4LWQA

Crystal structure of native peptidyl t-rna hydrolase from acinetobacter baumannii at 1.38a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
GSHMSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.38A resolution
rcsb
source organism Acinetobacter baumannii
total genus 64
structure length 196
sequence length 196
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4lwqA00
4QAJA 2Z2IA 4FNOA 4P7BA 4QBKA 3KK0A 1RYNA 4Z86A 3TD2A 3VJRA 4JC4A 4JWKA 3TD6A 3NEAA 2NAFA 2MJLA 4HOYA 4LWQA 4QT4A 3P2JA 4OLJA 1RYBA 4JY7A 2LGJA 4QD3A 3TCKA 3V2IA 2Z2KA 4ERXA 5B6JA 4DHWA 5IKEA 3OFVA 4FOTA 3KJZA 4ZXPA 1RYMA 4IKOA 5EKTA 3TCNA 4DJJA 4JX9A 4YLYA 5IVPA 5IMBA 2JRCA 4FOPA 2PTHA 2Z2JA 4FYJA
chains in the Genus database with same CATH superfamily
2XHEA 3WFIA 3TVYA 3LPDA 4TKZA 1UFRA 2P4QA 4F5WA 3KTAA 2JAQA 3GCXA 1TKRA 4HAYA 4IUYA 3UXHA 2QLFA 2ZI7A 4PX3A 1IUNA 4IV5A 4Z9XA 4ZYVA 4WLVA 1JUDA 1FSPA 1VBMA 3JASA 1L4HA 3PCXA 4TVOA 1RZRD 1LDNA 4P82A 1GAQA 5E1BA 5AESA 1KP2A 5E3JA 4A2WA 1ZXXA 4BTEA 1ML3A 4CR7A 2Z2KA 3D9QX 1DEHA 3NDRA 1WG8A 1W4ZA 3JCZA 3OQ6A 4KSYA 4P08A 4RHTA 1GUDA 4W6ZA 2A9JA 5B6PA 3V7FA 3EW9A 4K40A 3UJAA 3WLAA 1Z0JA 2OFWA 4Z0NA 1Z0KA 5EIEA 4GKJB 3E4DA 3KKKA 2QLMA 2BL4A 5JH7B 1NX9A 2Y9MB 5BW4A 2YWBA 2CNWD 3RHZA 2DWQA 3VGJA 4ZYUA 1GL3A 5G1NA 5BOSA 5DK6A 1IATA 1N2OA 4Y2UA 4BEJA 1N7HA 2EKPA 4XWWA 3G1WA 2LCFA 1OW3B 1D4AA 4R2XA 4NJEA 3AUUA 5T3YA 3T1NA 2Y1EA 3BMXA 3TGWA 4AIRA 3HCAA 2NU8B 5DTJA 5H80A 5BRNA 1PV4A 4N82A 5TQJA 2D06A 1BRMA 1XZBA 4DCVA 1TUEA 3O4IA 1VJ5A 2HA3A 4GIBA 3EXIA 3A4TA 3EE6A 3HUDA 1R8SA 2HLDA 2O0HA 2Z56A 3E7PA 4OHPA 3IQWA 4ZVOA 5IC4A 2P27A 3OUUA 1C9YA 4MMYB 1GZSA 2ZVDA 3AJRA 4Q5IA 5CCEA 2IL1A 2IZZA 3IPRA 5KSWB 2OXRA 2O3UA 4G1FA 1M5UA 1VCIA 2JI8A 4U2FA 4TSFA 3JQQA 3AI3A 3PHJA 4XPZA 3UJ3X 2HMWA 3IUMA 4HRAA 1DEOA 4MIYA 2J5KA 1L4LA 2AG0A 2Q5JA 1H8HD 3HBAA 1KOJA 2XE8A 1NR5A 4MUGA 4A0FA 1PZFA 2C9MA 2AK3A 1YRLA 2NU6A 3LVBA 4TSRA 4DM7A 4DLXA 4JOQA 3CNHA 4W7IA 2JCBA 4DREA 4H9GA 3GCZA 4XUEA 4YRIA 3K70D 2ZUFA 3H8VA 1P3Y1 5G3YA 5G3ZA 3I6QA 2BFMA 1G20B 4QSMA 3QU2A 4N7BA 1UQUA 1FY2A 2CL6X 3KJZA 3CLUC 1Z5PA 3JYOA 4ZAXA 3IEPA 4NZOA 2PKYX 4WLUA 2HNAA 3ZVRA 1HG1A 3TW0A 2OG2A 1KIMA 2VHVA 2WI8A 3IKMB 3EZNA 4GP9A 3ZE9A 2W22A 2IKQA 3R24A 4UTXA 4DSTA 4CETA 3L7BA 4JUBA 1C3OA 1NATA 4HDKB 3PTAA 5IF3A 1N0VC 1NNI1 1FS6A 2VZEA 2I87A 1GR0A 3PFWO 4BIIA 1SOWA 5THKA 1WQ3A 1KGDA 1L7VC 1FP7A 2BI8A 2MOKA 1OY1A 2IYNA 1NDUA 3ND6A 4M9SA 4TQAA 1A9TA 2GPYA 1Z0DA 3T61A 5JS7A 1YF3A 2C2BA 3L2OB 3JAWA 5LR6A 3MW8A 1BWRA 5KWVA 1TB4A 4G97A 3COJA 1MIHA 2N1MA 4CUKA 4YXFA 4X63A 3AHCA 2RG1A 4BO5A 2FFQA 2A92A 5CDSA 2K2WA 1U2TA 3QUSA 3EUAA 2E4XA 1CY1A 2ASVA 1XVIA 2C2HA 1JECA 2G1AA 3ZWNA 4IIVA 5JZVA 1LJLA 5IVPA 4TS1A 3ECAA 2DR0A 5KHLB 2BI4A 3D1LA 1KAEA 3NR2A 2A59A 3IVXA 1ZJYA 2ECPA 2Z1MA 4LOIA 3Q7PA 4PANA 1PJSA 3OE5A 4TMXA 4GMHA 1JKXA 4IVPA 3SXUA 3R0QA 4HP8A 4D79A 4NCAA 3TINA 4CMAA 1K7XB 4CNBA 4QULA 5FOVA 1JXAA 3EJWA 1V6CA 2VATA 2CLHB 3L5KA 5DIZA 5FWNA 3KXDA 4MRRA 3L0YA 1HFEL 4YROA 3THYA 2G9QA 1NXWA 1JMVA 1XKLA 4AJKA 4GMXA 3MWGA 1I0IA 1C3XA 1NASA 4O33A 3JZMA 3M4ZA 3PDWA 5D6NA 3OPVA 2XDQA 4ER0A 5C9ZA 5LN1A 2XGMA 1LI5A 1OTXA 4B6QA 1C7JA 2J3QA 4IDCA 3GEIA 4M1TA 2VWPA 1HI9A 3UOAB 3C85A 5AJYA 2UKDA 2EP7A 4GD3Q 2EFEB 4YI5A 3FCUB 3UJ9A 2ZYWX 1W0KD 3C5EA 1UP4A 2XZDA 5TV2A 3ZU2A 4A1OA 2QA5A 1IWPB 3K4QA 2QP9X 5DW0A 1YVUA 3EGWA 5TC4A 1NPYA 4MVYA 3DDSA 1T8SA 2XJ9A 5TARA 1FCJA 1SKYB 1ZI6A 1FRVA 1ZINA 1SXJC 1W6UA 4FJ0A 4QGHA 1OU4A 1RKBA 2JGNA 3KL2A 3NEYA 4NOJA 3UV6A 1MBZA 3RSFA 1CQJA 1Y8QA 4F4UA 4WTOA 2BBSA 3TR5A 3AF2A 2OXFA 5BNTA 3FR7A 1GRVA 3HDTA 1KYVA 1LKZA 4WADA 3CO5A 2KM1A 3OT1A 5HFJA 4JV5B 2GJ4A 4JJKA 1XLVA 2GETA 4GKKB 2QK4A 5EE9A 4C30A 3CVJA 4ZCIA 3QKTA 1I8TA 1NBMD 1YACA 3B1JA 4FUQA 1SCNE 2QTCA 2JFPA 4FSXA 5LQMA 2XKBA 4MUBA 2XVXA 3FVQA 3GF4A 4KXWA 4B6PA 1I7DA 1YGYA 3K0HA 4YT5A 2JCYA 2WT8A 4UE6A 3M1YA 2Q6KA 3K53A 2BH9A 4WNAB 3D4NA 4D4HA 5TSDA 5KMGB 2AWOA 1U2GA 3F1KA 1N25A 4Z7OB 4I1UA 5FI1B 1FTGA 1GU1A 4D4IA 5FBVB 1B8UA 4ZARA 5HZGA 4UEJA 3GLGA 1T24A 4I81A 1EE2A 2P9BA 4LGCA 1XMVA 2Q3MA 2WF7A 4PYLA 3UMMA 1U3FA 4PZ9A 2J30A 2VOEA 1YJQA 5IP5A 4JBGA 4XLZA 4EG0A 4UAUA 3EUWA 1X3LA 2B1QA 2XRFA 3HWRA 1RAEA 3K3PA 2CFOA 1L8LA 2VT7A 3AR2A 3HP1A 4NK4A 1I2BA 3UMCA 1SVWA 2AD1A 2CL0X 3HR7A 3KDAA 4R7TA 3PGKA 3WLRA 4BIMA 1MU0A 5C1BA 5HR5A 3K8YA 2BKVA 3EC2A 4M1QA 4E33A 3I72A 4BYMA 1W6RA 2CCJA 5TQ0B 5J4KA 4B3MB 3ITKA 1G0OA 1L3BA 2VJCA 1UMCA 4Q1CA 4F1WA 2QTVB 3W5CA 5DXJA 3BMQB 2VUHB 1DXHA 2J45A 2X1HA 2ZPTX 3MD9A 5GP1A 5LL6P 5LDDC 1XRPA 2CLSA 4EYQA 5E8JA 4PYMA 2CE7A 1OLXB 2IEDA 3Q11A 3ESAA 3U3KA 1GNQA 3Q3IA 2DSNA 2X4LA 2Z9DA 5C32A 1NNSA 4ZCSA 2VRNA 3FVTA 1J2EA 3KQVA 3LHIA 3LXRA 1P4AA 4K8RB 3VKFA 1H4TA 3FKJA 2BY4A 1VJRA 4YRGA 2P91A 4LDZA 2RGDA 4W5JA 1GN8A 4AWXA 2H31A 2WF8A 3KQKA 3THXB 1C0KA 4V3BA 1Z0ZA 4ZEXA 3RVQA 1ECFA 1EIZA 2GPAA 1A9OA 3JZFA 4Y2SA 4ZKDA 5KC9A 4DS3A 3NWBA 1T8PA 2VCHA 5JD6A 1FQWA 4G5SA 3KRTA 3KHTA 1QQTA 2WIJA 1N2GA 5ALXA 1C0LA 3H1TA 1X38A 2ZSJA 1PJ4A 4KREA 4HEA6 2WM2A 4GKVA 4FZVA 3HGQA 1QO0D 2X86A 2ZIXA 4O4IF 4B8ZA 4MW9A 5HKKD 4R31A 4AX4A 2WB2A 4EJFA 2G4VA 3EEFA 1NSTA 1ZUIA 1JKIA 5CK5A 3VC3A 5BN5A 2FR1A 2J0VA 2PRKA 1M7HA 2G63A 2GD1O 4JEIA 4RVCA 2XNDD 1T3HA 2XVYA 3GUZA 1QH1B 4MWCA 4PVDA 2WYOA 4CM4A 4AQ7A 1W36C 3Q2IA 2ZCVA 4M0CA 2WSIA 4P86A 3W6OA 4C3OB 4GMGA 3S2FA 2REBA 4AG6A 5JSZA 3FZQA 5ENDA 4XVUA 4KHZA 1PJCA 4TYQA 3FUCA 4EGQA 4WFJA 3K8ZA 2ZJ8A 3I62A 4TSKA 4D80A 2B99A 2IZOA 1JEJA 3G2QA 4M83A 3FNQA 1TTTA 4ZYXA 5KSOA 2REQA 1TCUA 2X5XA 4UJ5A 4DDUA 4K5QA 2A9KA 3RU3A 3KQTA 1XVUA 4Z8XA 4B0OA 2AOUB 4U3JA 1CF2O 3ASZA 4E4RA 1MOPA 3DTVB 3N2NA 3BREA 2JGAA 1C14A 2ZWPA 3GOHA 2HA7A 4TM8A 5LA6F 4Z49A 5GIOE 2C59A 3BWXA 3C70A 3GGSA 3OFJA 4PYOA 3OI7A 1X1BA 2B61A 4FTWA 1GDHA 5E95A 1NRIA 4XQGA 3K0BA 2HO5A 5JG7A 4C29A 2PWAA 2XW6A 5HG0A 1U2GC 5K03A 4DV5B 4AULA 5FRDA 1DXOA 2ORYA 1P6UA 2GCOB 4C4RA 1EWYA 1VCHA 4C1NA 3QJ5A 1AUVA 4R1UA 1T9DA 2GN9A 2ASEA 1N5JA 5JH7A 5L4SA 3KXKA 3EASA 1JALA 1DEAA 1OFVA 2AI1A 1RPTA 2EEPA 1SHTX 4S24A 4NZYA 4A7PA 1C0EA 2F3SA 2QLTA 2ZDHA 3ZDQA 2F59A 3IHKA 1KQFA 2V6JA 3INRA 2MSCB 3PJGA 1DV2A 1ODCA 4W99A 2NU8A 3RIYA 2ZBVA 1A7UA 1NQ5A 1YUMA 4KO1S 4DPLA 3HA5A 5CDTA 3EDMA 3WMRA 2OKGA 3UOWA 1E2IA 5G1OA 3CUVA 1B8NA 1P4JA 3D4PA 1KVUA 2GASA 5CM8B 5IJZA 5D3MA 1PJLA 2C82A 3BD9A 3M8KA 4RJJA 1E98A 5IBPA 4RCYA 2X4GA 3HDYA 1Q92A 1QQAA 1APBA 3OJCA 1MC4A 5SY6A 1Q20A 3WGOA 1M7GA 3ZW8A 2W6JD 3CLSD 4M9RA 3AXSA 3PNVA 1X0VA 3JSXA 2YKGA 3FM9A 3CYFA 1VKZA 1GUFA 4LYAA 1MJ5A 3TB6A 1NU6A 2ADMA 3UGTA 3Q8MA 1NU8A 2WUGA 1HFJA 2CBGA 2VK8A 4G1MB 4TWIA 3EZYA 2HCRA 1CUIA 4B40A 4D3XA 5J4HA 2II6A 5JDIA 1QH9A 3SE7A 3V4ZA 4XFDA 1BX0A 1U2ZA 5H3HA 4DYDA 1YHYA 3OAAD 4X20A 1QZUA 1PGNA 3TEJA 5BQOA 1DB3A 2PSEA 3AV0B 1G20A 1NLZA 2IXGA 3BXHA 1MA3A 3NU1A 4OXKA 4Q4JB 4DC9A 3CVXA 3K9GA 3IKLA 2LBPA 3K0FB 1HYBA 1SVNA 4NMMA 5HF6A 2WLTA 1RLIA 3MCAA 2FW9A 3HVUA 3LIIA 4YGYA 2AD5A 3HBJA 4UDYX 4DMLA 4K9DA 1BQ4A 3TEFA 1BSVA 4MV9A 2R5NA 1Q14A 2XSZD 1QOQB 3JD1A 4FX2A 3G0CA 3NH6A 1JP7A 3QPVA 5GGXA 4LSWA 2F4VB 4BXOB 4HDKA 2J31A 2EEZA 2GUWA 4KWCA 1G5FA 1WBJB 4CF7A 1CR1A 2P1DA 1B0ZA 1JIXA 2YRWA 3ETDA 4HWSA 3T1YB 3D5TA 2W4IA 4EGCB 1NVWQ 1AE1A 5LB2A 2PUAA 4BRSA 4BZZA 1GNVA 4XI9A 3UJ6A 1VE1A 1L3CA 3L82B 1VCOA 2PO7A 1PZXA 1QOPB 1AS2A 1I3MA 2R7NA 4YP1A 3H11B 2BH2A 1P62B 2ZITA 1CZOA 2J9YB 3VVMA 4JZYA 1B6TA 3SSAA 1NLFA 1PW7A 4P35A 2FWRA 4NZ9A 3UN1A 5EG5A 3W8FA 3O8RA 1F7VA 1RJ9B 3OTIA 2ECQA 1N2HA 3B1ZA 4V0ME 5H4HA 1BO6A 1FDSA 4FJ2A 3TIGA 4JI4B 3C8HA 3Q0EA 5ENVA 1R0KA 2Z83A 2ZROA 5LLTA 4JJGA 1NW4A 4JBNA 3O8QB 2VHWA 3REOA 2Q3DA 1Z8NA 1IBKB 1W5FA 2PLFA 4L5AA 4JNKA 2R87A 2A1UB 4GGPA 1VRVA 2H57A 1MO4A 4YLEA 1ZVKA 2P3QA 1D2EA 1XA0A 5IDVA 5B36A 1J99A 3V8QA 4LE1A 1WX1A 2ZJZA 2FQ1A 2H7VA 4O2LA 4RACA 3QEMB 1R66A 2IYTA 3N8KA 1FNCA 4PZZA 3ZXSA 4YPOA 4XEHA 2V6FA 3PA6A 4Q9IA 4JYPA 5AVZA 4HWRA 4FGWA 3V00A 5IBRA 3NRJA 2EVWX 3EPPA 3FZEA 1T2UA 4GW3A 5CD1A 4AJNA 2KYRA 2YZMA 4QWMA 3B1XA 2O48X 5A7HA 3VHLB 3ZZNA 3G8CA 5CR9A 4BNIA 4Y6QA 3N3BC 1OH7A 3HCEA 3A6GA 3MC1A 5B4TA 1SIBE 1OA1A 3GFGA 3KP1A 2BZ0A 4XDZA 2G9VA 3AR7A 5CVDA 1R3UA 1TMOA 1P6QA 1M6EX 3RM3A 2JG3A 2C9DA 2P9FA 4LY0A 3IUJA 4JI6B 1XTJA 4EJSC 5CM9C 5F9HA 3FFBA 3PQDA 1N9ZA 4P8RA 5C8VA 1QFZA 2WG2A 2F00A 2FCAA 4N5IX 2YJNA 2Z3VA 1IY0A 3TQCA 3U9TA 5A9RA 2ZYUX 5CRIA 2UU9B 3RVLA 3HCBA 2PH7A 2ZB7A 4H15A 5HFNA 1N3LA 1XZNA 4L6IA 4NY1A 1Y6QA 4H0NA 1EI9A 4HXGA 4R40A 3TZEA 5CVCA 5CFPA 2RH5A 1OIVA 2X58A 4G4IA 4YRQA 4WIAA 2ZSKA 1XTBA 4MPRA 1WCIB 4RENA 1Z08A 2JIZA 1FXWA 3KS9A 2C5HA 4QPCA 5DBEX 5DCWA 3SBXA 3ZQKA 1N2EA 2R9VA 1SH7A 5EJIA 5FL3A 2CKDA 4WNAA 3L0BA 4C5CA 3M1IA 2PSSA 4PGAA 5KMGA 4FDLA 3PGVA 5JDIC 3LW7A 2MCFA 1E2JA 3IKVA 3VNRA 1M34E 1JLHA 5HMLA 1QYWA 2BUCA 4LZPA 3Q2KA 3S40A 1H85A 1GUYA 1SVKA 2DPXA 1K7YA 5DYNA 3RIEA 5B6IA 1Z74A 3NGXA 3BE4A 4CTOA 2IH2A 1KZ4A 1P61B 1H0KA 2YFYA 1V43A 1WKVA 3D31A 1Z9BA 1VJ0A 5D1HA 1NW8A 1U80A 4ZV4A 2LNDA 4CODB 4HB0A 2P2DA 3DNMA 4WZBE 3ZBPA 8ATCA 5JDCA 4A16A 4MDEA 5CA1F 4BVAA 4LHXA 4CV3A 1I3NA 5DVZA 4CU5A 4F12A 2PH5A 1SKBA 3KWFA 5LMCA 2VYCA 4ZIRA 2IHJA 1USVA 3D3EA 1UP6A 3JRWA 5TQ0A 3WJ1A 5HP4A 3OJLA 4WXMA 1DUVG 4JT4A 4EB0A 4Q39A 4EPRA 2GBLA 3SJ7A 5BNZA 1AO0A 2OV4A 2VTBB 2EGHA 1ZQ1A 3CPEA 3JYHA 3GEHA 3K32A 4IICA 4NF2A 2H06A 5JSHA 4QRIA 2D7DA 3DLCA 1UM9B 4ALIA 3OEHD 4B3DA 3CLTD 1X7HA 3GNLA 3H1BA 1W35A 4FDVA 4NATA 1WW2A 2JIRA 2QX7A 1A9QA 1TZCA 4QPZA 1DCTA 2M98A 1T9GS 1O03A 1VIYA 1M1XB 1PL0A 1NVAA 3L7OA 4R1LA 1RPZA 2H1CA 2M6SA 4WXEA 2OBMA 1QDEA 3HKEB 1Y4DE 3JSAA 1TCVA 1W4RA 2QSJA 4GSKA 4DAEA 5KQGA 1OBCA 5KWJA 2HOQA 3V6MA 2YJGA 4RH0A 3LL7A 5AI8A 5AKGA 3FKQA 4JH0A 4ISBA 1SIOA 1O4VA 3FTPA 4IWXA 2PUEA 3EIXA 2BV3A 3VDNB 3BDVA 1NPTO 3KXLA 3E81A 1ZA2A 2QPTA 5FO1A 4LZOA 1KYTA 2C9ZA 3MUEA 4JL8A 4OH1A 2V7GA 5CA1B 2Z0MA 3CRZA 1NXVA 3FSRA 4ZDKA 1TAUA 3NIFB 4ZWNA 1T0IA 4WASA 4MYCA 4A5OA 4B6SA 3DCNA 4AJ1A 5A9SB 4ZHQF 1PLKA 3FPCA 4YMTA 4KRGA 4YMWA 5A3RA 4B35A 5K01A 2CXOA 3U49A 4LY6A 1P7CA 1D0IA 3IDAA 5BVGB 1WOMA 2BYTA 3C7CB 3FHLA 3TB4A 1MX5A 1X2EA 2CDNA 2RBKA 3FGNA 1QH1A 2G71A 1UT6A 5DHAA 1QTIA 3IPYA 4DJDC 1A1VA 3AVYA 2OZLB 2EHJA 3PXXA 5DN6A 2B5WA 1EHIA 4F7WA 4M0MA 3OQ1A 1KVSA 1Q11A 2QRQA 3ITNA 4UQOA 1G16A 5B7QA 3IOCA 5LP6F 1AM4D 2ENWA 5JAOA 1ZX1A 2DULA 3GROA 4FOLA 1ZM4A 3QBJA 4LYHA 1R1DA 5FIUA 1HXHA 3MHPA 4P7GA 5FF9A 1L5WA 2VF8A 3WQRA 4K3UA 2XT9A 1JJFA 4LSZA 4M21A 1IULA 1J33A 3V34A 2D1YA 4NQZA 2FZVA 2GILA 4DQUA 4KXVA 1YZHA 5BT8A 5CFQA 1DRWA 1EJ0A 5FUMA 3OKFA 1YVRA 3AEUB 3P19A 5FH9A 2H5EA 4O25A 1W49A 2P5SA 2IOYA 2XOKA 5J58A 5JXJA 4R71A 4MQUA 5JJIA 3DTVA 3QVXA 5CIQA 1Z0IA 4XGIA 3A2MA 3FPKA 2JJYA 3LZCA 4BQOA 4H0CA 1ZH6A 5EP1A 2DQYA 3O8OB 3UK0A 3DDOA 1DKRA 1KJZA 3HBMA 4Q3EA 1Z0UA 4EF4A 1GPH1 1EXDA 1YQEA 1H6BA 3KQUA 1NMZA 1N77A 1PJ3A 1YCFA 3PQ8A 1E1RA 5CIWA 1T6XA 3G8BA 2J6BA 2QXYA 1ZN9A 2P8JA 3HZRA 4I4IA 5IUJC 5AKKA 3G79A 4EITA 4RA6B 4DCCA 2GCOA 3G9QA 5AKEA 4FZ3A 16PKA 1AHNA 3NETA 4ZHQB 5K9ZA 1TM4E 1Z3CA 4Y67A 2RJ3A 5C8YB 1Z0SA 3RVOA 3RRFA 4DKXA 4WOKA 6GPBA 2H6EA 2CNNA 2AA3A 3DAPA 3RGWS 3TL3A 1NRJB 1P45A 1GM5A 3NIBA 1M5TA 3ZWOA 4CV2A 3HBNA 4WDRA 5CYOA 4LXQA 5JDCC 3WL4A 1NKSA 3VZSA 3UQYS 5JNTA 3OH8A 5LP6B 1ODFA 2DBRA 3FSGA 3RTGA 1X39A 4LMRA 3N9IA 5CDHA 4RKFA 4EKNB 1S01A 3B13B 4F46A 4X71A 4M4SA 5EJ4A 4QFBA 5CW1A 2GBLC 4M99A 1BD4A 4PQEA 3OZ7A 4AZ0B 1HDZA 1S2NA 1ESMA 4CRWB 2RMKA 2C5GA 2R4QA 3MOIA 4RZSA 4F38A 5JJ5A 1F3LA 1RTTA 2DOKA 2YY6A 4I1VA 5D84A 3WGUA 2GXAA 1CJCA 3ER6A 4ARAA 1K63A 3N0XA 1JE0A 4KDFA 4LRTB 1IOZA 1SRRA 3QU9A 4XIIA 1E6KA 3D6TB 4Y6RA 5CFMA 1JXQA 3KZVA 2YDYA 3AUJB 1K6JA 3WXMA 1ULBA 2BSQA 2O1XA 2XQVA 2VYVD 3Q7EA 3FOZA 2EW8A 2P5UA 4HY3A 3DNFA 1JEDA 3E7XA 3NT2A 4M76B 5A71A 4EX7A 2RD2A 1QR2A 4TN5A 4CEIB 1NHGA 4LRQA 4A2QA 2J9GA 3D7NA 4H7IA 4U8GA 4MGKR 3HM9A 3EFBA 1UKEA 1ZKDA 2Q1WA 2WWTA 2RAUA 3K8OE 4JLMA 3PDJA 4MW2A 1ZGAA 1O5TA 1K7SN 2R8ZA 4L57A 2OECA 1V9LA 3FRJA 6REQA 2CK3A 3K0FA 4KPUB 4R84A 4BO2A 3UMYA 2GEDA 2W0SA 2JGJA 1KQOA 1GOTA 2PS0A 2BEKA 3SZLA 1M74A 1I7LA 1Z22A 4I3FA 3QNWA 4QG7A 4YHHB 1NJ1A 1LW7A 1U4OA 1U3CA 2WHQA 3I58A 1GLVA 1XAGA 4H3KB 4J2OA 4EO7A 4BXOA 2R66A 2XB4A 1OH6A 4HR7A 4E03A 1RAGA 5AVTA 1H42A 2NGRA 1GVNB 3EZ2A 4P3YA 4DSOA 5AKLA 3VNVA 1QKIA 1TUIA 4OYHA 2PT5A 3S28A 1WVIA 2OB2A 3GDOA 2FQXA 5B3AA 1EWRA 1CEEA 4MW7A 1CX9B 1YZFA 4PIPA 4X90A 1VZ3A 3GA0A 1HBJA 1K5GA 2OGWA 4BBPA 1GKIA 3DR3A 1K86A 1T3LA 4EL5A 3QE3A 2PUHA 2CD7A 2X15A 3H11A 4NE9A 5L6LB 3L4EA 1MD9A 3AM4A 1LPMA 2C7QA 2XCQA 3TSZA 4XH9B 3VR5H 5DRTA 2C1EA 2WE8A 3IE1A 1EA7A 1IQ0A 2ZTVA 2FN8A 3HG7A 4BWGA 3N05A 1RJ9A 1LRKA 2PSJA 5IANA 1KKUA 3I73A 1X1DA 4ME6A 2R6R1 4CMEA 3BIJA 3O8QA 1X9IA 1JVSA 2J5RA 3L07A 4TZ6A 3H75A 3ZCQA 4IDOA 4ZZ0A 2DGDA 5AK0A 2ALJA 1TEZA 1E5TA 3BHNA 2QN3A 2A1UA 4AS1A 1BKDR 2O8CA 1D07A 3BICA 3T7DA 3ELYA 3I8OA 1SA0A 4XUCA 1NVEA 3MJVA 5A4JA 1MX3A 1NXTA 4TWZA 3QEMA 3RG8A 1V1JA 1Z18A 3SS9X 7AT1A 2C31A 2ICAA 1QU2A 4JBLA 4G4GA 1E4YA 1YGPA 1NUTA 3GJRA 2A4KA 4OU5A 2DT8A 3QIVA 4N18A 2VSOA 1SXGA 3DT9A 4RGBA 5JT1A 3PLAE 4B3RB 4ZQFA 4MQEB 1EQ2A 1S2MA 3AYZB 3W2IA 5BSGA 3DVAA 1TC2A 2PV0A 3H2KA 2E3JA 4YAGA 1R8QA 2VYFA 3AEQB 4GXNA 4ZJPA 2GESA 2IGTA 4N6OA 2BBWA 4IVNA 4IX1A 2Z3WA 3LX6A 1J2UA 2V3WA 4EUNA 1N78A 1N5RA 2PE5A 2VDNB 5D5QA 1X9GA 5C2JB 5TF0A 2JLAA 3SBEA 1PR3A 5B7GA 4JI8B 1KDYA 2IUUA 2WG1A 3CEJA 3I9NA 3N5CA 4TKVB 4C0BA 4DY6A 1JQKA 3E0XA 1YS2X 1JAZA 3I5MA 4BGVA 2BAGA 2HHJA 3DOEA 5H02A 1VYVA 2C4WA 4KYUA 1Z5OA 3UJNA 3J81A 3O84A 4QEDA 1GSOA 1AGXA 2AVDA 5DYYA 3KB1A 5LM3A 1WCIA 1FL9A 3COYA 1KNQA 2QE6A 4AJ9A 3C3DA 5J3JA 1XIVA 1Z26A 1Y8CA 1NUSA 3EXHB 3ELWA 4IILA 1EFRA 3ZH9B 3DGEC 2O1SA 1QNFA 1SUEA 3M4XA 4LX8A 4MUMA 2V8BA 4R51A 4RQBA 5EXDA 3HYSA 4ZV9A 3BIOA 1TKAA 3X43A 3C6BA 5C5CA 2G7ZA 1A9YA 1JDBC 4YJFA 4AY6A 3ENQA 4PCVA 4TRJA 4V02A 1ZCBA 3EGVA 1NVVR 5H82A 3V5NA 5K0EA 1YB1A 4KBFA 5TB5A 4OFBA 1M1YE 1EE1A 2R6GA 4WXPA 5GZ1A 1KBQA 5E7IA 2XMZA 5JAPA 2RDMA 3KB8A 1M10A 2QAIA 3KX2A 4PQRA 1B6RA 2FUG1 1QYIA 4C4XA 3DE2X 3ENNA 3VOAA 2UYGA 2PUWA 3CJRA 2FFBA 1BE1A 1NG1A 3B12A 5TQ2B 2D2VA 5EKDA 1G2IA 4HBGA 3FY4A 4P84A 3FMVA 4ZZ3A 1HYGA 4UPVA 1OOEA 2FPWA 4PFQA 3T5GA 5JVDA 5K99A 4JL5A 2VTBA 1QHXA 1UKAA 2PHZA 3RV3A 4GAEA 1Q1ZA 1UXGA 3TLAA 2XITA 4GQIA 3PQ7A 5AVJA 2PFSA 1OFUA 4HFNA 4NBWA 3CZCA 5B1SA 1IXZA 2QM3A 5T4BA 1UM9A 3PNKA 1TTQB 4EQZA 2IYXA 3GT4A 3BCUA 4GBED 3C15C 3PI7A 1TCBA 4FU0A 5LBTA 5CDYA 3DKKA 5KDDA 2POQX 2B8EA 3FTEA 1A5BB 4Z2YA 1JILA 3PDIB 3ZDEA 2P62A 5T4EA 1V2HE 4HQFA 3RVMA 2B1GA 5CJ2A 2CCKA 3KEQA 3GLRA 4RSMA 2ZIAA 5JCPA 2Q50A 3X1XA 1XZEA 3D4OA 3HKEA 1I94B 2LIVA 1A9XA 4C7XA 1I0LA 4C4TA 3I4CA 1U4SA 1J8VA 1HNNA 3QVOA 1CTQA 2BEUB 4YT4A 3G9UA 4CMEC 5CB0A 2UXDB 4TV8F 2CLDX 2H07A 3FVRA 4B9AA 5IWAB 3TIXB 1JA1A 3HXKA 1AXRA 3DF9A 3P2JA 3EEQA 3WADA 1YVPA 3IXLA 1ZEMA 2V7BA 3RWBA 1U2QA 3VYUB 2GZ1A 4IIUA 3RK1A 4B85A 4R0MA 2QZSA 3C24A 3WB2A 1XALA 2O2SA 3PFIA 1RPJA 2CFIA 5D2CA 3U1TA 4JP1A 3H9UA 1W0JA 4DLAA 3QG5A 2JBWA 1VLHA 3TL6A 4PPGA 4BNVA 3ID6C 5DH9A 2DEUA 1JR4A 3ICCA 4O3MA 5GONB 2BHTA 2G4LA 1L5HB 2EIHA 3THOA 1NRXA 5BY2A 3IV6A 3KLMX 5A9SA 5L4LA 4W5TA 3HJAA 2A5DA 2AW5A 3SOZA 1M6YA 4PAGA 1U94A 1RXCA 3A05A 3R6GA 5BVGA 1G8MA 3R23A 5KTOA 2ZI4A 4YGXB 2CLMB 1L4EA 4RPHA 3O1IC 4L73A 4G41A 1W7AA 2O8EB 2OZLA 2NTYC 2RHRA 2YYAA 2QQFA 4GC9A 2Q9CA 4L2IB 5F73A 1Z83A 5AXCA 2P35A 3SBOA 3MUFA 3WTCA 3BHJA 4Z51A 4Z4FA 1GZVA 2DPMA 5JRJA 2IQIA 1O9HA 1XQWA 3S5UA 1R9MA 1EGVB 2NZ8A 4PG7A 2VJKA 4TYMA 1M2FA 1RBQA 3EMKA 3AEUA 4GVXA 3C3AA 1JIUA 1T1GA 2UZ1B 3A6EA 5K0SA 3W9SA 3W2FA 1OYVA 3FCEA 3EYAA 4UHHA 2GXSA 3JQAB 4A10A 4OJTA 1DIGA 1NZDA 2RHGB 1IMOA 1DZIA 2QWXA 1EVIA 1DC5A 2ZEJA 3AILA 1P7PA 3O8OA 4BMPB 3WRWA 4C08A 4F06A 1PI3A 2F9FA 2D7JA 1AMUA 2Z04A 3BJEA 1X1CA 4AY3A 3CS3A 2RAVA 1YVEI 1IDN1 3BRQA 3CWCA 3AVPA 3BWMA 3LS2A 3QXJA 4Q3AA 5AOCA 1SU6A 3WJ2A 3PPIA 2HPZA 3IDOA 4RA6A 1DTEA 3IAHA 3LA8A 4URYR 4RBNA 3SFVA 2C5EA 2I7TA 2L17A 3D5EA 4IEFB 1A04A 5CLHA 5FBWB 4EI9A 1F20A 5C8YA 1U2RA 2PT6A 2QRPA 4BO1A 4ZI5A 3AG5A 4WBNF 1LFDB 3CRVA 4ODIA 2D00A 4RZHA 3KVNA 1ZK0A 2AQ8A 3R7LA 1YNOA 4CI9A 2OCAA 2OV8A 4V2IA 3MMNA 1KWKA 3P1JA 1RVDA 2VH1A 3KQWA 5J2UF 2H8KA 4LXXA 3EGIA 1TYCA 4HOYA 2GSWA 4IHJB 4BMVA 1HRKA 4R0VA 2HRQA 3ZKWB 1R4ZA 4TLDA 3TO5A 2HM7A 3VZBA 2H7CA 4IH4A 1O95D 2VP9A 3EF3A 4I50B 3W8RA 4ALKA 5JANA 4AG3A 2AOWA 5JZOA 4KQ6A 1QP4A 1OROA 3KAJA 3BEDA 4KSCA 3MWDB 3S4YA 3ZU3A 1EB9A 3IT3A 2ONZA 4Q1VA 3S1LA 5GJBA 5HJ2A 1BNCA 3CRMA 1KZ6A 1AQLA 2DPLA 3HWSA 2XUHA 4TT3A 4ZVRA 2WIFA 1I4LD 4AJOA 4GPD1 3ER8A 2G5TA 2PLNA 1Z36A 5FUVA 3ROXA 4HPXB 3ZUPA 1XOIA 1IEVA 2R8PA 4RH3A 4ERNA 2IU6A 1S9DA 1Z06A 5K05A 2XXBA 1F4LA 4K6HA 2W6OA 3DF7A 3H17A 3KR9A 2PD4A 1VDMA 4OK5A 3WLLA 3VH3A 3F73A 2Y66A 3QP9A 4JLOA 3H9QA 4ZMBA 4CEIA 1IUKA 1Z28A 1NHWA 5EGSA 1C1XB 2GRJA 4OXNA 4O1IA 421PA 4YAIA 4ZP1A 2IWRA 2P6MA 3GJZA 2XDWA 4GE0A 2RJOA 1O77A 2EKZA 2O4CA 3WJ7A 1CFJA 1IY9A 1JS1X 4KPUA 5D5PA 5E7QA 4DKJA 3VISA 1LA2A 3VNSA 4C4OA 3HBFA 4FMCB 4Z1MD 1EM8B 5K2MA 4HPJB 4E2XA 2B8JA 4TPKA 1HMPA 4BLWA 4F97A 1WM1A 1QF9A 1ZW6A 2EHDA 1FTSA 1MVOA 1KEEB 1PJQA 2PYZA 3HRHA 2JFOA 4JD5A 4R1NA 4RANA 4Q9JA 2Z30A 4H6XA 2QM8A 3N8IA 2PBFA 5KVAA 4HRVA 4RM2A 2HA0A 3EMVA 4CN8A 1MOSA 4XW2A 2F64A 4JUDX 2G3YA 4M0EA 4Q6BA 3OD5A 3OF5A 5J1TB 5A02A 2BFAA 1L8XA 3K96A 1DBRA 2WAXA 4JLKA 1P17A 4LWZA 4MA4A 2ATIA 3REQB 4BVEA 4C0KA 3DW3X 1A96A 2XYPA 3G5LA 2DX7A 3MCVA 5B12A 1L5YA 1WDKA 3TR6A 4FDMA 1NP3A 3WLSA 5KEIA 1QP7A 4HUTA 1XRQA 3L46A 1WKCA 3R7SA 2V4MA 3AZQA 1N8TA 2AZ4A 3KR0A 2ZVPX 2YJ6A 3SN6A 4AKTA 5KNBA 1A71A 1RHMA 4JDPA 1GFSA 1OHHA 4GYKA 3USES 1HT2E 4B45A 2QTHA 2I6GA 2VUUA 3JQFA 2QTBA 1USUA 1QFXA 1A95A 2WWWA 4C0AC 4CCSA 5A2QA 2OMEA 4UUPA 5AHKA 1T5DX 5BSTA 1UWCA 4DF3A 4EHDA 1E62A 4F92B 5JBNA 2B0JA 1L7DA 2JH3A 4F85A 3LQQA 2ZUBA 2IRWA 1RKQA 1JXMA 4UUMA 5EFOA 4E2YA 5IAAA 3HXPA 3IJ5A 4EY8A 5REQB 2B36A 4K9NA 4URUR 3PRKE 4FFSA 3MTDA 2HX1A 4HZUB 1QLJA 3VVBA 4OJNA 3OJWA 4D9KA 1KMCA 3MS7A 1U6KA 3H4VA 3LYAA 1FNBA 1JR3A 1M67A 4D6PA 2QR2A 4MQEA 5IJWA 2I65A 2WQ7A 2I71A 3ZCPA 2FE1A 4QVIA 1KY3A 3LP5A 3U7FB 3V48A 1JFSA 4K0RA 5JHGB 3UWPA 3AEQA 4ZYLA 4X93A 2VTEA 4WWHA 2QT1A 1J7JA 5TEWA 1X80A 1P19A 3JTEA 4J2HA 3WKBA 3HXOA 1DWQA 3QV1A 4R8RA 1QS0B 2P9GA 3CNQS 2IDMA 4YMHA 1D1TA 1XEWX 5KIAA 2V5AA 3WYCA 1BDMA 3IAFA 3U2QA 5CFLA 4TKVA 4D26A 4RJTA 3VYWA 1XPRA 4PHGA 4Y8VA 1XTUA 3LI2A 1T15A 2BEVB 3O7MA 1S2IA 1XZJA 2ZPAA 4M8IA 4PYQA 4BMNA 2RJNA 1IVNA 4DBZA 3IUNA 4L3WA 2IP2A 3NEAA 3G9XA 2CHVA 3TNDA 3EGCA 2JHFA 3A9VA 3A70A 4LOHA 4YT2A 1XZPA 4WGFA 2ISCA 1H94A 1U2EA 2PDAA 3IDZA 4YAOA 1LDEA 4OREX 3HCPA 1BDBA 4EF6A 2WJWA 2G88A 1TD1A 2ZRDA 5FTJA 3F6RA 1NC3A 2B8NA 4WA8A 3HVIA 1I4EB 1RJGA 4X84A 4E88A 1V6AA 1WMFA 4D0GA 4GSYA 3RU2A 1YRYE 1GIAA 1II8B 3HXTA 2Z4RA 4ZYYA 1SKQA 4L8FA 1MJFA 4NEGA 5CPFA 3C5CA 2VXOA 5CHEA 1AZSC 5T8KA 4W1QA 1NBEA 3NXSA 5D85A 4QARA 3BSWA 4JC8A 4MK4A 4C6TA 3CCCA 4LUCA 3AO0B 5AO9A 3K70B 4C78A 4NL4H 1ADFA 3G2IA 4V0SA 1FFBA 3MWEB 1RTKA 4HWOA 1J6UA 3WI7A 1R16A 4RDCA 1B42A 3SQMA 2PD3A 4BN4A 1SRQA 1K8ZB 4OHUA 4JI7B 2FCRA 2QTTA 2MSNA 4JUAA 4YMLA 4PX5A 5IZ4A 2IS1A 4F8EA 1P2VA 4Q4AB 4XEUA 3TSWA 1TJNA 4Q47A 4EEXA 1A9SA 2Y68A 3WMGA 3OJEA 3AHIA 1TT7A 3HVRA 4BE7B 3NYWA 4EYKA 4J3JA 2E49A 2VDWA 3QEKA 4HVLA 1WEKA 1BVRA 5A0FA 1AGNA 1E2HA 2EZUA 3PDIA 1SXJE 1NPDA 1QH8B 3JV7A 3VR4H 3RS0A 1PWXA 2DF8A 1UBSB 4MP6A 1PLLA 1LQUA 3BSSA 4M7PA 5LD2C 1C41A 2M2IA 1Q1EA 1E63A 3BH0A 4BNJA 4ZRNA 3HADA 3JQFC 1OCEA 1IU9A 4UCWA 3VV2A 4AQDA 5C80A 4TYNA 1PR5A 2O6HA 2GM9A 1G1AA 3R09A 4EARA 1KEZA 1RWKA 4TUYB 5LZ5A 3BIWA 2O4UX 3MCTA 2CL7X 4MH0R 4V3CA 4CYMA 4C2TA 2L2QA 3V97A 3TZCA 1DT3A 4EA7A 1LX6A 3P8ZA 5BURA 2IZ0A 4CF3A 1QHGA 2FN4A 2A3NA 1KVRA 1XZMA 1U9JA 1VPTA 2YNMA 2HQBA 4UDOA 5GONA 4BZXA 4UULA 3VZRA 3RAJA 2ZWOA 3IVCA 3UT6A 3GFBA 2FPLA 3QFCA 4J7AA 5H3CA 2BZGA 3W8EA 4X44A 1NLYA 5GTDA 4Q0MA 1XRRA 3QF4B 5B3KA 1WDMA 4IEIA 2G0AA 5EIFA 4GZ3A 4E7OA 4EQ6A 2IDKA 3EXG1 4I5GA 4PRZA 2XMBA 2HWXA 1HQYE 3WMEA 2Q4OA 2JFBA 3LLMA 3UY4A 4J3FA 4Q3LA 2UXBB 3I4LA 2Q0XA 4GOXA 3THSA 3MJ4A 2O8EA 1YZ3A 2DY0A 1W8DA 2J0EA 3DEKA 4L2IA 4FSHA 2AG1A 3DBIA 4REOA 2W42A 1H4SA 2ZUCA 4IYJA 3FOEC 1NBHA 2GH1A 1ICIA 3G8AA 4S1PA 5TGZA 5LQNA 2VNJA 4WZAB 4K2HA 2E4UA 3BSFA 2J6HA 3AOGA 2A78A 2OHJA 5DP1A 1KH1A 4LSGA 3LT5A 3VDXA 4WLFA 2UZ1A 4PSVA 4PQYA 2EJWA 4RV9A 3U4DA 3JQAA 3JD2A 4FMPA 2ONJA 2IH4A 5DTMA 4B83A 2YIJA 3IURA 2XMSA 1VG0B 4HS4A 4MUFA 4P4GA 1PG2A 2H4HA 2ZB8A 4C4YA 5B1HA 3I5XA 5DCUA 5JSQA 3QLTA 1VMDA 3K2EA 3FWPA 4RELA 4L7QA 3V1YA 5BYJA 1OFIA 3ETEA 2IPMA 5DYWA 1RAIA 1I5OA 1NZJA 1XD8A 1C1HA 2H2IA 5CXXA 4AUKA 4DCJA 5K8LA 1VIMA 4L08A 4DLSA 5AM2A 4DR5B 3N74A 1TZJA 3RI3A 5LBUA 1U6IA 2QF7A 1VPEA 4BB5A 1DJOA 2E2WA 1TO2E 1D2HA 3EA0A 3OIUA 1FFYA 4EG7A 3C3BA 4J4BA 1I7QB 1BJKA 3UMSA 2V7WA 2CFCA 4A0RA 5B7PA 3VR3D 4KQMA 3VNBA 3A6JA 1N8NA 5HA5A 5T8KC 4EYGA 3F9IA 4GR5A 2GS9A 4IHAA 5DCLA 2G82A 3NIWA 2YMLA 2ZREA 3OQHA 1FX0B 3NBMA 5HIIA 2RGRA 1JQBA 1ST3A 2GZDA 3AFOA 1ZEJA 3DVSX 4IHJA 1RABA 2LR0A 3E8MA 1BHO1 2W2LD 1WNTA 4HNHA 4O0LA 3ZKWA 4NOKA 5BSVA 1X9HA 2JEZA 4URFA 5EE3A 3H3FA 4CT5A 1WCV1 4J16A 4MKXA 3OCWA 4I50A 5EEGA 2ZYAA 3O47A 1RZUA 1HUQA 2AJLI 3P20A 3DPIA 4MVJA 5ABPA 1OIWA 2O5RA 3MWDA 4ZN6A 4KAXA 1I24A 3AB8A 3HK2A 3OPMA 4BDTA 1SCJA 4BO3A 4YUYA 1QIKA 4EHLA 2AB0A 5A7GA 4RUKA 3WGJA 1VBKA 5CT6A 3ZWWA 3OCZA 1XTZA 5BO5A 3FMFA 2JLZA 1JLRA 1Z39A 1ZK1A 1SBHA 5EVJA 3RF6A 4G5QA 3UYKA 1E2MA 3ROTA 3UMRA 2VNKA 1K6IA 1RP7A 3NM5A 3MGKA 5C35A 1DDOA 2C5LA 3GEEA 1TK2A 2JAOA 4QXRA 1YR9A 4RSGA 3WGGA 3CBGA 1C1XA 1QNLA 1CIVA 1PUJA 1OGIA 2ORWA 3ZEAA 4ZT3A 1A4UA 3PEWA 2FPOA 1T5BA 1T1EA 2V6GA 4GH5A 4XLLA 5TJ9A 3C4JA 3TMAA 2DT5A 4G4JA 3L04A 1UK6A 1E3IA 3B7GA 3F7NA 3S8MA 3GCWA 2XTAA 4TV9F 1EM8A 4B82A 3OQPA 4BNKA 3IPXA 5GPBA 3CEHA 1JLKA 3GELA 4TMYA 3ZIAA 1NGSA 1ZQ9A 1JHAA 1G5HA 3DAGA 4LRWA 1DG3A 1Z2NX 2YNMC 3I32A 3WX0A 4BVJA 4G25A 1SIWA 3GLGE 1UDCA 2OLEA 1KEEA 4L5CA 3VSEA 2FPIB 4OL9A 4FZRA 1GU7A 4DJFC 1W5EA 2R00A 2JLXA 2BW0A 4IPTA 1GYRA 1JLSA 2PX6A 3PG5A 2MR6A 5AOBA 4FNOA 1A8SA 2B35A 4P0QB 1NW5A 4IDHA 4UBJA 1E92A 3BWEA 3M82A 3REQA 1XDUA 2HCJB 3N2KB 1FDOA 1ZD8A 3HUUA 1UUFA 2SKCA 4N0MA 1B0UA 4QASA 5FR1A 3GZJA 3P2MA 4F4CA 1D8AA 4JIGA 2DUMA 4Q82A 1GRQA 3Q10A 2H48A 1B76A 2AG5A 2WKQA 3QF7A 1QVAA 4ETNA 3DE0X 5KAMA 1JL3A 2BGMA 4RPGA 3R7DA 4OHZA 2XXAB 4CQLB 4DR2B 2QGZA 5FPTA 3PDHA 4KR9A 2Q8PA 4MEBA 3L0IB 2I8CA 2DH5A 3UFXB 1LSOA 3VPBA 3ZY5A 1UBOS 3ZDBA 3WO1A 3AQ4A 3PVZA 2G77B 4RHFA 2DXIA 4F5YA 3BC1A 1GNRA 3HDJA 4I4CA 4OHBA 1GGVA 5F5LA 2PMCA 4XGKA 4NR0A 3TDNA 4H60A 4NMXB 4U6SA 1PF7E 4YRKA 4ZAZA 1Z29A 5CX1B 3ZWDA 4CM9D 4F72A 5JI3E 5REQA 1NI4B 5I45A 1UXKA 1CUCA 3C1AA 1YZYA 5BW8A 2GTHA 2QENA 3V7UA 3RSOA 1WB9A 1VKNA 3MWKA 1TM2A 1YKFA 1LBQA 4ER5A 1U1GA 5CT9A 2GJKA 5DWDA 2ID8A 4RVUA 2J3IA 3GUUA 3BILA 3CX4A 4DCMA 2L0XA 3WNBA 2I2WA 3DMDA 4IS3A 2A5JA 3LBNA 2H9AA 3NV7A 5LQSA 4DQKA 3I12A 4R2MA 1RZRA 2X13A 2PIAA 3FLAA 3TUZC 1UR5A 2FTKE 5EKXA 2RK4A 4FCTA 2AQHA 2YBEA 4I4NA 1BDJA 4MRNA 5H68A 3V55A 4V1CI 4E5UA 2OB1A 2V96A 2NQ8A 3GLVA 2VZ8A 5ERYA 4EFNA 3FUUA 1IQPA 1UC4B 2O06A 2WTBA 2ZRNA 3PI6A 3VPAA 5M5BA 5DX8A 1INLA 3LX4A 1QS0A 1XCLA 4LCBA 1KJ9A 3UH1A 3T34A 2WABA 3AU9A 1XU9A 3DMNA 3K1JA 4X1IB 4HK4A 5JUWA 5KQSA 2XRZA 2XPCA 2CNWA 2WFZA 4ITVA 1IQRA 3U0VA 3V2UA 2GBIA 3L8CA 1Q0HA 1DAGA 2CUZA 3GW8A 5KHOC 2FLWA 2ZAGA 1X86B 4J16C 2UUOA 1OGJA 4GI2A 3NHPA 3TRFA 1YQXA 3U26A 2BEVA 1ZRSA 1QWSA 3D1JA 1P2BA 4B0PA 1P31A 3KO8A 2XWJI 2AOVA 2PZJA 1FLAA 1G8GA 5IX8A 2CDBA 4C0JA 1J56A 1G5RA 5J9FA 1M8GA 2QVYX 1U98A 2OHGA 1G9SA 4M1YA 2Q3HA 4RD2A 3CH4B 1PHRA 5SICE 1XKXA 1WXQA 2CHUA 2C5AA 4F5DA 4MGIR 4CWAA 3OT4A 4PHCA 4K46A 4Q3BA 1XFDA 1XCOA 3K72B 4PIMA 2HI0A 1HX7A 5F3RA 4MJ7A 4FGZA 3B3JA 2D6FA 5T4HA 4PPYA 5SZHB 1F38A 1W2GA 1S2DA 4ZI3A 2W8BB 2GYVA 3WQQA 4II3A 1AGPA 1H8HA 3KUDA 4RY8A 4ZCLA 1O0CA 1QBGA 3FUVA 4HGPA 3AP3A 4JVOA 4XSHA 1M8KA 4U00A 4BO0A 4DA7A 3KWMA 1ESDA 1A9PA 1D4ZA 4E5YA 3NDPA 1VXRA 5EMKA 1C8BA 3UPDA 5B2EA 3AY3A 1GQRA 4P81A 1T35A 3MN1A 2DHDA 2PGOA 2W2NA 1Z4MA 5K3AA 1LPSA 1X7YB 3DOUA 3A9RA 1DMSA 3JALA 3FRIA 3PDUA 4MMXB 4R6WA 4FYXA 1BXZA 5LPNA 4DR7B 3NVKI 1I7NA 3WLIA 1WPRA 3ZLBA 1X14A 3NP9A 4TMVA 4QIHA 4CIAA 5HPYB 5JXWA 3GHHA 4RKEA 2IZ1A 1OBOA 3DC7A 3G0IA 1U0TA 1USWA 3PUZA 3Q85A 4Q4AA 3RSGA 1XF9A 1J4AA 3IT0A 3O2QB 2R00C 3H1FA 3QVMA 3RBAA 1JBEA 4FS3A 2JAHA 2ECFA 4NYJR 4TQUS 5MGBA 4A6XA 1JT9A 2IXDA 1TUGA 5KWSA 3EVDA 4ECAA 4Z0HO 5AIBA 2VI5A 3AFNA 1M8PA 4PYIA 2XT6A 3DH0A 3EXFB 4MI1A 4FHEA 4EY6A 3AUFA 1ISHA 1TEHA 1T1IA 4ILKA 5ELMA 3HP7A 5KYWB 1SAYA 1J24A 4CG1A 2XE6A 3KAQA 3UB2A 4BKUA 4E6PA 1DAHA 4NYJQ 1PR4A 2XYHA 3DLIA 1R15A 5F51A 3CSUA 1WRBA 3IEKA 4OVKA 4H7EA 3KL4A 2XUFA 3WKAA 4H3VA 2QT9A 1U99A 2D1FA 4TUYA 5HW0A 3PE6A 4RS3A 2F8MA 2R6CA 5CFOA 2ZQYA 3FNIA 4J0FA 2FSSA 1BKYA 4JOBA 1SUWA 4PC2A 3VQTA 4F9TA 1NA5A 3UJBA 4U5QA 4M1SA 3LUDA 3PFNA 4QQ8A 5B4UA 1HYQA 5G4LA 3MJFA 2UVPB 4J91A 4I6GA 4QODA 1T6ZA 3QF4A 2PT9A 4N0PA 4B74A 1G20E 3ZWPA 1ZR4A 1IXYA 3H6HA 3W9YA 2LVBA 4QBIA 3ZIUA 4FWIB 1E0AA 3MT9A 1J42A 2PYDA 2WYWA 3BCSA 4PZYA 1KKLA 3VZPA 4FFLA 4RKYA 2IE0A 3ADBA 3NORA 2D1SA 4EVRA 4Q4HB 1L4UA 2I8LA 2IY9A 2SKEA 5JZ9A 4J49A 1Y3AA 5BSHA 1XTQA 4WACA 3OIDA 4OHRA 1NULA 1A5ZA 2QX6A 2BC9A 4P5PA 2XBLA 3FYDA 3IAM1 4CM5A 1NI3A 2IITA 1E61A 4WZAA 4X3CA 3I9MA 2GHRA 1W0KA 2WKPA 1ZPDA 1EZZA 4HGOA 3G88A 3OQVA 4JQSA 5EXTA 2FEPA 1M1NB 2FZ4A 1WSAA 2FDRA 2FEWB 1IPEA 4KHPB 1ULUA 1A77A 1H5UA 1KP3A 1MMFB 1BH2A 1YRQA 1DDIA 4QDKA 5KREA 4KGXA 4GKAA 4WN3A 2RFLA 4TXLA 1DBIA 5JE8A 4TX1A 4UZEA 2XECA 2DUJA 3JWIA 1M0WA 2QVZX 2IXAA 3A0UA 3BD8A 2M1XA 3HMQA 4LNUB 4TMTA 4DRZA 4E46A 2YASA 4K9RA 3NTRA 1XQXA 5J1SB 1Z37A 1ZNWA 3OX4A 2NO0A 1JQ3A 1OIXA 2GAAA 3COSA 4QPJC 4V2UA 1NBMA 5CDFA 2G5CA 1VMIA 3NRBA 2AJCA 2NO6A 1WXDA 3BKWA 3UAYA 2ZJ7A 4DB2A 3H2GA 1YE5A 1UBJS 4GPTA 4WY2A 4E1BA 4EL0A 1AQNA 4DV1B 4E3WA 1YB7A 2AZXA 4GWLA 1P4GA 4Z0PA 4LCJA 2BMFA 5HEKA 2HTFA 3OQBA 3QUCA 3TSAA 1SMKA 5I51A 2FN9A 4MI9A 3F9RA 3C5WP 2H54A 2RGGA 3NRCA 3CQ9A 1R12A 3K0SA 1UK8A 4UU1A 2LPMA 1N2IA 3K70C 3T1HB 1FX0A 4ZQGA 5BR7A 2DWPA 2AXEA 3PIRA 2IHVA 1Z6TA 3NS7A 5IVHA 5E8RA 3VZQA 1RBZA 2NO4A 1Y1KE 3A9SA 3BTOA 2F7SA 2Q5HA 5BV7A 3WSVA 2BBTA 1AG9A 4DMMA 1OKKD 2AUNA 4MR8A 5BOVA 4ZO4A 3UUEA 3WWPA 3RTBA 3T9BA 3X2FA 3RV4A 2AR0A 2VDJA 1DEKA 3ZKAA 1WE2A 2XVAA 4AMBA 2CVHA 1IPHA 4NS4A 2OYCA 4CKYA 3GA5A 3SKVA 3PGXA 3OOWA 3WLHA 4HGQA 1NC1A 5HE9A 1Y89A 3CINA 1OWMA 1PFWA 4WZ6A 4RTOA 3NX4A 3B8HA 4OLFA 1R5BA 3WGTA 2ZG6A 3D0RA 5LZ2A 1BH6A 1MVNA 3GEBA 4IMJB 4KN8A 1A3CA 4LMAA 3EHEA 4AF6A 4CDRA 1HLGA 4U9UA 1UAAA 5FAXA 3VJKA 4FLEA 1SWVA 4LJ6A 1RYFA 3AQIA 3AUKA 1R18A 1GARA 4DLTA 1ZD5A 2OXEA 3A1VA 3QLJA 4GXQA 2JH8A 2PUJA 2H4XA 1XJCA 3OTWA 3HFRA 2ZRQA 3KJQA 4W8HA 3UVEA 3PNSA 3PL5A 2H08A 1SHUX 1G4HA 2PX4A 2WJAA 2YZKA 1G8JA 2QXUA 2I34A 1RHJA 2NTNA 9LDTA 3CKKA 3B53X 4K81B 4WK6A 1MXHA 3GZTB 3MT8A 5E7JA 2FUG6 3A1FA 3VO8A 3IBGA 3DGFC 2BEJA 2FPIA 2ZQZA 3TLEA 1Z7BA 2NZUG 2WE7A 1IK6A 1LPAB 2H4YA 4BLRA 2CSUA 3EHDA 3VU1A 4NH4A 1P5ZB 1QO0A 2C84A 1AUPA 2HIGA 3FVWA 3KE9A 4XRGA 1OI4A 4YV0A 3RH0A 5AM3A 5I4KA 3DBVO 3DXFA 3EIUA 4HXFB 2ANCA 2IUEA 2HY7A 1TMYA 1TIBA 3DDWA 1IB6A 2VSXA 4QFCA 1I5EA 2DQZA 4ZHSA 2NT4A 2XNDA 3EIQA 3O2JA 4JB2A 4G07A 3W7AA 3FYSA 1OVGA 5FPKA 3D6AA 3O9VA 4Q3KA 3G2OA 4NESA 3ZTTA 2XXAA 2KW5A 4CQLA 1GPNA 1D2CA 2QUKA 2FOXA 4R9VA 2FPSA 5ETJA 2OV6A 4P92A 3UFXA 5DYIA 3WA7A 5AVRA 5JRZA 1PQUA 4KQKA 1HSZA 2YXNA 3DEFA 4M1KA 2OK8A 1NQAO 1QTQA 3SVLA 2QAGA 5CX1A 4MQBA 2DBZA 2HB6A 1PO7A 1NI4A 4UVGA 3E3MA 2A0WA 2BVNA 4X00A 5ISMA 1E96A 2ZI9A 1IVSA 1DX4A 1K3FA 5HIKA 2G6TA 1C3LA 1O94D 4FNMA 1K6EA 3GLFB 1B4DA 2O8VA 2P9CA 4I1OA 4WK4B 1N4DA 2NXWA 3UGJA 3VPSA 1KQGA 3PC2A 4RE5A 2W90A 2PKQP 5EZSA 2FX3A 1OX4B 4DJ5X 4H08A 1TCAA 3LDFA 1NR7A 3TKLA 2QYOA 4YUAA 5BXYA 1FW6A 1DC8A 4XFJA 1HQKA 3IBYA 3ESYA 4LVCA 4KJXA 3IDFA 4RYDA 2MMGA 4JYBA 5HXAA 5JMTA 3UK7A 1G63A 2ZTHA 4XCVA 4MV3A 4FP9A 1E9EA 5DLDA 3ZX4A 4DCGA 4E5VA 3QM1A 2VPZA 1MQAA 1NF2A 4B3GA 3W5SA 2FH5B 1CVIA 4QLOA 3HYCA 3D8NA 4ZOLF 5FQNA 4F6RB 3SDBA 2JFHA 3I37X 4L5JA 1TRKA 1C2TA 4P83A 4L5BA 1JTEA 2BWJA 2A1TR 3PC6A 2WB4A 5ALPA 3L8EA 1L5FA 5EJGA 1G9TA 1YIDA 1ZICA 3SLKA 4XIYA 1EB8A 1JKJB 1OXXK 2BTOA 1B0PA 2GK4A 2H1FA 2CV2A 2FRDA 4H4DA 5DNDA 4D9NA 2YYSA 3SLRA 4RK4A 1AN9A 3CNLA 2ZS8A 3VC7A 1D0VA 5SZJA 3IRVA 4RQUA 4BV2A 3G1UA 3ZVMA 1XSEA 3DBHB 2A1TS 2R1UA 3PEUA 4HNTA 3DWIA 4AP6A 4X66B 1JLLB 1BA3A 1WUKS 3WLQA 3EPJA 3E03A 2SICE 3L7AA 2VT2A 1L7PA 1PK9A 3UO8B 4EI8A 4A8PA 2WR8A 3AH8A 2PWYA 3CLUD 3H97A 5I7EA 4ARIA 1HDIA 3L4JA 3OAAA 3IELA 1KR5A 1KFCB 5AK4A 1N2CA 2DUUA 2EFHB 2FP3A 2AEMA 3PP8A 2NXCA 3VPGA 2O7QA 3II6X 4N3CA 1X7YA 4LJ9A 3FYHA 5DTEA 4B2PA 5LP1A 1Z47A 1JW9B 2R8EA 4NAVA 5JCOA 1G55A 4L50A 4II7A 1Y3FE 1EDDA 2YVLA 3RBXA 4YCSA 4JSYA 3NHSA 3MBIA 1DHTA 5IS2A 4O8CA 1PFGA 2XSZA 1C81A 1BFKA 1IZ0A 1R7RA 3FWKA 4UVHA 5HQ3B 2EL7A 2GDZA 3M9LA 5JMPA 3SMQA 2YW2A 2W70A 5DHSA 1QSGA 4E94A 3BF8A 1M1UA 3KEOA 1X77A 4A0SA 5AHRA 1UDAA 4LVNA 4INOA 5I3ZA 4ZALA 3CVVA 4JLWA 3U7EB 3QVUA 4RTJA 4UZFA 3EF1A 1CRLA 4RORA 3VNAA 4BC0A 1YBAA 3P9QA 4ZT5A 3HXLA 5FAKA 3FB4A 4MXDA 4KK4A 3KIPA 5LKAA 4IXNA 1CUHA 1XRNA 3EVNA 3LLUA 1JDTA 4TGLA 2VNSA 1MC8A 1PDOA 3Q3GE 4XWYA 1ONSA 1ZU4A 3RVBA 4DLYA 4EVSA 4ICIA 1N6RA 1SU7A 4IFTA 4XFKA 3F46A 1Y81A 2AI3A 3W5BA 3NWEA 2DE0X 3F47A 3KEGA 1JHRA 2C94A 2P0EA 3QW2A 1C7QA 2ZJYA 3K8QA 3P9IA 4UAGA 2WNSA 2XVZA 3OFSA 2YVKA 2Q62A 4N49A 5TT1A 4C7OB 2QAGC 3RVPA 1U7TA 2FK8A 2JL1A 2X7XA 1BJRE 1OBFO 1TA9A 4PZAA 1XMSA 1SHKA 1L7QA 1TO1E 5EFZA 3KU1A 5IH7A 3CXRA 3DSRA 3EZLA 3M1AA 3UW1A 5DM70 4W1SA 5EKSA 1UEXC 1U02A 2PX8A 4DJTA 1X2BA 3N2ZB 1CERA 2VPWA 3AETA 2UVPA 3MGCA 5ALOA 3MTJA 4YASA 3TQQA 2X4DA 4JX8A 2JI6A 3P2IA 4KOAA 4N7MA 1R4NA 1RPAA 4X45A 4C2AA 2ZBGA 2WM9B 1AS3A 2H8GA 4RAOA 5JEEA 1NJ2A 3NONA 4AW9A 3E9CA 1JIIA 1WLSA 2ZRLA 4O29A 3LRXA 1WCYA 2W4MA 4RHXA 1V8DA 3EEBA 1L6IA 1R0YA 1GCIA 2M6RA 4I55B 1Z63A 4IXWA 4F5ZA 2I8AA 4HDAA 3DOOA 1ORIA 2C5BA 2Y1GA 4FS8A 1X92A 1LPBB 2HT1A 3WA6A 2OL4A 4IGKA 1KK3A 5I8WA 2B9EA 3BL5A 4AYXA 3FMIA 3GEDA 1EGMB 1SXJD 1URPA 2BFPA 2FWBA 1F0KA 2INGX 3A6HA 1PD0A 2HF9A 3GPCA 1ETUA 5K8CA 1H3NA 4YCNA 3OZUA 5E9WA 1B1AA 1BZYA 1N0IA 3E84A 4GGOA 1AHHA 3AR8A 3EBOA 1M1NA 3P9ZA 2YZNA 2HLDD 4Y0NA 2WD8A 1GAJA 5DW3A 2JLVA 5F64A 5LLSA 3AR6A 2A0KA 3HJHA 1Y6FA 3IO5A 2FSUA 3RTDA 4EB6B 1T0UA 4NCHA 2R3SA 2XQIA 3PFFA 1Q95A 4CTMA 1C8KA 2GRUA 1XMPA 2BLLA 2WINI 1ZONA 2E55A 2Q3CA 2HA6A 3L6EA 3Q87B 4LNUA 2FRDC 4QYXA 2AN4A 3TIIA 2CT8A 2IEGA 4BCDA 2FPGB 1H2HA 2Z1DA 2NYVA 3MAJA 2FXVA 3B89A 5GJVC 1H1LB 3ZI7A 3WB0A 1P5FA 4G1VA 3SIXA 1CUWA 1N5OX 3H04A 1T8TA 3CLSC 3G23A 1TZKA 1CUJA 2B94A 2RCNA 1TX4B 1C9DB 4LC9A 3HJFA 4I8IA 1T3TA 2R4UA 1JMYA 3KALA 4V0NA 4R41A 4GI5A 3SI7A 2P30A 1NVUQ 1T8YA 621PA 4KNYA 1NQOA 4LGMA 3B6JA 4PGMA 5EMLA 2ZI3A 4QPNA 2HUPA 4B73A 1VHLA 1P2UA 5LBIA 4BNDA 3IPLA 5F12A 4R3WA 1ULSA 1BX3A 3EDOA 3L7YA 1GQQA 2XNSA 3W5VA 1PR6A 4R2HA 4XD7A 7YASA 2O3QA 2PXHA 3CUUA 4PLHA 3VDQA 5JCOC 9ABPA 8GPBA 4KLRA 3RVNA 3ZXXA 1HE4A 4RK6A 4MVJI 2XUZA 1ORHA 1J1UA 3FNFA 2AZTA 3A06A 3KFLA 1UBGA 4EJSA 3TFQA 1JE1A 1QR6A 2VYND 3WHKA 2OD9A 2FWPA 2ZYRA 3NDIA 1EHYA 1SO8A 2CE2X 5JWRA 5L3SB 3GRFA 3EAQA 4OQQA 2QIPA 1SY7A 2RI6A 1KZGB 4WQMA 1QVRA 4CLDA 1O3YA 4JELA 3E9YA 5JLAA 4L4RA 3CZ9A 4KO4S 4BNUA 5KYGA 4DZZA 3TGPA 1QKKA 4JJ6A 3TMYA 4X1OA 1DOAA 4UHFA 3GDHA 1S3IA 1X94A 4B6GA 1MAUA 2IX9A 2QRKA 5EMMA 4QO8A 3PHBE 4DCUA 1UBFA 4MLZA 1DCFA 2GJ8A 3WISA 1P77A 1VMEA 1NYTA 2TMYA 3IMEA 4H1VA 4JBYA 2DCMA 2C2GA 1NUAA 1AO3A 3OZVA 1CJTC 4LE0A 4MVXA 3EVFA 4L1KA 4IYRA 4P9NA 3GRRA 2VHZA 2VJMB 3AL2A 3BK1A 4GRAA 3LQRA 3C6QA 2OM2A 5KNBH 1KYWA 1XGKA 2D13A 1NW7A 1RVV1 4FIDA 3QHAA 3SHOA 3KE8A 1B73A 4AS3A 1NP7A 5JCJA 1GT6A 1Z4KA 3Q0TA 4B47A 2POCA 5ITVA 1GQYA 2NXJA 4F4JA 1A2KC 4KKVA 3I76A 1AHPA 2B8TA 3PNMA 1U2PA 4O8ZA 2QRNA 1IMJA 2PLAA 2V0CA 1O6FA 1GTVA 1RCFA 3NGLA 4XJSA 4C0XA 4DLLA 2P4SA 2DH6A 4MP3A 2CLEB 1VP3A 4KEAA 4MGYR 1MQ8B 1SCQA 3KTDA 5AJWA 1F0PA 3UTDA 2WMOB 3DEJA 2WTMA 1FDVA 2D8MA 4J0GA 4M8LA 1XBTA 1RXVA 2GLTA 4DQVA 1R0LA 2F4NA 4D97A 3ON5A 1YD7A 1BWSA 4OGGA 2I99A 3HJUA 4FFNA 4Q1BA 1MABA 3PJFA 3QENA 3ZZ0A 4RPJA 1AMOA 2G83A 2FLKA 1VMKA 4JJ4A 2GEUA 2OAGA 5IKPA 2BM8A 4IIEA 5JJBA 1SXPA 4OLHA 5D01A 5GADl 1AV6A 2PO5A 1WMEA 1YH3A 2XKJE 3NTOA 4QBGB 1F8GA 4M2LA 5HIMA 4C87A 5EP3A 1J9EA 2ORED 2O5CA 3EDYA 4IJWA 1P3DA 5AW7A 2VPIA 3SR0A 3AR5A 2YHIB 1B15A 3DLAA 2JFUA 3D3KA 2I7XA 4B2YA 2V9CA 5E9AA 4NZPA 5IAKA 1V4BA 5D7BA 3JQ7A 2H1VA 2F9LA 3DQQA 2FJ0A 5D00A 5I7SA 1VOTA 1ZC4A 2PZGA 2ZB2A 3ILXA 3HSKA 4YJ2B 4CM7A 1KMHA 2XDYA 4U2BA 2JZCA 3KHUA 3GLFA 1YRBA 1K6MA 6PFKA 5HKAA 3CTPA 2DY1A 3KQOA 2HWYA 4UUAA 1OX4A 1RRPA 4UE3S 2X19A 3CX7A 4E2WA 3QUBA 4MUXA 5HE8A 3LXUX 2PZLA 2QTRA 5L53A 4HX5A 3QITA 3NJ4A 4QTUB 1KBZA 4JITA 1G98A 1UEIA 2V7EA 4TZTA 3SIPA 1P2SA 1Q77A 3IC5A 3WL6A 4BNNA 3HSYA 1T4MA 3B82A 2ISSD 3MJHA 4LI0A 5FOSA 1J7KA 4JB8A 4AXBA 1A4RA 5AM4A 4B9EA 4FD3A 4F6RA 1E3WB 3DM5A 2NUTB 3BL6A 3Q8XB 5DN9A 1DNPA 2AXNA 1QK3A 1F9EA 2PBZA 4FQ8A 3BS4A 1P5RA 4HJXA 1UDXA 2ZRBA 3D8TA 3RDPA 4OQPA 3L7IA 4HNSA 3QQ5A 2J4FA 3L7DA 1DAPA 4L72A 4EF5A 1ZG3A 1JKJA 1MCZA 1Z6AA 4P7FA 2WAAA 1JEQA 2Z43A 3UJCA 3VM6A 4DG8A 2BE9A 3OWXA 4IXTA 5B3JC 2C9YA 4LZLA 4W7SA 5EXEA 3MMPA 3JQPA 1NKTA 1CPYA 4RF3A 4UTZA 3ROZA 3O90A 2GQ0A 1QG4A 2PNFA 3TYXA 3EOZA 1LUAA 1Q7CA 1ZIDA 3BULA 3DBHA 4NDZA 1SWWA 3BFVA 2O2DA 2XE7A 3CLTC 4KPFC 2AJBA 2H5JA 2Q29A 3AM3A 3BVPA 2Q28A 4R7ZA 5JV5A 2VYVA 4G56A 5DU2A 3I9JA 4B4KA 3W6UA 1RYYA 4DPMA 1I14A 3H4TA 3ZIDA 2FUEA 1KO7A 1J20A 4RLHA 4F6LA 2OTCA 3C2QA 5A5VA 3OA0A 1EVLA 2HFJA 2E89A 2H9YA 3HC7A 2DR3A 4E7PA 3VR4D 4BNXA 2HEGA 4E4TA 1C9KA 1FFDA 4KZKA 3HHPA 5ARBA 1WB5A 1PNVA 1ZLXA 3OIVA 1FUEA 1XVAA 4MUJA 1PZGA 1UFKA 3KHKA 1C29B 1SCDA 1W59A 2O9JA 3Q8LA 3L8MA 4FEAA 2HBZA 2OBBA 5ALFA 3JVVA 1QX4A 5HQ3A 2HDNB 1PJTA 3I42A 3IT2A 3QU5A 1JDVA 3L6CA 1G18A 1E1DA 3QFSA 3TOXA 4YV1A 2DQ4A 1LNSA 1UK7A 3I2KA 3X2SA 3RQSA 3QUQA 2UYHA 4J4HA 4EHJA 1XTTA 1HL7A 3OE1A 3KVRA 2XY4A 2UUAB 2CFTA 3KT0A 1HKHA 5DHUA 4KSBA 1P1CA 4LYGA 3DBLB 5DM4A 1QGED 3GP3A 3HDGA 2BGKA 3PC3A 4LG1A 5C7LO 5KCZA 1IZ9A 3GUCA 2BKXA 4OK6A 1JTVA 2F2TA 2NG1A 3B9RA 3NWPA 3ZJVA 1HK7A 1W5BA 2DFDA 3GUVA 3NPAA 4F91B 1X1SA 3W2HA 4COOA 3FFAA 1YDFA 2B7BA 2EDCA 3AHHA 4O1HA 1XZKA 3B3AA 4AJHA 4BKMA 3CSDA 1T43A 3QE2A 3T5TA 4POAA 2YYZA 2QZZA 3LU1A 1WEHA 3M49A 4AB1A 5D3ZA 3WP0A 3QVGB 4YFYA 3HRKA 3KCQA 3RPEA 1NL3A 2Y67A 3L6UA 2NZYA 2LV8A 1D09A 3PUXA 1NVDA 3QU4A 3S2YA 3VKHA 4JEHA 4EEKA 4R2LA 4KQIA 4GU5A 3DJYA 4X8MA 4ZVNA 3LV8A 4BB6A 4IIJB 1LY1A 4L8LA 1VLZA 4X7MA 2ECOA 4B8WA 2MWMA 4OAQA 4KVGA 5KC8A 2V0NA 4XM2A 3WIEA 2XT0A 1XTIA 1LNZA 4IG9A 1DKOA 4EG3A 5BR4A 3SJUA 4E12A 2PG3A 5EE0A 3AVVA 5MN4A 4DEYA 5GV7A 4F11A 3CNEA 3RD5A 1Y8RB 2JAXA 2C5FA 1QAQA 4IIFA 4KO3S 5ITWA 4YMGA 1Q0PA 1U1CA 5JXHA 1KXZA 4I55A 4PO1A 3TSCA 4F9EA 3B1VA 1X1AA 1H2EA 3UMGA 3PJRA 5ILOA 4JA2A 3PRJA 3M3DA 5IDWA 4H1WA 3D2AA 8AT1A 4GPEA 1MN6A 2CVFA 3DZ8A 1CUXA 1K1EA 3WG9A 4OUDA 1NXXA 3ADDA 2JLYA 1HFKA 1SB9A 4KLAA 3CCBA 4D92A 5C7YA 4KODA 3K9CA 4IFEA 4U9HS 2WYVA 3KOWA 3FHJA 4G01B 3O4GA 4OKNA 1V4NA 1DAEA 3QH4A 4MAAA 1EP2B 3BEOA 4UD6A 4PYJA 3F90A 2FKNA 3GPIA 3HN2A 4N0QA 4AJ4A 1PL6A 4DJJA 4EO4A 4UATA 4EB6A 2Q6LA 1IM5A 1RLUA 1CFZA 5KPJA 2FLVA 2ZUSA 4MWZA 4RZIA 2CXSA 5ECDA 5TMBA 1TJ3A 4R2WA 3D59A 1K66A 2FPGA 1XYVA 3ANYB 5DKFA 3SC2B 4TKUA 4DLKA 3BM5A 1RYNA 3RYCB 1H1LA 2WQ6A 1SCKA 4Q9LA 2X5JO 1A7AA 1CUDA 3H5LA 3QPDA 3WQHA 4G0WA 4BAGA 2CDCA 3L84A 3BUSA 4KIWA 3C0KA 3LFHA 2EWVA 3AZOA 1O1YA 1TYAE 5K3DA 4B79A 4HNUA 4ZREA 4YRDA 3KJGA 1LRJA 4MVJH 4RNCA 4YAEA 3DO8A 3QNUA 2Q2QA 3J7TA 3TZKA 2J7KA 4P3OA 4YMVA 4PS1A 4RMGA 4QOHA 4PNZA 4ZDIA 1D6MA 6LDHA 1ULTA 5HKOA 4N5LA 3TDMA 1RE1A 2JFWA 1KMNA 3MTEA 2IK8A 4YPVA 5K0BA 1JSLA 2WJ6A 3MCUA 1PNRA 2WJPA 1JYSA 1CZUA 2HPVA 1W4CA 3N2EA 2VCYA 3IIJA 1QGYA 2G72A 4I0WB 3LTEA 1JR3E 4F3RA 1JZTA 1VKOA 3SLGA 2AWNA 1PD1A 2C4NA 4R8KA 5AM5A 2BGGA 2I4NA 5HUJA 1HNXB 1H2ZA 3H6GA 4Z4GA 4AICA 3MT0A 1WZNA 1BAPA 3L4SO 3OCXA 4ZTBA 3C7AA 1YB4A 1ACJA 3FAZA 3FPJA 5BR1A 4A2PA 5JYCA 2ZU6A 5L3SA 4BP9A 2OBNA 3CRNA 2WKRA 4PO3X 2QY9A 1LBTA 3IE2A 1BMFA 4Y6LA 4YI3A 4HJRA 4AY4A 1TFRA 1X13A 3ANTA 2D0PB 3V9AA 4WHMA 5BSEA 3G59A 1AQYA 5JNLA 3Q41A 4NCKA 3FPSA 4P7BA 4M6WB 1CDDA 3OEWA 2XR1A 1F0NA 1RLTA 5EZYF 1IAVA 1JHMA 4ZVQA 5GJWC 3SXPA 4RNDB 4BFXA 3DLTA 2Q46A 1FRNA 3H7AA 3NUQA 1R0XA 1RWVA 3G5AA 4NLLA 3VRHA 4B3CA 4D9HA 2ZTSA 3OUZA 1QF7A 5HHTA 2KX7A 1QRRA 2RBEA 5AYVA 2WJZB 1EJBA 2GF9A 3H2SA 4NEQA 1M34B 5G53C 2CW5A 2E48A 1ISSA 2E21A 2G1UA 4G5FA 4BJ3A 4BGUA 5DHRA 2BBOA 3HMKA 4O2BF 4ZU1X 4B75A 3H5NA 3LUPA 1KQNA 4US0R 2RI1A 2OBLA 2QU7A 2I6XA 4UCFA 5HIJA 1J8QA 1GG9A 3HB0A 3OHMA 5CVUA 4ESEA 4Z9FA 3ABIA 5IH3A 1NVXQ 2CY0A 5T57A 1R2QA 1V4VA 2PSHA 3LUJA 1TK3A 2YFKA 3I01A 5TPZA 2Z4TA 1FNNA 3GMDA 4X62B 2JHCA 1THZA 1WBDA 5F21A 4AY2A 1B16A 5IM4F 4HQLA 4R54A 1NE7A 4OL0A 1Q91A 4FHDA 3W3ZB 4BQRA 4Q4CA 1UJ6A 2EERA 2PU5A 3QWAA 4KX5A 1K4YA 3FLEA 1TCCA 1VL1A 3AR9A 3DHWC 5K2OA 4ENSA 5ALQA 2BFCB 4ZODA 4YCDA 2VAMA 2M6LA 1YR2A 4UKDA 2ZSHA 3DXYA 4GDMA 4I99A 2R96A 4QNMA 1Q12A 3PEFA 4YYEA 4H1TA 4ALNA 3P2EA 1E60A 3A0RB 3BFJA 4UVEA 2QVGA 2SHKA 1LU9A 3UWOA 1WXGA 2DPGA 1J8MF 1BJTA 1POWA 4FFMA 4YAWA 1UOOA 2YHIA 4HAIA 2NO1A 4CIVA 2H2WA 3VR2D 1GT91 3QYJA 3ZGXA 1QDUA 2IPAB 2QTLA 2Y1XA 1U9ZA 4O2BB 4YJ2A 2WA1A 2BKUA 3JR7A 1JR2A 1VKHA 2VTKA 1D5WA 3QOWA 4G89A 4RGYA 4W8OA 4ZVVA 4HAXA 4LK3A 1U7UA 1OLOA 5K8UA 1TTPB 1DBWA 4D57A 4RZXA 2CEAA 2O0JA 4ETIA 1XTVA 3OJFA 4KWEA 2EZ4A 3UC9A 4EHIA 2JZNA 2H1HA 4E6EA 4YIHA 3RWOA 3L9WA 1JF8A 4PBTA 1RBYA 4TMWA 5DV9A 4ER7A 3ZJTA 1ANKA 1LBHA 4HEHA 3W77A 3USZA 1WY7A 1GTZA 3OOYA 5K0CA 4ALJA 4R1QA 2GZAA 3WY9A 4YJDA 4FBLA 3JWHA 1K7EB 2HA4A 3WQSB 2F90A 2W6IA 3SF8B 1EUYA 1PUXA 3W3AD 2IHNA 3FHTA 4W8GA 3IAM6 2DZDA 1AZWA 2NUTA 1P8JA 1UBMS 1Z7GA 1ZHHA 3I52A 1XNHA 2ZCJA 1DMRA 4B3BA 4FYVA 4ABYA 2NTVA 4ACAA 2ZK7A 2R5WA 4LJYA 1SCIA 4AO7A 1OFGA 1WXIA 2WUDA 3ZCSA 4B43A 3JARA 1LD3A 1L5OA 4EHFA 2C0CA 2HA2A 2Z5GA 2YZ7A 1PVVA 1IHUA 5C4MA 2F3UA 3EWAA 1EVEA 3VR6A 1ARZA 1G6OA 2M1ZA 3LUBA 1S4QA 2NSJA 4P7JA 4UM7A 4YUZA 5I3CA 4CCWA 5FHRA 1Y6GA 2J3MA 1VSQA 5K4HA 5FA5A 2GCPA 3O75A 1BVYF 3R77A 1GYPA 3G9TA 4FI3F 2AQKA 1NOIA 5AHWA 1RI5A 4HVAA 5L8VA 5DXFA 1FQKA 4UMEA 5LZ4A 3GZ4A 5F7XA 4LOLA 4C4AA 3HGMA 3TTXA 5JAMA 3RADC 3Q5EA 1YHZA 2EC5A 3OSZA 1I2DA 2UZ0A 4R5HA 4QSHA 2WIBA 3G68A 3RIMA 1ILEA 1DXQA 4L51A 5FWXB 5FOTA 3COVA 5MN5A 3KV3O 1DO8A 3E9DA 4DUZB 3G6WA 1G41A 4B76A 4K03A 2B21A 3SYRA 1CZNA 5EYPB 5T3UA 3EEIA 3VU8A 3AF5A 3U16A 4S12A 1MQ9A 5MF6A 3ZK8A 2F1KA 3HHEA 2ZJBA 3IERA 3KVYA 4Z1MA 2FPRA 3PX3A 3PLRA 1P1HA 5K6RA 3IESA 4HN2A 4AN4A 1NURA 3G89A 4DGQA 2Z6QA 1SPBS 4QUGA 2OCIA 1H23A 3A3YA 4R69A 2I7DA 5IBQA 3V8MA 3DKPA 2X8LA 3S2ZA 3KM0A 3VAAA 2ZIZA 4KXFB 1KKMA 3ZVNA 2A33A 3SZOA 3DBLA 2B30A 1W5TA 1XMIA 1VJ1A 3INGA 4FOPA 1OV4A 2IYYA 3F3MA 3TDKA 1DAKA 2ZWAA 1KI1A 2A9RA 2EWMA 3MYYA 4HSGA 4LV6A 2W2KA 3GLIA 4IFIA 3FNBA 4O2AF 1ZXLA 2G76A 3E48A 2SKDA 3L7LA 3CZ5A 3EARA 5DZSA 5EERA 3W1WA 3ROKA 3EB9A 1CEQA 1G7TA 3I04A 4U02A 3T7EA 4DADA 4MVJE 2H2GA 5KB3A 2FHPA 3IRUA 2HUNA 3BE8A 2QLBA 4W5OA 5F9MA 8LDHA 1KI4A 1NNUA 5BUCA 1PL7A 2EBWA 4ILEA 4GX2A 5ECWA 1ONNA 4BJ1A 2JIPA 4L6AA 2VWQA 1Y4SA 4QAQA 5GINE 2P3SA 5TR9A 1BKSB 4KGZA 2OESA 3F1LA 5CJPA 3WVNA 1ZGZA 4IIJA 1N75A 4OHWA 5K6TA 3FNRA 3RK0A 4HF7A 3LPNA 3LX8A 3WGZA 3RROA 4X65B 2GCEA 5TGDA 4E07A 1QG2A 4A0QA 1OSNA 2QUAA 3K0CA 1Y5IA 2DQKA 5LZ7A 3QKWA 2ES4A 5LC1A 2VJPA 1ZNYA 2AJ8A 2H52A 3ZCUA 1Y8RA 2L42A 2HDHA 4O4HF 3HKCB 4Z99A 2JLWA 4HDMB 2D54A 1KAQA 4ITRC 5EUMA 3E27A 3GMTA 4FUTA 5AOAA 3R7NA 4AY5A 5HGXA 5C53B 1YQQA 1LC3A 1LK0A 4WX2B 5IAJA 1EX6A 2COKA 3GRPA 5F23A 3F6SA 3G2LA 3QY9A 4R3UC 1H9AA 2O2YA 1CG6A 4RV4A 3AW9A 3G2MA 1RWQA 3B1YA 3GAZA 3LY8A 3IGFA 2I3BA 2BMJA 4HEJA 4IQ8A 4WW0A 3M3PA 5A05A 1AKYA 5ALIA 2B4AA 1AKVA 1Z38A 4O2AB 1FZTA 1GPKA 3F3SA 1I4DD 4YBZA 3DO5A 3Q7RA 4MYSA 2YDXA 3RRNA 5AI0A 4BS9A 4QYWA 3BHIA 3MM4A 2IE8A 1M6WA 4AO6A 4G65A 2FN7A 1H6CA 2FKAA 5E6SB 4EJMA 4OHFA 1XVTA 1BEZA 3T5BA 2IZ5A 2GFIA 1LEHA 3NHYA 3FBGA 4V0MA 3TWOA 3T41A 3ND8A 2WV9A 1IFXA 4TLAA 2VC2B 1NSFA 1W73A 2BHNA 2JFVA 3PGMA 3R3VA 3BB3A 2NZXA 1NWHA 2VA9A 3KR1A 2WTNA 3PS9A 3RYCA 1ULAA 4WUTA 5AUQA 1LVGA 1XUOA 1YFLA 2IBTA 4QUAA 4UTOA 1NQUA 2I4LA 4IV0A 3DMGA 3VO2A 3WDKA 2R8XA 3BK2A 5CTAA 1JQAA 4ARZB 1Y8ZA 2HV8A 4TRNA 3GJ7A 1PGPA 4YAKA 3JQ8B 3IBSA 2CK3D 2ZYHA 1S3GA 2KE5A 3KEMA 3NHUA 4GR4A 3B5IA 1JB9A 2LZ0A 5AKZA 3EVGA 1MOQA 2ZFUA 5EZ5A 3TD9A 3AERB 1P0QA 4LISA 3OO1A 3RJ5A 5FLXA 5EXPA 1JFLA 1LLQA 1WHSA 3V4PB 3K2QA 1GPYA 4WD3A 4ZRDA 1N3YA 4TYYA 3QHPA 3U3DA 1WDWB 1FYEA 1A4IA 3AF1A 3IBCA 1PWYE 4I8DA 3CWQA 4B48A 3U6KA 2DWCA 1GZ4A 2BF4A 1Y98A 1RNLA 5TX7A 1BW9B 3O26A