1C2YA

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MNELEGYVTKAQSFRFAIVVARFNEFVTRRLMEGALDTFKKYSVNEDIDVVWVPGAYELGVTAQALGKSGKYHAIVCLGAVVKGDTSHYDAVVNSASSGVLSAGLNSGVPCVFGVLTCDNMDQAINRAGGKAGNKGAESALTAIEMASLFEHHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (LUMAZINE SYNTHASE)
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly.
pubmed rcsb
source organism Spinacia oleracea
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c2yA00
1KYYA 1RVV1 2C94A 1ZISA 5IM4A 2B99A 1HQKA 2I0FA 1KZ1A 2A57A 4J07A 2VI5A 1NQUA 1KYVA 1C41A 1C2YA 1KZ9A 1NQXA 1T13A 2A59A 3NQ41 1DI0A 2OBXA 3MK31 1XN1A 2C97A 4KQ6A 1KZ6A 1NQVA 1EJBA 1W29A 2JFBA 1KZ4A 1KYXA 2C9DA 2C92A 2C9BA 2O6HA 2F59A 5IM5A 1NQWA 2B98A 2A58A 1W19A
chains in the Genus database with same CATH superfamily
2MSCB 1O95D 1FW8A 2BFBA 5AJUA 3IQXA 3OFNA 2ZVQX 3PXAA 4S1OA 1GZ6A 3P9NA 4RPHA 5A03A 4NV3A 421PA 4BYMA 3RWBA 1UEXC 5CJ2A 2FMKA 4QT4A 3GH1A 4FBMA 4F1KA 4DNOA 1LPBB 3LG2A 4B3CA 1GLNA 4YRIA 3EXHC 3EXHA 4MVJE 3SZOA 1TJ3A 2ZOSA 4OHBA 2YVAA 1T2NA 3OHPA 1JZSA 4B45A 1COWD 4DLSA 3LQYA 4EZEA 3BKXA 2WTUA 3QU4A 3BXPA 1RHUA 1T6ZA 3A9SA 2FWAA 2W2LA 4UHKA 5FWDA 5JJBA 4M21A 1WSAA 5T57A 3QJYA 1V26A 2BGLA 2CYAA 3N1UA 5FTKA 2B9EA 4HQ6A 1YJCA 2JLWA 4RUKA 1BD3A 1XXHB 3UT0A 4L6IA 2J0VA 2O2YA 2XVMA 4X8OA 3ZTWA 3ZVRA 2GXAA 5D3KA 4Z9XA 5CT8A 4S0ZA 3DGFC 2PTGA 3NATA 3GV0A 4RVUA 3SM3A 1G5TA 3IULA 1CJBA 5I7RA 4GNKA 4IYRA 1OVGA 5IDXA 1UXOA 1SBIA 3Q8LA 2Q49A 1PJAA 4OD0A 1DBSA 5DGIA 4EPTA 1E7QA 4IJ5A 4RDIA 1DGQA 1FE8A 3V7WA 2GAAA 4MUBA 4RADA 2TMKA 4U02A 2R6GA 2ZKIA 1E61A 3HCBA 2IHKA 4CQMA 1MH9A 2QIPA 3C6BA 1O58A 1XFDA 4YAWA 3PJGA 1SURA 4D81A 2AN9A 4MEJA 3OTIA 3AKCA 3H9UA 3M2TA 3TTWA 3B6KA 1I5RA 5J4KA 2R8RA 3GA0A 2B6NA 1FK8A 4OREX 5LA6A 2KPOA 5KWIA 3A6FA 1E5TA 4OB7A 1QVZA 1M5UA 3WK5A 3VR3D 2JLSA 1HI9A 1UPCA 1PX0A 4H7IA 1W94A 2EJCA 1NMEA 3QXJA 3QYPA 4U9HS 4XB6B 1XLWA 4A82A 3PXBA 4J0DA 5LA6B 3WIEA 1M6HA 4X94A 2GN8A 1OF1A 2BCGY 1JVSA 3HJNA 3QVLA 4MQUA 3G5LA 1HYGA 2WM3A 2BM9A 3IURA 5CLFA 4WOBA 3TDMA 3WAGA 1BJKA 1VGQA 4IIGA 3HXMA 1PT8A 2PZBA 5FO0A 4P7BA 1G59A 4L4YA 1ZNZA 4AB1A 3TF5A 1BDHA 5A9RA 5EG5A 3KZVA 1QGYA 2X14A 2BFMA 2BGNA 2ZSFA 3LRTA 1DBPA 2HYIC 1P9OA 4U3JA 1NUQA 2VATA 3DH0A 4IX1A 4MPRA 5A3QA 4EX7A 2P40A 1I10A 1QDLB 1D1SA 4JT8A 4J07A 1CFZA 1NU6A 1RWKA 1A4XA 1VSQA 1C3OA 1R0LA 2H5LA 5DMHA 3ZPXA 5KWJA 4PGFA 4G1BA 1GUDA 3GFQA 4ME6A 3PQ4A 1THZA 2FLWA 2VF5X 3QA9A 4LS3A 4QODA 3BWVA 3L7YA 4MW0A 1E9RA 2FR0A 4FYMA 1JIVA 1UPFA 2ONJA 1R5OA 1WVIA 2WHPA 2OXRA 1T8SA 3G8BA 3HJGA 3PCRB 3PUZA 5JMOA 5TIIA 4RZHA 4A0SA 1CK4A 4P86A 3LXXA 1C7IA 3TI9A 3VPDA 3RROA 2Z3WA 4RQBA 4JS0A 2P8SA 2QN6A 1K8XB 1DOZA 3F6RA 4ZVTA 4ZYVA 1QMGA 1ZI9A 4IV0A 1Q0QA 1W1UA 1W96A 1CS0A 1PR5A 4M0LA 2VYND 5FT9A 3RG2A 2XNSA 1HE5A 1K5HA 1TJ4A 3BHIA 4CDRA 3MHTA 3QUCA 4TLDA 2DH5A 1JEQB 4UXHA 1COWA 4EGQA 2H08A 5FPSA 3Q6NA 1HFKA 1KVUA 2PK3A 2Q6TA 4DR6B 1S2LA 3A1TA 5FI0B 3SKXA 3QQ5A 5FI3A 4NG5A 1II8A 1DAKA 4NK4A 1H65A 1S89A 2CK3D 4G26A 4MOWA 3D8UA 1RBMA 2IUUA 4EB0A 4N48A 4M3NA 1BH6A 4HDMA 4M6WA 4WK0B 5LP6F 1TYBE 3MJEA 3ROQA 3C7DB 4A6EA 3I0ZA 1W29A 3IHWA 3IOBA 3EG9A 1QIHA 3WGZA 3GP8A 1V39A 2A5JA 4Q24A 5K8VA 2RB4A 1SG6A 1TYEB 4CMEC 3ZE8A 3KEFA 4FFPA 3GZNA 3N74A 4HB0A 3CONA 2XWQA 2UXCB 1CEYA 1KO1A 2PAAA 1F3LA 2VBCA 2ZYDA 2OBYA 2DTDA 4P82A 1IN8A 1FS5A 1GGVA 1YA8A 4P32A 2DECA 4Z3KA 4I4NA 5IEBA 2QROA 4UJ3A 1U90A 5F64A 4F0JA 3S2IA 1T5TA 1B73A 3AI7A 1WW2A 4B9EA 3I6ZA 3LIIA 1E79A 3OCVA 3RF6A 4RCVA 4KXFB 1M6VA 2QPAA 4QBTA 5DHUA 3RV4A 4G4JA 2G67A 2GGSA 5E6RB 3HE3A 3N75A 1FTGA 2CNDA 2VRBA 3G85A 3PQDA 3N0XA 4CMAA 3IHTA 1GXSB 4IIHA 5JO9A 1QQ5A 3DFIA 4DHEA 4QNNA 2Z8YA 4Q9LA 2W7TA 2PLRA 2B20A 3VO8A 3VR5A 3RYHA 3VJLA 3HKEA 1NVVQ 1G8SA 4GOJA 3HA5A 5P8WA 1K7SN 2BZSA 2J07A 5BP7A 2EQAA 2O8NA 1SKYB 1B43A 2FPPA 4EB3A 2A3NA 2FSSA 1ECPA 5BY2A 3OIYA 2CVPA 1T6YA 1LTHR 3CLVA 2ZS7A 1H8ED 1IAVA 3F4KA 3FPFA 1QFYA 2OSBA 3IV6A 4P98A 4N5MA 1A96A 2P68A 4C4SA 4NDAA 4A0GA 3LUCA 5CFLA 4LVOA 2B1IA 2FDRA 2E48A 4KBFA 2GO1A 5KWEA 4AMBA 2DQYA 1NKVA 3VSAA 4QDOA 4QZVA 4JGBA 3R74A 3K0FB 5J4LA 5DP2A 2ADFA 1Z0JA 3MS2A 4OMUA 2O0MA 3ZWQA 3THXB 3HDQA 2EGHA 1OXMA 2CLSA 4J75A 4KX3A 3V55A 2IYYA 5CX1A 4ZREA 3VMMA 3ZDZB 4X91A 3HBMA 2PKEA 3SKYA 2QG9A 2VEDA 1Q1GA 2Q8QA 1UWCA 3UTCA 1KYQA 3PDJA 4G25A 1RWNA 4HN4B 1FMTA 4PBRA 5FTNA 3RUIA 1POXA 4W5OA 4EI7A 2J32A 4NJOA 4RK5A 4D9HA 1K27A 1NP3A 1RWPA 4HVTA 1RXIA 2CZGA 4ZRDA 2X0KA 2O19A 2FHPA 3LY8A 2TSYB 3CNBA 5TE9A 1CNFA 5CT6A 3EHDA 4UNRA 1ZM2A 3B1KA 1QE0A 1E0DA 3HLYA 3LVFO 3WHKA 2VYNA 1DJOA 4Y8VA 2IPMA 1QIFA 3NKLA 4LWOA 2HB6A 2RG7A 2HRCA 3M4XA 3D7LA 1JSCA 1KL7A 4BQSA 4ER7A 4I5IA 3QBVA 1PBTA 1FLNA 4MYTA 5DXJA 2CWDA 5SICE 2YNMC 2HTFA 1R0SA 1VOTA 3FHOA 4HDRA 1KARA 3DCYA 4LY0A 1NE2A 1VJRA 2RH4A 1B0PA 4QSHA 5AVQA 1KVSA 2V3VA 1XQ6A 2Z9BA 1GA4A 1BU5A 2I22A 4NBVA 4BQRA 5JFTA 5L3QA 4BO9A 2VT2A 4LNHA 1UKVY 5CGQB 1YCGA 1XVVA 5C8DA 2JGKA 4FLEA 5A2GA 2W71A 2BSXA 2Y0CA 3GMIA 4REQA 1JU9A 4TTPA 3SX0A 2XGSA 4E08A 2K87A 2P3QA 2X5NA 2QL5A 1I1NA 3H0CA 4K9PA 2R8PA 2FN9A 1UOPA 1DTWB 2O0LA 2ONKA 2OMEA 3B6MA 4HQOA 2WQ6A 5FHRA 3Q3GE 4FHGA 4TM8A 3WJAA 1NUTA 2WSLA 1WUHS 1VP3A 2ZCVA 3DPSA 3TLYA 4P5PA 4RPGA 4TRJA 3RUPA 1QK5A 2A35A 3L2OB 1M2FA 5BORA 3TECE 1F4PA 2AT1A 1P4SA 2DPMA 1XMOB 1IBMB 2MINA 3DO5A 3NOQA 1T9GS 1ZLXA 1ZHOA 1M2NA 5ALPA 2ZI5A 5IJ9B 3LO5A 3QPCA 1T25A 3CX3A 4M36A 4J3NA 2RGUA 1LWNA 2AN3A 1IMOA 2JFWA 4XCVA 3VPAA 3ZHYA 1N9GB 3LC0A 3IP8A 2QZZA 4GR5A 1U0HC 3UHJA 4DE5A 3S81A 4TLEA 3VPFA 4KOEC 2VK2A 3O84A 1QLJA 4MVJM 1OPRA 2PEYA 1D9XA 2BKEA 5MN6A 3I4LA 2PO7A 1R4ZA 1YO6A 4MW6A 1XDBA 3NWOA 4O4LB 4S35A 1E2GA 3AY3A 3R8XA 1N2SA 2G4CA 2GHTA 4BLWA 3IDSA 4IO0A 2GCGA 2ZUBA 2ZRBA 4DY6A 4EI8A 2RKOA 4X1YA 5EQFA 3KQTA 5ABPA 1MG0A 3KOMA 4XQEA 1HE4A 3ZOZA 3A7EA 4QGBA 4D1YA 3FTPA 4MCHA 2CFCA 3IV9A 5HXAA 4GDFA 3O90A 4PS0A 3T61A 3F5QA 3L5OA 1AQIA 1YZUA 2LV8A 1Q1QA 3I9OA 3MYRA 4E2WA 4LQ4A 3IESA 5IM4F 3WYNA 3N86A 4B84A 1KJIA 3ETGA 2QRKA 5H68A 3RUAA 4M7RA 2WG2A 1EDBA 3OKAA 1PUXA 4ZOQI 1EXNA 2ISQA 3DDSA 3EZ9A 1TPZA 3DM5A 4XYEA 3KB1A 4AG6A 4EHAA 4TMTA 4ZK6A 3V5NA 5CRIA 1L5GB 1EFRA 2IDKA 3PCXA 5G1PA 2D1QA 5EAIA 1ATIA 2VAXA 1L5MA 2C9ZA 2QP4A 3CZ4A 1QP7A 5BSEA 1GL6A 1C9KA 5KWSA 2QU7A 2HK9A 1GD1O 1VBKA 2QVZX 4MQEB 2B82A 1IJKA 5CURA 4YUVA 2ATEA 1UBFA 1EVYA 3HCAA 1U8ZA 1U2QA 2FE1A 5H59A 4YRRA 5FCDA 5EZSA 2J33A 4KQWA 1Z73A 3OBBA 1Q7GA 3UNXA 1JLSA 3UJBA 4PC7A 3HWX1 5DHFA 1XZAA 1EINA 3SSMA 2AEJA 1L8QA 2VYVA 1V71A 3SYNA 2IEZA 3TI7A 4H1HA 1V1RB 1EWYA 3B51X 1CERA 3M89A 2ZRQA 3ER9A 2D4HA 2YV4A 4BU0A 4C08A 2PKXA 2FOLA 2IC5A 1CUEA 1NXWA 5KBYA 1RHKA 4LTDA 4Y6RA 5LP1A 4QG3A 1NF9A 5LQNA 3O83A 2PX8A 4HV4A 4O0LA 1B14A 1VHJA 2ZZKA 4B7UA 1SOWA 5CK4A 4CLRA 2KE5A 2XQVA 3QXCA 2KBFA 4OF4A 3A4NA 1HYQA 3DHYA 3TPFA 4MWSA 5JZ9A 3AG6A 4UXIA 5SY6A 1M8KA 2HPVA 2LD4A 1IJBA 5IKOA 4BV3A 3UMYA 1M75A 1OFHA 2PX2A 3PR2B 3V1NA 2ODQA 5JFOA 2C3UA 4RD6A 2ZKLA 4WCVA 4Z2YA 4X8HA 3WLLA 4X65B 4WOKA 3HBAA 1C4XA 1H2AS 3LDUA 4NULA 5I45A 3CLKA 2A8YA 2AMYA 3H3FA 4LHVA 1U7ZA 4P4GA 4A16A 3HPRA 4WZBB 4R1NA 2OCKA 5I9LA 4OI0A 1FSSA 1QHSA 2GTPA 3UAGA 4EABA 5L51A 3T9DA 5BSWA 3GRCA 2QN9A 3I5XA 4LVUA 5EYPB 5C3MA 4RZ2A 1QV6A 5HTKA 3IMCA 2QTRA 1GPDG 3COPA 3ISJA 2A92A 4KAJA 5F5LA 4DIFA 1E9SA 4WRRA 1CVRA 1HDOA 1YCHA 3NPMA 4GR9A 5TT1A 3T54A 1C41A 3UUFA 3TEMA 4COKA 1Y82A 3UMMA 1XPRA 2ZVJA 3OX3A 5KVAA 2XTZA 3UMBA 3I3OA 2P8JA 1RE0A 4HEA6 4L07A 5ITWA 1J0EA 5AM0A 5I4KA 3FKQA 4MJLA 3OPYI 5SZKB 1ZRMA 2P11A 4P4SB 5JNTA 1WSDA 5DEIA 1ZEMA 3T5BA 1RAEA 5L3VA 3GJRA 4UHFA 4E4TA 3ZZUA 4IGFA 2GEFA 5F4BA 5F3DA 2IUTA 1ADCA 4G5SA 5KO2A 2AR7A 1LI5A 2YV1A 2NMVA 3L7IA 1RRKA 3FGPA 4FQ7A 3OU2A 3EXAA 4OM7A 4PU0A 4PLPA 3WIOA 4EHLA 2VL7A 2G72A 4RGYA 4DAEA 4QHSA 4MRMB 4YMTA 4DWWA 4QEKA 4MWDA 3MGGA 2M6RA 4LOLA 1NDHA 4DSNA 5AW2A 5JHGB 4W5RA 1VPTA 3ELBA 2PZ8A 2NUAB 5JDCA 4ARVA 1E3LA 2ASVA 1G98A 1KWKA 1Z3IX 2I5PO 1G5PA 5GADl 1U9IC 1U9IA 5I8ZA 2W22A 2VZ0A 3OSZA 1RYDA 1JXAA 4J4BA 4N3BA 2GFQA 3CZQA 1XTVA 1ZKDA 2N9UA 3DLTA 3I92A 3VHRA 6ADHA 1JQDA 2DHEA 4GQBA 3SDBA 1GGHA 1UMCB 4GLOA 5KPDA 3HUEA 2I87A 1R2QA 1FRQA 3QBDA 5ED0A 4BYGA 3W6ZA 5DOZA 2W6ID 1K66A 1OYWA 1QO0D 2PGXA 4XJSA 5HFJA 2WB4A 3PIIA 3OTGA 4ZYTA 1CZKA 4KXLA 2JF0A 3ZQUA 2QMYA 1MO2A 3M83A 4TT3D 2OLJA 4EEZA 1QK4A 5TQ0B 3U4AA 1BW9B 1N6IA 2CE7A 4HYQA 4YA6A 5HJ2A 2ZUFA 2BHNA 2OP1A 4S12A 2QRVB 2EEZA 2VAPA 2W11A 4G0UA 4MGYR 4EY7A 4DMHA 1SZJG 3CMCO 2VPWA 1SHLA 5LD2B 2YZ2A 3T7RA 2ZFUA 3AKYA 2X1LA 1MAVA 1KY2A 3IERA 3JU3A 2H8GA 3LBAA 1DKUA 4V0NA 3RUHA 1ZO8A 1IPHA 1X7WB 2RB5A 1AQJA 2A0FA 2Z0MA 4MQFB 4HQ0A 1ZC3A 1TTHA 4ICIA 4KO2S 4TV9F 5KNCD 1NM5C 1FXSA 2YUIA 4TGLA 4KO3S 3PNMA 4U0JA 1APBA 3EN0A 3QFTA 3C1TA 2IU0A 3IHKA 3SZGA 3GIWA 5TQJA 4CTNA 2YUTA 3B3JA 5KDDA 4Y2YA 1UK9A 4RKQA 2PUTA 1FJHA 4YQYA 5A1TA 5JRDS 2RD2A 2WWGA 3VGJA 4GKVA 1Z29A 1HDYA 1MU0A 3EAGA 1JPVA 4JB0A 4PWZA 2CLDX 1F0NA 6AT1A 4LYDA 4DSZA 1SULA 2A58A 4K46A 4B6FA 1JU4A 1I3LA 2AFVA 3JAKA 3QKUA 3LL7A 2QTAA 3CZ5A 2OHFA 3G1TA 1USGA 1EUYA 3Q6IA 2AKYA 4LZNA 5FAKA 1W59A 5CGZA 4ILEA 3LHIA 1D4AA 4PHGA 2N3ZA 3AL2A 1XP8A 3MNFA 3VOTA 1E60A 4JYAB 4TXNA 2X6TA 2C29D 1ZN9A 3FB1A 2AZDA 3OJXA 2CXNA 4IDPA 5IWAB 3G9TA 1P4AA 3HCWA 2P5TB 2JGJA 4MPJA 1F9EA 2P9GA 2H85A 3G88A 3OHMA 4H2DA 3FXAA 2G71A 4L9WA 3TSOA 3ZG6A 1NW9B 4NS4A 1XPOA 3VJRA 1B0ZA 3S2FA 4DAOA 4C43A 5FBQB 5IT0A 2ZUSA 5IYZB 2PCLA 1K63A 4RK4A 2YMLA 3IFSA 3WWYA 1E1MA 1EDEA 1E5XA 2QZJA 4KKXB 1R37A 2CHUA 3W6NA 3WGTA 1HDEA 3DB1A 3LKBA 5IAEA 4LF6B 3H4TA 3IQHX 1QTQA 4OQDA 1MCZA 3D3WB 1GTG1 3OPYB 3GFVA 4ZAGA 5I3ZA 3ZDDA 3HRHA 4DC0A 1DQYA 3DOEA 1WZUA 3KZXA 3OCUA 4DKJA 1AB6A 1IM2A 1Q57A 2CDRA 3OG9A 1H3FA 1NXOA 4XSGA 4OGWA 4CCYB 3FZEA 3UXHA 5EJIA 1PQWA 3DEYX 1THGA 3BWYA 3NJ8A 3U56A 1CUGA 1E64A 4JVLA 3H75A 4Q3CA 2BBSA 2IA5A 3FPAA 4TT3A 3AR8A 5BQPA 4XIIA 2GEDA 3KYCA 4FOPA 4F06A 1JUDA 2GDZA 4B73A 5BWMA 4KFCA 4R0NA 4Q4AA 4CGYA 1GZUA 2AIRA 2ZS8A 5TPWB 4MNTA 4RQUA 2YWRA 4CKXA 2OQIA 1WIWA 2ZRIA 1XGKA 3NHFA 2C5FA 3O03A 4A6DA 3A3YA 1IFXA 2VPPA 4M2LA 2EWVA 2QL9A 2Y1KA 3A4LA 4YCNA 3AJAA 1E9BA 3IDZA 2AZTA 4LMBA 1EFAA 1X3SA 2P77A 4I9UA 1DLJA 3NR2A 4UZFA 1YA6A 5BXQC 1MJGA 4BASA 4EQ6B 2OBMA 3TRIA 2H16A 2GJ4A 1VPVA 4RIFA 2AWOA 2KQUA 3G8CA 4LXQA 5IAJA 3MT7A 4MS3B 4X64B 2RE8A 1MQSA 2QD4A 3MWDA 1EZZA 1CQZA 1YDHA 3NUZA 3QWIA 4KLZA 4M1QA 3RRJA 1ECGA 3O3OB 4E70A 3MINB 3H19A 1EVEA 1XIVA 2IU3A 3F49S 4GI7A 1KNQA 1RWMA 1ZWKA 2PH7A 4LCJA 1PR3A 3Q7TA 3VX4A 4YT8A 1T3LA 3R2JA 1TAHA 1FW6A 1R6UA 2W93A 2PWAA 1A9XA 1Z6ZA 2AK2A 2PQ2A 4NR0A 1FDVA 3DHNA 1NRWA 2J59A 4BFSA 4ER0A 4DFDA 3CUYA 3FDIA 4KZKA 4JFRA 2BFFB 4D57A 2AJDA 3KK0A 3IMGA 2AE2A 4LCEA 1KQFA 1GGFA 2Z6VA 5CVTA 1RU3A 5TVKA 1C8KA 4X6LA 3A2LA 1JHPA 4DSOA 3RQIA 1C9JA 3E53A 3C1OA 1T4CA 3BXXA 4J4HA 5KOHB 5ED4A 4HGQA 3P0JA 5TRTA 4Q12A 1Q12A 1L7BA 3KEGA 2F1HA 3QEBZ 1KFBB 2LXNA 4XYLA 4MGKR 1QGZA 3DAOA 5CCEA 5MFPA 3DEJA 3L1KA 4IVRA 2GFIA 2G09A 2J3HA 1YZHA 2GUGA 3NASA 3S68A 3BJZA 2AXPA 3AO0B 3CX4A 4OHMA 4R4JA 5GGXA 1XVAA 4E7PA 3CKMA 3QKWA 1OXTA 4P5EA 2HNAA 5IVKA 4PX9A 2B30A 3K8QA 1BDJA 2JJMA 2AJBA 2C9DA 4TQUS 1G8KA 4AU1A 1QQBA 1RWXA 1G21A 4UNPA 3MWKA 3DA8A 1CP2A 1UJBA 1ZJ5A 5B1HA 3LYUA 4PTZA 2IY8A 3KVOA 3NT4A 3FAKA 4V38A 2JCBA 3TW6A 4C3OB 3L7CA 4FZRA 3AETB 4XKJA 4F2PA 1DQRA 2NO9A 5JMTA 1J25A 5DRTA 4TZ0A 3EMBA 3B70A 1RKUA 4INOA 2XYHA 4O2RA 2PMKA 3JSXA 4C4TA 4OHFA 1ODLA 2Y27A 3F7NA 3MFQA 2IXGA 4E88A 4E51A 1E3TA 1PKEA 1Z82A 2JJ2A 4W7SA 5ES4B 4OJNA 1Y34E 4WHMA 1R10A 1N1EA 1MFPA 3ENNA 2P4UA 3OOSA 4FHEA 5EJ6A 1RLUA 1ES9A 5HKKD 5LBIA 3W5AA 3K9LA 3OAAD 2QBYB 5CA0B 4EO7A 4RHXA 3KL2A 1EWRA 4Q15A 5JCXA 1KS9A 3ZLBA 5TJ9A 1KEEB 2B83A 4J0QA 1XZKA 5I4CA 3IKLA 4DLNA 2C5AA 2ONYA 3FY4A 2WI8A 3W0LB 5T6BA 1R15A 3FMFA 2YWCA 4FR2A 4PAQA 4RAOA 4WUTA 1ZXXA 4YRJA 1B0AA 3UAWA 1RAFA 3ND5A 1WVGA 1YB4A 3MD0A 3ORFA 1G8FA 3FKSD 3JARA 5I8PA 2ODEA 3CPEA 4GYKA 3OE5A 3RSZA 3ICQB 1I6LA 4FZ3A 1GHTA 1HE8B 4JT2A 3AVYA 4YJGB 4XFKA 1U7WA 3PNLA 1TA9A 1V7QA 3G0OA 3BJRA 3RUEA 1G2IA 1DBRA 1XWWA 3DR3A 4D9JA 4QFDA 4F9TA 3TJRA 4C4AA 1BD4A 1ICIA 2H7VA 4IIXA 3A28A 3D2LA 5I9SA 2NZJA 3U7FB 1LD3A 4AKIA 4W5QA 1H6DA 2JFZA 3VAAA 4MV5A 3T7JA 3W8FA 2QNRA 2HM7A 3KJQA 2ZETA 1OE0A 1K8QA 2F1IA 3R75A 5EKDA 3VH3A 4R98A 3VKVA 3KYDB 4A8JB 2Y76A 3E7XA 1AUOA 1YRYE 3E9EA 3GJ4A 3MJHA 5DI9A 3PZRA 4BMPB 1WXHA 3IE1A 4BY9E 4C7BA 1H2YA 3TAXA 3WX0A 2Y3IA 1J0CA 4J90A 4BLQA 4D97A 3CRMA 2ZM5A 2OAQ1 4C30A 4OGGA 4XIGS 1N3YA 3COJA 1U1GA 2IW3A 4HDSB 4IGAA 1OLOA 4MS4B 4MV6A 2Q3EA 3LXRA 1VYUA 3BRCA 1SHZA 1J1IA 1OGYA 4D7AA 1UFOA 2BTQA 3L7BA 5KZMB 3C3KA 5LDHA 1XKQA 4TRNA 3U4MA 5AVZA 1A1SA 2IYVA 5IP5A 3D4OA 1QH8A 3OETA 2J85A 3HR7A 4G09A 4XSVA 2XMCA 3TG2A 2A5LA 4LF7B 3N2KA 5K9ZA 4AJNA 4RTQA 1K1EA 1XTIA 1NOJA 1Y5RA 2KS6A 3LW7A 4YMIA 4OVKA 2L2QA 4DABA 5EIAA 4D9MA 1FOEB 1IOVA 2ZQZA 2YVUA 1JB1A 1F0YA 4QJIA 3AZPA 1KJYA 5FDFA 4KW7A 1A2BA 2VDWB 1QRRA 1UT5A 3VHXA 1VXRA 1RM0A 2O7NA 1URPA 3IQFA 4Y6GB 4YMSA 5K09A 4JXXA 1IDN1 1FYVA 1R5BA 1Z28A 2Z43A 3C24A 3KXKA 1YQWA 2HSJA 1AGXA 3GCDA 5DI3A 4GRIA 3MB8A 2C1XA 3HHPA 3DF7A 1XF9A 5FWYB 1ACJA 1G0NA 2XKAA 1TA0A 4X3OA 4P36A 1XAIA 1QYRA 1A4UA 1I0IA 2C4VA 3ESCA 3G17A 3OF2A 3KQHA 2JLUA 1W7AA 3I2GA 1IZ7A 1NJ8A 1FA9A 4RVFA 3N2GB 1N7JA 3BWDD 3OVMA 4YS6A 5IHXA 5HKKA 5FPQA 3OI7A 2Y1EA 3OAAA 2EFEB 3L0CA 5JSZB 3RYCB 2X0NA 1EJ2A 5PGMA 4K6KA 2Y1OA 2Z5GA 5DW3A 4FLMA 4QULA 1C9MA 3ZXYA 3G1UA 1YDFA 4EX6A 1QWSA 2QVLA 4E3ZA 3ROGA 4PQYA 3OIUA 1M1NA 3RU3A 1E4EA 1ZINA 1XDUA 2EHJA 2DH6A 4KH0A 1F3OA 4BB0A 1BG6A 2E6UX 3UMJA 5FEUA 4GPIB 3FKSA 2H4WA 4RIGA 5HOEA 3PTLA 4YLYA 1FJ2A 2XCTB 1EX7A 2N75A 3HJRA 3BIXA 2VF4X 3HY4A 4EHDA 5IPFA 1C14A 4MVJA 4F46A 1B15A 1GPUA 2XMPA 3KHTA 1Y5LA 3FFAA 1E3DA 4DQXA 1ZUD1 3H2GA 5B30A 1EWVA 2FMXA 3RIMA 1Y3IA 2D00A 4LGMA 1Z4KA 3NTOA 4ZO8A 5HJEA 1KMCA 5AVOA 3RYIB 5KHLB 4A15A 2F8TA 1EWQA 2CB0A 4E5UA 2VDRB 4KUGA 3ICCA 4MB6A 4CMGA 2OAGA 2VDNB 3AQ4A 1XEFA 2P35A 1WZIA 5KU7A 2HA6A 5LOVB 4KREA 1X19A 2FSIA 2V7XA 1GR0A 2ZUWA 3V7NA 1I30A 1HSZA 3HUFA 3GH3A 3L79A 4MIKA 5E1DA 1YC2A 4ZT4A 4BB6A 4NAHA 3JQGA 4FKBA 2X0DA 2XHZA 4N5LA 5K0LA 2GVDC 2GYVA 2LGJA 3OZIA 1G2OA 5JMPA 1P2GA 2BHSA 2TRSB 2B1RA 5LQKA 1EHIA 1TZCA 2VOJA 3C8HA 3Q7IA 5GM2A 3EISA 1UADA 4PAMA 2PSDA 3WY9A 2XI4A 2PRZA 2O3QA 2OCDA 4O4HA 2ZJ1A 3TSWA 1QFSA 3EMKA 5A4JA 5L7WA 4IUYA 4JUDX 1CDDA 1TA4A 3ROXA 3KDAA 1ZMBA 1TLLA 3FVVA 2WYOA 2FW8A 2GETA 2QTHA 4OHWA 4DWOA 1GVNB 3TRJA 4UUPA 3AEKB 3B48A 4AJEA 1P0CA 2C7PA 1QM5A 4I55A 3PPIA 2FMTA 4KTVE 1E2EA 4RMIA 1SC9A 1PYGA 1IXKA 1XCLA 2PGOA 5AP9A 4FB5A 3VVLA 3WYEA 1SHKA 1AA6A 3I9V6 3Q5EA 4QXPA 1TQ6A 5E8RA 1DG1G 5THQA 2ZAOA 2NTYC 3M4ZA 2RHBA 2QQFA 1E92A 1OX5A 3TFWA 3C6KA 4B3HA 4LMAA 5AR1A 1X7ZB 4PG6A 1H2ZA 1WKBA 3CJRA 3ZWKA 4IFBA 5AJWA 1L5NA 5JCJA 5DM2A 4L5YA 3ADKA 3IVXA 1V37A 3PDIA 4BEBA 2D13A 1LBHA 2VZEA 3DBHB 5AHKA 3KSDO 4ZEMA 2XUQA 4GI5A 4D9KA 1O4VA 3CUVA 3PT5A 3GLIE 1L3IA 4IIEA 1XKLA 5KYUA 4A9AA 3EW9A 4AKHA 2RGGA 4IGKA 4JEHA 2OZLA 2M6SA 4FUQA 2J3KA 4MR7A 3CX8A 1EK0A 5LCXA 2ZIZA 3QBTA 4BO6A 2EVWX 3I2FA 3L7AA 4AFNA 2KWIA 5DHPA 5IJAA 1SCDA 2IE0A 4XASA 1UXHA 4D0GA 4QOJA 3K71B 4UARA 5DPMA 1KAOA 1ZJ6A 3BHJA 5DT9A 3ROFA 1G1MA 1CQIA 2IHTA 2C1EA 5AM1A 4HAXA 1JMVA 4DIBA 1LBSA 1GPJA 2VIIA 1OWPA 1Z4IA 5T4EA 3TB4A 3CZCA 1RQGA 5KINB 1H2BA 5G0SA 3OFVA 2BY4A 4OLBA 2Q5CA 2XUZA 2IEBA 4BO4A 4R0MA 1L5HB 1KEVA 4URXR 5ICGA 4G36A 1KK3A 3FVRA 2F59A 1TPYA 5JPDA 4Q9IA 4OEHA 4HUQB 4Q3DA 5CLLA 3BSYA 4RMGA 1T0UA 3BZWA 1H22A 1W88A 3BMQB 3MYYA 4YT5A 4LNUB 4PQFA 1L1QA 2VBFA 3VR4A 2FPGA 4JJEA 4XWKA 1R0BA 3LD9A 4NCKA 1GAQA 1SFRA 2WHXA 3B36A 3E9ZA 2VH5R 2WJ3A 5HTOA 2AS0A 3JQBC 2OBLA 3AESA 3HDGA 5TEVA 1A50B 3WWOA 4H59A 5EKXA 3SE7A 1TRHA 1PK9A 4OHXA 1QV9A 1GTJ1 4CBVA 1Q0SA 3QW4B 4DZZA 3NORA 5KKAA 4P84A 4RF5A 3PZBA 1VIAA 3O38A 4X7MA 1YVDA 5HKLA 3P2KA 3WK6A 5ADWA 3BERA 4ZCIA 1UAAA 4G8JA 3C87A 2NG1A 4F2WA 3KT6A 2JDID 1E2MA 4GP9A 5FNVA 2DHQA 1DHTA 2ADOA 2V5AA 3I2HA 4RTOA 4TXMA 4XQGA 2X5KO 2JFQA 2ZJ2A 1LQ2A 1PS9A 1VHDA 2VUTA 2O2EA 2RFLA 2QLNA 3DJYA 4LSWA 4Z3DA 2ET6A 3GLUA 2X42A 3KVVA 1HLFA 1I4DD 1Q1AA 3A3NA 3K9BA 4KV7A 4Y2QA 3TB6A 3TVYA 2FY8A 4ETMA 4FNOA 3M4JA 3CF4G 3H5RA 2OFPA 4PHCA 4WESA 3M1YA 1JB9A 3QU5A 1SO8A 2D74A 2HQRA 3RI3A 4DBLE 1DOHA 2I62A 4RESA 3KJEA 1P0FA 3UAVA 3UJDA 5KVQA 2ZRNA 5EXEA 3RS9A 5H9VA 5MGBA 4CKBA 2EBWA 5I7HA 3U7GA 1ESZA 1KH2A 1VGVA 2NXEA 5NULA 4F5ZA 2A1IA 5CB4A 1A9ZA 5BSHA 4EPRA 1ZR4A 5I5EA 5TVGA 1V2HE 1L1RA 1Q19A 4ZODA 4WX2B 5EXPA 3Q3CA 1W1WA 1KI6A 3U26A 4ZP1A 3M81A 4C04A 3BWXA 5CXQA 1L4NA 4YGXB 5EQTA 3OCZA 1G0OA 4PF1A 1YS9A 3PE6A 3D1JA 4IICA 2ONZA 2DFTA 3ZGXA 4WE3A 2JG3A 2FFHA 3C1UA 3Q98A 2I2WA 2ZTSA 1LWOA 3R3XA 3OHSX 3FMGA 2WJJA 4DDUA 4ZI2A 5K8TA 1PR1A 3MGCA 4FZJA 2WWFA 3FOZA 3F6BX 3EFOA 2D3TA 3B1FA 4M9RA 1MABB 1I5EA 2ZAIA 3UH0A 4BXOA 1QLWA 3OOHA 4MZDA 3EZLA 4RZUA 4K05A 1Y5IA 4JMPA 4Q82A 1KE2A 1CT9A 4KN8A 5H0IA 2I8AA 2DHDA 4TYQA 2EL7A 4WDRA 3JVIA 3G7SA 3X1ZA 3ZJTA 1GCIA 1E8DA 4F56A 2OAP1 2ORVA 1J49A 1OZHA 4NICA 5E8JA 2VKQA 3L6OO 2E4WA 4IMPA 1P72A 3ND9A 4OBWA 2VJQA 1YC5A 5DGHA 3F5FA 4PE5B 1OWLA 4K6HA 1K4MA 3IEXA 3PNQA 4L0QA 1CR2A 2IYXA 3GHYA 4OYYA 4I9NA 1TCAA 1TIPA 2TMGA 3N7TA 5E2IA 3TJZA 3ANTA 1JAIA 1V9CA 3T5AA 4DDHA 4D4LA 3NOOA 5HNKA 2I78A 1C9EA 4R3WA 3LZCA 1CP3A 4PV7A 2H0AA 2JBHA 3CBGA 1GZSA 4Y6SA 4NH4A 3L3BA 2G07A 2X86A 3HFRA 2AFIB 2NP7A 4J29A 4DUPA 3FYUB 1X13A 4HH3C 3CISA 2NACA 3K9QO 4CG3A 2W0SA 3HADA 1F8GA 4OJKA 5AXAA 1J8QA 3DVAB 3NYIA 3G49A 4ZKDA 2W8BB 1CQJA 3AEQB 3NBMA 4UZSA 1M5TA 3EXG2 3H5WA 4Q0MA 3V33A 3KAJA 1TMGE 2J3DA 3KT0A 2HAEA 2JDIA 2HQ1A 3MTAA 4OK6A 5KYYB 1G7CA 1USKA 2QUAA 3EQ8A 4N1AA 3AW9A 3L1IA 4ZRNA 4C0JA 2X41A 3ZIAD 1XALA 3EF1A 3I0NA 4JAVC 5F21A 1FLDA 3ZWXA 4PCUA 2QTFA 2RGRA 1AUXA 4WDQA 2YV3A 2QYHA 4HYYA 4HPJB 2GAOA 5GAJA 3BL8A 3ZS8A 3KPJA 4JSYA 1ZHFA 4G86A 3X1WA 5BMVF 3Q7EA 4GNRA 4HXGA 5KYWB 1SUAA 2C31A 4OB8A 3TX2A 3WGGA 1JDPA 4XQ0A 3OESA 5L6MB 4UUOA 1J2EA 1P75A 3IUSA 2PD4A 1UJ5A 4OXQA 4XAQA 2XUHA 2NO7A 2IHVA 2WY2D 5B1YA 1XYYA 4JKIA 4KN9S 1FCJA 1V8OA 3A6ZA 1IPEA 3DLBA 2PX6A 2BEUB 1MTZA 4L75A 3ZDAA 3QEMB 1RYNA 5M34A 1JXOA 2QLMA 4PAGA 5D3QA 5JR3A 1N1DA 2C2OA 1ESCA 5T4HA 3CVUA 5B2ZA 5EPUA 4EA7A 3TRHA 4CNBA 1V47A 1ML4A 1RXCA 5DX1A 2EYQA 2G80A 1FMJA 3KJFA 3INRA 3LP5A 3M3PA 4MMYB 6LDHA 2D1FA 1U2PA 5JAHA 2UZ0A 3PC4A 2YDYA 2GZRA 3G59A 1RLOA 1ZL0A 2PJZA 2Z5LA 3IP6A 3DMYA 1G6OA 3LFUA 5C1IA 3UPTA 3LO8A 1W0KA 5FHQA 3PD1A 2OXTA 1GZ5A 2X3UA 3C45A 4P2BA 2LDBA 2O52A 3DSRA 3II6X 3RSSA 5BR8B 3L7NA 4ZZIA 1KEZA 4E5PA 1SH7A 1YFLA 1CZLA 2Z2KA 4L16A 4CLOB 2OILA 4O6VA 5J5AA 2Q1YA 2HWWA 3TNFA 4R2MA 4ZIRB 4N0QA 1K6IA 3VR0A 5BSFA 4IL5A 3CYFA 1YR9A 5JS7A 2W2XA 1NFRA 4XUDA 4LDAA 3U4CA 3HU5A 1U2RA 2B4AA 3VUFA 4K9RA 4MZXA 5CDFE 3UVEA 5IU6A 2NZYA 3A58B 3LQQA 3CINA 3QV2A 2W6MA 3JZAA 2ZVPX 1ZM3A 4OSPA 5GWXA 2PVSA 5A7HA 3WB2A 1QHHA 5KCZA 1Z08A 3DOUA 3NDPA 4LJ7A 1F5NA 1YR6A 3L41A 4MV8A 3DPUA 5FULA 4UOEA 3NTLA 3IUJA 1CUYA 5J5VA 4J6FA 3AB7A 2VP6A 4YAGA 1DRUA 2O1SA 2PGJA 3QX7A 3QLVA 3WKDA 3NAMA 2W2NA 2NIPA 3LQKA 4K40A 3T3EA 3FD8A 4RO0A 4L76A 2W8ZA 1CJUC 1IOLA 2G1PA 1D2CA 3S2GA 2HWKA 3CR3C 4CLXA 4Z1MA 2FG6C 3W9UA 1WCV1 2VN8A 1JEQA 2AGVA 1KXZA 2YWFA 3VR5H 2A30A 4AF7A 1XTSA 1BA2A 2ETVA 3WO1A 1W4LA 2C95A 2GZDA 3ZY3A 2PLNA 3NC4A 2G28A 3SZUA 4E4RA 3DMRA 3B2NA 1U31A 4L9SA 1M1ZA 2OHHA 2WLTA 4TTIA 4B4VA 3SWWA 1LBEA 3JQPA 2IFTA 2JAUA 2J1LA 3IEKA 4CW7A 4EUNA 4KPGA 1JHYA 2ZDGA 3KEOA 2H7XA 1WL8A 4X8LA 3UB4A 4DXHA 5TX7A 1F5SA 4QPCA 2C4TA 5K6RA 3R0JA 3CJTA 2ASEA 1IXSB 3GRVA 3UV3A 1A76A 5AXBA 3WS7A 2P5SA 2XMRA 3U6KA 4L4RA 1XRNA 2I3BA 2YWBA 1B8VA 1RC1A 2OV1A 2XADA 1RFLA 4ZT6A 1OH6A 1I6WA 1N32B 4JOSA 4UTXA 5ESXA 4M98A 1AK2A 1O4WA 2LZ0A 5D5PA 3WRXC 3WRXA 2H1FA 3I1JA 4X7RA 3BQMB 3ORQA 4DV6B 5H80A 1QVRA 4DBZA 5LNK1 3O4HA 4DGQA 5F5XA 4L3VA 3H2ZA 3PPWA 1JHUA 4O4IA 3U81A 3GMTA 3EPHA 3OY7A 4M0KA 2XIQA 3DKRA 4JN6B 4RMJA 4ZU1X 4Z0TA 1YVEI 1JQKA 3RTEA 1QKKA 1GXSA 1FB5A 2OBBA 3DMHA 4Q18A 4Y6QA 5LB2A 4CM7A 2SECE 1RM3A 2O2JA 4D0NA 2FFAA 1CUFA 2XUFA 3GJYA 4CHGA 3B6JA 4Y1RA 1X8LA 2R2AA 3ZCRA 1RI4A 3PCTA 1Z16A 3VHLB 1FNMA 2VCYA 2W6ZA 1YJXA 4FCWA 3Q87B 3C3JA 1HT3A 2NXJA 1QCDA 3E1GA 2NLOA 1UMBB 4EG3A 1RKVA 2YHBA 5DNYB 4ECAA 4XVQA 5B3LA 2PZKA 3V4SA 2XB8A 3ICEA 1SOVA 2XLCA 1YRHA 1LFDB 1PZFA 2YV2A 5AI8A 1JTFA 2X0FA 4QVIA 1DX6A 1PQPA 4YR7A 1H2WA 1BU8A 1Z22A 2HI0A 2QRNA 3OQ1A 5ADUS 5CDGA 3L02A 5CG1A 1G18A 5CB6A 2W2KA 3UAOA 3FI9A 1YRAA 3OLXA 3Q5DA 3KVRA 4WMLA 3UN1A 5HK9A 1MA3A 2I2XB 1W47A 5BWLA 3PTAA 3T3NA 1ND5A 4F2DA 3DMTC 3GL9A 4TS9A 1CIJA 4ZOEA 1VJ0A 1NE7A 5AKJA 1VCOA 2QXYA 2QSYA 3A37A 5DRYA 3DZDA 1MNAA 3VPSA 4Q4DA 3T95A 5HUQA 5C8XA 4K0RA 4EM6A 2HDOA 4BLSA 2H9IA 1TEXA 3AWIA 4MPTA 5KPJA 3D6MA 4K28A 4I1UA 3K9NA 5JI2E 5JWOA 1Q92A 5CDUA 3B7WA 4IF4A 4Q03A 3Q85A 5EMKA 5ALDA 1Q3TA 3E5MA 3PNKA 1JHOA 5G3ZA 1Q15A 1P31A 2ZRCA 5JWHA 3BFXA 4DXAA 3G6KA 5J2TB 1H4SA 3E23A 4PCLA 1KY3A 5FUWA 3ROPA 3ZEIA 3K0KA 3Q88A 2C9MA 2NO1A 3RVKA 2FSFA 2QZ4A 4BWVA 3EUWA 4KO1S 5CVVA 4LJSA 1C1YA 5KVVA 2D54A 2OBNA 3T1YB 1NDQA 2Y1GA 5AOVA 4HB4A 2O50A 3A3PA 2ZRDA 4YIKA 1O2DA 4AICA 2I0FA 3EEYA 4MGIR 4FFVA 2NX2A 1F8UA 2G9ZA 5HFAA 1JDUA 1W5FA 1DTWA 1G38A 4ZICA 2YYAA 2XMSA 1GCUA 5KNBH 4DREA 1DI0A 2AOTB 3HGQA 2GMWA 3NWPA 4FXPA 4ZVKA 4CIYA 5FFMA 4KYVA 4KQHA 3OZXA 3SSAA 4WLNA 1IQPA 2G6TA 1FMCA 4IILA 4IO1A 1HTBA 1XV5A 5AHWA 1C1DB 4LYEA 4HEQA 5IJ9A 2OCBA 1KA9H 4W99A 3Q8XB 3EIFA 4XVRA 5C31A 3S29A 2XVZA 4UMDA 1GUFA 1MJ5A 1ZIDA 4UUQA 3K15A 2BD0A 3PEUA 4ND6A 2GARA 3URKA 2ZRLA 4IHKA 2Z5VA 1TVEA 3EQ9A 3LQ2A 4C0WA 2JPDA 3OJEA 5AK4A 3LDGA 2BEKA 1RXEA 1IY2A 1PJTA 3KHSA 4JP3A 1MJFA 1TJYA 5DXFA 3QYFA 5AM3A 4EUKA 3SQMA 5JZVA 2NADA 3DV2A 4O4LA 2ZJFA 1K92A 1LY1A 3CRW1 5CNIA 2LKDA 2O5VA 2VG8A 3EGXB 4IFTA 1Y6QA 4URVR 2YJ6A 3L8EA 2R62A 2ZE7A 3GDFA 1FQOA 3A04A 2EARA 1CY4A 3P26A 4RLFA 4XPIB 4NCIA 3U7EB 1XNGA 2YY5A 1DFHA 4C22A 3KQLA 3AHGA 3FCEA 2WK1A 4BP3A 5AJYA 4YXWA 3TQRA 1MO3A 1WPRA 2H31A 2ZR0A 4R31A 4BFVA 4UMFA 3WL6A 2EBUA 4YREA 1K5PA 4JENA 3UMSA 4B44A 4BIIA 4KVGA 5EP1A 4GL4A 4L78A 2Z2ZA 3IKJA 5C7YA 3UGJA 1JYEA 2I80A 1L5OA 4I50F 3O1IC 1PJQA 4C6SA 1IK4A 2HD4A 5DKFA 3WK7A 1XTTA 3X43A 3BMCB 721PA 1WSBA 1S8AA 3A2MA 3GDGA 5AJVB 1Z0KA 3SF0A 4A0FA 3EDQA 1TC2A 4G1FA 3A9CA 5P21A 4MW9A 4B7CA 5IH7A 3NRJA 3PQ2A 1XRPA 3N2YA 5M04A 1XELA 2HCJB 2I6UA 4MQEA 3RS4A 5KUTA 4YCAA 1U7PA 4PQGA 4DA4A 1S2MA 5T7BA 2QSJA 4GKKB 2IZ5A 1FF9A 4V0RA 2M6LA 3K31A 1ZP6A 4B31A 4E31A 1KEKA 3G2JA 3IJRA 3EVFA 2YS6A 2YC2C 1MN6A 2GPTA 3NAGA 1Y8RB 2QGFA 5B4UA 1VE1A 1QOPB 2ZJAA 3B3AA 4L74A 4LOAA 5SZJA 3WWCA 1V1RA 1TCBA 2B7LA 4NIMA 5FIUA 7YASA 5JQGB 5KOIA 5DNCA 3IOCA 1M8PA 3CXRA 4QO8A 4P7GA 3H13A 2W2VA 1AHPA 5FOSA 3DBRB 1MJGM 5IKXA 4HLNA 5JPCA 3KR9A 3VJKA 2IIBA 3LA6A 1RD4A 2GDJA 1H05A 4HFRA 3PP8A 3SS7X 4CV2A 1IZ8A 4HC4A 1PSWA 5DHSA 3ZJVA 2R6CA 3FPEA 5COBA 4DSUA 3KD2A 1RXYA 2GVZC 2ZJZA 3BE6A 3OQIB 2CZQA 4AN0A 2B34A 3A0RB 3GX1A 4GMKA 2H1CA 3X1YA 1AKVA 1N5RA 2OPHA 1RWBA 1NJGA 3D9QX 4BJ1A 2VQ6A 5C5DA 1V4VA 4Q01A 3PC3A 1G17A 4DYHA 1LPPA 1FVFA 1KMMA 2CDBA 3D59A 3KWFA 2WU0A 4EKGA 3P9CA 2AD5A 1ADJA 5FV7A 5TPZD 3KDSE 3PSAA 4WKCA 2C7RA 3WB9A 5TB5A 5CJPA 4WNAB 4BRSA 4KOAA 1ZR2A 4QUDA 3DMDA 1DBVO 3GUCA 4OCZA 2QUKA 3ZHRA 3B1WA 3NI2A 4I3GA 3WE7A 4C0QC 4EGCB 4KYIB 4YONB 4ZYLA 1CIVA 3NGXA 1FFDA 1ECCA 4XIJA 2B36A 5BWCA 2QG4A 1YHNA 3K70B 4LGYA 5JSFA 4MSUA 4KDFA 1HL7A 5DYIA 5THKA 3V46A 1E20A 1J2TA 1J6UA 1NJFA 3MWYW 1BH2A 3UUGA 3B60A 3WOHA 3HACA 1XMQB 3ZNNA 1YZQA 2VI5A 2I4RA 1N6NA 2W6JA 2B8EA 4M53A 4BJHB 1M8GA 6REQB 3F3YA 3WK8A 4ED9A 4YYZA 3EZYA 3PT9A 1CLUA 3L6CA 5CA1B 1EB8A 5C4GB 1DEHA 4JGGA 5TXGA 5LIRA 1TVKB 1OWOA 2F3UA 3R3JA 2IT1A 1W52X 3EZ2A 4F3CA 3MJTA 2FUCA 4H60A 2VYQA 5AQEA 3I9JA 1B6SA 4OL9A 5LUBA 4DB4A 3ACCA 1E2QA 3PIDA 4LRQA 4X44A 1GGMA 2DR2A 1SC3A 4RACA 4MRMA 4RC9A 1H1LA 2REOA 3HFSA 2I91A 5EUBA 2FPSA 3U19A 3FKJA 4Y18A 4E5MA 2YYSA 2FR8C 1BX0A 2FR8A 2XSZD 4IIJA 4P4TA 1QQAA 1M2JA 4HZIA 3HBJA 1V45E 3P71T 3H5LA 1SCKA 2UYQA 3K1TA 4OJQA 4PQEA 1DX4A 1GNQA 4HX5A 4L85A 4C1NA 2QD3A 1CZUA 2H11A 8GPBA 5IRCD 1WRBA 10MHA 2FZ5A 5HGXA 4ZQGA 3WYGA 2X9QA 2Q5FA 4XM0A 5A3JA 2C7BA 1P8JA 3B89A 3UY4A 3LLMA 5GZ1A 5CG2A 4YBZA 1T35A 3U0BA 4FFDA 5MF6A 1KRXA 3IE0A 3PUKA 2JZNA 1RW4A 4WLUA 3C74A 1LDGA 3LM8A 5ER9A 1VL0A 2R87A 4DLYA 2EOAA 2P27A 4Y9UA 2G4VA 1DKRA 2E4VA 1I1HA 3FOBA 3HO6A 3LH5A 5EP4A 2HHJA 4PZZA 5D7NA 2MR5A 4PN7A 4UASA 3T3OA 3R44A 1HLPA 1UZUA 2Z58A 2XDQB 3B9BA 2ZIEA 2P2CA 3KEQA 4KIFA 4CG2A 4QYIA 5TQ0A 3NMUF 3ETLA 1BW9A 4FFOA 2HGZA 3ID6C 1F9AA 4Q3OA 5C4MA 4L6CA 3W4IA 2AX3A 3HMKA 1JIIA 4CKCB 3CW9A 1ULAA 1L7EA 2VWHA 4KPYA 3LUDA 4ZOLF 5F1PA 3A26A 3U3ZA 1JDTA 1N78A 4MUNA 4HD8A 1LJ8A 2V7GA 3B1ZA 3COSA 3K7EA 3QTBA 3PE4A 3NIWA 2RKWA 3N0WA 3GLQA 1QVVA 2E5FA 3LZ6A 4B7AA 2WNSA 1EK6A 1ZSNA 3AM4A 3G3EA 1FNDA 2IELA 3HXLA 3NHRA 2VTKA 1G7RA 2OM6A 2FN3A 3DAGA 3NBQA 3WWDA 5ALRA 3I2KA 1W35A 4NI5A 3AIOA 2OCLA 2J67A 4Y0VA 5J1TB 5L7TA 3WB0A 4CTOA 2V98A 3H87A 2FOXA 5K0BA 1JLLB 4JNCA 4UAVA 2WLSA 3AR2A 4CIAA 3L6RA 2QMEA 4GOMD 3KKNA 4IJWA 1BAPA 1GWNA 5EESA 2Y77A 3VU1A 3QEAZ 2G9RA 1BVYF 1OZFA 1ZFNA 3A25A 1YIDA 1QGAA 3QPBA 1OC2A 2E82A 5D1NA 4RS4A 2IY7A 4M76B 5AT1A 2JRLA 1WHTB 5AJTA 1UKAA 4ZT5A 3UXMA 2JARA 3OJ0A 2WM2A 5FBRB 1ADBA 2IHUA 3F97A 1XDGA 4MV3A 1LVHA 1QXSA 2PT6A 3L1VA 4MUAA 2EBHX 2HK6A 1QPGA 3IELA 5CH5A 3UCXA 5C52B 4YJ3F 4BGVA 5KSWB 1SQ0A 2JGEA 4IHJB 4R9VA 1VYVA 3CO0S 4X7BA 4ZI5A 4BHTA 2NPOA 1CIPA 1P77A 4F3NA 5J3JA 2ZSBA 3T4EA 3WKAA 4D8TA 4W6ZA 4HR7A 3VFDA 4HY3A 1KH3A 2Y0PA 2ZSDA 3FCCA 2O8BB 3I6MA 4N3CA 3QF4B 1O94A 4RIEA 3OZAA 3SC2B 4BMCA 5HZMA 5F98A 1W4BA 3NHBA 4YEDA 2DUUA 4KHZA 4QGSA 2QM8A 3WMXA 1IB6A 2ZSIA 5KKNB 2B2XA 2WDZA 3ZOKA 2GA8A 2AV6A 5BOVA 2GHIA 9LDBA 2MTBA 3VV2A 3RK1A 3FWPA 1NIPA 2FQQA 1X1CA 3DTTA 1CZNA 3ODPA 5EJFA 4AYWA 3L4JA 2FEKA 1E6MA 1EXDA 1T2EA 3HP1A 1S4MA 2ODTX 1N34B 1H93A 2JK0A 1XL1A 2NQ2C 3DC7A 1N0UA 2YJNA 4OYRA 3N3AC 2W90A 1UJNA 4ZT2A 3W3AA 5HK8A 2LCFA 4YMHA 5T8KA 4CCYA 1QGDA 3D7KA 3H2HA 5BT9A 1PL8A 1ZIPA 3OZ7A 2P9BA 3CF0A 1Q74A 4ZJYA 2X5OA 4MQ5A 2A9RA 4TSRA 1Z56C 3ND8A 4N3GA 4XGQA 4R9NA 4OAOA 5CLGA 2WJYA 3EYWA 3NETA 3CCFA 2WZQA 1PD1A 3C8ZA 5JS6A 4EMBA 1MHPA 2HFKA 2D7DA 1XZDA 2CV1A 4YALA 5TPWA 2ZBGA 5SY4A 1S7GA 3L0OA 1ZQ1A 4HNRA 3AVWA 1T9KA 4RGQA 2FFBA 4X1IB 3FRHA 2P7HA 3UG7A 2B7CA 3OTQA 2NO0A 3O3NB 4FOSA 3ZTTA 4EQZA 1XDSA 3BGWA 5LZ7A 3M6XA 4RVDA 3WYCA 3L1JA 2HGSA 2PT7A 1UEJA 1E1RA 2RI1A 1KMHB 3F90A 3KFVA 2YXPX 3L82B 2FH5B 1JF8A 1DFGA 1CJCA 1XTUA 5JJCA 1TE2A 3QLJA 4QREA 3Q9SA 3SN6A 3THRA 4ER6A 4BNDB 1H23A 4G5XA 1U1DA 2IEIA 2YWJA 5DLEA 4GAEA 2RGNC 2RGNA 4MS3A 4W5HA 5B1IA 1C0IA 4DQLA 3B6ZA 7ABPA 2V1XA 3N8HA 3ZWDA 4ALLA 3SJAA 5C32A 4EITA 3MINA 1Y6ZA 1YR1A 2CVHA 4BN0A 2Q5EA 1EM6A 1M66A 4MQ4A 2AC7A 2OHXA 3KQWA 1LBQA 4JP1A 2O7SA 5TJHA 3RKSA 1W0CA 4DV0B 1XLVA 2NSLA 5AHRA 2WKRA 2O0KA 1VG9B 3OZVA 4XUEA 3VPGA 2FA9A 3PWZA 2VJMB 4KFRA 1E94E 2BJHA 4Y2TA 5EP3A 1FDWA 2SICE 3C15C 1TAQA 1PLKA 2H4ZA 3GT4A 4M1TA 3D8HA 4Y1GA 2JGAA 2A5GA 1Y4UA 4YPVA 4IR7A 4XX0B 1Z6PA 2BFFA 1NLZA 5JCZA 4GOND 2CXOA 3I0MA 1D09A 4TVBA 1EFLA 2F00A 3OZTA 4LYAA 1PT7A 2PV0A 4LI3X 1RKQA 4PHFA 1Q6ZA 9MHTA 2XMQA 4ZALA 1Y6JA 3NBAA 5KOHA 3GFOA 2QJTA 2AXQA 2EBFX 1G3RA 2R6FA 2JFHA 4KAXA 4YT2A 3GZ4A 4NFSA 1BFKA 2PTHA 1MG5A 3AXTA 5B3JC 1NRXA 2I4TA 3BPSA 4O59O 5B3JA 1F14A 3L7KA 2A0XA 3FG9A 3H2JA 5IJZA 1XK6A 1E2HA 1ZVQA 1YB5A 1WB6A 1Y80A 3T7DA 2GYUA 4L27A 2VH1A 2O8EB 4CKEB 2ZB2A 5I47A 3CFYA 5FD8A 1NYTA 4OMFG 1XRQA 2FSUA 5DNAA 5F7XA 2XCRB 3OEHA 4HDKB 5UKDA 5KX5A 4K86A 5JV5A 5I01A 1T2CA 1B00A 3WNZA 4DR5B 1ZEJA 3WK4A 2RAVA 3QUTA 4W9NA 5BR1A 3MPUA 1J9ZA 2BKXA 2H5IA 2E1PA 1Z2DA 2R5WA 2HRQA 2IV7A 3TINA 3FSJX 5EGNA 1R88A 3H6GA 5HP4A 3HR4A 2JHGA 2VHQA 3WADA 3A05A 4FHZA 2QK4A 3EXEA 1GG9A 4N3AA 3WZMA 4GSKA 1AVTA 1QTNA 5CH3A 3U44B 4G0MA 3KT3A 4HRYA 2DLDA 2HLDD 2UVDA 5LQUA 2Y4NA 1V7PC 4DCVA 3PGKA 1QGED 3TZEA 3QG5A 1LUAA 4MR8A 3HJFA 3MWGA 2JAHA 5CYPA 3GUUA 1U6IA 3PSHA 3FGZA 1ID1A 2QBYA 1VKJA 2WJHA 4O02B 3B3QA 5CBPB 5IX8A 2EFHB 4IIVA 4PX3A 4C06A 3G82C 3ML1A 4V2IA 5BRAA 2BEJA 5KOJB 4TLLB 1KEEA 1IE3A 2A67A 1VM6A 2JBAB 1V6AA 3IAAA 1A8PA 2BGUA 2HJHA 3TK1A 1AZSC 4DQ0A 5JZSA 1S1CA 2R7NA 5K0NA 4O2BB 2OO5C 3BBPA 2P6RA 1UKYA 2A4KA 1LH0A 4FMDF 5JH7F 1KP2A 1AG9A 4R81A 1D8AA 4L9RA 4EDFA 3J7TA 5L40A 5J40A 3C5VA 3L6UA 2QTVB 3BWEA 1SXJC 1SXJA 4AM8A 5D87A 4UVIA 2F2TA 3NU1A 4OIMA 4TKZA 1WF6A 4TUYF 5DBOA 3W8RA 2R3SA 1CRZA 2IBMA 2VNAA 2Y0BA 4YJGA 2XWSA 1KAEA 1T36B 2D1RA 2WKQA 2XJ9A 3I5MA 3P19A 2H2FA 5H3HA 2X6RA 4LYGA 4D4HA 5HKOA 4HTFA 2C7VA 3KVNA 1NNEA 4F86A 3DWEX 1Q14A 2ZJ7A 4KJXA 1DJPA 1Y63A 5FPKA 1I2DA 4MPPA 3L05A 2IP2A 1KJWA 3IAM6 3MRTA 4V3CA 1S9HA 4QBKA 3ZCQA 4J3JA 4BLVA 3GK3A 3KC2A 1EBBA 1J99A 1ZXLA 1MX1A 1XXLA 3KYDA 3WNCA 4A8JA 1NHGA 4XEUA 5A4IS 2B99A 2PXCA 1BKDR 3HYCA 4FZ5A 5DULA 2CNLA 5EJAA 3HY3A 3QMMA 3FM9A 2ZSJA 4ZVOA 4HDSA 1PNVA 4MS4A 4OI4A 4LGVA 3BTVA 3C48A 4CPDA 3I04A 4I2VA 4GOLD 2VNIA 3U4GA 4PW0A 1YH3A 5IJ0A 3ZW9A 3BWMA 3GUVA 5K3SA 1FUIA 3FUTA 1HTTA 4W1RA 1Z8FA 4BEVA 4QTZA 1D9ZA 2XYGA 1C1XB 4TTQA 3AOEC 1UPAA 3AOEA 4TQGA 2A6PA 1BS9A 2D4AA 4XZ3A 1OC4A 2O6HA 4IQ8A 4LKRA 4B8WA 4D43A 4GLJA 2XA2A 3CSSA 4ZVLA 1FTYA 3PFWO 2SCUB 4KO4S 4NRDA 3V4FA 3VR6H 3PBKA 2INGX 2PNJA 4UHHA 4NBLA 3EIOA 1XHEA 2VDWA 1HNXB 1KSGA 1N1GA 4DQVA 1NUUA 3AFNA 1GCOA 1Q0PA 1DAGA 4OQMA 3HCDA 3I8XA 4YIHA 2Y67A 1W1IA 1F1BA 4RDXA 3RVDA 2P9EA 3NKFA 3P5BA 1UJ4A 2EFGA 1NGSA 2R6JA 4KNWA 5FWYA 3NBYC 3KJNA 4RD2A 4AZTA 4GXNA 4HHEA 1ZAYA 2IDJA 2OZVA 2XQIA 5TGZA 1BDBA 1U0SY 3H0KA 3ZD6A 3V34A 1T10A 1WCIA 2JBWA 2YRWA 1F2TB 1Z0AA 1Q6YA 3BXFA 3L46A 4FYKA 2V5UA 3N2GA 2W4IA 4MUMA 1CRQA 4ZEOA 5GP1A 1O7JA 3ZZMA 4KMMA 3CEAA 4PPGA 3K0HA 2YQ4A 2HQSA 2PR2A 2Z98A 1G1AA 1VG0B 1LRLA 6GPBA 1B16A 1DELA 2QP9X 5CDTA 2OT3B 1OD6A 2O8FB 2D0PB 1P18A 1BKSB 2GF9A 4O4JF 1L8XA 3Q2OA 1JAZA 4D98A 1MC1A 1VKHA 3EY4A 4G0YA 2PUHA 4MO2A 4PC1A 2X0IA 4X20B 3AU8A 1WXFA 1SK8A 2PU7A 3BKWA 1UM9B 1VP9A 2FRVA 4QELA 2VRNA 5MN5A 2ZRAA 5FBWB 5E4YA 4AO6A 1P6UA 5AK0A 3WLOA 2HWYA 1YOBA 3EXIB 4LYJA 4LMPA 4AJ9A 5FWXB 2PZJA 2FFRA 2Y1LA 3BK2A 4RS3A 2I76A 4O2AB 4E1BA 1M10A 4PINA 2FK8A 2DQKA 4YP5A 1NBMD 1LFAA 4FNGA 2DG2A 1XB2A 1Y5NA 2OGUA 2ZJ8A 4RPIA 5FLKA 4GC9A 3RYIA 1PEYA 3KLPX 3OIDA 5HKBA 4EYGA 1H9CA 1F6BA 2ID8A 2KBEA 4GZ3A 1C8LA 5L4LA 1F20A 3QI2A 1TO2E 5KREA 2HU7A 4RAQA 4KAFA 1X8KA 3DT6A 3DDWA 4DPKA 5HDBB 4PZAA 5EE1A 3PGA1 3COZA 2ZROA 3NFRA 4M0EA 3ZZ0A 1ODKA 2I65A 4F2HA 4BBZA 3UBTA 2A5DA 2BGMA 4ZGGA 1VDZA 5JRJA 3C3WA 5CHYA 3ZUPA 4MVJG 2PRKA 2QF7A 2Q3CA 3GEIA 3RFTA 4EJMA 1F4VA 3DW3X 3ZU4A 3HYLA 4LJAA 4RTMA 4N39A 4QXMA 1TU0A 3D2AA 1BWPA 2BFOA 1UXKA 1CUAA 1DEXA 2X2EA 3BB1A 1ZWLA 1HC7A 1R6VA 4W5JA 4Y1EA 1EKXA 1NPDA 3R5JA 3ZGNA 2JKYA 3P8ZA 2V8OA 3GEPA 4GXRA 4H6XA 2V97A 4D25A 4MV0A 3DE5X 3G8YA 1Y33E 3EVBA 4MKRA 1U7XA 2XUPA 3AEKA 2V9ZA 2XV1A 3H7IA 3UMFA 1JE1A 2G1JA 5IT5A 3OQMA 1YHZA 3ON5A 3JQ7A 4AS3A 3ZW7A 3ENKA 3DO8A 4CM4B 4FKZA 4G1VA 4ALJA 3UWSA 2AI1A 4HDOB 4NNOA 1WR8A 4PSKA 4C7OA 3MWEA 1JR3E 1E32A 1S02A 1R66A 3FNIA 3OUUA 5JATA 1YTUA 3LX5A 5BQFA 3EIHA 5LXTB 3T1OA 1TF5A 4XA8A 1L4LA 2I6SA 2OV2A 4HXEB 1YZ3A 2I7CA 5FB3A 4DJFC 1QANA 3N8DA 4PFQA 3VR4H 2F7SA 2X9GA 1KI1A 1X7ZA 2I3ZA 2Q4DA 2XEDA 3GEHA 4CMIB 1L4HA 3HCPA 1A4IA 2AEFA 3PVSA 4AY6A 1UQTA 1XK7A 2AX4A 1Z7BA 3D54D 3FPLA 3JYNA 1MIHA 1KJ9A 3DBHA 3HCCA 4NVRA 1C4OA 5ELMA 1GTSA 1E9DA 1G5HA 1PJ2A 4KE9A 4KEAA 1E5QA 1FFXB 3OCXA 3PRKE 1F0PA 3Q15C 5HBRA 1PR0A 3DL7A 3CZAA 3TXAA 1DO0A 3UHPA 1K8RA 5G0TA 1HQCA 3LOUA 2AK3A 1VBMA 4WCFC 4WCFA 2FDXA 3AOGA 1E2IA 3UK2A 3WC4A 3LI2A 1VCIA 1JQAA 3QWBA 4GBJA 1TJNA 5F9HA 3SMQA 2EX0A 3ADBA 2HREA 5DYWA 1I4LD 4NU8X 4DUGD 3C3XA 1YT5A 2XX3A 1NASA 3PR3A 4HZUA 4WZBE 5J4VA 4ITUA 3S8EA 3MBKA 5DN6A 2QJWA 3EGVA 3OA2A 2WZCA 3V8NA 2EC5A 2HA2A 5B1DA 3KCQA 1RI1A 3I9NA 3K1ZA 5CNKA 1H0RA 1OCEA 3O8QB 2F4NA 1B8OA 3B1VA 4M1YA 3ZXSA 221PA 3MCAA 1AQ6A 1L5HA 3NNDA 1UBRS 1GQ2A 3R3SA 2EG5A 4LVNA 1ZD3A 4MUXA 3W2EA 3ZZ1A 5I7UA 4HUQA 3IUMA 4BMSA 1KOJA 3BMQA 3H2IA 3WLTA 4LNUA 3JV7A 1UBOS 2JLCA 3USCS 3DYBA 1D5WA 4ESEA 3R24A 1VDMA 3PNPA 4G0VA 3N59A 1LZKA 1QR6A 3JQEA 4IJVA 3VNQA 3W04A 1WTCA 3X1KA 4U4AA 3EUEA 2DXIA 3CB4A 3LP8A 2ZJOA 3AP3A 3GU3A 2ACKA 1E8NA 2FP4B 2IEGA 1EHCA 3TCXB 5ADVA 2ZM6B 4FCTA 1MQ9A 1NBOA 3FWNA 1FNSA 3D6JA 3KETA 3SBEA 3CJQA 4I2NA 4YJ2A 4H6VA 4KPUB 1JEEA 1VZ3A 4NQZA 4B3DA 5H4GA 4PPFA 4HDCA 1YMVA 2EJUA 2W58A 2J5KA 2FJUA 2QB5A 4ZZ1A 2CF6A 4LF4B 5FQNA 3D1VA 1L0BA 2HJWA 4XM1A 2C97A 2FPIB 3K9WA 5EXDA 3BGVA 3P20A 4GYJA 2GYWA 1GT6A 4PFKA 3CHYA 2DSTA 1A8UA 1RYYA 3WFIA 1A7JA 2WSIA 1M2GA 3EDCA 3MPOA 4CUKA 2A1TS 2KLBA 2WFLA 4J0GA 1QOZA 2FRXA 2YIMA 1YR8A 2Y71A 2QG6A 4B81A 1EUQA 2FZCA 3CLUD 3H1FA 3UJHA 3WLJA 2DRIA 1OI4A 2WSSD 5CFQA 3GLFE 4BZXA 5AIAA 3AXSA 1G7TA 5EHGA 4EW3A 3QE3A 4UPEA 3PC8C 3KFXA 1YTLA 3PC8A 4R71A 4TPKA 1E1QD 3Q7SA 1YFJA 3M49A 1UBMS 1RBZA 4GXQA 4U8HA 3BFKA 5CR9A 1KO4A 3CLTC 4BATA 1S2OA 5IJWA 1ZW1A 2QEQA 2M6KA 3UXYA 3QVVA 3TE7A 4F85A 2YHAA 1NUPA 2BSQA 4Q7LA 1I9GA 1C4WA 1CR0A 1MLDA 2SNIE 2W6CX 4M9QA 3CT6A 2FPUA 3JWPA 3H9BA 5C7LO 1Z4PX 1EVZA 1ZW6A 2FPWA 3S5UA 5HS4A 1YDMA 2E55A 2RAPA 2ZUDA 1FYEA 3D3NA 4M88A 4OBXA 5E9WA 3RE1A 2W6NA 3G8DA 3ZWMA 2VTVA 4KQFA 2B3DA 1CSEE 2TMYA 1X2EA 3AEUB 1K2VN 2WPDD 1PG2A 2ZJ4A 3EY9A 3I2YX 3JD1A 4RKWA 2ZBDA 3VZQA 3DE2X 1F48A 1OREA 4PZPA 2F1RA 4JASB 1FP4A 3PQ5A 4D26A 1NVKA 4XOIA 2G06A 2L19A 2ZIXB 4JUIA 4KQ6A 1P2TA 4YP9A 3WL5A 5YASA 1H69A 1ZMTA 1U8TA 5F77A 4UE2A 4DQUA 5A7FA 4JJGA 2V0CA 3DEHA 2AYYA 3IOMA 4G1UC 5LYJA 3TLXA 4Z4GA 4MV1A 5DLDA 3N8IA 1JA0A 1NF8A 1Q84A 3FJ1A 3FPSA 4X62B 4ZV4A 3JQAB 1M34A 3OICA 2CNKA 2HF2A 4OOEA 5E9AA 4HZGA 4FB4A 1AO0A 5TNXA 2BYTA 3AVUA 5FUMA 3DXXA 1DU4A 4DMRA 4G4SO 4KZPA 3QKSB 2ZIAA 1CV2A 1Z75A 2ATCA 2GD0A 1JBKA 1RAAA 1GUYA 1VE5A 2D1YA 2QRGA 4INJA 4ZZ2A 3T3DA 5B5SA 1YQEA 2AFIA 4FGZA 2VNHA 1PEDA 1DPGA 1EMDA 4D4KA 5A4KA 3RRMA 2D5CA 3DVAA 3LHSA 3U2QA 1I7PA 1YRLA 1TU4A 2C4NA 2X2OA 4PEVA 3V7YA 4ZDJA 3VC7A 1NFQA 4HDNA 5FL7D 3FR7A 5EMLA 4I1PA 3ZWVA 3HXOA 2G5TA 3UQYS 5J43A 3ZBPA 3NHJA 4OB6A 3TOXA 2CMFA 4FT4A 1G5QA 1ZGHA 3PUWA 1CXZA 1N3BA 2QD1A 1E2PA 2B5VA 2WSYB 4YFVA 3EPJA 3NHZA 4EPYA 2IODA 1W87A 4G01B 5HG0A 5C51B 1WUIS 1X2BA 4FGLA 1DEKA 2A94A 3EEIA 4YRBA 4OX9Y 4YQFA 5JARA 2Q0HA 2D1SA 2IU4A 3HGMA 3V2HA 1Z7YA 5DN9A 1GJRA 2WSSA 1WW8A 2AQKA 3T9FA 5HA5A 3UMRA 2H3EA 1GGKA 2DBRA 1NNUA 2NM0A 2HL6A 2XWPA 3OC6A 4QUJA 5K0ZA 5DHTA 1X3LA 3UJPA 3UWOA 1W85B 2VF7A 3ZX4A 1E1QA 1N2CA 3TQQA 1ZVVA 2DHCA 1E3EA 4WT7A 5LQMA 2FN7A 1NG9A 1XCPA 1C3EA 1GDHA 3G7UA 4NE7A 2QIOA 3OOWA 3RC3A 3Q3VA 1TD9A 2IE8A 2JK1A 3BRQA 2MSEB 3T6KA 1ODIA 2YXNA 4UHBA 3FWYA 2RI0A 4UATA 3SJBA 4GFDA 4C6RA 2D2IA 4GMDA 3BIWA 4WFIA 1YZFA 2XOKD 3WGKA 3TW4A 4BTLA 3U9LA 1L9KA 3IGFA 4TROA 3TLKA 2BMEA 4F3YA 1Z68A 3ZWYA 2CV0A 1NP7A 4X61A 4M1ZA 1OT5A 4LZAA 4DC9A 2Q45A 2FMFA 2FUEA 3DZGA 4YACA 4BRZA 4MIOA 3PX7A 4Q9HA 1J70A 1EK2A 4UULA 3ESRA 5KVSA 4NYJQ 1FEZA 1CUHA 2DWUA 1Y3HA 3WGVA 1JTVA 3GQBB 4IDQA 1ZIOA 3ROTA 2QSUA 4A5OA 2O05A 4CM3A 1BZYA 2RKBA 3V80A 1O0CA 3ASZA 1H2XA 3FUWA 3DE7X 2Z57A 3G2PA 1L4BA 4ZIRA 2ZB3A 3O4IA 3O4GA 1MR3F 3KTOA 3LDHA 1H1DA 2IPOA 2NOAA 1QGUA 1QVWA 1Z5UA 1BS1A 1GLVA 2PSFA 4TS4A 4XM2A 4WLVA 4RA9B 3EDMA 1YACA 3EVTA 4L5AA 5DWVA 2ZJ5A 4KHPB 4BGIA 1TCCA 1NMQA 4CF6A 2VXYA 3O31A 2EKBA 3VYUB 2MJLA 1NZFA 3MBIA 3F7TA 5KU1A 5LN1A 2QMHA 1KORA 3FYCA 4JJ7A 4MCAA 2FZGA 3KLMX 3TD9A 2JFXA 1I2MA 1VHWA 1SHJA 4EFMA 4L72A 1PFQA 4YASA 3V6MA 3IUYA 4BUCA 2G9VA 2WWWA 4AG5A 4HWOA 1NW4A 1SBTA 1U81A 4NMHA 4PNEA 3WV5A 4QEZA 4KQJA 2VHYA 3Q7QA 5EVJA 1KDOA 1M6NA 1Y4DE 2V7VA 1GPLA 1Y89A 5D3MA 5FR1A 2QNBA 1YS2X 4TVSA 4PZCA 1CUJA 4IW3B 2ODPA 5FL7A 1AUPA 4UNIA 4MWTA 1NWHA 3QNUA 4EY5A 2WJAA 4IMJB 5HR5A 3F4LA 4LZPA 3OE7D 3H5NA 4PANA 1X8JA 1BMFA 4XGNA 3ZJUA 1WXDA 1XTRA 1ZPDA 2JLAA 2QMQA 4WJKB 2O8CB 1GQRA 3QY9A 3VH4A 2CUNA 1EP3B 1NMYA 3FYDA 3KE8A 3I1YA 3KKKA 4Z9AA 3WL3A 4M1EA 3TD2A 1SEPA 4JDPA 2R8OA 4KDCA 1L5RA 1MQAA 1OH5A 3ZY4A 4MYCA 1G8AA 4M8KA 5G4KB 7MDHA 3M0EA 2GRAA 1T1IA 4R9RA 1KHTA 2QUIA 2VT7A 4RPLA 2A14A 1DC5A 4JIGA 3AIMA 4E12A 1N25A 4DMGA 4KE6A 5F7JA 1SVSA 4K9LA 3UAYA 1GG8A 1RMQA 4OYHA 4F4FA 4V0QA 3TVTA 3UYKA 2FCAA 4DT1B 3FNEA 2LIVA 2Q2OA 4BNLA 4HBZA 3IAS6 1HV8A 2RJNA 3UJ6A 4J1NA 2Q46A 3P32A 4E33A 1MFZA 3C2QA 4DCGA 1DQSA 2ZEJA 1H9BA 1HT2E 1FYDA 1J0AA 1HXHA 2VJCA 4X24A 2QYTA 1FTNA 1M2WA 3LRXA 4YHBA 4AUEA 5JASA 1RJWA 1FDTA 4B83A 2HK7A 5K4AA 3EVZA 2VHJA 1LEHA 3F8WA 1BS2A 3CR8A 5DNWA 3M5DA 5CNMA 5ARBA 1J5EB 2PH5A 5CXSA 2IGTA 2BR4A 3G2NA 4LSMA 4GG1A 3GDHA 5HZGA 3CY6A 1X1TA 3A1UA 2QW1A 1PZXA 3A6DA 1UMBA 3R8CA 3JWGA 4GQIA 1W36C 4F38A 4MV9A 2JGRA 3GJTA 4KSBA 1DUVG 1USWA 3FCOA 4H3VA 4KX5A 4Y9RA 1DIBA 3VH2A 4ZGBA 3KOXA 2CXSA 2P9JA 4Y9DA 1LCIA 3PDHA 1QE5A 1LBIA 3L7DA 2J5RA 4QU9A 3K5IA 4M1MA 4FP9A 4I5FA 4NK5A 2C0PA 3KAPA 3A2NA 4B3IA 4PNHA 5AKYA 5IMBA 1W5AA 5J2UA 2QAIA 1W4RA 4AMGA 1JLKA 2XIJA 3ZWOA 1JXMA 3DMGA 1RLIA 3NUGA 4W5TA 4GP7A 3PU6A 1BKYA 4ZJZA 1IBRA 3GJ8A 1R0ZA 3F6SA 4J8PA 2F62A 3FHJA 5EN4A 1UT6A 5NLLA 1Y7HA 3SX4A 4XB1A 2N0SA 2ENWA 2PY6A 3P52A 2I9PA 3LL4A 3BEOA 1MB4A 1NY5A 1ZG3A 2FPLA 5DP1A 3WRWA 3W8NA 4XVHA 2YWGA 3LX6A 3G0BA 4EVRA 1AXRA 2OZKA 4FNMA 3ZGYA 5IZ4A 2IH5A 2JD0A 4M8LA 3I64A 5JTTA 3OWOA 1MX3A 1YS1X 2QLBA 2UYHA 4R9UC 1ZICA 5FTMA 3ECCA 4QDUA 2FQ1A 2VT3A 3WZLA 3LVRE 3RBXA 1K89A 2QM0A 1R7RA 4DY4A 1FX1A 1QYVA 3DCNA 4R2WA 4F3TA 5EHZA 3R7LA 4OQLA 3NVDA 1VHTA 1YQXA 4Q4JB 2QRMA 2R8XA 5J2TA 2J0SA 1E99A 3E05A 5KTKA 1PGJA 1XR3A 2JJ1D 4EB6B 1A7KA 1SG9A 2YN0A 4NWIA 2H4JA 4ROTA 3DZJA 1TUBB 3P45A 2GBGA 2GN6A 4I8DA 3F3MA 5K3AA 5CFPA 3CUSA 1HFEL 4M7OA 3R5XA 4R54A 3IE2A 2RHTA 1CJTC 2W37A 1QV7A 1HUQA 2XYVA 3O7WA 4JKYA 4FE7A 4KQ9A 5F1OA 3RK4A 2HADA 3WMEA 5JCPA 1GTZA 2Y66A 1TYCA 4XYBA 1GKYA 4JC4A 4V1CI 2PYZA 1OI2A 4MGZR 4P33A 4A2QA 4LBYA 5ICCA 2CMDA 2X0RA 5JSHA 3U7QB 1OLSB 2Z56A 3PHCA 4HEHA 3UEOA 2HPAA 2IH2A 2WWTA 1GVHA 4JJAA 2FOIA 1PGPA 1F1JA 3MTQA 3TR5A 1UKCA 1MJNA 2I3DA 3PXCX 1ZOOA 4E5VA 4KODA 4QGFA 2BAGA 3JWHA 4O2LA 5LLDA 1WG8A 4A23A 3E5NA 4UUAA 2DB3A 4XWGA 2ZBVA 3PUJA 4BAZA 4XVCA 2X3YA 3AZQA 4PRZA 4UC0A 3C6XA 1IN1A 1SCBA 4BQOA 3BFJA 4Y7CA 4OHUA 5TQ2B 3MMZA 4IWNA 2B6HA 1E6EA 4URHA 1F8YA 3TIFA 3AVXA 3B12A 4CV0A 4PLGA 1PLJA 1PR6A 1I5OA 1QBGA 2V7BA 1UANA 2E21A 3WA6A 1E1NA 1EXWA 1ISRA 2NWQA 1IU9A 4OO3A 5LYYA 1XAGA 3TLCA 4AS1A 4YRSA 1RRFA 3N7AA 4KFTA 2CUKA 2XXBA 3MSXA 5EJ4A 5E4TA 5TS3A 3WLAA 1GPBA 3HR8A 3KAQA 4XPIA 1ZSVA 2IYWA 3KZ1E 1L1FA 2WNHA 2EGUA 2QYOA 2ZJYA 4TSFA 1QS0B 2GOYA 1K0UA 4D8WA 4D8UA 3IKVA 1ZGAA 3IUPA 2J9FB 2P2YA 5BPFA 2OORA 3T4PA 4OG2A 4AVYA 3HDVA 2FE4A 2FEWB 3OM1A 4B80A 4M83A 3NH6A 5DE3A 1I4TD 1PL6A 2HPHA 1TKAA 2VNKA 3CQ9A 3O26A 4DIKA 2V9PA 5JCOC 5K8JB 2Q21A 1IWPB 3NOXA 1W2WB 4DIEA 4KITB 2B9VA 3G5UA 1DIHA 4D9NA 2YRFA 5JEDA 5EZYB 5IANA 1Z38A 1L5VA 3BMCA 1GDDA 5DGDA 3ETCA 4CU2A 4ZCPA 4AJIA 2PS0A 4HN2A 4HTAA 2QRPA 3WRYA 1RAGA 4PX2A 1YIOA 1H0SA 1L5YA 2G5GX 4EUSA 1NPYA 4S04A 4FDMA 1DAFA 2X13A 4RX1A 1XZPA 2VHWA 4AN4A 1SNYA 2AUMA 1TCUA 1OZAA 1PFGA 1X1BA 1XD8A 3W4JA 4D8YA 3C5WP 3JY6A 5SYNA 3ZHCA 1W25A 2YWDA 3F7MA 4F4CA 1V95A 4RTRA 4OXIA 4ZANA 5J4YA 3SLGA 4JH0A 2YDXA 2HMAA 3R5FA 4GQAA 4BZZA 5HSGA 3ZVLA 4F6CA 1KI4A 1Z8DA 3FSGD 3U61B 3U3OA 1SB8A 1QOQB 2ATVA 2J9YB 3U4QB 4WXYB 1UPUA 2I1QA 5U9CA 2WYHA 1AQLA 1HG0A 1WCXA 3D8BA 2J9RA 3IUNA 5DIZA 5ALZA 4HYEA 1Q0RA 1E3QA 4KN5A 3EZXA 3NEJA 3V8RA 1S2NA 3VOBA 4DLTA 1P4RA 2EZUA 4DMMA 5KTTA 1FDOA 2PQ0A 2XPCA 2ZUCA 2FX2A 1A77A 5DWDA 1ODJA 2J6BA 3GWZA 3IPXA 3KYJB 4JLAA 1K6XA 5K0JA 3C5CA 4FD3A 4UDOA 1NVMB 4P3KA 1BGVA 4OI2A 1RBYA 4ZRMA 3DNPA 2FPRA 1G21E 1KEPA 3A06A 1AQUA 1Z0UA 2EDAA 4CKWB 3ZVMA 2BEVB 4RVNA 1VA4A 2GO7A 1C8VB 1KNXA 2B98A 5FPYA 4YY3B 1MNQA 4O08A 4TMYA 1SVUA 1Z18A 3WG9A 3NP9A 3EG5A 4XVUA 5CAEA 4M1OA 4ZQCB 2CMHA 1EZ1A 2Z09A 1D2NA 1KMNA 1QIEA 1U7TA 3DZKA 1BX1A 1E66A 3WSWA 3VR2D 2WAOA 2A1UB 2R44A 1EZ4A 2XGGA 4IG4A 3B7PA 3H18A 1GV0A 4PCAA 4NNJA 4YWJA 3RW9A 3RDPA 1WB4A 2QX7A 2ONCA 3DD1A 4HWPA 1K3TA 2B5OA 2O3UA 2C5SA 1LQUA 2YZMA 4BP1A 1NFFA 5B4TA 2OV3A 5G3YA 5FJJA 1Y9JA 4F4HA 1AX9A 4V1CB 4L08A 3TDNA 2WMYA 3OLVA 1U28A 3ORSA 1L4FA 1UR5A 4ZARA 3ED5A 3MQ2A 3U0VA 4ALIA 1QFMA 5ER6A 3CMMA 2QJRA 4LE0A 2G17A 1W5EA 5CA1A 3GCXA 4Y7DA 4X97A 3UPDA 4R0VA 1MENA 1XPJA 2JGDB 2X9LA 3VNVA 4PQRA 4PLCA 4IFIA 3MAJA 4BMXA 4OQPA 4JLKA 2HQOA 3UA3A 1NBME 4BGUA 4DCCA 1XKXA 4BE7B 4C1BA 4G5QA 3PRHA 1T4MA 2YY6A 2CLLB 4YFYA 3ROMA 1Y0BA 2NXNA 1Z2AA 3MZ0A 4LV5B 1L5LA 2D06A 5G0VA 4W7HA 5EEGA 5EXTA 3TQIA 4CEIA 2BGTA 3TKAA 5FKJA 1EG2A 1NKTA 5DNDA 1K9VF 1EVJA 1M83A 3IT0A 3G8AA 1ZAKA 1I2ZA 3L92A 5ILQA 3KSAC 3BA1A 3MUNA 2YHUA 4KXWA 1SCUB 3QEJA 1H8HA 2JCXA 3QOXA 3STUA 4Z54A 3CRZA 4UEKA 3VZPA 2R0QC 3W5IA 1O0SA 4FPXA 2D0DA 3LUHA 4ON9A 2E4AA 4UQOA 4JQYA 4MPDA 1Z62A 5K8CA 4RY0A 3U3DA 2DBVO 4BRUA 2R6AA 1MV8A 3BEDA 4UW9A 4B6GA 1GARA 4LECA 2BDTA 4UE3S 5DSXA