1C2YA

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
b'MNELEGYVTKAQSFRFAIVVARFNEFVTRRLMEGALDTFKKYSVNEDIDVVWVPGAYELGVTAQALGKSGKYHAIVCLGAVVKGDTSHYDAVVNSASSGVLSAGLNSGVPCVFGVLTCDNMDQAINRAGGKAGNKGAESALTAIEMASLFEHHLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (LUMAZINE SYNTHASE)
molecule tags Transferase
source organism Spinacia oleracea
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly.
pubmed rcsb
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c2yA00
2JFBA 2A57A 1RVV1 2C92A 1NQVA 2A59A 2C9DA 1DI0A 5IM4A 1W29A 2B99A 4KQ6A 1XN1A 2A58A 1EJBA 5IM5A 1KZ9A 1NQXA 3NQ41 4J07A 2OBXA 1C2YA 2O6HA 1ZISA 1NQWA 1C41A 1KYYA 1KZ4A 1HQKA 1KYVA 1KZ6A 2C9BA 1KZ1A 1KYXA 2I0FA 2B98A 1W19A 2C97A 2C94A 2F59A 2VI5A 1NQUA 1T13A 3MK31
chains in the Genus database with same CATH superfamily
4MV4A 3KXLA 2QLNA 2GN6A 3DL7A 2XTMA 1I7NA 2B0CA 2AWNA 5DULA 3U31A 4U7TB 3BMXA 4BUJA 4FEYA 3DFUA 2PWYA 5ETJA 2JAHA 3GFQA 3RWOA 3D4OA 3Q0TA 3LRTA 4J43A 1SB9A 1NPDA 4TSRA 4UFOA 4GIBA 1RABA 3O4FA 4LOIA 3EYWA 4IJQA 2VXOA 4S0ZA 3HU2A 3QF4A 1ATZA 3TZLA 3VTAA 4LY9A 4TL7A 4B3XA 1VJCA 2XYVA 4DIBA 2EFGA 3OLXA 1P5RA 2Y9PB 5J58A 5DN9A 3CZQA 4C4PA 5IPFA 1Y5MA 4ENUA 4Q3DA 1IE3A 2VJPA 3INNA 3QKUA 5A3SA 4GXTA 4ZQIA 1R0ZA 4QYXA 4R9NA 2G28A 4FYIA 4I0WB 5DLPA 3RRFA 1T8YA 3Q7PA 4LDZA 1L5HA 2WIJA 1Z0IA 1SHKA 3B1JA 2FETA 1I24A 2W0SA 2QYHA 3BA1A 4WN9B 4KITB 1UEJA 2PRJA 1SKYB 4Q3AA 3KZXA 1N2EA 5TF0A 2Q4EA 2AG6A 3U4DA 3RO7A 2C7GA 4DLXA 2GLTA 5JQGA 3HCWA 5C0OE 1MJGA 2H17A 3SXJA 4EI9A 5JY1A 4Z53A 3EMDA 3EGDA 3S7TA 2IOQA 3KAKA 4RD1A 4M1MA 8MHTA 1W9MA 5CT6A 4WUTA 3HXOA 2A5FA 3BBLA 2OESA 3N28A 1Z4OA 4GEKA 3H19A 3PSHA 2O8EA 1ORVA 1FDVA 4G26A 1EWRA 1Y8AA 2OZKA 4PYKA 5DI9A 3BTUA 1XTJA 2O2CA 3HCOA 2G0NA 1QIEA 1N5RA 1I01A 3ITKA 1TCUA 4YRSA 2PJRA 1XZNA 3VSDA 4DCVA 2X8WA 5LKRA 1RYDA 3GUVA 1A77A 4PYIA 1MH9A 1WSDA 2AL7A 3HMQA 1H0SA 3GFSA 1XEAA 4IS2A 2AOTB 4Q1DA 1ZD3A 3C41J 3LGSA 3V8RA 2WU0A 4ZYWA 3R9XA 4XGRA 5I3ZA 3PVCA 1IBMB 5HMLA 4OCZA 5MN6A 2BF4A 4MIEA 4DNPA 4ML3A 2Y1WA 3NT2A 4J16C 2IH5A 2IIVA 1HY3A 2P2LA 4I50F 5C9ZA 3GLKA 3W06A 2XNDD 1D4AA 5KBYA 3NONA 3VUFA 5JAUA 1U7ZA 4R2MA 5JMWA 1H8EA 2I2WA 2PH5A 2ZQ5A 1G6HA 2NNWB 3M3HA 5T4BA 3B3JA 3HKBA 1XNRB 2DE0X 1J2YA 1TUIA 1U11A 3T1YB 3TPFA 2ASVA 3NC4A 4IS3A 4J3JA 2EATA 1K7CA 4GPTA 3NEPX 1MCZA 2RGYA 2KE5A 1X80A 4HFNA 4WDRA 1KK0A 3U37A 3R20A 1G21B 3TLAA 2AFHE 1ZIPA 2ONCA 2O6HA 4RMHA 1WZUA 2W2LA 4XSGA 1QRAA 2ZUUA 1IY1A 1NVTA 2BZGA 3PLAE 2NV2B 3KZNA 4OQMA 1UKEA 4DWWA 1WZ2A 1KJ8A 2E48A 2I4MA 4JMLA 3ZV6A 5C1OA 3AVPA 2X5KO 3BSWA 2VJMA 1Q12A 1QK4A 5GM2A 4S04A 4JJKA 4AQDA 1Y4SA 3F5SA 4B3BA 3OU2A 5JD4A 1Y7TA 4ZMRA 5KOIA 1Q2XA 3F49S 3FHOA 3WL7A 4H17A 2FMFA 3QIAA 1BVYF 2L2QA 2MMGA 2WUVA 3F3YA 3LVRE 4PYLA 1E9DA 4RD6A 3KR1A 4IFIA 4MB2A 5EPEA 4HDCA 4E4TA 4JL6A 3U7QB 4YT4A 1RQ2A 3NX4A 4E0BA 2CHGA 2GM9A 4IL5A 3S1AB 2GT1A 4I9NA 4KR2A 3MJTA 1I1QB 5K5EA 1U6JA 3WK4A 4A7PA 5DMHA 4NNPA 3EBLA 2C1XA 3K9BA 3VU9A 1RU3A 3P5BA 1XD2A 3AVOA 3FTDA 3TRKA 1UFRA 2VF8A 2PMBA 3T61A 2W4MA 2R8XA 3FTCA 4UU1A 4EG4A 4K46A 4M3NA 4OGWA 3ZIUA 3S29A 1OZGA 2NQ8A 3BFKA 3R0QA 4FQ5A 4KE7A 1OREA 4U7HA 2IOFK 4WASA 5CFRA 2BF7A 1H0KA 2FW1A 2R8ZA 3WLLA 4I1OA 2XRFA 2ZBVA 5CJ2A 1B8OA 1JQLB 4Q7MB 1O6FA 5BWCA 2CFOA 3AHFA 3EZGA 2G5TA 1YVEI 3BF8A 2BGUA 1YASA 1CKEA 1XALA 2EAUA 3D3NA 3G2PA 2YN4A 1N0IA 3HCAA 3HO8A 2Z8YA 3IKJA 3GA5A 3UB4A 3LDHA 2GXQA 1YZKA 1YR3A 1A69A 1C7ZA 4GOXA 2R7AA 2VTBA 2XUOA 2PGLA 4LSZA 4Q37A 3R9KA 3S3TA 3I2JA 1GLNA 3ZLVA 3STYA 2GYUA 3UMMA 1NVEA 1N2CA 1VL5A 3C5VA 4IV8A 1NDQA 2HJ9A 4V38A 5CBKA 3PCXA 1WIWA 4A91A 3UHJA 2J6BA 4KR7A 2WR8A 5BNWA 3FNQA 4HEJA 2AMLA 1FYEA 1VP9A 2NU7A 3OVMA 1X9HA 5E3JA 4RE5A 2J9ZB 2WVJA 3FYUA 3JWPA 1PS9A 2JBAB 3EGCA 5IDWA 1JNYA 5JJCA 2HMTA 3L5KA 3AI1A 3PXUA 1N25A 1ENYA 1QYVA 3UMRA 1Y6QA 1J42A 4G5YA 2QPLA 3QVJA 1KI2A 3GN1A 4PFKA 1N5LA 2CDAA 5ILGA 2Q2WA 5U9CA 3AIMA 3H9QA 1P1KA 1T6NA 4AYTA 2PCLA 2UXCB 2C9MA 3KAPA 3W6UA 1CY2A 4ZMSA 5F7OA 3K1TA 4Z4FA 2DMRA 3C24A 4C7XA 1JAXA 1B93A 1KSFX 4OJTA 3TUJC 3IV7A 2SKCA 3MJDA 5FKJA 2O2JA 3JAKB 2FZCA 5FUYA 4W5OA 5HQJA 4JXXA 1C50A 3GCGA 1L7XA 1X7WA 5HS4A 3QI2A 4R7TA 4X95A 1IZZA 3G85A 5EJAA 5IFKA 1NE7A 5H70A 4A0SA 2H1SA 1XDWA 1QKJA 2X86A 2Y93A 2PMEA 5I3CA 1TUBA 2QM3A 1E7SA 2W8ZA 4CF4A 4RQAA 5JJKA 4FKZA 1NTRA 2C9OA 1YWGO 4DAOA 3OTQA 4V2IA 1AZLA 4LNHA 4B3FX 2HF7A 1EUDA 1Z34A 4WIAA 4OHVA 1JDNA 4OHZA 6NULA 3O2JA 2ADOA 2G1AA 4OTZA 4HVLA 3ADKA 1T13A 4W5RA 1T9KA 4PZEA 1O2DA 1M6EX 2LD4A 1GFIA 1XU9A 2CNOA 3UPUA 2F64A 2WV7A 1CJBA 5KJFA 3U3KA 3TLJA 2C96A 1R15A 4K87A 3T0GA 1RKXA 3QE3A 4NOMA 5ES3A 5SZKB 3ZUGA 4WERA 2DB3A 4NBTA 1TT5A 3ZDDA 3KALA 1GTSA 1OAKA 2NZYA 1DC7A 1NP7A 2FSUA 4YCDA 3WJ1A 4C7JA 2MU1A 1GHTA 1HC7A 4CQMA 1W0KD 1XU7A 3GDWA 3CRQA 3QFFA 4XJVA 2X9VA 2UUOA 4A92A 2V7GA 1QOQB 3QJYA 4AK9A 5JBIA 3TQFA 1W34A 2QRNA 1R16A 5TPZA 2NMVA 1EDOA 1Q2UA 2IQIA 2QTRA 3EZNA 3LVFO 1U7PA 2Z2JA 2IKSA 5H81A 3A9CA 1F5NA 2MINB 3IA7A 5IVHA 2E82A 5D6OA 3NNDA 3SM3A 3H0EA 1ZUNB 4HTFB 1YOBA 5DNAA 3EIHA 1XXHB 3B5JA 5FUWA 4FS8A 3OI7A 1WCXA 5FWXB 5TVKA 4UDOA 2IUEA 3RJMA 3FCYA 4DLRA 5KVCA 3BRCA 3R4VA 4PNHA 5L3QA 5I5EA 3FOZA 1BKYA 1C7EA 5DDIP 2C2XA 5SYNA 2YR0A 5SYMA 3T12A 1Y33E 3KR0A 2RGXA 3RG8A 1IBLB 3E5MA 5G0UA 4NCAA 1B6GA 5AXDA 1Z6QA 3MHPA 1R0LA 3TG2A 1MV5A 5LC1A 4CMHA 1KFBB 4QASA 2GO7A 1FLAA 3UJAA 3W2HA 1YJBA 3O75A 3JWGA 3AF3A 1EFUA 1KY5A 3GLHB 1XN4A 1PZXA 2QXUA 2AEFA 4B3SB 3JQPA 1UP4A 1BHQ1 4Z9AA 2HB6A 1FL9A 2EC5A 3DONA 3VTFA 5G3YA 1DDGA 1RRKA 1RJDA 4MWEA 3ZWNA 2XD9A 4F3CA 4ZIRA 5JYBA 2IF2A 1KS2A 3F9CA 2P6NA 1N0UA 5BYAA 1XRQA 4NG4A 2ZB2A 1NBAA 2V74B 5K3EA 3UJHA 4RMGA 1OLUB 1GITA 2VH2A 2BM1A 3ZHYA 1Q7TA 4LCJA 3KTAA 5A9RA 2CLKB 4QOSA 4CM8B 1RQLA 5F7XA 2PS1A 3BERA 3ONFA 3W2GA 9GPBA 4M46A 4X7PA 4Y9UA 2QJFA 3I9NA 4E46A 4EI2A 4ZCIA 1TIKA 1PL7A 2VDLB 2CFCA 3E22A 5CB4F 4G0QA 2Q4RA 5EEHA 5LYJA 3QLVC 1IMJA 1KR5A 5IK2A 4EHFA 3PIRA 1RBMA 1K63A 2XYRA 1F2UA 3LSYA 4JGBA 5J2UB 3RRZA 1OWPA 5GGXA 3X2SA 4D80A 4DQKA 2ZCVA 1UKZA 2X4GA 5ICCA 1BRMA 2D0OB 5IT5A 3LFUA 3HP1A 5BPHA 2H9AA 2M6KA 3F7MA 4TMXA 1U3DA 1IDN1 1XSEA 1GTL1 4AZTA 4RPCA 3VR4D 1KC3A 3D3KA 3CRZA 2ZWIA 3OAAD 4KUEA 3EG9A 5DLYA 3KLOA 4HB0A 1I2CA 4B46A 1OKKA 3C7DB 1GEGA 2EQAA 4R8VA 4P83A 1R4ZA 5CGQB 1DX6A 4I8IA 3GNQA 3I0MA 2GJSA 1H0HA 3B12A 3DZGA 3JALB 3H3JA 3R3JA 1SA0B 4BQOA 2EDAA 2P9EA 4HUQA 5DRTA 2B61A 4RMIA 3NJRA 3RKRA 1Z2CA 4ARZA 3LHSA 1LW6E 2D1TA 3LUHA 4FT2A 3GD5A 2WQ6A 5ALIA 4FHDA 1ECFA 4IUBS 2JAPA 4R83A 4RYDA 5K4AA 3E8XA 3WFIA 3PQ2A 2PUHA 1TYZA 4RS3A 4KPUA 5JUWA 5LMZA 2JGEA 3AOGA 5DEIA 4TKVA 1B6SA 5DSTA 1OB5A 4PAQA 3F6RA 4GR4A 1M1NB 3N7AA 5JAHA 1Z35A 1PG5A 2QL6A 2KB0A 3B1WA 3AR5A 4A03A 3JQ9C 3WAJA 2XTNA 3RYTC 5DSXA 1NULA 2ZWAA 2XITA 4L72A 1G7CA 4RK4A 3N0VA 1T0PA 2AC7A 2WVAA 1G5RA 2P9BA 4P36A 2GWHA 3JQAB 4QUIA 5LDHA 4S12A 3ZGNA 4OSPA 2NVWA 4P92A 4I8DA 2C92A 3U7RA 1NXOA 3QF7A 5KYXA 3DMGA 1L8QA 2P69A 1HL7A 3JTMA 2F8LA 2HLPA 2OECA 3FKQA 3OETA 3W1WA 4NULA 2V59A 1SU4A 3T9AA 4LE1A 3D7LA 5AJXA 4KWEA 3SZGA 1PNQA 1G8AA 2AN3A 4RCYA 2F4VB 3E3OA 1JIQA 4JI0B 3ZH9B 1L3BA 3RUIA 1QLJA 3JQAA 3RU2A 1IUNA 1U0SY 3Q6MA 521PA 3AFNA 5C5CA 5B30A 3WXMA 1R9JA 4X44A 4TWBA 1VE6A 1G5TA 4BC0A 1AN0A 3ZR4B 4RVUA 2RGNA 3V33A 1YB1A 2I0FA 5J5VA 2IU3A 4DR7B 2QVXX 4NARA 3FUXA 1G3UA 3PNQA 1KWKA 4BJ5A 1TAGA 4MKXA 4TVBA 5EPOA 1LPPA 2REXB 3HB1A 4X6LA 3W6PA 5CCXA 1DG1G 3MK31 5JVDA 1GG9A 3ELWA 5ESWA 4OSEA 3IB6A 4OF4A 1G8SA 1PGJA 2I3DA 3G8AA 2FSHA 4R8MA 5FUQA 2V7QA 1M1XB 3ILVA 1AMNA 4F5ZA 3NFRA 1XDUA 3A2LA 4HDRA 3N2ZB 4HUQB 5AW4A 2J59A 1Z45A 1P1IA 2TRSB 3GCXA 4URZR 3SVLA 2V0NA 4Y1EA 1IBCA 2HPVA 4PRYA 1DIGA 2PBRA 5EJIA 3TZQA 4GP6A 2X0NA 4GKVA 3BD6A 2NX2A 2H1FA 1VPTA 2LR0A 3NVDA 5LXTF 4DCGA 3QGMA 4YT2A 5L40A 2J3LA 4CM1A 5GONB 5F2OA 5JXWA 3KG2A 1TGVA 4QAQA 4WEQA 1YQXA 1U0LA 5AXBA 4MYCA 3RVNA 2XGMA 1FQOA 3WOVA 4U2DA 5HOEA 4C2UA 1Z83A 2GCOA 2GCOB 2W2PA 4UOZA 1CRPA 3DHNA 3WYNA 3V2GA 5B37A 2PLAA 5DGCA 3U81A 1R6BX 4B6JA 4D25A 2YJ6A 1YR1A 1RYMA 2C3MA 1T2EA 3G88A 1CJTC 1BVHA 3C15C 3PPWA 4IIVA 5KX5A 1GPYA 2IPLA 3FFWA 1DMSA 1GUFA 4DCSA 1P75A 1N4DA 1RKBA 3PZRA 4TL9A 4D9NA 1QO9A 2ID7A 4CKWB 3AUYA 1M2HA 6REQA 4IDCA 3M2TA 3CWZA 5DWQA 2B35A 3NOVA 2R86A 2AI1A 1MO5A 1QLHA 3DOCA 2ZRJA 1EA5A 3MQ4A 1JHVA 2IXTA 1J25A 1WG8A 3C1OA 3OLVA 1ONSA 3KS9A 5P8WA 4GI2A 1SUWA 2G0AA 3HBNA 2BKVA 1BXRB 4KBFA 3VKWA 1FP7A 2PZKA 4MS1B 2VDPB 4PZ9A 3KUKA 3H2KA 4HZGA 4X1IB 5IJXA 3O4VA 4CKZA 2CXPA 3RUFA 2PT9A 1XAIA 2QM8A 2QRUA 2RSLA 4ND1A 3U3DA 2YWJA 1U5CA 1UQTA 3WGMA 5CX4A 4TKLA 3ZDRA 4NJEA 1IPEA 4JU8A 4R68A 1BJTA 3CFYA 5C1PA 4ZZ0A 4EG1A 1L5FA 3CPHA 2QORA 2O2EA 3MYYA 3MBOA 3PICA 2OO5C 3P0IA 2ADFA 4TS4A 1AH2A 1PNOA 4WCFB 4R3WA 1UDRA 2QTVA 3PXEA 5H02A 1IM2A 3TMAA 1YS2X 1P0CA 5JI3E 1KSHA 5DM2A 3V6MA 2E1RA 3LSTA 1SURA 2V4MA 2YUTA 3MEQA 4X8HA 5K01A 3MT0A 1Z5UA 2ZJ3A 1E5XA 4IIXA 1E4EB 4EK9A 3AQIA 1SVUA 2B1JA 2BY4A 4UNSA 3B9QA 3GJ8A 4CKBA 3UYKA 2D1YA 1U2SA 3DPIA 2ENUA 4GXNA 5AOBA 4REQA 2K2QB 4INJA 4Q1EA 4B6RA 2OBYA 3GJQA 1W75A 2Z2YA 4BKPA 2ZIAA 5HOQA 4M76B 4MQFB 1NAIA 1NT4A 1U9CA 2OBXA 1K0FA 4QYIA 5B58T 2YJNA 5KAPA 2YJZA 1ZISA 4JGIA 3ZKWA 1AUXA 4BNHA 3WLHA 1JFTA 1D1PA 2FW6A 1T34A 2D54A 2QT1A 3FIJA 1Y8RA 3T7KA 4GBED 2A9PA 5J2TF 4OQXA 2C97A 4Q9LA 1X7YB 3VO8A 4RPJA 3H5LA 2RB5A 4Q6BA 1DCFA 3O2NA 2AR9A 2Q0SA 4K6KA 4KZKA 5FTWA 5HBRA 5JE8A 2PNJA 1C3EA 1SCAA 3A0UA 1RVV1 4DKJA 2ZI4A 4P0PB 3DXYA 5FBHA 1T8UA 4TS1A 3N6XA 3L7JA 1DXQA 1G2OA 1SBQA 3F6YA 3LL4A 4QBFA 3H8SA 5AKLA 4R0MA 1ECLA 3VSEA 3DKKA 4JKOA 2G25A 4EB3A 2LIVA 4UATA 4EW3A 3A1SA 5CDGA 1XF9A 2GERA 2IZ7A 4AKGA 4X7MA 2O5RA 3H7IA 3HMKA 4ZC8A 5IVIA 2RIRA 4B3JA 1I36A 5FOVA 4LF6B 2C9YA 2GEBA 2W2LD 3L0PA 2FWIA 4LOJA 1JBEA 2P4EA 3KVYA 4B74A 3ZJYA 1FQWA 4G41A 3UQYS 2W22A 3FUWA 4MV6A 3RYCA 2REQB 1Q11A 4A10A 2NXCA 4F6CA 5A3JA 1M2KA 5F12A 3T5BA 3GEEA 1P9LA 1E8MA 2PX3A 3KHUA 4RELA 5BSKA 2P9QA 1RLTA 3TLMA 2ZIXB 3DLBA 2EJTA 4TZ0A 2I55A 4IDOA 1CR4A 2QTWB 4PBTA 1JYEA 1CWUA 1MAHA 1UOQA 2EEPA 1DAOA 2NT3A 3BIXA 4QUKA 4WZBB 5TQJA 3UAXA 3A9UA 4MKIA 3VI3B 4QULA 4YRZA 2CD9A 2SHKA 3O3MB 3HYTA 4K1XA 4D4JA 1K98A 4YAOA 1Z0KA 4AMBA 3CNHA 3MTJA 4B3IA 1M7HA 1RHKA 3L05A 3AW9A 2JGFA 1DG9A 3RYIB 4W5WA 2ODQA 4BO4A 4E11A 5HKKD 1K86A 3L0IB 5J4KA 3OJLA 2WI8A 2GF2A 3ZJ4A 1LPOA 1GZDA 1ANKA 4FOPA 2H4FA 1NVGA 3E4CA 2GNOA 4MA5A 4MW5A 3WL8A 1RYNA 1CX9B 3KEOA 4HF7A 4YJGB 1LRJA 4U2KA 3TTVA 5KTSA 4JYMA 4I1YA 5J5CA 1ECJA 1CJMA 2J45A 3PYMA 3R3HA 2GBFA 1LDNA 2XNHA 5E4YA 4DMFA 3IOCA 1PV2A 4MV3A 1OT3A 4A8TA 3K9CA 4IIEA 3IP9A 5ALWA 1N6KA 2VHWA 3JWJA 4GKJB 4NZPA 3CEAA 1D7OA 1QYDA 3CF2A 3GJYA 5A02A 4LZJA 3QE2A 2ZYTX 4GLOA 1MUUA 3CBQA 1DOHA 2YQ4A 5FL7A 4EKGA 1BG6A 1BROA 2I5PO 3HBAA 5HPYB 4AN0A 4GWLA 3ZVNA 4EJSA 3KJHA 2OGTA 3O6VA 1E0DA 1U7TA 5JV5A 4J7AA 3DV2A 4WHMA 1S3GA 2E4WA 1Y34E 1DXYA 3CB4A 3TLCA 3V4LA 2JIOA 1UMCA 1O96A 5DTEA 3D7NA 3JQFC 4XXHA 1QR6A 1BOOA 3Q40A 5EMKA 3K5WA 1QUEA 3W4IA 4Z9BA 1DAMA 2XMGA 2F43A 3VKFA 1URPA 2P9YA 2XGSA 1U1IA 3OZWA 4FJ0A 4TS3A 2I4NA 4CFSA 1YU9A 3AXTA 4MUAA 2B7BA 3UUWA 5AT1A 2WPDD 3NIFB 1OLOA 3G0IA 3B9BA 3LZCA 4YFVA 4ZAXA 4EYSA 1UT6A 4ODIA 1VLVA 3UC5A 4Z4EA 3GLFA 3KE9A 1H42A 2ET6A 1GZ6A 2PIDA 3FSGA 5T64A 4AZ0B 1YRAA 2OYSA 2P9CA 3ESZA 2ZQZA 3O8BA 6LDHA 4LW8A 3G9UA 3JQGB 1ICIA 1C9EA 3B2EA 4JROA 5CT5A 4GXQA 1MN6A 1UBRS 5E3HA 3NFYA 1REQA 3TQIA 2R5NA 3AF6A 2HCFA 1EM6A 2MR6A 4GAEA 1XP8A 3RWMB 3GJ7A 5K0FA 1R5OA 1NVAA 2HU2A 3MLBA 4XX1A 1XV5A 2Z56A 1Q19A 3EZFA 1ADJA 3HO6A 3K0FA 5KYWB 3FPEA 3OZEA 4ID3A 1O57A 1RI4A 2LGJA 1UUFA 2ID8A 3DO8A 2CEAA 3GRUA 3KKZA 2XTAA 3MWDB 4ZCQA 3RT9A 1SELA 2D1RA 4BLTA 3JAWA 3UJCA 3D6TB 1XYVA 4NEHB 4ENRA 4B6QA 1ZRSA 1ADFA 1OU0A 1Q57A 2ODWA 2VJMB 1LNSA 3QVTA 1MXHA 4HLUC 5E0OA 4D4HA 4N48A 1TFUA 4KPFC 4BFXA 4EUNA 5EHXA 2D00A 3C8UA 4K9OA 2P65A 2Q0QA 3LQFA 3PE4A 4PG4A 5FOXA 5KB3A 3OUTA 1PZGA 3NG1A 3ML1A 1EQ2A 1AY0A 5GJWC 3SC4A 3TNYA 3ZS9A 2NXJA 1MJHA 2PH1A 2YFHA 2DFVA 2OV4A 4LDRA 5AKKA 2X0DA 3WP1B 2O57A 1X80B 4AVYA 1TUGA 4C0KA 4P93A 5TLSA 3A4VA 3TCKA 4CLRA 1CYDA 1JE1A 3AHDA 1EK1A 1J7KA 3IEVA 1T9ZA 3A3OA 3A32A 4Q9AA 1QE5A 2WINI 3Q15C 2GK7A 3ZZMA 1LC3A 3DOIA 2B5WA 2J4CA 4JIGA 4JT9A 4W7HA 1QG6A 1G4UR 4BDSA 4D8YA 1G8PA 4EEXA 4ZOAA 1IWBB 5AKHA 1FYFA 1QV6A 5T57A 2PXHA 4BMDA 1QYCA 3HFSA 4QNMA 1IH8A 1HYGA 2ORWA 5DPMA 1FFAA 1HDIA 2R47A 2HYIC 2Q5QA 3OJWA 1KJJA 1LXCA 3AVWA 4CIAA 1MXFA 1NBHA 5CJJA 2R4TA 1W29A 3HGQA 1VI5A 4FIDA 1GAWA 3F5FA 5I9TA 1T2FA 4S1TA 5IM5A 4MB6A 4B83A 5KJCA 1PV4A 3C5WP 5HZKA 1WHTA 3D5TA 3LHDA 4OLHA 4QPPA 2R0QC 3CUWA 1VHWA 4HQKA 3S2SA 1GL9B 3L7NA 1Z5NA 4RGBA 4GT1A 1ENPA 3WMGA 3PFWO 2BUAA 2CHQA 4HSEA 1Z62A 2VBIA 3T94A 5AUNB 4A2CA 4XFDA 2H52A 1LSOA 1O54A 2WJGA 1XKXA 1MC5A 5IP5A 1OH5A 2WJ4A 2R8PA 3ZZNA 1G2PA 1KWGA 1N9GA 4DDUA 1NV8A 4E2ZA 3L5OA 1E3SA 4KEAA 3TMYA 1LV7A 1ZNWA 3QHPA 3D1JA 5SZIA 1DC3A 1JT2A 1CZNA 3JVVA 3C0KA 1DHTA 2FEWB 1G16A 4TN5A 4UEKA 4DAEA 2AFIA 2P2SA 4M36A 4BDTA 4KLNA 4V0LA 1T4MA 2G3YA 2OHOA 4F97A 5BSWA 1DBIA 1I4LD 4J0GA 1YV9A 3CWQA 4JLDA 3A6JA 1T6ZA 2GO1A 4PR0A 4XLLA 3HSKA 1DQZA 2NPFA 4ND6A 5JTUA 1BCSB 3UB2A 1P1HA 3IJRA 4KQMA 1DRKA 1SQGA 3R3ZA 3IUPA 4B33A 4BVJA 3EGVA 1RZ3A 3ORFA 3CKKA 4IXDA 3V4RA 1FFGA 1NP6A 1FDOA 1QHNA 4BNFA 4BTLA 3LA6A 3BL8A 4YJ3F 1DMRA 3RF6A 3OCZA 3MJVA 2VPQA 4MWZA 1N5MA 3R6TA 3QXHA 1P80A 1X92A 1KPIA 3B6KA 3FCUB 5C4GB 4UCXA 1LF5A 1PFWA 2G82A 3C6XA 4J0HA 1ZLXA 3PQ4A 4P3PA 2C82A 5CT4A 1ZNZA 3TQCA 3ZHOA 3DEZA 4J0IA 4TUYB 1IEXA 2C3UA 1VJDA 2AE2A 3HUTA 2C4UA 4J4HA 5CW1A 3QLUA 5JD3A 5BW6B 5LWQA 1HT0A 1IXKA 3VC2A 1QRDA 1S6YA 3R5FA 3ISJA 2J0EA 4I1RA 2B37A 4IV5A 4P1ZA 4XFKA 1IB0A 3EXHC 2JAQA 4FC6A 1JDBB 2GMWA 2VHVA 3IAAA 3NOQA 5KAMA 5C8YA 3ZV3A 4EY6A 4YP5A 3U3ZA 3CVJA 4B3CA 3DMDA 5JH7B 2HQSA 5BSGA 1U1CA 3IAS1 5JZ9A 4I5GA 2NWQA 5KSPA 1X7DA 3AWDA 2F17A 5K3FA 4EFKA 2QOEA 2W6IA 3MT8A 4RGVA 5FPHA 2C03A 1ND6A 1YMVA 2C4WA 2LPMA 2NTYC 1JFFA 3AOEA 2I7XA 4G84A 2IS6A 4QKQA 2GHQA 1OH6A 2FOIA 1U2EA 2O3JA 2W6MA 1BZYA 1WBDA 4R6XA 4FLEA 1B14A 4PYOA 2JJ1D 1GILA 3S8MA 3H2GA 3VO1A 4B84A 4DNXA 2JFZA 1YKSA 4AO7A 1UPCA 4F93B 5CXSA 3FNIA 3AEYA 1Y3BE 1YQQA 1LTHR 3DZBA 2WICA 4KXMA 5KNBA 2YXDA 2C9DA 4I36A 3EOAI 1A97A 3G2HA 4IG9A 3ZV4A 4PO8A 4M0DA 3ZCRA 3FB1A 1U8FO 3A9WA 1JJFA 3Q87B 2GD6A 1UBNA 1EK0A 1U1EA 2ZE5A 3REQA 4ACAA 4ZPXA 4HUTA 5LPNA 1A71A 4J91A 2X8AA 2DFPA 4XGKA 2FVYA 5E8JA 1S89A 1KXJA 5AVYA 4MS3A 2FG6C 5DMXA 3ZU3A 2BTQA 3KVNA 3LUDA 2LZ0A 3AL2A 2IXEA 3BB3A 3EVBA 1RWQA 4C1BA 2I6QA 1NBMD 1XQXA 1GPAA 4CTOA 1RBQA 1XZIA 1RADA 4IPTA 4MRNA 3P4XA 4UM7A 3O47A 3CURA 4WUVA 1B73A 1S3IA 2RGGA 3MF4A 1SRRA 4NBKA 2HSJA 4TRJA 3IKTA 3D8RA 3KOUA 1GN9A 1HE1C 3M8KA 2XWQA 1UP6A 4K9RA 5JO0A 2GDJA 3L04A 4AWAA 4YCSA 4NIMA 2A67A 1NJ2A 1I5OA 1BA2A 1Y1LA 1PW7A 2K7ZA 1Y7IA 4L2IB 4RJKA 4YT5A 2J07A 2XCOA 5TNXA 3G0HA 4G9GA 3RJZA 3AGPA 3WA6A 1JX6A 4ENVA 5KREA 1UK9A 2IYFA 2OORC 3A11A 3KQPA 3SSAA 5A5GA 2DECA 5C8DA 1M8JA 3F8WA 2JFPA 4PBRA 3LZDA 4KYUA 2CL5A 3ZWBA 1FK8A 1JTEA 1T5LA 2W4IA 4EF4A 2AD1A 3FFAA 4X92A 3VR3A 5LDDC 1E7WA 1SAYA 5AK5A 4L2IA 4M38A 5KOHB 3GXBA 4ZVLA 4U6QA 1YRYE 2GAFA 1TEVA 4KNWA 1M2JA 1YRHA 3UAVA 1RJWA 4Q3BA 3AM3A 4KL8S 4D6XA 4CTNA 2YWRA 4CIWA 4LEIA 1T36B 1MB4A 1PJRA 3RC2A 1JWLA 1P33A 3T3OA 3IDFA 3ZD8A 5ALSA 4CLOA 2JI9A 3B85A 1Z13A 2Y0EA 3BRWD 2ODTX 1GZ5A 2Q5JA 1YKFA 3KOXA 2YBDA 1F2DA 2B8JA 3KQWA 3Q5EA 2A5YB 4ME6A 2OVBA 1ZGAA 3UN1A 1KZYC 4ER5A 5AW8A 2KQUA 2QAGC 4U2BA 5ITSA 4YWHA 5EXXA 2AOUA 4YYZA 3R5KA 1C4KA 1SG9A 2QN3A 3SDSA 2IZZA 3D6UA 3QU4A 4QLAA 5DYTA 1V1MA 3FCSB 2OPHA 4LQDA 3VKVA 2GGSA 1JL3A 2GJ8A 5GGYA 1YR9A 4YRAA 3MFQA 4RJ2A 3H1BA 4FSDA 3WNVA 3GROA 2GTPA 3RK1A 3DTVB 3JATB 4KDEA 1D8AA 2OV1A 3E5RA 4W99A 1O77A 4V0RA 4H7DA 3ETCA 3A1UA 2PFGA 2ZVDA 5L3QB 2ZZKA 1II8A 2WTEA 3JRXA 4CJXA 4Q1FA 1HE2A 2I4RA 2CFTA 1KH1A 1N3LA 1RWBA 2D1SA 2I78A 3HRHA 1HDYA 3DBLA 5CT8A 1SD5A 5EOVA 1GCIA 5ALTA 1T9AA 1JI3A 3KFXA 3T06B 4N49A 3DAGA 4X0EA 2QYOA 1T5BA 4IDEA 2B4RO 3F46A 4MV7A 5ALPA 4OQ4A 5FI3A 4GI1A 3A6EA 3TD6A 3BWXA 2FPMA 2V3WA 4G65A 4XTCS 4WQMA 2Q1SA 3AR3A 4K7JA 1C1YA 1JG2A 2NADA 2WJVA 3IUQA 2W6PA 4HDNA 3OCXA 3LS2A 4FOSA 4P2GA 4G0UA 4PPQA 1QQTA 4KLCA 4A4DA 3NLLA 4ZI5A 2XXAB 3A8TA 2XMZA 2Z9DA 4B73A 3O7MA 1A76A 3OJ0A 4NPHA 5GJCA 5BWMA 2JEYA 2JI7A 5DM0A 4Z7NB 1SUSA 2WFZA 4GOJA 3A9TA 2YUIA 1PR5A 5ITZA 3LQKA 1VRVA 5JASA 4AL4A 4HWRA 2UUBB 2HRRA 3LP6A 2WAOA 5LDGA 1CUUA 3R8CA 3ECAA 1IN8A 3RS9A 1TD1A 4L8YA 1TUEA 1G3IA 4A8JB 2JB9A 2P3OA 3D3QA 1U0RA 2ZRLA 5D5QA 4RDHA 3UHFA 1C7RA 4PGAA 1LDGA 4JL8A 4UJ5A 5KS2A 2Z98A 5FLYA 4FGJA 4QFDA 4BRWA 4CM7A 1PEAA 4XSVA 5F1PA 2VBCA 5J4VA 4GD3Q 5FO0A 1KOJA 1A7AA 3DV9A 3EGEA 3V4SA 3GARA 2PXAA 1SZJG 3WB2A 4FMPA 3UVEA 2XWPA 3NNSA 2SCUB 1BGXT 1CZHA 1VCHA 4R7GA 3MTAA 3VV2A 2I2CA 1TTQB 4KO2S 1KKLA 2QZJA 3IAM1 2IXDA 3MWDA 1E1QA 3ZWMA 2ZZNA 1N2XA 4Z54A 3JQQA 5IM4F 3CRMA 1XZDA 3KQMA 4F9TA 3A3YA 4QJIA 3GPCA 3A31A 4DDHA 2XOXA 1N6NA 3D4PA 4H9GA 2PBFA 1AS0A 1IXSB 2AOWA 3EEIA 3HVJA 4O29A 2FTKE 3O8LA 5CLQA 4CHTA 2XUJA 1R5BA 2NSYA 2O05A 2CB0A 1JFLA 1HT3A 2HPAA 3ICWA 2CZCA 3G9XA 1BXZA 1L4LA 3MMNA 1ZD4A 1U3TA 3QWAA 2ZS8A 4YK7A 5JMPA 5JFOA 1JEEA 1QKKA 2GTHA 4KG7A 1G8KA 3UQZA 1QHHA 2XCRB 3OEWA 3ZE1B 4I3HA 3OOEA 4DPMA 1CEYA 2IHKA 4RHUA 3K71B 3HEAA 3M9LA 2I6SA 5KYGA 3H4TA 1CV2A 4DA6A 3FYUB 5FAXA 2B25A 3DVLA 3GYGA 5AHRA 5F3WB 3GLUA 4BO2A 3HJNA 2FZWA 3PBKA 3WMWA 3VR5H 5HEKA 3KPWA 4PONA 3EH1A 2C3PA 3QMPA 1QX3A 2LIPA 2NZXA 1NNUA 2AXQA 1KRWA 1GG5A 1ESZA 3Q41A 4JBGA 3VPXA 2CN1A 4FNMA 4Q7KA 4ZOLB 4AY2A 5IC6A 1KY3A 1TLTA 1YDMA 3NPMA 1ZGCA 2C78A 3HXQA 4Q18A 1RLOA 1PL6A 4H0CA 1R0KA 1J1ZA 3M6IA 1P4AA 3RM3A 1ONOA 2GJAA 1PRYA 5AMXA 2OA0A 1GVHA 2DFLA 3TO5A 2ACKA 3V32A 4ABYA 2GJ4A 2JEOA 2FR0A 1UOOA 2V97A 3GUCA 4HPXB 1L7NA 3I76A 3QUCA 5ALNA 2V0GA 4UM5A 2YWEA 5T8KC 1ENZA 1GKUB 4PGFA 3BRQA 5CLIA 2ZTSA 4H6XA 4RPIA 2JAWA 5BT9A 2I7CA 1IC6A 4HZUA 3C5EA 1XRSB 4YMUA 4DR2B 3SZRA 1DBSA 1BWSA 1HTWA 1K7YA 1H3NA 4HWOA 4BO7A 3EISA 1M54A 2H4ZA 3GBPA 3C4JA 4CT0A 4EKNB 4ZGWA 1JH8A 1G6KA 2IPAB 3AJAA 2NVUB 3RC9A 2R8BA 4OY3A 4ZRDA 4IRUB 2C94A 1KIFA 1H69A 1CF9A 1Q50A 1MO4A 1OC4A 1XDDA 2VYNA 3HXLA 2WG1A 2ZVQX 3BILA 3B6MA 3LUJA 4FMCB 2EZ4A 3IDSA 5HE9A 4K9SA 4OKNA 4IO0A 2EHDA 3D54D 3IKMB 3TG8A 4HDQB 4NPCA 1K6XA 1OMOA 4QA9A 2RBEA 3WS7A 3I6IA 1OXSC 1IHYA 3LPLA 3SEQA 4XRGA 1EVQA 1SHLA 1M8GA 3G82C 3S5JA 5D8DA 3ZX4A 4W1SA 1OC2A 1BSVA 2GBCA 2JGLA 4WWHA 2JKZA 3Q5GA 3W1VA 5EMHA 4BFUA 4C5CA 5AQ1A 2ECOA 1I5RA 3E7DA 3D0RA 1JHPA 5LLSA 2P2GA 5K0JA 1LFAA 2NV6A 3OX4A 2FPSA 1MT0A 2VZLA 2MTBA 3WL5A 3NTQA 4JYAB 3AZQA 5IC5A 3W8RA 1XMXA 4OFZA 3K70D 5JNWA 3EXHB 3AB7A 4TLEA 3ZE6A 3HVHA 1EHYA 3QA9A 1EWKA 1NN3A 1I7PA 3U9TA 2OV3A 3BFXA 3GOQA 2GK3A 3GCZA 5D00A 3F4BA 1WW3A 3O8DA 3WLJA 3ZX5A 1WHSA 1E1MA 1EFLA 1PQUA 1ULBA 3E4DA 4FFPA 3E3LA 4NONA 2LE0A 1R8QA 1ZFNA 3AJ9A 4O4LA 2P30A 3O21A 1FXWF 3DCYA 1AK1A 4AZVA 1NN1A 3E05A 3FPLA 3FWZA 4R3NA 4YASA 2O2XA 4RCVA 3UHAA 3V8BA 3NEYA 2B5OA 8GPBA 3WV5A 3FH0A 2JIDA 2W4QA 1K3FA 1VLZA 4F7DA 5EUBA 2DF8A 4NJMA 4DIMA 3FVWA 3QUBA 2GM4A 4HRAA 4HFRA 1Y8RB 3FCEA 5CVJA 2BIFA 3O8QA 2ZSBA 4BX9A 4YJ2F 1EAMA 5YASA 4HYQA 4K40A 2EIXA 4O3FA 3LF1A 4DARA 2JFWA 5HWSA 3Q3GE 3S81A 3PENA 1AQLA 3OZAA 3IXMA 4JWKA 1U9ZA 1Z0FA 3KXIA 3CX7A 3KEQA 3K6SB 4IOKA 1AZSC 1K97A 2A58A 3DE7X 2WABA 4FN4A 5JYEA 5THQA 1BFKA 5HQTA 3AR9A 2R8OA 1XFAA 1A95A 5LD2B 3UICA 1NLFA 3CTMA 3RFUA 4BQQA 2Y0DA 3HN6A 4UM9D 4PN7A 1UBLS 4ZVUA 4DZZA 1A8SA 5KSWB 1G8JA 1JPNA 3TW8A 4ID9A 3KZCA 2BUBA 1FX1A 1VRCA 3EBOA 4HATA 4M1WA 2R3SA 3ENWA 4OREX 4KR9A 2IP1A 1MV8A 2VF2A 4L3WA 1XPRA 2ISQA 1K06A 2DZDA 2W8BA 3Q4GA 3UMYA 3L7BA 4J0JA 1H4SA 1DO2A 2YASA 1D04A 1AF7A 3SJUA 3TEMA 5B3LA 2J3DA 1SHJA 1SXJB 2CUZA 3ZN2A 3AH8A 4JJGA 1XEXB 4IF4A 2F62A 5IMSA 5C35A 2NQTA 2V8BA 1J70A 1JEDA 1QBKC 4M7WA 1E2HA 1OA0A 1EE1A 4G5HA 3OIWA 4E2YA 4R71A 2WT4A 3AI3A 1U0TA 4RK6A 3RBXA 5CYFA 4YUAA 4NU5A 2CUTA 1ZN2A 2FPXA 3VR1A 7MHTA 1NW3A 1BX3A 4OFXA 3WMXA 1YB2A 4N54A 5U1PA 3N2EA 4WFQA 1WETA 1B0UA 1RAAA 2ONKA 5AKGA 4F2HA 2V4UA 4GPZA 2QD4A 1U3CA 2NZVG 4H3KB 4MQBA 3HCEA 4FYWA 4MUHA 4MQUA 2OB2A 5AKEA 2GZSA 4RUKA 4ZDWA 3VO2A 3RW9A 1DBVO 2DWCA 4G09A 4MXDA 1NQVA 2JGKA 2IYAA 5DJ5A 3B2QA 5AD1A 5DZSA 3T3DA 1LLFA 4MP6A 4CTMA 3L41A 2WE7A 3RJ9A 2BFCA 1RACA 2GVDC 3K1YA 2WTMA 2H4JA 4UU0A 3SQNA 4M53A 1OBOA 4R1TA 3DF7A 4LRTB 2ECFA 3M4NA 5CLJA 2V45A 4P22A 1XPOA 3V55A 4OFWA 1CY0A 1DAFA 5JRDS 3ILXA 3ESXA 4BJ6A 2CXSA 2OHVA 2O8DA 1QDLB 1UK8A 4FZVA 3UNXA 2WSIA 1EQUA 2D5BA 4MV0A 3D02A 3DEHA 1U2GA 1RMQA 3C3XA 3WGJA 4MDEA 3OEED 2XH8A 5HJ5A 1L1QA 2X77A 1DI0A 4QUAA 5JDCC 1BKSB 2D7CA 3QVSA 4XWOA 5JAMA 1F2TA 1JAIA 4CM6A 3DCJA 4C0JA 2PVSA 6GPBA 3ONNA 4MGEA 2VRWA 1FMJA 1YIAA 1E63A 2O14A 2W6CX 4L9WA 1MRNA 1ZCAA 3PC3A 3SZOA 2IZ5A 3T52A 4A3SA 3IH5A 1UBMS 4PX2A 1KZ6A 2Q27A 4BRUA 3MTDA 4CKXA 4QFBA 2QTMA 3NHBA 4REQB 1KXZA 1IBSA 2QTFA 4CIBA 1MF7A 2FZ4A 3AI2A 4E5SA 1JH9A 3BGVA 3HVIA 2CWDA 5AJYA 2PT6A 1OIXA 1RYEA 2R6R1 3NPAA 5ITWA 3AF4A 1XVLA 1IXRC 1BXKA 2FLVA 2QENA 1WD7A 1DJLA 1VIMA 1UPAA 2GN2A 3PPXA 1H2WA 1YVDA 3WO1A 2DU8A 3L6RA 3GI1A 4YNBA 1P0FA 3P96A 5EGSA 3AETA 4XM0A 1ELOA 4YJDA 4DLKA 5MGNA 4DIKA 3MWGA 4HWPA 1F9EA 1DAIA 4E08A 4OJNA 2Z95A 1FYWA 1T1RA 1PSDA 2CLFB 3DZFA 4C2AA 2R6JA 3KQHA 5LIPA 3GT7A 3QVLA 2PZBA 3FWPA 2HJVA 3AZPA 3ZKAA 3QP9A 1JQDA 1QCZA 1IUKA 1TM3E 2I62A 3DEIA 3ZDZB 2FSSA 5E38A 3IGFA 4WGGA 4DA7A 1ZWKA 4W5QA 2E87A 1JZTA 3ZWCA 4TKVB 4E13A 4OQFA 4XCXA 1RC0A 3VBCA 4DJDC 1Y8QB 4KAJA 2H2IA 2I29A 2PYZA 3FUUA 1I3LA 4BQNA 3UWSA 4YV1A 4D0LB 1X0VA 4RQTA 3OHPA 2QIPA 4HL6A 1M8KA 2V98A 4L78A 1MABB 2ZRGA 1BDJA 4EBFA 3IQHX 4QXPA 1OHHA 4Y6LA 3DEFA 1ZJ5A 4LZNA 1RM5A 5ARBA 3NANA 2JS7A 4PZDA 1JFVA 2MOKA 4OUDB 1EP9A 1M3SA 1GRVA 2G77B 1L4MA 3WK9A 4TV8F 5D3QA 1RLMA 1WOMA 1Z28A 1PDWA 2PXXA 4R40A 1ZK0A 3L49A 3RSSA 3ZHBA 3IC5A 1IQUA 3FYDA 5D2CA 5HRUA 3ESCA 4EI8A 4NXMB 1I13A 4MUJA 3CF6R 2VJCA 3HU3A 3K53A 3VR6H 3NIWA 1O5OA 2XMQA 4JN6B 2ACVA 2JGMA 2Z1MA 4KQFA 2ZRNA 3LGAA 1YCGA 1YE3A 4L5JA 5EN4A 3RRNA 4O4HF 1X1TA 3NVAA 3WNDA 4A0RA 3KQKA 1QFXA 2VPTA 3EOBI 1IJEA 1Z4QA 3CBGA 3K72B 5HJEA 2PVCA 5DK4A 2HHAA 3H9UA 2X76A 4HGZA 3TZEA 2BISA 1TC1A 2H5IA 1P77A 1R6AA 4HYEA 4I4LA 4O5OA 4ZO6A 3AVTA 4KXNA 4OOEA 2ZJYA 4HN2A 4GW3A 4C0WA 4CM8A 5T4EA 5KPJA 5G4KB 3QFHA 4MUFA 2QR2A 2EWVA 1XVAA 3GHYA 1NNLA 2NP6A 3TDNA 1R9GA 1P1BA 1TVMA 3UG6A 3QVOA 5G2OA 1J2TA 4C0HA 4KSYA 1V4BA 4BO8A 3DOFA 3GRKA 1DJMA 1IJBA 1O97D 1Z4NA 3AKDA 5JXGA 2PQ2A 1SCUB 2X4IA 2H0RA 1AURA 2ZWPA 3HCBA 4DV1B 3UKOA 1TYAE 4KMMA 4QDXA 2ZUCA 3WGLA 3LT2A 2ZCJA 4P7GA 4QSMA 3ZWYA 1RLJA 3LBYA 5C4MA 4IUYA 2GZAA 2C2OA 4O8ZA 1AKNA 1D07A 2ODBA 2V55B 5KWIA 2FEPA 1KJYA 1K8XB 1SOAA 2QE7D 4IOJA 2I76A 4MIOA 4US0R 1UJCA 1D1SA 4PCAA 1U99A 3NVKI 4GMFA 4JC0A 1ZXLA 1EFVA 2WC1A 4JT4A 4WESB 6PFKA 4EWLA 2IU6A 3QA3E 3G0GA 1T0HB 3EIXA 5A9TA 2PX8A 4X91A 4DJ5X 5BMVB 3L79A 4DM3A 1N34B 1Z22A 3PNLA 5FYQA 4RH1A 1AJEA 4GX1A 3ND5A 1E2KA 3TI9A 2IDZA 1Z2EA 3B78A 2BKAA 3I04M 5FWXA 1Z7EA 2BFDB 3IP1A 4R2LA 4EJ0A 5LMUB 1S7GA 3PHIA 1H4TA 3LRPA 2P0AA 4BBAA 4I3FA 1Z0DA 1D03A 4OP1A 2EW2A 4ZEMA 5KINB 1W25A 4W4TA 3L8HA 5T3UA 5F2NA 2MINA 4PSCA 2HLDA 1JA9A 3EC2A 3VPDA 5F2KA 2E0IA 3M6VA 4M60A 2CXTA 4DRYA 1KYQA 1E2LA 3ABSB 3O3OB 1VA5A 3W04A 1SXJD 3GQBB 1ZA2A 5KYVA 2ZULA 1I9GA 2JLCA 4I5DA 2ZIGA 2X2PA 1PFUA 3T3NA 3TL2A 3VH4A 2QBYB 3IE0A 3MMZA 1SHUX 4UQLA 4YCMA 5J9FA 4NDNE 1E79D 5G4LA 3ICCA 4I50B 1S9DA 2Y8EA 2O50A 4J2HA 3Q5DA 3QVUA 3HUUA 2IBMA 1JNXX 3SR3A 7ADHA 1NWCA 2Q3CA 1XIVA 1ZN8A 1AVTA 1THMA 2JRLA 2A9KA 1VL1A 3BXEA 2WKRA 3ZI0A 5EFOA 1XTTA 1KDVA 2JJQA 3CPJB 3AHGA 3BF7A 3O9MA 5K03A 3OIDA 1SD2A 4JWTA 2D6FA 3PF9A 4V0OA 3IMEA 4Q7JB 5J59A 1TFRA 2I4LA 3UJ7A 1JALA 2Q9CA 2V5VA 3OICA 1PTKA 4TMVA 2H48A 2HU7A 1X7GA 1C30A 1WDTA 3WYCA 3HFRA 3RIYA 4HQOA 4KBYA 1CF4A 4Z49A 4EF5A 1TA9A 1EX7A 4XAQA 3FMPB 4C4TA 5A5EA 3B53X 3I28A 1LLUA 5EKUA 3U4CA 4ZAWA 3ZKWB 3I73A 3JD3A 3TIXB 4EDHA 4ECEA 5IVKA 3GLGB 1CDEA 3FOCA 1FFCA 2YNMA 2RMKA 1B74A 2ZG6A 4UEOA 3T3HA 4I55F 3V2HA 2FPRA 2YN2A 3D81A 1ODCA 1XLVA 2M2IA 4P7BA 1JR4A 1G18A 2V6JA 2FEAA 4UCFA 3IQWA 4LXXA 2CE2X 3TBFA 2DPLA 4TMYA 1BN7A 1MEOA 1FSFA 1U2PA 1MP0A 1E4EA 2JD0A 4GO1A 2ALJA 4IY1A 1Z0SA 2NO1A 5KMGB 4F8EA 2QTGA 3P9QA 1YZUA 1S1MA 3OO0A 4UM8B 4V0KA 4OLAA 4LF5B 4KTVE 3B2NA 3I01M 3L7IA 2C5LA 2ZYIA 1V9LA 4I99A 2L69A 4RQUA 4ZOQI 1EVLA 1MFZA 2YWCA 3BXGA 5FLKA 4P33A 3RF7A 5L7YA 4D56A 3WIUA 5BRJA 2Z1NA 3CNQS 2G04A 3LBHA 4WCVA 1CP3A 2NU7B 2ZGVA 4C76A 1Y82A 2MYNA 4FJ1A 5IJ9A 3QUTA 3L0CA 2ATIA 2O7SA 2FFJA 2GXSA 4RJIA 4N5IX 1VZ2A 3GLSA 5JATA 1RRPA 4CLEA 4OHKA 4AG6A 4DLVA 2YV4A 3IIKA 4PHFA 3LCUA 1RQ7A 4Y9TA 2AMJA 1P9WA 2Y0CA 4PRKA 3VHXB 5EZYF 4PINA 4R51A 2VTBB 4CT5A 3B20A 4WBXC 4JVLA 3HB7A 3RRXA 1OH7A 1DCTA 2JG3A 2VAVA 1HX7A 3WTCA 3DKRA 1Z0JA 1FSZA 1XLWA 3CH6A 5CH3A 3RU7A 4EBBA 4F4HA 3FLAA 4A2QA 1E6WA 5B12A 4PC7A 3W5AA 3P19A 2BEJA 3FCXA 4IP0A 1SQ6A 5LUAA 2BM9A 2ZBEA 3IAUA 3RKUA 2CZGA 1SQ5A 4ISCA 4NMHA 2EFYA 3P0HA 4RE6A 3OOSA 3COJA 1R00A 4YREA 4BJ3A 2FJUA 1PJAA 3LW8A 4OH1A 2HK8A 4MDYA 4UZFA 1O9HA 4UHCA 4KVGA 2ARKA 1GRQA 2OQRA 4JLUA 3ADOA 1DL5A 3AO0B 1X39A 1KI4A 2B83A 2W2QA 4YROA 1MNAA 2QN1A 3K9NA 4UEWA 1SEVA 1NL3A 3O0TA 1RBYA 3NBFA 4GZ5A 4IR7A 4NQZA 4QC2A 5B1DA 4B17A 4OHRA 3SFZA 1KY2A 1NJ1A 4JBHA 4DIEA 2OB1A 1XRNA 5IJZA 3PQ8A 1MLDA 4FGWA 4WK0B 4RIIA 1NR7A 2HMAA 4L7QA 2BMVA 3LOPA 4RZIA 2NYAA 5ENVA 4A1FA 2EW8A 3ZVMA 4ZQEA 4BV9A 5BN4A 2DHQA 4YIHA 1T10A 2IYSA 2VYND 4HXEB 2CNWD 3F1KA 4GX2A 4TM7A 1K0UA 1XZFA 2BDUA 3DZKA 2IHTA 4L4XA 4WOCA 2ZBPA 4LZAA 3IXLA 4MYUA 1E20A 1E2NA 2DVMA 3HJTA 1PNRA 2IEIA 1E0JA 2ZIFA 4YHHB 1ZAYA 1JIJA 1ILWA 2H57A 3GRCA 2GSDA 1JSZA 2VDNB 3ETGA 4FPXA 4M0KA 2IHZA 4JFAA 1THZA 4RBNA 4B0OA 1V26A 1EVKA 2AGVA 4BN4A 1JR3E 4E4RA 1N3IA 1Y3FE 3UM9A 3TGLA 3PEWA 1NURA 3EXFA 1VIAA 4E1AA 2G6TA 3CLUD 1C9YA 5ADWA 1F20A 2ZAGA 4KX5A 3U44B 4WOKA 4O63O 1AKTA 1UMDB 2AJTA 3P45A 4YJKA 1N2HA 4DREA 1KO8A 5AHOA 4V03A 3IBSA 3NQ41 1II0A 4S2EA 5CYPA 2EFCB 3T9DA 1V25A 4YCAA 1E9BA 4B5LA 3MWFA 1OHHD 5SZHB 2H1IA 4D26A 4IDBA 1SOVA 2PUTA 2QJRA 1GGEA 4G6ZA 2IUTA 3W05A 1P2TA 2VKQA 5F4BA 3VV3A 3QEOA 2FCRA 4R0NA 4GWGA 3GX1A 2HRCA 4H7IA 4V2UA 3RQIA 3TMKA 4N1AA 1S2MA 1QTNA 3DE1X 2RJNA 2PY6A 1RPZA 2HTEA 1SUPA 2OGSA 1SZDA 3HM2A 1JKJB 4LZWA 4YBZA 5B53A 4C3UA 4D9BA 2C5EA 4DMRA 4QM6A 3P2EA 1PJ2A 5FBRB 1E1RA 3IPAA 4BX2A 1W4CA 1EGVB 1UPTA 5CH8A 1QWOA 5FT9A 4BMSA 1KHTA 2ZT6A 3ENKA 3QUQA 4LRSB 4U3JB 2L18A 2RG1A 4AUMA 4X65B 2YZGA 2QBYA 3AVXA 4ILEA 2IS4A 3L7DA 4QQKA 1A9OA 5BW4A 3NASA 3EGXB 3O3CA 3F4KA 3UK0A 3ZNQA 2WNIA 5ICEA 1MPXA 1NUHA 3TTTA 4MW1A 1TT7A 3FUTA 5AVOA 2ZJBA 3RUAA 4NXNB 2YZMA 5JC1A 2YZ2A 2OFPA 3WB0A 3K2EA 1YULA 5B4TA 4WXMA 3MINB 2X1LA 3H6GA 3TOZA 3BQNB 3AESA 3F1LA 4MWBA 3LUAA 4PYMA 1HYQA 3EFEA 1T2AA 3QVXA 1EB8A 2BE9A 4EKYA 4JB8A 1WMFA 3PHGA 1B8VA 4I9FA 2DHCA 1UKBA 3P2KA 3ORYA 1LDYA 2JCGA 3HV2A 5EC8A 1CR0A 4LBZA 4R0VA 4U7PB 1E18A 1OLSA 3UXHA 4WXYB 2FG5A 3S2YA 2CB9A 2F9MA 4Q16A 2CSUA 2AT1A 4B75A 1PWYE 3EHDA 3FTPA 2PT5A 3CUKA 4XCVA 1NMZA 4RZUA 1N8KA 1NMQA 4O6VA 1NVVQ 4NK5A 3EVNA 2P68A 3AF1A 4HX2A 2HDOA 1YZVA 1EIWA 4WD3A 3GL9A 1JLKA 2W6NA 2XGOA 4YRQA 4P4LA 1NUQA 5SV2A 1PJTA 3OZ7A 3ANXA 2W37A 1RWXA 1E3MA 5C52B 3I8SA 1D2NA 2ZOSA 4F6RA 4CRWB 4KWHA 1SCUA 3AFIA 1HOTA 5F9HA 3BTVA 3QXXA 4C0LA 3WBKA 1Y48E 2HUPA 5JZOA 2W2TA 2FWNA 4M9ZA 1QGZA 1CS0A 3ETDA 4LWQA 1VCNA 2W6OA 2OCYC 1J0BA 4DDTA 3KLBA 4EVQA 4L9AA 2BTQB 2F1IA 4OYRA 4C4YA 5F9FA 1JVSA 1SXJA 3OKCA 2H2HA 3EIOA 2WUEA 4FINA 3WTBA 2OG1A 2PK3A 4IHJA 1FIUA 3LCMA 3SC2B 5BXYA 2NW6A 4YRBA 3REQB 4XPIA 1NMEA 2DUUA 1Y81A 3QFSA 2ZATA 2LTAA 1Z12A 3SJZA 3VH1A 3WV4A 2ISCA 4BQPA 1JV2B 2C98A 5M7EA 2CKMA 4OMUA 2BUCA 1XUOA 1EBFA 2JZNA 2BMFA 4JDUA 3VR5D 1ESEA 4QO7A 1QH9A 5FA6A 2IYZA 4XB6B 2C29D 4BLSA 3ZWPA 4MVJP 4U5QA 4ZGBA 1K88A 3N2NA 4S1NA 3U4QA 2JLQA 4CN8A 3ZWOA 1PT9A 4FK8A 2D74A 2PMFA 2PBLA 4LCEA 4XM2A 2LDBA 1ST3A 3FPFA 3JYLA 3QPDA 3RSQA 2AOTA 2QUHA 2TSYB 2YRFA 3ECSA 1RYHA 2EF1A 3FFTA 4MVJF 4AG3A 4YMGA 2Y3IA 3BMNA 4YN3A 3R40A 1L8AA 1LPNA 4ZT4A 1R4MA 1JVBA 2R60A 3VNSA 3W34A 1H8HD 1ZM9A 2CVFA 4MIYA 3KIPA 2HDHA 2G7MC 4LK3A 4QYWA 3ZU5A 5F35A 1O95C 3QTBA 4YMVA 2LCQA 1WOYA 1Y3AA 1Z8FA 3DF9A 4K9NA 4ZCPA 1U2GC 3HKCA 4CR6A 1OV6A 1WB9A 1H6AA 1CZUA 2VZ0A 3PUHA 2R1VB 2CE7A 1FU8A 4YCJA 2F3SA 2ZSUA 1E62A 1PG2A 3DV0B 5D5HA 2YWDA 3NYIA 5DGHA 1Y9ZA 4F45A 2G1PA 3M6WA 3ZQ6A 4TRMA 2C2YA 1FNMA 2I6XA 2WDPA 1ZNQO 3H9BA 4G5XA 4EPXA 3EH2A 4QQ8A 5FNVB 1F7UA 2H18A 3ORSA 3ESDA 3TQOA 1XTIA 2ERYA 3AR4A 3CR7A 4GE0A 5ALUA 3BJRA 4TV8B 5FI5A 5LZ4A 4G8BA 5I9MA 4UNQA 4WZAA 1VLHA 2YX1A 4B6GA 2AHRA 4BFCA 4L8WB 3V97A 4LYHA 3L8GA 1P44A 3OFJA 4RNCA 1CE8B 4URYR 4XR4A 3HEMA 4C4AA 1FP4B 5F4ZA 5ER6A 1XN1A 1K68A 2XRMA 3KKMA 4DSTA 2QHXA 2Y1FA 3E70C 1BA3A 2AJ8A 4L4ZA 2E6KA 3AEQA 1PUJA 4L9SA 2GPWA 3T34A 3T99A 2YJ5A 4P7KA 5AOVA 1R6DA 2EG9A 3NGLA 3K30A 4GGMX 4U02A 3K0KA 4Q9KA 3A4YA 1MX5A 5AVWA 3M4JA 5C53B 1SXJE 1QKIA 2I7TA 3OSZA 3RS8A 2QB5A 4HH3C 4HAVA 1IQ0A 3I6BA 2R97A 2EFJA 3VZCA 1JBQA 2PSDA 4F1KA 4KI0A 1W19A 2NUTA 5IUJC 3UAWA 5G0SA 3ZDBA 1LDBA 4H31A 3V9AA 4DUGD 2IEZA 3EDCA 1MPTA 2CLLB 3IB3A 3FZYA 4FHEA 2QT0A 4EG0A 3ZDCA 1QV9A 3NP7A 1HTBA 4LQCA 4Y2SA 4JZKA 4OX9Y 3B1FA 1U0FA 2GJKA 1Z5OA 1EFAA 1BKDR 2GXAA 1SXIA 2JBWA 1FDUA 3PL5A 2OMKA 1OTXA 2VNSA 2P35A 3AZOA 3CZMA 3KZKA 3KV3O 1N5IA 3PRJA 3ENZA 3L0OA 4PYQA 2PL3A 4QGGA 1FUYB 1NSYA 4N0PA 5LXTA 2JKYA 3K70B 2G5CA 3SQXA 3HVKA 1Z5WA 3CF4A 2FB9A 2AG5A 3DR5A 2ZS9A 4HAYA 3P0EA 2ZXEA 4TL8A 3CLSD 1ZGHA 1LC0A 4JSYA 1ESNA 1L4HA 2G9NA 3TUIC 4JS0A 3VU1A 1NQUA 1UKYA 3WWCA 3DXZA 1YZTA 4MVCA 3IAXA 3NM4A 5DHPA 2VJDA 4LRXA 3TL6A 5E6SB 6Q21A 1A5ZA 3HVRA 1DOAA 3X1ZA 3BAFA 4I1PA 5ALFA 3FI9A 4J29A 2QR3A 4Q39A 2VP3A 3FWNA 2GKOA 4ICIA 3VR4A 3UJNA 2ORVA 2PSHA 5TX7A 2XMDA 3FVVA 4S1VA 3KZ1E 4CL3A 2RK3A 3AHCA 2ZXUA 1F14A 4KP7A 1CE8A 4D97A 4TX1A 3W8EA 4EHHA 1VG9B 5CR9A 3ZXYA 3LU1A 5HRAA 1XZJA 3FF1A 4N5DA 1T26A 3LPAA 1JMVA 2D5IA 4W9MC 3WL4A 3LCRA 3MSXA 4EB8A 5AVUA 3ND7A 3MB8A 1FXWA 3RD5A 2WWFA 2JFBA 3NHLA 2Q6TA 4TT8A 4WCFC 3QH4A 3O4GA 1WM1A 1V16B 1QIJA 2ZRAA 1CLUA 4YRKA 2XA2A 3CF4G 5E1OA 3AM5A 2QZSA 1XVVA 2C7PA 1Q0PA 3S1AA 1E32A 1X8KA 4LXUA 4N41A 2RCYA 1QF6A 3SNKA 1MVNA 2XXBA 3Q0IA 4EYKA 2DXIA 2PFSA 4FOOA 3JQ9A 3UPDA 1Q22A 1Z4KA 3CU5A 1R0CA 5HF9A 2VUHB 1A8PA 1Z29A 4A82A 4QUGA 1H1DA 1USVA 2SICE 4HB4A 1FA9A 4QQFA 2VXBA 3TW8B 4EA6A 2ZP1A 1PP4A 3IVXA 3P9ZA 4NMLA 4WXEA 1JF8A 4MLPA 5G0TA 4BRSA 5I6DA 4EY5A 2UV8A 1DPFA 4NFHA 4Y98A 3VYTB 4ETWA 1MU0A 2JZOA 1DO8A 3F8SA 4MRMA 3VZPA 1YBAA 4ZO9A 3VI4B 4LYJA 4MV9A 2BKLA 2VDOB 2XD4A 16PKA 3ROFA 4DEXA 5C5EA 2A5GA 1FP1D 3PWTA 1NVKA 1HTTA 2OKGA 5AJHA 2VNKA 1QS0B 2O48X 3M82A 3VPSA 3B82A 3AFGA 3L0BA 1G8HA 1FXUA 4B7ZA 2X5XA 3LVBA 2VYFA 3EMKA 5EGNA 1QGED 2F3TA 2LBPA 3R41A 4YUZA 3LXUX 3FYTA 2H1RA 4CQLB 1RHJA 2QMEA 1RRCA 4P4NA 4B3TB 1H5QA 1XT6A 2HQ1A 4KQ2A 3EFHA 1QDEA 3E8MA 3DKPA 3WFJA 4Z86A 4RMJA 5I9SA 1SCDA 3IUYA 1WUKS 4UHJA 3RS3A 4AFNA 1Q0LA 2F1KA 4JLKA 4Y9SA 4BXOA 5AVVA 1CYEA 1N3BA 1HLDA 5L51A 3O9VA 2Z58A 2POQX 2X1VA 1P7PA 4HAWA 4OBBA 1DKPA 3ANMA 3BEDA 4I14A 3BCSA 3N7UA 4RIHA 2RI0A 2PUEA 2WIBA 5EHGA 1TZKA 1HLPA 1YQUA 2ORYA 3R7WA 3QXCA 1CNEA 4LFAB 2DT5A 5AM2A 4IKPA 1GTZA 5I8ZA 3DHVA 3WBFA 4EB6A 2PUDA 2H16A 1KOLA 1H93A 2DULA 4F2GA 2VK2A 2A0UA 1YE5A 1V2HE 1V8FA 1W1UA 3CZCA 1NVVR 1KHHA 3HCFA 4FQ7A 4LOKA 1A5AB 1B6RA 3F2VA 4PE5B 4RADA 3REOA 4BB6A 4Z2AA 5FEMA 5CM8B 1NXQA 2CNBA 3NWOA 2NGRA 1ZVKA 1JWAB 1UJMA 4D6YA 1GZ3A 1UBEA 2QROA 2XEXA 3ANSA 4LQ4A 4WNAA 4LY0A 2R68A 4ZREA 4Q7EA 2EYUA 1W0JA 2VHXA 3DO5A 2H4WA 4FU0A 4LXIA 5E1BA 4N5HX 4AM8A 1ARZA 3GLHA 4ALJA 4F3YA 5D6NA 2XT0A 5DGIA 5FF9A 3U3XA 3JR7A 4LG1A 4LDQA 3G5TA 1M76A 3DGFC 1P8AA 1V11A 1NOIA 2N75A 3HWRA 1NI5A 5IKOA 4YXWA 2YXEA 4JR0A 1W76A 1SVIA 1E3EA 1OY1A 3F6EX 3UMGA 1ULTA 2C20A 1QCDA 1G2IA 2PQ6A 3MUOA 2ZFUA 4QQRA 4RFLA 4FM9A 5JNTA 1PR0A 4LRYA 3A2KA 1OT5A 3UJ3X 1AO3A 4AJ1A 3WAKA 1JLMA 1V5GA 3OTIA 3CLUC 1DRUA 8AT1A 1RKQA 4CLOB 2M6LA 3JZFA 4TTSA 2IBTA 3C70A 4K0KB 2J9FB 1F1BA 4QBTA 1YQDA 4UE2A 5H9VA 2MSWA 2HRZA 5LWHA 1WP9A 2QAJA 2GCPA 3TB6A 1Z0ZA 4XLZA 1KIAA 2WM8A 1SVSA 3OF3A 4LUCA 1AG9A 1QFSA 2CXOA 5BN1A 2BFFA 2PNFA 1NIPA 1A9TA 4NZOA 4RO0A 1C30B 1TK3A 3JR3A 5D3MA 4C5BA 3DBRA 4X1IA 3I23A 2PTGA 2WKSA 1QIMA 3IR6A 1Y5NA 4UE3S 1X7XA 3CVOA 1AU9A 2V7BA 2VWHA 1LPMA 4HDKA 5FFFA 1ECBA 2V96A 1VIYA 2EWMA 3KSMA 2IE0A 2IYEA 2JAOA 1L6RA 1EB9A 4Q9IA 3L92A 4AULA 4G0MA 2FW9A 3COWA 3HG7A 4WPGA 3AUFA 1OWMA 3D7RA 3JVUA 4KWCA 4OA5A 4E70A 2C2HA 1T91A 3ZNOA 1T0BA 3LUKA 4JX8A 2XQGA 1JXOA 4HAXA 5EP1A 3EXIA 5FLEX 1G9XA 3KQVA 3FGNA 3R8FA 4EELA 4DS3A 2DPGA 4KE6A 1IMOA 1V6CA 3GNLA 4O4JB 1S3FA 4TV9F 1P4SA 1XQVA 1FNBA 1WV1A 1UJ6A 1X2EA 1FBTA 1IZ0A 2QLLA 3WZLA 2F7SA 1DT3A 2C3OA 2LKDA 2MT9A 3EQ6A 4MYSA 3D6HA 3WHPA 5A1JA 1P6XA 1L5MA 2QQEA 3FJOA 1SVNA 3BRSA 4BFVA 2J0SA 1F5SA 2CVPA 2JFUA 2RI1A 5GVRA 4L5YA 3SIWA 1CY8A 2WIFA 1II9A 4OL9A 1SVWA 3E7FA 4R31A 3PFHA 4TTTS 2BGRA 1MQ9A 3DWEX 2EQ5A 1FE8A 1TZBA 2PRYA 2WOJA 4UULA 1Y9EA 3P2JA 3U4IA 1R27A 2BONA 1G9SA 2FEKA 3VGJA 3WK7A 4UTOA 4DILA 2DBRA 3ZDQA 4DV4B 3M5WA 4L5AA 1EYZA 5FTMA 4DNQA 1O6BA 1ZBDA 1T5IA 4M22A 1SBHA 4P5DA 3K05A 5IFLA 3O8OA 5CX1B 4XYEA 1YS9A 2BHNA 4LF9B 2PPLA 1PKXA 3KFVA 5F9MA 3KYDB 3FF4A 3OX3A 1R5JA 3JPWA 3W7AA 1FTGA 3HZZA 5CB4B 3PR2B 4YLGA 4ZYYA 4ZFNA 4Z5XA 1G98A 4V24A 3FPAA 3TVTA 1YB6A 1LKZA 1DIRA 1KI1A 1M6YA 4X1KB 3ERCA 1U0BB 1RI5A 5J63A 4YQFA 4Z1MA 3AF0A 1U8ZA 2P11A 1AQIA 3Q88A 4PWZA 1XHFA 1EP2B 1BMQA 1XDBA 1W7AA 5IMBA 4XH9B 2JGDA 1ZHOA 2NO4A 5DM70 2XCUA 4EEZA 2KPOA 4RKEA 2E89A 1MOPA 3QI7A 1IN4A 1U31A 4M98A 5LA6F 1FF9A 4OKIA 1UPUA 1XRPA 4R8SA 1VJ1A 2GD0A 4NJOA 3U7FB 1CVRA 2FF7A 1HR0B 1H1LA 4BNDB 1I7QB 3DLAA 3A27A 2O1WA 1T2DA 3Q8LA 2V9PA 1BTOA 4F9GA 1D4FA 3HA2A 1EUQA 5A0VA 1V95A 3FKSD 1E4YA 1V7QA 3GLFE 3CIFA 4RVDA 3NBYC 3UA3A 2CHEA 2IYQA 5LZ8A 3LH5A 5FBLB 1R9NA 1EK6A 2IELA 1T2NA 5F98A 4Z7OB 3I5MA 1D6MA 5TMEA 4J0KA 1KAHA 5KTPA 4CLHA 1A8QA 3VR2D 4FMDB 1MC4A 2NNLD 3BJZA 1M5TA 1MGPA 1EAYA 3N86A 3FKJA 4NABA 4OXIA 3TZKA 4RCZA 5JAZA 3LCVB 2SBTA 2B21A 1RAHA 3RT1A 3KU4A 3CKMA 1E92A 3PEUA 4MULA 3QBVA 3VGPA 2O23A 5HJ7A 1BO6A 4G0YA 1EFHA 3LO5A 2CJWA 1TU3A 4P4SA 4YMLA 5KO2A 1U5BA 2GYVA 3EQ8A 1D2EA 1QHGA 2R62A 2XE4A 4TOIA 4QOHA 4Q1CA 1WD5A 1VYTA 5EJMA 1V1MB 4KMRA 4W1RA 3FOWA 3WDKA 1Q0SA 1O95D 2JDID 1SG0A 1OYVA 2AQHA 2JHAA 2P62A 2ZDGA 3GJTA 4X71A 2XNSA 5C2JB 4TTQA 1VI6A 1YKGA 2Q1TA 1U5BB 2PMWB 3PEYA 3BXPA 2WSMA 4G1EB 3DDOA 4IIUA 5B6IA 4INPA 3C3DA 4URFA 1RTKA 2A33A 2FI1A 3GBVA 3LLVA 4MX8A 2WPDA 2VHJA 3LCCA 2ZROA 1P5JA 3M89A 2HUNA 2CUKA 2F8MA 4LXYA 2NUTB 3AI7A 1OXMA 4IMPA 4PFSA 1ZVJA 1H6DA 4L0QA 3U80A 3GLGA 2QLJA 1CW2B 1QYWA 5BSTA 2ZTUA 2R6FA 2M1ZA 2XNDA 3DD5A 1BH6A 2WTNA 3NWJA 1KJZA 2XKJE 1HRDA 2X40A 2XPCA 3G0CA 3LF2A 4HDMA 5KNBD 1BE8A 4OGGA 1L5OA 3RLFA 3ZGVA 1NF8A 2GBPA 1CUEA 4O4HA 3RASA 1DEKA 4F86A 2I8CA 4OQNA 1ZK4A 3NGXA 1RRVA 3GEBA 5HSGA 5KCZA 4NBVA 2ZJ2A 3CG0A 3K1AA 1YQTA 2ZZMA 1UH5A 4ZU3A 4ZYZA 4NATA 5GV7A 4NP6A 3QPVA 4R5HA 5EESA 3VNBA 3G13A 2R84A 1WKBA 2QP4A 2QX6A 3C6ZA 4TMTA 4WZ6A 5KUTA 2RD2A 3EPHA 4PPGA 1MNQA 1XBTA 3BGSA 4YMSA 4IZOA 4DRZA 4B47A 2VRCA 4AQ7A 1YAHA 1Z38A 2DPHA 3C4QA 4DSAA 4QVKA 4UDXX 3VFDA 3V1NA 3QLUC 1AUVA 5IYZF 1IG0A 2XTJA 2WF8A 4H6WA 3CEJA 3THYB 1GNPA 3FR7A 3CLTD 1V5FA 1A4IA 4KPGA 3EWIA 4RGYA 4AO6A 3HJHA 4M8IA 4EX7A 4JIMA 2QAIA 3BA6A 4IVQA 5BW8A 2IYYA 7REQA 3PJDA 1PLKA 1UANA 4M1YA 1R0BA 2J46A 3UH0A 5JY6A 2XCSB 4BNVA 4FFVA 1Z6ZA 3QBDA 2G63A 2F3RA 2NAFA 5CYOA 1WLSA 3JQ7B 4REMA 1SKAA 4N0EA 3T5CA 2WD7B 1KL7A 2HDWA 3A06A 3A4IA 2Y6VA 2P91A 2QW0X 3G7NA 3HQ4O 4HB3A 4ITRC 4YRIA 4BNGA 4B6FA 4ZJZA 2EIHA 3B9PA 4L6AA 1M2GA 3T3EA 4WN9A 3TK1A 3TE7A 3B6IA 1KYIA 3RU9A 1JSXA 1PG0A 2CKDA 4IWNA 3WYDA 4QRHA 1K3UB 2QD1A 3DAHA 4LHEA 2ZR0A 1EVYA 2JCYA 3K0AA 1H2FA 3BAZA 4GKAA 1J22A 5DBHX 1MX3A 4IIGA 1E7QA 3GGGA 3MWEA 3OQIA 1AGPA 3OPYB 4B45A 5IDQA 5LYJB 3L93A 1ICEA 3RG2A 1JAYA 2Y1XA 3KJZA 1R8XA 3QHQA 5DW3A 4X6XA 3EVAA 3T7CA 3B1XA 2FZGA 3CN9A 2H63A 4J6FA 4XPIB 1XMJA 1O03A 3LNTA 1YE8A 3TLGA 2QMQA 1MENA 5ALZA 4B44A 2OK8A 4JVMA 2X2FA 1OR8A 1XLUA 1ML3A 5GADl 5DNVA 5FJJA 2IYVA 1ECPA 4R98A 3SKVA 3JZIA 1Q0TA 4F11A 1MQ8B 2XY4A 3RS5A 2VHYA 3ANTA 4N8EA 2ZPUA 4QBKA 1JQEA 2HIMA 4Z0TA 1W36C 1CUIA 3R9IA 1XG5A 4ZCLA 3ZDAA 2BFPA 4E3WA 4DIUA 2ZT8A 2PH3A 4BVEA 1ZC3A 2BEKA 2AX4A 4L8LA 2HXYA 3PJGA 3SDBA 2DQYA 3SYMA 4W5JA 2AKAB 4HWGA 4BV3A 1VKHA 4MRPA 4HDSB 2P9ZA 3PC8A 2HQBA 2RKOA 1NI3A 3NCHA 4GNKA 5K45A 1TYBE 1ETHA 3T15A 5IT4A 4U8HA 5KTKA 1CETA 4RXMA 2H1CA 4GECA 1FFHA 3EY9A 4UTXA 1UDAA 1X1QA 5DNYB 1GRRA 1TEZA 3H9EO 1P5ZB 1AGRA 1DBQA 1RJ9B 2B8WA 3FWHA 3S2IA 1VMKA 5JH7F 3EXEB 4ZO4A 3E53A 3ONDA 1NT2A 2QAGB 2IXFA 4HO1X 4NWIA 3W6NA 2CMGA 5FXMA 1Q0QA 4ZVTA 3OFND 3QWFA 5G1NA 1DBRA 4IZ6A 1XZQA 1Y3CE 3LYLA 2H29A 3QRWA 2AN5A 2PGJA 2Q5OA 3VZSA 3UMBA 3PGVA 5JLJA 1TQ6A 3UANA 3ACBA 3F71A 2CLEB 3DVAB 4NPAA 4DJJA 2XZPA 1NU8A 2GYYA 5HUHA 1KH2A 1IHPA 4MTCA 3NTOA 4QRDA 2E55A 1TVEA 2PRIA 2ANBA 4MQEA 1RJFA 2Q3BA 1FTWA 2PD6A 3QZUA 3H5AA 4DC0A 4WSOA 3T6KA 4YDRA 4LV6A 4WEOA 4C4XA 2QG9A 1N7IA 2L17A 3FWYA 5A6SB 1PZFA 5B7GA 2YMPA 3S70A 3LOUA 2Q4OA 1XTPA 3KXDA 2Q3FA 2MDTA 2VNJA 2HADA 2BFAA 4MNTA 2DC1A 4S1PA 4V3CA 4Q4LA 1GGKA 3KKKA 3QVMA 4WY5A 4EITA 2LCFA 4ZYVA 2QTAA 3IO5A 1USWA 5LR6A 4KIWA 4YAGA 2MWMA 3S1SA 4L0DA 3U1TA 2HWKA 5BMVA 2P4SA 4YJHA 3SBXA 3SX0A 5K0SA 1R6TA 5BWLA 1WXEA 3BREA 3PRKE 3RVKA 2DERA 4LXTA 1TK2A 3ACDA 5MGBA 1G8FA 1PE0A 1XAHA 2ZPAA 3PE6A 1CERA 4Z4CA 1EXVA 5A05A 2AQ8A 4O4HB 3D6MA 4QGAA 1GCGA 3H5TA 5LOVA 3PI6A 2OSBA 1F8UA 3AHEA 2FZLA 3UBMA 3CLHA 3JQFA 4JLVA 1LVHA 4GYKA 2HN9A 2JIMA 1US8B 3E2IA 4HAZA 3U44A 2P1ZA 3AEUA 2WIGA 4CMIA 1O9BA 1GPLA 1ORIA 4WKCA 4E7PA 4NV1A 3N8DA 3UCXA 4JEHA 3QIVA 3CISA 1K9SA 4YA6A 4Y7CA 5HTOA 3WR5A 2F1OA 2DSTA 4BKOA 3MJ4A 1OPXA 2IHNA 2CLSA 2G72A 3DTNA 2X1MA 3E82A 3HLTA 4G4SO 4KYIB 4BQFA 2C42A 2B98A 3FKSA 3E9EA 4CG3A 2ANCA 1SVKA 2C77A 2V3VA 5EJ8A 1FMLA 5LQMA 3KBBA 3QELA 1F8FA 4EH1A 4DQ0A 3SEAA 1E5DA 3LK6A 3WG9A 3ANNA 1GGHA 1Z3CA 5HDBB 4JBNA 2JLSA 1RRMA 1EBBA 3FNFA 3JSXA 4UXJA 1CUZA 1ID1A 1BMFD 4WAUA 3UWPA 1W5EA 4KN8A 2A7QA 4C0XA 3F5DA 3NEJA 1QIGA 4NJEB 4CFZA 1GG2A 2OGZA 4D0RA 2QZZA 2WLTA 1YMUA 4JVOA 1O4VA 4I4TF 3O2QB 2C4TA 2ASEA 1IVYA 1E9CA 3WKAA 4X8LA 4ZAZA 1K27A 3GJ6A 1D0VA 2O8VA 3CNOA 1U8UA 4LJ9A 2WMNB 3BWBA 4YB8A 4QJ3A 4ZK2A 3SXUA 1WKVA 1IN5A 3N8KA 1M5RA 5LQSA 3R3UA 4G5QA 1LH0A 4EPVA 2QJWA 2QVBA 4ZHSA 1R6UA 3KEMA 2I8AA 4RTPA 4OK3A 4HH1A 2PN1A 5F7ZA 2HWXA 1RT9A 2R00A 1JKXA 1E7RA 3CG4A 1OGYA 3EIFA 1JEOA 2N46A 1YFJA 4WJKB 2EX0A 1AGXA 1XC7A 2YXPX 2RH4A 4BNDA 4HH4A 1JEYB 3W9SA 3MWLA 2RAUA 1L4BA 3FDXA 2NM0A 3NBAA 3T9EA 2CXUA 3L9WA 1UL1X 1FVXA 1P72A 4O1IA 2QRZA 2A9OA 4IKEA 2I03A 4IDNA 1BQ3A 5HZMA 3UTDA 4P86A 3U7QA 5GONA 1UKCA 3IQFA 2ERXA 3NBMA 1FNDA 3BGDA 5T8KA 1R66A 3O4HA 1A9PA 2KBFA 2VF5X 1FY2A 1MO6A 1TECE 1VDZA 4GWKA 1GYRA 4ZZ2A 5DHFA 1Z18A 4HDSA 4AMGA 1K7SN 3UK7A 4FR5A 4UJ3A 2AFHB 1NRIA 4BWFB 1JN0A 4G07A 3SS7X 4H27A 4DLBA 5FBWB 1J2EA 3K0CC 3S2EA 3PDCA 4ALLA 4WXPA 2OQ2A 4XUCA 2O2IA 4HK4A 1IM5A 1F51E 2P75A 1E2FA 3HYSA 5CTAA 1EUCB 3DDHA 5FJIA 3UUFA 4UPEA 2ETXA 1SBZA 4CMIB 2OYRA 5LBIA 1OSNA 4B76A 4KLRA 3CT6A 4YDQA 1X87A 1VE3A 3H4VA 5EE5B 5FOSA 3ZDYB 3KLPX 3TLGB 4DYDA 1MJFA 2C9CA 2RE8A 2GEUA 4IEIA 3ZY3A 3RSOA 4GC9A 4PZLA 4JX9A 1M1YB 2R6HA 2NU9A 2PKWA 2J3HA 4AZSA 4NAHA 5JSZA 3A9VA 2X9QA 3DPUA 3HKBB 4GPAA 1MORA 1SQSA 3LUFA 4MJXA 4MVJD 4ZT7A 5FWAA 1C7IA 4F5WA 3ABIA 2NZUG 3F73A 5HCIA 3V7FA 1CEEA 4PLTA 1PT6A 4P3YA 4WZAB 1I2MA 1YB4A 3ND6A 4DV0B 3Q8MA 1C1HA 1J7JA 4JH0A 4O4LB 2CV0A 5KYXB 1VFNA 1L7EA 4KODA 1W85A 2O8CA 3NT5A 2YZNA 3UYLA 2AF4C 3ADPA 3LW7A 3VISA 1E6CA 2GETA 4XJTA 1N2GA 3TSWA 3JZAA 1Z47A 3LKZA 2NUBA 3EF0A 5I7WA 4OHPA 5BUSA 2YHAA 4Y2XA 4BX8A 2YVLA 3MOSA 4PANA 1QP0A 3DBOB 2BCEA 2XMPA 3ZOKA 1E7MA 3PNSA 1PYDA 1E4VA 3PKIA 4U2CA 1DFHA 4CIXA 4EA7A 1C0IA 3PYLA 5EJ2A 1QP7A 4C7OB 1EP3B 4RETA 1V5EA 3KOOA 2J67A 3C43A 2W6QA 5TY0A 2OV2A 1FFXA 1KVSA 3RV3A 4LSGA 4CM9A 2AWOA 3G6WA 1OOEA 2PUBA 1WXXA 3UT5B 3IAHA 1A3CA 4BEBA 3TLZA 1SKYE 2C4NA 5I4BA 4DA4A 3HLKA 4X90A 4C87A 4IDDA 2G8LA 4QECA 5DTRA 3JASA 1TMGE 4FX2A 4U7GA 2XBLA 4DTIA 3HNRA 5DHSA 2HU8A 1P4HA 2X7JA 5AW1A 2CL0X 3JALA 2WNSA 2PJZA 4JJEA 1BE0A 2IA5A 3D1VA 5IVDA 4QYIB 4FZRA 1KU0A 4EA8A 3M70A 3JZDA 2VUIB 4DQDA 3DM9B 3DWGA 4MP8A 1L5HB 2BFDA 3RFTA 1DAPA 4DVJA 2Q2OA 4GU5A 5DCWA 2FSGA 4HZIA 4QDJA 4CVNA 2Z2KA 3FDIA 3VSBA 4BATA 4ZI7B 4D8XA 3GWZA 1RXEA 3KQQA 4D9EA 2IUFA 5EJ7A 1AV7A 3TTUA 2ZSAA 1V35A 4IHJF 5TEWA 2RONA 2H51A 4YC7A 3JPYA 1VCMA 1SXJC 2BZ1A 3HPRA 2XMBA 1DUIA 3MNFA 4ISBA 4GPBA 3L9XA 4EGAA 5F3RA 1S8AA 2GTIA 4I46A 5KNDH 2OHFA 3SC2A 4Z7QB 2IX3A 2JAXA 1RWOA 4BX3A 4M7PA 1U7UA 3L4KA 1ODLA 3KKQA 3OF5A 3SK0A 3O82A 4MW9A 4MS4A 2F48A 4N3BA 3FFXA 1HMPA 2NG1A 3FPBA 3ITEA 1OX4B 1XWIA 1K5DA 2ZJ6A 4RZSA 4X1YB 5HHTA 1LJUA 2WWVD 4R54A 5L45A 2RHHA 4NECA 2PGNA 3O83A