4LWQA

Crystal structure of native peptidyl t-rna hydrolase from acinetobacter baumannii at 1.38a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
GSHMSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.38A resolution
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 64
structure length 196
sequence length 196
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4lwqA00
4DHWA 4IKOA 2MJLA 2JRCA 3TCNA 2Z2IA 4P7BA 4OLJA 3VJRA 5IMBA 4JC4A 2LGJA 4JX9A 3KK0A 4QD3A 4QT4A 4QBKA 3TD2A 4QAJA 3OFVA 5B6JA 4FOPA 4LWQA 4YLYA 4HOYA 3NEAA 4Z86A 4FNOA 1RYBA 2Z2KA 3TD6A 1RYMA 4DJJA 3KJZA 4JY7A 5IVPA 4ZXPA 3P2JA 4JWKA 4ERXA 2Z2JA 2PTHA 3TCKA 4FYJA 4FOTA 1RYNA 2NAFA 5IKEA 5EKTA 3V2IA
chains in the Genus database with same CATH superfamily
4FB4A 3E1SA 3BCRA 3DGFC 2VHZA 4FMCB 3TOSA 2CHFA 2X5NA 2R84A 3GZNB 1JDVA 4MRNA 5AW7A 2J9GA 3AM1A 3O2SB 4D9MA 4EENA 1A1VA 1YA4A 3GD7A 1XEWY 1N7JA 2WSBA 4X0EA 3LBNA 3ANNA 2FRXA 5CB6A 4U7WA 4WW0A 1KZ6A 1A76A 5DW0A 1VZ2A 2VOJA 2HLPA 2HMWA 3SNKA 1KL7A 1QYCA 3SOZA 2DWQA 1LZLA 5LQDA 1KMQA 2AKYA 3NKVA 4RZHA 5KIAA 1GU1A 3D2LA 1XTVA 3WFZA 3T3DA 1VL1A 2VNKA 4MWCA 1HZZC 1Y98A 2VHCA 1TZKA 3LVBA 2E4YA 3VNQA 3JPYA 5CEJA 1HKUA 3EZYA 4L78A 3OE7D 3C43A 2VJOA 1DKQA 1R3DA 1D6NA 3N86A 5A7GA 3AWIA 4HG2A 4QEDA 3A9VA 1P0FA 2ZI3A 3HXQA 3ZX4A 2WIJA 1ZN2A 4FFDA 3BFKA 4Q1EA 2VXOA 3B8HA 1H1LA 1N6RA 3FSEA 4L5YA 4TRMA 4OFZA 1S9DA 4K0RA 4QOSA 1TUIA 2Y66A 2QTRA 2M1ZA 1AMUA 4YJKA 1RT9A 4QGAA 3N2NA 4QG7A 1HDCA 3DXYA 3LBHA 4M1TA 5LZ5A 1CWUA 1OB2A 1M6EX 3NDBB 3IVGA 1WZUA 1OZ0A 4KVZA 3NJ8A 3A1TA 4HT3B 3TTSA 4GE3A 1GVHA 4MI9A 2WHQA 1TM4E 1YGPA 3S6JA 3I1FA 3W77A 4OXNA 1N8SA 2AVDA 3AVOA 1VPWA 2IE8A 1Y4AE 3U7GA 1NMSA 2NXCA 2RGNA 2ZS9A 3N2YA 4PYMA 2VYNA 4YV2A 1OCEA 1EKXA 1YS1X 3KYBA 4L4SA 4P7GA 2GZ2A 3D8RA 3MUOA 3E18A 1JQ3A 1FTWA 2O6HA 3NM4A 4V3BA 4EB0A 3IOBA 1E9RA 4BRWA 2RBKA 4HKTA 3NBXX 4MIOA 3H42B 4MW4A 5KDDA 1GDTA 5FORA 2JLCA 4IZIA 4BPBA 4UNRA 4AY5A 2ZSHA 2ZBPA 2BGUA 4QUDA 5A5GA 1Y8RA 1Z22A 2PEYA 4QM6A 2CZQA 2WBLC 1RHUA 1SCQA 3NHYA 4MMZB 2FSVA 4JZKA 5HBGA 3QBEA 4NZ9A 4QO7A 1JZQA 4NCJA 5A03A 1QQ5A 1F0YA 1UDWA 3CZRA 5H3HA 5DX1A 4BN5A 3KAPA 4OQ4A 2PH7A 2Q62A 2BC9A 1AQYA 3OICA 3OZBA 2IQ5A 4AC9A 1P4AA 3CA8A 4Q19A 5J3JA 1AKRA 2OYSA 1BH2A 2C4UA 4C5BA 4WXMA 1K8QA 2HN9A 3GMIA 2VKQA 3VKGA 1QR6A 3H5IA 4UZEA 3OD5A 4MV8A 1RQ2A 2WD7A 1ZM9A 4ZOLB 4MUJA 4YDHB 1UBHS 1UPUA 4I2VA 2PS0A 3FOWA 4RY0A 1ZGGA 4DVJA 5B4UA 1FSPA 4AS3A 4A0FA 8AT1A 4DY6A 3QYAA 2Q3MA 1ZOPA 1U3UA 5ELMA 3S7TA 3ZJ5A 2UXCB 1T9GS 4FOOA 3L7JA 3ZGLA 1L5NA 5C7OO 1OXBB 2VWQA 1RP1A 4KHZA 3B6JA 1NR1A 4ZAGA 2PXXA 5ES4B 5KSOA 3MXOA 3OU7A 3UOWA 2XUKA 4D25A 1TAGA 1NMYA 4G9EA 2R87A 1SQ0A 2F3UA 1N92A 4MTCA 2C03A 1UC4B 3H5NA 1N2SA 1MV8A 1NBHA 5JD5A 1KYTA 3S7ZA 5IYZA 4IF6A 4NOLA 5EIHA 4IL5A 1THMA 1PE0A 4U2CA 2AJCA 2EYQA 3RIEA 1NOJA 3ZW8A 4RAOA 3VR1A 5JD4A 5C1OA 3TZCA 2B1GA 5ALJA 3QPAA 1YS9A 2X6QA 3L04A 5G1NA 4INJA 1BO6A 1HYGA 4N7MA 2PYZA 5GJVC 5B1DA 3ANMA 4KYTA 2CV2A 2VTBA 3LPAA 3RU9A 3AERA 2UVPB 1PGNA 1Q1GA 3IBFA 2ONZA 1NPYA 4G36A 5L7WA 2BFBB 2GM5A 4Z4EA 4TXJA 1P8AA 5HEKA 5LU8A 1S8NA 3HCDA 1R6BX 4WNAB 3U0BA 5AW3A 4ID3A 4GPZA 1KS9A 2QAJA 4NFSA 1SCNE 2V5VA 1M1ZA 5FA6A 4NI5A 3DWEX 4EW3A 3KVYA 4KR6A 3QXXA 3QKSB 1ESMA 1RKBA 1V3VA 1WZ2A 1JEOA 1QH1B 1QVVA 3G0GA 4LPKA 3RSCA 4URZR 2WJGA 3FLMA 1DAGA 1XHEA 4KJZA 4B8WA 2PZJA 2VQFB 2DT8A 2QQ5A 5L9AA 1X2BA 1YULA 1KTVA 5G02A 5CT5A 3OHMA 5HJEA 1E2JA 4Z1OA 2PNFA 2UZAA 3P2IA 1LC0A 3L77A 5CURA 4EY4A 4G0UA 4OXQA 1MC1A 4KQEA 3GRAA 4G4GA 1FFAA 1SRRA 4LVNA 5E4FA 2JKYA 1DB3A 1EIZA 1CUWA 5G1OA 5AT1A 3W3AH 4FKBA 4Z2AA 1OI4A 4HS4A 1P1FA 4PX2A 5IEBA 3ML1A 1EXNA 5C4GB 1AD2A 1UXHA 2Q29A 4EI7A 1G19A 2H0QA 4IHKA 5ALMA 4AJHA 4BQPA 5BXQC 4Z54A 5CH3A 3CXRA 5BMVA 2GF9A 4JLBA 4WLNA 1E58A 4Z4CA 1PJBA 4I36A 3G7UA 2QD1A 3JARA 4ZO6A 1I2AA 1GILA 1E3WB 2GASA 3ZDEA 4RK7A 1FFBA 2OCLA 1RXEA 1ZW1A 3DEHA 2O2GA 2QL9A 4ERXA 1CF9A 1N1MA 3SN6A 5DYGA 4UJ5A 4JB2A 2XB9A 2C2YA 2VVTA 1IXRC 2VO1A 4IFTA 2CD9A 4JEIA 4EELA 5BN5A 1SCAA 2KMLA 3PS9A 3WIUA 3BL8A 4H1VA 2WFMA 4O2RA 1QHFA 4DTCA 1JX6A 3NGXA 4GD3Q 3SJCA 3IHLA 2W8BA 2A1IA 3ETLA 3DDSA 1IHXA 3UIEA 5JDIA 2I65A 3D8HA 4QBFA 4UHEA 2PRYA 3OWOA 2ZRQA 3TR0A 2X0NA 3DCJA 2HHAA 2RG1A 2WTXA 3UAOA 4ZEMA 2QM0A 3CUSA 2CDNA 3CVWA 5LUAA 1IDOA 1TW2A 2IEBA 2WE8A 3FJ1A 3R41A 2OVFA 1YKFA 2PPLA 3NASA 5D3QA 1CG6A 2P69A 5COAA 4YP6A 2FEAA 1KERA 4MUNA 2A14A 4PBTA 2OWDA 4N40A 5D7BA 3M5CA 4ZI5A 5JNLA 3R3VA 4Y2HA 4FYKA 4E32A 1NYTA 3H2YA 3C8ZA 1NV9A 3W6PA 3UMYA 4ER0A 3F7TA 5FLXA 1UBUS 1IIRA 1FF9A 4CKWB 2PV7A 2BDTA 2B94A 5CM8B 4FSDA 2X5JO 5BR4A 2R85A 3SIRA 3AXSA 1BE6A 2OFOA 1N1EA 1KEZA 1QUEA 2AEEA 1ADCA 1JHVA 2DU8A 2H1VA 2YC4C 3I28A 3UCXA 3W4IA 3LC7O 4LOIA 4TRRA 1QCYA 1TA4A 4QPDA 1E5VA 2IUSA 1NVGA 2G88A 1Y80A 5KYGA 3VTKA 1RWBA 2HYDA 3E53A 1AM4D 4ZVTA 1TYCA 1R88A 1Z74A 4HZIA 5JAQA 3ZI0A 1FFYA 2I71A 4MDYA 2MYPA 2ERCA 3E61A 1Q1NA 2IY9A 3FOAA 4PY2A 4L3OA 5CVVA 1B8PA 2VF2A 1Y3HA 2OQRA 1YU9A 4YT8A 3ZV7A 3M0EA 4L85A 3A0UA 3AUAA 4H7PA 2NLOA 3F6EX 2IWHA 5B4TA 3OX3A 2GCEA 1LPSA 4B0PA 4HWOA 2XYQA 1K3TA 1QP0A 1Z5ZA 1CJCA 1T2NA 2P6OA 3IRUA 1SR8A 3A6PC 4TKMA 1B2LA 3REOA 3HACA 2JK1A 4RPCA 4C0XA 2QTNA 3DHNA 3MTAA 5I4CA 2OFXA 4K86A 2VT7A 3ROXA 4DCVA 1ZRMA 2X9NA 3H99A 3M34A 5D3KA 3VA7A 5E6SB 1BDMA 2F8LA 2IHNA 1DQNA 1VBFA 2BMVA 5IHXA 5FNVB 3NETA 3UK7A 3ZU4A 4AMBA 5I9TA 2WUDA 2YWGA 4KO3S 4ZHQA 5DHUA 4E1BA 5E4YA 5TMBA 4BY9E 1SOVA 5I9LA 4CEJB 3UHOA 1PZGA 3RROA 3QV1A 4GVPA 4FNGA 3O38A 2IV7A 4AUKA 4E07A 2FCAA 1QZ3A 3N74A 1EGHA 4IKEA 4GEGA 4B6FA 4OFXA 5K8TA 1G66A 1O3YA 2X0KA 5DXFA 1QYVA 5EHIA 4QYXA 4EJSC 3U4QB 2OYCA 2BFDA 1E0KA 4WAUA 4TTRA 1GQFA 1NT2A 3ZDDA 2C78A 1M0TA 4M99A 2J46A 3MEQA 1M0EA 1E61A 1U2DC 2RGYA 2F8SA 4HFNA 1N6HA 5TF0A 3OJWA 3TIVA 1MO5A 3OOEA 1NG1A 1VL8A 3PKZA 3Q6MA 4RHFA 3OEED 4TMVA 3TKLA 4RH3A 1I7PA 16PKA 4HYYA 1F2TB 1I10A 2GVNA 1NKTA 3DEFA 3CZAA 3EE6A 3HKBA 1GTJ1 4HNGA 4GT1A 4M54A 3BMNA 5E6RB 2BSAA 1QKKA 2XVMA 3ECCA 2RGNC 1WW2A 4RXUA 1WUYA 1GZ5A 3ESZA 4EPVA 1X1RA 4ZV9A 3B53X 2OCPA 4JODA 4DSTA 5KVCA 1XBTA 1ZXXA 2ZPUA 5J4LA 2WPDD 3E82A 5EZ5A 3K1AA 3GJZA 4AKHA 2Y05A 2ZB8A 4FW9A 4RDCA 1EZ1A 4WK2B 3RSSA 3IAM6 2BF4A 3LZ6A 4GKJB 3WTBA 3WGLA 2F1IA 4LVUA 3OIFA 4HVLA 1Q17A 4JDPA 3RWOA 4F0JA 3KOWA 2A58A 1CF4A 1BA3A 3ROPA 2RAVA 1CJTC 4U2DA 3MJVA 2XNSA 5DPMA 3I2YX 2FSVC 3NWOA 5A4FS 5JY1A 1Z38A 3GCZA 3I9FA 1IOZA 5E38A 3DZKA 4Y9SA 4KR3A 3GZJA 1Z06A 4C6TA 4BQEA 2E5LB 4MGZR 2X77A 1B41A 1EVJA 2PUEA 4EECA 3KVNA 1UK8A 2IP2A 3PC2A 5BQ3A 3Q2KA 4B9AA 3AGPA 5EWMB 4W5NA 1RKUA 3B2NA 5D7NA 5KYUA 3H13A 4QWMA 3HV2A 1R0LA 2HQRA 2ZIEA 3A4TA 1K8RA 4CMAA 2Q6VA 4PO9A 2VUTA 3GRPA 3R0XA 1NMEA 3GHHA 1NP6A 2B6NA 5ALIA 5FPSA 3MOIA 1OXVA 3LWBA 1P61B 4E6EA 2ZSAA 3OUUA 3AQIA 5JZBA 1JJ7A 3NUZA 1PT6A 1QWSA 3T06B 2C0CA 4M7WA 3S2EA 3NHZA 1VE1A 4TXMA 2HA2A 4Y1EA 1W4LA 4YXFA 1ELOA 1C1YA 3VAAA 4WT7A 1M76A 1MQ9A 2OUKA 3HWSA 4P7BA 3L1HA 2CK3A 4WCDA 3VU9A 1NW4A 3EQ8A 1CEXA 2VPTA 1GNRA 1PZHA 1FUKA 2IE0A 4ZWNA 3CO0S 4CMIB 3CJQA 2H5EA 3GRKA 3WB9A 3M3PA 2ZRIA 4IICA 1LF5A 3FIJA 4TTQA 4R1QA 3R09A 1CD5A 4GECA 1IJFA 1XZGA 4NULA 3RFTA 1L2TA 1IN4A 3SIWA 2V6FA 2RHDA 2NSHA 2WW8A 3W90A 3LPNA 3MHPA 3HEAA 2WP0A 4ESVA 2DTEA 3AY3A 4GOND 3E7XA 3IOEA 4NSNA 3ZBTA 3JQ8A 2IOYA 4KAAA 2WP8J 1SCDA 2ZU0C 3C5HA 3NIFB 4MJ3A 4DDMA 4XYEA 1VRWA 1VJRA 3CVYA 1JZTA 3ETGA 2A86A 2VSQA 4H16A 5GM2A 5AW0A 2Z6AA 1FPMA 2KE5A 2V45A 3IUPA 1PK7A 2O0MA 3DTNA 5DO9A 4OHMA 1GRVA 1D8TA 1RPJA 4J0HA 2H00A 3V8QA 3TRJA 3DT6A 1JFLA 4RFVA 1E3DA 4OIFA 2DEUA 2GS9A 3PQFA 1G2IA 4FW8A 1YZNA 4GDMA 3SR4A 5EINA 3FETA 1C7IA 4GI5A 4B3FX 3DC7A 3NGLA 5A7HA 1MRSA 2JIDA 3HWWA 4BLWA 3DUFB 3PNPA 5I8ZA 4AZ0A 1CUVA 1V3UA 2H1IA 2IC5A 3ASZA 1R3UA 1GTRA 4WCFB 5KJFA 2JG3A 2PVSA 4YCCA 3G59A 3E8MA 4MV0A 4DCMA 2FF5A 2PS1A 3HS3A 5JYCA 6GPBA 3TX2A 4J9VA 4D9GA 1R9MA 1HG1A 2DX7A 2FPIB 2YV3A 2DFNA 3MJRA 4KXMA 2NV2B 3FSGD 3QVGB 3ONDA 5ALFA 2RFLA 2R6AA 3FWPA 4JUAA 1IZ7A 3RI3A 3UAGA 2PRIA 4BLQA 2KX7A 5C32A 2H3HA 4AZVA 5TGTA 3SVZA 1QNFA 1IBLB 3LBYA 4F06A 3LPDA 1WLYA 4JIGA 4KH0A 1XLVA 3ER6A 4FGSA 4TYWA 4V2IA 2G4VA 2WDPA 4HDRB 1U8UA 2R8XA 4KN8A 1T9CA 4U02A 2F3SA 4YJ2F 4AG5A 2QTBA 3BWVA 7YASA 4JWKA 2G7MC 2CL6X 3GRFA 1F3OA 2FMFA 4FFVA 2B69A 2GPYA 4HGNA 2PTHA 4IJQA 3GUZA 3GT3A 3JASA 5DDIP 2DKFA 1VG9B 5KMGA 1XK7A 2GAFA 5KYNA 1BXZA 4ZAFA 5B6PA 2E9SA 4K9DA 1G8PA 4TKLA 1M10A 1XVUA 1NGSA 2B35A 4HL6A 4LHSA 1T1SA 2ID7A 4DLBA 3AVYA 1DVRA 3ZLVA 3G5AA 3HHPA 1BH6A 1F2VA 5IZ4A 1TUBB 3UGKA 1S2IA 2C97A 3P9ZA 1T8UA 4J0EA 4TROA 5K6AA 1LPNA 3JTMA 2NU9A 5DCYA 1OBVA 2QNBA 5CG1A 3U7JA 3NDRA 5LL6P 2OZEA 5HJ7A 5BURA 1SIUA 3TAUA 4WK6A 1J7KA 1H2HA 2WWHA 1HTBA 2A84A 1KI3A 4KO1S 1DAHA 4X7RA 3UA4A 1TCUA 4C2UA 4MJXA 5CGZA 1GT91 2L69A 4DAOA 3L6OO 4P31A 1GQSA 3E70C 4L5JA 3LAWA 1I7LA 4Z4IA 3WLQA 3HEMA 4NDNE 2J7PA 2MSNA 2ZRDA 4IJVA 3D8SA 4P83A 4RTNA 4CEJA 1KHTA 1DTSA 3EFBA 3HDJA 3TAXA 3EN0A 4B48A 3VR3A 1XN1A 2F1OA 3MBIA 1V8ZA 1JMYA 2G9RA 3HCPA 4ENVA 2IXGA 2GYUA 1DBSA 3QKIA 2XBMA 2EFGA 2GLUA 3E9YA 2G0NA 4F8EA 1D04A 1R5OA 2BR3A 1OHHD 5LSAA 3EIWA 2C92A 3TIXB 4RIFA 2D54A 4Y2YA 5JAPA 1Q21A 4CUKA 3DE2X 4UHKA 3P0EA 2B3DA 3KYCB 4HDKA 1NQWA 3MJDA 4RK5A 5T3UA 1G60A 1Z0UA 4LHZA 4TL6A 1N5OX 2JHPA 5TQ2B 3T9AA 1TKBA 2W6CX 1XTIA 1QC5B 2EF0A 4OGGA 2LRHA 2PD4A 3CGWA 4JLWA 3BWMA 4L6AA 4A8PA 1C3OA 2D0DA 4JC4A 3L6DA 1GLVA 3K70B 1M7BA 2VNAA 3A6ZA 1NTOA 5JJ5A 1P7WA 3BSFA 3TAHA 2JAUA 2YBDA 2BR5A 2R2GA 2COUA 4CUJA 4HXFB 4M0UA 4BFCA 5HZMA 2LUOA 1VHTA 1MDFA 3CZMA 3CF4G 1JH9A 4A27A 5IVPA 3VU0A 1D4OA 4ZEOA 1ZO8A 1C30A 3ECSA 3URKA 5IDWA 2CZGA 2H9IA 2Z8ZA 1PWZA 1X9HA 2W2KB 2NP7A 2A57A 3AY0A 1GT6A 2CF6A 2DUWA 3N2GB 4CHGA 4ZYZA 2QENA 2FPOA 4JELA 5I3ZA 1XVVA 1Q19A 3K72B 3PHLA 5FJIA 5DYIA 4YT2A 4IFIA 2EJTA 5EMHA 1XJ0A 3HWRA 4K9OA 4ILEA 4WL0A 4C03A 3EJ6A 3BGDA 4BKMA 2FN9A 3FOBA 3EDYA 4JK3A 1IK4A 2R6HA 4ZKEA 2IKQA 1UK7A 3BN3A 2GEKA 3D2BA 3LTEA 4BJ6A 1LZKA 5ADHA 2DUUA 3ZK9A 1RAIA 1HORA 4XFKA 1GQ2A 4MGYR 1GGKA 3VR5H 4XCQA 4JCOA 5ARCA 1VE9A 2QTVA 3O91A 4NBKA 1CC1S 4CV0A 1QRUA 1GPNA 2YRXA 5ITWA 5F1OA 3FB4A 3DVQX 4EF6A 1O58A 3QKRA 1V4NA 4WGFA 4EABA 3W06A 1HZJA 3OEHD 3K9HA 4RE5A 3N8KA 4GYYA 2HOQA 2PVCA 4NJEA 5LQKA 5HF9A 3UCFA 3WLRA 2ZJAA 3BE8A 5CFZA 1E98A 1VE6A 2DCMA 2YHUA 2FOIA 2CXTA 4WZZA 5ALDA 3HYCA 4BNTA 3I5XA 1ADGA 4M6WA 5CBKA 3VHXB 4EVQA 2WHYA 3AEQA 5B7GA 1FP1D 5CVUA 4ZTUB 2J41A 2QB5A 2WLSA 1D2GA 1XCJA 2R8OA 2B8NA 3AO0B 3ZY6A 1DJLA 2FDXA 3BGWA 1VMKA 1V37A 2ODPA 1WHTB 3OQMA 1B23P 1IBRA 4WZBE 4BNFA 4RNCA 2QZZA 5JV5A 3EH2A 4MLPA 4R9NA 5H68A 2R7MA 1YKGA 5E1MA 2P9YA 3G2JA 1D0VA 3F8SA 4GPTA 3AEUA 3NI2A 3U1TA 4BP1A 4URYR 3VR6D 2R8BA 4CF3A 4WASA 4CHTA 4EG5A 2FZWA 3NDJA 5I47A 2XB4A 1GGNA 2JH9A 3B85A 5BWNA 2HJVA 4LC1A 4LC9A 3S40A 1NN1A 3BL6A 1DPFA 1GADO 1LW6E 3E3MA 1QYWA 1I30A 1PN3A 3ENZA 5ICMA 3PDWA 2WSSD 1GDHA 1KVUA 5AXCA 2WD9A 4OA5A 4OQQA 2QL7A 4TWRA 1N6LA 4QARA 1DQYA 1AS2A 1NQTA 2KI5A 3OD1A 4MVJH 1U0EA 2G17A 1U1IA 2VWPA 5JUWA 4PRLA 1I4OA 2PJRA 5JHHB 1AQNA 3IA2A 4A6DA 4C08A 5ICGA 1OXTA 2CXPA 2XADA 1JG2A 3RAJA 4BQFA 4F5EA 4TZKA 1N77A 5JMWA 3C70A 3FOFC 3TG8A 4IS3A 5IVHA 3HUFA 4LJ9A 4UEWA 5E95A 1R9JA 2XSZA 3D4NA 3MXTA 4XD7D 1KDYA 3U81A 3HDYA 3V97A 1KFKB 2AMLA 2C5EA 3TECE 2JLUA 2HIAA 3CQ9A 5J9FA 3USES 1AUQA 2WV7A 4KBFA 1PEAA 3B6ZA 2ZCVA 5BW6B 3T3EA 2C4WA 3ZLJA 1P5FA 1M2KA 3JRNA 5KTSA 4CCYA 1UOOA 3KOYA 5KVSA 3I45A 4N7BA 2DG2A 2GZ1A 3LSTA 3HO1A 2GT1A 3VRHA 2H1RA 2QYHA 3E9EA 2IIVA 4LOHA 5D84A 4ZVMA 3ZNNA 4QXOA 5MN5A 1YRYE 1EINA 4JSYA 1KZ9A 5K6RA 4K5QA 1VA4A 3STXA 2ZT8A 3G2PA 5KNDD 4NU8X 1OXUA 2H52A 2H54A 1JTFA 3TNLA 5CG2A 4RTOA 4Y9TA 2J32A 3DB2A 3TBKA 7MHTA 3K0SA 4V0ME 1CUGA 1G20B 1I51A 1SB9A 1COWA 1Y1RA 2F7SA 2ODAA 3JAKB 5DU2A 2WNHA 4QTXA 3UEOA 1X70A 2C8VA 5HJ5A 4GGMX 2IJGX 2J1LA 3OCZA 2PKQP 2JI6A 2ATVA 3X2FA 1IIBA 4DMHA 1I94B 2AXPA 3L1UA 5CFNA 5ADWA 1D2EA 2IHUA 3FPJA 3UFXA 3FCUB 4HC4A 5KNBH 4KN9S 1Z0IA 4TV8A 5L4NA 2ZVJA 2JB9A 4HAIA 4DLYA 3TE6A 1M1YB 3LQYA 3AUJB 4HWKA 1L5VA 2P0YA 5COBA 1QYIA 4KRXA 2C5HA 2UV8A 3AIMA 4WE3A 4W5TA 2DR2A 4D02A 2A9RA 3JVDA 1FTQA 3P9YA 2C59A 1E3MA 2I1QA 4J1NA 1J23A 1QQ6A 3O8QA 2P9CA 2PIDA 2PM8A 3L4EA 1XF9A 5LKAA 2BF7A 3FPBA 4BZPA 5B4VA 1YVUA 3U6KA 2QXTA 1DEKA 3NO4A 4EKEA 3THXB 1XL1A 1VIDA 2QUZA 2XTAA 1JFFA 2AC7A 2RHLA 4JVLA 1QTQA 1VJGA 2ZXEA 4GQAA 1HGXA 3CJTA 3D3KA 2NNLD 3JWIA 3L7MA 3CZQA 3L8EA 4PPQA 2NVUB 4L8VA 2PE5A 1LNQA 4DQUA 3KZKA 1E99A 3DLPX 5B1SA 1L9XA 1U8ZA 4XYMA 2ZTMA 1ZNQO 2RH4A 2XIJA 4KWTA 4L2IA 4QXRA 5E6UB 5EWJB 3TW8A 4CKCB 1Q0RA 1N2IA 5GOTA 1JXOA 3NHRA 3U56A 4AIRA 4I55B 1JXMA 3AFIA 2CNBA 4R1LA 4C0HA 4CG0A 3LQ4A 2W48A 3NC0C 2F8TA 2JH3A 3DKPA 2GA8A 3NEYA 3I92A 2QE7D 4A2WA 5LWQA 1CEQA 1ZA2A 5KWIA 5DJ5A 3KZVA 4K0KB 821PA 3IR7A 2JI9A 3NQ41 4H4EA 2V9ZA 1LB1B 3H1EA 1Q95A 4HP8A 4IXDA 4W6ZA 4CTMA 4PGFA 1GA1A 1FU8A 1QIKA 1X8LA 3KFLA 1IY2A 1Q12A 1Y8QB 1UKCA 2G70A 2PJUA 4JR0A 4K9QA 1T5LA 1JA0A 1K5DA 3OQ6A 1KZHA 5K6AC 1GAJA 2FPMA 2P41A 3KJNA 3DJFA 1L4NA 3OZSA 2GK7A 4O4IF 4P7FA 4J7XA 4ZXPA 4HAVA 3ZU3A 1O5TA 2HY7A 5JMOA 2CE2X 1AIPA 4ZK6A 5SY6A 3LUBA 3WLLA 3S28A 4LECA 1ZAKA 1P5HA 1G2PA 4FFMA 5TQ0A 3TZBA 1E2PA 1M6VA 3A14A 4ZPJA 3TRIA 2Q1YA 4MVJE 3GOHA 3SZ3A 1NSTA 4ZFNA 4W5RA 2ZRBA 1WAMA 4QJIA 4EWLA 3ZVLA 2NMVA 1KQOA 1NP7A 2XVZA 3BXXA 1V2GA 1UKBA 3G3EA 4DRYA 1B8OA 5KYXA 1MOQA 5EJMA 3PXCX 4DG9A 4KVGA 3PITA 3VHLB 3FFAA 3Q9LA 1FYEA 1NWHA 2Z6VA 2IXBA 2I3ZA 3BZUA 2V7EA 2Z5VA 3EC7A 2CLCX 4DILA 4ARCA 3D6VA 1RWXA 4WPGA 3SDSA 1U31A 4ZOCA 3SF8A 2ST1A 2UU9B 1VLHA 1Y5NA 3EBLA 1EXMA 4XX1A 1G5FA 5FD8A 5FAKA 5GINE 2IH2A 2IYQA 4ZI7F 5T6BA 3R3WA 1OSNA 2J0VA 1HI9A 1SXJC 3EQ7A 5K0JA 3ND5A 3RFUA 1S02A 1FX0B 1LJLA 1VKRA 3EGCA 1MV5A 3WMGA 4NCKA 3MIIA 3ROTA 5LP6B 3HM2A 3J81k 2I62A 4XJSA 4EI2A 3IESA 3EVEA 4RF3A 5FH9A 1R0WA 3UBMA 2AW5A 1JEQB 1DRWA 1ZD4A 1PIWA 2KS6A 2W6JA 3L9XA 4N9QA 4GPEA 5JIBA 1PT9A 3D8UA 4KSYA 3D8NA 1OW3B 1ZGAA 1XEAA 3WGTA 1N0UA 5AXDA 2WFLB 4J1TA 2JGIA 1PBTA 1D4ZA 2WAMA 3PXGA 3VX3A 3X2SA 1ARZA 2X6RA 2ZZKA 5LA6F 2HW8A 2GETA 3MJTA 3VH3A 3IKTA 3GP3A 1FCJA 3V33A 1M2VB 2EZ8A 3FNFA 4C07A 4CT5A 3A2LA 1DIRA 2IPAB 2REOA 3LT1A 1FZQA 3LT5A 4DRZA 4RJ2A 5AM1A 3QQPA 4K28A 4YRBA 1UBSB 4WWHA 4B8YA 5AVZA 4QL3A 5DEOA 1HL7A 4OCZA 4YIKA 3UT5A 1KNXA 9ATCA 3Q8LA 5DN6D 5LNK6 4ZKDA 3IIJA 2HHCA 3LM8A 1XGKA 4WFQA 2AWNA 3CLUC 2MINA 1XDBA 1AKMA 2D8MA 1N5RA 1ISJA 1JA1A 1ABEA 2ZJOA 3E0QA 3EIEA 3GXOA 3Q3EA 4PS1A 3UV6A 1RC8A 4X7BA 1JU4A 3WO0A 4DCPA 4PYOA 1FSZA 3E58A 4M0KA 1H22A 2OO3A 2ZB7A 3M2TA 3OSZA 4P7JA 2VA8A 2VF8A 1OBOA 2FTKE 2VZLA 3M1YA 2IZ5A 2B9VA 1APBA 1YB2A 2BTOA 2L42A 1IFXA 3CINA 4R7GA 1RPZA 1H1LB 5J4YA 3GV0A 3AR9A 4M1YA 1GNSA 3RF6A 2JCSA 4RTRA 1TQHA 4F2HA 1HT2E 3T3NA 2W11A 3ORHA 2ZDGA 5KQLA 9GPBA 3TSZA 1ZHFA 4L8WB 1QB7A 1JIVA 3IXLA 4ISCA 2AR0A 5GONA 3H9CA 5IMBA 4D9IA 1ODJA 2X3YA 3DMGA 1IRIA 5D6NA 1BW9A 2O05A 2K6GA 4AJEA 2BM8A 3KKNA 4M2LA 2QL5A 3AFOA 2XB2A 4UTNA 1DTEA 2QIOA 3GFOA 3ANYB 4NV0A 1Q1EA 2ZJZA 4IS2A 3N9IA 1T0HB 1NVXQ 1B14A 4EIWA 2QEQA 1E1NA 1EP1B 3KIPA 4L5AA 3QEBZ 4YI3A 1A8IA 4N47A 1CR1A 5KSZA 1QGDA 5ALXA 1Z7WA 3E9DA 4JQCA 2EJUA 5FUYA 4KR2A 1Y34E 4YH1A 1LS6A 2O19A 3MJ4A 3EF3A 3SXPA 4JB3A 2RHGB 1BJKA 2IPLA 2NU8A 2NUPA 2VFAA 1H3FA 3PEVA 1EDZA 4DLXA 4QVIA 4U2BA 2JJ8A 2XNCA 3ABIA 1VI6A 1JDBC 2JJQA 3L7LA 1W35A 4HEA6 3IR5A 3SBXA 1U1EA 4BQSA 2ATXA 3MWLA 3LPCA 1I3CA 1A9QA 4D9KA 3E9RA 4BCBA 1Y8RB 1Z0KA 4C0AC 1VCMA 2Q49A 3NORA 1NRJB 4R31A 2FLKA 4FYYA 2FDCA 4KO8A 3TLGB 1T4GA 3RV3A 4C7XA 1RHQA 2Y0EA 3TGWA 1YQUA 1A04A 4YCAA 3PSAA 1E77A 4J03A 4D46A 1WUKS 4CIXA 4RU1A 4BN0A 2PJDA 4XIJA 1G17A 5DV9A 3MWYW 1NQAO 3QUSA 4Z1MA 3WL6A 5IM4F 3WNCA 5G3ZA 2C99A 2KHZA 4AQYB 2PFKA 5H81A 1PK9A 3AETB 3WRYC 1KP3A 4E11A 5JSZB 3AB3A 1WHSB 2D1SA 1H93A 1XQ1A 4HNQA 2PAFA 1Z6PA 3RT1A 4A2PA 3PJGA 4JZYA 4WZAB 3SMQA 4Z6KA 2P4QA 4L57A 1WUIS 2OHFA 3IVAA 1DKPA 4GYKA 3RARA 2HBRA 4RTSA 1Q5PA 2D13A 2Y4NA 4HZUA 1FQJA 1XTUA 2BEWA 4DYVA 4BEBA 2BRUA 1QV6A 3B6EA 3Q10A 4A73A 3RSQA 2OBBA 1Y33E 4L51A 4I5FA 2YDXA 3G5MA 3U3ZA 2C83A 5HZGA 4JT2A 1VLZA 3FRJA 1UDBA 4CMEA 2GNOA 4LRSB 2FPGA 1R4MB 1J99A 4I9NA 4PZAA 1WD7A 4C76A 5AVQA 4TWBA 4H7DA 4OAPA 3IBCA 4MR9A 1ZQ9A 4LY0A 4MEBA 1O5IA 2ZRAA 4CMKA 4AXBA 2PUJA 4EHHA 3I2IA 4AL4A 4HDNA 3AVUA 1B0UA 5B6IA 2G0TA 4DMUB 1SBYA 1AQLA 2VT2A 2ZANA 4O2LA 1WP4A 2QZSA 1RXCA 4OLJA 2WKPA 3OBIA 1ZYUA 4YO8A 3VC3A 3MTIA 3ONNA 1I1HA 4AJJA 2VTBB 1GZ4A 3JS5A 4BVLA 1Z7BA 1G3MA 2R8ZA 4IIJF 2ZWMA 5TMDA 3UVEA 4ETWA 5LLSA 2HSZA 4QBIA 4FDMA 3GY0A 4OQYA 1Q1BA 2YY6A 1P39A 2E2WA 4HUJA 2FPKA 3CISA 5EJAA 3OM9A 4XH9B 1S4MA 1XMIA 4XYBA 2FVXA 3FROA 1QHHB 2H7YA 1SG9A 4U6QA 3N58A 3ONWA 3B51X 3GLGE 1FXWF 3ESBA 1E64A 2G82A 2IBSA 1O7JA 4G5OA 2YW9A 2J45A 4R2JA 3RBZA 4C4RA 2ZJYA 3GG2A 2GTIA 1KAMA 1XCBA 1PX2A 1JSXA 2PFSA 3IP8A 2Q0QA 2HSGA 4CL8A 4AJ1A 1YZHA 2EP5A 4GOMD 1T8YA 4NATA 1JYSA 5EXEA 3P9CA 1D0IA 2Q2NA 1BWSA 4TKZA 3PHCA 2GUWA 2CJYA 2ADMA 3EXFA 3N7UA 1QF6A 1IXZA 3I3OA 5DNAA 2J33A 3RNLA 1BYIA 1TLTA 1Y7IA 1EVLA 2X0RA 4LXQA 1G41A 5FDFA 1PW7A 3AF6A 3X1KA 2BKAA 5H7XA 2C96A 2PBZA 3LLVA 4RM3A 1K6MA 2ZVPX 3IDAA 4XGKA 3A3NA 3KJXA 4UM8B 1ZAYA 2HZBA 4GSLA 4LHEA 1BXRA 1I1QB 3S1LA 5IAAA 5C53B 5HCNA 4M1OA 1I24A 2E4WA 3R9IA 2I6FA 1BE8A 3BKWA 4WXEA 4H77A 3RLFA 3TQIA 2GO1A 4OKSA 3ORYA 2QTLA 4X8OA 1ITZA 3PVCA 3I76A 3EMDA 5BMVB 4YWHA 5KWEA 5H3CA 1IZ0A 1NC3A 1R4AA 3JARB 1B1CA 2YVLA 1SCKA 1SG0A 1GY8A 3G8YA 4UW9A 4BO2A 3ZVNA 3SM3A 1OJLA 3V42A 1BROA 2CXXA 2WF5A 2IY8A 4A0QA 4RO0A 3SLRA 2G25A 5JPCA 1IYZA 3GEIA 3IHKA 3KKPA 1DT5A 4CKEB 1UZUA 1NULA 1FLNA 2YIMA 3JQCA 5BN5B 2WQ7A 4CQNA 1OA0A 3QEOA 3AUTA 1O6BA 4J2OA 1JKIA 3K09C 3ZE7A 2W8BB 2XUIA 3V4PB 4OXYA 1JV2B 1QDLB 4FJ0A 4JBGA 1NBEA 2J0UB 2H85A 2JHGA 2V4ZA 5HXAA 1N5JA 1WPQA 3HUUA 3KR9A 1USGA 1U2RA 3EDCA 5LP1A 2AG0A 2PR2A 2CN1A 3AIIA 3JVIA 2AXEA 4UHBA 1JU9A 1NIJA 4XWWA 3EYWA 2MYTA 3TEFA 4YCMA 4MKGA 3IQZA 4BNLA 4X66B 1L7MA 1IMJA 1DBQA 1WQ3A 1YCGA 1TKRA 3I01M 4UDOA 4XX0B 3STWA 1T36A 4BAGA 1BEUB 1DEHA 4QYWA 2V6JA 4XSGA 2BH9A 1GNVA 4GLOA 4EFKA 3NR2A 3ADDA 4LDQA 3U5ZB 1S2LA 5F5XA 4ZK2A 2EG5A 4W9NA 5LB4A 4G0ZA 3OT1A 1RPAA 1L6IA 1YJ8A 3BVPA 4MV7A 4QVKA 4XQGA 1E0AA 2OD7A 2QRPA 1PP4A 3DEYX 5DM0A 3UO8B 2BHTA 4AP6A 1EM8A 3TSOA 1XDSA 2O0JA 2VF5X 4FHDA 4KAJA 4ZYUA 5HRUA 5HF8A 4ABTA 3RVRA 4R2XA 4D1YA 5BQ5A 1WEKA 1U2SA 5T8KA 1NNSA 3TRKA 2O1XA 4DLAA 2HMAA 3FZYA 3ZOZA 2WUFA 3OMWA 2J5BA 4DW8A 2OHVA 2QLMA 5ENZA 1Y3AA 1HL3A 4GOOD 2V7QA 3SSOA 1DKRA 1X7DA 2FKNA 5T4BA 4YRRA 3GIWA 5B1EA 3QU4A 2WUEA 5IK2D 5DP2A 3UB4A 3ZXSA 3ZEAA 1XF1A 1JAXA 1PFGA 5AHKA 3SYLA 1A7UA 1C8BA 2GYVA 4OUKX 1CQJB 2RGAA 1TTQB 2F9MA 2ZYSA 3DTVD 4KN5A 2HV8A 4Q3NA 3S0JA 1N5DA 3NIWA 4E88A 2B7CA 2OGUA 2CHUA 3Q7TA 4JI1B 3WYGA 3ELYA 3K5IA 1JNXX 2R6JA 4KMOA 3MTJA 3EARA 3PD1A 2XUJA 3RFFA 1FUYB 4QJ3A 1T9BA 1XR3A 3ZV5A 2CE7A 4X1IA 2GFIA 1FFSA 2GI4A 4K3VA 5D5HA 1DADA 1J07A 1OWPA 2VJMA 3DFIA 4MVJI 4TL8A 4DDVA 3IA7A 3WHKA 3EZ9A 4M1SA 4RLQA 4CM4A 1QJCA 1IQ0A 3NYRA 3AESB 3RD5A 3GA7A 1G2QA 4LWOA 1EB9A 2PMWB 2PO5A 5ITZA 5CB4A 4ADSG 3RUDA 5BW8A 1VE3A 2F00A 3BMOA 4QE3A 4AT1A 5B36A 4ZGWA 4RTLA 3F3MA 4FCTA 2E5FA 4XIIA 5EIXA 2G1JA 4CLHA 4KACA 4ZHQB 2GZMA 2DUNA 4QU0A 2KB0A 3IBYA 4MRMA 4P5PA 4WBSA 5H8WA 1QTRA 2M32A 2ZR8A 4MPJA 3L9WA 4CIWA 5F76A 4E5PA 3A4MA 1G8YA 1NSYA 3S99A 4NH0A 3PE3A 3HFJA 4RLHA 4WI1A 4KUHA 5JAHA 2VYVA 1X3LA 3FUCA 1Z88A 5HMMA 1A9TA 4OKIA 2DLDA 2XJ9A 3WLPA 2BFDB 4JHXA 2FB9A 1KP2A 4C0JA 4CN8A 5HIAA 4DT1B 4IDAA 2ESRA 1EX7A 3UXEA 1Q83A 3WLIA 3O3MB 3PE4A 2OCAA 4RQBA 2C3UA 4CCSA 5EP2A 1KKUA 4XGRA 5CYOA 5HIIA 3NHSA 2F4NA 3MS2A 3C5EA 3BMNB 4YAGA 2ECOA 3MWEA 4L5BA 5CLLA 3RVJA 3OJ0A 1P91A 1IHOA 2QK4A 4M8KA 4GDFA 4WINA 5EPUA 2GVDC 3WQQA 4F4FA 2P5UA 3K1AB 2CXSA 1RCUA 5EQTA 4QECA 2HLDA 1XEFA 4BV2A 6NULA 4DANA 1NYRA 1DELA 2V54A 4L72A 4AIIA 1A9YA 3BZBA 2BPOA 1RBMA 3OCCA 4P6VF 2Z9CA 5JCXA 2NX2A 3GUHA 4RGVA 3WISA 1SH7A 3QFRA 4XDYA 2NO6A 3QUBA 2Y68A 4HTFA 4JLDA 2ONKA 2Q99A 1EGMB 2QG9A 2EFJA 3CMMA 4M88A 4K8OA 4OL0A 3VSEA 4YLYA 4PHGA 5AJYA 3CRQA 4D41A 3TSCA 3IVRA 2YHIA 4NNOA 4AJIA 4TYQA 3A2MA 3DZGA 4OKNA 4PGHA 4QJ5A 1SB8A 4C6TB 5J4HA 1J1ZA 3N3BC 5H4HA 3T9BA 1BCSB 3W5BA 2HDOA 3ZV6A 1XNHA 1Y9JA 3C3MA 5BWMA 1MEEA 2P7HA 1VRVA 1ZD2P 4B85A 3ZDXB 3J80A 3LT0A 2KBFA 5KYUB 1IN1A 3QENA 4FE7A 3DEIA 4C7JA 4S04A 4X71A 3V8PA 1CQPA 3QHPA 1SZPA 2RI1A 3O74A 3OCXA 1T10A 3WJ7A 1XRMA 3MSXA 4A6PA 2L0XA 5A6VA 1VSQA 3HI6A 2QPOA 2QZJA 1M2JA 3F6RA 3DM5A 3ZQ6A 1JPJA 2BRUC 2J4CA 3FVRA 4IUDS 1O8CA 3OJCA 3BEDA 4KXFB 2RH8A 2NTVA 1EUDA 3W5JA 3OQJA 1J0DA 2XKBA 2FZVA 3HFRA 4F93B 5DMHA 3P96A 2VF4X 2WG0A 4ZJUA 1WSWA 5JXGA 8MHTA 2YOHA 1ICIA 2FZKA 4ZCIA 1V0JA 4CMEC 3R0JA 1VP9A 2JCXA 5D3ZA 2RGUA 3KT3A 3QELB 1RJWA 5AHRA 1PUJA 3QJ5A 3EVAA 1P6QA 4IWNA 4D9BA 1ZJYA 4DM3A 5TE9A 3ZHYA 4Y2TA 4P36A 4TRJA 3RUIA 1ZOOA 4EUEA 2J0EA 2M6KA 1TJNA 1KVSA 1B93A 4UATA 1VIYA 5JXIA 2EZ9A 2E4UA 4LZPA 5KSPA 3VYUB 3VZPA 5HM6A 3JQ8B 1S5PA 3RAFC 2C0PA 3AEZA 4BO9A 1NW6A 5JASA 1OH7A 1KWGA 2H63A 4A8JC 4CTJA 1L4HA 3HLTA 5K0CA 3II6X 2WKRA 1O0CA 2GN6A 4PRKA 3R0ZA 2ODTX 2IP1A 1N5LA 3G0BA 3BIJA 4XM1A 2EATA 1E3LA 4YX9A 2OHOA 2MSLA 1ABFA 3K9NA 4ETIA 5DNUA 1N2BA 4FEYA 3TQHA 4R9SA 2B2XA 3O4JA 3DMTC 4C7OA 3PGJA 2FRDA 4C4AA 1JLLA 2CXHA 3LY9A 4JI6B 1BIFA 2BP7A 2Q07A 2V03A 3HI4A 2GD6A 3MGAA 3CLHA 4ICIA 1SHTX 5FR1A 4ABYA 4BKQA 5EJ5A 5K3FA 3TG2A 4D2IA 4OLAA 1BDJA 3H18A 2E21A 1HA3A 1OREA 1QIEA 2O3UA 2ZBRA 4RQUA 1DZ3A 4B46A 4U5QA 4D45A 3QEKA 2O8EB 2W2QA 3W7VA 1NRXA 2VSXA 3C3XA 4TS1A 3VO2A 4BO6A 4BNMA 2A7QA 1EEXB 1Y9DA 3VZQA 3X2EA 5AI8A 3ESAA 3H9QA 2OK8A 3MMNA 4F60A 1P0CA 4O5OA 1F1JA 4II3A 2O07A 3RRJA 5C3MA 1DDGA 2YJ3A 5EUQB 5FTKA 3UWKA 2QM8A 2XXBA 5JTUA 3NT4A 1Z37A 1MTZA 2CNWA 1T3TA 2EAUA 4R8RA 5EHGA 5EJ2A 5FPTA 1WW3A 3C39A 4HX9A 4RAQA 3W6ZA 1L7AA 2NPIA 4BWVA 1X1CA 1V5IA 2QVCA 4LWPA 2JDID 3VPXA 1ZMRA 3KTAA 1W30A 4RVNA 3VSCA 2EX1A 4IX1A 4AQDA 5KMGB 1TCAA 1KAQA 3F1LA 3BRSA 3TMKA 3VR6H 4GMFA 3ZUGA 4WBXC 3OPMA 5A05A 2WICA 2QQFA 5TR9A 2H9YA 1JJAA 3CYFA 1K7EB 3DXXA 3PQ6A 4RDHA 3TGLA 3RSZA 1J70A 3NBZC 5TMPA 1T1RA 3VPSA 1R15A 1Z39A 1XPJA 4INZA 3HJBA 3DP7A 4BBPA 4KGVA 4QRHA 3I30X 1RI3A 3GBSA 1U02A 4A10A 2QTFA 5EJ6A 5DHSA 2OWEA 1L7QA 4JROA 1W88A 2A3NA 4WX2B 3R9XA 1OIXA 1M66A 3PPWA 1TUGA 3K9WA 2IXFA 4Q1VA 1M3SA 3HXLA 2F4VB 3G1WA 1NR7A 1QPGA 1C0LA 1X14A 3AJRA 4IV0A 1M34B 4WECA 4W9NC 3ZJTA 4DE5A 1XZDA 5EZYA 2QAGA 1I2ZA 1ONSA 5GZ3A 3QM1A 1VCHA 1U99A 1N2CA 1T0BA 1Y1SA 4KDCA 1UMBB 3PCXA 4ZVUA 2RBGA 3ZZNA 4RQAA 3G7SA 3ZHQA 4U7DA 2IITA 3IEVA 2IEIA 4CU2A 1J2YA 5B6JA 1NE7A 2ZIWB 2X3FA 3I8OA 1U1GA 1PQWA 2C3MA 2J6HA 1H23A 4EHAA 3E4DA 2WKSA 2OESA 2ZJ2A 3X1ZA 1G3IA 4ND8A 4FYWA 3G0HA 5KC9A 5H1YA 3T35A 2VUUA 3KUCA 3DLCA 3B1ZA 5G40A 1GEEA 2FQWA 2ZRLA 2XT6A 3BRCA 1NG9A 3ZLTA 5KNDH 2Q4TA 4I9FA 2HHLA 1J8QA 5KHAA 4BQRA 3EEOA 3MWDA 5FL7A 1KO8A 3TSYA 1YE3A 2JCBA 2R25B 5KAPA 4F6CA 1Z7YA 3MB5A 5LWHA 3WC4A 5IJ9A 3R3JA 1XO1A 1ISHA 1C3OB 3WLAA 2O9JA 2O8DA 4L4ZA 1XHLA 2Z83A 1SAYA 4FFWA 2HC9A 4F2WA 4Q03A 4Q01A 1B0ZA 4I46A 3NVDA 1E89A 5KNCD 1L4MA 3GUUA 4K6OA 5CIYA 1U5CA 4D9FA 5KPJA 4H7EA 2YJZA 3CTMA 1RHJA 1B00A 4BFYA 2SCUA 3UK6A 3EXHC 4I1YA 2V6BA 5F21A 2QLJA 5CW1A 3K32A 3JQPA 3OOWA 2ZI4A 4XUCA 3C98A 1VBKA 5TEVA 3QHQA 1P9NA 4I4TA 3G85A 1DJOA 3NNNA 5K8VA 2X1MA 2J3DA 4RZUA 1T3LA 4O2AF 3FD8A 3O4RA 4J2HA 3G02A 1E59A 1PEKE 1SPXA 2FOLA 4B6RA 1J97A 3BYZA 3TLCA 2EZ4A 3WL5A 4ARAA 4KLZA 2ZWIA 2P4UA 1UOEA 1ZNWA 3I2JA 3MM4A 2J6BA 4RIIA 3CN9A 2VBIA 1CJUC 2WOOA 5G2OA 1I9CA 5FUXA 5K4AA 5FR2A 6Q21A 1QHEA 2YCLA 3WGHA 4BNJA 1KDZA 4OJMX 9LDBA 4I1OA 2QTVB 2CDCA 5EIBC 2WK1A 3Q0TA 4Y9DA 1J0CA 3M5DA 5GMOA 1DL5A 3WWDA 1GARA 2C98A 2GBLC 2I4MA 3L5KA 3QKRB 4KN6A 2XUOA 1A8PA 1YR8A 3QVWA 3F96A 3RVLA 1QIMA 2LV8A 1QB8A 1E7QA 1RBZA 1RYMA 1RZVA 4GKVA 3OPYI 1XB2A 3KL2A 4X61A 2G40A 5A1TA 3PHIA 1SU4A 4MR7A 4IJWA 3LP6A 1J2RA 1Z6TA 3KDSE 4M6WB 1NASA 3D3JA 3D02A 3AEQB 4NFYA 4E94A 3V8BA 4CU5A 4B6SA 4C4TA 5EHNA 4DR5B 1V71A 2IDZA 4KQ6A 4LK2A 5EG5A 1LBSA 3N2KA 4V39A 3IVCA 1P2BA 2PY6A 3VU3A 3HNRA 3SHVA 2VEDA 3RTAA 1BHJA 1Y1KE 5C5IA 1LSSA 3QOYA 2BEJA 2I2XB 2A2ZA 3AEUB 3R7FA 2CBGA 3OIDA 5IU6A 5I8PA 5JNWA 5AJWA 2P6UA 2HMSA 1OXXK 4MVJG 1MVLA 1II8B 4TS4A 3T5BA 3KOZA 1ZBQA 3DP9A 4AYTA 4AY2A 1A50B 6REQA 4CGYA 1Z2OX 1A88A 1DXHA 3VR2D 4FJ2A 4R3NA 3DTYA 1KI9A 1RHMA 5JNVA 3C3JA 3NHLA 1WPGA 2HWYA 1GRRA 3Q9SA 2C9DA 3PXDA 2N1MA 4MX8A 5KX5F 1ZJWA 4QIHA 1CJKC 1E0DA 1THGA 4FD3A 3OZRA 3SZUA 2C8JA 4DCUA 3M5PA 1SCJA 1NUAA 1CF2O 5ALTA 4WBNF 2VRCD 3CB2A 4PYNA 2Q4DA 3HUEA 3JSAA 2YBEA 3OX1A 1TF2A 2BMJA 5CU7A 2BFAA 2JJ1D 2YJ5A 2YJ6A 1AHIA 4GWLA 1Q7RA 2IIBA 3FNIA 3PGVA 4P80A 2R44A 2G07A 2D3WA 2B25A 2GPTA 3OFND 4BMCA 2V7XA 1Q16A 3U09A 1Y4ZA 3G9ZA 3HN7A 3G1TA 3KD3A 4KX5A 2FPXA 3CB4A 3WDKA 1XPUA 3HRHA 5BV0A 1X7YA 3EC2A 2JFFA 4GX0A 1DOZA 1N0IA 3FLAA 1TU3A 3DB1A 3PGKA 4OI2A 3GLUA 3A9RA 1QO9A 5DSZA 4BMZA 2AI1A 3UXMA 1Z4IA 1TVKA 4TUYF 2J6CA 5KWSA 4AXXA 3FGNA 3DZ8A 4RJJA 2V6IA 4PC7A 2IV2X 4J0KA 4JKYA 4KMMA 4NPCA 9LDTA 1KMCA 1RQXA 3WMXA 2P9JA 4GLBA 5EJGA 1KAOA 2F9LA 5CIWA 1AMOA 2OSVA 5H59A 3BXZA 1H2EA 4F9FA 3W6UA 3ZI4A 1H5NA 5KJCA 3RHTA 2FR8C 3C6MA 3HVHA 4YAOA 1QAMA 1G8GA 3MT0A 1D1PA 3H5RA 4MULA 5AI0A 3RSLA 2HZ7A 3SJBA 3ZXYA 1N4AA 3HU1A 4MUMA 3EAGA 3RS2A 3GLHE 3ZD8A 4LZOA 3SU8A 3PU6A 3UAYA 2VDLB 1HK7A 2QP9X 2B20A 3PICA 4HB2A 4X8HA 1A9OA 2NVOA 4ESHA 1W4BA 2MSDB 5E7JA 2WVAA 3M4NA 4TV8B 4DDHA 3Q7IA 4RD0A 1OX4B 4PAQA 3DXFA 1E6UA 1PZXA 4KAFA 4ZXFA 4LKRA 4P98A 3TEJA 5JNSA 3BCUA 2PWYA 2EIHA 3WNVA 3ANXA 3L0YA 4TWZA 5BOSB 2JGJA 4ZO9A 4AF7A 2GN9A 3LVQE 4C2AA 3ESYA 4DLTA 4XQCA 4EYOA 5EI5A 2PQMA 2VCEA 1RQRA 5H4GA 1PDWA 4XUGB 2B21A 3O8QB 4KSBA 4IGIA 4Q4AA 2C1EA 1TK2A 1H4TA 1BS2A 1MJNA 1HFKA 3JWHA 4Y6QA 1Q6YA 3TBHA 1RTTA 1U7ZA 1ZW6A 1UC5B 4CL2A 4JJGA 1JFFB 1UAYA 4EEKA 1TTHA 4BOYA 1H4QA 4ALLA 2QYSA 4YQEA 3LH5A 3PIDA 1H8HD 1NM5C 5ALHA 2DWOA 4XD2A 1N2JA 3ZV4A 1NW8A 1U65A 3FYUC 1ZNZA 2B83A 1KBZA 3KUXA 2RARA 2DHQA 1JHRA 4UAJA 4KYUA 5AK5A 3TW8B 3E3NA 4PPFA 3V1LA 2UUOA 3ZWCA 3T95A 2DERA 1NZFA 2G06A 2C95A 3GMDA 3DKKA 3MPOA 3Q85A 3QE2A 5CH5A 2P2DA 3OMLA 4YBRA 3BD9A 3O3OB 3REQA 5ICCA 4S1NA 2EERA 1KVTA 3GU3A 2J6IA 4D97A 2BDEA 4FI3C 2UZ3A 3HR7A 2RGDA 4GXNA 3VYTB 2WR8A 1UP4A 1VJTA 2FQQA 5MFPA 3WV4A 1IY9A 4BZZA 4BDTA 3OQNA 2P2SA 4CL3A 2F1KA 3F1KA 4U00A 3LUFA 1MR3F 5C8XA 4D8YA 2FYTA 2IWRA 1VC2A 1HX7A 2HTFA 2YHSA 4OXXA 4NOMA 1MLDA 2Z8YA 3ZYZA 1PFVA 2FXIA 1WSDA 2HJSA 2I03A 4DABA 2DPYA 1PVOA 1YFLA 1HFEL 1FTSA 1FMCA 1LBIA 4PGMA 1CY4A 3UTCA 4XVRA 2PHZA 4M38A 3AF1A 4C6RA 3KTOA 5IXYA 3GP8A 3IVMA 3KEQA 4YUXA 3BXFA 5TQ0B 1M6VB 1F38A 3RVDA 5JMTA 1PNVA 3WA7A 3TLZA 2VTDA 5JWRA 1UXKA 1ZN8A 3RC7A 1NXVA 4R01A 3LC2O 1L3BA 4BX8A 5FEUA 4UAGA 3PNSA 3H19A 2XUGA 4XXHA 1BWPA 5KYXB 5IAJA 1UOPA 3FFBA 4LXXA 1JHQA 3LUCA 3ENNA 4MO9A 1HT3A 2O7NA 3DV9A 3FMPB 5G4KB 1YQXA 3KEGA 1BGXT 3RYTC 5HKLA 3ZDAA 1QV7A 1T5HX 5IC4A 2GNPA 3OX2A 4S0ZA 4JFAA 5HUQA 2ZTHA 4JV5B 1SXJD 5FI3A 3H4IA 1O03A 1W4CA 1VKNA 1Z3IX 4LOJA 3IT2A 3MD0A 1RLUA 3JWJA 2A9KA 3OP4A 4DF3A 3C87A 1R9NA 3DHVA 2WJVA 3STHA 3T5CA 2HO4A 2YMMA 1NAHA 3EHEA 3O1HB 2JVIA 3EEIA 5FBKA 1YASA 2R751 5BVHB 5L6LB 1P5JA 2XLCA 3EXEA 4H3HB 5IABA 3OIVA 2BH2A 4EI9A 1T4BA 5I01A 3I9LA 4I50F 1RMYA 2JARA 3MNFA 4PGAA 1QPZA 1FB5A 1VBMA 3PFNA 3O4VA 4F72A 1QTIA 3JQFA 3SC2B 3O95A 1PGQA 2Y1EA 4RFLA 2H5IA 4QUJA 2IYPA 1OXSC 2JZCA 3F8WA 3G79A 3ZE2B 2CMGA 5JJIA 4H3SA 3RC2A 3FTQA 3ZKAA 3PL5A 1KEEA 3F6CA 3OCWA 2C9YA 2ZIGA 3OFVA 3QG1A 5GADl 3GEBA 4JGIA 1EVIA 4AJOA 1GM5A 4NNPA 1K6IA 1T6BY 4R68A 3GFTA 3DJYA 1QS0B 1K66A 4TSKA 3RJZA 4KVFA 1UJ5A 4CKXA 1EWQA 4JOBA 3RLIA 1GZ6A 3IAXA 4X1YA 3R77A 2HPHA 2I2FA 4G4JA 5EIAA 1CVLA 4EO4A 1R74A 3VR0A 2HCRA 5JRDS 3MWFA 3GJRA 3CH7A 4QPNA 2R5FA 3V8VA 1OH6A 3F46A 3JWGA 3KT0A 5CR9A 5HOQA 5J58A 1R16A 4FC7A 4A1OA 3FY4A 4HLQB 5IAOA 2WJWA 3GEHA 4O3MA 4J4HA 2X0EA 1Z6ZA 2IKSA 3DQZA 2C94A 4C3VA 3O31A 1M5RA 3HN2A 1U04A 2QKYA 1GG8A 3R0QA 4OHVA 1YUBA 4W7SA 3KYJB 4D9JA 3N0WA 3O1LA 1YZ3A 1P9WA 2PIAA 3H6KA 1VJ1A 1E6LA 2IEDA 4IHJF 2AD5A 4PLFA 2ECKA 5GOZA 1MAVA 1I1NA 4XGIA 3WA6A 5FXMA 3UICA 2ZT7A 2B78A 3B60A 4YASA 1BW9B 1NUTA 2CDRA 1KORA 1PVDA 2HSDA 1E94E 1UP7A 3ADOA 3DWGA 4HK4A 4QNRA 1VA5A 5D2CA 3RYHA 3VMMA 4EG7A 1L7EA 3JATB 1NWCA 3SK0A 2FCRA 3GLFB 3N07A 2ZE8A 1P1CA 3SQWA 1DQPA 3I39X 1HE1C 4ILKA 3MUNA 4J49A 3QUQA 4DCSA 2DWPA 3GG9A 3S3TA 3R3YA 4E7PA 1IEVA 2PXAA 3KBBA 4JN6B 3F9RA 1W29A 3LOQA 1K9SA 4CV1A 2AOUB 4JI5B 4RTJA 4KPEC 2NU8B 2YOGA 3LP5A 4N7JA 1N34B 3K73O 2P65A 1Z62A 2X5OA 2EBFX 5E3JA 1P8JA 2QJFA 1NA5A 1XJCA 2W00A 4NU5A 1KPIA 3SQMA 4OSPA 1YAHA 3WX0A 1K4KA 2FSSA 4A0SA 1CFZA 2POCA 2G77B 2OGSA 4O1MA 1I4LD 3G8BA 2ZBDA 3FPKA 4YJDA 5BOVA 5HCIA 4E3WA 2AYZA 2GB4A 2MCFA 2J85A 5IM5A 2P77A 2JCYA 2ZR9A 1M2FA 2PRSA 1TQ8A 5FI1B 2IYNA 4D8TA 3NANA 3UMGA 4JNKA 4FILA 4CLOA 3UJNA 3KB8A 1GHTA 1YC2A 1I13A 2WT4A 1CFJA 2QROA 3K2BA 3LGAA 2WINI 1QRRA 4LE2A 3FVQA 4WA7A 2G1KA 4D9NA 1H85A 4RYLA 1BVUA 2VIIA 2EBUA 1KE1A 4M0PA 4HZUB 4S05A 1SOAA 3R7NA 4LYAA 3E6AA 1FNSA 3CNQS 2ODBA 5DX0A 1THTA 1QHIA 1LLCA 1W93A 3SGLA 1EDDA 3R6GA 1O9HA 4K1XA 2Y27A 4CFZA 1Z0FA 3OQVA 2R62A 2HV9A 2X5KO 1FK8A 2VSYA 5EP1A 3LDAA 1JVSA 5B3LA 1K86A 4DEXA 3JQ9A 3ESDA 1TZCA 4EL5A 4XVUA 1NQXA 2FPGB 4QUIA 4AP9A 1A2KC 1W59A 4F96A 5HOEA 1NHGA 1Q7GA 2LIPA 3O7MA 1UINA 4TSFD 3H2KA 1PV4A 2B7BA 4MR9B 1NI4B 1XDUA 4TVSA 3ES9A 1KSJA 1LUAA 3K16A 3PQ2A 3RV4A 3V6LA 1IL0A 1T8PA 3LIPA 5KB3A 4LBYA 3NCTA 3W9BA 5JYBA 1CUCA 1YMUA 2H2WA 3VBCA 1QKJA 3PP8A 3ICVA 4ZMSA 3IB3A 1LPPA 2O54A 1GSIA 5BSTA 3LLUA 4ZU6X 4UVHA 4X54A 4E5VA 4NWIA 4F3YA 4OM8A 4DMKA 3CX8A 3I9MA 2X76A 4JVOA 1A2OA 4TTPA 1KIFA 3IPRA 3RUEA 2I3AA 1XMPA 2PKQO 3PLNA 4PN7A 3P5SA 4ZTBA 1GPWB 1O57A 3QEJA 4Q24A 2WAXA 1DFIA 2J8ZA 3PUXA 3VX4A 5A06A 4JGGA 4NS1A 1KPHA 1RJEA 2WKWA 3N2ZB 4L0DA 4YRKA 2Y1CA 1UEJA 1CRLA 3ZQKA 4DIUA 1ZNXA 4B33A 1J0AA 4KTVE 4UUPA 4F4HA 4XJXA 2Q50A 3WLMA 4UVDA 2VP3A 1LGYA 2YY7A 2I34A 3K1JA 4LX0A 2GEVA 1DHRA 2HQBA 3O93A 2O3TA 2B4AA 3AF2A 3OC0A 2ZTVA 3Q72A 3EXFB 3D0KA 3FMIA 2O1SA 2Q4RA 3R3SA 3B78A 2B1QA 3VPDA 1PTJA 2OENG 1P72A 2PUHA 4Y2XA 4EHNA 1G7SA 4QJ4A 4C14A 4ENQA 2XKKA 4GBJA 2O8NA 4LF8B 2DB3A 2UXBB 5K7SA 4WY8A 1PT5A 3RADC 3AB8A 1QGYA 3BXPA 2V3VA 3ZTWA 3JYPA 4ITRC 2HA4A 2I1LA 1BXRB 2IV3A 3RGGA 1ZS9A 3CIFA 2BDUA 4TRNA 1NZDA 2BJHA 5TPWA 1EXVA 3MPUA 1ZEMA 5HQ3A 1N75A 1WTCA 5BUSA 3GZ4A 3RUAA 1OTXA 4IIHA 1W46A 2HLHA 3D5TA 5GWXA 5BO5A 1MCZA 4A6EA 2UXDB 5I9IA 4YAJA 3ZE1B 3E15A 1XELA 2H4XA 3OJLA 3AVVA 4HWRA 3MT9A 1E8DA 2PXCA 4JYZA 2Z6QA 1GA6A 1FS4A 2VK1A 4B3MB 1AZTA 1ZCZA 4LN1A 4DV4B 3LF2A 1SVLA 1GVNB 3LS2A 1R6XA 3RSFA 3F7OA 1CHDA 1JHOA 4BVKA 1NR5A 4JHLA 4XFJA 5BNIA 2PUFA 4EY3A 1BNCA 1G6Q1 1FFWA 2W8ZA 4J7CA 4KC0A 2P7IA 4MHSA 3R7SA 1EBFA 2OFFA 3X0DA 1LVUA 2JLQA 3VYWA 4ZVOA 3C5WP 4MA4A 3K4QA 1WKBA 2QN1A 2XNJA 2P78A 2YY5A 3H97A 3R3HA 5A5DA 1B74A 4G9BA 4YJ2A 1KMHB 2Q2WA 2B7LA 3BTOA 5DI9A 3AU8A 1ZD1A 4FU0A 4UPEA 1AMNA 2IDMA 4LOKA 3VR4D 4Q9JA 3D4IA 1ZUHA 5A2GA 3WIOA 1A1SA 3A8TA 3VDNB 3SZOA 3TZQA 2PSDA 3THWB 1XZAA 3QW2A 1BKSB 4KWHA 3YASA 3PUJA 1DPGA 1F8YA 2P9EA 3M1LA 4O4HA 1VMDA 2HH9A 2X86A 3OT1B 1VMAA 1Y3CE 1W47A 4NBRA 1DHTA 1ISPA 1Z2CA 3QVXA 4TV9F 4JJKA 5K1ZA 1RMQA 3NBQA 4ZAYA 1TTPB 1C1XB 4LTMA 1RNLA 4U7GA 1N6OA 3FUUA 2YV4A 1WMSA 1N78A 2QQGA 1GTMA 1S89A 3WLTA 1FNDA 5L4LA 3X44A 2P5TB 1F0KA 3SKYA 1PJ2A 4Q9KA 3TNYA 2O8CA 1MQ8B 2D2XA 1QXSA 1VI5A 2CMKA 2ZSIA 4B2YA 1TAQA 2I1VB 4C9BA 1HNXB 1ZU5A 2VUIB 3V1TC 1TX4B 3STTA 3B2QA 1TK9A 3RSHA 3M2PA 3VFDA 4YDRA 5IZCC 3IL2A 2O5VA 2ZATA 3BWYA 3D7LA 3K96A 2CHQA 5JFGA 2W42A 3I64A 4MVJF 3QQ5A 1X80A 2J3EA 1L7NA 4I08A 4M83A 4L22A 1H3NA 3LUAA 3OZIA 3RWMB 4E46A 4U9UA 1J0XO 3VV2A 4N3AA 1OV4A 2GHTA 3B2EA 2B3TA 4IR7A 5TY0A 1OX6A 3GN1A 1YL6A 1SUEA 4ZVNA 1FBTA 2F1RA 4RKEA 1D2AA 4B32A 2PH5A 2VJMB 1QZXA 2FN7A 3LLCA 5HF5A 4R5HA 4F6RA 4H6WA 1S4QA 2VS1A 2R4QA 4CM4B 4YMWA 2Y1WA 2PSJA 2I22A 1YQQA 4Y9UA 2BI7A 3U7EB 1M2GA 4I4NA 1FYFA 3GLSA 5CB4B 5ITZB 5ICFA 4OHYA 3KQUA 3BMOB 3M70A 4BB6A 1LSUA 2HGZA 4C4PA 4K05A 5K8LA 4UBLA 3ZJUA 2A5LA 1CZLA 1XKTA 1MO6A 1A7AA 1Z5GA 3R5SA 4G0WA 1JQKA 4Q16A 2VPPA 4YPVA 5EZ6B 3JD3A 2DKNA 1L7RA 1Y4DE 4P3XA 2CMHA 2QN2A 2BFPA 3IEUA 1SCUA 5EZQA 1GUZA 3PVZA 4IYRA 2RHMA 4B17A 1CBUA 3IKMB 3LZCA 4IWXA 2EEPA 5FHQA 4BV3A 1PFKA 4A0GA 5G4LA 3LYAA 2YWDA 2IVFA 4MB6A 2HXYA 1B6GA 5LQCA 1Y81A 4QDZA 5CTAA 4M0CA 2ZE6A 4M9XA 1SY7A 2R47A 1HDYA 2BZGA 4P3OA 5D87A 5DW3A 5JXHA 5LIRA 3FAKA 3SR0A 1ULAA 2YNMD 3TRFA 2QSUA 1II0A 4F5YA 1YMQA 5HKBA 3B48A 3ETCA 1DQZA 1W5SA 2DHCA 1WULS 2NW6A 3NCHA 2W58A 1MHPA 2VYFA 4MRSA 3ZBUA 2DOKA 5BN3B 2NYUA 2EF1A 4EB6A 4BTLA 4KLRA 2ROQA 2R86A 2WIDA 2WQ6A 3AY6A 4HY3A 3UMSA 1CHNA 4EJFA 3PA8A 3ZIDA 1V1RA 4P22A 2OSBA 4OM7A 2JHAA 4FFPA 4YLGA 5EGSA 4BB0A 2FEOA 1E9CA 2Q46A 3WWEA 3N3AC 3I83A 1Y1TA 3CKKA 3Q1KA 3TYXA 4R8KA 5HW0A 5IBPA 1W85A 4ZT2A 1MAAA 2ZPTX 3MCVA 2AZMA 2A1TS 1W44A 3GRZA 2E6UX 3HCEA 1HT1E 3MBKA 3W7BA 3C45A 2OORA 3HU5A 3PXAA 3R5KA 1UT8A 2FFQA 1LWOA 3MERA 1U5BA 5DRTA 2XNDA 4C3OB 3KQHA 3AT1A 5ILOA 3ZWPA 2QD5A 3DE6X 2XXAA 4D0SA 1T3HA 3UKJA 4CI0B 2CEAA 2WG1A 3GJTA 3I2FA 4YT5A 4Z8YA 2SKCA 5JD3A 4QFCA 4ZYVA 3V2HA 3OCYA 2B2CA 2XUDA 4QAJA 3PGMA 5G0UA 4YV0A 2JFQA 2O8VA 1FBNA 3N53A 1IEQA 1AOXA 1RC0A 4LCEA 2IW1A 3PTZA 4YRIA 2H7XA 3RU2A 2H2IA 2ZYVX 3NHFA 3CEJA 2Y8EA 1J33A 5LVAA 2WYHA 4XSHA 2NO5A 3RRFA 3GUYA 3K2EA 3H3XA 3UJBA 5J4KA 4OSOA 3H0EA 4PAWA 3GUVA 1OFHA 3P9SA 4YRLA 1VKHA 1ZX1A 2WLTA 1E1LA 4XLTA 3OH8A 3T7AA 4BU0A 5IFKA 5LOVF 3HVRA 1MKYA 2H07A 3C41J 4NDZA 5AQ1A 1WP9A 2QN8A 3G2HA 2GM9A 1ECGA 5JQWA 1EH5A 3WWZA 1MXFA 1WNTA 3E7DA 2Q45A 4UMDA 2JBAA 3TH5A 3P2YA 4EMTA 4FGWA 3V4RA 1N5IA 1V95A 5CT4A 5EVCA 2G28A 2P91A 2X7HA 3Q1LA 3Q2OA 4R2IA 2VPIA 1TIBA 2HK8A 3R76A 3WB2A 3GDWA 3UWPA 3C6YA 4NYJR 2IOQA 4B4UA 3E7WA 5C3UA 1TGVA 4R2KA 5GM1A 1CUHA 2ZUTA 2P4EA 3HCRA 5D86A 3HZZA 2BTEA 4F9EA 3QKWA 4M9QA 4D0NA 4Q82A 5HIMA 3GK3A 4EQ6A 4RHUA 5CXXA 3C6BA 1QLJA 3V32A 4CBVA 1NI3A 2P68A 5FB3A 1WX1A 2QHXA 3PKIA 2HU7A 4C7BA 1E9BA 1RKQA 1ZCJA 2MMCA 4DJFC 4MQFA 5DTRA 4HAYA 1UT6A 3TW4A 3HCAA 3TEMA 4COKA 5F98A 2RGRA 2O4UX 4FYIA 3NKFA 2I7DA 2P3OA 1V11A 3HU3A 2ZI9A 1XAIA 5KTYA 1E92A 1ZESA 2C3OA 3MVEA 1HF3A 4K81B 3SMVA 4B5KA 4V1CB 3DPIA 1IWOA 1SXIA 1TCBA 3NVMB 1A77A 2GZDA 4KKXB 5CLIA 3L8DA 5DWVA 2OYRA 1LX7A 2JIPA 3MWGA 2C3PA 1HQKA 3FUXA 2AUMA 3DWFA 3SR3A 3NNSA 1L7DA 4GIBA 3UPUA 4UUMA 2C9BA 3EZXA 2WYUA 4G63A 4C20A 2BZSA 3AF3A 1JLLB 4EHBA 5I7OA 2V59A 4YC7A 4M0LA 5K3FB 2TECE 3D0RA 3GXBA 4JL8A 3LSYA 5CBPA 4X62B 4I5IA 5H16A 4O0MA 4MZDA 4Q3EA 7ABPA 2X7XA 3FCAA 3PUWA 2B92A 2XDWA 4MSUA 1DE0A 3A6HA 5I9BA 1GCIA 4AF8A 1V45E 2GLTA 4Q3DA 2Z5FA 5HFJA 4N3GA 3TUIC 1HNNA 3MFYA 4LAFA 3OTHA 1D07A 4MLDA 3TIIA 3DS8A 1EPUA 1RJDA 2I29A 4P9NA 3DV0A 4DV1B 2Q3BA 3ROQA 3WYBA 4FHEA 2XRYA 1GXSA 1C29B 3IV7A 4AVYA 4JEHA 5HNKA 4HLCA 2UUPA 2WHPA 5FTNA 4KCGA 1Q1QA 1NY6A 4MP6A 3PWZA 5YASA 4F45A 5AW1A 1Q1ZA 5IM4A 2VYCA 2PD3A 2VNJA 3O3CA 4NU0A 3KTAB 1EFRD 4C6HA 1CR4A 1TCVA 5AXBA 4H0CA 1DS6A 2V98A 5MGBA 3AOEA 5G0SA 3FKJA 3Q0IA 2ZUWA 4AROA 5KYKA 1E1YA 2G9UA 4RHYA 4RH0A 4RLFA 1P7CA 3B12A 3QK7A 2QPTA 2QZ9A 3K4HA 4LHXA 3RRMA 4EDHA 7AT1A 5DCWA 2YNMA 2VJQA 1EHIA 2MYNA 2NZVG 3HP4A 4O4JF 4MQEB 3T7DA 4IBOA 2Y2VA 3PUZA 4X93A 1YK1A 2P4HX 1S2OA 5D5QA 1W88B 4CF6A 5DXJA 2RGBA 3RVOA 1S3FA 2VJBA 3FF4A 3HXTA 1P6UA 2G8NA 2R4UA 1U80A 1F2DA 2JRCA 3J7TA 5JNTA 4DAEA 2Y1GA 2Q0SA 1N8KA 1P9OA 1KSHA 1U9IA 2ODQA 4RE6A 3ICQB 4FIZA 4YROA 2C7RA 3CC8A 2D4HA 4DQDA 1D2MA 5DCLA 5EZYB 2QAGB 1YZGA 3FHJA 3L2OB 4X1KA 1N2CB 4G8BA 4EG0A 5C7YA 1J49A 3AR3A 3ELBA 2AZDA 1U3DA 2GERA 2H2FA 3A70A 4O4IA 1X7WB 2RI0A 2VA9A 1G8JA 1R0XA 2F90A 3H9JA 4BRSA 5LFAA 2PZAA 3TGPA 1LBQA 2EW8A 2BEVA 1FA9A 4F3NA 5ADUS 2PKEA 4LGVA 3HSYA 4FPXA 4ND8B 2GAIA 2XMGA 2FK8A 1Q2UA 3BEOA 1BQ3A 3AR7A 3LYUA 4DLNA 1PDVA 4UM5A 3EDQA 4LJ5A 3C7TA 3CNLA 1TEVA 4CMCA 1GL9B 1ZH6A 5B2ZA 2I7XA 4MYDA 3KV3O 1IN5A 5IC5A 3N1UA 1OX5A 5DCUA 4OHFA 1GCAA 5DLPA 4UUAA 3W9UA 1LPOA 2O8DB 2HWUA 4M1MA 4BYGA 2QTGA 4BQQA 2G7ZA 4BNYA 1YZQA 3TXYA 1N7HA 1PRYA 2O4CA 1E66A 3P0JA 1A71A 5JOQA 4L8FA 4MYHA 4DV0B 2QM7A 1RZRD 1U3CA 1NLUA 2DFTA 2SCUB 4D26A 2J5QA 2AEMA 2VZ9A 2DBVO 3GLTA 3O0TA 3QBTA 2QVZX 3V7YA 3GLKA 4A8HA 4U7FA 4MW0A 4B47A 1JKFA 3SYKA 1W5EA 1NBMA 4NAHA 5DGIA 5AXAA 3G82C 2DQZA 5JAMA 5K0TA 2IYUA 2Y1OA 3LMKA 4G97A 5JS2A 2IDKA 3JZFA 1OWNA 2RD2A 1GAXA 4BGEA 3MELA 4PVCA 4DKJA 4E21A 2V65A 5JZOA 4HVTA 1XL0A 4GQBA 2HMTA 2WVHA 4AQ7A 1Z9BA 3T94A 3F74A 4BFVA 1N9GB 3V2UA 5ESXA 1XEWX 3BDIA 4UXIA 5HE9A 4QPJC 1TCCA 3FRHA 4QPPA 4I8IA 1IQUA 1H6BA 2VDUE 4UM9D 2HMYB 5IX8A 5KCZA 2EGUA 5DNVA 1FDVA 1U2GC 1WB4A 3I0ZA 3INTA 3JVEA 4HMPA 1ILWA 4LEIA 4WA8A 3WK7A 2K7FA 1ZJ4A 5KO2A 3IMEA 5K3BA 1UL1X 1X1BA 4LV8B 1BHQ1 4IDNA 4RV4A 1CY6A 3PWKA 4MR7B 2OCKA 1L7XA 3TZ6A 1X74A 2XPCA 3BE5A 2YIVX 3O4IA 3GCDA 5KSWB 5IUKC 4XWYA 1P4GA 2ZTLA 2V1XA 4Y8VA 4EFDA 2BW0A 2J08A 5EEGA 3VZSA 3CGGA 1KJ8A 1XMXA 3IQHX 4JBWA 1EVQA 1EFHA 3NX4A 4PZLA 1L1QA 2PPVA 4DOMA 3FJOA 1K7CA 1WBDA 3ICWA 2QLBA 3N2KB 2QVGA 1M0SA 2XMDA 4LJ7A 3ONEA 1L5MA 4KV9A 3MQ4A 1DXOA 2WU0A 2VK2A 4YMVA 5I3CA 2ZM6B 3CG4A 1MIHA 5FA8A 1AGNA 2JGAA 3CZPA 3QLEA 3D6AA 3JYNA 3QV2A 1NLZA 3K0KA 3D5EA 4G81A 4H4CA 4KDEA 4X91A 4EG4A 1RJFA 3O8OA 2B4TO 1I3OA 4FGZA 3FTFA 4KIUA 3AHFA 6REQB 1ZMOA 2VNIA 3BIWA 3GW8A 2EFHB 3ZHCA 1KFCB 3C2QA 2SKDA 3GLIA 5JH7F 3LFUA 3MGKA 4HV4A 1SXQA 2ATIA 3DEZA 3FWNA 4NYMQ 1WS6A 2Z56A 4N03A 5JQGA 4UE2A 1WDTA 3KPVA 5JRJA 4CG3A 1MOPA 4BMOB 3T61A 3WYFA 2FUG1 1QE0A 2XWBF 2GTHA 5LXTF 3FSJX 4RORA 3UANA 4AY6A 2XUFA 4OX9B 3PDIB 1E7WA 4RZ3A 1YDMA 2QORA 1ZLYA 4D74A 4EUNA 2A67A 2HA6A 3G13A 5AO9A 5F52A 4PICA 3WR5A 4F91B 1FDWA 1FS6A 3ODPA 4A2CA 2C07A 1F14A 2WF9A 1A5BB 4XM2A 5AM5A 4ZAZA 2WHXA 3NP7A 4X64B 5J2UA 3THYA 5J23A 4BKRA 1NLFA 2WF8A 1G6KA 3IJ5A 1SK8A 5FV7A 4DLSA 1QVAA 1KMNA 4BLOA 2I91A 3RVSA 1CE8A 1QG2A 1JTEA 1NIPA 3UJAA 1GV1A 2F9FA 2Q3EA 4O1HA 1NKVA 1WIWA 3PDJA 2BONA 4EAAA 4UFOA 1G1AA 4C0SA 3Q0EA 4HNAB 1TVKB 2H06A 2I2AA 2XGOA 4DRXA 1SJ9A 1P1JA 5U9CA 2W4MA 1JAYA 1OVMA 1KU6A 2X22A 2XECA 3IUSA 4IQGA 4PF1A 3AR2A 3WKDA 3X1MA 5DISB 2NSJA 3FBWA 2YJ4A 1DX4A 2ZYHA 1VTKA 4L73A 4MVJM 1JSCA 4RHCA 4RVGA 1N25A 2AKAB 4M4SA 5BMOA 1ZKDA 3NBFA 3CZ5A 2CLKB 5KQGA 3PSHA 5KAMA 5L3SA 1G21A 2JIZD 4G4IA 5A02A 2BZ1A 2I4IA 4H08A 1DC5A 3ER8A 4XCXA 3S1AA 4B4KA 2P67A 3UUEA 4DSAA 1RI5A 1MRNA 1EX1A 1LXCA 4QDUA 1NVKA 1YRLA 1SD1A 1F12A 1Q7CA 1MB2A 1T9DA 1CDOA 1F4PA 1O95A 3P4YA 4MQBA 4Y6GB 3AW8A 1VCIA 5BV7A 1UDCA 4KE8A 4WLEA 4XPIB 4D9CA 1TTTA 5EYPA 4OXRA 2JI4A 3VOAA 3OZXA 3GF4A 5DYYA 1P1IA 1WRBA 1XMSA 2NZXA 3SKXA 2A0WA 1HDZA 3KVRA 1PUXA 2ZUSA 1X1QA 1O54A 1T3GA 4X6UA 1OT3A 1M1NA 4BZQA 5KC8A 5JT1A 1U1CA 4DQ0A 4W1PA 4DIEA 4KUGA 2JCVA 1U8CB 2YYSA 1OGIA 3L4SO 4PYQA 4Q7EA 4X97A 5ALQA 5T4EA 2PDAA 3HVIA 5AM4A 1Z6GA 2NPFA 3W5SA 3VOTA 1OWOA 1R0RE 3QHAA 4R6WA 4LQLA 3RYFA 4AICA 4QT4A 3UMMA 4C5CA 3DW3X 2J9XB 3CT4A 3V7NA 1HLDA 3VO8A 5ILGA 3DOOA 4IIJA 2EQ5A 2R9VA 2XF8A 4G67A 3GZNA 1AGXA 3VAZA 3FMOB 3HTXA 2B8EA 1OGYA 3B6IA 2OKGA 1L4FA 2BGIA 4QXAA 1TLLA 4HEJA 3WNQA 4XGNA 2NO1A 3BSYA 3ZIAD 3OLYA 3ZZ1A 3GNSA 1XK6A 2P6RA 2ZKIA 4KQGA 1CK4A 4Y2UA 1U4SA 5IBRA 2B30A 3U31A 1YB7A 5I4BA 1CJBA 3FOCA 3OEYA 1OBCA 3LWDA 4RMGA 4RCYA 3REQB 3CVOA 3VQTA 3COYA 4Q48A 5H3LA 1LLUA 3OU6A 2D06A 1GEGA 5AKJA 1X87A 2QTAA 4RACA 2ZT6A 4EO7A 1REQA 1GSAA 1JT2A 4LF9B 4DQXA 1T2AA 1MJHA 4LGYA 1DUVG 1R7RA 1ZKMA 2FJUA 5TF4A 3EGDB 4RGYA 3MAJA 2M9MA 5ESWA 3K92A 3I6QA 3PRJA 3OLXA 4YHBA 3R7LA 4G0NA 3WAKA 5F12A 4K7JA 1TIKA 4PZYA 4X44A 1G6HA 2GQ0A 4D4GA 4YRZA 2WFAA 2XGSA 2XB6A 5ECDA 2OBXA 1PYOA 1RYDA 4J0DA 1Z3CA 4BO5A 4C89A 2GKSA 2WUGA 3OF5A 3U7IA 1J5PA 3ILXA 1QGED 2QXUA 4J7UA 1W5FA 1BJRE 1YI1A 2GR9A 3JX9A 3LHIA 3Q7EA 3R0VA 1HV8A 4NONA 3EIXA 3KK0A 2ZRMA 2W4IA 3CF4A 3KSZO 3R4VA 4HAWA 5BQOA 4AM8A 3WZMA 4D79A 1OKKD 4BVEA 1ID8A 3K6KA 4K2HA 2G6TA 2G8LA 2D8AA 2W90A 3ABQB 2L18A 3H04A 3HVJA 1O9GA 1WUTA 3KQQA 1FP4B 2J5RA 1G42A 3UKDA 1UQUA 1ZMTA 1WPRA 3OLQA 3RS4A 4PAMA 5FA5A 5A5EA 4BLVA 2DWUA 4CQMD 3KWFA 1K5PA 3BM5A 5H80A 3SX4A 5CFMA 2WA2A 4A0RA 2BTQA 2P11A 2ZJ1A 3HB9A 1XG5A 3NXKA 2DHEA 2JJ2A 2AFHE 4AFNA 3DMRA 4NCIA 4UTZA 3GEEA 4NZYA 2CCGA 5F2EA 3D43A 3VPHA 4EHLA 1YQEA 2QF7A 4L1KA 4MK4A 5EFOA 3A31A 4CKBA 4ETNA 1NVBA 3KR2A 1IJBA 5EJ4A 3H9EO 1TD1A 2EKQA 1U1FA 5ETJA 3U61B 3DXZA 3UMBA 3UMRA 3UAWA 3QLVA 2QP4A 5IF9A 4UU8A 3EXEB 3MT7A 5KDLA 3DKIA 3EZ7A 5C81A 3A6FA 2BSXA 3RFXA 4ZZ3A 2VDVE 4FLEA 1I2BA 1I0ZA 4ZOLA 3DDZX 4DA6A 2ETXA 4G41A 4N1AA 2K7ZA 3H9GA 4QELA 1STOA 2UZ4A 3W34A 4RTPA 1HYBA 5AKZA 5FF9A 2YZNA 3ETHA 3KFVA 4FX5A 4IEFB 1HOXA 6LDHA 5DTIA 1I0LA 4RPIA 1PU2A 2CXRA 2YYAA 3KKMA 4L07A 3IERA 5JJKA 4M9RA 1T4MA 4DIDA 4G1CA 2CJWA 4B3XA 1QIIA 5DTJA 4HLUC 4QTYA 5J2TF 2ZAYA 1JEAA 2P3QA 1X77A 4PHHA 1UF9A 3PXUA 5CM2Z 5A0VA 1ONPA 1Q22A 2BVNA 2PWZA 3INYA 3OZFA 2D5AA 3EWAA 1J39A 2BELA 4HEQA 3S29A 5DSXA