4LYYA

Crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
179
structure length
171
Chain Sequence
YFQSMKHTTEVMITAEEIDQKLDILAEQINAHYADSDRLLMVGLLKGSVVFMADLCRRIKGHVEIDFMSVSSRDVKILKDVQSEIQGRDVLIVEDLIDSGNTLNKVRDMLLLREPKSLALCTLLDKPERREVDVPVDFIGFTIPDEFIVGYGIDYAEQYRNLPYIAKVVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hypoxanthine phosphoribosyltransferase
publication title Crystal structure of hypoxanthine phosphoribosyltransferase from Shewanella pealeana ATCC 700345, NYSGRC Target 029677.
rcsb
source organism Shewanella pealeana
total genus 47
structure length 171
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyyA00
1R3UA 1IBSA 5KAMA 1HMPA 4P83A 1NONA 1O5OA 3N2LA 3DMPA 4WMLA 1A98A 5ESXA 5BRNA 1ECFA 1GPH1 4X45A 1XZ8A 1I0LA 2PRZA 1JLSA 4RADA 4LYYA 1AO0A 3G6WA 4RAQA 1Y0BA 4X44A 2HCRA 5BSKA 1TC2A 1UPFA 2GEBA 1ECJA 2PRYA 1DQPA 1FSGA 3HVUA 2AEEA 4LZOA 1P4AA 1L1RA 3ACBA 5E38A 4LZNA 1NULA 3OZFA 1A96A 1QB7A 2YZKA 1YFZA 3GGJA 5BQPA 1VDMA 1GRVA 2DY0A 1J7JA 1BD3A 4RHXA 1ECBA 1BZYA 1G2QA 1OREA 1U9YA 1G9SA 1TC1A 1ZN9A 4JLSA 4PAWA 4RQAA 1ECGA 2JKZA 4QYIA 4RACA 5K51A 1UFRA 1JLRA 4M0PA 1DQNA 1XTVA 3O7MA 2E55A 1I14A 3LRTA 5BQOA 3M3HA 2H06A 5EUCA 1I5EA 1XTTA 1XTUA 1QCCA 1OPRA 1VSTA 2JI4A 5JSQA 3S5JA 4P86A 3OHPA 4TWBA 1A4XA 1BD4A 4P80A 4RAOA 4P3KA 1QK3A 2XBUA 4LYGA 1P18A 4S2UA 5KAPA 4P81A 2EHJA 4MB6A 4RV4A 1A3CA 1DBRA 1CJBA 2PS1A 4JITA 1W30A 4OHCA 4RQBA 1QK4A 4P82A 1HGXA 3EFHA 3GEPA 2VFAA 3LPNA 4KN6A 1A97A 2C4KA 5IAOA 1OROA 3MJDA 1U9ZA 1I0IA 1VCHA 3KB8A 1V9SA 2P1ZA 2WNSA 4RANA 1XZNA 3MBIA 5HKLA 4PFQA 1G9TA 4LZAA 4RHUA 4QRIA 4ZFNA 2IGBA 3DEZA 1A95A 1L1QA 1STOA 4P84A 1PZMA 1Z7GA 2FXVA 1QK5A 2JBHA 1DKRA 4M0UA 4WN3A 1ECCA 4RABA 4IJQA 5IPFA 1QB8A 3GGCA 4F8EA 5HIAA 1QCDA 5ESWA 3NAGA 3ACCA 3DAHA 1WD5A 1D6NA 1O57A 4M0KA 1LH0A 2JKYA 3QW4B 4QYIB 3OZGA 3H83A 1ZN8A 3ACDA 4RHTA 1UPUA 2H08A 5JV5A 1MZVA 1P17A 1P19A 1ZN7A 2H07A 1G2PA 1DKUA 1I13A 4Z1OA 4FYMA 4RHYA
chains in the Genus database with same CATH superfamily
1OTYA 3R9IA 1W0KD 4I4TA 4JFRA 4R51A 4RZHA 4YCMA 4NENA 1S0UA 3UM9A 2I7VA 1C1YA 1GARA 1C7IA 1GPKA 1C30A 2CCKA 2X13A 2GCIA 2YZ2A 4MH0R 4U3JA 4WERA 3Q10A 2QUIA 3VDNB 7YASA 3WL6A 4HWRA 4Q00A 4EY8A 5CB4B 1YFJA 2BGUA 2IXAA 1RYBA 3A70A 4AYTA 1ZN2A 2WU8A 3JD0A 1F48A 4OL0A 3JQ7A 5ITSA 5HJ5A 3ID6C 2RGGA 1CDZA 1X7ZA 4FFPA 5B3LA 2X15A 1SA0B 4O4LA 1NVMB 3GNTA 4BLUA 1M2OB 4QUBA 4YT2A 2B2NA 2YL2A 2IYUA 2IL1A 2AC4A 3CLHA 4I5IA 5CH8A 3D4IA 5BV0A 3QUTA 5ED4A 4G0WA 5DLYA 2R7AA 1KO7A 4F3TA 2ODAA 2OM6A 3ZXSA 4Q9AA 2FLKA 5F9MA 5KNCA 1SVIA 3RG8A 2YVLA 4RKRA 1T2VA 3F78A 2OO5A 4QVGA 5LKAA 4RPKA 5B30A 2IQIA 4OHMA 3D9QX 4G01B 4NEGA 4RIGA 4D8XA 4IVNA 3W4JA 2V98A 3FKSA 5KNDD 2XB4A 1SU6A 2IOYA 2EDCA 4C4PA 1ECGA 4B1FA 2OBMA 1OYOA 5JJ5A 1DE0A 3Q5DA 3ABZA 3DZIA 4XX0A 3O2NA 1ZFNA 3Q1LA 9LDTA 4O2AA 1R9MA 3E7DA 4HDSA 4F97A 3B3QA 1U28A 3MFYA 3O93A 3EVZA 1SCDA 3KHUA 5FJJA 3SOZA 1T6XA 3G49A 1HLPA 2EX1A 4PIVA 2OYCA 3P9YA 4PSCA 3OMWA 3T9CA 4U7GA 2FHSA 2ZJZA 3DTNA 3UKOA 3I8SA 1UBHS 4RD4A 2ZJFA 1N5IA 1NX9A 4G0UA 1CF4A 2XE8A 3LCMA 3W5SA 4N3AA 5DNEA 3PXDA 5K8TA 4BNTA 1USKA 2G5GX 5IXSA 2CZQA 3FG9A 2WTEA 2XMZA 3BZWA 2PRIA 5ALKA 1SIBE 4GOOD 1CJBA 4I6GA 1WDTA 4JR1A 5IXYA 5K45A 2AI1A 5I9NA 1QE5A 4X20A 4K9SA 4C89A 1SXIA 4LQ4A 1U0JA 1SXJB 2FE4A 2FETA 3QE4A 5F51A 5B12A 2D1FA 2AOUA 1KEVA 3C5CA 3GMSA 3RRNA 4NS4A 2CJPA 4FYXA 5LP6B 4G1EB 1NUTA 3KWMA 3LO8A 4OXNA 4QU8A 4D6XA 5BVHA 2OZKA 1HOXA 1TMGE 2NVBA 1NI5A 2PGXA 5FUMA 1NKTA 1AB5A 2X23A 3BXFA 4F56A 1XCOA 1KJWA 2P68A 4NSNA 1PQYA 1T35A 4UD2A 4TMWA 2GD6A 1DELA 1RXIA 4B7AA 2C29D 1M1UA 2BF7A 3FFWA 4R3NA 4R16A 2ODNA 1RVV1 3PA8A 1R6VA 5BMVF 2ZROA 3TIIA 2FZVA 2HJWA 4PN7A 3O3OB 4TGLA 1V4BA 1O57A 2LR0A 3L77A 1N2SA 4KXWA 3PJFA 3AU9A 4TSRA 3QKRB 6REQA 3U37A 2Y66A 5JSFA 5J3JA 4K6FA 1SVWA 3IO5A 1CUXA 5A7FA 1JG7A 1QOZA 2FZCA 3CX7A 1SBQA 4GYKA 2O0KA 5HEKA 1AZTA 1GNPA 2O8NA 4FU0A 3TOXA 2GF9A 2RJ3A 3SXUA 2VDRB 5JLJA 2HDNB 3EIFA 3A3OA 4ZOCA 2H5JA 4EG7A 1CRWG 2RK4A 4OQQA 2OAQ1 3KP1A 4DLAA 4YT4A 1O94D 4WACA 1Q7TA 1QRTA 5BT9A 3FVWA 2X86A 4IQ8A 1SOAA 1ZMBA 1C0EA 3EDCA 4HLUA 1ZMXA 2RHDA 3HL0A 4MK4A 2CLIB 1YD7A 1E2PA 1N6IA 1J5XA 2BWJA 5GV7A 2YY6A 4BKPA 2HWYA 1X87A 3TSZA 2NO4A 4ZOLA 3WGVA 1L4UA 4EI7A 5I7WA 2XVXA 3KSBC 4HB2A 2NYVA 3CEAA 3ZZTA 2PZJA 5CXQA 5JMOA 2WT8A 1H9AA 3S2UA 1E8NA 4LZOA 5FQNA 5BWMA 2NYRA 3T0FA 3F4BA 1MVNA 1WW3A 1TQ4A 2VT7A 2F3RA 5HS4A 5EZQA 4KR6A 3TAXA 4LUCA 1T2NA 3T41A 4RK0A 3FSGA 3BDAA 4CW7A 1G21B 2E5WA 3IQHX 5HE9A 5IABA 1C80A 4GW3A 1LVHA 2FMFA 2J0UB 3G17A 2OV4A 1CP3A 4XX1A 4MCHA 3AEKB 2JGIA 4E03A 2E4AA 5CNJA 1XDZA 2OHOA 4X1YA 1FVXA 5CDGA 2H1HA 3TLGA 1HF3A 4G5OA 4TTVA 3EX7C 2EZTA 3IVGA 1XMOB 1KRWA 2RHJA 3GPDG 3IMCA 1B1CA 4EARA 5GZ1A 4BQPA 2R47A 2P3LA 2W2OA 4V2IA 3HGQA 2C54A 2UUOA 2HIHA 5LYJA 3RGWS 3RHTA 4ER6A 4R81A 1YHNA 3WGQA 3VKVA 2RHLA 1EQ2A 4DLVA 3F8WA 3TYXA 3B8HA 2F3UA 1BGVA 2F1KA 2IXGA 2ZS7A 2B83A 3U4DA 2OWDA 2FSPA 2ZIWB 3TR6A 3CZMA 3NVMB 5JS6A 2QL5A 1EGAA 3IUMA 1IPFA 1KSGA 1CUZA 3ZQUA 4TSKA 1O03A 5D3KA 5BMVB 4DG9A 5FO1A 4PRKA 3WLSA 4IILA 4DWJA 4KFCA 1BGXT 3R6TA 1BGWA 3ESDA 2ZSKA 5DBIA 5ULLA 3ROQA 3BCHA 1M73E 3T9FA 3F9CA 4CDGA 5LU9A 2BR4A 3LDUA 1S3FA 4K81B 4C7VA 4EB3A 2QN6A 4RV5A 4X41A 1C1HA 2IC5A 2VYVA 1OV4A 1PSZA 1JAHA 3NIDB 3Q3VA 1V4VA 4BTLA 3PQEA 2RGXA 3OMLA 1PFYA 1XDWA 2N0SA 2X19A 5CU7A 2QS9A 3OTGA 5B1DA 1M2WA 4UTPA 3I6MA 4LDAA 4D3ZA 3V7NA 1QQBA 3AGQA 5D6NA 1A8HA 3A4LA 4YRBA 3GA7A 2JFQA 1ZJWA 5HKBA 2PZLA 3GT4A 3HZZA 1JEAA 3IQIX 5P21A 4C87A 1CRPA 4EFMA 4AIRA 5HIAA 5I01A 3OJLA 4TX1A 4DM7A 3AETB 3VHLB 1D6NA 5DOZA 5JI3E 1ZJJA 3AR6A 5GM2A 3FH0A 4FZVA 5AXDA 5CDTA 3F7OA 5JSUA 4YRPA 1BE6A 2HU5A 2OYSA 3GLSA 3R7AA 2H4XA 2UZ0A 2Q3LA 3CVOA 4R8RA 3IOYA 3RSZA 4AZVA 3FDZA 2HBQA 4OU4A 3EBOA 3QXCA 1KVSA 1E7WA 2GA8A 1VI5A 2Y68A 3PUVA 3FCYA 1PL8A 1LBIA 1JLLA 2K87A 4OQPA 4WVLA 4TS4A 4A23A 1E77A 5KQMA 3H8VA 3NV7A 5GOZA 4EGSA 1GM5A 2OHFA 1V5FA 3BXPA 3MMZA 3PR1A 3OE5A 4MLCA 4NK4A 3N2YA 3QXHA 5D7NA 6NULA 3FPSA 4ALJA 3WKCA 1KI3A 1XNRB 4XARA 2B5VA 3THXA 2B7LA 1XYGA 2BM8A 3W1VA 4BO6A 1GL3A 1U2GC 1RKUA 2IHTA 1NJ8A 1PEKE 2GI4A 4EKDA 2OP1A 2RGNC 3STHA 1RVDA 2OV3A 1WA5A 1U4SA 3I3OA 4LY6A 4U7PB 4ZCIA 1IWOA 5IM4F 1CZOA 1M6HA 4GKJB 5TS3A 2NZ2A 2P2CA 4M60A 5CH3A 1WZNA 5BQPA 5B5SA 2VWPA 3VC2A 5FAKA 4Q9NA 1PK7A 4NHEA 1YACA 3GRPA 4FEAA 3AY7A 1WW2A 4MJLA 5DWQA 4BO9A 1G9SA 4NCNA 3LLVA 1YB6A 3KQLA 4ODIA 2FWJA 3ZHZA 5JMWA 5L3QB 4ALMA 2D6FA 2IS2A 2UYHA 3SX0A 4QT4A 2ODWA 1E32A 1W8IA 2H3EA 2I8CA 3C48A 4H1TA 3W4IA 2HNKA 1J22A 1SXGA 3NEJA 4DANA 4ZA2A 1K88A 2VR1A 3L8MA 5GOTA 4HVCA 1AU9A 1BQEA 2IYLD 2VSXA 1RW4A 1ZISA 2G1AA 2VXCA 2W8ZA 3E22B 4OCZA 3ZIAD 4X00A 3L5OA 1BEZA 2WVAA 5FPSA 4BVLA 4DSUA 3KVVA 4NV3A 4AQ7A 4N01A 3IQFA 2XCTB 5AI8A 1ULBA 2AC2A 3PGLA 2HA2A 3D8RA 1NWCA 2YWCA 2UUAB 3QYPA 1G17A 1Z5PA 4JUCA 4MLPA 1ISRA 4QG7A 3NYIA 2GBGA 1JPVA 1P3JA 5BN3A 5U1PA 3HKBB 4GYYA 4O8CA 4JJ6A 1G2IA 1OFGA 3KR2A 3GDHA 2VO1A 4YROA 3R7LA 3U39A 1WXFA 2A84A 4U4AA 1YS4A 1CTQA 2AG8A 3NAZA 3LIIA 3M1YA 3QFRA 2SNIE 4R6XA 1DBRA 1UEXC 2J5BA 3A4YA 1UFVA 5BNTA 1W7AA 4RPGA 5I9BA 2FWPA 2ZIAA 3EZFA 4KWTA 4N0DA 1XROA 5HZKA 3P9NA 2P90A 1D0IA 3R5TA 3LDFA 3A1SA 5SV2A 3TUIC 2ATVA 3TPCA 1E69A 2R4QA 4MR7A 3M6UA 2Z5FA 1DAFA 1T2EA 4RMJA 1JXMA 2CLKB 4RA6A 3CX3A 3GEDA 1NQVA 1WG8A 4BAGA 3UFXB 4TTTS 3BE8A 3LQYA 3VHXA 1R00A 1L1QA 3D0QA 1UDWA 1PZMA 4U39A 1FUIA 3EMKA 3GLFA 3CZPA 2R9VA 2C8JA 3VXKA 1XU4A 5EIEA 1TI7A 5AJTA 4F9GA 3VU1A 4ENRA 2WWFA 2BFBB 4AVYA 4BQOA 2ATCA 2BJWA 2ZSFA 4QE3A 4DJTA 4OFBA 3EIHA 5LLSA 2JZOA 3UTDA 1NSYA 4EJ6A 3QY0A 2ZIGA 3KYCA 4FGSA 1E3LA 1U2QA 2JANA 1H2BA 2XTZA 3DTVD 1SKYE 1E1QD 3FYUB 1U1EA 3JR7A 3B6KA 4OJQA 1WDKA 4P4NA 1WR8A 3T0GA 4CQMB 8OHMA 4FW8A 1DLIA 5J1TB 5TT0A 3GH3A 5C5IA 2QBYA 3E58A 3TNLA 3NXSA 3QIVA 4X7RA 1BWPA 1VPEA 4MKXA 3P94A 4QYSA 1QIIA 1YS7A 5ALFA 1A9XB 3K73O 4FYIA 1PG2A 3ZW8A 1ESZA 2FWIA 3CF0A 4PCUA 4V0KA 1J1ZA 5DLPA 4ZZ2A 1N6LA 2OA0A 4G0XA 3NJ8A 3UG6A 4UTRA 1FP1D 3W3AD 3K0BA 4JXJA 4LWOA 2XYPA 4DCJA 5FWXA 5I9IA 1X1AA 1VSQA 2PN1A 1OLXB 1Y0BA 2G25A 3C6KA 3QUAA 3LK6A 4IRMA 4EHDA 2BTEA 3Q7SA 2NO6A 3VDMA 4OJKA 1XXHE 1WEKA 1JFSA 3G7UA 1QC5A 2REQA 4RYLA 5FPTA 4EITA 1BROA 1D0VA 4EPRA 5C18A 1R5OA 1VHTA 4F2GA 1QNFA 1V1MB 2E6KA 4L9SA 4YAJA 5G1NA 5AIBA 2I4OA 2CD7A 3JSAA 4RKYA 5IAKA 1R88A 1B74A 3DZHA 4IGAA 1HMYA 4EHNA 2R2GA 3GLGA 3QUBA 4OQ4A 3HXQA 2D2FA 4I0WB 3KBOA 1DRJA 3AR3A 3DD1A 4K03A 4PG6A 3MUNA 4OGWA 3S68A 3O1LA 3MT9A 2Q4OA 3OE7D 2QL7A 4N39A 2ZSIA 3Q8XB 4GPBA 3B48A 4TTSA 1QZUA 4N7RA 3PIDA 2EKBA 1OVMA 4DLSA 4ZEVA 1VYUA 5JCJD 1YDWA 3CM0A 5C2JB 5CYGA 1ZW6A 3PEYA 4PIPA 4QATA 2OXEA 4QVKA 1KDZA 4RTKA 2JF0A 2XMCA 2WF7A 4K9NA 3HVHA 2HJHA 2PX5A 2XE4A 3RADC 2WMNB 2XUDA 3COZA 1YR3A 1IU9A 1F1JA 3KG2A 4XYMA 5EE0A 2O0HA 2QVCA 4G5RA 4HS4A 3NATA 3SPXA 5JANA 1YBFA 2G1JA 2XOKD 3COPA 4LMRA 2IHJA 2R8OA 2UZIR 5JAMA 1P18A 1KXJA 4CT5A 1V96A 4EWLA 5J47A 2IEBA 2H65A 3SJBA 3QUCA 1HLFA 4AKSA 5DBGA 1Q0RA 3LL7A 2R8BA 4PM4A 5H68A 2OBLA 2BGGA 2XCQA 4Q19A 4U02A 3W2IA 5JZ9A 2WUFA 1YQTA 3OSZA 3OZBA 1GITA 5G0SA 3EGDA 3F3MA 1B0ZA 4PHHA 5LSAA 1L4YA 1J70A 4MZXA 5ER6A 1T13A 1OR8A 4LCBA 2PLNA 5G3YA 3UXHA 5HM8A 2AC7A 1N0IA 5I3ZA 3ZY3A 5IHPA 2VC2B 1IXZA 3BJRA 3LOUA 5M34A 3UGQA 4JXZA 3DBIA 3QOYA 3QWIA 1VHLA 2IUFA 1I6KA 2Z8YA 2A9RA 4MLZA 3VJMA 1MAHA 3ONVA 2A9PA 6ABPA 1N33B 5A5DA 5AUOB 1YZYA 4JP3A 4N18A 1IHXA 2ID4A 5L3SB 2C4VA 5CLFA 3V8PA 1VCIA 1X74A 3A6GA 5F7XA 3T95A 1ISSA 4P7GA 4COOA 3MTGA 1V3VA 2F90A 3CZ9A 3TRDA 3WIVA 4NZPA 3WMWA 4C4TA 3WB9A 1FMTA 5F4BA 4WEOA 3DXFA 4MGZR 2ZT8A 3W7BA 1I4LD 3C2QA 4L5BA 4F9EA 1FNDA 1P2DA 1ZD9A 2ZRJA 3GZ4A 3WA6A 3USZA 4RZIA 1EDZA 1WHSB 3JWPA 4J9VA 1QKKA 4UARA 4WKPA 1FOEB 3WQSB 4QPJC 4EJ2A 1ORHA 3KTDA 3NTQA 1HEYA 1UZLA 2AR9A 2CVFA 3CUVA 3WQQA 5LMNB 3B89A 3BGOS 3ZS8A 3E2IA 4U00A 1IYZA 1KOLA 2ZB4A 3REQB 4CKWB 5AK0A 3KAKA 2ZKLA 4A5OA 1NONA 3D43A 4OP2A 4V03A 3U09A 5L6LB 2Q62A 5ARBA 2XDQA 1HNWB 2YHIB 1ML3A 2H9AA 3PFHA 1QBGA 4QU0A 3RF6A 1F9AA 4JP8A 4LNUA 2DPMA 3QLJA 1WCV1 2X8JB 3CYFA 4MVJH 4LFBB 2DF8A 4KITB 3ZVMA 4Q4LA 3U4HA 2LDBA 4OQXA 4AZTA 5CAEA 4CKCA 1PFVA 2ZTMA 2G67A 2WE8A 2BMDA 5CG1A 4D4KA 3RKRA 3I58A 3A6HA 1CUFA 3GCXA 4QOGA 2FN7A 4WZBE 1XNHA 2J3LA 2YHSA 3E4CA 1BKSB 4BGDA 5L4SA 1W4BA 1B93A 3LQRA 4YJFB 4RHXA 5LQDA 3P0RA 3ZUPA 1AC5A 2GCPA 1PS0A 4O2LA 2MSLA 3G0HA 1YUBA 5IN4A 2XF8A 3C3DA 2AIRA 1HLDA 2HIAA 3BXEA 1OXKB 2R5FA 3JQFC 5JNVA 1UL1X 2ACKA 3O8DA 3QLTA 1BDBA 1MNQA 4XR4A 5TQJA 2FH5B 3TAHA 1BHO1 5FA6A 5IWAB 3L3BA 5H70A 3UN1A 2VF4X 2ZE8A 4W9RA 4DOMA 4EG5A 1MP0A 2WHEA 3DKRA 3JXEA 5E6UA 2O3RA 4UXHA 2DP4E 3ESBA 1Q6ZA 1TLTA 1ENYA 2C82A 2PU5A 3L49A 2A7XA 5J59A 1XZCA 2QQEA 5J23A 1T0IA 2OCAA 4X7PA 3RFTA 4BVAA 5FTNA 4XCXA 1DQYA 3V1UA 1T6YA 2CLHB 3DE7X 1KTVA 5IVDA 1NVBA 4LC1A 5CYFA 3D4LA 1ZL0A 4FHDA 3ZDFA 1SU7A 4H18A 1RC8A 4QDOA 4YP0A 3ZJUA 2EV9A 3BFVA 4L8GA 2OZEA 3Q98A 3ADPA 1NTOA 1SQ0A 3SYTA 1RAAA 2PS3A 4MROA 1T4CB 4RV4A 1X14A 3QVJA 1EQUA 3A11A 4GR4A 5TJHA 4KPYA 3EYWA 3A6PC 3PC6A 3HKCB 3JATB 3GLIE 4ZYVA 2CVOA 2L82A 2FSVC 3F7MA 5FI3A 4BO4A 1Z74A 2MTBA 1LWOA 3KHKA 4HY3A 4XWYA 3M5DA 5DK6A 3SEQA 5JQGB 1D2EA 3R9WA 1CDOA 3GJ6A 4KQ2A 1J56A 3C1AA 1U80A 3BCSA 4DY4A 2WJGA 4E11A 3KB8A 5JBNA 1XU7A 1MW9X 1UFOA 5CB6A 2Q8NA 3M6XA 1QO0A 5H5JA 1F0NA 1W44A 3TQFA 3SSNA 1YS9A 4LF6B 4TWZA 5EJ6A 1OF1A 1MC1A 4KCGA 3VTZA 1XWFA 2IDKA 1C7ZA 2SBTA 4MLDA 5SZIA 5C3MA 1QGUA 5IX8A 1I1QB 1I94B 1STOA 4UHFA 3UGJA 2RB4A 4K6KA 1BW9B 2V54A 5JFOA 1ZJYA 2GPNA 1QB8A 2XCSB 4B83A 2D3TA 2TSYB 1WVGA 2K7FA 5ILGA 4YAKA 4F21A 2HSEA 2YHAA 3MWEB 5AKJA 5JWOA 3ROEA 1SKBA 3E48A 4W99A 2V03A 3O4GA 5KYVA 3ZDYB 4E5DA 1J2EA 1V6CA 2AV6A 3ILSA 4Q7LA 3MXTA 1CNMA 3O95A 3VTAA 5BNZA 5JYCA 2O8DB 1TMYA 2H07A 1KS2A 4J0CA 1IK6A 1NF8A 4YRLA 1ZSNA 2Q6LA 3ZCUA 2PEYA 3AFIA 3NW9A 1SKUA 3KSRA 4RHFA 4E1BA 3DNMA 1FEZA 1N6PA 1Z7WA 3FYCA 1PL0A 1XTJA 2DR0A 4KFTA 1JIIA 1HSZA 4M76B 1KMMA 2VSQA 1ONOA 1YHZA 1Z15A 4DADA 4CG0A 3SBXA 2ZCVA 5IVIA 2AYXA 1M8GA 2OCLA 1CEXA 3B9PA 3ELWA 1K8XB 1FFCA 3GPBA 4JJ7A 3WRYC 1QSGA 3OLZA 4DEXA 3SSAA 5L6MB 3FM9A 2CNOA 5DCYA 4Q1DA 4GICA 2O4CA 4HRAA 3QJ5A 2DPXA 2WHPB 4B6FA 3O91A 4FDVA 1E1CB 3D2BA 4CMEC 3ND7A 3QTBA 1EH5A 1FYWA 1G4AE 5LP6C 5FFMA 3AYZB 1K6EA 4TN5A 2I3GA 1HDZA 1UEIA 3DE3X 1LDNA 2JLRA 2OEPA 3H17A 3IP9A 3LF1A 4LRSB 3QXXA 1NNUA 2P3QA 5ETJA 5JATA 5KHLB 5FWNA 4JLKA 3ZS9A 3RAEC 2PJDA 3VKHA 1RADA 4XQ0A 3S2GA 1SUDA 4MTLA 3HM9A 4JXXA 3V8EA 1MOPA 1FJHA 4EH1A 4GPIB 1KRXA 3WHKA 2I3BA 2GN0A 2WWRA 4QGBA 4Q9DA 4QO7A 2KM1A 4D98A 2X8BA 3ORSA 4AIIA 4LNHA 1ORIA 3MWFA 4A0QA 1UFRA 4R84A 5JDIA 1O1YA 2JD1A 2OILA 2QR2A 3NHYA 4GM0A 2YXNA 4ZVNA 2GEVA 5IHXA 2AUNA 2IEZA 1UDXA 2VJBA 1XF1A 3UJAA 2FW7A 4EL0A 4EFLA 1LA2A 1QTNA 3SVTA 1YC5A 3PC7A 4G0OA 2GXAA 1EGQA 3BS4A 2R6HA 3BXHA 5B58T 5FLYA 4BP8A 4BX3A 1E7RA 3KXKA 3ZEIA 3MJRA 4Z1MA 1DS6A 4AMYA 4URUR 5FX2A 2FX3A 3QBEA 2RCYA 3FMGA 2PO7A 3DWGA 2AJCA 1NUAA 3AXSA 3B9QA 3OCZA 4TVBA 1JIKA 2Z8XA 5JVDF 3O8RA 2BL4A 4M0EA 1KZ7B 4HAUA 4YYEA 1LKZA 1M7BA 4L27A 4NG4A 5DHFA 1A9TA 1FYFA 2DG2A 4K6GA 1ADFA 1Z88A 3OBIA 1O94C 1NBAA 4ZRDA 1DCTA 1C9KA 3DL0A 4OLBA 2MHCA 1Y63A 4S04A 1H94A 1RT9A 4UE3S 5F7ZA 1J0DA 2X3YA 4JI5B 3ZV5A 1VI2A 3SG0A 4Z4CA 3DC7A 3DW3X 2ZAMA 2HH9A 1W5EA 3ABQB 3LZ6A 1MDBA 2P1ZA 4QQNA 3EXIB 3K09A 4GI1A 2D0PB 1NU8A 2FVXA 4L72A 4YR7A 3ETEA 1PJ4A 1U3GA 3PXEA 1AMOA 2Q7OE 3AV0B 4FSHA 3DEZA 3KSMA 2F1IA 3QX8A 2PDAA 3KR1A 3ZEAA 5EESA 5D3MB 3DO5A 2BGJA 3EWSA 2O2XA 3D02A 4RUKA 3OZUA 5I8ZA 5LWHA 4G41A 4NPHA 2NU9B 2JFVA 4HRYA 5BWNA 1VL2A 2PMKA 3AL0C 2PWBA 2XITA 4DQLA 2HSDA 4Z53A 3BIXA 4EEKA 3ADKA 1IM8A 2I29A 1H0HA 2XZDA 3TZLA 1MX1A 3AXTA 2P62A 3RVKA 2C7PA 2I7DA 2DCUA 5FJIA 3OM8A 4HWPA 3LLSA 2X77A 3HKBA 3DHYA 4LSWA 4RIEA 1T8YA 2VIIA 1M2VA 3HXTA 4IJ5A 2X8AA 1RWMA 3EFOB 3D81A 5EI5A 1N1MA 5EE3A 4Q1CA 3QF4B 4XYLA 2WINI 2QIOA 2C42A 2YYSA 5FTMA 2PYDA 5AOAA 2H18A 4O6VA 4QQRA 5J5VA 4CBVA 5A0FA 5AVXA 1GUDA 5A2GA 2WD7B 2H92A 1FFGA 3OCCA 2J5RA 4G56A 3GJ7A 5H82A 3PIIA 1KEZA 5JLAA 2B8WA 2RHGB 1R8XA 1Y6RA 2RSLA 4BMYA 5JWRA 1E7YA 3NOXA 4RD3A 3UFXA 2QY9A 3ZWMA 2UYOA 3KFLA 3WAKA 5IC4A 1E2GA 2XBMA 4YJDA 4HR7A 4ZO4A 1CUVA 3LUGA 2I76A 4MUKA 1ZD3A 3LJKA 4MUFA 2DETA 1MPXA 1GRVA 1ULTA 1DOZA 4TL8A 5KYNA 1IUOA 3WIOA 4C4ZA 3DA8A 1PGPA 1CR0A 2EEPA 1ECBA 2FR0A 2OGZA 4XA8A 1T8TA 4ZXPA 2X4GA 2OO3A 2D5BA 3R5FA 2WJ3A 2BZ0A 1VECA 3CX6A 4MGKR 3A4IA 3RHFA 3EPHA 2R60A 1YZ3A 1KMHA 2EKDA 4QBTA 2V58A 4EW2A 1Z16A 2X76A 3LC0A 4JH0A 5CUQA 1TM7E 2EVWX 3KOUA 3LFHA 5HTKA 2AMFA 5PGMA 2D4HA 3G0IA 2DHCA 2G9UA 3P0IA 4NEHB 2JHGA 4OSOA 4MWSA 2I7CA 2JEYA 1JKJB 3I0MA 2C5LA 1NKVA 2QL9A 3A28A 3AY6A 3MTEA 3PLRA 4XXHA 3ZKWB 3UYLA 4F72A 3THWA 1T3GA 1QZZA 1BTOA 1DWQA 2ZE5A 1EVQA 1ES9A 3CUYA 1A69A 1DCMA 1SOUA 3NU1A 3JYQA 4KXVA 3M6FA 3WHLA 1C2TA 5LFAA 3D6JA 5IKXA 3IRVA 3TEFA 1XA3A 3NTLA 1OFUA 1YT5A 2IDMA 3LHFA 4G9EA 4ZRMA 4Z3DA 1YB4A 3I64A 3S40A 3HR4A 3IILA 4L02A 3I4CA 3PJEA 4BFCA 4RH1A 4LY9A 2QTAA 4EX6A 2C7OA 1P0MA 2A5YB 1PI3A 3NVDA 1ITZA 4JCOA 1NBOA 4Q01A 2NVWA 3KQVA 2WAMA 3ZDCA 3E53A 4IWNA 3HBNA 2NSYA 2ZT5A 4FYHA 2AFHA 4OMUA 4PAMA 1ILEA 1BWQA 3ZH9B 3GZTB 4J4BA 3BWEA 3GFOA 3LF2A 1SZDA 2H63A 3O26A 1V1MA 4P4TA 1RPJA 3E3AA 5DTJA 3PXAA 5IAJA 3V8NA 3R9KA 3BGIA 4HX9A 1I2ZA 3LAWA 5K6AC 2J9XB 2NV2B 3KWFA 4OATA 5ALRA 3WGJA 3ZU5A 4BKRA 2QQGA 2JLYA 3E05A 4WCDA 4DA8A 4YEDA 1PV2A 2C4TA 3HP7A 2FEXA 4G97A 4ISCA 3V4VB 3WL4A 6Q21A 2ESRA 3E84A 5CIWA 2HF2A 3DDHA 2XRMA 1DKRA 4LTDA 4RBNA 3LDAA 1EGMB 2D5IA 4C3OB 3TUZC 4A73A 2JATA 1AUXA 4G3XA 4WCVA 2VT3A 3PZRA 3JTEA 3M5PA 3G2QA 4OLFA 2YOFA 1R0RE 1N1GA 4TSFA 4RZSA 3ZHVA 7ABPA 5LB2A 5JUWA 4E7OA 5FB3A 4F0JA 1QF6A 5KKCA 1CZHA 1ZIDA 1XMSA 3LGSA 3RC1A 3ZDQA 4XCVA 5CD9A 3LW7A 1FLVA 1YZGA 4V0NA 1AKUA 1MAVA 1VSUA 2GT1A 3DMFA 4G5XA 2L69A 4MQFB 5EXPA 4DMRA 4W5WA 4B3TB 4PZPA 2J3QA 1YQXA 1XZPA 1IHYA 1R9GA 3W8RA 4UNPA 4UJ3A 4JL5A 5KCMA 3OUTA 4LJ4A 4B8WA 2BI8A 2JHFA 4FFLA 4NMHA 1FRQA 1OX6A 2MIIA 4LZWA 4LYAA 3V1LA 2BELA 5LBIA 4IJKA 1FP2A 1PEDA 2WF8A 3K9QO 1XWIA 4NNOA 2IUUA 1CY8A 1IEWA 3I34X 3WGGA 5C81A 3MIIA 3U7QA 4D5EA 1LY1A 1PJ2A 2I6QA 2HRQA 2BFFB 1JQ3A 1D2MA 2WU1A 5B37A 3NBFA 4DVGA 4FTWA 1Q3HA 3I2FA 4QLAA 3G02A 4HB4A 2IYEA 1XNGA 3T1OA 1JSLA 3N5KA 2QJOA 4BLSA 1TM1E 2WFLB 4UQOA 2CBXA 3JQPA 5L3SA 4OP1A 4QYMA 3NBAA 2I1LA 4FYWA 1GXSB 1XN1A 2IY8A 1F17A 1KMNA 1QANA 1UXHA 2FVYA 2J3EA 1HYBA 4KKXB 3DNPA 5E4JA 1IUKA 3L7LA 2B0JA 4RGYA 2AJBA 2QLBA 3FKSD 5ICGA 1MXFA 4PVDA 1N8NA 3SC6A 4YR9A 4YQZA 1PR4A 2WU3A 5D6OA 4DZZA 4ENWA 5BV2P 2BCGY 1V8DA 2XUZA 3N5CA 3K8YA 3FI9A 3DEFA 1AUPA 4TLAA 4LG1A 4N3NA 4Q4HA 4M8IA 3COJA 1FB5A 3REQA 3FYUC 5CD1A 2R11A 1H2ZA 4PC7A 1AQJA 3CUEF 3OVMA 3CRMA 3U3KA 2R6JA 3VGJA 1OSNA 3PUIA 5IJAA 3OHPA 3UK7A 2FFBA 3V1KA 1HR0B 2NZXA 3F98A 4N9WA 3E1SA 4UCXA 3LC2O 1G7TA 1DP4A 2IOHA 1PNOA 1C7FA 1P4SA 2X8JA 4P0TA 3ABRB 4JI2B 3EZ2A 3INTA 1SCBA 4FQ7A 1MC5A 3C8HA 4IRUB 2JLZA 3C3WA 2X0IA 5KMGA 2GZMA 3ICWA 2C9BA 3KZVA 1L5WA 2WG1A 4A5SA 1WDMA 1TOAA 1WMBA 1XIVA 3GJ3A 4M9QA 5DTRA 1UR5A 1EMDA 3BMNA 2ETVA 3SF8B 3D31A 1XHEA 1LDBA 2GM5A 1THGA 4YJFA 2JLUA 3G59A 3LXUX 3U4IA 3H8JA 4GSYA 2OYRA 4JXKA 4NCJA 4N3BA 2V9PA 1QONA 5K0BA 4W5JA 1XQ1A 2HB6A 2YHUA 4M21A 3WGLA 3BG5A 1DADA 3HGMA 5CIQA 5C1PA 1FA9A 4GUAA 5DM0A 3QPUA 5CDUA 2OHHA 3OA2A 4DBLE 5A3RA 5K2MA 1CLEA 3Q3IA 3AI2A 3AKDA 1BMDA 1HWYA 1C4KA 2W6NA 2E4UA 1YIAA 2ZT6A 3INGA 2NYUA 4XVHA 4BFXA 1TT5A 4RNDB 2BAGA 3IALA 3M3DA 2FUG1 1RBMA 1S2NA 1Z8DA 4MMZB 5G4KA 4BNDA 4E6EA 2JJ2A 2XYRA 2Z2YA 3CT4A 3WGIA 2C5FA 4P5EA 5CX1A 3LTNC 4M1MA 4NBWA 4E32A 1OGIA 4GP7A 2B82A 2VPPA 2BHNA 3TFOA 3QMPA 4Y18A 2KWIA 3A3PA 1JU9A 3O9VA 3HKCA 3JATA 5LA6B 4HEJA 1SU8A 3WGZA 1TKCA 1U04A 4Y1GA 2VJAA 4PRLA 1EK1A 2H2IA 3GBVA 5JQGA 1ZVVA 1XTZA 1T3HA 2BSXA 2DPGA 3H11B 4P7KA 5MGNA 5EPEA 3TJRA 3UEOA 2ANCA 1ZJ6A 4HN2A 2CHUA 4WOJA 2J48A 5DXFA 4AP6A 2ECKA 2WYIA 3LP6A 4C14A 1J24A 1NNI1 3A1FA 3OQVA 3HTXA 3GY0A 3GU3A 3HB0A 2XNJA 4OGFA 1W47A 1AK9A 1PSDA 1ZHFA 4ETMA 2VDVE 4FMPA 3T9EA 1DDOA 2IU3A 1BX3A 1PUJA 5TX7A 3GGJA 4YS6A 5C4GB 2VBCA 4HYYA 4GZ6A 4B0OA 3PX3A 2P41A 4WKGA 1XPUA 3I8OA 5IW8A 5LPNA 2XGSA 1EFPB 4JC4A 5JASA 1FFEA 3MWEA 5AM3A 3U60B 2WYHA 3DFUA 2XUIA 3B2QA 1VKZA 3FSGD 5IH3A 2AKEA 4GKAA 3EFEA 3IESA 2IS6A 4TLCA 5JJLA 4TTQA 2CT8A 1ETHA 4E94A 3I3SR 5YASA 2LV8A 4KIFA 2O8DA 3IRUA 2E4YA 2JIMA 2MJLA 3CUKA 2MYPA 5BW5A 2EEZA 2R8PA 2Z1MA 3U80A 1ISIA 3KQHA 3TDMA 4B09A 2IKQA 3C7DB 3PQ4A 1OPRA 1VSTA 1ZUNA 4KMOA 1JDTA 1JXOA 2B35A 2PD3A 2DTDA 2GXSA 4B32A 1WS6A 7REQB 4DREA 1BOOA 3GLKA 1NMEA 5TLSA 3Q2OA 4TXMA 3K70C 2OV6A 4ZT7A 4PYQA 2J8ZA 1ZHHA 2GNAA 3F3YA 2ZYWX 3GXBA 4F45A 1T1SA 2GWRA 3EIUA 3A2LA 1DX6A 1SOMA 3IQZA 4HKTA 3W8NA 4ZGGA 3U5ZB 3DVAB 4MP6A 4WNAA 5KYXB 1E1CA 1WXWA 2J5KA 3PDUA 1KQ3A 3DZGA 3WGMA 4CM8B 3C16C 4OI1A 5H8WA 2O9JA 1D1TA 2WI8A 3A4NA 1J9ZA 3FLAA 4CMGA 4NXNB 1O5TA 3RU7A 1E3JA 4HYEA 1UBGA 4IWYA 2E21A 1NN3A 4U9UA 3EVGA 5FBLB 4BFTA 2V7EA 3GAMA 4DFDA 3D4NA 1UBNA 2Q2NA 2VAPA 2G80A 3WB1A 2Y1XA 3NPAA 2FEKA 1W9HA 2VYVD 3IHTA 3HR7A 4UE2A 4KU4A 1G9TA 3AEYA 1VRCA 5FUWA 4CM9A 4F8JA 3GZJA 4X92A 1SIOA 4H7DA 4HNUA 2WB2A 1E2MA 3ZX5A 6REQB 5ER9A 4CMHA 5DHQA 5JCOA 2MT9A 4XJVA 4B35A 3ICEA 2CNWA 1SZPA 4G5FA 3DNFA 3GIDA 5H7XA 2W70A 5BY2A 2OD2A 2V7QA 5IF9A 1JB9A 3GGCA 3AW9A 4NOLA 3KCNA 5IFKA 2OD9A 3AWIA 4ZAXA 5L3RA 1B2LA 2GZ1A 4UU1A 1OD6A 2DAPA 3WC4A 2WYUA 4DABA 3R41A 1UDBA 3SHQA 4H17A 2NU8A 4WK6A 4CFSA 2BV3A 3WGOA 2V7PA 2O2HA 2ZQYA 3F6SA 1JJVA 3I37X 3OZRA 2XCOA 2OHXA 2Z9CA 3AP3A 3G88A 5K4HA 3KJIA 2G5PA 1G8HA 2EAUA 2C77A 2Q46A 3VVBA 2GKGA 1D7AA 1K0UA 1QXSA 4PX2A 1Z5GA 5B55A 1RKXA 1NUUA 1M6NA 2KYRA 2XB9A 1GT6A 5ILQA 4QZVA 4H7IA 1X38A 3DMPA 4OPMA 4QLOA 2HMVA 4NOJA 2OQRA 2ZYVX 2HCBA 1Z3CA 1Z18A 1TCCA 3P2YA 3KNZA 4BJ5A 4X1OA 4H35A 1LI7A 2ADOA 4UXJA 4TYNA 4BO5A 3MCWA 4FR2A 4M9RA 3D7KA 1N8KA 3ZBTA 5EIWA 3C1UA 4CZ2A 1VLVA 1SJ9A 3GJTA 1G20A 1NMZA 4JK3A 2A30A 4I4IA 4K28A 1Z08A 4LWPA 2C7QA 1DRVA 1G98A 4Q1EA 4ALIA 4QPNA 2C7GA 5E6SA 2CKMA 1OQAA 1SUFA 1KVQA 1T0PA 1JYFA 2QMYA 4IZIA 1JT9A 4NAVA 4XLTA 5D3MA 4EHJA 2QRHA 2XWPA 4WNCA 2ZVPX 3TLJA 4PQYA 2PGIA 3W8DA 3HDJA 3NTRA 2C8LA 3DM5A 4V0RA 2BZGA 3LBYA 4C3ZA 2VXBA 1L5MA 4MW9A 4WTOA 4OK3A 3V8BA 2NU9A 4BP9A 1GV0A 4I36A 3IXQA 4ENVA 4YMIA 3BSWA 4HWKA 4JLSA 4EABA 3FTEA 1SC1A 3CBGA 3T5CA 2FJUA 4HATA 3KZ1E 2AH5A 5EIFA 1X7HA 1KZ6A 2ASVA 3W05A 3ZY4A 2OGTA 1I7LA 4CLHA 1SXPA 5KNLA 2LCFA 1TJ3A 2CHEA 5CVJA 3VAYA 4NCXA 1JSZA 2AWNA 1GP2A 3L46A 4BZQA 2XHEA 1SBTA 3WRWA 4TRNA 4N03A 1R6BX 1XTUA 3RYHB 3EFOA 4GZ3A 1II8A 4M89A 4ENQA 1FQWA 2F9MA 4UZSA 4Q4AB 2H00A 3CLSC 2GK7A 3KL2A 3QF4A 4WZAE 5CB8A 3ER9A 4EO7A 2R3SA 4ZVRA 3GRRA 3SQMA 3UMMA 3PNVA 1Q2XA 4IMPA 4M9UA 3IXLA 4JIMA 3VZBA 3W4KA 3LVRE 2D1TA 3T9AA 5C5CA 3SXPA 4Y6OA 4NZMA 1OV6A 3C3MA 5TGZA 5LLDA 3THYA 1NVVQ 1YJQA 1W1IA 2QX7A 4EB6A 2NU6A 5C7LO 4F3KA 2XZOA 4M54A 1PD0A 3UT6A 1NJ6A 1RTTA 1Q20A 2XXJA 3HDQA 1YNOA 2LKDA 4N5IX 2XT6A 3QY9A 4KXNA 4KO4S 1W88B 3I2HA 4Y2VA 1H1LB 3BB1A 2GXUA 3HI6A 5GJCA 5KDOA 1RYDA 1HZJA 3BZBA 4JLUA 1VYHA 1U9ZA 3WXBA 3OZWA 5AT1A 4ATNA 3QSYA 1TYAE 3QU9A 4UU8A 4PBRA 2OLEA 3GGDA 1J0EA 2PJZA 3OFVA 1RM5A 2QE7A 1WXXA 1DVRA 4Z6KA 4J0HA 3H5OA 4KQ9A 3LUAA 3QPAA 3AUUA 3MINB 1J33A 1T9KA 2JBHA 3OX2A 3AR4A 3W9BA 2C1ZA 3BWBA 3CH6A 2BEWB 3AB8A 3QELA 3R23A 1YXMA 2A4KA 4FQ8A 4HWOA 4X85A 3RVJA 1LLFA 2VDNB 3RJMA 4YRZA 1PBNA 1JKJA 2BR5A 2X4LA 1EP9A 1QV7A 4E30A 5BOSB 1JQLB 3WB2A 1BDIA 2AXEA 2G36A 3M70A 2BJVA 5KWEA 1O6CA 1W0JA 4RMNA 3WRXA 1EFKA 1ZVMA 3HEAA 3RWBA 3IELA 3KPWA 4XD2A 3LY9A 4N3GA 4S1TA 2VDKB 3TE7A 5KTNA 2DXIA 1D04A 3HJRA 2IH5A 1PFGA 1SEVA 4J94A 1ZK0A 2E89A 1CZRA 1T8PA 3TD9A 4WECA 4X64B 4HGNA 3ETDA 2UUPA 1D6SA 4BNWA 3IIIA 4BQSA 1C8KA 3OP4A 2JCVA 1F20A 3R5JA 3OM1A 1I5RA 1WSAA 4KG7A 1CUAA 2XTJA 4BJ1A 1T15A 5ABPA 3EPPA 2QRJA 4J43A 4YAGA 1JU3A 4BGEA 1ATIA 2B4AA 2AG6A 1G3MA 4ERXA 4WBNA 4Z51A 3ZBQA 1TGYA 2YDYA 4OHXA 1E99A 4UEWA 4DY6A 4XB6B 3VR0A 1KC3A 1NVKA 3IE2A 1ZIPA 5JPIA 2R87A 3GJRA 1F6DA 3I0NA 3PD7A 4NS1A 3L1UA 1XOIA 1OH8A 2ZUUA 5IZCA 2O59A 5CITA 3A6KA 1EXNA 4X91A 5IDQA 3LUCA 3VR6A 1Q19A 4Z4EA 2PXXA 4IO1A 3USCS 3AKCA 4NH4A 3RQIA 1OREA 3ZXUB 2C7VA 4IZOA 1U0HC 5CT4A 3I39X 2PRKA 3JZAA 3TLEA 5BR7A 1V16B 2XMQA 4PAWA 1RMTA 2UZ3A 1A82A 4KI7A 4C43A 3TR0A 1ZI8A 3G5LA 1Q77A 1SUAA 2NT3A 4LWZA 5EIXA 1B8OA 5JMPA 3WIDA 2FK8A 3BXGA 4MS1B 3IKJA 1HEIA 4MQFA 3NDIA 1A7UA 4M0PA 4C0SA 3OA0A 3BXXA 3I6IA 4HDOB 4TYWA 1RWXA 4R8KA 1J8QA 2PSHA 2RHTA 2ZI7A 3ROGA 3T1HB 5JU6A 1W29A 4RJJA 2HGZA 4U8HA 2ZFUA 3UXYA 1W8DA 4FLFA 3PUJA 4KEAA 1FFYA 1GFWA 1A1VA 1L4MA 5AJZA 2A0XA 2HRZA 3AF2A 3N6RA 1A9RA 2QIPA 3H04A 1R1DA 4JOCA 4LVNA 2WABA 4W8GA 4ZT6A 4POOA 4UOZA 1W36B 3N2GB 1Q3KA 1KGDA 4MA4A 4DARA 3LHSA 2B9VA 2C83A 5SY4A 3S1AA 1UPTA 1CG6A 2BI4A 3GI1A 4RFVA 3H1TA 2ZRAA 4L4XA 4RVHA 3A4MA 3RC3A 3W5VA 2G9QA 1QS0B 1RXCA 4X1IB 2QZPA 1M5UA 1OWPA 3R2JA 4S0XA 4BE9A 1FSZA 4C5BA 3E9QA 1L1FA 1S3IA 2O06A 3SS9X 4CIXA 1BEUB 4YAWA 1Q7GA 4DHWA 1FUEA 3KLOA 4HDKB 1CUJA 2HJVA 2QLJA 2CSUA 1XZNA 1I6MA 3OOEA 1TEHA 3EG9B 4Q7KA 2NTNA 3TLXA 4B4OA 4ZEWA 1F2DA 3G9XA 1NXWA 1UANA 2O1EA 2EXXA 2W7TA 3K8ZA 3Q12A 4IEIA 4LHSA 1TU0A 2O07A 3PG5A 1ZC4A 3KKKA 4J29A 4M1SA 5FTWA 3UAOA 1JG1A 3ADOA 3IT1A 1THTA 1ZJ4A 4WASA 1NJ1A 3OU6A 3P20A 3LT4A 2GEFA 4I8XA 3PQ7A 3O3MB 1AS2A 3L0DA 1UK9A 3QLVC 3BF7A 4OK6A 4YRTA 2AFIE 3DFZA 5DGIA 1I2DA 3IB6A 3A4TA 2XEXA 3ETJA 2XKKA 4U9IS 1QF9A 3F6BX 2PSSA 4OLJA 3RS8A 3TZBA 3T1VA 1EFRA 2J59A 3A1WA 4LE0A 3RI3A 1Y5LA 5ICSA 4JC8A 5ALUA 2JFBA 1T5HX 4TKUA 3FOAA 4DRZA 2QMOA 2FGJA 2P65A 3DWEX 5DZSA 3Q3EA 1TMKA 4B79A 1GSOA 1U2ZA 4CDMA 4UPEA 2D5CA 4QOSA 4LBZA 2R68A 1DMRA 3A8TA 1P45A 3CPEA 2ZWIA 1D6JA 1T91A 5FPKA 1F38A 3NUQA 4EHFA 2UVPB 3GRFA 4JKOA 1KP2A 1E2NA 1U6KA 3BORA 3SD7A 1FTSA 1Z2CA 3LX8A 1W93A 3V97A 4AK9A 3FOZA 4NE9A 2BCJQ 1IG0A 1U7ZA 2HHJA 4DDUA 3RTDA 1NUSA 2NG1A 1E2LA 1CHNA 1AO0A 1E5XA 4HN9A 1MEEA 1Z6XA 4X63A 5EP4A 4Y2RA 2F64A 1YKGA 3UJDA 1X7XB 4LDRA 1YU9A 5D5QA 3ZCSA 4BMDA 1NVDA 1H66A 1CUWA 3JWJA 1M34A 2KBFA 2AEEA 1NJ2A 3C5EA 2EP8A 5GMOA 3T1NA 2WKRA 2X41A 3AL3A 4R0NA 4ZQBA 3UC5A 3ICCA 4DRXB 1NF3A 4S1NA 2OXRA 5DYNA 3TCKA 4HPXB 2G1PA 1O58A 2V3WA 5TMBA 4X8MA 3PF9A 1UADA 2EF1A 5JS2A 3R7BA 3H97A 3CY6A 1T43A 3TZKA 4WSOA 4LMPA 1C0LA 3R44A 3OEYA 2ZXEA 3GT0A 3JWEA 1M74A 2I33A 4A36A 4GKBA 4JJEA 5KC9A 1XZFA 4MX8A 1FDTA 2PV0A 2A8YA 3MYYA 2FR1A 3V8QA 5CJJA 3FPAA 3D6MA 1E64A 1IOZA 3UF0A 1QQ5A 3WI7A 2WOOA 4I1RA 4JHXA 3GR6A 3ZDDA 4JJGA 4DR5B 3CNHA 2CL5A 3MHPA 2FR8C 4HZIA 4JKIA 5LA6A 5I6DA 4PO1A 4KH1A 2WKPA 2VP9A 2VDWA 3CF6R 4OQZA 2V6IA 3LDGA 2GFQA 1V11B 3C3AA 3H11A 4L50A 1IJBA 4P35A 4PY2A 3S44A 1WSDA 1DKQA 5HK8A 2JEOA 4H4CA 2AZ4A 2YX1A 4BNNA 3DSRA 1G5PA 1QNLA 2I2WA 4JI0B 2HSGA 4M38A 4R1QA 2PH3A 1BU8A 2VPTA 4ICIA 4ZAVA 1G8PA 2Q1XA 5LMZA 3UUGA 3NC1C 3VO9A 2VAVA 2YFHA 2QUJA 1E6WA 1TECE 2DUWA 2UZAA 4BV3A 4E88A 5K3SA 5HKKD 1KE1A 2ZRDA 4YECA 4EPWA 5J9FA 2YYYA 1NW3A 2A2ZA 2X42A 1QO0D 3PFIA 3VSDA 1U8CB 1W46A 4OHRA 4R9VA 5HF8A 2PAFA 3VPDA 1H3EA 2QT0A 3ZHRA 3IEMA 1G16A 2QLTA 2GPJA 2Z08A 2ZBRA 4CMAA 4R7TA 3MILA 3LBNA 4YRMA 3HUTA 3K92A 4IIJB 3E1GA 1T3SA 3TSYA 3B6JA 2HT1A 4JBYA 3RBZA 1IVYA 3WV5A 1OXUA 3FYSA 2E2WA 3JQAA 4NBUA 3O8OA 4DM4A 3IFSA 8AT1A 4WNIA 3TFQA 4CKZA 1J5EB 3R3ZA 1SMKA 1W87A 3G23A 3WX0A 1RWQA 1KPGA 3IVCA 3PX2A 3OJ0A 2OCIA 4JA2A 1AN0A 1KF0A 3BPSA 1E1YA 2WIKA 2HLDA 1Q14A 3ND5A 5DHPA 4OK5A 1DEAA 2A9FA 3AJ8A 3GHHA 3T7EA 1VIAA 1OGJA 3SE0A 1E3TA 3CCBA 3KPVA 4FWIB 1WXEA 1Q21A 1AHNA 3DVAA 3F5QA 4IKEA 5E9AA 3RNOA 2JGDA 5KYXA 5CDFE 5KX5A 2Q6KA 1QQ6A 1EA7A 4W1SA 3HV0A 5JYBA 4JYMA 3SOPA 4F1KA 4W1PA 4J1QA 2QRLA 1IONA 2JVKA 1KXZA 4C4OA 5KVCA 4GBMA 3SFVA 2GJSA 4UM5A 1QYRA 3HMQA 4LVCA 4RAQA 5T4BA 2JLWA 1FP7A 1TC2A 4TZ0A 1HE2A 2HQBA 3ZGNA 5I45A 2A94A 1T1IA 1QP8A 1PR5A 4GR5A 4EPVA 3CMMA 3WLHA 1MGOA 2PMEA 3Q2IA 1A7JA 4P3YA 1TO2E 4ZI7F 2IYYA 3MYRA 3VISA 4UCQA 1YZTA 3AVXA 4FDMA 4PG5A 3TG2A 4HLNA 2QROA 4W9MC 4UUMA 2GHRA 1JQEA 1G1MA 1XI2A 1BMFD 2ZB8A 4BLQA 1E6LA 1PP4A 3MQ2A 1O97C 3CSSA 1IHUA 1M8FA 3SHOA 4CCYA 4CV1A 1HT0A 5BR4A 4UNRA 3KETA 3U4QB 2FN9A 1IPHA 4P3OA 2Q5HA 4E21A 1M6YA 2CL0X 2Y1LA 1M5RA 3EVTA 4QREA 1U7OA 1SB9A 3LD9A 5HTOA 1N2HA 5FNVA 2GKOA 3KQMA 1NMXA 1MOZA 2Q3CA 2ZBUA 2HA6A 3UA4A 1WZEA 2VSYA 1MG0A 1NE2A 4RETA 4P3PA 4YAFA 5CAEB 3DBRB 4Z1MD 2ZSEA 4RM3A 1W2HA 4ZKDA 4WADA 3B1KA 4W9NC 3AFGA 3OIUA 2B7CA 1H8HA 3DVRX 4TQAA 5DYIA 5EKUA 2UXCB 2A5FA 1Y7IA 4XEHA 1DC8A 1QHHB 4CIYA 3V4FA 4IIFA 4RF5A 1A3CA 2WYWA 1OAKA 4OKIA 1JSRA 2NVUA 3QYAA 4V0ME 4BBJA 3E7PA 2WG0A 3ABSB 2G9NA 5HS6A 3T7JA 2W2VA 3OICA 1LSOA 2GARA 2P69A 1Y3CE 2BKUA 1I8TA 2R65A 3C8MA 3M5WA 3GFTA 1WPQA 4AY2A 2X9VA 5FLKA 5EZYA 2PFGA 3GQBB 2R79A 1VLQA 1PVVA 2IYOA 2VK4A 1YF3A 2B1QA 4PZYA 5TARA 1JEQA 2C5HA 3O21A 4WIAA 4XIYA 3H75A 4I08A 4UHEA 1AMUA 4K46A 2QMUA 3PGVA 3NGXA 1YRHA 2O20A 4Q3AA 1B43A 3OCXA 1CUUA 3RTGA 2CLDX 4HBGA 3ZE8A 3FUCA 5FL7A 5BWBA 2Y4NA 4WXPA 1ZOSA 2Q6IA 3DFKA 3SDZA 3W79A 5EHXA 3AFNA 3GLTA 3T5DA 3VKWA 2EFHB 1VXOA 2O14A 2VBIA 3DAOA 4YJ3F 3EZNA 3GGPA 2WM9B 1DO2A 2YZMA 3EB9A 4Q4AA 3U17A 1F4LA 1U2DA 1WW8A 2OG2A 3IAS1 4RHTA 1FSSA 3ZNOA 1H65A 5JV5A 3ONWA 2XWBF 3I9OA 1L7QA 2ZCUA 3HN7A 2QX9A 2YC2C 2PUBA 4ZCMA 4PICA 3ELUA 2RHRA 3IP1A 4FYMA 1JXAA 3PE4A 3CE6A 2P6OA 3RFXA 3TQTA 2D74A 4BTEA 5AVYA 4M3NA 2B4RO 3T7SA 4ZI7B 3JZMA 4JZKA 3R7FA 2C9MA 3AM5A 5IRCD 4E6PA 1SVSA 1UJMA 3OD5A 4MULA 5JD5A 4LV8B 3EIWA 3AIKA 2Q7DA 1QHFA 5HVNA 3BK1A 1MJ5A 1W88A 4GWLA 1H1LA 1U2PA 2XVYA 3OFNA 3IBSA 3KOZA 3UG7A 2VDUE 1L5KA 1JLSA 3RU3A 2YW2A 2LCIA 1V41E 4BWFB 3AP2A 1TB4A 3N2NA 4PLYA 4BO1A 3PX7A 3EISA 1ZJ5A 3KIPA 4N7MA 2NSJA 2RGWA 3ETGA 2LTAA 3UWMA 1G5TA 1AGYA 2A35A 2B3DA 3ACBA 1FX1A 2HU2A 1T6NA 3MFQA 4OB6A 3MINA 5DGCA 3A14A 3WMEA 1EJBA 3V2GA 4C03A 2RHMA 5DULA 3ZCRA 2YWGA 3L8CA 2BEWA 4FUQA 3RU2A 2BW0A 2XCIA 4YYZA 1Z2PX 3C0KA 3M4NA 3SJUA 4DPKA 2FGKA 4ER7A 4TMKA 5C4IA 1E9BA 2ACVA 2J4FA 2PR2A 3EVEA 4MB0A 4L6AA 3D6VA 3BD9A 4D3YA 4YUXA 3KPJA 4QPCA 4U0KA 4TMFA 3RPEA 1U8TA 3KK0A 1L5QA 1R8YA 2HK7A 3PNSA 2RC5A 1CERA 4N40A 2NPIA 2Y1FA 3LLMA 5H3HA 1CV2A 1J8FA 3AK4A 2OFFA 1EZZA 1HEUA 3AHJA 2E7ZA 3T35A 1FBNA 3UK0A 1ZCAA 3BE4A 1HYEA 2GASA 1HE8B 3DAGA 2L0XA 4LYHA 5HIMA 2AYYA 5JNSA 1SWWA 3EK2A 1SHLA 3GMDA 2BUBA 3BWVA 1H5UA 1RACA 3LVBA 3NBUA 5K3BA 3S8EA 3HUEA 2NV6A 1G6HA 4PVCA 4XVRA 5AJUA 5HILA 2P9YA 2ZYHA 4XWWA 3AUKA 4KR3A 1RLJA 5CA1B 4LWQA 4MGIR 3JASA 1PJTA 1R50A 3IPRA 3PXCX 1C0KA 4FC6A 5BRAA 5B3KA 1P29A 3SI7A 5A6VA 2WJAA 3WFZA 4YJ3B 4AJJA 1JDBB 2JJ8A 3L05A 4B33A 4D3XA 2DFTA 1P1JA 1YZHA 1VB5A 2EG5A 1FUKA 3HPRA 1I1HA 2QYOA 1N36B 5ALYA 3PT9A 1F0KA 1P7CA 2D0DA 1FRFS 2HF8A 1OFVA 2OORA 4FYKA 4JJ4A 1C3EA 1P5FA 2V65A 3SIWA 1B7GO 4ASUA 4Z4HA 1UWCA 3V32A 4E46A 2VTVA 1ESDA 3BRWA 5LCXA 3EC2A 4LDZA 4I66A 2NMVA 3NTXA 4HHEA 3TLMA 4N4AA 5GY7A 1P5HA 4YLGA 4N7BA 3DJYA 1KJ9A 3WZLA 2HI0A 2P9ZA 4BWGA 4GAEA 3TW6A 3COYA 3W1WA 1JQ5A 1BS2A 2P4EA 5CCDA 2QW0X 2X5NA 1ZUD1 1R0CA 3IHLA 3R5XA 4TSFD 1GUFA 3RF7A 5ALQA 4PGGA 4DSTA 2MYNA 5C35A 4NYJR 2I2BA 1T5OA 3LM8A 4RNCA 3DZFA 4OQLA 3I6ZA 5FUXA 3QJYA 2WHRA 1VG9B 4ETWA 5AK6A 1ZD4A 2BONA 2CFOA 5SY9A 1SUEA 3VHQA 4Y67A 1CB7A 3EPJA 3TOZA 3I2IA 3AIMA 3ONFA 1I51A 1DC7A 2O5RA 4QODA 3KB1A 4V0LA 5DW3A 2B2XA 2H57A 1IMOA 2C5AA 4X1IA 1KEEB 2NWQA 5DT9A 3P0FA 2I62A 2OHJA 4ZO6A 1MOQA 1SC6A 2UZ1B 4GOLD 4R2HA 4A8HA 4CG1A 4RTPA 4TWJA 2VVTA 3CSUA 2FWMX 4N65A 2IHBA 2QZSA 2KHZA 4GMKA 4HDKA 4WA7A 2I6UA 3G7SA 5GJVC 4KWCA 2V3VA 2PNJA 4AZ3B 1PFQA 2AVDA 3F71A 1YE5A 4H6VA 4DMMA 4Z2AA 4BYGA 5C52B 1LQTA 1AXGA 3PI7A 4W6QA 1T0JB 4ARBA 5HNKA 3QX3A 1WB6A 1RWKA 3HUFA 5B7NA 1TKRA 4C4RA 4YAUA 5DGTA 2HV9A 5EGSA 4QNRA 4DKJA 4L3OA 1C1XB 1QG2A 2EFDB 3N0WA 3OOJA 1RE0A 2HY7A 4D6PA 3OQPA 3K71B 1JSCA 3KCQA 2XB2A 4UTXA 4OTZA 2XMBA 3UUEA 3V55A 1RR6A 5AUNB 2HOQA 5U9CA 3GXOA 3OPMA 2WT4A 2HW8A 2BDEA 4TRJA 1BO6A 1VHQA 4Y1RB 2HTEA 3RRMA 4ER0A 4C7OB 1S2GA 3PNLA 3R8XA 5JAUA 4WJLA 1ISFA 4K2AA 5HM6A 3UFBA 1NLMA 2DUNA 3LKVA 5BV8A 4CTOA 1AE1A 3KR0A 3UJ6A 2ZSBA 5AJXA 1WX1A 2P91A 4WA8A 1K6MA 4I50A 3GA5A 4QGAA 1DC3A 4HNRA 4GGOA 3A06A 3J81A 4JR0A 4PCLA 4QUDA 4CEHB 2P9FA 2JL1A 1Y3BE 5DNUA 4FOTA 4DG8A 4DLRA 2XKAA 5KDDA 3V7UA 4MVXA 1K7EB 1DARA 2JLAA 2YICA 4B9AA 1FSPA 2YCLA 1D4AA 1VL6A 1G8KA 3ENWA 4LDNA 1SK8A 1PNRA 1JHVA 2FPIB 4G0PA 4FWTA 2I4IA 4WOPA 3U40A 2B3TA 4BO3A 2WBLC 1L3BA 3O8QA 2OFOA 4MJ7A 2BPOA 2JIZA 1X7XA 3CEHA 3ONDA 1MOSA 4Y2YA 2HPVA 4PLTA 4US1R 3CLVA 3RLIA 4QECA 2PGAA 1O6ZA 4LPSA 4D9HA 1PWXA 1SKYB 3TFWA 1XRNA 1B26A 1P1FA 5CK4A 2VFAA 2VRNA 1YBMA 3HE3A 2KI5A 4NH0A 5FBQB 3TEJA 4DRXA 1OFTA 1QHGA 3R3WA 4PONA 3EEOA 1PO7A 2IZ5A 3GQVA 2A58A 2AG0A 2FKNA 1AKMA 4JASB 3NBQA 3GG2A 5HOQA 3OEHA 4Y98A 1IVNA 3PC3A 4WJKB 4JDPA 1U1CA 1NJGA 2WPNA 3SIXA 4TUYF 5T3UA 2W8BB 1DIOB 3SQLA 4BLVA 2IH4A 2XW6A 3LE8A 2AKAB 2PL9A 3T61A 3D3NA 3GH1A 3WLNA 3H87A 4JJ8A 4BEBA 1VBKA 4E2XA 4MVJE 3F6PA 1U31A 3W2FA 4BFZA 1ETUA 3O4JA 1RXVA 4JLAA 3OQHA 4C7MA 1NAHA 3Q41A 1I9CA 1C29B 2JJ2D 3HXKA 2MDTA 4RTJA 2DR2A 3TNFA 6PFKA 1PR1A 2HPHA 1P19A 3KD3A 4LV6A 4MKRA 3PE6A 4NNPA 1XDSA 4B6RA 4II7A 2MMGA 5A9RA 1G55A 3WKEA 3KQQA 2O8CB 4LJAA 4LZLA 3C6QA 4TYQA 4CJXA 1NGSA 1HFEL 3W5UA 3KJHA 1T1GA 1NURA 2G7ZA 3B9RA 3FHJA 1ONBA 3GX1A 5FR2A 3I5XA 1QH1A 3FNGA 2ILTA 1XL0A 1C4WA 3FNHA 1KYVA 4LQDA 3AW8A 5H59A 2P2DA 1R16A 2GZHA 3KU4A 3ZWNA 1CQIB 1WKBA 1M54A 2GZ3A 3EVDA 3U1TA 3PUKA 3FHTA 3EWIA 4GGPA 3GLHA 3QJGA 4QOIA 5TGTA 3AB3A 1KDPA 1ACJA 1Q7BA 1OYVA 3RV3A 2Z9BA 3U3XA 5AIAA 2JAUA 2WDZA 4IIJA 4B46A 1U8XX 1VDMA 2NU7B 2ZJYA 3O90A 3PQDA 2P5YA 3WK9A 4ARAA 5C8YF 2WYOA 2H1OA 2DJ5A 5A3VA 4ZICA 4DIUA 4HWSA 2R8XA 1SQSA 1YA4A 3FHLA 4I1OA 1P31A 1QAOA 3GP5A 4HGOA 1ACMA 4QOJA 4UUAA 1NG1A 1YGPA 3T7RA 5JROA 5JTUA 2PMBA 4NBRA 3G8CA 1RHMA 3RKUA 3SGLA 4UULA 4UXIA 1RWOA 2B8EA 4QEKA 1XTIA 4KREA 3KJNA 3AUTA 2YS6A 1K5PA 3E18A 1K75A 4FKZA 4HQ0A 2PH1A 1CR1A 4JQYA 3HCNA 4M7OA 2H1WA 3QENA 4Q4JB 3P9KA 4FCCA 5KOJB 4ZVTA 2G09A 3OT4A 3ZOKA 2ZRKA 2O8VA 2P75A 1N75A 2AB0A 2W0MA 3HA2A 2C1EA 3N0VA 1XDUA 2BIFA 3JRWA 2G6BA 2ZB7A 3DBLB 3PGJA 3UV6A 2OVFA 3GK3A 1EDBA 5CVTA 3LHDA 3Q4GA 1HBJA 2OGWA 4GLLA 3BHJA 3DT6A 5GGXA 3UANA 2QP3A 1RQPA 2BP7B 2OC4A 2DHEA 4KMRA 4RA9B 1M1XB 4BPBA 1GPUA 1GCIA 3DZCA 2N3ZA 3N39C 3U19A 1GQQA 1UBUS 4MWGA 3KOXA 5E4TA 4DPLA 4HADA 5LQMA 4EAQA 1RJWA 1E6EA 4YASA 5DRTA 2WTMA 4MDFA 3MJDA 4QSMA 4DJDC 1EJ2A 4KO8A 3OIYA 2RGCA 4NYIR 4FMDF 4D9GA 2AXQA 1JI3A 1K0FA 4INPA 4LBYA 5C8VA 2PNFA 3PITA 2YVKA 2AMYA 4UDOA 3T3MB 4GBJA 3T8YA 2GFIA 5CCBA 2C04A 1DRUA 2XV1A 1QF7A 4ONEA 4CM9D 1QHIA 4M98A 1RZRA 1XX6A 1CS0B 2BBWA 4RVDA 5C1IA 5ECGC 3PNBA 2CV2A 2X7HA 5HGXA 4Q5IA 2CNWD 2FHPA 2EL9A 2WLSA 2YXBA 3ICPA 4JLJA 3IEVA 4AUMA 2V7QD 4QFCA 3PLAE 3H2YA 4LI3X 4OI0A 3S8MA 4QXOA 4GUDA 4LJ9A 3AERA 2YS7A 5EFZA 1JYEA 1JQKA 5LZ7A 3WQHA 3PFWO 2QP4A 2YH2A 1YTLA 3FMVA 1TM5E 2GUGA 3DBRA 3PDHA 4HYQA 4RZ3A 5EE5B 1SBHA 3TJZA 3O1IC 4BATA 3BXZA 1T5LA 4BVGA 1G2OA 4K05A 4Z1OA 2KE5A 4N5LA 1L4EA 3KTAB 3K1AA 4O3FA 5BOVA 4FGUA 4IEEA 5TR9A 2H2GA 1JI0A 3T3IA 3BBLA 4PZDA 2VTBB 1QQAA 1O7JA 2QVBA 4GEKA 3A6DA 2ONZA 3EULA 3G2HA 4I3FA 5F1YA 4AN4A 3DOJA 1W76A 3MGGA 4PTZA 4RF2A 2I3DA 2JLQA 4LZPA 4JUFA 4MRNA 1EBUA 5LKRA 3JZIA 3OCYA 5CA0A 1UJNA 5G0UA 1VQ1A 2PGNA 4L9RA 3EAQA 2YQ4A 4JENA 3R3YA 2B1RA 2Q5FA 1RCFA 1A27A 5CVEA 3TO5A 3QU7A 2O7SA 1U2SA 4EW3A 4PNPA 4GHWA 3KJFA 1V3UA 3IA7A 4WY8A 4D9JA 4KHPB 5TQVA 1SBZA 3M3PA 4CHGA 3G13A 2YNMA 5IC5A 3C8DA 2F2TA 4KODA 3M81A 3FFAA 1TC1A 3KC2A 3ZXYA 3KJEA 1BDHA 3ZDEA 4AJHA 3KLMX 4U63A 1W5BA 3A2MA 1PK9A 1IMJA 3AR8A 3M9XA 1DRKA 2XI4A 3EZYA 3M8KA 4RORA 5K51A 3HUDA 2ZM5A 3B20A 3HM2A 3IO3A 4WKCA 1TQ2A 2NUAB 2ZUEA 3MGAA 1YSCA 4XSHA 4IIEA 4AC9A 1NLFA 4DW8A 4QM6A 4CIBA 1TF5A 2QN3A 4GM4A 4EBBA 5EL0A 1UBJS 1XG5A 3M4XA 2QAGB 1PTJA 1S7GA 3KXPA 3LOQA 5F33A 3OZIA 1CXZA 4HXFB 1J1IA 3W04A 1V8ZA 4IUDS 3QX7A 3QYJA 3SYNA 3TR5A 1DJPA 1MX9A 5F12A 2YW9A 2B7BA 1KMQA 2EP7A 3HYRA 1JWLA 4FS3A 2QTGA 5DN9A 3NHAA 3LECA 1EIWA 3VH3A 4JFAA 2Z83A 3WGNA 3H8SA 3IULA 4FKBA 4UCWA 1KJ8A 1NPTO 3OETA 2R48A 4WESB 5KQGA 5BYKA 4B7CA 4OJNA 3E9MA 4OOFA 3NKLA 4Q6BA 3K0CC 4M0DA 1LJUA 2HK6A 2VCYA 3KDSE 1V9SA 4RKFA 5E7JA 5KNCH 2Y71A 3HJHA 1DBSA 1JW9B 3HVJA 4KFUA 4R8LA 1K4YA 1KY5A 3OWXA 5DLEA 4KJXA 2JIQA 2QRKA 3RSQA 1UMKA 5C7YA 4ACBA 4N41A 4U5QA 3IBFA 5HFNA 1INLA 2PO5A 2QE7D 3U3OA 1H2WA 2RK3A 2CXHA 4GPZA 5D87A 5GTDA 3L4SO 4XIIA 1ZQ1A 3W5DA 3MN1A 1M8JA 1SHKA 3U1BA 4KXMA 1CPYA 5KTSA 2V7VA 2OCPA 3F9IA 1RRGA 3EC1A 3LUFA 1QQTA 2ZJBA 4QRDA 3EY9A 4MB2A 2DBYA 2GYVA 2YJ6A 4LKOA 2B4TO 3FYHA 5HW0A 1Y6GA 4HCJA 5AO9A 4DMFA 1W0JD 3KHTA 3ZE0B 1I3MA 2W6MA 3L06A 4IOMA 1SVMA 1IJEA 1SUIA 2PRJA 1GTL1 1X0XA 3OJCA 4GPTA 3O03A 5DM2A 3R9XA 1KJJA 1VJ0A 1UP6A 3KB2A 4KQ6A 3FZQA 1QVAA 2H9IA 3N05A 4QBFA 4U2CA 3RWMB 5IT0A 5CA1A 1UJCA 3VM6A 1OXBB 2P1RA 1SC4A 2PA0A 5K1ZA 3P4XA 2X2EA 1FU8A 1HFKA 3A04A 3K15A 4J75A 4LXIA 2Z3VA 3ULKA 4AWAA 3ND6A 1B15A 3QRWA 1IEXA 4JBWA 1ODFA 1EP2B 5TSDA 3DVQX 3PXXA 4H6WA 1S2DA 4YI5A 4CF3A 3KYIB 4LXTA 1RXYA 3ZN2A 2RCNA 3NRJA 4EP1A 1X1RA 1SOVA 3ZVLA 4X44A 3KPUA 3SYKA 1VPTA 4HAYA 8ADHA 5FI5A 2QVXX 3DUFA 3ILHA 4RTSA 1COZA 5ITZA 1E62A 2EF0A 4QUGA 5AVZA 1XRSB 2H5EA 3IDOA 4GMFA 5CT8A 5G1OA 2WJ4A 3U13A 3T3NA 1NVTA 1A96A 3KUKA 3NVKI 3CUWA 4H1VA 4OXQA 5ECDA 1DEXA 4UAVA 3VR6D 3TOCA 3VOSA 4D45A 2QPAA 3KD2A 2UKDA 3MLAA 4OMFG 3H7IA 4CTKA 1W5FA 2PQMA 1Z33A 1F2TB 1HETA 2K2QB 1FDRA 1R0YA 1OW3B 4FIDA 1FMLA 5EN4A 5AVVA 2BFNA 1IDN1 4E4YA 2W2LA 3AT1A 4BQNA 3ORFA 3GEGA 3ZLTA 3GD5A 3RU9A 1PLJA 2I6FA 1YZQA 3RYFA 3FYDA 4PQRA 3FMFA 2FW1A 1EFDN 3UH0A 1AQYA 1K63A 3CNNA 1KOGA 4Y7DA 1DXYA 2WKSA 4RV9A 4Q15A 2BEUA 4LIPD 4QSHA 3QMVA 1KEEA 2HWXA 1PU2A 1TCBA 5A6SB 4GDFA 1W85A 3V34A 3GCZA 1YCFA 3EG5A 1FQOA 1XC7A 2IUTA 2QTVB 4GRAA 3GRAA 4LYDA 1CY0A 2IFTA 7REQA 4EO4A 4G09A 4J16A 5AW8A 1XK7A 5G4LA 1E6CA 3AF5A 4AZ3A 1GNVA 4B73A 3GYBA 3V5NA 4P38A 4RELA 5AVKA 2QYTA 2WP8J 4FDLA 1B6GA 1VKHA 1WTAA 3DLCA 3OD1A 3PDIB 4Q24A 2IXDA 1BXGA 1WMFA 2P6UA 4UEKA 1JDSA 3K0FB 1ZJZA 5DNAA 4CT0A 3ZD7A 1C1XA 2EZ4A 4J07A 5SZJA 3TXYA 2PK3A 2XOXA 1YMQA 1E9FA 1JDPA 1TZ2A 1OU0A 1XZAA 2O3QA 3HWWA 3VZPA 1BA3A 1GZ6A 3KSZO 4DCPA 4JS0A 4GMHA 4Y6RA 4JIGA 2ZRMA 4AZ0B 2C2XA 3MWDB 4ON9A 3AP1A 5TDHA 4LFCB 1D9ZA 4Y1RA 3RQSA 5ADWA 1PWEA 4R5HA 4C7OA 1TZKA 4B2PA 4KLAA 1BA2A 1BFKA 2BGNA 2IUYA 3R0XA 4JUDX 1ZK2A 4LJ8A 4ESHA 1Y8ZA 3FWHA 2CHFA 1OC2A 1YVRA 3BGSA 3BAFA 5BN5A 3CNLA 4UAJA 4OJYA 3PHGA 3ZVKA 4PZ9A 4ZO7A 2EJVA 3P27A 4CEHA 1IY0A 2VKQA 2EBWA 4PHGA 1M3SA 2WSIA 4QUIA 5AKLA 2CDBA 1VSVA 3ENQA 3ZBUA 3O8CA 4IXNA 3RLFA 1YZLA 4IICA 1TKAA 4OQFA 1BCRB 1EWRA 2ZDGA 2CHQA 3L0IB 4H08A 4DUPA 3BMCA 3DDOA 2MMCA 4X9XA 1EFRD 3TLYA 1U8AA 4DNFA 2JCXA 2OXFA 1XSEA 1EVZA 4IVPA 5A1JA 1MQAA 3GOHA 2D3WA 2XTAA 3AR2A 2WWYA 3BH0A 3WP0A 2RONA 4M7PA 1DX4A 5E2IA 1A98A 1CIVA 5F52A 5KSPA 1ZEJA 3I09A 4YMHA 3QV1A 2OBYA 1NRXA 3OJOA 3SNKA 3DC2A 2E5FA 2ERXA 2BFDB 2A0WA 3AR7A 3B36A 3OF3A 3ZHCA 3BJEA 4F2WA 4GP9A 3N8KA 2ETXA 4KPUA 4U7FA 4RDXA 1KZ4A 1Q84A 3O82A 1Q6YA 1Z0SA 3PNYA 3CRZA 4TTRA 4X3CA 4YN3A 1Y8QB 2AX3A 3OO1A 4CEIA 4F46A 2IVZA 2OY0A 1XAJA 3MWYW 1JFFB 2VPIA 2XMGA 3SU8A 5HQ3B 4MRMB 3HDGA 5KOYA 4F5DA 1X80B 2W8BA 3H16A 2C2MA 4I19A 4H1WA 3SKYA 5K0ZA 4NFYA 4JI1B 1ZMOA 3M6VA 4L5CA 3X2EA 5CFPA 2C1XA 4OBXA 721PA 3A3YA 1GVNB 4HX5A 4EGCB 1S4QA 1HDGO 1JH9A 1U7UA 3NDRA 4G1UC 3EGVA 2RJOA 3FUXA 4N1AA 1QU3A 2CEAA 4J0GA 1NXQA 2HXYA 1OBOA 1Z8HA 1P6UA 2BGIA 5IKOA 4DUGA 3O7MA 3RRXA 3TI9A 3ROXA 4QG3A 4FGWA 1EM8A 5KPDA 4KPEC 1SHJA 2WZCA 4DDMA 4P4UA 4C0XA 4XGIA 2O8CA 2B1GA 5IDVA 4H7PA 1YIDA 3G5MA 4Y0NA 4K8RB 2O8BB 3T5TA 3IEIA 4M55A 3HRKA 1IN7A 3IR7A 4MRRA 3E8MA 3ZD8A 1Z4IA 2E4ZA 3DCNA 2ZXFA 3G2MA 3EUWA 4NYMQ 3RVDA 3S2IA 3FWNA 5JPDA 2V9CA 2X40A 5ISMA 3RS2A 3V8RA 3F49S 4B3RB 4GSLA 2AG5A 2X4DA 2QG4A 3Q9NA 4Y0AA 2GNOA 3AHDA 2EERA 3OJXA 1NR1A 1JAXA 4ZCPA 2C94A 2WB4A 4EUKA 1QK4A 2AF3C 3L7IA 3RTCA 3TK1A 4O29A 2CJFA 4BBZA 1IZ7A 3D6TB 2NU7A 1MRNA 2FQYA 3BCRA 4DV3B 3DMHA 3ANNA 4PEVA 2C9OA 4CLOA 1U0NA 2H8GA 2HTFA 2O6HA 2QM7A 1H4TA 2Z30A 4ETIA 2Y05A 1XAHA 3TQCA 4EF4A 3P9ZA 4DCTA 3R1IA 1B16A 1NIJA 4IMIB 3ENNA 1ZOLA 3X1WA 3FXAA 5FDFA 2O2CA 2XH8A 5KHOC 1E5VA 3SC2A 2VDJA 1U1DA 3JSXA 5BUCA 1H4SA 4ZJUA 1JKMA 3IQWA 3X44A 1N9GA 3JQAD 4Q4JA 3REOA 1BRMA 3EXEA 1MBZA 5KOJA 5E95A 2GNPA 1JN0A 2SICE 4DKXA 5J4HA 1PEAA 3TSCA 3CVUA 4DV6B 1N9KA 5CT6A 2V6GA 4O0MA 3NJ4A 2HFKA 5G0VA 5M29A 3B5JA 4TV8B 1LPAB 2HLDD 5CHYA 4YMUA 4ANFA 1XBTA 2OC9A 3SSOA 1ZITA 2NN3C 1A76A 2O3TA 3DO8A 5KYTA 1BG6A 2H0QA 4BMSA 4G63A 4X24A 2FW8A 2G4LA 4M0CA 4P36A 4DPMA 2BP7A 3C4JA 4RA9A 3ZI7A 2QTHA 3ZWXA 2ZK7A 4CQJA 4YIHA 2P7HA 3ZZNA 2ECOA 5BRNA 4FFOA 5EYPA 2ZBVA 2WNIA 1NKSA 2GZSA 4F96A 1XVVA 2XZLA 1FNSA 2EGHA 1USIA 1Y3FE 3AI1A 2J85A 3DV0B 4I8DA 2PGOA 3OHMA 5AHXA 4IZ6A 5DMXA 1JKXA 2GJAA 4IOJA 3S7ZA 4EMUA 1JEYB 1M0SA 4NP6A 4D8YA 2PPVA 5A5GA 3L1VA 2G72A 5IK2D 4BLRA 4E1VA 3EIOA 1NQAO 4JL8A 3MA0A 4NTZA 5AH0A 2BGWA 1V5EA 1L1RA 1EBFA 1LPPA 3D8NA 3QEJA 2JGRA 2BM0A 2C00A 1G7RA 3GARA 1MA0A 3TKYA 4C4AA 1SHZA 1OHHA 4FT4A 4RDCA 1U6JA 4Y2TA 3RE1A 4MWDA 3HVRA 2E3JA 2XLCA 3NETA 3T1QA 1SD1A 4L73A 3G8AA 1UZAA 4GX5A 1Q0LA 5ICFA 3RVPA 4BVBA 3OSUA 1KFJB 2A5GA 2Z2ZA 3GDWA 4LRUA 1QWOA 2VJNA 3C3CA 4Q9IA 1TRKA 3PJGA 1ZL2A 2ZUTA 2R25B 3VMFA 4X62B 2A3RA 2CB0A 2BZSA 3RYCA 2Q49A 2BSAA 2PVCA 3TMAA 1K6IA 3FBWA 2ZI9A 3WBKA 2J3IA 4D0LB 3I9MA 3E61A 1H4VB 1NJ5A 4TKMA 3HBAA 4G36A 3HA3A 3WLMA 2EWVA 3WYDA 5M2QA 5JHGB 3ETHA 2GK3A 2RHWA 2PAAA 5CCXA 4ZARA 4EJSB 5B7GA 2XB6A 4LV5B 1GAJA 2X8LA 4ZXFA 3QMMA 3AM4A 3ELBA 1H8HD 4R0VA 2Q7XA 1A04A 2VQSA 3C3YA 5AK5A 1KERA 1AZWA 4IUBS 4HF7A 3RS3A 4EVIA 2F1RA 1OZHA 4BWYA 5JS1A 1SVKA 3L4BA 1DSSG 1ZDMA 1AVTA 4EG6A 4TTAA 2P4UA 2NTJA 2ZDQA 4D02A 3CXRA 4L16A 2OFPA 3X0DA 4E2YA 2WNSA 3H13A 4W7HA 1FUUA 1MV5A 1V9CA 1ZH6A 2C61A 3EF0A 1DKNA 4DIOA 4GMXA 3LVQE 4DQUA 3EODA 4L07A 5EG5A 2FPPB 2HL6A 1CNFA 1RM0A 4PZZA 3D7LA 3RROA 4RE5A 4XLLA 4CYMA 4FBMA 3GT3A 2X14A 1FE8A 3G0CA 3GHYA 1IEVA 1ZP6A 4NZNA 5FL7D 3SXJA 2D4AA 3ADDA 2JFOA 2Q9BA 3JD2A 1LS6A 1Z0JA 2QAGA 1QTIA 1XELA 3ANYB 3GN1A 1R5JA 1B23P 4DQKA 1P75A 1LW6E 1J2TA 2PLRA 4BIMA 4R41A 4BMNA 2ZTVA 4IGFA 1JLHA 4AX4A 2P5SA 1SBNE 3E3LA 3GO4A 2DTXA 2QEQA 2XCLA 4NU0A 5TE9A 4FJ0A 4D4JA 2NZYA 3ICQB 1GZHB 1K5HA 2DFLA 1SUWA 3CKLA 2PIDA 3H2GA 4W63A 3B6EA 1RBZA 4RSHA 2ORIA 3UMBA 2NVOA 3G5AA 4WESA 3RUIA 3A6ZA 4YWJA 3WKBA 1ECFA 3L7OA 4D0GA 1ISGA 2YV1A 4P53A 1QGAA 3UJPA 2HPAA 3LQ2A 1HXHA 1NP3A 2ECQA 3O83A 4YCNA 1WV0A 4D8TA 3OFND 4QTUB 4CM7A 3VR5H 4HGPA 3ZYCA 4NF2A 1XMVA 4IEFB 4N54A 2Q3JA 5CM9C 3ZKAA 1ENPA 2GPSA 3DLPX 4WOKA 2XGOA 1OWLA 4CPDA 3ON5A 1TYDE 2IHZA 2QD2A 4FDTA 4NBNA 5ADUS 5EXSA 3C14C 1MR3F 1YQEA 3IPXA 4XRRA 3E82A 1HE1C 2A57A 1ZD5A 1LNQA 4DSNA 3KKOA 4K0KB 3M89A 3P2EA 4RD0A 5TGDA 1KYWA 3GFQA 1U3UA 6GPBA 3CNEA 3B3AA 1V7PC 3N9IA 5FF9A 4DE5A 3K6SA 1CZUA 5B7PA 1UMDA 4Q3EA 4GMGA 3LYHA 2GRJA 1XLTA 3E9DA 4H27A 1DKMA 1EJ0A 1SQ5A 3PNOA 3LV8A 2P6MA 2P2GA 4OUDB 4YRSA 4AG3A 4X7MA 1SBCA 3F96A 1C9DB 1Q7EA 1WP4A 4IHAA 3K7EA 5FOUA 1J7KA 5LU8A 2YKGA 1ZGCA 4TKLA 4X61A 4D82A 2YV4A 1EDEA 4IOKA 2I2DA 3SIRA 1GYRA 2R66A 5TQ0B 3OZDA 1YDHA 1G1AA 2G5CA