4LYYA

Crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
179
structure length
171
Chain Sequence
YFQSMKHTTEVMITAEEIDQKLDILAEQINAHYADSDRLLMVGLLKGSVVFMADLCRRIKGHVEIDFMSVSSRDVKILKDVQSEIQGRDVLIVEDLIDSGNTLNKVRDMLLLREPKSLALCTLLDKPERREVDVPVDFIGFTIPDEFIVGYGIDYAEQYRNLPYIAKVVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine phosphoribosyltransferase
publication title Crystal structure of hypoxanthine phosphoribosyltransferase from Shewanella pealeana ATCC 700345, NYSGRC Target 029677.
rcsb
source organism Shewanella pealeana
molecule tags Transferase
total genus 47
structure length 171
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lyyA00
2VFAA 3GGJA 3N2LA 5EUCA 1G9TA 1DKRA 1UPFA 4RABA 1XZ8A 1V9SA 1BD3A 4F8EA 4WN3A 3MJDA 1MZVA 4P83A 4RQBA 1ECFA 4RADA 2PS1A 4RANA 1PZMA 1HGXA 2E55A 1ZN7A 1CJBA 3OZGA 1P19A 1ECBA 1P4AA 4WMLA 4PAWA 1YFZA 4LZNA 1QCDA 4QYIB 1XTTA 1NONA 1OPRA 1TC2A 1XTVA 3G6WA 1GPH1 3LPNA 5E38A 2P1ZA 4RAQA 1G2PA 2DY0A 2WNSA 1O57A 3H83A 1BZYA 4KN6A 4M0UA 4OHCA 4RHXA 4RHYA 1ECGA 2EHJA 2H07A 1I14A 1A97A 1BD4A 4RHUA 4M0KA 4X45A 4IJQA 4JITA 1OROA 1QK4A 1I5EA 2JKYA 3O7MA 5KAPA 1FSGA 4P80A 2PRYA 1XTUA 5K51A 2JKZA 1DQNA 4TWBA 4ZFNA 4RHTA 1JLSA 3GEPA 1A96A 1HMPA 2C4KA 3M3HA 4M0PA 5ESWA 3OHPA 5ESXA 1ECCA 1Z7GA 4RACA 4JLSA 4P84A 5JV5A 1L1RA 2HCRA 1A4XA 1R3UA 1VDMA 1O5OA 1XZNA 4S2UA 3ACCA 1VSTA 2JI4A 1IBSA 1A3CA 1I0LA 2FXVA 2YZKA 1NULA 1VCHA 1GRVA 1Y0BA 3S5JA 1DQPA 2PRZA 4QYIA 3DMPA 1J7JA 1QB7A 3EFHA 4RQAA 1STOA 1U9ZA 5BQPA 1W30A 1WD5A 2GEBA 1JLRA 1A98A 3QW4B 4LYYA 1UFRA 5BQOA 4P86A 4P82A 4LZOA 1QB8A 3DAHA 4QRIA 1TC1A 1QCCA 1AO0A 5IAOA 1P18A 1P17A 1I13A 1LH0A 1ZN8A 4Z1OA 3ACBA 1QK3A 2H06A 4P81A 3MBIA 1DKUA 2AEEA 5BSKA 5IPFA 3LRTA 4FYMA 1ECJA 1QK5A 1UPUA 2XBUA 4RAOA 3GGCA 1OREA 2JBHA 1L1QA 1D6NA 4P3KA 5BRNA 3DEZA 5HKLA 3HVUA 4MB6A 1G2QA 1ZN9A 3KB8A 3NAGA 4LYGA 1G9SA 5KAMA 1I0IA 5HIAA 1A95A 5JSQA 2H08A 3OZFA 4X44A 1DBRA 4RV4A 3ACDA 4PFQA 1U9YA 2IGBA 4LZAA
chains in the Genus database with same CATH superfamily
1NOKA 2ZR9A 1P0CA 4WA8A 3P4YA 4MMXB 5DHPA 4EYEA 1G20A 1BSVA 1NBMA 3OPQA 2FU5C 3GA0A 4FFDA 4TS1A 4AIIA 3PNBA 3AIIA 3I92A 5AI4A 5LJLA 4HYEA 2C03A 4WUTA 2OHGA 4O2BF 1PHPA 5JXGA 3D6NB 2I91A 3IXQA 4Z9YA 3MBOA 1SD5A 3RT1A 5AVKA 2OQIA 3UNXA 1DP4A 3E8MA 4H7IA 4HZIA 1KK2A 3MGCA 2V54A 3LQ1A 3FUUA 4DA4A 4OREX 2WPNA 3STXA 2DQYA 3CFYA 5K8LA 1CUVA 1NVAA 2EJVA 1OJLA 4L22A 1C5KA 3CG0A 4KITB 3DTVA 1W5SA 5E3IA 1N5RA 1R4ZA 2V4UA 3ZV5A 4MQEA 4G36A 3SC2A 4UNNA 2W2KA 2VR1A 5FBRB 3WLSA 2Y27A 3ZG6A 3NI2A 3ZE7A 1P74A 1RMYA 1IUNA 2FOIA 2PCJA 5F23A 2IEBA 4W9NA 4OUDA 5GIOE 2YKGA 3KLOA 3CBGA 3PD7A 1SC6A 1XTQA 5KWEA 4UCFA 1GSOA 1U81A 5E6SB 2HMVA 3BE6A 3VVCA 1X9HA 4QPJC 1E64A 4C0WA 4DM7A 1GPKA 5JYDA 2PUFA 2ZYTX 4I66A 2GFQA 1DXHA 4P80A 3UQZA 5ED4A 3S2EA 4K9LA 1J5PA 2O0JA 2PZAA 3GEBA 4OKNA 2C4KA 4NQZA 1Y8QB 1ZMTA 4OM7A 2D5IA 5G0TA 3T7JA 2R5NA 3D8HA 1DKPA 3TQIA 2AX3A 4CEIA 3F96A 4X00A 1E5VA 4XWTA 2WJ3A 1NW3A 5EXTA 2XHEA 1R3UA 4UNPA 2D1RA 2ZWOA 4TTVA 5DE3A 3L7OA 2XH8A 3DAPA 3JD4A 5F9MA 4F7DA 3SOPA 2Q7DA 1JXAA 4JODA 3U31A 1UBSB 2CEAA 5BW5A 2QMUA 3GA7A 4E21A 2XKKA 2I6TA 3I45A 1QP0A 1KQ3A 4QDOA 2R5FA 1H2BA 1YOVA 3GRFA 1T9AA 3QFRA 1STOA 2PUEA 1ZUWA 4Y1RB 1T3LA 3HY6A 5CTAA 4JOCA 2HWYA 2O57A 1XNGA 1E1YA 3UJ3X 5AHKA 2FUNB 4LKRA 3L18A 5H3HA 4PICA 4B6RA 3UBTA 4LN1A 5DTMA 3FOFC 1P18A 1UAYA 4GLOA 1RAGA 3P71T 3GYBA 4KIJA 5IUNC 1MB2A 1JKXA 3VMFA 2VDLB 4C4SA 1YAHA 2R62A 4OATA 1C7IA 4LMRA 2NU9A 1UDRA 3KZMA 2NXEA 4KQMA 1Y7PA 3PX7A 4HX9A 2NO6A 1F5NA 1J2JA 1R9NA 1IQUA 1ZSVA 2JIZD 1T5OA 2PRSA 3B6EA 4NBUA 3D8BA 3AYXB 4C21A 4CCYB 4FB5A 4Q24A 1TIKA 2BN4A 2VWPA 4C07A 1A9ZA 1XCGB 1CR0A 1DOAA 1XLTA 2C4TA 1KJWA 3AUSA 3AR9A 3KOZA 4Y6PA 1EUDB 3KAJA 1EZ1A 3IP9A 2BBWA 3QUCA 1PZNA 4HRVA 3D4LA 4JNKA 3KSAC 5BMVA 3GFQA 3JVUA 4R51A 1NFQA 5CVVA 1EX9A 4S24A 3S1AA 5BR1A 3VNVA 4MQ5A 1ONSA 1TFUA 3IJ5A 3S2SA 2JJ8A 4R31A 3DEYX 2CGEA 2MJLA 1OFHA 4RVGA 1XMQB 3N5CA 3MZ0A 4B7XA 5JSFA 1KI2A 2X7HA 4DANA 3B3AA 3RS7A 3G8CA 4D8WA 2DWCA 1LDEA 1CV2A 1J5XA 1UK8A 5BSFA 3W7BA 4NEGA 1W34A 2OBNA 4XWAA 1Z06A 3WICA 1UF9A 1GNLA 2GZRA 1Z5OA 1HM5A 3GLTA 5AJTA 5JD4A 1VL5A 3GDFA 3NBUA 3OTQA 4QPDA 4RDCA 4J0EA 2WU3A 2LIPA 2EX4A 1HYBA 3L1JA 2ZTVA 4FU0A 4GFDA 3CLHA 2OCBA 5AKJA 1TEZA 2PYDA 2WHEA 4V0MA 4INOA 1JSRA 3EGCA 3A1DA 4DC9A 3ODGA 3CH6A 1CW2B 4JI6B 4MYSA 1LLCA 4G63A 2D54A 2ZWIA 4FDAA 4PO9A 5BSUA 2ZM5A 3A10A 5I7RA 3OVMA 1A97A 1S5PA 1POWA 4IKPA 4E2FA 3DMTC 4PQEA 3U7HB 2DETA 4P2BA 3P9ZA 4PO8A 4F6CA 3DBOB 4Z4GA 3VPSA 2IYNA 2VJLA 1RYZA 1AY0A 5IJAA 1CQJB 1Z2NX 3PTZA 3ADPA 3OTHA 4JUIA 2XCQA 1JDPA 1WZIA 3L3BA 2G17A 3RVOA 1GTMA 4BUCA 4CQMB 5CIYA 3KQKA 1IWOA 4XRRA 5D01A 2PKRA 1BWRA 3BMCB 4M0PA 1J2YA 3CEJA 1UWKA 3G2PA 2PKYX 4KN8A 3VKWA 5C32A 1Q0SA 3MXTA 1ADJA 1SIOA 1I2MA 2VTDA 3SEZA 2ZM6B 2UUAB 3LYHA 2IIPA 3OTIA 4XQCA 5CB4B 1BJTA 3IBCA 4B0PA 1XN4A 3GVHA 3VPXA 5LLTA 4UEOA 3H84A 4JI5B 5HK8A 1Q1AA 4FJ0A 5K01A 5ALOA 4MVWA 1W5AA 1I2DA 2FQWA 3VDMA 1YQXA 3MUFA 5IVPA 4MB2A 5JJLA 2C4UA 3AP3A 3QPAA 4BU1A 2V0CA 4Z4CA 1ZI6A 3SEQA 1UJ2A 2J41A 2PSDA 3U0BA 1XPJA 4HJRA 2XD9A 3HKCA 4FN4A 4H4CA 4JUDX 3E58A 2VAWA 5AHXA 2GEBA 1JEDA 4RXUA 2DWOA 1SZCA 1R8SA 3E4DA 4OJQA 1T4GA 4WNIA 4ABTA 2OBMA 4CU5A 4WOBA 4DKXA 3IKMB 3B9BA 3VVBA 4NS1A 5K3DA 2X4GA 3BILA 1PVOA 2WM9B 4Z1OA 1W35A 5G1NA 3H16A 3G0HA 1DAMA 5JIBA 4QXAA 3THXA 2W6PA 5CVUA 3O8QA 4Q3KA 3UK1A 5TS3A 1MEOA 4FZRA 4MWOA 2BCGY 4N12A 4PCAA 3VO2A 1Z08A 1H8ED 3HADA 4G0NA 5AW5A 2QMYA 1K89A 1K6IA 2JIZA 3R5FA 3I5XA 5HVNA 3WG9A 1T91A 1U1CA 2ZLBA 3ITNA 3IV6A 3CEPB 3FWKA 1W76A 3KOUA 5DKFA 5C1DA 3N2NA 2Q6VA 3SM3A 1G9SA 5GV8A 3SG0A 1IBRA 3OUZA 5JY1A 2QM0A 2FYTA 4NATA 4YJFB 5T6BA 5IK2D 1PW5A 2Y9PB 1JDJA 2NO7A 1JW9B 1Y9ZA 4N5HX 3BZWA 1WSDA 1VLJA 2VWQA 4BS9A 4OX9Y 2XWQA 3I83A 3QJ5A 4M8LA 4BWFB 2WDPA 4EG4A 2YTZA 1OX6A 2EGUA 4UCQA 3ZS8A 3T9FA 5IKEA 5FPSA 1AOXA 3EC1A 4MWBA 4AO7A 2B4AA 1OBHA 1IWBB 4JI1B 1KNQA 5KOHA 1V7QA 1L4FA 2F1JA 4YMHA 4BLQA 4DFDA 5EJEA 1E9BA 1YFJA 1A0OA 4V0QA 3K9GA 1Q15A 2D4HA 4L0QA 4YUVA 5TSDA 1N3IA 1L3BA 1U8TA 1NM5C 4EUKA 4YPOA 1QO9A 4PZUA 1QV6A 3UCXA 3C4QA 1EAYA 4DA0A 2PFGA 3DE2X 1BW9B 1Y4SA 3KVVA 4NP6A 5AOVA 4FCCA 5HRCA 2HMTA 1PGQA 3HSYA 3OP1A 4G5SA 4OBBA 4KXYA 4RHUA 3IUQA 3TZBA 2EKLA 4FI3F 5ED0A 1IXSB 3U4QB 2BGGA 3I4CA 3VH2A 4TLAA 3Q3IA 4GVXA 5BSRA 1XKTA 4WXMA 1DBIA 3KQSA 2Q0XA 3B2NA 1Z2OX 4FFWA 1OXKB 4AICA 4EUFA 5HWSA 5I9LA 5J23A 3WK4A 1K97A 1W85B 3GMIA 2JGFA 3TL2A 4H7DA 3HP4A 2IHVA 3ILYA 3O8NA 4LOHA 3RC2A 3DJYA 4V3BA 4WVLA 4P53A 2XVMA 5DWVA 4I55F 4Q66C 3RC9A 4IXMA 5F73A 5JBIA 2JGRA 5IN5A 2CE7A 2QSJA 4EHLA 4Z4HA 1NHWA 5L53A 3QFTA 2CD7A 2Z9DA 1P6XA 3JY6A 5AKYA 2EL9A 3R5HA 3SPXA 4NE9A 1MDBA 2KI5A 2PWPA 1GZ5A 2IEDA 4MULA 3I52A 3X1DA 4CMEA 2P2NA 2QT1A 1FYFA 1UBKS 5J4LA 1TZMA 4IIVA 2P9QA 3ZU2A 4LSZA 5L4SA 1NPDA 3TRFA 3MOGA 2GYVA 2O8FB 1CR1A 5ICEA 2R6GA 3P26A 2QQEA 4WNYA 3U3ZA 3KETA 2E3JA 2PZEA 2RJNA 4WZZA 1QOPB 2VPIA 2C96A 1M2WA 1YJBA 2CYAA 4M1TA 4LRUA 3Q11A 1YZQA 4B80A 1H8EA 4IV8A 2JDID 2PWZA 1JLKA 4DCJA 4KAXA 4YUWA 3P0RA 4S3MA 4YIKA 5JS8A 3CZRA 1W49A 1V37A 2RAPA 2XOXA 2ZKLA 3FYUA 3VISA 4CT0A 1U2GA 5A03A 4J0DA 3AVOA 4PYRA 1DAKA 1UWCA 4ERNA 3R1IA 3T0FA 1JTFA 3PQ7A 3IMGA 4WECA 4OLHA 2JJYA 4FZ3A 1DBQA 4PGAA 5IK2A 1SCUB 4QT4A 3FB1A 1YRHA 3U3XA 3QENA 4YV7A 3MQFA 3DBRB 5EL0A 1H4SA 1XVAA 1I3LA 3S99A 3U81A 1PTJA 1D1SA 4RV4A 5TQ2B 3ZBUA 3WAGA 1UBRS 4PFQA 5DOVA 1OSNA 3KTAB 4US1R 3GIDA 2II6A 2PD4A 3KK0A 4R0NA 4RTPA 2OO5C 1GITA 3ESXA 1LBIA 1SK9A 3IEPA 5IUJC 2WJYA 4Y6GB 4WBNF 3EFOB 3EVEA 1BE8A 2JFHA 4P92A 4YHHB 1QG4A 2BGKA 1K92A 1XZ8A 3BUSA 2X1MA 5EKXA 5LQUA 3B9PA 3N8IA 1B23P 3T5MA 4PS1A 1ZXBA 1ECFA 2RONA 1ZIDA 1E9FA 1YRAA 2DBZA 3Q3GE 4LJ9A 4RF3A 4BWVA 2V1UA 2BGUA 3O8DA 5FJJA 5H3CA 2O0MA 2FRDA 4ND8B 4NFSA 1D2HA 2DF8A 2QRVA 1VJCA 1PS9A 1THGA 4WKNA 4KTVE 1T2VA 2R65A 1RQGA 1JRLA 1FMCA 3GGPA 3DMYA 4BAGA 4EW6A 1E6MA 2EFJA 3CU5A 3AR5A 3AESA 5AQEA 3HJTA 3AR3A 5HFJA 5A9SB 1HLPA 4IX9A 2P79A 1Y80A 4CIWA 4W4TA 2DLCX 4KPEC 1F4PA 2HDOA 3QBDA 3WTCA 5CFPA 4R8SA 1BHSA 1FJXA 1VB5A 2ACWA 3FG9A 1HQKA 1C29B 4UM9B 2D06A 1ECGA 1JHDA 2WSLA 3ZTWA 4YRZA 5C8XA 4U2BA 4YGYA 1QHEA 2P2GA 3NIBA 4X66B 4HH0A 3BPSA 1E1MA 4EYQA 3QLVA 4MUGA 3DC7A 3EVBA 3G8YA 3K5HA 1SQ0A 3RBAA 3AM5A 2VYCA 2W37A 1RRVA 5H80A 2NAFA 4TWBA 3HKBB 5FUYA 4CGZA 2CMHA 1PFWA 3PR3A 2ZQZA 1AGNA 3IJPA 3LWNA 3DKVA 3QOFA 1IZ8A 4I1SA 4LXTA 5FTWA 3REGA 3S5UA 1QU3A 2D2FA 3NW9A 3R4CA 1H2AS 4H3KB 5KYTA 1QZTA 4RZIA 5B7NA 1SUAA 4BBPA 1DMSA 3U4GA 1HEUA 3HXOA 3BHMA 5AVXA 2EAUA 1L8OA 1L7RA 2A9PA 3SOZA 4S1TA 2IEYA 3OLYA 4DRYA 4UVHA 4ZQHA 3WGOA 1PWYE 5GONB 4DADA 4TQAA 4CDGA 2W7TA 3PVSA 4RD3A 1W5BA 2J6HA 4TTSA 1CJKC 5BR8B 4AYTA 1RAFA 1KEKA 5C46F 3WYDA 1X94A 2NGRA 1MAHA 3AF2A 2A30A 1DXQA 5F12A 4YWJA 4DXHA 4CM8A 3SGLA 1KY5A 3T4PA 5MDHA 5D3MA 1SOWA 3A27A 5CCBA 3I3SR 5FI1B 4C4YA 1SC3A 4PSUA 2ODNA 3DAGA 3WXBA 2YJTD 2K2WA 5JEDA 4DKJA 2ZR8A 2H18A 4HWRA 3AFOA 4OHOA 4NEHB 3RYTC 4JGBA 1M1UA 3S8MA 1BMFD 2OUKA 4X61A 2YOHA 3DKRA 1JJ7A 3KPUA 3RC7A 5CCXA 1MNQA 2P75A 3VSDA 3A31A 3C15C 1QE5A 1MAVA 2I7VA 4MO2A 1TM1E 4YJHB 5E1OA 5EWMB 3VSCA 3FFWA 3IEVA 1LDYA 3JQBA 1ZU4A 1KGSA 5IYZA 5KSYA 2JLCA 3TTWA 5ALWA 4U8HA 1Q6ZA 3Q8XB 1JDBB 4YDRA 1P7ZA 5CT4A 3RRXA 1NT4A 4F38A 4E5YA 3U62A 1JH8A 3FD8A 4RD2A 1H23A 3E1SA 4QGAA 2FEWB 4K6HA 2EJBA 2FPIB 4MNTA 4OQ4A 4TMXA 2XGMA 4W1PA 1GA4A 3VR1A 3K3PA 4MOWA 1FFCA 2BZSA 1ESCA 1ILWA 1JR2A 2ZRIA 3P9KA 4HWGA 1Y5IA 1SC4A 4PQYA 1POXA 1MTOA 1RE0A 2F3TA 2QN3A 5FOUA 4LECA 2OMEA 5EPUA 4RTMA 1SRRA 5LQCA 3KJNA 1KH2A 4V0LA 3FTFA 2A94A 4G97A 1TNDA 1XE3A 3IFSA 4J4BA 2QRPA 3WYBA 2JFQA 3KG2A 1JWAB 1DZIA 4G9EA 1N2CB 4R8VA 1HGXA 4FYKA 1AHPA 2IPOA 5J4HA 4ZAGA 3M33A 1DS6A 4RMGA 4WE3A 4LJYA 1LXCA 3H4IA 1UT5A 3U7FB 4XDHA 5JYBA 1JILA 3AHCA 4MI1A 4BQIA 1SBNE 2IY7A 3OY7A 4K2AA 4NV3A 4WCVA 2J7KA 2F55A 1HE8B 3AFHA 4FS8A 4BKRA 4BTVA 3EVDA 3LECA 3OBIA 2R6CA 4OQMA 2WDZA 4KIWA 4DVJA 1P33A 3HU3A 4L4YA 4LOKA 3KQLA 5ERYA 5TVKA 5JZSA 2HMAA 4XDZA 2LR0A 1EGMB 4QGSA 4GM0A 4MIYA 1GGFA 2PIDA 2WNSA 1ADCA 1T0PA 2HK7A 3LKZA 2JD0A 4OHCA 5DGTA 5KNBH 4CEHB 1ONOA 3ME5A 5DLQC 4BLPA 3FM9A 3EEIA 3AWDA 2O2CA 2GKSA 1GPLA 3H5WA 2O7SA 3H42B 3GPDG 4Q4HA 5IJZA 3C7KA 1N3LA 4KLAA 4C7OB 4DCNA 4FDVA 1UXIA 2XVYA 4N3GA 3SD7A 2K6GA 1SBZA 2C0PA 3L7BA 4RX1A 4Y7DA 3EX7C 4PG8A 5JVDA 5E2BA 3WLEA 4ZDIA 4LRSB 1SAYA 4K9QA 5C7LO 1B41A 1NG1A 2Q1UA 4L4XA 3O75A 4C7XA 3ESQA 4MS3A 2GCOB 3LV8A 3PRHA 2QT9A 3WYGA 2BKAA 4BRZA 1MJHA 3TW0A 3GJYA 1D9ZA 1LY1A 4G0OA 2WIJA 5HQ3A 4YCBA 4NYJQ 1BS2A 2BFFB 3L0ZA 4HRAA 2VZ9A 1EK0A 1GNVA 3L6BA 4P3OA 2HIAA 4QELA 4RJKA 4QXOA 4QX6A 4ARSA 4D96A 2HCTA 2DFLA 4ZV9A 3SE7A 1P2GA 4KB5A 2IH2A 3A1TA 2PKQO 5JNTA 4RSMA 2K4MA 1PV1A 3RREA 2OAP1 3R6WA 1IHYA 1BMFA 2FWNA 4PBSA 3U49A 5ADUS 3FJ1A 4M7RA 4NBRA 1RYDA 3FZNA 2H4YA 4B4DA 1P3JA 3LOUA 1G1AA 1VLVA 1TXGA 2ET6A 2IODA 3KSMA 4RELA 3KLMX 1Q91A 1QRAA 4EPTA 4UASA 4BO0A 3FGZA 3OCXA 2JFWA 4L8LA 4ZMBA 3V8VA 4HDSB 1SCDA 4NCJA 2ERCA 3AF0A 4D0SA 4QFCA 2W2QA 2VRWA 2C2MA 3H2BA 2B5OA 2RDMA 5HNKA 3U4AA 1K88A 2Z9CA 3RROA 2RHRA 3WYEA 2O1EA 3NORA 5MGNA 1DV1A 3EXG2 1U6KA 3HGMA 4XW2A 3VR2A 1XZIA 3P0FA 4MW0A 1OYOA 1JKJA 1Z2EA 4RZQA 3UJPA 3LQRA 1Y4UA 1C4OA 3LKVA 1A5SB 3HXPA 4NMHA 4CWAA 3K05A 5HIAA 5I4IA 2OGZA 3HFJA 1YONA 3ETCA 1TI7A 3PE3A 4KXLA 3EEYA 4PEVA 4N7RA 5CRIA 1DZ3A 1E5LA 2QA5A 2DY1A 2QP3A 2QRUA 3L0BA 3LY7A 4GYKA 4WCFC 1E2IA 1KQGA 1P44A 2BMFA 1V47A 5H02A 5BV1A 5F5LA 3RI3A 4Q1BA 1NPYA 4Y7CA 1EBUA 5IZ4A 2V7EA 4WN3A 5KS2A 2J4CA 2Z5LA 4DVGA 1X7WB 2XYRA 1Z18A 2WYHA 2Q2VA 2XVZA 1CUXA 2V58A 3PEFA 1CUEA 3OAAA 3A4YA 4HZUA 4Q7KA 3IQGX 3TLYA 3ZLTA 4B47A 3OZGA 2I1QA 1E3DA 1V26A 3E35A 1U02A 4TLDA 2Z30A 1J8MF 1EKXA 2FZWA 2ZSHA 1T1RA 4QYIB 1E0AA 1UQUA 2AW5A 1SA0A 1G3QA 5AM3A 4UAGA 5JE8A 4D56A 2C1EA 1V5GA 4AB1A 2J9FB 2X0RA 2PX0A 3LX5A 3FOWA 3FVQA 2PUWA 3H1EA 4WBXC 3USZA 1VP3A 3N2KB 1R6VA 1E32A 8ADHA 3ABQB 3FUTA 4ZJPA 2QW0X 1KAMA 4QE3A 4XB2A 2C58A 3AUTA 3RSZA 3UA3A 2RI1A 3TSCA 4BATA 1KDVA 2CXUA 4HH4A 2ZG6A 3EMKA 3GJ6A 3JQFA 3N70A 4RPLA 2XXAB 1KMMA 1ZUIA 3M82A 4JITA 2PRIA 3ND9A 3Q9LA 5AKHA 4ZOQI 4FKZA 2BP7B 4TT3D 4X94A 3VC3A 1F2TB 3OOSA 1AKWA 4N0MA 3T9EA 1FSGA 1I10A 2XE8A 8AT1A 4NCBA 1N32B 3DV9A 4EMSA 2YQZA 3HFGA 5DI3B 1U0JA 2QAJA 1P0FA 1E99A 3KB6A 4CYMA 1UKVY 3NRJA 4D6PA 1J9ZA 1NJGA 1Y6JA 3TMKA 4ZOAA 1U28A 1BEZA 4JXKA 4WAUA 1NQUA 2A9FA 1TD1A 1ZSYA 3K35A 1GRQA 3RFUA 3AINA 5FPHA 4E5KA 1PJ4A 1W8DA 1ZCAA 4TYNA 2ZYIA 2GX6A 1DC8A 1RADA 2ZJOA 3CO0S 4MRSA 2RH5A 4TL8A 5DNCA 2F9LA 5TX7A 2BI7A 4TT8A 2UDPA 1Y81A 1V1MB 3UAOA 1IJKA 3UPTA 1C3JA 2ZSAA 2XDQB 2WYIA 1PLLA 2Z1MA 2NUAA 2V7UA 4BKPA 2C7BA 4QULA 3FPEA 4MV4A 2JHCA 1P1HA 4R3UC 5IDYA 3MCWA 1PSDA 3I32A 1MLDA 1W30A 2AJ8A 3GN2A 2HCFA 3LIIA 3LY9A 4K2HA 1PL8A 4Q7MB 4P31A 3FCOA 1CNEA 1S9DA 4DW8A 3GEIA 1LI5A 4F85A 4ZJZA 3E2PA 2UUOA 1OAAA 3W2TA 4TOIA 4BJ3A 3EZ9A 4RV5A 4H7JA 1ZJYA 2QZ9A 5TVGA 3PRKE 5JSZB 4J7CA 3K30A 1QG2A 4I4TF 3GGDA 4BNYA 4BXOA 3R4VA 1XVIA 1FU7A 2OM2A 3E9ZA 4UKDA 3RVNA 3W6PA 2ECQA 2BFWA 4M54A 4FR2A 1LSOA 4G4IA 2H4WA 2P8JA 4HDRB 3KALA 4UU0A 2YY5A 4A03A 4FEEA 1WXGA 2GM3A 2RMKA 2ZRBA 2O2GA 4LBZA 2DBYA 2P4EA 2HU2A 3H18A 4YAWA 2ZUCA 3T3MB 2CSXA 3NC1C 2WD8A 4EEXA 1GQSA 4I1UA 2Q6IA 3KHKA 1WG8A 4JMLA 2X0DA 1UDAA 2AK3A 1NUAA 4I5FA 4LVUA 3W5SA 3Q1KA 3PQ5A 2PXCA 2G8NA 3I30X 5CDHA 4XVQA 3ZDDA 4EQ6B 3BJIC 2VDUE 1EVIA 5DIFA 4WLNA 4ZI7B 1UP4A 1OLUB 2Q3DA 4ZVVA 4YRAA 2CXQA 3GD7A 2DHRA 1F48A 3GJ4A 3MFQA 5IDVA 2A7XA 2P2DA 5JO0A 4LV6A 2PQ0A 4DYVA 3RWOA 4JOQA 4UTPA 1M76A 1N1DA 3BFJA 2AQIA 2D5CA 1NF3A 3BXPA 2YZ2A 1JG7A 3AETB 4OB7A 3K6SB 5J1SB 2FA9A 3AEKA 1PQYA 1ZVVA 1T0UA 4UUAA 4HQ6A 3K1YA 5BSEA 3PL5A 4LQDA 1N2BA 3H5NA 1HEIA 1O0SA 1PJ3A 4LJ8A 3D6TB 1QGZA 3QITA 3F47A 1SJ9A 2QWXA 4C0BA 2LRHA 4J0GA 5BV2P 3OX2A 1N7JA 4IJ5A 4BO6A 5FA5A 3REQB 4PHCA 2JD1A 5D84A 1QRUA 4ML3A 3AOGA 4TT3A 1X1RA 2Y2VA 3SZUA 3LZ6A 1OTHA 2F2TA 3H6GA 4LTDA 3N5KA 1NBIA 2F43A 3ZGLA 4EA8A 5LA6F 5E1BA 4R2XA 1B8VA 4W9MC 4QOHA 2EW8A 2WIAA 2QUBA 1OR8A 1OZGA 3U40A 3ADDA 2FQYA 3IS3A 5D3QA 4IHJB 2ZBGA 1F60A 3TTYA 4ASUA 3FHOA 4MGYR 4NICA 3FR7A 5KTSA 2ASEA 1R5JA 3GR6A 3OPYA 1TVMA 1AO3A 2YWHA 2AB0A 2D3TA 3ISVA 1C4KA 5LIPA 2RGNA 1H85A 3A6PC 5A3JA 3DE3X 1TA4A 4E1AA 1QM5A 2Z04A 4MO9A 5EEHA 4URXR 4TKUB 3NT2A 3GD5A 3FYSA 3AEUB 1COWD 2VDOB 3CUUA 3IT3A 2VNKA 3GEMA 5H9VA 1KO7A 4OQQA 3FMVA 4GDMA 3WL4A 3WVNA 2O8DA 2CCKA 2MSEB 2AFHE 1XDWA 3Q0IA 3W7AA 2C3YA 1XXHA 2QRJA 5LZ5A 2W2TA 5AQ1A 2FN8A 5C8DA 5AI5A 1YE3A 2G1UA 4O2AB 2AV6A 2BYTA 1VCIA 2PEYA 1E7SA 2B6HA 3Q0TA 2H7YA 2AG8A 2CJPA 2XV1A 4OLJA 2V6GA 2QTRA 3WK7A 2FR8A 5C35A 1PK7A 3VHLB 4NJEA 3I3OA 1ZUHA 1T35A 4J0KA 4B9EA 1KEZA 3P1JA 1E1RD 3I8OA 4XGKA 2HPVA 3DHEA 4FYMA 4BC1A 3A3KA 3U09A 1NLMA 1E2GA 5K03A 1GGVA 3DV0A 3RQSA 3KZCA 4JJKA 2YV4A 4C1BA 4MS1A 1BFDA 2GRJA 3FLAA 1M6VA 3CO5A 3NT5A 4LYEA 4L76A 3RK0A 1XHFA 4TMVA 2BDUA 1KJQA 1WSAA 1RKVA 2D5BA 2YINC 3DBIA 2NPIA 3DL7A 1HFKA 4LWPA 3TZQA 4ZYWA 1JQDA 5BYAA 4CL2A 2PGXA 4PG4A 5K0CA 5C4GB 1MABA 3O1HB 4TXLA 4WBNA 4ZMSA 1I7QB 1HTWA 1WHTA 2YV3A 3NM6B 3CJTA 5E7JA 2XUHA 2WJGA 4EEKA 3EMDA 4BQFA 4IGIA 2I9PA 1YXMA 3CN9A 1HE3A 1OAOC 2BGJA 1EP2B 3DOUA 3HN6A 4XTCS 3CF0A 4MCHA 4W7SA 3S28A 3JZIA 4H7EA 2BFCB 1LK0A 4QQ8A 1NJSA 2V1XA 2ATXA 3H1TA 5CK4A 3R7LA 3MJDA 2FUEA 2VDWA 3PWZA 2OHIA 2FEAA 2EKDA 3QX7A 4RFSA 3GP3A 4ZDKA 1N6KA 1WXIA 4G85A 1QGUB 1DC5A 2FY8A 1H6AA 1QQTA 1K7XB 4Y6OA 5K8TA 1M1YA 4V0RA 4YCMA 2GJAA 2FEOA 3U44B 1S3FA 3GGOA 3ANSA 3TNDA 1KQOA 1CUHA 1YASA 2PJZA 3L82B 5FBHA 3GLRA 4NZPA 2N1BA 2YC4C 1KEWA 2FJ0A 5LL6P 3UJ6A 2VZ0A 3OJLA 1AQIA 3QX8A 2B7BA 2BTQB 3ONWA 1RC8A 4U7FA 1JFTA 5AVUA 4XVUA 2YN2A 4ZCMA 1TYDE 1T1GA 3CMMA 3JQAB 1EWYA 2R79A 3CZ5A 3WV4A 3GDOA 3UOWA 2QRHA 1L7NA 1QTIA 2GZHA 3EIWA 1USGA 3GPIA 4OAPA 4RSHA 4I9NA 3CKLA 2FPKA 4J94A 4KRGA 3UV7A 1CZUA 3G1UA 3K20A 4OA5A 4DEYA 4RF4A 3KC2A 5G0WA 1HLGA 3QVTA 3DZBA 4DJJA 4DXAA 3IUYA 7ABPA 3DONA 2ADFA 4FFPA 3Q2OA 1KZHA 1AX9A 3N59A 4PQRA 3K0CC 4RY0A 4ZT3A 5IBPA 3FAZA 4OHWA 4D3FA 2GTPA 4ZTZB 2VO1A 4QDKA 4X3PA 4F46A 2EHDA 4W5RA 3O0TA 4R7ZA 3PWKA 5HBGA 5KYWA 1AKEA 3HR4A 1GUZA 1PL0A 1S2DA 1YDGA 2GO7A 1COWA 2CZQA 2PMWB 4OXKA 3VO9A 4Z51A 1CJMA 1JZSA 5BURA 2P69A 4EFNA 1AH2A 4JXZA 5D7BA 3RU7A 4FNOA 3TN7A 3SN6A 1TJPB 4ZQGA 3UCEA 4XJTA 3ESBA 3U4IA 1WZCA 1RI2A 2PYZA 3M4NA 4FR5A 4RK7A 1XTIA 2E5WA 1TE2A 3P5BA 3STHA 4IMIB 1U6IA 1YA6A 2MU1A 5HZKA 1YQUA 3HR7A 2O2EA 3RU9A 5A2GA 3NHLA 1KJ9A 1JVBA 1MH9A 2PJUA 2QP4A 3D5EA 1KDPA 1UBMS 1DRKA 3MN1A 4MIOA 4N0DA 1Q0TA 4CKEA 2Y0DA 1Y9JA 2XMDA 5CNKA 2UV8A 1HG0A 4IFBA 4JLVA 3RAJA 2HA6A 3TJRA 3W3AH 4P36A 2NUPB 3VHXA 2QNIA 3QOWA 3FWZA 5A62A 1EFVA 1HFWA 5EMNA 4HV4A 4LSWA 3VNSA 1NVWQ 3FI9A 4DIKA 1RJ9B 1OWMA 4CBVA 3W3ZB 1K0UA 3S6JA 5CVCA 4D97A 1SELA 2C31A 1PDVA 2QJFA 2NSHA 3D2AA 3C98A 1IZ0A 1GPBA 3FSGD 2QQGA 3RVDA 4ES6A 2FWPA 1DEHA 1U94A 3EXFA 3HVUA 2GK3A 4I4IA 3WBKA 5FT9A 2HF7A 2WW8A 2BSQA 3UHJA 4W7IA 1U80A 3CVJA 4AMBA 2XAUA 2AHOA 1CXZA 2KS6A 3MUOA 4PAMA 3K1ZA 1RM0A 3O6VA 1S8AA 5BN4B 3WL7A 2UUCB 5UKDA 4YJ3F 3II6X 1NATA 2B0JA 2EIHA 3K16A 4OFBA 4WNCA 3PEYA 1PR4A 2MSLA 1JS1X 5ELXA 1IXYA 1EEHA 1RNLA 4MRMB 1MMFB 4GBMA 4M37A 1ZEJA 1RABA 1ZOSA 1A9QA 2CL0X 3R0ZA 4GLFA 4Y1GA 5TJ9A 1EBFA 4WXRA 1JI3A 1YDEA 2NU8B 3RUDA 4NMLA 3SEAA 4WEOA 1M8PA 3AY0A 5L40A 3SVTA 1VLLA 2PY6A 2D0IA 2Q49A 3C70A 3SLGA 2OSBA 4BFYA 3AK4A 2XMZA 4YCSA 1U2QA 2GF9A 4IS3A 3RU3A 1QOZA 2FFJA 4EECA 3WY9A 1KI7A 4L5AA 4DRXB 2VP9A 2GAJA 1J0DA 2H7CA 2Q3MA 4ARBA 3L0OA 4K28A 3OEHD 1IRIA 3GLHB 1R0RE 1W9MA 4RYLA 3ROQA 1QSGA 2ZI3A 2NX2A 2PS0A 1RYEA 4I2VA 1CY4A 3WB1A 5K09A 2QN8A 4F4IA 3P9RA 4DV2B 2QY6A 5T4BA 3TJMA 4UMEA 5ER9A 2A1UB 1OLXA 4BEJA 1GR1A 2YWGA 1AK9A 3GJ7A 3ZLJA 1TD9A 1AGRA 1YBAA 3DZFA 5LBUA 1KQNA 2GJSA 1E5QA 2IYZA 3G1WA 5C53B 3EH1A 3ROTA 2BZ0A 4YYZA 1XYVA 2B1QA 4Q9IA 3W4KA 4BVLA 9GPBA 4QGFA 2EX1A 4MMYB 3SI7A 3RBVA 4F6RB 3PRJA 2R9VA 3QKWA 4E5MA 2J4FA 1FDWA 3CZ9A 3VYUB 1VA5A 2ZT8A 5AVQA 1Z4LA 4TTJA 2BGLA 2PMEA 2VNSA 1JU4A 3I39X 4MTLA 4NF2A 3MMSA 4LJ4A 2RI0A 3I0MA 2YWBA 3STTA 2H3EA 4FOPA 3PCTA 2Z58A 2H5LA 3UAYA 2ADOA 3THYA 2W6MA 1SXIA 1SZJG 1PZGA 3DZ8A 1QQBA 4EO9A 4PTZA 3UY4A 4DGSA 3JW8A 3OQNA 4LNHA 2GS9A 1E9EA 2ZE7A 4KN9S 4NRDA 5LXTF 3AF4A 4B45A 5FH9A 5KREA 3GVPA 3JR3A 5BQPA 4LNAA 3QVUA 4P32A 3U7GA 2GAFA 1G8PA 4P7GA 1QDUA 4MP8A 1TTHA 2P9ZA 4H27A 2XE7A 4DQUA 4BKMA 3F5FA 1DQSA 3QXGA 1N2GA 4IJMA 1P7PA 4PONA 4O1MA 1SHJA 2ZBPA 1ZP6A 4HH3C 1QH0A 3HJHA 2VTVA 4PHFA 1DFIA 3WGMA 3ENNA 3FNIA 4J6FA 3QVGA 3N2YA 2XY4A 4BDTA 5IG2A 3FSGA 3SNKA 4JL5A 1FP6A 1E62A 3IAHA 2BM8A 1XIVA 2PQ2A 4I8IA 3EW7A 4F8YA 4XQ0A 1JYEA 4B8YA 1QYIA 1J0AA 2VDNB 1X80B 4KAJA 1T43A 2B7LA 3O73A 4JT2A 1N1GA 4YT8A 3FYCA 1ZVJA 1GGHA 3FKJA 4WRRA 3SHTA 2P6MA 2XQIA 4OUKX 2ZI4A 3R5JA 1RAEA 3V1TC 2DZDA 4ZO8A 2QTMA 5DOZA 1G5IA 4L73A 3S68A 1FL9A 3CXRA 3PPWA 1A5BB 1TK3A 3LPAA 2BJHA 4G09A 1M1XB 1U2PA 3QEJA 4F9EA 3ZVKA 4Z3OA 3TE6A 1P7YA 1ZO8A 2GQ0A 2HCBA 1WZUA 2DTEA 2X6QA 1E92A 3DF7A 3IOMA 1A9TA 1V9SA 2IA5A 3JXEA 2FP4B 3OF2A 4L78A 5K3BA 3ZCXA 1W88A 5MN4A 4QU9A 5LBTA 4EENA 2VNIA 5J4YA 2GZ2A 2N75A 5AHOA 3BD9A 3U60B 3KT3A 2BY4A 2O0HA 4ERXA 1N78A 1RMQA 3V48A 5KUTA 3WIBA 4REQA 3AM1A 1KE1A 3VZDA 1TCBA 2IV2X 4ARAA 3NBKA 4G23A 4QOGA 3KAQA 3P94A 5IF9A 3TIFA 5H4HA 1SHZA 1RJFA 3OEHA 1LZKA 5F4ZA 4W5WA 5JD3A 3OKPA 4K6OA 5LCXA 1OFIA 2XIQA 3MQ2A 2B3TA 2Q1XA 1IU9A 3CEAA 4TWZA 2CUNA 3L43A 4HXGA 4LMAA 5CLIA 1A8QA 1EXNA 4GGPA 4OP1A 3NHUA 5HILA 2HY7A 4LI3X 1JQAA 2F00A 2IYQA 3PSHA 3NNDA 1PZHA 2I55A 1VPEA 3FTNA 4XTRA 5E38A 4YDSA 3UVEA 4HNHA 3V42A 4FFOA 1H2RS 1RWMA 5DGCA 5CA0F 5BN5B 4Q12A 3MMPA 1EP9A 4BO9A 2ZJ4A 1MPXA 3LX8A 3NYIA 2BBTA 2VUSA 4ZCSA 3SR4A 4J0IA 4A5OA 5HM8A 4BASA 4Z4EA 1M0EA 3PXDA 1SUBA 3W8DA 3ZE8A 3D5QA 1U7OA 3MBKA 4NK5A 3LY8A 4NONA 4PPYA 2ORED 2PRYA 2D1YA 1UH5A 3RABA 5KNCH 1DQNA 3S8YA 1EJ2A 3QVLA 5KJCA 1X38A 2QTVB 5L3SB 1ZI9A 4M1OA 2AX4A 2JBAA 1P1RA 3R6TA 1PD1A 3COPA 3O90A 1QLWA 1AQJA 2O8BA 4YQYA 4K6GA 3BSSA 5J43A 4PZ0A 4G1BA 4G5FA 4YN3A 3BZBA 1UBUS 4KYUA 3M5WA 4NH0A 2HBZA 4KK4A 3P32A 1L7MA 3N3BC 3ZXSA 4D4MA 4DEVA 2IZ6A 3V4RA 4GAEA 5DBHX 4PSDA 4PHHA 3FZQA 2V4ZA 1NW4A 1BKDR 4IG9A 4MI3A 5JMPA 3UHFA 3UUGA 1MJ5A 1QVWA 3AWIA 2HDNB 4Z99A 1T1IA 4UDYX 2Q5IA 3L5KA 2NU7B 1OXXK 1G4HA 1N2ZA 3C14C 1V0JA 2VCYA 3W0LB 3FDJA 2PVPA 1E9AA 3G5TA 4AZ3A 3AR8A 2WTAA 2H5IA 3ZK9A 2GEDA 2I1LA 3TRKA 1X1QA 2W58A 3V1KA 4CG3A 4DCSA 1FP7A 1CE8B 5DCWA 2G1KA 3BD6A 3HNRA 3KZVA 3P0EA 5ALSA 4DCCA 3HL4A 3MPOA 4I4TA 2O5EA 2GF2A 1UM9A 5DW0A 4CNQA 1EMDA 1MQAA 4PS0A 1E2HA 3PDCA 2GK6A 2I87A 2W8BB 3MTQA 1SQ6A 3MC1A 4KQ1A 2NO4A 1KE2A 3W8EA 2CLOB 3GOQA 3O74A 4NKRA 5A3VA 3Q3CA 1LLQA 4DLAA 5B2FA 2CE2X 4JJ7A 1L8XA 4C2UA 3OSZA 3PQ2A 3GZNA 2J5BA 3QKTA 3BHNA 1EFRD 3UBMA 3OZRA 1FVXA 1RJDA 4LY6A 5EINA 5EE1A 5BRNA 1UBGA 3BM5A 4N47A 1G2QA 4LZWA 1UKBA 3VX4A 4BQOA 1RKXA 2WFLB 1ZCBA 2JJ1D 4RPJA 3IOEA 4QNMA 5I47A 1XHEA 1NXTA 1QFXA 1ZGHA 2HCJB 3D9QX 2VOEA 4JENA 3U4MA 5DYWA 3V7NA 3KEFA 2R47A 3DVLA 4NK4A 1QYVA 2ZUEA 1Y48E 3O1IC 3JD2A 3LZDA 4C7VA 3EPKA 3U9LA 1UXKA 4UEWA 4Y9DA 1LC0A 3LMKA 5CFZA 5I45A 4HDNB 5CM2Z 3A4IA 2Q4OA 3WRXA 3RHSA 3RSGA 4IDQA 1RDFA 4DQ0A 2CXRA 5I7VA 1NLUA 5L8VA 5JNVA 3L7CA 4HG2A 1JLLA 5AW8A 4TUYF 1RMTA 4A73A 2OENG 2OZKA 1L5WA 3AEXA 2UUBB 1FFSA 2P27A 2NM0A 3RVJA 3X1MA 4LZNA 1P7CA 2QVLA 2BKXA 1NVFA 4L5BA 3K15A 1DEXA 1JNXX 5E4JA 4DSAA 3MHTA 1NZJA 4URVR 5JNLA 2D62A 3EOAI 4X41A 3ZLBA 5BWLA 5JAZA 2O8EB 1Z4NA 2WEKA 2WWRA 2IPXA 1PJ8A 3BB1A 2V5VA 1UJ4A 2EBFX 5SY6A 2DCMA 2BIFA 3RRNA 3E9CA 1I1HA 4R3WA 4B7ZA 3LQYA 4LK3A 4ND6A 4RAQA 1QHXA 5DWDA 1U0GA 4GSYA 3ILXA 5EQDA 1K7CA 2HW8A 4F4UA 4R71A 3OJFA 1QGYA 5FA8A 4BPBA 2Q2NA 1DTWB 1H8HA 2FEMA 2VF2A 4RGYA 3CVXA 1RYMA 2Y8EA 2X2PA 1H65A 3OZCA 1QLJA 1RLJA 2BFDB 2IXGA 2E48A 4N49A 1KYVA 3DFZA 1NN0A 1O6ZA 5KC9A 1SEVA 3L8CA 1YZUA 1NW7A 3GDGA 1EXMA 3B12A 1GQYA 1LDBA 3P96A 3WR5A 4B17A 4DWOA 5JZOA 3JAMA 3SYMA 4P38A 3K1AB 4F1KA 3BGDA 2I3DA 4W5JA 5AVVA 1SH7A 2UYGA 1BXGA 4KW7A 3C97A 4LDJA 1IXRC 2VXBA 5IS2A 1T1EA 3O8CA 4IX1A 4GOKA 2HOQA 1RKQA 2HRBA 2DERA 3D6FA 4HDAA 4PG6A 1JAHA 3QSGA 3WWZA 5IWCA 3SWWA 13PKA 2LKDA 2PZMA 2AYZA 4XSVA 5EXDA 3UWMA 2HMUA 4B4KA 4B3IA 4IIUA 4D0NA 3WLPA 4JJZA 2HLHA 4JQYA 2H85A 5CYPA 5EUQB 1XZQA 2WUGA 2BCEA 3EHDA 4MR9B 1CVLA 1YNOA 2YVUA 3AEQA 2VJPA 3N05A 4H60A 4H3SA 5F2OA 3T3HA 2J0UB 3QW4B 1O08A 2E4YA 2IHJA 5AI6A 3U6BA 3COWA 1YJQA 3P9PA 3DLPX 1CDOA 2V6JA 4P82A 3L77A 5GJVC 1VBKA 3LD9A 3OH8A 3LXMA 1OH8A 3P0HA 1HT3A 2AYYA 2X58A 1FNCA 1KK0A 2J09A 2NO5A 3HI4A 4GL4A 1YBHA 1VHQA 2J33A 3IV7A 6LDHA 1V3UA 4TYPA 2GRAA 2VSFA 2R8EA 1VM6A 3JQ8B 1EFRA 2RHBA 4OD0A 5FUWA 4JR2A 1PLJA 5G4KB 3SNHA 1PGJA 1OGIA 2O2XA 1JJFA 3PC3A 4DLXA 4WK0B 2JJ1A 3A0RB 3SKYA 4P3KA 3FNHA 3K09A 4B74A 3L1KA 3EIEA 3DMHA 1IH8A 2R5WA 3AERA 1NC1A 1PGNA 1WR8A 3KUUA 4RGQA 1JH9A 3JQ6A 3L40A 3HQ4O 3P2EA 3IE0A 3NCHA 1T9DA 3QUTA 5AOCA 3T54A 5IDXA 4DV4B 1EFAA 4X90A 1VYVA 2C92A 4MVYA 4LZPA 4DG5A 4NXNB 1QIKA 1KI3A 1B7GO 1T0JB 4LPKA 2CUZA 4PG7A 4UHJA 4MUIA 4UNSA 2WVHA 3C0KA 1ISPA 3C16C 3D54D 5G41A 3HKEA 2Q8QA 3KWFA 2OL4A 2C3MA 3DDCA 2Q28A 3BXGA 4QDUA 5FL7D 3WGYA 3VU0A 1VFPA 4BFLA 2F4VB 3NWPA 3QE2A 1EE2A 2JFUA 3DO5A 3Q9SA 4RF5A 5D8DA 4BP8A 2CLCX 4Z2YA 3QPDA 3PNOA 4A16A 1LLFA 1LPPA 2OPBA 2P6NA 3H2ZA 3EPRA 4QO7A 3GJSA 2VC2B 2ONZA 5AM0A 4WESA 3I9JA 2BONA 3CG4A 1HKUA 2KWIA 1GDDA 4KE8A 5JZMA 4FMCF 4IBOA 5LQDA 4KLRA 4B84A 2CCJA 3TWOA 1XU9A 3EGVA 2CZGA 4EG3A 4ZOLF 1DXOA 2QR2A 3WWEA 2IDZA 1NOIA 2WUFA 2EVWX 1MO5A 1NW8A 1M2VA 1UFQA 3D31A 3JYPA 3QEMB 1RHMA 3DXXA 2Q50A 3V1YA 3C6MA 3R0VA 1ZHFA 4HRYA 4OLBA 1VRVA 4XI9A 3L8FA 1NP7A 4L5YA 5CT9A 1HNZB 1ISSA 1UC9A 1ZMOA 3NHSA 4G1VA 5EWJB 1P29A 3R75A 2IUEA 2J48A 4XJVA 4DABA 3AKYA 1F0NA 3HVKA 1Q3TA 2VQ6A 1NP3A 1XCLA 3RUIA 5J47A 4MA4A 3FRHA 3FYDA 4BC0A 4MUNA 3QE9Y 5F9HA 1ISGA 1ZSNA 3JTEA 3SQLA 2VHUA 1TM2A 1ZNXA 2YV5A 3TEFA 4LFAB 4J29A 4AX4A 2XB6A 3PFCA 1CF4A 3C3BA 4HNSA 1KH3A 1ZR4A 1MA0A 2NV2B 4TKMA 1ESMA 2CN1A 2WTBA 1YK0A 2VRCD 2OYSA 5EJIA 4MAAA 2MR6A 3NBFA 1VPDA 1O7JA 3FPKA 3PDWA 4X8LA 3F98A 1R5NA 2BCJQ 4C7BA 3DQQA 1M7HA 10MHA 3HU2A 3WLJA 5K4HA 4U7JA 3L2OB 3GCZA 1LBEA 3LHFA 2NTNA 3ENZA 3HCPA 3K9FC 1ZOIA 5K3SA 1M1ZA 2Q5OA 1RWWA 4K0RA 1KR5A 3HWSA 3PLNA 4GIBA 1EK2A 5ANRB 3T4EA 1B8NA 1W1WA 4IJUA 5CVEA 1X7DA 1THTA 1CK4A 3FDXA 3KPJA 4O4JA 2GN4A 5LP6B 4OXYA 4Y2XA 4I8DA 3SQWA 2EZUA 2QX7A 3QEAZ 1UKEA 3H8JA 4GP6A 3PQ4A 4I36A 3D3EA 2CB9A 1U0TA 1WABA 1TC1A 2BR5A 2V6MA 3E2IA 2WSYB 1FUIA 1C9MA 1Z22A 2N1MA 3D1JA 4EIWA 3WLLA 2ZOSA 3DT8A 3GWZA 4EHNA 5KU1A 2XBLA 3K8QA 2GYWA 2BELA 3KJXA 3PC4A 2QG4A 3BFKA 5K3FA 3OQPA 4CLDA 3O8LA 1BDHA 4L0DA 4F45A 1ECJA 1QK5A 5C8ZA 1GQ2A 3LLSA 3F3YA 3GGCA 3LFTA 4LE2A 4GSLA 2B8NA 5LOVA 2KLBA 1L1QA 3DFIA 2A0KA 2C9MA 2P9YA 4FNGA 5KC8A 4DCMA 1K6MA 2JATA 2W48A 3BJEA 1FA9A 4F3KA 2LPMA 3FCEA 1G17A 3ICQB 2AOUA 4ZEWA 3D1VA 2EJUA 2FZLA 3JATB 1Z5VA 4RQUA 3E9RA 4YJ3A 2F9MA 1UADA 5B3LA 4FNAA 3KFLA 3FETA 4RY8A 4C4ZA 1HQCA 4DDHA 3AB7A 2UKDA 3L8MA 5ALGA 4GPAA 3AVUA 1OUMA 4NDNE 4AJKA 2PMDA 1EWKA 2HSGA 1M6HA 2QBYB 3RWBA 4YUXA 2GBIA 5F33A 4DQKA 3DOOA 4RFVA 3WHIA 2CHFA 2W00A 3HYTA 3KJQA 3T41A 4AWXA 5A1TA 1W36B 3CX4A 2NT3A 3NH6A 4AJ1A 1MZVA 1HV8A 2X42A 4TV9B 1U04A 1UMDB 3A3NA 3IJEB 3RIHA 2HK8A 2AG5A 2I54A 1VCOA 2QPOA 2X2EA 1WXHA 3PEUA 2HRCA 3K9LA 4I1VA 4QUEA 5FV4A 4Y2VA 1U65A 2PZGA 4YFYA 1AZWA 3V34A 2J9GA 2SBTA 2FKAA 1RHKA 2IEZA 4I7EA 4WKGA 5BWNA 1L4NA 2FPGA 4RK4A 4Y0VA 5IBQA 3V4ZA 1G16A 4M9QA 3RYIA 3ER9A 2O52A 2XTMA 2ZETA 3TCNA 4YK7A 1SXGA 2AJCA 1OPRA 4L7QA 3EGEA 3OZBA 5HQTA 1K7SN 1L4EA 4MPJA 2FMXA 2RHMA 5IXYA 2GLXA 3CRQA 5K0EA 2V7GA 1JJBA 1Y7IA 1X7ZA 1IC6A 3RHTA 3IDQA 4J2TA 3IP5A 4EY7A 3THOA 2ZJYA 3AHGA 2AZXA 1J9EA 1YACA 5CCEA 1SK8A 2BFBA 3C1OA 4XFKA 2DYKA 4CV2A 2I4LA 1NUUA 3NALA 1PCXA 4CTMA 1U2DA 1B0ZA 1J0EA 3O7MA 4OB6A 3GJTA 4W8GA 4YREA 2CJWA 2BRUA 3AB8A 3KKEA 1F3OA 4PAOA 5FOXA 1DPGA 1YBVA 2B2NA 2VRCA 1O95D 2OP1A 5ALNA 2I2FA 4BLRA 3MWEB 3WQBA 4I6JA 1QUEA 3A6LA 2HF2A 3BERA 3E18A 2XIJA 4QUJA 4R1SA 5E6UA 2A33A 4ZODA 1GZHB 4ZRDA 2GB4A 1V2GA 2DUMA 1N5DA 4LYAA 3H8SA 2CEKA 5EMJA 4A8JA 1GGNA 3OZTA 3OF3A 3TLMA 1Z28A 1Z7YA 5KOJB 3F49S 4UM9D 3PC8A 2C78A 3TZKA 3I9V1 3EDQA 5IZCA 3I01A 3V8BA 5LXTA 4J76A 1ZD1A 1IG0A 1V6AA 4EUSA 1MR3F 3A9RA 1DQPA 1M66A 4MI9A 4X1OA 5KNBD 3I62A 3ESZA 5DNYB 3IOBA 3QEKA 2DSNA 3HLTA 1QV7A 3TRHA 2ILTA 3AEZA 5H68A 3F67A 5B1HA 1EIWA 2FFQA 1RPTA 5M29A 1FFYA 2C07A 4IZOA 3W9UA 1KVUA 2OKGA 2HBYA 4QRIA 1SHUX 3CRW1 3M1AA 3ETLA 2PTHA 4TLBA 1SQFA 4XLTA 2WUWE 3OQIA 5DB4A 4FBLA 1NMZA 3HRHA 2BFPA 3K4HA 4XKJA 5MGBA 3L79A 4KGVA 4D9HA 4BJHB 1XEFA 1GA1A 2C2ZA 1Q1NA 3DLCA 4FFBB 4HDKA 3JVVA 3A6KA 2XZOA 2YJGA 4GKKB 1UPUA 2X1HA 3B2QA 1Q11A 2AD1A 5EIAA 1JTVA 4AD8A 2G08A 3FZEA 3S2GA 1AZTA 2DGDA 3H2GA 2OV4A 4L4SA 3OX4A 3VNRA 1V7ZA 4BL5A 1L7XA 1SIBE 5G0VA 3M5PA 1NI4A 5EYPA 4BNKA 4XYLA 2IW1A 5ESRA 1KFCB 2WB2A 4LMBA 4YCNA 3EAQA 4OIMA 5IJWA 2R87A 2GDJA 3MCUA 4G41A 3IAXA 1GUBA 3PZBA 1FNBA 1V16B 2P9TA 3N58A 3R7FA 2GI4A 1KVQA 1I7NA 1Y82A 3O4FA 1WOYA 3B36A 3OQHA 3R44A 4GU5A 4HQLA 3JU3A 3PIIA 3RC1A 2CJYA 5C52B 1FRFS 3GC6A 2AUMA 4NI5A 3JZDA 3OTGA 2Z2XA 1T36B 3JAWB 3CVYA 4ZALA 3UMCA 1DIGA 4W1RA 3WYNA 3RTDA 3WIOA 2WYOA 2ZYHA 3RTCA 3TOSA 1MUUA 3OPVA 3U3RA 4CIAA 3THSA 1PR0A 1ZIYA 2VSQA 3HB5X 1UP7A 3IP7A 1V4BA 2F3SA 3H9GA 3Q7EA 3BS4A 4JT8A 1V3QE 1FFXA 1XLWA 3L0CA 3JX9A 4LXGA 1E79D 1ISJA 4FXPA 4ME6A 2VZLA 4P8RA 4E3ZA 2HSDA 4RKWA 4L9RA 1CUAA 1JFLA 4PHTA 3TLJA 3ZWWA 2XB9A 5J2UB 2FNAA 1N5LA 2C4VA 3EJWA 1B6RA 2YMMA 3MTAA 4L2IB 4BVGA 2RH8A 4DV7B 5H3LA 4R40A 1CX9B 1TYBE 3QTTA 5HS6A 1SMKA 4EY6A 2WE7A 4MA5A 2PT7A 3QBJA 3I6IA 1MHTA 2DECA 2IXBA 2Q5LA 3L9WA 3WHKA 1DJNA 2IYUA 4QUGA 5ERGB 1U4OA 2ZZMA 2WU1A 1P1IA 4YWHA 1I6LA 1Y5NA 5EN4A 2PGJA 5CX1B 2WILA 1EFHA 5FX2A 1O95A 1YJXA 3ABIA 421PA 7MHTA 2E0IA 5C5CA 4KDRA 2BHNA 4OU4A 2QUJA 1IN4A 3UF0A 5BNZA 3GJZA 4PGHA 4QARA 2GD2A 4UBJA 2P4SA 3WBFA 3GJ3A 4LZZA 5K7SA 4GL2A 3RUHA 3SYKA 2G04A 4L85A 3PDIB 1DFHA 3AY3A 1I5OA 3L6EA 4ZREA 1IHOA 2ZR7A 3NDJA 2OCKA 2QTBA 2RG1A 3F6PA 5AK6A 2EOAA 3IO3A 4LTMA 3RQIA 3W5CA 4RGBA 3MA0A 3SXUA 4G89A 2IZZA 3R3XA 5A06A 4WN9A 4YPFA 2QPAA 3COJA 1CNFA 4UPEA 3EQZA 5FI0B 4O2RA 4DC0A 1YKSA 5C4IA 2QX9A 2YZKA 4B6GA 2I03A 3BFXA 4XQ9A 3ZWNA 5TMEA 2F1KA 2WJAA 4ZYXA 4DA7A 1DMRA 4RNDB 3EAFA 5FFNA 2F62A 5TMPA 3RTAA 3V80A 2QIPA 2YBEA 4QYXA 4R05A 5T57A 1RPZA 2JASA 4OAQA 3QXJA 3KWJA 4PM4A 1YB2A 5CJ2A 2V03A 3IBYA 5TPZA 3WWPA 1JG4A 4JBLA 1AV6A 3JAKB 4CKWA 2VZEA 5C7OO 4R01A 4LOAA 2HQOA 1BIFA 4OFZA 4Z9AA 4BX8A 1FY2A 3JALB 1RQXA 3M6IA 5A05A 1X1SA 4IH9A 4PZ9A 3PHBE 1R4MB 2BI8A 4W8OA 4TWIA 1Y89A 1DKUA 2HO5A 3A11A 1HFEL 5JALA 2X5NA 1PZFA 3ELBA 2CFIA 4UTNA 1YA8A 2JBHA 2DC1A 4UHEA 3ZN2A 3EGIA 3HXQA 2OWEA 1SQ5A 1Q7BA 1B43A 3FJYA 4OJMX 2P5YA 4KVZA 2ID9A 4HWKA 3P9SA 5E1MA 1WCYA 1QAQA 4FWBA 3QA9A 4XCVA 1F2UA 3WLAA 1SN7A 4IXNA 1SRQA 4MS4B 5FJIA 1B0UA 4E5DA 1HQYE 4GKBA 4G1MB 5FWYB 1KRWA 1MC5A 1J00A 2R1TA 3K1TA 1SXJD 4RZHA 4Q03A 3NHYA 3KHUA 2DMRA 5EWLA 4DCOA 5L95A 2GPBA 1ZM9A 2EL7A 1WE2A 1Z2CA 1BDBA 3PC6A 1RCUA 2REXB 1EXVA 3KXLA 2C8VA 2C20A 2W2VA 1D6MA 2LIVA 5FTMA 4TUYA 1S8NA 5CW1A 4ZYTA 1KJYA 1EFTA 1KZ4A 4NHEA 1MW8X 2P3OA 3C85A 1DXYA 4RLQA 1K8ZB 721PA 3NDPA 1E79A 1RBZA 1XRRA 1XZLA 1Z35A 2DFDA 2R8YA 2PEZA 2WAOA 3ONFA 3QNWA 4BEWA 4JI7B 4AI6A 1NQOA 1OFUA 4NLLA 4QXMA 1W2HA 5AW7A 2ZBVA 3HB1A 3IEKA 4LGCA 1KI9A 3IAM6 3E8XA 4ZVMA 2GBFA 3R20A 4B0OA 2Y66A 3MUEA 5DGDA 4ZQBA 4C0AC 4OHUA 2ZKIA 3OMLA 3UB3A 3W8RA 2BDEA 5THQA 3GNLA 1NVGA 4QUAA 2TS1A 1ISFA 1VIDA 3CNLA 4I50B 2ACKA 4UXIA 3NWBA 2P1ZA 4IOKA 4QBIA 1E1NA 3H65A 3EARA 3QLUC 4JWTA 4MKGA 5L3RA 2BTEA 2UXBB 4KI7A 1N75A 3WMRA 2ZRFA 4B09A 1GL7A 1M2OB 2FSFA 2VEDA 2BGMA 3QU5A 1W1IA 1JG2A 3BIWA 3A6ZA 3G2KA 5ELLA 5KAPA 1W59A 4BQQA 4WASA 3PUXA 4D3XA 3E8SA 3KKLA 4HOYA 2ZI5A 4OHRA 4B81A 1AQNA 1ZOOA 3H2IA 2FZGA 3UW1A 2ZRPA 1QIMA 5KNLA 3M3HA 3A6JA 4Z4FA 3NGLA 4JKIA 1VBNA 1FP4A 3JWHA 1SEPA 2C5BA 3O4HA 1U2RA 1TX4B 2KPOA 5AXDA 5JC8A 1V2HE 1CPYA 4JLSA 1ORWA 5AVJA 4XGIA 4IDFA 3RRYA 1WB4A 2QXTA 3GJ0A 4CMHA 1S4MA 2ZU6A 4MWTA 2NSLA 1C1HA 4IGFA 4KJZA 2Z2IA 4UBMA 5TLSA 3D4NA 2JGAA 2CVPA 2O8CA 3UOGA 5EIBC 5GIPE 3ONEA 2G67A 4ALIA 4ZU3A 4PO1A 3E9MA 1ZRNA 2W71A 3UK2A 3ZE9A 5JZBA 5I6DA 2Q1YA 4BMXA 4JXJA 2HA7A 4HNTA 4ZK6A 5JXIA 1PO7A 2E2WA 5M04A 4M53A 1CZHA 1G41A 3BL8A 3T38A 2O6LA 1XDSA 2Z5GA 2G9NA 5ITZA 3CWZA 2WWTA 1V25A 5SZJA 2YNMC 5C3MA 1ZGBA 4EA6A 2JIOA 3PQDA 5C51B 1U0RA 2H0RA 3LT5A 4D1YA 1G38A 4Z0PA 2HTFA 4C0KA 1J2UA 1P0IA 3N7TA 1YAJA 1XF1A 3QX9A 4OBWA 4IKOA 4HYQA 2ZSJA 3MCVA 4ZP1A 1ZINA 5JVDF 4X5OA 4TRNA 1XJ0A 3HB0A 4OSPA 4DNPA 1XQXA 1E96A 3OQJA 5IVDA 4IHAA 4GNKA 1TM3E 3ND6A 3MINA 1JXQA 1KC1A 4Z8YA 3VO1A 2OESA 1XAHA 2NOAA 1A77A 1C7FA 1NURA 2WD9A 2PT5A 1JU9A 2A9JA 4LWOA 1FQOA 2ZUBA 3AU9A 1J42A 1N1MA 3I73A 5A4JA 1SXJA 2OLJA 4C6RA 1EWQA 5JANA 3P4XA 4EY4A 4DJDC 4KPYA 4EJSB 3CZPA 2YMLA 4PPQA 1M8FA 1DU4A 1KYIA 2B61A 3DCNA 3E61A 3JRXA 4GEKA 4QUIA 4S1VA 4G81A 1WP4A 2VVTA 3JYLA 4LZJA 2POCA 1QFJA 2HZBA 4LZAA 3VPBA 1CS0A 2Q6KA 4AJ2A 1O9BA 1X7YB 4U2GA 3WKBA 5C31A 2QAGB 2NVOA 5ICMA 2HBRA 1SWVA 3W7VA 1XNJA 2Q1SA 1QDLB 3DVQX 3IVGA 3ZZ0A 1Q0RA 4E51A 2GCEA 3O82A 2XWJI 4WACA 3IT2A 4U0KA 4R8LA 2X9LA 4O08A 1AUXA 1D6SA 2D74A 4R2HA 4ZOLA 1MC1A 5ITSA 5IU6A 4DV6B 1R7RA 4RXTA 3T7AA 2K87A 1YQTA 3ABZA 5CP8A 4A8PA 1J2RA 2VHZA 4BGEA 5HJEA 4G9GA 5IT5A 4DG8A 4TM7A 2EC5A 1OH6A 1ADBA 1HDGO 4FMDF 3N8GA 5EGNA 3FW1A 1FFDA 1FK8A 5I7EA 4LPSA 1IBKB 1NC3A 1MX5A 4WZBB 3FFAA 1RYYA 3UHAA 3EZ6A 2Z8XA 3WC4A 4DDKA 4RPGA 1NE7A 3KKQA 1DINA 1B0PA 3G68A 2OP0A 2XMRA 1OI4A 3CLKA 5BT9A 3VV2A 1D07A 4M86A 1NUQA 5FHQA 5AVOA 5CURA 1HBJA 2VT2A 3KSZO 4M8SA 3UMBA 1L5HB 1ZKMA 5BNIA 1YDWA 3QF4B 1T13A 1H0HA 1L4MA 1T5IA 2XNJA 3I6YA 1WO8A 5K0ZA 1W4LA 5CG1A 4RVHA 1XMJA 2CUTA 5DYTA 4ZCQA 3P9XA 5GVSA 1T6BY 4ITUA 2Q2QA 3PPIA 3C6KA 5EGSA 3E9DA 1BXRA 2XMGA 4YCJA 4S2UA 3K70D 1DC3A 4ANFA 1Z68A 1ENOA 4D9MA 5ERXA 3B2EA 2INGX 3CZAA 5IJ0A 3NAZA 1W6UA 2L18A 2Q3EA 3CQ9A 3ITEA 1WCV1 2AXPA 2B36A 3E3AA 2FB9A 3L1VA 3WL5A 4LY9A 3AJDA 3N7UA 4AKTA 3JD0A 2QRNA 2J5XA 3M4XA 4ER5A 4F4HA 2ZAMA 3UH0A 4G1FA 3KXIA 1KVTA 2K2QB 4ZKEA 2IP2A 3SS9X 5BWBA 1EVKA 2Y99A 3NVAA 5AI0A 2I2CA 2NPFA 3X1WA 3DNMA 3VNAA 5BRAA 4LX8A 3EWIA 1G7TA 5BUQA 3K9WA 2REQB 3ANTA 2Z5FA 1AO0A 5ADVA 4KR0A 4G0ZA 4PHGA 3ZCRA 3DJFA 3IAFA 1I9CA 4HO1X 4O4LF 5C9ZA 1ZD4A 3BORA 1NA5A 4KXMA 3K0SA 1OFTA 2IBSA 4CDRA 4R5MA 4G5HA 4FS3A 1MH1A 2GXQA 1GLVA 3E03A 3NUQA 4XVCA 3ZD7A 2IDKA 2GM5A 3KPYA 4Z0NA 1EB9A 4IQ8A 1CUWA 4EGQA 2ORWA 3DEZA 4NR0A 4Q6WA 4AS1A 1JDSA 3UENA 4OTZA 4ARUA 2WHPA 4IP0A 2XDAA 3TLZA 5C7IO 3R7SA 4I9UA 1H2HA 1ZBQA 1EBBA 1Z9BA 3A3YA 3HYRA 2A5JA 3K0HA 5KAMA 5JXHA 4EGJA 1OIXA 1PE0A 2DBVO 3GA5A 4X44A 4UM5A 1OPXA 4UD6A 2OVBA 4FE4A 4LHWA 1R0ZA 3G2HA 4LRTB 4XGRA 1H6DA 1ZG3A 4LQ4A 4MPDA 2WF5A 1XDZA 4Q21A 2CC2A 4EPYA 4PRZA 3NPAA 4Z8XA 1SC9A 1Y9EA 2FHSA 1KDYA 4E32A 4RABA 1DOHA 1WHSA 1XYGA 3G79A 3H7IA 1PKXA 2FW9A 4U2KA 3WX0A 2J0QA 2HLDD 2P9GA 3PF9A 1OFGA 3N76A 4YRFA 4U6NA 3T12A 4DAEA 1GNRA 5BVGA 2I62A 2ABWA 1XNHA 3EGDB 4UHCA 1CJSA 1GZDA 1IQRA 1LTKA 3AUAA 2CFTA 2NXNA 3TNFA 1FEZA 1DKOA 5KX5F 1CY7A 2WKPA 2GWHA 4GWLA 3GLIB 4ZANA 1UKAA 5IT0A 4YJGB 4JS0A 3BWYA 2FZ5A 2OXIA 4P0TA 1H2XA 1L8QA 1OU4A 4KX3A 4LVNA 3RTBA 1C0PA 3UG6A 4F06A 5KTKA 1GGKA 4DLBA 2AVNA 1KYTA 1XTVA 4EYOA 4GF5A 2AL7A 1XZBA 1EG7A 4IO0A 1JG1A 1FYDA 1TTPB 5JDIC 5SZHB 5J4VA 1CLUA 2HNAA 4Y18A 4EZBA 3DZDA 2EDAA 1JSLA 2EFCB 2FMHA 3PCXA 4MUEA 2YFQA 3ROZA 2C04A 2FX2A 3UTCA 3ZH9B 5KMGA 1LA2A 1TAGA 2VJYA 3NAQA 4JL6A 3SVZA 5IVIA 3VPAA 2SKCA 3EUFA 2X0FA 3SSAA 3X0DA 3E5MA 1NV9A 5K6TA 3UAWA 1EPUA 4OO3A 4AQYB 4U7WA 5E1DA 4CHGA 4QLOA 1A2OA 3OOHA 5IKOA 4WFQA 2VTBA 5BVHB 5CFNA 2I67A 5IJ9A 1PR3A 1NBOA 1JHXA 3OE4A 2Z2YA 3TIGA 5HMLA 3AKDA 2V7WA 2PGLA 1DJLA 2DX7A 4FGSA 4IDPA 1G55A 3ZHCA 2VLIA 4DLRA 1DJOA 1JFFA 1G20B 4G6ZA 3SF0A 2Z6AA 1Q7EA 4GGOA 4B71A 3QX3A 1XEXB 1XMIA 3S27A 1NI3A 1YVPA 1N33B 3A26A 2XYQA 2J3QA 3H19A 3N2GB 4L4UA 1CWUA 1KA9H 2EQAA 4RD0A 2AC2A 1DG1G 1WD7A 1XVTA 4F5ZA 3ET5A 1KAQA 1VMEA 5CFOA 1L0BA 4Z2AA 1QVVA 3RS3A 2WA1A 2DBRA 3F71A 4HYTA 5AVSA 4DB4A 4J9VA 4IICA 2JD2A 3B1ZA 3G9XA 4QBKA 3V46A 1XRJA 3LDAA 4JLMA 3HV0A 3WB2A 2ZJ7A 9ABPA 1DHRA 1NY5A 3KLPX 3DTVB 4B48A 3UJDA 4NHOA 3D6JA 2UYHA 1FTNA 1Z16A 2F64A 4D99A 1CIJA 4MQEB 1H22A 3SC2B 2C99A 3WMEA 2RH9B 4BEBA 3EG9B 3K92A 3C43A 5J58A 2GXAA 4MV7A 4WJZA 5CPFA 3AR2A 3EWSA 4EYSA 1BYUA 1XAGA 4OUDB 1KAOA 3UUWA 1V96A 3R0QA 3HMQA 3UAVA 1P9OA 4CZ2A 5ENZA 4DR4B 3A1VA 3LC2O 3KJHA 4L16A 5FXMA 3V8MA 4NMXB 2I3AA 3ZE6A 4DF3A 1XJQA 1XZKA 3OJEA 3DOJA 3VAAA 3VPHA 1MCZA 1RWPA 1Q3HA 1HDRA 1QAOA 1I3NA 1ZM2A 4GZ6A 1BGWA 3PFWO 3PL1A 1KSFX 4GI7A 5J3JA 1YQEA 2PXXA 2OD9A 2O1WA 2OYCA 2VJMB 4E0BA 3R3ZA 3AUXA 3LM8A 4XIYA 2OVFA 4AF7A 1A1VA 4K46A 4I1IA 4I19A 3DLIA 1WF6A 1SOAA 1YMQA 2HLDA 3UPDA 2P3QA 4C0QC 1CUBA 4GKJB 4CEIB 1F12A 1BKYA 3IIKA 1BN7A 1PR1A 3IQFA 3N74A 4GQIA 3LI2A 4OP2A 4Y2TA 5JLAA 4C0HA 4A6XA 3IBSA 3RFTA 5H9WA 1GRRA 5ALHA 3T1YB 3FOZA 4C7KA 1UUFA 5E8JA 3SZRA 4FHEA 5JG7A 2H51A 4GZ5A 5IWAB 3KBBA 4RE6A 3H5AA 1HR0B 4S1NA 2F8MA 4C5BA 1SUWA 2QE7D 1ISMA 2ZIUB 4KYTA 4ZVQA 4JN6B 2C2YA 1PFQA 4HQNA 3ZWYA 3VR6H 1YOVB 3NDBB 3I01M 3CE9A 4BCDA 1KEEA 2PWYA 3PK0A 4Q3NA 5AHRA 4DC1A 1Y33E 3HH8A 2W22A 5A6SA 1CJUC 2Q9CA 4JU8A 1JQJC 4YMIA 5TARA 2YOFA 5EHZA 5EMLA 2D59A 2M9MA 3K8ZA 1OBFO 2R7MA 2YJ3A 1JIQA 4DARA 2LDXA 3CZCA 1A27A 4D6XA 3EF1A 1ZD8A 2B20A 2R1VA 2FSPA 3GJRA 6Q21A 5MF6A 2IYXA 4KHZA 3V00A 2NU9B 4AVYA 3OE1A 5KBYA 2I1VB 4M99A 3NWJA 5U9CA 5ALTA 5I7OA 5IH7A 1TU0A 5KB3A 1JAXA 3KSDO 2JJMA 3DMDA 4MP3A 4WWHA 2IZ0A 1UKCA 5EP2A 5FI5A 3D8UA 3OM0A 4YMTA 1E2BA 2ZYVX 1IULA 1JB9A 3M6WA 4B5KA 2C7QA 2C8JA 2AJDA 3QMMA 3V6LA 5BMVB 2D6FA 4KIGA 1QMPA 4Q1EA 3S1AB 1TUBA 1P91A 3E5HA 1NULA 3FB4A 4GBED 4FLFA 3L0DA 1IM5A 1KSJA 2A4KA 1XYYA 3RRZA 4IOMA 2FDCA 3DZJA 1LCIA 2FZKA 4ZU6X 4G4GA 3JWPA 2IU4A 4PX9A 4F1WA 2JCXA 1N5MA 1YJ5A 2AS0A 4HDMA 1JTEA 4CI0B 2YHIA 3U56A 3NHKA 1OV4A 1E4OA 4Y8VA 2PJRA 5EJ6A 1O6GA 1NZFA 1VPTA 2X0NA 2AG0A 1YQ9A 4HB2A 4R6WA 2PGDA 2AFVA 4MDFA 2HU8A 1HTBA 3EHEA 3EGXA 3N0RA 4PINA 4ZWNA 4A1OA 4BMVA 2EV9A 3CR7A 3HWX1 1G3RA 3RASA 5KNCD 2NQ2C 3GPBA 3DWIA 4G5OA 4OYRA 4EB0A 5FR2A 4INZA 5JAPA 5K3CA 4GKVA 3CUTA 3UN1A 4DS3A 3DCJA 4M4SA 3ANMA 5E2IA 2VAVA 2BE9A 4P81A 5DLEA 3KUDA 1WQ3A 4O4IF 4H77A 1VE1A 2SKEA 3VPDA 1UZLA 1CQXA 5E95A 2VATA 5B2EA 4LJRA 4BVBA 5LB4A 3HJRA 1CUYA 4PRYA 5BYBA 3L6DA 1KZ6A 1MJFA 5CXXA 1XNRB 1T2UA 1FW6A 5BSMA 3MJVA 4DQDA 1K3FA 2AOTA 2LCQA 3TUIC 1WXFA 2I2BA 3OFVA 4L9SA 3VC2A 4YA6A 4DHWA 4ZZIA 1Z7EA 2I4MA 1CUCA 4E6EA 2C2WA 3AVYA 1N6NA 5AUNB 3PG5A 3A2KA 2CBGA 1GAEO 5ECYA 3MCZA 3HYNA 1NVBA 1UZNA 1TECE 2QMOA 3KHSA 1ISIA 3N0WA 3D3WA 3PX2A 1G9TA 2SHKA 3AXTA 3B70A 4L0CA 2REBA 2J3DA 1ACLA 1Y1PA 4RM3A 3VV3A 4K7JA 2A6PA 1PN3A 2RGWA 4F97A 4EJFA 2PAAA 2ZRDA 1E2LA 3F6EX 4RZUA 5DT2A 2ZUTA 3X1XA 2CV1A 3VGPA 2QE7A 4WD3A 4Q1DA 3KKKA 3D3QA 1P4AA 4GX1A 4BNNA 2C54A 3WNVA 2ZFUA 4QOFA 1O58A 1QCDA 2BBSA 1CZOA 2DFNA 2JJ2D 3JQ7A 3KYCA 4KE7A 4L8FA 4O59O 2CMDA 3IP3A 3IEXA 3JYQA 2PZKA 1E6EA 4IZ6A 3ORRA 4MVJM 4KQ9A 1U0HC 3ORQA 4O1HA 4QGGA 2WY2D 5B7QA 2BF7A 5BQFA 1D2RA 2UVPA 2Y9MB 1LLUA 2QF7A 2QKYA 3VKVA 1RWXA 3UHOA 4QEZA 2QVYX 4KQCA 4OQFA 1U2ZA 4HAYA 4MAFA 3IEIA 4R1LA 1NIPA 3PKJA 5AVWA 1M2EA 3ZY3A 1OYYA 2D1QA 2WB4A 2RB5A 2ZTHA 5BUSA 1GSIA 3THXB 1A9XB 1BTOA 3A1WA 3Q7PA 4OYHA 4MWZA 4DL9A 2WTUA 1KDOA 1JR4A 3CLVA 1Z63A 1N36B 3SBOA 4GECA 1AMUA 1AKVA 2JI8A 3BJZA 4IYJA 2OAGA 3RIEA 3FIUA 1DBPA 1PDWA 3HBLA 5DRYA 2ZITA 1THZA 2HA3A 1BQEA 1Z3IX 2IOFA 1NPTO 1U31A 1LV8A 3BCHA 2ZAYA 3NIFB 4H9GA 5DXJA 4IDOA 4RVUA 3GHHA 1GFZA 1LF0A 5BP7A 5EESA 1VPVA 5A9TA 5T4EA 2HGZA 3ZDYB 3UWKA 3L4SO 1MFZA 3EODA 4LJAA 3T4UA 1YU6A 3BA1A 2FXIA 3QV1A 1MX3A 2PK3A 3WDSA 5E3HA 2PUTA 1KC3A 3LVRE 2OMKA 4D4IA 1EGVB 1T15A 3A1EA 3AR7A 2VP0A 1N1EA 1SPXA 3VR5H 4HWOA 2VWHA 4ZC8A 2PX5A 4B5LA 5KOHB 1J1UA 2WJZB 5TR9A 3W78A 2PJDA 3HCNA 2YIDA 4WL0A 2PX2A 2I6GA 1VKHA 4E46A 4LBYA 4ZHQF 3BRSA 1L7OA 1RQLA 4X63A 4DDVA 3CKYA 3JVDA 2ZI9A 2J6CA 4IOLA 3GDWA 1JIJA 4KZKA 1R16A 4BFXA 1JIVA 3FNRA 3WK6A 2P6RA 1J39A 3W5JA 4AXXA 1ULZA 3IEUA 5IC4A 5L4LA 3NHPA 3O5AA 3CMCO 1VSQA 1TZCA 3OIWA 4ND4A 3SBDA 3UFXA 3ELYA 1TZKA 3U7RA 1Y3FE 2JG3A 3M6AA 3WJ7A 4M46A 1X1CA 2GN9A 1A7KA 4W63A 2LTAA 2QVZX 2QZ4A 4LYGA 2C83A 2EEPA 4ID3A 4RL6A 4MQUA 4LQLA 1D2NA 1TOAA 3GFGA 3UJCA 3G0GA 1FDSA 3K31A 3DEIA 3LVFO 2LDBA 3I53A 4RVFA 4ZJYA 4JC4A 3C3XA 1ZAKA 4EZIA 5FFFA 1R74A 2EQ5A 4HH1A 4MWCA 2X76A 4CLXA 1PHRA 2HF8A 1N7HA 3E9QA 3HA2A 4GR5A 2QJOA 4YRJA 1GUAA 1WIWA 3BDVA 3C8DA 2Q3JA 4BX2A 4YT5A 2RGXA 4BZQA 1GM5A 1XA0A 2FG6C 2X3UA 3FH0A 5ALPA 4BO8A 4EH1A 4A15A 1BCSA 1YL6A 3A2MA 2JJ2A 4G65A 1DJPA 1I7SB 2ONYA 3PFFA 3GG2A 2C5FA 4GD3Q 2AR9A 2M2IA 3JQDA 4XM2A 4HNGA 1NU6A 1ZK4A 2FZCA 4K40A 2E7ZA 2RK3A 4WZBE 1LRJA 1WSBA 3VGJA 3HJBA 2WFAA 4PLWA 4C0JA 1EA7A 3OJXA 2XTZA 2JANA 2OZLB 5T5QA 4I4CA 5FUBA 4RV9A 1U5BA 2EZ8A 3B52X 3SDZA 1V5IA 4K9OA 4FKBA 1QHFA 3V8PA 3R9KA 4PCUA 2IGTA 4DLPA 3IDFA 3ISTA 5BXQC 5B12A 4D0GA 1DJQA 2WYVA 3KE9A 4V3CA 4X54A 1E2KA 5TT0A 2VJDA 5EA2A 5FPPA 5HZHA 1I5EA 4HRXA 2EX0A 4EHJA 3C3DA 3FYUB 3ITDA 2JVJA 5A4IS 3ZIAA 4DJAA 3OD5A 3U3DA 1PWEA 3DTNA 4PIMA 5IKPA 1U9IC 3E1GA 4K8OA 4A23A 1TLLA 4BWGA 2FSUA 3ETJA 4XD7D 2FFAA 3I05A 2CDAA 2XXBA 1CETA 4Q05A 3CSDA 3LK6A 3IMCA 3FVTA 4UU8A 2SECE 2RIRA 2COUA 1IBCA 5FOQA 1ZZGA 1IHPA 4C5AA 3ANXA 1D1PA 3EBPA 3ADOA 1U5CA 3TH5A 2XRFA 2A9OA 4A82A 2I6UA 3R09A 4RETA 1MC8A 1CVIA 1Y3DE 2H1CA 3RYHA 3LKBA 1JBQA 1NQVA 1T9CA 3TVDA 4XYBA 4RXMA 5DBOA 4WXEA 4HAZA 4DQXA 2ORVA 3ESDA 1MIHA 2XCRB 1CDDA 4PGMA 1KDTA 4UULA 3BH0A 4HNRA 4EW1A 4RQAA 4WW0A 4ZXPA 2ZBDA 2PV0A 1JXMA 5IRCD 2QRVB 1UBFA 2HHHB 2H00A 1J25A 1CQWA 1FE8A 1L9XA 1NBAA 2W4MA 2CT8A 4RIIA 3TI9A 1UEXC 1MB0A 3AESB 2B6NA 4C22A 1GT91 1ZGAA 3CONA 5LZ4A 3ZLUA 2Y1XA 3B3QA 2Z08A 3D7MA 4RLFA 4TS9A 1IZYA 1Q57A 1HSZA 2WAMA 3WLNA 4F4CA 1Z0FA 1VGQA 1IK4A 2YRWA 4P6VF 4BOYA 4EJ6A 4QJ3A 3KHTA 2OWDA 2GKGA 3JWEA 4YH1A 3BEOA 4R9UC 5B1YA 5K4GA 3V1UA 1Y8ZA 4K9NA 3UT5A 5EVJA 4P4SA 3UGQA 4ND3A 1LUAA 1N2HA 4ATNA 3ZUPA 4B3DA 4BCBA 1YZTA 2A0XA 4QGBA 3TSYA 3WWCA 2ZWVA 3HL0A 1P6UA 2YUTA 3OP4A 1T8YA 3K0FA 4S2EA 2I8AA 3L6UA 4PQFA 4AECA 3CLRD 3FPSA 4OSOA 4R9SA 1OA0A 1ZS9A 1PNVA 3QVWA 1G3IA 3RODA 2IOQA 4JYZA 2FZ4A 3G0OA 4ETNA 2H29A 2X3FA 3R9WA 1QJ4A 2BAGA 1ND5A 2AE2A 3DEJA 5LQMA 2RGDA 1AUOA 1XVLA 1OXBB 1XCJA 2FWBA 3CNNA 3E7DA 2QUIA 3LBNA 3M6LA 4DMMA 3C3MA 5GWXA 1MIOA 4E03A 2VDJA 1C7ZA 2QYOA 2WPDD 3GAZA 5EUMA 4YQEA 2P4QA 4BO1A 3GLIE 2UU9B 2V3CC 1EM8A 3I04A 4URZR 2YWCA 3JWIA 3OUTA 4DOMA 3L8YA 5AJHA 2OBFA 2J8ZA 2R8RA 4TKVA 4Z54A 4Z9BA 3O8OA 1J70A 4EVSA 5CH5A 5CDYA 1XQVA 1ZA2A 3EWNA 1IVNA 3VJMA 4CM8B 3EASA 1YL7A 3LUPA 5D3MB 4Q4AA 1G0NA 2GM9A 3TDMA 4QBGB 3PDJA 1O4WA 3NEPX 3QYAA 4AZ0A 4L07A 4OGGA 2UZIR 2BEVB 2VN8A 3H6HA 3KZKA 3NEJA 1KORA 4MV5A 4J0JA 1Z6ZA 4LDRA 3E7PA 1S8OA 3WADA 2WZCA 1ABFA 2I5PO 3A14A 2YFKA 4BAZA 1P3DA 1WDMA 3AO0B 4PGFA 1CIVA 2VF5X 4R69A 4TWAA 3OFKA 4D79A 1N0IA 4R4JA 5GONF 4O3FA 3EXEA 3MGAA 5FQNA 5IYZB 2HH9A 3AEYA