4UD2A

Structure of anaerobically purified d. fructosovorans nife- hydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title [Nife]-Hydrogenases Revisited: Nickel-Carboxamido Bond Formation in a Variant with Accrued O2-Tolerance and a Tentative Re-Interpretation of Ni-Si States.
pubmed doi rcsb
total genus 84
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ud2A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ud2A02
3RGWS 1WUJS 4KO4S 1YQ9A 1UBRS 4UEQA 4C3OB 4CI0B 1UBLS 1UBOS 4IUDS 1UBUS 5JSHA 3AYZB 1UBMS 1YQWA 4UPEA 3H3XA 1UBJS 4IUCS 3ZE8A 4UEWA 1YRQA 4UD6A 1E3DA 4UCWA 4UQLA 4KN9S 1UBHS 3ZEAA 4UD2A 5D51S 3CURA 5JSYA 4UE2A 1WUHS 1WUKS 4UCQA 4OMFG 4UE6A 4UPVA 4IUBS 4U9IS 3AYXB 1UBTS 5JSUA 5JSKA 3MYRA 4UCXA 1FRFS 3ZE6A 3ZE9A 1H2AS 3USCS 1WULS 3USES 1UBKS 3ZE7A 4KO1S 4UE3S 4UQPA 4KL8S 4KO3S 4KO2S 1WUIS 3UQYS 2FRVA 5JRDS 5A4IS 4TTTS 5JT1A 2WPNA 4U9HS 5A4MS 5ADUS 5A4FS 1FRVA 4URHA 1CC1S 1H2RS 4GD3Q 3CUSA
chains in the Genus database with same CATH superfamily
1DAOA 3EISA 2IQIA 1HNZB 5KREA 1CWUA 1X7HA 2P6PA 4EGJA 4HDMB 3CVVA 3A1UA 4BO5A 3K1AB 4OQZA 5FX2A 5KUTA 2UXCB 1L0BA 4N48A 2OXIA 3G0GA 2IXFA 1RWMA 1WPGA 2D3WA 3OFND 4NCKA 1GZSA 2P9HA 2IYOA 3ZY4A 1E89A 1X7GA 2B7CA 4N7RA 4V0KA 1IHOA 3V8QA 2O5CA 4RK4A 1YZTA 3HCPA 4MV9A 3UJ8A 2ZG6A 2X1MA 3SDBA 1NW6A 2VHUA 4L5YA 4MQFA 3K5PA 1FYDA 5CLJA 4YRIA 2MJLA 2Z9BA 4Q4AB 1D0VA 2V1XA 1CYEA 4H1UA 1ODTC 1NJ2A 3OIDA 2Q8PA 3HA2A 2KQUA 4G0UA 1F17A 7MDHA 5K7SA 1NASA 1Q5PA 3LJKA 2FV8A 1Y7LA 1ZRNA 1Q19A 4IGEA 4LXIA 1RRVA 1VLQA 4CM9D 4ZV4A 3QSYA 1G59A 1QS0B 1RLMA 3WLPA 2R00C 4FOPA 2JC3A 2QM7A 3WZLA 1SH7A 5A02A 5IT4A 4MVJF 3T5DA 2QMOA 4J0FA 3UATA 5EVJA 3OEEA 2P9BA 1L7EA 4H6PA 2A84A 5E95A 5LN1A 1GG5A 2P67A 1X7ZA 3QFRA 4IGIA 1YB4A 4RFLA 5EEGA 5FUVA 5JPCA 2A1UA 3SEAA 4IDAA 2RAFA 1USIA 5CT4A 3SE7A 1NURA 4RD3A 4AY3A 1MJNA 2N47A 3K9CA 3WGYA 1UBCA 5JR3A 2ZIAA 1EFDN 4XWOA 4NPHA 5KOHA 4N8DA 5HF9A 5DGXA 4EW1A 1YZYA 2M6LA 4BFCA 4O63O 4DRXA 5JSYA 1GT91 4BO6A 4TV9A 3TRHA 4EKYA 4I3FA 2Z57A 2QD5A 1DIGA 2BE9A 3MVEA 3C0KA 1IHXA 2HKIA 3V7NA 5FNVA 4DMUB 4JQCA 4ZQEA 4ZTBA 2ZYTX 1VFNA 1EM6A 3CNOA 1FB5A 3TW6A 4YROA 2VCHA 1SC9A 3IOCA 4ISCA 4DWJA 4BNJA 4D2IA 5KYNA 1NBAA 3UFXA 3SP1A 1JXMA 2IHTA 3ZWMA 2H18A 3WNQA 1Z4JA 1BS2A 2HDNB 3LCUA 1IOVA 1EP9A 1NF2A 4H0FA 4MKIA 2ECKA 2ST1A 3R6TA 2Y1GA 3KAQA 3M3PA 3OLWA 5I9BA 4F5WA 4PCUA 2D6FA 2H7VA 3GEHA 1OF1A 4FEAA 2Q41A 1NQOA 3GI1A 3UMJA 4Y0NA 4IH4A 3L6OO 3N2GB 5GMOA 3VH3A 1QMGA 4K8OA 4Y7CA 5B36A 3OQMA 3M5WA 4TLCA 2GXAA 5EUQB 2XZLA 1YB6A 1DRJA 2POQX 4N03A 3U3XA 5L8VA 3I2YX 1Z34A 1G8MA 1NQXA 1PT5A 1WVMA 4YP6A 4BWYA 1YR8A 3T4PA 1PE0A 1RM3A 4U5XA 2HJWA 2R8XA 4FIZA 5DBFA 1DLJA 1QVVA 3T7TA 4AMVA 5IT9A 4DOMA 2O8BA 4AY4A 2GCPA 4MYTA 3AR8A 1J70A 4EHAA 3CVYA 1DDIA 1LEHA 2LR0A 4MINA 1Z6QA 2BI8A 1UQTA 1RAHA 1B0PA 4YR9A 1GAXA 2ZKLA 4B4KA 3UHOA 3UVEA 2O2IA 3FR8A 1EQAA 1GXSA 3KFVA 1KRXA 1XXLA 1YKSA 5HYVA 2A7XA 1PN3A 3KKZA 4B3IA 4D4LA 1M6VB 5FDFA 5CA1F 1FDOA 1KJ8A 4OAQA 3TD9A 5FOQA 1KWGA 4G8CA 2R7NA 2FFAA 4Q6BA 1V1RB 2Y76A 2BGNA 2AOTB 5T6BA 5EZYF 1SBHA 4KQGA 2Q2NA 1XCGB 4U2DA 4W7IA 4MVXA 1THTA 3D6NB 1PRYA 3NRBA 5FUYA 1ZM9A 2Q21A 3CMCO 1FTSA 2JFVA 3S2UA 1Z29A 4JGIA 4NE9A 4QGFA 4IOMA 2C7RA 3ZGYA 2P5TB 4Q1BA 3IP1A 1U0OC 2NTJA 4PZ0A 4W5RA 1QQ7A 1R6AA 3UC5A 1PGJA 1U3UA 2NZVG 4BPBA 1C3LA 2AGVA 1ZD1A 2BEUB 3FSJX 5JQGF 2EG5A 2HLHA 2AG0A 1X39A 1XEFA 4Q00A 3PK0A 1LSOA 1VCOA 2W6JD 3VNSA 3WWEA 1XN1A 3DVQX 2OHVA 1HNNA 1TC2A 4JLUA 4UFNA 1LPAB 1Q2XA 1PZNA 3GN1A 2W90A 2BMVA 1F8FA 4I5GA 4XDZA 3I32A 1V47A 4FDMA 1VXOA 2ZYSA 5I8PA 1OX4B 4ZCQA 4ZEXA 3GCGA 2BM0A 4GI2A 4OXQA 1RQNA 1ZJWA 4FR5A 2CLEB 1EFRD 2WIFA 4UNSA 5EIFA 3VR0A 2I1LA 3VTFA 2BKAA 4TS4A 1A4RA 2RHRA 4Q15A 4DUGD 2BW0A 1WCYA 3DNPA 5CYFA 4ZTUB 4CTOA 5DHUA 4BN0A 1B7GO 1N78A 3QE2A 3UAOA 3BD7A 3FPHA 4GBED 2WYOA 2I5PO 1NLYA 4GICA 4KBYA 5CYGA 5IZCA 4WXMA 1OFTA 1AXEA 4FT4A 4NMWA 5FPHA 2QRGA 3TSAA 1VM6A 4WCDA 2BGUA 3PJFA 3H6GA 3KO8A 5F76A 5GP1A 2ZWOA 4EYKA 5A9RA 2O8DA 5EMLA 4PPYA 2PYZA 2L42A 1R9GA 4QJ3A 3ADCA 2OC4A 2CJXA 4I5DA 3TEMA 3IDOA 4YAKA 3UCXA 5FCDA 4YONB 3GLIE 4EY3A 3A0RB 3R0ZA 2Q2QA 4WA8A 1NP6A 4WXHA 4TUYB 3OZWA 2RI1A 4BRUA 2CD9A 4I4TB 3U3DA 2BMDA 2AVNA 1GQQA 2QMYA 3EGWA 3K8QA 4B0PA 4BYMA 5IULC 1UBKS 2BFFA 5ALYA 2Z8YM 4O8ZA 5HKKA 3EC2A 1DTEA 3K1YA 1KFBB 1T6ZA 4XVUA 1UT8A 2H2GA 2VDWB 2C2XA 1SC4A 3RTEA 3D0RA 4Y9TA 4IMRA 1VSBA 3VNBA 2CDNA 2E1PA 3G5AA 5CDSA 4PZZA 3K9NA 4MUXA 3SAJA 4ER3A 2Q0QA 5SYMA 1T34A 5TT0A 2PUHA 1BXGB 4ZQHA 3RI3A 1Y81A 2ZI6A 4W9NA 4ARUA 4WY2A 3USZA 4XWAA 1SOVA 2AFVA 1QG2A 2FPIB 3KLBA 2JIDA 3QA9A 3QPCA 2PH1A 4W4TA 5AJXA 4BXOB 2Q2WA 2JCXA 1VG9B 4B6SA 3TUJC 3OJ0A 1IPFA 3R9KA 4TS9A 1WUJS 3E4CA 1F4VA 4GFDA 2GPJA 6CHYA 1ZRSA 2X8JB 8ATCA 3I1FA 2H2FA 1KO1A 3RASA 3JPYA 2V7VA 3MWYW 4URFA 4JJKA 4ATNA 2ANBA 4IFIA 1W0CA 2GPWA 4JHLA 2QQFA 4E5SA 3AHFA 1M1XB 2FZKA 3HV0A 1KP2A 2C4HA 3I76A 2BVNA 2IZZA 1IUKA 3C3CA 4C0LA 1YMQA 3C7CB 4CHGA 4DT1A 3CKLA 3INTA 4PSUA 5D3KA 2JFGA 3L1HA 3SEZA 1A4UA 2XVAA 4GG1A 1I9CA 1ID8A 4WCFA 4MQLA 4WKPA 4TTVA 3KQTA 3DMGA 3VNRA 2HREA 5AW5A 3P0JA 5KHAA 4OFZA 4AMGA 1G2QA 4MIYA 1CIPA 1LW6E 5EIXA 4XQ9A 4L72A 3SSMA 5JSHA 5JD5A 1NSYA 2GERA 3NLLA 2FQYA 4JSTA 5AXAA 5GONF 1RWVA 3M6IA 5JMPA 5JROA 1UM8A 4K03A 4NJMA 3ICEA 2I4TA 3WK4A 4EHFA 2N1BA 4MYUA 1DKRA 1PVVA 5B7PA 2PGAA 3LRPA 2OYCA 5AVYA 2Y0EA 1F0PA 4FNOA 4W1RA 5DNCA 1L4YA 3VNVA 5KJ6A 1XWWA 2IZ1A 4AM8A 4CLEA 3PPIA 2XHEA 1M6HA 2VAXA 4I4LA 4QOHA 4TXLA 4G6ZA 4UMFA 3DUFA 1RRCA 3FTEA 1RIFA 4PLWA 4RCVA 3CLTD 2RG7A 1R8XA 1HE3A 4NP6A 3B5IA 1ZSVA 4B3CA 1T8SA 2IEGA 1NFRA 4INZA 4QXAA 5GOZA 3TLXA 4BO3A 4ZAYA 3FKQA 1PAUA 1QHIA 5CT6A 4CQMD 3GLHE 5G4LA 4MEAA 2GSDA 1F2VA 3GRCA 4OSOA 3N8HA 2IW3A 3PGJA 3RVMA 1BTOA 4BTLA 2PD3A 4H16A 1QBKC 2F64A 2G6TA 3RRZA 1IMOA 3IQFA 4J9VA 1ZU5A 4NV0A 3WBFA 5IKMA 3A8TA 5IEBA 4ZYYA 3C48A 3COYA 4H7JA 3HVUA 1MENA 4AG3A 4B81A 3TXAA 1ECCA 1RC0A 1GGJA 1RCFA 1DV2A 1TI7A 2VPWA 2XUPA 1PJTA 1P6XA 1SVWA 3L05A 4AMYA 3AV0B 4BCCA 2EERA 2VXCA 3FTCA 3E9EA 1O95D 4N5MA 2QUHA 4GH5A 2HQ1A 4BNZA 1A5SB 1PHRA 3AR4A 1EHCA 1Z4MA 4A0RA 5FTWA 1QP8A 4QUEA 4M54A 2WHQA 3D7SA 4HEJA 1VKHA 4TLEA 4LXHA 1QM5A 2H1IA 2VATA 2O7VA 1YNOA 3ODPA 3NYIA 1PX2A 2XR1A 4KO1S 4RHEA 5D3ZA 4CODB 1B23P 1IY8A 1DFIA 2DSTA 2QZSA 4JDPA 1Y8QB 3S1LA 1E6LA 1EE1A 1DKUA 5EKUA 4EAQA 1L7NA 3FXAA 1SUPA 5FT9A 4HC4A 2AYZA 5JCXA 1Z6ZA 2A0WA 2NSYA 2W6PA 3ACBA 3EIQA 4LXXA 3TSCA 3ZZTA 4CT4B 2P2LA 3O1HB 3OKFA 2H4ZA 2H8GA 4JD5A 2DR2A 5DYGA 5G0VA 5C8YA 3PQ3A 1RJFA 4IX1A 1LDBA 4L8FA 3GY0A 1RJ9B 3S4YA 3WQHA 3K7EA 3RFTA 1L5GB 2P9JA 2AW5A 2WJYA 2E5FA 2HIHA 1RABA 1Z7GA 4GL4A 3VC2A 1OA1A 3IVMA 1KH2A 3RO7A 3Q1LA 1CDOA 1T9DA 1ZBDA 4X91A 5ARCA 5B2FA 3Q6MA 4LYEA 5IJ0B 2FPOA 4YP1A 1UR5A 2QUZA 3EGDA 4GI1A 1P1JA 5SY9A 3V2UA 4GLOA 3FHLA 1AF4A 5G3ZA 3C6BA 4AYXA 2LUOA 4N1AA 5KJCA 1N8KA 4HSEA 4MGYR 3O4GA 1AA9A 1JHRA 5JY1A 4QE3A 5CD1A 3GLFE 3R3ZA 3UUWA 1FC0A 1U90A 3G7NA 3C8HA 1GV1A 3QUBA 1OTHA 4YJ2F 2WZCA 4QREA 4KK4A 3JSAA 1UJ5A 5IJ9B 1Y9JA 3KD2A 4FE4A 2IXDA 1XTZA 4NZ9A 2XTZA 2JFXA 4L8YA 1M10A 5H4GA 2IYAA 4DQXA 2JGMA 1RSZA 2AWOA 4HUTA 4QIHA 2B4TO 3M6XA 3TM4A 3DDOA 5I7OA 3B5JA 1XMQB 1BA2A 3Q7EA 5KCZA 1G17A 1U9ZA 3OO0A 3UJ3X 4XKJA 1JSCA 4HAWA 1QCCA 4I9NA 4RSHA 2WWFA 1J00A 3K9GA 4L50A 3DMRA 4YY3B 2W2QA 3ZVMA 1QX3A 5J23A 4ZEWA 1BROA 1PNTA 3E1SA 2BLNA 4PQGA 3UWOA 1THMA 2EL7A 3GPDG 4ER7A 1E3DA 3MLAA 4K26A 4V3BA 4X7MA 2ZYRA 4ZZ3A 5K3OA 3HLTA 2H7YA 3RK4A 5IYZA 2AN5A 3B2NA 4HAIA 2QGZA 1DKQA 5JNVA 1VMIA 3WIEA 5HIMA 3UYKA 1QQAA 2C2KA 4ZJYA 3JVUA 4CKCB 1CEXA 3RV4A 4HVLA 1RWQA 2VP9A 3GFPA 4GOJA 4PC2A 1KVUA 1PQUA 1ZVQA 1XLUA 1YJXA 3Q10A 1RTKA 1WIWA 3QXXA 1GDHA 2XUHA 5E9AA 2I29A 2PRJA 4H35A 5FAKA 3AUJB 3SLGA 3A31A 1G3RA 3LFHA 3B52X 4I55A 1XEWY 2I8AA 3F8SA 2VUSA 3JWEA 4R68A 4XIIA 2QGNA 5ENVA 2VN8A 2G17A 2VL7A 4OMDA 3DKIA 3R41A 3A14A 3EHDA 4Y6GB 3M6VA 3MT0A 2OCIA 2GF2A 3GJQA 2PMCA 1EP1B 3GJZA 5JSUA 1D6MA 2QRKA 1TEHA 2DBYA 1D2HA 4FSXA 4ZC1A 1SXIA 3C39A 1Z2CA 1YUMA 4WNCA 1QE0A 4HNRA 5BYKA 4NCXA 5LQCA 2R7LA 3SZOA 3K0KA 2C00A 3PNBA 3UKOA 4B83A 2X14A 3ZJUA 2V7QA 1HG0A 3WZMA 2EFCB 5IVIA 2UZAA 5L7YA 1DGQA 1DPFA 1P9RA 2HF8A 4IX9A 2XRYA 2VP5A 4XCQA 3CLVA 3ZV7A 1L7RA 3HXQA 3CXRA 4PAWA 1EZZA 4BVHA 1O58A 1XN4A 4MAFA 4RC9A 4CKWB 1C29B 1QYWA 2WE8A 1CJCA 1MAUA 1WP4A 3M0EA 1ZHHA 1V5FA 1BE1A 4LHVA 5KDOA 2IH4A 3AGQA 2V5AA 3EOZA 4DIKA 1I7QB 5C1OA 1AHHA 3M9LA 4IGAA 2WV9A 4ZDKA 3LT5A 1O94D 3LL7A 1VSVA 5AT1A 1Y5IA 2EKZA 2QL5A 5F77A 2R00A 3RGWS 4AK9A 3MMZA 4FFPA 4MYCA 4KPEC 3A9SA 4ESHA 1R4AA 2RGEA 5CH5A 2ZI5A 4KQXA 3CVWA 1EWVA 3I2KA 3PHJA 1NULA 3WGUA 2D7DA 3K5IA 3WP1B 4C6TB 1KERA 4NV3A 2B8TA 1W59A 2J46A 3A0UA 2C61A 2V4ZA 2ZE7A 4BN4A 2OV1A 4HF7A 4ZOLB 3B36A 4Z1MA 1N36B 5JFTA 1HH4A 5CT9A 1TD9A 1X0XA 4NHOA 4C7OB 1FSSA 4YMWA 1U2ZA 2JHAA 1LPSA 3F49S 3IKJA 3OP4A 2XVMA 5IAGA 4B4OA 2EKQA 1VQ1A 4QQ8A 5AW1A 1N6LA 1R37A 1O8BA 3TPFA 4A03A 3UAGA 2PVPA 1UQRA 4IDEA 2FW0A 2OK7A 4KQ6A 4YK7A 1XKTA 2G08A 5HCIA 2R8RA 2QSUA 5IDXA 2AEEA 3FUXA 3K1AA 4Q0MA 5EJEA 2VJMA 1UBNA 3CG0A 1KJQA 1Q12A 3AEKA 4Y1EA 5CDFA 5DYTA 4GOMD 2Z58A 3EVNA 1N5IA 4FGWA 1XKLA 5MGBA 3TTTA 3VTZA 1M8KA 2G09A 1QH0A 1DZ3A 3R6GA 3T7KA 4X64B 5D3QA 3AY3A 3K16A 2XTMA 4WW0A 2FOXA 4HCJA 1DARA 3V4FA 3Q1KA 1U8AA 2TRSB 1NJSA 2WWVD 1E2NA 4Q4AA 2GA9A 4TMWA 1JIJA 4QNNA 5AWFC 1M83A 4IV5A 3QTBA 4R0MA 1E0SA 1N1GA 5CD9A 3OWOA 2E89A 3BB1A 1V96A 2NAFA 4PS0A 4RELA 2XT9A 3TQQA 4BATA 5CAEA 1QS0A 4XGKA 1N2JA 1DAPA 1P0IA 2CZGA 3CGWA 4MW6A 4RVDA 5T64A 4BZXA 1GZ5A 1HE2A 2ZR8A 2IY8A 2Z83A 3QWIA 3FWYA 4Q3EA 5CW1A 3GUUA 1HFKA 4JODA 4U2CA 2NXCA 3S68A 2ZRMA 1QZXA 1YIAA 3PGXA 5AJVB 1W29A 2AR0A 1Z7YA 2DRIA 4TTRA 4B85A 1D5CA 4IV0A 1C9MA 3FA2A 5EJ2A 1FUUA 5IAEA 2VWHA 5KQSA 1GPJA 1YZUA 1ULAA 2WP0A 3GLGA 1SC1A 1K3UB 4P86A 4C22A 2PMWB 3W6OA 4KGVA 4MV6A 1H65A 3PFHA 1JSLA 5ICCA 3CPSA 3TDMA 4YWHA 3VU3A 3TINA 5LP6A 1EWQA 4MKFA 2DPGA 2OSVA 3BWCA 3PFWO 2PX3A 3SFVA 1FFHA 2BGMA 4BNKA 2XB2A 2Q4TA 3OX4A 6YASA 2RGDA 2YYZA 1E98A 4YV1A 3H97A 3VU8A 4BMZA 4XH9B 4BLQA 2Q9UA 4ZYVA 2LWIA 1XAGA 3CA8A 3HJNA 4HGPA 3CMMA 1SCDA 3VA7A 4P1ZA 1FFYA 2DETA 3JATB 1CDDA 5I8WA 2AKAB 3SX2A 3LH5A 4B34A 4BHTA 4EKNB 1E1RA 5EIEA 1Z15A 2Q4RA 1GGMA 1UQUA 2TSYB 4P6VF 5ALMA 5U4QA 1L7QA 3WHPA 3T5BA 3TR0A 4BFZA 5KYWA 1M6WA 5HZMA 4IOKA 4O25A 1M1NB 1E2MA 2ZJFA 5BR1A 1P2DA 1GSIA 1QDEA 1U3TA 3BZWA 3NM5A 4AUEA 1TGVA 4DLBA 1K2VN 1D6NA 1R15A 4XIGS 2FX5A 3I9KA 2WJZB 1EX1A 4KQKA 4BBZA 5JD4A 1DV1A 2O9JA 3ZX4A 3KNZA 3JQGB 1CUHA 1SBQA 1AKUA 3GGSA 4H7PA 2ZVPX 3DNFA 1A5AB 5CIQA 3ADBA 4FYJA 5J59A 5KQLA 2R9VA 2HK7A 1GVNB 1JMVA 1E9CA 1V9SA 4MV1A 5IPFA 2Z8XA 3IUQA 1HNWB 1WLSA 4PSVA 5L7TA 3D4LA 3VC7A 4ZV7A 4ZVQA 2Z1NA 1LJUA 3V42A 3CISA 1VCHA 1Q74A 1W2WB 1YVEI 2D8AA 1Q7CA 3H0CA 4Z7NB 2AFIB 5DCYA 1O0CA 3AOGA 3ZN2A 4IFBA 3UKDA 1KOGA 1JIKA 2O06A 3GWGA 4HDAA 3A4IA 1PK8A 3OOSA 4WKGA 3W78A 4C21A 1IXSB 4CL0A 5JEEA 3QPDA 4NULA 4WWHA 2JKZA 3EBLA 1WL8A 4JKIA 2H9YA 3WS7A 3U6KA 2RB5A 1NFQA 4AWAA 4UEWA 4UBJA 5F2EA 4DR3B 3P32A 1ZITA 3U9TA 3H83A 2PRKA 3GHYA 2B34A 5AICA 1SULA 4JLMA 1G41A 2V7WA 2OOSA 4Q3NA 1M6VA 1E79A 4NSNA 3ADDA 4J3JA 3QMWA 3BTUA 4IDBA 2ZUCA 2V55B 2VHTA 5ALIA 1V1RA 2FW6A 2AOTA 3RIGA 4JI3B 4BMXA 4EZBA 2DZDA 3NETA 1PJSA 3MN1A 1KYVA 3E9RA 1EHYA 1DHRA 4DIBA 4PCLA 4BMDA 2B61A 3M6MD 2PZKA 2VDKB 3TDNA 1E7MA 2H4YA 5TR9A 4UEJA 4RLHA 5LBTA 2ZYIA 1OTXA 2QN8A 3ZBTA 2VEOA 3M6UA 4FEYA 1JSRA 521PA 2I2BA 3FUVA 1QHGA 5TEVA 3TQSA 4PHGA 2BEUA 3BICA 4XGQA 1AV7A 1W1UA 3IEXA 1GDTA 2CV1A 2PZ8A 3QXSA 3MCAA 2HHLA 3W8EA 1QPZA 5C34B 3RSCA 3GAZA 3E35A 2O23A 1TLTA 1X87A 2PGOA 3E3NA 4YCDA 3IR6A 3G82C 1TYCA 4AO7A 1TDJA 3WLLA 3P5SA 1DAKA 2IYSA 1FFEA 3FFXA 1C0EA 1KJZA 2I3BA 4I50F 4PPGA 1YA8A 4PLZA 3KPVA 3T4UA 3TTSA 2ZIXB 3PQ5A 3CO0S 1OX4A 5TX7A 4U7HA 3NTVA 5K4AA 4MOWA 4QRIA 1Z06A 1DWUA 2QD4A 2WZQA 5MN6A 1UKZA 1VKNA 1S7CA 2AOUB 2FN8A 3B9QA 4G0MA 4NCIA 3WOHA 5CNJA 4OH1A 3GEPA 2Y1XA 5CXQA 4I1IA 4ZC8A 2DUNA 3OCYA 2RE8A 2QD1A 2R44A 2E4UA 3QV2A 1DDGA 3GGCA 1ZP6A 3BORA 3CLUD 3SHVA 4LVCA 1YZVA 4KLCA 3BF7A 4LSZA 1WB5A 2WAOA 1Z74A 5AW8A 3SEQA 1DCTA 5LR6A 3D3NA 4YXWD 2D1YA 2ENUA 2WHXA 3QNUA 1KU0A 4G5SA 4KPUB 5E7MA 5ALPA 1NOIA 4JBLA 3ECCA 3VO9A 1F2TB 1NI5A 2X2PA 3IFSA 3NVAA 5G1NA 2B0JA 3H11A 3WWCA 4FOLA 4D80A 4TUYA 5EXEA 1TL7C 1KSFX 2NTNA 2P62A 4ROTA 2IODA 4L8VA 3DL0A 4I4TA 5LP6F 2IHYA 4GWGA 1IN1A 2JFUA 5H3LA 1BQ4A 1HG1A 3UHFA 4L8WB 4MW5A 3U61B 2C99A 1R5JA 1M5RA 5LMUB 3QBDA 2VDWA 1LF5A 1P7PA 1QWOA 3BIJA 3ZHZA 3F4KA 5JCJA 4BZPA 1HA3A 3GG9A 1OKKD 1JHXA 1IXRC 5FLKA 4MEBA 2GRJA 4JI7B 2VUTA 2XVZA 3ORSA 2ERCA 5HF5A 4EB0A 4ZYZA 2KHZA 4IDFA 1KFCB 3N75A 1CY4A 1VP3A 1KYWA 1L3IA 4GXQA 5HUJA 1X1CA 1XJWA 1SHTX 4QUAA 3AU9A 4WUVA 1PSWA 3F3SA 3PQ8A 2FZLA 4HBGA 1Z5VA 2XNSA 3FCCA 4E2WA 1C0IA 1UC8A 3AWIA 3DNMA 5AM0A 2PK3A 2HCFA 4NICA 4IQ8A 5SY6A 1J1IA 5ALEA 4LG1A 3TQRA 1LV7A 1JXQA 1GCOA 3KT0A 3NDRA 3QX9A 3I3SR 5D5QA 4C7VA 4CEHB 4C6SA 1Q83A 3CNNA 2C0CA 1NKVA 3HBNA 2JEZA 4H4CA 1MOSA 1ZD8A 2WOOA 5IHXA 1K4KA 3AP3A 3TI9A 3OQIB 4R7GA 5IW8A 1Q7BA 1MAWA 2AJTA 3E9CA 4L75A 2F6RA 2CGEA 2PFKA 3VFDA 5KVAA 2A4MA 1L5FA 1LQ2A 3R5KA 2AHRA 1U8TA 4A6EA 3VR1A 3LUHA 2G7ZA 4Z6KA 1KKUA 2E6UX 1CG6A 2CXTA 2IRWA 1QF7A 4HEHA 5DOZA 2P2NA 5D6NA 3ZZUA 2F3PA 3TXXA 2QTWB 5FTNA 1T6BY 3BBLA 3U7QB 3VM6A 1EX7A 3ASZA 1VJGA 3A25A 3B20A 3JD1A 1QPGA 2IIBA 2QZPA 3ID6C 1TKBA 4HQNA 4UTPA 5JIBA 3D3JA 2QB5A 5JSKA 1Z88A 2PBFA 3T0IA 3AR2A 1Q15A 1SQGA 2B83A 2BTQB 3FKJA 5ALNA 2YUTA 3X1XA 3ZU3A 1G7CA 1GPBA 1RHMA 4KZKA 4B8YA 4TOIA 4KHZA 4V0ME 5AVTA 1FSZA 2ID9A 4G56A 2I2AA 2Q1YA 4AZ0B 4HN9A 4O2AB 1SD5A 1TCUA 3NDJA 3SFZA 4QD3A 1X1AA 4RZXA 2G1PA 2XUJA 1TMYA 1F2UB 3GD7A 1W9HA 1Z9BA 1UXHA 2J0UA 3GW8A 2LIPA 3ZLVA 5I7HA 1CF9A 3P0RA 4G5OA 1V8BA 4L5BA 2HPHA 2P9GA 2P27A 5CYPA 4CI9A 4QXOA 2CDRA 1QHEA 3DLBA 1SY7A 2Q1TA 4RQBA 3S44A 3GNTA 4P53A 3VVBA 2IU0A 4PRYA 1TQ4A 3EOAI 1TVKB 5EPUA 2ZBDA 4ZU6X 1WPQA 1KDVA 1G5IA 3ED1A 4RJIA 3MUNA 4WVLA 3P0EA 4QPPA 4RIEA 4A73A 4CF3A 1P0CA 2A5JA 4KR2A 1TC1A 2GJAA 3T1YB 5IDVA 1XQVA 3DKKA 3HNRA 4NBKA 3T1HB 2GKSA 2PHZA 4F5DA 3L2OB 2OV6A 4FMBB 4C0HA 5ALRA 2VSQA 2CVZA 1VGRA 4M7RA 3ITEA 2PQMA 3Q85A 1LY1A 4P3XA 3UA3A 3X1DA 4AJHA 3WVNA 4AJNA 1S5PA 1ZONA 2ALJA 4UEQA 2JD1A 3SNHA 3U7GA 3CZCA 3DFUA 4TYWA 5DW0A 1BX0A 1Y8QA 3RVBA 1H0KA 3BE8A 4NMLA 3DDWA 4OQPA 5HFNA 2ISCA 3A3KA 2ZRJA 4JJFA 4I0WB 4WE3A 5I9MA 1N0VC 4KSBA 4H6VA 4J0EA 1JU3A 4B3GA 2FOLA 4R84A 2RHDA 3FPLA 1YFLA 1JFTA 3UBMA 1XZEA 1GADO 2AC2A 2C7VA 2OZVA 3CVXA 4S0XA 4NBTA 2VXOA 3N7UA 4GS5A 1Z5GA 3X3HA 1RYNA 2G7MC 2WIJA 1FJHA 1RJ9A 2OP0A 1XPOA 3HK2A 4D42A 1Q7TA 1E4VA 2HPAA 2OECA 3LA6A 4DDWA 3UPTA 1GA4A 2EBFX 3RG8A 3OE4A 1KTVA 1VLLA 2NVWA 4ER6A 1TM1E 1JX6A 4DQKA 4I2VA 5IJ0A 5JWRA 3AVPA 3NIGB 1EK5A 2HA6A 4BMCA 2I76A 5L3QB 3P2JA 1DL5A 1PR2A 1WDTA 5EMMA 1YZGA 621PA 4JLKA 4YP0A 4W1QA 1Z7BA 2E3JA 1V6CA 3WISA 1FTYA 1IM8A 3NAMA 5JEDA 4H3KB 3VX3A 1RQ2A 3RVJA 3SC2A 1GRVA 2G25A 1BG6A 4OIFA 2JLSA 2H7XA 4EJSB 1JEJA 5FOUA 3S2YA 5A5VA 4YRKA 1SZCA 3WXBA 5IJ9A 4F72A 3I9JA 2EBHX 4QGAA 1L8QA 4C5AA 3TGPA 3OQHA 1XLWA 3TL6A 3DL4A 5AH0A 2OO3A 3U39A 4RPLA 3ZDFA 2MSNA 5CLQA 1JHVA 4I4NA 1I2MA 5LDHA 3UK7A 2F8LA 1DJPA 3Q8KA 4DA7A 1OR8A 4G01B 1GUYA 3E8MA 3G5MA 1JTVA 2I8CA 2DULA 2IOFK 2HLPA 3FVTA 3T3OA 2H4XA 1WF3A 2MYTA 2R8PA 4GSYA 1ZCFA 3MINB 4JLBA 1YUBA 4N6NA 4PAQA 5KX5F 3WGZA 5LIPA 2ZUWA 4DV2B 1G4UR 2WKWA 2ORVA 3O4JA 4N6OA 1ZSYA 3G0DA 4JLVA 2VEDA 3ISVA 3JZDA 5BMVF 1H5UA 3F9RA 4JK3A 4YMTA 5I51A 2C2YA 2X5OA 3DWFA 4MZXA 1OPRA 1TZKA 2L0XA 1QHHB 2MSWA 3OM8A 3LUKA 1XJCA 3AUTA 4BWVA 2HMWA 1TKCA 4MAMA 4TVOA 3TZKA 3W5IA 3ESDA 2PE5A 3HR8A 3PUYA 3ES9A 3HDQA 1W6RA 5IC5A 1AF7A 2PL3A 4PG4A 5EUBA 1PNOA 1XU4A 4IG4A 4L5IA 3KSMA 3BRWA 3CZRA 4G0QA 5A05A 5E8JA 3OTOB 1WBBA 1XB2A 1JG6A 5DPMA 3QMMA 5GIOE 2ZRDA 1QDLB 2WD9A 3QHPA 4M0UA 4QDOA 4JUFA 5LA6F 3WTCA 5K0JA 3HJTA 2FX3A 2HF9A 1KSHA 1H2HA 1C30B 3FSGA 1MB4A 1RE0A 4IS3A 3SQWA 1RQPA 4G0NA 1BJRE 1E9SA 1PEKE 5CMLA 2QM0A 1E2EA 2IU3A 1GNRA 1R8YA 3AY6A 1SVUA 2FETA 3DMTC 4WOKA 2ETXA 2ZSHA 3VPBA 4BTEA 1GNQA 1ML3A 1RI3A 3Q8LA 5K3SA 3GG2A 4GLJA 5B7QA 3FOFC 1UBRS 2IA5A 3TQFA 2IGBA 2QN1A 1VJ5A 4LZLA 4JXJA 3PGKA 3RAFC 3Q8XB 2HC9A 3C3MA 3TQTA 3PDCA 1DO0A 1I4OA 4A2QA 1BC5A 2TYSB 4RMGA 1XZKA 2ZS8A 5AM1A 2VRNA 2WJHA 2OM6A 2CC2A 2J3KA 3PGLA 1PK7A 2PNJA 4EG5A 4CKWA 2WYIA 3TLKA 1Q20A 1Z0KA 3F8WA 5BW5A 5C7IO 1D8TA 1BE0A 4RYDA 3OIYA 2X0JA 4O8CA 2WYVA 3ROGA 2F1KA 1Y1LA 4DY4A 1KRWA 4HNSA 5JHGB 1T5TA 1XELA 4Y6PA 5KHOC 4DA8A 1JI3A 3QYFA 1IPHA 4JX9A 3SHFA 1JDVA 1DCFA 1SNYA 3AG5A 3EAFA 3LXXA 3H84A 3TLAA 3U17A 3W8DA 3GNLA 1BMFA 3T99A 4KO8A 1GEEA 1HYQA 1PW5A 5CCBA 4YRPA 1E3JA 4UUAA 4KKXB 3BD8A 4FYWA 2RHHA 1QXSA 5BT8A 3TF5A 4C6TA 1O54A 4BNVA 1E2JA 1RBZA 4UTXA 3UZUA 3ET5A 3HY3A 2QSZA 1E5QA 4KPGA 1YE5A 1A8QA 1N1DA 2NADA 2X15A 1HETA 4FMCB 3CWZA 4BJHB 2ZFUA 4QO7A 3UGKA 2EJBA 2PV7A 1IXKA 4XIFA 2QV0A 4ZOLA 3GLHB 2WM3A 1M72A 3QW4B 5C3UA 5JCZA 1SKYE 1NOKA 2EIXA 2NO1A 2OD9A 2JHCA 1JGTA 3FPEA 3QVJA 5BYJA 4C7OA 2CFIA 1SD2A 5DK6A 5EAIA 2JATA 3OAAD 3M83A 5ENZA 5ITSA 4BKOA 4DJDC 2O2EA 4KRGA 4ZAVA 1ABBA 4OXRA 3O83A 4EYOA 3M34A 2QTMA 2KWIA 4QQKA 2GEVA 2BFAA 4X20B 5AFSA 5TLSA 1IJBA 2WD8A 2VP0A 3CE6A 2FR1A 1BQ3A 3F8TA 5B6PA 1AS0A 4XR4A 2V6FA 4K6KA 1XQXA 1G8FA 1EFVB 1RXSA 2HDOA 4TWIA 1KF0A 1JKXA 5B1YA 2DM6A 1NYQA 1I10A 1T3LA 1IJFA 2A59A 2AH5A 4LHSA 4OB6A 3QUQA 3NHUA 4EG4A 5J4KA 1SXJD 4KIFA 4JQYA 4N9QA 3SYMA 5DZSA 3VR3A 4EYEA 5T4BA 4LOJA 1GFSA 2V0CA 4LDNA 1T36B 4BFYA 2YOGA 4HB4A 1CUGA 1KI3A 3UT0A 4PZEA 1QCZA 4QASA 2J5QA 3V8NA 2FEPA 5FUQA 1SWWA 1FTNA 2BFBB 3F5SA 3G8CA 1ZN9A 3OUUA 3WMGA 4CR6A 3UQYS 1MNAA 1XAJA 5SICE 2VWGA 2VHVA 1BCSB 3PTZA 4QBKA 5L4NA 3NFRA 5EQJB 1BJKA 2IUTA 5FH9A 2DP4E 4D5GA 2YNMC 3VMMA 4OL0A 1E3LA 1G1MA 3CN7A 1BWRA 2X42A 4P0PB 2AV6A 4YV2A 3HUTA 1EWYA 2OQIA 1R7RA 2CMHA 3F7TA 4K8RB 3K0EA 3RTDA 4N5IX 3G1WA 1PZHA 2J6HA 3LXUX 3VU9B 3THYA 1I4LD 3IBGA 4DLYA 3SQNA 2B0CA 4QDTA 2ZTLA 4E2FA 5FBHA 2I3DA 2RI0A 1XDDA 5B58T 4TWRA 4Q7QA 5KVSA 1QHYA 1DX9A 4HH4A 4N0QA 4Z0HO 4NENB 1AZLA 1RPNA 1YQEA 4QXQA 3B78A 4M3NA 3ZNOA 1Z5PA 3JQ8A 2NU8B 4PX3A 1PD0A 2XA9A 2AFRA 2V74B 2V9ZA 4IIJB 4BX9A 1CUDA 1D9ZA 1T4BA 4LK2A 3O31A 1PZGA 3GLFB 1CY7A 1EBUA 1K7EB 1KI6B 3C15C 3CH6A 3OEWA 4G1CA 3W7AA 4P7JA 3OZSA 1PUIA 4K9LA 2ZQZA 4DR1B 2Q99A 3E58A 1UJ2A 3K05A 2PWBA 4FBLA 4J07A 5JZOA 5IJWA 3IAXA 5HFJA 1YGYA 4WPGA 4FYHA 2A7QA 3GCXA 3I92A 4YUVA 5TPZD 2FE4A 4UPEA 3JATA 4M21A 3RYFB 4BQFA 3T1QA 1C3EA 2BWJA 2QSJA 1Z3CA 3F5FA 4MW2A 5E9JA 2IBTA 2DTDA 3PNSA 3N6VA 1E18A 4R3NA 5CRIA 4YFYA 4L4XA 5F2OA 1VKRA 4EGAA 4AU1A 1KHHA 2X6QA 4LJ9A 4MHTA 1M1NA 1E1QA 2RC5A 2YN4A 1RXEA 5T3UA 4BNDA 2FCAA 4DTCA 2FMHA 3U62A 4K9MA 5HWSA 2NPOA 2FWMX 4FIDA 1LBHA 2Y1CA 2DH6A 4QBIA 4PQFA 1I0LA 1P77A 2RG1A 3DKVA 3OJWA 4HDCA 3EIOA 1HTTA 1W4AA 2TMGA 1BDHA 4FNMA 1XC7A 4OYHA 3ZNNA 1N2CB 4LY9A 4ETIA 4LZAA 1QF6A 2VHQA 4P08A 2DHDA 4YQFA 5GJBA 2VJDA 3ZDRA 4EQ6B 2AFHE 3H9QA 2UKDA 1POWA 3GJ8A 4OHYA 2XCRB 1YC5A 3SHQA 1IWOA 2UZIR 5EJFA 1FU8A 4MAAA 2YXLA 3ABQB 3W5AA 4MB6A 3M5CA 3S1SA 4E5MA 2NP7A 3JQ9C 1G19A 2H00A 3EY4A 2B6NA 1FMLA 4OMFG 5K3BA 4IRUB 3HFJA 5JFOA 3CR3C 2B5WA 3IO3A 2RHJA 3IDQA 5KWVA 1Y7HA 4KMRA 2C97A 5LD2C 4CR8A 1J99A 3AFNA 5HRCA 1ORWA 4I4CA 1Q0UA 1WDLA 5GINE 4DR5B 4Z0TA 1SUEA 2NO9A 1ZY2A 1MC8A 3FROA 1JAZA 1CR4A 3RF6A 5GV8A 4EF5A 1D0IA 2HK8A 2IDZA 3C45A 3PT5A 3Q2OA 3CF4A 4KIJA 4ALNA 1B6GA 1WTCA 1JHZA 1P1IA 5J2UB 4TLLB 1UFQA 3ZDQA 1GRRA 4JI1B 3PDHA 1RCTE 3JV7A 1LW7A 5LU8A 1F4PA 3H2SA 3GT4A 4OXYA 1WUIS 3ZD8A 3VH2A 3MCZA 4B47A 3OZUA 4UDXX 1E6EA 2GZHA 5JZSA 5CYOA 1MOQA 3F96A 1W4ZA 3C4JA 1XRMA 3D0KA 4N76A 3EH2A 1TK9A 3K2BA 5EESA 5DWVA 3KTAB 1Y5LA 4CUJA 4Y6OA 4PO1A 4NJEA 4WK6A 4XWGA 2JH9A 1YHNA 5BSHA 3D0OA 3KELA 4LW8A 2KX7A 5AUPB 4MX8A 3U4AA 1CU1A 1U3WA 4P4NA 2OZPA 4PFSA 4DCVA 1IZ9A 2BBSA 2P2DA 3NIDB 4PLPA 1P2BA 5BYAA 2OWDA 4JJ4A 5DLQC 1YHYA 2ZB3A 3JQBA 3BB4A 3TH5A 2QE7D 3KIPA 2XTNA 3NM4A 3PC6A 2BZGA 3VJMA 1FDWA 1QNLA 3IBCA 2HXSA 4GRAA 5ADWA 4TXMA 2ZIXA 1G8GA 2X9QA 2E5LB 2HL6A 2XOKD 1ISRA 1QK4A 3AUUA 1JG7A 1T6XA 2II6A 4R8RA 1QV7A 5AHWA 3BL8A 3KXPA 3PWTA 4XM0A 3J80A 3R8XA 2CLDX 1SBYA 3JQ7A 4IUDS 1Z62A 3C14C 1Q7RA 3F78A 3HB4X 2JIOA 3KUDA 3H8SA 1VKJA 2C2ZA 4UCFA 2XE4A 4JX8A 2GHTA 4H4DA 2JG3A 2BC9A 2A9VA 3IA2A 4O4HB 1T2NA 1X9IA 1UBMS 2FZCA 4R2HA 3ZS9A 4QT0A 4E2YA 4GZ6A 4N39A 3UKJA 2AQIA 3GVIA 3DOOA 5IVKA 2VOJA 4RF5A 1SCJA 4JY7A 4KPUA 4C04A 1B3BA 1H6CA 2UZ0A 4G0YA 5LYJF 1N8TA 2JS7A 3O0DA 2O1EA 3HI4A 1L2TA 1B93A 2NSHA 3OQVA 4TWBA 4OJQA 5L3RA 4BX2A 2A3RA 1YRAA 2R4TA 3HYSA 3OE1A 1Z68A 3FUTA 4QXPA 1ZC4A 4DLWA 5EHXA 1Z8HA 4XSHA 1TFUA 1VB3A 1NT2A 4S12A 4WK0B 2QQ0A 2W2MA 4NE2A 1WW3A 1AC5A 4A0GA 5GZ3A 4YJGB 1PQ4A 3ZIAA 2Q28A 2HBZA 4GQAA 3QX3A 2QX8A 3AVTA 1SU4A 2BFOA 3OJFA 4FEEA 5TS2A 4WZBB 3MT9A 1FP4B 1FXSA 1XL1A 2A88A 2J31A 3F74A 3I42A 3NEPX 4K05A 3STYA 4PRZA 2HLNA 5A06A 1L8AA 3QVSA 2ZAMA 2NUAB 3OPXA 5CLHA 2GSWA 1L8OA 4MYHA 3I8OA 1UWLA 5JAHA 2W7TA 2JLYA 2RAPA 1P7YA 4FGZA 2CVHA 2JGIA 2XH8A 5K3CA 3WX0A 3DZJA 4CBVA 2YY6A 2IOQA 2HN9A 3FUWA 1M6EX 1Z7EA 3M5PA 3T5GA 1UZLA 1NF8A 4BV3A 4D9JA 3GYBA 4R71A 2AEFA 4CEHA 2I0FA 4MSUA 4OQLA 1XCMA 3IQHX 3WRVA 1BRTA 1CLUA 2DFVA 2MSCB 1PFUA 3E8XA 1CZNA 1VLJA 5CPFA 2CL5A 2JK1A 3BH0A 5FPQA 3SHOA 3ZU6A 1QCDA 2DEUA 3HVJA 3CVOA 3OQIA 4PWYA 3NIFB 3ONFA 3AIMA 3COVA 2FWIA 3GH3A 4Q1CA 4RY8A 2H1RA 1GQ2A 2QLJA 4HL6A 1CZRA 3H87A 1Z25A 1WCIB 5JMWA 5CCXA 1I2ZA 4Q24A 1D1PA 3AI1A 4UNQA 1LUAA 3VYTB 3N76A 4CMIB 5DN9A 4L78A 3U7QA 3T5TA 1P3DA 4DLPA 3PX3A 2YRXA 3CUSA 5E7JA 1Z2DA 5EHQA 1W76A 3DLHA 2OQRA 4Y2PA 1RWKA 5EXSA 2WICA 2BTQA 5JI2E 4D8XA 1XP8A 2DFPA 3OOEA 4EW2A 2ZRGA 4KWEA 5EL0A 4L16A 4F92B 2GCIA 1OVGA 1OU4A 1FPQA 2VO1A 5HMLA 1Y89A 3M49A 3BSYA 1V2GA 1AZWA 4BKPA 1L5RA 4KIWA 4BX0A 1KO4A 3H6HA 2VDVE 3HSYA 3FDIA 2WUDA 3KYIB 1F2UA 4DQVA 4IVNA 1ZK4A 3R9XA 4HDOB 5IT0A 1Q92A 3PUWA 2DBZA 3D6MA 3FCUB 1JEAA 5FL7D 5HOQA 5AW2A 3SDSA 1C4WA 4RSGA 4EEXA 3UJ7A 2A9OA 2CXQA 3G7UA 2NT4A 3DQZA 2NU9B 3VH1A 2J5XA 3VZDA 1F6BA 1HDXA 4TWZA 2RGXA 3ZWOA 5G0UA 1N4DA 4HPJB 4ZOBA 5LMNB 4I08A 2QNIA 3AKEA 4PZLA 1H6BA 1T9BA 1TVKA 1A98A 3R09A 3VPGA 1TUBA 2HRDA 3FF1A 1I5OA 3MRVA 1I9GA 4X3PA 2W58A 2EU8A 3TIXB 5B6JA 4RMHA 2GCOB 5AW4A 1WBDA 1AUQA 4GX2A 2UZ1A 1N2SA 1V41E 3PPYA 4XWYA 4E51A 1F12A 3DB1A 2O05A 4GM1A 1P5FA 3F46A 4HI0E 3CSSA 4UVDA 4CMHA 3RFVA 1U1GA 2NAPA 3IP9A 4E4TA 3EN0A 4QYSA 2ZTHA 5AHRA 4ZGBA 3DBRB 4NYIQ 1MO4A 4FMDB 4FYXA 3RSHA 3N07A 5KTPA 4M1OA 4F6LA 4RJJA 3EXHB 2ZZMA 5T4EA 1Y5NA 3HJCA 4AZVA 1OWPA 3HNPA 2C2WA 1JIIA 1UC4B 1RRGA 3KAPA 1E63A 3LYLA 5HJ2A 3W9YA 2Y93A 2BISA 2NSLA 4HDKB 4RSRA 3RIEA 3M6AA 1AT1A 3S7ZA 5KYUB 1X74A 3DPSA 5LBIA 3VHRA 1EK1A 3GRYA 4L7VA 3IMGA 3Q9UA 4GPIB 3IUPA 2FG5A 4E46A 3GUHA 3WFZA 3GXOA 4IKEA 4G5FA 3ZV3A 1NZFA 5L3QA 3R5TA 1SUCA 4IMJB 4D79A 5KOYA 4UTZA 3VZSA 3CW8X 4IQ4A 4FX2A 2MSDB 1ZAKA 3CLSC 1GSOA 3P9ZA 3DHYA 4NMMA 3AEZA 5FLXA 2DKOA 2BKUA 2YWGA 3N2KB 3BD9A 4RY9A 1NNLA 2OAP1 4PX2A 4W5WA 5GGYA 4B33A 3DMTA 2P2ZA 1CCWA 3IPLA 5BV1A 1U2RA 3GBVA 3M2PA 2QR3A 1M34B 2RH8A 4E5YA 3ZLJA 3KKEA 4IXNA 4DRYA 1D09A 1W581 4DLSA 5ICEA 4FUTA 4N0DA 4K1LA 1RKUA 2WM9B 5JJ5A 3ROFA 2GFIA 3SOPA 3BOSA 3LP5A 1UFVA 4NTZA 4DMRA 4ZJUA 1OJ7A 3C6KA 4H59A 1TK3A 2M98A 3P9YA 2A5FA 1EQUA 1PGOA 4GP7A 1KPGA 1I14A 2O0MA 1MIHA 4BFSA 2E18A 4R2JA 5TARA 2QT1A 4X3CA 4TQUS 4MS3B 4MI6A 4PHFA 5B1EA 3VYWA 3G0IA 3S99A 2WRZA 2IXAA 3NORA 1PLLA 1FW6A 1XQ9A 3D6AA 3LS2A 3NCTA 5FTLA 2JAXA 2QTTA 4Y6RA 5FUBA 1YS9A 2E9SA 3IMEA 4FWIB 2Y0BA 3MINA 3KM0A 5FA5A 1N4AA 1KQOA 3B1XA 3BL5A 2IHVA 3VUEA 1GRCA 1XJ0A 1YFKA 2GAAA 1NMXA 1NXPA 4UHKA 5H1YA 5LJLA 4PPFA 2ZJ2A 2XHZA 1O6GA 4EO4A 3C4QA 3TNJA 1T8WA 2IZ7A 3EXHC 3O9VA 4AC9A 3IIMA 3IELA 2BH2A 4D6PA 1B6TA 2OV4A 3OMXA 5GGXA 5HM6A 1TE2A 1W46A 2EFHB 3WI7A 5CFZA 3LBIA 4I8XA 2P11A 3E5MA 4QOGA 1SU6A 3TQIA 2ZGVA 3C3JA 1ISPA 2RBGA 3E82A 2NUPA 4WFIA 1VL5A 3QU5A 1YOVB 3H2HA 2ZXFA 4N54A 1EB8A 4Z51A 2AS0A 2DPHA 3THRA 1NLUA 4AROA 2VDOB 2GBCA 3ZDZB 4US1R 2A9PA 3KSBC 1BDMA 5K5EA 3FRHA 5LUBA 3UHPA 3K31A 4F8JA 3OO1A 1FNBA 4GKVA 3R9IA 4BO0A 1LWNA 3PX2A 1IYZA 3E5NA 5M5BA 1ZKMA 1UJCA 1GQOA 3N5KA 3KG2A 2BHTA 4FN5A 2FWJA 4MUFA 1KKMA 1BAPA 4WKCA 5LLSA 3LTNC 2J5BA 5L9AA 4XEUA 2FZ4A 1Y3FE 2JGLA 4QOEA 4J4BA 4Y2JA 3RD5A 4IIXA 2RKBA 4F97A 3L6CA 5DMHA 3UWDA 5BW6B 4C01A 2QK4A 1ES9A 2DPLA 5CU7A 3ZU2A 2J32A 2DBQA 4O0LA 3H4VA 1O08A 2YWDA 3ODGA 3OIVA 4MIEA 4N65A 5E1BA 2CNNA 3ZXYA 1AM4D 3G0OA 1Y9DA 2VJNA 4RPGA 3PKIA 3TB4A 5K3DA 2HK9A 3DM9B 1M2EA 2VH1A 5G41A 1YFZA 2AIRA 2OD7A 3WYAA 2FSSA 4XGIA 3HG7A 1CQWA 4QJIA 2YNMA 3CRRA 3LWNA 2V1UA 3DA8A 1MFZA 1SQFA 4OQ4A 1THZA 3LQRA 4OSEA 3R44A 4ZI3A 3T9AA 1S4QA 4RX1A 5DI3B 4Y2YA 3SS7X 3PGA1 2ZCUA 3PEEA 3QNWA 4FCVA 4Y30A 4EHKA 5CA1B 1K8QA 3LLVA 2D5LA 3IAS1 3ESZA 3VZBA 1MX5A 1WXEA 1ZOPA 4TT3D 5EZYB 3W7BA 3ST7A 2WMYA 3HYRA 1KZ9A 3MSCA 4UQPA 1LRLA 3UHJA 1P9LA 2GZDA 10MHA 4UDOA 4BDSA 2RH4A 4FC7A 3GLHA 3TIIA 3N8NA 3D8BA 1W49A 3FG9A 4RGVA 3LY8A 1V2HE 3L6BA 5AVRA 3FOCA 1DCMA 5JQGB 1V26A 3E7DA 1IY2A 3HLKA 5IK2D 2H3HA 1EAYA 1ZAYA 2WNSA 1NVWQ 1A7UA 1SJ9A 3L0BA 4X20A 4MKXA 2WBLC 2YZGA 2CNWA 3KZOA 4GKAA 4Y2XA 3RG2A 3NBYC 4BV9A 1FE8A 4Y9SA 2ZJBA 3D0QA 3QKSB 1F4LA 4TL6A 1EFVA 1NMZA 3TRJA 4E09A 2OCKA 5G0SA 2GLXA 3DDCA 2CE7A 3H7IA 1IZ7A 2WVAA 5G1PA 2CYCA 5AM3A 5A3VA 3RADC 3IGFA 3OKCA 3BXPA 2C04A 5DO9A 1CTQA 1RMTA 4CW7A 1T36A 3A1DA 1Z4IA 3WO0A 2C54A 4M53A 3J81k 1GSAA 2CMKA 3ZY5A 1I2DA 4PYLA 4MDEA 4F2WA 2BFBA 2ODQA 1OFHA 1V3VA 1P1HA 4MMZB 2QN7A 1P44A 1WRBA 3I09A 4PQRA 1BCSA 3JU3A 4P4LA 2C8LA 2H1LA 3AW8A 3A37A 4HYQA 1ZJ4A 5THKA 2N9UA 3SC4A 3TE7A 2A9JA 3AQIA 2IYZA 3FNFA 4B4VA 2GAJA 1GQSA 5E6SA 2EGUA 5CLLA 3DAYA 5DNDA 4ARBA 3HYTA 3JQ9A 5K8VA 2Z08A 4HAYA 1Z47A 1SELA 2G6BA 3ZK7A 2OAQ1 3FIJA 3VU9A 1ZM7A 3AJ8A 1RXYA 5EFOA 1MT0A 4X7PA 1NKTA 3TX2A 1HL7A 2A9QA 4H6WA 1IK4A 4EBFA 4N7MA 2ZSUA 3RV3A 1PWEA 3Q3HA 5F9MA 4NENA 1Y1KE 2KI5A 3ELDA 4HEA1 4NEGA 1T3HA 5REQB 4EA7A 3GEMA 4LC1A 1XD8A 2W6MA 3D3KA 5EEHA 5C18A 4KN9S 3SYRA 5HNKA 4HRXA 5AI9A 1E7RA 3FUUA 3OTHA 3PHIA 5HILA 3SIXA 4E6EA 3SBXA 4IIJA 1NWCA 1OIXA 2HTEA 4P84A 3IKLA 3TLGA 4DA0A 3GLFA 1KIMA 4DMCA 1KI6A 3HHPA 2F1JA 3EARA 2GVDC 3AVOA 4JT8A 2X0DA 2B8WA 3HWWA 4B3HA 1RYZA 2ES4A 4XUEA 1W5EA 3FMIA 4YJ3B 5AKXA 3O92A 3T3NA 3K8ZA 3QOFA 2QM8A 3KWJA 3OH8A 1KPHA 2IU6A 3P45A 1QQ6A 4DBVO 4JLPA 2BMJA 1VZ3A 2X76A 1XVIA 1YS4A 1W5AA 3DTNA 3DSRA 5D85A 4DZZA 2WABA 1PO7A 3DC2A 2K4MA 3MFYA 3RYFA 5KO2A 1NJFA 1YJCA 1LFAA 4F21A 1ADFA 4AXBA 5DHTA 5FBVB 5K0EA 4C5BA 2BGWA 3PUVA 3CF6R 1MOZA 3KT3A 3VAYA 3X1MA 3V4OA 2JW5A 3JQDA 3ZC3A 3PQ6A 4WD3A 5JU6A 3ASYA 1C3OB 2OO5C 2HT6A 4JJAA 3WKEA 4QRHA 4WOPA 5I6DA 1N2CA 4JLOA 3BWXA 3UT6A 1O9HA 2CNBA 1G6KA 2X1LA 4URZR 1LX7A 1YDFA 4HH0A 5CTAA 1XCJA 4LRQA 4EQ6A 4V1CI 5JDCC 1LQUA 2SKCA 3SBDA 3WJ7A 2ARKA 1GTSA 1U7ZA 2LTAA 2GTIA 4IV8A 1S1MA 4DJJA 1H8HA 4ZHSA 4FFVA 4II7A 1JEYB 3OEHD 1PFQA 1DQSA 1R6XA 3SVTA 3OPMA 2DQKA 1AN9A 2FQWA 2ZB4A 4H15A 2WPNA 4Y2QA 3WYDA 1BXKA 2PDAA 2D1SA 5ADUS 1QYDA 5HKAA 1BKSB 2V4MA 3RYCA 2WM8A 2Q50A 1QO0A 3L0OA 5CVEA 1IZ0A 5KOJB 3UG6A 4WMLA 3WWPA 1H9CA 5FO1A 1KVRA 4BZQA 3GFRA 2C3MA 4I4IA 1SEVA 2PXXA 3QWBA 2AG5A 4J94A 1XZNA 3TRFA 1WU7A 3UUFA 2AC7A 5TY0A 3I61A 3RVLA 1P8JA 3NFYA 1JDBC 4YMVA 6AT1A 4G23A 9MHTA 3UAVA 3BZBA 5J2UA 1HFWA 1U4SA 3B6KA 4CNBA 4M0PA 4C0XA 4HWOA 4HNGA 3LC2O 3ONVA 4QYTA 1LTQA 2D0OB 3MLEA 1T5BA 2EFYA 4WJLA 1UBLS 4Z4CA 3ZGZA 1RBYA 5E2IA 4GECA 1ZI6A 4ALLA 1RZRA 1Y3DE 3L8ZA 1H2BA 3MJ4A 3UMBA 4GXNA 1NN5A 1U7WA 1PZXA 3KTAA 1SMKA 2OHIA 3CZQA 4K87A 4OBEA 5D1HA 2H17A 4ITVA 4JB2A 5DW3A 2OCLA 1A27A 3B82A 1T5HX 1VSUA 4JBXA 3MXTA 4RF3A 4JL5A 4TXJA 1BFDA 5CG1A 1K97A 4IDGA 1H8EA 5T3YA 2GK4A 1EQ2A 2FSGA 3PE3A 4R1QA 1VRCA 2BFWA 1ORHA 4MB0A 1GEGA 1NL3A 1Q11A 3KX2A 1USWA 3DO8A 3RTAA 3ZD6A 1YK0A 2HADA 3K6SB 3A1CA 3ZIDA 2OA0A 3IP6A 3RU3A 3V34A 2CFOA 1Y4ZA 4J43A 4YV7A 1SB8A 2HCBA 4O02B 3MCWA 2GYVA 3QE4A 2B37A 1V71A 3N2IA 4GMFA 5BUQA 1IN5A 4TYPA 2R751 3RNOA 3RU7A 2EYUA 3ZHOA 4NR0A 3C70A 1OA0A 4KX3A 1V37A 4D1YA 2Q6KA 3A3YA 2MSEB 1OXVA 2BGTA 1X19A 4BQRA 1VA5A 2XBMA 1AUXA 1WUKS 3PNVA 4OHWA 4CLHA 2PSSA 3SXPA 2WT8A 4Q3CA 4YTEA 1SVLA 1U4NA 1L4EA 2JIBA 3OZDA 5ALTA 4O4HA 3OLQA 4X62B 3RJMA 3WE7A 4UM9D 4CTJA 2G4LA 1E8MA 1ENZA 2Q1SA 3V4LA 3I6QA 3IXMA 3L06A 4GI3A 4YUZA 4P7BA 5KJFA 1AKVA 4GYWA 4CQLB 2H48A 4MPJA 3BB3A 1ORIA 16PKA 1R74A 1SKAA 1HL3A 1ZGZA 2GXSA 3KLNA 3ZYCA 2YL2A 3H4IA 2YJZA 3QLUC 3M33A 2H9IA 1GYPA 1H0RA 3H4TA 3LAWA 3NTLA 4M7OA 2Z6UA 2B98A 2ISQA 3MBKA 4QQRA 4D0SA 2OZLB 3LP8A 3USES 3BCHA 3ROXA 1QP7A 3SM9A 5F7JA 3TZEA 4MULA 2QDKA 3QM1A 4YJ2B 5SZHB 3U1VA 1XXHE 3G88A 3DONA 3EGCA 1UAAA 4W9RA 4GPEA 4REOA 4BVBA 4G09A 4RM3A 1EEXB 2O2SA 4YJGA 3JRWA 4GSLA 4HPWA 2XA1A 4ZPJA 5EJ9A 3M6WA 1EESA 5IJXA 3F2IA 3WYEA 2VJYA 4F4CA 1FP4A 5DGCA 2CSXA 3AHEA 5HKKD 5A9SB 4G0ZA 4BJ3A 4K9OA 5CHYA 2OENG 3AKCA 5FOXA 3LUDA 2HCTA 1WJGA 1NUUA 1S2NA 2NUAA 4M1WA 4MA4A 4S35A 2QTCA 4D74A 1T91A 5JNLA 3KTFA 3U37A 2EKLA 1GV0A 1ZESA 3PJDA 2PZAA 5B30A 3H19A 4XAQA 3LVQE 1B2LA 2A1TS 5AKLA 3VU1A 1DO2A 2Z4SA 1F8GA 3QEKA 2OBFA 4XA8A 3JQEA 2PH5A 3C3YA 4XX0B 3ZWNA 3RREA 5AXBA 4FQ5A 4FM9A 4EG3A 2ZSFA 1A8HA 1YVRA 1QG4A 3OOWA 1DJLA 1KI8A 1FYWA 1NAIA 3IEPA 3OEYA 5HKLA 3RLIA 4CIVA 4EHNA 1CV2A 2OBLA 3O2NA 3HXLA 1EDZA 2ZW9A 5JLJA 1CEEA 2HEGA 2H2HA 1ZRHA 3EQ2A 2V3WA 3K0SA 1QVWA 1RDFA 2PLFA 1CJMA 4IO1A 1ORVA 3FD8A 3NASA 1JHAA 2ZCVA 3HADA 1WCIA 1Y4UA 4MCJA 1YA6A 4Z4EA 2J0EA 1RACA 3UB3A 2X23A 1HDOA 5BSGA 4R1PA 4CMIA 2VBGA 1T6YA 4ZAWA 5IUNC 2ZYGA 5LCXA 2W37A 1G4AE 2W2VA 4DVJA 5C4IA 1XVAA 2GUGA 2XUZA 4PZPA 1GP2A 3FZEA 3DEFA 4KVFA 2XUOA 1QOPB 4EH1A 4YA6A 5HJ5A 3OX3A 4B6EA 2P0EA 3TQOA 2VDNB 3WV4A 2H11A 4JNKA 4U7PB 4XEHA 4DCMA 1E2BA 2OY0A 5A3QA 3O0TA 1K9VF 4RKEA 1VMAA 1REQA 2A8YA 2Q4OA 4DA9A 4Z53A 2ZIEA 3JYPA 1F38A 4PIPA 3U0BA 4AX4A 4Q05A 2ZR7A 2NIPA 2FKAA 2QZJA 5H3HA 3ZCQA 1OW3B 2G63A 3ME5A 3UEOA 4BEBA 3CT6A 3KB1A 4C2TA 2AFHB 3EWAA 3TN7A 2C31A 1VECA 3AZOA 2VHZA 3DM5A 3F0TA 3PL1A 3BIOA 1QCYA 4NARA 4NU0A 2A86A 4HWTA 4W5QA 4JR2A 5A4JA 1UPAA 4KXXA 4JT9A 1IM5A 3SI7A 3L02A 2XYHA 1N0UA 1GPKA 2NU9A 5ESDA 2CL0X 1ZU4A 4EB3A 5K45A 2PJRA 5INTA 2CHFA 2Z3VA 1M8JA 2W2NA 1KI2A 3EVGA 4I7EA 1AUPA 2O3QA 4S1WA 4WKNA 1AS3A 4AVYA 1X7DA 3I6YA 4OBWA 3GJ7A 4XGRA 3IH5A 5ECYA 3UWPA 1OSNA 1RW4A 1P91A 3LX8A 3B6IA 5JBQA 1NV8A 1SU8A 1Y3CE 3BXEA 4G25A 4HRVA 5LP1A 4PNZA 1IBKB 2GCOA 4JJEA 2C07A 1JJAA 1BD3A 3QHAA 4R6WA 4KWIA 3G23A 1QRUA 4MV3A 2O20A 5IC4A 4B3SB 1E3QA 4FFOA 2E4YA 3FKSA 4HMQA 4KBFA 5DSZA 2OQ2A 3VR4A 4WOJA 1I2AA 4OUDB 1HURA 3DBRA 4RGYA 2JFZA 4TN5A 4B80A 3AF3A 4A2PA 5EE3A 1W0KA 3AP2A 3ZWKA 2PGJA 5SY4A 1AKNA 5CB8A 2NGRA 2BI4A 4M1YA 1NUPA 5DBEX 4EDFA 3H1GA 2UYYA 3EXHA 1UFRA 4LBZA 5JI3E 1N5LA 1VLVA 4QATA 1Y6JA 1V5EA 4KR9A 5BNIA 4HDKA 1MX9A 1ZLYA 1IBSA 3RUPA 1NQUA 2V7XA 4MP3A 4QWMA 1F06A 3C3AA 3RSQA 1P61B 1VSQA 421PA 5KC9A 2ZBUA 4M9UA 2WPDA 4ZZ2A 3R3VA 1JFVA 1U0GA 2C2OA 2R8OA 1JHQA 5A6SB 4PVCA 1MXFA 1IIBA 1WX1A 4GW3A 4DADA 2P2CA 1Q0RA 4TS3A 1XALA 1D2AA 2L17A 3DP7A 3BCSA 3K73O 3AV3A 4A36A 1M1YE 4MIOA 1JEEA 3N2KA 1VL2A 1XRLA 2Z56A 2FW9A 4EMBA 2Z5FA 1JDUA 1MN6A 4MHSA 1OBHA 5FHRA 5LQRA 4D0NA 3V2GA 2QRVA 1Y4SA 2LCIA 3INGA 2YMQA 1Y82A 4TL8A 3TECE 3DHEA 2CXXA 5L53A 1EVYA 3PITA 1T1JA 1WB4A 3PXAA 2G0TA 2GBFA 4Y2VA 3L93A 4DAEA 1SG0A 3UGQA 2EZUA 4D9NA 1X77A 4IFEA 1GGHA 1G8KA 3ZZ0A 1TKAA 4ND8B 2VSXA 3CYFA 3CX6A 3I58A 4MVJA 4Y6LA 4MS3A 3ET4A 4D3YA 2DUJA 1JLMA 3U4MA 4UASA 5KKAA 5C1IA 3VPCA 1EJ6A 5KPJA 1FF9A 1XNGA 1SVNA 4HXGA 3ZWWA 2VJLA 2PQ0A 1S8OA 2DBRA 1RC1A 4WK2B 2MU1A 5KYTA 2CMGA 2WIDA 2WQ6A 3AM3A 3JAWB 3DT9A 4RZ2A 1EYZA 5DU2A 2ZUTA 3DV0B 1OGJA 3KT6A 1NRXA 4Q6WA 5AP9A 3WSVA 2CCKA 1V5IA 2O2GA 4LC9A 1P73A 2Q45A 4UCWA 3TOZA 1KEKA 5HS6A 3V8MA 2CZCA 2WIBA 2WJAA 4NAHA 4TPKA 4S3MA 6NULA 3FOZA 2XYGA 2J4CA 5TQJA 2ILVA 4N41A 1MRSA 4QSMA 1J4AA 1EH5A 1PNVA 2X77A 3MAGA 3NR2A 4CPDA 5CFLA 2XDAA 1C7ZA 2ISSD 1XAHA 2XIJA 4PLHA 2W48A 1N34B 1EK2A 3Q3EA 4E5NA 1VA4A 1V3UA 2WKSA 1I5EA 5A4KA 3OIUA 5ILOA 3GUZA 1YOVA 5F73A 5LZ5A 3V1NA 4YX9A 4FZVA 3O6VA 2XQGA 1KQFA 3AEQB 3O1LA 3U5ZB 2NP6A 2HB6A 2OKGA 1AQYA 4ERXA 4X1IB 4DV5B 1UXKA 3V4VB 1CYDA 5B1IA 2NYUA 4WBNF 4ROSA 4ZJZA 3PICA 2GD0A 1WETA 3W8FA 1EUCB 4DIDA 1AX9A 1RRFA 3KYCB 5JH7F 3TVYA 3DZGA 3OTQA 1H2AS 3LDFA 3IEIA 3FCSB 3OZAA 3IO5A 2Q4EA 3L5OA 3ETDA 1RXIA 4UC0A 4HTAA 5DT9A 1JQKA 3OSUA 5MDHA 3DZDA 1P60A 2Y05A 2YMLA 3I5YA 1CRQA 2ZTVA 3LCCA 3FOEC 1O2DA 2IPAB 3DEAA 1GQFA 1J0EA 4I99A 2VTBB 1IOZA 2H29A 3ZVRA 3AKZA 3BCRA 1DIBA 1LXCA 1Z4QA 2P9EA 3JQAB 3ERCA 5E4FA 3IHKA 1QG0A 3I39X 3RYHA 5TQ2A 2XQIA 3B7WA 3KOZA 3KOOA 3Q2IA 4X61A 1NXVA 2P7HA 3RQSA 8ADHA 2BEJA 3O84A 2GR9A 2V7QD 3N2NA 4IVPA 5I9IA 1Y7IA 3MTJA 4OO3A 5DXAA 4HLUC 3MQ4A 2P5UA 1NPYA 1U0HC 4LISA 2LCQA 2G9RA 4R8KA 5DM70 4MA5A 2IHJA 4U63A 5FLYA 4G63A 5J1TB 2YIVX 3DD5A 3KXLA 4NAVA 4OYYA 4QFBA 2QENA 3T06B 1QIMA 5DI3A 3PE4A 4DFDA 1AIPA 2SHKA 2PRZA 4XZ3A 2ZDQA 2C5EA 4ER5A 5J4VA 4U0JA 1EFTA 5CA1A 1HC7A 2B4QA 3TIVA 3UV6A 5CCEA 5FWYA 1AXGA 1FJXA 3KQWA 1TO2E 4LHWA 2ETVA 3N8DA 1U31A 2R1TB 5F1YA 5EZYA 3ZDYB 3QVTA 1CZKA 2O3JA 3QSGA 1GTJ1 4V0MA 3PA8A 1ZVVA 4LVOA 4QG7A 5EQFA 4ZALA 1E0DA 4AZ3B 3X2EA 1Z2AA 4N0MA 1HDRA 1OFUA 1QK3A 4O08A 5DRYA 3TTVA 2E7ZA 2IXBA 1RQXA 4CIXA 1Y1RA 4Q9AA 4CG1A 3EX7C 3EYWA 1DG9A 4JI5B 1VFPA 1GNVA 1DINA 4K9SA 1E4EB 1KK2A 3ZY2A 1N5OX 2DHEA 2LD4A 1FYEA 4YCCA 1YIDA 2TMKA 5BSUA 1M5UA 5JQGA 1G3MA 3UAWA 3V2IA 4ZK2A 2YBDA 2C4NA 1GPH1 2VDLB 3DZFA 3W3AA 3EZ7A 4ADSG 2AEJA 1KY5A 2QN9A 3Q88A 3BTOA 4Q93A 2ZP1A 3ESQA 5TMBA 4R2IA 1VGVA 4X65B 3EGVA 3OD1A 1DBVO 2H1SA 4CCSA 4Z1MD 5LQUA 2JBAB 3WMWA 4NH4A 4Q37A 3B38A 3PIRA 1FYFA 2YWHA 3QKSA 1JXOA 2H2IA 2V5UA 3HKDA 3P9IA 4FZRA 4DC1A 4ZTZB 1BX1A 4I50B 1VMEA 1OZ0A 2I80A 3FYTA 4YUAA 1YVPA 2CEKA 4O5OA 4BE9A 2CYAA 1LK7A 1T9KA 4JC4A 2G76A 4J3FA 2J3EA 4LNHA 5LQKA 3MTAA 5DHSA 1B0UA 3D1JA 4W5HA 3TLMA 1CRPA 2OO5A 3F6PA 1ZN7A 4BNNA 3A6LA 1I01A 4TKUB 2H5IA 4ES6A 2P4SA 4JLWA 4DDTA 4YT8A 1CW2B 2REQB 5B12A 1LLQA 2NZ8A 2PKEA 4MS1B 2FUG6 2R4QA 3MTBA 5JDCA 4KDCA 4BLTA 2XEXA 3ZUPA 4GQBA 3ZZMA 4D4KA 3ZZNA 1SKQA 1E1KA 1N3BA 3RKUA 2IYVA 2I91A 2BZ0A 1WKVA 3WC4A 3FPJA 7ADHA 2HJHA 1M8FA 1XTVA 1DKNA 2ZAOA 3GDWA 4L85A 4N5HX 4ZHQB 1U1FA 3DTTA 3PNLA 3WV5A 2ZTMA 1BU8A 1OQAA 1ILWA 3O26A 3DE2X 4I66A 2G9VA 3EXEB 3C4VA 4PE5B 5F35A 3E70C 5IFKA 1WW2A 3AFOA 2C2BA 4AD8A 5C35A 5LP6B 1NC1A 5GM1A 4CIAA 4CCAA 3DD1A 3FB4A 1GD1O 5IKEA 1ETHA 1NXQA 5DKFA 2WF9A 1AG9A 4BECA 5HZHA 3RC8A 4MP8A 4N8SA 1OAOC 3M3DA 4E33A 1NVXQ 2C57A 1QRRA 4JIMA 4LUCA 1RI5A 3T94A 3MQFA 4C06A 2C84A 5BWLA 4H0CA 1EXNA 1FZTA 1WUYA 1HQYE 2Q5HA 3QA3E 1SCAA 5LQMA 4C4TA 1HDEA 1VYVA 4ESEA 4NFYA 1YBFA 5DF1A 2YJGA 4GPBA 3R7AA 1RI2A 2QTHA 4JLDA 4P92A 4UM5A 4YMUA 2PFSA 1Y42X 2VNJA 1JWBB 3OZFA 3RFFA 1L1EA 4IHJF 4BKUA 1CC1S 1GCAA 2I7CA 5DBIA 3W2IA 1W36D 1DC3A 1DLIA 1RYDA 3IOYA 3HL0A 5COAA 2Z3ZA 3BFKA 3MS7A 3D02A 3LPNA 2GTPA 4UUOA 2OXFA 4Y7DA 4E6PA 3KR2A 5JNWA 4DM3A 1N6PA 1VKZA 1W19A 1PBNA 3SM3A 2LKCA 2VYVA 1OWLA 1C3OA 1PNRA 4X71A 4LJAA 1A1SA 4OXXA 1E1RD 1LGYA 4R6XA 5K6RA 4CM4B 2IUFA 1LJLA 2X9NA 4J0HA 2FFBA 2DY1A 2BFCB 2JJ2A 3A70A 3ESAA 5B4TA 4LF9B 3W6NA 2I4OA 4CG2A 2EX1A 3ETCA 3G8DA 5CVDA 4ZQBA 3E3LA 5GONA 1ODIA 2EW1A 1WPRA 5GVRA 1AZSC 2CDAA 3I9V1 4I1UA 1Z4PX 3DUWA 4A2CA 3E22B 1OH7A 221PA 4OHVA 1G42A 2CK3A 3UNXA 2AOXA 1Q44A 1Z0FA 4X8HA 2VH2A 4XUGB 5A5EA 5KOJA 2B1GA 3Q9NA 4CMAA 3V8RA 3H5NA 2JZOA 2OSBA 3S1AB 1WOMA 1R64A 4UAJA 3CTPA 4X8MA 1ZGCA 4WUTA 5CBPA 4P9NA 4FUQA 3HP4A 3E2IA 3QI7A 4FDAA 4H7HA 5DM0A 4D8WA 1DEAA 4E07A 4PNEA 1LSUA 4JN6B 5AHXA 3C1UA 4CGYA 4QM7A 3AEUB 2Z98A 1UINA 2PU5A 5GVSA 3NTQA 4BLPA 1BE6A 2YASA 3K0BA 1JDSA 1N1MA 1O6BA 2HIGA 1RZUA 1JZSA 3SQMA 1ZMXA 4EA9A 1ORRA 3AH8A 4QBTA 3SQLA 4CVNA 1X7XA 1EUYA 3I6MA 2FPWA 2J9ZB 1SR8A 4ODIA 1KP9A 5JCOC 3LUPA 1NOJA 3U4DA 5EHZA 3KQHA 2PMBA 2PUBA 2X1HA 4CMBA 2YIJA 3BWVA 3GFSA 5MN4A 2FUKA 2XY4A 3GWZA 5CIYA 2HQRA 2OXCA 2QPLA 4J29A 3LQFA 2HGZA 4OHXA 2LP4Y 3TQCA 1HEIA 1X1RA 3HEMA 4MMXB 1Z83A 4ZVMA 3WR5A 4C0JA 1FQKA 1XTTA 4EFDA 3K15A 4RSMA 2Q7OE 4AIIA 3NZEA 4PLFA 4L2IB 1GNPA 1SCBA 1OV6A 3K6SA 2XMDA 4IL5A 3A4TA 4DPKA 3NJ4A 3U49A 4D9IA 1X9GA 4KR0A 1FUEA 1R0RE 2NQ8A 1Z18A 4XOUA 4F91B 4DE5A 2GBPA 4QFCA 1H22A 1TQ2A 1LBQA 2WAYA 3AVWA 3NRJA 3UAYA 3HO6A 1WZEA 4LJ7A 4UE3S 5GV7A 3WHIA 3GAFA 4PSAA 1SQ6A 1PV1A 1UKEA 4HR7A 4NBNA 1C3JA 3IULA 2EX4A 3WDLA 3A3PA 1A82A 2ZB2A 1JZQA 3WXMA 2GM3A 1QFZA 3OFKA 4QDXA 5KSZA 4TKVA 1EI9A 1XZGA 3VSAA 1XE3A 3QVMA 1BWSA 3N0VA 4BQSA 4ND6A 4CU2A 2AD5A 4LY3A 3KBBA 3R7DA 1FLDA 5HG0A 1H9BA 1FRVA 3DZBA 3PQ2A 4KDRA 2IFTA 5TF0A 1XROA 4MVJM 5FA6A 4U4AA 2JGAA 3QV1A 1JN0A 5LDGA 2FB9A 5BOVA 1C41A 3C5EA 4U3JB 3LT0A 2QAIA 2G1KA 1I24A 2VF4X 4M0DA 4NG5A 2FAXA 1K0UA 2JBHA 3OZVA 3LX6A 4ARSA 5KNCD 3VJLA 4D98A 5HPYB 3E7XA 1HF3A 3UMRA 1YJ8A 3EVZA 2V7UA 1A97A 1QR6A 4KDFA 4JUDX 3B3GA 3W04A 4KIGA 3AFHA 4G67A 3HM2A 4C5CA 3DBHA 4J3NA 1DAEA 3DLIA 4EBBA 2Z04A 4YJ2A 2X4DA 4JYMA 4JEIA 5BY2A 4YIHA 3AVUA 1X9HA 2C5GA 3DLPX 3DTYA 4OMUA 2XTJA 2HZBA 1YQQA 4EITA 5CFMA 3L7JA 3RB8A 3VUFA 1SOUA 4QXMA 4DWOA 1DEHA 3FZYA 1TIKA 1VPWA 5FEMA 1X2BA 3A6GA 5ADHA 4JUBA 2Q1UA 3KDSE 5U9CA 2O8CB 2QZ9A 3I9LA 3I45A 4YAFA 4C89A 4A2WA 5LYYA 1H4VB 2J9YB 3H13A 1VBNA 5A9SA 4MV7A 1U8UA 3CSUA 3FJOA 4I5EA 4KLRA 3H3XA 4IHKA 2RCNA 2Z4TA 4R1TA 5FULA 1KVSA 2XNDA 1YI0A 3EE6A 4ND7A 5BMVB 4OOFA 2CXHA 1MNQA 1Y7PA 4ZVPA 2W6IA 1HYHA 3FPCA 3TW0A 2B1IA 3JZIA 4WLOA 5FEUA 2Y9PB 4P35A 4TVSA 4R9NA 4RDHA 5AI4A 2JBWA 1G20B 4XX0A 4YUXA 3HR4A 3BWDD 3MCUA 4JR0A 3I4CA 1P1BA 3BF8A 2ZJ5A 2JI8A 3OLCX 1WXGA 2XB9A 1Y6GA 3CZ9A 2WNHA 1TAHA 4JP2A 2PGXA 4YP5A 5BYBA 2O5RA 3DEZA 3WLRA 3JY6A 4EWLA 4FYMA 1IL0A 1M1ZA 4GWKA 1XYYA 5I9LA 2ZZNA 4LWQA 4Q3KA 2QIOA 3RABA 3TCXB 2GT1A 4RWZA 1HT0A 3HZZA 2Y99A 2ZSIA 4YN3A 1NXSA 4KQFA 4ZO6A 1PD1A 4IILA 4CV2A 2GN0A 2ZU6A 5BWBA 4GL2A 1Q3TA 1T1GA 4A0FA 2CBGA 3ROTA 1OBCA 4HQRA 4KACA 4ARAA 2ZBRA 3KB2A 2Q3JA 4X92A 3QVOA 4ZAZA 2XLBA 1SBIA 2JFYA 4JVNA 2C0QA 1KYXA 2XWJI 3L0YA 3PNPA 1QYRA 5LZ2A 4ZOAA 2B4RO 4H9GA 4EL5A 2PT6A 1HT2E 4TMTA 3O4VA 4HDRB 4DCUA 4P36A 3RVOA 1ZBQA 3QXHA 2O7RA 2HPVA 3NJ8A 4D45A 3FBTA 2JD2A 4FZ3A 5EP1A 2WSSA 3ISJA 2H65A 3QK7A 2FWNA 2ZSKA 3ZWXA 5MHTA 3FHTA 1Z28A 1Z26A 2HNBA 4MV0A 4A6DA 4JH0A 4G5RA 1Y0BA 3MGGA 4KAJA 2AFHA 4PLYA 5DLEA 5DT2A 5I4IA 3DAPA 1ZGGA 4LGMA 3FMGA 3NGXA 4WEOA 1ZDMA 2GI4A 3GLVA 2PT7A 1QYVA 2GPAA 2HO4A 3ETJA 4RJKA 2C9ZA 3RUEA 5AM2A 3LU1A 1IZYA 3MPUA 1OLUB 1B0AA 1XR3A 2VQDA 1CX9B 3CSDA 3CB4A 5ECGC 5HF8A 4IQGA 4EHLA 3MJDA 1ZGHA 2IYFA 2QVBA 2VYCA 3EQ9A 2JAQA 4BCBA 2Q5JA 2JIQA 4QPDA 1QE5A 5A6VA 2YFHA 2RMKA 4J4TA 1FFSA 4MLDA 1YQTA 3L6DA 2FZVA 5B4VA 1L4LA 3G0CA 3QKRB 3D9QX 4TVKA 1F3OA 5EWLB 3RWBA 2F1OA 5FWDA 4KR7A 3EASA 2ZT5A 3NHZA 4FMPA 3ANNA 2XCOA 5K8JB 1NY5A 4CCYB 3DE1X 2EW2A 3N7AA 4OUDA 4KO4S 4CEJB 3PNOA 4J8PA 2X5NA 2COEA 3TSYA 4EYGA 1T2FA 2BIFA 1T2UA 1T4MA 2X7HA 3L01A 2QJWA 5BSTA 4C14A 2WSLA 3C6XA 2RI6A 2WHEA 3K5WA 4FBMA 3EEBA 4PZCA 1DC7A 1O9BA 1GA6A 3DCYA 4NNOA 4R41A 3IMCA 4HFNA 2ZANA 2CLKB 3LQ2A 4KWTA 2QG6A 4OFBA 4MPRA 3ABZA 4U0KA 4UHHA 3CJTA 3GEIA 3BEOA 3C3XA 4D41A 4QGSA 2V6IA 2GAFA 4L0QA 2XA2A 3IPXA 3MWLA 3O2JA 1MBZA 3Q7RA 4FGUA 2BCEA 3PG5A 5A6SA 4B9AA 1HM5A 1A5ZA 3PZBA 1Y1SA 1GUBA 4NWIA 4R9VA 3RS8A 4TLDA 3RK0A 2IVFA 3DOEA 2O5VA 3W2HA 2IEYA 5MFPA 1U0TA 4MQ5A 3EXIB 3GMTA 1NG9A 3IRVA 3EDMA 1O0BA 2PM8A 1Q2UA 4JUIA 1T1EA 1Z8DA 1MO3A 5KYYA 2NU7B 2FEAA 1TXGA 1JA0A 2RGWA 4C4SA 3SYTA 3QH4A 5D51S 2GWHA 2JJMA 3VAAA 4D3XA 4EG8A 3MWGA 2V58A 3SXUB 4JEHA 1U0BB 4DMLA 1DJQA 3NMUF 1YCHA 2DWQA 2XX3A 4GLFA 4Q01A 5DOVA 3SDZA 5A2GA 5LQJA 3AM5A 3LUGA 4BB0A 3AZPA 1P7CA 4G0OA 3LQ1A 2B8JA 2VUIB 1ESCA 3D43A 4O4LF 4NNJA 3RSLA 3TLYA 4BKMA 2I8LA 2YXPX 4F9FA 2F00A 3KZMA 5FB3A 5F2NA 3DZIA 4D0RA 4HLUA 2GN9A 4AF8A 2BMAA 1QH1A 4H7EA 3C3DA 2XGGA 4UNIA 2TMYA 1K66A 1U6IA 2CLMB 2IZOA 3JAWA 1KAHA 4ZI2A 1RHQA 2BZ1A 3I6ZA 3DV0A 4LX8A 1LC3A 3L0IB 2AE2A 4L9RA 1T8YA 1NMEA 1X86B 2AC4A 2BJWA 1YV9A 4GC5A 4QDUA 4Z4HA 2Q3EA 3TZ6A 3C3EA 4E2ZA 3ORYA 1VG8A 3QI2A 1NZJA 2GLTA 4Z9XA 4F4HA 4KVGA 4YPOA 3ULKA 3U09A 3P96A 4KL8S 1ZIDA 1LFDB 2DB3A 2MYPA 1L9KA 4IOJA 1QSGA 4L3VA 4BIIA 4FONA 3RSFA 1B8VA 2J07A 2I4NA 5DTJA 4MLZA 4O1HA 3TUIC 3IHWA 3G2MA 3DR5A 3V7FA 1W44A 2O8NA 1ORDA 5TQVA 4WH0A 2WK1A 1WDKA 5EP3A 3RRMA 3KU4A 2FA9A 1ESNA 3A6DA 4F2GA 4X1IA 4ENVA 2HJVA 1H2RS 5KS2A 1JSXA 2I9KA 3A4MA 3HUFA 5JRJA 3DW1X 3N1UA 1X7YB 4TTPA 3KKQA 1GZDA 3T9EA 1XMOB 3KYCA 2UXBB 3HVRA 2FWRA 1MQSA 1TJYA 2IOFA 3I1IA 2FDXA 3P2KA 4Q3AA 3RVQA 1JG3A 2IITA 2O6HA 3QTTA 3BRWD 2HM7A 4HZUB 4UAVA 4OTZA 3VTKA 4Q47A 4PR0A 4B6RA 5K6AC 4LSWA 2A1TR 1EFLA 1JQDA 1M33A 3HCEA 4UHDA 1H2WA 5D87A 3IYLW 4CG3A 5BQ3A 4JZYA 2BEWB 4Y8VA 4BUCA 5KIAA 4KFTA 2ZUSA 2VTBA 4E3WA 4PS1A 1PK9A 1GN9A 5GOTA 4JGBA 2P30A 1XZJA 3NXSA 3ILSA 4AJ9A 1UUFA