3FVWA

Crystal structure of the q8dwd8_strmu protein from streptococcus mutans. northeast structural genomics consortium target smr99.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
179
Chain Sequence
KRILFIVGSFSEGSFNRQLAKKAETIIGDRAQVSYLSYDRVPFFNQDLETSVHPEVAHAREEVQEADAIWIFSPVYNYAIPGPVKNLLDWLSRSLDLSDPTGPSVLQDKIVTVSSVANGAEVFEDYRSLLPFIRMHLVDQLTGVPINSEAWSTGILKVSAEKLAELSAQADALLSAIEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAD(P)H-dependent FMN reductase
publication title Crystal structure of the Q8DWD8_STRMU protein from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
molecule tags Structural genomics, unknown function
total genus 55
structure length 179
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fvwA00
4QOJA 5LBTA 3OX2A 4YAOA 5JROA 4YAUA 3ZHOA 4BMPB 3O73A 2FLVA 2QX6A 1BVYF 4LTDA 4ICIA 2D5IA 2BZSA 3OX1A 2R97A 1QRDA 2QMZA 1SQSA 3LT5A 4DY4A 4N9QA 4U7HA 4FGKA 1AKWA 4F8YA 1ZWLA 1FLDA 4QOGA 1WSWA 3F90A 1QHEA 4J8PA 2RG1A 1J8QA 3O2NA 2MT9A 3F6SA 4NULA 4YAFA 2HPVA 5EAIA 3P0RA 4QOHA 3UXHA 3L9WA 2Z9DA 1YCFA 5LMCA 5B3LA 4Y9RA 4LAFA 4ESEA 2BN4A 5EA2A 1XI2A 3OVMA 3NFRA 4CETA 3ES9A 2QR2A 3NHUA 4GQIA 3NHFA 2B3DA 2HNAA 3KAQA 2QX9A 3TZBA 3NLLA 1AG9A 1H69A 1FTGA 2M6RA 2Z98A 2BMVA 3LCMA 3W78A 4R81A 2FZVA 3QFRA 4GI5A 4LTMA 4GR9A 1ZX1A 5F12A 3K1YA 1FVXA 1FX1A 4N65A 4PU0A 2Z9BA 3L9XA 5NULA 1YDGA 2FX2A 2X2OA 3NHJA 4BMOB 4ZVNA 4Y9UA 3NHKA 1TLLA 5LVAA 4S24A 3U7IA 2WC1A 4D02A 2V5UA 2QX4A 4C0WA 2XOEA 2QMYA 3EYWA 3OJWA 1AMOA 3W77A 3HR4A 1JA0A 1CZKA 3W7AA 1QBGA 1OBOA 1AKUA 3NHSA 1CZOA 4PTYA 2F1OA 4OXXA 4H6PA 4QOFA 3NHPA 4U7FA 2FDXA 1J9GA 4YAWA 4ZVLA 1B1CA 2MTBA 2MWMA 1YOBA 4QODA 3GFQA 1ZWKA 1CZHA 3GAMA 4C0XA 3KEGA 2ARKA 2FCRA 1AKVA 2KLBA 3FNIA 3TE7A 3QE2A 3N39C 3NHLA 3GFSA 3HA2A 4LTNA 5NLLA 3ESXA 3ESYA 1AKQA 5LBUA 4CF6A 3F6RA 1X77A 3ESZA 3KLBA 3FX2A 3OWXA 1WSBA 3F2VA 4ZVKA 1CZNA 4DILA 3D7NA 1I1OA 2OHHA 1AHNA 1T0IA 4LA4A 1RLIA 5LJLA 1J9ZA 3KAPA 3JSXA 1YCHA 3NHYA 1AZLA 5BUCA 4FGJA 2OHJA 1C7EA 3EDOA 3HLYA 3B6IA 4HEQA 2MOKA 1F4PA 4DIKA 3OX3A 5F4BA 3W79A 1SG0A 1DX9A 4N82A 1YKGA 3B6MA 2XODA 3QFCA 2X2PA 3TEMA 2FZ5A 4NLLA 4QOEA 1TIKA 1AKTA 1YCGA 1FLAA 4XDHA 1D03A 2BF4A 4YALA 2FOXA 6NULA 1FLNA 2ZKIA 1CZRA 3G5MA 1RLJA 2A5LA 3R6WA 1YRHA 5FUQA 1CZUA 5A4KA 5ULLA 1FLVA 1E5DA 2GSWA 1H66A 2FVXA 2AMJA 1CZLA 4HS4A 3UXEA 1DXOA 5FA6A 2Q62A 4M0CA 3K20A 2N1MA 3NHRA 1GG5A 1QR2A 2R96A 1KBOA 1XT6A 4U7GA 4H2DA 5LLDA 5FX2A 3SVLA 4C76A 1J9EA 5F51A 1C7FA 4XDGA 2HNBA 1V4BA 4FGLA 3S2YA 1XYVA 4ZVMA 5B3KA 3FW1A 3N3AC 5LJIA 1OFVA 3FVWA 4C14A 1NNI1 1T5BA 5EMNA 1D4AA 3FJOA 2OHIA 4YQEA 1BU5A 2V9CA 1AKRA 1KBQA 1XYYA 2Q9UA 3B6KA 1RTTA 4QOIA 1OBVA 1D04A 2BPOA 2QX8A 5TGZA 3OJXA 2OYSA 4PTZA 4Y7CA 2W5UA 2V5VA 3GFRA 3NHWA 1FUEA 3B6JA 2M6SA 3OWHA 3N3BC 2Z9CA 1VMEA 3U7RA 2QWXA 1JA1A 2KQUA 3RPEA 2FAXA 1DXQA 1RCFA 4FX2A
chains in the Genus database with same CATH superfamily
1GHTA 3ENWA 1C9DB 3WHLA 3TG2A 1HMYA 4YJKA 3H1PA 4HAIA 3UK2A 2P9YA 3QYPA 4NBVA 1DRKA 2QTFA 1ZN9A 4MUAA 2Y4OA 4E15A 3GLIB 1AS2A 3TCKA 3L6DA 4EYQA 1EFCA 1HO3A 1E0JA 1UM9A 1U2RA 3AFIA 3OMWA 3P0IA 4AKGA 3IAEA 3A1FA 2UDPA 4XSVA 3RVJA 4B9EA 3WL7A 4ZV4A 1ADJA 2ID9A 2BJHA 3LH5A 4MW2A 3NH9A 5GJWC 3TQSA 1UAGA 2YW9A 3OSZA 4MV6A 1NR7A 3AYXB 4RD3A 3DL4A 1H2WA 4BKMA 4J0IA 2H9IA 2IZ0A 3OX4A 2ORIA 1TTQB 1P19A 4Q3BA 1C0KA 2B7LA 2EV9A 3O3CA 3AUJB 4RH3A 2LUOA 1W0JA 2NUPA 2J3MA 4IHAA 2DWPA 2B7BA 3NANA 2VYVD 4HVTA 4IIDA 3W1EA 3QUSA 3OEEA 5IDYA 1JAZA 2ZRQA 2PS3A 3FPAA 5AOVA 3RROA 3UO8B 4DLLA 1M8FA 4F1JA 4BLRA 4HAYA 4WNAA 4F04A 2ECKA 1D2RA 3D6FA 1K4YA 4YMVA 3T35A 3TZHA 1YQEA 3PFNA 3R8FA 1Y3BE 3ZI0A 4GQAA 1R00A 5T8KC 4BE7B 2AMYA 1V95A 3C7DB 1RKVA 2QTTA 2ZG6A 3V8BA 3ND5A 1M2HA 4JSYA 2CF6A 1J21A 1Y0BA 3MLAA 5LQKA 4WCFC 3WA7A 1O97C 3QPDA 3OHSX 1E5VA 2RHRA 5EGSA 1ZCZA 4ENPA 2D2FA 2BT4A 4FYKA 2GQ0A 1EK0A 2VP2A 4KLNA 4GFDA 3KYDB 1MV8A 2XUPA 3N8HA 3UH1A 1WXDA 2ZYUX 2J4FA 4XXHA 3HKCA 1G16A 1ZIYA 4IFEA 4DGQA 1RW4A 3UB4A 1X1BA 2ZS7A 2QPTA 3BA6A 1TT5A 4DUGD 1D0VA 3D8SA 2JI4A 4KAXA 4KOAA 1DAMA 3KT3A 4WXEA 2AFHB 3BDAA 2XEXA 3E27A 5BP7A 3S5UA 1GSIA 5IM4F 5EJGA 4WCFB 3G5UA 4FYMA 5CB4B 4M4SA 2ENWA 1SUSA 2UKDA 4AZ3B 1WZCA 5K0JA 3MRXA 2C9DA 2F8LA 4BNUA 5DFAA 1NX6A 1PE0A 3CUWA 3IB3A 3EZLA 3JQ9A 5ALZA 1NQOA 3EW7A 3V9PA 1AHPA 2A9KA 2WSIA 3SZMA 5IN4A 4ZT6A 5P21A 3RYCA 1O96B 2W6JA 4M76B 4V03A 1UJNA 4XWYA 1U1CA 4BMXA 1U63A 4JYBA 2FR0A 1SU4A 3HJRA 2VHUA 2EZ8A 1MC8A 2B92A 3MJTA 5A1TA 2BW0A 1X7DA 1PNTA 4C6HA 3KXKA 4JJ7A 1YKFA 2PA0A 4OJMX 3ZY3A 2WZDA 3R0XA 3A1CA 4NCXA 5B6IA 1JFFB 2JDIA 4JN6B 3OIYA 1GQRA 1P5JA 4M9SA 4Z7QB 5I48A 3EXAA 2O5RA 4EARA 2DQYA 3VSBA 1A71A 2WG0A 4C3UA 1XN1A 2O1SA 4D82A 4BNLA 1WMEA 5H4HA 3UGJA 2ZJ3A 3DZGA 1BFDA 4HN4B 3T7EA 4P5EA 3CR3C 2CFRA 3K30A 4UCWA 1O0SA 3ZCQA 1JDNA 1AG9A 1H69A 1NMXA 2WDPA 1C9MA 4CI0B 2TECE 3ABZA 4DG5A 3PICA 4GBED 1C0EA 2CLLB 1EM8A 1ZQ9A 2QVCA 4MCAA 2ZW9A 3K1YA 4P32A 5FJIA 2A0UA 1LBEA 3ZHBA 4BX0A 4EHJA 2B0JA 3H42B 2GKOA 2C42A 2CE7A 1V6CA 2XW6A 2CJXA 1LPSA 1CEYA 2D1FA 3CN9A 2R1ZA 1IXZA 2ZR8A 3BYZA 4U8GA 5JYCA 2PZ8A 2CMFA 4I5DA 2PO5A 4MRMB 1OD6A 1VIDA 2H0AA 2FZKA 2HN9A 4X90A 2DLNA 4KH0A 5JADA 1N78A 2NXWA 2CJFA 2UVPA 3IB6A 1SQ0A 3LNTA 3ZHCA 4B2IA 3WNZA 3G59A 3R41A 4BX2A 1ISPA 2PMFA 3L1VA 4WACA 1KDVA 3PC3A 1LGYA 3N7UA 4GM4A 1GP2A 4J43A 2QG6A 1DAIA 1STOA 2Z4TA 3EWNA 3I8SA 3KWMA 3LT2A 4LRXA 2FGKA 3TS1A 1CS0B 1ZUNB 4XIYA 5K5EA 1WCIA 4JVNA 3ANMA 2DR3A 1MC1A 3ZXYA 1L4KA 4Z9XA 5BWLA 3BGVA 3EZFA 4CUJA 2VYQA 4NHOA 1PU2A 2BI7A 3AKYA 3T7KA 3CZ9A 4BQEA 1FDTA 3GXOA 2ODPA 5IM5A 2JFQA 4AMVA 3BMXA 3PJFA 3R5FA 4Z9BA 2CW5A 3ISVA 3KEQA 4LOKA 4YWHA 3F5QA 3U4QB 1QONA 1YE3A 1SCIA 3H13A 3ZTWA 4E6PA 1YL7A 3LRTA 4R2IA 3OURA 3TQTA 2FN9A 1I4DD 3LIPA 3NRCA 1GDTA 1AMOA 4GICA 4LNUB 2O1EA 3W77A 1XGKA 1M67A 3IKTA 3DD5A 3K05A 1QS0A 5FWAA 3LYAA 4PQFA 3VPSA 1LI7A 3PWTA 3WGTA 2H0RA 4DPMA 1I5OA 3Q7EA 4GSLA 1KA9H 1SRQA 4WY2A 1T9BA 4HZUB 5E8RA 5H0IA 1MEEA 1T8TA 2OFFA 5EE5B 3AF6A 5BW5A 4HX9A 3BXXA 1T91A 1V1RA 2H63A 1OHHA 3LWBA 1RBYA 2A33A 3FWKA 3JARA 4PG5A 1OBOA 1FUIA 3QKSA 2XYPA 2GPYA 3IP9A 4E7OA 1A77A 2XVXA 4ZALA 4BNWA 1PWHA 2OHXA 1GTRA 1XTPA 4GDMA 3AF3A 3AR4A 3UWMA 2IKSA 3VU0A 1QFJA 1P29A 1FFHA 5AHWA 3NHPA 1RI4A 4N5HX 3KETA 5E7MA 2WW8A 5JLAA 3WFZA 4BNJA 5LQDA 4Q9HA 2IH4A 2FPKA 2FDXA 3NRBA 1PNQA 3C5EA 4JJ6A 5EZYA 3SKYA 1T29A 1XDUA 4H15A 1BH6A 3BMQA 1B0UA 5LOVF 4YJ2A 1NPYA 1PRYA 1DWQA 3NHBA 3OQOA 4BGIA 1RPNA 2R48A 3MNFA 2B4YA 2D62A 2QTRA 2YQ4A 2V1XA 4WX2B 3K6KA 4CKZA 4YI5A 4M7WA 1FP1D 4E12A 2P77A 4MUFA 2OD9A 2HPHA 3A8TA 2CVOA 5EMMA 3ORFA 4BCDA 1JIKA 2ARKA 1UEXC 3P4YA 2FJUA 5A4DA 4IIJB 1ZDMA 2I7TA 1G19A 3MPUA 4QGBA 4ZVVA 3NYIA 2BL4A 4JZYA 3NHLA 3M6LA 3V7FA 2ET6A 4URYR 3EZ7A 1DU4A 1VCNA 4R0VA 4CLRB 1N9KA 2PNFA 4LTNA 1YMUA 4MO9A 4YAEA 3PLNA 3ESXA 1B41A 3C3BA 4D3SA 1SQ5A 3F6RA 4E31A 3G79A 1Z4IA 1RYMA 2FUG1 2YS7A 2G0AA 2VTBB 1PVOA 2HK7A 4ENRA 2VDJA 3DB1A 1J0AA 1QANA 4JIMA 5E6UA 3V1YA 3V8EA 3WXBA 1F8FA 4EYGA 2ZBRA 4TWJA 1BXRB 3G85A 3Q0IA 2C00A 5CT4A 2PUAA 3CLRD 3WZLA 1Y7IA 2D4HA 3ESDA 3WWZA 1N0IA 4A8JA 3GRZA 4KPUA 1QHYA 1WP9A 1CQZA 1P4GA 2FPIB 1ZK1A 4ZQCB 5ALXA 4KQ6A 3BRQA 2C3OA 1SK8A 1MZPA 1XROA 4ER0A 2ZTMA 1X8XA 4OGGA 3U81A 1R1DA 2XZPA 4QULA 2HBZA 3DC2A 3D6HA 2VA8A 4JROA 4Y2HA 2D00A 2YY5A 2XB8A 1YCHA 1J24A 4TSFA 1MBZA 2ORED 4ZAVA 3UY4A 4AU1A 4MR9A 1SURA 4LY9A 1DJLA 4IKEA 3SC2A 1NA5A 3IQHX 4FOSA 2PUFA 5AK6A 5TGTA 3WNCA 2DUMA 1BCSB 5K4AA 3EDOA 2NXEA 3G0DA 4BN4A 4KO3S 2GDZA 4ER7A 3DE6X 3LYHA 1YBHA 2R00C 4NK5A 2J7KA 2FMXA 1T9HA 3PC8A 5F52A 1DBVO 2ECPA 4XWAA 3ACDA 4FNOA 4ZPXA 1N6KA 4G23A 4Z7NB 2YWFA 5KNCA 3U3JA 4MGYR 4NQRA 2CC2A 5L9AA 3U0BA 4Q7EA 4MR8A 2X0EA 4DV1B 1XBTA 3V80A 5KHLB 2AOVA 2CLHB 2E55A 2C54A 2FN8A 3WGYA 3U7FB 1JALA 2IC5A 1P72A 4AIRA 4X63A 4XFJA 2E18A 3WK8A 2IU0A 3IT0A 4C7VA 2QT0A 2X7HA 3FTNA 3URKA 5KX5A 2XZTA 1F4VA 4MULA 3ITNA 1GGJA 5HG0A 5JR3A 3H8WA 3B5IA 3SIXA 4X65B 1T9GS 4B83A 2HSGA 2JF0A 2G88A 2GPNA 1FJXA 3VPAA 2PUJA 3EPLA 1MN6A 3KHKA 4JQSA 3HKDA 3DV2A 3TGPA 4O5OA 3HCFA 2UXBB 2ZTLA 3EGXB 1GY8A 4JMLA 4JBLA 4YALA 1M74A 1XQ6A 2AZ4A 3A2MA 2LKDA 3PA6A 4R40A 3FOFC 3P26A 4MGZR 5JPIA 6NULA 1HDEA 1MJGA 1VHWA 3PHLA 5JWRA 1WUHS 3GLHA 2HA0A 3O47A 4N7RA 3G5MA 2DTXA 4KQJA 2ZAMA 4FYXA 1KJNA 1XDGA 3B3FA 3UOGA 4RQBA 2YINC 3JRNA 2F8SA 4JLBA 2DOKA 4V0MA 3D6JA 4ZKDA 2Q6LA 3M3DA 4GPTA 1HE5A 2YX1A 3H9JA 2LGJA 2QR3A 4YUXA 5BVGB 3A9TA 4CL0A 5IN5A 3T38A 1F2DA 1VJ1A 3WYGA 5DNCA 3LLVA 5E7QA 1SD1A 2HWYA 3AHDA 3O4HA 1NI5A 5DISB 1V8PA 1VPWA 1AGPA 4GR4A 1AXEA 4NPHA 2G0NA 3WGNA 4X1KB 2HZBA 4NBLA 1YA8A 5I7RA 4UUAA 3PGKA 2GH1A 5DLEA 1L7AA 2IF0A 4S05A 4U2BA 3PR2B 3H5OA 2W6PA 1U6JA 3FCYA 4PC2A 4RORA 1NVKA 1G4UR 4RQUA 3HO1A 4OHOA 3LGAA 3TRHA 4PQEA 2HRBA 5J3JA 5BV1A 5I9NA 3G49A 1MABA 4DMGA 5I51A 4B45A 4RQAA 3EIWA 1O5IA 1XCMA 2C8JA 2VDUE 3KQVA 3ZBUA 3ZWAA 4B6FA 5ECWA 1H6AA 5CH8A 4TYPA 5A06A 1QP7A 2FQ1A 2DPXA 3U17A 4R2MA 3ZU3A 1FPQA 2XWBF 3LY5A 1J20A 1DXYA 3H3JA 4W9NC 1JDPA 1UFQA 3ZHUA 3CRVA 5B55A 5KSZA 1BRTA 1CIVA 1KH1A 2DR0A 3FGOA 2D59A 4IH4A 4KB5A 4FOOA 1JEYA 3IBYA 3U3DA 1UBLS 2GLUA 1G3RA 1EJ6A 3PB3A 1M10A 2H1LA 3VH2A 2Z5VA 4RFSA 1B8NA 1XYVA 4WVFA 5IDQA 4JBGA 2TMDA 3ONWA 1T3GA 3ZY2A 1CUIA 1F2UA 3ELYA 3WZMA 3DEIA 4RM3A 5FUMA 3UWPA 4TZTA 2BGTA 2Z95A 3T1YB 3N3AC 2AEJA 2XGSA 3CX3A 4U6SA 3VPBA 5KJ1A 1W0CA 1TXGA 4XD7A 5GV7A 5TDHA 4BBPA 2QJRA 3AHJA 4ISCA 4AD8A 2ONJA 1ILWA 1MAWA 2NAPA 2Y77A 1UKYA 3FFXA 3TWOA 2LPMA 3LQFA 2WAYA 4MV3A 1T2AA 4UBLA 2NUTA 3HC7A 4UM8B 2FSFA 4JIGA 4AJHA 1CVIA 3W6UA 2PGOA 2IBMA 2GN1A 4L9WA 4PVCA 3TLAA 1Z08A 8ABPA 1VPEA 4X6XA 3IKVA 3IDQA 5FR2A 2DB3A 4QO8A 3TTSA 4JLDA 3FXAA 3DCYA 4BLUA 1KYTA 5TNXA 2ZB7A 1I7DA 3FWZA 4R83A 1SVSA 3A4IA 4DNQA 3NJRA 4U2EA 4BNMA 5LQUA 5K20A 2BFNA 3NT5A 4M0DA 4PNZA 1OXKB 2IS2A 4QYSA 2ZJ7A 2X19A 5TB5A 4DZRA 4TKLA 3HH8A 2VWPA 4LQLA 4UNSA 5BRNA 1X1QA 1ZKDA 4I3GA 3WSWA 1NQAO 2PMBA 4JLOA 5LP6B 1KP2A 4B76A 4TRMA 3HKEA 3IUMA 5DW0A 4BTEA 5K1ZA 5J9FA 5SY6A 4CBVA 3MT9A 3PYXA 4C29A 1PW7A 5FLEX 4MH0R 3VKFA 3OLWA 3QUCA 5J2UB 4QUIA 5MGBA 1CV2A 2ZRLA 3NHWA 4YRNA 1HZJA 1WL8A 3RODA 3JYHA 2O7VA 5EWMB 5ICEA 1O77A 2Q4EA 3BSYA 1ODJA 3P20A 3UHAA 2Z9CA 3G0GA 5C8DA 3ZCTA 2W6ZA 3L84A 4OHCA 3U7RA 1USVA 1WB4A 4G6ZA 5I4IA 4RANA 4OQYA 3JWEA 5LD2C 3PD7A 4KHZA 1I0ZA 3OM9A 3VHXA 1G21A 3FNRA 2V3CC 3X1XA 1A88A 2APJA 2ZI3A 2HT6A 4RA9A 2FEOA 3F8TA 5FPSA 4OQDA 4FHDA 3ZV5A 2CDNA 4JA2A 3EC7A 5JMPA 1FXUA 1N3LA 3RJTA 1Q6YA 2JIZD 1GL6A 4Q4JB 4UU8A 3G2NA 4DRYA 3DG9A 3D3WB 1PL8A 1L4BA 3KUKA 4D3FA 4OMFG 4QGSA 2HIGA 2HSWA 2P0YA 2XCQA 3FPSA 1P9NA 4YACA 2XOXA 3V6MA 1P77A 3PCXA 6REQA 2HHHB 1JVBA 3S28A 3UJ7A 3MJRA 1TD1A 3T1HB 2AG6A 1OR8A 3H2IA 2PMKA 1G2OA 1NUQA 1PVVA 2ZRMA 3HADA 4II3A 3T3NA 1T24A 1ZI9A 2I2FA 2VDWB 3R5SA 1OYVA 3K9BA 4TV8A 4WK0B 2HY7A 4LDNA 4M86A 5EKTA 5IKXA 2V1UA 5KC9A 1OX4A 3IQXA 3FOBA 4JA0A 4C4OA 5FWNA 5JYEA 2ASVA 1W2HA 3BHMA 1IVNA 2EJBA 3DUFB 4L1KA 3KD3A 4L0DA 3AHHA 4FN5A 3ZK7A 3RVKA 1YTLA 4ZZ3A 2BKEA 2DHRA 4FMCF 3GPLA 1HSOA 2VJQA 3SC4A 3TGLA 5HXAA 1LX7A 4CNQA 4RAQA 3B20A 3B38A 3TSYA 1UJCA 2BZSA 3ELBA 4MYTA 4NR0A 1XZKA 4CV3A 5D6OA 2G0TA 5IF3A 1G3UA 3ISTA 4Q3AA 4F45A 1Y37A 1P81A 3FNGA 5T4BA 3N75A 4EUKA 2B35A 4N8EA 2WJJA 4MV4A 3TLKA 2HV8A 4N9QA 3OLCX 2H1OA 2G04A 1ZIOA 4O4LF 2ZRGA 3VPDA 4CCAA 1YR8A 2JH8A 4BB0A 1TZBA 4PVDA 5LA6A 3L7NA 3OEWA 1ZSYA 3EEYA 5IUJC 4EFNA 4G0VA 5ANRB 3CLUD 2W6OA 4FYVA 3A70A 3BH7A 2XOKA 4R1TA 1FFXB 1GNLA 1R0ZA 3BDIA 1H0SA 3LXXA 3VJKA 4ISBA 1AC5A 1L7NA 2EYUA 3GLFB 4DKJA 4KPEC 3AVYA 3WLPA 5JVDB 1M66A 2QVYX 4TRRA 4C89A 2BI8A 5JPCA 3M1YA 4FCCA 2BE9A 2WAMA 2IVFA 2HPZA 1NSTA 3GCXA 3IIIA 1GG9A 2VPPA 4JCOA 4CT5A 1G7CA 3SZ3A 1SVKA 1WEHA 4C08A 3BMCB 5T7BA 1Z74A 2W6NA 5A71A 3OIVA 2IYRA 2RHWA 4MI6A 4D45A 4RULA 3AONB 1ORTA 4F60A 3O21A 4TYNA 2WHRA 1K7FB 4TTJA 4TPKA 3KQWA 2NO1A 2W0MA 1L8QA 3S4YA 2PZKA 1S1CA 1DCMA 3PIIA 4WT7A 3AXTA 2IV3A 1FSGA 4JXKA 2XA2A 3USZA 3OJEA 3TRFA 2QU8A 5C81A 3KAKA 5IT5A 1CJUC 4QJ5A 2E4XA 4BGEA 3I5MA 3AFMA 3D3NA 4ND5A 3RASA 4L9SA 1ID8A 1ZKMA 4KTVE 5AJXA 2NYUA 5JD6A 3TW8A 4MI9A 1E98A 1LBTA 2OWEA 5EA2A 3SJ7A 3A6KA 3T06B 1B76A 3EJ6A 2ZIGA 1CSEE 4MYSA 3IMGA 3D6MA 4N6OA 3MS4A 1K2WA 3Q9UA 5CRIA 1Q6ZA 5HFJA 2SKCA 2C95A 4L6AA 3WLOA 3X1KA 4BO3A 2ZRHA 4Q7KA 4OKIA 4N5LA 3FCAA 2HTFA 3UVEA 2EW2A 4BX9A 3RAEC 2VXYA 4G56A 1MRNA 2FWJA 1LSSA 4ZAGA 3IEVA 3AM1A 1NLYA 3N8GA 1LDMA 3C1TA 4KVGA 3KCQA 4WI1A 4KN5A 2HX1A 5EKDA 2JFVA 1EK1A 1Z38A 1F14A 4MGIR 2DKFA 2ZYGA 3ABOB 1K27A 1BMQA 4BX8A 2DFVA 3REOA 4GI1A 1L1EA 2EFDB 2XZLA 4ARAA 1KMQA 2YIVX 4I6JA 3S0JA 2JJMA 3JQAD 1E79A 5CIWA 3C8UA 4BVKA 2UYCA 3EZNA 3W4IA 3V2UA 3EXEA 2ZTHA 1XD9A 1U3UA 1SXJD 1FX1A 1WCWA 2DCUA 3BJRA 4KFTA 4BZQA 5MDHA 2G28A 2Z9BA 4KV7A 2LTAA 3L9XA 4RNDB 4QDJA 4XE5A 3LUHA 1ULBA 3TEFA 3R20A 1L5GB 4EJSA 3SYRA 3KOOA 2HXGA 4X45A 4F4IA 4GWLA 2D7DA 2O2DA 4MDFA 2X9VA 3D31A 1OLXB 3AB3A 4ALLA 5JJLA 1OX6A 4WINA 3A05A 4M38A 1T26A 1R8QA 1A82A 1TJPB 1E0SA 2W98A 2DTEA 1K7SN 2CDRA 2QJWA 2IIQA 4AY2A 1NQUA 5LWHA 1TLLA 1AK1A 4DYHA 4S24A 4PRZA 4D02A 5B3JA 2MJLA 1GZVA 2HCFA 4BO7A 1KZGB 2C4MA 4X61A 1BS2A 1B8UA 2ORWA 2YXBA 3LVRE 2G4LA 1LPOA 1XVAA 2FPLA 3TQQA 1BXKA 4RVNA 1JIUA 1J2RA 5BPHA 3ADPA 4I5GA 3AKCA 2GESA 5DNUA 2ZCJA 2RK6A 4OGFA 3RWOA 2OV6A 1XMIA 2XCSB 3QNWA 3UIEA 4MYUA 1YFLA 5JAMA 5D87A 4D9JA 3WDSA 3KSUA 1QVZA 4TLDA 4L72A 4JCCA 2XKKA 5IPFA 4QUDA 1E2IA 3N2KA 4D9CA 2MINB 2TMYA 4LE2A 5E1OA 3HJBA 3OZCA 4A8PA 1MDBA 2SHKA 3EPRA 4HGYA 3RUEA 3CLKA 1KI8A 2NZ8A 4ZVPA 1D6SA 1EEHA 4L4XA 3SFVA 2XECA 3EQ7A 4NBNA 1N0UA 3EZYA 2IIBA 3L0SA 1G5FA 2QG4A 2O2GA 4NOMA 8MHTA 5G53C 1E3LA 1EB8A 4IDOA 5BURA 5D3MB 1R50A 1MQAA 3B82A 3X1JA 1EIWA 1NSFA 1I7LA 1NOJA 2XNHA 2XVAA 2BSXA 4XGIA 4EYEA 1KPHA 1OQAA 1CQJA 3CZAA 4S12A 5F9FA 4DEXA 1HRKA 1I3LA 1HEUA 4TYQA 1WDMA 1XCPA 4XPIA 1P80A 5B1EA 5HKLA 4OQZA 4RTOA 4NXNB 3BL6A 3C6BA 3ETGA 1J90A 2NO0A 3IHTA 2J0EA 3WYAA 1CEQA 1QHSA 2IYQA 2UYQA 2QUKA 2BJVA 3BSFA 3LUCA 4O4JA 4DDWA 7REQA 4OIMA 2YHUA 1I4OA 2EDCA 3SLKA 2YICA 3I8OA 2VH5R 4FGSA 4MKFA 1SIWA 4NNPA 2IT1A 3G68A 5B5SA 4MJXA 3OQJA 4ML3A 1I3CA 1ZGGA 2QW0X 4JVOA 4BLQA 4CCYB 5IJZA 4PX5A 1C7QA 1RHMA 1XDSA 3KT6A 4RGBA 4U2KA 3JZFA 1L5KA 3V4LA 2BR3A 4AXXA 1DIAA 5EJ8A 1NR1A 1B93A 1E3WB 2PL9A 2GOYA 2FE1A 4B3HA 5JZSA 5FV4A 3ZWVA 4RL6A 1H9BA 3N39C 1JHUA 1KIMA 4OA8A 5DV9A 1H8HD 3KYCA 1BVUA 3IDZA 3R9WA 1XU7A 4FGZA 3WYDA 1N0HA 2AJDA 1G2PA 2X23A 2NZVG 3DCNA 4MINA 5AW0A 2O8BB 4HPJB 3BD7A 3TOVA 4PG4A 4FNAA 3NH6A 3P94A 4OJQA 2N42A 1UIMA 1RRGA 1DWOA 2XDAA 3H4IA 3GUCA 4ENTA 5C1PA 1AM4D 1UZUA 2DFNA 2GD2A 2SKDA 2WIAA 3CONA 4GI7A 1PX2A 1XAGA 1B2LA 2QIPA 3FJ1A 1AZSC 4G5GA 3WIOA 5F3RA 2X1MA 1BDIA 2CHFA 1CBUA 1LPBB 1N2SA 1V8FA 7YASA 3P27A 3HI4A 4YHHB 4MWCA 1X1EA 4V3BA 1PUXA 2WZCA 3H1BA 3KBOA 2OQIA 3QKUA 1AB6A 1NAIA 4UD6A 5CVJA 3VU9A 2DECA 3EMBA 3IDSA 1Z2AA 2QNBA 3GGJA 3KE9A 5C4GB 4YCAA 4OXIA 4S3MA 3QPVA 5BSRA 3KB6A 3S8YA 4TX1A 1I80A 3UTCA 4CWAA 3MMXA 5FI3A 4ARIA 5D00A 3IXQA 3NHYA 4KWHA 4ZCRA 1YDFA 1JXMA 1HUQA 3LOUA 4EB8A 2EEPA 3RTGA 2IPXA 1KDYA 4L4UA 4F3RA 1X13A 2C07A 5LOVB 4Y2PA 1HX7A 5FWYA 2Q3BA 3AI2A 4QGAA 3HLYA 4BX3A 2J9ZB 1US8B 3KB8A 1OXUA 4OI4A 5AVVA 4FM9A 3NBMA 4Q3EA 2FQQA 4Q4HA 3T5GA 3JZIA 4TOIA 4MICA 4WOJA 3NYQA 3F6BX 4RKFA 5DE3A 3I3SR 2Y0PA 4ETNA 4HKTA 1EESA 4NMXB 3W6OA 4N41A 4FEGA 3O74A 2I34A 3EFBA 4WWHA 4MV5A 3KUUA 4KCGA 1QC5B 1YAHA 1LTQA 4MV9A 1BXGB 1VCMA 3NRJA 4OQEA 2YW2A 1BDBA 1ITZA 4UE3S 4DLVA 1MX3A 3QH4A 2ZPUA 2WSSD 1NF2A 1UQUA 5JNVA 3TW0A 5FLXA 1B6TA 3WQRA 2ZWAA 5FCDA 4WPGA 2B9EA 3SZOA 5BOSA 1FE8A 3OF2A 4NBSA 5AW9A 3Q4GA 2QQFA 4XQ0A 1YTUA 5HJ2A 1FS5A 3ZDZB 1F0KA 3AW8A 4B6EA 3S1AB 4DS3A 3GJYA 3CWQA 1CY8A 2O06A 1VL1A 1QO9A 3U19A 3WJ1A 2HRQA 3KOZA 2XB9A 3IDAA 2FXIA 2R8OA 4JB2A 4TM7A 3VSCA 3PVSA 5CT5A 5K2OA 1SHUX 2VPYA 1C1YA 2NPIA 3IUBA 2AOXA 2XHZA 3T95A 5I6DA 1D2CA 1ZCBA 1GPNA 1DEOA 4J0KA 3SJUA 5FUXA 2GBIA 1L6RA 3DV9A 4ZI7A 2QGFA 3NIBA 2GKSA 2AC7A 2PO7A 4K03A 1RLUA 2NZJA 3UG6A 3CS3A 1VCOA 3JALA 4IDNA 3LGSA 1EFPB 4CFZA 1OLOA 5C5EA 3DOIA 2F1IA 1D8AA 1Y4SA 4NG5A 3ZE8A 1PWEA 3O8RA 4J1QA 4A5OA 2C99A 3O9ZA 1PG0A 1N7HA 3T9DA 3CISA 1YRHA 1JQDA 1L1RA 3VZSA 1XA3A 3I1JA 5U9CA 4YO7A 2CJWA 3M4NA 1BO6A 1UK7A 4PO1A 5ULLA 3VR2D 2RE8A 2J41A 3QIAA 4MS1B 3P71T 1LTHR 4GIBA 2WWVD 1XRMA 1RXVA 2GSWA 4BP9A 2B1RA 2YZ2A 1E1NA 4K9MA 4L5CA 3SG0A 3R40A 5DBHX 2FFHA 3DBOB 4UOZA 5GZ3A 1UDCA 3T9FA 4X00A 5KYWB 5LXTF 3KZ1E 1EDOA 4YCMA 3THWA 4RMHA 4ASUA 4QYMA 3EG5A 1LI4A 1PEKE 3QU4A 2C1EA 3QHQA 4M87A 3KVRA 4YHBA 4I50F 3KVYA 3LLMA 3MJSA 5FBKA 6LDHA 1PVDA 1VKHA 2GI4A 4JB3A 5AVUA 1A76A 1KBOA 4U7GA 4X41A 5FQOA 1K7CA 1PNRA 1GNSA 5KMGA 1X1CA 3GJTA 3VU8A 3EODA 2EQBA 5D1HA 1DRVA 1L5MA 2CWWA 3KPJA 4YMUA 2BR4A 1C0LA 3U7GA 4R9RA 5TMPA 3U44B 4WUTA 3KJIA 4BFYA 2OZEA 2GR9A 3FMPB 3Q0EA 4XDGA 3MELA 5A9SA 1GT91 2C8VA 1N3IA 4FZVA 1QP8A 2FZ4A 2Y6VA 3NOVA 5REQA 1PBNA 3DTYA 1A27A 4XFDA 3DNPA 3DFFA 4FT4A 1QGZA 2P2NA 1P4AA 3EZ9A 2Y1LA 5KOIA 1QP4A 5KCZA 1KJYA 1DC8A 3D1VA 3K9CA 3QELB 4QXQA 3JVDA 4UEKA 1DE0A 2PKRA 3N76A 4MWDA 3KLOA 5ESDA 5L3ZA 1KXJA 4RESA 4E7PA 1TZJA 4QXMA 4MVJM 1YR9A 4C4YA 4G07A 4GBGA 3EXHA 4PZCA 5GQSA 5KYYA 1W94A 3F7NA 2WFAA 2VP6A 2QN9A 4TV9A 4U7TB 4R8SA 3H1AA 4CKXA 1BU5A 2BGMA 3JQ7B 1RXEA 2IEZA 4LI0A 4R7ZA 4EI9A 3FG9A 4R9UC 3T5CA 4G0WA 1OB5A 3NONA 3GLRA 1XYYA 2OB1A 2B25A 2ODAA 2BFBA 3VR6D 4CKCA 5IAAA 1DQYA 5JJKA 1Z0ZA 2H59A 3C3JA 2L2QA 3I9OA 4DV2B 3WWOA 4QOIA 2PUCA 3HVUA 4F4DA 3P2IA 1DAGA 3OLQA 1YZKA 4K8RB 2YDXA 4E2ZA 3INYA 2HWKA 3UCXA 1J8FA 1DQZA 2VATA 3W8FA 1OFTA 1DTWA 4M37A 1T35A 1WP4A 4LXHA 4AG5A 3AEKA 2QIOA 4CTKA 4E08A 3ZDCA 1ZONA 2O2IA 2H06A 5A05A 4R41A 4GKKB 5GJVC 3P4XA 2Z08A 5GM2A 3QE9Y 1A2QA 1FUEA 1S2OA 3FZQA 2DLDA 5TLSA 3O4IA 3ZGZA 1NF8A 3QTLA 4R1PA 4B09A 3PU6A 4KO1S 4RZUA 2XY4A 3ONEA 2BD0A 3V32A 3ZR4B 2FLWA 1O4VA 3FF4A 4KFUA 1Z2CA 3RIYA 2ZULA 3OFND 4GT1A 4X8HA 2CLEB 5JG7A 3DOEA 3WKAA 2QWXA 1W6UA 4YRMA 1JA1A 1QO0A 2CLIB 3BSWA 4OD0A 4RY2A 5AJTA 3IE1A 2P2LA 3II6X 4P08A 3JWJA 4FVTA 1U8UA 2QA5A 2WM2A 2P6RA 4CEHA 4M36A 1M2OB 4BZPA 1DT3A 2IS4A 3ICVA 2KX7A 3U31A 1TLTA 2BEVA 3CRNA 2J87A 4FCVA 1S1MA 3UB3A 1JIJA 4D9EA 2XWPA 3LCJA 2VK1A 2EBWA 3O26A 4ZOLA 4DHEA 4BJ6A 3FCCA 4WIAA 1T2FA 2PKQO 3H83A 2ZYTX 1AKYA 3KJZA 1PL7A 5FBQB 3ASUA 4B47A 5DOZA 5HCIA 2KI5A 3OFVA 1R0YA 1VI5A 3OOWA 4FU0A 1XJ5A 3OU6A 1WXXA 3JRXA 1LJLA 4WOBA 3L49A 3W2EA 4EFKA 3I37X 4QAJA 4P4UA 3H6HA 5A6SB 2AB0A 5T4EA 2VVTA 2C2OA 2CXPA 5DM0A 3ZHOA 4DJ5X 4V02A 3E15A 5CLFA 4FYIA 1MUUA 1WLSA 4A6DA 1NVGA 2VCHA 2DVMA 3MTEA 4RD0A 3G8AA 4MP3A 2C97A 1OI4A 5LNK6 1K8YB 1YV9A 2AN5A 3SYNA 1V35A 3TL3A 3MVEA 5IABA 1ZS9A 3DT6A 4M0KA 2Z6AA 2A1UA 3G5LA 3ID6C 4FGWA 1WULS 4GPAA 5B58T 4A6PA 4URVR 4Z6KA 1R8YA 2RHDA 3ET5A 3EH2A 4I81A 5DYTA 2XE8A 2XUIA 5DJ5A 1J99A 3KD2A 3PXUA 5EESA 4MUJA 1FC0A 3INTA 5KVQA 1CR0A 2VNHA 3OUUA 2R1TA 3TLBA 3T12A 3BCSA 3RTDA 2OORC 2QMZA 1NW4A 4PLWA 3SYMA 4BQNA 3ZCRA 4KDCA 1ZM4A 3DQPA 1TVKA 1MAUA 3RO7A 4L5IA 3R9KA 4YR7A 3PQ3A 4OYHA 1E64A 1SPBS 2CYCA 1NXTA 2QE7A 5FAXA 2OZLA 5CFNA 4BXOB 4LFAB 3L4BA 5COQA 2WY2D 4UNQA 3WTCA 1IJFA 2BP7B 2W22A 2GVDC 4QJ4A 4I9UA 3TLGB 1GKLA 4I66A 1DP4A 1P9OA 2I2CA 1D8TA 3RRYA 3OQPA 4DXHA 2CE2X 2J46A 3LUGA 4Y0VA 4ZGWA 2HF9A 1V71A 1BHO1 2GNPA 1BD3A 1MX5A 3AIMA 3LDAA 5DI3B 3RSHA 1F51E 4OMCA 2Q1WA 1UBFA 1C3OA 1K8ZB 2PKYX 2QY6A 2XJ9A 3DE4X 3ZY5A 5JZMA 1A5AB 1TO6A 4G84A 1FSFA 1XVIA 4WZBA 1KEPA 1VLHA 3P5SA 1TJ4A 4WLEA 3I5XA 2QL9A 1VB3A 3RKUA 1Y33E 2I87A 3QHAA 3AZQA 4RMJA 4EECA 1I2MA 3FWHA 2PIDA 3C6XA 3AR7A 3OU7A 5TQ2B 4C0HA 4XX1A 2HR1A 1QK5A 3VZPA 4ADSG 3RD5A 4FMPA 3UMVA 4C1NA 3IFSA 2ZDQA 2BAGA 5BO5A 1Y3AA 2TRSB 3FUVA 4XSHA 1Q11A 1KTIA 3E1GA 2ACVA 2JAQA 2WWTA 2VIIA 4B8WA 1GM5A 1L8XA 5JWOA 4QVGA 3K6SB 1TT7A 4AUMA 2XYGA 1G6OA 1FBNA 3DDCA 4YASA 3OVMA 4FMCB 4DSNA 4E51A 4L4SA 3FI0A 5HGXA 1OH8A 1B42A 1J23A 3B3GA 3EK2A 5AUNB 1RWKA 4ZCLA 3L7IA 3P2JA 3N2YA 4ZEOA 4GQIA 2A9RA 3N86A 3G5TA 2I71A 4WZAE 1BROA 1W87A 2AEEA 3IJRA 3QW4B 4GSYA 3WR5A 2WWGA 3C15C 2X5OA 4LRYA 1LPNA 3PFGA 3WP0A 5CFZA 4WD3A 4B4VA 4CQLA 7MHTA 3E7DA 4R1LA 2WM3A 4ZANA 3PNBA 1KNQA 1XA0A 3CVOA 4LGMA 2BJWA 1O5OA 3GEEA 4OREX 5JNWA 4IFBA 4Q37A 4BE4A 1OGIA 2VBCA 4HNQA 5DO9A 4C88A 5A6VA 1ONSA 1Q77A 3LXRA 4EW3A 4O4LB 5AVOA 4QAQA 1I2CA 3VV2A 4O4HF 1KRXA 4COOA 1E69A 1E7YA 2RH9B 4GR9A 4OAOA 4G3XA 5EXPA 2WF7A 3SS9X 2ZYRA 3WL6A 3WLNA 1U11A 4MRVA 1RHKA 3JYQA 5ALFA 1I4TD 2VNJA 2OXFA 1Q0LA 2QRPA 1FVXA 2OCLA 1H93A 4YV2A 2V8BA 3HDGA 4JGIA 1EHIA 3PSAA 4A6XA 1C30B 4FFBB 1E2EA 4F11A 1AHIA 1U80A 4FHCA 2PJUA 1V16A 1XZ8A 1HQDA 2XUGA 4G25A 1AB5A 2R11A 4X24A 3ZDEA 1GYRA 2HH9A 4Y0NA 1SXHA 3RFTA 3SN6A 5DEIA 1YS4A 4UXJA 5FPYA 4IJVA 3BBPA 1R5NA 1PS8A 2AN3A 3C8HA 3LDGA 3NU1A 4FJ2A 5EMKA 1EFVB 4I55F 1N9GA 3FOWA 2XZOA 2NTEA 1TYBE 2X77A 5KJEA 2I22A 5KPJA 4RUKA 4Q9DA 4BYGA 1VIVA 1M6EX 1PT7A 4GM0A 1ECFA 1R4AA 3DV0A 4ZIRA 4B31A 2HIMA 3W3AD 3T7CA 4U2FA 1ZVMA 1HLGA 1U9YA 3N28A 3ZDYB 4XVUA 5DM60 1FNSA 4GPIB 2ZRBA 4KN6A 2DU8A 2J33A 1R64A 1EE2A 3BHIA 2XKJE 1NJ8A 3DHNA 4C0JA 3CH5A 2I6GA 1UM8A 4QJBA 1L7XA 4QBFA 3RTEA 2A7QA 5IXJA 3NTLA 2UXCB 1JDVA 4PRLA 4QLAA 2IL1A 5DGTA 5IHXA 4ZV7A 4EVRA 3P4UA 1HM5A 2X4IA 4QQ8A 5K6RA 1LQTA 4GZ5A 2OXIA 1PV2A 1RHJA 3IPAA 1G8MA 3VJRA 1COWA 3Q3VA 1BKYA 1O97D 2HC9A 2RH8A 4WNYA 5AXBA 3CNOA 3V2GA 1T9ZA 2HADA 2PVSA 1J2EA 4QFBA 3V4PB 3KFVA 1J49A 2FDRA 1JE1A 3ZWKA 3KSZO 1JWBB 3RAPR 4CG1A 1G7SA 2HEIA 3PYMA 1M1UA 3MINB 2CLSA 1UPXA 4Q4AB 1FXWA 4YFYA 5FLKA 4A4DA 4L08A 1XTJA 4L8YA 4CR8A 4YCJA 2P69A 3DVLA 5DK6A 1C8VB 5FFMA 3UEOA 4PHGA 1SKYB 5HK9A 1J9GA 3KKZA 1XTVA 4ZVLA 2ZS8A 5E1MA 1JRLA 2IE8A 4UDXX 1X8LA 2B9VA 3ISJA 1CZHA 1FP7A 1K98A 4FDTA 1QIFA 3CO5A 4E3ZA 1Z16A 1NQWA 4DIDA 4QU0A 2ZITA 3RNLA 4WKGA 3N6XA 1KYXA 1G98A 4QPZA 2A7XA 4MR8B 1BAPA 1AKVA 1N2EA 2QQ5A 5BR4A 3T7IA 1I13A 5C4IA 3O75A 3CIOA 2J6BA 3DEFA 3ND8A 3FMGA 2WHYA 5LCXA 2BBOA 3ZQUA 2ATEA 2YYYA 3VC7A 2IZ7A 4NBRA 1VXOA 1YJXA 1N6PA 4JI7B 4MWTA 2NXCA 4L5YA 4IDQA 4BVEA 1T2VA 3GBSA 4D2IA 4G89A 5ITZA 2ZWVA 5LBUA 3CT6A 4EAQA 1Z5ZA 3C4VA 3ESZA 4I46A 4R8RA 4GH5A 1CRZA 1YIDA 2XYRA 4OJKA 4YLEA 3U13A 4NFLA 3TZLA 1FA9A 3ZCUA 2GZSA 4NZMA 2I91A 4ETIA 4G1UC 1HYHA 3FDIA 3QLUC 5CPBA 3B9RA 2JD2A 3DF7A 2XKAA 3DA8A 4RPLA 1Y5NA 5JO0A 3IT2A 5ARBA 2Y92A 1YA4A 3PNYA 2ROQA 4M0PA 1MJGM 3AYZB 2EL7A 4WECA 3RS5A 1EWYA 2BBSA 3NC1C 3QIVA 4XARA 4ITRC 2YDYA 1SBZA 2DFKB 4BQIA 5SZKB 4R05A 1ENZA 2ANBA 3IXMA 2OBMA 3BBLA 2V3WA 4YP7A 5HE8A 1HNZB 3K0AA 3MCZA 3WB1A 4XGRA 2XSZD 3O4VA 5JNLA 4Y2SA 1I0IA 3BWVA 3EXG2 1YB1A 1E1RD 4FGJA 3TFWA 3PEEA 4G37A 1UOOA 1KDZA 1AQUA 1HDOA 2QU7A 1U0LA 3T5DA 1NXSA 3ITEA 2VH2A 3DL0A 4I2VA 4X1YB 1NU8A 4NYMR 4KPGA 1IHUA 1H2FA 2P2SA 2OFWA 2Q5CA 3GVXA 3MFYA 1MB0A 3HGMA 4RS3A 5M04A 2HU2A 3UMMA 5JDCA 2QQ0A 3GA5A 3KQKA 4F56A 3KOMA 3EVTA 2GERA 1U3WA 4P36A 2BRUA 1II8B 2GBCA 3EHDA 3QLEA 3T5PA 1BWPA 5ES4B 2RJ3A 2ZYAA 4QWWA 1N92A 4FYYA 1Z0FA 2G7MC 1YZNA 5ADWA 3KLNA 5C46F 3ZU6A 1FNBA 2C2HA 3WRXA 5D6NA 3L6UA 4AJKA 3B6MA 1DHRA 3V4OA 3C1OA 4RABA 4URZR 4XLZA 1E1MA 3I76A 3K9HA 2X14A 3RT1A 1YVRA 4RW0A 2FZ5A 1IB6A 4HQ0A 2QNIA 4KO4S 2W6IA 3L8EA 3W8NA 4Q7QA 2VZEA 3HNPA 4MA4A 4OHUA 4U7JA 1QU3A 1PDVA 2GN9A 1N9ZA 1PDWA 5EMJA 3K0KA 4BNHA 2HDHA 5CA0F 5K0BA 4WJZA 5KVSA 3ENNA 3LG2A 4LDZA 1AQYA 4MVJE 3EIQA 4BMZA 1DMSA 2HQBA 1FLAA 2VYVA 1ONPA 3DXZA 1EINA 1N25A 4NH0A 2C5BA 4JJGA 5T4HA 4ZQBA 2R0QC 3LZCA 1QX3A 4DC0A 2BHNA 1Z0SA 1U4SA 2YC2C 2OO5C 5HQJA 5TV2A 3ZWWA 3BN3A 2XNDA 3JVUA 3CSDA 1U4OA 4D9FA 1CCWA 2BKVA 4AF6A 5I9BA 4BS9A 5GZ6A 5TF0A 1WUJS 1GAXA 3QJ5A 4ME6A 3STYA 3GRVA 3WGGA 5BNTA 1NKTA 3FWNA 2AE2A 2DYKA 1GTMA 1BNCA 1C3LA 1T1SA 2JFBA 4UJ5A 3K70D 2WWYA 1RZRD 4LS3A 1FF9A 3FDFA 4D42A 3EEBA 1E7SA 4DUGA 1UDXA 3FSRA 5A03A 3NZEA 2X3FA 2ZJ2A 4IMRA 4PR3A 1Y1LA 2AFIB 2QB5A 3K5WA 4UUNA 5K09A 4M9QA 4HR7A 4LJRA 2E5WA 1TLFA 3B9QA 1PD1A 2YCBA 1SBIA 5AOCA 1TEZA 1K86A 3CUEF 2HSEA 3I9V1 4DLSA 4GSKA 2GZDA 4UUPA 3LGXA 3VA7A 4G1VA 1Y9ZA 1B3BA 1ZIXA 2OKGA 3E1SA 3DXXA 3D8BA 5B2EA 3KQLA 1W59A 5F33A 1UEJA 3DNFA 2J59A 1N6HA 3CZPA 2H1WA 1XV5A 3EB9A 2C92A 3DAGA 1UBJS 3GUUA 4HZGA 3T15A 4NEGA 2P2YA 3SC6A 1PP4A 1F8XA 1TD9A 3HV2A 3P9KA 1AN0A 2EP8A 3K1JA 4AKTA 5BSHA 3HXKA 5SICE 2QZPA 4URXR 2YOFA 1V11B 4PG8A 1I2AA 5I9LA 3CE9A 2R6AA 1T25A 4RJ2A 5TRTA 1L7OA 4F46A 3OH8A 4PX9A 1JZSA 1OYWA 2P9CA 5EP4A 3RRNA 2VQFB 1E2HA 1ZYUA 3WGKA 4OI1A 1I9CA 4RA9B 4YDRA 2PYZA 4TN1A 4C3OB 5B3KA 3ZJUA 1O9HA 1W88A 2IYNA 1A4RA 3JX9A 1XZBA 3Q7RA 5I3CA 3HB9A 2WBLC 1R9GA 4JUFA 3H9UA 2J3EA 4KQWA 5L3RA 4V1CA 2O52A 3GAAA 3IIKA 4YI3A 1L4YA 2I9PA 3DSRA 4F2HA 1NW5A 2NZUG 5EMNA 3PUXA 3PQ5A 4ZDWA 3SDZA 2JJ2A 4DA0A 2V96A 1I3MA 1QYRA 3B53X 3DQZA 3OLYA 2A5YB 1FRVA 1EUCA 2PKCA 2ZT7A 2YL2A 4R9SA 3MJCA 4G0XA 3QBDA 5DM4A 5A0TA 4AZ0B 2DSTA 2LXNA 4BP3A 2B69A 4D8UA 3JWHA 1DKOA 2ZJAA 3GCWA 4Z4IA 1KO8A 1VFPA 2OTCA 4IF4A 2ZTSA 4J49A 2C04A 5LPNA 4F4CA 4QUKA 2ZJ4A 1X8KA 9LDBA 1LVUA 3MGCA 1FDIA 1WIWA 3WRVA 3CUUA 1EUYA 2W2MA 3GQBB 4I9HA 4CJXA 4MUXA 5LXTB 3O2QB 1SCJA 3EZ2A 5TGZA 2JJ1D 3ADKA 1R9JA 5BMOA 1ZK0A 1OWNA 3LBHA 4BJHB 3BWCA 1E7WA 3L6CA 4I50B 4RD4A 2V59A 1SBTA 4HQFA 1RE1A 4EG3A 1KZ9A 1MO4A 1Q92A 3H9GA 4N3CA 3HY4A 3C3KA 4IJ6A 4ALIA 3QEOA 4HRAA 3LO5A 1R37A 3TOSA 2VC2B 3ILHA 2KWIA 2ISCA 3N3BC 5CDFA 3ZD8A 4JSTA 5TARA 1VMEA 7GPBA 5IS2A 3CW9A 4BRSA 2RHTA 5D5HA 1DG9A 2C57A 2I6XA 1ETHA 6GPBA 5GAJA 2ZSFA 4OLHA 1QLJA 3WKDA 221PA 2YASA 3DFZA 1QQBA 4QELA 1AA9A 1GU7A 2XUQA 1KEUA 1FFDA 3U9TA 2O8EA 3KE8A 1Z7WA 2GAIA 3OZTA 1SB9A 4U7WA 3IQEA 4Z1MD 3WFJA 4PSCA 4D0GA 2Z5FA 3EVGA 3V7WA 5KYNA 1N1MA 4C4AA 4WFIA 3KDAA 1J2UA 4UMFA 1JJFA 3PQ8A 4PHFA 3EVNA 5ELXA 1EUZA 4F1WA 3KB2A 2NYRA 1P0PA 1I4WA 4O29A 3V7UA 1O5TA 3FBGA 4QX6A 4FX2A 5KQRA 2QJTA 4KBFA 1E1KA 2Z2YA 3WIDA 1OBHA 1DDOA 1T5IA 3UCFA 2YJTD 4H7PA 3WLHA 2OBYA 3EPKA 3KB1A 1ND6A 2G8LA 3K1AA 4RCVA 2FUG6 1Z62A 3ZJYA 3AVTA 2JLBA 1BGXT 1K5HA 3AJDA 3W5HA 3ZJVA 4TSRA 1YR2A 4BPRA 3EOZA 1IXYA 1GCOA 1VKNA 3MCTA 2PGIA 4WKBA 1XVTA 2GN2A 3IP7A 3LD9A 4QECA 3ELWA 1XTQA 1D2AA 5IZCC 3BIFA 5CLHA 1L5SA 4V2IA 1JXQA 5IYZF 2I7CA 1IMOA 5ILQA 4YY3B 5CNKA 1QF6A 3TIFA 3IEXA 1UKEA 4BMCA 2HQRA 2IXEA 1CR4A 3G8CA 3OCJA 3F6YA 3I9JA 2K5UA 2ZAGA 3DW3X 4IHJF 4QDKA 1X19A 2L82A 2LRHA 3DTVB 2HGSA 3T3MB 3AVVA 1JR3E 3P0HA 1Z39A 2X8BA 2AEMA 1ID1A 2RCYA 3F71A 3Q7SA 1PUIA 2NNLD 1X86B 3LF2A 1JU9A 4U7HA 3LAWA 4QQNA 5AK4A 5FOUA 5HUJA 1SUPA 4PINA 3TLMA 4R4JA 4B6RA 4ITUA 4LC1A 1QKIA 1HETA 1VLVA 1VE5A 1KYYA 1N6IA 3BHJA 2JCYA 3L7LA 5IVPA 5I7OA 3CZCA 1H0HA 4UJ3A 2VEDA 4N0EA 5FBHA 4ANFA 1D4ZA 1RABA 2Q5LA 4QBKA 3MMZA 3I64A 4HHEA 5DWQA 4D5GA 1WTAA 3KUCA 3W3ZB 3LQQA 4R16A 3KPWA 4FINA 1PYOA 4NYIR 5EJ6A 3DBLA 4DNOA 4LNAA 2GCIA 4BNNA 5BWCA 3NBYC 1CERA 4ARVA 3LUJA 4EVQA 1IUPA 3AR6A 1EJBA 1PWZA 5EQJB 3W5JA 4QOHA 4WOPA 3OOEA 3GELA 3IQGX 3QOXA 2Q21A 5C8XA 1SUDA 3W5UA 4BNIA 3CF4G 5E9QA 4DLNA 4WBXC 2YWXA 5CDYA 4PLVA 6CHYA 2AHRA 1Z6PA 1T3LA 3QLVA 5F2KA 4LMRA 3TAXA 3F7OA 3P45A 3AVUA 2G7ZA 3ECSA 4F84A 3I0MA 1OWMA 1O6ZA 1Q2UA 3N59A 3FTQA 3NFRA 1YQQA 2CUZA 4KK4A 1LVHA 4WN9A 4X97A 4R8VA 2FP3A 3ES9A 4LZZA 3RVPA 2O2CA 3TUIC 3I0NA 1DPFA 2H8KA 5G3YA 2QQGA 1UOEA 5E38A 1MAVA 2BFDB 3O82A 3IR7A 3Q72A 3CURA 5DLPA 2JBWA 1QFXA 5IBPA 1VSQA 5HRAA 1UXJA 1P4RA 3KAQA 3BFJA 3GUVA 3ZN2A 2A35A 1GVNB 4QBIA 5IJ0A 3VUEA 3RS9A 1YDEA 3NLLA 4HWKA 4JJKA 4RA6B 1C3EA 1RSZA 4FNGA 1Q0SA 4UUQA 5IARA 3QVMA 4P53A 1T6XA 4GI5A 2F8TA 1DV1A 3CVVA 5A4MS 2QYSA 3BWMA 5ERGB 4EQZA 2VHTA 1YZGA 4F2WA 3WJ7A 2XDYA 2WM9B 1QAQA 3O8NA 5K45A 1XCOA 2G9UA 1UF9A 3K72B 1C7IA 2WTMA 4OOEA 1E1QA 1QQ6A 3OA2A 4HTFA 4LW8A 3T4EA 2F4VB 2R8ZA 1EAYA 1XD8A 2YWDA 4UCFA 1MJNA 9LDTA 4P2BA 3ORSA 4GPBA 1YS9A 4Q12A 1P9LA 2X2OA 4GLFA 1GG8A 2AJBA 3F78A 4M0EA 2H3EA 2QP9X 4GEKA 3UYKA 1KE2A 3KZMA 1EX1A 3PF9A 2JKYA 4E4YA 3PXAA 2C1ZA 1KRWA 3SQMA 4U8HA 2VI5A 3LC2O 3G1TA 4RYDA 2QSZA 2VSYA 1U2PA 2R6FA 2Z09A 5DU2A 5GMOA 4D8VA 4DQVA 3ZVKA 4QGHA 1KI6B 1L9KA 3RS3A 2EHDA 3UGTA 3BE6A 4B6JA 2ZJFA 1E18A 4XAQA 1DQSA 1IFXA 2YMPA 4PC3A 3JAKB 4L5BA 1G3MA 3D0RA 2EJTA 2RH4A 1GR1A 2IA5A 4G8DA 5INTA 3ZD7A 1NVMB 2JHPA 4A1FA 5F7XA 1UOQA 2HA2A 3BXEA 2OHOA 4IYJA 1LNQA 4MQFB 1M72A 5KQSA 3NVKI 1KJQA 1XKXA 1QCZA 1CUDA 3H5LA 4WESB 3Q3IA 1Y1RA 1V7ZA 3P0EA 4OH1A 2A86A 3LL4A 3LNCA 1RE0A 3OO1A 5C52B 4W9RA 4Q7MB 1GG2A 3X2SA 4EITA 4H7JA 3TIIA 1WU8A 2H4FA 3MUFA 3CQ9A 2YJGA 4L9AA 4ZRDA 4CMKA 3ER9A 2GAOA 4ILEA 2B4KA 3I72A 5H1YA 1QRAA 2IYVA 2DBYA 3GLHE 4MVXA 2RK4A 3LUPA 2NV6A 1KARA 1CZKA 4UTZA 5AK0A 4AUNA 1Z63A 4DA7A 1DJMA 1I5EA 2JIOA 2JHFA 5FL7A 3PFFA 3UPUA 4LDQA 3FHCB 4O4HB 4V0ME 1F12A 1DG1G 4DTIA 3AQIA 1LS6A 3W7AA 1JA9A 1QBGA 1MOSA 1JHQA 3QEAZ 1X9IA 4L0CA 1RC8A 1SC6A 3E5MA 1AT1A 2HRZA 5CNJA 3ROXA 5EIEA 1ZR4A 2Q2NA 1T6BY 1D3AA 1C9JA 4PQRA 5AHRA 1THGA 2FW6A 1T1RA 4OM8A 3MILA 1DTSA 4UTNA 4N0DA 3WO0A 2PXXA 2VDVE 3GVCA 3GWGA 4QFCA 1RM4A 4DM4A 1RAEA 2MSDB 4U7FA 2X9QA 1A9XB 2FW7A 1Q7BA 2X0FA 2F3SA 2MSCB 5ENVA 4JI8B 3ZEIA 2M6LA 4FE3A 3DKKA 4ZAFA 5FWYB 2OM6A 1U5BA 2R8PA 4NWIA 5EUQB 3KQQA 1TOAA 3DZJA 2MTBA 4FHFA 3O8QA 4FYHA 4L8VA 4L15A 4NNOA 4GYKA 4UUOA 4WOCA 2WJVA 2NU7B 4ZK6A 2ZGVA 4I55B 5KYKA 5AHKA 5JRJA 1MTZA 5BW8A 4DVGA 1TAUA 2FZGA 2JFXA 4XJVA 3AO0B 1KJ8A 2Y6UA 3R7WA 3W9UA 1P4JA 5ALUA 3SSAA 5FF9A 1TK3A 2RGRA 1BGWA 2CLCX 4M3NA 5CLLA 1OF1A 3BIWA 3FNIA 5L45A 3OTGA 2DULA 4XWOA 1QH0A 2BHTA 4NCJA 4Z0PA 1TVMA 2X13A 1NWHA 2WPDA 5C32A 1QFYA 4GLLA 5LZ9A 2DBVO 4KGVA 1A7KA 1VG9B 2FB9A 1HEIA 4RYLA 5DT9A 1ONBA 1QNFA 2QZ4A 5ENDA 2PRKA 1T8UA 4LF8B 2UXDB 2BKAA 3H4VA 3D3KA 5L3QA 4BB5A 3VKHA 5K3FA 5MF6A 3SX0A 4GMGA 3L1UA 5BRAA 3RUFA 3ZGYA 3TXXA 1JR2A 2X40A 4HWRA 4JP3A 3U7JA 3ULKA 5FBZA 4BEBA 4KXLA 2V7VA 1QGDA 2E5FA 4BU0A 4CI9A 3STWA 2RHHA 1YF3A 2QVGA 1HOXA 3JALB 1JGTA 4F9FA 1AUXA 3GGGA 4LUCA 4OVKA 1TJ5A 1MPXA 4NCNA 1I8TA 3THSA 4EHKA 3HDVA 3VOBA 2JFFA 3B36A 5CD9A 1SU7A 4LRUA 1N8KA 3EUEA 3FH0A 3JVIA 3NJ8A 4H08A 2CB9A 3IBGA 3U9SA 1M34E 4NPCA 3FMVA 3UUEA 4IF6A 1QCYA 2XXAB 3A1SA 2JATA 4DIMA 3CU5A 4PS1A 2ZUUA 3MWEA 1N2BA 1WVGA 4KRXA 5E8JA 2C2MA 3EHEA 5AKIA 2JIZA 1M73E 3TRJA 3NNSA 4WKCA 2VJAA 2SICE 8GPBA 3QWIA 4D8TA 1RRVA 4OLFA 3O84A 4TKVB 3TAUA 1GZ4A 5AVWA 1RKUA 3INNA 2HT1A 1RRFA 1VBFA 2P2ZA 4EY5A 3S44A 3SDSA 4H1HA 1KMIY 2C82A 3K1ZA 1VJ5A 1O89A 2VSQA 4ZYVA 3HXMA 5AXAA 5JJIA 2WUVA 3F4BA 1ZJ5A 2BWJA 4PPFA 3ZZ1A 5K03A 5EGNA 1ZOLA 4K6CA 4KTTE 4YJGB 1FUKA 4ZWNA 5DHAA 1OI3A 5EQFA 1M6WA 1E1DA 4GI3A 2O3TA 2VCYA 4C1BA 2R8EA 2F1KA 1Z0UA 2B2CA 4P86A 1OA1A 5A1JA 1Y1KE 2R2AA 2LZ0A 1IRXA 5KTYA 5U4XA 1G21E 5A9SB 3Q2KA 4OQ4A 4D3ZA 5HIKA 1SZDA 3GZNB 2DQZA 2UYGA 4XB6B 4B80A 4D57A 2WTBA 3D5EA 4G36A 1QPGA 3AF4A 2YQ5A 3H5VA 3K0BA 5KSOA 3OEHA 1LEHA 3D7RA 3J7AC 1U6IA 3CKYA 5E4YA 5EOVA 2CVQA 3VGJA 2OCAA 4KSBA 1QIMA 2J8ZA 1W35A 4I4TA 3U4MA 2GK3A 2IPOA 5E1DA 3ASZA 1UJBA 3SQWA 2X0KA 1E4OA 2BUAA 3KR0A 1GA1A 2FG7C 1KS2A 2XEDA 2GEBA 4FZ3A 2Z56A 2H4ZA 3S55A 3D43A 5E0OA 5KJFA 1FDWA 2ZKIA 5CIQA 2FMIA 4BLTA 1LDEA 3IERA 2ZB8A 4TM8A 1ODCA 5K6AA 3QFFA 4U9IS 4WVLA 4N3NA 4EH1A 4UM9D 3ROKA 1SBHA 3NAZA 3UT5A 4RF2A 4IIHA 4GP6A 3KNZA 1EGAA 1CW2B 3WMEA 2ADMA 3PHCA 5TXGA 1T0BA 4Q6WA 4CL2A 3VZQA 2QZZA 2V7XA 1XMOB 3PJRA 1EDBA 3FB4A 4YX9A 4ZVUA 2HWUA 3SM9A 4MCIA 1CUXA 4ZV9A 1REQB 2R7KA 4JK3A 4PWZA 5C31A 3RE1A 3R6GA 5H9WA 3TTTA 2FSSA 1QGED 2JAHA 2E89A 4OMDA 1CY2A 3KELA 3QVVA 3AHFA 4J16A 1SR8A 2MIIA 2IZ5A 3H0CA 4WLOA 1NJFA 1SO8A 2FVXA 1ZGBA 1W25A 2ZANA 2AMJA 3B3QA 3D3QA 4DCUA 3UJ3X 2IOFK 3I23A 3EVDA 2F48A 3CNQS 3TVDA 3ZU4A 4QJIA 3SJCA 4B3MB 3PBKA 3J80A 1PBTA 2DWCA 2CMHA 3O1JC 4PZ0A 3OZRA 2B21A 4QDXA 3PRYA 3R3HA 1C3VA 4G5XA 1DADA 2OOSA 3ZDXB 1ZVVA 1Z83A 4L8FA 1B7GO 1ZVQA 2IH5A 3PXCX 1ECCA 2FPSA 3QBVA 3AVOA 3ADOA 2BVNA 2ACWA 2PT6A 4HADA 1IDN1 4CQMD 1UMCB 2XYQA 3SVLA 5F51A 3DDUA 4GE3A 1UJMA 3JD0A 5ABPA 2G1PA 2QM0A 2WICA 1H5NA 3QG1A 1UC9A 2FCAA 4JNKA 4TLBA 3PQ2A 3SIWA 3VX4A 4AN4A 1XPJA 4CRWB 5DNEA 2HA6A 2NU8B 2P62A 4KE8A 2V6IA 3DAOA 5CA0B 2A4KA 1Y3CE 3FFWA 5CLIA 2FI1A 3AG6A 4ESVA 1Z3IX 3AWDA 5IT9A 3KSMA 3VJMA 4L4YA 3PCTA 2A3NA 4GBJA 4X62B 4HEA6 4WLUA 4ZMRA 3HCPA 3ROQA 2VDQB 1CXZA 4L3WA 3CXRA 4JKIA 1I30A 5C4MA 5LJIA 1OIWA 3H99A 3Q7IA 4I6GA 3CLTC 4MOWA 4C5BA 3SBXA 4EENA 4QUJA 2HTEA 5H70A 1KP3A 2WU3A 4LZOA 4QEZA 1D4AA 1EDEA 4RM2A 4BLPA 5JCZA 1VYUA 1LA2A 3AOGA 4ECEA 4EZEA 2QRLA 4OQXA 4JP1A 5IC4A 1CVRA 1EXDA 1DQNA 1KBQA 4LXXA 3I62A 2PAFA 1UP6A 4N48A 3C41J 4OK5A 2DUNA 2QE6A 1NVEA 4D8YA 3FCUB 2JB9A 1PJ2A 2XMSA 4QXOA 1CP2A 2HNKA 2VK4A 2GO7A 3ZE0B 1PFVA 1JBQA 2F2TA 2QJFA 3R7AA 3ZNNA 5JQGA 3BX1A 4HX2A 2ZPTX 4MQ6A 1VC2A 2ZIFA 1JLRA 2RHJA 4GL2A 2GUWA 2P3LA 4ZYYA 4IDFA 4IBOA 3PPVA 5B53A 1QBKC 5E3IA 4OUDA 2RAPA 3QFSA 4AJ9A 3TOZA 2V5VA 1ORWA 4RV4A 2ZSDA 4L8LA 1DCFA 3B6JA 3QXXA 5FORA 3GD7A 1LFAA 3KC2A 4QHTA 5EHNA 3WLIA 1E2GA 4EEXA 2BEUB 1DO2A 2WE8A 2RHGB 4R1QA 2ADFA 4WZZA 4C6TA 4YR9A 3ANTA 4LWZA 2GDJA 3DBRB 3IVGA 3GJ0A 3UJNA 4JJAA 5EJMA 4LHVA 1NLMA 2MSKA 4B7UA 4ZO6A 5AVRA 1BGVA 3SIPA 4LBZA 1JSRA 3U4GA 1S0UA 1KAMA 1WNTA 4JLMA 5JQWA 3OPMA 5IAOA 1PJCA 2QJOA 2R44A 4ZPJA 5CW1A 1L2TA 3U1TA 5I45A 2P30A 3JWIA 2W2TA 4W1RA 5FOWA 3K35A 3PE6A 3VPFA 1AV6A 1ZQ1A 4G4IA 4MP8A 1NVVQ 5EQTA 3THOA 1GWNA 5TSDA 1V3TA 2FEXA 1RLTA 4HYEA 4MPTA 5LMUB 1PZMA 1FYDA 1ZITA 3COWA 2AOTA 2JBHA 1XEXB 3FCXA 4PF1A 3QNUA 4RJJA 2G6BA 2JI9A 1MXFA 3G2KA 4ZZ2A 4M0MA 4LF9B 2YN0A 5HDBB 4IDCA 1P6UA 2D1YA 2XUAA 2WUWE 1XAJA 1VGQA 4LX8A 3MWDB 1SQFA 1KZ7B 1E77A 3B2NA 1VG8A 3M6AA 1F8UA 1F7VA 1Z25A 3O95A 1XTZA 2AEFA 2E4YA 5J4KA 1CUJA 3MCVA 4LDPA 4YJ3A 1BVYF 1IQUA 2QN3A 2WK1A 1HLDA 4RK0A 4E21A 1VYHA 2CHUA 1KYQA 2LCFA 1EEXB 1F0NA 2DBZA 4FCTA 4CCSA 3STHA 2R6GA 3GMDA 2PD3A 5EXEA 4ZEWA 3ETCA 1WOYA 2GYWA 3A9CA 4RPHA 4XQGA 3SR0A 2XYVA 4MLDA 5F35A 5TJ9A 3NATA 5BN4B 2ORVA 3C0KA 4NZPA 1NW8A 1Y6JA 1WSDA 1NMQA 2BH9A 3NTRA 4FYWA 3UAZA 3N2GB 4GQBA 5SY4A 1SQSA 2OE2A 2QW1A 3HWX1 3T3IA 3L2OB 4KQFA 1VI6A 5ECGC 2AXEA 1RAGA 4N49A 2WJYA 2YY7A 4ZOQI 1RADA 1JIQA 1GZ5A 1RI5A 3A1EA 1P5ZB 3GW8A 3KXLA 5HTKA 4HG2A 1Z5GA 4J7UA 2ZBDA 1KVTA 2AXPA 3GG9A 4HDKB 3AP2A 1FLDA 4Z9AA 1S4MA 4FDMA 2ZZNA 1XXHB 1JVNA 1YVDA 2G9NA 4NOLA 2PZGA 1RWMA 1XYGA 2GAJA 4J1SA 3OT1A 5TT0A 1T6YA 2F7SA 1Z33A 2JAWA 2XJ4A 1XLUA 3TOXA 1HFWA 4R5MA 4YVFA 4H7DA 1JECA 1T36A 3KJQA 3WLTA 4W99A 1ACMA 3ND7A 3T9AA 1JXAA 2H9YA 5JC1A 1U2DC 4YAFA 4DOMA 4PLPA 2WRZA 3A6EA 1L7BA 2E48A 3FLAA 1W1IA 4KPFC 3P32A 1U1FA 1VLZA 3L7AA 4G1BA 3E9EA 3WNBA 4B6OA 1KIFA 1L7MA 2EQAA 2W2NA 1UMBB 3OE7D 5LFAA 4IMIB 3IUSA 5JCJA 4RHUA 5FHQA 4P7GA 2CVPA 2HQSA 4RDXA 4E46A 5CYFA 3ZK9A 2NX2A 2DQSA 4A27A 2CHGA 2VN8A 4FW8A 2PZFA 3EGVA 3DV0B 1YDMA 1VP9A 4HNGA 3E18A 1HTWA 1VA5A 4DJAA 3G9UA 3O90A 3QV1A 4CTNA 3P9SA 4YTEA 5IMBA 2WTXA 1P91A 1XWWA 1IM8A 4XPZA 3LQ1A 3VKVA 4ESEA 1OXSC 3HCOA 4PLHA 1GDHA 4A5SA 2HF2A 3CCBA 3OPYA 1DOHA 5F1OA 1O9BA 1X7WB 4M6WA 2D06A 4FEYA 1GLNA 4EELA 5KPDA 5IYZB 1C81A 1H22A 2BZ0A 3WK4A 1JVSA 1KMNA 2W58A 5ALDA 1MQSA 4B46A 5MN6A 3EQ2A 4JLAA 1NQVA 4U9UA 4I4NA 4IHJB 3JR3A 4QNNA 4JI4B 4Y30A 3DE1X 3L8CA 2QI9F 4HWPA 5KWVA 3QQ5A 3IAM1 5C80A 2X6TA 1IBCA 2H2AA 1FTGA 3AOEC 4R98A 3OJFA 2HRDA 1R0SA 2J0UA 3AETB 1NOKA 4QSHA 4DR5B 2BYTA 4R81A 1H05A 5DTRA 4A16A 1F20A 1RM3A 1A9SA 1NJSA 1KL7A 2PR2A 2WSYB 2AQ8A 2WSSA 2X8JA 4MJ7A 2MSEB 3UV6A 2QYHA 1PTJC 1WG8A 2UVDA 1CQIA 1S2DA 3D4OA 4EQ6B 4P4LA 1ODTC 3L40A 4B82A 1EP2B 2O2JA 2P68A 4BFUA 4EHBA 2H5EA 2DAPA 2KPOA 4GR5A 1GSAA 4HGRA 1MC4A 4N65A 2A8YA 3N2IA 4MW7A 5E7JA 1G38A 4UOQA 3FHTA 4YGYA 1OJ7A 1N5IA 4KEAA 1MX1A 1VKOA 4RVCA 3RKSA 4DA9A 3W2FA 4ETMA 3IAUA 1A9PA 3OT4A 5EJ7A 3DZCA 3LTEA 1J8MF 2P7HA 3AXSA 1M8GA 1R3UA 1BVRA 1A0OA 4TQUS 3U16A 1E5TA 3CZRA 3ILVA 5D2CA 4DV6B 4MITA 4DJTA 2N0SA 2X3YA 3HVIA 4UW9A 5EWLB 2OQRA 3KZNA 3S7ZA 4ZVNA 2W6MA 4L5AA 4Y9UA 4A2WA 3GGCA 3ODGA 2YS6A 4C20A 5A5GA 3KKLA 2JGDB 4DKXA 4RVGA 3V8RA 1JFLA 1MNAA 5GIOE 1GRNA 3CNHA 3S68A 3VYWA 3D6NB 2HU5A 2XI4A 1VSVA 4BJ1A 1HG1A 3PEYA 2O14A 3WBJA 4BO8A 1WHSA 3KPUA 2AQHA 3UZUA 2WIBA 1JDBB 1E3TA 1T2DA 3VR2A 1OZGA 1B26A 1R9NA 1N77A 1BFKA 1JLKA 2C58A 1NATA 3RTCA 5K8VA 1QM5A 3GP5A 3R3JA 3SIRA 5KTNA 4HYTA 1SUAA 1U7DA 3IA7A 2NTVA 2DRIA 4QVKA 1FP6A 2HLDA 3OE4A 1IZ7A 4P81A 4HEHA 5J23A 4KR0A 5DT2A 4C7OB 2W2LD 2I6FA 4MA5A 1WABA 4RK5A 3U7QB 4ND8B 4O3FA 3BG5A 2BONA 3BFPA 4PNHA 2GJAA 4M83A 4UPVA 4MP6A 2VYND 1NMSA 5EL0A 4EGAA 1TNDA 2ZJ0A 1QRSA 2IHYA 2X0JA 4DDUA 3VTFA 4LRTB 3DWFA 4QXPA 4MS4A 1I5RA 2H11A 1UPBA 2C4VA 2ZE6A 2HYDA 2ZYDA 5ALEA 3HU1A 2X1VA 3EWSA 4IZHA 3OJCA 3AX6A 5CXQA 2C2BA 5FNVF 3MBOA 2G9RA 4AUKA 1GGVA 3HA3A 5THXA 1P1FA 1OFHA 1AKUA 2HCJB 3IHKA 3IO3A 3W5SA 2WJIA 4NK4A 2AUMA 3PT5A 4ZU6X 2VS1A 2OCGA 1YHNA 4LXUA 3FOAA 3OKAA 5CCXA 3E9RA 2H08A 4MVJP 4F93B 4IUCS 4M9XA 2AFVA 3MCUA 1SHJA 4TYWA 4L0QA 3VKGA 2G25A 2IODA 1WW3A 1OAAA 1J5XA 2WD7B 1FS4A 2N46A 2WJZB 3NEPX 3OO0A 3OZFA 4X91A 5D5QA 3VNSA 4UMVA 2QZJA 3QUAA 4QODA 3WQQA 3KJXA 1R3DA 4G2TA 4GOLD 1Y8ZA 2PRIA 4G1MB 5CA1F 4Y2JA 2VJBA 4KKXB 1SA0B 2W4MA 3H6GA 2B1GA 5DLQC 2FEKA 1M1NA 1U0TA 1FY2A 1FYEA 2HHAA 2ZIWB 4BU1A 4YONB 2XTZA 1G8AA 3M49A 3VR6A 1D0IA 4OBXA 3QWBA 3QE2A 3HB5X 4Z4HA 4MW5A 3OIDA 1KVQA 1NG1A 1MO5A 3GFSA 1QDEA 4IV8A 3ROZA 3SAJA 1GCGA 1S2LA 2R7AA 4E13A 1F9AA 1B16A 2VAWA 4N8SA 5B30A 3OJLA 3RHFA 3U7HB 1KZ1A 3G2OA 1XWIA 4RGVA 3HSKA 3AZPA 1X77A 1O7JA 2I8AA 4JLVA 4NQZA 1M83A 2O7SA 3U3OA 2WWFA 2ZUDA 2QLFA 1OLUB 1L1QA 4J0JA 3OWXA 3W7BA 2NO7A 4PGGA 4DUZB 3DOOA 1XSEA 5BSFA 3FPFA 1ZGJA 3BTSA 2PHZA 1AX9A 1MW8X 1QNLA 4Z5XA 2JH9A 1Z6GA 5KU7A 2WFLB 3CRRA 2DSNA 1QMPA 3JYOA 3KV3O 3E0XA 2ZR7A 3TNYA 4A82A 3U5TA 1YJAA 1ZAKA 4Q18A 3ZVLA 1L9XA 2ZBEA 5EUCA 1ZUWA 2ZBGA 4C43A 5C1OA 4N9WA 2QSUA 3BERA 5IC6A 1Q0RA 3JZMA 2OCYC 1VG0B 2BDUA 2ODQA 4JY7A 2W00A 3TNDA 3I32A 4H59A 3H9EO 2O50A 3H2KA 5FB3A 3SSOA 2XCLA 3D64A 1D1SA 1M1YB 3BXHA 3MS7A 2NU9B 2IEAA 5EN4A 4FFWA 3PUYA 1XKLA 3GI1A 3ZHXA 1P3DA 1CKEA 3VI4B 1M3SA 2PS9A 1WMFA 4ZC1A 5KAMA 3RU9A 4CV1A 3RQSA 3IJPA 5KU1A 1C7JA 4CFYA 3J81k 5DYGA 4ZQEA 1Y8RB 4XW2A 2PGXA 4KWEA 2F3QA 4DT1A 4MUBA 3FTDA 4S35A 3HJUA 4QA9A 4H4EA 3WISA 1Q7CA 4OHBA 1CIPA 4DIKA 1T9CA 5ITVA 4QQRA 4D9GA 5HM8A 1DQRA 3FRJA 1DIGA 1SG0A 2NXJA 4IX1A 1LK0A 1U1DA 2D54A 2Y9PB 4TMWA 4X54A 1VE1A 3V3KA 1F6DA 3PHHA 4FFPA 1PK7A 4JENA 4Y6LA 4UASA 5GONA 1R8SA 3X3HA 4UKDA 5EIBC 2X2PA 2Z3VA 5K2MA 3M4XA 3L04A 2ZSHA 3UGKA 1QQAA 5IH7A 4Y8VA 3GT3A 1WX1A 3B52X 1RYBA 1RXCA 2DTDA 3MTAA 3NHMA 4XCXA 3UW1A 4EI7A 1SD2A 2AK3A 1CHNA 1O95A 1TIKA 2O8NA 2ZDGA 3AR9A 3D4BA 3LVBA 1UC5B 5DNVA 2L19A 4K46A 2D0IA 3STTA 4MVCA 4TMVA 2WIDA 2QUZA 4UXIA 4N12A 1V4NA 3HB1A 1GZ7A 1O58A 2IXTA 1O6GA 1FTNA 2V7QA 5DGXA 4V1CB 3LKVA 3ZJ4A 1L5QA 2YVKA 1N6RA 1X80B 4MGKR 1FLNA 1M6NA 3FDZB 5K3DA 2IITA 4CR7A 1JU4A 1HKHA 2PKXA 2QTAA 2QRQA 3G9XA 1FP4B 3KU1A 4H7KA 2HUPA 3IEKA 3TD6A 4XSGA 1ZJ6A 1UMDA 2GJ8A 4L95C 4E14A 2VZ0A 4LEIA 1HDYA 1Y3IA 1KJIA 1XE3A 3ZWXA 3OTIA 2G40A 4OQFA 1XDBA 2JI6A 3GAFA 3K4PA 4LC0A 2QL5A 4LVUA 4OFWA 2I8CA 2PFGA 1AZTA 1H23A 5DX1A 3VISA 5BNWA 2P9FA 1AMUA 4TMYA 2RGXA 1WBJB 3CM0A 5J4LA 2CEKA 1SELA 2WAAA 1E5XA 4R69A 4JGBA 3JSAA 4OGLA 3ZXXA 3GPIA 3A6ZA 5LQNA 1KAQA 2O1XA 2CGEA 3I83A 3VR4D 4ZHSA 1A8QA 3TM4A 1CZLA 3WVNA 1MGOA 5HRCA 1VPLA 4MGEA 2EJCA 4B3RB 1GEEA 2Q62A 2QD1A 1QK3A 4YV0A 1FS6A 2QENA 3BDVA 3LI2A 3UA4A 3T0IA 2OG2A 3W8RA 3MG9A 1XTKA 2HU8A 3N7AA 3SFZA 1DAKA 3GN1A 4Z9FA 4YJFB 3GZ4A 4JUBA 4DBZA 1QH1A 1HFEL 1Z6ZA 4TZ0A 5DGIA 1K97A 1DLIA 1KOLA 1P7YA 5LZ7A 1VPDA 3E82A 3FNBA 5H16A 5LLDA 2J0QA 1G20B 1AMNA 1HE4A 3JQDA 1GPAA 1FYFA 1R6XA 1RVDA 4D9HA 2AZDA 1S6YA 2EFJA 1PQWA 1KC3A 4J1TA 2QGNA 2O8EB 4YWJA 1RKXA 5I7VA 4UQLA 4WZBE 3RBZA 4CL3A 1Q20A 3BMOB 3ESQA 4CM4B 2Q6IA 2P6NA 4O8CA 4GM1A 4S0ZA 1NQTA 4Y1RA 5EYPB 1HBJA 4ZVOA 4JL8A 3GUZA 1L5YA 2UZ1A 3CE6A 4OF4A 4Y2YA 5JCOA 2GYUA 3GPBA 5HBRA 4YAJA 5J2TF 2B2XA 2IPMA 3WGZA 1DIBA 2QOEA 3LSYA 4C14A 3SK0A 1Y4AE 1QYDA 3HN6A 4M1ZA 3QPAA 3GLIA 3GT4A 2D6FA 4G9GA 2O5EA 3RC2A 3AFHA 1L4FA 1Q57A 3COZA 4AZTA 3EGCA 4IUDS 1XTSA 4OGKA 1EDDA 3A4MA 2B20A 4N1AA 5AW2A 4UFPA 2PCJA 1ONNA 3B6KA 2ICAA 5EY5B 4NIMA 2D5LA 2AXQA 2YQZA 1L4NA 2G09A 4F8JA 2X6RA 4CG2A 2HCBA 2O57A 2ZB4A 4YT8A 3W5BA 4FR0A 4I3HA 1S02A 2ZM6B 5B12A 4AJJA 1KS9A 3O0DA 4FMDF 3CC8A 4IQGA 4NFSA 3LWZA 3I9FA 4B35A 1V3QE 1IWBB 1XTTA 2IX9A 2OESA 3H0KA 4DQDA 2VWQA 3EQ8A 1N5JA 3N6VA 2O2YA 4HO1X 2REQB 1B73A 2GK4A 3G7SA 4MKGA 3CA8A 2W2QA 4OKSA 1Z5PA 1JJIA 1EQAA 4KV9A 4GX5A 4YO8A 3CWZA 3HEAA 4NJMB 4MDEA 2W5UA 4D44A 1E4VA 5DIFA 1ZD4A 2H4JA 3I12A 4LV6A 4E0BA 5JI2E 3OOJA 2CMDA 1XQWA 1ZD3A 2P90A 2QW8A 3BT7A 4DUYB 4I8XA 4UHCA 3INRA 2AN4A 1Q1EA 3CLRC 4J0QA 1NURA 2WIKA 4P0TA 3ER6A 1JG3A 2WU1A 4U3JB 3L4KA 3IR5A 2ZI6A 3GROA 1N5RA 2V7BA 4GNRA 3PVCA 4LOAA 1PR1A 4XYBA 5DM1A 4CHGA 3KYDA 3FZYA 4D79A 2NTNA 4NFHA 4FDVA 2B8JA 4WHMA 4JJIA 3H65A 5BXQC 5K0TA 3OF3A 1UJ4A 3DWIA 5T8KA 3MA0A 3ZX5A 2EP5A 4FKZA 1J0DA 4GECA 2AFHA 2XT6A 3EASA 3TXAA 3Q1KA 1SIOA 2XCOA 2OPHA 1ODLA 3RK1A 1I33A 4WCFA 4AWAA 4BHTA 5CB4A 4Y2GA 4AZ3A 2XDQB 5ELMA 4ZYTA 1EG7A 2EP7A 1PWXA 2FPWA 3TIVA 5KOHB 1RCFA 2FVYA 1TAGA 4C0BA 4WFJA 2IZOA 4RTJA 1BFUA 3HDYA 4JVSB 1EE1A 5EFZA 5LBTA 3WMFA 4C4ZA 2Y0EA 1KAEA 3QLTA 1O96A 4WK4B 3KALA 1TEHA 3UM9A 3WNDA 5TE9A 1B0PA 4AUEA 1QYVA 1RYHA 5JROA 3TTWA 1OZ0A 1JU3A 5KVAA 3TFOA 3TG8A 2XCIA 1F4LA 4PZEA 2VJOA 3CKKA 1W47A 2C84A 3A9UA 1JFFA 3GNLA 1JS1X 3FCOA 2QLJA 3ND6A 4P7KA 1Y7TA 1K7X