1I6WA

The crystal structure of bacillus subtilis lipase: a minimal alpha/beta hydrolase enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Bacillus subtilis lipase: a minimal alpha/beta hydrolase fold enzyme.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords LIPASE A
total genus 62
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i6wA00
3DKRA 1A7UA 5HF9A 4B81A 1CUBA 3PFBA 3STTA 1LPMA 1QIEA 2WHPA 2XLBA 1ISPA 5A71A 1CR6A 1XZEA 4H18A 4AQDA 2OAEA 5AI6A 5SYNA 1ZGBA 4QEKA 4ZREA 3WL6A 1ODCA 4CCYA 4TVKA 4OYYA 5EFZA 1ZD3A 5ALNA 2XUFA 2CMFA 4KRXA 4X93A 2YH2A 4G4GA 1DU4A 5K3FB 5E4TA 2JGFA 2LIPA 3TJMA 2QS9A 3G0CA 3N2ZB 2RHWA 2X5XA 3FVRA 5EIAA 3RM3A 3WK8A 5AOAA 3F97A 1G66A 2W6CX 2WILA 4DMKA 4OYLA 4G8BA 5ALSA 1G4HA 2JF0A 2GBCA 4MJ3A 3YASA 2JIDA 2J3QA 5ISMA 4J0HA 4JYMA 3DEAA 4UBLA 3ZI7A 4AMZA 1EDDA 5HK9A 1TCBA 2QUAA 1G42A 3V1KA 4HRYA 1E89A 3H17A 1GT6A 3ESCA 3C8HA 2XT0A 4FTWA 3O95A 4ZV9A 3ZLVA 5CH8A 1JU3A 2PSJA 4DMHA 2H7XA 2J4CA 4D9JA 2VA9A 1EINA 3IVMA 5FKJA 2YXPX 3P2MA 4CCYB 1VZ2A 1R1DA 3DD5A 3WIBA 4X85A 2O7VA 1JMKC 1ZD4A 3L1HA 4FLFA 4QWWA 5AM5A 2BKLA 1QFSA 5AM1A 5EHNA 3FLAA 2VJBA 1C7IA 4EHBA 1UK9A 5EGNA 1VXRA 2ROQA 2ZVDA 1RP1A 2VJAA 2BCEA 5HF8A 1A8UA 5ALFA 2WFLB 4JEIA 4LYDA 2JEYA 4L9AA 3STWA 4HTAA 3V1NA 1CQWA 2HIHA 1EDBA 3NOXA 3LIIA 3AINA 3DQZA 2C7BA 2DQZA 1VE6A 2BUCA 3WWPA 4XJVA 1ACLA 3QBJA 2GYVA 2WTNA 4DYHA 2CZQA 3C70A 1QIGA 4GBGA 3HLKA 2XUAA 5KWIA 1Q84A 5EHZA 3OG9A 3H1BA 2XQFA 1HQDA 4FBLA 4BZZA 2HA6A 1LZLA 2RONA 2R8BA 1DWPA 1XQWA 2Y6VA 3GROA 1YS1X 3WK9A 2E3JA 1GGVA 2QRUA 4IH9A 2PSEA 4Y9SA 3A70A 3DDUA 4B80A 2XUOA 5JD5A 3IB3A 1XQXA 1UWCA 2AJBA 1QIKA 4HXFB 4J0KA 4G9GA 3BDVA 3H19A 4UUQA 1FFEA 5CH3A 4CIAA 4XIIA 1QE3A 5AKJA 3O9VA 2HA4A 2HU5A 4GECA 1KU0A 3I28A 4X71A 1W1IA 5DYYA 3Q8WA 1H2WA 3VVMA 3LS2A 1FSSA 1GQRA 1NX9A 4BE9A 2ZYIA 5ALMA 1A8QA 3M82A 4GXNA 4UHCA 1GPNA 1KU6A 4DIUA 1ORVA 1IZ8A 1LLFA 1ETHA 1EA5A 3O9MA 3BXPA 4I4CA 2Y6UA 4GEGA 5C8VA 3K6KA 4IO0A 4UBKA 2QJRA 5LZ7A 4X6YA 4X3CA 4OB8A 1HL7A 1XZBA 3IUNA 4E11A 2G63A 4P9NA 2B20A 2XMZA 2W22A 4P93A 1F0NA 4BTVA 5AM3A 1K8QA 1W76A 1MPXA 4J0CA 3STUA 5JATA 4B6GA 4E46A 2HFJA 3G7NA 2J3DA 5AI5A 1CUWA 1MNAA 3V48A 2JGMA 4FMPA 3TGLA 2PVSA 1R50A 3I6MA 4WDQA 2X76A 4QDTA 1QIJA 3PI6A 1E3QA 1TCCA 5HFNA 1IMJA 4Y2TA 1L7QA 4CIBA 3D2CA 4KAJA 3HJUA 2JGLA 2O2HA 2CUTA 5T4BA 1ODTC 2GBIA 3F98A 5FPPA 2FUKA 5AM2A 3ED1A 2DQYA 5CURA 4EY5A 4H7DA 4BTLA 1CUYA 3O4IA 2VATA 5AP9A 1QJ4A 1XRRA 3E1GA 3X3HA 3C5VA 3LLCA 1BN7A 1WCYA 1C4XA 2VQ6A 3BWXA 4LIPD 5E4YA 2C58A 1ZI8A 1P0MA 1E8DA 4BP8A 4U2GA 5AJHA 1JMYA 2D5LA 1CUJA 2DHDA 2CJPA 4S0XA 2IX9A 3BL8A 4L3WA 4X90A 4N5IX 2Y2UA 1MX1A 5AK5A 1O6FA 1TRHA 2WHPB 4UFPA 1GXSA 3RKSA 4BAUA 2OQIA 4U2EA 2WG1A 2G4LA 4BB0A 1CUCA 3I2HA 5K3EA 5A62A 1W4LA 4X91A 3GZJA 4F60A 4FHZA 5T4EA 1U2EA 4KRYA 3STYA 4A16A 4C4ZA 3I2FA 4X95A 2HL6A 3ANTA 1TCAA 2DHCA 5BWBA 3QMMA 2VTVA 2WIDA 1MX5A 5LZ2A 3EF3A 3ICWA 1ZGCA 4K5QA 5HK8A 1EH5A 3WYDA 3S2ZA 5AKEA 3HXKA 1QFMA 1WB5A 1W75A 1UKCA 3DKKA 1WHTA 2O2GA 3CN9A 4Q3KA 1CPYA 1FFBA 4EB0A 1ORWA 2XMQA 2WSLA 3AJAA 5JALA 2VAVA 3O0DA 4BYMA 4B82A 1XQYA 4W1QA 4PNZA 4DTCA 5ALVA 3IULA 2VAXA 3EBLA 1CIJA 5IVIA 3T4UA 1K4YA 1UOOA 4OB6A 1USWA 4INZA 4BE4A 3KWFA 5JAUA 2WLSA 5KWJA 2QZPA 5HKBA 5K3DA 1CUZA 1K5PA 3B12A 5A6VA 3BF8A 3HABA 2WIKA 3FSGA 1YAJA 4H7IA 5ALEA 3FCXA 3WZMA 2PBLA 1Q0ZA 4UBNA 5K3FA 5BWCA 1JFRA 4L72A 1AZWA 4IQ4A 2QVBA 2G5PA 1LPSA 1L7RA 4L0CA 4EBBA 4FFWA 3G9UA 1R88A 4TPKA 3SK0A 3RK4A 2Z8ZA 3ICVA 4PW0A 1AMNA 1CEXA 1VXOA 1PFQA 4ARAA 5AI9A 5FUMA 4HZGA 4QLOA 5JIBA 2HA2A 3I2JA 1TQHA 3I2KA 5ALKA 2WUFA 3G0DA 3GELA 5JAPA 1VOTA 4G5XA 4N8DA 2CEKA 3V1MA 2C5GA 4QLAA 2P8SA 3OC0A 1E5TA 1YCDA 5CMLA 3I6ZA 1AQLA 1B6GA 4E15A 5C8XA 5I7UA 3N0TA 1N1MA 1Q0RA 2I3DA 4MYSA 1QIMA 2RI6A 1AUOA 3E4DA 1CUSA 4UBOA 4NS4A 4ITVA 2OQVA 3ZLUA 1R9MA 1RWQA 4TGLA 1VZ3A 4EY7A 3W06A 5FLKA 4UHHA 2XI4A 2OAGA 1GKKA 4F5ZA 4KACA 5ALPA 4Y2UA 3UUEA 1MN6A 2WQZA 4BAZA 5ALLA 2G5TA 3O4HA 4PF1A 3AIKA 1MU0A 1T2NA 4HVTA 5FDFA 5IH7A 2XMCA 3I1IA 3FAKA 2VT6A 4FOLA 2XLCA 3LCRA 2BUAA 5FOQA 3I6YA 1EK2A 1XZAA 1XZGA 1DWOA 3STVA 2OCGA 2QKYA 3IUJA 5LKRA 4GW3A 1AC5A 4WY5A 2H1IA 1JJFA 4OUKX 2QUBA 1FFAA 1N5RA 1GKLA 4LHEA 5HCUA 5K5EA 4DNPA 1H2YA 5D3ZA 2OGZA 3WIOA 1FJ2A 3QYJA 4J0DA 1Z68A 3PFCA 4N8EA 5AK3A 1H23A 5LP1A 2VJDA 1QIFA 1HKHA 2NW6A 4ZRDA 2QOEA 4JUIA 3C45A 1BEZA 4J03A 1QO9A 5JZ9A 4QDXA 2BJHA 2C4HA 1XZKA 1U4NA 1ZJ5A 5JYCA 5DYTA 1FFCA 1YSCA 4UFOA 1JJBA 1UK6A 4PV7A 2QXUA 2GBFA 4G1FA 5EI5A 2HM7A 1N5MA 1EI9A 5ALUA 5A7FA 2QT9A 4FKBA 2XUDA 4BAGA 5D6OA 4B0PA 1YA8A 5CT8A 2ONCA 4PO3X 4KR0A 4B7ZA 3H0CA 3U0VA 3FLBA 4GLBA 5ALDA 5AICA 5KBYA 2PU7A 3KXPA 4KE8A 3QMVA 4AN0A 5I9IA 3AIMA 5CT4A 2R11A 5J3JA 4Q05A 1TIBA 2ACKA 4IH4A 1KEZA 4BBZA 2WUDA 1QIHA 4G9EA 4KE7A 1DT3A 4MWSA 3CCBA 4BVLA 4FBMA 5AHXA 1E8MA 1EK1A 1VLQA 4LYEA 4Y2VA 2QR5A 3IBTA 4UBJA 3JYHA 4FLMA 2XUQA 4NMWA 2AXEA 1CQZA 3SWWA 3D2BA 2OCLA 3H2IA 3HEAA 3C6ZA 4BRZA 1ZOIA 1BCSA 3G0BA 1GPKA 3C43A 4B85A 2VT7A 3HI4A 2CBGA 1XFDA 2PX6A 1H2XA 1ZI6A 3WZLA 3R41A 4GI1A 2X8BA 4H7HA 3W05A 3DCNA 2OCKA 2V9ZA 4AZ3A 1SOMA 4OPMA 3LP5A 4W1RA 4QZVA 5BOVA 5DNVA 4GDMA 4C4XA 1K63A 3FVTA 3OM8A 4WY8A 5LZ5A 1UZAA 5JD4A 5C81A 5CTAA 2O7RA 1LBTA 3A2MA 1J07A 4B9EA 1LPAB 4C4YA 4MQLA 2ZJ7A 3WL5A 3QM1A 1XQVA 4LKOA 3GA7A 4CG1A 4DGQA 3VKFA 3AZPA 4AO7A 2WTMA 1TKRA 2WUGA 3C6BA 4WCVA 4BCCA 5AKIA 4KJXA 5ALGA 3IUMA 5E2IA 4BCBA 3BIXA 4IHAA 2B9VA 4ZXFA 1XZIA 4GWLA 3WK5A 3F9CA 4Y2SA 3CN7A 3D5EA 3H2JA 4RPCA 4W9RA 2UZ0A 4GHWA 1J06A 4WFKA 4LXIA 1EVQA 1LBSA 3EQ9A 5ALYA 3DS8A 2CB9A 1QLWA 2BUBA 4EA6A 1XRQA 5EIEA 3ZLTA 1XZCA 3WKAA 1SFRA 4X92A 3D7RA 4EUSA 4DMCA 1XLUA 2V97A 2IITA 1QO7A 1K6EA 1DINA 5C8ZA 1WPRA 3R3ZA 4K6GA 4CG3A 1GZ7A 1A8SA 4K2AA 3WKCA 1CUEA 3WWCA 3K9BA 3PDCA 4FLEA 3OURA 4U2BA 1F8UA 1UKBA 3W04A 1LGYA 1CUFA 5ALTA 1MT3A 3A2NA 4ZV7A 3W9UA 1CLEA 3F96A 5CW2A 3HSSA 4QDUA 3ESDA 4J7AA 1F0PA 4X6XA 4IH1A 1XRPA 2WM2A 2C5FA 2WHQA 4Y2YA 5ALQA 3AUKA 3AILA 4C87A 1Y37A 2XMBA 5ALHA 3DLTA 1IUOA 1E66A 3KDAA 3UUFA 5EHXA 1WPXA 3HC7A 4Q1VA 3UMJA 4G4JA 3WQHA 1ZD2P 3WMRA 2JBWA 4B83A 3PICA 3OPMA 2H7YA 2GYUA 4BP9A 2XDWA 3MUOA 1W6RA 4AXBA 4C01A 3QH4A 4OU5A 4P92A 2WKWA 3PF8A 3Q0TA 1JJIA 4UHEA 1VE7A 4BZWA 5AKXA 1LPNA 4X6UA 5AO9A 2HHAA 3G9XA 4MYDA 2OGTA 1F6WA 1X70A 2ZJFA 1IZ7A 1WOMA 2PL5A 2WUEA 5F4ZA 4PQEA 2HDWA 4LXGA 5FXMA 1MNQA 5AK6A 1Y7IA 3GFFA 2WIJA 5JZSA 2QTBA 1XZMA 3VJLA 2BAGA 3BIWA 4AN1A 5HQ3B 3TEJA 1U8EA 3WL7A 3WA7A 5BV7A 2ZYHA 1RYYA 3H2KA 4H7EA 1EHYA 4X7BA 1TK3A 2JGIA 1UXOA 2WG2A 1UK8A 4RNCA 3R3UA 5AKLA 5IKXA 1XLWA 1AGYA 3DOHA 3A6ZA 3ANSA 4Y2PA 3NGMA 2JGEA 5JANA 2XUKA 2XUHA 1ZICA 5CRIA 1VJ5A 3SC2A 2Z8XA 1MX9A 1BU8A 1DX6A 5AKYA 3FWHA 2K2QB 4FNGA 3VJKA 3T52A 2WFLA 3C5WP 2B61A 3DYIA 5SYMA 1AURA 3BJRA 4CI9A 4BC1A 3IA2A 3L1IA 3D0KA 1CUXA 1N8SA 1UOPA 3K2IA 2DFPA 2EDCA 5AKZA 4UBMA 3STXA 2PUHA 1SCKA 1XROA 4N8SA 3O4JA 3IIIA 5CXXA 4MWTA 2HA3A 3WL8A 4Y2JA 2YYSA 1WHSA 3IDAA 4BVKA 1LZKA 3FSGD 3GBSA 4M0EA 1MAHA 3WKEA 1XLVA 5JD6A 3HACA 3FBWA 5ALIA 1Y7HA 3WJ1A 4DSAA 4I3FA 3A2LA 2PPLA 1THGA 4M0MA 4BVJA 5DNWA 3KOOA 4WFIA 2AJCA 3QITA 4HAIA 5JARA 4X00A 4Y7DA 5HKAA 1VA5A 3AFIA 5LZ4A 2CKMA 3QZUA 1EX9A 1H2ZA 2OXEA 2HRRA 1XZDA 1LPOA 2HA7A 3G0IA 1JI3A 4AMYA 1O6GA 5AH0A 3KD2A 4FNMA 1R4ZA 1R9NA 1OILA 3V1LA 2I03A 3G8YA 1AX9A 2BGRA 1SCIA 2XUJA 1LPBB 4DM7A 1NU6A 2JEZA 4U2DA 4PSCA 4KYVA 3G9ZA 5ALXA 1MO2A 5H3HA 3QPCA 2ZSHA 3FYUB 3QPAA 1XZHA 3EQ7A 5AOBA 4JNCA 3C87A 4QDZA 4UPDA 1DQYA 1I6WA 2RAUA 2PKYX 3R3YA 3EQ8A 3ZWQA 5CT9A 1DTEA 2XMGA 2XQGA 4KE9A 5AM0A 1CRLA 3GUUA 2DR0A 1HPLA 5FPQA 2VF2A 3FYTA 5K3CA 2PU5A 1UOQA 2WJ4A 3DOIA 4Y2RA 1GPLA 4Q3LA 3FCYA 3F67A 3RLIA 3R40A 4Q34A 1XRNA 4WJLA 5LLSA 4UFNA 2XB6A 1UFOA 1BRTA 1LNSA 3W9BA 4HRXA 4W1SA 1A88A 4C6HA 1R3DA 5HQ3A 5K3AA 2WFMA 3E3AA 4PSDA 5AI4A 4ZI5A 1YA4A 5AKHA 2ECFA 4W63A 4WDRA 4A5SA 5EIHA 2WU4A 2OLEA 5IVDA 4MQMA 2QM0A 1VA4A 1CFJA 5HFAA 5LZ8A 5AK4A 3G02A 4OB7A 5DTIA 1QTRA 2HA5A 3HYSA 4NZZA 1CUUA 1HDEA 3BDIA 2XMSA 4X94A 5LKAA 4QWMA 5K3BA 3WWEA 3HZOA 1BE0A 2D0DA 2ZYRA 2Z5GA 3SX4A 2PSDA 3I1YA 3D3NA 3S8YA 1DQZA 4QDOA 4HS9A 1P0IA 1GQSA 5ALWA 4U2FA 5ESRA 2XQJA 3R3XA 3JWEA 4B9AA 5AIAA 4AO8A 2ZYSA 5DTJA 1M33A 4BATA 3ESBA 4KAAA 4DNQA 4N5HX 3VDXA 2AJDA 4DNOA 2PSFA 2WG0A 3QPDA 2ZJ6A 1DWQA 4G8DA 3QVMA 3H04A 2WIGA 4EY8A 4E14A 3WA6A 4UHDA 4JH0A 2HU8A 4JYPA 1XKTA 3FYUA 4OU4A 5CXUA 3VVLA 3DJYA 2Q0XA 4XVCA 2WHRA 4O08A 1T4MA 1CUHA 4I19A 4OCZA 4X97A 3WK7A 4FDMA 3D59A 4NVRA 3IURA 3BE8A 3H18A 3ILSA 2ZSIA 5AKGA 1ZIYA 2XQKA 4YASA 4Y2XA 4F0JA 4AX4A 2EDAA 3AZOA 5HF5A 1X2BA 2AJLI 2IIVA 2VJCA 4C89A 3ZPXA 4ARBA 3JW8A 3WJ2A 2DCMA 5I8PA 1CUGA 3R0VA 2Z3WA 5LIPA 1QGED 1P0QA 2GYWA 2OPHA 2FX5A 4FWBA 3I2GA 2DSNA 1S8OA 4KAFA 2Y2VA 3PE6A 5HZGA 3VXKA 1WM1A 3KWJA 1XRMA 1QIIA 1WB6A 1Q83A 2WIFA 2H7CA 2RHTA 3G9TA 4UHBA 4B0OA 4MEBA 3FYUC 1UKAA 4HXGA 4WFJA 4AB1A 4XWGA 2HRQA 5C7YA 2HU7A 4YX9A 3B3QA 4P08A 3MVEA 1MJ5A 3BF7A 4QA9A 3H2HA 3W2TA 3AIOA 4ETWA 1P0PA 5D7BA 5A7HA 1U65A 1UT6A 3MUNA 3OTQA 2HA0A 1BEEA 2XUPA 1QOZA 4LXHA 1YB6A 4H7KA 1JT2A 4ZWNA 1EB9A 4BDSA 4RE6A 5CT5A 3M3DA 1XKLA 1BROA 3WYNA 1AKNA 4HXEB 1SCQA 1EB8A 1G5FA 3WKDA 2HADA 1QIDA 4CFSA 4KEAA 5ALOA 4H7JA 4EZIA 2O2IA 3WK6A 4Y2QA 2QMQA 2XUGA 1BN6A 4AZ0A 2GZSA 3FNBA 5IVKA 5E4JA 4QNNA 3WWOA 3U1TA 7YASA 1C7JA 4J0JA 5YASA 1IVYA 2WU3A 2H9YA 4DNFA 5D3KA 1H22A 4U2CA 4F21A 1PJAA 3ZV7A 5A2GA 3PUHA 1QONA 1ZJ4A 2RGUA 3WK4A 4C88A 4G8CA 4RE5A 2Z3ZA 1L7AA 3L1JA 4EY6A 3B5EA 1EDEA 1OCEA 2AJ8A 4W1PA 3FLEA 3V9AA 1OXMA 2OGSA 2GBGA 3G0GA 2FJ0A 5A7GA 1THTA 3MGAA 4J3JA 5JASA 4EY4A 5FV4A 2XQIA 4Z49A 3WLAA 1JKMA 3OOSA 5EHQA 3IUQA 3C6XA 1J2EA 4MXDA 5JAHA 2ES4A 1XZFA 3PUIA 4H7FA 4ROTA 1DT5A 4OSEA 4Q82A 1DX4A 1IUNA 2XMDA 2I3ZA 1HBJA 2XUIA 4DLNA 1J1IA 5AIBA 5ALRA 2JGKA 1SC9A 5DLPA 1YAHA 3H1AA 4CG2A 4J0GA 3R3WA 4A23A 4BDTA 2OG1A 1CUDA 3O4GA 3PF9A 5AOCA 2BFNA 2OCIA 1YS2X 3WWDA 3WKBA 3NUZA 3BJMA 2V96A 4H0CA 3DL7A 3D2AA 4BC0A 2XMRA 1WB4A 1CV2A 1W52X 2WJ3A 4YK7A 3M83A 1QZ3A 5CBKA 1EVEA 4B84A 2DHEA 1XZJA 2ORYA 1E8NA 4DMFA 4KE6A 2Y1KA 1EXWA 3R3VA 2FJPA 1ZIXA 2QXTA 5ALJA 1ZI9A 3AZQA 3FOBA 2C0PA 2XE4A 3CXUA 1BS9A 4PSUA 1YB7A 1XZLA 1MTZA 1YR2A 3WI7A 4CCWA 5CT6A 1D07A 4RGYA 1QTIA 2EEPA 5T4HA 1XRLA 1ZD5A 3DYVA 2QJWA 4K6HA 4ZGBA 3LIPA 4H77A 1FFDA 4UBIA 5KREA 2YASA 5AI0A 3DNMA 5AM4A 1VKHA 5FP0A 3KSRA 1BCRA 5JAOA 2PUJA 2VEOA 2GZRA 1IUPA 3VJMA 4QE3A 1JU4A 3DL4A 6YASA 1CUVA 4BRSA 5DYWA 2C0QA 3EIOA 4FFVA 3D4LA 3TRDA 2JGJA 3RARA 2VSQA 5T4FA 5LZ9A 1ACJA 4MEAA 3ESAA 4M0FA 4YPVA 1PV1A 3HRHA 2ACEA 3C6YA 2PSHA 4XX1A 4J0IA 1CUAA 5CH5A 2PM8A 5FRDA 5LYYA 3QMWA 5HF6A 1YASA 3NWOA 2HFKA 4G4IA 5DJ5A 5DNUA 4K6KA 4BCDA 1UK7A 1CVLA 3E0XA 1HLGA 3VISA 5IVHA 3I2IA 2WJ6A 5ALZA 4AO6A 5JADA 1TAHA 1CUIA 1ODSA 2WFZA 3M81A 3CCCA 5DWDA 2BGNA 2I78A 2V98A 4UHFA 5JZBA 4V2IA 4DSZA 4OD0A 2RIPA 3H2GA 4H35A 1B41A 5AKKA 1X2EA 4Q3OA 3C8DA 2J4FA 5AI8A 1NU8A 1LPPA 3F8SA 2B4KA 1MAAA
chains in the Genus database with same CATH superfamily
1E3JA 3DKRA 1TT7A 2EBUA 4HLUC 3RHTA 3BK2A 3HGQA 3SXUA 1Z74A 3ZGOA 1XYVA 1GCAA 4BZPA 3ECCA 5IWCA 3K31A 2H5EA 1RHMA 4F4JA 2FWMX 2ZI6A 5LBUA 4GZ6A 2XKJE 5F52A 2R1ZA 2G06A 1ATZA 1QIEA 2ODWA 2WHPA 1WNTA 2XLBA 2Q4TA 3FYHA 4KFSA 4Q3NA 1QKJA 1TEVA 4YRCA 2IZ7A 4AZ3B 2FPWA 2I3BA 1IJFA 1GUZA 3IEUA 4KAXA 4ND6A 4N39A 4QAJA 1BXZA 1KTVA 1L5GB 4EMBA 3O8CA 4OI0A 1Y6RA 2I54A 3IMCA 1JZQA 4IX9A 3WL6A 3BE6A 4ZO6A 4CCYA 4MW1A 3OZUA 4X63A 1PBTA 4DAOA 2PH7A 4TVKA 1I9GA 3AUTA 1V41E 5EXXA 2Z1DA 3AF4A 5TEWA 1BVRA 2DBVO 3KUXA 4M99A 1KJ8A 3QE4A 1K7EB 2Z8YA 4KRXA 3T3MB 4A26A 3NXKA 3JVVA 2GBPA 4MDEA 4B3GA 3RGGA 2JRCA 2AMVA 4ED9A 2G6TA 1O5OA 2JH8A 4JXZA 4W5QA 1T1SA 4V0QA 3BKXA 4X84A 4MW4A 2J3JA 2BONA 4N3NA 3TJMA 1FS4A 1S9HA 3LUCA 4JJ6A 2W2KB 4HN4B 1YGPA 2CMHA 3PHLA 4D9MA 2RHWA 4WMLA 2ECQA 3RM3A 3RU2A 2PMCA 1ID1A 1Y89A 2A78A 4ZARA 3GNTA 3M6VA 4F6RA 1A76A 1JR3E 2JD2A 1JEQB 4JGIA 3ZCXA 4C4SA 1K97A 2WILA 4PLZA 4BQEA 1E96A 3HCDA 3BK1A 1R0SA 4ER6A 1X1DA 4LE1A 5E6RA 1PTKA 4TUYF 2WD8A 3ZNPA 4I4IA 4OIFA 4Y6RA 2O2JA 2O4UX 1QQAA 1RDFA 4P4NA 1KBQA 1E4YA 4GSYA 4UBLA 5E7IA 1TVKA 4FD3A 1EDDA 1ZUNB 4KWEA 4AMZA 2C78A 4A91A 3HXOA 1KDVA 2NP6A 4PLWA 3QXJA 2ZB2A 4YB8A 1RM5A 2QUAA 1W88B 2L0XA 5FWAA 2ID7A 2DTXA 3TO5A 4DT1B 1E89A 2J3HA 1GT6A 1VYTA 3ESCA 4MRMA 3U60B 4WESA 1E2JA 4BB6A 3TOSA 1T5LA 1G6Q1 1Y1LA 3DVAB 4HMPA 4BRWA 1F2TA 5IKEA 3GGOA 4N3BA 4ECEA 2VDVE 3B2EA 4UTXA 4R1LA 5E6SA 3PNKA 3ZVMA 1EM8A 1R0KA 2PNJA 1UPXA 1KI4A 3FOCA 4D9JA 3F7MA 3H6HA 3Q7PA 1MEJA 2WYHA 1EINA 2N1MA 5HJ2A 4F9EA 5KUTA 3U5TA 1MHPA 2YXPX 2HYDA 3P2MA 3Q88A 3QXXA 4CCYB 3PFWO 3UWMA 4POOA 3V33A 1R1DA 5IJ0A 3KJNA 1NMEA 3BMOA 3G85A 4QARA 3T1OA 3WIBA 5CAEB 1YMQA 3PJRA 4FOTA 4J2TA 1WSBA 2GD1O 2GM3A 3A36A 3PG5A 2JIZA 3R6TA 4P22A 4DY4A 5KNDA 3RTAA 2V6BA 2QMOA 3KQUA 3EPLA 4DG5A 2Q4OA 3TGWA 3MGKA 1MC8A 3L7LA 2NZVG 5LBIA 4WZBE 1VIDA 1I36A 3QVOA 1MBZA 4FCTA 4IPTA 4Q39A 5DN6A 4MVJP 1GAQA 3UMGA 2BKLA 3AVYA 1FVHA 4YJHB 3D02A 3KQNA 3THYA 3PXGA 1VKRA 1NFFA 1PDOA 3KP1A 3OUTA 4B3TB 3EXIB 1CB7A 4PE5B 2I99A 1T3ZA 1YFJA 5AVVA 3IAS6 1R8XA 3SS7X 2AQKA 3HVIA 4C3VA 2UZ4A 2LGJA 5C5IA 5AVTA 2ZP1A 2MR6A 1WMEA 4CIDA 5EXDA 2VHCA 2QTFA 3ZD6A 5DNEA 1K7SN 1G9XA 3NHYA 4I1PA 2ZPAA 5KNDH 4GYKA 2QK4A 4PXSA 4ZHQB 4LYDA 4OQZA 3ETNA 5EZ5A 1YR7A 3FZYA 4FFMA 7ABPA 1SUPA 2IE0A 2AD1A 2ZIWB 3EGCA 5AJXA 5J2TF 3QW4B 4HTAA 3HCBA 3F49S 4I81A 1T0PA 1JPVA 4Q24A 4O0MA 4B71A 4KLCA 3IQGX 3BJIC 2CNWA 4ZMBA 1OGIA 4MA0A 3AINA 5DISB 4OM8A 1ZCAA 3RJZA 1G59A 4GICA 1EUQA 1EYZA 2GEUA 1ACLA 3QBJA 1WCIB 3BWEA 1MJGA 2EWVA 2ZT8A 1A5ZA 4RTJA 3HYTA 4DYHA 1P1HA 5JVDF 1LWOA 4GBGA 1FS6A 1GPYA 2EKPA 3DBIA 4F11A 1RI2A 4C0WA 5KWIA 2RGGA 1A7KA 2PLWA 4I1YA 1KOGA 3M4ZA 4NCHA 1VGRA 4YRRA 1PQ4A 2AIRA 2XQFA 4DRYA 2BGMA 3AR8A 1RWMA 1L5YA 2P7HA 4MNTA 4V1CI 4UMVA 4BZZA 3WLHA 1EQUA 4R2KA 2B35A 2NMVA 1LZLA 2MMCA 3LHFA 1R66A 5LQKA 3O4FA 1DWPA 2EJUA 2JIOA 1UMCB 1XQWA 2WTAA 3IELA 5CVEA 2Y6VA 4ZVMA 4DLYA 4TMTA 1T3SA 1ZIDA 4MGIR 2IW1A 2NU7B 2YXNA 4H3SA 2Y92A 3BE4A 1OLUB 4B6SA 1LW7A 1GGVA 2E3JA 3TQHA 3UK6A 5D2CA 3VPDA 3VU9B 2ZBUA 2ADOA 2IL1A 1U0SY 4D8VA 2BH2A 3DW3X 4D8XA 3KQMA 4F56A 5HDBB 4HGZA 2PSEA 1HUQA 1Z4PX 4G24A 1ZH0A 5HKKD 2D6FA 2YIDA 4JELA 3DDUA 4PYNA 4B80A 2V5AA 3ZIAD 7GPBA 5JD5A 1MHTA 2MINB 2VHTA 2RGNC 3IB3A 4IG4A 1Z37A 1XQXA 4XQGA 4FCCA 4PRYA 3GAFA 2E49A 1HFEL 4KKVA 1QIKA 3PQCA 4HXFB 4JNKA 4G9GA 3N7UA 4X1OA 4UUQA 1J24A 3RFVA 1O94C 3VC7A 3ZEIA 1M8JA 1O03A 1AS0A 3A6KA 2O8BA 2BE9A 2W00A 1PGOA 5LMNB 3AY0A 3VUFA 2IZ1A 2VHUA 2QEQA 2VLBA 3IIEA 3KM0A 1WETA 1XEWX 1FXWF 5HWSA 4U5XA 1C1HA 1K8ZB 3E82A 4TOIA 3U4CA 4KHZA 3ZWWA 1X80B 1BH2A 4HXYA 3P0IA 3N3BC 3PIRA 4DDHA 1P1KA 2WKPA 1CY4A 3ZWXA 5LQAA 2B99A 1TUIA 1LEHA 1VG9B 1X3SA 1RPTA 3VV2A 1K7FB 2I80A 4P81A 3J81k 4BX8A 1Y1PA 3VVMA 4YV0A 4OL0A 4MRAA 1GKIA 4KO1S 3AG5A 4BE9A 1XJ5A 1N1EA 2AN4A 3HL4A 1JA1A 5ALMA 3WWYA 5JSZA 2PRZA 3ILYA 3M82A 3S4YA 2OFFA 1GPNA 1C0IA 4HMQA 2CJWB 1KU6A 3LBFA 4E6EA 1MB3A 3WICA 4FDAA 4IXWA 4XWTA 3EA4A 5F3WB 1YZFA 3P9IA 4AM8A 3AT1A 4PIPA 2G7ZA 2A58A 4ZJUA 1L4GA 2QRVB 2JCSA 3BXPA 4HNVA 5FI1B 5CFRA 5JEDA 2XB8A 3W6NA 1SCAA 2PUTA 2Q1YA 3DTVD 1SR8A 4GEGA 4OJTA 4DDMA 5CD9A 1G19A 1V8OA 4LDJA 3I73A 4MV4A 4IO0A 3WL3A 3QUCA 2EZTA 1RR6A 3L0OA 4PCUA 1IATA 3LYUA 5FUMA 4IOJA 1BVUA 5BSRA 3U7QA 1Q17A 2B8WA 4FWIB 3KVVA 4X3CA 1VECA 1V16A 2RSLA 3B36A 5TY0A 4F06A 1TAGA 3JSAA 2GVNA 5HIAA 4E11A 3QPVA 2G63A 4EYEA 2GDJA 2BN4A 1F8XA 3ZJ5A 5LP6B 4ZOLF 3GJ4A 3MHTA 1GUBA 2Z3VA 1Y6QA 1CBUA 4CM1A 1MH1A 1F0NA 2FSFA 5AM3A 1ZP6A 5JS7A 3GJZA 1K8QA 3C14C 1LQUA 4BXOB 4ZYXA 3W2HA 1W76A 2E87A 2YV1A 3EIQA 5CK4A 5B37A 1ABEA 3UICA 1COZA 3FJYA 3L8CA 1YQWA 3VPBA 4YCMA 2VWPA 3WLRA 1Q3TA 2R5WA 4LXUA 4LVCA 2YJZA 5I4BA 3CLRD 1E60A 4UCWA 4B6GA 2HFJA 1IOZA 4HWTA 1QH1B 4P3YA 1NJ2A 3BE5A 3OIVA 4LSMA 1JQEA 4RIFA 3SXUB 4RTSA 2ZWAA 4H16A 4IF6A 3V48A 1BH6A 1NJ5A 2JGMA 4N3GA 1UDWA 1QGOA 5ITZB 4FMPA 4PFSA 3V1UA 1HI9A 1WIWA 3GJ7A 2PVSA 1R50A 4Z3OA 3WTCA 1QO0D 5PNTA 3IEKA 4N0QA 3PCTA 3C8UA 2PTHA 2QSYA 4WDQA 3UB3A 4OBXA 3H4VA 4LYJA 4E31A 4JFRA 1QIJA 3BMCA 1KYYA 1XKQA 4U7FA 4ARSA 4KUEA 4DARA 1P19A 3CZCA 3CW8X 3PS9A 1E3QA 1JPUA 2XB9A 4PCVA 2CDRA 3M2PA 4MQEA 1PP4A 1TCCA 4EPVA 3CUTA 1H8HA 1MO4A 4AWBA 2ONYA 3MLAA 3H97A 2RK4A 1IMJA 1E1QD 1KR2A 1KYQA 4QGBA 4Y2TA 5IW8A 3ZDEA 4ZEMA 5KO2A 1O0BA 4L28A 3CR3C 4OEHA 4RSHA 1I2BA 1Y8AA 1UC9A 4DQDA 5CFOA 3HB9A 3G82C 3S81A 3OX1A 3WGMA 5DX0A 2ZGVA 5DN9A 2OBLA 2ZUSA 1FTWA 2UKDA 1Y1QA 2FK8A 4MR7B 4KXNA 4ZAFA 3SHVA 1UZNA 1IY9A 3IJEB 1XELA 5JISA 2EQAA 5T4BA 3ELDA 2AG6A 2GBIA 1D7AA 1V37A 2HLDD 2ZBRA 3K6JA 5CVVA 2PUCA 3FOAA 1IYZA 1E7MA 1VSUA 3PDWA 3TOCA 1R00A 2JI8A 1O9HA 3F2IA 2AG8A 3NB0A 2RHLA 3P9NA 4LBVA 3HUEA 4HH0A 1NUPA 2X9LA 5P21A 3RWOA 2XITA 4GQBA 3O2NA 4EY5A 1C2TA 4HH3C 2BBWA 4HNHA 3RRJA 1EFRA 1ZH6A 2RDMA 1E7WA 1PYGA 4LOLA 3O4IA 2HF2A 2IHZA 3X1MA 4EO4A 1DXHA 1L5QA 1K5DA 5AP9A 1JQLB 4QQKA 1BW9B 4UW9A 1XFAA 4ZVQA 5ADUS 1XRRA 5AJTA 2GCOB 4R8MA 5DK4A 1DOHA 1GLGA 2IP4A 3N74A 1V11B 3K4QA 1FTQA 3B5JA 2NO9A 3HU2A 1BN7A 4AKHA 3K8OE 1B0ZA 1WCYA 3I39X 2VQ6A 1NJFA 4R5HA 4D0RA 1EXDA 4JI8B 4TSFD 5GMOA 3BWXA 4I50F 4LIPD 1JIVA 1S2IA 2H31A 2YZKA 1U3DA 5E4YA 3SF8B 3OM9A 1ZL0A 2ATEA 2ODNA 5JDIC 3DL2A 3I42A 1P0MA 3C7KA 4WJZA 5EG5A 4E09A 3KX2A 3LQQA 3VC2A 3ZHUA 2V7EA 1XN4A 4PHHA 3E03A 3H8VA 3LX4A 4IXTA 5AJHA 5LYJF 2C59A 2QZSA 4GLOA 1XV5A 4OHWA 1DELA 1IIBA 3R0IA 2J7KA 2HC9A 3KJIA 5CJ2A 1T9ZA 2B78A 3SNKA 2DHDA 5KINB 1PJ3A 5FNZA 1M1YA 3OQOA 1XPOA 3BHMA 3C3XA 4ZC1A 1B8NA 1YI8A 2X7JA 4PXAA 4EKYA 2FUCA 4HQ6A 1BJKA 1GGKA 3C6QA 3NWBA 1MQ8B 4Q19A 2WJGA 1ABFA 1N7IA 4AZ0B 4BNZA 3I09A 4W5OA 4BLTA 4QXMA 3IEIA 5AK5A 1NMQA 1G63A 1TRHA 5B58C 2XB4A 4CFZA 3T06B 2J33A 3R7FA 1Y9EA 3VH1A 2BCJQ 1XU4A 4UFPA 3T95A 3ND7A 4MVJF 4KO4S 4WTOA 3BGDA 3BCSA 2HHJA 5FBVB 2WWWA 4BB0A 3Q40A 3I2HA 3TB6A 4AJ2A 2GCPA 5FTWA 1Y8RA 4JL6A 1IEXA 1N5DA 4OJMX 2QVYX 4ER3A 3WV4A 1K27A 2H4JA 3C8ZA 3W9SA 4JVMA 1DGQA 1H8EA 4FZJA 4FHZA 1E69A 4WEOA 2PE5A 1TFUA 2K2WA 4JB2A 4DGSA 2I91A 1F6DA 1J8FA 3F73A 1RI5A 3STYA 4OP2A 2AQHA 3CPHA 4GGOA 1NI5A 1KDYA 3QBTA 1JIIA 2AUMA 1E3WB 2GX6A 4Q4HA 4F3TA 1TCAA 4I50B 4OX9B 1E1MA 3HP4A 2UUBB 1QQ6A 3LL7A 3SJ7A 6Q21A 4JA2A 4O1HA 4Z0NA 1TYAE 3PGXA 2H65A 4OJQA 4HPJB 2O2CA 3ICWA 5M34A 1ZGCA 2QSUA 1T8WA 3TOZA 2WSIA 3S29A 3D0QA 4K9OA 1QH8B 4AX8A 2BM0A 2UYYA 3FNGA 3WYDA 4Z3KA 9GPBA 3O2QB 4IGKA 1QRSA 4YAIA 1O8CA 3T3OA 3IBYA 3PRJA 4RD4A 4WEQA 3RFFA 1BC5A 3WC4A 3PQ5A 4R51A 4B2PA 2FP4A 3EYAA 1B8VA 3IPCA 2BI4A 4J3FA 4HTFA 3C0KA 2BEWB 2O2GA 5J2UB 1Q1GA 1WWKA 3FUCA 4KQCA 4RV5A 1JR6A 2ZQYA 3DE5X 1JHMA 3PD0A 1V7CA 2BFCB 2OB2A 3MJTA 1CPYA 3MTGA 4FCWA 4Q3KA 4QYIA 4XQEA 3SXPA 4GM0A 2G76A 2XMQA 5TMBA 1B4DA 4MI9A 4GI2A 2XGMA 3RNOA 4O25A 3AJAA 2CXPA 2C5BA 1EFPB 3B6KA 2RK3A 4IF4A 4M6WB 3QSYA 4HGQA 2CLCX 4LY9A 3O0DA 2BELA 4I8XA 5BN4A 1WBBA 1P5JA 1V5WA 1BOOA 3P0RA 1ZJ6A 3W34A 4DTCA 1Q2UA 3ABRB 3D4OA 4P7JA 2UXBB 3AETB 3IULA 4Z2YA 1GUDA 4YGXB 5TQ0B 2PH5A 3OOYA 3EBLA 4B7XA 3RAEC 4R8RA 1CIJA 2X8WA 3UK7A 1ZK0A 3RRMA 4MV7A 2DB3A 1NXXA 3T54A 3FCUB 1LBEA 4HQOA 3QFSA 1NOJA 1RC8A 4WOPA 3HMKA 2N75A 4RD1A 4RWZA 2WLSA 1NXVA 3U9LA 4BE4A 4ZAWA 1NP3A 5FAKA 4NZOA 3T1TA 1X1QA 5K3DA 1K5PA 1JHZA 3B12A 2ZE5A 5HIIA 1QHHA 8AT1A 1V1JA 3CLTD 4F72A 2FVYA 1KC3A 5F35A 3T8YA 1N6PA 2ZI5A 5A6VA 5AHOA 1U4SA 2BDUA 2ZRFA 3ZWCA 4B3RB 4W7IA 1A82A 2HV8A 2PMDA 2UUPA 2WIKA 3U0BA 4BX3A 3K0CA 5KQPA 3II6X 1EVLA 2WR8A 3RFTA 3FCXA 3U6BA 3NDJA 5KC9A 2ORIA 3R7SA 3Q7RA 2PBLA 4UBNA 3THRA 3P94A 4W5WA 4ZQHA 4YJGB 1Z5ZA 3BQMB 4JJEA 1ORDA 1JFRA 3D3WA 2FSSA 4FU0A 2B4YA 3TLMA 2X0JA 2XDQB 2ZRCA 1JEYB 4F1WA 2I71A 2MYNA 2QVBA 3COZA 1PK9A 4A6EA 3H8WA 1C3VA 2G5PA 5FBWB 2DFLA 3WYAA 3VBEA 1N6NA 1T1IA 1GU1A 1L1EA 3H9QA 1NE2A 3L6BA 3TDMA 1Y98A 4E4RA 1DKQA 1JXOA 1S1CA 3INYA 4CMAA 2XH8A 1CR4A 5BNZA 4U3JA 2AC4A 3QKIA 4J4BA 3TRKA 4EQZA 4LHVA 2P5SA 4FFWA 1EHCA 2F64A 3G2LA 3G9UA 1KSFX 2NU8A 1QF6A 1U3UA 1NOIA 4ZQIA 4Y98A 1HYGA 5IUKC 1FU4A 1H69A 3SK0A 4ENTA 3E9QA 1YZQA 4LX0A 2FPOA 2WYUA 2Z8ZA 3MOIA 4KWTA 4RVOA 5JNRA 1ZM9A 1BE6A 1X9HA 3QFHA 3ASZA 3DKVA 4W5HA 5JXIA 4R2MA 4KFRA 4ZZ0A 1QYIA 1IEVA 1AMNA 2KBEA 1CEXA 5JJCA 1M2KA 4ZYTA 3EB9A 1PFQA 3OCJA 1C8LA 3L7CA 4HZGA 3MJFA 4J16C 4S1VA 1HE5A 1OMOA 1QR2A 3OOJA 2WWRA 4A0FA 5AW3A 4EB6B 3PBKA 3GLIE 1DJNA 1W36D 4FFBB 1DC6A 2A9VA 2WUFA 3G0DA 3GELA 2FSHA 5A03A 1SC4A 2Q28A 1BGVA 1G7RA 2X8JB 4G1MB 4FYJA 3B8EA 2QPAA 3KYDB 3E48A 4QLAA 3TZKA 4EUEA 4TVSA 1CS0B 3WRXC 5KYWB 1J2JA 3CNEA 2X8AA 3E9YA 3H4TA 3I6ZA 3IUEA 3QTLA 4KLAA 4LSGA 3V7WA 4ZKEA 5C8XA 2EG5A 2QI9F 3DE4X 1XG5A 2F00A 3TRJA 1RWBA 4F45A 1Q0RA 3MWYW 4M54A 1W0JA 2AFHE 2P9BA 5FJIA 1E1QA 2RI6A 4N6NA 3KTAA 3Q9UA 3G5UA 3QI2A 4NECA 1AN9A 3E4DA 3OQMA 4JI4B 5ULLA 3T7IA 4EFNA 3E1KA 3RIHA 3EEYA 4C2BA 1KMHA 3KQPA 1QDEA 4TGLA 4G6ZA 3UJ9A 3QWAA 3V7NA 1YB4A 1IY8A 3DLAA 4F5ZA 1CDZA 4EHHA 4MK4A 4U7JA 2CXHA 1PNVA 1I2DA 1ZGHA 4KC0A 1DMRA 3RQIA 2JIZD 4I1VA 3UUEA 3ZBPA 2X3YA 3VZRA 2WWIA 4F7DA 3F2VA 2AN1A 1YMUA 2YFYA 3VHRA 2DOKA 2J32A 3B85A 2NWQA 1JLRA 2EL9A 4FYMA 3JD2A 4JEMA 4N65A 1FIUA 2G5TA 2FG5A 2D3TA 1OZHA 2D1RA 4PF1A 2R8ZA 5JNSA 2XOEA 4HVTA 4M38A 3ZQUA 2QENA 4WFQA 5IH7A 1HM5A 3JYNA 2QMUA 3OQPA 1Z2OX 5SICE 1KGSA 2HTEA 4KPUA 4LXYA 4FOLA 3AQIA 4Y1EA 4FIDA 1RU3A 2Q5IA 2MHCA 3LCRA 3VVBA 4X0EA 4PG4A 1PDWA 5FOQA 2WM9B 4TM7A 4QYSA 1WUHS 3P71T 1T0HB 1DKLA 1JW9B 1G60A 1XZAA 2HR1A 5C5EA 4F3NA 3PIDA 1XZGA 4AULA 1EK0A 1EIZA 3WG9A 4LRWA 1A8PA 1OZGA 5K0ZA 4GW3A 4TRMA 1AC5A 3H5IA 3FKQA 4WY5A 1T3TA 4AG6A 2CFRA 4OUKX 3JQ9A 5B4UA 3ZHQA 2GPSA 3WB0A 1WXHA 2B82A 2IRWA 3KR9A 4XRGA 1N5RA 3OY2A 5CVTA 1E2BA 3WO1A 2BGKA 1RHUA 3AKEA 4MV8A 2OT3B 2F2TA 3HCCA 5HCUA 1I7SB 3SQXA 3OLQA 2Z4RA 4JI6B 5K09A 4DNPA 2XZDA 4RZSA 2JGDA 5AW4A 3LV8A 5CLGA 3EQZA 2A5LA 4M1TA 4GXTA 1FLNA 1SIUA 2OGZA 2R85A 3RREA 3KVOA 4DV1B 3MMPA 1FJ2A 2NU9A 1FW8A 4ROSA 5JCJA 1SUIA 5KEIA 1NG9A 3BFPA 5KQGA 1B2RA 5FHQA 3O90A 3PFCA 4N8EA 2A6PA 2ZSEA 1DRUA 1E59A 3L7BA 3E35A 4YT5A 1GY8A 2ZT5A 4QULA 1H23A 1L4KA 1G16A 1U3VA 2PMFA 4P3KA 3I23A 3TG8A 2HDHA 1YL7A 2LKDA 4U1RA 5K2MA 1AK1A 1PG0A 4FZRA 1JH8A 2IYFA 2SNIE 4Z0PA 3CVUA 4CJXA 3TECE 4DCMA 2QOEA 4NU5A 4RA9A 1GEGA 1EHIA 2CC2A 2Q0SA 4M2LA 4ML3A 2C4HA 1U4NA 5F1KA 1X19A 5ARBA 3N8HA 4QEZA 5IHPA 2FPXA 4UPEA 3GIWA 2IYYA 5I4IA 2QYHA 1TX4B 1YSCA 1XD2B 4HDQB 2CFTA 4KGXA 1UK6A 4PV7A 2Q7OE 5DM0A 2JI4A 3LBIA 4EABA 3DBLA 4G1FA 4QHYA 5EI5A 2P9QA 2OWDA 5KJEA 2H0QA 5ALUA 2I6GA 4CU2A 5T41A 1T4CB 4FOOA 2QT9A 4FKBA 3E0QA 1EGMB 1XQ6A 3IQIX 3L1VA 4XUGB 3FGPA 4KFCA 2ZLBA 4PQYA 3GA5A 3DAHA 3O75A 5HKKA 2DTEA 5JBNA 4AUEA 2OKCA 4TMZA 2C2KA 4KR0A 4LYFA 4ND3A 5L7TA 2JKZA 2PQ0A 1ENOA 3RVLA 5IBPA 4IIJB 5KVCA 4B3DA 2JFGA 3FFAA 2HMAA 4S12A 3RB8A 4CG0A 4O3MA 3RVJA 3HVKA 3K9CA 5L3ZA 1XWWA 1T9HA 4EZEA 3ZTTA 4K6MA 2FOLA 4YH1A 3MD0A 1RJ9B 3U0VA 3WLQA 5C80A 4D1YA 3T41A 3OICA 3LW7A 1GRRA 1WUIS 2P9ZA 1UFQA 4BN4A 4BL5A 3BFXA 4Q93A 1G3QA 1TJ3A 2YV2A 1RPAA 3DZGA 1DAHA 2XZOA 4HQFA 3UKOA 4UUNA 4LX8A 4PM4A 3LLVA 1JV2B 2YOFA 3QJGA 3SX2A 3F9IA 1EGVB 1KZ4A 2EFEB 4UD6A 3KT8A 4CKCB 3S1LA 4HL6A 1QU2A 4YJDA 1UJBA 4KLNA 1UM8A 4U9UA 3I05A 5D7NA 3N8GA 2P7IA 3U4QA 4PQRA 2DVMA 4Q05A 4QQRA 2E6UX 2AI3A 2Q6KA 3A7EA 4XEHA 4YLGA 2ZB4A 1STOA 3JR7A 4BBZA 4FYKA 5EMKA 3WGQA 3M6UA 2J09A 4G9EA 4DPLA 2FPMA 2FEMA 3IQEA 4D9HA 1GOTA 1VRVA 1VIVA 1DT3A 2EERA 2Q4DA 2XR1A 3KYCB 4H3HB 3VU1A 3AM3A 3N39C 5ERYA 5J40A 4LECA 4MLZA 8MHTA 8ATCA 3RYTC 1XT6A 3HCOA 3W4JA 1SC3A 4G0QA 3K6RA 3WXBA 4BWVA 1Z7BA 2OO5C 4EG3A 1ZUD1 2D2IA 1DUSA 1Q14A 5EZSA 1ITZA 4HUQA 3CRQA 3O6VA 1M73E 2X8LA 1E58A 1TVKB 3H9UA 3HTXA 2XF8A 2EJTA 3UXEA 4DW8A 3ZU6A 1AIPA 2QR5A 3IBTA 4IJQA 3JYHA 2H3EA 4FLMA 4KO3S 4YRDA 3T9AA 3HR4A 5M5BA 1RZRD 1WBJB 3OX3A 3MJ4A 3O94A 4KNWA 1LS6A 3M9LA 3NNSA 4JT2A 4NMWA 4R8LA 3SYRA 1CQZA 2H5JA 2IC5A 3DT6A 3N8DA 4RCYA 1U5BA 5LXTB 3SWWA 1CF4A 2HZ7A 1EFUA 3HDQA 2VF5X 2OCLA 3CLVA 2ZJ2A 1SCJA 4FS8A 5AXBA 3QFTA 1QP4A 3U62A 5JROA 1P6XA 5KNBH 4M7OA 4YT2A 3C6ZA 3VNSA 5IF3A 1GPDG 5CGZA 4BRZA 1FVFA 1QDUA 1NI3A 1Z5WA 1ZOIA 1WXGA 5GGXA 3P0JA 4JL5A 2QMEA 3LWNA 3QE0A 6NULA 2ORWA 4DB4A 3ND6A 5JDCA 4OKSA 1U0FA 4LBYA 3PX7A 1J20A 2EZ8A 2FUNB 1R7RA 1ZI6A 3ENQA 4QYXA 3W7VA 2XRYA 3RVDA 3WZLA 4AJEA 2QMYA 2C5HA 2BSAA 4Q4JB 4LISA 1W5EA 3MGGA 2PX8A 1WZEA 4LY0A 3DCNA 4MP8A 1N57A 5C1OA 3ZOKA 4QO7A 1P4HA 1CRWG 2DUWA 4ESVA 1MC5A 1L1RA 1RZUA 1SKYE 3HJCA 1FFYA 2XXAB 4AZ3A 2JVJA 1U8CB 5A1TA 1WMFA 2ZIVB 2IHKA 2Q3BA 1UMCA 1GZ6A 2QG6A 3DOJA 2AKYA 1Q0UA 4W1RA 4BVAA 3TRHA 2BEJA 4YECA 3DTNA 2FFJA 4BO4A 1Z7YA 2GXSA 4DILA 1K63A 3E9EA 3FVTA 1ZQ1A 2WW8A 1V1MB 3GJ3A 5BSKA 2PT6A 1FFWA 1SQ5A 1EUCA 2B6HA 1YS9A 2GBLA 3D64A 4GVXA 5FO1A 2WZCA 3IEXA 4IMIB 3HA7A 2RHOA 5LZ5A 4C0KA 5AVWA 1UWKA 1N1GA 2HLPA 4OQXA 4MITA 2CY0A 2OHOA 2V3CC 1DKMA 1U3FA 2O7RA 4L15A 1LBTA 1J7JA 3I2YX 2NSLA 3GCWA 5AW8A 2J9GA 3UANA 2FW0A 3U9SA 1WPGA 3V3TA 4C4YA 2ZJ7A 4B35A 4LZNA 2OFWA 4H6XA 3A58B 4MUAA 1M8GA 3I5AA 1KAEA 3O8LA 4I36A 1X42A 4AUNA 1HG0A 3WL5A 4WV3A 2FW6A 4TTAA 4RKEA 4YP5A 4EYGA 2NXNA 3GLTA 4LKOA 1BYUA 4WN3A 2R60A 2WAMA 1RLJA 2JIBA 4IIVA 4DVGA 5DHQA 3OQIA 4NEHB 2OMKA 3GG2A 4CG1A 3S2IA 3LWBA 1NMZA 1ORHA 4G4SP 1JIUA 3CVWA 3W7AA 2QNIA 4JU8A 1AQIA 3K4HA 3L4BA 1RBQA 1Z08A 4AO7A 1D2EA 1KJNA 1W1WA 2F1JA 3TRFA 2IYLD 4G2TA 4XB6B 4BMCA 4FYIA 1NXQA 5AKIA 2DF8A 2V8OA 4KJXA 4R1PA 4TQ9A 1XGKA 5M04A 2I9PA 3HUUA 4TMFA 4AWXA 2I87A 1DBRA 4O4LF 3EXHC 3PX2A 1NN0A 1SIWA 3BIXA 3ETJA 3GZNB 4N9QA 4R7GA 4EK9A 3CXRA 5EOVA 4M49A 4ARVA 1G5QA 5G0SA 4BZQA 3JAMA 1XCGB 5HG0A 2R7NA 3GBPA 1UEJA 4FXOA 4UARA 4GWLA 4EX6A 1VG0B 3JQFA 2GZ2A 3WK5A 1Q6YA 2EW8A 3BFVA 4BBJA 3O3NB 4KUHA 4UZFA 5LOVA 3AM1A 3KAKA 1FFXA 3B13B 2FPIA 3CN7A 4W9RA 4RPCA 4EP1A 3H9JA 4C0SA 3ND8A 4IMJB 1P4SA 4NDAA 3PJFA 4RH0A 1J06A 1YACA 2P3LA 4OHOA 1T2DA 2H1SA 3NPMA 2A4MA 5CVUA 3RT7A 4UQLA 4YREA 3RUAA 3EMDA 2AFRA 4WFKA 1Y81A 3I12A 1QQ5A 2OECA 3H3JA 1TD9A 4HAOA 5JNUA 1KP3A 1LBSA 1P75A 5ALYA 2FPLA 1MENA 2YJ5A 1N2XA 2WKRA 2MDTA 4G0ZA 1KI9A 1MJNA 4PTYA 5KTRA 4I8DA 4JLBA 2CSUA 4NR0A 5KYKA 1QLWA 1PS0A 5DV9A 1V2GA 1H3EA 1F7VA 1GILA 2BUBA 4LRSB 3WISA 3BXFA 3H2BA 4UM5A 2GZ3A 4ZGGA 3WKAA 4OK6A 2ZIAA 5JWHA 5H16A 1W5FA 2AOUB 2D13A 1QO7A 2RG1A 4B6QA 1K6EA 3U7RA 4A2CA 2E37A 2QYSA 3TMYA 1KK0A 1H66A 3IOEA 4CQMA 1GZ7A 1G5IA 4FFDA 4YWHA 1D4ZA 2DUNA 1EVZA 4NYMQ 2GWRA 1HFKA 3GRRA 4S04A 2DFNA 1CUEA 3KU1A 3GP8A 1TIKA 1UM9B 4AYTA 1H1LA 5AVXA 3GLIA 2VYFA 3I37X 3PXXA 4K9SA 3B38A 1WOYA 5CA1A 4MRRA 2Y68A 2DECA 4YRBA 1UKBA 3W04A 4RKFA 1J1UA 4FW9A 3LHSA 1LGYA 4JQCA 5FIUA 3U26A 2MCFA 2C3OA 3VPFA 3WHIA 4NF2A 1F38A 1J0BA 4EKGA 1A27A 2W83A 2BBTA 4PYOA 1Q19A 3U7FB 3E15A 4HDOB 4ZV7A 2O9JA 3PDIA 2QAGC 2FPGA 2YIJA 1SHLA 3KXDA 3I9NA 2JJ2A 1UBJS 4L95C 3PC2A 2OBMA 4DIMA 5A4AA 4DYVA 3IFSA 3TQOA 2EKLA 1TM2A 1SO8A 4CQLA 2D4AA 1CLUA 2O8FB 1T0JB 2CXUA 3MAJA 4IP0A 1PNTA 1H6AA 1T8UA 4PZEA 5A4JA 2BIFA 2CMGA 2BSQA 4BU0A 4HVCA 4FP9A 1F0PA 1UM9A 3NOOA 2D7CA 2G80A 3BSWA 3WFJA 2VDNB 4X6XA 2IS6A 2Q0QA 2WM2A 5ADHA 4INPA 3IQZA 4G0XA 3TL6A 2P9JA 4IHQA 2WHQA 4KBYA 4G26A 4CKCA 4D82A 1PI3A 3FPHA 3ROKA 3COJA 2AMYA 1T5OA 4JQOA 1DB3A 2IP1A 1X1CA 1OJ7A 5JLJA 3FMVA 4C87A 1OTHA 1Y37A 2BGTA 4I0WB 1NNLA 1Q1AA 1T91A 4ZP1A 2LP4Y 5K4AA 3TM5A 2FDRA 3KZMA 4REMA 5DDIP 3GLHE 3RQSA 4URFA 2PLAA 1O87A 3V42A 1AQJA 2RD2A 3FUTA 3X0DA 1Y5RA 1JTVA 4ZI7A 4B5KA 4Q1VA 3QLEA 4LNUA 4B3MB 1PQWA 3U81A 2G1JA 4RM3A 3Q7QA 3W6OA 3PTAA 3EX7C 5AVYA 1PL7A 2HRZA 3EZNA 3ITEA 1ZD2P 1NYTA 2AOVA 3CX6A 1YZKA 4KH1A 5EVCA 3EMKA 5GV8A 1MTOA 3WGYA 2C3UA 4GRDA 4NNPA 4IVRA 1FTSA 3W3ZB 1JA9A 4EYSA 1Y4ZA 4K0KB 4Z4FA 1Z7WA 4TS1A 1JSLA 2Z83A 4L8LA 4V3CA 4BNLA 1SUEA 3OPMA 3CC8A 2P6NA 2BFAA 2PRJA 3O3OB 1GVHA 2GRUA 2P2YA 1Z36A 1WHTB 3A6DA 3EF1A 4IM7A 2ZUFA 5I9TA 3L1KA 3L05A 5IYZA 1I5RA 2GYUA 2SHKA 2Y1EA 4AQYB 3TI7A 4I55A 4L4RA 2J3EA 2QY9A 4AECA 2E5FA 3M7IA 4M0UA 1U28C 1DIOB 3UV3A 4CF5A 1D6JA 2GNAA 2UZIR 2XDWA 5LA6B 4D3ZA 2DLDA 5BN1A 2A1TS 1TM5E 3D43A 3MQFA 3EXFA 3K71B 2SECE 3SR3A 4DCOA 5FPSA 3A9UA 2GO7A 1JFFA 1PGPA 1BXKA 4TZKA 2W6ID 2YHUA 3A6PC 4WZ6A 3W2EA 3LT0A 4EJSC 2AE2A 3PUJA 1SG6A 3AUJB 3VBCA 4ZODA 4P92A 3M9WA 1Y3FE 4GBMA 1XUOA 3BGIA 1YL5A 3TL3A 3A06A 3ZC3A 3MINA 3PYLA 4EFLA 4V0RA 4R5MA 3TR5A 2ZIGA 2PR2A 4Q02A 5TT1A 3GVHA 4ZANA 5LQUA 1NLMA 1KI7A 1E6EA 4H31A 1TRKA 2PLRA 1PRYA 3M89A 4IIJA 5IAGA 3ZWPA 2Y1OA 1LPNA 2C4UA 3GLVA 3O83A 4P4TA 4X6UA 3P19A 4WD3A 5AO9A 4BKRA 2C7OA 1Y8QB 3G9XA 2Q8QA 5IM4F 1QAOA 2WHXA 5SZJA 2LRHA 1F6WA 2OGTA 1X70A 4MKRA 5ILQA 4QGFA 3N6RA 3L82B 2VP3A 5DBOA 2O2ZA 4PYQA 5DHAA 3TW8B 2IOYA 1EFCA 2POCA 1M1NA 3BRCA 1MNQA 4RU1A 3IVXA 4D4KA 1WABA 1Y7IA 4NE2A 1EUCB 3FTQA 4RETA 1QCCA 2WIJA 4E1BA 2ODPA 1Y5MA 1I24A 3QVLA 3V97A 5C8DA 3P0FA 3A6GA 2QTBA 3OE5A 2PEYA 4IJKA 4OSOA 5EIWA 5EMHA 2R2AA 1ZMBA 1FMCA 5A4IS 3C3DA 4R3NA 3H7AA 1OI2A 3TZEA 5E3JA 4EJFA 1JWBB 1NNI1 4YCBA 2R84A 2YNMA 3BD9A 3NM4A 1YK1A 2FA9A 3TEJA 3FMOB 4XTRA 3FYSA 2QN2A 2X13A 3NIBA 3INRA 5E8JA 3WL7A 3MTJA 4OMUA 3WA7A 3T7TA 1M6VB 2AN3A 5BV7A 2O4CA 1Z5VA 3UJAA 5JE8A 2ZYHA 4ER5A 3BTVA 4QOIA 2VRNA 3OD1A 1FX0A 1C4WA 3E7PA 4TTRA 5ETJA 4RNDB 4ASUD 1AN0A 1NLZA 3U7HB 2VHZA 1RLUA 1E0SA 1TK3A 4N9WA 2ZUEA 1NVUQ 2YQZA 3E3LA 4XOIA 2C97A 3KKQA 1A4XA 3M5PA 3PT9A 4XUCA 2IUUA 3JPWA 4OLFA 1CQIB 2W70A 3UV7A 4BVEA 5KHLB 3QEOA 4P98A 4HB0A 2FPUA 3SQDA 4CEIA 4UU0A 4PC3A 1LJUA 1PR5A 3VU8A 2H85A 2HSJA 4DIOA 8ABPA 5BR7A 2JBAB 1OBCA 5B3LA 3DOHA 4ZN6A 2XCLA 1A8HA 4YMGA 3J7AC 1IDOA 1TF5A 2AFIE 1B1AA 1C1XB 1SOVA 4CKEB 2AF4C 4PN3A 1FB5A 2GTPA 3E7DA 4HPWA 3AUSA 2QNRA 5F77A 1E9DA 1HSOA 3R2JA 3HU5A 1XRJA 5IMSA 1NL3A 1WDWB 5AW6A 4RFSA 3T3DA 2IUYA 3NNDA 4FNGA 1YOBA 3U4GA 1GTRA 4KFUA 2W93A 3UW1A 2O5EA 4R1OA 1E98A 3DULA 4BFWA 2PLFA 1PJQA 3SEAA 2IKQA 5LQNA 2NVUA 4F4FA 2B61A 5LB4A 1P60A 5C2JB 3U09A 3L7OA 4FYXA 3VKHA 1GQYA 4FN4A 5K0TA 4YHHB 2LCFA 4P82A 4XH9B 1SVKA 3WHKA 4NHOA 2IX3A 1N3BA 1XXLA 4IDAA 2PJDA 3TM4A 1ZCBA 4PAWA 2VBIA 2O5CA 1ZA2A 1BX1A 2J67A 1UOPA 2ZM6B 3DVQX 1I13A 1LI7A 3NKLA 4Z6KA 4H08A 1JKXA 1YE8A 2GLXA 2IPAB 4QLBA 5ED4A 2EDCA 4UUMA 5AKZA 4FR2A 2R97A 1N6KA 1V5EA 3AVVA 4QUJA 4AF8A 3CH4B 1DKOA 3JS5A 1DJOA 1E0KA 3V2GA 3S5UA 2FPPA 1A72A 2GMWA 2OCBA 4MWTA 2QX8A 5DBIA 4YXFA 3WL8A 3NASA 3GFVA 1JSXA 4JVOA 3IDAA 2B7CA 2BEKA 3S6JA 1LDBA 3OBIA 4NATA 1CWUA 3D1LA 1MAHA 1RLTA 3WKEA 2O52A 3KKKA 1LS1A 3MRVA 1TPZA 5E8RA 4LPKA 2OVFA 4BJ5A 4TV9B 3TBHA 4AU1A 4E5SA 4X7MA 2OXRA 3GVIA 3WJ1A 4GOOD 1TECE 2WA1A 5FT9A 1VM6A 3JRWA 3A2LA 4F2PA 1JG3A 2SKEA 1ND5A 3E9RA 2AEMA 4MLPA 4YVFA 3W3AA 3RUPA 1JQKA 2WAXA 1B14A 1U3TA 5LQRA 1QYCA 1YZUA 1IN6A 2ZB8A 4D0LB 2CFOA 1MQAA 4EUHA 4ZU1X 1OYVA 3FA2A 1IJEA 3FDXA 3F4KA 1U9IA 3ANNA 4HAIA 4E08A 1WLSA 2XA9A 1R0RE 2R62A 2PCJA 2GK4A 4TXHA 2QBYA 2FHPA 4UTOA 5KS2A 1GGHA 3Q15C 2QDXA 3VPAA 3F6RA 4E88A 1OH5A 4LF5B 1PJBA 3S5JA 3Q11A 3BEDA 3N0RA 1DUIA 4PU0A 5JG7A 3ZVRA 1C50A 4YRNA 1D5CA 4FM9A 1EX9A 4RX1A 1N2HA 3ZGYA 1ADBA 2CE7A 1LSOA 1H2ZA 1NVVQ 3GRPA 4MHSA 3UHJA 4CDNA 3GN2A 5BXYA 3T12A 4C7BA 3OZTA 5EJ9A 1KAGA 1RS0A 1W581 4N47A 1SWWA 4DJEC 4EHAA 2F9FA 3D81A 3G0IA 1JI3A 4JI7B 1JMVA 1U8FO 2GN8A 3O38A 5AH0A 5TPZD 4XSHA 3THXA 1KYZA 1SUBA 5D85A 1FP4B 2JJ1D 1GQFA 4I5DA 4YLYA 2IS2A 1YDEA 2QN8A 3K1AB 1EJ0A 1NOKA 1R8JA 4E2WA 4LE2A 4KO2S 1URPA 1OILA 2B1GA 2UVQA 4QRHA 1UXHA 2XD4A 4UPVA 1BDHA 3CQ9A 1P0CA 3KOUA 3EXHA 1DC5A 1T6YA 3HH8A 3ZK7A 1BXGB 2BGRA 4KXXA 1C9DB 1L7NA 1AXGA 4D02A 4MB6A 4OY3A 1F12A 5TJ9A 2FDCA 4MJXA 1S9DA 3FGOA 3ITNA 3O31A 1NU6A 2O6LA 3P9ZA 4KRGA 4YRPA 3QX3A 3GC6A 2FETA 3UMVA 2HF7A 4RD2A 5IKOA 2I3GA 5COBA 3D6TB 2Q2OA 2Y0CA 3IV9A 5FNVF 3UMRA 1KO8A 2AH5A 3I34X 3QPAA 4KU4A 3EQ7A 4MRPA 4XD7A 5AOBA 4X1YB 4RJLA 3ZVLA 3RAFC 2WKSA 4Q7KA 1DQYA 1KEWA 3PWSA 4CQLB 1NLFA 2PGXA 3BC1A 1VL5A 3EQ8A 1RCUA 4HGRA 2F1KA 1RYMA 5CT9A 2XMGA 4EQ6A 2LXNA 3EOZA 3GUUA 1HPLA 4H17A 3OUZA 2BFCA 2XV1A 5K3CA 1A9XB 1NY6A 2JA1A 1ECJA 1UOQA 3LLUA 3FM9A 4BHTA 2A94A 4AP6A 5LUAA 2BZSA 4FC7A 3LNCA 1AXEA 3H9CA 1HA3A 4YGYA 2CNBA 1QH0A 2ZRAA 1H0KA 1OI7A 2FPSA 3CLRC 4JUCA 3WGVA 3F7NA 1NDHA 5K6TA 1ACMA 1FCJA 3DKIA 3S1SA 2EKBA 3MMSA 1KZ6A 2NVWA 3FCYA 2JHFA 4MJ7A 4MUJA 3RH0A 3F67A 3KTAB 3TAXA 1CS4C 5JTTA 5AVQA 1YRHA 2PFGA 4BMOB 5JFGA 2D5AA 3JWPA 1VHWA 4H0FA 1DIHA 5AESA 5KU1A 4OM7A 4UFNA 2BFPA 4AC9A 4BO0A 3CIOA 3EVFA 3HNOA 2CXOA 2BKVA 4C43A 3FHLA 1XR3A 1BRTA 3VKVA 2DQ4A 1G8JA 2BI8A 1FYWA 2ST1A 4HRXA 4PLPA 5JY1A 5B1YA 1WVGA 1R3DA 3P26A 3PK0A 1ISSA 5IT0A 3IE0A 1CDDA 3N2YA 1YU9A 2CD9A 2IYRA 3AHHA 5K3AA 2FQQA 2FEKA 3E3AA 3Q3GE 2O0JA 4BLUA 1U6KA 4HH1A 4ZI5A 3MF4A 1P2TA 1UXKA 5FOSA 2KPOA 4B2YA 5AKHA 2ECFA 3GLKA 3K09C 5AJVB 4WDRA 5LDDC 4YQEA 1WEKA 3U4MA 3RIYA 4A5SA 2DFKB 1Y7PA 5EIHA 3E2MA 1KFJB 2WT4A 4YBZA 1RWWA 4N82A 3AFGA 4MQMA 3ITDA 2W71A 2Q9BA 2YWJA 1PJLA 3TNFA 1YVEI 1DCKA 1CZHA 2QQ5A 2BW0A 2R48A 3D6FA 5HA5A 3ZZTA 5BUQA 4JJ8A 3MS4A 4TYNA 1PYOA 3C6MA 4RABA 4PC7A 4UE6A 5AJWA 5B53A 4EA7A 2OORC 4JHXA 3Q5EA 2HA5A 3M4YA 4FPXA 4M9RA 4F6CA 3AP2A 4NZZA 1HDEA 4YJFA 2GM5A 4RHUA 4PLYA 4J2OA 4ZCMA 2E2WA 2W6PA 2R1UA 3AV3A 1J99A 3CCFA 3B8HA 4P3PA 5DXAA 4F2WA 3HZOA 1A4UA 3LHIA 4RACA 4TLBA 3TH5A 4OHFA 4F7WA 4G86A 4XEUA 3HLYA 4N49A 2VUHB 2D0DA 3KTFA 1W5BA 3AR4A 2ZYRA 4KIWA 4XKJA 5BWOA 2YWFA 1OX4B 1SRRA 2FWIA 4F4UA 4LZLA 1W47A 1NRWA 4C0LA 5J4LA 3CZ9A 1V35A 5F21A 1IXKA 1IBRA 5IDQA 3GJXC 3HG7A 4BWFB 2BFFA 2QPTA 4HS9A 5DGTA 4BNDA 2BTOA 5F1YA 3ZJTA 5A1JA 5EGSA 1GQ2A 1AKVA 2Z1NA 3ESZA 2K4MA 3EPJA 2QLFA 3OIGA 1C1DB 1L7PA 1JPJA 3R3XA 2GEDA 3VSDA 1OIXA 3T3EA 1I30A 1NAHA 4COOA 4UOEA 4UAVA 4NE9A 1EBFA 1GPWB 5AIAA 5HKLA 1KP9A 3AI7A 4RMIA 2YVQA 3AR7A 3A31A 2Y76A 4J3NA 5DTJA 3GF4A 3EDYA 1C7EA 1ZONA 3FG9A 1JT9A 4Q4DA 3JRNA 3WFZA 1Z3CA 5DMXA 5ENVA 3SVZA 4BATA 1NW9B 3H75A 5JBQA 2J9YB 3MIIA 1NDQA 3R6DA 2B5VA 2QVXX 3SHTA 2AJDA 5FOTA 3CE6A 3PXAA 4CM4B 5JH7B 5LDHA 3U61B 4B3JA 4HFRA 3P4UA 1NNEA 5A9SB 3WGGA 3ANXA 4PLHA 2DHQA 4G8DA 3V7FA 1HURA 1YGYA 3QK7A 3IJ5A 3R0XA 3WHPA 2JFFA 4BEVA 1EFPA 5CHEA 4GC9A 4WOCA 4B3FX 1M8FA 1TVEA 1ZLXA 3PWZA 5CXSA 3V4PB 4RA6A 2GA8A 2PA3A 1NWCA 4JX8A 3AG6A 2TS1A 4LY3A 3ET5A 3LCMA 3RTDA 4B7AA 1BJTA 2HU8A 2J85A 2EOAA 4LMBA 2R6ZA 1J42A 3FYUA 5CXUA 4LZWA 2RH8A 1UUFA 2Q0XA 1TAQA 4IFBA 4XVCA 2WHRA 3BMOB 4PLGA 3SU8A 1NNUA 3REGA 3DFKA 1CUHA 1J0AA 1ZK4A 5CFLA 4FVTA 4S1TA 2QTWB 1I4OA 2AEJA 2RAFA 4UXIA 5AMXA 2ZROA 5LXTF 1DG1G 1YV9A 3QVXA 2DUJA 3D59A 3WK7A 3LQ1A 6GPBA 1P3JA 1RWNA 2R5NA 2Z2JA 3IURA 4L5JA 1L8QA 3BE8A 5JEEA 5E6SB 4PWZA 3KFXA 3NBMA 4KIGA 4RK0A 3UKDA 1EIWA 2ZSIA 4AJNA 5AKGA 4BWGA 4C5AA 2XBMA 4PO1A 1ZIYA 4OL9A 3RYFB 2XXJA 1NTRA 3KJZA 5IZCC 2OV6A 5F9HA 4EW1A 1FRVA 1PLLA 2FRVA 2HX1A 3TDNA 4F0JA 2PKWA 4CYMA 1RPZA 4XM1A 1ADFA 4QOHA 4KPYA 2ZIFA 1UDBA 2EDAA 3CM0A 4PFQA 4WJKB 5JCJD 1G8PA 1QDLB 3GXOA 3KKMA 3GMTA 3PNLA 1YDWA 1X2BA 2FR1A 2QNBA 4B2IA 3PDHA 2Z98A 3E6AA 4WZBB 1PR9A 3ZPXA 4A0QA 4DPKA 4UU8A 3MW8A 4RTLA 3JW8A 1ZGGA 3RW9A 4TWAA 4CT5A 3QV1A 5E6RB 1AK9A 3MHPA 4QRIA 4UOZA 3K6SA 4NE7A 4KI0A 3K5WA 2Z3WA 4KN5A 3IOBA 1Z6GA 3VRHA 3O8QA 2JJQA 3N2NA 5D3QA 2VQFB 1T5DX 1SG9A 4K81B 5CIYA 2COKA 2XCTB 1GRNA 2O2YA 4BO1A 4NCBA 2QUKA 2FX5A 3RS4A 3I2GA 2ILTA 4MLCA 2DSNA 1HLFA 3NT4A 3PGJA 2GSDA 1Q0LA 1W48A 1T29A 2PANA 3B9BA 4RLFA 5EAIA 4RELA 1T8RA 2JAXA 1WM1A 3NANA 1YKSA 3KWJA 5JDIA 1DAFA 2DJIA 1SXJC 2AGVA 4A8JC 5DRYA 4IUDS 4DMRA 1E3DA 1GZ5A 5FQOA 3LY5A 2J08A 2I7XA 4K3VA 5I7FA 3K5IA 1NRJB 4KQ2A 1U63A 4WZAB 4G81A 3G2KA 4DVJA 3G9TA 2FX3A 1JYEA 4LWQA 4CM9A 2HV9A 2ZU0C 1UQRA 1R74A 3UC9A 3R6LA 3ZLJA 4MEBA 3FYUC 3K0CC 4NOKA 3SLRA 5A5GA 2CJWA 2HIMA 4R4JA 3JZAA 5C7OO 2YXLA 2Z09A 3L6UA 4RZIA 1IHUA 1VL2A 1PQUA 2PRYA 4OXXA 3BEOA 3DXYA 3K8QA 4MI6A 1R6BX 4YONB 3JASA 4KSYA 3GU3A 4MX8A 2J45A 3ZH9B 1KMMA 2GNOA 2BBOA 2ZIZA 3NDBB 3RU7A 3PD7A 1QAQA 1SBCA 2GZMA 3P27A 4OQNA 5E2AA 3S28A 3WNDA 5LXTA 521PA 3DXFA 5IYZF 1BDMA 3GNSA 2V03A 3FTFA 3QPUA 2WB4A 2IHNA 4K6FA 1GYRA 1XWIA 3QENA 1MJFA 2FR8C 5D7BA 5LD2C 3MUNA 1VTKA 2HA0A 1NF9A 1BEEA 1UXIA 1W1UA 1QOZA 3F71A 3WYCA 5LMUB 3K70B 3DZJA 4H7PA 1GM5A 2OQ2A 3CLHA 2HBYA 2Q3EA 4YMTA 4MCIA 2EF1A 2P6RA 3H0EA 4TTQA 2WJYA 13PKA 2HK9A 3FCAA 4MGHA 4E0BA 1T10A 1O0CA 1B8PA 2R751 3RV3A 2FPIB 2X4GA 1S02A 4HMOA 2ZSBA 1BROA 3LC1O 1M66A 2I29A 1CRZA 4MO9A 1EGHA 1L3CA 3EZFA 4DEYA 1AKNA 1JN0A 2NQ8A 3I5YA 1LBHA 4HLQB 4BFLA 5JVDA 2EXXA 2CFSA 3S2GA 3WKDA 1JDBC 1XD2A 4KQWA 1QPGA 2QUHA 4LFAB 1S2DA 3PYXA 4TLCA 4GMGA 5DW3A 4XCXA 5E9QA 1PWYE 1TU4A 1TT5A 2QHXA 4KV7A 2G83A 3VR5D 1NVGA 2ZBGA 3G0OA 2PBRA 2PWBA 4H7JA 4EZIA 5CG1A 2ZIUB 1ICIA 1PQPA 3GLHB 4UJ3A 4Y2QA 5HCNA 3WGNA 4EEKA 2HBRA 1AHNA 3R9KA 1NQ5A 1JP7A 3DDCA 4V3BA 5EZ6B 3SDBA 4KDRA 2IF2A 3QFFA 3WBBA 2OHJA 3UBTA 4MTCA 1Y1SA 4QNNA 3EXIA 3AUUA 1IN5A 3U1TA 4YCNA 4H59A 1UOEA 5KOJA 1RT9A 1C7JA 5IX8A 1RRMA 3D6UA 4D96A 5J1SB 1AZTA 5F64A 2H6EA 2P3SA 1PDVA 2H9YA 2WT9A 5FOVA 5CFPA 4NYMR 3R5JA 2V1UA 2CDCA 4NYIR 3TZCA 1C4OA 2CXSA 5D3KA 4RSGA 3KQWA 2J9ZB 4YY3B 2C84A 5EP4A 4CM9D 2W2LD 4PGAA 4U2CA 3K9QO 2NAPA 4W6QA 4F21A 1P2SA 2PJZA 5CUQA 5ILGA 1VHLA 3ZV7A 4XZ3A 1ISFA 2VUUA 2WU0A 3PUHA 1QONA 1ZJ4A 4PGFA 4C88A 2X0FA 4DMUB 5IJ0B 2G36A 3UV6A 4B84A 3FVWA 3HXQA 2W2LA 4DV4B 3DBLB 4G3XA 1Y4DE 3KLBA 2ZYVX 3V9AA 2HCJB 3FZEA 1FDSA 4M9SA 4QU5A 4ZOAA 1U02A 1FNSA 1WY7A 2GPNA 3ORHA 2W0SA 1F8GA 3E81A 3UMMA 3FNFA 2Q9AA 5A7GA 3ZK9A 3HR8A 3IUPA 4CKXA 4JQYA 1GV0A 1GPMA 1THTA 1UFKA 2UVDA 3PRKE 4G37A 4GOLD 4JLWA 4MIOA 4MRMB 4OQEA 4PHTA 4CLRA 1EEXB 1OQAA 4DT1A 2C82A 5JASA 3C16C 1YI0A 4I5GA 1S8AA 3AOGA 2V65A 5KYVA 3EF0A 4RL6A 3EDQA 4PG7A 4HI0E 2RGDA 2AC2A 3OOSA 4PAMA 4E51A 3OLWA 1J2EA 5CDHA 5JAHA 3ZU3A 3E3NA 5FUWA 1JQJC 2B3DA 2A5DA 1TM3E 4LJKA 2XE7A 4LEIA 3L8MA 3ID6C 4CKYA 5AQ1A 4NBVA 1CZKA 3NJ8A 3S8MA 1AGXA 4BFTA 5KDLA 2VWHA 4RD6A 4BEWA 4MS3B 4FGLA 2QW8A 3AVTA 3LA8A 3A4TA 5AVRA 4AUKA 2RGRA 4Q82A 1K9SA 2CUNA 3I72A 1YULA 4MVJD 2K7FA 3OKCA 4ZVLA 4HNTA 1DX4A 5CEFA 4D25A 2X6QA 1V0JA 2JH9A 2I1VB 4ZALA 1YRQA 1QB7A 2C07A 1HOTA 3MNFA 5JNLA 3QU4A 3OY7A 4WZAA 1FSPA 5AIBA 1ZBQA 2ZRHA 2H2GA 4IZOA 4NCIA 3RBAA 1YZTA 4KB5A 2GF2A 1Y8ZA 3ZE7A 1GKYA 1GGNA 1WXDA 4O5OA 1EZ4A 2FZVA 5GGYA 1F51E 1MV5A 2J31A 1G2PA 1QF7A 3DMTC 1X80A 3MM4A 4YXWA 4G25A 3JX9A 1MB9A 1BAPA 2GJAA 2JJYA 3H1AA 3T38A 4CG2A 2PWZA 3DMRA 4YRKA 2ZBEA 1WPQA 3M4NA 4KR6A 3GV0A 1VJGA 3BN3A 1I7NA 3DB1A 3QX8A 3KHSA 2BFNA 1G3IA 3B6IA 3DBHA 2PA0A 4OP3A 5DCYA 1YS2X 4C3UA 3IR5A 3UHAA 3I5MA 2NV2B 4YIHA 1TYZA 5AYVA 1Y3BE 3WKBA 2HIAA 3KUKA 5A4MS 1KPGA 5FFFA 2YVKA 2QTGA 3FCCA 3BJMA 5IJZA 1C30A 1I4WA 4UM9D 2FZKA 2RHMA 3OJLA 3B52X 4X8HA 3ADOA 1VFNA 3Q87B 4ZYWA 4ZYUA 3BK7A 4QU0A 1XEXA 1WB4A 5BVHA 1W52X 2Z56A 4YK7A 4C3OB 5BMVF 4BGDA 3K1ZA 4WCDA 1X92A 2CLIB 3ZXIA 3ZZ1A 3B53X 5JMTA 1QG6A 3E5HA 3N0VA 4G07A 1EVEA 4U3JB 1CJBA 5LOVB 5D87A 2YY7A 1Z26A 5C46F 1IOLA 2NUAB 1L5RA 3DT9A 4A6PA 3ESXA 2VZEA 1ZXXA 1E8NA 3NORA 4OMCA 5DTMA 3DOFA 5HILA 1K88A 4DMFA 1IWOA 2Y1KA 4JR2A 2EZ4A 2DE0X 1QVAA 4M4SA 4NDNE 5C5CA 1FW6A 2H2AA 3HEMA 2Z4TA 1HZZA 1RYEA 3LDGA 3UFXA 3VH2A 4PZAA 5ALJA 1K75A 4NCAA 2ZJ4A 3QU5A 4AWAA 3AM4A 2C0PA 2XVYA 1KSHA 3MWEB 4PSUA 3T3HA 3VYWA 4R2WA 5CITA 1AT1A 1KFEB 3M1IA 5GJWC 1MTZA 5DYIA 3C7AA 2F8LA 1H4VB 2AZDA 2Z5LA 3FRIA 2KYRA 2ZUBA 3D4NA 3QVGB 5CT6A 4KW7A 1ZVJA 4KOAA 1QTIA 2EEPA 3OEYA 2GARA 1AF7A 2RGNA 5I48A 4NU6A 1QP8A 1RWXA 1ZD5A 2VDJA 4LZZA 4M9UA 5FOXA 6REQA 2FSVC 1D1TA 2GHQA 2GBLC 2Q5FA 2QJWA 4Q9LA 2PX3A 1BA3A 4B82A 1M10A 1J0CA 1RQXA 1X1SA 1KJJA 2P40A 4XIJA 3KPUA 3T5MA 1F8YA 1PR0A 2REXB 4H77A 4KWHA 4XCQA 3KC2A 4IKOA 5CYFA 3FKSD 3H1EA 3ELWA 3ZNOA 2YASA 3W2IA 1CY6A 1VKHA 4EW2A 1RAAA 2GOYA 2H0RA 3PA6A 2WUWE 1VIAA 1G5TA 2AX3A 1BEUB 1NXOA 1ZCZA 3MAAC 4JODA 4XR4A 5AW7A 5JAOA 3C3WA 3Q41A 4PIVA 4FGUA 5CU7A 4KN9S 4ZYZA 2P3OA 4EBFA 1LSSA 4QE3A 2PKCA 1KDOA 5IANA 1JXMA 3VR1A 5C5DA 3ZS8A 1PG2A 1QRDA 1P5FA 4D6XA 5J63A 5TS3A 4YJGA 1HLDA 5JLAA 2WYOA 4Y6LA 1V25A 4QYIB 4YJ3F 3QQPA 5H82A 2Q99A 2ZTLA 3SHQA 3OAAD 4RC9A 5B12A 2QLBA 3IMFA 4A03A 3MPOA 5DIFA 3AHDA 4TV8F 4F6LA 3DOUA 1SEPA 5D84A 5KOHB 2P91A 3E9MA 2DH5A 3A3OA 1M7GA 1PT8A 2JGJA 1JQBA 1OR8A 4LQLA 3NQ41 5EJ4A 2I1WA 3HB0A 5CW1A 1ADYA 2G5CA 2ZSJA 4GI7A 4URUR 4BNUA 4ZDJA 5LZ9A 2KWIA 1H65A 4FZ3A 2IEZA 2QTRA 5KQSA 2BFWA 1UAGA 3ESAA 4Y6OA 2PWPA 4F5YA 1N78A 4JP8A 5FULA 3RS8A 4YPVA 2L82A 1RMYA 2NUTB 5A3JA 4RTQA 3COPA 3SBEA 4KODA 3HRHA 1DCMA 1GR1A 1TZJA 1SZPA 1QO0A 4JJ4A 1AUXA 2RK6A 3RFUA 1NATA 3OZDA 1O89A 4J0IA 1J70A 1PV2A 2VI5A 4FC6A 1OE0A 2O8VA 5HS6A 3GRVA 2PM8A 2I6TA 5FRDA 3TXAA 3WY9A 4IJUA 4JWKA 3PX3A 1RQ2A 2AF3C 3HYNA 2QPOA 3NWOA 3R3SA 4GOND 4HN2A 1F2UA 3IQWA 3EGDB 4HDRA 2R6R1 4G4IA 4LOHA 3UEOA 3IAAA 3AJ8A 4C0AC 5DNUA 1R0BA 5HR5A 1UK7A 1YRYE 4HGNA 4I1UA 3D7LA 1QC5B 4LDNA 5D3MA 3UW3A 1K98A 2ZBFA 3ZDZB 5ICCA 4UOQA 1V9LA 5AQEA 3RTBA 3O8OA 1N2ZA 4RDIA 5C7IO 1RWOA 1GDHA 4CL0A 5LYJB 2YBEA 3U4AA 5CB8A 1TZKA 1QTNA 4HEA6 1SXIA 1THZA 4FFSA 4HTFB 3RRYA