1I6WA

The crystal structure of bacillus subtilis lipase: a minimal alpha/beta hydrolase enzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIPASE A
publication title The crystal structure of Bacillus subtilis lipase: a minimal alpha/beta hydrolase fold enzyme.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 62
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i6wA00
4AMYA 1FFDA 1OCEA 4QWMA 3DOHA 3MUOA 1SCKA 3OPMA 4LKOA 2HFJA 4OSEA 3A2MA 1S8OA 4X91A 3IUMA 4EY6A 4B9AA 3BWXA 1R9MA 2WHRA 2O2HA 4ARAA 4CG3A 4H7IA 5FLKA 3DCNA 1WHTA 3VJMA 5SYNA 4V2IA 2G63A 4DNOA 5LP1A 2PX6A 1TCBA 3VDXA 3KOOA 4H77A 4W1PA 1JKMA 2CB9A 1X2BA 3M81A 1IUNA 1A7UA 2G5PA 4J03A 5AKYA 1R88A 5AM3A 1Q0RA 4EA6A 1QGED 2QTBA 2ZYSA 4OU4A 3WA7A 4H7DA 2ZJFA 2HDWA 3WKDA 1CPYA 2XUJA 4ZV7A 1QTIA 1N1MA 2XQKA 4QDTA 1JI3A 1K63A 4XJVA 4WDQA 5FV4A 5ALLA 4DMKA 2H7XA 3FCYA 5HCUA 1ZOIA 2OXEA 3PF9A 2LIPA 3DD5A 2B4KA 4BC1A 5EHXA 1DT3A 3VVMA 2XUIA 1TRHA 1USWA 4UUQA 5D3KA 1CUGA 1UOPA 2HU7A 2I3ZA 3WK7A 2C0QA 1ZGBA 2WUGA 5DYTA 2C7BA 2PPLA 5EIAA 3TGLA 2D0DA 1MT3A 4L72A 3IDAA 4BP8A 3AJAA 4MEAA 3T4UA 4G8DA 3QMMA 3FAKA 1EVEA 2JEYA 2XMDA 1ZGCA 5K3EA 3FCXA 5A7FA 4ZREA 2GBIA 3QZUA 1KU6A 5CBKA 3FSGA 1ZIXA 5CT9A 1RYYA 5CRIA 3Q8WA 1LNSA 1XKLA 1E89A 3QBJA 4UPDA 4EZIA 3TJMA 5AI0A 1B6GA 4DNQA 1XQVA 5DLPA 3FLEA 1UT6A 4B85A 3X3HA 3DQZA 4LXGA 2YH2A 2OCIA 4U2FA 4RGYA 3W04A 1CQZA 4OUKX 2XMQA 5LLSA 2DQZA 1SC9A 2WHPA 5DYWA 5AK4A 4X00A 3R40A 3D5EA 4AZ0A 4X92A 3GUUA 1G42A 2WIGA 1VE7A 5ALJA 2RONA 5CT5A 4KRXA 3IB3A 1QE3A 1YR2A 2PSDA 5AKHA 4DMFA 3WL7A 3S2ZA 2OGSA 2GBGA 1CUDA 4UBOA 3NGMA 3ANTA 3H2GA 5AP9A 5E2IA 5AKIA 1K8QA 1EDBA 4TVKA 2PSJA 4X71A 4G4GA 2HU8A 4WJLA 4F60A 2ZJ6A 1LZKA 4XVCA 1J06A 3W06A 1QO7A 3G7NA 1R3DA 4KR0A 3C87A 2VA9A 2JGLA 4FLFA 4LXHA 2XUAA 4G9GA 1CUBA 1F6WA 3PFCA 5T4HA 4BZWA 3IIIA 3BDVA 4DNPA 1XZAA 3FNBA 3D2BA 2PSEA 3I2HA 5EHNA 5T4FA 4Y2SA 4UFPA 2ZSHA 1Q0ZA 4GDMA 4N8SA 2IITA 2WJ4A 5IH7A 5DNWA 4G9EA 2WIDA 5CT8A 1XLWA 3JW8A 4B9EA 3G0IA 4X85A 4QE3A 4OYLA 2GBCA 4E15A 4IQ4A 5ALGA 3ZPXA 1DX6A 3TEJA 5EI5A 4J0GA 1UK9A 3KSRA 2WIFA 3FYTA 4H18A 1HLGA 4PV7A 4G8CA 1XZGA 1CUEA 3LIIA 2OCGA 2PBLA 1CUIA 2H7CA 2WIKA 1MJ5A 1J07A 1VLQA 1VA4A 2WG1A 4QEKA 5A62A 1WHSA 1DT5A 5HF6A 3WKBA 4BCCA 3LS2A 2VQ6A 5I9IA 5JASA 1XRNA 1VZ2A 2XQIA 4UHEA 3NUZA 2WFMA 4MWSA 2HFKA 4GLBA 3D59A 4PW0A 4B84A 4QDXA 4K6KA 4E14A 1CEXA 1SCQA 3CXUA 1EB8A 5D6OA 2XB6A 4WDRA 3HYSA 4IHAA 4TPKA 4Y2XA 1CIJA 5ESRA 1QFMA 1E3QA 1EDDA 4KJXA 4H35A 1YA8A 2FX5A 2Z8XA 3WIOA 4BBZA 2BJHA 2ZSIA 2O7RA 5AOAA 1CUYA 1EA5A 3V1MA 2WTNA 5T4EA 3DLTA 5DNVA 3D2AA 5J3JA 4HXGA 3WK5A 1J2EA 1H22A 3L1JA 1YAHA 3K9BA 4RPCA 4BZZA 5AI6A 1AURA 3N2ZB 1ZJ5A 1E5TA 4INZA 4J3JA 2J4CA 1HL7A 1N5RA 2WFLA 4B0OA 4FLMA 1EINA 1AX9A 5AKXA 4ZV9A 1GQSA 3AZPA 1A8UA 1XRRA 2ZYRA 4EBBA 4X93A 3BF7A 4X94A 3AZQA 3O4IA 1GQRA 4WY5A 1ZI8A 4Y2RA 2DSNA 5IVIA 5YASA 4FDMA 1XZEA 1EB9A 1F0PA 1L7RA 3FYUB 3WWEA 5D3ZA 2EEPA 2JBWA 3DKKA 3ED1A 1YCDA 1LBTA 3C6BA 2XMCA 3I6ZA 3PFBA 1EK1A 3VVLA 2PUHA 2O2IA 1C4XA 3OTQA 3UMJA 1RWQA 4CCYA 1VA5A 2WKWA 3IA2A 3GZJA 4JYPA 5K3CA 3AIOA 4EY8A 4UFNA 2V97A 5FPPA 1BEEA 4H0CA 5DYYA 3FVTA 5AJHA 4ARBA 3WL5A 4F21A 1Q84A 2CMFA 1L7AA 5HF5A 4KE7A 2XMBA 5A6VA 1CUCA 1JMKC 2VJDA 5JD5A 3WA6A 1XRQA 4NVRA 3WK4A 5AM2A 1LBSA 3BIXA 3O0DA 4PF1A 5C8ZA 1N8SA 4AX4A 2Q0XA 3HZOA 3IURA 1EXWA 4Z49A 4EY4A 4HZGA 4KRYA 1K6EA 3PI6A 3G8YA 5JAUA 5AKEA 4OYYA 3I1IA 3KWFA 4M0EA 3HXKA 4BP9A 1EI9A 4RNCA 3DS8A 4WFIA 4BRZA 2QJWA 4F0JA 5AM5A 2QM0A 1UK7A 3WYNA 3NOXA 3I2GA 2GYWA 4AQDA 4Q82A 2X8BA 2PUJA 5SYMA 2QOEA 1QIJA 3P2MA 2Y6VA 1WPXA 1Q83A 2O7VA 4BC0A 4Q05A 5IVHA 4UHFA 1LLFA 4E46A 1ODSA 3IUJA 1LGYA 4WCVA 3DEAA 5IVDA 4MEBA 3GBSA 1P0QA 3AIKA 3DDUA 5AM0A 4BB0A 4N8DA 3IBTA 1TKRA 4ROTA 4TGLA 3JYHA 2QUBA 3AUKA 5LYYA 2OCKA 1MTZA 5JAOA 3RLIA 1ZICA 3JWEA 2PSFA 3STWA 3F98A 5HZGA 5AM4A 4M0MA 3IULA 1AZWA 4C4ZA 2C0PA 5JANA 1BU8A 4QLOA 4UHCA 2WHPB 4U2BA 2GYVA 5BOVA 5E4JA 5AM1A 1EX9A 2I3DA 3FYUA 3WMRA 4YASA 5ALFA 4X97A 5HKAA 6YASA 1CUAA 3BDIA 2DQYA 3I2KA 3DYIA 1IUPA 4FNMA 3E4DA 4C4YA 2Y2VA 5ALZA 5IKXA 3H17A 3R41A 3VISA 1THTA 3LIPA 4KAJA 1ZD3A 4H7JA 3W9UA 3FVRA 4AO6A 2XI4A 2HA0A 4JEIA 4Y2PA 3O4GA 3KXPA 2XE4A 3ZLUA 4BCBA 1WPRA 1DX4A 4AO7A 4DLNA 4J0HA 1T2NA 2BFNA 3PE6A 4MYSA 2BCEA 2O2GA 3AZOA 4B6GA 1IZ8A 5ALKA 4C4XA 4QLAA 1LPOA 4CG2A 5ALUA 3KD2A 1FFAA 3ESCA 5FP0A 3C45A 4MXDA 2CZQA 5LIPA 1XKTA 2VAVA 2DR0A 4KEAA 2XUOA 1FFBA 3SX4A 1XZBA 4GWLA 2QRUA 3VKFA 1X70A 4OPMA 3RKSA 1CUFA 4NZZA 2GBFA 1HDEA 4DGQA 1QIKA 4WFKA 2OLEA 5C8VA 3DOIA 2XT0A 4OB6A 2ZYHA 4U2CA 4XWGA 5HKBA 3HC7A 3ZLVA 3MUNA 1NU6A 4KYVA 1JT2A 1QLWA 2CEKA 2HRRA 3QVMA 2WU3A 4BVJA 2FUKA 4Y2VA 2XQFA 4HXFB 3I28A 2QS9A 4CG1A 4DM7A 4BDSA 1Y37A 2WIJA 3H2HA 1ORVA 1MAAA 1WB5A 1SCIA 5A71A 2PVSA 3WLAA 2I03A 2OAEA 2QXTA 2VJBA 3F67A 2WG2A 3O9VA 2BGRA 4EY5A 1A8SA 1J1IA 3GROA 2CJPA 3M83A 1VE6A 1MAHA 1G5FA 1YSCA 3ZWQA 1UKCA 2ECFA 3D0KA 4DIUA 5FUMA 1QIFA 1CVLA 3AINA 3QMWA 1XZLA 3CCBA 1LPAB 1XZDA 2BUAA 1YASA 4DYHA 1MO2A 3B5EA 4ZXFA 3ZLTA 4XX1A 1AC5A 3T52A 4X95A 3FLBA 1W4LA 5JATA 1H23A 4H7HA 5LZ4A 5ALDA 1QIGA 3A2LA 4S0XA 5ALEA 2JEZA 1BROA 5K3BA 1DWPA 4PO3X 5ISMA 5AI4A 2XMSA 1JJFA 2JGMA 4P92A 3GELA 4QZVA 1SFRA 4J0CA 3KWJA 1MNAA 5HF8A 2JGIA 4Y7DA 3LLCA 2ORYA 2Y2UA 1QFSA 5AK5A 4W9RA 4GW3A 3EQ8A 3U1TA 2OQVA 1HQDA 2C5GA 1Z68A 5KBYA 4H7FA 4H7KA 5AI8A 1R9NA 2G5TA 3V1LA 3EIOA 3WKCA 2WFLB 5AH0A 4J0IA 5FOQA 4PSDA 5AKKA 4X7BA 3R3YA 2YXPX 1XZIA 3WK6A 3BIWA 1W76A 1F8UA 5JIBA 3R3ZA 5KREA 1BS9A 1DINA 3ZI7A 3R3XA 4G4JA 2H9YA 2HA4A 3QM1A 1XFDA 2HA3A 4I3FA 2AXEA 4JNCA 3DKRA 1A88A 3Q0TA 4J0DA 4J0KA 5I8PA 4GBGA 1DU4A 4L9AA 3PUHA 4J7AA 2XUFA 1DQZA 4QNNA 3UUFA 1D07A 2B61A 3SWWA 2HRQA 4HRYA 4CCYB 1MNQA 2OCLA 3MGAA 1BN6A 1K5PA 2RAUA 4UHHA 3CN7A 2PU5A 3OC0A 5CH8A 5DTJA 4HAIA 1EH5A 3I2IA 4L0CA 5KWJA 4X90A 3WKAA 5JZBA 2VJAA 3STUA 4KE6A 2Y1KA 2K2QB 3C5VA 2FJPA 3WK9A 3WI7A 1PFQA 1EK2A 1ETHA 3FYUC 1EHYA 5JYCA 1MN6A 1E8MA 1AQLA 1U2EA 3C6YA 1GKLA 1ZIYA 3OOSA 7YASA 3C43A 1IMJA 2CUTA 4O08A 5LZ9A 4P08A 1DTEA 3C5WP 4K5QA 5JADA 1IZ7A 3PF8A 3QITA 2RGUA 4QA9A 3F9CA 4UBKA 1QIMA 3HRHA 3N0TA 3EF3A 4C87A 2HHAA 5BWCA 3H19A 1YA4A 3ILSA 1N5MA 2WILA 2YYSA 5K5EA 3FWHA 1EDEA 5AICA 3PUIA 2XUHA 1CUXA 1H2ZA 1WM1A 1L7QA 5HQ3A 3I1YA 3PDCA 3E0XA 1QIEA 2Z3WA 2XMGA 1BCSA 4LYEA 5AK3A 2ZJ7A 4UBJA 5CH5A 5FXMA 2QR5A 2X5XA 1P0IA 5K3AA 4J0JA 1YAJA 3VXKA 2GYUA 1NX9A 1GXSA 1YS2X 3QYJA 4Q3OA 2QJRA 1U65A 3H2JA 1UK6A 5JD6A 1CUJA 2V9ZA 4MYDA 1GT6A 5CT4A 5T4BA 1K4YA 5A2GA 5ALWA 5EHQA 4YK7A 4K6GA 3WK8A 2WJ6A 2XUDA 2Z5GA 2QT9A 1MX9A 4RE6A 2RHTA 1O6GA 5BV7A 5AK6A 4X6UA 5EGNA 4U2DA 4B7ZA 5EHZA 2HL6A 4N8EA 1XRMA 2DFPA 1CUZA 4W1RA 4JH0A 2HM7A 3HEAA 1ODTC 1XLUA 4IH1A 3E3AA 3C6XA 1H2WA 4KAFA 1XLVA 5AKLA 4EHBA 4K2AA 1QONA 3A2NA 5AKZA 3U0VA 3DNMA 1GPNA 3GFFA 3G02A 4N5HX 5AI9A 3G9TA 3WJ1A 4EUSA 2JGKA 1C7JA 4FFWA 1DWOA 3RK4A 3ICVA 2JGEA 4FHZA 4FBLA 3ICWA 1BN7A 2DHEA 2ACEA 5C81A 2OGZA 3K2IA 3O9MA 3IUQA 4X6YA 4HXEB 1ZI9A 2G4LA 5AI5A 3CCCA 3OM8A 4FLEA 1TAHA 3E1GA 2B9VA 5CW2A 1UKAA 4Q1VA 5FRDA 5HFNA 2W22A 2PU7A 5LKAA 4UBLA 5AIBA 2AJ8A 4DNFA 1R4ZA 5AOCA 4C6HA 5LZ2A 3VJKA 2WTMA 3WIBA 3I6YA 5K3FA 1QO9A 2GZSA 3F8SA 3D7RA 3CN9A 1QTRA 4FBMA 2VEOA 4BRSA 4P93A 2R11A 3M3DA 4AMZA 3HACA 3GA7A 1ORWA 3KDAA 5CTAA 4CCWA 2XUQA 2OPHA 4BVKA 2WFZA 3R3UA 3WYDA 3I2JA 3STXA 2BUCA 4P9NA 1QJ4A 3F96A 4HTAA 4PSCA 5A7GA 2J3DA 5JAPA 2OG1A 5DTIA 2ACKA 5E4YA 2XMRA 1Y7HA 4CIAA 3FSGD 5A7HA 3SK0A 1CUUA 4W1QA 3L1HA 1JU4A 2JGFA 4C01A 3MVEA 3FOBA 1JJBA 2XUGA 3O4JA 5ALSA 5ALVA 4MQLA 4HS9A 2XDWA 2YASA 3O4HA 4QDUA 3D3NA 3G9UA 5DNUA 3WWOA 4MQMA 1IUOA 4N5IX 2WU4A 5E4TA 3ZV7A 2XLBA 4FMPA 3HLKA 2HA5A 3I2FA 1BCRA 5ALIA 3HJUA 4Y2YA 3F97A 4KE9A 3TRDA 3FBWA 3WZMA 2WUDA 3DL4A 5C7YA 4FTWA 4KACA 5FPQA 3UUEA 3EBLA 1VJ5A 2CKMA 1KEZA 1BRTA 1EVQA 2R8BA 1PV1A 4BTLA 3H2IA 2WQZA 2HADA 4G4IA 1UK8A 3VJLA 2E3JA 1ACJA 1AGYA 1ODCA 4ITVA 2Z8ZA 1FSSA 2HA7A 5HF9A 2NW6A 2WG0A 5HK8A 1XZMA 4B80A 1JU3A 2Z3ZA 3H0CA 1VXOA 3WKEA 4QDZA 3A70A 4I19A 5DWDA 2OAGA 5EFZA 2J4FA 1HPLA 4UBNA 1XZHA 4U2EA 2ZVDA 1VOTA 4GXNA 3STVA 2DCMA 1YS1X 5ALMA 5AKGA 2JGJA 3BXPA 4CFSA 1ZI6A 1CUVA 2JIDA 1TK3A 2VATA 1MPXA 5BWBA 1UOQA 1LPSA 5AKJA 1UFOA 3C70A 4CI9A 5CT6A 4BATA 1CUWA 5JALA 4A5SA 2QKYA 5ALOA 2BAGA 2XMZA 1R50A 4F5ZA 2ROQA 1ZD2P 4CIBA 5K3DA 3I6MA 1XZCA 1P0PA 1RP1A 1JFRA 5EIEA 5H3HA 1GGVA 2EDCA 2QXUA 4LYDA 1BEZA 4FWBA 3EQ7A 5CH3A 1W75A 4X3CA 1W52X 4LIPD 4B83A 3OG9A 1QIHA 2XUPA 1NU8A 1JJIA 1H2YA 5JAHA 4OB8A 3LCRA 4WFJA 4BE9A 5CMLA 5FKJA 4QDOA 3HSSA 2ZYIA 3G9XA 4PQEA 3B3QA 2AJDA 3WWPA 3D4LA 3G0BA 3BL8A 1PJAA 1WCYA 2BKLA 4FFVA 4RE5A 1VZ3A 3AILA 2V98A 4UFOA 4B0PA 4FNGA 4Y2UA 4Q3LA 5KWIA 4BAGA 1MX5A 1UZAA 3QPAA 3G0DA 3M82A 5AOBA 2AJBA 4MWTA 4D9JA 1CUHA 4DMCA 2VTVA 4E11A 4ZGBA 1THGA 1GPKA 1XZJA 1CQWA 5LZ8A 1QIDA 3DYVA 1ACLA 4Y2TA 4ZWNA 3WZLA 5HQ3B 2FJ0A 1LPBB 1QOZA 4BCDA 3EQ9A 4AXBA 1T4MA 1O6FA 1DQYA 2JF0A 2C5FA 3BF8A 3IVMA 1LPNA 2D5LA 4WY8A 2OQIA 2VT7A 3H04A 1LPMA 2WJ3A 1WB6A 4OU5A 4ETWA 3H1AA 1GZ7A 1E8NA 1UOOA 2W6CX 4G5XA 3V1NA 3R0VA 1DWQA 5LZ7A 1ZJ4A 1WOMA 1I6WA 5CXXA 5AO9A 2RIPA 4M0FA 2HU5A 2VSQA 4AZ3A 1G4HA 5LKRA 5ALNA 1XQXA 3K6KA 4G1FA 4PNZA 4DSAA 1ISPA 1KU0A 1SOMA 2EDAA 1HKHA 1E8DA 1TCCA 3W05A 1MX1A 3V9AA 3C6ZA 1ZD4A 3D2CA 5ALXA 5JZ9A 3QPDA 2RI6A 3L1IA 3OURA 1XZFA 3V1KA 1M33A 3STYA 1XRPA 1XZKA 4K6HA 3C8DA 4I4CA 4UBIA 1TCAA 1R1DA 5LZ5A 4FOLA 4LXIA 1AMNA 1XRLA 2DHCA 1HBJA 2IX9A 5IVKA 1B41A 1GPLA 4GEGA 1IVYA 1FFCA 3WJ2A 4C88A 3W2TA 1C7IA 3QH4A 3ANSA 2P8SA 3FLAA 2BGNA 1TIBA 3AFIA 1UWCA 3BJMA 1F0NA 2HA6A 4NMWA 5EIHA 4OD0A 3QMVA 2WM2A 3DJYA 1AUOA 2GZRA 4EB0A 3H2KA 4QWWA 3LP5A 3BE8A 5F4ZA 4AN0A 5ALPA 2WLSA 4KAAA 3WQHA 2I78A 2PM8A 4FKBA 1FJ2A 4DMHA 4JUIA 3G0GA 1CFJA 2XQJA 2VJCA 5D7BA 2HIHA 3G0CA 1A8QA 3IUNA 4BTVA 2QZPA 5K3FB 3RM3A 5HFAA 3H18A 2XQGA 1MU0A 1X2EA 2J3QA 3R3WA 4GECA 2DHDA 2QUAA 2ONCA 1XQWA 1OXMA 4OB7A 1U8EA 2QVBA 5C8XA 4ZI5A 1CRLA 3QPCA 4UHBA 4Q34A 4BVLA 2WSLA 1GKKA 4DTCA 4Y9SA 5I7UA 5FDFA 1H2XA 4W63A 1CLEA 4BAUA 4GI1A 4XIIA 4EY7A 4U2GA 4Q3KA 5ALQA 4BE4A 1YB6A 2V96A 1JMYA 2HA2A 3STTA 4A23A 3B12A 1XROA 2AJCA 2PKYX 2XLCA 1AKNA 3RARA 4B82A 4Y2JA 4L3WA 2VT6A 1G66A 2BUBA 4YX9A 5JARA 4UBMA 4X6XA 1P0MA 2UZ0A 3W9BA 2OGTA 2QMQA 5DJ5A 2WUEA 4ZRDA 5CXUA 2CBGA 2AJLI 3ESAA 2WUFA 5ALTA 3WL8A 2H1IA 5JZSA 4LHEA 1QZ3A 4HRXA 1CR6A 4DSZA 3HABA 3WWCA 4IH9A 3PICA 2RHWA 5AHXA 3DL7A 4MJ3A 4BDTA 1W6RA 3HI4A 1XQYA 2C4HA 2VAXA 3BJRA 3H1BA 4YPVA 4Y2QA 5CURA 3NWOA 1TQHA 1ZD5A 3O95A 1UXOA 5HK9A 4G8BA 3ESBA 4HVTA 4C89A 4W1SA 4KE8A 5ALRA 3WWDA 1UKBA 2H7YA 1VKHA 2ES4A 2B20A 2PL5A 4BAZA 1CV2A 3G9ZA 2C58A 1E66A 2X76A 1LPPA 1FFEA 1Y7IA 3AIMA 3SC2A 1LZLA 4AN1A 1WB4A 3R3VA 5AIAA 3WL6A 1VXRA 5JD4A 4PSUA 1YB7A 1CUSA 4BYMA 1W1IA 3S8YA 3YASA 4NS4A 1BE0A 4GHWA 3C8HA 4A16A 1OILA 4IH4A 1U4NA 3A6ZA 4OCZA 2VF2A 4IO0A 3V48A 2PSHA 4JYMA 4H7EA 1QIIA 2Y6UA 4AO8A 4UHDA 5ALHA 4B81A 2WHQA 4AB1A 2XUKA 3ESDA 5ALYA 2IIVA
chains in the Genus database with same CATH superfamily
4HDOB 4PPFA 1HOTA 2I9KA 4CE6A 3MUOA 2WJVA 5DBFA 4AVYA 2YMLA 1RWOA 3ELUA 4LKOA 1IRIA 1UXHA 2PD4A 4RF2A 3WB9A 4DUGD 4X91A 1E3SA 2BM1A 2X4LA 3IUMA 3QU2A 3EAGA 4PXSA 2NTJA 3OMXA 4GKJB 4Z6KA 4IV5A 2XDYA 2Y05A 2EEZA 3FWPA 3QVLA 4PRLA 2V1XA 2ETVA 3FHOA 4NENB 1QGUA 4I1SA 4CDNA 3AOEA 3AHFA 3OWXA 5E9JA 1N34B 4QYMA 1W5EA 3GAAA 5DK6A 1T9GR 3D31A 3NW9A 4ME6A 3DCNA 4EYKA 2F90A 5IJ9B 3LT1A 3Q9NA 2WFAA 3T1TA 4CR6A 3FI0A 4V2IA 4AZ0B 3H2ZA 1HI9A 4ZO4A 2V7VA 3RRYA 2PUVA 5AW3A 2GJ9A 4FWIB 4BU1A 1ZR4A 4FOOA 4N0EA 2X6QA 5JSYA 1FUIA 3VO9A 4DNOA 3TIIA 1RXYA 1XTTA 1G18A 1KI2A 2VH1A 4M8KA 3SM3A 1JPVA 2VBIA 2CFCA 4V02A 4V1CB 1S2GA 4FT2A 5IC6A 2ZBQA 3QUSA 4P31A 1ONPA 3SYLA 5EFOA 1C0LA 1CULC 1FXWF 2CYCA 2QZ4A 4X65B 1MZPA 4Q9DA 4BHTA 1R9JA 4GT1A 3BWMA 1O95A 1GFIA 4K88A 5HR5A 1IUNA 1SVLA 3HB1A 3A1NA 3WYFA 1KOGA 2J0EA 3SLRA 1YKFA 4MVXA 2DWOA 4QGBA 4QTUB 5IK2A 5FR2A 5K09A 4BY9E 1ZK3A 5F12A 1C9DB 4EKNB 1FDVA 1JR3E 4C22A 1R88A 1R27A 1Q0RA 1ZCZA 2RHJA 2CDRA 3UB2A 3H8JA 4GQBA 4KYIB 5CJJA 1JAIA 2QTBA 3HYCA 2ZYSA 3JZMA 3WLIA 4CM4B 1NI4A 2OZLA 4E6PA 2NO0A 3FPSA 3PUKA 1S89A 1ZGJA 2D7JA 3MGKA 4P0QB 1JTEA 1CPYA 3F5FA 2XUJA 3HMKA 1YZGA 3OJ0A 1XL0A 3EEYA 1QTIA 4HADA 4HNSA 2E48A 1MO3A 3GJQA 2OP0A 4Y1RB 4CV2A 5KOJA 2WAYA 3GQBB 4PLCA 2GJAA 4I14A 4MMZB 1K63A 4XJVA 1JB9A 5COQA 4DIKA 4FGWA 1GYPA 5FOVA 3FCYA 4EG3A 4WUTA 1VKZA 2C9BA 2P62A 3L07A 2ZIVB 3DD5A 3DCJA 3OTGA 2AFIA 4P82A 2B4KA 2HBQA 4R7TA 3TI9A 5EHXA 1YFJA 3RS2A 5B1DA 2XUIA 4DR3B 2OO5C 4E3ZA 1GDDA 2WICA 3NBZC 3OIYA 1USWA 3A04A 2JGAA 2DFLA 1DCTA 5FI5A 1P3Y1 2N47A 2JH8A 5BN3B 3GEHA 5C46F 5D8DA 1CUGA 1DAGA 4ALJA 1NBHA 2XCLA 4LK3A 2YY6A 4JGBA 1CR2A 3ZV3A 2QTRA 1N0VC 3D6VA 4WBNF 4CVNA 5CP8A 1RADA 2LE0A 1NVTA 3NAQA 4EKGA 1H2HA 4ARUA 1NR1A 2DULA 1OFIA 4DADA 2WUGA 4U39A 1RPZA 2P67A 5KTRA 1L7OA 1SUBA 4L8GA 4QGHA 1CQXA 2JBAB 2PUWA 1K6MA 2PPLA 3K4QA 5CM8B 1XCMA 5KOIA 1R10A 3RS5A 5AW6A 5DI3B 2GTIA 2J5BA 3H99A 1TUBA 1UIRA 2W0MA 2W6ZA 3Q0IA 3KXDA 4KB5A 3DOEA 4L72A 3ABSB 4AROA 4BP1A 6NULA 2K7FA 3JQAD 2QBYA 5LOVB 1EVKA 2BE9A 2VNKA 4G8DA 3B13B 3IPRA 1RYFA 4RKWA 3TNYA 2VEDA 2PRJA 1VSTA 1C1XA 1HH4A 5H3LA 4PX5A 4MV0A 4UOQA 3RC9A 3KCQA 4YFVA 3FTFA 1G16A 1WKBA 3ZX5A 2J1LA 1SVUA 2FN8A 1XAHA 1ZGCA 2WSIA 3HPRA 3WRYA 3FCXA 1ORTA 5IZCA 4MA4A 1RLTA 1T4CB 2GBIA 2XBLA 2IYYA 4ZREA 3QKRA 4Z3DA 2R7LA 1GTVA 4NONA 3TN7A 4OLAA 1YVRA 2V65A 5CT9A 3PCXA 1RYYA 2JJ2A 4LA4A 3D3WB 2GA8A 4US2R 3Q8WA 3EXHC 2DTXA 4A8JB 3DM5A 3OIFA 2GKSA 3LVQE 4YA6A 3ZHYA 5KJ1A 2UZ3A 4AS1A 2IBMA 3L8DA 1RAEA 2V3VA 4JIMA 4XD7A 4BMCA 2J07A 4UPDA 4K9DA 1XEWY 3ONWA 1U11A 3LK6A 3T9EA 3TJMA 2Q3JA 3ORFA 3U1VA 4E31A 2GZ1A 3DH0A 3ECSA 2IEDA 4HAWA 3TCNA 3V97A 3LT0A 4AULA 4DNQA 5BV1A 3FLEA 4UQPA 1UT6A 3RYIA 2UUCB 4TRNA 1AQ6A 2A14A 4RPJA 4OXYA 3DQZA 4HR7A 3TNLA 1RBYA 1KHHA 3Q85A 2YH2A 2VSFA 3BJZA 3UWMA 1WXXA 3MMSA 2R6FA 2WR8A 1N8KA 2ODBA 3H84A 2OXCA 4LWZA 4NENA 4R1TA 1NYLA 2TMKA 5THKA 4BKPA 1IQPA 4LVNA 3GMDA 1LY1A 5AK4A 1D2NA 2FPKA 2H5JA 3DT8A 3P7MA 3R40A 4MV6A 1MLDA 1G0NA 1UJBA 3RTDA 4D98A 4M99A 1IY2A 4S2UA 3U4HA 1MVNA 2MSLA 3D5EA 1L5ZA 3L7DA 2BEJA 3RNOA 3CZCA 4AZ0A 4TXNA 1I9CA 2PZBA 3B1VA 3E22B 1I80A 3GUUA 3I4CA 1Z83A 5E8JA 2WIGA 3KAPA 3Q7TA 5JHHB 5HDQA 4F38A 1VG9B 3O31A 1G20A 4BNDB 3SE7A 2ZKLA 4QJBA 4K2HA 3C8ZA 5IT4A 1Q17A 1YS4A 4MYRA 3E2MA 3R8XA 3WWYA 3V8BA 3OCXA 3FUUA 3AU9A 1CY8A 1DB3A 2IBSA 4Z54A 3JARB 1YR2A 3FRHA 4UMVA 2PIDA 1VLLA 1GGEA 4I08A 3FDZA 4RF3A 2AD1A 5AKHA 5DT2A 5E1DA 3RS8A 2QG4A 3BXFA 4M9SA 2OK8A 2C7PA 1XKXA 2BYTA 2GBGA 2VG8A 1AUQA 3PQ5A 1ENOA 1IXYA 2A78A 2AG0A 3ANTA 1HE2A 2YXLA 2JGNA 1KEPA 4M1EA 4BNGA 3VZBA 4RH1A 3QLVC 5DEOA 5E1OA 3OLZA 2EP8A 2FW7A 4KO8A 1U4OA 2YX1A 2FF7A 4TVKA 5G4KB 1GNTA 4BNIA 1XCOA 3CKMA 1PKEA 4KWHA 1RI4A 3MS4A 1FPMA 2GPYA 3A4VA 4OXIA 1E60A 4BN5A 1LDMA 2BHRA 4Y1RA 1N9GA 2OXIA 3SHOA 4LGVA 2EF0A 4JQYA 4F6CA 1DUVG 3H16A 1JDBB 1LCIA 4FHEA 4R8SA 1EDOA 4MPDA 3R5JA 4F60A 2DR2A 1MAVA 1WLYA 1FXUA 1ISMA 3MNFA 3UK7A 4CL2A 3KYJB 5DI9A 4BBJA 1P81A 1KSFX 3QHQA 4JC5A 3UO8B 2LCIA 4N12A 3LQKA 5EZYF 2I3AA 2IHUA 3VOSA 2H52A 3KAKA 2CL5A 2Q07A 1OI3A 1CVIA 2VA9A 4MZXA 4EKYA 1IN5A 1KJ8A 1YJAA 3BRWA 1X7ZB 4M1OA 4NEQA 5IC5A 3LUCA 3VPAA 4EHKA 5B7GA 5BQXA 2QSUA 3CURA 5A3JA 4C6TA 1GGNA 3I8OA 3JALB 4WN3A 3RWBA 4F9GA 5JR3A 3NATA 2L17A 3WX0A 4WSOA 4RIIA 1F6BA 4N5MA 1VHLA 2V7UA 3CG0A 1AS2A 3CZ4A 3PR3A 4EGSA 4YDRA 3F49S 2WAXA 3IP1A 2B2XA 4MKZA 3EZGA 3I23A 5J5AA 4ONEA 4A2CA 3D2BA 4MEJA 2PSEA 4S05A 4NG4A 1YO6A 3I2HA 2FRDA 3HWX1 2JJMA 1CDEA 2JIMA 3ND7A 2ETXA 4LRUA 5FNVF 5EHNA 2AFVA 1XJ5A 4HLNA 5T4FA 2EJUA 5JJKA 2CXQA 1NUAA 4U4AA 3TM4A 3K9GA 5A4FS 2W93A 4JLUA 2RCNA 2O54A 4Z9AA 1IEQA 1IJEA 1ITZA 3X1KA 3P2IA 4LZAA 4ARZA 1Q0ZA 3QPWA 4NDAA 1A9RA 3HPQA 1TC1A 4QTTB 4RAQA 4A6DA 2IITA 5HTOA 1RSZA 5IH7A 4FYIA 3SFVA 2MSCB 4LJ8A 3KPVA 1LS6A 5D5PA 1YUBA 2JCBA 4HGQA 4PIVA 2C59A 3E9EA 1XLWA 1PS8A 1WMSA 3QI7A 3EG9A 4Y30A 2GBCA 2GUWA 3K1TA 4E15A 5K0JA 2PYDA 4IQ4A 5FBKA 3G7SA 1PX2A 1RRFA 2HLDA 3K1JA 1DX6A 3D81A 3SR0A 3K31A 3QIAA 3D7MA 4E2YA 5LMNB 1WQ1R 4A8JA 4V03A 5AVZA 2I2XB 1KI6A 1VTKA 3HV0A 4ESEA 2RHHA 3KD3A 1PNRA 1DRJA 3R6TA 5BW5A 1AS0A 1UK9A 2MSKA 3OT5A 4Z8YA 1E7QA 3C1OA 3MMZA 5C1OA 1AV7A 2X15A 4I1YA 2BGGA 2Q8PA 1XDDA 4PIMA 5DCUA 1UBFA 5DRYA 1CJUC 1Y3CE 4L3VA 4LXUA 3T94A 1NGSA 2VHJA 3FMVA 1HYBA 4RCZA 1TQ4A 4WPGA 4G8CA 1WABA 5F1OA 3TRHA 1XZGA 4QL3A 3JZAA 2FX2A 2ONJA 1VJCA 1P0FA 3TXYA 4OXNA 2ON6A 2H7CA 4G41A 4L85A 4S1NA 1XJCA 2TS1A 2A5JA 1AO3A 4UNSA 1VA4A 1OU4A 3AWIA 2F3RA 1NJ5A 3P97A 4MMXB 4MRSA 5AVSA 3GVCA 3BL6A 5IDVA 3OOHA 3C4JA 1SZPA 3GCDA 4PS0A 2W43A 2Q3CA 2P3LA 3CLUD 4LBZA 3MJHA 1WSBA 3IESA 2OO7A 4IKPA 3RS0A 5HF6A 2PANA 1UKVY 3BAZA 1R64A 3P0HA 4PLYA 4F96A 5DGTA 4JJ4A 3AL0C 2VQ6A 1JJVA 1NW3A 1TMKA 1ZC3A 2QV7A 5JBNA 1SXJC 1XRNA 1GNQA 2F00A 3RF7A 1UZMA 3QI2A 3UAVA 1KVTA 3OP1A 4BVFA 4DBVO 2JPDA 3I0MA 1JHQA 1J49A 2V4ZA 3DGEC 4JD5A 4QNMA 4LFAB 3V4SA 1O9BA 3K09C 1BU5A 1I0IA 3GT3A 5TGZA 2QQ5A 2HFKA 5DTQA 1U3TA 3K70D 4GLBA 3FJYA 1ZYUA 3SZGA 2FOLA 1RJFA 3AR9A 1P6XA 3LF1A 1W4BA 1TUEA 4EJSC 2XITA 4PGMA 4Z4FA 4IR7A 1FB5A 4G8JA 1PR9A 4G4SP 2O2EA 2CLEB 4OQZA 4P4UA 4CIWA 4E14A 4QBFA 1CEXA 3A9TA 4DLKA 1GFSA 1N5DA 4LYHA 4W82A 5K0TA 5KSYA 2PKWA 4D4IA 1EB8A 4Q7KA 3L7IA 4KPGA 4R3NA 4ZQCB 3S8MA 1AQYA 1OGYA 2ORVA 4DWOA 4XWOA 3OUZA 1ZMOA 4FQ8A 3FVVA 4OI4A 1IHYA 4H1VA 2VIIA 3HYSA 4MIEA 1ACMA 4MVJE 4N03A 1T9ZA 3JY6A 3WVNA 4EW6A 1ENYA 4DCNA 3CZAA 1CIJA 1IIBA 1FU4A 3KOUA 5JS7A 5L4NA 2IS1A 1C0EA 3A6EA 1T43A 4QXOA 2PZEA 5ESRA 1QFMA 2J6BA 4P3OA 1L1FA 1LEHA 3N2EA 1R0BA 3O3NB 1EDDA 4BJ3A 3RUAA 3PEYA 1SNYA 4HUQA 3DBHB 2I4MA 3PPVA 2PLAA 4P3PA 2ZCJA 4JUAA 4UZEA 2PXCA 4NBVA 3M1YA 1VMDA 5EJMA 4CR7A 1WG8A 3WIOA 4BBZA 4HRVA 1G2QA 3UJNA 2YCLA 3NONA 9ATCA 2P79A 1CUYA 3T9FA 2OHGA 3KX2A 2HGSA 1EA5A 1K86A 4IXTA 3ZTTA 5J4HA 2X19A 4Q7EA 4DXDA 4Z9FA 1HE1C 2WTNA 5EUQB 2MYPA 1JDSA 1GGHA 3GVPA 4P4LA 2G77B 2P1DA 3UAYA 1WZNA 4UQOA 3C48A 5EVJA 2EBUA 4GR9A 2D2XA 4LMRA 5DM60 3A31A 3WK5A 5IAAA 2CVQA 3RS7A 4C0AC 1RS0A 1EZZA 3HYNA 3P96A 3L1JA 3QFCA 4JJEA 1P5JA 4MKFA 4PPGA 4RD4A 2VS1A 1QM5A 3K9BA 4XR4A 5INTA 3T95A 2XYRA 1KTIA 3DDHA 3MWJA 5AI6A 4URWR 4D99A 1CS0B 1DHRA 3O26A 3GU3A 3R5HA 2YV4A 4W5QA 1V8FA 1BE1A 4EAQA 1HNXB 1ZJ5A 1X77A 3GC6A 4INZA 1PLLA 5BUZA 3Q72A 3GMIA 5AQEA 2RGRA 5EIBD 5HX7A 1S4MA 3PR2B 4W8HA 3PENA 2WWIA 5BYKA 1GL3A 1ZSNA 4H16A 3S8EA 1FQJA 3AI2A 3ZCRA 4ZV9A 2XE7A 2I7DA 3CNEA 1GQSA 1AKUA 1XPJA 3PNYA 2GFIA 1L9XA 1DAKA 1XRRA 3A05A 2DKNA 4QYXA 1H5UA 4QODA 5F76A 2YOHA 4X93A 2HJSA 2XZPA 3NEAA 2ICAA 3OFND 4BWVA 5EAIA 5B4VA 4ZTBA 2GXUA 4MCAA 5JVDB 4F45A 4Q4LA 1QORA 2C4MA 3AZQA 3DEIA 3ZD9A 4FOTA 4IV8A 1MJHA 1NLZA 1XRSB 2IEAA 3LM8A 3MD9A 3G5AA 4OKNA 2J46A 4Y2RA 2DSNA 1RRMA 1L8QA 3AUUA 2WTUA 1LQUA 3KYBA 1I7NA 4J49A 4W7HA 1SVIA 5FPYA 3MJDA 1L2TA 2WMDA 4XVHA 1MRZA 2YXDA 3RT1A 2EU8A 2GS9A 3IAXA 2DUNA 3WRXA 3IKMB 2HCJB 4HQ6A 1CFZA 1ML3A 4K9MA 3B1KA 1DEHA 2R0QC 1Z4OA 4FU0A 3T0IA 3ISVA 2JBWA 2CHFA 4JITA 1CZUA 1PT7A 3QU4A 4CFZA 1T8YA 1ULSA 3OEEA 4LJYA 3V5NA 3VNRA 2WZCA 3ADPA 1WMDA 3R3SA 2JASA 2X9VA 3KYDB 3I6ZA 3G49A 2ODNA 2PCLA 3VVLA 3E9DA 2PUHA 2ZAOA 3A0RB 3CV3A 3OKFA 3TBKA 3SYMA 1FU7A 4EUNA 1TYZA 1RWQA 5D87A 2NSDA 1B26A 2ZIXB 4PZEA 5ILGA 1FXSA 3SQDA 3B51X 5HG0A 3FB4A 4XGIA 2A0KA 4TQAA 2P5UA 4MHOA 1R8QA 2REBA 4CCYA 4WGFA 4CMBA 4E5YA 1RWXA 1ZUHA 1JHPA 1O87A 1NVMB 3AIOA 3ZW9A 4EY8A 1G7RA 3PTLA 4BPBA 1TAGA 4ZTUB 4TYYA 3DB1A 2V97A 2R6CA 2AMLA 2JG3A 3AJEA 2IIBA 1HFEL 1L4GA 2X7JA 2FQQA 4ACAA 4MDEA 1G8HA 5ICFA 5CB0A 3F6EX 1P60A 3ASYA 3JYNA 1BGVA 2XRZA 1NBME 3GPDG 4GUDA 3JX9A 2PFSA 5DM2A 4EUKA 4U7WA 2A92A 3GN1A 4NSNA 2C9MA 4BEBA 2VDVE 1FRZA 3A6FA 1QQAA 2MINB 3KHTA 3ZHVA 2H7VA 4OXKA 3DUWA 4KE7A 4QYWA 1T5DX 5HF5A 3KAQA 2IYXA 4LY9A 2C2XA 1JAYA 2ZREA 2JRLA 1PF7E 4FYKA 3WBFA 1DXQA 1GTG1 4WTOA 4DJFC 3TSYA 2DPYA 2TYSB 1IN1A 1V9LA 4YJGB 5EQFA 3WA6A 2G1JA 3GFGA 1VYVA 1IY9A 2B25A 3T7TA 4MB0A 5T67A 2LTAA 1U2ZA 2RH4A 4NVRA 1ZH2A 2A5DA 3VZDA 4RA6A 4X41A 1O0SA 2EFHB 1PJTA 2PS9A 2JVJA 3HCPA 3W9YA 2QEQA 1W36D 2FE4A 3F3KA 1Y4SA 2BFFA 4MS3A 1WTCA 4TSFA 1KHTA 4EK9A 1HF3A 3C16C 2YTZA 1QK3A 3K5WA 4Q02A 3PD0A 2AYYA 2B37A 3HXTA 3R76A 3KQMA 3PI6A 5H5JA 2BFPA 3F6CA 4RKYA 5JAUA 2MT9A 4WNYA 2PKEA 2BP7B 3A1UA 1U7UA 4H2DA 4YR9A 3ZGVA 1Y3AA 3TSAA 1E2FA 2PO7A 5LOVF 2CF5A 2PMDA 3AK4A 4IVPA 3DBHA 1WQ3A 5GZ3A 1H3FA 1EI9A 4CW7A 4EZEA 3L84A 2X8LA 1U1FA 3DS8A 3OCYA 3PFWO 1BHO1 1E2QA 3UB4A 4AP9A 3RLFA 3M5DA 4EMSA 1A7JA 3CEHA 3VZPA 4NZ9A 3E82A 1CRWG 1Y4ZA 1NWHA 4TTVA 4EI7A 1DKNA 1JWAB 2PWPA 4G5RA 4GMFA 3T6KA 4A7PA 5B3KA 1UK7A 2B8WA 1W59A 3OUUA 3WYNA 2CBXA 4ZCPA 1G1MA 2MTBA 3CB2A 4Q00A 4RV9A 4ZVNA 2RB4A 2LR0A 1OYWA 3G7UA 4Q82A 2WWHA 2JLQA 3V8VA 1XJWA 2PUJA 2YFKA 4X44A 5SYMA 3KVOA 4DRXB 2QOEA 2WD7A 2BSXA 1MW8X 4QU8A 4FFDA 3P5BA 3KKNA 1EJ0A 4R8KA 4A27A 3DB2A 3MCUA 1CS0A 4OX9Y 1D2MA 3WGIA 3VDRA 1JQLB 2ZS7A 3OO1A 3AU8A 1BKYA 4E46A 3R2JA 2YYZA 2VHXA 2ZJBA 3P9YA 4JVLA 1NV8A 2EJBA 2X42A 3GBSA 5C31A 3VR2A 4YEDA 1K2VN 1OWMA 4IVRA 4N8DA 1CNFA 2VSYA 1T3LA 1TKRA 4WA8A 3P9QA 4RD1A 5LFAA 1AHNA 3OZGA 1CP2A 3LQ2A 5LVAA 5C34B 1AKVA 1BE6A 2D5IA 4JUFA 3I1JA 1NQVA 1MTZA 3ZY2A 4BLPA 5HS6A 1OXVA 4OBWA 1G4AE 3PRKE 4AURA 3COJA 1EUDB 3U49A 5KZMB 3ZJYA 3ZK9A 4UREA 3OKCA 2PSFA 1T26A 4Y0VA 3DQQA 5T64A 3DNFA 3AHCA 5G3YA 2FPLA 3RVPA 1TB4A 3IT2A 5EWLB 1ANKA 2ILTA 2G0AA 3OM9A 1BU8A 2GYVA 4FSXA 1SHKA 4JT2A 3S68A 3OF3A 1A4XA 1RXEA 1U9YA 1X8LA 2Q5FA 3UXHA 2BLLA 1EX9A 2I3DA 2OGUA 3DDOA 4MV1A 2I22A 1M6EX 1NRIA 3PGXA 4QX6A 4DYVA 3ACDA 4XSVA 3SBXA 1WXHA 2E18A 2P65A 1DTWB 2QAGB 4M6WA 4YJFB 5ALFA 3T9BA 3PKZA 4GOXA 4OHKA 2EJVA 4HEHA 4RWZA 2P91A 4F4HA 1S9DA 3I39X 4G2TA 4BNNA 1CUAA 3BDIA 1PBTA 1MD9A 2V03A 3CF2A 3I2KA 4GUAA 4P0TA 4CM7A 4HDSA 1DKQA 2F64A 4HGZA 1G63A 5DWQA 2NQ2C 4G0YA 2ZIXA 3IIEA 3H9BA 3JSAA 3FYSA 3RS4A 1M7HA 2PXXA 3NBAA 3EQ6A 5KQLA 4I6GA 1E7SA 4UEKA 2WDZA 4ND7A 2VJOA 2EGHA 4IDBA 1Y3BE 1YZHA 1J97A 2WBLC 3RNLA 4TLAA 2Y2VA 3WXMA 2ZB8A 2PT5A 4BB5A 2RHLA 1JHDA 3SC3A 2Y9PB 2ZIGA 3ZEAA 5DCWA 4ZCLA 2O50A 1KQGA 1THTA 1NF8A 2QTTA 3LIPA 3DMTA 1E7MA 4QFMA 4LTMA 1M2FA 3HDTA 4H7JA 1RFLA 2WYIA 5FI0B 4IMJB 3CLRC 2B3TA 2YJ4A 3I5XA 1BDMA 2PL9A 1GDHA 2YMPA 2ZI4A 3O4GA 5HUQA 3EDOA 1T2FA 4WA7A 2QRJA 2F3SA 1JEQA 3ZHBA 2N0SA 5EJAA 1U1DA 3VR6A 1C9JA 2J9RA 3Q98A 5TQ2A 3VDQA 3ZLUA 2Q5JA 1IPHA 3AKDA 3EC7A 4WEQA 4BCBA 3VVCA 4TT3A 3OPXA 1J22A 3LPCA 4JLJA 1AK1A 4RYLA 4TM8A 3UHOA 1I30A 4JN6B 3Q11A 4MNTA 1IFXA 4YJGA 4E6EA 3C74A 2WM3A 3EB9A 3LGAA 2FPIA 2Z8YA 3CRVA 1NQAO 5A06A 4L78A 1AOXA 1JXOA 1OGIA 2IW1A 3R1IA 1KI4A 4ZYLA 5JSZA 5EOVA 3HVUA 1RJEA 3NHRA 1XJQA 2BCEA 4KFTA 3VR6H 1B42A 4GZ6A 5DN6A 2YIJA 2WAMA 1I01A 1YB5A 1BW9B 4IWXA 4KX3A 4X20B 1IUKA 1PEKE 1W94A 4EQZA 1BWRA 1U2DC 2J31A 2VLIA 2PUDA 2X41A 1N0IA 1MPTA 1DC8A 4LOKA 2AH5A 4CG2A 3QHPA 1W6UA 1NM5A 2DLCX 5DM70 3C98A 1AGPA 1GQFA 3HR7A 3H5OA 5I01A 5K0EA 2JFNA 3K0FB 4C4SA 2P78A 2BP7A 2WWYA 5D3MA 2A94A 1NIJA 4RVCA 4LJAA 5FAXA 2DR0A 3VO8A 4KEAA 2C2YA 1I5RA 4HT3B 1UAGA 5JCJD 3KSBC 3GQVA 4LE1A 4YRCA 3IERA 4Q6BA 4HSEA 5K51A 1X74A 2X23A 4V0QA 3CF0A 4RULA 2YYYA 4URYR 5DBOA 5P8WA 1NLUA 3LHKA 2YHBA 1E5XA 2QP3A 4OGFA 1PYDA 3WRWA 4BO1A 4BVBA 1QZZA 4NZZA 4CM6A 4DGQA 1QIKA 4QBIA 4GYKA 4GZ3A 2JHCA 4D26A 1VJRA 3REGA 3U4MA 3GT0A 3FDXA 1XRJA 2G5GX 3KL2A 3CY6A 3V55A 4LJLA 3IVRA 3N28A 1NX6A 3BKXA 2CLIB 4XYGA 2JLUA 2ZYHA 2ZSKA 1HMYA 1DAIA 1MOPA 3K96A 4MKXA 3GRCA 3U7IA 4AY4A 4E30A 5A9SB 2P0YA 2R84A 2ODQA 1JYSA 3MF4A 2R60A 1AT1A 4N1AA 4UOEA 5IF3A 3ML1A 1NMYA 1S6YA 3MJEA 3OX3A 1V43A 1V4NA 2VAPA 4PIPA 3ZLVA 4DJJA 4BFWA 5BV2P 5L51A 1VLJA 2I5PO 2R62A 4WLUA 4R2JA 2ZAYA 1MJGA 3AC0A 16PKA 3U3JA 1GCAA 4IHKA 5DXAA 3VYSB 3FOZA 4QBKA 1GTZA 3L8EA 1IE3A 2P9HA 3PUWA 1D03A 1HFWA 1M6VA 2O8NA 2PQ6A 3PFIA 2WU3A 2Y99A 1EAMA 3F3SA 1V96A 4CG1A 4XCXA 4JQZA 4DM7A 5KC8A 2Z6QA 3NTVA 4PY2A 1X8JA 2G5CA 3L0ZA 3PI7A 5JS6A 2J5KA 4IEEA 5ILQA 1ONOA 4QEZA 2DG2A 2RGYA 3IMGA 4H1UA 4RC9A 1ISSA 1C1YA 2FP4A 3WLAA 3FPBA 1BMTA 3JAKB 4HXYA 1S01A 4PLZA 1I4OA 4NXNB 3TPFA 5LYJB 4NCNA 2AKYA 2ZBGA 3TKLA 4MQ5A 1CZOA 2NU6B 2WG2A 3E3MA 3DJFA 1IPFA 1DIBA 3SIWA 1D6JA 1SHUX 2C4WA 2QLBA 2VFAA 1WHSB 1J1IA 2BGJA 1ONSA 2G36A 2W6OA 1N2OA 4HLQB 2CJPA 3RIXA 2NVUB 4HNVA 3GUCA 3EWSA 5CIQA 4MRMB 1VBNA 5CVDA 3VKHA 1DTWA 4JA0A 3C39A 1YSCA 1YMVA 8MHTA 3BK1A 2NSYA 2ECFA 3D0KA 3SDZA 5FUMA 1QIFA 3F9IA 1W19A 3TB6A 1NXWA 2FPOA 3QA3E 4PGHA 1U2QA 3L06A 5J40A 4E12A 2WPDD 2YOFA 4TS4A 1CVLA 3G0HA 4D4GA 1AV6A 4JLVA 1LPAB 2VK8A 4FBGA 3ANXA 4PN3A 1J8YF 4LOHA 3IOMA 3MTQA 4MUYA 1MQ9A 1ZHHA 2QNRA 4I1IA 4EJ0A 2JJYA 4RENA 1DIAA 1HDXA 2VNSA 3ORQA 2YR0A 5IM4A 1B7GO 4EARA 3QJGA 4YUAA 4WXYB 2WMYA 4BKQA 3BTOA 4XX1A 3QELB 1CEYA 3AH8A 2JCSA 4KN6A 2REXB 3CIFA 4JGGA 4NAVA 4ML3A 3B2NA 2ZCUA 3T52A 2YJ5A 3UMYA 3RVOA 4PVDA 4UC0A 3QX3A 2AA3A 4JBYA 1G3IA 4TUYA 4Q9JA 1TD9A 3R0QA 4H17A 4X95A 5C7IO 1XUOA 2FNAA 1TDJA 3FX2A 4MI6A 3PWTA 4X7RA 3R3HA 5JO9A 2QX6A 4FHCA 2XYVA 5JATA 1UODA 1P5RA 1O97D 3ACCA 1PVOA 3SZLA 1H2FA 1NMZA 3JASB 1KI9A 3MT9A 4FDTA 4L9WA 4OLJA 5FBZA 3WQBA 5BR4A 4S0XA 1I2ZA 2QDKA 2I7CA 1QH8B 2OBYA 5EE9A 1GVNB 1BROA 1OX6A 2N1BA 5K3BA 1DWPA 3TWOA 1GTMA 2QN3A 4Z1MA 1CB7A 5BSFA 4DQUA 1Z2OX 1VIMA 2B8NA 3V7YA 3QPBA 13PKA 5AI4A 1OH5A 1P0CA 1Y42X 1WDKA 1VKRA 2C77A 2JGMA 4OBEA 5ICSA 3EZXA 2HLPA 1V11B 1XFAA 1BW9A 4ZVSA 3B3AA 4L08A 2CY0A 2WEKA 3EEBA 3V6LA 2H00A 3CUYA 3RVSA 2VSOA 1AZLA 1QQ5A 2ORYA 3PL5A 4GMHA 4NQZA 2JIOA 4I9FA 5E7IA 2Q4OA 4GW3A 4EPXA 3K0FA 4U63A 3U1TA 4IJMA 1PU2A 1KI8A 2F9FA 2OQVA 4EX6A 1HQDA 5JLJA 1YQXA 3BN3A 3H5RA 5C4GB 2MSEB 5AI8A 5JJLA 1KJYA 1QGYA 3CLKA 5SZKB 1Q0HA 2IYPA 4QUKA 4ODIA 1QSGA 4AJLA 1R9NA 2L19A 3OZSA 4A2PA 1NQXA 1V45E 3DE7X 3EIOA 4TTPA 3I45A 2WFLB 1SRQA 3Q88A 3VSEA 1GTL1 4J9VA 1RQGA 2J7KA 3EMDA 2ZRQA 1QCYA 3IVGA 2IYZA 4BNVA 4ER0A 1A27A 1I4DD 2I7XA 4HH1A 3KKKA 3X43A 5FOQA 1JJAA 4M0CA 4QUGA 3DR5A 5TMEA 1UT5A 1ULAA 2COKA 3BIWA 1W76A 4YTEA 1TF7A 2R44A 1F8UA 4NJMA 4NK4A 3VNQA 3ZDQA 4AJ1A 5JIBA 5FHRA 3ENVA 4E5DA 1ZA2A 1RLIA 1VIAA 1E1KA 1IWOA 3T9AA 1EAYA 1JIQA 3DONA 1I10A 4FGKA 3L3BA 3ZI7A 4PG5A 4J6EA 3GLTA 4GWGA 3JRWA 4MK4A 4XPZA 2HA3A 3LHSA 1II8A 2B8JA 1HV8A 1G7CA 4I3FA 3LOUA 3IJEB 4MW9A 4JNCA 4C7VA 1A88A 3O90A 4N48A 4J0KA 4GPEA 1RWMA 1SEVA 3IKJA 3PBKA 4ZTZB 1X7GA 1F0KA 1J09A 4XOUA 4JBIA 1BX3A 3BZWA 4Y9UA 3PUHA 2O3SA 5E95A 4G1CA 3WFIA 3D4PA 4D2IA 1U0JA 2F8LA 4G5QA 4WH0A 4H27A 2WSYB 2X8JA 2XY4A 3EASA 3FWZA 4P7KA 4RV5A 5EYPA 4QT4A 2E1PA 3PXEA 4XFJA 1NASA 1QB8A 2HF2A 3JS5A 4NOKA 4TTIA 3UUFA 1K4MA 3TZ6A 5IZ4A 3JYQA 2GZ3A 4L07A 2O8DB 1E0JA 3DVLA 3HDJA 1OBHA 4B3CA 2V54A 3ZHZA 4HRYA 2ZBEA 3NWPA 1EUQA 4OQEA 1U2TA 3QV1A 1KMQA 1BN6A 3Q6IA 2FPMA 3SKVA 1E2HA 2RAUA 1WETA 3KV3O 4GQIA 2NU6A 4BV3A 4KOAA 1QLJA 1NPYA 1ZVKA 4A2QA 4WKGA 1SKYB 4ACBA 3W5VA 3ELYA 4UAUA 5ARDA 4P6VF 2W0SA 2NVUA 4PC7A 2IH2A 1A7KA 3CT6A 3BK2A 4UD2A 3BPSA 5EP3A 1NW9B 2C54A 2Q7OE 2ZR9A 2ZQYA 4HAIA 4XB1A 1D4OA 1MV5A 2J08A 3E8MA 4L0CA 2FEXA 4K3UA 1I7SB 4G25A 4P38A 4GPIB 4X90A 3L7BA 4R2XA 4N39A 3OKAA 2PXHA 2QUZA 2VJAA 3N2NA 1JQKA 5ITVA 2FWIA 3R7DA 1OTXA 3LCMA 1QC5A 4D8YA 2XPCA 4YT4A 4R81A 2QAIA 1AIPA 4MUXA 4DFDA 4X64B 4EHAA 2XAUA 1V41E 3S6JA 3ZV6A 1ZPDA 2OO5A 4U7FA 1I1OA 1QF9A 3MTJA 5IPFA 3KOMA 1KZ6A 1UXGA 2O05A 1A95A 1Z4MA 1M1UA 2H85A 3WI7A 1X92A 3GLFA 4BFTA 3SVLA 3R9IA 5FTMA 5LR6A 1PZHA 1OFGA 1JN0A 3CU5A 3FYUC 3IV7A 1LQ2A 1SPXA 3IMFA 4M1MA 4QIHA 2ZYWX 4YV2A 3EZ6A 3EK2A 1JDNA 1E8MA 1L7BA 3H1EA 5CCDA 3EXIB 1VJGA 1AQLA 3C6YA 3GP5A 3JXEA 4M60A 4QGFA 3TPZA 3OOSA 3BILA 1D6SA 1KNQA 1A8HA 2OT3B 1T15A 5LD2B 3K1YA 1V3TA 2GCPA 5BW4A 3OBBA 4KUEA 2G0TA 2FZCA 3C43A 2YWGA 4MJXA 1IMJA 5AXBA 1URPA 1IEVA 1H8EA 3CH6A 2LP4Y 2CUTA 3U3RA 4UPEA 4JVNA 1M8KA 2BJVA 3N0XA 4NU5A 4OA8A 5ULLA 4HQFA 4ND6A 3RO7A 5LZ9A 3H11B 4E51A 4KQXA 3FPFA 1RRGA 1Z6PA 4HPXB 1IZ7A 2WA1A 3QKWA 3QOWA 2C84A 1VFPA 1PK8A 3QV2A 4EY3A 4FX5A 4DQDA 3UBTA 3AERB 3F9CA 2JLWA 3NWJA 3TIXB 1QIMA 4V24A 4RPLA 3PE4A 4DMMA 1FSZA 3ROPA 5LP6C 5LQKA 1T6BY 4MGZR 2FWBA 4ZVOA 4RQTA 3WLSA 5BWCA 1MT0A 1X1AA 2I66A 2O2XA 4FZ5A 4AXXA 2WSBA 3EE6A 3TE7A 3THSA 4F93B 4WT7A 1SUCA 4U2KA 4QPPA 4RGBA 3CW8X 3EZYA 3EXHA 2FKNA 1DOHA 3GIDA 3FWHA 4PAMA 3P0EA 5JJCA 5CR9A 1J2YA 4HDQB 3DYBA 2XUHA 2GBLC 3IJ5A 3W8NA 1WM1A 3BB3A 5M04A 1RE0A 5CAEB 2QSYA 5FOUA 9LDTA 1PJ2A 2R7KA 1T5BA 2CZCA 1OV6A 3OF5A 3QGMA 7ABPA 2HSEA 3K9HA 2J85A 4JMLA 2I8AA 2P9CA 1I7PA 6REQB 3LC0A 2XZTA 5A6SB 1IH8A 2VYND 2PMEA 2BPOA 2P11A 3FKSD 5CCXA 3GJZA 3GD7A 4KIFA 1DIGA 3T9DA 1MJNA 1SWVA 1YS2X 3QYJA 3UUGA 1AY0A 3GDFA 4DUYB 2ZS9A 1RI2A 1H4SA 2Z58A 3V46A 2R5WA 3WWZA 4TKMA 3HUEA 2XNJA 5I45A 2QJRA 2WZQA 5TV2A 4ERNA 1U65A 3NUGA 3Q3IA 1C9MA 5IBRA 1UK6A 2IELA 2O2YA 1J8VA 2IDKA 3L4EA 4XIJA 5ITWA 5JZMA 1YI0A 3L4JA 2ZKIA 2R4QA 1I3MA 3HUDA 4FQ7A 3ZE9A 2C7VA 1AF7A 1LQTA 1PJSA 3K53A 4PRKA 3E7PA 3IS3A 4F5WA 2PUFA 3WQRA 2Q1TA 1QNLA 1VL2A 1C0PA 4GGMX 1L7VC 3VSDA 1ZR2A 4OFZA 3CMCO 1K4YA 3KOXA 1ZMXA 1GN8A 3T35A 4CCSA 3IKLA 1YWGO 5EHQA 2PUEA 5LM3A 2O5CA 4PU0A 3F6BX 4B2PA 3WAJA 5IM4F 1UWLA 2AFHB 4UEOA 1KPGA 4GP6A 1FW8A 1H4VB 1Z8FA 4EJSB 2Z5GA 1U31A 2RH9B 3FJOA 3AESA 3OJXA 1FE8A 3WGYA 1V47A 3GO4A 1JFSA 2A0FA 5DCYA 4CFYA 5LBUA 2RHTA 1KKLA 3FPLA 5DIZA 1RWVA 4FFLA 2FUG6 1TEXA 4HYTA 3ODGA 5I9LA 2D7CA 1YFKA 2NLOA 3BFXA 4KXQA 5H3CA 2X13A 2C2MA 2DQSA 3ET5A 1YFZA 4LBVA 1L3BA 4TUYF 5FPKA 4GRAA 1W85B 3NP9A 4YAWA 3ES9A 4TTAA 4A0GA 4JP5A 1OH7A 4KHZA 1N1GA 1G3QA 5DULA 5A9RA 4B7ZA 3JQBC 1X13A 3BDAA 4ID9A 5EHZA 1NLYA 2XCTB 3L04A 4MV7A 4N8EA 5HTKA 3FB1A 1NFRA 1XRMA 1QHFA 3SQNA 2G83A 1FS6A 4MI1A 4NMLA 2GN6A 4EB8A 3PNKA 5KINB 2FSIA 3B6EA 1V1RA 4W1RA 1BCRB 3GDOA 4JH0A 1XIVA 2HM7A 1ODTC 3EIXA 3E3AA 1E3EA 4V0SA 1HQCA 4XH9B 4YXWA 3LBIA 3TM5A 3VU9B 4DAOA 5AKLA 1JEJA 2C3YA 2ASEA 4XDYA 2ZIEA 4ZVQA 4JB8A 3ELBA 3DEZA 3PNSA 1X3SA 1AZSC 1XEXA 4FS8A 3VR4A 1O1YA 1X39A 4P98A 3SDSA 4D92A 5HKKD 2HBRA 2MSWA 3NWEA 1IBRA 1OC2A 1QONA 2L69A 3A2NA 5FLEX 3SR3A 4YDQA 1MGOA 1RAIA 4WOKA 5ERYA 2VRCD 5A1JA 4D43A 1C4OA 1EP3B 2HUPA 4N5HX 1N2ZA 4OXXA 4DG5A 1RRVA 3UJ3X 1FP2A 2UZ1B 3NB0A 3LWZA 4N9QA 3WJ1A 2JGKA 4D02A 4QU9A 3BH7A 3HN6A 4C43A 3FGPA 1L4UA 5J2UB 4X1YA 1L4HA 2V7WA 3VR4H 2NYAA 5ADVA 4ZKEA 1DWOA 3EXIA 5B2FA 1FSGA 1UXJA 2PHZA 3JSXA 3N74A 2JGEA 1QVRA 4TVBA 1XU9A 1PDVA 1Y33E 3AY3A 5ARCA 3ICWA 5K03A 2IV2X 3IO5A 3G2MA 1CR4A 1KIMA 5D51S 2GXQA 2EG9A 2VCEA 3HVJA 4BO3A 3GOQA 4R5HA 2DHEA 3DMRA 3ZHXA 4B3JA 4E4YA 3U7HB 1M83A 1E99A 3ADKA 3L8FA 1IXZA 1RIIA 1OA1A 4W5JA 3QSYA 5EKUA 4HGNA 1B15A 3LW7A 4RZUA 3WRVA 2OZVA 1DUIA 5C7OO 1EE1A 1FP6A 1ZQ1A 2AQIA 2OXRA 3LPMA 4RQAA 4RGVA 3PNBA 2GN0A 4B5LA 3ZU4A 2GAIA 4WLFA 2R4TA 2QRVB 4AT1A 1KS9A 2H07A 3L8ZA 1HE3A 2HSGA 3G8AA 4FLEA 4XX0A 5LWHA 1K3FA 1KO5A 2EWMA 3DHNA 2B9VA 4L57A 2PXAA 2WC1A 5CW2A 3RSLA 1GQYA 1UKAA 2VWHA 1P19A 3DXXA 3GEEA 2HHHB 4UCXA 2GPAA 3C6QA 1TEHA 5FRDA 4HBZA 1GG8A 5LKAA 3BWVA 4C29A 2GM5A 5AIBA 2AJ8A 5FB3A 2P2GA 3M0EA 4ZVLA 1R4ZA 2NO5A 4CLRA 3FUCA 1NVWQ 2WTMA 4NE2A 3U9SA 3V8EA 3I6YA 4B17A 5HFJA 3PT5A 4O1HA 1NSFA 1SG9A 2AFIE 2B1IA 1K8XB 4NDZA 1QO9A 2OVFA 3KQSA 2PGOA 4R69A 4TTRA 5LA6B 1B4DA 3D7RA 4BQPA 1D2EA 3L43A 1X7XB 2B92A 4Q48A 1QTRA 2QTCA 4Z0PA 5TC4A 2Q0SA 1MA0A 3PVZA 3MBIA 1XTPA 3S7ZA 4YP1A 1J2UA 4BRSA 1RRCA 3KFVA 4P93A 3NR2A 4DVGA 3M3DA 3UF0A 2G71A 1QE5A 3GA7A 1CY4A 4YALA 4E3WA 2VF8A 4EELA 1BWPA 4Q1DA 5LYJF 3PPXA 1USKA 1CJVC 1TZMA 4PRZA 4B3SB 4WKCA 4C5AA 5L45A 2ID8A 5T8KC 2X0IA 1YDMA 3IRVA 3FROA 2I55A 3AF5A 5CLIA 2E4WA 3NBKA 2QVYX 2IGBA 3WYDA 4RNDB 5KYYB 3FR8A 1VPLA 1YD7A 2YUIA 2ZSAA 4X8OA 1BDHA 4A0HA 4B6SA 4C1NA 1N5LA 1ZNYA 1Q0PA 5AHRA 2NYRA 4AIRA 3E8XA 1E5QA 1SXJA 5J4LA 2DPXA 1JG1A 1OXSC 4MW1A 4F71A 1UBSB 5DTIA 4CCAA 4C7KA 3IEKA 2J0SA 3K09A 3KKLA 1RKQA 2R79A 3KPUA 3QUAA 2XMRA 4GP9A 4BX2A 1XT6A 3ZVNA 3E58A 1FBTA 3E53A 1GRCA 4Q18A 2VOJA 3W4KA 4KQIA 3EIFA 4ZQEA 2AFHA 1M1ZA 5H9VA 4YRNA 1DXHA 3FRIA 2PTGA 3DVQX 1CUUA 1P7ZA 1V1MB 5CXSA 5JYDA 3L1HA 4EJSA 2J5XA 4PSKA 1OH8A 2QGZA 2NGRA 1K06A 2WK1A 4C01A 4EFNA 2V58A 4NZPA 3EQ2A 2AKAB 4ZKDA 4OI1A 1X1SA 3DZDA 4M86A 4TVOA 1PUXA 1E9BA 2NV2B 4C3OB 4DC9A 1OWPA 1NUHA 2F1JA 2O3QA 3LWBA 4ILEA 4NEHB 1QK4A 5I3CA 1YRYE 3O4HA 3AF2A 5HZKA 4WLEA 4BYGA 1H2RS 4DV7B 2RK6A 3WLFA 5DNUA 5KVVA 1V3QE 2GPWA 3TTXA 4N0QA 3M4NA 1PL6A 4KQFA 4PONA 3HK2A 3VJRA 1UIMA 1PTJA 2DBZA 4MO9A 2D62A 3ZGNA 4ABTA 2ZZKA 2EFEB 4NBNA 3ZV7A 4MP8A 2XLBA 4JX8A 4ZIRA 2FP3A 1CC1S 1BCRA 1FF9A 2PYIA 5ALIA 4YUVA 4DR5B 1RCFA 4YR7A 1L7PA 1ORIA 3HJUA 2AT1A 3KSMA 3EFEA 5MFZA 1L5VA 3SEQA 4NKRA 1FP1D 3DVAA 3OPYI 2XWSA 3F97A 2R6R1 4KE9A 4HQRA 3TRDA 3RVMA 1FY2A 1WUYA 4WOPA 2PUTA 1HQYE 3JYOA 3T3MB 2II6A 1BOOA 5I7EA 1C29B 3M6XA 3W5SA 2IZ0A 1P3DA 3SZMA 2WJPA 4BZXA 1O94A 4ENQA 3IR6A 4KVAA 3LLSA 2JZNA 2RG7A 5JISA 1J0CA 2W6MA 2GPTA 4QQ8A 2GUGA 1ZC4A 3IDOA 2FKAA 4FJ2A 1IQRA 4IYJA 3M8KA 1T9DA 4J2OA 1KEZA 2AVDA 3V8QA 1BRTA 1DAOA 2R8BA 3ZQJA 4CTMA 2IOHA 5KTNA 4CLHA 4IQ8A 1VSBA 1KK0A 2IXTA 2Z43A 2DEUA 4S1PA 4EKEA 1LRKA 2HADA 1WEHA 1ODKA 4G4IA 3IQEA 1N3LA 1GKYA 1KYIA 2BEVA 2QQGA 1KIAA 2Y1CA 2E3JA 4ZODA 2YDXA 1EDZA 1AGYA 1RLUA 3I9JA 5TEWA 4B3TB 2CDNA 1X1EA 5DNEA 2PGNA 4KO1S 2IUYA 2OZPA 2WD8A 4KQEA 4PYNA 2D7DA 4E09A 3B52X 3NT2A 4NARA 2PMCA 5HF9A 3SS9X 3O4VA 2FDXA 5HK8A 1J2RA 4GOKA 4KAXA 4TL9A 1XZMA 4QU0A 5AJVB 5K6TA 1EXDA 1JU3A 1AB5A 4KN9S 3DOJA 4V0MA 1IY1A 4WZ6A 1K92A 4QRIA 1VXOA 3W4IA 3WKEA 3A70A 4I19A 4WBSA 4HWTA 4RZSA 4DBZA 5MF6A 3OT1B 4QOJA 1NVKA 3E9YA 5FYDA 5GOZA 1JLMA 5BPFA 1FPQA 1U81A 3OJCA 1HPLA 4NU0A 1YHZA 2PKCA 3LQ1A 1K5DA 4GMXA 4UBNA 4ZO9A 4ETIA 2XNCA 2D6FA 4P3YA 1MGPA 1SQSA 1GZUA 3WISA 1CY2A 2EVWX 5CDFE 2J9ZB 3T12A 4MUIA 3WFJA 2ZVDA 2FZLA 3KT3A 3MB8A 1T1GA 4GXNA 4JCOA 3DWIA 4IIHA 4WQMA 1T9BA 4WXPA 1YS1X 3HKDB 3STVA 3BJEA 2IKSA 1ISFA 3LDHA 2A4KA 4GGPA 4KDCA 4LXTA 3MXTA 1KEEB 4BJ6A 4J16C 4KH1A 4FFNA 1CR0A 5AKGA 4GWKA 2D54A 4O02B 2F4NA 2JGJA 2Q9AA 2OFWA 3PXCX 3ROKA 3CUTA 5IABA 4Q37A 3QBDA 5E6UB 3ZS9A 4OLBA 1UPAA 2GDJA 2H31A 3AF6A 1JVBA 1ZI6A 2FK8A 4B3DA 3L92A 4YI5A 1TK3A 4J6FA 4RPGA 3P2YA 2HT6A 1MPXA 5DGCA 1V9CA 3DA8A 1UOQA 4QASA 2Q6TA 2E37A 4OQXA 3DAFA 2GEDA 5E7JA 3TQCA 1QB7A 4MR9B 4TS9A 4AUNA 2QV0A 1XNRB 1LV7A 1T3HA 4CI9A 5CLFA 2Q0QA 4BATA 1WBBA 3PGA1 1XJ0A 5IJXA 1MC8A 2ZRPA 4I8XA 5EL0A 4A5SA 1CQIB 1NWCA 1JA0A 2X1MA 3EXFA 2O2SA 4L4SA 4TXJA 3UK2A 3AVQA 3F4LA 5TLSA 4BGVA 3ED5A 3AVTA 1QS0B 1RJDA 1AE1A 3WP1B 1J8MF 3CUVA 2LD4A 2Q2VA 4NCKA 2J3EA 1YC5A 2HMWA 2HWWA 3CKKA 2WJYA 3D7SA 1OMOA 3ESQA 3W3ZB 2HF8A 2LUOA 3GCGA 4BB9A 2EZ8A 5CNIA 3ZD6A 3JWJA 4DSUA 1GPH1 1G6HA 1ZX1A 2AEMA 4OUDA 1ECPA 3LK7A 3W8EA 4HG2A 1BEZA 3U7RA 5H4GA 4WADA 3EFOA 2X9QA 4RJJA 1EXVA 2IKQA 5BVGB 1RPJA 4X3CA 2H5LA 4D0SA 5BSRA 4LIPD 4MTCA 1NQUA 4ARVA 2K4MA 2P41A 4B83A 5DMHA 3OG9A 4UKDA 5A4IS 5KJCA 4DMRA 1V8OA 2XUPA 2OM2A 1LNQA 2JLAA 1XHEA 2JA1A 3URKA 3CBGA 4M9CA 3LFUA 4OB8A 1RJ9B 3NBXX 4BO4A 4U7TB 4NZOA 2IEIA 3CRNA 4ZAGA 2ID7A 3AHEA 1I4WA 4XUEA 4WK2B 2E55A 1OD6A 2I7TA 2OKCA 1A2KC 2QRQA 3NHYA 5JLAA 1OV4A 1EGQA 5FBWB 5GY7A 4F5DA 1GO2A 2WZDA 2FEPA 2XNDA 3PC8C 5CMLA 1QGOA 2WUVA 5EXEA 1YQGA 1DMSA 1SK9A 4PQEA 1YL7A 5A1TA 1ORHA 2V4MA 4V0RA 2AJDA 3AF1A 1IVSA 4AAYA 3CZPA 5CEJA 3F7TA 1H3NA 2A4MA 1BXGA 1ZK2A 1Y1RA 2ZRHA 3L0BA 1E18A 1D8AA 2BY4A 1PJAA 1ST2A 2BKLA 4TZ0A 4FFVA 1OIVA 4RE5A 1VRWA 1NV9A 4WERA 4DS3A 1YGPA 3AR2A 5GONA 1VJ1A 4YLGA 2JH9A 4L0MA 3HKCA 4JYBA 2VTKA 4BVAA 1AXEA 1K89A 1FFWA 4UFOA 2NTNA 4OHWA 1L8OA 2XW6A 3ZW7A 1G59A 2XTNA 1QP8A 4J76A 1V7QA 4Y9DA 5GGXA 1P1RA 2NM0A 2QYTA 3FZEA 4J0QA 5U4XA 1H1TA 1FVOA 3PNMA 3GRPA 1MX5A 1UZAA 3EXG1 3QPAA 1NJFA 1F17A 1KYTA 3GLQA 3L01A 4XGNA 5AOBA 2ZRKA 8GPBA 3EVAA 1CUHA 1N75A 2I6TA 3MCAA 2VTVA 4ZFNA 2GXAA 4MA0A 1JR6A 3X1YA 3NJ8A 4ZGBA 4ZZIA 3IILA 3CHYA 1Y8RA 4IG9A 5FUWA 1XZJA 2ZJZA 1T0BA 3ZGZA 5LZ8A 1TF2A 1QIDA 2VJMA 3DYVA 3W1EA 2BGWA 2FSFA 1GZ3A 2H5IA 1ACLA 2SCUA 4P3NA 3C2QA 5KHAA 4KP7A 1Q1AA 1NW7A 4WNAB 4U8HA 2I62A 1FZQA 4ZWNA 2VHVA 2DPMA 1VBMA 4Q1FA 2IE0A 2FJ0A 1LPBB 1F14A 4Y2HA 4QSHA 5DHFA 3EZ2A 4ZT6A 1X94A 3EQ9A 3KJIA 4MV4A 4PQYA 4TV8A 1ECFA 3VAYA 1JEAA 1M5UA 4KI0A 4PR0A 1E4EB 1JKIA 2JF0A 4PM4A 4PPNA 3BF8A 3U37A 4K0RA 4AYTA 1J5PA 4WY8A 5AVUA 3KQYA 3H04A 4LRTB 4FB5A 2B7CA 1ST3A 1WB6A 4MO2A 3EVEA 3MTBA 3ZE7A 4K3VA 1NN1A 2B21A 2B99A 2XX3A 1UCFA 2CXHA 4IJ5A 4PQGA 4XSHA 3ZWWA 4ETWA 1E8NA 1ECGA 1FTSA 1QG6A 2HQSA 1UOOA 2ZPTX 3SYRA 3VR1A 2D00A 5H02A 4F3RA 5BUCA 5JXGA 1I6MA 2H08A 3HP7A 3R0VA 4XR9A 1QHEA 2HNBA 4BNWA 4EG0A 1WOMA 4JKYA 4EYEA 1I6WA 5L3RA 3DKIA 5FFFA 5DISB 4FMCF 4RORA 1QCDA 5CXXA 2RGAA 4TMYA 5ES3A 1DADA 4Y3UA 5AO9A 5ADHA 3A06A 5EZ6B 1GFWA 3DPSA 5I7FA 5FQOA 3SDBA 1G4HA 4OL9A 4D74A 4F5YA 3D7NA 4F9TA 1XQXA 2RE8A 2B4RO 2IZ1A 2ZSJA 1HA3A 3AOGA 2YVUA 3OSUA 5IUNC 5DWVA 2NWQA 4PNZA 4DSAA 1M2VA 3L1VA 3ME5A 2F48A 1KZ9A 4KMOA 2Q1WA 1LLUA 2H0AA 2YXNA 2FZ5A 1ZVQA 2CLFB 4FUQA 3DSRA 4Q93A 3UMRA 1CS4C 1OTYA 1MX1A 2H2AA 4OQYA 5DHSA 3C6ZA 3W05A 4X6LA 4AUKA 1SAYA 1J5XA 1SU4A 1D7OA 1E7YA 3IB6A 4I8IA 5ALXA 3OAAA 3UYLA 1J56A 2Z30A 4C5BA 4EKDA 3GWGA 5CDGA 3B1FA 1AA6A 1EP2B 1KFEB 1JW9B 2JZCA 2OCDA 4D6XA 3HJFA 1L5WA 2CNLA 3A9VA 3GG9A 4ZOQI 4D9KA 1DAPA 2WP0A 2VWQA 4PC3A 3WOHA 1M33A 1V5GA 5CFNA 3TF5A 4DLZA 1KK2A 1CE8B 2GZAA 5M2QA 4JJFA 4K6HA 4UCWA 3H13A 3K0EA 3Q7SA 4KKVA 4UBIA 3P5SA 1VHQA 4PZDA 1Y6QA 1UPXA 1WXQA 3D54D 5LZ5A 5ADWA 1P39A 4N5NA 4Z2YA 4LXIA 1TM7E 1XTKA 1H69A 3O2SB 4PO9A 3T5DA 1JF8A 4NRDA 3J7AC 3GNTA 1GGKA 2C00A 3Q0EA 4GEKA 1XRLA 3WMGA 4MTLA 2PD3A 1DO2A 1ZU5A 1PEDA 2GRJA 3ENWA 1YK0A 5J2UF 1B41A 3RVNA 3CZRA 1RWKA 1NXXA 1Y8QB 3PK0A 1FL9A 5EE5B 4ZEXA 4E5SA 1YMUA 2QPAA 4OJNA 4AMVA 3WJ2A 1U2DA 4X8HA 5HZHA 3VGPA 3TI7A 1C7IA 3QH4A 1TM5E 3ANSA 4UNRA 4INOA 3THWA 4R7GA 1DQNA 2P8SA 5GQSA 2OR3A 5SZIA 2EXXA 1JHAA 3C5CA 4UU8A 3RYFA 5KPDA 1B0AA 4YBZA 1RXUA 3FYCA 5FA6A 2HA6A 3OQHA 3B1XA 4YGYA 1Z4JA 1FQWA 3KQPA 4P33A 3SG0A 3ZHTA 4FC6A 4ZU1X 2WM2A 3T5MA 1T4GA 1L0BA 2B4YA 2AOTB 1TQ8A 5KTPA 1XZ8A 1QHNA 3EZ7A 3FGZA 3OTHA 1EX7A 4FCVA 1G8JA 1S3SA 1YE8A 2QE6A 3FY4A 3LD9A 3LLVA 4Q47A 3AM1A 4GOND 5E9AA 4AN0A 2UAGA 2TECE 2FSUA 5FBVB 3Q1KA 2W2OA 3T7EA 2CXSA 4JT8A 2DJ5A 4JSRA 3ROGA 1ZUIA 1TX4B 5I7SA 1FJ2A 1FS5A 5L4SA 1M2OA 4DMHA 4JC4A 4X45A 2D1TA 3OOJA 1ISHA 3E9NA 4WD3A 3AB8A 5SZJA 4M0PA 4DA6A 3NMUF 4LYFA 3O94A 1Q12A 3E3OA 2OV8A 3PB3A 3QOYA 1TYAE 2PRZA 1GAQA 4WGGA 4ZOBA 5DF1A 5LA6F 3UG7A 5A4JA 2W4IA 4G5FA 1R6DA 5C3MA 2BSAA 2XKAA 4B09A 2JFYA 1GZ4A 1SWWA 5IWAB 1K0UA 1XX6A 3MD0A 3PC3A 3WLKX 2G76A 4I50A 4J3NA 5B1YA 3HO8A 4ESHA 1QV9A 1R5BA 3IUNA 4PG6A 4R01A 3ZUGA 4JFAA 4RK0A 1X15A 1XHLA 2QZPA 2VPTA 3I0ZA 5ES4B 1GCGA 5HFAA 2VJNA 2GM4A 2R6HA 1S0UA 1MU0A 1GPUA 1X2EA 2WKSA 4LGCA 1PS0A 4FI3C 5KOHA 1VHWA 3ZV5A 5AJUA 5HIMA 3R9XA 4FGUA 3GJ8A 4EF4A 2QX9A 2IYUA 2QUAA 3IQFA 2ONCA 2X5NA 2VZEA 3WLNA 3NBYC 4TZ6A 1MH1A 1IG0A 1OXMA 4IKOA 5F35A 2ZAIA 3K6SB 1F8XA 3DM9B 1W47A 1GY8A 2PH1A 4KIUA 4YUXA 4Q34A 5EZ5A 3CEPB 3TCXB 1S5PA 4J1QA 3AEUB 5IEBA 5I7UA 4Y9SA 4F92B 1PJQA 5FDFA 1H2EA 2PT9A 2ID4A 3IIKA 4EA8A 4PQFA 2GZDA 1DRVA 3DXZA 4JAVC 1KH1A 5DM0A 4RMNA 3ZU5A 3S2EA 1J42A 4BAUA 3KFXA 2PGAA 1MB3A 4XIIA 6GPBA 4A26A 1PJ4A 3P9RA 3NHJA 1H0KA 4XYEA 1BXZA 3COSA 2R8RA 2VXBA 3HBAA 3WLEA 4JK3A 2BEUA 5F4BA 2P4QA 4BE4A 4KITB 3IAUA 1E3MA 2FWRA 2NTVA 2PZMA 1JMYA 1JWBB 3MLBA 3SMQA 1QQBA 2HA2A 3WL4A 2ILVA 1E4YA 3RREA 4MI9A 1C7QA 1TF5A 1E61A 3D02A 3GHYA 2GHRA 2NV0A 3R5SA 4KWIA 3UATA 3ZYZA 2FGJA 1C1DB 2DRIA 4ZVUA 3R0JA 4GM4A 3M4JA 1ZHOA 3RWOA 4MSUA 4WZAB 2BMVA 3KQOA 4YMSA 5H4HA 4TTQA 3FCSB 4XVUA 5JARA 1QR2A 1G3MA 1MG5A 2Y1DA 2ZTUA 4NYMR 4AKGA 1ZRHA 1YR6A 3BRQA 3AGPA 2ZVJA 3OE1A 3OZVA 3HB5X 2HRBA 2RJ3A 1QP0A 1LFDB 4A91A 2Y1GA 1JHUA 2IS6A 3AY0A 4HEA1 4I1UA 4X9XA 3A6DA 1ZN7A 3C7AA 3QX7A 4WLNA 5H7XA 3W9BA 3X2FA 4DCGA 4ABYA 1O6ZA 1JEYA 1UWVA 4D1YA 4C3VA 5DJ5A 3PWZA 2WUEA 2GF0A 5CFOA 3KJHA 1BVHA 1MV8A 4ZRDA 2QM8A 1D1PA 2HPVA 4R1UA 3TPCA 1I3CA 3QG5A 1LI5A 4NP6A 1CE8A 2CBGA 5CXUA 4E1AA 5E9QA 2MJLA 4NOLA 4M1QA 3F46A 2FHPA 3GEMA 4NCJA 2QK4A 1JG4A 4ZMSA 4ZYXA 2AMFA 1BHQ1 2WVJA 1X1RA 2AG8A 3R6WA 1QFZA 2NPOA 4LHEA 2V8BA 4M3NA 4TOIA 3CBQA 3C24A 4GM0A 1CR6A 1YACA 2QRGA 3C3KA 5K4AA 3U62A 2DF8A 1E6WA 2AEJA 4WN9A 4FINA 3PICA 1DIOB 4ZK6A 4GL2A 2G3YA 1U7OA 2RHWA 1KR5A 2NZXA 5EXXA 3LDGA 4MJ3A 1FLNA 1W6RA 3KKMA 3RJTA 1Z37A 1Z82A 8ABPA 1GA4A 1Z34A 3N6VA 1PTKA 2QMZA 4TROA 4MROA 4UAGA 3GJXC 3JVUA 4JXZA 2YVQA 4DLTA 1YJ5A 1X7HA 1GGMA 1UZNA 4MH0R 5REQA 4EUFA 3PVCA 1KVQA 5KVQA 4D80A 3J81A 3PE3A 1IHDA 5TVGA 1P1HA 1NBWB 2HUNA 4ZGGA 5H82A 1WXEA 1JEDA 3PXDA 1BGWA 2IOFA 2MYUA 2GN2A 4HQLA 4YY3B 1Z0DA 4QQFA 5G1PA 2FGKA 3KTFA 4HFRA 3ESBA 3FCOA 2PX3A 2Q4BA 4HVTA 1COZA 2Y1LA 1OYVA 2EJCA 1BO6A 3WB0A 4C89A 4C7OB 3QUQA 2W00A 3V9PA 1NMEA 5DBGA 4O0MA 2M98A 4KVGA 1WZIA 1B23P 2V6MA 4JY7A 5J5CA 1P7YA 2GCEA 2NPFA 3IGFA 3Q9SA 5COBA 2O5EA 3EA0A 4MP3A 1E2DA