4LWQA

Crystal structure of native peptidyl t-rna hydrolase from acinetobacter baumannii at 1.38a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
GSHMSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.38A resolution
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 64
structure length 196
sequence length 196
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4lwqA00
4JWKA 4FNOA 5IMBA 2PTHA 4QT4A 1RYMA 3KJZA 4P7BA 3V2IA 4ERXA 4DHWA 4JC4A 3OFVA 4OLJA 4JX9A 4QAJA 3P2JA 4QBKA 4Z86A 5IVPA 2LGJA 1RYBA 3TD2A 4YLYA 4QD3A 5B6JA 3TCNA 3TD6A 4DJJA 4JY7A 5IKEA 4FOTA 2Z2JA 1RYNA 3TCKA 2MJLA 2JRCA 5EKTA 4HOYA 2Z2KA 3NEAA 4IKOA 4LWQA 3KK0A 4FOPA 3VJRA 2Z2IA 4FYJA 4ZXPA 2NAFA
chains in the Genus database with same CATH superfamily
3OQHA 1POWA 2VT7A 3QLVA 1G20A 1TYAE 3A6GA 1Y5MA 2B82A 5EHNA 2ZRMA 2ZI7A 4QXMA 2H2GA 4U6QA 2XR1A 4PLPA 4UEJA 1Z4PX 1S8FA 3OF3A 5IUKC 4MUMA 1E1CA 4OMFG 3T0IA 5C1DA 1R0XA 3HN6A 4QDTA 4R2MA 4FCWA 5D86A 4EHKA 1SB8A 4UDXX 4JLAA 1XYGA 2BI8A 5CM9C 1VDMA 2OTCA 4OU4A 1EX6A 2R97A 1X1EA 2NV0A 2BHRA 3EYAA 3H4IA 2VAPA 2UVPB 5I7EA 5FPQA 5DNCA 3BGOS 2CBXA 2D2XA 5HJ7A 3TW8B 5REQB 1P1RA 4FOOA 3DAOA 3IIKA 1DC6A 2J4DA 1VG8A 2JAWA 2H5EA 2JNWA 2PS1A 3NFRA 3QU4A 4GI5A 4GPTA 4NF2A 4NS4A 5SYNA 1G41A 2ZATA 1M0WA 4EVRA 1BGXT 1KOJA 5KOHA 5EZ6B 3VHXB 2VQEB 4HB2A 1U65A 4OQ4A 4QJ5A 4X1IB 5EE0A 3T3GA 2CXUA 3D3KA 4WFQA 4IDCA 3GT4A 2WUWE 1HZJA 1E2QA 3HSKA 3KR0A 4LVUA 4C4OA 1NYRA 4BZQA 1ZN2A 2AC4A 4JBLA 3F5QA 1GQOA 3LXMA 1D5CA 4LXUA 1AKNA 4B2IA 5KTNA 4YHBA 3DVRX 3NXSA 1HK7A 1P73A 3F49S 5D3QA 4OHOA 3UOAB 4G4GA 3CRZA 4I6JA 3FI9A 2YOGA 3NVAA 3BYZA 4M1QA 5H4GA 3NGLA 4PZZA 2HJSA 2I1WA 2NYVA 2VK8A 2P0EA 2ADOA 1FBTA 1QG2A 2ON6A 4X8LA 1YULA 1W5AA 1ZXLA 3Q10A 4QELA 2I03A 4L8LA 1WDLA 4Y2PA 1NRXA 2R96A 2PNJA 4C5CA 1PEKE 4EKEA 4MKHA 1QZ3A 1JG4A 2B9EA 1WNFA 4ZAFA 3E82A 5FR2A 1ODLA 3ZCSA 3DVQX 3ZGZA 3UUFA 2XADA 1JLSA 3GUHA 3BMQB 2VNIA 4MR7A 1TD1A 3CFYA 4LWPA 3WNQA 2YXBA 3EG9A 3E22B 1KY5A 3EMDA 3SR0A 3ZOZA 1XRJA 5TEVA 3ZDXB 4D9GA 5KREA 3OI7A 1YZUA 3OTHA 3GEHA 1AM4D 3OETA 4I5DA 1HDRA 2CJPA 2Q1WA 4IVPA 3MB5A 4OJTA 2PZKA 5DH9A 5TPZA 5KCZA 3VO9A 4PWZA 2UYCA 2A5JA 5BSEA 5CLFA 4NG4A 3RASA 2YYAA 4M21A 3FNIA 4M89A 4AX4A 1RTKA 1WUHS 4TMZA 1PQYA 1Z75A 2COEA 2XDQA 4D0LB 2PWAA 3B12A 3A4IA 2VJBA 2VDLB 3UTDA 3CB4A 2IYNA 1DKLA 2P4SA 3B8HA 3DV2A 4IY1A 1T5OA 2FVXA 4R1UA 2AL7A 5DSXA 1IMOA 5F73A 3ZE8A 4WY2A 1Y1QA 2ZTLA 1M10A 4X8MA 4QNMA 1NW9B 1YC5A 3BE6A 1RLMA 3NLLA 4E6PA 1KEEA 1W36D 5B2EA 3ZWPA 1W88A 3GJYA 1VKRA 3MILA 4DJTA 2WNIA 4X84A 3WQQA 4Z6KA 2I66A 2DOKA 1W9HA 4REOA 2GLXA 3D7LA 5CDTA 3G5MA 4Q1BA 5D7NA 1RI5A 5TX7A 2GCOB 4QLAA 3IA2A 1E9SA 3TS1A 2OKCA 3AR9A 1ZOLA 4TWBA 3RNLA 1TUGA 5FBQB 3W2HA 4Q3DA 5EKSA 2H1RA 3KPYA 3OH8A 1T4DA 1CQIB 2I99A 2AYYA 3NHLA 4GOOD 4L75A 5AW5A 4H27A 1GZ7A 2UV8A 3EZLA 3N59A 1KY3A 3GLSA 5JMWA 1JFFB 2ZB8A 4KO3S 4RIGA 1E18A 1G38A 3R5XA 2MU1A 3M1IA 4HNTA 1WOMA 3QYFA 1CY6A 3HJRA 3FWHA 4HYQA 4QQ8A 4DBVO 3PUYA 2OHFA 4ESHA 3AEYA 2R5WA 3G68A 1H2EA 2EFJA 3BL8A 2ZS7A 1KKUA 2OHGA 1L2TA 1PL6A 1Z06A 3AM4A 3OZRA 2B7LA 4KXNA 1BE6A 3HPRA 1SD2A 4A7PA 1YXMA 2JIRA 4MQ5A 4M8NE 1MDBA 1W5TA 4Q19A 4LK2A 2VLIA 5EPEA 1VCMA 2X0FA 5MGNA 4DJAA 4PBTA 3HQ4O 1D1TA 1F17A 1SXJB 3BBPA 4G1CA 3UV3A 2CXNA 1IAVA 1PN3A 2D0PB 3LS2A 4B3TB 1FMJA 1JI0A 5ED0A 2COUA 4GBMA 3GLGA 2G0NA 2I3AA 4RENA 4B73A 5ICSA 5BSRA 2J5QA 1UDWA 3AIOA 2R47A 3VKHA 3RHZA 3WLQA 5LSAA 2P69A 3QVOA 2H1IA 2GPTA 4XD7A 3UJ7A 1TKRA 2J0VA 3A9UA 2Z9DA 4L5AA 4KQ9A 3CVWA 4CMEC 3HVIA 4PYKA 4ER0A 1WXWA 4A6PA 1FTYA 1N0IA 2E55A 2CV2A 2AVNA 1T5HX 2D2VA 1YZYA 5BUQA 2P6MA 4M88A 4UU8A 5A5GA 2HRQA 4WESB 1IOWA 2ZJ3A 4ECAA 3UM9A 3ZY4A 3UGKA 4B3JA 1HNWB 1N4DA 2C9BA 5DV9A 4ZC1A 3VRHA 3TG2A 4LF5B 4PO8A 1U5AA 4X20A 1R6XA 2V7TA 4YP1A 4LYAA 4FM9A 3JPYA 4DPMA 4TZ0A 5IVDA 1OX4B 3MCTA 4JR0A 2PT7A 5IBRA 4JYAB 2PAAA 1G2QA 5FWXB 2QM3A 2WVAA 3AM3A 3NHFA 3P5BA 3ZNPA 4B8ZA 4E03A 3GDHA 3KQTA 4RTSA 3AV0B 3P9XA 4JWKA 3SDSA 5B3AA 3MF4A 4RH0A 1T6ZA 5JH7F 4N0DA 5DLPA 3JALB 2AHRA 3BORA 3T0FA 3O21A 1YQTA 4D9BA 1FDUA 4B80A 4GOKA 2GN1A 5HHTA 4OA5A 2DBQA 2IGTA 4YJ3F 1CJCA 5A0FA 4P7KA 3WSVA 2VJNA 4ZYYA 1WBJB 1G1AA 2JAOA 3SHQA 3KLBA 4TKZA 1LS6A 5BN5B 3PDWA 2YV5A 1G21E 3EUAA 4IIHA 3THYA 2JZOA 3RC7A 4PPGA 2FR8C 2B94A 4PFQA 1GADO 1L4UA 1AMNA 3PUKA 3AF1A 4HXFB 1R5NA 4OMDA 3PB3A 2QY9A 2BRUA 1ZQ9A 3EY4A 1ZMBA 5HMLA 3HMQA 2ZYDA 10MHA 4DV0B 2VHQA 2GBLC 4P82A 2A9JA 4QXQA 2NZUG 1XTQA 1KPIA 2ORED 3CRQA 4A9AA 4E88A 2F8SA 4YV1A 1NUSA 2EF1A 4Y1EA 1ISIA 3ETDA 3JW8A 4PIVA 3SC2A 4JI0B 4OG2A 4WLUA 2BRUC 4IQFA 4P3YA 3VR6A 1U4OA 1RHQA 3PR1A 1UXHA 3RV3A 2VJOA 1TQ4A 3C3PA 3U5TA 1DINA 4MYDA 4TV9B 2IYPA 4QVKA 1QFZA 4LC0A 3AHFA 3FNGA 1NVVQ 4QTZA 1I8TA 3BWCA 5IJ0A 1XCBA 2VTBB 4GZ5A 2BMWA 3T7RA 2YY5A 1LZKA 3LY9A 3LE8A 2OHHA 1C9NA 1YZLA 4ARVA 1C30B 1R0RE 1P9OA 2H4YA 3MWKA 1S3SA 4AN0A 4FNAA 4KFTA 1FSSA 1KIFA 5DPMA 3UKDA 1JZTA 3TM5A 1DO2A 4EX7A 1AS0A 3EZNA 4HLUC 5AVJA 1GG2A 4OQEA 3VR6H 3VHQA 4DUGD 4P4LA 5LZ8A 2G88A 1FX0A 5HA5A 3L0CA 2VP6A 3GZNA 3MUOA 4HAWA 2H00A 3NOOA 1B15A 2QDXA 3AESB 3PF9A 3P4UA 2I80A 4LOJA 1W73A 3L18A 3G6WA 3LUPA 4KP7A 1CEEA 4LCEA 2H8GA 3JVEA 1VHWA 2YRWA 1O6GA 2H2DA 4XX0A 1R74A 5IDVA 1P4SA 2GAIA 4EL0A 2XEDA 2BISA 4A0HA 2D0IA 2MSCB 2PZBA 3L92A 5KCMA 4KTTE 3QV1A 5BN5A 2PJUA 2ATVA 2NNLD 4JROA 3GIDA 4WY8A 4X6UA 3WNCA 2QRPA 1U4SA 5DI9A 3OIUA 2H2AA 1UWVA 3U4QB 1R0KA 1TQDA 1Y8RB 2J3LA 3ZCVA 4EDFA 4WBSA 3BMXA 1YZTA 4MP6A 4DLLA 3KQNA 3E4DA 1G8GA 4EY7A 4LRQA 4IF6A 4Q37A 4UCXA 2IYAA 2HIHA 2BEVA 4FXPA 2X9QA 2XDYA 5KHAA 3C6MA 3H2GA 1T9ZA 3K16A 3FY4A 1WVGA 3MK31 4R2IA 3TR0A 3U13A 3W3AA 5LQAA 1E7MA 4Y0NA 3VH4A 1YS9A 3N87A 3ODGA 5ER6A 1GIAA 4YUYA 4XQCA 1CQPA 2VJLA 2AH5A 2JD2A 2XH8A 3G3EA 3I2IA 4ZQGA 2R60A 4P0TA 1TI7A 5HJ2A 3PFNA 4EJSB 1YHYA 3QLUA 1TJNA 2Q8QA 1GPLA 4Y6OA 1NFFA 3FYUA 3D7MA 4YROA 3IQIX 2NV2B 3KV1A 3BTSA 1A96A 1X94A 3UHFA 4UMEA 3TIGA 5IJ0B 4ZQBA 2DYKA 4JASB 4V38A 1MENA 1R4NA 2W6CX 1SHLA 5K20A 4U6SA 2M32A 2VYVD 3QMMA 2WAYA 8MHTA 5FL7D 3TVTA 3UWDA 1HY3A 1D6NA 1NP6A 1XMQB 1NY5A 2ODPA 1LWNA 3C8ZA 1M2VA 1XZFA 3OFND 4NBRA 4TKVB 5JZVA 2WZBA 5IXSA 1XDWA 3S1AB 3VSBA 1YDFA 4R8LA 1IHDA 2VUHB 2JIOA 1ZRSA 5CVEA 1GU1A 4HF7A 3UW3A 4EVSA 3VQTA 4MVYA 1HDZA 4PYIA 4EYKA 4L50A 1IWPB 1N33B 2IDMA 1PJCA 3LUFA 3UO8B 2SCUB 1XTUA 3OBIA 4V24A 4ARCA 2WYUA 2ODNA 2ZLBA 1KEKA 3FCSB 3KC2A 5GONF 3CXUA 2VJMA 4G97A 5K45A 3CUSA 1EX1A 1CVIA 4ZZ3A 1Z7WA 2FDRA 3WGKA 5C5CA 1PBNA 3HABA 3QMVA 3O2SB 5EZSA 2AXNA 4MVWA 4OH7A 2AJCA 3I83A 2ETVA 4GGPA 3ZV3A 3TI7A 5J5VA 1NFQA 1B8VA 4EUFA 5AOCA 4BNGA 5CVTA 2I6FA 1YZ3A 4WLFA 3MWYW 1K75A 1GQ2A 3ZUPA 4WJKB 1RXWA 3QHPA 4Y6LA 2XCLA 3JQAD 1ZD3A 1NPTO 4EYGA 4MA0A 5BNIA 3I01M 3MLEA 2LNDA 4WT7A 2B7CA 1NR7A 2V6IA 2F00A 4N5LA 2GKSA 4U02A 1PJTA 5AHWA 3IQDB 3X1JA 5L3QA 1S4QA 1G3IA 1PJQA 3RSGA 4PTZA 1HOXA 4M0DA 1FP6A 1KSFX 3B78A 3WL8A 4ZD6A 1TVMA 5IWCA 1F6DA 4XSHA 4UOZA 4G0VA 1MC8A 2IODA 3GPLA 3DPUA 3M2PA 2X8JB 1KO1A 4LHWA 4CTJA 4ENTA 5HPYB 1AHHA 3F2VA 3MFYA 3S2SA 5KWSA 1WRBA 2HW8A 2JHGA 1U7ZA 4FONA 2O0HA 3FJOA 1RKXA 1ZVJA 3MTEA 4PU0A 1DV2A 1USWA 5B53A 3TBFA 1JMVA 2OO7A 3T12A 2JEOA 2XBUA 3QPAA 1LDNA 1PYOA 2JA1A 4MRNA 3VZCA 4JU9A 3FFBA 1R4NB 2PA3A 3O4VA 5C1BA 5HS4A 2NIPA 3R6WA 3ITKA 2NG1A 3PKZA 2ZWAA 2VBIA 2P35A 1L5YA 3BICA 3W9SA 3WRXC 4WW0A 1H4QA 4CEJA 1SKYE 1G5QA 3TW8A 3BH7A 3WLAA 2JFFA 3LA8A 4FE3A 4ZOAA 4P81A 4D9IA 5JTTA 2D2IA 1W8DA 1X3SA 1BX0A 1JJBA 1YI0A 5J40A 1U3UA 3GVHA 4NQRA 5EQTA 1VKOA 4LI0A 1Q22A 5JJIA 1XOIA 3BTUA 2IH4A 1OUMA 3KZKA 1T5DX 2OHVA 3VC7A 3NXKA 4Q7LA 4QICA 1H3EA 2DBZA 3NV7A 1DL5A 2HRCA 2OZLA 5F3RA 3SKVA 4B6GA 5IFLA 2WT9A 1IULA 2PUDA 2Q9BA 3KO8A 3DZ8A 3WWCA 4LDZA 1V3QE 3WA6A 1J8MF 4MJXA 3AR2A 4XQGA 3UXEA 1W5BA 4JDUA 1PT9A 3M6WA 4RIIA 2C4VA 2OMEA 1EQ2A 1UMBB 1UZUA 2PYDA 1IY0A 3DLCA 2ZULA 5DBOA 5TB5A 1LU9A 1ZGCA 4MGYR 3MOIA 3IKJA 4TZKA 1QNFA 1GA6A 3AZPA 4GX5A 4YMWA 1B6SA 2FPPB 3L6CA 4II2A 4ZRDA 3JQQA 4KYVA 5AJHA 4M36A 3K9LA 2HLDD 1QHGA 1O96A 1ZOOA 1YZVA 3IOEA 3GR6A 4KMRA 1KOLA 1ZNWA 3CLUC 1Z7EA 3VC3A 1EBUA 4JYMA 1I3OA 3DWIA 1A7KA 5F9MA 1Z5GA 4YUAA 1NQOA 5JAZA 2YS6A 4MVJM 3ZDEA 2O0KA 1P0PA 1SCDA 1X2BA 1XMSA 2ZPUA 1EVYA 5CLHA 4JLMA 3RRFA 1YOBA 5LMCA 4TWIA 3WLSA 4E4RA 1D6JA 5BT8A 3IAS1 4MIKA 2QR5A 3JZFA 3M6MD 4UQOA 5CLLA 1SUAA 5BPHA 2CUZA 2YJ3A 4RW0A 4QFDA 4ZVPA 1ST3A 4D4KA 3U81A 5BORA 2ZRHA 1UM9A 4TTQA 4YRFA 1W59A 1X8KA 2A92A 4QODA 4RESA 1XJQA 2Z4RA 1A72A 2XMGA 4NMHA 2VHVA 3WMXA 1PLJA 3NHJA 3ZU3A 5IXYA 1MO4A 3CJQA 3HKDA 1EAYA 4UVDA 4BATA 1Z18A 1QTQA 3D3EA 3TLZA 3MOGA 1DIRA 1OD6A 1RRMA 2W6ZA 2X2FA 2FPMA 2FN4A 5KYVA 3O8RA 5CFMA 1Q1GA 1L5ZA 2R7AA 4HGYA 4JQSA 4YFVA 5HRUA 4WWHA 4HGPA 1J70A 1DOAA 2VRWA 3PQCA 4B2LA 3I4FA 1JFSA 3K0AB 1AV7A 2J0EA 2DHEA 2OUIA 2WDZA 4C6SA 1MLDA 1UPBA 1KMCA 1I3LA 1PFGA 4R31A 5EFOA 2DBRA 1F6WA 1MAAA 1T9DA 1EX7A 2QORA 2JLBA 1GPMA 1PVVA 1DIHA 1SU7A 1WDKA 2JD0A 2Y4NA 3BIFA 3DR3A 3E9EA 1OXTA 1ZUNA 2GCEA 4R1LA 4LGYA 4C07A 2IYZA 3GW8A 4MTLA 2B6HA 4WXHA 5K7SA 2QD4A 2QX6A 4HQRA 1DC3A 3JWHA 5AUNB 5E7JA 1GL3A 1QHEA 2HB6A 3PYMA 2V6FA 2C5BA 5AI4A 3ZYCA 3DO8A 3Q7QA 3I1YA 2ZUUA 4UUPA 5EJAA 4JC5A 1G1MA 2G04A 4EG4A 1E20A 1OPRA 3FCXA 4NZPA 2I2BA 2DETA 1BCSA 5DM70 3F4LA 1WDMA 5CH3A 1U98A 3ZTTA 1F0KA 5HGJA 2OL4A 4JU8A 4RPCA 2QGFA 1V47A 1GZ6A 3IIIA 2YJGA 4FGSA 4M22A 2ZWIA 2WHPA 4IOKA 5DNVA 3WK7A 1KQFA 1E62A 5DMHA 1QHHA 4ER5A 3SQLA 5E4FA 2X6QA 4UTNA 4W6ZA 4DNXA 2BE7A 3D1JA 3N8DA 4ZN6A 4EYOA 3VU1A 3K8QA 1NWHA 4IRUB 4B3HA 4CF5A 1YUMA 2YHUA 4R9UC 3HJCA 1JYEA 1IATA 2WLTA 4BNDA 3ZZ0A 5FI0B 3JX9A 4EA8A 1GGKA 2AYZA 3KXIA 3RKUA 4QG3A 4M54A 1P19A 1E3WB 2VP9A 2PZJA 3O4GA 4FBLA 4HQ6A 2XTNA 4IFBA 4R2KA 2PSSA 4FHDA 1E2KA 2JFOA 3X2FA 3H1GA 5L95A 2CZCA 1JEYB 1G16A 3FUWA 4E5KA 5HKKA 4ILEA 3ZS9A 4NYMQ 1K7FB 1VL5A 3KZNA 3TDNA 3HEBA 4PG4A 4Q3AA 1QJCA 2HPAA 3PVCA 1HQCA 3I52A 4QECA 4LHVA 2J0UA 2DQZA 2XOEA 2ZIAA 4GF5A 5ALYA 4RTNA 1M0SA 3VO2A 4W63A 4E4TA 3CG4A 1ZKMA 2QTLA 2LPMA 2QN2A 3LGSA 1TD9A 3HV0A 3MSXA 3T7JA 2GYVA 3ZTYA 3DLIA 1H5NA 3K4PA 4CFYA 4F71A 1SHZA 1YRBA 1YBMA 3FWYA 3FVVA 1OH8A 3VDXA 1OROA 3SMVA 3LMKA 4EW6A 1NW4A 4Z0NA 5E7QA 2G1PA 4PS1A 1AURA 2EU8A 1K6JA 1P74A 3UWPA 2Z1DA 4JJEA 1M5RA 1XK6A 2ZSEA 1NUPA 3AUTA 3AVQA 2H4FA 3B3FA 4G5OA 1C9KA 3QYPA 4RK6A 5F5LA 1UPCA 2DX7A 4P4SA 1P2UA 1R8SA 1N0WA 4OAOA 1ZVKA 2GHIA 3KB1A 3KP1A 2J5RA 2GEFA 1HL7A 1NRWA 2AFHA 3BMOB 1N8SA 1UBEA 3D4IA 1OYOA 1M3SA 3EVEA 1NBEA 3MS4A 5K3AA 3D4BA 1EH5A 3C7KA 1P5HA 2CNKA 3FHCB 2XMZA 5K8IA 2WV9A 5HBGA 3DUWA 1H9AA 3GN1A 4IQ0A 2NZYA 2J9FB 2CVFA 2PU7A 4IXDA 4JGGA 5DBHX 5JJLA 3ZHSA 1T5TA 3BRQA 1S3FA 3FWKA 4U2FA 2FY8A 1X1RA 3DOEA 3U7QA 3ZDCA 3FDFA 4HWOA 4OQMA 4MGEA 2BF4A 4NZ9A 3BL5A 2EWWA 5KNDD 2R7LA 1N4AA 3MXOA 4LHSA 1QIMA 9ABPA 2VDNB 2A7QA 3AWDA 4B45A 1FTQA 2Y92A 4MVJI 4QU5A 2RBKA 4JVSB 2O1EA 2Z3ZA 5BQ3A 5J2UB 1U7TA 4ZOLA 2EBHX 5EIBC 5I7OA 2EYUA 1GITA 2AOVA 2D1YA 2ORIA 4B85A 4I4LA 3RVKA 1DJPA 3MA0A 2F1IA 1KAGA 1U3WA 2I6TA 2PCJA 2YCBA 2YUIA 2ZDHA 1HORA 2JFVA 3BXHA 2B5WA 1JFVA 2YOHA 1VP9A 4HAOA 3BQ9A 2W6NA 2XIJA 3PEFA 4HGRA 3BZWA 4PRYA 5AKZA 4QYWA 2GS9A 3K96A 3QUAA 2FG5A 5DYIA 3ILYA 1S8AA 4E4YA 3PEEA 2IGBA 3EDMA 2F43A 3ITNA 4OBBA 4Z7NB 1V2HE 1GRQA 1MO5A 5WRFA 2JGJA 4QTUB 4RGVA 3RH0A 3LUAA 2MYTA 2W8BA 2XHZA 1NI4B 1QG4A 1P61B 2GCIA 4J2OA 1P4HA 2VHZA 3ETGA 4L0CA 1SXGA 5GJCA 5A5DA 4HUQA 2MSDB 4Q4JA 2FPRA 1P2GA 1E3JA 1F8YA 1QRTA 1HDYA 1HQYE 3KLPX 3PQ4A 4KZKA 1R6BX 1KNQA 4X54A 3VPXA 2AR9A 1QKJA 3GCZA 4CRWB 4DIEA 2C8KA 5GIOE 1L7VC 1Q1NA 3TNYA 1FP2A 4C04A 5KHLB 2I0FA 4IH4A 4QM7A 1Y3FE 4QOJA 3R77A 4V0QA 1Z0ZA 4FPXA 4ZHQA 4BUZA 4LF7B 3IEIA 1INLA 3S4YA 4DMGA 3WAGA 2GBLA 1J2TA 2PVCA 2FFRA 4FFDA 5KX5F 5ITZA 3KOOA 4UATA 1H5QA 2HF9A 4ZJYA 3A3PA 4NU5A 4BP1A 2I91A 5FNVA 1W8IA 3JAWA 3G88A 2PGIA 2VP2A 1L4KA 3ENNA 4CTOA 2R1TB 3AHCA 3VJMA 1D4ZA 4RORA 4R98A 3N2GB 5E9JA 5C34B 5JZBA 1YBVA 1EVKA 1F38A 2C5LA 4QARA 1ABEA 4TXHA 3WQSB 2O54A 1FP1D 2YR0A 4A10A 2YFYA 2P2CA 1A97A 2QN8A 4KUEA 1N6KA 4NX2A 5HFAA 4EGFA 3S1SA 3C1AA 3PC6A 1IFXA 4TYYA 3IVMA 2REOA 5JATA 1E3DA 2CHGA 2R5NA 2YHIB 3OCYA 1IEQA 1QO9A 2ZGVA 3D0QA 4LJ4A 4MRSA 4Q16A 4B6JA 5LJIA 3TRFA 4RKEA 4K7JA 4KIWA 1NJ8A 5JBIA 4B7AA 2CUTA 3NWEA 3LQQA 4PG8A 2QVGA 3GLFB 3F7MA 3H3FA 2N0SA 3PA8A 2AIRA 3I34X 2BM9A 2F43B 3B52X 4LXQA 4HBZA 5H68A 1X80B 2ISSD 4XDHA 2GEJA 1DEAA 3NP7A 1OHHD 3FRJA 5AR1A 4GG1A 1JEAA 3ET4A 1AKVA 1YVUA 3AU8A 3EAFA 1JPUA 5HOQA 2HL6A 4XJVA 3SYKA 4C76A 3L01A 4IICA 3U39A 1STOA 1ZNZA 2GM9A 4O4HF 4LY6A 3P2IA 3EJWA 2HLPA 4ZZ0A 1P29A 3IPCA 2WFAA 4CL2A 3RSHA 1IDN1 1AGPA 1HFEL 3K2IA 4BGIA 3N05A 4CQMD 4AP5A 4D8UA 3S0JA 2AFHB 2TRSB 5D3ZA 3HBMA 4ITUA 3I5XA 1U8UA 1JEDA 2Q0XA 4XIFA 3RUPA 4EQZA 4KFCA 5LKAA 4ENQA 4TRJA 3E58A 4PYMA 4FQ5A 3QIVA 1M7BA 3CU5A 5F98A 1FFHA 4AP6A 3PFWO 1VA5A 3ZHXA 3O9ZA 3V7UA 3AXSA 4COKA 5IM4A 4CNQA 2VT6A 2PQ6A 3M1AA 1XQ1A 1L3IA 3LHKA 5CJ2A 1XRLA 2C5EA 4QRIA 4AZ3A 4PYNA 4ZYZA 1XLWA 2R1TA 2P4UA 3LQKA 2QSJA 3MCUA 4JP2A 4UHKA 5B1DA 3VTZA 3RRYA 2IS1A 3MSCA 2A1IA 1A82A 1JP7A 1O6CA 5JXWA 3HWWA 2ODEA 4BWGA 5M2QA 3LFTA 4PG7A 1HT3A 3JYOA 4RKRA 5B58C 4PW0A 4RGYA 2KS6A 2PLWA 2I6UA 3FKSD 4WE3A 1WB5A 5IF3A 1AGXA 3OT1B 1O87A 5DI3B 2ZG6A 4ZV7A 4E09A 1QZZA 4XYGA 4ZVMA 1O9HA 3PUIA 3ZIAA 2ZBEA 4EB8A 1XUOA 3GLGB 2GXUA 1TIKA 1SC3A 3HU3A 4QDJA 1MRSA 5DBEX 1SAYA 5DHTA 3SK0A 3KKNA 1CDOA 1YB1A 1ZIXA 2BH2A 1NJ6A 3LKBA 2QLJA 3PVZA 2IDJA 4M46A 3TAHA 3F78A 4A36A 2MYPA 2ZUCA 1GLNA 3E4CA 4Q1EA 3WY9A 4OAPA 1GRRA 3EW9A 3P27A 3LVBA 4DLYA 1Z82A 4F93B 3CURA 1ZLXA 3OOEA 4FGUA 1U0GA 2A8YA 3E23A 5DN9A 3EBOA 2NQ8A 5FO1A 2O5EA 4BP9A 1Q17A 1F7UA 3HDHA 2QN6A 4Y9TA 4WNIA 3PGLA 2YZGA 3MUFA 5ISMA 2QUJA 4O4JA 4EPRA 2WYHA 4HOYA 4U0KA 1EK6A 3CNLA 4CG1A 3JQAA 1JQBA 1N6IA 2WFLB 3I62A 3AVTA 2WWIA 1ZL0A 1WR8A 5EP3A 1GRCA 2O7SA 1NN5A 3MJTA 4DV4B 5HCNA 2CMFA 3EA0A 1E2BA 2IQIA 2YXEA 2FZ4A 1GL9B 5K8CA 1P75A 3FVTA 2XB8A 1GCAA 1OA0A 2YN0A 4EKYA 1B73A 4R83A 2VDRB 1ISRA 4DEVA 3KKOA 3RTAA 3LFUA 1NF3A 2ZTSA 2EKBA 2FKAA 1U1GA 2PJDA 2Z2YA 3N1UA 4HQNA 3OEEA 1LLDA 1Y3DE 3EQ2A 4RJIA 2X41A 4RBNA 5J4KA 3FYSA 5CEJA 1K98A 4ND2A 5SZKB 1A95A 2PQ0A 4MEBA 3ERCA 1CUCA 2F90A 1J9GA 3JSXA 4H7EA 3L5OA 5EZYA 4XOUA 3NZEA 1YZHA 4KN8A 4NZZA 4JXJA 1SPBS 2EERA 4IXMA 2J09A 4O8ZA 2L0XA 2R11A 3P0EA 5CT5A 1WXXA 2WVHA 1KMHB 1EINA 1DO0A 5I9LA 1ZHOA 4F9GA 1IQRA 1ID1A 1XZEA 5HCIA 1O54A 2OCIA 4INOA 3SG0A 5A4MS 4W6QA 4LF9B 4AURA 3FIUA 3VR4A 2OHIA 3ZWYA 1QGAA 3TUIC 3CGGA 5C8XA 2NVUB 1TMKA 5HJEA 3I12A 2HYIC 3UB2A 4P53A 2MR6A 1E2LA 1IM2A 1ESZA 2Q5CA 3VU8A 1A7UA 5C31A 1QGZA 2PKQP 3B2QA 4NG5A 5EWMA 2YINC 3CH7A 3EH2A 5BQFA 1NXVA 3U7FB 2R84A 1H2AS 1P0CA 3C3WA 3SXUA 3JZMA 3E0QA 2BEJA 5ALRA 4JA0A 4ZMSA 3Q4GA 2CL6X 5DLYA 4ZGWA 3WVNA 3K1AB 2CN1A 3DTVD 4D2IA 4DYHA 4FDVA 4KXQA 2QQEA 3NEYA 4PQRA 4PZDA 1A4XA 1I2CA 1PRYA 2WJHA 1CJMA 3KHSA 1G98A 4X41A 3UXHA 2NO5A 3HKDB 6LDHA 2ZIUB 3ZE6A 2ZBVA 1UC8A 5JJKA 1CULC 1AA9A 3C6BA 1P7YA 4M9XA 4GNRA 3ZHTA 1JU9A 4TLCA 1Z4IA 1FFYA 4M9UA 1X1QA 4GSKA 4GZ3A 3A9VA 3EG5A 3QBJA 4LPSA 5JAOA 3QUQA 2YJ6A 1KQNA 5I3CA 4NNPA 4BP3A 1DAHA 5CK4A 1GCOA 1FX1A 3N0RA 5E4YA 1FFEA 3IPYA 1I4OA 3IQFA 1FYXA 1XLVA 1MMFB 1EGHA 1H0KA 1UP4A 2PV7A 1M0TA 4IOLA 1YKGA 2BE9A 5I47A 4K6MA 2PZLA 4GLLA 4YAGA 3EZ7A 1XVUA 3ITDA 3WGIA 4MP3A 3HGQA 3CGWA 1YJ8A 2XWBF 3RTBA 2BFEB 2RHHA 3RT1A 4N01A 3GRCA 3WLKX 4D80A 1WX1A 4DTCA 4O08A 1JAXA 3JQ8B 4J94A 3FGZA 4H0FA 1JN0A 3UW1A 3QQPA 4D81A 5J2TB 1NVFA 1IG3A 1QOPB 1QZXA 4XB2A 3BIXA 1KEVA 3D0OA 4S2UA 5F35A 1K6IA 1V0JA 1VL1A 2FDCA 4WGFA 1QYIA 1F8GA 4KOEC 8ABPA 1S7CA 3U09A 1JAIA 1E3SA 1X8XA 3Q0IA 1QR6A 4A27A 3O4RA 2PSFA 5G4KB 2Q45A 1NQVA 4RMHA 4HD8A 5A3SA 5K3OA 2E49A 2HV9A 4NZNA 4PLTA 3IUJA 2DR2A 4ZOBA 3UMJA 2V7GA 3BMCA 3NAMA 3R3XA 5FOTA 4Z1MA 4ZO4A 3DMNA 2BZ1A 2PV0A 2VA9A 2VHCA 1E5QA 3DDSA 3ND5A 1TJ4A 1JMYA 2P90A 2XX3A 3GGSA 4JWTA 3M70A 1YA8A 4GKVA 4KU4A 4R6WA 3ZZUA 4XGRA 4EEZA 4N7JA 5JYDA 1TFUA 2WM3A 2XD9A 4DLBA 3KOXA 3LC0A 4Q34A 2H4HA 5D87A 2YVAA 5DCWA 3OJWA 3G2MA 3IA7A 2GX6A 4M1EA 4ZI7F 4DZRA 3B8EA 3FDIA 2IEBA 3HYSA 2ZI6A 3I8SA 16PKA 4N9WA 5TIIA 4QQRA 1IQ0A 3JYQA 2OV1A 2QNBA 4PNHA 4CNBA 3N2NA 1UKEA 3SVLA 1EKXA 1I9CA 3I09A 3LUJA 2GSWA 3JU3A 2ZRDA 4DCOA 3MHTA 2BL4A 3KSZO 3UTCA 1P7VA 2ZSDA 3KLMX 1SZDA 3NEJA 4LYHA 1ULZA 4G5QA 1VL6A 4AWBA 3WWZA 2CXTA 3QX7A 1NQWA 4EECA 1SMKA 4G1EB 4RO0A 3LA6A 4ZQHA 1VFPA 1Y1RA 3DAYA 2RH4A 3GCGA 4EIWA 4DCVA 2VHXA 1PUIA 1PL8A 2JGFA 2WTXA 3FPAA 2Z8XA 3LBHA 4JBHA 5JNWA 3WHKA 1LVGA 1ZU5A 4WKBA 1IY8A 2GJSA 2YWJA 5BMOA 2MJLA 3F90A 1GPWB 1EXMA 1G17A 3PTZA 4TWJA 5FEMA 4C0XA 2C1ZA 2BY4A 4BDTA 2A57A 2C9CA 1H6CA 1C8VB 2GA9A 4GMDA 4ICIA 4MV1A 4WZBE 3T8YA 3JTMA 4EY4A 2GOYA 2MYNA 1JQKA 3VM6A 1NM5A 4RFSA 5JLJA 1MR3F 4HNGA 5ALDA 3E61A 2DR0A 1FVOA 4MWEA 3IP6A 1YB5A 3BDAA 4R1MA 1LSUA 2Y1KA 1NUHA 5EGSA 4AN1A 1L5VA 3DFKA 1QPZA 4NAUA 3OIWA 4AG5A 1NJFA 1XRNA 3RIYA 5BXQC 1EGAA 4RH1A 4YV2A 3ZQ4A 2VOEA 2TECE 5KTRA 3NNDA 3HE3A 2O8NA 3OEYA 1X8JA 2MMCA 2BFDA 3BD9A 1LBEA 3NM5A 3Q8WA 4GZMA 1OH7A 1P33A 5A5VA 5B58T 1E9CA 1UBMS 1QVZA 3T1TA 4MS4A 2B69A 1Y1SA 2QD3A 4I55A 4F91B 2B4KA 3BD6A 3JCZA 1ABBA 1S4MA 4X1KA 2Q3HA 5BN1A 4OVKA 3BFJA 3F7OA 4AY6A 1ODKA 1VJTA 2QVXX 1GG5A 5JRZA 2QQGA 2Q6LA 4URZR 2GKGA 2DB3A 1E99A 3EXHC 4RZQA 4ZXFA 3WGNA 1Y4SA 4FILA 2AD5A 5A3QA 4HEQA 1H23A 2B4TO 1OIVA 3WWEA 5BQXA 3TK1A 4CCAA 4I2NA 3DJYA 3VU9B 2C99A 1IOLA 3ADDA 4DMLA 4TWAA 1JHOA 3HXQA 1GFZA 2F3SA 3BXGA 2B21A 3WKEA 2D74A 2DTXA 3CKLA 2QMOA 3DE0X 3EXHB 3H4TA 1E8MA 4CEIB 4D9JA 5EP4A 1K3TA 2G28A 3PKJA 4LV6A 3H8SA 1A5BB 1PWYE 2QZPA 2EYQA 1LBSA 3CNHA 1YT5A 1FMCA 1Z5VA 5HUHA 3DHEA 4PLHA 1KJ9A 1P2FA 1ZXXA 4J9UE 4X1YB 1J2YA 1SWVA 3BFKA 3IAHA 4GOMD 4NPCA 5P8WA 3R44A 1YQXA 1NKTA 3KWFA 1GG8A 2J9ZB 4GXRA 5LYYA 3TF5A 4BXOA 1E6MA 1KDOA 2Z2JA 5EERA 5A6SB 2VUTA 5ITZB 4MICA 4HAYA 2IUTA 4BO4A 5EG5A 4CCSA 3GEIA 1WXDA 3GRRA 1SZCA 2CNDA 4M0EA 3QYAA 4KB5A 1WUKS 3DD5A 5HRAA 2D7DA 4DIKA 1T9BA 5EL0A 2IS6A 3SP1A 2J41A 4B4VA 3LHDA 1KAQA 4YDHB 5BNWA 1CEYA 2ZR9A 1DXOA 1WUTA 2GI4A 4DSTA 3QJYA 4G0MA 3FMGA 1KA9H 5E0KB 1HEIA 121PA 4NDAA 4RNDB 3B51X 3IRVA 1TAGA 3TIIA 2JGIA 3EH1A 2NYRA 2F4VB 1E2EA 1JE0A 1ZJYA 2F1RA 3PQ2A 1QLWA 1NQAO 2J6CA 3LQRA 3UFBA 3V8NA 3VDMA 4B3DA 1WJGA 1KDTA 3BHMA 2EW1A 4CQLA 1UM9B 2VRCD 5I9IA 1RXVA 4DABA 1JSZA 2L18A 1RPTA 3VR3D 5J63A 4C4TA 4MQBA 1Z83A 1LK7A 3BB3A 4KQJA 3KK0A 4S04A 4QEZA 5LP6A 1JXAA 5IC5A 3EDCA 1MDFA 1E2JA 1GKLA 4MVCA 3ZTWA 1DRJA 4YRNA 1PJRA 1GZHB 3QITA 4N4AA 5LDDC 2FWJA 3B5IA 4I5GA 4HADA 4ZVVA 2IT1A 3L4SO 3R6GA 5EXPA 5NLLA 2W2KA 1O97D 2QL6A 4MLCA 3MTDA 3V97A 3WISA 2GFIA 2W2LD 4QA9A 1E5VA 4Z86A 3NBZC 3S70A 1R66A 5KX5B 1IPHA 3G0CA 3PD1A 2OCBA 5AVRA 4O2BB 2PANA 2F4NA 1BG6A 4BYGA 1BWPA 1TUEA 3N75A 4WOPA 2Q2QA 3QWBA 1Z3IX 4FR5A 3H75A 1RQ2A 4NMMA 3TAUA 3OCUA 2FUCA 1VG1A 3FDXA 2B8JA 2RHDA 3GLIA 2ZE7A 4KPEC 1AH2A 1LV7A 3RF6A 4X1YA 3FCUB 4D96A 3W06A 3R6LA 4CM8A 1KQGA 5I9SA 4BMSA 2UYQA 1AF7A 1MZVA 2F9MA 2LCFA 2ONYA 4J7UA 2W70A 4MR8B 2M6RA 2QPOA 1G60A 4ZTBA 5EHGA 4BMYA 1S9DA 5FUMA 1EFVA 1PI3A 1PJZA 2F67A 1LBHA 1QGED 1REQB 1TA9A 4IXNA 5IABA 5IEJA 5GP1A 4CM5A 2YX1A 4DWOA 5AM5A 2OY0A 1Y6RA 3THOA 4IAOA 4YRSA 1P45A 2WAOA 4BJ3A 2FSIA 3A6LA 3U17A 4IYJA 4GXNA 3ZWOA 5BOVA 3G2KA 4UVIA 3U0BA 3EGCA 4DSOA 4PBRA 3DUFB 2BTQB 4IJQA 4Q01A 4I9UA 3RFCA 3JQRA 5EIAA 1CETA 4DQVA 3TG8A 1DXQA 3C6ZA 3B53X 5ADVA 1P0FA 1ZYUA 3IOCA 3LBAA 2G1JA 4I55B 3OKAA 3KQHA 2PGNA 1PFWA 3K9CA 4RY2A 5EWLB 1AUVA 2CLSA 2QP3A 2O1XA 2XRYA 5KDDA 3K6SA 3FF1A 4KRYA 5CFNA 5L3SB 2WJVA 3QUBA 1QK4A 2JC3A 2WSSA 4BBAA 4CT0A 2RGGA 4UBNA 4DE5A 5AJZA 1IM8A 4CF4A 2WOJA 1D0VA 2IYFA 5EWJB 5GV8A 2ODBA 3UK6A 1N5RA 3PCRB 4E7OA 1W94A 2ZRBA 4FYVA 1YJXA 2RHCA 2QDKA 3GEGA 2J0UB 2C4MA 1LRKA 2YTZA 3I73A 4KPFC 4QPZA 3DP9A 3PJRA 1YI8A 5KVQA 4A91A 4C03A 3DV9A 1N77A 3JQGB 4X6XA 1BVUA 1VJ0A 1V39A 4LE0A 4BLVA 4WL0A 4K9QA 4A03A 3ET5A 3MWLA 4UBMA 2V7XA 1V4NA 2X58A 3FHOA 1E1YA 1YVPA 1EEXB 1C7IA 1MN6A 1NJSA 4EHIA 1I24A 3Q9UA 4E5VA 4BNXA 3HVJA 1KVRA 3ORFA 2P2NA 1POXA 2CDAA 3KE9A 2GO7A 3GH3A 2QI9C 4LGMA 3Q7EA 4V0ME 1H9BA 4IIXA 1C9JA 1QDLB 1WETA 3R8XA 2I3BA 3RVPA 2I4LA 3TX2A 5KNCA 1XWIA 4MCAA 3RNOA 1EGQA 1LTHR 2CE2X 2QMZA 2ZSBA 2AUMA 3AJAA 1DCKA 2XYGA 2RMKA 3HBJA 2BZSA 3IUYA 1JAZA 2XCQA 3ZBUA 4P38A 4YHHB 2D5CA 3KIPA 2M1ZA 1QHNA 2YW2A 1U7HA 3KAQA 3N2EA 4IYRA 4M9CA 4DR7B 4GSLA 3EEFA 3LDAA 1QYXA 2CNWA 3E2MA 4KUGA 4S0XA 4H4DA 3LH5A 1J2JA 1C4WA 2Q3EA 1JDNA 4Y98A 4HLQB 1G20E 2GEBA 3QU5A 3OZGA 4LYYA 3WIOA 5KNDH 3QNUA 4LF6B 3EPHA 2XOKA 2XZDA 4JZKA 3OKFA 2MR5A 1F5SA 2CGEA 1DIAA 4W82A 1RRPA 2B2XA 4XASA 3BGWA 1FLVA 5EXSA 2Z56A 1Q44A 1M1YB 3FYTA 4F1WA 1MV5A 2PMDA 3DBLB 2WU4A 3GA5A 1XEXA 1T3ZA 1OV6A 3FWZA 1ZJ4A 2GK3A 2VF4X 4IVNA 4EKIA 1DC7A 4I66A 1GHTA 4HH3C 1TF2A 4RF3A 2C00A 3H3XA 2LCQA 5GIPE 3ZE1B 3E48A 4MVJP 2V6JA 1WHTA 4N12A 2DPLA 5IEBA 3A11A 4HYTA 4KWTA 1KIMA 3BAZA 5FUYA 1YNSA 3J81k 2LP4Y 2QAGC 2QSUA 3TO5A 1LC0A 5KQMA 2ZU6A 1ADJA 1U2ZA 3D7NA 4R9VA 3BB4A 3PQEA 1KYTA 4W1QA 1CC1S 2VAXA 1DI0A 3VHRA 3OHMA 2HEGA 2WY2D 1KZ4A 1E5TA 2XODA 3KB2A 1AF4A 2ZBGA 3I2GA 3HL0A 1F14A 3B7PA 2MMGA 1JQ5A 3QM1A 1PYDA 4JOQA 4K05A 3WK9A 3X1DA 4B87A 1ZL2A 4MWGA 2IELA 3IR6A 5HNKA 1XZHA 2II6A 3BM5A 3DBIA 5CFOA 1COWD 3GUCA 3OEHD 1JXOA 3QVKA 3CT4A 3DZKA 4KQ6A 4LHYA 1CUZA 4D57A 4I4NA 4PPQA 4UOQA 2OE2A 2R4QA 2C2OA 1EDOA 2W5UA 3HYNA 1DRVA 3WV5A 4YCMA 4GKAA 2C7GA 1WF6A 3C3DA 1HTBA 4NYIR 4LF4B 2QYSA 3BE8A 4IDNA 4QHSA 3T5BA 1C3EA 2AOUB 4TV9F 1QTRA 2C2MA 4AN4A 1Y9DA 5TF4A 3LPLA 3PJEA 2VKQA 1I33A 5JARA 1JDSA 2QJTA 1W1WA 2YJZA 1R8QA 1SKAA 3Q3EA 1BCRB 2FAXA 3DSRA 3L6DA 4B3SB 1NR1A 2WIKA 1F4VA 2X3UA 1YGYA 3CKKA 9ATCA 2ZCVA 2ZRQA 3GRYA 3N2IA 5HZGA 3VYSB 5DTIA 3U4DA 4E3ZA 1YTUA 2I71A 1MEEA 4N03A 1OCEA 4K3UA 4MI6A 3X2EA 1Y5RA 2X7XA 4IDPA 1ML4A 5CB4A 3NHUA 3W5JA 1J2EA 3OO1A 1E2MA 3K8YA 1EFDN 1Q0ZA 4Z2AA 1UXOA 5CVVA 4FE7A 2B0JA 2HMVA 4GPD1 1P44A 1FYWA 1OREA 1U02A 4MUNA 6PFKA 3E1GA 4W5TA 3K0CA 3SEZA 2H54A 2J6BA 2OLKA 3QXJA 2AVDA 2QEQA 5HEKA 4YJ2A 1P0QA 1LRLA 3KETA 3SF8A 3MZ0A 3N5CA 1QGYA 4MI9A 3OQMA 5BWOA 4D42A 3JZDA 5EHXA 3I23A 3CLTC 3EGXA 3PC3A 3K5HA 4YPFA 3GP5A 4XB1A 2OPBA 5EWJA 3I9V6 1JJAA 3G5UA 3IESA 2NUTA 2R2AA 4DR2B 2PGOA 2ZUDA 5I9TA 1SKMA 2PSHA 2V7UA 4TUYA 5JWHA 3OJXA 1KO4A 4WJZA 1KRXA 1KZ7B 3WSTA 1GN8A 4R7TA 2E6UX 5ALMA 3MJHA 3T52A 4D9KA 4MRRA 4DY4A 3RVSA 3BOSA 4I5EA 3V4OA 4FOPA 5T7BA 3G0HA 2PKEA 5DK6A 4J4HA 1K4YA 2AJBA 1JEOA 4KO8A 5AOBA 4FD3A 5JSZA 1K7YA 4LZPA 2X4IA 3EXAA 2X23A 4H1HA 3X1ZA 1NJGA 2PUHA 1UBSB 1BX3A 2FPXA 1RI1A 2H16A 4K6KA 5B36A 1UJ4A 1T1GA 1GPUA 1WHSB 1I5OA 1UWCA 3N7UA 3DXYA 3GEDA 5F64A 4L9WA 4MTCA 1SG6A 2WRZA 1LLQA 4Q3OA 3NPMA 4YGYA 1TVKA 4MYSA 4WQMA 3WBFA 4QU0A 1XGKA 1ZH4A 4KR0A 4F3NA 5J4HA 3LVQE 4Q3NA 3R20A 3TR6A 4FFMA 4LHZA 2BFFA 4IZOA 2FGKA 1ZIYA 3OFKA 5BVGB 2CXPA 5G3ZA 4AKSA 4XPZA 1U0NA 4CF7A 5CT9A 2P91A 2W6IA 3GUUA 5LU8A 1V48A 1YJAA 4OXXA 5LQSA 3CWQA 4FYXA 3SS7X 3V1MA 4HKTA 1MAHA 4URFA 1CPYA 1QC5B 1NIPA 1OFUX 3U7JA 4CE6A 2VQFB 4JEMA 2ZIEA 2DMRA 1XEWX 1MB9A 1ACLA 3P9QA 5DRYA 4FGZA 2R25B 4I50B 4P93A 3ECAA 4IIGA 3C87A 4BMPB 2GESA 4JKOA 3AETB 4K6HA 2P1RA 4WFKA 1NNI1 4ZOQI 1DCFA 3QFTA 4YWHA 2DSTA 1KDVA 4CMKA 1ODJA 1RKVA 1RM3A 3RRMA 2FPGB 3QYJA 4KYTA 5C4GB 1A2OA 3VI3B 5I45A 4F9TA 2ZS9A 1QTNA 1SUFA 1E1QD 3ZVLA 2CZQA 5A4IS 1C0KA 1DUIA 4MUEA 2P6RA 1NR5A 1UWLA 2IS2A 1OSNA 1CUYA 1C7JA 2A0FA 2CC2A 2GR9A 2ZRGA 3GGJA 4NC9A 4CYMA 4CIAA 1A5ZA 1GTRA 2FV8A 5B57C 5U4QA 3HFGA 4DV7B 1U8AA 1IN7A 3P2JA 1RXCA 4FDUA 2UDPA 3DKVA 2ZWPA 1HSZA 3RWOA 4FHZA 1CRLA 3MBKA 4G37A 1L7AA 2ZU0C 3GXBA 1EQUA 2HA3A 1PGPA 2HJ9A 3MCVA 4MX8A 1ZJJA 1OLSB 4I46A 2I9PA 1J0CA 2OV2A 5G41A 3ZQUA 3OQIB 4B9EA 3TQOA 4EO7A 3CF6R 1MX3A 1R1DA 3CH4B 3IHTA 4QSMA 2BSAA 1CUUA 2BKUA 4R3WA 1X87A 4HFJA 4EEKA 1NQTA 3DE1X 5TSDA 5IWAB 5EXEA 5G53C 1YFZA 4ZAXA 3ZJYA 1LPOA 1Q0QA 4S35A 5A03A 2GT1A 2WTAA 4C89A 1GUYA 1KJYA 4UMDA 1BU5A 1T1IA 2ISCA 1MB3A 3RROA 4Y1RB 5JHGB 3DM9B 3ZWKA 4HMQA 5FWNA 5JH7A 1KOGA 3PUJA 4P7BA 1Z7GA 4HPJB 4Z3OA 2P3SA 1GUZA 1Y9EA 1YAHA 3ICVA 5DYYA 3I9LA 4H1VA 5LYJA 4RDIA 2DPXA 2E9SA 2YFHA 1BCRA 4XVQA 1IXYA 2YNMC 5AKHA 1ZWLA 3CX4A 2ZE8A 3HUUA 1PU2A 4C3ZA 1F3OA 2A5YB 5AHKA 3WMFA 1Z36A 2EBWA 3E5MA 3MWDB 1G9SA 4JI5B 2WIGA 4Y2QA 4IIJA 5HUQA 4DMUB 5B64A 3CHYA 1Z0DA 2TS1A 4QX6A 2Y93A 4BKPA 1N2CE 1G19A 2YJ5A 2QYTA 1USKA 1EE1A 5DTQA 4F85A 3V3KA 2BM8A 2PJZA 4FDMA 1EP2B 3P20A 4KLCA 5AMXA 4IJ5A 5ULLA 5AJVB 3HRHA 5MGBA 1WV1A 2ONZA 3U16A 1DRUA 1C7FA 3HWRA 2DF8A 1Y48E 2HJRA 2PRJA 4OYHA 3R3WA 2JHFA 1D2CA 1Q16A 2G9ZA 4GSYA 4MWOA 2PUWA 4QUHA 1QP8A 3IP7A 2X0DA 2HWKA 3EGXB 3EWIA 1OXBB 4V0NA 4TVOA 1YR3A 4BX9A 5B30A 4KX5A 1MNAA 3H19A 4C21A 5F4BA 4TMKA 5CBPB 5TGZA 1Q7TA 5AJUA 3HACA 3KT3A 2IX9A 5SZIA 3L1VA 4TMWA 1YR1A 3QWAA 2PZFA 2YY6A 4HTAA 4YASA 3HXMA 7ADHA 3A3NA 3CEAA 3W9YA 4WVLA 3FNBA 5CB4F 3I2HA 3ZCUA 5ALQA 1II9A 1QH0A 2OD2A 3R76A 3LCUA 4LJ8A 1IG0A 1QB8A 1P7WA 5EJ4A 4WOBA 2AXQA 2G08A 1YBAA 3FGPA 1OX5A 2K2WA 3HKBA 3JVUA 3ROMA 2BCJQ 4KV9A 1H8ED 5ALTA 4HVLA 1DJQA 1GYQA 3WWPA 4HDRB 3ZS8A 2GN6A 2WP0A 2GNOA 4OHWA 4YUXA 2YL2A 3KZXA 1PKEA 3V4SA 3ZXIA 4KE7A 4NBLA 5ED4A 4LF8B 3D2BA 3TQQA 2JGKA 3SOZA 4N41A 3TTSA 4N7MA 4TV9A 4FE4A 3ZWDA 2JW5A 4KO1S 4FHEA 3C85A 4MWDA 4ONEA 4YIKA 2C77A 2CB0A 1Z39A 2ZUTA 3RAFC 1ZONA 2UXBB 3GCWA 3GEEA 4R9NA 3GYGA 4DC0A 3G9XA 4DDKA 1DX6A 5AFSA 4D0NA 5J4LA 3OU6A 2K7FA 3VDNB 1UK6A 1YU9A 3VYRB 4FMDF 1K9VF 2X5JO 1T4GA 4TMTA 2VA8A 4XIYA 2G8LA 4BY9E 3HTXA 2CCKA 2RI0A 1J9ZA 3IDAA 1C50A 5CA1A 4JT2A 3UCEA 3HB1A 4M7WA 1PGJA 4NE2A 1OWLA 1J2RA 1UADA 5H3CA 5BSKA 4AB1A 1KARA 4MKXA 3NHKA 1HEUA 4J4TA 1UKAA 1WF3A 1YU6A 3ZJVA 1SD1A 4F96A 1QGUA 2YZMA 1B8PA 1UEJA 4JI2B 2HQOA 4EW3A 3V1UA 5LBIA 3AUAA 1WU8A 5U9CA 4X44A 4ZO7A 2XCSB 5B1HA 1UQUA 4XM0A 1XQVA 2FWMX 3UJDA 1NJ2A 1MH1A 3AESA 1HWYA 3C3CA 3VR3A 1TL7C 2QUAA 3AV3A 3CLTD 4WCDA 3WC4A 2ZREA 2XMDA 2XNSA 3OC6A 4UULA 3P32A 1V8ZA 2OQVA 1YONA 4DCNA 3I3SR 4CLRA 4ABTA 2JS7A 1I14A 3FPCA 1AO3A 1UOPA 1YKFA 5B7QA 4WKNA 1SVMA 5E1OA 5FLEX 4JLSA 2F62A 1R6AA 4WZAA 1K89A 4C14A 2RKWA 2O8DB 1PSWA 1WTAA 3QVSA 4L08A 1N5OX 1M7HA 3CSDA 3ANXA 2YV2A 2HQBA 3HR4A 2X77A 4R2JA 3BBLA 2BH9A 4K0KB 3SX2A 1ZNXA 4L6AA 3BH6A 2JIZA 3V46A 3OPYI 4WESA 1WM1A 2BHSA 2H51A 1GGVA 1JQ3A 1NWCA 2BBOA 3HDGA 1WCXA 1Y9JA 5AWFC 3DO5A 3SQMA 4AUKA 4C7VA 2XTZA 1E59A 2GZDA 5J3JA 4GE3A 1PG2A 5EMLA 4D4GA 4WFJA 4WKOA 1DIBA 5BYKA 2O7NA 4AJEA 4RGBA 5BT9A 1XMPA 3UKJA 4EFNA 3UMSA 3HB5X 1O77A 2FX2A 1CEQA 1WEKA 4HG2A 4V02A 1Z74A 5AKJA 3SI7A 3FYUB 1X1TA 4B3RB 4ZO9A 2RHTA 2V55B 4KLRA 3TL2A 3ZWXA 4ZCMA 2Z6AA 2C9YA 3BGDA 1ORVA 3GD7A 3TCNA 5JZOA 1NOIA 1BJTA 1DXHA 4K6OA 1JR3A 2X9GA 1IB0A 3LZ6A 4KJXA 3UQZA 2VVTA 2CL5A 2XUOA 3EW7A 4Z3DA 1EHCA 4UJ3A 2WJPA 2EARA 3THYB 3WMEA 3OIYA 1PWXA 3TW4A 5K03A 1RAIA 1MIHA 1ACJA 2R1ZA 4XB6B 2UUOA 4EUHA 2CF5A 2HU7A 3I4LA 5ITSA 8ATCA 5K01A 3ONEA 1QIHA 4BNMA 1ZICA 3G0OA 5JW6A 3WP1B 4TYPA 5IN4A 3LP8A 2UZ3A 3MVEA 3OIFA 5BSTA 1QJ4A 3AUKA 3EIHA 3UWSA 4LDAA 1T8UA 3OM8A 4OOEA 2WPDD 3DDCA 2VJMB 2XT9A 3RJMA 4CLHA 3LLCA 1DE0A 4MPJA 3WYBA 2QTMA 2R8OA 2XGSA 5CFZA 1Y8CA 4OMUA 1JZQA 3HM9A 1N2IA 4B6RA 3QEJA 2H65A 3NVMB 4GZLA 4BRSA 3VO1A 5KU7A 1GQRA 5TT0A 1XDDA 4X3PA 5DX8A 5T6MA 2OCAA 4RF4A 2O8DA 1CS0A 3CZCA 1T4CA 5A9RA 4GM1A 1T2VA 4IV8A 3INTA 4NCIA 4AUMA 4TVSA 4XH9B 1HYBA 1XAJA 5FI3A 1O5TA 2RB4A 4HLCA 4LSMA 4CZ2A 2QQ5A 3Q5DA 1Z2AA 2O8VA 3QELA 3ZWCA 1O6BA 1ZD1A 3HCRA 1O08A 3EGIA 5HF6A 3ZGXA 4AUNA 4A2QA 2XUQA 1A27A 3N7AA 2H9IA 3DZDA 3PFFA 2BC9A 2OC4A 4JR2A 1ECBA 2ZAGA 1LLFA 3IVGA 3L7AA 3X44A 4BNWA 1DBWA 4RQBA 2L2QA 4AJJA 1T4MA 4CG0A 2O48X 4P4TA 1QS0B 4QD3A 3WZ2A 4EYSA 2JJMA 5LUAA 2GF0A 3IS3A 4EKDA 5J1SB 4E22A 2F64A 1APBA 3F9RA 2XTJA 5LU9A 5KDLA 1KEPA 1ZK0A 4C6TB 3RTCA 3LECA 5KYWB 5IBCA 1C9MA 1MJGM 3HU1A 4YRAA 5JY1A 2H7XA 4GDMA 2QN9A 1V1MA 4FYKA 2NV6A 3LYHA 2WB4A 5ALEA 5IC4A 2ZYWX 5F76A 4JGBA 2IYXA 1IY1A 2NXEA 4BNYA 1HH4A 4CG3A 3U9TA 1A9PA 2FX3A 4CLDA 1E4EB 1Z4MA 1YRLA 2ZETA 1ZUHA 2LIVA 2Z43A 3N07A 4MJ7A 5EKUA 3OC0A 4G84A 1CE8A 4QUAA 1W75A 5IC6A 1U0BB 2W83A 2QMQA 3QA9A 5ENVA 2A33A 3UAYA 3RAGA 4O2LA 3NRCA 2BOVA 4ZI5A 3ZK7A 2JFBA 1JHPA 2GEUA 2I6XA 5CG2A 3ABOB 1I1QB 4UCWA 3PHGA 1V3VA 1NW7A 1UBTS 5A6SA 2GEKA 3QBDA 2DUJA 1UWKA 5EMMA 4ANFA 3W5AA 1T3SA 4YCLA 2RAVA 4ZT4A 4PRZA 1T3GA 4XCQA 2YHAA 5T41A 4I1VA 3MINB 4EI9A 5FYQA 4C4AA 2IHNA 2ECKA 1G66A 2HKIA 1A9ZA 3LUHA 1JWAB 1QH1B 3VPDA 3WHPA 1BWSA 1E92A 2PN1A 3C8UA 3PXBA 4QO8A 1T2CA 1YACA 5AQEA 4UM9B 3CUTA 1E4VA 1YD7A 3GGDA 1B43A 1RVDA 1TU3A 1CY8A 3EHDA 4NEQA 4YP9A 4FLEA 4I5IA 3VPSA 4E12A 4C4SA 1W1UA 1X19A 4YALA 1JKMA 4YRKA 1ULUA 5FAXA 2YWDA 4CL0A 1T35A 3R3ZA 1CIJA 2EJWA 3MJFA 3H16A 4YI5A 3SX0A 2DH5A 2HC9A 1RLJA 4DBLE 4EG6A 4EG3A 3FAKA 2CLCX 4LYDA 2GMWA 2FPIA 2XAAA 5EQDA 4ETIA 3GK3A 5A1TA 2QXUA 4K46A 1IN6A 1ZC4A 4XWTA 3MC1A 2Q1XA 2GGSA 3G2LA 5E0OA 3BWEA 3OLVA 4LRTB 2Z5LA 5KYXB 4MMYB 2G25A 3Q85A 4QUGA 3RVBA 4J6FA 3SHTA 1Y8QB 5ESWA 4HDNA 4JJ8A 4E5YA 1LTKA 3MMSA 1XXHB 3OX2A 1R0SA 5FFMA 5JISA 1M2OA 4FI3C 1C0LA 1C80A 2B4YA 3E7WA 2HCJB 3BX1A 1E9DA 1NMZA 1O0SA 2JFGA 3D3WA 3GGCA 4MKRA 4RA9B 4X92A 2YMPA 3MYRA 3GLHE 1A1VA 1G8KA 1PT8A 1VKNA 2G76A 4F4FA 1E4YA 5LNK6 1ITZA 2G40A 4QPCA 3B2NA 3T6KA 2BGRA 3G7UA 4WADA 3ILVA 2IOQA 4J91A 3A14A 3ASUA 2PUBA 4JJKA 2F1KA 4IVRA 4MV8A 2CFSA 1GU0A 1YGPA 1QPGA 3FH0A 3WDLA 5D5QA 1SKQA 2R8XA 2G0AA 3EIFA 3EXEB 1KZHA 4L8VA 3H87A 4M3NA 5I8ZA 4A26A 3TIXB 2XWQA 5HM6A 1HG0A 1KZ9A 3MCZA 4M49A 4NLLA 2IEYA 4MR8A 1ORTA 4PTLA 1YOVA 1GPH1 1NQUA 4EH1A 2DM6A 1QU3A 1W25A 2JJ2A 3ED5A 2Z09A 3KRTA 5GOZA 1KBZA 1CUVA 4FK8A 5KQPA 5LOVF 5ELLA 5CFRA 4P8RA 2ZBFA 4R54A 1AB6A 2VP4A 3HZHA 4AG3A 3DHWC 3JV7A 1GUDA 1N34B 1GZVA 3LWNA 4PYLA 1GVHA 3O84A 2E4AA 3FNQA 5CW2A 4BMOB 3SBDA 4QOFA 5FFFA 5BMVB 3BCRA 4XLLA 4DIUA 1E79D 3H5WA 4Z4CA 2J3MA 2J67A 2DT8A 2OORA 2OVBA 4N8DA 3TLYA 4X24A 3S44A 1HKHA 1U0SY 4EENA 3UA4A 4V1CI 5JNUA 2ZYSA 4AJ9A 3UGJA 1PNRA 4YRGA 3AHHA 1J97A 2B8NA 1LPBB 4IO1A 3RYFA 2IITA 4WD3A 4MV0A 2YVKA 5KJ6A 1WQ4A 4N9QA 1SBQA 3DNMA 1VB5A 4F5WA 1FZQA 1EBFA 2QN7A 2YWBA 3HG7A 4IBOA 1DBRA 2GASA 2QENA 1ODTC 2W58A 1BJKA 2V4UA 3BIOA 3TW0A 3EDRA 4BNIA 3ER8A 1ZISA 1SXPA 1YCGA 3NWPA 2ZXEA 3R3UA 1DB3A 1PJ4A 4M1MA 3SEQA 2CWDA 3IT3A 4AF8A 5B2FA 1UFQA 4GR9A 1Z6GA 4K9MA 1UM8A 2C5SA 4FSDA 4GGMX 3VA7A 2PPVA 3ORQA 1TUIA 3JXEA 1FS4A 9GPBA 2QL9A 1XXHA 1J5EB 5INTA 3OVMA 4BFXA 4KAXA 2C4WA 1YZFA 5JI2E 1W52X 1SK8A 2EHJA 1AUPA 5K1ZA 4L4RA 5KMGA 1ZH2A 1SCAA 3FW1A 2ZIZA 1KKLA 5B55A 1HL3A 1X2EA 2A9KA 1UC4B 3HP1A 1UK9A 3A9SA 1FNMA 2KYRA 3BK7A 3KNZA 1A71A 4GO1A 5CX4A 3KB6A 5F7OA 5A5FA 1OW3B 3R5FA 2J48A 3JWIA 1NV9A 3DE7X 3RK0A 1E0AA 1LV8A 2G06A 4IILA 4X8OA 2CJXA 5LA6B 5REQA 1T8SA 5FXMA 1XVLA 1SUSA 4E46A 5JCPA 4D41A 5L6LB 2L69A 4LPKA 3T5DA 4INPA 2N9UA 2J0SA 2GPYA 4Z49A 1E9BA 1BWRA 3RANA 4IL5A 1EGMB 4UXJA 3F4BA 3F4KA 2HD4A 3LCJA 1V5FA 3MEQA 4JP8A 1GZ3A 2HMYB 1G5IA 1WDTA 4J6EA 4D56A 5BY2A 4ZKEA 3G8BA 1CVRA 4ZEVA 3UHAA 3CNNA 2OO5C 1KVUA 2AF4C 2VWQA 2WJ3A 3PG5A 3CW8X 3QKSA 4HLNA 3AL2A 3ISJA 4JLBA 5CVJA 2NUPA 4B3MB 2EAUA 2I1LA 1JG3A 1EP9A 2FZVA 4QUDA 3K0FA 3VTFA 1VGQA 1KO5A 1ADFA 1I4WA 5H80A 2H1LA 4P08A 4C3VA 5ALWA 1V4BA 1RADA 1FVFA 4NONA 3PX2A 3BK1A 1UPXA 4YACA 1E0SA 2HWYA 2XQFA 4RTPA 4E21A 1V8OA 3VU3A 1ADGA 1TTHA 2CV0A 3ZHCA 3S29A 2JFZA 1YB4A 2PBZA 4QYTA 4W8GA 4ACAA 4C0QC 4BIMA 3JARA 2ZRLA 4Q18A 1BDIA 1JUDA 3S68A 1A98A 1OR8A 3SLKA 4CR8A 1YDEA 1H5UA 1GD1O 4F4DA 1U9IC 1WXEA 3F6BX 1LI5A 4OLBA 1P17A 1A2KC 4NXNB 5E2AA 1FJ2A 1LFDB 2LDBA 1TE2A 3WADA 1VOTA 3EVTA 3KKMA 1FFAA 1QH9A 1QHXA 1ZEJA 4M37A 3LWZA 1P60A 1P4RA 1YRWA 2ZE6A 2QHXA 2PL5A 4P36A 4BO2A 2W4MA 1G6HA 1PS8A 1ZOIA 4G0OA 1Y1LA 3WIDA 5JDIC 1L7EA 3QENA 1SBCA 4G23A 2I4MA 4KIUA 4PHHA 1QCYA 4G1FA 4JEHA 1ZAYA 1FXWA 1E1RD 2C31A 4HX2A 3ZVNA 1OIXA 4ENSA 2HJWA 1ZNYA 1H66A 3L4EA 3FUUA 3L07A 1YQQA 4RVHA 4UUAA 1PJSA 2H5LA 1ENYA 1UQTA 1I2ZA 5EJ6A 1IWBB 3KDSE 5BSWA 2Q3DA 2H0AA 4DHEA 4MVJH 3VI4B 1XD2B 4Y6PA 1ONNA 3RUHA 1AO0A 3OE1A 4LZAA 3RV4A 1K7CA 1AA6A 2AV6A 4COOA 3BXXA 5IJXA 4B46A 1XZMA 3T3IA 1SB9A 2C0PA 5CA1F 1OU4A 3VPBA 2V7EA 3I42A 4UAUA 5SY9A 1RMTA 2VQ6A 2YN2A 3N74A 4J49A 2AC7A 1FFXB 2Y77A 4U2GA 1NHGA 2O2XA 4HAXA 4WLOA 1I1OA 3A6ZA 1RYYA 1SQ0A 4B48A 5EAIA 3LVRE 2YV3A 1YZNA 1ZPDA 1EK5A 3TZHA 4JYZA 2DQSA 4U7FA 3ZWAA 5JCOA 5EQJB 2XTMA 2GUGA 3FPSA 3ND7A 3Q8LA 2CSXA 4JOSA 1GJRA 3D5TA 1T8PA 1SUWA 4FCCA 4MITA 1AQIA 3ANYB 4YCCA 1P2SA 1NKVA 2AX3A 1L8OA 1N0HA 4QQNA 3WB0A 1GXSA 3NX4A 4YRQA 4DT1A 4PGMA 5AW2A 3W5IA 2R1UA 4XVRA 1LWOA 3G7NA 1TRHA 2W98A 4WY5A 2WSLA 4D3FA 1P8AA 2XI4A 5GPBA 3EIXA 5JO9A 1SXJA 1CR4A 1B3BA 5A4JA 2CFRA 2PHZA 4L5BA 3TAXA 3GPCA 3ZCTA 4B81A 1MGOA 1M5TA 3SZRA 1GGNA 2CJWB 3Q1KA 4DWVA 3D6AA 4BC1A 4I6EA 4UTPA 5JVDA 3JS5A 1ZA1A 3M8KA 3PJDA 3HY3A 5EMHA 4DKXA 2O2SA 3OLZA 5KYTA 1RD4A 1NUQA 2OBBA 3AT1A 3BMOA 3J80A 1JJIA 1N3LA 3M1LA 3RBZA 1Q1QA 3Q2OA 1TYDE 2Q46A 1KS2A 1NYLA 1B93A 4P2BA 1A9XA 3U49A 4QOIA 2CXRA 3V2GA 1U3CA 1VL0A 1NULA 2I8AA 2X8LA 3JRNA 4CM1A 5KOJA 2K2QB 3OEWA 2Q1YA 2WM8A 1OAOA 5IARA 3C3XA 2W0SA 3CKYA 3FPFA 5B1SA 3ACCA 1QIFA 3HB4X 4F2PA 1UJ5A 2Z2IA 5BVGA 2WIDA 3SHOA 1CW2B 2FQXA 3D1VA 1H85A 1CUHA 2XB4A 4BFWA 1PEYA 3NT5A 1VC2A 4JLNA 5CT8A 2C54A 2ZKLA 2Y1EA 1JA0A 1QH8A 4M1ZA 5AW9A 2NM0A 3WL7A 5JALA 1NDUA 3TVYA 4OOFA 2PIDA 4ARSA 4L3OA 5DGIA 5LR6A 5IJAA 3GJ6A 2GBCA 2QRMA 3NUGA 3TI9A 3V4VB 2A0XA 2I33A 1L4HA 2BFCB 4FFRA 1PWEA 4OHFA 3WLNA 1A50B 4H3KB 4F3YA 1MP0A 4QULA 4Y2GA 1L7PA 3GG9A 4V2UA 5LOVA 1E3QA 4XM1A 2GN8A 3CH6A 1KRWA 1PR1A 4XD2A 2IBTA 4OP3A 1NATA 1I4LD 1AKTA 4GMHA 2YWEA 2J5BA 1OYYA 1UMKA 2JFYA 3C8MA 2BP7B 5DYGA 3ND9A 1VHDA 4PANA 3HJGA 3Q7PA 2IOHA 3JZAA 1WIWA 1VHQA 3G79A 5EMKA 5IBQA 3LP6A 3LUBA 4AUEA 1DQYA 3G5AA 3DKKA 3NM4A 5DX1A 3VPHA 3ZBTA 4RJTA 1AKMA 2FW0A 1VGVA 2B92A 2O8EB 3TNLA 3GV0A 1YUBA 2OG2A 2J3IA 4K3VA 3IXMA 4PEVA 1BS9A 4ZV4A 4IOMA 3IB3A 5DM4A 6REQB 2OV4A 3DKIA 1RYNA 2DHQA 2PH3A 3KR2A 3DFMA 1PX2A 4TV8F 4BNZA 1TAUA 4KKXB 3LG2A 4P83A 4EF4A 1YQWA 2P27A 1SCIA 4PGHA 3O2QB 4CDMA 3O3MB 4HYEA 5C5DA 3VJRA 2PXXA 3U44B 2HJGA 2FEPA 3PUHA 4PX9A 4B3GA 1VBKA 4Q7KA 4E5PA 3CX7A 2C3YA 3RS2A 1T34A 3AF2A 5L7TA 5DRTA 4JL8A 1P4JA 2RGCA 2ORVA 3STVA 5H8WA 3R9XB 3HHEA 1E2GA 3GN2A 3WKAA 5BV8A 3GEMA 1YNOA 1QQBA 1I1HA 1RE0A 2I2AA 3IELA 4GPAA 1Q0UA 3SC6A 1FUYB 1DS6A 5EJ2A 2FEOA 3A3YA 2RGXA 2ROQA 3VZDA 4V1CA 3IVXA 4XQ9A 1NHWA 3QU2A 4HR7A 4QGGA 1PS0A 5ITWA 2IY9A 1E1DA 3H8VA 4LE1A 4EG7A 2C1XA 1LPPA 3ASZA 4BIIA 3D2AA 1O2DA 5K3EA 5ALKA 3G0GA 4KQ1A 4NCNA 4RLHA 1NAHA 2C94A 3OWOA 5ERXA 4OBEA 4ZALA 3GZNB 3IP1A 4KXVA 5BXYA 4O2AB 3ENQA 4MW9A 4HS4A 4MIYA 1R0WA 3ED1A 3MRTA 1R10A 4KE8A 4WOCA 3FCOA 1II8A 2R86A 4I5FA 4A8PA 1IBMB 3C5CA 1LGYA 1P2VA 3SFTA 4DA8A 1W5SA 1WB4A 1Z2DA 1YL6A 1ZUWA 2FN3A 4JLJA 2EDAA 4EP1A 4URVR 4BJ6A 3B6IA 4R1QA 3ORYA 3FRIA 1LI7A 3V9AA 1E2FA 3H2BA 4NULA 3ZD9A 2GZMA 4J3FA 1LVHA 3RQSA 3VZQA 1ONPA 4WFIA 4Y30A 1O89A 4DEYA 2Q1UA 2GARA 4N6GA 1B0AA 3FOBA 3MCAA 1CYDA 2LBPA 1Y8RA 2G07A 2YYSA 3C24A 3IJPA 3GFTA 3L8DA 3NTQA 3RIEA 4CMIB 1QYVA 4ZOLF 5JSKA 2IPOA 4UVHA 1Y9ZA 3CE6A 1GTG1 3SQXA 1PDWA 1WSWA 2FHPA 2W9XA 2RCNA 1HYQA 3OPNA 2O8EA 4W7HA 4XVHA 1AGYA 2V0CA 2WD9A 3LM8A 4U5QA 2VPTA 1FDVA 4PX5A 1NLFA 5CP8A 2G9NA 3ZV7A 4DEXA 5DN6D 5K2OA 2IV7A 4V3BA 4WX2B 4LJRA 4JP3A 3W2TA 3I04A 1GWNA 1GFWA 3C8HA 3KYDA 2ZRJA 4R05A 4HI0E 4EG8A 4JJ4A 1P2TA 4R1NA 3PHBE 1O94C 2ZYUX 3A4TA 2DC1A 4GQAA 4HDSA 1T9CA 4O3FA 3WZLA 3ZGNA 2NU7B 2SNIE 1KI9A 3K9BA 1EVEA 3PFCA 4RV9A 4BZZA 2OFPA 1IZ7A 3OMLA 2FMUA 2E5FA 4LBZA 5A7FA 1P3Y1 1XF9A 1E7QA 3F9IA 1XQ9A 4C2TA 4CMGA 2QXTA 2I54A 2P4HX 3WYDA 1Z4KA 3B2EA 3E2IA 2WZDA 4Q4JB 3SJAA 3CYFA 3N0VA 4HXEB 2PMBA 4XCVA 4AF7A 1BE0A 4NE9A 5BUCA 1RHUA 5IVPA 2BEUB 1P5FA 4NENB 2AZMA 1QGUB 1S5PA 3N3AC 1WVMA 2NU6B 1PR0A 4CV2A 2QL5A 4QXAA 1G7RA 1KI4A 3R23A 3Q11A 1FYEA 4L0DA 3B89A 3D64A 4I8DA 3L1JA 1WKCA 1BQ3A 1RLIA 1YS6A 3QE3A 5E6RA 3ZDQA 3EPLA 4MULA 3VSDA 1XVVA 2W2TA 4K9OA 2XF8A 6CHYA 2JFPA 3GMIA 3GAMA 2JH9A 1AY0A 1CJBA 2W2NA 2BUAA 2UVQA 4QO7A 3ZNNA 3U3MA 5I51A 1Y98A 3LW7A 3LCRA 5CAEB 4DLVA 2JCYA 1WW8A 3RLIA 2I7XA 1Y3AA 2QRJA 1EM8B 2O7VA 4JL6A 5TQ0B 5IW8A 2BGTA 1NT2A 4X66B 1SQSA 1YK1A 3C43A 1FQJA 1Q77A 3O8BA 4Q6BA 3TSOA 5K8UA 5CCBA 1FDIA 1OJLA 4CDNA 1HX7A 2N47A 2QUHA 1KXJA 1G8JA 2ZWVA 4EUSA 4DXAA 5IJ9A 3NALA 1KFJB 1CDDA 1U80A 2XOXA 3HYLA 8GPBA 4ITRC 4QJBA 2EGHA 3G49A 2G82A 2XXBA 3TXAA 2HDWA 5AOVA 3GX1A 5GV7A 2WMYA 2B1GA 1UR5A 2FK8A 2LD4A 2Q0SA 3ZBQA 4FQ7A 4B47A 5J23A 1RW4A 4DSUA 2HRZA 4AIRA 3IPRA 4GH5A 1X70A 1P1KA 1PDOA 4WI1A 1Z4OA 2ZJ7A 3HVKA 4OAQA 4ND8B 1DTWA 1WU7A 3GMDA 4RUKA 4R7GA 4BFTA 4DG9A 1V16A 2JIDA 3GT3A 2NYAA 3T5CA 2ODTX 3TNDA 2VPPA 2VTEA 5DM1A 4P3XA 3RS5A 1GGMA 4JOBA 1QVAA 3FJYA 3KYJB 2Q3CA 5T3YA 3JD3A 1HT1E 1SC4A 4XX0B 1RWOA 3ETJA 5LDHA 1W34A 1T2EA 2H4JA 1YVRA 3UMBA 4LTNA 1UKZA 2B5VA 3MQFA 1S2GA 5HIIA 4WCVA 4IW3B 4WASA 4QXPA 4BO7A 4K1LA 1N57A 2AG6A 2D1SA 4MDFA 2QR2A 4MPRA 2IDKA 1DAOA 3QKIA 4TTJA 5CNJA 4KIFA 1XAHA 1ZVVA 1H8HD 4X45A 4GVLA 1EAMA 4BUJA 2C3PA 4E5MA 1ZEMA 3WLOA 4UU7A 1JHYA 4NE7A 3HH8A 3ICPA 2JLYA 4IJKA 2CNLA 3WDMA 2MT9A 2BEVB 2B99A 3P9IA 1USGA 3MWFA 4MQEB 4IIUA 3RHSA 5KKCA 4DVJA 5E6RB 3D6JA 1HZZA 3HV2A 2UXDB 4YI3A 1YS4A 2BKXA 3BD7A 4UDNA 2XWSA 1NBMD 1XYVA 3EUEA 1SIWA 4LJSA 2WFZA 5AD1A 1S2LA 3WL6A 4E1BA 1I1NA 2XUKA 4LV8B 4DV1B 4NOLA 2PH5A 2DHCA 2OCLA 3N2YA 3GI1A 5EWMB 4M0UA 2W2XA 2J07A 1UEIA 1Z73A 2NTVA 1A9OA 2XVMA 4R4JA 3T7AA 2ZJBA 2Q5EA 4NARA 2W6JA 2P2YA 2IOFA 2XLCA 3E70C 4CMIA 3SHVA 3H5AA 5AKGA 4BAGA 4RVDA 1QX3A 2BFWA 3Q9NA 3RK1A 3FDJA 4MA5A 1CKEA 2BGNA 2H63A 2P11A 3FOWA 2IFTA 4DLWA 4TKVA 1WCIA 1GAWA 1LH0A 3P19A 2AKEA 4OGWA 1TF5A 1WMAA 5IT5A 1OB2A 1W2HA 4FC6A 2Q5FA 1SR8A 4NV0A 4FKBA 2BEWB 3TLJA 1PR3A 4AO7A 1LBIA 5EIFA 1FRNA 1THTA 2X2PA 1FUEA 3DS8A 2CXXA 3KJXA 1U5BB 4H4EA 4F1JA 2VHEA 4NABA 3NOVA 2PZEA 5DW0A 2OC9A 3ETNA 5BR8B 2G72A 2OBLA 4CEHB 3B1ZA 4L4UA 2PX0A 3THRA 2P30A 4I4TF 1T2UA 3MMXA 2OGUA 2XNHA 3E3MA 4REQB 1Z0IA 2Y1WA 5DTJA 4X1KB 3CPHA 3F67A 3OMXA 1L5HB 5ALFA 4M98A 1PSDA 4JNCA 3AEKB 5L4NA 2ZJFA 3LT0A 3K32A 3TBKA 4ADSG 5DM60 3WB2A 4KQHA 1GEEA 3AY3A 4TLBA 3PNSA 5DHRA 4MKGA 1JZSA 2X5KO 4C0SA 2CKMA 4NCKA 4IIDA 3RSSA 1MJGA 4LX8A 4YV7A 3EZ6A 4MVJG 4DMMA 3HSSA 1G20B 1XTBA 4CDRA 5LZ4A 4S1OA 1ZVQA 4HAVA 2QZ4A 1XK7A 2O2YA 3T3HA 1F4LA 3HEAA 4GR4A 3UB4A 2AEFA 4E08A 2VWHA 1ISFA 2IIPA 1KYWA 2X8JA 3DL2A 4TT3A 1BSVA 4U7JA 1FSZA 4J0GA 3SXJA 5LZ7A 1IQUA 1K5PA 1O95A 3F5SA 4RM3A 3RAPR 1XTKA 1Z25A 4AMYA 3GMTA 4XVCA 1UPUA 4ESOA 1T0PA 2BFPA 4ZYVA 1HETA 1K8XB 5A05A 1J09A 2BFOA 1ZCAA 5DGXA 4N76A 4YJFB 2NU9B 5JG7A 4NS1A 2FMIA 1G3QA 1NFRA 3ENWA 4B40A 2FEWB 2IDZA 3C3JA 2Z3VA 1PT6A 4RQUA 1A69A 1EFKA 4G4SO 2LZ0A 2ZSJA 3QWIA 5MF6A 2BLNA 3DHVA 4TL9A 5AM3A 2JFHA 2X0RA 2NSYA 5AVKA 2WSIA 2YWCA 3HNRA 2J3QA 4FJ0A 1MC5A 3PEVA 4FZRA 4PO1A 3IC5A 1NX9A 3A3KA 1GSOA 8AT1A 1RAAA 2VYFA 5BN4B 2D2FA 1M8GA 2CDBA 3E9NA 4C2BA 3PUVA 1C3XA 1PZXA 2X15A 3WGMA 2NXWA 2B8TA 2PBFA 2ZQ5A 3BAFA 1SZJG 2GHRA 2HCFA 3ZLJA 4FN5A 5DCUA 3QVLA 1Q3KA 3BEDA 4K6FA 3LL7A 1EBBA 5LWHA 1R18A 5FPYA 2BMJA 2NSJA 2RH8A 3ZX5A 4KH0A 4JLOA 2FZCA 3BZUA 2R85A 4N8SA 7GPBA 1MZPA 2P78A 4IRXA 3CM0A 1UMBA 4Y2TA 4DCPA 5BV1A 1O03A 4UFOA 1X13A 3IMEA 2XHEA 1VLZA 1V35A 3JYPA 1A9XB 4EDHA 1SCJA 1A2QA 1G0OA 1N6RA 1BMDA 2H48A 4U2CA 3MJVA 4G0PA 4EBFA 5I4CA 4HP8A 2IYLD 4K2HA 1Q92A 1BAPA 2CLEB 2HSJA 2Z4TA 3OZFA 3G9TA 4KWIA 4DTIA 4Z4IA 4N65A 1T2AA 1E96A 2QAIA 2YMMA 2BAGA 1K8YB 2A4KA 2B4QA 1K5HA 2OMKA 2EKPA 3IKMB 3PGA1 3PT9A 1Z56C 4PV7A 4C30A 3ZG6A 3VMMA 3L0IB 1E6LA 1C0PA 2XJ9A 1XG5A 3PDIB 4K87A 2P7IA 4LMAA 4UBOA 4ZCIA 2I4TA 2IH2A 5DF1A 1OI4A 1Q84A 4U9IS 1ATIA 2E5LB 4II7A 1CUIA 4UZSA 2GM5A 2QZZA 1FDTA 5A0TA 2ZUBA 3A1CA 3VAZA 3PP8A 3VSAA 3FSJX 3LSTA 2AT1A 4TQ9A 3RYFB 1E66A 3SSNA 4D26A 2R6GA 3CVOA 1DVRA 1RQGA 1G2IA 4J1TC 2GRAA 2QN3A 5BNTA 2KI5A 3RC3A 1ZCFA 2V7PA 2XE6A 2XRMA 3W8NA 1XCLA 2DKOA 1R9NA 4MJ3A 3LDHA 5I7FA 3P2MA 3DAHA 3HVHA 3FPJA 1JBKA 1V5GA 3G1WA 3X1XA 1ESDA 1XDUA 1G55A 1QRUA 1OWPA 3P2EA 2EL7A 2XA9A 4HN2A 4BFVA 4TN1A 1N8KA 4QYXA 3CUVA 5I7RA 2JAPA 2VPIA 5K0ZA 2FWAA 1KI8A 2ZXUA 1WB9A 4QTTB 1U9JA 3HRKA 2EIXA 2J4FA 4ETWA 4ZK2A 3PFBA 5TPWB 4B17A 4OJNA 3JRWA 5FPSA 4B9AA 4OI0A 1JHVA 2PLFA 1DARA 1X42A 3IKLA 5FDFA 1Y7TA 3JATB 1AZLA 4MYCA 2IHUA 1G9XA 1U0JA 4LJKA 4CM7A 2EZUA 2I4NA 3FETA 3TSWA 3WLPA 4UARA 1HOTA 4EB6A 4EZBA 1CQIA 2DQKA 1L5MA 4WNCA 3AKEA 4HNAA 3SEFA 4ERXA 4OMCA 5KOIA 1AQLA 3JRXA 2BIFA 2LCIA 4ZJPA 4BU0A 3ZZ1A 1ZMTA 2GVZC 1XHLA 3DMPA 1V5EA 4LY0A 3ZU5A 4IDGA 1JA9A 4RAQA 5AI5A 4DM4A 3L5KA 2XUIA 3WSWA 2WUFA 3SC3A 3JQBA 2NT3A 2O1SA 1L5SA 3IBSA 4G4JA 4P22A 4PNZA 2E18A 4DRXA 2JGDA 4IXTA 5LFAA 3LTNC 3DNFA 4P7GA 2H1FA 2H52A 2N1BA 5DU2A 3UAXA 1SQ6A 3L49A 4PNEA 1A5SB 3SZOA 4CM9D 1ILEA 1WBBA 3A2LA 1SBNE 2OZLB 2P75A 5FBLB 1SXJC 1BXRB 1D6MA 1JQLB 3ETCA 3HNOA 3M81A 5BQOA 4QKQA 3T1HB 3IHWA 1BD4A 4NDNE 1DPGA 4MKFA 3NHYA 5KSYA 5L9AA 3REOA</