA 1Z06A 2AFHE 5B58C 5HKKA 1UEIA 3QKSB 2B7BA 1IAQA 4M9QA 5JFGA 5B57C 5GJBA 3LV8A 3C4JA 1QZXA 3BB1A 4R9UC 2N1BA 3A1UA 2FX3A 2UVQA 2D4HA 1WQ1R 1TF2A 4OQFA 1U9IA 4ZIRB 1WE2A 1ZM4A 4BLPA 4EPWA 2HYIC 2ZRJA 2YZ2A 1Z29A 2BM1A 1UADA 4OHWA 3SJZA 1J99A 3K09A 2EFCB 4JKIA 1G7CA 1EXMA 1YRAA 4BQSA 4LWZA 2QMUA 4ZKEA 1DE0A 3IDQA 2ZRHA 1GG2A 4R71A 3TKLA 1U94A 3VU9B 2XZOA 1H65A 2A78A 1P61B 4C7OA 3CNLA 2QE7D 1R0YA 3HPQA 1EGAA 1ELOA 4PC2A 2MMCA 5KDDA 3GLIE 1CS4C 3QKRA 3HYRA 2AKAB 3DM9B 3R7WA 4NONA 2AFIE 2PH1A 3AKDA 2CNWA 1FTSA 4LK2A 4Z51A 4MKIA 4PANA 4TL8A 1CJMA 2FSFA 2VL7A 4GFDA 4MGZR 4MRRA 1E2GA 1KI1A 2DFNA 3CRRA 2ZR9A 5TV2A 3HU1A 1SXJC 3EZFA 2HYDA 3BXZA 3CF6R 4OK6A 4DSTA 2J0SA 4GZMA 4TQAA 5EZ5A 4A82A 3JZMA 2X1VA 4A15A 2YYZA 3VR5A 4ARZB 4V0NA 1YE8A 5G53C 1AZTA 1J70A 2IC5A 2ZUBA 2ZSBA 3CRMA 2YWGA 1TQ6A 2R8RA 1PUJA 4O2RA 4B43A 1BO6A 4PFSA 4CEHB 1JPJA 2WMNB 3QXXA 4CT5A 3DKVA 4DLRA 4LHZA 3SR0A 4BWYA 1D8TA 4CDGA 3C5CA 4OBEA 3KKNA 2QZ4A 1ZD8A 2V6JA 3UWKA 1MKYA 2PJRA 3VKHA 5CLQA 1E1RA 4BFSA 1JB1A 5EXSA 2TMKA 1CXZA 4V0LA 1O3YA 3HR8A 1F3OA 3EPKA 3RWOA 1AJEA 1E6CA 3UXMA 3KTAB 5KDOA 4ZCMA 2W83A 1S4QA 1XTIA 4KBGA 3B8HA 3KB2A 3QNUA 5E7MA 4A0GA 2DFTA 3KUDA 3NC0C 4AG6A 2O8DA 4LRWA 3OHMA 2QP4A 3LNCA 2R6GA 3I8XA 2QMEA 1PJRA 2PBRA 3QPUA
chains in the Genus database with same CATH superfamily
1U5CA 3K0AA 1ES9A 3K8YA 5T8KC 5BV7A 1E1LA 2VVTA 4X45A 4LN1A 3LT2A 5IAAA 1K7EB 5AHOA 2O3JA 5IDQA 3WK7A 4NY1A 2IHJA 4J3NA 2P2DA 2O2XA 4RTPA 3GEIA 3MCZA 4IOKA 5L3RA 1UWVA 2V7TA 3LDAA 1ISPA 1G8HA 5EN4A 5TS3A 3UAWA 1VSQA 4Q1DA 1XD9A 3PYMA 4MQFB 4MO2A 2J31A 1CJCA 1RI1A 1RJWA 3V33A 2WU1A 4DC1A 1YR9A 5JS1A 3NASA 3RTDA 3K70C 3AVXA 4LOLA 4D8UA 1BA2A 2JBAA 2XJ4A 3N7TA 2FN4A 2QU7A 5DTJA 2F00A 3OFSA 5D5HA 4BQNA 2V5AA 3NV9A 4OK5A 3RKUA 3BZWA 3EC2A 3TI7A 1W2GA 3V9PA 3WKAA 4QUIA 4MKFA 2ID9A 1M1ZA 1QZTA 5JQGA 1U0BB 1C1HA 1ORRA 4JASB 1UDBA 3PA8A 4DA8A 3TRIA 1BDIA 3KHSA 4H77A 1YCFA 3CUSA 3IC5A 3UANA 1W0KA 2F1RA 1JGTA 3WK6A 5LOVA 2RJ3A 4W8OA 1PJSA 2IOYA 2K4MA 1OROA 1DEKA 4HX5A 4EEZA 5LOVF 1UBHS 3BC1A 3RG2A 3K5IA 3BD8A 3BTSA 2O7NA 3AI3A 2X86A 3HE3A 4AD8A 1JEQB 2OZVA 2VPPA 3HZHA 1RJ9A 1QVRA 3EARA 3NC1C 4I3GA 3TM5A 1Z4OA 1Z08A 4EA6A 2FR1A 3K0SA 4JROA 2XKKA 2QIPA 3G7UA 1PJ4A 5KAMA 2QL5A 4C88A 3A1WA 1V9LA 4ALLA 1MG5A 1PWZA 3OIFA 3U3MA 4RGYA 1SXJA 4C05A 1AKNA 1QQ6A 1R5JA 2GLUA 3M6XA 2J6CA 2YJ5A 1T3HA 2I9KA 5C8XA 3QVWA 3TOXA 1M34A 4M1OA 2A84A 3ZHYA 4FDLA 2PGIA 2PGDA 1COWA 1PZXA 1QHFA 1XVVA 3WHPA 5EJFA 3DO6A 3V00A 3WXBA 2OZLB 3CF4A 4QGFA 1BRTA 5F1OA 1RQPA 3ROFA 3SZOA 1RMYA 2QUHA 1KERA 1CQIB 1TF7A 2NPFA 4MUAA 5DLYA 2B30A 3KAQA 3W7BA 4C4TA 2CXUA 2QTZA 3DWFA 5E1BA 4CI9A 1XZ8A 3L41A 4L6CA 3DFKA 2X4DA 3FPGA 3RC2A 4D6PA 5IKXA 3N8IA 3EGXA 2K87A 3FMVA 4S1VA 1CQJB 1B8VA 3U44A 5ICSA 4AY5A 4ZCQA 1EWTA 3UMSA 1NBAA 1I3CA 1WY7A 3WYDA 4J0GA 4KIUA 2M6SA 4GRAA 2PSEA 1XQWA 3LXXA 1VJCA 3QSGA 2RK3A 3FZGA 3UGTA 4BJHB 1HOXA 5I4BA 3AJDA 2Q9BA 1JDUA 2YC4C 3MJ4A 1ZA1A 3KAKA 4Q3CA 3JWJA 5GADl 3HBLA 5FUXA 3F7OA 2WINI 2V74B 5D6NA 1KZ6A 1N8NA 3WAKA 1OH6A 2GBLC 4HTFB 3VKFA 4MW1A 4AG5A 2ZJ0A 3PHBE 2YS6A 4XIFA 3P9XA 3L6RA 2CBGA 2Y1CA 4GT1A 2AVNA 5I51A 4BU1A 4A0FA 3PUWA 3WL4A 1AK9A 4MYDA 3ZWPA 4NU0A 3O82A 1WZNA 4TWAA 4E31A 5FBVB 3GVXA 3HG7A 3JQAD 1BS9A 3AX6A 3CLUC 5FNVA 5K8IA 4L0QA 4J4TA 1CQWA 1MAWA 1PVDA 2ETXA 3JQ9A 4I6JA 5HFJA 2M6RA 1ZOIA 5DO9A 4ER6A 1QRSA 3VISA 4EQ6B 1XZHA 1ZPDA 1KH2A 2HKIA 4F8YA 3PQEA 2XCRB 3BCUA 2NP7A 2ZCVA 1Y8QB 4H7EA 5CB4B 3EGVA 1Z4LA 1UMKA 1DSSG 1KZ4A 2OGUA 4GOJA 4WOPA 3ZWQA 5BR7A 2E21A 1DEHA 5K9ZA 1EK1A 2I4IA 3VBEA 3I83A 3VXKA 1Q50A 2HT6A 1GSIA 1RQ2A 2OBFA 2IH5A 3TGPA 5BPHA 3THRA 3N8KA 1DAKA 4WLEA 2CCGA 2OO3A 3R8CA 5CA1A 1UPAA 4I2VA 5HFAA 1HNWB 1FMTA 5CA1F 3MGGA 5EJGA 1M2OA 1SCQA 2JIZA 3IBSA 4PX9A 4F5WA 1FYDA 2PE5A 1ECJA 4RJKA 2BFDB 1AHPA 1KP9A 1XTVA 3OX1A 5DRYA 5SY4A 3KZXA 1HE3A 5FAKA 2CV0A 2NSJA 4L78A 3SYKA 2QWXA 3UWPA 3MIZA 3OZWA 3E48A 1I2CA 1B3BA 4PLZA 4S1WA 1R0BA 3DTTA 1TVKB 1LFDB 2V7XA 4AICA 4DLPA 5KSPA 1D2AA 1DWUA 5JZSA 3S68A 1P77A 1W0JA 1G66A 2DKOA 4OQZA 3RAJA 2FEPA 2AMLA 1VA4A 3REQA 2KX7A 3LDGA 3O4GA 5CVCA 2C2YA 1FFXB 1RBQA 4LGYA 4BFVA 4D74A 2LIPA 1A97A 1IL0A 4OLFA 3OEHA 5AI4A 3U7HB 2R44A 1MX5A 4INOA 2OXTA 1ZK2A 1EJ6A 2VJQA 4F5DA 3AKYA 2FW9A 2YY5A 3Q1LA 1CV2A 4RGBA 2V6GA 1MHPA 3G2PA 1SCIA 1AKTA 3OF2A 2CDNA 4JIMA 5EKTA 1O2DA 3ZGXA 5JAPA 3TQHA 5LXTA 3HVHA 4BQRA 4EFKA 2A4MA 3PEWA 4J6FA 3F49S 1VB3A 1XTBA 3CEHA 3DE7X 2X19A 3P0IA 4MV5A 3B3GA 5LXTF 4QJ3A 1P0PA 1E61A 1LQ2A 4HPXB 2C42A 5L4LA 1I1QB 5H4HA 2Y1KA 1UQUA 2WHEA 4NULA 3PVSA 2NUPA 4RTKA 4C2BA 1TUEA 2Q6OA 1IBKB 2FPMA 1LU9A 2A1TS 5DMHA 3FNQA 3D8TA 4P8RA 2BKAA 5DM4A 5TIIA 2PGNA 3E9RA 4MB2A 2CFRA 3AWDA 4XAQA 3IJRA 1NUHA 1HTTA 2JFPA 5JH7A 1L4EA 2HHLA 3B1KA 1L1QA 4YJ3F 3UMVA 4DVGA 4BO6A 2PNFA 4BNVA 5JH7F 3G3EA 4QATA 2G9ZA 2Q62A 5FBLB 2W6NA 5H16A 3VUFA 2WR8A 4CODB 1A5AB 1KORA 4N7BA 3FYSA 2HWWA 3DE6X 4UEOA 3ZHCA 5KQMA 4MEAA 1GARA 2ICAA 3DZBA 3WS7A 1R6UA 1HT3A 2O8EB 1KDRA 1SKQA 1ZHHA 4DZZA 1H4VB 4TT8A 5AYVA 3TG8A 1MDFA 1G5QA 2DPYA 3RAGA 3AESB 3RUAA 2O7SA 1Z34A 3CUKA 2DPXA 3G02A 4LMPA 4PGGA 3U39A 2NN3C 2GA9A 4CWAA 3B78A 4F5ZA 16PKA 1CZRA 4DYVA 1VKJA 1HTBA 1J0EA 2ATIA 5A5GA 1M5RA 5KNDD 3T5CA 4E12A 2YHSA 1VG9B 2DBVO 2IGTA 2WG2A 4CNBA 2D7DA 1ZK4A 1ZR4A 3GCGA 4X93A 3HA3A 2C61A 3RV3A 3ZBPA 3PWTA 1E2BA 3MWKA 3BG5A 1KZ9A 4GNKA 4URUR 2Q21A 5A5VA 3THWB 1LDBA 1Z0FA 2Q9AA 5J59A 3B7WA 1BS1A 2O6LA 4P83A 3DG9A 1LZKA 4LJ5A 5FPTA 2P1RA 2P65A 4N65A 4YRPA 3RSOA 4JFRA 1XZFA 3DMTC 3G85A 3QM1A 3AUFA 5G4KA 3A11A 1YFKA 3F8SA 1Q16A 2I33A 5CMLA 5E6SB 2OHFA 4Y2TA 5FL7D 2YS7A 5EHQA 4CG2A 4ZV9A 2OFWA 1CETA 3FYHA 2OHXA 4WXMA 4IIBA 2W70A 4MRVA 5EIFA 4BNGA 3OT1B 6AT1A 2YW9A 3EOBI 2GCOB 2M2IA 3GGDA 5K3FB 1G16A 4MTLA 1AK1A 4EYSA 1RHKA 2AHOA 1TX4B 4L5AA 1NE2A 5EE3A 3TLAA 3TUIC 3BMOB 4B47A 3AR9A 3WJ2A 2HO4A 3WO1A 4DLSA 2Q9CA 3RYFA 3QEBZ 1LDNA 1HYGA 2FMKA 2SHKA 1J2YA 1NIPA 3EZXA 4FSDA 1MQAA 4KK4A 5EXPA 3DR3A 4Y6SA 4N03A 2D2FA 1GFZA 4GBMA 4BNNA 4RF2A 3U3ZA 2H1VA 3QFHA 3WKEA 3KHTA 4ZV4A 1YXMA 2OHHA 1DMSA 1QE3A 2XOKA 1JHVA 1NW6A 3Q9NA 2WJ4A 1V16A 5JATA 1XVIA 3SCZA 5ARDA 2D1QA 4B31A 1F2TA 4IIEA 1ECCA 3CIOA 3UWMA 5DZSA 4ESEA 1AMOA 4E5KA 1FDTA 2GDZA 4E7PA 2ZE7A 3BMNB 1X15A 3LGAA 5J40A 2IU4A 1OU0A 1RAAA 1HK7A 5U1PA 3QEKA 1VIDA 3MRVA 4KXXA 5AHXA 2VA8A 3B1FA 1YGYA 5SY6A 1HURA 4OH1A 4LKRA 3DAPA 3V4PB 4CF4A 4QPNA 5U9CA 1YJBA 1VHQA 2XHZA 1ZS9A 2Z83A 3RUPA 3M6LA 4OXRA 4ARUA 4YCLA 1L3IA 3GZTB 2TECE 3QTTA 4HDRA 4G0ZA 2VH5R 4FN5A 4XFJA 3H1TA 1R8YA 5K8JB 1OXTA 4PGMA 5TS2A 5GZ3A 4K86A 4OY3A 3KWMA 4DIUA 5CFNA 1Z4QA 3QA9A 3ANSA 3OECA 1CUYA 3E8MA 3OT4A 5EHGA 1PAUA 2G71A 2O2IA 4N5HX 1R8JA 5DB4A 2Z6UA 4ZI2A 2YDXA 4LGCA 3GLGE 2VNKA 1Q6YA 2XB6A 5I8WA 5GGXA 1GUZA 1SMKA 1R8QA 3IRUA 4PLGA 1CKEA 3WGZA 4MYTA 1KEWA 3AGQA 3D31A 4J94A 1ZO8A 2BBOA 3U49A 5BRNA 5ICCA 4RSGA 4YYEA 3A2KA 3HSKA 1KFBB 4N3AA 2WJWA 4BLQA 4TRRA 4YJ2B 4BX8A 3LUJA 2DR3A 3B1YA 3KNZA 1DC6A 4RFLA 1KI3A 1DT5A 1ESZA 3LZ6A 5CAEA 5I7FA 1XCGB 1YZVA 2AX4A 3IP8A 3L8CA 5C37A 4NDAA 4AULA 4JYCA 5D01A 4XFDA 4WA8A 4ETMA 1ZUIA 1FLDA 4WCFC 3M1IA 1CEQA 3E3OA 5CR9A 3G68A 3INGA 4Z3OA 1P2FA 5BN5B 3FWPA 3B9RA 2AEFA 4COOA 1B1AA 1NBIA 3DDOA 1BGXT 2W5UA 3NKVA 4URHA 2WT9A 5ARBA 1N9KA 3IS3A 3UXHA 3ZDAA 5BQ5A 4KR6A 2H29A 2IYRA 1YB5A 1YS7A 2GNOA 2BGNA 2R79A 3D8NA 4MPDA 4C0QC 3I5AA 4ZTZB 1ZL0A 3KL4A 1Q57A 4WESB 4MUMA 4ZI7F 2GK7A 1TA9A 4P0PB 4UAGA 4NE9A 5T5QA 1TT5A 1V7CA 3B2QA 4NMMA 3VVMA 3FKJA 2FSSA 4AJKA 4M1EA 3ASZA 1A98A 2DHEA 2H3HA 4F4HA 3RWBA 4CV1A 2AOTB 3FYUB 1HT2E 5IK2A 5FBWB 4Z54A 2FPUA 4CEJA 1K3UB 1TIPA 2CDAA 4MV6A 4EY6A 3RTGA 4Q66C 2G80A 1PGPA 3QU4A 2XGJA 1GYRA 1RM4A 4E6EA 2XXAB 5IJ9B 5BXYA 2HF9A 2PY6A 5LSAA 3P9IA 1LSUA 4TTSA 1G3IA 1PHRA 1QVWA 3R3JA 4IM7A 2ZTMA 3C1AA 4Q3KA 3DSRA 3TSAA 1N2CE 3MT0A 5KAPA 2NVUB 4JOBA 3MJFA 4WN3A 3SYNA 2BBWA 3Q3EA 1WKBA 3A05A 5AIAA 2G1AA 1RNLA 3GRUA 4XX1A 1XRRA 4MVJI 1GNPA 4V0RA 2DX7A 3BTVA 3C16C 4FEYA 4IXNA 2YOGA 5E2BA 4GU5A 5ESRA 4B85A 4DV6B 2GF0A 4TX1A 2ZSJA 2C57A 4RPLA 4H15A 3FSGD 4FGLA 1Q20A 4ENWA 3HI4A 1XWIA 3G7SA 1VE6A 2XZTA 4JQCA 4RV9A 3AJAA 5J2TB 3Q87B 4FZ5A 1Z6QA 3BQ9A 4DQLA 2SKEA 9ATCA 1U04A 1EM8B 3QE2A 1QF7A 3KKQA 4QBTA 1P5RA 5G0WA 3ICPA 1GZ5A 4KXVA 2OXRA 4D9NA 3IQGX 4AUKA 1KJZA 1D4AA 1NVUQ 6GPBA 2OAQ1 3DP7A 2I8LA 3SOZA 4PQRA 4PPNA 2IS1A 1P6QA 1KGSA 2CGEA 1TPYA 3Q5GA 3DHYA 1R6XA 2BGJA 4LY0A 1QR6A 2J45A 1DAHA 3LQ1A 1PVOA 2X6RA 4B75A 5GZ1A 2HHAA 2J67A 3E82A 3E84A 4UZEA 4ECAA 4ND6A 4CIWA 3B1JA 3I30X 4KNWA 3WTCA 3AEZA 3PI7A 4P7GA 2H5IA 2MSKA 4HNAA 5ALKA 4BVEA 3JZFA 4Z2AA 1RQLA 1UWCA 5EXXA 5LBUA 4KPFC 4YQFA 3ECCA 1RKBA 4BMNA 1U3TA 4XFKA 3OESA 5ELXA 3RV4A 1PX2A 4ND3A 1H3FA 2JAUA 3GO4A 1MB0A 4US1R 2WUDA 1SVSA 3MYRA 4L76A 4CLRA 5HYVA 3B3FA 5TT1A 1FSSA 4RD4A 3C85A 2AW3A 4UE6A 2A1UB 4W7SA 1DUVG 4DMCA 2WQZA 2X7JA 1YNSA 2DMRA 3IAS6 4NBWA 4WCFA 2PAAA 4JJEA 2IEGA 1J7JA 1WQ4A 3AEYA 5AKXA 4J1NA 2F9MA 4G2NA 4JLDA 1E79A 2WOOA 3NYQA 4HKTA 2UZ4A 2IUFA 4DR5B 1KDTA 1SO8A 2IDZA 1ZQ9A 2WJYA 3H2JA 4Q7EA 2E5LB 2NPOA 1RE1A 4I08A 4R41A 2IXDA 1QRUA 1Y82A 1B8UA 1EUDB 1NXTA 1MOPA 4Y6OA 5AK6A 3VRHA 2B21A 4BNFA 1V2HE 3DKPA 3QUQA 3KQQA 4QYMA 3TDMA 2MSNA 2H4FA 2ZBPA 3PUHA 2WOJA 2ZREA 3QPVA 2EW1A 2PL5A 5DEOA 5DKFA 1FJHA 3ABZA 4YRBA 5HRAA 3CWCA 1LW6E 1SZPA 2UUAB 2V7QD 4LOAA 2VQ3A 4ZT4A 1WTCA 2GF9A 1KL7A 4JNCA 3B20A 2D62A 4M86A 2CJWA 2PUVA 3IEVA 2ORED 4OA5A 4EBFA 2EP5A 2ZYAA 3O2JA 3SR3A 1KKUA 2LV8A 1RAEA 4IWNA 2ZT6A 4GP7A 3UKOA 1WMEA 4PC3A 2WIJA 3CZRA 4HRVA 1CUSA 1JAXA 3I9V1 4ZDWA 3SJAA 1T4DA 1KYIA 2WPDA 1OAKA 2Y71A 2DWQA 3RIGA 4ZHSA 4MGEA 5KTTA 2PS9A 3IL2A 3H8SA 3QQ5A 4IUBS 1JDNA 2ZPUA 4IDHA 3L7KA 3LUAA 5J1SB 1VMEA 4WEQA 5JNLA 1SKAA 3E15A 4QPCA 2LXNA 3DGEC 4L4SA 4UE2A 4COKA 3RFFA 4FDMA 5H1YA 5IJ0A 1QH1A 4KAFA 2RHJA 1ZP6A 3LXUX 1UEJA 4QLAA 4O4JA 4KO1S 1ODCA 4TVKA 4KWIA 2AKYA 1D3AA 3GZNB 5SZIA 3STTA 3J7AC 4H31A 1R0LA 4O4JF 4A6PA 1GZ4A 3UEOA 4F1JA 4I1YA 3URKA 3A7EA 3PX7A 1XU9A 1GA1A 1Z8DA 5C7YA 8ADHA 5LZ7A 4BQOA 2FPRA 1C1DB 5FNZA 4P4LA 1HRKA 2XMGA 3COSA 2DH6A 2J33A 2YMQA 4XVHA 2ST1A 4OP1A 3KQPA 3DP9A 4PRYA 4A6DA 3G9QA 3HCEA 4C03A 1N25A 2GEDA 4HGYA 2ZDQA 3UJHA 1V45E 4II7A 5A2QA 4UNSA 4AKTA 2AMVA 2R751 3TW8A 1C7IA 2VHUA 1AGYA 2CF5A 4HN4B 2IQIA 1H2BA 4BMPB 3OI7A 3MA0A 5EZYB 2FB9A 1TPZA 4JGBA 3T5MA 5DCYA 3ODPA 3HDTA 4IIFA 3A1SA 4OHXA 1P2UA 2I87A 1SM4A 4QU9A 5AK5A 5M5BA 1Z6AA 2OSBA 3FCCA 1TYZA 4U6SA 5DSZA 5HE9A 3V6MA 5KNBH 5HDBB 3LP6A 3MOGA 4Q3AA 4KYTA 5D1NA 5HF5A 4QYXA 2Q2QA 4KH0A 1J2RA 3C8UA 2NXCA 2FHPA 1QX3A 1XGKA 2XWBF 3HKCB 2ETVA 4MWSA 1F60A 4KTVE 4G0YA 4RMJA 3DCYA 4UEKA 4DSOA 2DWOA 1XAGA 2C7OA 3TAUA 5JI3E 3G0GA 3GP8A 2QM7A 1G2IA 3ZJ5A 5KYYA 3GCXA 4G0MA 1CUGA 2ZJ5A 2XRYA 1KVQA 4TKLA 4AJOA 4D0NA 1FVXA 1L6IA 4ES6A 4G97A 2MMGA 4Q4JB 2VHTA 1K1EA 2ZI4A 1U90A 3BORA 4B84A 5EYPA 4RA9B 5K0NA 4BNDB 4ZOBA 4LHWA 5DHAA 3T3PB 4CVNA 3LP8A 2WB2A 4DLKA 4WAUA 3ESXA 5CFZA 2FQXA 4DRZA 3PU6A 4IUYA 4D3YA 3A3KA 4CKYA 4ZVVA 2IKQA 2WT4A 3HJRA 5CM9C 2QVGA 4FYJA 1H3NA 5FA5A 3P2KA 2P5UA 3NT5A 2A0WA 1KZYC 2J3LA 4G1FA 1PYGA 3ZU6A 1PR0A 4FMBB 5C80A 9GPBA 4DLXA 4BGUA 4N18A 4OFBA 5CDFE 4NOMA 2N1MA 2XVXA 5GM2A 3A04A 4MV1A 2OFOA 4G5YA 4OHOA 4WLOA 3USCS 3DNPA 4UNNA 4GWGA 4CMIB 1DQSA 4WWHA 5C53B 2YXEA 3KVNA 1EX6A 2HLDA 1IHOA 3DCIA 4QQRA 1E0AA 1E2NA 1W4RA 4W1RA 2WJIA 3RTCA 2PQ0A 4ASUA 4DE5A 1JXQA 4IDBA 3IESA 4KE6A 3K20A 3W2IA 2ZLBA 2BFFA 4M7RA 5AVWA 2AZ4A 5C4GB 1QHEA 2QX8A 3G5UA 5CX1A 1MAAA 1RFGE 3T95A 3EFOB 3FPAA 1M54A 2CJFA 4C06A 3R77A 2NXEA 5I9MA 4CT0A 3F5FA 2FP4B 4DJ5X 4LF8B 4RD1A 1DFHA 1ZHFA 3DTVA 4E03A 5K51A 2DUUA 2WIDA 3CPSA 2HQOA 1ORIA 1SVWA 3VR4H 1GCIA 3OOSA 1Y5IA 1U6JA 1WRBA 4IR7A 4P84A 3UV6A 2PT7A 2ISSD 2IY9A 1QE0A 2XTMA 3CLRD 4MARA 4NJMA 4OO3A 5AO9A 4BP3A 2WZCA 1NNI1 3JWEA 3F6EX 1OBOA 3KYCB 1SXIA 1BXKA 2OP1A 2PT6A 2W0MA 3L3BA 1P7CA 3P0HA 2UZIR 5IAJA 3WMWA 1KYXA 1OXKB 1RP1A 2JFHA 3IUEA 3P45A 3T0IA 4I1PA 1KE2A 1DAPA 3FVVA 5DN6D 1IB0A 3WIOA 2L0XA 2Y1OA 4IHJB 5CFPA 1HQKA 4I8DA 2Q8PA 2HSWA 3L7YA 2H7YA 4RV5A 4J16C 2GM4A 5CM2Z 1XEXB 1Y37A 1OT3A 2HMTA 3V1YA 3UJ3X 4EF6A 5JDIC 1KBZA 1ZZEA 2ZP1A 4KRYA 1OA0A 1SHTX 1VPVA 3VPBA 7ADHA 2CV2A 1XZCA 1Z6TA 1VYTA 3OZEA 5FUMA 1F2UA 3TQIA 4CR8A 1IOZA 3THXA 4HN9A 1SUDA 4WXEA 3R0ZA 5AP9A 3D5EA 4TRNA 3DPUA 3GEBA 3WNVA 4D0SA 1K7FB 2O2CA 1RRPA 1T43A 1TJYA 1L4NA 2OV2A 4OFZA 4XA8A 2DJ5A 5EWMA 5TVKA 1EI9A 3ESAA 2PX8A 3UUWA 1CRPA 1Q0SA 4GZ6A 3U5TA 1UT5A 2I65A 3EK2A 2AWNA 2JH3A 3BF7A 1UZMA 2FPSA 1U11A 4FUTA 4D3DA 4C7OB 1GRRA 1A9SA 2ZYIA 3IEIA 5IXYA 1T3LA 2E4UA 1OPRA 5DX0A 3LA8A 2AHRA 3VR3D 1WMSA 1M0TA 5GVRA 4D41A 2Z5LA 3AR2A 5FWYA 2PVCA 3ORFA 2P0YA 1QJ4A 2OV6A 1Q1ZA 3FCUB 1F0KA 2FE1A 3M6VA 2NU8A 4N47A 1CRZA 1EA7A 4W5NA 5CT4A 1AO0A 2UV8A 2DWUA 4O2AF 4YGYA 3ROEA 3GLGA 4F4DA 3FYTA 3H84A 2F2TA 3H4TA 1ULAA 4WFJA 4C7KA 1QIIA 2YJGA 2PYIA 2D06A 3N58A 3F67A 3NFYA 4NJOA 5KREA 1YZQA 2IHBA 1DIHA 2HEGA 3P32A 2EFDB 2Y1WA 3QHAA 5D3QA 4A4DA 4FOOA 1BMQA 4YGXB 1P8AA 2G7ZA 5JISA 1E1DA 5AKZA 1UL1X 4H6PA 4IOLA 4JA0A 4HUTA 1WUIS 2EFGA 1MRSA 4EG4A 4ZOQI 3EIEA 1YCHA 1FP4B 1H2FA 4LV8B 2IP4A 4IIXA 5I7AA 4EFNA 1YS4A 1DAIA 1ZD2P 2VDWA 1VRCA 3A10A 4EUSA 3MFYA 5AVXA 3LVQE 1UZUA 1P5ZB 4GXNA 4YRSA 4F7WA 5ANRB 5LKAA 1YOVB 3PL1A 2RBGA 3SE7A 1EFPB 4BEBA 2GT1A 4MUXA 3JRWA 1W87A 2VI5A 3IO5A 3PQ6A 5FFFA 3H1PA 4MQLA 1DLJA 2WD9A 2O3QA 4U8HA 5ALTA 5H70A 1GU0A 2I80A 4JJKA 3G1TA 4L4UA 4CLOB 1Z0JA 3C14C 1NBME 2ECQA 4G3XA 1S9HA 4J0DA 3HPRA 4KQXA 2CC2A 3FLAA 1GOTA 4E21A 4F11A 1SWWA 2P11A 3IR5A 4HBGA 1G7TA 5CJ2A 4YN3A 4DR7B 4U2KA 4UHCA 2JHGA 5EXEA 1GHTA 3DVLA 2CDBA 1PNRA 1OMOA 3B5EA 2H65A 4H6XA 1Z4JA 3CN7A 3KS9A 1P81A 3GAAA 1K92A 3CPEA 4C3ZA 4RXMA 4GHWA 3L79A 4UVHA 3MG9A 1OWNA 2C84A 4B6PA 1L6RA 1ZM2A 5A0VA 5AFSA 2ZCUA 3UMBA 4WRRA 1GADO 5J5CA 1L5FA 3FROA 4ZCRA 1HA3A 2A7XA 3GB9A 4NF2A 1X14A 3U17A 1RABA 3UV3A 4FZRA 4RTQA 2IHUA 4L8GA 1L5QA 1N2CA 3WIVA 4ZHQA 2CVHA 3DAGA 4OFWA 1G2OA 3CH7A 3D1LA 1MTZA 2WIFA 3FDJA 1DINA 4FYWA 4ZHQF 4KQ9A 5DH9A 1FUKA 1UMDA 2VT2A 2AJBA 2CN1A 1C4KA 4RIEA 1LSSA 4WNAA 2GM5A 3QPDA 1N2GA 2I3DA 3LX4A 4ENVA 2HFJA 4RY2A 5FHRA 3BEDA 3IBFA 1EDDA 2HCJB 2J5QA 2QRJA 1RACA 4ZAWA 3CMMA 4DF3A 2JGNA 4EG0A 2WYIA 5L3QA 1ZD1A 3VDQA 1ZUNB 4D99A 3GJXC 4JELA 4WXPA 5ALZA 4NMXB 3WL7A 1E3SA 3T7DA 5THXA 5B53A 3V5NA 5JV5A 2GZHA 1PNOA 3PVCA 1NC3A 4V03A 2JHPA 1OCEA 1VGRA 2H0AA 3QEJA 4MDYA 1VGQA 3OCCA 3A14A 5DXFA 2K2QB 5K0EA 1DKMA 4PNHA 4QBGB 1XZNA 1YVUA 1FCJA 2G5GX 1Z5ZA 1F7UA 2YVKA 3HXKA 4Z4EA 3WYCA 4Q03A 3ANXA 1ZJ6A 3SJBA 4LJ4A 1A72A 3LL4A 5CLLA 5AVKA 3PXUA 3WP1B 1G8MA 2C3MA 5CH8A 1K7CA 3L46A 4AS2A 2ZAIA 1SAYA 3V4VB 2QQGA 3C1OA 4HB4A 1Y4ZA 3LDHA 1Y7LA 5EEHA 1I2BA 3GVPA 3TD6A 1B2LA 4KR2A 3A31A 4EG8A 3GIDA 3NALA 4CKCA 3RRMA 1JAZA 3U26A 1ZN8A 1YB2A 5HUJA 2W2LD 4QYIB 3RHFA 1B74A 2H2FA 3TW6A 3LRTA 5CCXA 5BWMA 1LVHA 3L8GA 2VUHB 4JOSA 3IEUA 4WY8A 4FFRA 1OH8A 2LE0A 2H1LA 4J1SA 5DHQA 3H0KA 3OZFA 1D2RA 1Q3HA 3EOZA 3IT2A 3RSCA 3CM0A 2FFJA 2HJVA 3T35A 2J9ZB 4LAFA 3VVBA 4BUCA 1PFVA 3GCWA 3GRKA 3X2EA 3MGAA 1E64A 2RAFA 4G1CA 3W77A 4LK3A 1ZH2A 2VAPA 4R5HA 5BOSA 4AMBA 3KQLA 2X5OA 3KQTA 3EWSA 4CV0A 4B7XA 3NWOA 2RSLA 5FUWA 4MH0R 4S04A 3Q3GE 2LCQA 3U4QB 1KSFX 2HQSA 4G65A 4TXNA 4FLEA 4DANA 5ICMA 2R96A 2GO1A 5DYGA 3MTGA 4QAQA 4R83A 1ISJA 4RELA 1G0OA 4BNMA 4YMHA 3DQPA 4CFZA 1O9HA 4XIIA 2OBYA 2EX4A 2RIPA 4HB3A 2XCIA 1RI2A 4CTJA 5HTOA 1H5QA 1TYEB 2HXYA 3AGPA 3WGLA 3R7DA 4TTQA 4UU0A 2NU7A 4XB6B 5A6VA 4UUAA 2CFIA 1PL0A 2DPMA 5AT1A 1HV8A 2RGWA 4B6GA 4QOGA 2ACKA 3NKLA 3W8NA 5JR3A 1ZAYA 4OQLA 2ERCA 2FRDC 3PQ3A 3PGKA 4X6LA 3ICOA 1F6DA 2VP0A 4Z86A 3TD2A 1OVGA 4NQZA 3SS7X 2HK6A 1H4TA 5K2MA 2WSIA 5BMVB 5I7RA 1Z6GA 2CVQA 3F9CA 4QBHA 4R7GA 2DC1A 5LUBA 5BVHB 2QF7A 3PC8A 4RX1A 4D3SA 4E51A 1NMYA 4PFQA 4JB2A 3NHZA 1VPLA 2F1JA 3HJBA 4POAA 5A62A 4U7FA 1HE5A 3H04A 4FFBB 4CM4A 4GI5A 3DHWC 3MLEA 3AM3A 4IBOA 5KYUB 3C6YA 2VF5X 4IIJA 3V8MA 3EWIA 3OWXA 4L15A 3ZU3A 2IXFA 2NT4A 4I5DA 4IIJF 5EHNA 5LMNB 4KNYA 4D6YA 3SK0A 2PX2A 3HCRA 3PNKA 1V47A 2D0PB 5FDFA 3HKDA 1QOZA 1KK3A 3OO0A 5CDYA 1H6CA 2X6QA 1CD5A 3UT5B 1M73E 1PEAA 1U7XA 4CV3A 4NZPA 1ZUWA 3OQIA 3DAHA 3EA4A 4MA5A 1YBVA 2I6QA 2KWIA 3V1NA 2QTLA 3ZXUB 4B6JA 4BNHA 5FWXB 1RWXA 1I80A 1BVHA 4LXIA 4I50B 4PSVA 5KSOA 4OV6B 4C01A 4TLBA 3GLIA 4AIIA 3K9NA 4KX3A 3C97A 4CBVA 3IEMA 3CVUA 1W1UA 1Y4UA 5AJYA 3BGWA 4QO7A 5JWHA 1A9XA 2D1RA 3PNPA 1N4DA 1UPTA 1J5EB 3QF4B 4M0UA 4Q00A 1P1KA 4ZAGA 4YWHA 2LZ0A 1H05A 3GJSA 3IAM1 3KU1A 1PCXA 4DLLA 4RVSA 1MEEA 4C0JA 3T99A 1NJ8A 1IWBB 3ZH9B 3LD9A 4FFOA 3U09A 3GAMA 4D79A 4RPIA 4U2BA 4LYYA 4W9MC 3ROQA 3DYBA 3VR5D 2LNDA 1AOXA 1H6AA 1W8DA 1Y4AE 2ZE5A 3VJKA 3CWZA 5CFQA 5ITZA 3OPNA 3I39X 4JLMA 4P32A 1LSJA 4JJIA 2K2WA 1MR3F 3QEOA 3A4IA 1LWNA 2QTRA 4K6HA 4MR8B 4DPKA 4R8KA 1ATIA 1MA3A 3A1DA 3OHPA 4U7JA 3VAAA 4LMAA 3PHCA 4D81A 4ZICA 3U5ZB 3I2JA 3AZQA 4Y30A 2VP3A 5IJXA 2DSNA 1A9PA 5T6MA 4DV2B 3VDNB 3KXLA 5JS2A 2VJAA 2W8ZA 3IAFA 4XTCS 3TIIA 3ZQUA 5LZ9A 1N5IA 2AG8A 4OXKA 1BQ4A 4PLYA 2GPJA 1IYZA 1UWKA 3ZVMA 3KJIA 1GITA 1NLFA 2R4UA 4MRAA 4BS9A 2CDCA 2R1VA 3PCTA 3PGXA 1R6AA 4R2WA 3C45A 2EG5A 3I4FA 5AJVB 3VH4A 2F1KA 5B6IA 5AW6A 2MINB 2QRUA 3DWIA 2GD6A 2H2WA 3HFJA 4CMCA 1S2IA 2GEUA 2PMWB 5CDFA 1THMA 2AZDA 1A4IA 1NVVR 1XO1A 3P9PA 4FCCA 4RFSA 5BSGA 3G79A 4JSRA 1NHGA 1MB9A 3NNNA 3T1TA 5FWAA 5IFKA 3VZPA 3ZY5A 4RW0A 4B3BA 2MR5A 3MMNA 4FCWA 2Y27A 1U5BA 4AF7A 5L51A 2AG0A 4HJXA 5ECGC 4UCWA 2GS9A 1KZ1A 1N0HA 3R9WA 1G5PA 2NQ2C 2BGUA 1S4MA 4LE2A 4OLHA 3E2PA 9ABPA 3EXFA 1M3SA 3BXOA 1GKLA 2A0FA 2O5VA 3L8DA 1I1OA 3I2GA 5AM1A 5JCXA 1KWGA 2P9TA 3ECSA 2WTBA 4MVCA 5KTPA 3T41A 3UK1A 3NYWA 3AR8A 4KJXA 1KEVA 1Q1QA 1RR6A 2A2ZA 1PVVA 1U3GA 2NVWA 3QMWA 4JKOA 3RT1A 2BHRA 3ZGNA 4EFDA 3NVAA 5ECDA 1U0FA 3GUCA 2GCNA 1GV1A 4WI1A 1D4FA 4XYMA 3L82B 5FFNA 2EJTA 5A2GA 4DYDA 3W8EA 1ZLYA 2XE7A 3ZY3A 1I3KA 5THKA 4POOA 4FHEA 1COZA 2JLSA 2HU2A 1PIWA 2H6EA 3GHHA 5C18A 3FCOA 2FMUA 4TVBA 1TAHA 4LNUB 1KARA 2ZRNA 2DPLA 1BKYA 4P58A 1QH8B 4Y2GA 4EI8A 1BH6A 3D5TA 3RYHB 1Q91A 1N2XA 3Q8XB 1B23P 3CLTC 8AT1A 1GKYA 3AHJA 1WDKA 2BFOA 4URFA 1J7KA 1Z0AA 3C7AA 3HC7A 1A96A 4DG9A 4ROTA 1TMOA 4NYIQ 3T1OA 2DQYA 1TMKA 3BK1A 3D2AA 3OWHA 4FFMA 1Z7BA 5FOSA 2W22A 1AQ6A 1ECFA 3A0UA 3IR6A 4AK9A 4A2PA 5HUQA 1C30A 4FT2A 1S89A 3NTQA 4WXHA 2X9QA 3WWYA 2MSCB 1EA5A 4J49A 3KJNA 1LRLA 3NXSA 4H1VA 2D5CA 2BI7A 2JAOA 2VDQB 2ADMA 1ZD4A 4MW2A 4Z7JA 1ND5A 4QTUB 1WPRA 1XD8A 3E0XA 3V7NA 4E08A 1HR0B 1J2EA 5EMHA 2KS6A 3VH2A 1EGQA 3K09C 4PO9A 3I9OA 2VTBB 3CBQA 3R6LA 2VSQA 3BQNB 3W04A 3DTYA 4ZMBA 4EO4A 2OCGA 2WILA 1A3CA 1NJ2A 1NT2A 1J9ZA 4FHZA 1KVTA 1OZ0A 4Z8XA 3T7EA 1CUVA 4YJHB 1NMEA 4YNBA 4YPVA 2A9QA 5AHWA 4YRQA 3HVKA 1OIWA 4CU2A 4EAQA 4F3KA 2O59A 4JJ4A 1RTKA 3EVDA 1H1LA 4V2UA 2O0MA 5EUMA 2IHVA 1X8JA 2A30A 3TLZA 3GVIA 4UJ3A 3ZTYA 2ODAA 4CNQA 4GE3A 1PK8A 2QSJA 4IVRA 4MRSA 3DEKA 3C7TA 4LXYA 1TJNA 5GZ6A 3ZCQA 1H93A 1GEEA 4LI0A 1V3TA 2OD2A 1M8GA 3GN2A 1MIOA 1NXVA 1RHRA 1HXHA 3ZQKA 4YRKA 2FJPA 4QPJC 4AN4A 4DLAA 4CE6A 2WYHA 2ZWPA 1J1ZA 1FSGA 1R6BX 1YC5A 2AN9A 3SS9X 1E3IA 3PNYA 3PHJA 1RADA 1F6BA 2B0JA 4RPHA 5FPHA 1JA1A 4G5FA 1YHZA 4ZCLA 4I4NA 1Z07A 2K5UA 5LL6P 1OLSA 5AVOA 4CR7A 5SZKB 2X23A 1G3RA 2CXTA 4E88A 4B3SB 1KK0A 2HIHA