1C2YA

Crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MNELEGYVTKAQSFRFAIVVARFNEFVTRRLMEGALDTFKKYSVNEDIDVVWVPGAYELGVTAQALGKSGKYHAIVCLGAVVKGDTSHYDAVVNSASSGVLSAGLNSGVPCVFGVLTCDNMDQAINRAGGKAGNKGAESALTAIEMASLFEHHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (LUMAZINE SYNTHASE)
publication title Crystal structure analysis of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly.
pubmed rcsb
source organism Spinacia oleracea
molecule tags Transferase
total genus 53
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 1999-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1c2yA00
2C9DA 1W29A 2I0FA 2B99A 4KQ6A 2B98A 1XN1A 2A59A 1KZ1A 2VI5A 1NQUA 2O6HA 1ZISA 1T13A 2F59A 2OBXA 1HQKA 1RVV1 1W19A 1KYXA 1NQVA 2C92A 5IM4A 1KYVA 2A57A 1DI0A 1C2YA 2JFBA 2A58A 4J07A 1KZ6A 2C94A 1NQWA 1KZ4A 1NQXA 1C41A 3MK31 3NQ41 2C97A 5IM5A 1EJBA 1KZ9A 2C9BA 1KYYA
chains in the Genus database with same CATH superfamily
2Y1GA 5IBRA 4NBVA 5HMMA 4DDTA 4R9UC 4QQRA 3VO2A 3JARA 4BMYA 3AV3A 3RKRA 1MIHA 5DTJA 5B2FA 4OI2A 1QIJA 2RJNA 2VP9A 4X44A 1E2FA 5HG0A 2BHSA 5BYJA 4GE3A 3LC7O 4NCIA 4O1IA 1ESNA 3EGDB 5D3MA 2HBRA 5CB0A 1C9MA 2BFNA 2ZUVA 4PIPA 2O0MA 4M0DA 1WMSA 5A9RA 4HNQA 1UBGA 1OWMA 5DE3A 3NBKA 3OX2A 5TVKA 4BZXA 5IM4F 5P21A 1JR6A 3QWFA 1UT6A 1ZMBA 3AMVA 3TNLA 1RAIA 2ZI3A 5BWOA 1GRNA 2P3SA 3OY2A 1GLGA 2IA5A 5LWQA 1BDHA 5CYOA 4NZ9A 1R8QA 1LLDA 1DRWA 2YZKA 3QVTA 4JHXA 4NH4A 1WMBA 2XYPA 2Z1DA 1F2UB 3HADA 3HGTA 3KSZO 4FC7A 4KI7A 4MS4A 3WDMA 1M10A 2Y66A 2G0NA 3V4SA 5LJLA 1K7SN 3F6PA 4DJEC 1T6BY 3EQ8A 3PQ4A 1DBQA 1LI4A 2ZUCA 3DCNA 8MHTA 3G2OA 3O4IA 1VJTA 4J1TA 3HYRA 3AZPA 3OURA 1AURA 3A26A 3P0HA 1W85B 5J2UB 1ULBA 2G72A 3ILXA 2ZIFA 1EB9A 1JLRA 1LDGA 1L4NA 4XA8A 3VR6A 5HM6A 1H1LB 2O5EA 4LSWA 3C7CB 4DYHA 1L8QA 1LX6A 1XI2A 2C5GA 4ENWA 3GLGB 5EMNA 1A2BA 2B8TA 4GL2A 1FFXA 5L51A 3KQKA 1C8KA 4GUDA 3LHFA 3U1VA 5F2EA 4D92A 1OFIA 2AJBA 1OH7A 4OD0A 4G0OA 2I4RA 5CRIA 3PC3A 1BX3A 1N77A 1ZN9A 1ZBDA 1SXJB 1E0SA 5BVGB 2GILA 3VU0A 4YXFA 5JMPA 1G2QA 4WD3A 2J0UB 1QZXA 1G63A 3CUVA 2GZ2A 5REQB 4JEIA 2WF7A 1DEKA 4OUDA 5KDOA 4HSGA 4RTOA 2QY9A 4MARA 2WK1A 2Z1MA 4D9KA 2YHIB 1T8TA 1CJBA 3KVRA 1Z6AA 4LNAA 5CDYA 4LZJA 3FNIA 4LE2A 4B9AA 3TDNA 2IHBA 3A31A 4FCCA 4P3KA 1OB5A 2ZPUA 1RPJA 3D3EA 4HX2A 1YS6A 1I7LA 1NKVA 2VUSA 3EMBA 4GOKA 2PZEA 2P1ZA 4HB0A 4OKNA 4D3XA 4PHTA 5FPPA 4MA5A 1T2EA 3IUNA 1J9EA 4MMYB 3CEMA 2ODPA 2EKLA 3WGGA 5LYJB 3AONB 3RK1A 1M8FA 1WS6A 2OQ2A 5CCEA 2BBTA 2K87A 1UIMA 4D6XA 5GONB 1TYBE 2REBA 1T8PA 2P4QA 1ESDA 5TEVA 4BASA 4F9GA 1MG5A 3B1VA 1JQDA 4LJ9A 5D5PA 4BP1A 3ICOA 4Z0NA 3L9WA 4E3ZA 3CBGA 4PLZA 2VUUA 4XIJA 1HEUA 4B4VA 2FMXA 4KGVA 2IIVA 4YBRA 1LQ2A 1GTZA 4DJJA 1J0XO 3AUJB 5L9AA 5MHTA 4MKGA 4XJSA 1YL6A 2OLEA 1W1WA 3PHGA 1UFKA 2FPLA 3HLKA 1M1NA 1OY1A 4I55A 4WLVA 3HXLA 4U2BA 1RHKA 4V02A 5DNAA 3S68A 4AIIA 4FHZA 3AVOA 3II6X 5KQGA 3SSMA 2L42A 2BR4A 1WRBA 1SCJA 1CZUA 2IZOA 1V45E 4RVSA 4ZHQA 1NHGA 2O7VA 2XQJA 3ELWA 1NC1A 3LP6A 2HYIC 2E85A 5DNCA 3D4IA 3LQFA 1UMCA 4JNCA 2IGTA 1CR1A 3PICA 3VVLA 1SK8A 1R0CA 2FR0A 2HJSA 3E22A 3MJSA 4E13A 5IJWA 2DB3A 5EA2A 1WVGA 1ZUNA 3GLTA 4OL9A 1A9YA 5G0TA 2ZIXB 4MHOA 5EI5A 4KVFA 4C3ZA 1A96A 1KZHA 1U0GA 4DDVA 3UMCA 2A1IA 5BUZA 2I65A 1AB6A 2ZJ2A 3BMNB 3PD0A 2H4ZA 1RHJA 2I62A 4CTMA 1I0LA 5CBKA 4UVHA 1BFUA 2PEZA 3HBMA 1QV9A 5EKSA 3JZIA 4H7HA 1J09A 1YB1A 1Z29A 2RJOA 2X8JB 2AW5A 5DIFA 1DO2A 2QX9A 1PYOA 3ELBA 1Q1EA 1R5JA 1E96A 5AJXA 4ZT2A 2NTVA 4X64B 4F2DA 1AHNA 1NBAA 2EX4A 2XWBF 3EXG2 2ZLBA 1W30A 3MCWA 4QEKA 3ANNA 4XLZA 1JB1A 2ZXFA 3DE2X 1TEXA 3AJ9A 4EFNA 3HB0A 4YASA 5DLDA 4TT8A 4K7JA 5JFTA 4YAUA 2WJPA 4ZOBA 4US0R 1GSAA 4RD4A 2ZBVA 3KQVA 2O0JA 4KIWA 1QYIA 4PYRA 3TW8A 4JZYA 4C0XA 1ZUIA 5AI4A 4G5RA 2OCYC 1Z0JA 4UU0A 2ZWMA 3LBIA 3I9V1 3U7JA 1XAIA 1QDUA 1BTOA 3M82A 1N57A 1QGAA 2HXSA 2IIPA 1C4KA 5BN3A 4G2NA 1Z4MA 1JEQA 1NVKA 2P9HA 3RQSA 2I4LA 3NWPA 5BQOA 1EE2A 5ITVA 1HNWB 1XU4A 3HYTA 4P3OA 1VKRA 1AHIA 5JZBA 4MLDA 3EGCA 4BIMA 3KOZA 2W4MA 4EJ6A 3WNVA 1WJGA 2IS1A 2UYYA 4O1HA 4N0EA 2VUTA 4X63A 4AJJA 1I4WA 3P9YA 1L4EA 1BMFA 1L4FA 1JWAB 3KVOA 5JOQA 2Z83A 4HS4A 5ALTA 2ET6A 1BD3A 3EN0A 2REXB 3OCVA 4N48A 4PXSA 1I4OA 3A8TA 1E77A 3M2TA 1VC2A 1JFLA 4KXYA 4X1YA 3KJZA 4KU4A 2E4WA 4D9EA 3WJ7A 4E15A 2B5VA 4EO7A 2PXCA 2ZM6B 1NUUA 3EEYA 4YMIA 4A3SA 1XDUA 4H7EA 3L7MA 3U19A 3O8CA 1DCTA 1EX1A 2XMDA 3NJ4A 2IS2A 3PSHA 5F5LA 1K6MA 3F6BX 5DCLA 5HEKA 2FX3A 3ZCUA 2B61A 3A1VA 1ZR4A 1AKVA 2DTEA 3PDCA 4F8EA 3HL4A 2ANCA 2OCIA 3KK0A 1MAWA 3A14A 2HQSA 2Y99A 5AKIA 4GECA 5DI3B 3ME5A 3ADDA 4DR7B 3DZCA 1EHYA 1ZHHA 2WPDA 2PX8A 4E08A 1VMAA 3VR5H 5G0VA 4C22A 3TECE 2DQSA 4M49A 2Z43A 4OQPA 3LUGA 4DUZB 1GZSA 1Z4JA 5IS2A 5JRJA 1BMFD 3BOSA 1G19A 3R24A 2QORA 4JMLA 3D54D 3SZ3A 3C4VA 5DGHA 4L5YA 4CKBB 5KCZA 4UZEA 4HBGA 1CUUA 1V9SA 3TLJA 3U7FB 1XFAA 4RHEA 2NPFA 4YYZA 2ZYWX 4J2TA 1U6JA 3EE6A 1AGPA 1DEXA 2QMZA 2SKEA 4XSHA 2O3JA 2DCMA 1T5HX 1CK4A 2L2QA 3OJCA 4S1WA 3CRNA 4YIHA 3KYBA 4WVLA 4WCFC 4G85A 3RLFA 4ZYVA 3GGDA 1PS8A 4GKAA 2G1JA 2FXIA 2ZWIA 3H11A 4QOFA 5CGQB 3TCKA 2EJCA 1WP4A 5LOVF 4NPAA 4RWEA 3BCRA 4B4WA 5T7BA 1ZH6A 2UYHA 5LLTA 4ILKA 2W6JA 5IVIA 3EXHB 2WPDD 1AQJA 3AI3A 3KPWA 4A8PA 3MT8A 1KMHB 4XYMA 4L0MA 4GQAA 5DNDA 1M2JA 2AQIA 5EWJB 1OFTA 3TGPA 3AZQA 2FUG1 2OBYA 5BSEA 2XCUA 2OBBA 2OT3B 1JQ3A 2FDXA 1DKLA 1RPAA 4NHEA 1QIHA 1ZK0A 2C7OA 3GMIA 4QVKA 1KETA 1GL9B 1QAQA 4ISCA 2OLKA 4HTFA 1SZCA 1U2DA 1Z6QA 5B1HA 2P9TA 1HZJA 1RLJA 2R79A 3BTSA 4BY9E 2F8TA 3U62A 8LDHA 1OWLA 1IB6A 2QX6A 4MKHA 3EVCA 2Q3LA 1Y8AA 3LX6A 1DX4A 5BT8A 4F1KA 3CLUC 3PCRB 1KAEA 4M1SA 1U8FO 1K08A 3JX9A 3O3CA 1RAHA 2BFBB 4DMLA 2W6JD 3RNLA 1E98A 3JU3A 1ZH0A 1UJMA 4JUIA 1VJCA 2Z2KA 3Q2IA 2R00C 3NHAA 4IEIA 1LEHA 3JD1A 3UK2A 1R6UA 4EQ6A 4F46A 3W3ZB 4US2R 3GARA 4FKMA 3EIXA 4BCBA 1CHDA 2UVPA 5IHPA 1W47A 3HBJA 4ZVSA 1OZGA 3RV4A 5KKAA 4PC1A 1UIRA 4KCGA 2FCRA 2WJ4A 2BFDB 1A8IA 2H2IA 2I22A 4M1TA 3TNYA 3A0UA 2G5TA 5B3JA 3TPFA 3QLTA 1NSTA 4AS3A 2GJ9A 5E3HA 1JDSA 4L2IA 3G2KA 1OLXB 3AIOA 4A4DA 2TSYB 3E7WA 2OFWA 1FDOA 1HM5A 2P4SA 4ANFA 1E1CB 4D9NA 3KUXA 4RY2A 5FB3A 2P0AA 1I3LA 1DQYA 4ZKEA 5AW7A 4YUZA 2R11A 4U8GA 4FZVA 5F1KA 4QLOA 4F5DA 3FX2A 1WZEA 3PKZA 1VE1A 1G5TA 4I2VA 3HP7A 5ALGA 2OXCA 3L8FA 4OAPA 3LO8A 4WDRA 5CMLA 2ZXEA 4F4IA 1YKSA 2H2WA 1L9KA 2DE0X 1N4DA 3K8ZA 2YMQA 1KI3A 2A1UA 3L40A 3F8SA 4MEBA 1HG1A 1ZOLA 3ETEA 4BNKA 1XZEA 1M66A 4IDEA 3D0QA 4BFTA 3MBOA 4MRAA 2PGLA 3TTYA 6REQB 1Q15A 3PRYA 3I23A 1K0FA 2BTQB 4YRTA 4QIHA 2VHTA 4EITA 3VRHA 2ZT8A 5A4KA 3RVNA 1IQUA 1K88A 3A6DA 4X00A 3HK2A 4JV5B 2VXOA 2H4JA 3GGCA 2Q6KA 5JY1A 3CKYA 3NBMA 1DXHA 2CSXA 3R0VA 4DRZA 2RH8A 2Z8YM 1TGVA 1M6YA 2JD1A 2IYLD 3PUKA 1D4FA 1T9CA 4RYDA 1Y1QA 2QYHA 2DUNA 3ON5A 1FRNA 1E5XA 1WIWA 2Q3MA 4B4UA 4PYQA 3OBIA 4OB7A 2G25A 3U7GA 3B5EA 2WU0A 5EMKA 1T5SA 2I2BA 4Z6KA 5HRAA 3QLUA 4R8RA 1VDZA 2NTNA 2VF2A 5EZYB 4EEZA 5CFZA 1MT3A 2AI1A 3O4RA 3NHZA 4MK4A 4CLDA 4DM7A 4BFVA 2V9ZA 5EHGA 2J6IA 2HU2A 1FS5A 1HL7A 4UNNA 2NG1A 3R1IA 2HV8A 4R2HA 3H8SA 3OCWA 4FZ5A 4IDAA 1WZUA 4UHKA 3CZ5A 1GVNB 4MGKR 4CCYB 1VPWA 2PY6A 2BUCA 3S44A 5FOWA 4KYVA 2GHTA 2HKIA 2OQRA 1GPDG 2QE6A 4H1HA 2VDMB 1I7SB 4QUIA 4JT4A 2C2BA 4Q37A 2BEWA 1B6TA 1R0SA 2EL9A 1WXWA 2HCRA 3EG9B 3I1FA 3ZI0A 1XVAA 2PWZA 2HBQA 2FZLA 2AYZA 4HPXB 4V1CI 4JU8A 3FHCB 5A0FA 4C1NA 3OQOA 1BU8A 3AHIA 3U0VA 5ELXA 4NEGA 1CJUC 1L5FA 1DVRA 1NVVQ 3D31A 5IVDA 1JTFA 1DGQA 3L1JA 3R5FA 4FYXA 2OXFA 1JRLA 1BKDR 2OMKA 5F1PA 4UHEA 1TB4A 1Y0BA 2H8GA 4ZVMA 3W5CA 4NK4A 4ZGWA 5B3KA 1HFKA 2QN6A 4ND1A 2AFIA 2YMMA 2HRZA 1DHRA 3I4LA 4F3NA 2ZSBA 5F23A 3PE6A 3UA4A 3KAKA 3NUZA 3LW7A 2DKFA 2I76A 4B87A 1AO3A 1IEQA 1SBHA 1X14A 2F4NA 1Z68A 3ZTYA 2H1CA 3KXPA 2HA5A 4IJVA 3NGLA 3L0OA 4Y2UA 3N2ZB 1KIMA 2IYAA 2W2KA 3K4HA 3ZY5A 2A1TS 1CUWA 1YACA 3F46A 3HI6A 4IIXA 4OF4A 1UP4A 4FD3A 4EK9A 1UJBA 5DFAA 4E4YA 2H63A 1VLZA 2XT6A 4WN9A 5T64A 1JHMA 1WPGA 2Z5GA 3LAWA 3IMFA 4G5OA 1C3OB 3BSSA 4LDPA 5AO9A 5JNWA 1YTUA 4GE0A 2YZNA 4KZPA 4NBNA 4ALNA 4ZRDA 2QTBA 3AVQA 2IODA 1YJCA 1XYYA 2HQOA 4MSUA 2IYSA 3Q7IA 4R01A 1ENOA 4UAVA 4W5JA 3DWFA 1CUCA 1YZ3A 3DZJA 3HG7A 1DEOA 2GJ8A 4TLAA 1IL0A 5ALRA 5ABPA 2GEUA 3I9JA 4JBGA 1C0KA 1GCGA 4LF4B 3H4VA 1FUUA 1YI0A 2GDJA 4WZ6A 3RG8A 2ZYSA 3U17A 3PVCA 1DKUA 1AKMA 2VP4A 1PR4A 4PZYA 4Y9TA 3L84A 3AI7A 3FM9A 5FORA 3WK6A 4MUXA 5H5JA 4TTPA 5H80A 1IE3A 2VDNB 3SNKA 3D2BA 3ZCTA 3DEHA 4KWCA 4MPJA 1KVQA 3D1VA 2VKTA 4FMCB 2Q29A 4FSDA 2C7PA 4X90A 5FLEX 2FUCA 4IINA 2ZATA 3L6RA 1TJ3A 2C2MA 2VNKA 1R10A 1K9SA 3I1IA 2WFZA 3UCXA 4AURA 4XI9A 3NUQA 2E3JA 2DQYA 3GNTA 2UUCB 1MR3F 3R3XA 1EUCA 3AHDA 1N6HA 2R86A 2WWVD 3WB0A 4QJ3A 1RHRA 1ISHA 2OV3A 3AL3A 3S27A 1MPXA 2XVYA 1IWBB 4LOAA 5LCXA 5JV5A 5K99A 5ESXA 3WB9A 5KYUB 3NEYA 4HHEA 4TMXA 2O3SA 1QQ7A 4XWGA 2XYVA 1RZVA 2EV9A 2JBAB 1GRQA 5TEWA 4JBHA 3C3DA 3WWYA 4O33A 2RB4A 1EXNA 3Q1KA 5EFZA 1ILEA 2BM0A 2HU8A 3A4TA 2XB4A 4FGJA 2DAPA 2YN4A 5MN4A 1EP9A 4X41A 1LFDB 1LJ8A 5K8VA 1L1FA 2FMKA 4DJ5X 4DE5A 2OZPA 3PXGA 5CVUA 2OAGA 4RTSA 1Z7BA 5DHTA 4BGVA 2UKDA 3EGDA 1DWQA 1RP7A 2UYOA 2BONA 2ODQA 3RD5A 3OFNA 1EH5A 4LCBA 1SK9A 5DCYA 2AX4A 4O29A 3DPUA 3TM4A 4EMBA 1CY8A 2JKZA 2PUVA 2AOTB 2HX1A 2ZTHA 4JL8A 3WYGA 3H9CA 2IXGA 2PGAA 1N8NA 2MSCB 2PR2A 3X2EA 4LDJA 1B7GO 2BZGA 5B58T 1IONA 3DJYA 3LUAA 3R4VA 4GRIA 1YQDA 2E2WA 2V0GA 1P4SA 3WNZA 5I48A 3HTXA 1DDGA 1NU6A 2WM8A 4AK9A 3RUIA 1P9WA 5CFOA 5MF6A 1KZ9A 1O54A 2NGRA 2NYRA 4IXDA 4WDQA 4KK3A 5H3HA 4REMA 1Q21A 5EJ9A 1NPYA 5KQPA 4D6PA 4L4YA 4GI3A 4IJUA 3KR2A 4HDSB 4QAJA 1W5EA 5DP1A 3K6SB 3GJZA 4MITA 1Z4PX 5JTTA 4ZJUA 4E2XA 3M5WA 4DV3B 1P0MA 1W85A 4LJYA 2EL7A 2QN3A 5J2UA 2ZZKA 3IEPA 1O6BA 2CE7A 4H4CA 3W34A 4HLQB 1H1LA 4G0QA 2WZCA 3FWPA 4CN8A 1CY0A 3AKDA 1T5BA 3OFSA 3OFND 3GLGA 1WBBA 3G2QA 2R68A 4EKDA 4F3RA 3W2HA 1U7DA 1ZICA 4HZIA 2XBLA 4Z9AA 3TKLA 4KO4S 3W4IA 4X71A 5A6SA 5CD9A 1QYVA 1SVSA 2WRZA 2G83A 1JVBA 3BCHA 4OA5A 2JG3A 5G1PA 2O0LA 4D5GA 3CKKA 5H9WA 3DO5A 4HL6A 4MGEA 1YIOA 1M6WA 3W6OA 2AN3A 1WB4A 2FH5B 2CFRA 1OBCA 3RG2A 1SXJA 2QLMA 3FOAA 1L5OA 2IBSA 5LFAA 4O2BB 3IQZA 1P3JA 1XBTA 2AJ8A 1Q1BA 3IIIA 2GRJA 3TS1A 1VHLA 2QP3A 2PV0A 3BBLA 1ZUWA 1ADBA 4CCAA 1S1CA 1GA4A 2ZIAA 3VZBA 7MDHA 2EJUA 1V11A 4L3WA 2YHIA 5ARDA 5HK8A 2R8BA 3HUFA 1ZOSA 4GVXA 1JDVA 2OM6A 4I50B 1N6LA 2Q4TA 2OGSA 5TMPA 1H69A 5ESWA 3HH8A 1OWNA 4WHMA 4N7BA 2FRDC 1VJ0A 1TZMA 3T12A 4O4HB 4BYMA 4M36A 3LY5A 2GVDC 2PBZA 4MTLA 1RKXA 3MJDA 4C6RA 3FDZB 3RANA 3VXKA 1XMOB 5H81A 2QU7A 4KMMA 3NW9A 4GXRA 1PKEA 1V7ZA 4GI1A 4N03A 2VBCA 3JASB 1XTPA 5LMZA 2IXBA 3ZI4A 3MLEA 4CGZA 1SXJD 1XEXB 3P32A 4JC5A 3T95A 1NNEA 5GZ3A 3VOBA 1PR5A 3WWDA 2FCAA 4P4NA 3TQFA 5AJTA 2D1TA 5U9CA 1PFYA 5J2TA 2FOIA 1IIRA 1WCIB 1KMQA 4PNZA 1U6KA 2WE8A 3I72A 4FYWA 3J81k 1DBRA 1WZNA 1VZ2A 2CHUA 4KQCA 1LFAA 4QHSA 2HTEA 3A9SA 3ZTTA 3O8OA 2FF5A 5CLLA 3RU2A 3V2HA 1NI5A 3CZPA 2IP1A 4I5EA 4R54A 3TRIA 1PV4A 3IBTA 4FR2A 4UTVA 4I55F 2C84A 4M7PA 2ZIUB 2VJMB 2O3UA 2JB9A 3JQBA 3I34X 3EXFB 5MGNA 1I6KA 2CD7A 1XGKA 1BVYF 3G89A 3WBFA 1J20A 1TZ2A 2JFOA 2VPIA 3ODPA 1W19A 4WY8A 4KE9A 5AVJA 3ZCXA 3EW9A 5B55A 1ODCA 4JKOA 1BWSA 2VJYA 3CH6A 1OMOA 3ZD6A 2ZIXA 3HBFA 3PI7A 2WTUA 1E1QA 1BQ3A 1WOMA 2HF9A 2IPAB 2Q3HA 3D5QA 3MAJA 2GX6A 4PFQA 1I1HA 2J09A 3ER8A 5CG1A 3B7PA 3RIXA 1DIHA 1PCXA 5IM5A 1F4LA 1FVOA 2DLDA 2PRYA 4C7JA 1CWUA 2XE6A 4I9UA 3SQLA 2RI1A 4E2WA 3VVBA 2X8JA 1USIA 3JAKB 1I7PA 3VPSA 1L6RA 4DADA 5I45A 3T1YB 1JG4A 1L8LA 1SHJA 4D79A 1PHRA 1RWBA 5AKLA 1HFWA 2PL9A 3O1JC 2O3RA 3GPIA 4J7AA 3QIAA 2VPYA 5FWDA 2R6FA 5ALKA 4CKCB 5E6UB 3U4DA 1VCOA 3CXUA 4KJZA 4RV4A 5F2KA 5LQKA 3DV0B 3KTAA 3OSUA 3DCYA 1U2RA 1NW9B 4PW0A 2ZWAA 3SYLA 2YJ3A 3TE7A 2GARA 3UG7A 4PN3A 1YBMA 4JUFA 3L93A 3F7OA 1J0DA 3LUBA 3MMSA 4JXJA 5FA5A 4XTCS 3SXPA 3UOWA 3VDRA 3QFTA 3VM6A 4BQSA 1UQUA 3MFYA 5AQEA 4HDKB 5AVKA 2VTDA 2C31A 3EWNA 3G79A 4KUHA 1FQJA 2GPYA 1E1QD 3QPDA 3RFFA 4Z4HA 4HMQA 2O2SA 2GTIA 2IW1A 5ADWA 4BS9A 3ENKA 4HAXA 2XCRB 3WMEA 1SQSA 3JYLA 4QT0A 4RS4A 4FGKA 3HWWA 4Q9NA 3W5SA 1G9SA 3FKQA 3ND7A 2WUEA 7AT1A 4EBFA 5CEJA 5JSQA 2NO5A 3LT5A 1J1UA 1E5VA 3OTQA 4OHPA 4YJ2B 3IULA 1T1JA 4OJMX 1RJGA 1W87A 2FPOA 3BAZA 3ILHA 5FX2A 1B23P 4JGGA 4CF4A 3SEQA 3A04A 2ZRDA 1XLTA 2FQQA 3FGNA 3SKVA 4C14A 3I2FA 3M81A 4IW3B 3JYQA 3H0CA 1NW7A 1FNSA 2DBZA 3IHKA 1PS9A 5KTTA 4ZVLA 4WRRA 5FJIA 3T6KA 1Q92A 1ZI8A 1E60A 2BMEA 5T4EA 1AMUA 3OC6A 4YRDA 1ARZA 4KSCA 5AUPB 4KQWA 3UJ7A 2ZJYA 2QQEA 1B93A 1J7KA 1S8FA 2FETA 3EOAI 4B4OA 4LZLA 3PEEA 1EP3B 2VHJA 3GV0A 4R4JA 4MR8A 3AF4A 5G41A 5TIIA 1RCUA 2DY1A 1W25A 1HXHA 3TW0A 3FVWA 3LMKA 2H4WA 5DI3A 1EVYA 2B6NA 4PZDA 4XW2A 2PKWA 5CR9A 1QF9A 1ORIA 5JWRA 2W2OA 2JHCA 4L3OA 1FNCA 4GXQA 3L1IA 1CEQA 3LL7A 5B53A 3ZWOA 4IJQA 3SC4A 2DFVA 4YONB 3SFZA 1TLTA 2C9MA 4NNPA 4D57A 4DCPA 4ZREA 1CY4A 1OXMA 1PR2A 4PEVA 3NHWA 3CUSA 4I3HA 3EPRA 5K3OA 2IHYA 4JYAB 3ZLJA 2ZRNA 3PQ6A 4OP1A 3QE0A 4RFSB 3KAPA 4QPCA 3TZ6A 3UTDA 4JJ4A 3IRUA 4HADA 4OK3A 4MQMA 1OIXA 5K8UA 1G8GA 1N2GA 3KB1A 4FONA 4QDKA 1P0PA 4GC9A 5CUQA 2JIQA 1D1TA 4Q00A 2C2GA 2CC2A 4QDUA 3V2UA 1KGDA 2YJ6A 4YP5A 3ZHRA 3B6ZA 4DBLE 3KL2A 1PJBA 1GDHA 1GZ6A 1TI7A 2GZDA 1BH6A 3C85A 3DMYA 4H16A 4BJ3A 1LS6A 2W2PA 3LDGA 3D8BA 2JI8A 2GXSA 1UC8A 4X85A 3EXHA 3UO8B 2XDQA 2GEKA 3PRJA 1KMHA 4M98A 4J0GA 4RLFA 5KOIA 1M73E 3WNQA 1WDLA 1B00A 1H2HA 2ZRGA 2R6ZA 5F35A 5AXDA 1HH4A 1NF2A 4TS4A 4R2LA 3OG9A 5IASA 2HDOA 4B75A 1VLHA 5I9MA 1I1OA 1R12A 1U02A 4HVLA 4NL4H 3OPYI 2AV6A 5LDGA 3PUZA 3GJ4A 1GFSA 3NDRA 5BRNA 1H3FA 1SNYA 3WGQA 3BGSA 3DE7X 3E9NA 1TO1E 4TYYA 3CGWA 5C37A 1ZR2A 2O50A 1SU6A 4KYUA 4M37A 5LP1A 3LBAA 2DR3A 1GG5A 1VI5A 2RBKA 3K9NA 5F78A 1MVNA 2IT1A 2VYCA 4LSMA 2C7BA 1Q1NA 4L73A 4PYLA 3W1EA 1WQ4A 3M6AA 5WRFA 3T8YA 4ALMA 3JWPA 1LBSA 4LXQA 3IYLW 2BFBA 3OJLA 4QRIA 4YEDA 4INOA 3F9CA 4M8NE 2RGNC 4LHZA 1T9AA 1STOA 4GLJA 4JP3A 2BI7A 3R77A 3UWPA 4FJ0A 1R6BX 3DBIA 3IKTA 4OJYA 3T99A 3TMYA 5K4HA 5BW6B 1J23A 1NQAO 1VBFA 1E9BA 3DFUA 2H7VA 2EKPA 3H75A 1QRRA 3N2KA 2P5YA 2PX0A 3CRZA 4RH0A 3W7BA 1H5QA 4KR6A 3ED5A 2ZJ5A 4IH1A 2HF8A 4PWYA 4UFPA 3TBFA 1HDIA 3STUA 3IVGA 1MQ9A 2I29A 3VR6H 3KLMX 1TIKA 2C9YA 2FWMX 2IX3A 2PAFA 3UEOA 3LIIA 1MB3A 1OGJA 1OBHA 1E1CA 4V1CB 2IKSA 2XYHA 1H9AA 4FN5A 1U2TA 4Y2VA 4BNIA 4BU0A 3SMQA 1HFEL 4AJHA 3C8ZA 1OI3A 2QX8A 2XMQA 3O4JA 4J0HA 3K2QA 3GDHA 2QQ5A 1M2HA 4P9NA 4MRMB 5JSKA 2WJ3A 3WO1A 1KQOA 3Q98A 3UBTA 1ZVQA 4IHJB 3ONEA 1S89A 4ARAA 1U3TA 3IL2A 3IDSA 3FOEC 3WZ2A 1DFGA 3ZWAA 2RJ3A 2WOOA 5CM8B 4TYMA 3BF7A 3KIPA 2X0DA 3AYXB 1RI4A 2X2OA 2XYRA 1FA9A 2KLHA 3QKTA 4HGZA 2HPZA 4WCDA 1TW3A 4L9RA 5I9TA 3O90A 1F17A 1DC5A 1P91A 3O93A 1TTQB 4J7UA 6REQA 2ZKLA 4UU7A 2BFOA 5GOTA 4MAMA 3OMWA 5C7OO 1L2TA 3GG2A 1I5OA 2BY4A 2OGUA 1WA5A 2EKZA 3LQ1A 2VTEA 1GQRA 1T2NA 3G0GA 4P86A 4J16A 3WYNA 5AICA 1IK6A 1KTVA 5ESDA 1LLUA 5FBWB 3RRFA 3CX7A 4RHFA 4ENVA 4MWOA 3B1FA 2W00A 3P94A 4CHTA 5DW3A 4C88A 1G21A 2G9ZA 4JJZA 3S1SA 5KWEA 1OGIA 4QO8A 4BNYA 1S4QA 1TF2A 3ZHTA 5GJVC 1JFTA 2XOKA 3AX6A 2FRXA 3ZQJA 1QBGA 4WXEA 2PLWA 4Y6RA 2FMHA 3KFLA 2IW3A 4RAQA 5BPFA 2WKQA 2CDAA 2R85A 3DGEC 1I2BA 2IKQA 1PEDA 3GO4A 3R6LA 4I1YA 2VR1A 4JLSA 4C87A 1V4VA 2I3DA 3FA2A 4I6JA 4JWKA 5COQA 3TBKA 1NYLA 4CCYA 3LUHA 2QRUA 1SFRA 4LMAA 4R0VA 2UXCB 1RW4A 1Y3DE 2KI5A 3OESA 4RVCA 5E0KB 1EHCA 5KNCA 3SWWA 2WWTA 2B82A 4DV7B 5E9JA 4DLSA 1O7JA 1IG3A 1GZUA 1HORA 2GCEA 4AJNA 2EHJA 3RKSA 4D8VA 1UADA 3EG9A 3WGIA 1UPCA 2VT6A 1ID8A 5A7FA 1UBKS 4RACA 3TO5A 4IHAA 4JEHA 2GFQA 5AWFC 1V1MB 1EWTA 2XUFA 4IJMA 4CIDA 4L7VA 3STWA 3UV6A 3NKLA 2GZHA 4TMVA 2GF9A 3UQYS 3WP1B 1M6EX 3WQRA 3CF4G 2XOKD 3A1WA 1MRNA 3BEDA 1AVTA 3FPAA 4XH9B 3MMPA 5EJ6A 3T7IA 1TIPA 2X14A 3PHBE 3STYA 1PGPA 3B9PA 3A3PA 2HPHA 4ZU3A 3FIUA 3PQ3A 1TAQA 1I5EA 3ULKA 2YMLA 4FVTA 4TS3A 2AJCA 3IQGX 1U1IA 2ACEA 2RI6A 4HYTA 3GNSA 2CEKA 4KQ2A 5IKEA 3DZFA 5KNCD 3QEBZ 4PRYA 4GPIB 4LCJA 1O6FA 1JQ5A 3H7AA 1Q19A 5CH8A 1JIIA 4TYNA 5G0UA 1QC5B 1XTJA 4NNOA 2V97A 4OM7A 4ICIA 4NMLA 4LF5B 4QWWA 3SBXA 3OFJA 2HI0A 1C3OA 2VNJA 5FPHA 1CP2A 2F3PA 3PHJA 2A67A 1PL0A 2PL5A 3C8HA 1A5TA 1HPLA 3FOCA 4AJ2A 4N8EA 2IITA 3IPLA 2WB2A 2C4MA 4U7TB 2VWQA 5BOVA 4BRZA 3RHFA 3VGJA 3QY0A 2AHOA 3P9PA 3RUAA 4EYKA 4IIJB 3UATA 5JYCA 4DA4A 2Z09A 3WL3A 4JY7A 3G6WA 2C54A 2W2TA 3G82C 1XMVA 2C29D 2ZRHA 3QVJA 2BMJA 1GZVA 1T13A 2ZYTX 4KHZA 5K0GA 2ZZNA 1I24A 3QMWA 2ISQA 3PTZA 2OV8A 1I10A 4A8JB 3SK0A 1L5YA 4AZWA 1C9DB 1E5TA 3L1HA 4XYGA 2IYEA 1P81A 1TVEA 3NTVA 1QB8A 1G64A 4YAFA 1DXQA 2XNDA 2Q7OE 3RH0A 4DOMA 3QE9Y 3U4MA 1NJ8A 4MJ3A 3P2KA 2PUEA 4XSVA 1ZK1A 3S1LA 5K8IA 1S9DA 1W8IA 3F2VA 3AEXA 1AGNA 4EG5A 5SZJA 3KD2A 4K6MA 1VKJA 3JD0A 1NJGA 4ZJZA 1Z75A 4QYWA 5KVQA 1OYWA 1B3RA 1Q0HA 3LPLA 2IYTA 2DX7A 1QYXA 4LCEA 3ZIDA 1XB2A 1EK1A 2FRVA 3N2YA 2XW6A 3KZVA 3M6VA 4KXNA 4Q3DA 3FF4A 1THGA 3L8HA 3FDFA 3JQFC 4YK7A 1REQB 2CFOA 3WO0A 1RXSA 1XZFA 4KTTE 2QSJA 2VA8A 4NS4A 5FOTA 1U2GC 4MULA 2WHRA 4KEAA 2DSTA 1QCZA 4QU8A 3O8NA 2I4IA 2QE7A 4JB2A 4XYLA 3QW2A 2CMGA 4JT9A 1QQ6A 2GWHA 1GLNA 4HAUA 2MCFA 2PFSA 1GSHA 3RIEA 2XNDD 3T0GA 2VHCA 3A6HA 3MTBA 1ORRA 3HNRA 1X19A 1DS6A 1R3UA 5JD6A 3ZJ5A 5LVAA 4OP2A 4YRNA 3JQAB 2V3WA 1KI1A 3P45A 1MX3A 1PBNA 4IG4A 2KLBA 3V4PB 3B3GA 2JLYA 4FFPA 2PS3A 3D0KA 2E5FA 1P2TA 3IGFA 4AJ4A 3EEOA 1JLSA 3AR5A 3FTDA 4UTRA 5L45A 2W8BA 5JRDS 1L4MA 3JWEA 4PPQA 3KELA 3EQ7A 1IRXA 1V37A 5DBGA 1A9ZA 5EJGA 4OH1A 5HIJA 2RIPA 1P3Y1 1MAUA 2GAAA 1LNSA 2IGBA 4DY6A 5KOHB 1WXEA 2OD2A 1LRKA 3A10A 1M1YA 1MAAA 3X44A 1KL7A 2AT1A 5AKYA 5CCXA 1U1DA 3FR8A 5JYDA 2VFAA 4B33A 2ORVA 2WD9A 2QE7D 2PZJA 2A1TR 3P9CA 2QPTA 5E3JA 4HDSA 4ARCA 2P7HA 4Q1AA 3RSFA 5I47A 3K6SA 3CNLA 4G65A 1XCLA 1J9ZA 3LNCA 2FMIA 5EWLB 3U37A 1OBOA 1YL7A 2FHPA 3GI1A 3QXGA 4M9CA 1U5CA 1O9BA 5C46F 2IEYA 4IFTA 4W8HA 5CVDA 1FP4A 1JSZA 4C08A 1WSDA 4XDZA 3NYIA 1HSOA 3FHLA 4G5SA 5EE5B 4CFZA 3CINA 2OSVA 3K2BA 4X20A 4BCDA 4CF7A 1BA3A 3OZIA 1OREA 4E5YA 2YBEA 5K1ZA 2EP5A 2JAQA 3DEFA 3MAGA 4LSGA 3U48A 4B48A 3MAAC 4Q82A 1QFYA 1ES9A 2HMSA 3DTVA 1CPYA 1Y98A 4IXWA 1U80A 4L95C 4CEIB 4OHYA 5JY6A 2J9FA 4HNRA 4O1MA 5LQMA 2Q8NA 3ETHA 3G1UA 4G07A 1UPTA 4O2BA 4QOHA 4YJFA 2PL3A 1D9XA 4OM8A 4LF6B 2DPLA 1MV5A 2OG2A 5AP9A 1XD2B 4GGOA 4BGDA 2R9VA 1DL5A 4BJ5A 4G81A 2WTEA 1QGOA 2UZ4A 2FGJA 5FFNA 3F97A 1D8TA 1AF7A 3DR3A 3D8NA 4AKTA 1J8FA 3PA8A 2FSHA 4I50A 4A27A 2Q8PA 4NVRA 4YRAA 3KV1A 1YZGA 4P3YA 2O4UX 1MC4A 3BIWA 4P4GA 4MV8A 2CJPA 3BD6A 5FO0A 4JB3A 1WB5A 1MO3A 4P7GA 4WESB 1I3OA 2EEPA 2J85A 4O4HA 4XOUA 2QR2A 1MJGM 4O8ZA 1ELOA 3GFTA 3L4SO 4MX8A 1T3TA 3N9IA 4JQCA 3FDZA 3D7NA 1TTHA 4K6FA 3RT7A 3ZE8A 2HJGA 4W5HA 3ZX5A 4E51A 1PE0A 1YQGA 5AJVB 4ZQGA 3GLKA 3VJKA 5JFGA 5JWOA 1S0UA 3RAGA 3DTVD 3ORSA 5L3SB 5LYJF 1BFDA 3HVJA 4MWTA 1G7SA 3FTCA 5AVXA 3IAM6 1T4DA 1UEIA 2A3RA 5GONF 4OXXA 2B4AA 2WWGA 3NOVA 4S0ZA 1EBBA 4HEA1 4NV3A 4IRUB 4MW9A 1XAGA 2OEPA 4QICA 4HC4A 2HJWA 4CI9A 1X6VA 4L28A 1S2NA 4GL4A 4UUQA 4CEJA 4L57A 1Z4QA 4GMFA 5AHRA 4PLHA 4TQUS 2W4IA 3IDOA 2WTNA 2GHQA 2GKSA 4R9NA 4K1LA 1PWXA 3ZH2A 2OUIA 5I9SA 5BV2P 1EM8B 4MVJF 2VJMA 3DQZA 3FSJX 1NY6A 2HU7A 1KI7A 3EXFA 5E6RB 4MWBA 2HIMA 3K5PA 3WP0A 3TL6A 5FIUA 3D3JA 5CT8A 1Q1AA 1UK7A 5DOVA 4LYDA 3EMDA 3OCJA 1MH1A 2VJLA 2GPTA 2WT4A 2ZI7A 4YREA 1HMYA 2EZUA 3LKZA 4E32A 3G49A 3H6KA 4N54A 2VJAA 2VRBA 3GEBA 1H22A 1P9LA 3KKKA 4RY0A 5CJPA 3FNEA 4DSZA 4EY5A 1UBRS 1WZCA 2QMHA 2J3QA 4KX3A 3KCNA 3LFHA 2F3TA 4GPTA 4BV3A 1BYIA 5G1NA 4B2PA 4F1WA 3QF7A 3D64A 1GG9A 3T5PA 1D4OA 1AV7A 4UQPA 4FYPA 3O7WA 3E35A 3HB9A 1B3BA 1UJNA 3Q5GA 3VYWA 1YRLA 4AMGA 4XDYA 2G8LA 4L8FA 4ZEXA 2Y0DA 1QOPB 4CKCA 1AXRA 4UDNA 3GVCA 1T3HA 3DV0A 1UBCA 3RUCA 1BNCA 1A9TA 1U3DA 1JIVA 1KJNA 3D7SA 2GXQA 3F74A 4LGYA 1G5FA 3GA0A 3MC1A 2CDNA 2ZAMA 3S29A 1GNPA 1MP0A 2GKGA 1CJKC 1SUSA 3DEYX 4HDKA 3VKUA 5EEHA 2NZJA 4GOOD 2J48A 1UK9A 3KL4A 4WKCA 4RSRA 3KKZA 2ORWA 2WAXA 1EJBA 1QGDA 2EJTA 3E3LA 2BRUC 2ALJA 4LZNA 5FTKA 3RODA 1UBJS 2H5LA 4NOKA 1XCGB 1L8OA 1Q57A 2P6OA 3BMCA 2GD1O 1BXGB 4EGAA 2JIBA 4BPRA 2IQIA 3WKEA 3N05A 1M2OB 4YJ2A 3SE0A 4FFOA 3W77A 3DCJA 1QB7A 4DJDC 2HZ7A 4DILA 2GN8A 1F20A 3EXAA 2WJGA 4O0LA 4F4UA 4MVJE 4BKQA 3UJHA 2X7XA 1UKEA 3IAUA 3SICE 3MTGA 1XRPA 2W0SA 2AN9A 3GGSA 1KXZA 4KTVE 1JHXA 3ZOKA 4EMSA 2J9RA 1X8LA 3TRDA 4WNYA 3AM4A 4NF2A 4CM9A 2XD4A 3P9ZA 3U40A 3EVTA 4ZEVA 2IHUA 1KDZA 3T4PA 1NLUA 4ASUA 4ZQHA 1L5HA 4Q9KA 1BIFA 4ZO6A 4NE7A 1BE1A 3DBHB 4ZT6A 5IRCD 4U2FA 9MHTA 2YIVX 4A0SA 3R75A 3TPCA 5KYWA 1JHPA 4EI8A 1M33A 4R05A 2ABWA 1FZTA 3TRKA 1ABFA 2JCVA 1ZQ1A 4X1IA 3WNCA 1W36B 4BE7B 3QA9A 3I6ZA 2G67A 1Z06A 1M34E 1XL0A 1AK9A 3KZMA 5CX4A 1VB3A 3ZGOA 3C7AA 2P1DA 3WLJA 3F3SA 4HBZA 2CL6X 4M8KA 3D6MA 3EISA 2XTZA 4UUAA 4N5HX 4EPXA 2GBIA 2IU3A 3ETJA 3RFCA 4X54A 1LF5A 3NHFA 1J21A 3OPVA 4RV9A 4HUQA 4ME6A 1J70A 1J5PA 4MUGA 1R5BA 4YRQA 3EZ7A 4Z4QA 2QDXA 2CJWB 4RFSA 4A16A 4PAMA 4CM9D 5EIHA 1JAIA 1LDEA 1SCUB 4ASUD 5IAJA 2EEZA 4RE6A 4CI0B 1P73A 2PGJA 4YV1A 3BC1A 2D7DA 4TRNA 5I8WA 1VIYA 5JASA 1KSJA 1PBTA 1P8JA 5FEMA 3QKSB 4ZAWA 4LKOA 4ZDKA 1KR2A 3KQPA 4M1EA 4BLVA 3DOOA 4IMIB 2P2DA 4KVZA 1V2GA 3ND6A 2E55A 4IPTA 4TMYA 2JGKA 5IJ0A 5KX5B 5TARA 5JCOC 4IIGA 4J94A 2H54A 1Z88A 2YFHA 2SECE 3OTIA 1GGMA 1DRKA 3A36A 1UR5A 3AF5A 3GRCA 3PFWO 2C4KA 3PE3A 2IXTA 1E69A 4MH0R 4DRXB 3CURA 1KBQA 1OX4A 4Z3DA 1Y42X 3CZAA 2HHLA 2HWWA 4FNOA 4A1FA 2FW6A 2QGFA 2VYFA 2OZKA 3CF6R 3M5CA 3NDIA 4YR9A 4TZ6A 1ETHA 3ECCA 4GX2A 1HQDA 2ZT5A 1EG2A 4L85A 4OYRA 2I0FA 5I7AA 5KTMA 3FRHA 1R4MB 4BO2A 4OLFA 4PLPA 2E4AA 3NJRA 4RCZA 4UBNA 5LUAA 3KZNA 1OXUA 2QT0A 2HRCA 5ERGB 4EGFA 3HDTA 1EWQA 3MGCA 4QFMA 4KOEC 5CAEB 3WRVA 2PXXA 4X95A 1A97A 1L4UA 2JZCA 4KIGA 3IMCA 3FLAA 2P6RA 2HLNA 4C2TA 2XUZA 1ULAA 2QJRA 1HL3A 4MVJG 1QTRA 1DI0A 4QA9A 4LNHA 1KI8A 3ZLUA 2MSEB 4ZYYA 5AOCA 3W5UA 4GR9A 2XX3A 3JQ9C 3PGMA 5EWMB 1GTRA 5ENZA 3ZHUA 2QGNA 1OU0A 2HFJA 1RRGA 5C5CA 2PG3A 3FUTA 1TVMA 3OUZA 3BXGA 4OSEA 1JE0A 2NUBA 5C34B 1UAYA 1VJDA 1WHSA 2BHTA 2B8WA 4GBMA 1EFVB 4UTXA 5ALZA 5H83A 3S7ZA 1BX0A 5J4HA 2IUSA 1JIXA 2ZQZA 1UXHA 2Z57A 1P4GA 2V4MA 3SF8A 4G5YA 1F06A 1JVNA 2OCLA 2P9BA 1FE8A 4J2HA 1H4VB 1FU7A 1R0BA 5EP4A 1ZJJA 2DG2A 2GERA 3L5OA 2Q3JA 2IPLA 2OD7A 3AF0A 3L41A 3NATA 4IIBA 2FVXA 3GP5A 1N6IA 3G2PA 1T4BA 3Q11A 3QKIA 3UUGA 1IXKA 4CMIB 1SVIA 4D81A 3UJ6A 3QFCA 4KLAA 3MOSA 3CH4B 4GOMD 1F0YA 2D5BA 4KSBA 3V48A 5CDFE 4W7HA 1AGYA 3S2EA 1T43A 3GFQA 5JH7B 1E8MA 3AVVA 1K63A 1II8A 4GO1A 4HD8A 4UDYX 2Z3VA 1EFPA 1D2MA 1YUMA 2XGSA 4JL6A 4Q6WA 5LC1A 1JF8A 4MIYA 4IHJA 3FN4A 3WNBA 2VPZA 4Y2YA 3IQDB 2NU8B 3ZK8A 1U7PA 2P0EA 4Q9LA 3FGPA 4BWGA 2RAFA 2VQ3A 5D00A 4R1OA 1UKVY 1XVTA 5K3BA 4LF7B 5JJLA 1JJ7A 1G291 2IDMA 1GUAA 1ND6A 2C82A 3DC7A 3O03A 4JDPA 1OF1A 2C92A 4Y7DA 3TUZC 1Q74A 1U8EA 2R6DA 4PTLA 1U0EA 3T5CA 4LRYA 1PK7A 1ZGGA 2A9PA 3FHTA 4DB2A 1SBZA 4W9NA 4GM1A 3KJGA 4OBEA 3PPYA 2R66A 1AZLA 2XE8A 4YJDA 1UDBA 1KAGA 3ST7A 4BTEA 5GZ6A 1RCFA 2FFBA 4EENA 1ZD2P 3DEKA 4GSYA 2E82A 3FPFA 3AQ4A 4Y6GB 4YT8A 2Q4DA 1CG6A 1W76A 5AMXA 3VUEA 2NYAA 5CA0A 5AM2A 3LBYA 3VBCA 3PR3A 3WDSA 1U90A 3AP2A 1AKUA 4BQNA 4O4IB 4TVKA 3HKDB 1GAQA 2QDKA 2QZZA 3TXAA 4HWSA 3FOFC 2CWWA 4LC0A 3BVPA 3N6RA 1P74A 4IDNA 5EZYF 2Y77A 3WQSB 3OZXA 1L5LA 5AKEA 4F8JA 1KS9A 4QTTB 4BRWA 1DHTA 3QUTA 4XGQA 3PKIA 4WFIA 4C01A 1QO0A 2GM9A 3QUQA 1IIBA 4G9GA 4MVJH 1CF2O 3G1TA 4BVFA 5CXUA 1QH1B 2RB5A 3M5DA 4UHBA 1UDWA 1BDBA 5B36A 4TROA 1YASA 2Z2IA 2J4DA 4UTOA 2ZU0C 1H2ZA 1I2DA 1V1MA 4KMRA 4PZPA 5COBA 4BLOA 4BO7A 1RYZA 1ODKA 3UW1A 3E81A 3LBHA 4DV4B 1J2EA 1KVUA 1E4YA 3B20A 3RTCA 1IHPA 2FPGA 4H7FA 2HMVA 3ASUA 1M6VB 4GVLA 4I99A 5AVOA 5A7HA 1R4NB 3RTEA 5AHKA 1TMOA 3SQWA 1YNOA 2HO5A 4BKOA 1IZ7A 1LD3A 3I0NA 1ST2A 2Y1WA 2BWJA 3S0JA 2TS1A 2P2SA 2WTBA 3A6ZA 1R2QA 1E99A 1XWIA 2ZI9A 5DHUA 1ZNYA 4OGFA 5KPJA 4ZN6A 3IMEA 4NXNB 1K0UA 1Z5WA 3FVTA 1QO0D 2JKYA 4XSGA 4K88A 1D09A 2RGUA 2WUGA 5DT9A 1PWZA 5IC4A 4CM5A 5EUQB 4YUAA 3PUXA 3T5BA 1QC5A 2OXRA 3KAJA 1HQKA 2R8EA 3M4NA 4DMGA 1E3WB 1JFFA 1X15A 3VHRA 3S8YA 4PYOA 3WK5A 4F3KA 2RG1A 3LUFA 1CZNA 5JUWA 5E4FA 1T26A 3CW2A 3LBFA 1PHPA 4MHSA 4UNIA 2FQWA 1HRDA 1RM0A 1JIKA 4TXHA 2A5GA 1XEWX 3HDJA 3OO1A 3RYHB 2C58A 2B4YA 4YRBA 1SUPA 1OFUX 3AVXA 1KFJB 2WD8A 5L3QA 2I1QA 4HWKA 5EGSA 1APBA 1NVTA 3DDUA 4IIJA 1OV4A 5GOZA 3GJ0A 3HZRA 1EVEA 1PZXA 2WI8A 4OJNA 1RHQA 1Y8CA 3VV2A 1JILA 1ZRNA 2E89A 2R62A 5GVSA 3K9WA 1FX0B 1QZUA 3MEQA 4BXOB 3A6PC 1WW8A 1DTWB 1PT5A 1NPDA 3IA7A 3O2SB 1O77A 4UEWA 4Y0VA 2AXEA 3ZWQA 1SKMA 2K7FA 1B42A 1SEVA 5LKAA 4S3MA 4HWPA 1YAJA 1BN6A 1YR3A 4J1SA 1U98A 4X7RA 5B64A 3JQQA 2WZDA 2VTVA 4ISBA 3QV2A 2JH3A 1SVUA 4RPIA 3A05A 4F4DA 4OVKA 2WFLA 4FMCF 4Y8VA 3I73A 2O57A 4TLDA 5AW9A 1O57A 2Y1XA 3BDAA 4IDCA 4NKRA 5K0JA 2FR1A 1VI6A 5BMVB 2IJGX 3AR9A 5K51A 3SLGA 4EPRA 1KIAA 4UC0A 1Y1PA 3H2BA 4BO1A 3A4VA 1ZPDA 2FPUA 3H2KA 3QLVA 4FLFA 4IG9A 2FP3A 2OCPA 5FUBA 3RS0A 5FI3A 2VYQA 1IN4A 1KU6A 3ETGA 1G4AE 4UD6A 1A9XA 2W42A 1JP7A 4K0KB 4COKA 3QVOA 2ASEA 3H4MA 4J9UE 4FE7A 5G40A 1JAXA 1TCUA 1L4BA 1LV8A 5J9FA 5JXHA 4QQKA 3VR1A 1LSUA 3OSZA 2B9EA 2GSDA 3DOFA 1EVQA 1SH7A 4PGHA 2ZCJA 5AD1A 4ID3A 4F85A 2XLCA 2JA2A 2HSZA 2XOEA 621PA 4P38A 1WQ1R 1IN1A 2VF5X 5HCIA 4DXDA 4ZHSA 1KKUA 1GCAA 1Z37A 3AR8A 4P83A 2Q5OA 2ZBFA 1AUQA 1YF3A 3U4IA 3A11A 4UNSA 2GZSA 4GZMA 3W79A 4UPEA 4QUAA 1QFZA 3DOJA 1SUCA 3IPCA 2JATA 4MUEA 4OHVA 4AVYA 2GEVA 4C7VA 2R8RA 3ISJA 2ONJA 5L95A 1TE2A 1DKPA 3S3TA 2PD3A 5ALJA 3PJDA 2XI4A 2RHMA 3L01A 3DT6A 4CKYA 4B46A 5KOHA 5DW0A 4RLHA 1GVHA 5KEIA 2H51A 3AR2A 1M6NA 3CLSC 2O3TA 3DZHA 3DDSA 4RIIA 1YMQA 5DVZA 2ZRCA 3I01A 4C06A 4RF2A 4IFBA 2BFAA 2Q5JA 2NYUA 4AS2A 3LPDA 4EGJA 4NP6A 1FVXA 4I1OA 3C97A 1LUAA 1RADA 1IJEA 1KYQA 3A2NA 5D87A 3C1OA 3C3MA 4HLUC 1UOQA 1E58A 3D4NA 4ZZ2A 4KQ9A 4B7CA 5EWLA 2EZ9A 3U4AA 3D0OA 4D9GA 1XYVA 3E23A 2QUKA 2OFPA 2BHNA 4FHEA 1SOMA 5AJYA 2XKKA 1D5CA 3O94A 4V0NA 3K8QA 4MV9A 2W93A 3UGTA 2O7QA 1U2ZA 4WUTA 1S2IA 2Q07A 1W52X 1E7QA 3ZV6A 1M1ZA 1FUIA 1KFCB 4UMDA 4WQMA 3PQ2A 4MYUA 2EIHA 3HE3A 3OZBA 3L6EA 2G9VA 1NP3A 1QTNA 1S01A 5BNTA 1F5NA 5IYZB 2V6JA 5DU2A 3G85A 4L6IA 2GBGA 3C98A 4UE3S 5FPSA 2VUHB 1BYUA 3EVAA 1VKZA 3Q0IA 2RD2A 1W5AA 4DAOA 1LLFA 4O2BF 2A0YA 2W6PA 4JA2A 4ETMA 3LJKA 1O5IA 1K89A 3NPAA 4JELA 2R8OA 2JK1A 2ZJZA 4PX3A 3BWEA 4YJ3B 1LTKA 1UKAA 4PGMA 5SY9A 2FJ0A 1JPJA 5EIWA 4I50F 2MT9A 4D45A 2IHVA 2PK3A 2WR8A 1N6PA 4RETA 3VU1A 4JVLA 3ZCVA 1FFDA 2X5NA 5DMHA 3RRZA 1AS2A 2VN8A 3QKUA 1KEEB 4FWIB 2A9KA 3EGOA 4O4HF 4LC1A 1O03A 1NBMA 1SVNA 2H5EA 3WIDA 2ANBA 3MN1A 2FK8A 3R0JA 3H17A 4D0GA 1FUEA 2VP6A 4L3VA 4MO2A 4EGQA 2XDWA 2Z9CA 1RZUA 3CUUA 3EC7A 4FOPA 4RH3A 1Z82A 1CQPA 4KPUB 4UBOA 2YZGA 3O2JA 5BSHA 1GCOA 4G89A 2O2YA 4C04A 1DIAA 1NDUA 3U16A 1GGVA 4KUEA 4JLDA 3FZEA 5P8WA 4R83A 1WMDA 5HW0A 1OA0A 1ONNA 2BM8A 3HJCA 4YDRA 1ZAYA 1GAJA 1H65A 3G9UA 1ISFA 2MINB 3HFJA 4I3GA 1NQ5A 1XCMA 3RK0A 2M1XA 5LXTB 4A92A 4EVRA 2J7KA 1JKXA 3DR5A 1WU8A 2BTOA 1EM8A 2A5LA 2JAWA 1CJSA 3WYDA 5MFZA 3OTGA 2HSJA 4QL3A 4R98A 4V0OA 4WGFA 3W78A 3PC2A 5FNZA 5K3DA 1YDHA 3IB6A 3ACDA 4IIEA 1ORVA 2F00A 3HB7A 3GAZA 1KORA 1NBMD 5LB2A 3D3NA 1QV7A 3LS2A 3DT8A 1AHPA 1L5MA 5BQPA 1YHZA 5IAEA 5BSWA 1HDYA 1IPFA 2I7TA 5FL7A 1K2WA 3BXOA 3NLLA 5AHOA 4MKIA 5JWHA 4KXWA 5I4CA 1CS4C 3OEWA 1T0HB 2MTBA 2W70A 2KYRA 1MQAA 4UQLA 1DT3A 3V9PA 4IMRA 1HOXA 4K40A 4OOEA 1XO1A 3OA2A 1L5QA 3NEAA 1DC6A 4ZI5A 1X7GA 5EINA 1I4LD 4ESVA 1UXIA 4PHFA 3IPXA 4AYWA 1VYUA 2B8EA 1FRVA 5GM1A 2WYVA 3H2SA 1YFKA 5AK5A 4ILEA 5J5VA 4M76B 3GK3A 3B6KA 3H5WA 1PX2A 5FRDA 2LIVA 2II6A 1G6Q1 4H27A 2P2NA 3OX3A 5ALNA 1OXBB 5B6IA 1GKYA 3Q7RA 4F3CA 5KNCH 4W1QA 3Q41A 5KYYA 1SOWA 2GF2A 4HDCA 1KFBB 2GRAA 4H7DA 1X13A 3MCZA 3WKAA 1CE8B 2I3GA 3C8DA 2C57A 3Q7EA 4G97A 1S3SA 3U3XA 3BQMB 3FYDA 5FL7D 1WXQA 4L8VA 3UGKA 5BWMA 5EJFA 3O38A 1NLYA 2WHPB 2VAVA 3DMRA 3RTBA 6CHYA 1QX4A 3G0CA 5CGZA 1HZZC 4WA8A 1BE8A 1JDJA 5BVHB 2I6QA 4G1VA 4AP9A 4BX0A 1BXGA 2WINI 4ZYLA 2JW5A 2XE7A 2F62A 3GLQA 3IR7A 2YHBA 1M2OA 3SHQA 4BNWA 3G2IA 4L9SA 5FV7A 4UARA 4X91A 5BRAA 4ZALA 1K68A 2YZMA 3PL1A 4KV9A 4CR7A 1USWA 4D4KA 2B21A 3S2IA 5IKPA 2B0CA 3KZCA 5KMGA 4YRMA 3UMFA 1KC3A 1G8AA 3FAZA 2QIOA 1HGXA 2NO6A 3BIXA 3G59A 3PFHA 1P2VA 4OQYA 3CUWA 3RB8A 4H3SA 4M9ZA 4QDXA 4CM6A 3QBVA 1ZUHA 3GFFA 3AWDA 5GJCA 3A2KA 3GRVA 4OGKA 1ORDA 4JR1A 4LPSA 2ZJ3A 3BERA 5H8WA 4PICA 3PT9A 1NUTA 5HFNA 2NO7A 1BOFA 3WL4A 2ZG6A 1N2OA 1C7RA 3OZRA 5AM3A 1QGUA 4KYIB 1J00A 4L07A 4WNCA 3RVDA 5EJEA 3AINA 4QPNA 1VBKA 2FHSA 3I2JA 5T6MA 4CG0A 3PPWA 1PGJA 3DOUA 4C29A 1RP1A 4L1KA 4BNXA 2R4TA 4Q03A 4BEVA 1UBLS 4BVGA 1SKQA 2HPAA 4ZGGA 3C8UA 3ZS9A 1QLWA 4Y6QA 3VNBA 1MO6A 2BV3A 3DP9A 3HJNA 5DWDA 3QF4B 3R0XA 4Z9BA 5JSHA 1P62B 3QOFA 4D4GA 1KDVA 2CJWA 5E8RA 4OI4A 3QFSA 3GVHA 2RSLA 3AHEA 4RNDB 1E66A 4AY5A 5ADUS 1SCUA 1YE5A 4G41A 4C43A 3GLHB 2M98A 1UL1X 4RZSA 4IDFA 1NM5C 1MB2A 2RK4A 5IT0A 3L6DA 2WU1A 2C2HA 2O8FA 4DV2B 3DAHA 1JDBB 3EARA 1KDTA 2QQGA 2B94A 3QKSA 1E18A 3CT6A 1TL7C 3MWLA 4XCVA 2FZVA 4JP2A 5E95A 4C0BA 3JWGA 2CMKA 1U0HC 2X3UA 4OJQA 4WWHA 3GFRA 4MUMA 4IP0A 3FYUB 3K09C 1U9IA 4XM1A 3DLPX 1W36D 4LVUA 1XE3A 2EBUA 3PHCA 2ZAIA 4H3HB 4HXEB 4DRXA 1JKJB 3KR0A 3H18A 5D86A 1LSJA 4MVCA 4ZQIA 5HM8A 1DJNA 5AOBA 4OUKX 2E5WA 2HIGA 4JOCA 2QVLA 3B2EA 3RI3A 1A7AA 1XAJA 2WKPA 5FLXA 1G8SA 1XMIA 1DAOA 1ISSA 4MMXB 4FEEA 3QVLA 1U7XA 3CSSA 1GPWB 2QTZA 3P4XA 3JYOA 3M9LA 1TK2A 2Y1FA 1QHYA 4YCMA 2ZJ4A 4IWYA 6GPBA 1Y9AA 2C8VA 3P52A 2GO1A 3RVPA 1WL8A 3D7MA 3EIHA 3T1NA 1IHYA 4W7SA 4DMRA 1MUUA 3IDAA 3LZCA 2VNAA 4U4AA 4JJFA 4KQ1A 3H8VA 1S2GA 3PLRA 3UF0A 3WLTA 2JLCA 1VPDA 3T5AA 2CLSA 1PGOA 4L4UA 1KYWA 4RK4A 3RS7A 2CYCA 4WFKA 1JG7A 1H9BA 3TUIC 1BS2A 5EWMA 3FWYA 5HOEA 5HGXA 4WERA 3PLNA 1G5QA 3FRJA 2ZIVB 2QAGB 1EGQA 4QXPA 2FW1A 3IKVA 4WACA 4XIIA 1C41A 4IDQA 5F5XA 2NNWB 1TM7E 1A5ZA 2QRMA 1EFVA 4D25A 3TNDA 3C3KA 3VSAA 2PMWB 2ZSIA 3HU2A 5DISB 5JVDA 5G2OA 3SQDA 3R40A 2IZ6A 3I2YX 2QM3A 1F60A 2A0XA 3Q8WA 4G23A 3KYIB 2Y0EA 5I01A 2X5JO 1DO0A 3PQ7A 5DGDA 3DMTA 1FLDA 1KK0A 1Z26A 1B0PA 4DQ0A 3N3AC 5L4LA 4JBNA 3M8KA 3WHPA 4CMIA 5T6BA 1QMPA 4LQCA 5TNXA 2OD9A 2JHFA 1NVWQ 3AETB 4XD2A 1AUPA 4E30A 5FR2A 3C4JA 3JQ7B 3HMKA 2WM2A 1RM3A 2GJ4A 2ERYA 5LD2B 5JH7A 2MYNA 4IZHA 3KSBC 2QR3A 4GKJB 4CM8A 4HK4A 3TL3A 2ORED 1VPVA 5F64A 5BORA 2ZRBA 3GW8A 2AWOA 4YR7A 4PZZA 1QK4A 1R74A 3DULA 4LRSB 5FEUA 3HDYA 3OLWA 3M6FA 1SUFA 2NU8A 4W63A 4OXYA 2WP8J 2ZUUA 5EKTA 4KWEA 5AUQA 2VNHA 3TQCA 4BB6A 1WO8A 2X86A 1VA4A 3UM9A 4IHJF 4JX8A 2Y1OA 2JCBA 1A8HA 5K8LA 1ECBA 4X6XA 4QOEA 4X66B 1L7BA 1P1BA 2GCIA 3I9V6 1JDPA 5EZ6B 1KVRA 2LKDA 3W90A 4D98A 4TVSA 1PR0A 4PYJA 3C43A 4P7BA 4V2UA 4Q19A 2P0YA 3JWHA 3L0CA 3TRHA 3V4FA 1LWOA 3FLBA 2C7VA 3I4FA 4Y2XA 4JLBA 2F17A 3PDHA 1RLIA 3ETLA 4JBXA 2IV3A 1RDFA 1JDTA 1VP9A 3CC8A 1GUYA 1X1CA 2ZBDA 3DQQA 1F8FA 1OXKB 4JJAA 3EPHA 2CW5A 2H1FA 4QM7A 3PENA 3A9UA 2FEAA 3MWDB 3DBOB 3A9VA 1HRKA 3NXSA 1MF7A 2E87A 4W8OA 3WL5A 3O4FA 3OE5A 5CDGA 3I9MA 4M54A 3MRTA 1E1KA 3WJ2A 1GCIA 4RDHA 5BQXA 4V0RA 1Z08A 2I4TA 3G0DA 3P2EA 3ROZA 4O4IA 2QG4A 1GD1O 2XDYA 3KU1A 1XDDA 3TXYA 1A8QA 2HLPA 1RI1A 3WMRA 4QKQA 4YRZA 3H42B 2QLBA 3GH1A 1RLOA 2ZI6A 3VR2A 1PEKE 4ZOLB 2AEJA 2WJJA 3KEGA 2WLTA 2QN1A 2X1MA 3EK2A 3LWNA 4GVPA 2JAOA 4J75A 2O2HA 3TNJA 4B43A 2X22A 1KZ7B 4QT4A 5FD8A 3C15C 1EFTA 3OQIB 4PYIA 5ICMA 3TK1A 1MEEA 3OLXA 3NDPA 2J46A 1Z15A 4GZ5A 4IRMA 2CHFA 1VL0A 3FTPA 4UU8A 4Y0NA 2O8EA 1K86A 5JD4A 4X6UA 3EFOB 1E2KA 3GZNA 1FYWA 2Q9BA 2ZR8A 3IQIX 4XAQA 3WL6A 1P75A 1T8YA 3DHWC 5EMLA 4N9WA 5GM2A 1M6VA 3ZHVA 5LWHA 5D85A 2JLVA 5FI5A 1WB9A 2NQ2C 1R4NA 4E14A 4OXIA 1EKXA 1HE8B 2A0KA 1M67A 5JSUA 1U1FA 5G3YA 5HE8A 2E1RA 1U0FA 3VSEA 3VR2D 1EFLA 3BGVA 4PLVA 3RS3A 4B4KA 1E7YA 4GU5A 4PSUA 1IBLB 4FSHA 3U13A 4IVRA 1ZCFA 1ZNZA 1EP2B 3C6QA 3VNRA 4X65B 1KNQA 1RWNA 2WTAA 1YA6A 4TV9B 5AKZA 2ZQYA 2PPLA 2WHEA 2V7PA 4MTCA 4EKNB 3T7CA 1GZDA 2OENG 3NANA 4M7RA 4C0AC 4D4HA 2V7UA 1E3WA 2JHPA 4ZMBA 2DBVO 3G3EA 3PFBA 3VTFA 3ZCRA 1HYEA 2CHEA 3LDUA 3MJFA 3CZMA 4Q3KA 3B1XA 3E8SA 5ARBA 3DO6A 4LIPD 1IOWA 4BMCA 3DJFA 1Y1KE 2PGNA 2V45A 4JENA 4OXRA 3TBHA 5SV2A 4E88A 4ZYXA 3UWKA 5CFPA 3U61B 4DGQA 3KETA 1TT7A 5IBQA 3SMVA 4EYGA 1V1RA 2W83A 4EJSA 4LYEA 5AI9A 2XCOA 1T25A 3CH5A 3IP1A 1Z56C 4M86A 1BHJA 3PIRA 4Q02A 4UHFA 5ER6A 4WPGA 5DEIA 4GLOA 4C7BA 1FX0A 5JXWA 4BXOA 4ND3A 2B34A 1LBEA 3PFIA 2H0QA 4C1BA 2XUHA 1N2CA 2AL7A 1O95A 3MGAA 2H1IA 3AR7A 3EPPA 3NOOA 4IIJF 1RQ7A 5CIQA 1D2AA 4EFMA 3LRXA 5KNBA 1XQ1A 1GQQA 1GUZA 1V8OA 1JA9A 1VGVA 3PDWA 4KE7A 4WSOA 2RH9B 2J31A 2R47A 3ANXA 3CNQS 4FFBB 1T9ZA 5D1HA 3AB7A 3LHKA 4XQ9A 1MB0A 3DV2A 3DZKA 4PLTA 1NXXA 4N1AA 2NLOA 4ITUA 5CPBA 2QJWA 1EK0A 2YIJA 1YR2A 3V8MA 3EDYA 3ZZNA 2V54A 3ADBA 4ZDWA 3WAKA 2FKAA 2YIDA 4TXLA 3G6KA 5DCWA 4WECA 3IKMB 1QDEA 1RXVA 1MJNA 2WTXA 1XPUA 5BMVA 1LZKA 1NBEA 5AIAA 3PC4A 3LUJA 3IBCA 1MA3A 5DNUA 4UKDA 5AM0A 5B1EA 4B6JA 4D5EA 4JYZA 1A8UA 3KB8A 3ZVLA 4L4SA 2PZMA 4JLNA 3DL7A 3BYZA 1JZSA 4MRSA 4AZTA 1GRCA 1G8JA 1SUIA 1PJ4A 1UBMS 5FP0A 3WK9A 4DLRA 2C2KA 5LB4A 3E9EA 4RLSA 1KAHA 1O95D 2MWMA 4QTUB 5A5GA 4JJIA 4A2CA 8ADHA 2EDCA 2ZUWA 3KZOA 5KNBD 3V55A 1XHFA 4RDCA 5AM5A 4ZT5A 4O0MA 2UZIR 1FVHA 2ZSDA 3HWRA 3DZ8A 1GL6A 3O47A 4R2JA 1W35A 4ZCQA 4PSAA 4GG1A 4R1QA 5I9LA 3UH0A 2I78A 1QAOA 121PA 1XSEA 2QTCA 5CLIA 3NRJA 3WI7A 3ZXXA 3BRCA 2GXAA 1O2DA 3QVUA 4UXHA 1OFGA 3C2QA 1E2BA 3LLSA 1OX6A 1NC3A 4PRKA 2JS7A 1MAVA 4QWMA 3LGAA 3PD1A 4HAIA 1F9AA 3BXPA 3RPEA 4Z0TA 2ZS8A 3R41A 5TXGA 4C0LA 3MWJA 4R1MA 1PJSA 1PSDA 3GIDA 5L8VA 1R27A 4J3NA 4E4TA 5FFMA 1ZU5A 4GZLA 1JIQA 4RZHA 2OPHA 2Q0XA 3WX0A 2G80A 4BVJA 4JJ8A 1XAHA 4XRRA 1D04A 1XRNA 4CJXA 2IBTA 4DM3A 3C41J 4GYWA 5A04A 5EKUA 2RKOA 3CU5A 3QBJA 1RQ2A 2IPXA 4R40A 4D9IA 3GPLA 1PFKA 1G20B 3NO4A 4OU4A 4YT4A 4M9QA 3UAYA 3QHAA 1PJ2A 2GB4A 2ZBUA 4WKOA 3TSAA 3QPWA 3W6NA 2H7XA 3PGJA 1O94C 3SQXA 2WDZA 1W2GA 4XYBA 3OLQA 3HS3A 1TF5A 3UHPA 1ZMOA 1PYGA 1TUIA 4I6GA 3T7AA 2ON6A 1CCWA 4HDNB 4X92A 1WMAA 2YYZA 2Z5FA 3FI0A 2AZXA 1DPFA 4BQIA 3L77A 1AS0A 4FK8A 3ESQA 1Z5GA 4EA9A 3TTUA 3P9IA 3FPGA 4EI7A 4HGRA 4Z4CA 1R37A 1Z2CA 5H68A 1SEPA 1KEWA 3C7DB 1TQ4A 3ASZA 4OB8A 4RYLA 3EYWA 4QNMA 4WCFB 3GVPA 2QZJA 3VNUA 2YOFA 1ZRMA 2PKRA 1VFPA 4Q1DA 1K2VN 3AUAA 2X15A 3A1NA 2OY0A 3OP1A 4WLEA 3WVNA 4AKSA 2ZPAA 4D8XA 2UU9B 4RTPA 4DV6B 3I45A 4YJ3A 4R9SA 4RHYA 5KB3A 3PU6A 4Y6PA 3ZLTA 4M8SA 2IY8A 3TR0A 1CUGA 2RAPA 3U6BA 1QLHA 3PNKA 1YKGA 3REQB 3GEMA 4BNTA 2NN3C 5EXXA 3WGMA 1CUBA 4FT4A 3O4GA 3LBNA 4BQFA 5CXXA 4P3PA 2W71A 2NXCA 2GNPA 1MJFA 5HX7A 4C0KA 3TQSA 2FPIA 4XLTA 3WYCA 1GJRA 1W4BA 2BMVA 2VYVA 3W6UA 1HEYA 2EJVA 5E4YA 1ZNWA 2PBLA 3O3MB 3CZRA 4KPUA 4OOFA 4WZBB 4IX1A 4I1UA 4K9KA 1PLKA 3HSKA 2H9IA 4F8YA 2YOGA 4FCTA 4RS3A 3T06B 3UHAA 4AY4A 4F9EA 1ZGHA 4V38A 5K4GA 2XEDA 3FFAA 4WXPA 1L1QA 4Y9RA 3EGXB 4FQ7A 1X70A 3HCAA 1RYEA 2MINA 1NP6A 5LKRA 1UJ4A 4YN3A 1YC5A 4H08A 4HUJA 5C8VA 1BHQ1 3C87A 2I7CA 2UUOA 1PGNA 4DGSA 1THZA 1DAIA 1TLLA 1Y9EA 3FH0A 2A58A 1A50B 1HE5A 3REOA 2NVOA 4DXAA 4KE6A 3HJRA 1UZNA 5J1SB 4D7AA 4G4SP 1GPAA 1PX0A 1NQXA 5I7WA 2VBIA 1WUYA 2IZ1A 1K6JA 2VDPB 2XAUA 1E7RA 821PA 3Q8KA 4CU5A 3ZBQA 2X2FA 3J81A 2H1OA 2QRNA 4AICA 1D6SA 1SBQA 3CMCO 3P97A 4N41A 2VYVD 4JJGA 3W2TA 4PHCA 1ODTC 5CHEA 4YV7A 3HLTA 1EGVB 3A3YA 2B4KA 1QK5A 1JNYA 1KZ1A 2CMFA 1F4VA 3FETA 4REQA 2YHSA 4NTZA 1IUKA 3RU9A 1ISJA 3CKLA 3SX0A 3I64A 4LAFA 5EHNA 5M04A 4NBTA 3IVXA 1ZK2A 2Q0QA 5B3LA 2Q6OA 1RSZA 3IURA 4O2AA 1M1XB 4ENSA 1W8DA 2VP3A 1LNQA 3DWGA 1G5RA 2Z8YA 4W6ZA 1ZGAA 5DN6A 1BDJA 3CM0A 2V6MA 1AZTA 2GRUA 1QCCA 4MJXA 3T7EA 4YRLA 1QP4A 3RKUA 3O8QB 5ALXA 5G0WA 4ZVKA 2FMUA 3BB3A 5IUJC 5IH3A 5IAAA 5FHQA 3ENVA 5DM60 2RARA 3P2IA 1NZDA 2HEGA 1N2SA 3KTFA 4KLRA 4Q01A 4EJ2A 4CMBA 1X1EA 3R3HA 5KTSA 3G02A 1T4GA 2VF7A 2YASA 3H2IA 4IVNA 3QEJA 3KVNA 1CE8A 3B7WA 1HG0A 5GGXA 3L04A 1J8QA 1ITZA 1H9CA 1JR3A 1BDMA 3H5OA 3MSXA 3MRXA 1WEKA 5DM1A 4YUYA 4KQKA 4NOJA 4A0RA 4ECEA 2F1KA 4N82A 3AVUA 2CVPA 5MGBA 4L75A 1OFUA 4HZUB 2J9GA 1H0SA 1P29A 1Z0SA 1PQWA 3N2GA 1XQ9A 2J3LA 1NVFA 5HCUA 3SS7X 5CB8A 4EAAA 5K2OA 5BVHA 1I7DA 2VNIA 4LVOA 4TTJA 1TAUA 1ECGA 1K66A 2ZAYA 3L5KA 4JI8B 3W5JA 3DO8A 1R6VA 2PGIA 5DN6D 9GPBA 3RC8A 5KUTA 3LY7A 5DP2A 3N5KA 3RIYA 1Q95A 3DL2A 1C1HA 1UEJA 3HC7A 2H57A 1SXQA 3Q3CA 2H2DA 2PMDA 2RHLA 2X41A 4IMPA 4X9XA 3VPXA 2EWVA 3DOIA 3FFXA 3CX8A 2X4DA 2ZIZA 3K5IA 4XUDA 3CUYA 4P5EA 2O2GA 3CRVA 1NQVA 2OVFA 3ITEA 5CJ2A 1FXWF 4EFDA 3IJ5A 2DPHA 4JK3A 5K6RA 1EEXB 3GAFA 1NUPA 1JR3D 2NZWA 3MTDA 4UQOA 5CM2Z 5AUNB 4P7KA 3DEZA 1PG0A 1EFUA 4M55A 5E4JA 2BKXA 1M2VB 2F1HA 3HDQA 2ZSEA 2QM7A 3SFVA 1H4TA 2FJPA 1GL7A 4WNAB 1UCFA 3Q5DA 5ALPA 1PK8A 5AJZA 5AUOB 4N5NA 2YWJA 5G4KB 3RYIB 2V7BA 1KAQA 1SBYA 1WD5A 3AEUA 4ADSG 1WF3A 2NVBA 3NRBA 3E03A 4XTRA 1YI1A 1CUZA 1S9HA 2DFNA 3CLKA 3PB3A 3AJRA 4FIDA 3VC3A 5KIAA 2FFRA 3VHLB 1DFIA 1Q0RA 4IICA 4TTVA 3UK6A 4AS1A 1K3FA 1CZKA 1M0WA 1JMYA 4UUMA 2PHZA 3EQ6A 4LOHA 4PVDA 3B82A 4Z9FA 1QSGA 3FWZA 2B4TO 2ZBEA 1LZLA 3N07A 2AVNA 4J1NA 4JS0A 3V8NA 3WJ1A 4EX6A 1QORA 5KSYA 2LNDA 2DWPA 3FWNA 1QHIA 3Q3GE 1RBYA 1SU4A 2QTVB 4B2IA 4D3SA 3UKOA 1Y82A 1ULUA 2W11A 5CX1B 2Y6UA 3DE5X 3LY8A 5DHPA 4CRWB 4HS9A 2J0SA 1ZEJA 1WDMA 3GLHA 3BXXA 3VPBA 1ZYUA 4ZVVA 2YMPA 3A0RB 4CL8A 4EP1A 3B89A 4P2BA 1Z8NA 2GN0A 1RJDA 3PC6A 5HIAA 2KBFA 4JI6B 3IP5A 4ZIRB 5BW5A 5KYGA 3W9YA 1A0OA 1ADGA 3AHFA 1EDBA 2OAEA 3NWOA 4L6AA 3FRIA 4KBFA 4LYGA 1X7XA 3RHSA 3AH8A 4EFKA 4Z5XA 1RZRA 1JKJA 4FQ5A 2RHCA 2QTRA 3L8MA 1HTTA 2CLEB 1D2CA 3PCXA 1E1MA 1L3IA 4X93A 3VYUB 5LL6P 2HQBA 4CIAA 3FJOA 1ZN7A 3T1QA 1P4RA 4X24A 1WBJB 1XA0A 4DBLC 2HHHB 2IS6A 4MA4A 1KZ6A 3JSXA 4PYKA 5HJEA 4OXKA 3WKBA 1XEFA 1HT0A 1KEPA 3G23A 2VPTA 1C3VA 3KR1A 3Q4GA 1N34B 3HR8A 4NPHA 1US8B 1UT8A 2RH4A 2ZRIA 2PRZA 4YDSA 1UPBA 1Q7CA 3BA1A 3ZW7A 1A8SA 2QROA 1FTYA 1NE7A 2Q62A 5AW0A 2A94A 3CR3C 1KC1A 5ADHA 4N5LA 4IAOA 4FZJA 2FZ4A 1Z22A 1SAYA 3IAS6 4CTOA 4KIJA 4IL5A 3GFSA 2XGOA 4MQ6A 4C7OA 5C53B 4F91B 1K27A 1WU7A 1ZD3A 1JHQA 2NOAA 4F7DA 3OIUA 3F6RA 1PJTA 4RENA 3EX7C 1OZ0A 3HXPA 1IHOA 2QAGA 3ZE0B 4QGGA 4MP3A 5B58C 5F3DA 4B3MB 1OLSB 1NFFA 1XKTA 1RZRD 1TEZA 1MRSA 3LT0A 1U0SY 4FFWA 1J2TA 4OHKA 3LP5A 1GAWA 2IS4A 2PQ6A 4YALA 3WV4A 4G1FA 2OP0A 3NOXA 4CUZA 2HFKA 3GJ3A 2NVUB 2JAXA 3OPXA 1Y7TA 1TUGA 1X38A 2N42A 4JEUA 1RRPA 2JCGA 2V0CA 4OQZA 3X1DA 1XTVA 5IJXA 1W0CA 2XKBA 3ER6A 3FOBA 3W1VA 4KPEC 1HUQA 5AW3A 1XZGA 1SA0B 3HYLA 1UJ5A 1NQUA 1XJ0A 1K6IA 3A1EA 3TI7A 4N6OA 4RZUA 3D6FA 5B4VA 1HR0B 2Q3EA 2R25B 4QUEA 3AETA 1DRUA 2FSVC 3ITKA 1V8BA 2WV9A 2XGGA 4HLNA 3BD8A 4V03A 3H04A 2HPVA 3JQPA 3SEZA 2EERA 1YBFA 5LPNA 1K75A 4ML3A 1BRMA 3J7TA 3OP4A 4OQEA 2HA4A 1JLHA 4U5XA 2EBHX 3TCXB 2ATEA 4J7CA 3C70A 3F3KA 1N2EA 3O4HA 4Q93A 5TS2A 4CM7A 5JH7F 2Q4RA 2C4TA 3TVTA 4ES6A 4W82A 4CKWA 3O74A 1PL6A 2EZ8A 4E5KA 4TMTA 1QR2A 4X3OA 3MJ4A 2XT0A 1FNNA 1KFEB 3PYXA 5BV1A 6ABPA 3NBXX 4EVQA 2EFJA 3BHNA 3E0XA 4G5GA 4MS1A 3SIXA 3WGUA 2WWIA 1ISIA 3L7YA 3TLYA 4PAWA 4PC3A 3G7UA 4MMZB 4R8LA 5G0SA 3K16A 2VTKA 1DBPA 3R0QA 4DJTA 8AT1A 2XADA 1Z2PX 2N9UA 5DHFA 5BMOA 3C3WA 3PYLA 2OG1A 4JP5A 3F8TA 3NM5A 3NYQA 4J9VA 4L7QA 1ZI9A 4PQYA 2CJFA 1XQ6A 4ZT3A 1HT1E 1M8PA 1I1QB 1YUNA 2F3QA 3C5EA 1OIVA 2E4XA 3HDHA 2G82A 2HWKA 3QNMA 1PNOA 1EFHA 4ENRA 1JT9A 1C29B 5DWQA 3ZWNA 3EODA 4BBZA 4EEKA 3OEHA 4LXGA 1SVMA 2WTMA 1ZNQO 4JI2B 1T9HA 2GHRA 2D3TA 2VYNA 3OMLA 3U7QB 2I6TA 1JG2A 1KJ9A 2OXIA 1MFPA 1QIIA 4MIKA 5AYVA 3IESA 2ZT6A 1LJUA 4W5OA 1EGAA 4A2PA 1NA5A 4ATNA 3ZX4A 3E1GA 4ER0A 3GR6A 4L8YA 3G0HA 3KYDB 1LV7A 4MUHA 2HMAA 4ZOLA 3X1XA 4O4IF 4JMPA 3WWOA 3MIIA 1R4ZA 3DD5A 3N86A 1NMZA 3I2HA 5GJWC 4DT1B 4EKGA 5ITWA 3LRPA 4HGYA 1W5BA 1XCOA 5EPUA 1I3CA 2QRGA 3LX8A 2XZLA 1NAIA 4NE9A 4HV4A 2Q4OA 4F4HA 4RULA 4FGWA 1ODSA 5F76A 4DV5B 1MABB 5IU6A 1D3AA 1Q2UA 2HGZA 3BGOS 3EFOA 4BVBA 3GCZA 1P72A 2ATIA 2HA3A 4HRVA 4L9WA 4MW4A 3PWSA 4UUNA 5LQSA 1LDBA 1EMDA 1V41E 4KBYA 2QD3A 4QPPA 1Z8HA 4AXBA 4CKXA 4CW7A 2FOLA 3F4KA 1NOKA 3LCMA 4LV6A 5KJCA 3OEHD 3OQJA 5A06A 1RXIA 4UCWA 5C51B 5B57C 1G5IA 1N0UA 2CMHA 4XDHA 2VYND 4BO6A 4D97A 4YCNA 2IHNA 2JEYA 3VMMA 4IUDS 3K70B 4POOA 3KEMA 3ZHCA 1KO5A 3LO5A 3WLIA 3I1YA 4QELA 4DMHA 1XCPA 2FPPA 3K1AB 2IQ5A 2E1PA 4R2XA 2CZCA 5IN5A 1V96A 2P79A 4U7DA 4EW3A 3DCIA 3SM9A 1QHNA 3ANLA 1GOTA 1XTSA 4LBVA 3RRXA 3HU5A 4Q21A 3U80A 4B80A 5I5EA 1AKWA 5L3ZA 4ITVA 2HCFA 1W29A 2XZTA 3L1UA 4TV9A 3TFWA 3KM0A 3V7FA 1R8YA 2BFPA 2QENA 1QNLA 1EBFA 2FPKA 3LOQA 3FAKA 3WMWA 2CKMA 2CXHA 3KWLA 5JI3E 1DZ3A 2I6FA 1SBIA 2IE8A 2WYUA 1N9KA 4HDAA 4LI0A 4NAHA 5EXPA 5KNLA 4K9PA 2G0AA 3LPAA 3MINB 1RMTA 3FMFA 4MV7A 2PNJA 1L3BA 1ZIYA 1SVKA 2HA6A 3EG5A 3T7DA 4AJOA 2PPVA 5A4AA 1F2TB 3VSCA 2YVKA 3DD1A 3MJCA 3LL4A 5B30A 1TPYA 4JA0A 2H2GA 1XVVA 5TPWB 3IA2A 1ST3A 2GJAA 3L8CA 4AJEA 4YCCA 3PLAE 2D5LA 5EPOA 2Q99A 1GKKA 3PUJA 2C3YA 2FN7A 1F38A 5C8DA 1HKHA 1E9RA 3GZTB 2HY7A 1ADFA 5KQRA 4I6EA 1N7JA 1LC0A 1ZLXA 2B2XA 4BEWA 2QVBA 1P7PA 1QBKC 3LCJA 2XQFA 1GTG1 1LF0A 1XTKA 2VCHA 3QELB 1ML3A 4TTSA 2WJHA 3RS9A 1S6YA 3RO7A 3C6BA 1KEZA 1M0SA 1XCJA 2IDJA 2FPRA 2CXXA 2X23A 2XA9A 1KQPA 2OECA 4FFBA 4FFVA 5DDIP 4B3DA 1LPAB 2I1LA 4V24A 1GTSA 2F4VB 5F2NA 3KC2A 3ND5A 3BHIA 3IPYA 5B37A 3DP7A 1GQ2A 3H3XA 3COJA 4AROA 3BL5A 2ORYA 5H3CA 2QMQA 4E31A 4H6WA 3KQLA 2W2QA 3BH7A 2HDNB 4C05A 1XOIA 2FUKA 3JV7A 4HYEA 3P9QA 4J0FA 3NIFB 3ABQB 4NZOA 2FF7A 4GW3A 5LNK6 1GV0A