4LYYA

Crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
179
structure length
171
Chain Sequence
b'YFQSMKHTTEVMITAEEIDQKLDILAEQINAHYADSDRLLMVGLLKGSVVFMADLCRRIKGHVEIDFMSVSSRDVKILKDVQSEIQGRDVLIVEDLIDSGNTLNKVRDMLLLREPKSLALCTLLDKPERREVDVPVDFIGFTIPDEFIVGYGIDYAEQYRNLPYIAKVVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine phosphoribosyltransferase
publication title Crystal structure of hypoxanthine phosphoribosyltransferase from Shewanella pealeana ATCC 700345, NYSGRC Target 029677.
rcsb
source organism Shewanella pealeana
molecule tags Transferase
total genus 47
structure length 171
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyyA00
1HGXA 1FSGA 1YFZA 4RHTA 4RABA 4LYYA 1U9YA 2JKYA 1J7JA 4RQBA 1R3UA 5ESWA 5BQOA 1NULA 1OROA 1VDMA 1A97A 3S5JA 4M0PA 1ECGA 1I5EA 1ZN8A 4PAWA 2H06A 4WN3A 5E38A 2PS1A 3GEPA 5BRNA 4M0KA 1ECJA 1QK3A 1BZYA 4Z1OA 3OZFA 4P80A 1XZNA 1OPRA 4RV4A 5EUCA 1DKUA 3LPNA 4P83A 1LH0A 3NAGA 4X44A 4RADA 3MJDA 1G9SA 1G9TA 1JLRA 2HCRA 4MB6A 1GPH1 1A96A 1NONA 3DAHA 1G2PA 1XZ8A 2FXVA 4QRIA 1U9ZA 1A98A 1BD3A 1UPFA 2JBHA 5BQPA 5IAOA 1OREA 1DKRA 4TWBA 1V9SA 1QB8A 4M0UA 1WD5A 1AO0A 1QB7A 2VFAA 5IPFA 3LRTA 1XTTA 5ESXA 1ECCA 1GRVA 1O5OA 1UPUA 1PZMA 3OZGA 4RHUA 1ECFA 3EFHA 1Y0BA 4WMLA 1I14A 4IJQA 1HMPA 4RANA 2XBUA 2YZKA 3DMPA 4KN6A 3OHPA 1UFRA 1XTVA 5K51A 1QK5A 4P86A 1QCCA 4JLSA 1STOA 2DY0A 5BSKA 4RHXA 1XTUA 2IGBA 1ECBA 5KAPA 4JITA 5JV5A 1QCDA 1TC1A 4RAQA 4OHCA 1A3CA 1JLSA 1I0IA 1L1QA 2JI4A 4P81A 4RQAA 4QYIB 1P4AA 1IBSA 1W30A 4QYIA 3MBIA 1Z7GA 2C4KA 1G2QA 1D6NA 3ACDA 2GEBA 2WNSA 5KAMA 1I0LA 5JSQA 1A4XA 2H08A 4LZOA 4LYGA 1TC2A 2JKZA 3G6WA 1MZVA 1P18A 4P3KA 4PFQA 2PRYA 4RACA 4RAOA 1I13A 1O57A 4P82A 1QK4A 3H83A 4LZNA 4P84A 1DQPA 3KB8A 3DEZA 1P19A 1A95A 3HVUA 4X45A 1L1RA 2E55A 2AEEA 3ACBA 5HKLA 3O7MA 3N2LA 3M3HA 1CJBA 3ACCA 2H07A 1DQNA 4LZAA 1P17A 4FYMA 5HIAA 1ZN9A 4F8EA 1BD4A 2PRZA 1VSTA 1ZN7A 1VCHA 3GGCA 4ZFNA 3QW4B 4S2UA 2EHJA 2P1ZA 4RHYA 1DBRA 3GGJA
chains in the Genus database with same CATH superfamily
4H6PA 1MEEA 3GBSA 1YFZA 2AE1A 1AKEA 3FVWA 3IVAA 2NU9B 3VNSA 3ZLTA 3HCEA 4ECEA 3A0UA 4XDHA 4YX9A 3S2EA 4Z2YA 4O4IF 4ESVA 2O4CA 2Y8EA 3PL1A 2H9IA 4HNHA 3JQPA 2PCJA 4CQMA 5KWIA 2B4QA 5AOCA 3OLWA 1C81A 3ONVA 3C3KA 1CIVA 3IUSA 3NBZC 1VCMA 1RXWA 2QW8A 4CKEB 1O08A 5BSUA 3CVJA 4CG3A 1QAOA 1SCBA 3MS7A 2FCRA 1Z0AA 2AW5A 2BFPA 5H3HA 1T0UA 3FFXA 2V6IA 2J3QA 2QLLA 4RSMA 1GN9A 1ZAKA 4N3BA 4N4AA 3TQOA 2UUPA 1JKIA 1S89A 2V7TA 1PR5A 4BMXA 4BKPA 1VYTA 4L4ZA 3SI7A 5ADVA 2XHEA 2PX4A 4F92B 4QRIA 1HO3A 1N5MA 1NRJB 2GZDA 1BGXT 1QIDA 2NSDA 3JZDA 1G2IA 4C87A 2CDNA 2CMHA 3OX4A 3NDBB 1XRQA 2IXFA 3CRNA 1CJUC 2QU7A 5DNDA 4Q9LA 1M34B 1TM7E 1ZU4A 3B20A 4EB6B 5CFRA 3EA5A 1CQWA 1GD1O 3RE1A 4KIGA 4FINA 4JI8B 2DR2A 1HG0A 2UKDA 2Q6IA 2RC5A 2VNSA 3PVZA 3Q3HA 3GWGA 5IABA 1XKLA 4EEZA 1MENA 1NQAO 1YRYE 1Z5NA 4OD0A 4KC0A 4XVHA 4JQCA 3VPSA 3NANA 4NMMA 5IXSA 2GETA 2UUBB 1HMPA 3SK0A 1X7XB 4DLSA 5IYZA 3DV0A 2GX6A 4RMHA 5FX2A 1U1CA 1MABA 5IN4A 3GL9A 4NP6A 1LDEA 3UA4A 2QRVB 4DNXA 5E6RB 3QJGA 2XT9A 4O2BA 4RHXA 3KR2A 1P81A 2WEKA 3C70A 3RIGA 2GSWA 2DWUA 3LUJA 2RARA 1XVTA 2WHEA 4LVUA 4DLWA 4Q4DA 2VDWA 1WM1A 4CTJA 3MJTA 3LC2O 4AS2A 3RC3A 4MUBA 1RKVA 2GO7A 4X6YA 1F17A 3D9QX 3LT1A 5ALPA 3MZ0A 4Y67A 1P80A 2OL4A 4N49A 2JEYA 4QTYA 3KE9A 2WHQA 4EY8A 1VSUA 5HYVA 1DKQA 3M5PA 4J8PA 1Z6TA 4OU5A 1S1MA 1L7DA 4HTAA 1ABFA 5HWSA 1XZGA 3SM9A 4UNRA 2QJOA 1DJQA 3K0AA 2CXNA 1SVWA 5EZSA 1U5AA 2YY6A 2ZVJA 4ZO4A 1TW3A 1ELOA 3HI4A 4JI6B 1VRVA 2HLHA 3QBEA 4K6KA 5F12A 4D3YA 2HQSA 5A4MS 3TNYA 4DV3B 4OQPA 3NIFB 5AI9A 4OP2A 2I55A 3HZOA 4PBSA 3RD5A 1PEAA 1ZAYA 3N87A 3HEBA 2GZSA 4K40A 4QWWA 1GTZA 1AGRA 3KAQA 1CDZA 1PL7A 3WKCA 4DXAA 5IDWA 5C37A 2V1UA 5F1OA 1RM0A 2PBRA 3IS3A 3DKPA 3N2LA 1U02A 4IQ4A 1JLLA 1HTWA 1I80A 4MQ4A 3B9PA 3RU9A 2COEA 5IDYA 5IVIA 4FDUA 2JH3A 2YXNA 1RXCA 4BPBA 3CUEF 3SSOA 1WKCA 2WJ3A 2QUAA 1PR9A 3KWJA 1S2GA 4RDHA 2BLNA 3MWFA 4RGYA 2Q3HA 5GV7A 3VO9A 5CCEA 3Q8KA 3S3TA 5B55A 1Z5GA 4RK5A 1BQ4A 3Q3GE 2QMUA 4F3TA 5A9TA 4XQGA 5LWQA 1ESDA 1TQDA 2X58A 5CCXA 3IQFA 2GHTA 1FDVA 2B8NA 2LWIA 3D4PA 4MKXA 4WHMA 3ZVMA 3FSEA 1EE1A 2H5EA 4INZA 1I5EA 1T5BA 5EUQB 2Q5QA 1VJTA 3AUYA 3JU3A 4MWCA 1NT2A 3DE3X 3SHOA 3JWIA 4EMBA 5KYGA 3G9XA 1U4NA 4NNJA 4TTSA 2O7NA 3UUFA 5FV4A 1EK1A 1ND5A 3LSYA 3L7AA 3MIIA 4ON9A 3T99A 3C8MA 3CEMA 4N54A 2V5UA 3GROA 4JGGA 4W1SA 4RW0A 2GB4A 5B6IA 1U0LA 4IIXA 4IWYA 2HX1A 2ZVQX 2JFYA 1NSTA 4MWBA 2VYND 1FDUA 5DN9A 3EGVA 4IV8A 1Z39A 3HC7A 5BXQC 3LFUA 2VCHA 5BQFA 3THXB 4JI4B 3QBVA 3QTTA 1RXUA 1A69A 3WGYA 1DKPA 2JD2A 2P62A 3FPAA 5IC6A 4PZZA 4XVQA 1KEVA 2JL1A 4K03A 1BQ3A 3RQIA 1KPGA 3UJ8A 4BCDA 3P4YA 4D9KA 4MULA 1J1ZA 2A5DA 3JQGA 3QUTA 5A6SA 1U63A 3EMKA 3D6UA 4XAQA 1ZM7A 3F7NA 3EA0A 3HEAA 3PT9A 4C03A 2IDMA 2P2SA 3NFRA 2XCRB 2JFQA 3EVFA 2H4YA 3M9LA 3U26A 4ZI7F 3ER9A 4HQOA 4EB3A 2P9CA 1TECE 2QSUA 3ZBQA 1U81A 2UZ1B 1QGDA 3OE4A 3QPDA 5J40A 4GXTA 1VKRA 1DG3A 4RZUA 2Q0QA 4ALNA 1ZH0A 2F43B 3ZEIA 1KO1A 4KN6A 2AZDA 2LV8A 2W6ID 3HSSA 1T91A 1X0VA 3H9EO 4ECAA 4R16A 2QI9C 1U28C 3AXTA 1VL8A 2B1QA 4BMZA 3IIKA 1O94D 1YB2A 5B7PA 2BEWA 3QY9A 1FOEB 1Y7PA 2HLNA 2TMYA 3A9TA 3TPFA 3IIIA 2AXNA 1VL0A 3VOAA 1W6UA 1RVV1 4ENTA 1A1VA 1XJ0A 2FMUA 4A0SA 3OAAA 4GOOD 3FDXA 3GJ0A 4QYIA 3M4XA 3L18A 3RC9A 4B3FX 4F2HA 4H18A 2MOKA 1IK6A 1EIZA 3IDQA 5I8PA 3LQ2A 3QM1A 4HWKA 2O2JA 3L8CA 1J1UA 1G6Q1 1KI6A 1Y3IA 1GZ7A 3KUXA 4BTLA 1KY3A 3EUEA 4RPGA 2W70A 1U04A 3SWWA 1M7HA 3S81A 4BLUA 2BZ1A 1WSBA 3GNTA 4CT5A 1QR6A 3ZIAD 1Y42X 3ET4A 3LYUA 4MR8A 1W52X 2C58A 3HHPA 1EP3B 2OZKA 5ED0A 2A0UA 4NG4A 3MW8A 5CBPA 1TKCA 2HGZA 2PRIA 4Z9FA 5C4GB 3VH1A 2VO1A 5FI5A 1GUAA 4QXOA 2G09A 4UTZA 2DT5A 3EE6A 4MICA 4ZO9A 4HFJA 3VPDA 4AZWA 2DKNA 1JEJA 4P7JA 4DYVA 4UAVA 2HDWA 3QITA 3VYVA 3HADA 1WW2A 1CJBA 4FBMA 4P92A 4EFKA 4WBNB 4K9SA 3UGJA 2J6BA 4CR7A 5JAPA 3L7CA 4A36A 1IUNA 1J2JA 1B6SA 2GEVA 3N8KA 4HNAB 4QGBA 2WILA 5EJMA 1D1QA 2AG6A 2ZDHA 2X7HA 4BEBA 1OZFA 1KAQA 2I3ZA 1KMCA 3PNBA 5A9SB 4UQOA 2O8EA 5T6MA 1G4UR 4FC7A 5AVQA 3FDZB 3L02A 1RDFA 4IHQA 4F2PA 3PIDA 3KQNA 4PVDA 3ZJYA 2C00A 4ZCPA 4AJ1A 1K3TA 2Q4RA 3GFTA 4ED9A 2ZRJA 2YJ3A 1V6CA 1PHRA 2PFKA 4N5DA 5EMHA 2ONCA 3AK4A 3VZPA 3T0GA 5D3QA 5KVAA 3D3EA 3DEKA 1N1DA 3Q2OA 2XXBA 2ATCA 4E4RA 4YQYA 4N01A 3H3FA 2PS1A 3EEYA 3NO4A 3KHTA 3UT5A 5HILA 6YASA 2NO7A 2DPYA 1JLLB 1RBYA 2WFLA 2JHFA 1RRFA 4HXEB 4JT4A 4BDTA 5F64A 5EAIA 1M2KA 1DWQA 1FXWF 1I2ZA 1UPTA 2BTQB 3P9IA 5JD6A 2W2NA 2QV0A 4C2BA 3F7OA 3NR2A 4KQ9A 4EY6A 2XY4A 2AF3C 2ZJ2A 3EQ2A 1R0WA 4GQIA 3ZWAA 1NGSA 2HCRA 3HUUA 1YCGA 3CUSA 1B3BA 5CH5A 1HKUA 3MT8A 4I50B 1XZ8A 4PFKA 4FSHA 2LCFA 4KUGA 4EYKA 1W75A 3QFCA 4KG7A 4E3ZA 4Q37A 1W6RA 1FUUA 3ORHA 4LJYA 4JI3B 3HDVA 4EA6A 2FPOA 1UC8A 5BV0A 4A0GA 3TWOA 3CNQS 1CB7A 4JBGA 3FI0A 2H0RA 5JBIA 3CINA 1E7MA 1X87A 4V0NA 3PQ4A 5KO2A 3C74A 3M8KA 4B35A 4ZEVA 1JZSA 4L5CA 1KE2A 4NCJA 2FPMA 2P4EA 2PQMA 2QG6A 3BRQA 1ZRNA 2QQEA 3CX7A 1YD7A 3FPBA 1UINA 1KMHB 2D2IA 3ZIDA 3OOYA 2XADA 2XOXA 1YB1A 2B8EA 1XAGA 2NVBA 3LQFA 4FXOA 4JKYA 1EINA 3QMVA 4FP9A 1ZKDA 5FBVB 1S7GA 4ZTBA 1V1JA 1E1LA 1II8B 2EWMA 3H4TA 4R31A 1N6RA 2A1IA 1P7PA 2FSFA 5AKGA 1T35A 4NYIR 5ICFA 5BSWA 4C2TA 1M6HA 1QCDA 1X14A 1Y6JA 2R9VA 1PHPA 3DBLB 2GUGA 4WKOA 2AGVA 4PEVA 4M54A 4ETMA 2HJSA 2H85A 1MC5A 4R1OA 5ANRB 1VPDA 5HK9A 5LUAA 4K6OA 3UKDA 1E18A 3H2HA 3G5UA 3PC2A 1NI4B 4QL3A 3ZE0B 2G83A 3IKLA 3STUA 1EXWA 5GMOA 3UK1A 4B84A 4AJLA 3TLKA 1CR2A 5G41A 1JIIA 3TECE 2G5GX 5CT8A 1BE1A 1WR8A 3KDPA 2QBYA 2DTDA 4MVJD 2WD7A 3TFWA 4A6XA 3A9CA 4KVAA 1TLFA 3WJ7A 1M8KA 4HCJA 4ZAXA 5JCOC 2H1CA 4ROTA 1UDAA 4LY0A 3AR4A 3OEEA 2NGRA 2HFKA 3ZXIA 5I9TA 3R24A 1Q7GA 2J41A 2FWNA 2XYQA 5IBQA 3SOPA 3WMEA 1UJNA 3QF4B 3FNQA 1SC9A 2BGKA 2YUTA 1D0IA 3HVJA 4D4KA 1ZOSA 4FPXA 1CY4A 3EDRA 4L7QA 1FMTA 1TPYA 4IGIA 3D3KA 4H27A 4ZOBA 4AJ4A 2I6FA 5ENVA 4CF6A 2DCMA 2I7TA 3HRKA 3O2QB 3WIUA 1RS0A 2VAMA 1JIUA 4ARZA 2ZRHA 2A8YA 1PWHA 1I8TA 3N28A 2JZOA 2EQ5A 4YCMA 3BRWA 1ZXBA 4RTRA 1X94A 5FOVA 2VSXA 5K3FB 5MFZA 3OLQA 3T5MA 4XX0A 2BEVA 3C5EA 1UXGA 3PEFA 4PC6A 2J6IA 1EP1B 1LLUA 2RJ3A 2REXB 1K8QA 3NXKA 5GV8A 6ADHA 1BMTA 2ZIFA 1YR8A 3HNRA 9ATCA 4Q9KA 4TLCA 3OMWA 3FMGA 5FL7A 4CGYA 3BMOA 1XA0A 4OQZA 5IZCA 3AERB 1T5TA 1MZPA 2YXPX 1ZWLA 5ETJA 2A1TR 2B8TA 4AJ2A 4KAJA 1NW3A 2E4UA 3ELDA 3DA8A 1ESMA 4FWIB 1PVVA 4OGWA 3WYEA 1I3OA 2UYCA 1NE7A 1LH0A 3DBRA 3I73A 3E0QA 2LDBA 3IBFA 4GBGA 3ICCA 2B4AA 3RRFA 3PE4A 4EO4A 3EJ6A 4DQVA 3U1BA 5B1YA 1RAGA 3KT8A 1QF7A 2VZEA 4D0SA 3K53A 2V65A 2YZ7A 3GFQA 1CUBA 1LS1A 5AJXA 4LOLA 4BQSA 4EW2A 3ABOB 2XUHA 3H5OA 1KHTA 1M8FA 2HF2A 2JFWA 4GYWA 3WNQA 1T9GR 4OMCA 1CUGA 1RE0A 4ACBA 3QOFA 4IXMA 3K1ZA 1Z45A 1M1XB 2CD9A 1SCIA 4IY1A 4B3HA 1TJPB 1PDWA 5LQMA 1XVUA 3DMPA 2D7JA 5CDTA 3NBAA 1N7IA 4A26A 3PE6A 1WAMA 1YS1X 2AI1A 3H5WA 3I64A 5I8ZA 7REQB 2ERCA 2CY0A 2ZYHA 1O95A 2WOJA 3F2IA 4B4OA 4PN3A 5IJ0B 2TMGA 1AQNA 2CDCA 4Z54A 4BDSA 2X6TA 1G42A 1P9OA 1DAHA 4P0TA 2F3TA 4W8HA 1XD9A 2ORVA 1GPYA 3BX1A 3WDLA 4B5LA 4C0SA 1TMYA 4KX5A 3G6KA 4L1KA 4DLKA 4K1LA 4TKVA 4FHEA 2X2OA 1IBSA 1PQ4A 2WSIA 3ENVA 2B83A 1SBIA 4DSOA 1ZRHA 4JK3A 4ENUA 4QARA 5F3RA 5FBQB 5BURA 1QGUB 1IZYA 3GA7A 1AUVA 4NE9A 1YR6A 4BO8A 3VAAA 2G4LA 1Q0RA 2PZBA 3IVCA 3NJ8A 5FT9A 3D2CA 5B1DA 4C9BA 3U3OA 4GMGA 1FP4B 3WYNA 2C8KA 1OAOA 3OFNA 5SV2A 4DMMA 2GJAA 4TTVA 3K0KA 2P9QA 3BDAA 3U17A 4O4LF 4EKYA 5CEJA 4YO8A 2H11A 2GN4A 2P67A 3EVDA 3F3KA 2JVIA 4UTVA 3LP8A 4Y2RA 2I80A 5ISMA 1W49A 1HDRA 3DZHA 2DEUA 1TADA 1BCRA 1RP1A 1VPWA 1KRHA 3O0DA 2LRHA 3QWBA 3IQDB 3BQNB 4QZVA 3P7MA 1E0JA 4G5GA 3V6LA 3P2OA 4E30A 1P1BA 1RJ9A 3HJTA 2XB6A 5KJ1A 4B3DA 2NT4A 1FUYB 3M6IA 4N3GA 3O8NA 3KJXA 3PEVA 1OX4B 4GS5A 4UHJA 2ID4A 2AH5A 3E9DA 2CYBA 4M3NA 4TLAA 1CUDA 1WXXA 1ZO8A 3GFFA 4Z0TA 1OXUA 5JDIA 1ZZGA 2FFHA 4FYPA 3TJRA 1WXIA 4IDEA 4YRBA 3BFPA 5LOVB 1XNRB 4NZOA 4LRQA 4CL0A 1JAXA 5EWLA 1EVEA 1B1CA 3TM5A 4M98A 1DIGA 1SD1A 5B64A 5JNUA 4RU1A 2ZJOA 3GEEA 4FW8A 3TZLA 5BPFA 2GUWA 1QP7A 2NIPA 1P9NA 1RWKA 1A1SA 1Y1KE 2B1IA 2PKEA 2WWRA 3MTDA 2XIQA 4K5QA 3AHCA 4OX9B 4UM8B 5L8VA 4Y7DA 3G23A 2Y0DA 1I2MA 1QYWA 2QAGB 4PIMA 4YP7A 5AVOA 4B4UA 3I9V1 3R0XA 1F8YA 4M9ZA 1JQ3A 2QJTA 4L72A 4S1PA 4ARZB 4X92A 3CCCA 3PLAE 1E1YA 1TKBA 1V71A 3K6SB 1H4SA 3LP5A 4F6RB 1TU0A 4EY5A 1PV2A 1EGMB 4Q7KA 3REFA 2BEVB 3U4CA 3ZEAA 3CZ4A 3PIRA 2QQ5A 1SA0B 1PDVA 4AO6A 5IAOA 2IHYA 1IEWA 2XUPA 2PD4A 4JYMA 1PI3A 1X7GA 2H1FA 2M1XA 4R5MA 1LX7A 5EJIA 5AVSA 5C1PA 1W2GA 3QHQA 4MMXB 4QLOA 2FN8A 1W4ZA 5C1OA 4HSGA 1RQ2A 4DCJA 4DA8A 2DU8A 2Z1NA 3MPOA 4IH9A 3ZBUA 5KVSA 2C7PA 3DCNA 4K1XA 2ZJ4A 2XODA 3TS1A 4ITVA 3G2PA 3DUFA 1SN7A 3AHJA 4LK2A 2Z2JA 4PRZA 1DG1G 1J5PA 3O7WA 2XUZA 3BL8A 2FOXA 3C6ZA 3IELA 3LWDA 4UZSA 3VKWA 4DY4A 3DQZA 5K6AA 4UOQA 4HN2A 1OAKA 1E5VA 1FBTA 3BA1A 4QQKA 1QPBA 2WU0A 3UGTA 3K70C 4P0QB 3W2GA 5ER9A 4TTPA 3JTMA 4WOCA 4PX3A 5DULA 1YKSA 2BISA 2WWVD 5KTRA 2XNDD 3KLOA 1JQ5A 4C4YA 1X1AA 3EG9A 2JJYA 4MW0A 1SQGA 3W1EA 2CLKB 2BJVA 2Q28A 4L74A 5TGDA 4L2IA 1JX6A 2EV9A 4TXHA 2AJCA 4DJEC 3FCYA 4J0HA 4ZGGA 4V0LA 5CXSA 2CB9A 5F7XA 3S2IA 5T67A 1IPEA 1XJWA 3AZPA 4RDCA 2JC3A 3SLKA 4BVJA 1TE2A 2Y1XA 3ETGA 3MLAA 1YS4A 3OEHD 3P9ZA 4WOPA 3NT4A 3RU3A 1Q95A 1I6WA 4LQ4A 4K86A 2BFBB 2G9ZA 5D85A 3O4VA 3HA7A 2RHMA 2CXUA 3DTVA 4KEAA 4PWZA 2FR0A 5T4BA 3K71B 1QE5A 3OCVA 1EBBA 2OAQ1 1V7ZA 1VHQA 3UFXA 4BAUA 1E32A 3LCRA 2EZ8A 5CFLA 5K8UA 5DCLA 2ENWA 5BWNA 1YZFA 1DHTA 1SCNE 1G6HA 3S7TA 3C4QA 4MLDA 3NHKA 4L0CA 4YJ3F 4U02A 3HLYA 4CL3A 4RZ3A 3F90A 3KR1A 5KEIA 4TKVB 3EVBA 2TRSB 1R6DA 3HFRA 4MZXA 5CA0F 2JEOA 5KNDD 2GF9A 5J3JA 5KTNA 3B1YA 5F3WB 4F9FA 2JF0A 5EJGA 4WINA 1WCYA 1VTKA 4OI4A 1SOAA 1CSEE 2DWOA 3A31A 4X1KA 4ZVVA 3P4XA 1GUDA 3GFRA 4AX4A 2VA9A 1PL6A 1BA3A 4AJJA 1L6RA 3UJNA 4RTKA 3P9QA 1PYDA 2JGDA 3RSSA 5DP2A 3T5BA 3RFCA 3O90A 3QOYA 2PV0A 3QLTA 1LBHA 1A9OA 2XE7A 4R1QA 4RCVA 5ESWA 4DDTA 3CXUA 3DVAA 4E46A 1W48A 1JB9A 4J1SA 4MCHA 3LUDA 4XA8A 1NWCA 4M53A 3M5CA 2FV8A 1H2ZA 4HATA 2BKVA 2VQDA 2NV0A 4WDRA 5FNVB 3A9SA 3ZJVA 1RJ9B 1U5BA 2X1HA 3ZDAA 1RC1A 2LPMA 2Q4BA 2XCTB 1Y6FA 5FKJA 3V4FA 1NOKA 3LPNA 4F60A 4BB5A 2W90A 3BE4A 4L5AA 1I2CA 1UBCA 4ZI5A 2BLLA 1G60A 2HSEA 1XTBA 1MTOA 2FRVA 3ANMA 5DOZA 5T4EA 4BNXA 4TYQA 2QPAA 4L3WA 1J25A 2GPWA 3B1WA 1TYAE 3OPYB 5CLJA 2AZXA 2YMQA 4TMXA 2H7VA 4US0R 4GNKA 3KYBA 4DMFA 4W9MC 3ZHUA 1GCIA 1V6SA 1Y8RA 2ECQA 4Y6LA 1XU4A 1NQWA 3AVPA 1MX3A 2BFDA 3OLCX 3GEHA 4NCAA 4MLZA 4LRSB 2O20A 1TIPA 5BUCA 4HG2A 221PA 2D1RA 3ZKWA 5IHPA 4JJ8A 1OBHA 1L5QA 2CNWD 2B7CA 4YJ2B 1YVPA 4OUKX 5IM5A 3FJYA 1RXVA 1P62B 4KV9A 5HA5A 3IEPA 1HETA 2OO5A 1VSVA 3LUCA 3RLIA 1RKBA 3SLGA 2E9SA 2YZNA 2Q41A 3GWZA 4GFDA 4RHCA 4Y98A 2YMPA 5DF1A 4XIJA 5JC8A 2RCNA 1L4LA 1UC5B 3WLIA 3OPMA 2HSWA 2O1EA 4MV4A 4Z0PA 2JB9A 4M7RA 4DC0A 1B8OA 4PSVA 3VA7A 1YU6A 3D59A 1BVHA 1ECPA 2UUCB 2JIPA 4AF7A 1M1UA 4XR9A 4QO8A 4EH1A 1FFXA 2F3UA 1VG0B 2PKWA 2PWPA 3DT6A 3IEXA 3P94A 4FOSA 4L15A 5J9FA 3ZLJA 3FPKA 1BHO1 1DS6A 2ZBEA 5KYVA 3UJDA 3P27A 1VHJA 2HA7A 3R4VA 5JNWA 1UZMA 4NCXA 4EG8A 3OX3A 1HYQA 4YK7A 1F3LA 2HCJB 3B53X 2V7UA 3CJRA 4H17A 4PGFA 5KYXB 1IXKA 4IO1A 3ROKA 4L8YA 4OI0A 3COSA 1RKXA 1RHUA 2D3TA 3PRJA 2C2YA 4ZT5A 1FFCA 3CLHA 3DR3A 1NNI1 1CP3A 1HYGA 2VBFA 4L2IB 1FSFA 2CB0A 2ZLBA 3K0FB 3MQFA 2ZE6A 2IW3A 4Q48A 5AW3A 1DQNA 2G28A 2ZWVA 5CJ2A 4TQGA 1A9YA 1WD7A 2UZ3A 1Z07A 3H1AA 2GM9A 4ZODA 3IPRA 3ZQJA 3SXPA 5AVZA 4BU1A 2QTVA 2WLTA 2FK8A 2DLCX 4MI6A 2JLBA 1SKBA 2IOFK 2ZRCA 1PSDA 3T5AA 3OMLA 4BX0A 1EU1A 5MF6A 1KC1A 3INYA 3PF8A 3TLEA 3X1WA 1HY3A 5DP1A 3K0SA 1PS9A 4UU1A 5EZ5A 7ADHA 3VR4D 3JQEA 3F9RA 1J22A 2IYFA 4BV8A 5LB4A 1X6VA 1RWXA 4HFRA 4E09A 1MTZA 1MEOA 4WKCA 5F2EA 2A6PA 1ZH6A 4P32A 3L0ZA 2KBFA 1PJSA 3CW9A 5D3MA 4F4IA 1MB2A 3O8BA 1XK7A 5CYGA 1WP9A 1JQBA 1JVBA 1UEXC 1X80B 3E8MA 3SFTA 4Q9HA 1DHRA 1JE1A 4NH4A 1F14A 4EJFA 2QRJA 4JJAA 3B7GA 5ALYA 5H1YA 4C5AA 2HWXA 2GYYA 3GXBA 2R85A 3H1PA 1VYUA 4K87A 1IE3A 1KAOA 4D96A 1FFGA 1Y6QA 2YW2A 2R6R1 1P3DA 2AR7A 2P0YA 3DGEC 3DMGA 4HWTA 4M38A 4HDSB 4Q3EA 4B4WA 1AG9A 3SNHA 3ZHQA 1BKDR 3WMWA 2B1JA 3RUDA 4B6SA 4EX6A 1PQYA 1B23P 4FFDA 4PHCA 1P7ZA 1V45E 1Z7BA 5BT9A 2R8ZA 1FDWA 3JYHA 4M0MA 3TGWA 3IKTA 3DEFA 4WT7A 1FS4A 1ZJJA 2RGYA 3BVPA 4UBNA 2G0NA 2R6FA 4EIWA 4W9NA 3JWPA 3HBAA 3K0CA 4Y9UA 2L0XA 1UKVY 4FOLA 3PBKA 3F7MA 4J94A 1GRVA 4DKJA 4Q7JB 3T1NA 4FGJA 4QX6A 4UXHA 1EUZA 4EDFA 5IH7A 3O3NB 1Z5VA 2RI1A 2YHSA 4LYAA 2IXDA 1IBCA 3U0BA 3SYNA 3RPEA 1V7QA 1NXVA 4NXMB 2J8ZA 3PQ8A 4TWAA 3H7IA 3D7SA 3IBCA 4H60A 2FEWB 2IBMA 3U48A 4HJXA 4JP1A 2ATVA 3O9VA 4I1OA 3ZE1B 4RO0A 1PS8A 4B7CA 4EHHA 1G3QA 2IPOA 3KOXA 2IS2A 2IS1A 1Y8RB 4RORA 1GGMA 3RO7A 2Q50A 3HU2A 4D4HA 1NVUQ 4CEHA 3DBOB 1Z3IX 3G2LA 1SXGA 4RXMA 3AFMA 1H2XA 1KP3A 3ZV3A 1YSCA 2YDXA 4B4DA 4ALLA 1TAGA 5J4YA 2RMKA 4E4TA 1X42A 4ARBA 1HURA 2FQWA 1POXA 1XDZA 1EX6A 1QLWA 4MCIA 3FPEA 4YUVA 4BMDA 1ISHA 4KNVA 3Q8WA 2W42A 4DANA 4KQEA 2GILA 1NDQA 2YBEA 3DL0A 4Q47A 5BSGA 4DUGD 3DKVA 4MJ7A 2PLWA 3COPA 3HDQA 4TWJA 4CQJA 1MXHA 1RI1A 1RIFA 1VL5A 4ER6A 1R2QA 4H4DA 4TSRA 1KI8A 3UXHA 1C9JA 1H9BA 3UJ3X 2BGTA 1T1RA 5PGMA 4I7EA 1VMDA 3AEQB 3RSZA 4DBZA 1E6MA 5CA1F 1I24A 3ILYA 2FLVA 1Z7YA 1IJFA 3UAZA 2IX9A 3W2FA 1E59A 2GPBA 2YXEA 4FS8A 3UMVA 1MD9A 4JLDA 2VAXA 2VWHA 1JYEA 4GOMD 2WU1A 3ZH2A 1TQ6A 3RNOA 1X70A 2ZWIA 2XUDA 2R8BA 3ONWA 1FFXB 3B12A 3FB1A 1GUZA 2HBQA 2XXAB 1ZCBA 2FEOA 3KR9A 3KU1A 4XFJA 4BZWA 3QE0A 2R86A 3NDPA 4OTZA 2ODTX 1C8LA 3D4NA 2B3DA 3MWDB 3V1YA 3HB7A 4RYLA 2D2VA 1FU4A 5J4KA 1UP4A 3TQIA 5K45A 5I7SA 5EZYA 4HR7A 4KAXA 2ZAGA 4FS3A 5J58A 2HQOA 3HWWA 4C43A 4F06A 1N8SA 4K8OA 1XC7A 3B3AA 3KD2A 3IT3A 3C3WA 2BSXA 1PJLA 1JIKA 1M0WA 2P68A 2ODWA 5H4HA 3ZCQA 4TV8B 3CT6A 3P9CA 3PDJA 1HXHA 4IMJB 4JUDX 3M81A 4RESA 2GAFA 2QTVB 3HHEA 2P2LA 1FLNA 5EIWA 3U39A 3KEMA 4KBGA 3DE4X 1ZH4A 2O3UA 3JQ8A 5EG5A 2V3CC 3TD6A 1VE5A 1LBQA 2QRZA 3DAHA 1KAHA 1NRWA 1E6WA 2VJLA 4GOJA 3KTAA 1ZMTA 2ZPUA 3O38A 1E2GA 1KI1A 3EC7A 4P54A 3NBQA 3T7DA 2PX0A 4M8IA 1QG6A 3DM5A 2QMOA 2Y9MB 3A1UA 3PFHA 4HXFB 4DT1B 2BHSA 3RRNA 4AS1A 3T5TA 4Y6OA 3IDAA 2L82A 4BNHA 4CE6A 5ESXA 1NXTA 2F48A 2IGTA 3A6DA 4JEHA 1FFDA 3KFXA 4ZREA 3RJ5A 3I5YA 3E2IA 1XLUA 4KXUA 4YQZA 2OGSA 1RJFA 4TUYA 4JLAA 3ROFA 1V25A 3EXG2 2CNDA 2W4MA 1M6WA 4RNDB 5AVWA 1X7ZA 3K8QA 4Z0HO 1NVTA 3PFBA 1TTPB 1UP6A 3K7EA 4NF2A 4GR9A 4RH1A 4RMIA 2GI4A 3MCAA 3TXXA 4RE6A 5HK8A 2CLEB 1D2NA 2QLNA 1T4BA 1UFRA 1ULAA 2WKQA 4Q21A 4IM7A 4N8DA 3TK1A 4D99A 4ZEMA 4K9QA 4Y2GA 1DBIA 4EOGA 2NZXA 4WCFB 3JQAD 2C4UA 3EZ7A 1UKYA 4FEGA 4BZPA 1LDMA 1XQXA 1M2NA 3OKFA 4PXAA 4DEYA 4EZBA 1L1QA 4P81A 1XXHA 4EGAA 5CD9A 3L4JA 1JQLB 3TRJA 3UJ6A 4L8GA 2PSEA 1DRVA 2H51A 3MEQA 3U4IA 1GDTA 3AM1A 5BQXA 1ZNXA 4LZZA 3CW2A 5L7YA 3BGSA 5CCDA 2W11A 2MYPA 2PXXA 1JF8A 1N92A 4OM8A 3FF4A 4ZANA 1CQIA 5DGXA 1XD2A 3M4NA 3EEQA 2AMLA 3ZWBA 4IV5A 2QVXX 3WBJA 1L5ZA 4PYOA 2Y1KA 5B58C 2IE0A 2ZJZA 3H83A 3HVIA 5HIJA 1CR6A 3EVNA 1FY2A 2WOOA 4OHBA 2D54A 1U2RA 3GGOA 3QJ5A 4N5MA 2AUNA 3D5TA 2HK9A 3B6IA 1E6EA 2E18A 2VT3A 3EXHB 3IRVA 3THOA 2NZWA 4TRRA 1PK9A 2UUOA 5F5XA 3JWGA 2FG5A 3GP8A 1TTTA 4FYMA 2HLDD 3KOUA 1YJQA 1YZNA 3HCCA 3OOHA 2OMEA 1FFBA 2QUIA 4I4IA 5ALSA 3U9TA 1CK4A 3FAZA 5HFJA 4C89A 2NU7A 2M1ZA 3BIWA 1B6GA 2XQVA 2HL6A 4OXYA 3TIFA 3FPHA 5LU9A 3QNUA 5JISA 3KQSA 4F21A 2QX7A 2E4VA 3WKDA 1KZ1A 3BWXA 4L85A 1F6BA 2POCA 1W4LA 3VGPA 4EQZA 1GQQA 1J7JA 2ROQA 4GLJA 2I91A 3R1IA 3TOVA 2ZJ1A 1K9VF 3VKFA 3C85A 1EK2A 3KLPX 4JR1A 1ZC3A 2JDIA 2PX2A 1VSBA 2QZ4A 2C4WA 3A2LA 4M4SA 5D6NA 3SZLA 1QXSA 5CLGA 3UMSA 4CUJA 2PBLA 4H6XA 4J6EA 4D8WA 5JYDA 2PEZA 3SHWA 1Z7WA 4BRZA 5KC9A 3MHTA 2GM4A 3S68A 1WU7A 3WRYA 5GZ6A 1UOPA 2DOKA 4QUDA 2AXPA 4KFTA 3USZA 3IPAA 2JLUA 4JYAB 5DI9A 3M9WA 1C7RA 2NPOA 3BILA 3OTHA 3D8SA 2ZR9A 4TLLB 5LA6A 5DNUA 1E2UA 4L73A 2AK2A 2QTTA 1I6KA 3U44A 3D8TA 1JLRA 4GI7A 1V3VA 1G8FA 4L3VA 3FHLA 3A4LA 3BE6A 4JUCA 1XZFA 4E6PA 3HO8A 3BB3A 3H2BA 4M9QA 3GRFA 4NJMB 3GJ3A 2ECPA 3E3AA 3QSGA 1GCAA 3GXOA 5KSZA 1H1LA 1PG0A 4B7UA 4MKZA 1EFVB 1WDMA 2WWXA 3CE6A 4ZCMA 1S7CA 3U16A 2FWJA 1VOTA 4GOLD 4AQDA 4BLWA 1G1AA 1PCXA 3H87A 1L7PA 4MP8A 2DHRA 3ZNNA 4XFKA 5COBA 4I8XA 4IW3B 1TB4A 3H16A 5LC1A 1HMYA 1VZ3A 2SHKA 4M37A 4RVHA 3K3PA 5G3YA 1DJMA 3TFOA 5K51A 3PJDA 5KQLA 1X8JA 1APBA 4BQPA 5BN4B 4AI6A 4IIDA 1OZAA 1NQOA 3G85A 5ER6A 1NBHA 1IVNA 1ZUIA 3LGXA 5H0IA 1FZQA 2A2ZA 2OVFA 2IYOA 2BFNA 2XT0A 4GU5A 4ETIA 2JCXA 4IXTA 1BNCA 3T6KA 2HXSA 2HV8A 4HUJA 5ITVA 1T2EA 5TNXA 5J63A 4XB6B 4D25A 1ZONA 4DVGA 4RC9A 2IZ7A 2XRZA 4O63O 2C5EA 4KLRA 4PYRA 5K6TA 4P4NA 4K0KB 2GHRA 4ENWA 1FVOA 4G5XA 3LXMA 2O59A 1IIBA 3UHFA 4D8TA 4LRXA 1P0PA 2DHCA 2MT9A 3QWFA 4HN9A 1P5HA 1DTSA 4RK0A 2GKSA 2Y0PA 2EFEB 3W8EA 3D3WB 5GQSA 5FPPA 4HFNA 2IPAB 4K26A 3ZU4A 4CL2A 4RTQA 3KT0A 1WZ2A 1Q1NA 2GFHA 2PR2A 3QPBA 4EG1A 3DNFA 4UDOA 2D2EA 1CHDA 1I1HA 4MGZR 2BEJA 1R5OA 3GU3A 4CV2A 3RTAA 2QKYA 2XB9A 3MF4A 2C2XA 5T57A 5LM3A 2AR9A 3W0LB 3VJMA 4DDVA 1JAIA 1MJNA 3HXQA 5CJPA 1ZD4A 2DKOA 4M1ZA 1HZJA 1U6KA 4NPHA 1PP4A 5FPYA 4UMVA 3W5IA 4A10A 2OE2A 3DXXA 2XI4A 4MO2A 1ZD3A 5B4TA 3K96A 3LL7A 4PRKA 4LXTA 2QP3A 4PZAA 3RSQA 1WVMA 1OI3A 3BDIA 4DPLA 1W1IA 4LDNA 1QANA 4REOA 1CQIB 5FYQA 2JK0A 2WJJA 1KY5A 4F85A 3AEUA 2R6ZA 2RH4A 1TT5A 1E2LA 3DAGA 3QLEA 4CUZA 1AQUA 2VSNA 3U9LA 2YWDA 1Z3CA 4NKRA 2WWYA 3AR7A 3KQYA 5FPHA 5CNKA 1VBFA 3BGDA 1PNVA 1FX0B 2OP0A 4E5SA 2KHZA 2I65A 2WFAA 3OFSA 4BVEA 1C9DB 2J85A 4E31A 4PNPA 1CS0A 5I7FA 1QO7A 5JWOA 2PGXA 5KIAA 2DUUA 1DKNA 2RKBA 1SXQA 1T1EA 3OZAA 3INRA 3EGDA 4LJ5A 1GL9B 3A9WA 1I2BA 1MPXA 3EIQA 4MUKA 1RJWA 4NYJR 3TBHA 4DLAA 1Z34A 2VTVA 4JP8A 5B2FA 5DKFA 5K2MA 1KDZA 2XQKA 2WY2D 1M2OA 4L3OA 4C05A 1LEHA 2O7SA 4ZVSA 3ZWVA 1BSVA 3BSFA 2JHAA 1U9ZA 1LK0A 3I23A 1JJFA 1QYCA 3NC4A 3P5BA 1KTIA 4CT4B 1TCCA 3BD9A 1AO0A 2D74A 4ZVUA 4P4TA 2H2AA 2WWIA 4D79A 2RHGB 4NMLA 1NW6A 2Q4TA 2DHDA 4H3SA 4QD3A 5IVDA 5JJLA 2WB2A 5JD3A 4ZQGA 2Y1CA 3KCNA 3UBTA 3EIOA 3L5OA 3H0EA 4KI0A 1E89A 2O14A 1SBQA 1U0FA 4MV7A 5C5EA 1TD9A 1V26A 2V6MA 4QVKA 3U7QB 4KH0A 1SO8A 1XXHE 1KIFA 2ILTA 1UBSB 1AXGA 2Q0HA 2XAAA 3ZW7A 1T9KA 3ID6C 2OWEA 5JRJA 1HQDA 2OB2A 4TRNA 3JAWB 4AF6A 2X8AA 1TJ5A 4YUWA 4Z6KA 4CI9A 2F9LA 3I58A 1W4CA 1V3UA 1JR3D 3ND8A 4D3FA 3GZNA 4LBYA 1E92A 1NDHA 1NXSA 1YACA 4IJVA 2W6JD 4RAQA 4YI5A 2BSAA 4MI9A 1IDN1 4FHFA 3NHYA 5TRTA 3TLBA 4Q7EA 2P3OA 2GQ0A 4FFRA 3KYDA 4D26A 2VYQA 1TKAA 3V8BA 1NY5A 1AN9A 1DLIA 2AJTA 4BFCA 3QA9A 3JX9A 3U7HB 5D1HA 2CZCA 2HCFA 5JVDB 3U3DA 2I4RA 4ZHSA 1QVAA 1YI1A 2IQIA 2VF5X 3TI7A 1I2DA 2C61A 3O31A 1Q1QA 3NI2A 3NALA 5A3SA 1NBMD 2DF8A 3UT6A 3ZPXA 1Y7HA 1KE1A 1R6TA 4F5EA 1FLDA 2ISQA 4MW5A 5HZMA 2AWOA 3LIIA 3UMCA 3HXMA 4E11A 4F0JA 1MW8X 2F7SA 3J80A 1ZGJA 1IIRA 3D6TB 4F71A 3NBYC 3QLUA 5JJ5A 6ABPA 1DL5A 3SIWA 3RKRA 4MIYA 4LY6A 3FROA 3AR2A 2FFQA 4F11A 4PG4A 1P5JA 4GKJB 3WYFA 1KFBB 5DTIA 4B80A 4B5KA 1CY1A 1O95C 1DDOA 1P1JA 1KO8A 2PUWA 4RK1A 2O2YA 1AKMA 3NC0C 3WIVA 4EUKA 4E5KA 4KL8S 3NJRA 1Z4IA 4H1VA 1YS6A 4XR4A 2HF8A 1W46A 2KM1A 3QV1A 3L8HA 1DIHA 4I1VA 4R1LA 5CT6A 4EJSB 5FFFA 4PGGA 4QOSA 3A1NA 2OCIA 4XD7A 3SJAA 4L9AA 2ECFA 5JAOA 3NRCA 1NJ6A 2OCPA 4C1BA 1NVEA 1EM6A 2XCLA 2AL7A 4FSXA 4AJ9A 3IURA 3UA3A 5AD1A 3EF3A 4OHKA 4N0PA 2EJBA 2ZRMA 3E4CA 3FX2A 1A9ZA 2JJQA 3C3MA 3FWZA 4GBED 1W581 3T3PB 4BL5A 1CY6A 1JDNA 4MMYB 2ZRAA 1A9RA 3T4PA 5HOQA 1KI7A 1OAOC 2NTEA 4MQFB 3LWBA 3FDJA 3HZRA 4ZP1A 5DW0A 5TT0A 5M7EA 2LIPA 1BTOA 5K8CA 1KK3A 1LFAA 4AG5A 3E53A 3A3OA 1T2VA 4LZPA 4OHFA 5EE3A 3HYSA 4BX9A 4YS6A 4Z3OA 4QDKA 2PGIA 5A7HA 2RGRA 3D6JA 4PLTA 3PA6A 4HLCA 5KPJA 2C77A 5K8LA 4BGUA 3FR7A 3DMYA 2L69A 3MLEA 2ODPA 2Q1UA 2VUTA 4IZHA 5DBHX 1XTJA 4DRZA 2Y1OA 4RZQA 3B8HA 4EEKA 1TEHA 4KVFA 4QFMA 4QJIA 5ENDA 1P73A 2OHIA 1T9DA 4AZ3A 5JDIC 3Q3EA 2O2GA 2YS6A 2QU8A 4TTJA 4BNYA 1PZXA 1CS0B 3F8WA 3MWYW 3PXDA 3HBFA 3GRRA 3N58A 2GAJA 4Q66C 5E1OA 5HS6A 3RTGA 1AQIA 4DR2B 3OHSX 4F1KA 2H5LA 1AKNA 1CIJA 4GG1A 2IU0A 4HDAA 2EFCB 2G17A 3I6YA 1RRMA 3ENWA 1Z62A 2D06A 2EBHX 4J7AA 4K88A 3B6ZA 4K9DA 3TQHA 1M8JA 2CUZA 3KRTA 4MDYA 2BBSA 3CVXA 3ROEA 3LLCA 4FYKA 1XRRA 4CMJA 3KUUA 4MWEA 4YMGA 3COZA 1U65A 3DZ8A 2JFOA 4IGKA 2WP0A 2BGNA 1M1NA 1V5WA 1CETA 3AEYA 1BFDA 2DGDA 1ZK3A 3H1FA 4TN5A 5FBLB 5TS2A 5BNTA 4CMGA 5DM70 4J7UA 1AJEA 5FOUA 2GN8A 4OB8A 3DP7A 4X94A 3TEMA 1NQ5A 2H8KA 4IS3A 2P5UA 2XGMA 4E7OA 5KQMA 1FNBA 1KF0A 2HHCA 2V97A 3OE7A 4O0MA 4EJ0A 2VK4A 5DNAA 3VPFA 1U2TA 2EVWX 1VLZA 4AJNA 2PWAA 4B71A 5BVGA 5A71A 1AGNA 3R7FA 1P2VA 1GRNA 2QTGA 2QLMA 5ITSA 2H2DA 4L8VA 4WK4B 5H70A 4F6LA 1KQFA 4N6GA 2OORA 3RK1A 5DYWA 1FYXA 2P40A 4KPEC 2JI8A 4ABYA 2JBAB 1E60A 2FW9A 2XA2A 2YIJA 3HUDA 3UKOA 4Y0NA 3E58A 1EIWA 1ZHFA 2R00C 3PTAA 3WK9A 1F9AA 1NBWB 2JAXA 2V5AA 3DLCA 1C2TA 5ECDA 4YRAA 1E2QA 4H7DA 5JNVA 3T5DA 1VB5A 1U8EA 2OBBA 1KQOA 4I50F 5GTDA 2OV3A 2GLUA 3CTPA 4ZCTA 2FZLA 2ZTLA 2OV4A 1AIPA 1LCIA 1Q7BA 1KXZA 2V7QD 4JHXA 3TSCA 2ZIWB 3VU9A 4DCSA 1T3GA 1V4NA 3NJ4A 4Z1MA 3VPAA 1FSPA 3IHLA 4HQ0A 1DAPA 2JI6A 4HQKA 1YOBA 3VC7A 1XSEA 1MAUA 1GQFA 3Q6IA 4H9GA 3IBSA 4PINA 1D4AA 3W2EA 1VL1A 3RYIA 4MGKR 3KHKA 1MORA 1TW2A 2PH3A 3CUWA 5LBUA 3SBXA 1SIBE 2NUTB 3UXEA 3WK4A 1X1EA 4D4IA 1C1HA 4G01B 1YKFA 3EXFA 2V9ZA 3AM4A 2Y9PB 2ALJA 3FCXA 3H5VA 4LHYA 1JAHA 1FRZA 3HL0A 5EQFA 4EYEA 4L57A 4AP5A 2EBWA 3WQQA 1IMOA 1C1XB 1DCFA 3D5QA 3M70A 3Q6MA 1JQEA 4B3XA 4ZCRA 4MAAA 4Y9DA 4EA7A 4QO7A 5AKEA 4TWZA 3W5VA 4QYXA 3OQBA 3T1TA 4EFDA 4E22A 1EUCB 2XMSA 2ZIXA 3QFSA 3HO1A 3ICQB 3K6RA 3RUIA 4PFSA 2I1WA 4TTTS 3KVOA 3L6RA 2F9FA 4LXQA 4AB1A 5IUKC 1EUDB 3ABQB 1WF6A 2VOJA 3DCJA 4B32A 1FSSA 2OECA 4I9NA 4MTCA 5KJFA 3E61A 3AF4A 4BUCA 1LJLA 1NW5A 4TMKA 3A58B 4LSMA 5FIUA 3W2HA 4FLEA 1T3SA 4HZUB 1CUZA 2WSMA 1LBSA 5K3AA 3S27A 2AT1A 4L0MA 1Q0TA 5L3SB 2HPZA 5ARDA 3WAGA 2I2AA 4P4UA 3QQ5A 5JPCA 3CZAA 4FGKA 4G89A 5LWHA 2QSJA 2JANA 3BQMB 3ESXA 3U49A 4KQ2A 5AOBA 1AK2A 1E1DA 1TQ2A 2O0LA 1OYWA 2ANCA 4N9WA 3RBAA 3CUYA 4GRDA 4U2BA 1DKLA 1F0NA 2HOQA 4ARCA 2NP7A 2EDAA 4QEDA 3PWKA 2JLZA 3G2KA 5FUQA 4RA9A 2O2ZA 3L7KA 4OKIA 3LKZA 2O52A 2Q1YA 2HF9A 3RYCA 4AZ3B 4G3XA 4KIJA 3F71A 3DLHA 1BOFA 4E5UA 2HCTA 2VJYA 4FZ5A 3AVWA 2IKSA 3DE7X 3NTRA 2SCUA 1UMBA 2EKQA 1SIUA 3IODA 4JT8A 5LFAA 2F3PA 3O0TA 1QQ5A 5TF4A 1J2TA 3T4XA 3C5VA 3ZNOA 5ADUS 5JECA 1MAHA 2JLRA 2K2QB 4BV9A 1VMEA 4DV2B 2VCYA 2X2EA 5ITZA 4CR6A 1CYDA 3EOAI 1JWBB 4R8VA 3GMTA 4D0LB 2PRYA 2QG4A 2P65A 3I53A 3M5WA 3HMQA 5EYPA 3KPVA 1E3DA 4MCAA 1TM2A 1BX1A 1FTGA 4JB3A 1QHSA 5IJ9B 4D2IA 3BAFA 5LQRA 2EEZA 1VKZA 4ZV9A 1XPJA 1J9EA 2ON6A 1IQ0A 1YONA 1W94A 2XSZA 2FPGA 3OF3A 3CLRD 2IUTA 2VI5A 1PZNA 4X85A 1E3LA 1GA4A 1CE8A 2H07A 1ETUA 2C4VA 4DBVO 3OJOA 4B44A 2SKDA 5EIOA 1AX9A 1E6KA 3UT0A 4HFMA 3DMNA 3FOAA 3FSJX 3P97A 3STYA 1T5SA 2B2XA 1B2LA 3KVYA 3EIXA 3GDHA 2VRNA 3LQKA 4BC0A 4DWVA 1GLVA 5I5EA 5JXGA 4YJGA 5DNVA 4X20A 1W4BA 5C1BA 3DMHA 5ALRA 2APJA 5SZKB 3ENZA 3VR6A 3ZHOA 2I3DA 5K5EA 2J3JA 3CISA 4YNBA 4H35A 1JLMA 3NH6A 4JU9A 2EW2A 3PQCA 5BR8B 4RCYA 2AW3A 4IRXA 4KUEA 2RGWA 3AETA 5AK0A 1P8AA 3KPWA 2OZLA 5DT2A 1GARA 2J3EA 4R8LA 3A36A 1OH5A 1HH4A 4MLPA 1RWNA 2HPAA 3B2EA 2JH9A 2YV3A 5D51S 1NASA 1Z82A 1RTKA 4IINA 2H54A 1UKCA 3AM3A 4JL5A 3WLQA 3B5EA 4GZ6A 3HB4X 4DRXB 3TQCA 1BXZA 1L9XA 2Q3EA 2BAGA 2AN4A 5AKLA 1TM3E 1KK0A 2IZ0A 1KYZA 4U6NA 5DXFA 3RAFC 4LDQA 4UZEA 3E18A 3GJZA 5CVCA 4JB8A 5EHIA 1XZJA 3T8YA 3OZBA 3EPRA 4BFTA 4WZAA 3D0RA 3K6JA 4FNAA 2ECKA 1CCWA 3ENQA 2K7FA 1WP4A 2DQZA 3GLUA 1PDOA 1QFXA 4WNYA 4AN1A 5CNJA 4DM3A 2VJCA 5CDSA 4FHCA 3MOSA 1BYIA 2IPNA 3C8HA 1JIXA 2YV4A 4R51A 5ICCA 1NVWQ 3NIBA 4Q02A 1J2UA 1B0UA 2O3TA 4IVRA 5B30A 2HUPA 1FF9A 4MRMA 3OCZA 5REQA 1J9ZA 1GILA 3JQ7A 5C5DA 5JXWA 2XV1A 1U0NA 1KMNA 3NKVA 1IULA 2D0OB 1A2KC 4FFVA 2PH1A 1GXSA 1P2UA 3G88A 1MOQA 1U1FA 4JLSA 4TT3D 2AN1A 2X0JA 3OQVA 4GQAA 4NBRA 2YVUA 5G0WA 3UMMA 3BHIA 1NNSA 2IGBA 2HMYB 3GFVA 3MTJA 4PRLA 3BQ9A 1FFAA 1OJ7A 3BXGA 4JITA 5LOVF 3W5DA 5E2AA 1RWWA 2R84A 2X5JO 3FZQA 3L0BA 4Y2PA 1JLSA 5EESA 4QDJA 4R1MA 3DDCA 4HDKA 2ZDGA 3SX2A 4FI3F 1I0LA 3I28A 4I66A 3MXTA 2YNMA 3Q9SA 4R3WA 2C54A 3GEMA 4CIBA 4U39A 1HNZB 1M33A 1DU4A 1O9GA 4WAUA 2A9OA 2F1HA 1IY0A 4XVCA 2VHQA 4POAA 2C1EA 5GJWC 1IZ9A 2GPTA 5FL3A 1LVUA 4W9NC 1F2UA 1M66A 2IP4A 2ZULA 4MW1A 1TU3A 2UU9B 4I4NA 3CB4A 1CUVA 3TSOA 4J0JA 4URWR 2ONZA 2IH4A 5FI1B 3L1UA 4P84A 1GGHA 3CPJB 3HMKA 2QUBA 3DONA 1TOAA 2A3NA 1YR9A 5ARBA 3N1UA 1Z47A 3RHFA 2I2XB 4OXIA 3GARA 4RPKA 3PNKA 4DG9A 1HV8A 2A3RA 2R8RA 3A4NA 5E9JA 1H2YA 4UE2A 1OE0A 2QLJA 4WUTA 3TJMA 4FD2A 5IN5A 3TQSA 3AL3A 4DLRA 5JWRA 4CTMA 4GPZA 1RAHA 5AW4A 1JFRA 4ES6A 1FK8A 3RS5A 5CT9A 4QPPA 5EEGA 3UBMA 2ZBVA 4NJEA 3PC6A 4Q3BA 3MMNA 5ITZB 5JNTA 3OD1A 1M1YA 3ZWWA 3ESYA 1LBEA 2YC2C 3PGKA 3PKZA 3AVXA 1UMDA 3HU3A 2BFEB 3NWJA 4MA4A 1DWPA 2OQVA 4PLCA 3X1ZA 3P45A 4PYIA 2W71A 1ZLYA 2IQ5A 4MPDA 4B6OA 1VMIA 2Y0BA 3DF9A 3DPSA 3PR3A 4MUGA 4RKWA 2VTKA 2XGSA 4B7AA 4C0LA 1Z8DA 3A9UA 5IAJA 5GM2A 2IODA 2IYSA 2V74B 2YYZA 2GESA 4MNTA 4PCUA 3V33A 3O8RA 5CURA 5GJVC 4HB4A 3BS4A 4ISCA 2ZTSA 4MWDA 3D2BA 1KMIY 1YT5A 2NV6A 2WZBA 3PJGA 4O29A 5C8ZA 1N2OA 1XALA 2QUKA 5BWMA 3GVPA 1NX6A 1PR6A 1YZQA 4DMCA 1RHQA 3T4EA 4KTTE 4RSGA 1KZHA 4DEXA 4HX2A 4L16A 5FA5A 2QN1A 7GPBA 1ZCZA 2Z2ZA 4MA5A 4C07A 1DC6A 1G4HA 1RBMA 5I7UA 3IL2A 3NM4A 5I7WA 2FX5A 4R2IA 1BD3A 4R2XA 4D80A 3LF1A 1JJBA 5EJAA 5K3OA 1CPYA 1U7WA 5E7MA 3IOBA 5GIPE 3C3BA 3Q11A 3A4TA 1U3GA 2OUIA 5BMOA 4E2YA 3J81k 2EFHB 1R6XA 3FKQA 1O03A 3QBTA 1RYNA 1P39A 3H84A 3LP6A 4ZVLA 5TPZA 2KPOA 3BD8A 1A77A 1WVGA 2Q8NA 4RJJA 5K2OA 2HW8A 4N5IX 4TVKA 1ESZA 4ND2A 1VPVA 1WXDA 4NOKA 4CM7A 3C3AA 2VJAA 3K1AA 3SQNA 3FYHA 5EUBA 2JW5A 4UM7A 5TEVA 1GA6A 4TS4A 3LAWA 2W2VA 4Q1CA 1NG9A 1EGVB 4KQ1A 5K0ZA 3NP7A 3OJ0A 2V6FA 3WWZA 2BFFB 1SKYB 3AU9A 1MFZA 1C0LA 1SQ6A 1S8FA 3I1FA 5DIFA 3RFVA 3E4DA 4WIAA 3WG9A 4UMFA 4EYOA 3VZBA 3E22A 1EYZA 2ZRFA 3HA2A 2PLRA 2VYFA 4J49A 1HFEL 2CMKA 4YC7A 5WRFA 1PJQA 1OHHD 3VYSB 4GAEA 1NKTA 3IOEA 3MWLA 4PF1A 1AC5A 1PL8A 3PSHA 1XF1A 3OA0A 3GFBA 4RK6A 3KZOA 2W2PA 3G2JA 2VNKA 3Q2IA 2VJPA 2BHRA 2I1LA 2W00A 2WSSA 5BSVA 1P6XA 1KYVA 1KYXA 4W1PA 2X3UA 2VDLB 4R40A 5EWJB 1A9SA 1OXKB 2AFVA 3UG6A 3EARA 4URVR 1KI9A 2D2FA 2I99A 3COYA 4Q16A 3SE7A 5FH9A 3UMRA 4IFEA 4E2FA 4LF6B 5HKOA 4RTPA 4NBKA 1HE8B 4A1OA 5FNVF 1CERA 4AM8A 1PU2A 4TXLA 5CAEB 4TZTA 3KDAA 3DKRA 2XR1A 4P82A 2YN0A 3RFXA 3CYFA 4XTRA 4ZVNA 1BAPA 1CQJA 2FWRA 4LCJA 2F8TA 3G8CA 3NYRA 3ZHZA 3BMNB 2BKXA 4KGVA 2ZUTA 3VTAA 5HRUA 2OHXA 3W3AH 1FC0A 1J23A 3D1VA 1O7JA 1JHPA 4HK4A 4GI1A 3CH5A 1XUOA 3GMSA 2VDUE 1F1JA 1ZINA 4XOUA 4O3MA 2GF2A 3TL6A 3LUAA 4QUBA 1BFKA 3M1LA 5H80A 1CS4C 1FX1A 3I9LA 3PPXA 4BLOA 5LQAA 2WC1A 2HT6A 3E3LA 3N8GA 2G5TA 2VTDA 4BVGA 1P6QA 1LY1A 3O74A 1Z5WA 4OL9A 1AQ6A 4ZT7A 4XI9A 2QY9A 4PZEA 3TIVA 4AXXA 2AOTB 1J1IA 2BHLA 3KXDA 3ON5A 3NVMB 1WUYA 4YJ2F 4I4CA 5GAJA 4ZD6A 2J45A 3TNFA 1I1NA 4CETA 3MCTA 1SU4A 4IKPA 1I6MA 3UJPA 2QP9X 4U7GA 3WXMA 2JD1A 4QFCA 4ZQBA 1XZHA 2X5KO 3AF1A 4JENA 3ONDA 1Y63A 1XDWA 3NH9A 2KLHA 2XWBF 4UCXA 3G0IA 3HL4A 1VE9A 1R64A 1FJGB 4LPKA 3VYTB 4N1AA 4G1UC 5DM4A 1QH0A 3DW3X 4WZAE 5ALXA 5F2NA 1RQLA 4HYQA 3CV3A 3GEDA 2QVLA 2XVAA 2VJMA 1DC3A 2IYLD 3UV6A 1N1EA 1VGQA 3R6WA 3A3KA 2BFAA 1UXJA 2X9LA 3WMGA 2FZVA 3FRJA 1DEHA 1JU9A 3F78A 3V2HA 2Z6QA 2IXBA 2RSLA 3SJ7A 2JLCA 3L93A 5TVGA 3W5JA 1UKBA 4G36A 3PFNA 2QXUA 1H4QA 1M76A 2V6BA 3PX7A 5F3DA 5LR6A 2FPKA 4CM8B 1UPCA 4WKPA 2PKYX 2Z3VA 3ZZUA 1E7YA 3FWPA 2Z6AA 4RX1A 5KX5A 4ALIA 2G80A 1VGRA 4YHBA 1BO6A 1RHJA 1Y1QA 3M7IA 3AFIA 1GAXA 1GLNA 4ZKDA 1Q7TA 1Y0BA 2YWBA 1ODLA 4M1EA 5B4UA 1F2TB 1Q0LA 1NUQA 1USIA 1DP4A 1E61A 1XEWX 3MUFA 5FHRA 3ZDEA 2CEAA 3OWOA 2P3LA 4FIZA 4Y3UA 3SF8A 1FIUA 4HJRA 1EJBA 1K7XB 3V7YA 2V7GA 4RJLA 2PSHA 4BNNA 3GD5A 3N59A 2NO5A 1IN6A 1NJ1A 3KVVA 3QRWA 4OXRA 3WRVA 3D6VA 4CQLB 1DGQA 2X8JA 2BCEA 5G4KA 1T0BA 3W05A 1CC1S 2NUAB 2PTGA 1KH3A 2FPRA 3ZWQA 3K09A 5IX8A 2ODNA 3RADC 1OXXK 5AT1A 4JBYA 4NAVA 1IB6A 3LGAA 3D7NA 1Z7GA 2Q8PA 4QPDA 4X6UA 3H2GA 1OLUB 2UYGA 3FVVA 3OE1A 4NIMA 4HTFB 5INTA 1Z0DA 2A1UB 1E1QD 1JDBB 3CLTC 2RI0A 3HKEA 2JJMA 5LZ2A 1WB5A 2WJVA 3GUCA 1QRUA 3KSZO 2N9UA 3UH1A 3GN1A 2JNWA 1W0JA 2FPPB 2OG2A 2P77A 3QFTA 1A82A 2BMJA 2ZFUA 4YV7A 2DJ5A 3QBJA 5GM1A 5SY6A 4BJ1A 1MOZA 1GTRA 5IKOA 1EWTA 1X8LA 2V8BA 3T3IA 5JQWA 5K09A 4HAZA 3HV0A 1M1YE 1XEXA 3KOZA 1KYQA 2GRUA 2E55A 2MCFA 1FUKA 1OLOA 2AFIB 5DASA 5BRJA 1DUIA 3EWIA 4MW2A 1YC2A 4OQ4A 1QIKA 2NADA 3DYBA 5EXEA 4KN9S 1M10A 3QE3A 4DJ5X 4Q24A 1R7RA 1CZRA 4Z8YA 3KVNA 3HTXA 1L4YA 4L08A 3ESDA 5PNTA 1E9VA 5CVJA 2FWAA 4QASA 4R1UA 4BN4A 2JI7A 2Q99A 5ALZA 1O97C 2Z2IA 5CGZA 1RFLA 3F97A 2D0IA 3MINA 4G9EA 4JJEA 3RFTA 4DSUA 2OZPA 3MCWA 1WEHA 3ONEA 4HEHA 1OSNA 3QNMA 5JASA 5H8WA 1JL3A 1E4EB 1OXSC 2R1ZA 1Q21A 1WW3A 4RY9A 3EISA 4MS3B 1C1DB 3P2IA 4OKSA 3E9QA 2LCQA 1SCUA 4DCMA 1P72A 2LUOA 4YRNA 4TYYA 5EERA 2P3SA 1Y7TA 3MUEA 4A8TA 1S1CA 1B41A 1VIMA 2WZDA 2AI3A 3RHTA 2H3HA 2VHYA 2PJZA 3B9RA 1SB8A 1DIRA 4TV9B 3C39A 5DDIP 4JX9A 1GSOA 2VNHA 3GG2A 3JATA 2MSLA 1Q77A 3AUKA 3EUWA 4R3NA 2RGNC 3HY6A 5DGHA 3U3MA 3N0VA 4AIIA 4KREA 2NXEA 1UDWA 4DV1B 4OU4A 1Q20A 2AOXA 4JLOA 4LHZA 5FAXA 4MIOA 4LXHA 1FW6A 2WAAA 3PS9A 2C78A 1N8TA 2JAUA 4CLRB 4O4JB 1VIAA 3KUDA 3AONB 3RRJA 1HT3A 5DK4A 4C6HA 4QGSA 3U5ZB 2P1DA 1GR0A 1Z4LA 3LTEA 3JAKB 1MDBA 1MKYA 2XVMA 1ZNZA 2AEMA 3NV9A 4NE2A 3DPIA 1AS0A 1J06A 5KNCA 1YB4A 4M9CA 2WZQA 2QRLA 1S9DA 1WW8A 4FDLA 2HH9A 2OBMA 3A1VA 2FAXA 3A4YA 3H1GA 4RLFA 4QGFA 3OOEA 4IH1A 3RYFA 1LW6E 1NF9A 1W47A 3B9BA 5HIIA 3A7DA 4HS9A 3QG5A 5AHKA 1AZLA 2YZKA 5DVZA 1JA0A 4HLNA 5EEHA 3M34A 1P1HA 2AG1A 2E1RA 3PPVA 5EQTA 3EFOA 4JJFA 1K8YB 1RQNA 3L06A 3W1WA 4RPHA 3V1LA 3OLZA 4XW2A 1K4YA 1PG5A 1B1AA 1T4GA 5ILGA 4HDCA 1QWSA 3QUCA 3RC2A 3CNHA 2BGGA 1SQ5A 2VTBA 1PKEA 1X1RA 2WYOA 5HOEA 3T3NA 2ZRGA 1OPXA 2QJFA 3ROTA 4U9UA 4C4OA 4J2OA 4C0QC 1YQTA 3OE5A 5D3KA 2CSXA 1IM5A 2OPBA 3HR8A 1QTNA 1QM5A 1AGPA 1A4XA 3LY8A 3VO1A 1O3YA 5C3UA 3QU2A 4CG1A 1AO3A 2FEKA 3ENNA 4I0WB 2J0UA 1ZY2A 1UBOS 3ST7A 1NW8A 1QH8A 3EGCA 5L53A 1FMFA 2FETA 3SF8B 1FJHA 3L7DA 1H69A 1T29A 2ZBRA 3T15A 3X1MA 4TV8F 1T8TA 3BD7A 4G1VA 1BCSA 2B4TO 3BSSA 2X8JB 3D4LA 3QMWA 1F8FA 3DNMA 1XQ1A 4KW7A 3VDQA 4CM6A 3TOXA 4JROA 3IUNA 3RKUA 1KVQA 2R47A 1KP9A 2IE8A 3CH7A 4N7RA 4OBXA 4DBLE 2DAPA 4MYUA 2CXTA 4A7PA 4UNIA 3AQIA 3BFJA 4B3CA 1KSHA 3HKEB 3JASB 2I2BA 1ESEA 2BZGA 2P9ZA 5AP9A 2FMKA 2REQB 4ZGBA 4ER3A 3A7EA 2H6EA 4NFYA 1BQEA 2CDRA 3VSEA 4TSKA 1JFFA 1LA2A 2LCIA 1E0SA 1G0OA 2CFCA 3DTVD 3WNDA 1Y9EA 1YOVB 4D5EA 3W5SA 4QJ3A 1A2OA 2DFVA 2LBPA 4YV1A 4MR7B 3S2YA 2GASA 5BPHA 2A0FA 3MHPA 2HU7A 3FRHA 5J4VA 3JQQA 4O5OA 1X7DA 4GXNA 2AD1A 1OGYA 1X1DA 4BPRA 4IHKA 1Z37A 2R60A 3IOYA 4MVJP 4ZAZA 3I12A 3ZWPA 1YIDA 4B3BA 4HI0E 4BBPA 1E5TA 4J3JA 1Y4DE 3SS8A 2EFYA 4PYKA 4G81A 1AKYA 4D3XA 5MGNA 4O4HB 4NU0A 1MDFA 3NC1C 2DQSA 2OKCA 1V5FA 3NTOA 3Q12A 3QLUC 4IIJB 4TMVA 3TTYA 2CV1A 2R7MA 4TQAA 5IM4A 1E2IA 2BUAA 1VJDA 4FUQA 4WGGA 1RWOA 1Z2AA 4UEQA 3GLIB 1UM9B 1UT8A 2GRJA 4DKXA 4UREA 4F38A 2WWFA 3OQIB 3NWOA 4UFPA 2EWVA 2YX1A 4ID9A 3QPAA 1O6ZA 4M9UA 5EJ7A 4NABA 1AS2A 1DJNA 4JJIA 2FE4A 2JVKA 3TLYA 2W48A 3P5SA 3IQWA 2GTIA 4C04A 1RBQA 4C3OB 3WNBA 3QI7A 4MKRA 2Q3LA 2FB9A 2QHXA 1QV9A 2DFLA 2Z1MA 4J75A 2ONJA 5KDDA 1GL7A 3RASA 3B9QA 4NBVA 2QPTA 4ZYVA 3SC2A 1XRLA 3RVSA 3ND5A 2PDAA 3L6UA 1NP6A 4FN5A 4LE0A 4DJDC 1W19A 2W37A 4Q7LA 1UFOA 3GQBB 2FMXA 3SVTA 4UBMA 1GKKA 4AZVA 4KO1S 3BICA 1E2HA 1QQTA 4IUBS 4PXSA 4YR9A 4P1ZA 5HUQA 1CRPA 1V4BA 1YFKA 2HA6A 2Z1DA 3LX5A 3RRYA 1JB1A 1TZCA 4MPJA 2C2GA 5FD8A 2Q5FA 3UOGA 3VGJA 1LB1B 5JV5A 1R15A 4UVGA 2RIPA 1BU8A 5IHXA 4WFJA 1QYRA 1RC8A 3KNZA 1N6LA 2WYUA 1BXRB 1Q6ZA 3TGLA 2C4KA 1FNMA 1K66A 5FP0A 1DADA 2L18A 4I3GA 1BWRA 4IVPA 5AM1A 2FEAA 2VYNA 5TLSA 4DYHA 1ANKA 1KGDA 3CTMA 4TZKA 7MHTA 1A9XB 4KP7A 3FYSA 1GR1A 4RKYA 4ESOA 1GNVA 3AJEA 4I1UA 4ZVOA 2CVOA 3HCBA 2RK6A 1P2DA 4D74A 1KO5A 3NEAA 3WBBA 1QRTA 1N3YA 3WK8A 3DMTC 2ECOA 1PJCA 2IYWA 4L4RA 1L8XA 2PKRA 2FMTA 4WSOA 1NP7A 2W2LD 1YBFA 2C5FA 3FMOB 3TSZA 5C1IA 3TUJC 3ZK7A 2DB3A 4AQ7A 2J31A 3SSMA 4Q34A 4ALJA 5BN3A 3P2MA 2R0QC 3C8ZA 3DJFA 1L1RA 3AW9A 3ADKA 2VTBB 3HGTA 1FLVA 4WWHA 1OWPA 4O5AA 5BO5A 4CMEA 4QT4A 4JXZA 2CXSA 4MITA 4XCVA 1L3CA 3C6KA 3W34A 4Y1RA 3JRNA 4P7GA 4PSAA 1EDEA 3DDOA 5AW2A 2W6IA 4WESA 4IZOA 2DVMA 4Q4HA 1USWA 1OTHA 3AT1A 4MWTA 3NKLA 2V54A 1QH8B 4D3DA 4FJ0A 3EQZA 3AP3A 1RPNA 2ZPAA 2OM2A 1O94A 2EKPA 2J5QA 3ETNA 1C4KA 4MAFA 4HKTA 4OXNA 3BE8A 5FO1A 4BHTA 2ERYA 1J24A 1S96A 4N48A 4RVDA 1RMQA 1GGFA 4K9MA 4E3WA 3SJZA 4AWBA 4KQGA 1AKQA 1A7KA 3LUFA 2WT9A 4GDMA 1Q1GA 2OCAA 1JN0A 4KQWA 1M0TA 3VKVA 2OORC 3VM6A 1Y9JA 2CSUA 2QAIA 2LP4Y 1PD0A 4E1AA 1XF9A 2J9YB 3WK6A 4M99A 2X15A 3SR0A 1PBTA 4KXMA 1YZGA 4Q4JB 5F77A 3KETA 5EKUA 3GPBA 3T41A 3ZDFA 3ZIAA 3C5WP 3IEKA 3JRXA 1E2MA 1Q3TA 5KHAA 1S01A 4BFVA 2IU3A 3AUJB 2HMVA 3IULA 3MJSA 1A96A 3W8FA 1TFUA 2NUPA 1SK8A 5BSMA 1WDLA 4FN4A 5BR1A 2H4FA 4BO2A 4RDIA 6Q21A 1W2WB 3B1XA 1XMSA 5K05A 1T6NA 3CRQA 3AZQA 1XBTA 4OGGA 2O1WA 1OZHA 2CLFB 3FPJA 4KGDA 4HLQB 4MLCA 4WX2B 3DHEA 3A1SA 2Q3BA 3LU1A 2WB4A 4OGLA 4Y2XA 1PS0A 3NUGA 3P9KA 1Y1PA 1LQ2A 3HXPA 1IEQA 1G41A 2Y27A 3CLKA 1ABEA 3IVGA 4OH7A 4R68A 3LRPA 1KIMA 3DV9A 1KI4A 5KNLA 1E98A 4GQBA 4Z4QA 2PX6A 2UVDA 5KOJA 2RB4A 1C14A 4G0ZA 1WIWA 2LGJA 4RANA 5HFNA 4NYMQ 3R5JA 4OUDA 5AXCA 4AL4A 1QV6A 4U4AA 3BSYA 3Q7QA 2AOUA 3BXPA 3V9PA 1ZUNA 4HC4A 2VZ9A 5CLIA 4RD1A 1J8FA 2R8XA 5KSPA 3BMCA 1JGTA 2XCQA 1GEGA 3D3JA 1M8PA 3OZTA 4FEEA 2RB5A 1T1SA 4IOKA 4KQXA 1EVYA 2R68A 2DPMA 4X1YB 3QUQA 1CW2B 4LRYA 1Z0UA 4LNAA 2Q7DA 1QRAA 1KPHA 5HCIA 1K92A 1NPTO 1W1WA 3M4YA 3SOZA 3V48A 4GX5A 2XDAA 3DBHB 3GB9A 1ZOLA 5KMGB 1NI5A 3AR6A 5AKKA 4BEJA 2O3RA 3NASA 2PUTA 2PO7A 4ZICA 1JHMA 3RODA 1DMRA 5C80A 1ENYA 4COKA 1HE2A 2JAQA 3H3JA 3D4IA 5IAKA 3KP1A 1CT9A 2EIXA 2BI8A 4GXQA 2ZRNA 4GI5A 1ZGBA 4Q4CA 2FZKA 1WY5A 1Z0IA 2PMEA 3TL2A 1ESCA 4NU5A 3DO8A 4IJKA 1T2FA 3ZLVA 1LPOA 1N2EA 5CUQA 4WERA 1M5UA 1NVVQ 1OFUA 1UL1X 4FFBB 4OAQA 2PZLA 3KQOA 3T3DA 1RHRA 5DMXA 1IVSA 4FGWA 4G1MB 5JCJD 1U8TA 3AB8A 1E96A 2H1VA 1KDPA 4OSPA 1ACJA 1G5RA 1Q3HA 5M3BA 1RLJA 3CQ9A 4US1R 2RH5A 4Y9SA 3K1YA 2D6FA 2YRFA 5DH9A 5AVTA 2O5EA 2F90A 1QKKA 3PFIA 5EKDA 2E5LB 4NDZA 3N05A 4ILEA 4OV6B 2EP8A 5FWNA 3WHIA 3TQRA 5BQOA 3U4QA 5CTAA 5CDYA 3BTVA 4H77A 1UF9A 2G36A 3B89A 4MHTA 2F4NA 4FILA 1Q0SA 3G13A 4KE8A 2B8WA 3QPCA 2PR7A 2ZSKA 4EW1A 3W77A 5JCPA 3SHVA 1W36C 2WG0A 3VKUA 1TJNA 3QIAA 1URPA 4M0KA 4NJOA 1IY1A 4R1NA 3G3EA 4WKNA 5E95A 5ENZA 4FR2A 4BV3A 1J6UA 2VEOA 2YDYA 4E2WA 1YZLA 3PUWA 4X24A 2DKFA 2BFMA 2VYVA 1QU3A 4Y1RB 1T0PA 2JGLA 1DZ3A 2PWYA 3IQIX 2DFNA 4LDPA 3WAJA 2ZUVA 3ZLUA 5BNWA 3TVDA 4GWGA 4TKZA 3AHDA 1UAGA 4EUFA 3GCXA 2WINI 2ZUDA 1QPGA 3RVJA 5BYKA 2FLKA 2ADFA 3A4VA 4JFRA 4LZJA 3LDFA 3MTBA 4KFUA 3UGKA 1RYHA 1OTYA 4LMPA 4H15A 3U37A 3G5MA 4OHMA 5JVDF 5KYWB 3GGSA 4XDGA 1NNLA 1GQSA 3K5PA 3OTGA 1QB8A 4ZU6X 2D4AA 1DMSA 1ZIXA 4MYHA 2QT1A 2Q6TA 3MB8A 3OM0A 1PR4A 1K88A 1SIOA 1Y4ZA 3U19A 1NZFA 3N2GA 2IWHA 2X9GA 3K5WA 2A92A 4JMPA 3F98A 3BWVA 4M8LA 1B0ZA 2MR6A 3EGXB 5FTJA 2OXTA 1DCTA 1H2EA 3QJYA 1IQRA 1LK7A 1DC8A 4ERXA 1OKKD 1D4OA 2Q21A 2V7VA 3PEUA 2H00A 5JI2E 1DEXA 3UCFA 4CFZA 1M9NA 4G5QA 3PI6A 1E1CA 2NWQA 1CJMA 2NUPB 2IZ1A 1STOA 4QDOA 2GLXA 1RYBA 1R0ZA 2ZANA 4HH4A 4PZLA 1FQWA 2FP4A 2D2XA 2JFXA 1TC1A 5AM0A 3HXOA 5E6UB 2QS9A 2XE8A 5SY4A 1J8QA 4P8RA 4P5PA 2A7QA 4F97A 2WA2A 2VQEB 1GHTA 3VO2A 3PGJA 3HU1A 1H6CA 1ZU5A 4A91A 4WNAA 4B6JA 2H4WA 4H4CA 4E2ZA 4D8UA 2DR3A 2FX3A 3CLUC 2J3DA 3IJRA 3HM9A 4QGHA 1DAEA 2EKZA 3EW7A 5SZJA 3RSFA 1UK8A 4AU1A 1L9KA 2J7PD 3V00A 2VT7A 1Z6QA 2XCSB 2BMVA 1XVVA 4ZV7A 2VIIA 1XAHA 4Y1EA 4A1FA 5EE5B 4RTNA 3DFUA 5EMKA 1HKHA 2ORED 4GH5A 2HO4A 1VKHA 2B94A 2E4AA 5ALWA 3QUAA 5J43A 4TWIA 4RE5A 1CJTC 3O92A 4ZMBA 1MB3A 1BXGB 2XUJA 3I5UA 4XZ3A 2FPIB 1YTLA 2Z58A 2PT9A 3BWDD 1OBOA 3G0GA 2O54A 3BXXA 2XAUA 4NMWA 3G7UA 2EZUA 4HQRA 1P2GA 5JR3A 2ZYSA 1E3QA 1OLSA 4FZVA 1BVUA 2PSDA 2XB2A 2HIHA 4II7A 4YRGA 5BR7A 4W5QA 2GO1A 2OHGA 2QTWB 1PBNA 2PGDA 2WAMA 4NU6A 2I9PA 4H1HA 4PPYA 4W5NA 2JG3A 2YNMC 1E77A 3CEPB 1UXIA 3PX2A 4IDCA 1RHKA 1ZN8A 4HB3A 3ZVNA 4CLEA 1HRDA 5BV2P 5BUQA 3GGDA 4IGEA 4A8JA 3NGMA 2V4UA 2Q3DA 4MYCA 2H7YA 3DVSX 4LE2A 3R7LA 3TSAA 1E4YA 2ZWOA 3ZDDA 3GLSA 1ULBA 1LS6A 3VHXA 2WW8A 4LW8A 4LC9A 1N8NA 4J1QA 3U5TA 1OLXA 1J2YA 4OHYA 1L5YA 4ZC8A 1ITZA 2TS1A 2DE0X 1ZCJA 4HGPA 1FRNA 3GPDG 3GLHB 5BWBA 1Y98A 4Y2SA 1O5TA 3K0EA 2OFFA 4U6SA 3WKBA 3H2IA 3E3MA 1DOZA 3VVMA 4DA7A 2OILA 4ZYXA 1OASA 4UPDA 1GCGA 3PXXA 4PYQA 121PA 3F4BA 3UCEA 2BY4A 1LPSA 2ZSJA 1E6UA 1JG7A 3OIUA 5EQJB 5DYTA 2ZXUA 1YGPA 3B6EA 1RWVA 2C4NA 4F4CA 5LP6A 2PUBA 4ARIA 2QIPA 3IDSA 1WHSA 2GEUA 2PL3A 3B85A 3R7WA 3IPLA 3SBDA 3WHPA 3N8NA 1IOWA 2W2KA 1YH3A 1E9CA 2C97A 2GN9A 2OLEA 3AY7A 1VB3A 3D6MA 1USGA 3H5AA 4G63A 3R8CA 4TQ9A 4DG5A 5T3YA 2GFQA 3ECAA 4YMSA 2VQ6A 1SVIA 5TVKA 5GZ3A 1P0FA 2IXAA 4FGSA 5ALOA 2P2NA 2BJHA 4X54A 1X3LA 1RWQA 1QH1B 1AHNA 3FBGA 3H18A 4YJFB 2AEJA 1T5HX 5ESRA 1MO2A 2C31A 3OUZA 4F2DA 5F73A 1QHYA 3CLTD 3O47A 4HUQA 4XFDA 3FWKA 3FETA 4NZPA 3DHNA 2Y1FA 2WVGA 3I6QA 4HEQA 3H6KA 1C7IA 1FQKA 3N8HA 4DR5B 2CHVA 1A7JA 5KVVA 3H19A 3OTIA 5DX0A 3PFCA 4LTMA 4BQEA 2HQBA 1C7FA 4G0QA 1FDTA 2ZXEA 3O4HA 2BYTA 1WZIA 3DQQA 1N7GA 3O1IC 4ZWNA 1UKZA 2R6DA 2KE5A 3VXKA 4OQEA 2DUJA 4XYMA 2QRHA 4A2WA 2ENUA 1EVIA 3I2YX 2OHFA 2HRCA 3MFQA 1T25A 4EFNA 1U0JA 4CCYB 4F56A 3QEOA 4PAGA 5IFLA 3RREA 2ZUFA 2O7RA 3R3YA 1Z4JA 4BAGA 4NQZA 2RHBA 4E5VA 2D1YA 1U1DA 1O97D 2GCOA 2RGXA 2IHZA 3CXRA 3ZY3A 5LXTA 2P2GA 3GVCA 3LY9A 4CMAA 3H97A 3MNFA 3VZDA 7ABPA 4CCAA 2FR8A 4RA6A 3SFZA 2OK8A 5JFGA 1H2FA 4NCNA 1JALA 4JLWA 2ETVA 2WJZB 2C42A 1ZBQA 1QF9A 5FPKA 3ZCXA 1E3IA 3HO6A 2QENA 4OJMX 4MW7A 3ZV7A 3KLNA 3TG2A 1S2NA 1SZDA 3MJRA 3DZJA 4CMIB 3TO5A 4PVCA 1QLJA 2KJQA 2XNDA 2XTMA 3FFBA 4RABA 4UU7A 3CWQA 5I9MA 5A6VA 1SUDA 3OQPA 1G8PA 2PD6A 5HR5A 1YZKA 3LUBA 2B25A 2A9QA 4LS3A 3S5JA 4S1WA 5T64A 1VKNA 4R2HA 5K0FA 4MARA 4J3FA 5IDQA 3DFMA 3CNBA 4OFXA 5A1JA 5HHTA 1MRSA 2I8LA 3W79A 4HNVA 3R5XA 4XM2A 2FQXA 1PNQA 5F51A 4CLOA 2QL6A 3NORA 2PYIA 2Z8YA 2IOYA 2BV3A 1VE1A 1JHXA 1RFGE 3OEHA 2I3GA 3JVIA 5EN4A 5F35A 3FE2A 4TTIA 1OB5A 4Z4GA 1NUUA 2I2WA 5AI5A 1BXKA 1BA2A 4LTDA 2BZSA 4MJXA 4A2QA 1G7SA 1B2RA 2H9YA 3NS7A 2DFTA 2QB5A 2DULA 1PQUA 4C6TA 1PFUA 3NYQA 3LNTA 3O8QA 3NNNA 4D02A 1LJUA 4D3SA 3LUPA 1L7AA 3GRPA 3QYPA 5HUJA 4KR6A 2J07A 1VPLA 4V24A 1FDIA 2WNIA 1R74A 3LHIA 3FUVA 3N5CA 3KYCA 3QVGA 4N3NA 5I48A 1BW9B 1K6JA 4TS1A 4ZYTA 5CXUA 4A0QA 1WD5A 4OHOA 4JP2A 2CJFA 2D0PB 4KQCA 3JPYA 1DB3A 4LOHA 5KNDA 4RD6A 4DMKA 1ICEA 2NYUA 3DEJA 3L41A 1G5QA 3C8UA 3U7FB 4L6IA 3HCOA 4DE5A 5IBCA 5TMPA 4DBLC 1LNQA 3PNVA 4WOKA 2BFWA 3TMAA 4WLNA 5F9FA 1EVJA 1U2GA 4WW0A 5P21A 4M7OA 1PJRA 1W9MA 1CUAA 4HWGA 5FOWA 4IUCS 2YYSA 4BVAA 1E7WA 1FU8A 2IHVA 4QXRA 5EIHA 3GRAA 5J2UA 1Q7CA 2XUFA 1B0AA 4GKVA 4PHHA 4Z4HA 4I3HA 4DIKA 4FLFA 1A5BB 521PA 1L5KA 4KHPB 3NWBA 3PYLA 3BXHA 3M1IA 5ECWA 3ZI0A 2QTAA 3PRKE 2G7ZA 4RJ2A 5CB4A 5IJZA 5G0TA 2VNJA 1W76A 1JHOA 3FPLA 2Q2OA 4HP8A 3RH0A 4WEQA 5KJCA 5AJHA 4ZQEA 4CKBA 5T6BA 3LXUX 4WECA 4XGIA 2VJOA 3OCYA 2ZU6A 2Y05A 4IVNA 4PSUA 1JEQB 2EX1A 1RYYA 2ZSEA 2FZGA 3RDPA 5JS2A 3UWOA 3ZW8A 1JR2A 3QXCA 3DP9A 2HB6A 1K89A 2DJIA 4KMRA 5LBIA 2AVNA 2VPXA 2Q27A 5TMEA 1U4OA 3F96A 1L0BA 4WD3A 4HN4B