4LYYA

Crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
179
structure length
171
Chain Sequence
YFQSMKHTTEVMITAEEIDQKLDILAEQINAHYADSDRLLMVGLLKGSVVFMADLCRRIKGHVEIDFMSVSSRDVKILKDVQSEIQGRDVLIVEDLIDSGNTLNKVRDMLLLREPKSLALCTLLDKPERREVDVPVDFIGFTIPDEFIVGYGIDYAEQYRNLPYIAKVVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypoxanthine phosphoribosyltransferase from Shewanella pealeana ATCC 700345, NYSGRC Target 029677.
rcsb
source organism Shewanella pealeana
molecule tags Transferase
molecule keywords Hypoxanthine phosphoribosyltransferase
total genus 47
structure length 171
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyyA00
4RV4A 1OPRA 3OHPA 5BSKA 1A97A 3N2LA 1W30A 3QW4B 2GEBA 5HIAA 4WN3A 2XBUA 1LH0A 1HGXA 1A3CA 1STOA 4RAOA 1QK3A 4RABA 1XTTA 3EFHA 1P4AA 1VCHA 4S2UA 1QCCA 1TC1A 4X45A 5JV5A 1UFRA 4P84A 5KAPA 4RHXA 1CJBA 3LRTA 1UPUA 1JLSA 1D6NA 1J7JA 5BQPA 4RAQA 4JLSA 1U9YA 1I14A 1HMPA 3GEPA 5BQOA 5IAOA 1QB8A 4MB6A 1ECFA 2JBHA 1XTVA 1DKUA 2H07A 4LZOA 5HKLA 1G9SA 1ZN9A 1BD3A 4RHUA 4P82A 4Z1OA 5E38A 1U9ZA 1GRVA 4RADA 1Y0BA 1OREA 1I13A 2E55A 4RQAA 2EHJA 4P3KA 3DEZA 3GGJA 1GPH1 1DQNA 2FXVA 1TC2A 1QK4A 1DBRA 3NAGA 4RHTA 4LYYA 4ZFNA 1Z7GA 1ECJA 2JKZA 3LPNA 4X44A 4F8EA 2C4KA 1XTUA 1BD4A 1UPFA 1L1RA 2VFAA 1MZVA 1QB7A 2DY0A 1JLRA 3DMPA 3H83A 4PAWA 5ESWA 1I0IA 1VSTA 5K51A 4RQBA 3M3HA 2WNSA 3MJDA 4P83A 1ECBA 5ESXA 1BZYA 4KN6A 1P19A 1YFZA 1OROA 5KAMA 1A4XA 1DKRA 1DQPA 1O5OA 1XZNA 3ACBA 3ACCA 4RHYA 5BRNA 1FSGA 1ECGA 1I5EA 2AEEA 1A95A 1G2PA 2H08A 4TWBA 1NULA 1ECCA 2PRZA 1G2QA 1L1QA 1ZN7A 3OZFA 4QYIA 5EUCA 1VDMA 4QYIB 1AO0A 4RACA 2JI4A 2PS1A 2YZKA 4M0KA 4RANA 1I0LA 3HVUA 4IJQA 1O57A 4LZAA 1R3UA 3MBIA 2P1ZA 4LYGA 3DAHA 3OZGA 1PZMA 2HCRA 4M0UA 3ACDA 1QCDA 1XZ8A 3S5JA 1QK5A 4WMLA 5IPFA 5JSQA 3GGCA 1G9TA 1NONA 3KB8A 2IGBA 4LZNA 2JKYA 4JITA 4OHCA 4PFQA 1V9SA 2H06A 1P17A 4P81A 4QRIA 1A96A 4FYMA 1A98A 2PRYA 3G6WA 4M0PA 3O7MA 4P86A 1P18A 1WD5A 4P80A 1IBSA 1ZN8A
chains in the Genus database with same CATH superfamily
4WXMA 1O8CA 2HCFA 5SZIA 4EHDA 3W6OA 2XCRB 4W9MC 2ZWIA 3WSTA 4N3AA 5CM8B 3D7LA 3QGMA 1KU0A 2QT0A 4DPKA 3IGFA 1NIJA 4R81A 1HE2A 4G0OA 1B3RA 1JP7A 4IKPA 4OU5A 1JLLA 1J2RA 2Q9UA 3IIIA 4IIYA 4NFHA 2Q3CA 3FDXA 5FULA 3RT1A 4C76A 5CDYA 4WA8A 1JR3D 1Z5UA 1Q6YA 3GFRA 3PF8A 4PLTA 5IVHA 1GTL1 3DOCA 3KYCA 5EWLA 6REQA 3KAQA 3MB8A 2XWJI 3AZQA 4ND6A 5FFNA 2IHZA 3PNOA 3U7EB 3VZCA 5ALPA 4G0XA 2FG6C 1L2TA 4D97A 5ETJA 2CXPA 1VJDA 2ZB3A 2XUAA 4GS5A 3VBEA 4M53A 4YT4A 2DUUA 3NLLA 4IJUA 3RYIB 1GCUA 2RGXA 1DKOA 2L82A 3H1FA 1HXHA 3QVGB 2WU4A 1U0JA 2OB2A 4JLNA 3GLFB 1KI4A 2GEJA 2AFIA 2J3DA 3VH2A 1L6RA 5KPDA 4NONA 3KT3A 2C4NA 4LDZA 4DC9A 4TMTA 2PZJA 3BYZA 2IYLD 1W4CA 2HNBA 3SCZA 1SKQA 3ZWCA 2HK7A 1SVKA 2QN8A 2PUGA 1XGKA 3P0HA 1UEIA 2UVPB 3M6FA 4WACA 2M6LA 4RTNA 3CVXA 1ZMRA 2JRLA 2V6FA 3DE6X 3T1QA 4V2UA 2FWRA 4TMFA 4R54A 1XOIA 4XYBA 5JQGA 1M83A 4KDFA 3K71B 3UCXA 5CVJA 1Q0ZA 4G5HA 1MFZA 4EBFA 3HNRA 4FT2A 4ZDWA 2G1JA 4MJ3A 4CCYA 4WKNA 1RE0A 2FPIB 1IQUA 2H1FA 1TQ2A 1W0JD 4KPEC 4OXYA 3W9BA 4EP1A 4L0QA 2H0AA 1PS8A 4BRZA 2BGTA 1T0UA 2N1MA 1XKTA 2GAJA 4P3PA 4C7OB 1XMVA 2P7IA 4OUDA 5JSZB 1DC4A 2BFPA 4FOOA 5CVDA 3SXUA 4OI0A 1QCYA 4KJZA 3U9SA 1XXHB 2R3SA 1WZUA 1FQJA 3P0FA 1NUAA 4FLMA 2QMEA 3JQBA 4O4JA 1CUHA 1KIAA 2KBFA 1T5BA 4MKIA 1GHTA 4L4RA 4AQ7A 2Z8YA 2O54A 1OY1A 2ZRPA 2V8OA 1S7CA 1R4NA 4F4CA 4QOGA 3BRWD 1LSOA 1P2GA 3QPCA 1T3GA 1ZL2A 4U7HA 3LTNC 2LWIA 4MVJD 3WNVA 4Y3UA 4HNAB 6LDHA 1KH2A 3DAHA 3MJTA 1T2UA 1LXCA 4GUAA 3OY2A 1O9BA 3I01A 4YJFA 5EE1A 3TVDA 3VVBA 2MYPA 1K3TA 4QO8A 5CYGA 1YJAA 1Q1EA 4RPCA 4ZREA 2G4VA 3DXYA 3PL1A 4KE6A 5F98A 1YJ5A 5BV8A 3V8BA 4YUAA 5IK2A 1GUAA 1U8UA 1AUXA 4I5GA 4LMPA 4M0PA 4KIWA 1E2KA 2QNBA 4KRXA 3SBDA 3VR3A 2XOKD 3RF6A 3LH5A 1D1TA 3M2PA 3KSUA 2E0IA 4R3UC 4YXWA 3CKKA 1E9RA 2FF7A 5E1BA 1W2WB 4YJ3F 1L4LA 1H5NA 1J0AA 3L79A 4IUCS 4BJ1A 5FPTA 3T5AA 3WGIA 1JR6A 2G5GX 3PPVA 1ARZA 4KFSA 3TI9A 1J4AA 1SIBE 2PX6A 3ZKWA 3CMCO 5CK4A 3HDVA 4GR4A 3WHPA 1QONA 1Z18A 3A28A 1KAEA 4RLHA 4UC0A 4XVQA 3OQHA 3AUXA 3RVDA 2YHBA 4D9IA 3MYYA 3J81A 5L7YA 2ENUA 2ZIWB 5E3JA 5EKSA 4KX3A 2O8DB 1LWNA 1PQPA 1NYLA 2EP7A 4GXTA 2ZIXA 4HLCA 2QQ5A 3NM6B 4YUZA 4LYFA 4G0ZA 1CUJA 2ZRQA 2H7VA 1OB2A 2PSFA 1Z6PA 4RA6A 1XTVA 2PMWB 5BW8A 4CIBA 2OYCA 2C1XA 3ZHZA 2H2DA 3KXPA 4GNRA 2D1QA 5F1YA 1PLKA 4R2IA 3G9UA 1GN9A 3BC1A 5EWJB 3KJGA 2VNKA 1XHEA 2E55A 3LNCA 3OMXA 5MDHA 5KDDA 4Y30A 1YZLA 2QV0A 3ZYZA 3F6YA 1GFWA 2ZAOA 4JVSB 4W82A 1P73A 2O50A 2EKDA 1OWNA 2Y3IA 1HEUA 5HF8A 2J8ZA 2HT1A 4AP9A 4QOIA 4MR7A 2QUBA 1GUBA 4JD5A 4H60A 5DM0A 4V0ME 4QDUA 1IVSA 1ZC3A 4MV8A 3V4OA 1F4PA 2AIRA 3N3AC 4E5VA 3AGQA 1ISIA 3T3PB 5FPKA 4PRKA 2KE5A 4YN3A 5GJWC 2P9QA 2M6KA 4BQFA 1GUYA 4YJ2A 2O7NA 5L3SA 1CD5A 4A73A 1A4IA 3HB0A 1T9BA 3U1BA 4P5PA 3AVQA 5HK8A 4TKZA 1UL1X 2B8NA 1RAEA 5IVDA 3AF3A 3SP1A 3UQYS 4AXXA 1K86A 3PBKA 1SQ5A 2YY5A 3N8GA 1P3JA 1Y3CE 4FD2A 5GINE 2MCFA 2OCGA 1I5RA 1YRQA 1IATA 2HHCA 2DULA 3E5RA 3L8HA 3ZWXA 1Z0IA 4V03A 1VP9A 3TAHA 5BV2P 4D9JA 1MABA 1E9AA 4ZT7A 1LRLA 1CUDA 1G20E 1WKVA 2RAPA 4I46A 3G2MA 5IVIA 4XZ3A 3TAXA 4RANA 2FNAA 4B0OA 3HVUA 3B1KA 1GO2A 2Y2UA 4NJEB 1P80A 1F8YA 4C2BA 3KOWA 1FJHA 4MJ7A 3T9BA 3D2AA 1EVKA 2C78A 2I3ZA 3KJHA 1JVNA 1YDWA 4RA9A 1UFQA 4MW7A 4BX9A 1PQ4A 4ZAXA 2Z0MA 3NRCA 4IDDA 4PPYA 4BV3A 2ZK7A 1E2EA 5BNIA 2AYXA 3TPFA 4ND8A 5IKEA 4HXEB 4V0QA 4RTOA 2OENG 1KY3A 2D62A 3FW1A 4FNOA 4EPYA 3OA0A 4PGFA 4D7AA 2GXSA 2WD8A 5DNYB 3HXQA 3KDSE 4A36A 1UEXC 1VLZA 4HUTA 1CT9A 1I7SB 1DWOA 3DWFA 1U3VA 3MUEA 1X74A 2PD3A 2QAJA 4FXOA 4DMGA 2P0AA 5FEMA 1NVAA 3LUPA 1JEDA 2RGWA 3U7QB 3Q3HA 3EVAA 1WXEA 2OCAA 4Y2XA 4HLQB 2I3AA 2MINA 1IN6A 2A3NA 3QWIA 4ZIRB 5EG5A 1N4AA 2RGNA 5JV5A 5EKUA 4NCBA 2L42A 2Q0HA 1P0MA 2EP5A 1AGYA 1UCFA 3I2IA 3MWEA 5CBKA 3ORQA 3BSSA 2QTGA 1TQHA 4F56A 5DX1A 3RB8A 2ZSBA 5CLQA 1BQEA 1U8YA 5JPIA 1SU8A 2O8CB 3GLRA 2O6HA 2WPDD 4K46A 1IVNA 4WFIA 5LDGA 4ZT4A 5HKKA 4UNPA 5P8WA 4OHUA 3A6DA 2QQEA 3T95A 4EHNA 4PCLA 1UKVY 1G5HA 1YR2A 4PGGA 2G25A 5DM4A 1G66A 1A9QA 1AK1A 1WX1A 2JGRA 2OAQ1 2R96A 3IOYA 2BEUB 4BLWA 2ZZKA 3Q72A 1FCJA 1G5FA 1L5RA 4G0UA 3WLJA 4UXHA 1O9HA 5GAJA 1FB5A 2YR0A 4UNSA 2P40A 4BRWA 2C7PA 1VOTA 3HC7A 1E7WA 1XG5A 3C1OA 3NOVA 1QWSA 2ZT5A 4M8NE 2I6XA 2H1HA 4IIFA 2IW3A 2I1VB 3LBNA 4TM7A 3UK1A 1A69A 2RHGB 4K6KA 1WV1A 2XUJA 1F1BA 1LDNA 3MRXA 3HZZA 1JPUA 5A4KA 1NF8A 1XTKA 1CRWG 2EFCB 4G36A 2A0FA 2ZIFA 1QB7A 4E09A 3UWOA 2JDID 1ONBA 1I30A 2HADA 3MZ0A 2YRFA 4KR0A 1K8QA 1EDOA 3D4BA 3UWMA 3I73A 4WKGA 4XIIA 1JDUA 2O8EA 4DCOA 1P39A 2EIXA 2JS7A 4K7JA 4A5OA 2PUTA 3ZHTA 2WJAA 4XFDA 5BV7A 5HGXA 4Q7KA 1T4CA 4KLRA 4HGQA 2V7XA 1E2HA 5LYYA 2RIRA 4EJFA 5BQFA 4LHWA 4AM8A 1FVFA 2B36A 4YXFA 3NTVA 2DHRA 2WIGA 2GLTA 5ECDA 3OIWA 1NYQA 2GF0A 2CLMB 2CXTA 2DUWA 4EMSA 3AF6A 2XLCA 2BLLA 4X8HA 1E69A 3QEBZ 1N32B 1DBPA 3K9WA 2AVNA 3SQDA 1MW8X 3RSCA 4ILKA 4C7KA 2FUNB 1DTWB 3LKBA 4GX1A 2E5LB 1DELA 3WKAA 3QEAZ 1KO8A 2QN1A 3IP3A 4G5OA 1TYAE 4BNGA 1SUAA 2IYNA 5KSZA 4N47A 2GVDC 2PKQP 2H5JA 3QVSA 4INZA 4KL8S 4L9RA 4PC1A 3X1ZA 4ARZB 1Y8RB 1RWKA 3OZTA 5LN1A 1RKVA 2EL7A 4ZCIA 5DHFA 1IBRA 4TMXA 2MSCB 1AS2A 5FTLA 2ZI9A 3Q88A 4NTZA 1UM9A 4R1SA 4K8OA 1YO6A 2P90A 3QMMA 4YDRA 3GVCA 1AQUA 4AJ9A 3QX8A 1L7XA 3D59A 3IDFA 4QHTA 4B6RA 5C1PA 3TO5A 2O8CA 4KK4A 3RO7A 3OHPA 3T9DA 2O3JA 1A9XB 2IUSA 1YB1A 5AP9A 3G1WA 4L7VA 1RZRD 3OE7A 4NFSA 1OVGA 1AF7A 4LAFA 1HEYA 3JQFA 1K6EA 5EXDA 1Q44A 4JYBA 1NX9A 5FWDA 1IBKB 3H2BA 2FGJA 3MGAA 3CUWA 5EGNA 5JE8A 1SC3A 3EF1A 1V7ZA 1YQ9A 2ODNA 4HGOA 2BMAA 2IHBA 2EKLA 2W90A 4DCSA 3DH0A 3V4FA 3C8MA 4Q1FA 4TUYF 2G9UA 4C1BA 1JQ3A 4LC0A 1XU7A 3BD9A 4BB6A 4AKHA 2BFBB 3DB1A 4OQ4A 4Y2HA 1VFPA 2QE7A 2C3UA 4PYMA 2Z8YM 4OHMA 4ARUA 1ESCA 1KEEB 1S3FA 3JU3A 4QUEA 2D00A 2II6A 2Y0CA 3ICWA 4MW5A 4WERA 4CMAA 1C1HA 4JJ4A 5FUQA 3JQ7A 3GRFA 2OUIA 1K7EB 3ECSA 2AMLA 3H9EO 1GNVA 1GLVA 2W6CX 5DBEX 3NKFA 4EHIA 1RMTA 1P2FA 2WUEA 3K8OE 1IHDA 3BGIA 1NC3A 4BE9A 3R41A 3CSUA 4Q4JB 1J2JA 3RUEA 1DCMA 1X19A 1V25A 1EDBA 1AN9A 2I6SA 1AUPA 1RPNA 4N54A 1QS0B 2BM8A 4UEQA 5DCUA 4J6FA 4C08A 1JVSA 4QLBA 4L8GA 3RV4A 4KTVE 4BIMA 1V95A 5GPBA 4LWOA 2W43A 1LI7A 3LT4A 1G6OA 2I8LA 2OWEA 4O33A 4F2DA 3P2EA 4CR8A 4QFDA 5IUNC 5DXAA 2DUJA 5TB5A 4BLPA 5ER9A 4B7UA 1Z15A 2E4XA 5LZ5A 3NO4A 3TLCA 1L5QA 2WG0A 2E82A 2YYAA 3KAKA 3ZZTA 2R47A 2LZ0A 3VC3A 4CT0A 3ASVA 4DR2B 3AM4A 1V47A 1C4OA 4G9EA 2RGRA 4NEGA 1A4XA 1RRCA 4DNFA 1OXBB 4MKGA 3U37A 2PPVA 3GJTA 1BH2A 5CA1F 1DX4A 2NVUA 2RG1A 2PZ8A 1DNPA 2AN3A 2P2NA 1SVLA 1P1KA 2FFJA 3CXRA 1XA4A 4KACA 1CQXA 4M1KA 3VOAA 1Q20A 1CZHA 3P8ZA 3OZAA 5BR1A 2PBFA 3UMMA 2PWBA 4J4HA 3CXUA 4BKMA 2X5OA 4IOJA 1M0WA 3BN3A 3CW8X 3HCEA 4L6AA 2O5RA 4EGAA 2QAIA 4YPVA 3ICOA 4XPZA 3MJRA 1CQJA 2A4MA 2IYWA 1YOVA 3I9LA 4I1IA 2ZZMA 1M0TA 3I4LA 2CZQA 3ZD8A 4HEA6 4Y6QA 4DXAA 1MZPA 3LCVB 5AI9A 3RSZA 1XSEA 1CTQA 1JDBB 4OLAA 1N34B 3S70A 1VSQA 3HP1A 3K5WA 1NXTA 2BHRA 3LXMA 4UFOA 1JU9A 3L6BA 4MW4A 1GCGA 2Q21A 5DU2A 4HVCA 4OAOA 3MNFA 1KK1A 4X64B 1AGXA 3BMXA 3ZEAA 3REQB 4O4HB 3CH6A 5K6AC 2XMQA 2QX6A 2PSHA 3DYBA 5A6SB 1CJTC 2IOQA 2RH5A 2WWHA 3HNPA 4ZCRA 3ZJVA 3IKVA 5KWEA 1WB9A 2WF7A 2Y8EA 1JIVA 1YHYA 2XNDD 1JQAA 2W83A 4BP8A 3FFXA 1QVAA 3HDHA 2QLMA 3UMFA 1J5XA 2QTZA 3BCRA 1K7XB 3D4OA 3T3GA 1OYYA 3PSHA 4UTXA 4CF6A 2O8NA 2WAMA 4YECA 1WW8A 4GM1A 2IY9A 3OZVA 3W5IA 1M2VB 3QLVA 2VUUA 3PXAA 4Z0PA 1E1KA 4X0EA 5CFPA 2FN7A 2Z30A 5IKMA 1BW9A 2GO1A 4NMLA 3UUWA 3EWAA 4J2TA 3TJMA 3JQGB 2Y77A 1W1IA 4IJ6A 1BFUA 4UFPA 7YASA 1T36A 2O2IA 3BKWA 5EE5B 4D4MA 3W05A 3TCKA 1E5LA 2CZCA 1NTOA 3ED5A 1UP4A 5H83A 1GWNA 1G8YA 2HNKA 2XUIA 4GBMA 1AT1A 2ZBGA 4M8IA 1TMOA 4XARA 1P81A 1E3DA 5CYFA 5JCXA 4EKYA 5DYGA 3E9YA 4QEZA 1TAUA 2GOYA 4QU8A 2AQ8A 4Y6SA 2AJTA 2WSBA 3G9ZA 3K9FC 2OLJA 2WM3A 3PX7A 1WMBA 4L72A 3SC2A 2R00A 8GPBA 1ZN9A 2C3MA 2WG1A 3DF9A 3QNWA 1I9GA 2FJUA 3DE0X 4IILA 2V5AA 4ZVVA 5DJ5A 3TBFA 3WKEA 4H7HA 1YRHA 3WTCA 5DLYA 1KQPA 1S1CA 4HR7A 4FIDA 4HMPA 4KUHA 4NCXA 2MHCA 2QHXA 3MELA 3GEDA 1JGTA 4BLQA 4M1MA 4B2LA 4CODB 1QGDA 2Q4TA 4U2BA 2J3QA 2PR7A 3WLEA 5LQNA 3UBTA 5ICGA 4WKOA 3DMFA 1E2DA 1YTLA 2BWJA 3ADDA 2H1LA 3GLHA 1OLSB 4GDMA 1CY0A 4UMVA 2YWCA 3PUIA 4NZMA 3ZXIA 1JEQB 4DLTA 4X44A 2YRWA 4WLVA 3GA7A 3Q8XB 4IJKA 2HQ1A 4W5OA 1L9XA 1SKAA 1Y1QA 3MPOA 4DMCA 1N5MA 2H2IA 3LZ6A 3GH1A 4W7SA 1ZSNA 2D8MA 3PXXA 4GKAA 4R8KA 4ZQCB 3GRAA 4OFXA 1AUOA 2DFKB 1RZVA 3CU5A 1Z7EA 1U5CA 1MIOA 3IQIX 3THXA 1P1CA 4JLAA 4RTLA 3CX7A 4XJXA 1YZNA 4B71A 1DUVG 3WC4A 3ACCA 1E2BA 1TUGA 3LFTA 4JLWA 1KJJA 4IGIA 2GPSA 3A1CA 3BMCB 1NW7A 1REQB 1CR2A 4IL5A 1O8BA 3L5KA 3FBGA 2HFJA 4CEHB 1U4OA 4QO7A 2NX2A 2PO5A 1WVMA 1EFTA 4RCZA 2WLTA 3Q41A 2BLNA 3OJCA 4U6NA 5AXAA 5L4LA 3AR9A 2NSYA 3FYCA 2GAFA 2ZYDA 4AZTA 1ST2A 3I32A 2N9UA 2UZIR 4Y18A 5LZ4A 1A2OA 4L4YA 1Z25A 3ENWA 5FUYA 4NDAA 5FWNA 3A3NA 1Z74A 2UVPA 3LC1O 2BKEA 2WAXA 3QW2A 1F48A 2BM9A 5BWLA 2M1ZA 2CJFA 2VWPA 3F3YA 4M83A 4QYXA 3TRKA 3MD0A 3EBLA 2DQ4A 4E0BA 3OUZA 1ELOA 1LJ8A 5C3MA 5FLEX 2GPYA 3GGOA 5ENZA 1DEAA 1CHDA 3ZJUA 2W9XA 1JFLA 3CB4A 3HZOA 1IONA 2VSYA 2W2MA 4W7HA 1QDEA 4QDJA 2ONZA 5AKIA 1RT9A 4Q1BA 3F7NA 4Z0TA 4HEA1 4D98A 1I94B 5K8CA 4JP8A 3FNRA 4MIYA 5AOBA 4DLPA 1ADGA 4EHBA 4FUQA 2P6PA 3U9TA 2B3TA 2IKQA 2WBLC 3FDJA 3OQBA 3RVOA 2WUGA 1CUSA 1QQ7A 1XJWA 4OQDA 5AJVB 2O7RA 1KI9A 1L7NA 1MAVA 2Z98A 4UU7A 2V5UA 3IMFA 2IYAA 3JWGA 3DDCA 4J91A 4LXHA 3AU8A 4QU0A 1EUDB 1OU0A 2Q8NA 2RH4A 2PGOA 3DHYA 5F73A 1MTOA 4C0SA 1T3TA 5FWAA 3G2OA 5TSDA 5TXGA 3RSSA 3VSAA 4H31A 1C1DB 1JAZA 1F17A 1KZYC 4GZ6A 4DUGA 3U4MA 1R5BA 1A4UA 2BISA 2XOEA 3GRCA 2W2VA 4MH0R 5G1PA 4I14A 4E7OA 5K8TA 2OXRA 1J00A 1FSSA 4YRZA 5THQA 3GH3A 3QXCA 4PFKA 4RYLA 3I76A 2O1EA 4LECA 3PR3A 3PCRB 3RRZA 5K6TA 1U0BB 4M98A 4MGHA 3DOUA 3QU9A 4L5YA 2WJ3A 2RKWA 3U0BA 2W42A 4BIIA 4S35A 1R0SA 4BLOA 4FFVA 1RYMA 1NM5C 4Y1FA 2X9NA 2BFEA 1R6TA 5DXJA 3W6ZA 4W5JA 5HW0A 1RYBA 2H1OA 1CDDA 1VTKA 1OXXK 2X1LA 1Y4DE 2K7ZA 4AU1A 3ZE6A 5C8DA 5AOVA 1T9KA 5JNRA 1FYVA 5JRZA 3CYFA 1V5FA 1QH9A 3ANXA 1C9NA 3TCNA 1X7XA 4HHEA 5C4MA 1S2GA 2V7PA 4P8RA 3D8HA 3R6DA 4RMGA 5ICMA 5HQJA 1XFAA 1ZD9A 2AMYA 3R3WA 1T10A 5CDFA 4BNVA 4OYYA 4ZHSA 3ENZA 4E3WA 3GPLA 4MKRA 4FHGA 2HDNB 2WA1A 1D6SA 1NMXA 5TEWA 3RS8A 1GPUA 3IPCA 3L1JA 5T4BA 3DP7A 4JLDA 1AMOA 5GQSA 4KNYA 1BZYA 1EQ2A 3T7JA 2PLWA 3ZQ6A 1YFZA 4OQFA 1BS9A 4M54A 4YV1A 5CDHA 3NAQA 3OZEA 4HNTA 3ACBA 1LDEA 1QBGA 1X39A 2OXCA 1C9DB 3COYA 1GZ6A 2KS6A 4F06A 3OT1B 5HOQA 2IEDA 2NUTB 1GXSB 4P31A 3EC7A 3ZHYA 1XMPA 1R6BX 3C74A 2Z5VA 5D84A 2DG2A 2P2SA 2OZLA 4X1IB 1O2DA 2C2ZA 1KYVA 1CIJA 1LWOA 2G06A 5LVAA 3OT4A 5CLFA 4Q9JA 4TSKA 4G86A 1I4LD 5JSHA 5IZCC 3T3HA 3O90A 1T0JB 1WIWA 1NI4A 1KZHA 1W5AA 3IQWA 4UCXA 1KZ1A 4EF5A 3WMFA 3UKDA 3E05A 5A7FA 3HDQA 5K01A 3TXXA 4FVTA 4BO7A 4JT4A 4RD2A 1OXVA 1G9TA 1QZXA 5M04A 4ZK2A 3F2IA 4OBWA 2BUBA 3VZQA 2BEVA 3HCNA 3QJGA 2HRBA 2J46A 3DKRA 4IDQA 4YXWD 1E2UA 4KE7A 1PV2A 1E6UA 4O29A 4OKSA 1Y1TA 4R2WA 1OLUB 1P7PA 3IS3A 2Z1NA 4DHWA 2ZVQX 1ODIA 1M2HA 4DA6A 4EI9A 5C5IA 4DMUB 2JD2A 3HJFA 3SU8A 4ZJUA 3T06B 5DX0A 4OHOA 3WQRA 3X1YA 2IZZA 2OFOA 3P2MA 4Q18A 5AJXA 1JZTA 3AZOA 3DZDA 3N2LA 2KPOA 4MITA 1AHNA 3EAQA 3VR5H 4PAGA 1GR1A 2HSWA 4ZOBA 4A0QA 4B3HA 5D86A 5EHXA 1T5HX 3DAFA 4GZMA 4BKOA 3WYCA 3DDSA 4UZEA 1GPWB 1RSZA 1X7YB 1XEFA 1Z36A 2Z4RA 3GXBA 4FR5A 4MQ5A 4O5OA 2WU3A 4B35A 5BNZA 2C5LA 1Q5PA 1N8TA 1P4AA 2F90A 2A5JA 2FRDA 4UAUA 1TC1A 4XR4A 3TW8B 4PGHA 3ET4A 2C4WA 4RSRA 3GP5A 1EHYA 5LC1A 4GZLA 4M7RA 1KMIY 3L49A 4UASA 2PUHA 4A6PA 2RDMA 2OP0A 5KNBA 3LRXA 3JQDA 4K9LA 2PQ0A 3R0IA 4KMOA 1EZZA 1T5OA 2OHHA 3B78A 4R7ZA 4FW9A 3FLEA 1XQ9A 4FFLA 3RTCA 5JVDF 1AMUA 1BX3A 1H94A 2QMOA 1F12A 4QBTA 3FGPA 1KVSA 4J0EA 2O2CA 1DRVA 2HRCA 1TVMA 3RM3A 4TZ0A 1LBSA 1P5JA 2C0CA 1A8HA 3I0MA 3CUUA 5DVZA 2LCFA 4M9XA 3DWGA 4ZD6A 2VBCA 1KS9A 1EVZA 1U80A 3H5LA 1ZCZA 5A5DA 3A9UA 5IS2A 1TC2A 1KR5A 4TTSA 4LEIA 1EXMA 4MV7A 2MU1A 2CDBA 1VBMA 4DCCA 2YFHA 1RXCA 2AX3A 2PS0A 1ZAKA 2VOJA 1RKXA 4RDXA 1G21E 5C4IA 4FFSA 1SXJD 3M6XA 3WHIA 4JOSA 2GRAA 4GOND 2OBLA 2P41A 4CTKA 2RSLA 2NUTA 3RADC 1HZJA 3EEYA 3U4QB 2DY0A 3JAWB 1KJZA 5AVXA 5KOYA 4X9XA 3GYBA 2R79A 3QFHA 4DCTA 3FHOA 3NIGB 1R0CA 1YOBA 2EFEB 4KXFB 4RYDA 4HT3B 2OZEA 1GILA 3ILXA 4FZVA 5BYJA 1KWGA 3O4GA 5CTAA 3THOA 4FYVA 1RJ9A 3OF3A 1UK9A 4B0PA 3MAJA 4MO9A 4JQYA 1E6EA 1FSPA 3MS4A 1NZFA 1N1DA 2RGBA 1VJ5A 2PFGA 2XWQA 3FKSD 3FUVA 3GAAA 3QI2A 1LEHA 4TQ9A 2P9EA 3BERA 2J0SA 2JGDB 4C21A 3C6XA 1NQWA 2BL4A 2PSSA 2BPOA 4CKEB 2JJQA 2CB9A 5JASA 3MLEA 2ATCA 3QUAA 1U2EA 1GG8A 2NOAA 4K2HA 4KE8A 4U0JA 4U3JA 1TJ4A 2YCBA 1I24A 4KGDA 2GI4A 2R8ZA 2W6JA 3UK7A 1JWLA 3ZY4A 5FDFA 3I61A 2EW2A 2GDZA 3QE2A 2VA9A 1U0FA 3DKPA 4FHDA 1NDQA 2VHZA 3OZGA 2BGUA 4J03A 5FOXA 3SZRA 3EC2A 1KJIA 4CE6A 1EGAA 3C8UA 2J45A 1EP9A 4RKRA 5J2TB 2ASEA 2C83A 2RHWA 3A6EA 1NONA 2GJ9A 2PV0A 1YZHA 4JODA 4PSAA 4TN5A 1D2HA 1SHUX 1TXGA 4FJ1A 5DIZA 2DXIA 1X1CA 4Q3BA 3IO3A 4JVLA 4EQ6A 1IL0A 3LUJA 3C4QA 2FDXA 4FMDF 3NEJA 4BZQA 4UEWA 3E2IA 3G6KA 1BOFA 1B0AA 3UJPA 1IEXA 4M88A 1Q17A 5F4BA 5J63A 3T7IA 1L4GA 3DEJA 3W1EA 3WI7A 2QN3A 1G21B 5EJEA 4N76A 1M1UA 1JLKA 3WB0A 4MK4A 2NU7B 5BSKA 1FDRA 2BHSA 2HLDA 4AFNA 1E0KA 3DPSA 5F77A 3ZHRA 2E4VA 4F1KA 3ZK8A 1NMQA 5LP6F 2QUZA 1RS0A 1LPBB 5J5VA 1ZI9A 3TMKA 3WTBA 2E21A 5LCXA 2VH1A 3ZK9A 3OIUA 16PKA 1AUVA 2AFVA 4XQCA 1RJWA 2Y9PB 4X7BA 2IV2X 3SKYA 4D6YA 4BNWA 4NS4A 4U7DA 3HE3A 4LTDA 2W6ZA 3G2JA 4MWGA 5CX1B 3S8YA 3O95A 2WE8A 2QTWB 1SWVA 3R5XA 3MRTA 4DXHA 3FFWA 1EUCA 3H9JA 4LN1A 5CHEA 5B1IA 4AX4A 4UPDA 1JLSA 3FRJA 3LY9A 3U62A 1MU0A 1WMSA 3QFTA 3L6EA 4G0WA 1GKLA 3HSYA 5H8WA 2W8ZA 5ALQA 3GJ0A 1D6MA 3EUAA 4HDAA 3K31A 3WLFA 1ID8A 2C5HA 3S2UA 2IUEA 3BQNB 5CB6A 4BVKA 1W36C 2IL1A 2VF5X 5JD6A 3VJMA 4TL6A 4ON9A 4NAHA 4MQ4A 5L3ZA 4PYLA 3CWZA 3B60A 2VTKA 1WG8A 2FK7A 4MEAA 5B30A 4DLRA 4HD8A 5JZVA 1AS0A 1CCWA 2OG1A 3T54A 2UZ1B 2XUQA 2Z2JA 4JB0A 3FB4A 1DKLA 3WLPA 3FKSA 4RWEA 5KYVA 4ATNA 3ABRB 3LW7A 4BLVA 5A9TA 2VPWA 3QHQA 1IZYA 4P4UA 4EG1A 4Y2RA 1WR8A 1Z08A 1W34A 1XZKA 2MR6A 2PUWA 4OH1A 2OO5A 4KDCA 5IDVA 5J40A 2EKBA 3JD4A 3R4VA 4CGYA 2DR2A 1YR9A 1SCNE 5CFLA 4A1FA 5LU9A 3MJDA 2AV6A 3LD9A 1Y5LA 5LA6B 3NEPX 1ZUWA 2NYRA 1WZEA 4RK4A 5JS7A 2FMXA 4BGDA 2ZKIA 3V80A 3LHKA 3PCTA 4OHFA 4OA8A 1E1YA 1CR1A 4N82A 1HLFA 5EXTA 1CV2A 3N28A 4G56A 4KVGA 2R6R1 3H7IA 5HBGA 3ZV5A 2NZXA 4MHSA 4YAUA 2DUNA 4JUIA 1G18A 3W2EA 1XCPA 4YI3A 4Z9BA 3UB4A 1CB0A 1S2IA 5E6SB 2YYYA 1MIOB 1VYUA 4BZZA 3OPVA 4AO7A 4HN2A 4PBRA 3NKLA 4HMOA 3ROPA 3B3QA 1ID1A 3CVOA 3EDQA 4ZYWA 5F9FA 1DWUA 2PCJA 1X8JA 2QL6A 3LLVA 1XVIA 3I6ZA 3NBXX 1K08A 4ETWA 4UD6A 2C2XA 4GG1A 4QVKA 3VX4A 3W2GA 1P8JA 4ZT6A 3EISA 5DI9A 1G38A 4CV1A 4V0LA 1X77A 3O9MA 4H3SA 4YR7A 1HPLA 1ZIDA 1KVTA 3QYJA 2B1QA 3THSA 1U3FA 3ESDA 3IQHX 2ZJYA 3O7MA 3B1JA 4G4IA 5C81A 4RULA 1HI9A 1V1MB 4B3CA 1MJNA 3PICA 1LI4A 1Y7HA 1PL6A 1JG3A 1QCZA 5E0OA 1JVBA 1Y37A 2Q6KA 1Y42X 1HBJA 5KREA 4DIMA 1L4BA 2C00A 3GNSA 1D4AA 3AEUB 3R6TA 3DEYX 4J29A 5EIBC 5B4VA 2QZ9A 3VR6D 1E9FA 4QC2A 1D1SA 3IV7A 4OHPA 3ESQA 3M4JA 2DMRA 1F0KA 4OM8A 3MQ4A 2QE7D 3PGJA 2JJ1D 2AL7A 1F2TA 3JVUA 4OPMA 5HZGA 2C9YA 2HAEA 2J67A 2I03A 2RONA 2VG8A 2O2XA 1ZDMA 5EP3A 1CQJB 1ISMA 4WV3A 5CXUA 3JXEA 5J59A 3V1YA 1WHSB 1KR2A 3F6SA 1GU0A 4MR9B 2IXBA 2OCXA 4PCAA 4XOUA 1S89A 3D3EA 1UK8A 1JT9A 4N8DA 4B43A 4IR7A 1BMQA 3GJ3A 4DSUA 2OYRA 5A1JA 1EE2A 3AKYA 3IEUA 3IP6A 3KXIA 3FUUA 3W5AA 2PQ2A 4GWGA 1MQ9A 4F9GA 1UJNA 2OBFA 1LW7A 3PFCA 4RL6A 2FPRA 4AMBA 1G1AA 5E38A 3G8YA 3IL2A 2ZVJA 1UAYA 3RBVA 1FPQA 2ZT7A 4TOIA 3C3JA 4Y9TA 5EGSA 4IFIA 2JHPA 3GGJA 1QH1B 2AE2A 3QEKA 5ITWA 2IDKA 4UAJA 2D2VA 1Y81A 1BVYF 3ONNA 1S2NA 2YJNA 3TR6A 1SXQA 2DKNA 1AUQA 2CN1A 2O1SA 3LP6A 3X2FA 4TXLA 4WD3A 1T2CA 1TA0A 1U5BA 4GO1A 4CZ2A 1GA4A 2EQ5A 4V38A 1N2OA 1W93A 1ZXBA 2XYRA 4I5EA 3VDRA 4ARZA 5IAKA 3SBOA 3GJ7A 5IDXA 4LKRA 3PFIA 2FN4A 3EZXA 4GC9A 2WNSA 2FSVA 4Q1AA 1TZJA 2CD7A 5LU8A 1S4MA 5A03A 2VDWA 3WLOA 3HCPA 4LISA 4ZC8A 3OJWA 1VZ2A 1NI4B 3OMWA 3A6FA 3E4DA 1SJ9A 2Z8XA 5K8VA 4RHYA 2HMUA 3UK2A 4G24A 2ATEA 2IUYA 2O4CA 1EXDA 4CL2A 3HN2A 3ZG6A 4JOQA 3N5KA 2YMPA 4PLPA 4REQB 3GEBA 4TLCA 3R5TA 2BOVA 3TLGA 3KOUA 4LBWA 4X1IA 3ZGXA 1F0PA 3JRXA 1OH6A 1CYEA 4Q4JA 2GWHA 4UPVA 5KBYA 1PDOA 1GQRA 1PZXA 3EOBI 4HZUA 2NUAB 4LV8B 5B4TA 721PA 3R9IA 1CJUC 3N2NA 3PNQA 4DSOA 5DV9A 1R5JA 2NQ2C 2EBWA 1GAEO 1L1FA 1SVIA 3OSZA 3V1MA 2Q5LA 1FW6A 3HP7A 4U9HS 5KYNA 4DBLE 2HCRA 1L5WA 2YH2A 3A06A 4MKXA 5LFAA 2GN4A 3F4BA 3OKFA 1R1DA 3QXGA 5SY6A 2GYUA 2PRJA 5LIPA 4HGPA 4XUEA 1WMEA 1Z47A 1HV8A 2XPCA 4BNTA 3PXUA 2XDYA 4Q7LA 2UZ0A 1VLLA 2Q3JA 3B3JA 4LW8A 1N0VC 1LTHR 2I87A 1V5GA 4FMPA 5KVCA 2ID9A 2R5WA 5CNMA 1N2CA 3RU7A 3ZNQA 4AZ3A 1PWEA 3O8OB 4D92A 4WZAA 2A9KA 3QBDA 1P75A 3L0OA 4X97A 4R1LA 1BC5A 5L9AA 2VAXA 1VQ1A 6Q21A 4D79A 3I42A 3ONVA 3TINA 5FADA 3TTYA 4C03A 2ZGVA 4EYKA 2VTBB 3QYAA 1T13A 1OQAA 2KX7A 5JQGF 3SC3A 2WPDA 4M1OA 4MYDA 1T6YA 3AOEA 1A3CA 1E3EA 4UXJA 1US8A 1BCSB 5DN6A 2P7HA 4RAOA 2IZ6A 4NCKA 3EGDA 1N5LA 3DFIA 4V0KA 4BFCA 2AE1A 3GN2A 3STHA 3ETCA 1Z0KA 3MMNA 4M7WA 5DTQA 3KTAA 4FU0A 3E03A 3V2HA 1FFWA 1PGOA 2C94A 5F2OA 5T4HA 3EIFA 5HZHA 3LLCA 3QK7A 4LJ4A 1Y3HA 3H2JA 3SJ7A 4DJJA 4K6FA 4LDAA 5TNXA 1FXUA 1FVOA 4XD7A 2PNJA 4EW6A 5L6MB 1YI0A 4HFJA 4IJVA 1QP7A 1I4DD 2R7MA 4WLFA 5DBOA 2PL3A 2E85A 4UCFA 3TLAA 3D5EA 4NZPA 1QIGA 1ISHA 3TLMA 3K53A 1X3SA 3CZPA 3WP1B 3DLTA 2O8BB 2QLTA 1OREA 3EDOA 3EVGA 2QIOA 3H1BA 4IV8A 3BAFA 3CLKA 3FVTA 4Q7EA 3DEZA 5CXSA 5K0BA 2ZR8A 2AMFA 4YQYA 1D0SA 4UU1A 3L93A 3OLZA 4JI4B 3KKZA 1R6VA 4F5DA 5GONA 2D0PB 1EEXB 1QOQB 2H8GA 3N74A 3M6UA 2UAGA 3WGKA 1B42A 1J56A 1WO8A 3ZWWA 4CCWA 5AVWA 2WD7B 2LPMA 4LOAA 2XQFA 3WGYA 2Q5IA 3KZXA 4N40A 3I04M 1UBLS 4HVAA 4C01A 4ZZ2A 1ORTA 2FHPA 3EVTA 3BH0A 4WLEA 1KEPA 4K86A 4MROA 3RFVA 4BX2A 3VBCA 3HDGA 3QYFA 2OK8A 1P3Y1 4XFJA 1GT6A 2Q6VA 3CBGA 3Q5EA 3U4HA 1MQSA 4UOQA 1NASA 1DJPA 1JTVA 2PDAA 3D8BA 1K9VF 2VPTA 1DKRA 1EXWA 3IHKA 1FRFS 3QXXA 5CH8A 1KMQA 1Y7PA 2FUG6 4OX9B 4Q5IA 1H1DA 2ZR9A 1OWPA 2FETA 4RPGA 5DT9A 3X0DA 2GVNA 4UUMA 4AECA 1GZVA 1NJ2A 1MJFA 2C9OA 2IZ0A 3U4GA 3ESCA 3TG2A 2JGEA 2P1RA 4D4JA 4JBIA 4EQ6B 2QG9A 3OQOA 3BH7A 1SHZA 2YYZA 5DLDA 3L18A 3GD7A 2Q5EA 3LDUA 1VE5A 3KALA 4ZCTA 3A0RB 2HJRA 2F4VB 2VHTA 3FUWA 5HZKA 2PAFA 3BXFA 2I8AA 3G2NA 2HH9A 4G5SA 1RQGA 4PZEA 4N48A 2CWDA 3W2TA 9LDBA 1XDGA 4DKJA 3RC9A 3CCCA 1XD2A 3THXB 1KI6B 1SZJG 4DNPA 2QM0A 2IU0A 1IVYA 1T24A 1XRRA 3MINA 1QHSA 5CW2A 2F00A 3C4VA 3HKDB 3QUBA 2W2XA 3TLJA 3CR8A 3VZPA 2NSLA 1NYTA 4PFQA 2PT7A 3Q8LA 4B3MB 4WY2A 3MTIA 3ZDEA 1XKXA 1XPRA 2JAOA 3CJRA 1H1LA 4MW1A 4U2GA 1ZRSA 2CNDA 2FEAA 2GTIA 4YB8A 3KQHA 1P18A 2ODQA 1Q0UA 2V6JA 3GVPA 3GYGA 4G6ZA 4RK5A 4Y2YA 3TTSA 3U48A 1XXLA 1CF4A 1R8SA 3UZUA 1HT2E 4D9CA 3T7CA 3NW9A 1MHTA 3VO8A 5C3UA 4R1UA 1UBGA 5M5BA 2PO7A 2PX3A 2V8BA 2Z09A 3ZHSA 2GXAA 4HAUA 4Q6BA 2YUIA 3M6WA 4YWHA 1F9EA 5EIFA 2A9OA 2ZSAA 3UHJA 3VDNB 1FQWA 1RM4A 3ON5A 2XCTB 4YAEA 5JZOA 2OEPA 3AHCA 4KV7A 2YJZA 4IVNA 1DZ3A 5AJUA 4DSNA 4S1OA 2AR7A 1KDRA 1K98A 2HO5A 3VU9A 4NH4A 3WGJA 4PX3A 1ZVQA 1ZD5A 1TLLA 2FG7C 5KYGA 2IIBA 1GTRA 4FOLA 1D5CA 5EZSA 5DN6D 4L0CA 4B3GA 1EUCB 1FFSA 2E9SA 4ZC1A 5BN5A 4DS3A 4RJ2A 3RK4A 3PS9A 4ZWNA 4HDRB 3NS7A 4LSZA 4HH0A 1H1TA 3RHFA 4BHTA 4KWTA 1DC8A 3ZGYA 2OLEA 4J0FA 4R3NA 5BQOA 1CUZA 3ORFA 2JKVA 4PYRA 4F6CA 1CIVA 4K40A 4I4CA 3REGA 2SKCA 4CF4A 2FPSA 5KQSA 5BMVA 1U4NA 2ZYAA 3FHJA 2H4WA 4YAKA 2BN4A 3RTGA 5L4SA 4NI5A 2BKAA 2P5YA 4GOXA 4OB7A 4WXRA 4XW2A 1GL3A 1KJYA 1MO6A 1UF9A 3QVXA 3EJWA 4DLZA 1P3DA 4MRMA 3TFOA 3B52X 5MN4A 3K4QA 5IYZB 3WLRA 4LRTB 1EUQA 1LNSA 3DE4X 3T9FA 1RKQA 3E81A 5TT0A 1SXJC 2E2WA 4WGFA 4MIEA 2KW5A 1U8AA 2NQ8A 3AFGA 3KHUA 1QHEA 4FI3F 5I9TA 5I7OA 2ZZNA 1QG4A 4WCFC 2WMNB 3KPVA 3R5KA 1VBFA 3WA6A 1N2HA 4CHTA 1FUUA 2XB4A 4JI6B 5KOIA 1Z5GA 2OGWA 2W6MA 3DBRA 3H2KA 1UJCA 2I9PA 3OEHA 1IY2A 3D3WA 1LNZA 1RJEA 4QASA 1QH8B 2XUKA 1V6CA 2ZTUA 1RAIA 2OZVA 4G63A 4MAMA 3WKBA 1H3NA 2I4IA 2WOOA 1BE0A 5HQTA 2QW1A 2HB6A 2ZR0A 5CG2A 4KOAA 5BY2A 2FLWA 1WW3A 2VF2A 4Y9RA 3ZD6A 1V5EA 5KNDH 4M9UA 2DTDA 3ABIA 4D80A 1LPPA 2DE0X 2SBTA 2YIDA 4PSVA 5HM6A 1CZNA 2RK6A 3WHKA 4B2PA 2JHFA 3KTFA 1S2OA 1OZ0A 2DJIA 4Q7MB 1G41A 1D2MA 2WINI 4D9NA 3KSAC 1NY6A 4AZ3B 3VO2A 5JAIA 1FRNA 3CUYA 1I3OA 3DXFA 3A9SA 1ZM4A 3DVRX 1P2UA 2R8YA 2Z95A 4RSMA 5GVRA 1Y8QB 3GLUA 4WOCA 2AK2A 4F97A 2K87A 1W7AA 4RGBA 5JANA 5AJWA 2P8SA 1AN0A 5FPYA 5EHZA 4UU0A 4E2YA 1IOZA 2F4NA 1Z8NA 4XCQA 1UADA 1SZCA 3ZK7A 3K1JA 3R7NA 1UMDB 1EX1A 1Q21A 4YP7A 5CDTA 3QVGA 5G4LA 5BSTA 2QE6A 4HEQA 3T9CA 3AM5A 1UDBA 3B1ZA 2JW5A 4UNIA 4HY3A 2B5WA 5ES4B 5LP6C 1U6IA 5DM60 2E5FA 4EY7A 1SULA 2V6GA 3AKZA 5G0TA 3NDPA 5F1PA 2C99A 3VJRA 3GCWA 1WABA 2JHGA 4J8PA 2FMFA 1AIPA 3I5MA 4O25A 5DWDA 4ALLA 4DN6A 1T8YA 4F9FA 2JIDA 4EW2A 4N7RA 1ECLA 1Y1KE 3UXYA 4E03A 2B25A 4L9AA 4HBGA 3WWYA 3AG5A 4C7BA 3QKTA 3ZZMA 2VLBA 1N0WA 3WIDA 3Q2KA 4YRKA 5HHTA 5IABA 4JLBA 3FTNA 4H9GA 4YUXA 1T6XA 5KDLA 2Z6AA 1PI3A 4IQ0A 3SFTA 1RPTA 2HOQA 3CEJA 4DADA 4DT1B 1I01A 2XRZA 1JWBB 2XB9A 2A1UB 3O2JA 1PQUA 3NH6A 4ODIA 4A91A 2GSWA 2V45A 4ARVA 4CQMA 4P5DA 2EFJA 2ZXEA 4POOA 1QYVA 1SIOA 3FNHA 4ESVA 2NZJA 4Y2TA 1JI0A 1GNTA 1P0PA 1NG9A 2WTNA 4R31A 2PA3A 3B1XA 4XDZA 5K6AA 4LQLA 1FDVA 1GTVA 1HQCA 4JEMA 4OJNA 4V0SA 3WMGA 4ENQA 1RC0A 3BULA 3K7EA 4MDEA 2A5GA 3S1LA 2GFQA 1ODSA 4TWIA 4EMTA 2P2GA 3LQ1A 4HWTA 4MW0A 1YVEI 4XSVA 4NG4A 4EFNA 2NACA 3OH8A 1EH5A 1X0VA 1X80A 3U4QA 2GILA 2ISQA 1NLUA 5SZJA 1YCFA 3EZ2A 4JN6B 4MP8A 2PTHA 4NYJR 1DHRA 3OJLA 1KAOA 1G42A 1MOPA 1X86B 2NPFA 4C4RA 4DV0B 1YBVA 4EPTA 1BJKA 2QRVA 4DA7A 3Q5GA 2J9XB 4JI7B 1L3CA 2Q6OA 4GPZA 4IV0A 3IOEA 4D0RA 5HMLA 1P7ZA 2H4FA 3QMVA 2WFLB 3NMUF 4CLHA 1QGZA 1P4HA 2JIMA 3RIEA 1YQGA 3NIDB 1OA0A 4O8ZA 3AEKB 1U0LA 4ZYYA 4CEIB 4AY2A 3PQ5A 3O4RA 3HNOA 4KTTE 1VDZA 1XDWA 5GOTA 3BWXA 3QH4A 2CMGA 1HNXB 1DMSA 3IRUA 1PJCA 3L6CA 4RV9A 3BXZA 4WXYB 1GRRA 4WX2B 3I5AA 3SSAA 5KOJA 1RWBA 1CVIA 1BO6A 3JSXA 4ENTA 3IYLW 1W36B 3AH8A 2RI0A 4KVAA 3WLLA 2IX3A 2DF8A 3KVYA 2OKCA 5D00A 1ZFNA 5ILOA 1DG1G 1UBHS 3CLTC 3H1AA 3TEFA 5B36A 1Z6ZA 2JAHA 5JXWA 5LXTF 5K09A 3OLCX 1Y82A 3HN7A 1K06A 2XVMA 2H7YA 5FWXA 2C95A 4NK5A 3UJCA 3AR6A 4KNVA 1OT5A 4YAJA 4IYJA 3PUWA 3S4YA 1PE0A 2DT8A 3Q6IA 5EE3A 4HAZA 1FC0A 2C3PA 2YMLA 3L1UA 3O4JA 2J9ZB 2CDRA 1UZNA 5B37A 1UJ6A 3LS2A 4FFRA 3BDVA 5HE8A 4DYVA 3PJFA 1MTZA 2JFGA 1O77A 1PTKA 2WABA 3DVQX 4Q1CA 2ZIXB 3ZE9A 4L3OA 1V1RA 1RADA 3IVCA 3OTHA 1D2AA 2R9VA 1SCJA 2ZI7A 3ESRA 2H0QA 3INNA 3NNNA 3VTFA 3I9V6 5F5LA 2DB3A 1T2DA 1PR3A 1TYEB 4FDUA 5HX7A 1TCAA 3G9XA 4GEKA 3RJ5A 2UYYA 1H2AS 4TSFD 4F1JA 4CQMD 3IKLA 4MB2A 1FVHA 1R16A 2FK8A 2IUFA 2Q1XA 1LDBA 1KY4A 1VL0A 1RHJA 2OWDA 4HUJA 3LG2A 4TTQA 1Z88A 1G8SA 1ONOA 3FTPA 3M1IA 4RH3A 1EFRD 3KYIB 4II7A 1NI5A 2YWDA 3EGEA 4CU2A 2IT1A 1OXUA 1EQUA 3CEMA 1K2VN 1N0UA 3MJ4A 4DV3B 2VSNA 2VTDA 1UFOA 2XI4A 2OD9A 3NYWA 5EJ2A 4DYDA 2P65A 1PF7E 3SYNA 2GRUA 3I6IA 4NESA 3BF7A 1G7RA 1M1ZA 1MRNA 2YY6A 3DZIA 4BO6A 3LMKA 4MW9A 1BIFA 1VYHA 4JZKA 4D8XA 4K03A 5HBRA 4NOKA 1GPKA 4U3JB 1ZQ1A 2X0NA 3OFSA 2VS1A 4J2HA 5FIUA 3NOXA 4HL6A 1KO7A 2FEKA 1P74A 3T61A 1XCOA 3JQ9C 2F6RA 1UKZA 1PBTA 4XI9A 3WK5A 1BCRB 4YCLA 2OGTA 1D1QA 5BXQC 1ULTA 1L9KA 3OU7A 1DXYA 5CIQA 3DDHA 2QMZA 3AJEA 3BWEA 4A9AA 3HUUA 5JTUA 3MUOA 4PAOA 5T4EA 4LF8B 2NTEA 4HVLA 1B6GA 5JXHA 4P3KA 2ZYIA 4D4LA 3HXPA 3VYRB 4O2LA 3FYTA 2J3IA 4B31A 4UQLA 4RKEA 4PZUA 5M7EA 1EDZA 2W93A 3BK1A 5KWVA 5CYPA 1N5IA 5JG7A 1GZ7A 2GR9A 1R88A 1YKGA 1P7CA 4R4JA 1Z7GA 1WL8A 3G9QA 3WA7A 2YW9A 1XRPA 1QIKA 1EK1A 1H2XA 4NMMA 3SJBA 2FW6A 4FS3A 1AQJA 2V4ZA 4V1CA 1XRJA 1C8KA 1N1MA 4AZSA 1S3SA 4MV3A 2WZCA 2FZWA 1NVGA 2ZBEA 5B1DA 1PX2A 1LA2A 4I6GA 2OQVA 2PKCA 3ZXYA 4ZI7F 2NNLD 2VTEA 5DWQA 1RM5A 3EGCA 1OROA 4GU5A 5DP1A 4CR6A 3GJSA 3A6LA 1HLDA 1XCGB 3O1JC 3SWWA 3B89A 3VR1A 2B34A 4GWKA 4JDPA 2O8DA 3MXTA 1YVRA 4AS2A 5DW3A 2V0NA 1JNYA 3KB6A 1H8HA 5TQ0B 3JQ8A 1R64A 1OILA 2JC3A 2ZJAA 1V5WA 3SX2A 3VYVA 4ZHQF 2Q99A 4HQ6A 3OM0A 2JFFA 1M2NA 1EFLA 3HN6A 5EYPB 4EY3A 1JQLB 4J94A 3VU0A 3IIKA 3R7SA 2YN0A 3U3MA 3UG6A 1GNQA 1W48A 1RQXA 2BGRA 2JFVA 2XDQA 1E4EB 2P3OA 4QU9A 1L7MA 4BFXA 3LQ2A 3LCCA 2BH9A 1U2DC 5T64A 2CHVA 4QPDA 2OHVA 2IP2A 1KJ9A 1ONSA 2LCIA 3MRSA 3PFFA 3RS3A 1CRPA 3OY7A 5IXSA 3NIBA 1URPA 1L4FA 2H06A 2ZRDA 1TIKA 2DPMA 4R6XA 1VRCA 5TJHA 3ZVNA 1IHXA 2FWJA 1PFYA 2DTEA 1PJZA 1U81A 2JLBA 4KEAA 5AXDA 2V7WA 3DMDA 5FBVB 4GI7A 2PMEA 1E6WA 4RPLA 3V4LA 1DEHA 2EX4A 3WIVA 1L5MA 1CDEA 3NT5A 3MM4A 3M9XA 1XD8A 1L7BA 2ES4A 3B5IA 4H1UA 5FBRB 4MUJA 5ERYA 1NWCA 3LUKA 3FIUA 4TL9A 4G4SO 4WBNA 4FR2A 2PFKA 4XUDA 2IOHA 3DE1X 1CUGA 4XTRA 5DHPA 3ZWDA 2C29D 4F9EA 4GI2A 1BW9B 1CSEE 1LLQA 1Y5IA 2OBMA 3OM8A 4FYHA 5ARBA 5JDIC 6ADHA 2Z6UA 3BWMA 3E7DA 5B58T 2J7PA 3ZHUA 3KSBC 3C6YA 3LUCA 4CL3A 2O0LA 2J4FA 5BN5B 1DX6A 4O4LF 4A1OA 1D0VA 4B4OA 3B3AA 3CF0A 3D8NA 3FYUA 4OK6A 3IAUA 1DJNA 3TSOA 4M36A 4MV9A 4E5NA 1P4RA 5BQPA 3FE2A 4LHSA 3LPAA 2ORED 4Q4CA 2X2OA 3H1EA 3ZI7A 4L07A 4QELA 2B94A 1QB8A 4DGSA 2R6GA 1OWMA 3RS2A 3VR2A 5B2EA 1J9GA 2FRVA 4BB0A 2RGGA 1YFLA 1KFKB 1I2BA 2L0XA 1POXA 1VA5A 3SZ3A 3NP9A 2B9EA 4LXGA 3G23A 3OCVA 3C7KA 2HA6A 3IKTA 4YRBA 1G59A 2FH5B 1DCKA 1TQ6A 2R6FA 4E4YA 5FWXB 3TQQA 5LQMA 1XKLA 3UJ8A 5AJTA 3EAGA 1NOKA 1SVSA 3RUDA 4DR5B 1Z4LA 4MXDA 5C8YF 3MMSA 4O6VA 1MB0A 2E5WA 4YGXB 4Y9SA 1C4KA 4ER5A 3EZ9A 4L5CA 3QPDA 5DP2A 4HATA 3KQUA 1Z6XA 2DFNA 3E8XA 4CIVA 1EWVA 2ZTVA 2R44A 3RNLA 4RJJA 2GGSA 1MIHA 3CVJA 3PYLA 4IUYA 1XK7A 2AFIB 2QRZA 1M6HA 1Z4NA 3DQQA 4NR0A 2ABWA 4PAWA 5FCDA 2VSXA 2YWFA 3OX4A 4IIEA 3EXFB 4AROA 3PG5A 5AH0A 1Z5WA 2EBFX 1P19A 2YWXA 3FPCA 1P6XA 5A71A 1F14A 2WF9A 4DABA 4R2MA 2HNAA 4UQOA 3ZVMA 2IEIA 3F3MA 2WJVA 1A1VA 1L8OA 3HUEA 2YDXA 4PC6A 4ZGBA 1YDMA 2D5CA 2GQ0A 2N3ZA 4GICA 1IHYA 1I3CA 5DM2A 5JJCA 3Q7IA 5FOVA 1L7DA 2JDIA 1OZGA 2FE1A 3K92A 3IAHA 1PT6A 2ZUDA 3ZC3A 1GEEA 1N7HA 5C31A 3PTAA 2YZKA 4YIHA 4GGPA 4YMIA 5JNTA 5KHAA 2Q1SA 4YRAA 4LZAA 1QV9A 2G5CA 3QUCA 4JI8B 5DHTA 2JCYA 1OAOA 3Q8KA 4Z4GA 2HA2A 4RELA 2ZU6A 1Y1PA 1GLGA 2XAUA 3ETLA 3M1AA 1CRLA 2E4AA 4BZXA 4D0SA 3CNQS 3AEYA 5EAIA 3OOYA 1KVUA 4YMUA 4QTXA 2D4HA 3D3JA 3MWKA 1KHHA 1THMA 4AWBA 3PNSA 4ZARA 1ZRHA 2CL7X 1T8SA 3C5CA 3C8DA 3VHRA 3ZLVA 2LXNA 2BZ0A 3ND6A 4Z7QB 2CNLA 3NWPA 4WTOA 2ZSFA 5B2ZA 3SHTA 3RIHA 3V2IA 4BX3A 2CSXA 3OUUA 4N5LA 5I9NA 1RWVA 5DNAA 2GN6A 1TK3A 1Y4ZA 1QHYA 4DCUA 4M7PA 4U63A 2IH4A 3KVOA 3EGOA 5CXQA 1RBMA 4RNDB 1OC4A 3AMVA 3DV0A 2HX1A 3H65A 1JYSA 1RQRA 3H75A 2QUAA 4H27A 4O4JF 3UHOA 7MDHA 1Y5RA 4AP6A 3VKVA 4R1OA 5CLIA 2JIZA 5CGZA 2HGSA 5SY9A 1IYZA 3Q0TA 5MGNA 1VRWA 3OJ0A 1QH0A 1BA2A 1A2QA 1HG1A 1T3LA 2R84A 4O2AF 2HQBA 1KEVA 5E2AA 5GZ1A 5KUTA 2ZJBA 3FDZB 4AKIA 2I99A 3NATA 2RAVA 4PWZA 3BK2A 3KFVA 5ALMA 3TSAA 4CG2A 2Q45A 1P4SA 3K6RA 3NU1A 3UYKA 1SAYA 2EEZA 2FY8A 5AO9A 1FP6A 2GEUA 1XQVA 1BDBA 1H2ZA 1Q14A 4G41A 3V4ZA 1WB5A 4C7JA 4TV8B 1JKMA 1HDYA 5LIRA 1EGHA 1J39A 4PLYA 2PY6A 1W4LA 1NPYA 4YCMA 3SR4A 3PE3A 2PXCA 3ZDRA 1N9ZA 3MJFA 2X5JO 4XGKA 4IEIA 5COBA 3ZVKA 3T0IA 1KVQA 3KTDA 2G82A 3DNFA 1JJ7A 4X65B 2EW1A 1JJBA 3AR2A 3O8OA 3PEWA 4ZGGA 5HKBA 2I0FA 1J0CA 4MULA 4RMNA 1ADBA 1PNVA 4RZQA 3GT7A 1SG0A 2OD7A 3C45A 1O94C 4ND5A 3ZQUA 5FTNA 4C0XA 4CVNA 3L0SA 1QVWA 2KLBA 3RYTC 5MF6A 1JJVA 1VZ3A 1XRNA 3AQ4A 4NYIQ 3TTVA 1NNSA 4WT7A 1L8LA 5CH5A 5JBQA 5KNCH 3JARA 6NULA 3QOWA 5H16A 1UEJA 3SYTA 2I4NA 3SZOA 1RNLA 1SY7A 1BXGA 3O4HA 3KOMA 3X1XA 3VJLA 5EWLB 1TZKA 5C37A 1WZCA 3EH2A 1ISPA 1NBEA 1GR0A 2B82A 3ESYA 5IBPA 3D6AA 3WYDA 3UGKA 1A7UA 1YTUA 1VECA 2QYOA 3D4NA 3T5TA 4DTCA 4FS8A 1HTBA 3O2SB 2IK8A 1ZD1A 1ZGZA 1C80A 1DQPA 1ZMOA 2YJ5A 3MD9A 3V7WA 4X71A 5BRNA 2XMRA 1RIIA 3EOAI 3F67A 3QKSA 2XT0A 3H5TA 1F51E 4WK4B 5ADHA 4TMYA 3RVPA 3VNVA 1RZUA 2H08A 4MYCA 4QLAA 3RVLA 3CKLA 1GARA 2JASA 1IWOA 3AUKA 4D8WA 5C1OA 2Q5OA 5EEGA 4KQCA 1A72A 3HEBA 2C61A 4YRSA 4HB3A 2HIGA 2WT9A 4K28A 4Q82A 4JZYA 1JZQA 3O93A 1NMSA 2Z2XA 5GIOE 1HZZC 5FBWB 1WDWB 1D9XA 1EVIA 1KQOA 3C7DB 3KZ1E 4M8SA 4QGBA 4WCFB 4ENWA 5DYTA 4P3XA 2AN4A 3BMOB 3V7YA 1OBOA 2G36A 3L41A 5HK9A 2VF4X 4A16A 4H15A 4L5BA 4MMXB 5LL6P 1G5TA 1I33A 3I52A 1JECA 1JXOA 4LJRA 1PR5A 2C20A 2FWNA 2IE8A 3FI0A 3VGPA 3N5CA 1XYVA 5BSMA 3CY6A 3UW3A 1S1MA 2ZRNA 4M9ZA 3VOSA 5AM3A 2REXB 1V4VA 3OCXA 4I9NA 4L8FA 2GD2A 3M6IA 2VZLA 3RPEA 3W3AH 5KC9A 1IAQA 5L6LB 2QX7A 2YDYA 1II9A 4KBYA 1GPDG 3G82C 2NZ8A 1KIFA 4R5MA 5CNJA 4FN5A 4GVLA 2UZ3A 2WA2A 1C1YA 1K75A 3BM5A 2QDXA 3OLYA 1Y3BE 3GK3A 4I50F 4KXUA 4BMVA 4JT8A 4ZEOA 5CXXA 1T4MA 2UYHA 3HCDA 3MT8A 4KWIA 1QKIA 1M8KA 2WE7A 3R3JA 3IV6A 3ZGVA 2JARA 3ELBA 1IN5A 2WAAA 4OXQA 3U7QA 1T3ZA 4UTOA 1Y6QA 4N3GA 4CCSA 5ALVA 1R9NA 2WK1A 4BQNA 3K2QA 5BQXA 5E0KB 1XHLA 1XF1A 3AL0C 3EBPA 1CJBA 3ETDA 5LLSA 4QGHA 3V55A 3CLTD 2VJDA 3FN4A 4J2OA 4QTYA 2JFQA 4XRGA 3H17A 2PGAA 3GRRA 3EIOA 3FAKA 3OQ6A 1V8DA 2Q07A 4IO0A 5I9BA 1ZESA 3EXHB 5JWHA 3RHSA 1DIAA 2B99A 2BVNA 5BWMA 3CF2A 1ZX1A 3PZRA 3QF4A 2D2IA 3U7HB 1LS1A 3G7UA 3NVAA 3SICE 2C5FA 2OBNA 4PIVA 1IXSB 1AZWA 3WGZA 4RTSA 3TKAA 3ELYA 4RQAA 3H8VA 1ZC4A 5F51A 1I36A 1VE1A 5K7SA 1BXKA 1DRWA 4ZAFA 2QN7A 5C9ZA 3KQKA 1C41A 3QG5A 4B09A 2O2DA 1G8HA 2O5EA 2HO4A 2RKOA 4RU1A 4QOHA 2R1TA 3U26A 3PWKA 4LJ8A 2EFGA 3FOCA 1KTIA 2CF6A 4GOLD 3HH8A 3AERA 8ATCA 3KU1A 2FW7A 2P5TB 4FWTA 1QPGA 3KWFA 1HC7A 1C0KA 2H3HA 3F74A 4KZPA 2XXJA 4HH3C 3U17A 5EZ6B 2VJMA 2IHYA 2O2GA 2XQKA 3W79A 1V11B 3S2ZA 4CMIA 4RKWA 3OP4A 4XIJA 5TC4A 1RHMA 5HEKA 4JJGA 4IPTA 1N3YA 2WR8A 4GM4A 4HTFA 1A9SA 2FOIA 5AHOA 1CLUA 4WZAE 3L43A 3GX1A 3FF4A 3OIDA 1WQ1R 2QNRA 2EBHX 1LPAB 3MPUA 5I4IA 3AY7A 4FE7A 4YFYA 4DB2A 2F3PA 2NO0A 2XVZA 5F5NA 2CXRA 3TBKA 5A4FS 1O0SA 1NVFA 5SZHB 1M1NB 1U1CA 2IWHA 1VG1A 4WINA 4CMJA 3LDAA 2O14A 4BLRA 4NMHA 5D1HA 3UT0A 3T1VA 4KPUA 2ZB7A 4ZYUA 1XQYA 2IPLA 2QGZA 1M2OB 4C7OA 2J5RA 3E15A 4RNCA 3TDKA 3C98A 3VNRA 3THYB 5A0VA 1FZTA 1Z4JA 1GAWA 4GHWA 2P4HX 4H1WA 4MCHA 4YUYA 3UUGA 2PKWA 2B1IA 1KQ3A 3AXTA 2F7SA 2Q3FA 2R68A 5ILQA 4D1YA 2B7LA 4MI1A 1E8MA 3P9IA 4TWZA 1E9EA 2AEJA 3F6CA 1S2MA 2O57A 2ZSHA 3FVVA 1TVEA 3KTAB 5BUQA 3V9PA 3BMQA 4F4IA 5KOJB 1ODCA 2FUKA 2GK6A 1WKBA 4P3NA 3LGAA 2YBEA 3VTZA 2IEBA 2I91A 2BI4A 5A9SB 4IQFA 2Q9CA 1CDZA 4FYYA 4QBFA 3OETA 2IQ5A 5KNCA 1XVTA 4L28A 4IMIB 5EMNA 3H84A 4DM7A 5CT9A 1JPVA 1AMNA 3OIFA 4ROSA 4BGVA 2YXPX 3ZBTA 4WH0A 4EYQA 1H8HD 2EL9A 2WB2A 2W5UA 3ZDXB 1RYNA 3C15C 3IEXA 2NTYC 4X45A 4ZI7B 4RLSA 2QTAA 1MXHA 3VOBA 4YRNA 5TE9A 4PNEA 4ZOLF 1R6XA 1W5BA 3FPJA 3HLYA 3LOUA 3ISTA 4D57A 2NAPA 4DDHA 4E1BA 1BX0A 3H5WA 4IVPA 1RBYA 2CE2X 2QXYA 2ZANA 3G02A 3M82A 2ZVDA 3NZEA 4FQ8A 3U3KA 1X13A 3NHJA 4F2GA 4NHEA 1PEYA 1O4VA 1LC3A 2JBHA 2TMKA 3VKHA 2AZ4A 3AP3A 3FD8A 3O8RA 4B74A 4XTCS 2OC9A 3TQHA 2XNJA 2FPXA 4G2NA 2ZYWX 3AHEA 3ZXUB 4EI2A 2FAXA 4A92A 3KUKA 2ZTLA 1C3XA 4NBNA 4OY3A 1CB7A 3FI9A 4HNVA 3A8TA 1E79D 4XYLA 1UBFA 1VPDA 4K6CA 2XMGA 4MJXA 1XALA 4EG6A 1GSAA 2XOKA 3SDBA 3L4BA 3EMBA 3WIBA 4M76B 1XNHA 5IJ0A 3V9AA 2YZGA 1CFJA 3GY0A 3BXEA 5EHGA 1NXSA 3JATB 3FSEA 2QR3A 5FO1A 5HQ3B 4TS4A 4DR1B 5EHNA 2X0JA 2WZQA 1QVZA 3NXKA 4WNCA 1TAQA 4Y6RA 3PDIB 1J24A 2IYXA 4BMYA 2ZCUA 2AI3A 2R2AA 2Y99A 3HB9A 1UWLA 3EE6A 2C9BA 2H1IA 2C31A 3GOQA 4N8SA 3R5SA 4BFLA 5LPNA 3RT7A 4W5NA 2PX2A 3BJIC 2JFXA 3CH5A 1DC7A 2AXPA 2CLOB 4YV0A 3CLSC 5HYVA 1GPBA 1MPTA 2JGFA 1RI1A 5F5XA 4B6FA 2PUDA 1NWHA 2F17A 4QYMA 5K3SA 2V7QD 1YXMA 4Q93A 4U7PB 4JNKA 1HFEL 4XWOA 3IQZA 1VM6A 1UR5A 3DTTA 3R6GA 2NVWA 3R4CA 3UMJA 3LO8A 3ESBA 2QRVB 4NP6A 2XVYA 4EB8A 3F3KA 2OQRA 1EWRA 1GITA 1QMPA 1XVLA 3PFWO 3O7WA 3W0LB 5ESDA 1H1LB 1ZZEA 4MKFA 3GGSA 4MMZB 4RDCA 4TXJA 1DIGA 2PBLA 3ANTA 1W8IA 2VNJA 1D03A 1VL1A 2MIIA 2B6NA 1V3QE 1VYVA 5J4KA 2C4VA 3LKZA 4YA6A 4CQJA 5JRDS 3E8SA 1KAHA 2FUCA 1YJQA 1WTAA 2GD1O 4DDVA 5JYDA 3AF1A 1DFIA 5ICCA 2BEJA 3G0GA 4GXNA 4EABA 2IGBA 4CM5A 2H17A 1U7PA 2VBGA 1Q92A 1SA0A 2GZDA 3VU1A 1L4NA 1Y4UA 2YXBA 3NBZC 5EHQA 1UDWA 3HCAA 2EWWA 1OUMA 1EFDN 3TE7A 3M1LA 3PHIA 2Q46A 1OZHA 4LYJA 1W4BA 4ND4A 5AQ1A 4LRSB 3W4IA 1JH9A 1PIWA 5C8XA 3L8ZA 2YJGA 3S2IA 1D09A 3JYLA 2Y67A 1SN7A 4ZKEA 3SFVA 3GEMA 3GLFA 4QFMA 2AS0A 3QU7A 5JMPA 5JZMA 1ZGAA 4B3XA 4QQ8A 4HBZA 4B6OA 3DBLB 1OTHA 4OOFA 4UOZA 5IXYA 2IEZA 1I1NA 2ZS9A 3NTOA 4RA9B 1XELA 1B73A 3FWPA 4D45A 3F73A 4ZU6X 5TARA 3QVKA 5HF6A 5BMVB 1Q7TA 4MYSA 3PFNA 3U5TA 2WFMA 3QMWA 4BEJA 4XRRA 4YRGA 2Y1CA 4EA8A 4Z54A 2IZ5A 2EFDB 1G8FA 1RLOA 2J5XA 1UKAA 4RBNA 2JLAA 2VJCA 5JDIA 4D8TA 3K0HA 5HWSA 3ZZUA 3E9DA 5IYZA 4GX2A 2A92A 4LC1A 4R0NA 4CEJA 1XTBA 5KTPA 5AUOB 1Q7RA 4FPXA 3I23A 4MOWA 1IN1A 1CNMA 3I6BA 4JB2A 4BAUA 1BHSA 1IG0A 1AHHA 3QFSA 3GJYA 2OHIA 5IH3A 3VYTB 1E7MA 1J21A 3AB3A 3EZ7A 4M6WB 5AW7A 5ALGA 1H9AA 1ZCAA 1ZPDA 5I7SA 1JG2A 1YMVA 3IP5A 4RHCA 3WL8A 4MYHA 1LBTA 3G1UA 3LY8A 3OM1A 4EHHA 4OYHA 4EUFA 4LVNA 4LGCA 2WRZA 1E3SA 2H4XA 4MPTA 6CHYA 3PTZA 2X42A 1T34A 2GB4A 1SHLA 4WECA 3BXGA 3B9BA 4L8WB 3WDSA 2F3TA 1EUYA 4GLLA 4F8EA 4C4AA 2C96A 2YMQA 1QGUB 4DLXA 2CNWD 2RKBA 2VP4A 3PF9A 1HORA 2AOTB 2HZ7A 1KOLA 3H3JA 2UYCA 4M9RA 1KJ8A 1FMFA 4HSEA 4BOYA 1C1XB 2V6IA 3KQVA 4LCBA 1U2SA 2XRMA 3NGMA 3EFEA 3HB4X 5K1ZA 4PU0A 3HFSA 1WSBA 5EMJA 5KDOA 1DOHA 2W2QA 5A3SA 3V4VB 2LBPA 5AJYA 1XBTA 3LP8A 3PXEA 3O2QB 4US1R 4I6EA 3V6LA 3B85A 3ORYA 1SMKA 4ZOQI 2YXLA 4PGMA 4YACA 3QBEA 5LWHA 4NYJQ 1KBQA 1YBFA 2HA4A 3VR4H 3QI7A 2FPKA 1U1IA 4ZQGA 3OAAD 3DKVA 4KLZA 3I2HA 4CM9D 3DTNA 3M5CA 5KHLB 4KRYA 1SZPA 2QN9A 1CP3A 1LDGA 1SKMA 3P94A 1KVRA 1QFJA 3BTSA 1TD1A 2XRYA 4C22A 4MPDA 1MOSA 2YJ3A 4LE1A 1XD9A 4DGQA 4WY8A 3P5SA 2OO5C 1QCDA 4EA9A 4XVUA 1EQAA 5DDIP 4A6EA 1E60A 1O89A 2N75A 1UIRA 1WP9A 2WQZA 3RYFB 5IH7A 2C7BA 1U98A 3TLGB 4F4DA 2FSFA 4QTTB 1NE7A 1UFVA 4F38A 1BXZA 1J8MF 3DLHA 2IDMA 4F12A 4PVCA 4JT2A 2L69A 2WTMA 3M33A 4CUJA 4DWOA 1C81A 1JBQA 4ZVPA 5IU6A 3F6PA 1XI2A 4CL8A 2QU7A 3I5UA 4ZVTA 1Q83A 1P1RA 3R8FA 2ECQA 3G2KA 3MMPA 5CT5A 2Q7OE 2C7VA 3OLXA 1U0GA 2NT4A 3D1LA 5L45A 3FPFA 1YDGA 3ZW7A 1AQIA 2PV7A 1U3CA 2H11A 2W0MA 4WOBA 4B6PA 3JD2A 3L8MA 1G19A 2C2OA 1YR1A 2XJ4A 4RMHA 3DHEA 4ZDIA 1JB1A 2YJ4A 5LJLA 5EOVA 2CHQA 5ESRA 1OAKA 5H0IA 1IQPA 3QE4A 1APBA 1ZICA 4OAPA 1S96A 1XEWY 2YVUA 1QYWA 1EFVA 3MTQA 5F9HA 4LYEA 2FXIA 4UUQA 1YIAA 1JHRA 3OTQA 4M55A 5FI0B 1COWD 2H65A 3GFSA 4HGNA 2YWGA 3CF4A 1M8PA 1VPVA 2HU2A 3GUZA 2BCEA 3LOQA 5GM1A 5KYUB 4MICA 3BMNA 2VRBA 2IYOA 3DE5X 1Z7WA 3INRA 4WFQA 3QF4B 2XUGA 3QZUA 3ETHA 5KNDA 1P7YA 1VLJA 2JFWA 4JBHA 1THZA 4GM0A 1C7ZA 1R37A 1V5IA 3A9WA 4QQNA 3C24A 4U7GA 1WQ3A 2DLNA 1RIFA 4DDTA 4XYMA 1DCTA 2B4TO 1GPMA 2JFPA 4FINA 2GKGA 4I4NA 3D3WB 2REBA 3FOWA 3P2IA 1FX0B 2YHIB 5AQEA 5KMGB 5J4HA 1GYPA 4OOEA 4DIUA 3QM1A 1BVHA 4D46A 3LRPA 4I81A 4K9PA 3KXKA 4UUOA 2Z43A 4EVSA 3A37A 1QF9A 4Q9LA 2PH3A 2GF9A 3L0IB 2CXXA 3H1GA 2Z8ZA 4ZEXA 4ZAYA 2JKZA 2FSPA 3D5QA 4YQEA 3LHFA 2XUZA 1XDSA 5HSGA 4QWMA 1JQKA 1G3IA 3BGSA 3I4FA 1CS0B 1HFWA 1VL5A 1P45A 1VL8A 2HF7A 3I2GA 4Q9IA 3SKVA 4XSGA 2QRKA 2YZMA 1P44A 5REQA 1T8RA 3EWSA 3KLPX 3AJAA 4LHZA 5H70A 1Q7EA 4P83A 3FHTA 3LLMA 3I2JA 5L40A 3N0XA 4RW0A 1WJGA 3TZ6A 5E1OA 3MEQA 3MQ2A 4PQRA 1N5OX 1SKBA 3OBIA 1E32A 4E13A 3WWDA 3KHKA 2WT8A 4DRYA 5BUCA 2WAOA 4H35A 2A1TS 3FMOB 4P9NA 4ZO4A 1OC2A 1P5RA 1EAYA 3DZBA 4B83A 4FYKA 3LVRE 4JJ6A 4MEJA 1D6JA 2X5NA 1VDMA 1Q2UA 1BU8A 2VDLB 4LXTA 3SEQA 1R9JA 1U31A 1PJAA 4P7BA 4XB6B 3F4LA 5J2UA 5FBLB 3UGQA 2P3LA 3RLIA 1ULUA 1ZO8A 2M1XA 5JH7B 2DEUA 4P0PB 3LVBA 2HBRA 4NECA 3GMSA 3G8BA 1K63A 5CCDA 4DV4B 4LV6A 4NHOA 1ZEJA 1T5LA 2X0IA 4H7DA 4R2LA 4P34A 1A8QA 1P9WA 1VHQA 2Q1UA 3G7SA 2Y6UA 4YFVA 3UFXA 2N47A 3NDJA 2YV1A 1YB7A 2G7ZA 8LDHA 4FR0A 2QTCA 2XNHA 4BMZA 4HXGA 4HDNB 3TLBA 4JSRA 3F7OA 3LUGA 2EERA 1YNOA 1OX4A 4URWR 3E3NA 2I33A 4L2IA 1W9MA 3GDGA 4AJ4A 3GV0A 3QLJA 1C8LA 3FUXA 4MUYA 4U7JA 4KB5A 3MWDA 3P2KA 3HCBA 3R7AA 5E8RA 1RM0A 4J1TA 4GKKB 2CDNA 2AOVA 1MAWA 3G89A 3MYRA 3Q7TA 4KW7A 1JB9A 3X1DA 3PJDA 4KGXA 4UXIA 3U3JA 1YZYA 2IV3A 3PXDA 4AMUA 2DHDA 1NW5A 2PSJA 1W2GA 1JU4A 3CSDA 1FYDA 1YCHA 3NHBA 4CM3A 3WHLA 5JEEA 3CONA 3UA4A 1QP4A 5D5PA 2A8YA 2CHGA 2PMBA 3ZEIA 1XZLA 4BCCA 1M6YA 4E94A 5CDFE 1PCXA 2QG6A 5FQOA 1SURA 1TQ4A 4JASB 1XPJA 4D8YA 4AB1A 3PLRA 5KX5F 2QRLA 4ETNA 3GUHA 1UFRA 4B6EA 5ECWA 3R7LA 4EHLA 3EZFA 1T1RA 3MGCA 3OHMA 3FGOA 4Z9AA 2DVMA 3EB9A 1KE1A 4X41A 3B2QA 3LUHA 3MTAA 4Z86A 3HJCA 3ITNA 1I6WA 4NAUA 2VDNB 4U2EA 4PZ9A 1RHQA 2JFZA 2G1PA 1PFWA 3V1TC 3BQMB 5IARA 2V0GA 1E6MA 3A2MA 2JIZD 3BFPA 3BG5A 1K8ZB 2AOTA 3FUCA 4N5MA 5CUQA 2Y1EA 2IEYA 2WLSA 4N6NA 1FLDA 2B6HA 5C0OE 1OFHA 2Z2KA 1GUFA 1OMOA 2VVTA 2XSZD 3N0VA 1TD9A 1V6AA 2AFHB 2Y76A 3AKDA 5ER6A 2HPAA 1CQWA 1XDUA 4TN1A 1ICEA 4UMDA 1N9GA 4OX9Y 3ETGA 2HLNA 3F3SA 2IPXA 5KJEA 3PDJA 3CE6A 2X9VA 4FEEA 3NB0A 2Y0EA 1T4BA 3GFPA 4K9KA 5F33A 5FR1A 2GCGA 3VPBA 2GUWA 5EP1A 3VAYA 3EQ2A 1IUNA 1LZLA 3B2EA 2RB5A 1X80B 4BFUA 4IDHA 3D6TB 1KEZA 4C29A 4EUNA 2CCJA 2QMQA 1GTZA 2W4MA 1IXRC 3QF7A 2IS6A 4EG8A 3UWKA 1W4ZA 2G6BA 1Q7GA 4J0HA 4EM6A 3UA3A 1KSFX 2R6AA 3AO0B 4X7PA 1XZPA 2PKRA 1E58A 2I4TA 1XEAA 3TPCA 1ECGA 1O96A 4PLWA 5I9MA 1HLGA 2C1ZA 3OFVA 3RU9A 1P0FA 4ZZIA 1H8EA 2R8RA 5GJVC 3S7ZA 1HQYE 5M29A 1BDIA 4F72A 4AQYB 4OXRA 2G4CA 1K89A 5H80A 3KKLA 3TRDA 4UHEA 2FR1A 2NO4A 2K2QB 3L7OA 2JLCA 2J3LA 3HKBB 3PNYA 1JKJB 4ZI3A 3G7NA 1WLYA 4QOJA 1OJ7A 1V9LA 2KLHA 3BDAA 3DAYA 4V39A 3OKPA 1XZEA 3FSGA 2W2TA 1Z33A 4YRCA 2O5VA 1KJQA 4ESOA 3JWHA 3RF7A 1W5FA 4R1PA 1RM3A 1T0IA 1E1DA 2B9VA 3CLUD 3STTA 3KKQA 3ZWYA 3FCOA 2ON6A 3D1VA 2BGLA 3T7SA 3U7IA 4Z9XA 1B2RA 3AIIA 1QM5A 1GDHA 4XQ0A 5FEUA 2R4TA 1MX9A 4YQZA 1SXJE 4BQIA 5JZ9A 4Q39A 4INPA 2LDXA 3MGGA 2C5AA 4LRQA 4TT3A 5AW0A 2G72A 3DVAA 1WXGA 1Z8FA 4AYXA 2C2MA 4U4AA 4I36A 5FLYA 5I45A 4MI3A 4RTMA 2H51A 1EAMA 1TNDA 2XBUA 1T9GS 5JCZA 1ZD2P 1EINA 2WHPB 3VC7A 2AR0A 1M2FA 2Y92A 4RL4A 4Y1RA 4DCVA 1TEHA 3NASA 3VSBA 2IA5A 5C53B 4B1FA 2ECOA 3GCXA 3BXPA 1J70A 1JLHA 1MHPA 2HA3A 4MW2A 1U5BB 2AFRA 2X4DA 1TTTA 1GRNA 2DFVA 2REQB 3OQIB 3EXHC 4QGAA 3O4VA 1J8QA 1G16A 4ZI5A 2C03A 2DCUA 1MX3A 2CYAA 2GN8A 3IBGA 5KOHA 1FX0A 2IZOA 4KX5A 4PGAA 5KMGA 5LYJA 4P54A 4I4LA 3MIZA 4BVJA 4X66B 1BHO1 1DL5A 2JH3A 2D06A 1J5PA 2R7KA 3GWGA 1FDTA 2HWKA 3RAPR 3ONFA 1W5SA 3ZWKA 2N0SA 1ZNYA 2IS2A 2J48A 4M0DA 4LHYA 3RBXA 1VKOA 3GCZA 2LCQA 1NSYA 3LPCA 1SM4A 3V4PB 3KYDB 4H7IA 2X0FA 3DEFA 2X2FA 5REQB 2O19A 1I13A 1IIBA 1RACA 4IV5A 4J7UA 4O4LA 3ODGA 1YRLA 2DM6A 3EY4A 3JQAD 4JKOA 4KXNA 4QD3A 5THKA 3QELB 4XM2A 2EFYA 3R8XA 4YAGA 2HBQA 2VYVA 4NF2A 4FGZA 3DZ8A 1A8SA 3Q3JB 4HDQB 4C2TA 2QI9F 4R40A 3PNMA 1QIMA 3KKPA 1E7SA 4PZLA 5JI3E 4ZOAA 1FTWA 3E22B 4DDKA 4BJ5A 4G07A 4MQUA 2YVQA 3UOGA 3ZLUA 3ND7A 4DJAA 2O05A 2ZREA 5FTMA 4BNDA 4ZPXA 2RC6A 2ZUTA 4O2BA 1U7OA 5ALFA 5E8JA 4OD0A 1CP2A 2NN3C 1IJKA 1TL7C 1X1QA 1W87A 1HYEA 1ZA2A 1USGA 2G9RA 5KKCA 2G6TA 4N6OA 3UAYA 1EFUA 3OFKA 1UBOS 1VRVA 1IN7A 3UY4A 3K4HA 4PXYA 2EU8A 4HEJA 2CV0A 1UT8A 4K1XA 5FFFA 4C3VA 2I2FA 2G5PA 3QQPA 5KTRA 2ZG6A 3N2KA 3ND5A 2I6TA 4O1MA 2CXHA 1VIAA 3D4IA 1ZN7A 2HV9A 3WV5A 5IULC 1B0ZA 2IXAA 3STVA 2ZBRA 1YA4A 3RSLA 1R0XA 4B76A 4O4HA 5KSOA 1TU0A 3RBAA 2JI6A 1ZJ6A 2B30A 2YZNA 3BA6A 4JBWA 4RPJA 1W59A 2IYTA 3AIOA 5FA5A 5PGMA 4NPHA 5IUJC 5ELXA 1LRJA 1DIBA 1OF1A 1K27A 4YIKA 1NLMA 4YK7A 2VQDA 1V48A 2ZRBA 3D3QA 4ARBA 4JQCA 1ADFA 1DQRA 1MVNA 3T0FA 1KEEA 3CISA 2FSIA 3SN6A 4BUJA 3U44B 5I47A 2DBRA 2I2AA 2W4QA