4UD2A

Structure of anaerobically purified d. fructosovorans nife- hydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
b'AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title [Nife]-Hydrogenases Revisited: Nickel-Carboxamido Bond Formation in a Variant with Accrued O2-Tolerance and a Tentative Re-Interpretation of Ni-Si States.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ud2A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ud2A02
4UEWA 1H2AS 3ZE9A 1FRFS 4UCXA 5A4MS 4UE6A 4C3OB 1UBKS 4UPEA 4IUDS 1UBLS 1UBTS 1WULS 4CI0B 3MYRA 1YQWA 4UQLA 1WUJS 3H3XA 3ZE8A 5JT1A 3ZEAA 2WPNA 4U9IS 4UCWA 5ADUS 5A4IS 1YQ9A 3USCS 1CC1S 4GD3Q 3ZE7A 1E3DA 5JSKA 1H2RS 4KO3S 1YRQA 4UE2A 4UE3S 4IUCS 5A4FS 4KO2S 4UQPA 3UQYS 4IUBS 3RGWS 1UBJS 4UPVA 1WUHS 1FRVA 4URHA 4U9HS 2FRVA 4UCQA 4UD6A 4TTTS 5JSUA 5JSYA 1UBMS 1UBRS 1WUIS 4KO4S 3USES 4KO1S 1WUKS 1UBOS 3AYXB 4KN9S 1UBUS 4UD2A 5JSHA 3CUSA 3CURA 4UEQA 1UBHS 4OMFG 5D51S 4KL8S 5JRDS 3ZE6A 3AYZB
chains in the Genus database with same CATH superfamily
2AEMA 3AVPA 4U02A 1RWKA 1J90A 1YSCA 3ONVA 5IT9A 2O8NA 1G18A 3BK7A 4YECA 4PY2A 4XQCA 4MYSA 3HSYA 2A9RA 4KHZA 4YUZA 3BJMA 3LRTA 4ZV4A 4MDHA 1T9DA 4IV8A 2XKJE 1NJ2A 3VR3D 1CDEA 5FD8A 5AOAA 4CBVA 4W8HA 4RXMA 1ZD4A 2V7WA 3O1LA 5ICCA 5JV5A 4QPPA 4QDKA 4DM3A 2VQEB 1JG1A 1NPYA 1O7JA 2VP4A 3T0FA 3FKJA 3BWYA 5UKDA 1SKUA 5ECDA 1PSZA 2QR5A 4NFYA 4ARZA 2ANCA 3CLUC 1J06A 3BIOA 1N7HA 1EZZA 3B85A 1F8UA 2NXJA 2XSZA 3FHLA 3TTVA 3Q3VA 4CV1A 3DKRA 4PTYA 3EQ9A 2OY0A 1O9BA 2ZIGA 1BDIA 1W94A 2J9YB 2WPNA 4F2DA 2YN4A 2ZSBA 3JQDA 1ESEA 2FZEA 1L5FA 3KOZA 4B79A 3DCJA 3GD7A 3NB0A 1E7WA 5C3MA 4IUYA 1BC5A 3STTA 2REOA 3BRWA 4MYCA 3VC7A 2XMPA 1OXXK 3LO8A 2XZOA 1OY1A 4YAGA 1P1CA 1VGQA 3QOFA 4FC6A 1PJ2A 1JEDA 1PFKA 4DDKA 4C5BA 4UOEA 5JAQA 4X1KB 2SECE 1LPSA 4E70A 5CEEA 3NW9A 4HC4A 4J90A 4IYJA 1QV6A 3FX2A 4MS1B 3L8ZA 5EJGA 4PIPA 3V4VB 5AD1A 3FWPA 1N2BA 1ZCBA 3CZCA 3Q2KA 3TSYA 3QA3E 5C8XA 3FCXA 4QUAA 3TLJA 3NCHA 1O58A 4MWCA 5KX5B 2AOUB 2Z8YM 3HPQA 4NCJA 2FY8A 1OGIA 2GRUA 2JH8A 3ELYA 1RQ7A 3GLHE 4R1LA 4YRTA 3HJCA 4RVNA 5E7IA 5F3DA 1NN3A 5IDYA 3H11B 3F98A 5C5IA 1JQBA 2LCFA 1CWUA 1XXHE 2HPZA 3HVKA 3KT0A 4H7JA 4A73A 4ANFA 4HWSA 3GOQA 1R88A 5CX4A 2OUIA 4RJKA 4FIDA 4FNAA 2COUA 4S1TA 5HFNA 4DCSA 3NP9A 1TCCA 3CTMA 1PGQA 4HBGA 3NVMB 4ECAA 3IEUA 4BP9A 4DABA 1QONA 1KEEA 1TKBA 2PYZA 3RVLA 4TTAA 3WAGA 3EC1A 4G1VA 1XCGB 4WASA 3NTQA 3O4IA 4D92A 4LXQA 1E6EA 1XQ1A 4G1BA 3PS9A 3OPQA 1HT0A 3RBAA 5M2QA 1ZUNB 1G8MA 3NASA 3M6WA 5EHXA 3KXKA 2Q5HA 5BXQC 3NWJA 3URMA 4JYPA 3FF4A 3IIIA 5DV9A 4BGUA 4FW8A 5F64A 4YS6A 5H82A 4C05A 4C3ZA 2RGCA 1TYZA 2H4JA 5IMBA 1DVRA 3QVVA 5DXAA 3RRXA 3U4MA 4RVFA 1SIUA 3KOMA 4WESB 3UB2A 1E9AA 4XVHA 4D4KA 4EHLA 4BQEA 4Q7MB 3UGJA 1NBEA 4R2XA 3UK6A 3GLFA 1WU8A 3GP8A 4HWTA 3DDUA 4EB6B 1A9XA 1H2AS 1GVNB 2L17A 4J1QA 4WZBB 5IWCA 1E1KA 5BW4A 4LJAA 4IH4A 2IYXA 1GYRA 2YVKA 2NUBA 1DRJA 3BWCA 2GF9A 2F3UA 4UCFA 2J4DA 4HAXA 3VO2A 5LJLA 1FRFS 1VYTA 1X7WB 4BNFA 4YQZA 3MILA 4KRGA 4DT1B 2QV7A 2CD7A 3GFBA 3U19A 1P4HA 2YHSA 3EVNA 1WW3A 3GCZA 4GUDA 4KIUA 1F2TA 3H7AA 1HR0B 4LDZA 4EZBA 5K0ZA 5AVUA 4AMVA 1CFJA 2GCGA 4EHIA 2WYWA 1KDZA 1L7OA 1B15A 1UWKA 1GKIA 1NNI1 1R3UA 4JH0A 2W70A 1UIRA 4QASA 4RLHA 3KZVA 4M1OA 4AJ1A 4HPWA 4A2WA 1VG1A 4Q18A 5GMOA 1FNCA 5LQUA 1QIIA 1DIAA 1DLIA 4I50B 3PX2A 5BOSB 4DQKA 2I7VA 1Z0IA 1BEEA 3QWHA 5FUYA 3IP1A 4DLWA 5IJZA 3GLGA 3Q3CA 5PGMA 1QHHB 1JYSA 2V45A 3KL4A 1WPRA 2X22A 4KZKA 4KE8A 3B1FA 4TRRA 5EE9A 2Z2ZA 4OL0A 1TZMA 1DFHA 3W04A 4WDRA 1E9SA 1ACLA 1SB9A 4UEOA 5HQJA 3UEOA 3WQBA 3ZDEA 1D4ZA 3B7GA 1P3Y1 3R24A 2J30A 4RL6A 4R51A 1QMGA 1MXFA 2PSDA 5AHXA 1IVSA 3FN4A 1ML4A 1CZHA 1HX7A 2I8LA 5ALFA 3DC7A 4RPCA 5IW8A 5JALA 1RAGA 4GR5A 3VR4A 1GDTA 1CEEA 2VR1A 2EW1A 1H6BA 1DBPA 1NBIA 1PV2A 1PW7A 1RAIA 1Y5MA 2EKZA 2QPLA 2QUKA 2CKDA 1F0YA 1QS0A 2G80A 4KO8A 4L3WA 4O3FA 5GY7A 4B6JA 1RHQA 3D6UA 3QW4B 4G85A 4QWMA 4LF7B 1KJ9A 2I2BA 3FZGA 4KWIA 3K9LA 1CUUA 4LQ4A 2AMFA 3V8QA 1P75A 2JGDA 5BV2P 3WXMA 1PS9A 2FRDA 1JEQA 5J3JA 3MWFA 4RM3A 2PUFA 3HP1A 2CHUA 2ZRMA 3EY9A 4FBLA 1JAZA 1HE4A 4QFDA 5DHAA 3TBHA 4DBLC 4ZVOA 5HNKA 3TRFA 1PHPA 2JD2A 2RKOA 3VGPA 4CEHA 1JALA 1W34A 3G2OA 3LIIA 1UJ4A 3D6VA 5LA6F 3OX3A 5I3CA 3CJQA 4HJXA 3OFVA 3PLNA 5IAOA 2AXPA 3F3MA 1P77A 3QVMA 1EUZA 2GJ4A 1W48A 2BLNA 3AFMA 1JMVA 2G1JA 3OCVA 4MWGA 4ZPXA 3RLFA 4A8JA 1O4VA 1LNQA 3C24A 1U0SY 4JELA 2PUHA 5EMJA 1TZ2A 1NMEA 5A9SA 1QVZA 2GEUA 2PZMA 1M8JA 4R9VA 4JJIA 2Q50A 3ADDA 1O03A 2FP4B 3CY6A 1P0CA 5A05A 3EGVA 5M29A 4BLTA 5HKBA 3D5EA 3BCUA 2BGRA 5AYVA 5JG7A 2E4XA 3GA7A 3HLTA 1VIYA 4ZGWA 1NBMD 1I14A 2FE4A 2QR3A 2J3QA 4PO1A 2X0NA 2DKOA 1XZ8A 3DFUA 4P3PA 1D2GA 3MERA 3RC9A 3F5DA 3JASB 3SICE 4DREA 1VLHA 5EIXA 3CZ9A 2XMRA 2CVFA 4G8DA 4LXHA 3KNZA 2FMFA 5GZ6A 4RHTA 4ZI3A 2GXAA 3GX1A 5DTRA 5LB2A 4D42A 1XALA 4UBLA 1SY7A 1YDFA 2I6FA 2X4IA 2XMCA 1EBFA 3J7TA 2J48A 3OO0A 4AX4A 4HLUA 3ZJTA 1RCTE 3E2PA 1A72A 1N2ZA 4L4RA 1FC0A 2ZRDA 2GEKA 2J5XA 3DF7A 3I83A 4ONEA 4DLXA 4F4HA 1LRJA 3X2SA 1H2EA 1Q1QA 3DM5A 3AEQA 1J1IA 5KTPA 3FUUA 2RBEA 4NDZA 4UHFA 2DCMA 2RHHA 3UMGA 4BNMA 4ERXA 1F17A 2DHEA 1R0BA 2MYPA 2C5LA 2IK8A 1U3GA 2PDAA 1PLJA 4B3IA 2FX2A 1LJ8A 1N2CB 1SRQA 4F9FA 1V8PA 2C2ZA 2V6IA 2VSOA 3G7NA 1EHIA 4HQRA 1H8EA 4PZYA 4RSGA 4WZBE 5DBOA 2XWBF 2ZYHA 3JQAD 4B4OA 5EJ4A 1LWOA 2DHQA 4CQMB 1ZI8A 1FUYB 2WYHA 3GMIA 4F4IA 5DYWA 2OQ2A 4MV1A 3BBPA 2ZRGA 3DOJA 4UBNA 3R3ZA 2CCJA 2RGNC 2YXLA 4FLFA 1BXGA 1MV5A 1SR8A 1V0JA 2A59A 2R6JA 3HSSA 5DCYA 1E99A 1JNYA 1N2HA 1VI5A 3QNMA 2AFIB 3DO6A 1UM8A 1OQAA 2FHSA 3PGJA 2OK8A 3KE9A 4GYYA 4LIPD 4UM9B 4YJ2A 3OP1A 2AV6A 1A8SA 5I7WA 2C77A 2B69A 2FXVA 4QTTB 5GJWC 3RO7A 3TEJA 2WD7B 2B98A 4UATA 4IMIB 5AUNB 3EGDB 2GA9A 4O2AB 3L5OA 4JP8A 4KN6A 4MCHA 4Q93A 4S2EA 4JLMA 4KWCA 1KC1A 4CCYA 4EWLA 2ZBUA 3AB3A 1NR1A 2AJBA 3TB4A 4TMVA 1KMNA 2GVNA 3B5IA 3KOOA 3HKBB 2M6LA 5DU2A 4MVCA 4KJXA 2XNCA 3FCEA 4F8JA 1V3VA 1H65A 1X1AA 1R50A 3MVEA 4LZAA 2YIDA 3MQ4A 4ZOQI 1OUMA 4NKRA 3PNVA 3H16A 3DBRA 3F3KA 4PC3A 4UTRA 2QRMA 3H4TA 1POWA 2H4ZA 3K9CA 1SUDA 4HMQA 4Q02A 4GZMA 3HPRA 3WLTA 4G9BA 1UFRA 3WG9A 4BJHB 2HMTA 3BSFA 3NEJA 4RKEA 1K8RA 3TAUA 1FDTA 4Z1MD 2JIZD 3LWNA 2W2QA 4BNLA 4H1WA 2EATA 1RYZA 1XRJA 2DY1A 3IUNA 1APBA 1YF3A 4GXQA 5IYZB 3U9LA 3AYXB 2WFAA 3A6EA 3OEHD 1CR0A 3HNRA 4D1YA 3TL6A 1BMQA 4JVLA 4MR9A 2AW5A 3MJSA 4L8GA 2OM6A 1H1DA 4CLOB 1I3LA 3FHCB 4R1NA 1GUDA 2F9LA 3E7DA 4M1MA 3QVJA 1ACMA 1JQKA 1ZDMA 3T9FA 3TLGB 5B7QA 1UOQA 2UZ1A 3NHWA 4M89A 1Y7TA 4AP6A 4D9KA 2GNOA 3GFTA 1PZXA 3N7AA 4FHFA 4E7PA 4KXUA 3QNUA 1YVPA 2JKZA 2WWIA 2UXCB 5FOWA 2LXNA 3HEMA 1WNFA 1XA0A 3TIXB 5L95A 4UNNA 3TNDA 3CUVA 4HNVA 1II9A 2IYTA 2XX3A 3QUCA 2HRRA 2FF5A 3HNPA 4D3ZA 1NBHA 1QZTA 4MROA 4H7DA 4R1QA 5DHQA 1EVYA 1L5KA 3HJTA 2ZB4A 4YPOA 3CJRA 1X7ZB 1HKHA 1KFKB 3L1KA 3TS1A 1I10A 2ZYAA 4G5FA 2PWAA 4RPIA 4UEWA 3ZCUA 4F6CA 3W9SA 3LUDA 4Z0PA 1JSCA 1DWPA 2KBFA 2R1ZA 2FDXA 5D3KA 4EI7A 3SC3A 3R3YA 3L4JA 4ZYWA 3EVGA 3N2YA 1OT3A 5KJ1A 2OEPA 2C7PA 4ZZ3A 4CQLB 2EF0A 3I3OA 4N9WA 1BWPA 4OPMA 1V8OA 2XYHA 2I2AA 4ZHQA 4UULA 3JWHA 1MGOA 3SZUA 4C3OB 3HA2A 3OZBA 1S6YA 2ID9A 5K20A 1OFGA 1KKUA 1T5IA 2PSFA 2PL1A 4LQLA 5IXSA 4P3YA 5HRUA 5EP4A 2HMUA 1JKMA 2JDIA 3LRPA 2X9QA 3I0ZA 1IOZA 1GNTA 1WMSA 5F1YA 4BQFA 2VAXA 4G36A 5HDQA 4AJOA 1LGYA 2CYAA 4OKSA 3SHOA 3U26A 2JGMA 5JD6A 4ERNA 4DUZB 2V0GA 2OLKA 1JIUA 1S3IA 1WAMA 4PC7A 1IHUA 1G3UA 3B8HA 3D2CA 3ZBQA 2IS6A 5IPFA 5T5QA 2FEWB 5BSRA 5C9ZA 3SQDA 4ZREA 1U8FO 2JC3A 2AMLA 3ZWYA 2YDXA 3ZHZA 1TPZA 1T25A 3O9ZA 2HDHA 4V2UA 4LRTB 5EYPA 3DYBA 1PQUA 5TVGA 3VBCA 1SU7A 1QDUA 4F86A 1E61A 1HDEA 1Q2XA 4UNPA 3VJMA 1XQYA 3KVOA 1DGQA 1MU0A 2IYWA 4QYWA 4TS9A 5E8JA 1VZ2A 5L40A 1RZUA 2NO9A 3KPWA 2HYDA 4XFJA 4IDAA 1X70A 1SCAA 2Y93A 3RT7A 3INRA 4BLRA 1L7VC 1N2CE 5ALEA 5CIYA 1DKLA 1FTWA 5AUOB 2HUPA 1FFYA 2HCJB 5FTKA 3SC6A 2ZI7A 3N0VA 3KAQA 4GX0A 1R5JA 4PSVA 2GCNA 1NW4A 3UUGA 4W1QA 1ZW6A 4JKIA 2VT3A 3I4LA 4P3NA 1F3LA 5EWLA 5BWNA 5M5BA 3O94A 3GUCA 1SHTX 3R23A 3IAS6 1DXQA 2W11A 2AFIE 2OCLA 4TV9B 4B3HA 4JI1B 1CCWA 1UF9A 2XMZA 4KI0A 1QP8A 2CYBA 3M8KA 4YDRA 4GI7A 5GJCA 5DBFA 3H1GA 3PC4A 3G5UA 1QANA 2PD3A 4J8PA 2M1XA 2EKQA 3LL7A 1QH1B 2ZAIA 3SYLA 2A6PA 3KR2A 3L0OA 2FN4A 2YNMD 2YZ2A 1I4EB 3P94A 4O2BF 5DYIA 4FMDF 2V55B 5K45A 4MPRA 1CBUA 4MVJD 4F46A 4CEJB 2P1ZA 1R27A 4OKNA 1T2AA 1FRQA 4G5OA 4Q37A 2YYSA 4PBRA 3BXGA 3GF4A 4J07A 1RI4A 3QMVA 4JJ6A 4L5CA 3H2KA 3ZG6A 5I3ZA 3V8PA 5DTQA 4KAXA 5F76A 4M87A 4CDRA 1C9KA 2ACWA 2B61A 1OWNA 1Z3IX 3FUTA 4NULA 1Q7GA 1AGNA 2I6QA 3LYUA 5DGDA 1Q50A 1YAJA 3NCTA 1R12A 3NTVA 4GPTA 3T1VA 3WE7A 4CMEA 5KWSA 4ZCPA 3VOBA 1N1MA 4TN5A 2I2CA 1FQKA 5KNDH 1ORVA 2RG1A 3OHSX 2DSTA 2RBGA 5EJ5A 4L28A 1EGHA 3P5SA 1I7LA 4MV3A 3THXB 3FRJA 5EJFA 2OV4A 2BFEB 2II6A 2R4UA 1SOUA 3D3WB 2QN1A 3ESDA 3I2FA 4MWOA 5JZVA 1JE1A 2GEBA 3NG1A 1MA3A 1UK7A 4BXOA 4CKCB 4E33A 3GIDA 4LYGA 1Z75A 2K87A 4MV5A 4F1WA 1PJBA 2CDRA 1V4VA 1DSSG 1RMTA 3D8TA 4W1PA 4ZQCB 3HYRA 4J4HA 5GOZA 1DC5A 1SBIA 1QGED 2O3TA 3DD1A 2GNAA 4CMBA 4D3YA 4ES6A 3B82A 4EB0A 2IX3A 4GL2A 4LE2A 1JXAA 4Q1DA 1Z4MA 2BF7A 4XPIA 5HK8A 1Y3CE 1PR1A 3E3OA 5JS1A 3ZWCA 3AQ4A 4OXYA 5EJIA 3ZHSA 3I39X 3N53A 5CJJA 4C6RA 4MKRA 3C3WA 5A7FA 3IJPA 2IU0A 1LVGA 1OLXB 3BJRA 3JSAA 2YBDA 3GDHA 4B33A 1QJCA 4PLCA 1J0EA 2IQIA 1GL3A 4C7BA 3OTGA 2F9MA 3JQEA 3LVBA 3L7BA 4WZAA 4CG0A 3O1JC 3NUZA 4DLYA 4JVSB 4DSUA 5E6SA 4D81A 3VBEA 1IEXA 1M2VA 2RCYA 3K1YA 2GPAA 2J46A 3WS7A 5HKKA 3AY7A 3LTNC 3CZAA 4NZYA 3BGOS 3HYLA 3LI2A 3Q6MA 4QBKA 4KE6A 1THTA 1A4UA 2QT9A 2V0NA 3W3AD 2BTOA 3BDIA 3PX3A 3B89A 1M1NA 2UZ0A 2JA2A 3PEVA 5KYTA 5A4FS 5A5EA 3C70A 1IZYA 4D9BA 2OECA 2OVBA 3TZLA 4BZZA 2ZVJA 3BD6A 1PIWA 1PNRA 3I09A 4MB2A 1NXTA 1XPOA 1XP8A 1PFVA 1KO4A 4RFSB 2XZDA 3TW8A 2G25A 1Q7EA 4AG6A 4PHTA 4YP5A 1SC1A 1FXUA 4WXHA 3RYHA 3JY6A 3ZC3A 1DFIA 3H5AA 2NQ8A 1N3LA 2CBGA 2VDMB 3QA9A 4AO8A 5LQNA 5A3RA 2ON6A 4ALKA 2FWIA 3IUPA 2H5EA 5EERA 1YASA 2NZXA 4Z54A 4FD3A 3OY2A 4H35A 2AH5A 5CNKA 2D59A 3TXYA 3VR2D 4JA0A 4M8KA 1ADGA 1AA9A 1L9XA 1YFZA 2WFLA 2ZBGA 3AK4A 2QJRA 1GGFA 1H2ZA 2DHCA 3MCAA 4DJFC 1EFTA 1YGYA 1U0TA 3FYDA 3GFOA 3WI7A 2D1RA 3KSMA 1J42A 4D9NA 1C5KA 4YFYA 1O1YA 2PWBA 1W85A 3FIJA 4GWGA 1JHPA 5EIBD 5BN5A 5ICMA 2Q6KA 5KWVA 1RYEA 1KKLA 4KDRA 4MSUA 3PUWA 4W5TA 4CMJA 1E9CA 4HSGA 1JG6A 1ZSNA 4K7JA 3VV3A 2RHBA 3ZY2A 3C14C 1G64A 2ORIA 5ENDA 2EBUA 3I1YA 3JYLA 5DF1A 3TZBA 1X7XA 2YH2A 1ZBQA 3B3JA 1NRWA 2H7YA 2HEGA 3ONEA 4LPKA 4A2QA 1CUFA 2IZ1A 3AF3A 1B2RA 4Z2YA 1OHHD 3PDIA 4FDAA 5JTUA 3MWDB 5CGZA 2WF9A 1R5BA 3NFYA 2Q4DA 3CRRA 1FZTA 2XT9A 3W9YA 4E6PA 1Y80A 3RUDA 1PRYA 2ZTSA 1JKJB 1YZQA 2FPIA 1NJ6A 2X8AA 4E32A 2OXFA 1C9DB 3JD1A 4OJNA 2NAPA 1NMYA 3CUUA 1R16A 5CDSA 2PWZA 1XX6A 1WKBA 1Y3HA 3P4YA 4Q12A 4JU8A 4YWHA 5G0TA 3TZEA 3AVYA 1WVMA 2BR3A 2HV9A 1Q7RA 1D2NA 5CYPA 1Z0UA 3OA2A 4UQLA 3ZLBA 2IYRA 2OSVA 4MYDA 2GAIA 4DUGA 2J9GA 1P2FA 2PX2A 3QEJA 1LBSA 3DFMA 3UPUA 3O9VA 2O7SA 4GRAA 1KI9A 4NR0A 2O5VA 5CLLA 4ALNA 2QX4A 3ZWAA 4EPXA 3TKAA 1WXWA 3C6MA 1WY5A 1FTQA 3TTTA 4H6VA 4W9RA 1Z2AA 2GOYA 3HM2A 3PUKA 4GS5A 4LHEA 4BRSA 1D1TA 2QMHA 3BGSA 3AESB 4M0PA 4TMFA 5I4KA 2VJDA 1T9AA 4RIEA 5IDWA 1FJGB 5EI5A 1OTHA 2XDAA 3V4OA 5LSAA 4II7A 4IL5A 5F21A 5FI0B 5KJEA 1XC7A 5REQB 4MJ7A 2NSJA 2WLSA 1YK1A 3FB4A 1XZNA 2JRCA 3KM0A 4PIVA 4C43A 5K0BA 2ZSJA 4EY5A 4MLCA 3ZH2A 1KH1A 2J3IA 3WB0A 3RU3A 3WMFA 2Z9CA 3L0SA 5KNBH 1KZYC 5EUMA 2X0IA 2LCQA 4N41A 1IIBA 1R0ZA 4A2CA 1PV4A 3PNLA 1Y4AE 1KEVA 3A1FA 4FLMA 2JEYA 2HU7A 1DKPA 1DT5A 1I9GA 1QE0A 4EYGA 2VTVA 5BUSA 5HOEA 1NUHA 3VZCA 3RTDA 4IVQA 5I9BA 2D8AA 2DJIA 3ET5A 1DBVO 2DT5A 2GK4A 4YCSA 1N3YA 4DPLA 3MJTA 1V8BA 3FMGA 4EO9A 4UEJA 3PA8A 2JJYA 2WJPA 4YYEA 4GBMA 2WVHA 3DV9A 2QT1A 4KN9S 5CNJA 3RWOA 4ZU1X 4K87A 4LVCA 3M1YA 3RFUA 4BTVA 2CNOA 1XHEA 2R0QC 1KBQA 3RASA 2EP7A 3G2JA 1M2EA 1V9SA 1OYWA 3AU9A 2HY7A 4ROTA 1QQ5A 5F3WB 4P93A 4R83A 2Z2KA 4L6AA 2QI9C 3I2GA 3S1LA 3DMGA 5J2TA 2OXCA 4JKYA 3KZMA 3KX2A 3LQYA 3UPTA 2AVDA 1XAIA 2H4FA 2LGJA 4KQ9A 5AFSA 5J1SB 1U98A 2X1MA 5DXFA 3GK3A 2MR6A 5LD2B 2YYZA 2GHIA 1D2HA 4OAQA 3RS3A 4YRIA 3WWYA 4PFKA 2O48X 4S3MA 4B40A 2RBKA 3P2MA 1U1DA 1TD9A 4KVAA 2ID8A 1P5JA 5BYKA 1TJ3A 4QULA 2OFFA 4PVCA 3RFFA 2PLNA 1DWOA 1XBTA 2DM6A 2N46A 3IXLA 3PPYA 5LBTA 4EPRA 3C0KA 3HCAA 2I8CA 3OIGA 1GWNA 2DFVA 1F2UA 4IIUA 4KXLA 1X80B 3RUAA 4TWJA 1BWRA 4AQDA 4TTIA 1DJLA 4N7JA 4FJ0A 1ZHFA 2HD4A 2Q7OE 4F4CA 4NQRA 3W5SA 2EQAA 4G41A 4N01A 3W8NA 3PJDA 1U4OA 2A0FA 1BCRA 1NZDA 2I66A 2L69A 3GUVA 5CW1A 4ZK6A 1Y4SA 4OHWA 1X7DA 2JI9A 3M5CA 4LTDA 4JI6B 2VUUA 2ZS9A 2VF7A 1DCMA 2O1XA 3QWBA 4NMXB 3AU8A 4D3FA 1JEJA 1LPMA 2R1UA 1GZ3A 4G1EB 1KDYA 4QSMA 4B6PA 4D8XA 1Z4LA 4ZYZA 5FFNA 3HXOA 4LHWA 2ZM5A 2IU6A 3G13A 2AG8A 1YVRA 2XV1A 4HRAA 1QO9A 3IKTA 3KFLA 3TLEA 3C85A 5LYJB 1XNJA 1ODJA 2JAPA 4QTYA 4TZ0A 1UJCA 2W2PA 2XAUA 3ACBA 2W71A 3OPNA 4RVOA 3UJ9A 4BZWA 4JJ4A 4F7DA 4WRRA 1K6IA 5JVDF 4D2IA 4Y2GA 5EWMA 3AHJA 1ZXXA 1UXHA 3KHKA 3ZGZA 1J56A 4DSAA 1GRVA 3L9WA 2G8LA 4GC9A 1K2VN 3N2LA 2BHRA 4BOYA 1AXEA 1XIVA 4EFDA 1B6SA 8AT1A 5A5GA 3D31A 3H8SA 3NHBA 4D02A 5IBCA 4TYNA 4JI7B 2QM3A 3L0IB 2H85A 5CFLA 3T4XA 1E2EA 2ZXFA 9ATCA 5JI3E 4QPZA 2F4VB 3A6FA 1FSZA 3PWTA 4JBLA 1OXKB 2IV7A 1R6DA 2MWMA 3FMFA 4RFLA 5FHRA 1S1MA 2I1WA 4L8WB 5FULA 3GJTA 4ZRDA 3TRJA 4Y2YA 3TKLA 4OL9A 1N5IA 3A31A 1ZNWA 3DGFC 3HQ4O 2Q49A 3MRSA 4IUBS 4UM8B 1L1RA 4PGFA 2NSDA 2RGEA 4ZYTA 1KARA 3LWDA 2OM2A 3O92A 2C58A 3R7AA 1QFYA 2BE7A 4KLRA 2Q4EA 5AIBA 1DTWA 2JFYA 2WYVA 4HLCA 1GZDA 1MO5A 2XB4A 3F7TA 2IEDA 3ORSA 4WH0A 1UEJA 1UBRS 1YUBA 4AZWA 4R68A 2QTLA 3T4UA 1FY2A 2RJ3A 1FPMA 4PGAA 2P3OA 5HQ3B 1BG6A 4ECEA 1VL0A 4DKJA 2GZRA 2VATA 3Q7QA 4B4VA 1L0BA 4NEHB 2ZT8A 3Q9LA 1HETA 2VYVA 3FBTA 3PDHA 1QIGA 3KALA 1R6VA 2IYPA 4YJGB 3ZHVA 2RGXA 2BM0A 4NY1A 1DBQA 3I1IA 4EGAA 1KXZA 1RWNA 4K1LA 3W6ZA 3X43A 5JANA 3ZDCA 4FR5A 2ZRLA 1GV0A 3CONA 3MPOA 4JT9A 4MS4B 2C61A 5DI9A 2HCFA 3AJRA 3V8RA 4FMBB 1Z37A 3A6PC 3AKDA 2TS1A 3WGHA 1YE8A 2CW5A 3WNCA 4D41A 4ZCTA 1GRCA 3GPBA 1I4LD 4QHYA 3NUGA 5LZ9A 1AA6A 3NAGA 4RX1A 5F2OA 4NJOA 2VPXA 5ALKA 4ZCLA 4INPA 1E98A 1OILA 4WY5A 1PBTA 3WVNA 1VJ5A 2BHNA 4GECA 4N0QA 1I2CA 1BA2A 2YINC 1Z7WA 1B1AA 3BHMA 3D81A 3PJGA 4EG0A 2C2KA 4F1KA 2HYIC 2E18A 2DH5A 2FP3A 2RC6A 3GAFA 3D6NB 1EJ0A 1L4LA 4MW4A 3O73A 3VVMA 3ZIUA 5B30A 3K70D 4FSHA 3GH3A 3SR3A 4DWVA 1U02A 1RWVA 2X8JA 3L46A 3FNEA 4MEJA 4D4LA 4XRRA 3VPFA 4MQ5A 3G9TA 3T1HB 1PG0A 2HHLA 3Q41A 5M34A 2QHXA 1PT8A 1ZN9A 4P6VF 1XMQB 2FB9A 3SLKA 2EHJA 3TLCA 5IU6A 4KFCA 4HDNA 2JHGA 4X92A 4ZDKA 5JBQA 4YGYA 1Q12A 4HLNA 1JEAA 4REQA 1E6WA 2W2KB 5LQRA 5CYGA 1E32A 2WMDA 3NEPX 3NJ8A 1U81A 3VYVA 4EOGA 4MLDA 1K6XA 2ECFA 4XDZA 2O2IA 2XF2A 5HTKA 3PYXA 3UCFA 4EYEA 5JPDA 3KXIA 2QTVB 3TQFA 4PYOA 5C8ZA 1QG4A 2JLUA 3WMRA 4EHAA 1GA6A 3KJZA 3RYCA 3T4EA 2OFWA 3Q98A 1ISMA 3MQFA 3OHPA 5HMMA 1Z3CA 4HB4A 1M6VB 4YAJA 5DISB 4FK8A 1JYEA 4D6YA 1U8XX 3MTDA 3PFGA 1OX4A 3SPXA 1FTGA 3BDVA 2TMYA 1I4TD 3MRXA 3TK1A 1NFQA 1YKGA 3TRDA 3KJNA 4U7DA 1ICEA 1OLSB 2JAOA 3HWRA 4HGYA 4EMTA 5CK5A 3BORA 4E3WA 1R18A 4BVFA 1NR5A 5C4IA 2ZR0A 3CX8A 1IULA 5KTSA 2YJNA 2G9NA 2EXXA 3HB9A 2POCA 3A4LA 3MW8A 5JASA 1OLUA 2FWRA 3PEUA 1XZAA 1LPBB 3LUAA 3DUFA 2V6FA 2AC2A 4ZQIA 5TQ2B 3GJ6A 5HTOA 1QX3A 4PWYA 2ZYUX 1GHTA 1RZ3A 2PV0A 6NULA 2DYKA 1U8TA 3DT6A 1ATZA 1C8BA 1G21A 4IICA 4B4UA 3Q8KA 4OH7A 3TOXA 4R2IA 1T4CB 5JUWA 2B1JA 1C1DB 2I2XB 2P91A 4RD0A 3PQFA 5KTNA 1H42A 4JKOA 3VPXA 2ILTA 2ZIXA 4DDWA 5AVJA 2X6QA 1XQWA 3HHEA 4IS2A 1B2LA 2JJ1D 2HJGA 9LDBA 3K53A 4IRXA 3WLRA 4OSOA 3RC3A 1Q0UA 2QY6A 3U7GA 4E3ZA 3H8WA 2IT1A 2CZQA 1V96A 1A71A 3FVQA 1DKNA 4FMCF 1O87A 5KYYB 3ZJ4A 3T7JA 1ZVJA 4OQPA 3CXUA 3INYA 4E94A 2AX4A 1GYPA 3U4QB 2Y1LA 1RQXA 3RW9A 3WV4A 2FSUA 2HNBA 4KO1S 1EFPB 3BSWA 4X5OA 3RJTA 4CKBA 4ETWA 1W8DA 4DJEC 4ZT5A 3CVYA 1CS4C 2AYZA 5T4EA 2A5FA 1ZK4A 3DEIA 2HAEA 4KFRA 3GG2A 4UUOA 1N5OX 2WTNA 4NXNB 4KIWA 1SPXA 1X1DA 3E3LA 4NENA 3RSCA 4ACBA 4HNUA 3SCZA 2WWWA 3KO8A 4TV8F 4ZANA 3GN2A 1U7PA 3P9YA 1DXHA 1LPNA 3JU3A 2ZULA 1PJ4A 3RFVA 3QTTA 2ZI3A 3IO5A 4ZKDA 2IUSA 1N8TA 3DAGA 3G2IA 2R8EA 4JEHA 4ARCA 2RGUA 4QL3A 4D9MA 1W36D 2HMYB 1U5CA 1U2ZA 2RH8A 1Y33E 1KS2A 3A1WA 1Y1TA 2OHFA 2HF7A 4KQJA 4R2JA 2CNNA 1V35A 1YK0A 1BGVA 2C94A 3L6UA 1J2RA 1VKHA 3JQAB 3RHZA 4MQUA 1CUIA 2WFZA 4Q3CA 4X62B 3H05A 1C8LA 1YULA 1ETUA 3VH3A 1NT4A 1OI3A 1VC2A 1EK2A 1C29B 3FI9A 5HA5A 2H7CA 1K92A 3ECSA 1DTEA 3CGWA 1SUFA 4ZOBA 5BSKA 1G6HA 1FFAA 2QTRA 1IVYA 2XQFA 3TSAA 2QLLA 1GPJA 4FHCA 4HSEA 2J3MA 2JNWA 1JTFA 2BV3A 3W5VA 5I7EA 2HEIA 3U1VA 1W87A 3AR2A 3IV9A 1C7ZA 3L77A 4LMBA 2ONKA 5CYFA 5ITSA 1EEXB 3EXHC 3X1JA 2D3WA 2PUCA 3SMVA 1BMDA 4U6SA 2G36A 3OZCA 1GZHB 3GRUA 5C1DA 2AEFA 1MN6A 3T3GA 2VFAA 2IYFA 1AVTA 5LLSA 5L7WA 2V7GA 3KYIB 1XLVA 1JLLB 3IP5A 4U4AA 4XE5A 4CMIB 1S3GA 4DQDA 5B7GA 3N2KA 1J7JA 1Z0SA 2Y1DA 3JTMA 3QMPA 4LMAA 3UJHA 1G17A 1U31A 4NESA 3UHAA 4OB8A 1H8HA 4EUHA 2R85A 3AW9A 4UU1A 2NSLA 1XFAA 2W9XA 1NF2A 2O05A 1KMHA 3UG7A 2RKBA 4MR8B 4CG3A 4CWAA 2RI1A 3SKXA 1NNSA 4B09A 4O4LB 4QPNA 3SG0A 4ZV7A 1P73A 2BY4A 2YJ6A 4GW3A 1HDYA 4UDOA 3D3KA 4HFJA 5FI3A 4CJXA 1HNWB 1KI3A 1V2GA 4IKEA 4R8LA 2ZZMA 1ST3A 3C3AA 4EECA 2DFPA 2HADA 4AF8A 1PTJA 1SZDA 2FJUA 1ZR2A 1IRXA 2XCSB 1IBSA 1W581 1GILA 2WTAA 2HPVA 3SVZA 1AURA 4D9JA 4BJ1A 4WOPA 4XX0A 1W88A 1NN1A 2IEBA 2ZU6A 3IJEB 4Q7QA 5BVGB 3PVZA 2RD2A 2IU3A 1SKMA 9GPBA 2H48A 2PIAA 2FPLA 2ZAOA 4JBXA 2Q9CA 4DV4B 1KI6B 3K73O 1HE3A 2OGSA 4HD8A 2B4KA 2R47A 4IZIA 4CHGA 1AV6A 3TR6A 3K0AB 10MHA 3CF4G 1IYZA 3AV0B 1RCUA 2QS9A 3LLUA 1BN7A 4ZOCA 1Q3TA 4E4TA 4LGCA 5T4BA 1U0NA 4PYNA 3D7RA 4ASUA 3F6EX 3GW8A 3BUSA 4YFVA 4B5KA 4EVRA 1L4KA 2JASA 2B8TA 1CVRA 5SYNA 4GGPA 4W5JA 4N3GA 4CM9D 4A16A 5MFZA 3VPGA 4C6TB 2HC9A 2O07A 2QB5A 4DR7B 3QBJA 1AQYA 4NH0A 3RT1A 3PQEA 3F6CA 3TVDA 1TMKA 1VJDA 1S7CA 3QWIA 4OUDB 4RL4A 1I7NA 521PA 1JIIA 2E4AA 2XE6A 5A0TA 4MUYA 2FUNB 5GONF 4IIHA 3FWHA 2XCOA 3H1EA 2G06A 3VOAA 1YCGA 5DHUA 2WIJA 1U2DA 5LMCA 1NBME 4H7EA 1E69A 3B52X 4D80A 2FJPA 2BUBA 5BP7A 5JNRA 3WL4A 1U7WA 1PF7E 1II8A 3DBLB 3MTQA 2FXIA 2DCUA 4KVGA 4LOAA 3AYZB 3OT5A 4TQGA 2J0QA 5A4KA 1C30A 1MT3A 1HWYA 3IEIA 3RG8A 1EJ2A 3KTAA 5ICFA 4BKPA 1DLJA 3GLIB 3FM9A 4I2NA 1LF5A 5BRNA 4ESEA 1N9GA 2SCUA 3L82B 3HLKA 1UZAA 3OOJA 1KU0A 3QU4A 2XUIA 3QOXA 1HDZA 2E48A 2X8WA 1BRTA 3FPGA 4DA0A 2JIMA 3SYNA 2PZLA 1AQNA 3I6ZA 1VG9B 1EVQA 4ZAWA 3CVVA 2PBLA 5ALTA 3B1ZA 4CCYB 4BY9E 3H2YA 3E5MA 1RHRA 2A0UA 4WOJA 5ARBA 2P3QA 3PEWA 3RS9A 1K86A 1H2WA 3MYRA 1MZPA 4M0DA 1BXRA 1O94D 1Z18A 3AH8A 1PR6A 1QQBA 1KK3A 4FONA 2PO7A 1CY4A 1WUJS 2W37A 3FVWA 3OEYA 4P4NA 3SI7A 4ZAVA 3U6KA 4M9ZA 4P0PB 1J23A 1D03A 4N3NA 3SDBA 4MYRA 3OPYA 3CVWA 4G1MB 3FTDA 1WOYA 3QLJA 1J8YF 3USCS 4RMGA 1T3ZA 4WKOA 3TLAA 3DWFA 3FTEA 4KTVE 1Y1LA 4MI6A 2P6NA 4RORA 4TMYA 1WVGA 3SX4A 2Q62A 1G7CA 3WYCA 1NNLA 3X1XA 3AVWA 3EH2A 3AUSA 4R40A 3O84A 1BH6A 1ZM2A 5FWNA 1WCIB 1YAHA 4R9NA 2FSVC 2Y6VA 3PCTA 5CM9C 2FZ4A 3K94A 4BNUA 5KMGB 1ULSA 5J40A 3FOFC 1KQOA 3QEOA 5DLYA 4JBIA 2HMVA 3UXYA 1DPFA 1LD3A 1DAEA 2CJWA 2LDXA 3LSYA 1L7PA 3FOEC 4NE9A 1HL3A 3AIMA 4ZEOA 1SGWA 1M83A 1JECA 1GNPA 4D3XA 3ZDBA 3TLMA 4P7GA 5JD3A 1RXUA 4TKUB 4B3BA 3I42A 1FP7A 3L6OO 3TGPA 2YW2A 2J3EA 2QLJA 4JLJA 1TVKA 2I62A 1XDWA 2QRZA 2ZYDA 4Y0NA 4M99A 3MAJA 2NYAA 2Q9BA 5KQGA 1YTLA 4Y1GA 4BV8A 4R98A 1PJCA 2YJGA 2VUIB 2HA5A 4J1TC 1MVLA 3SK0A 2QSJA 4I3HA 1USIA 1NJ1A 3GT7A 1AH2A 3ML1A 1NVUQ 5ICSA 2BUCA 4EJFA 1ZU5A 2QYSA 1GZUA 1WXIA 2XW6A 2QZJA 3CH6A 2VUHB 1XYGA 4GOKA 5JATA 3QKWA 4NMHA 4NZPA 2QVXX 4G2NA 4RLSA 4ESOA 1KYQA 1A2KC 3AINA 1KXJA 3JQ7A 4F5EA 1LWNA 1NQXA 3T9AA 4AS3A 4A0RA 4ALLA 2B8EA 3HO8A 1ESCA 4M9QA 3LF1A 4TWIA 1SCUB 5A71A 2HRDA 4ICIA 2F8SA 5DT2A 2ZTHA 1CNFA 2CK3A 1FBTA 3N8HA 1TA4A 3WSTA 2QPOA 3DFIA 2WIGA 3ONFA 4S0XA 3VDQA 1J0XO 2YIJA 1L3IA 1QK4A 3GV0A 1P8JA 4X64B 2VH1A 1AQIA 4QXQA 3GIWA 2PYDA 2JCBA 3CSDA 3DJFA 2Y2UA 2B34A 1HQYE 2QTMA 3IJRA 5FJIA 1FLNA 4ZAXA 5GM2A 2J0UB 3LECA 5C0OE 3WZLA 3TNLA 5JLJA 3B70A 4WEQA 2CLSA 2VG8A 1AF7A 3AJEA 1SD5A 1XDBA 3HXTA 3QVSA 5F3RA 4I81A 1K0UA 5FL7D 2C20A 4QFMA 2G28A 3GA5A 1A9ZA 1IM2A 2BFDA 2IKQA 3OKPA 4REOA 5F1PA 3F4KA 2OZKA 2C3YA 4ND2A 5AHKA 1MIOA 2C4KA 4C7JA 1AOXA 1VP3A 2E9SA 3TTSA 1DPGA 1NMSA 1DO0A 1AE1A 3K6RA 4GOJA 1JSRA 2GK6A 4CGYA 4MWTA 4DADA 3I5YA 1MXHA 4B7CA 5JFTA 3REGA 1HFJA 3GLKA 5DMHA 1YMQA 2HK6A 2GN4A 4MMXB 4D0NA 2ZJ4A 2ZWIA 1YKSA 3IKJA 1RPNA 4IFBA 5DI3A 3GLIE 1CG6A 1U5AA 4P7KA 3FPBA 1N2SA 3NS7A 2W6JA 5A4AA 4XD2A 5A62A 1Z5NA 3NOVA 2FMKA 2ZI4A 4YCMA 1UMBA 1G1MA 2D5CA 4P98A 4XSVA 1A4XA 5I9SA 3H0EA 4WWHA 2GBIA 1XQ6A 4LC1A 3PKZA 1JV2B 1J4AA 3AFIA 3E15A 4OQZA 1UODA 3U56A 1FBNA 3EVEA 3K9QO 1NL3A 1EB9A 3D0QA 3A1DA 3H5NA 4TZTA 3THYA 4KQIA 3G8AA 2J3HA 4HNSA 1E63A 5CAEB 3G7UA 3QLEA 5CITA 3QKUA 2X14A 5E7QA 1URPA 1GPDG 4LFBB 1J2YA 1MAAA 2G67A 1TO1E 4CV0A 2V9CA 3G59A 2G8NA 3WAJA 4EJ2A 1O0BA 2QMUA 5TARA 4JC0A 2NU6B 5KX5F 4FYMA 1SELA 1UUFA 1PUIA 1XJWA 4XSHA 2EZUA 4R3NA 4LF5B 1ZESA 4WZ6A 1B6GA 5DCUA 4C7KA 3MAAC 4UTVA 4Q34A 2CF6A 1VMAA 4GLBA 3E82A 5JXWA 4QJ3A 3RVJA 1P4GA 4O4IB 5HG0A 1J2TA 1D0IA 1P7CA 1Y81A 2FKNA 1BCSB 2IELA 3OETA 3OZWA 4XGRA 5CYOA 3PC6A 3OZ7A 1A76A 3ISJA 3B53X 4EL5A 2ONYA 1C8VB 1UFOA 3TUIC 4J16A 3GWGA 4JITA 4EAQA 5KYKA 5EESA 1Z8NA 2JHPA 3WNQA 4MRSA 1WCV1 4KZPA 2R1TA 4YUXA 4MVJE 1K63A 5FAKA 1E9FA 1ZXLA 1OKKD 5FBQB 4QRHA 5THKA 1ZEJA 4JT4A 1EFHA 3SQOA 2AXEA 1AUQA 4MS3A 1KZ7B 1GL6A 2DFTA 1RXEA 2W8BA 4LDQA 1MO3A 4JR2A 4MW6A 2PFGA 1ZIPA 4D4HA 1J22A 2X5XA 2QNIA 5DNVA 3ZWBA 3KEGA 4X6UA 1C7QA 1W1WA 3LCRA 2GASA 5DTIA 3O8QA 3RUFA 1H0HA 4XDHA 3HRIA 4X6LA 3WGGA 2OYSA 4EKNB 3GRPA 2QX7A 2XNJA 1DOHA 2PFSA 5FTMA 1HZZA 4HI0E 3T7EA 1NOKA 1ORIA 1FFSA 3EAGA 4BX3A 1IBKB 3AHFA 5LZ5A 1R1DA 1PQ4A 1TM2A 2AI3A 3GBSA 3A4MA 4URWR 5AK5A 2OXTA 3SEFA 1MHPA 2XUAA 1PW5A 1H6AA 4CL2A 3UJ3X 2ZIVB 1S8OA 2JVIA 1SN7A 5DO9A 2I71A 4LQCA 5LIPA 3LCMA 1MP0A 2OCKA 4X20B 2QQFA 2GSWA 5G0UA 1UFQA 1SMKA 1U0LA 2QGNA 2NMVA 3C15C 4M0KA 5IHPA 2J6IA 3ZK7A 4B1FA 2VAVA 3VFDA 4CV3A 1PGNA 1ZJ5A 1GFZA 1LH0A 1YS2X 1EXMA 2DSNA 3E3MA 3NXSA 4G4SO 4GRIA 4IDGA 4LZOA 2OA0A 4BN4A 3PF9A 1PNVA 3O0TA 4OI1A 1I4WA 4S24A 5HKAA 2XT0A 3B6IA 3N3BC 3PFFA 2PGJA 4XJTA 1JUDA 3L8FA 2P7HA 4I50F 2OVFA 3ECAA 5F52A 4FNGA 1JXMA 1Y6FA 3M4NA 4IEEA 1GTMA 1U3WA 3ZGNA 3I05A 5D1HA 3EEOA 1VRCA 4MQ4A 3L8DA 4W82A 1ISSA 2WMNB 1J5PA 2J33A 4DQVA 3OCCA 2OV8A 4EX6A 3BB4A 4NPAA 2RHLA 5FTLA 2AWNA 5LQDA 4KOAA 4MVJG 4RU1A 3PUZA 4X61A 3VNUA 2X0RA 1XELA 1TC1A 2EFJA 2J7KA 4GM4A 3ZJUA 1FCJA 1MX1A 4YXFA 3ASYA 1W4CA 3IESA 3RABA 4JVMA 4CV2A 4Z9BA 5IAEA 5DM1A 2J7PA 1BS9A 2KYRA 3DB2A 1X9IA 3ROPA 2C7RA 5JTTA 1K2WA 1YA6A 4EVIA 2YHUA 3LJKA 1L2TA 2QN7A 1JA0A 3B2NA 1O95A 4G0UA 1QQ7A 3SZOA 4C87A 4PSAA 2C7VA 4UTZA 2CE2X 1JR3A 5CJPA 2GVDC 2Y1WA 4Q19A 1ORDA 3R7WB 3UHPA 1C3XA 2HMAA 4R1UA 4QUDA 1E2DA 1F1JA 5SICE 1DIBA 4QUJA 2PSJA 2OUKA 4HZUB 5KINB 3ZWOA 4B4WA 1L1FA 2GHQA 3G8DA 3CZMA 1Y8RB 2WVGA 1E3JA 2MSKA 3PUIA 4YCDA 4YH1A 5CEJA 4DV6B 2AS0A 2CVPA 3LUHA 2RHWA 2VCEA 4RKWA 3AL3A 3ETNA 4JBNA 1E0DA 1FDIA 5FL3A 3BXPA 4C9BA 4Z7OB 1JAXA 3DHWC 4IDDA 4XA8A 5JSZB 2FKAA 1QFMA 4TROA 3GRVA 5T41A 2G1UA 4LNAA 1CUGA 5EEGA 1JFLA 1AHIA 4UHEA 1TAQA 4B3FX 5LQKA 1AO0A 2V96A 4B76A 4MJ3A 4GR4A 1TD1A 2COKA 1GQFA 4Y6OA 4BECA 4FGSA 5K05A 1JDTA 1RJEA 1L5WA 1Z39A 2E1RA 3WP1B 5B5SA 4AS1A 1JH9A 2OO7A 1UBGA 2E1PA 3ACCA 4HS4A 4M1EA 4QM6A 1E6MA 1XU7A 3RYFB 3VOTA 2IVZA 5AHOA 2HA4A 4AK9A 4RDIA 5FPPA 2FQXA 4ZCRA 1PT5A 4PRLA 2CSXA 5ADVA 4A8JC 3SHVA 3H5VA 3R6GA 4LISA 1C3OA 4H3SA 4LXIA 1NW9B 2CFIA 4PZUA 1EP3B 4FI3C 4RSMA 3L01A 3ABSB 2YW9A 3I72A 3O8OA 4GVXA 1CE8B 4HNAA 2JFFA 4NBTA 5I4CA 2PJRA 3VKHA 5JMWA 2GPBA 3U62A 1NKTA 4FEGA 3QVXA 1FB5A 1VB5A 4BIMA 1Y89A 3KAJA 1ZLYA 2GO1A 2VC2B 3H2BA 2BTEA 4M86A 1QV7A 3CEAA 4PRZA 4JYMA 5D8DA 1VJTA 2V7XA 3JZMA 5BUCA 5J5AA 1TYBE 5DTJA 4I1YA 3UWMA 5IM4A 3QMWA 2XTMA 1WXDA 3QNWA 5AP9A 3JYNA 2Q3MA 1NVVR 2MSEB 3M2PA 5G2OA 4QTXA 3M5WA 2AUTA 3EXFB 5GWXA 3GRRA 3GWZA 3ZWXA 5LLTA 1A77A 1DIHA 5JCPA 3OQNA 1BW9A 1FXWF 4TKVB 1PG2A 2R4QA 3A05A 3MELA 5J4KA 2PFKA 3FJ1A 5FOXA 2DQSA 2ZKIA 4QZVA 3MUNA 1UBEA 1XWWA 2AHRA 3BJZA 1TK9A 1QUEA 2DWQA 3LL4A 2RAVA 5CG2A 2HHAA 4M8NE 3F96A 3G2QA 3CCCA 1N5MA 3MCVA 1NR7A 4LCEA 3VTFA 2PS9A 4MRPA 1VLLA 4Q66C 4YO8A 3IR5A 1VSTA 3WKCA 4WIAA 3C1UA 2AKEA 1TRKA 4IQ4A 4S1WA 3DLCA 4WVLA 2PZ8A 3MWEB 1PEKE 3DC2A 2O7QA 2AOTA 1YQ9A 3JQQA 3GVIA 1HORA 4LSMA 1NQTA 1WXGA 2A9VA 1F60A 3P26A 5HUQA 1BA3A 1ID8A 1JLHA 2M1ZA 1SPBS 3PDWA 5EIEA 5A2GA 1A04A 2ZKLA 1XEWX 2JIRA 3M89A 3QPUA 3L8HA 5ES3A 1EFDN 1KDVA 3REFA 2O7NA 2AT1A 1FJXA 5FLKA 4BNWA 4O2AF 5D5HA 4DMUB 2FUKA 4O02B 5GIPE 3D4OA 4FKMA 1DB3A 2GXQA 1CYEA 1NXXA 4Q7LA 1Z88A 2CN1A 3PHLA 5AOVA 4DIOA 4DYHA 4EFMA 1D8AA 2AK2A 2GH1A 2H6EA 4XVQA 5TRTA 5J4YA 4WXEA 3T1OA 4XB1A 3ZCTA 3QXJA 2O4CA 2O5CA 5KJFA 4IVRA 2MHCA 4KU4A 1PO7A 3O82A 3JR7A 4GDFA 1D0VA 1L5RA 5LQMA 3K92A 5KSWB 4B3TB 4PO8A 1JJAA 1K8YB 2VDVE 4EVSA 2JK1A 2ONJA 1FRZA 4YJ3A 4N47A 1N4AA 3CVXA 3FF1A 2IVFA 4DNQA 5HS4A 4L5JA 5AXCA 3K70B 3KLPX 2NV6A 1YJQA 2Z5LA 1UDCA 4Y1RA 1PEAA 4KXQA 4RF2A 1SUAA 5IYZF 5LOVB 1M8FA 4TUYB 2GBGA 3E3AA 5C32A 2WINI 3R6DA 2VHWA 3MYYA 3TRHA 1IN8A 4Z99A 3GEHA 5JWOA 2UXDB 1HTBA 4KH1A 3RFTA 1QH8A 1ZUIA 1X15A 1P0IA 2ABWA 2GFHA 3G0GA 5FUXA 3EQ7A 5C1IA 4BO4A 2IYEA 4FFBB 4PPGA 1WQ4A 5BW6B 1H4SA 3K5HA 5CDYA 4I5IA 2ZJ6A 3BSYA 4Q0MA 2JJQA 1TCUA 2WWRA 1EDDA 3KJIA 4LSWA 2CNLA 2PUTA 3EIOA 1DX4A 4EY6A 2ECOA 3LA6A 1WB6A 3CISA 1CXZA 2JB9A 3QENA 4GOLD 4C4XA 3WHKA 2KE5A 4HDSA 4HWOA 3ANXA 3EDRA 4DIFA 4RW0A 4EKGA 4ZZ0A 4LW8A 5HUHA 1LBTA 1R0RE 4YRSA 1L4BA 3A9RA 5B2EA 4QOHA 3EHDA 2PUJA 4LI0A 5ESDA 4DV3B 1FNBA 4RF3A 4YP7A 3CS3A 3WL6A 3STXA 3HFSA 2EL7A 2V8OA 4RZSA 4JVOA 4E5YA 1KE1A 3WLQA 4I5FA 3OLVA 3M4XA 3NBYC 3I92A 3P4UA 3PIRA 4DAOA 3TUZC 1F0NA 3T38A 1R00A 1JZTA 1ZG3A 2D74A 4XIIA 5KO2A 5CFMA 5IAKA 1JFTA 1A95A 1F14A 1Q11A 1T0HB 3VH2A 3V4SA 2IEZA 3E1GA 1E1RA 2VJMB 2BTQA 3IEKA 4U0JA 3W3AH 3S1SA 5AJUA 3U49A 3CZ5A 3VZRA 4HFRA 4HRXA 2PZJA 1RQLA 2PRIA 3PHJA 1P72A 2ZATA 3CG0A 3H65A 3NFRA 4H08A 4KUHA 4L6IA 2BFFB 1NUQA 4OU4A 4DWJA 5TGDA 2LRHA 4K1XA 4TTVA 2HLDD 2PMWB 4Y6LA 2CWWA 3KOWA 4DQLA 2BIFA 4LSZA 2QLBA 2JCGA 4QVGA 3UCXA 2YBEA 2QMQA 5C18A 1XEAA 3H5LA 4E13A 4ZDJA 1BVRA 2IYYA 3HBNA 4KN8A 3QFFA 1C1HA 2JBAA 2QZSA 3I0MA 1FS5A 3ELBA 3CINA 4NBSA 1U1EA 1UOPA 2P40A 1IPFA 1E4VA 1EZ1A 5KWIA 3KQVA 3S7TA 4B48A 5DIZA 3WB1A 1LTHR 2ASVA 2RHTA 3K20A 3DDNA 5FWDA 1PJ8A 1S0UA 2QL7A 1R6TA 2P3SA 4IYRA 3OF2A 2JLBA 4IWNA 4XTRA 4PIMA 2G9RA 5EJ2A 4EZEA 5K0TA 3BWVA 3QQPA 4DFDA 4DSTA 4FUQA 1XEXB 1ZOLA 3RJ9A 3DG9A 2X86A 2PUBA 2X9VA 2WLTA 1CQZA 1R4MB 1ES9A 2PU7A 1CP2A 1YCDA 1VLMA 1DQSA 4TYMA 5H02A 3SZGA 2DR3A 4HDRA 4DLBA 2ZZNA 1U0HC 1M1XB 1DEHA 1YDWA 3K05A 3TR0A 3UC5A 4QLAA 3DMHA 5GVRA 4KTTE 4B85A 3CC8A 5BURA 1NN0A 3QF4B 4O25A 1PZNA 1H69A 2CD9A 2HSEA 1Z83A 3FPLA 4EG5A 5KQLA 4PZ0A 1IN1A 1ECLA 3KHSA 1CLEA 4TV9F 5E8RA 3T5DA 3WBKA 4QATA 1D1SA 1LK7A 3PFWO 1A5ZA 2GTPA 4B35A 4CT4B 2QE6A 1HNXB 5AWFC 4V1CA 4QUIA 1DAIA 1V6SA 5G41A 1EGQA 2YWRA 4INJA 3AG6A 4L2IA 2CUKA 1G19A 1FDUA 3HWX1 4LA4A 1BX1A 3ROZA 3HV2A 2J3KA 3PQDA 2EKLA 4RO0A 4WOBA 5NULA 2PG3A 4IHKA 3RVNA 1M2OB 2XGMA 3L0ZA 2A3NA 1TM5E 3M82A 4X1YB 3UMMA 5TDHA 3ZXYA 4CIYA 1EUYA 1IMJA 3W5JA 3BL8A 1T3SA 1NBWB 1PEYA 1C0LA 2DG2A 3BULA 4RUKA 2HQSA 4ZD6A 1ISGA 3BD7A 5F5LA 1LY1A 1Y4DE 2OD9A 3GGSA 4DS3A 3AI7A 3LY8A 2C84A 5ICGA 3LHSA 1GPBA 3WA6A 4J2TA 1B0UA 3OBBA 3LD9A 3IHKA 2IL1A 4IX9A 1KVSA 4YASA 4BLQA 5U9CA 1CZKA 2I29A 3U4IA 3T9BA 1QOPB 1R9MA 2EU8A 3DTVA 3CF0A 4O4JA 4OB6A 3G8YA 5KOJB 4JS0A 5BYAA 1OPRA 2R60A 4LZJA 1PKEA 1KJ8A 2XEDA 3IO3A 3IAS1 1BZYA 3LY9A 2PEYA 3B9QA 3DB1A 1A7KA 1E6UA 3B51X 1OC4A 4M88A 4UAUA 5AQ1A 3KQNA 2W4IA 2HFKA 3L4BC 2QXTA 3IMKA 3IQEA 4G23A 4NBLA 4YHBA 4G0NA 1P6QA 4PG6A 2UXBB 3LMKA 3DAPA 4EELA 4KW7A 1CRWG 4JR0A 2JAQA 5AW3A 3QPVA 2WAMA 1R15A 4PZLA 3U3KA 2EJWA 4OEHA 2R00C 1KZ6A 4DCVA 3QPWA 2G09A 4LDAA 3NYRA 2R1VA 3ZDDA 1N8NA 3MK31 2P67A 4F93B 1EYZA 1P1FA 1YZHA 4OHKA 3KJGA 1NNEA 1ABEA 4HPXB 1GA4A 1SZJG 3VU3A 4DIMA 3B9PA 3HR4A 1YQQA 4KKXB 1F7VA 3FCAA 1W46A 2D2VA 3DAHA 2XA1A 3U7IA 2QORA 3UJBA 4I1IA 2WYUA 5H59A 1C14A 2M2IA 2A7XA 4WJKB 3HCBA 4V0QA 4HDAA 3LZ6A 5AIAA 4EJSC 7MDHA 3S1AB 4K9LA 3WKEA 3T1QA 1KRWA 1SVOA 3S0JA 3QKSA 2JIZA 3DBOB 4DA6A 2AUNA 4D8UA 2QUBA 3AHCA 4PE5B 4TV8A 1KS9A 1NF9A 1PSDA 3B1WA 3UK1A 3HC7A 3X1YA 4V39A 1Z28A 4Q9HA 4RTPA 1YRQA 3E9EA 4L72A 1XTZA 1G8FA 2NO0A 4GQIA 2V9PA 1GL9B 1V2HE 1TEHA 1WSBA 3E9RA 1U3TA 3DQZA 1O77A 4G56A 4BBAA 4D0SA 3LUKA 4M0MA 3GELA 5TEVA 1X0XA 1BYUA 3EFEA 4E5PA 1XUOA 5HEKA 3B38A 5L8VA 4E2YA 3ZYCA 3ZK9A 1KDRA 4EX7A 4OHUA 5EEHA 1I32A 4HNQA 4F5YA 3D8BA 1WRBA 4B3SB 1Z33A 5LZ7A 2J85A 5DZSA 1BD4A 1Z5UA 1GA1A 4M55A 4UVIA 4OFXA 2QVGA 1F48A 3E8SA 1N5RA 3HU3A 2JVKA 1UKBA 1VMIA 3D7MA 5JO9A 2I6XA 4PZEA 1AN0A 4CGZA 5JJIA 3OIYA 4ZO7A 1I6WA 4B0PA 1JDPA 4YREA 3GJSA 2XIQA 3A27A 2NPIA 4LJLA 4Q4AB 1T9CA 1GG9A 3JD0A 1LW6E 4A91A 16PKA 2GPTA 4Y18A 4IGKA 4V3CA 3KU4A 5DLQC 4CN9A 3G9ZA 1L5OA 2FEKA 1C9NA 1TCAA 3C5CA 3D1JA 1ZKDA 1DCKA 4QDTA 5JCJD 3OCYA 4KIJA 5BPFA 3ITDA 3KZNA 4CKWB 3CW2A 1QNLA 4TX1A 4GP9A 2Y3IA 4K2HA 4BFXA 4CKZA 3PXDA 3VA7A 2E49A 2AXNA 2FETA 3HVJA 1X7HA 1HQDA 3VR5D 1R4NB 1TQ2A 1E3WB 3A6HA 5D3MB 1QU2A 1NW3A 3R9XA 3FG9A 2C2GA 1H2HA 1U2GA 5BMVB 1E2LA 2FVYA 4MULA 1C1YA 4EB3A 1ATIA 2PR7A 2HA0A 1M8GA 5CHYA 4F3RA 2TMKA 3O3OB 4MK4A 5KYWB 4EG6A 4H3KB 4WJLA 1YZNA 5K2MA 1Z6QA 1F6DA 4HDQB 4NC9A 3KJHA 5T8KC 3ZYZA 4HXFB 4R41A 4RPGA 2XB2A 3IUEA 3AKCA 2PKYX 4OMCA 3U4HA 1EIZA 1EVIA 1I2DA 4XPZA 3GA0A 4TXLA 1XYYA 2O3RA 3CSUA 4TL6A 4ZC1A 3NKFA 2JFOA 3ADOA 3RIEA 2CHVA 2O1WA 1P9NA 3PWZA 2FSSA 3IB3A 2A5YB 4BNYA 4TLMB 2KMLA 2R4TA 1E1LA 1KORA 2A14A 2GCPA 2HIGA 1T4MA 2HA6A 2RI0A 3IQDB 4BAZA 4BUCA 4KXVA 3QFSA 3L4EA 4MQEA 4EW2A 1XAGA 1GZ4A 2C9MA 3ICWA 3JAKA 3KQTA 2YWEA 4H0NA 4LWPA 1V3QE 3E18A 1LV7A 4RK7A 2YV2A 4RQTA 4MGHA 3I37X 5EKDA 4B47A 4UMFA 4YR9A 3E0XA 3AJ9A 4GI2A 3P9IA 1H1TA 2Q3HA 1KKMA 4TXNA 4DZRA 4AKIA 4AUKA 3SYKA 3IVXA 1AUOA 3AIKA 3E58A 3LPDA 3F2IA 4K3UA 1R37A 2OAP1 1X7YA 1U7HA 4TYQA 3ZNPA 2C5FA 3ZWKA 4DLAA 2O1SA 4X97A 4UNRA 1Y4ZA 3I5MA 2XSZD 3EY4A 4PV7A 5BR4A 1DJNA 2Z3ZA 1YQGA 2H1RA 3NTUA 4H7FA 3DFKA 2F3RA 3D8SA 1YHZA 3EEIA 3EXEA 2Q0SA 1AK1A 1GNSA 1S2MA 1NRXA 2G3YA 4A10A 1V3UA 3QXCA 1MQSA 3E70C 5IP5A 4M0EA 5H3LA 2YR0A 1WPXA 1KWKA 3BRWD 4Y2XA 2QTWB 1EWRA 1N6NA 3QBDA 4KPGA 2Q1YA 3JD2A 4OP1A 4DARA 1RTKA 4HCJA 1J8MF 4CODB 1L8XA 1YBVA 1XZLA 1QYCA 1ZNXA 1ZONA 2VZ0A 5FBRB 5IC5A 4AWBA 1RVDA 3JW8A 4Q1AA 4U3JB 3KSBC 4BUZA 5ITZA 2PUAA 2H1VA 3WJ2A 2VF2A 2BEKA 3HWWA 2A92A 3EG9A 3F1KA 1W0CA 2C9YA 2V6JA 3BMNB 2MCFA 5KI6A 3ZGLA 1AQJA 2O8BB 3JQGB 2HCTA 2B25A 3LQQA 1YHYA 4X93A 4OGWA 4OA5A 2X9GA 3DOEA 4CM4B 4UD6A 1JZSA 1G8GA 1XMIA 2BMWA 1XE3A 2H1CA 1KIFA 1PAUA 2BZ0A 2YV5A 3IP6A 2O3SA 3JARB 3M70A 4ZOLA 4ZCSA 1NY5A 4EABA 2ISCA 4WFKA 1JGTA 2ORVA 2VAPA 5DBEX 4BGDA 3J7AC 3URKA 3G9QA 1A9PA 3PR2B 5CUQA 5AJZA 2XECA 5IJAA 3U3OA 4C0WA 1GV1A 1BU8A 2Y9PB 4LOHA 2BHTA 1M10A 3DL7A 4G9GA 2VJKA 3WDKA 3I6YA 4DSNA 5MDHA 4UVDA 3N6VA 4J75A 2LIPA 5KAMA 1ZA1A 2IUUA 2QJTA 1SHKA 4QDOA 1XDZA 5ALHA 3D4BA 2PVCA 4JEIA 1VGRA 1FVXA 4Q3EA 5DK6A 4ENQA 1W2WB 5EJMA 5CNIA 3DMDA 4P83A 1B8PA 2IUEA 5JD4A 4KSCA 3ZBTA 1YI1A 2WWHA 2MOKA 1TYEB 2MSLA 2YWBA 1R5NA 2F1HA 3U80A 2EFHB 4WADA 4EENA 5JAHA 4E12A 2XMSA 2VPWA 2HA2A 3FYUC 2AMVA 1TYDE 5FA5A 3HCPA 2I6UA 5I7VA 1F20A 2ETVA 2PNFA 3AR5A 2CXNA 4JMLA 1I1QB 3I3SR 3Q1KA 4ZI5A 5ENZA 1EUCB 2RG7A 2ZSKA 4GX1A 4C2UA 3X3HA 3CPJB 1A7AA 5D6OA 2Q5FA 2GNPA 1JHQA 2WU1A 3A8TA 4K8OA 4QM7A 2NVUA 1YDMA 1LSUA 3DMYA 2V8BA 1CJUC 1DHRA 2DUNA 4TQ9A 4GXNA 4Y0AA 1RYYA 4ND8A 4MUFA 4WBNF 1RWXA 3AKZA 1E9BA 3B36A 5K0GA 3JYHA 2JLYA 3N0TA 2NU9A 2PPLA 3WWPA 5DX8A 1DDGA 5EE0A 4FDTA 3AETA 2XR1A 1TX4B 4ZI7B 5K1ZA 1OIXA 1DINA 3HP4A 4FGLA 2BMEA 5LYJF 1NXSA 4JDPA 4I4TA 1RYDA 4ZIRA 4O3MA 3M4ZA 4PO9A 4EG3A 1YB2A 4QTZA 1VHDA 2ID7A 3IHWA 3OCWA 4WEOA 4OOEA 1C3VA 1QYIA 2WKSA 2VJNA 4PXSA 3TI7A 3TL2A 4YMLA 3K4QA 2ZJBA 3IT0A 3LVRE 4DTCA 4P8RA 3TCXB 3FPAA 1RXIA 1A50B 3ZU5A 3I9KA 2R6ZA 1HQCA 2BP7A 3PUYA 4RF5A 5IBQA 2Y1FA 4L57A 1OD6A 3GDFA 2HSZA 3BMQA 2PH3A 3IKMB 4GP6A 1JDBC 1XPJA 3OY7A 2WZBA 4NZ9A 4GQBA 3UC9A 1RI5A 2V7TA 4GSYA 1LNZA 2D8MA 5BSHA 4BEWA 4K9SA 1RLIA 4RGQA 3BE8A 4PBTA 2VXOA 3UXMA 3DL4A 4FWIB 4QSHA 5M7EA 1TLFA 4FE7A 4LY6A 3I8SA 1N3IA 1ZU4A 4Q47A 2IJGX 2VSQA 4ZA2A 5ELLA 3UM9A 5EJ9A 1TK3A 4XWWA 1G7TA 2DUUA 3KZXA 4Q03A 4E1AA 1QP7A 5JAIA 1ZD9A 2NZ2A 1SC4A 3VR4D 3BMXA 4XSGA 5HF8A 3TW0A 1JIQA 5KCZA 4R2MA 1K6JA 3DV2A 4GU5A 5B6PA 3OMXA 4NG4A 3BTOA 3C16C 1BGXT 4HZGA 4JBGA 4WXMA 3S2FA 1X13A 1FUUA 3QOYA 3SXPA 4UHKA 3ZGYA 3BMOA 5DRTA 1UT5A 4ARAA 4MWBA 4WL0A 3E1SA 1V8ZA 4QODA 1PJLA 1W5EA 5EA2A 4GOXA 2QD2A 2FZLA 3MTBA 3ZHTA 3KWLA 3N2GA 4HPJB 3W6UA 4XAQA 4I36A 3AUKA 1N0HA 2WM3A 4BMSA 1WJGA 3C97A 1DZ3A 4L02A 2XT6A 5FNVB 5H16A 1OXUA 5K0LA 3NTLA 4HUTA 3DGEC 4ZCQA 5LM3A 1KFEB 2QMZA 1Z47A 3IT1A 4PCAA 5A2QA 2D7DA 4RHCA 1M67A 4M8IA 4RJIA 5HXAA 4PNZA 4QPJC 1JFFB 3EISA 1UBUS 3GDWA 2F1IA 4Y9RA 1Z5GA 4B5LA 3CH7A 4U1RA 3DHNA 3FHTA 4OJYA 2ZI6A 4GH5A 3UTDA 2D06A 5EZ5A 1JN0A 2ZUDA 5JJ5A 4V0ME 5H81A 1OZFA 1FP1D 3VSDA 1GGNA 1OX5A 3O90A 4R1PA 4K2AA 1NI5A 2PBRA 3CURA 3LPLA 4P34A 1SVUA 2Y4NA 3C3BA 4P7FA 3RD5A 3WWDA 3C6QA 1WLYA 3JVDA 4FBGA 4H4CA 4QNNA 4QQRA 3NALA 3I6QA 4MUEA 1YR7A 1CUDA 5FH9A 3LHFA 2BGWA 3F8SA 1D9XA 4UJ5A 4NZOA 1W0JD 3D59A 3EDCA 3TLYA 2QT0A 3C7CB 4JNKA 3EUEA 4AI6A 1P39A 2AG6A 4R1MA 1FYXA 1K6EA 5I8ZA 4GE3A 1E4OA 1RBZA 1IBLB 4D8TA 2R65A 1H9AA 1E4EA 2N1MA 4FR0A 3UICA 4JOBA 1XVLA 4E5SA 4J7CA 2AOUA 3L1IA 4S0ZA 1NJ5A 3MBOA 4WLEA 5FWYA 1Z0FA 2G9QA 3ZVRA 4H2DA 5JEDA 2WU0A 5JJKA 4MP6A 5AM1A 4GLOA 2HZ7A 3IVAA 2Y1EA 2ZU0C 5EGSA 1YQUA 2ZIZA 1OWPA 2GD0A 1SG0A 2JIPA 3C4JA 3MGBA 1XTKA 2G04A 4LYEA 4OA8A 4WVFA 4XM1A 3BE6A 5CH5A 5E2BA 2IOYA 4XJXA 3K8QA 4INAA 1DXYA 1DQNA 3V7WA 2B35A 2VP9A 3JQBC 3LPNA 1TAGA 4CM8B 1K7XB 2G6TA 4OU5A 1BEZA 3RAFC 4YGXB 1XMSA 1ZUNA 2HF2A 2GPSA 1H8ED 2ZB7A 3FUVA 3K8YA 5DGHA 4YPVA 3HYNA 1EM6A 3UY4A 1EFVB 2BMVA 2PZFA 2Q6IA 2CEAA 3LXMA 1M1YB 3HDYA 3OD1A 3N2IA 4YAWA 2VS1A 3EJWA 4FHZA 1YJ5A 5FYQA 3K0EA 4UVEA 4WESA 4TSRA 3R5FA 4KODA 2WHPB 4LZWA 2Q0QA 5TB5A 3MG9A 1JKXA 4PICA 4DDVA 2NZWA 1QFZA 4DA8A 1E18A 3AEUA 1K7YA 3BCHA 3T61A 4EB6A 3CWQA 2VDQB 4WZBA 5BSVA 4AMYA 4H3HB 3SZLA 3GQBB 2PL9A 1OBVA 1Q91A 3O8LA 1SXPA 1CS0B 1JX6A 2H1IA 3Q8WA 1WUHS 1XB2A 2C96A 2R7NA 2X2FA 5ARDA 2CF5A 1X7WA 4FILA 1KAHA 1I5RA 4PFJA 2F2TA 2V65A 2I55A 2FRXA 1CUXA 1L1EA 4FHEA 4ABYA 4MDEA 2DPGA 1QCZA 1U8AA 2GM4A 3EUFA 2B4TO 4HNTA 3ZWNA 1K3FA 4KO4S 3Q72A 2RGBA 4GWLA 2PCLA 4RF4A 5KS2A 3TD6A 3LGSA 1PCXA 4F85A 1M6EX 4O63O 2WPDA 4S05A 2GXUA 4KLNA 2REXB 4Q9DA 3K1TA 4BB0A 2VDLB 2Y1XA 4EZIA 4NHEA 4GPIB 3NQ41 5PNTA 4X65B 5KYXB 4L08A 2QTCA 3HRKA 4I50A 5AI9A 3SQMA 1I7SB 3AI2A 1WDKA 2PJDA 2QTAA 4K9NA 1X0VA 4GPD1 5FOVA 2JFHA 1R6XA 4W5OA 1GNQA 3EWAA 3H5WA 3QRWA 3D6JA 1QHHA 3L2OB 1REQA 2VHZA 4IIBA 4ZRNA 3SJBA 5HK9A 3IPRA 3CUSA 4MZXA 4R0NA 4DYDA 1EVZA 4UZFA 2TSYB 1IY2A 4MV4A 3H8VA 3BD9A 5P21A 1OJ7A 3IULA 1IB6A 3WK4A 1X8XA 2V5VA 4JUAA 2YWHA 3AC0A 4AY3A 2BEVB 4D5EA 1D2EA 2PTHA 5SZKB 3GAAA 3WFJA 1VYVA 2VDKB 4NMLA 3L7KA 2A5JA 5K3BA 3PHHA 1IUKA 5SY9A 3NVDA 3QVGA 3VJLA 1IIRA 2GLUA 2Z4SA 5B3LA 3R9IA 1E94E 4BV3A 2ZRIA 1NC1A 2H2HA 2OWEA 3MSCA 1YJ8A 4GMFA 4WBSA 1P62B 4MVJM 4RLQA 5F51A 4C1NA 5K3OA 1U8ZA 3PKIA 4CR7A 3CLTC 2JLAA 3PT9A 4RDCA 5FPKA 4QRIA 1K68A 4TYPA 2ZXEA 2WT9A 4Q1CA 3WNDA 5K09A 1QAOA 1Y1SA 3ZN2A 5A4MS 1HNZB 3LBNA 2JGLA 1RYHA 2P4QA 5K8IA 3EPRA 1TTHA 4TL9A 4NF2A 2CJXA 1MC8A 2Y0CA 4Q4LA 1D2MA 1W6UA 1OBHA 2Q1WA 1UKAA 3L8CA 1TJ4A 4OHZA 3QIVA 2IV2X 3REOA 2YS7A 1I3NA 1CUVA 3SY8A 5EJ8A 1EKXA 2QYHA 5HM8A 2X19A 3I4CA 2JDID 1CY2A 1XEWY 3PEEA 1HSZA 1U90A 1WE2A 1ZK2A 2AN9A 4WGGA 3WYFA 2GDZA 1SXJA 2NXCA 4AJ9A 2GM9A 4OBBA 3KUUA 4D45A 3L7IA 1JHDA 2Y67A 3VYRB 1NI4B 4O4LF 2O2SA 3WLFA 3WNBA 3UAVA 4D9GA 3KHUA 1CRPA 1GAXA 4A1OA 2R2GA 1XZQA 3MWKA 2VDWA 3JQFA 3GARA 2RGWA 2IYNA 3C87A 1G16A 3PJRA 3AY6A 1TM4E 2C9OA 4IXMA 2FP4A 3SR0A 2C2OA 1V6CA 2HBYA 3WIEA 4HWKA 4QUHA 5SV2A 2BGKA 4YA6A 5INTA 1FYFA 2QBYA 1C8KA 2ZVQX 2QROA 4HTFB 2EERA 3F67A 2LCIA 4DMMA 3UBTA 2B1IA 3JASA 1K89A 1RHKA 1ZH2A 2NU7A 3RCBA 5IT0A 4AZTA 1GKUB 1P5FA 2IYZA 2G5GX 1DX9A 2OCYC 1UQTA 4OKIA 3SF8B 4YMVA 3REQB 3NH9A 5TQ0A 1R8XA 4RTNA 1E7YA 2J9RA 2I4MA 2IYUA 2RH9B 5B2FA 4RA6B 4OLHA 1NG1A 1NZFA 1CFZA 1UKVY 3E27A 3WL7A 4YUWA 1OTYA 1T36B 2D0IA 5BSWA 2LZ0A 3H4MA 1CUHA 4H17A 4QEKA 4NATA 3DPIA 2JFGA 3OEEA 4DCOA 4HK4A 1Z2NX 4L0DA 1M1YE 4MIEA 2PTGA 5CA1B 3LF2A 1EVKA 1XZDA 1SC6A 2BFBB 5K8VA 5E6RB 1YRYE 2E89A 2R8PA 3A1EA 4GPBA 1QCYA 2C3OA 2XZPA 4UHCA 4WLFA 4EI2A 5HX7A 5I7RA 5H8WA 1CJCA 1XKXA 1W30A 3L02A 1D7AA 4IDFA 2CJYA 1QLJA 1RFLA 1E9RA 2IWHA 3GMSA 4C4SA 4Z1OA 1SVMA 4MTCA 5EQDA 3U0VA 1CY7A 4PRYA 1ZGBA 1N2CA 1VJRA 2L42A 3L8GA 3PTZA 3AB8A 3KYBA 1FP4B 3E2MA 1CUBA 3AOEA 3EXHB 3HB4X 1KZ9A 1XTPA 4BGEA 5I8WA 3U16A 4B3JA 3G23A 3VNVA 4KP7A 3BEOA 2R6CA 2WV7A 1D04A 3B7PA 3PD1A 1MC5A 3ROXA 2P0AA 4OAOA 3O26A 1D09A 4DWOA 2LNDA 1E2JA 1UKYA 2I7DA 2IX9A 3M7IA 5D3ZA 2ZR9A 1SBQA 1B0AA 1GUBA 1K4MA 3ESQA 1II0A 1BQEA 4N5DA 3RRJA 1OAOA 2WD7A 5JMPA 2BM1A 3A36A 3EGDA 1HDGO 1R0KA 4EO4A 2IOQA 5B57C 2UUBB 3AJAA 4EPYA 2NADA 1QC5B 3T8YA 2GK7A 3P1JA 3N8IA 1CUSA 3P5BA 1IQ0A 3HJHA 4H1VA 3GUZA 3SHWA 3C6XA 2O23A 3KXLA 3ZDQA 2HDNB 4RWEA 4DZTA 2CL7X 1X6VA 4NTZA 1JB1A 3HKBA 1NDHA 4HH1A 1MO6A 2QG9A 2O0LA 4GEGA 4R3UC 3U60B 3AM1A 4NCBA 4EA7A 4DLSA 3B8EA 4NOMA 3DMPA 4UUNA 4NJMA 3VHLB 1NFFA 5KTTA 1J9ZA 4QE3A 5HYVA 1SNYA 2WJ3A 3LU1A 4GR9A 3TR5A 4EK9A 4FYIA 1IN5A 1DG3A 3O8NA 3DEAA 1MB9A 2VPQA 1W59A 4RK6A 2NUPB 4JLAA 1UBFA 1T3HA 4G97A 5HF6A 1USUA 2IHZA 3KLBA 3A32A 2QRVA 3HJGA 2BLLA 2HO5A 4R05A 1U2SA 5J58A 4PX3A 4IDNA 4Q4HB 4ZU6X 4J3JA 1DQRA 3A9SA 1NVKA 1WL8A 2CCKA 2XDQB 4QFBA 3TJMA 1YFJA 4JXZA 1EEHA 4JYBA 5HKKD 2R5WA 1XHFA 5KDDA 1VI6A 5F5NA 1MDFA 5KQMA 2V97A 1H2FA 4MVJF 4OH1A 4IUCS 4EY8A 5BSEA 2W5UA 4IO0A 3ROMA 4ZN6A 3NRJA 1AD2A 4FHGA 4XGIA 3AOGA 2OAGA 1X7ZA 2VHCA 3KKOA 3LQ1A 4RIGA 4HEHA 4XDYA 5ARCA 2Z09A 1O5TA 4WN9A 5F7XA 4R2LA 1YZYA 2VDOB 2XE4A 4C22A 3BH7A 4NEGA 2C07A 3X1MA 3LP8A 5BRAA 3ZXSA 2B0CA 2OOKA 1YACA 3R09A 5A7GA 3WZMA 5K01A 5KOHA 3JAMA 2QL9A 2HJVA 1KPIA 1ZY2A 5B3KA 2O0HA 4CE6A 2DLDA 4X71A 5AW9A 2PT7A 1MEJA 1GTG1 2FSIA 3ACDA 2VUSA 2XMGA 3IBYA 2XJ4A 3TPZA 1P17A 3V4RA 2ERXA 4M49A 4OHCA 2Q9AA 4AVYA 4JU9A 1WABA 2X0KA 2QRGA 2BPOA 2DPYA 3E84A 2RSLA 1LTQA 4D43A 3UMBA 3O1HB 3A58B 1ZL0A 4NV0A 4FVTA 4CR6A 2J07A 1CQXA 4Q7JB 3EZFA 2I2FA 4I0WB 4KEAA 4WJZA 3GJYA 2X76A 2C4MA 5EWJB 5FQOA 2IIBA 4IZ6A 3G0CA 4QOSA 2P8SA 4HTAA 3NVKI 3G2NA 2EEZA 3K3PA 3AR9A 4JXXA 2ZWAA 5JLAA 2UVPA 1SXGA 3GGGA 3EYAA 5FT9A 4KGDA 1MFZA 1FUEA 5JCOA 4B4KA 1QKJA 4F21A 1IHXA 2ZCJA 4PGHA 4J3FA 1XTVA 2O6LA 2ZE8A 4WI1A 2UYHA 4QD3A 3A2MA 5DT9A 1CT9A 3IMEA 3NIGB 1EK6A 2E5WA 5L3QA 3ADCA 2ZXUA 2RJOA 1NXWA 3FFTA 1NVXQ 1C4XA 4JZYA 3PX7A 4D7AA 1WVIA 3F97A 4GKAA 3EPPA 3I34X 3D3QA 5E95A 1M0SA 2O8EA 3D7LA 5C1PA 2AXQA 4ADSG 3DZKA 3ZW8A 3OOEA 4RV4A 1I4DD 1QVRA 3OQPA 4IX1A 2P6PA 3ZCSA 621PA 1HT2E 5IANA 3OIWA 1UT8A 4BVJA 4P86A 2WP0A 7AT1A 1ZRHA 3C6KA 1ITZA 4O0LA 1ISJA 1DXOA 4WXRA 3OUUA 5E6UB 3ZTWA 4DA7A 5FBVB 1MAHA 1YOVB 3CO5A 3QWFA 1RWMA 1U8CB 2OV2A 3RS2A 2GN1A 2Y27A 3TWOA 2O2CA 4Y1FA 2GFIA 3H1TA 3P9PA 4F2GA 3JRNA 4JV5B 4MMZB 1A5TA 3C6BA 4HAZA 4H1TA 3H97A 1M76A 2R48A 3R3HA 4DUGD 1U1IA 2BRUC 3SX0A 1MMFB 5G53C 4I5EA 4AZSA 2A33A 3VU8A 4C1BA 3EULA 4N3BA 1G3QA 1UKCA 4LNUB 3WQRA 4X7BA 3ZLUA 2HNKA 4YRBA 4NE7A 3MUOA 3HBJA 1JR6A 3VV2A 2RFLA 3GLVA 7REQA 3I0NA 4MUIA 3RYIB 2WJJA 1RJDA 5AVTA 1GRQA 4UE2A 3WWEA 2BKVA 2JLQA 5C8YB 1SZCA 5JO0A 3U2QA 4LRXA 5MF6A 3IDZA 3Q7RA 1CRLA 1H4TA 1VHJA 2AJDA 2QZZA 4C0HA 2A2ZA 1NOJA 2WWGA 4KO2S 5I9IA 1Z25A 1Y9EA 4JQCA 2BBTA 1L4UA 3HKDA 5CDUA 2ENWA 1PL8A 2EWMA 2GZSA 3A9CA 4JB0A 4NL4H 4BX2A 3THXA 4B7ZA 3FHJA 1W49A 2BFEA 2PSEA 4GLJA 4OQQA 1YDEA 4O4IF 3PK0A 4QEDA 4JAVC 4EW1A 1VLQA 2GAAA 2VK8A 3O3MB 4DBZA 1RC0A 1YHNA 1G20B 2FTKE 3RS7A 2X4DA 2J5QA 3UUEA 4EFNA 2DLCX 1TB4A 1R9JA 3BICA 1VSVA 2Q2NA 3KOUA 4AN1A 4ZVSA 2JI6A 2ZJZA 4J0EA 4ZCIA 4TS3A 2FQ1A 1SO8A 1J2JA 3DE0X 2ADOA 3GRFA 3OT4A 4ZICA 1WP9A 2JCYA 2XD4A 4QVKA 1G8KA 4KNWA 1Q15A 1X2BA 2QRHA 5FV7A 3ABZA 2FOIA 3BGWA 5E1BA 4ER5A 1MF7A 1YDGA 2IZ6A 2XYRA 4J16C 3P20A 4CLXA 3I5XA 1MO2A 3ZR4B 3NDPA 4TTQA 2JVJA 1WEKA 4G0YA 1VL2A 1AGPA 5D7NA 3UW3A 3FUWA 2OQVA 3RC7A 1L7RA 5AVKA 1P2SA 3GEIA 1Z2PX 1S2LA 3ILYA 2QRLA 1TUBB 1T8UA 2AFHB 5EMMA 3R3XA 1ZGJA 1JJIA 5IM5A 2HSJA 1OH5A 1K8QA 1QORA 2HPHA 1EX6A 1G8HA 2PT6A 4HV4A 1WDLA 1G38A 2QD5A 3EVDA 4RCYA 1J07A 3ZX4A 3IQFA 2HREA 2WYIA 4Z9YA 1R64A 3JWGA 3U3MA 1P81A 3O8RA 2GK3A 2UZ3A 3RTGA 5FPSA 3FJYA 3S2GA 2Z83A 4G5RA 3CRZA 3IP3A 2BH2A 1YBHA 2VK1A 5IZCA 5KTMA 2G88A 3NBAA 1LQ2A 4BWGA 2CYCA 1D3AA 1KYWA 1VL6A 2ZYGA 1BX0A 2ZITA 4P2BA