4UD2A

Structure of anaerobically purified d. fructosovorans nife- hydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title [Nife]-Hydrogenases Revisited: Nickel-Carboxamido Bond Formation in a Variant with Accrued O2-Tolerance and a Tentative Re-Interpretation of Ni-Si States.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 84
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ud2A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ud2A02
1CC1S 1FRVA 1WUIS 3AYXB 1UBRS 3MYRA 4IUDS 4UCQA 4UEQA 2FRVA 3H3XA 4GD3Q 4KO4S 4KN9S 4U9HS 4UD2A 4UCWA 4UPVA 3RGWS 3AYZB 4IUBS 4UE2A 1UBLS 3ZE7A 1WUJS 1UBKS 1E3DA 1FRFS 4KO2S 5D51S 5JSYA 4IUCS 3UQYS 4C3OB 4KL8S 4UQLA 1UBJS 5JSKA 3CUSA 1UBTS 1WUKS 4UE3S 4UCXA 3ZE9A 4KO1S 4UPEA 5JSUA 5A4FS 5A4MS 3USCS 4URHA 1H2RS 1UBOS 1UBMS 2WPNA 4UQPA 5JRDS 5ADUS 1YQ9A 4U9IS 5JT1A 4OMFG 1UBUS 4UD6A 3USES 1YQWA 3ZEAA 1WULS 3ZE6A 1WUHS 4KO3S 4UE6A 4CI0B 1YRQA 4TTTS 5JSHA 3ZE8A 3CURA 5A4IS 4UEWA 1H2AS 1UBHS
chains in the Genus database with same CATH superfamily
2VH5R 1BXGA 1Y82A 1PJQA 4DEVA 5BUSA 4G23A 1IPEA 2VUHB 2YQ5A 4B7UA 1EUCA 2IHZA 2D5LA 1H8EA 3UBMA 4CFZA 1NNLA 2YC4C 4CFSA 1ZXLA 2N3ZA 1VRWA 1L6RA 1U5CA 2QE7D 2RKOA 3F90A 4JT4A 5E1BA 1LRLA 2YWEA 4KUHA 3ICCA 3U5TA 4EX7A 4H27A 1H8ED 4GS5A 3TLGA 1RXSA 4QREA 5JQWA 2FUEA 4MDEA 1E6UA 4PC2A 3FNRA 4JLDA 3G0HA 3KKLA 4G8BA 5EZYF 6REQA 2QZJA 4EGQA 1OH7A 2HWYA 2QG4A 3RFXA 1JTEA 3IOYA 5DK4A 2ZRLA 3B3AA 1EGMB 2X41A 1NL3A 4UEWA 3TI9A 3K8QA 5FWNA 3T7RA 2JL1A 4TSRA 2ASEA 4LYGA 4WBXC 2FK7A 9LDBA 2FUNB 2Y6UA 3H2GA 5TGZA 4BX8A 1WUJS 5TS2A 3GOQA 3EYWA 4BJHB 1S2DA 2AC7A 3K0SA 4MZDA 4WHMA 3HR7A 1Q2XA 2DB3A 2VO1A 4Q9HA 1HG0A 2ES4A 1RXVA 3Q9LA 3OF2A 5COBA 5IJ0B 3T9AA 4UTNA 3GUYA 1PQUA 2OESA 2K2WA 1TU4A 1F8GA 1SZCA 4M1YA 3VHRA 2CK3A 5KQSA 3FB4A 1Z47A 3DL2A 2WV9A 3QMMA 5F9MA 2QX8A 2HNAA 4GGOA 4Y2PA 3L4SO 2AHOA 1QDEA 5F1YA 4UM9B 5B3KA 1GYRA 1GPDG 2ZRJA 1SVLA 3Q3IA 2CVHA 2YIJA 3TD6A 4B31A 2ZWIA 2O05A 3Q3JB 2X42A 3TWOA 5C5CA 2PS3A 3ZDYB 4HGOA 1T9KA 2XWPA 4MJXA 4NCJA 3WNVA 1S5PA 4CN8A 4DLSA 1H65A 4M88A 3VPBA 5KINB 4LYFA 1XP8A 2PZJA 3JY6A 3WWZA 4QPCA 1P19A 4FONA 3PGVA 4D57A 1BEZA 2O0HA 3BGSA 2YUIA 4ML3A 1X9GA 3E23A 3KZCA 3QXXA 1Y4UA 3D7LA 5LUBA 3TMAA 2RONA 3HEAA 3VNQA 3OE1A 3RJ9A 2H1HA 3ETDA 1GZHB 3WLNA 2X9GA 3ONDA 4B71A 4FI3C 4HXGA 1U1FA 5BNZA 4K0RA 1L4EA 2GVZC 3W2TA 1M2JA 2PYDA 3CKLA 1NP6A 3T3NA 2ZKIA 5T3YA 3GAZA 4UNRA 1VLHA 4NBUA 5EJGA 1FRNA 3UYLA 2DMRA 5BPFA 4NNPA 2H92A 1PEYA 4URUR 3H5IA 3VUEA 3X2FA 3EIXA 2H1IA 5BN5B 2XRYA 2ZROA 3IMGA 3OCUA 4BNIA 5HF9A 721PA 2QS9A 4LJKA 4Q3CA 5I9SA 1IPFA 4PFQA 3CINA 4UULA 1Z2EA 5KTTA 3VZSA 1E1KA 4D74A 4UPEA 4KLNA 2YRWA 4XLLA 2VDMB 3W77A 1EIWA 2R1UA 1P3DA 5H9VA 2WU4A 3AHHA 4ZT2A 1CUYA 3NPAA 3QTLA 4LRSB 2AUMA 2AG5A 4KJXA 4UZFA 2BFEB 4GP6A 2ZRCA 2BFBB 4XA8A 2ZSKA 1G8YA 4H4DA 1D7AA 4INZA 5J47A 1VQ1A 4PSDA 1HQCA 1UDRA 2YL2A 4IBOA 1XAJA 2R9VA 2YWFA 4B40A 4N5IX 1U7XA 2FW7A 5IKMA 2JG3A 4IP0A 1AE1A 3ZZUA 1EFHA 2VPTA 1BE6A 1J39A 5FL3A 5JJBA 1EGVB 1E66A 3DKVA 4N3CA 4U3JB 2Q4TA 3E3OA 3ZIUA 3I12A 1VE6A 3A4MA 3MILA 3RSOA 3RVQA 1Y5RA 3OC6A 5DCYA 3GEHA 5FPYA 2QTWB 1JYEA 2OQRA 2P6NA 3B3JA 2CLEB 1GITA 2OBLA 3OZWA 2W8BB 3SWWA 3X1MA 4F4HA 4BMCA 2VDRB 1DZIA 2WIDA 4PCLA 2M1XA 3I2KA 4CT0A 2DPXA 3AR8A 4WUVA 3UJHA 4KODA 5E38A 3MTDA 1Z0IA 1ULHA 4P4UA 3O21A 3PNOA 1CRZA 1B0PA 4NS1A 2DFTA 2VQ6A 4IVPA 1M2WA 4UMFA 4EDFA 6YASA 3JZMA 3CT6A 2XXAA 3DV0A 7GPBA 5KYVA 1Y9DA 1RBYA 1S01A 4KVAA 1ZAYA 2JIZD 1R6TA 3CSSA 2WBLC 3KFVA 3I4CA 1W46A 1G55A 3WRYA 4DA4A 1JECA 1W88B 1BWQA 1LVHA 5K4AA 1M2NA 3NHJA 2CVQA 2BYTA 5HGXA 1GL6A 2C57A 3IO5A 1LKZA 4IGEA 2D0PB 4M1MA 3GT4A 4PHHA 4JUDX 5K01A 1MNQA 4Z2AA 4RTQA 1JPNA 2QAGA 3JTMA 4JLMA 1XJCA 2GFIA 3ODGA 1W85A 1VKOA 4GC5A 2ZB8A 3M6AA 4LDJA 2JBAB 2HXSA 5A3QA 3V8MA 6AT1A 1GGKA 2C20A 2PUWA 5LU9A 2P90A 4PIPA 4EEKA 3OFND 2F1RA 3TQQA 1PFVA 5MFPA 3CVUA 2H00A 2AMJA 3N2NA 3Q3HA 1X15A 1Y7HA 1HDYA 1NN3A 4RM2A 2C8VA 4I9GA 4LY3A 4BVAA 3ZU2A 3S1SA 4IHJF 3U0VA 3DEFA 2HR1A 1I1QB 2BSXA 2A9FA 3B3QA 2C9OA 2QTFA 1ZCFA 2OFPA 4FTWA 3ZUGA 2O8EA 5CEJA 3KT3A 4A8JB 1Y7LA 2P11A 4XUDA 1EUQA 4TXMA 4KK4A 5DJ5A 4DAEA 1M83A 2IY7A 1DXYA 1U80A 3D54D 2DFVA 4IEEA 1DQNA 4CEIB 4R3WA 3RTCA 4EA8A 2CF6A 1P61B 3B7WA 4HNSA 2RGUA 3GA0A 1AF4A 3LXUX 4G0OA 3GLGB 1Z22A 4D97A 1U98A 1A8IA 3SMQA 3ZCXA 4MWZA 4JUFA 4CR6A 4ARZA 2C7RA 2BF7A 4LWOA 4CCAA 2GBGA 3LKZA 4AZSA 1GDDA 2G08A 1G2OA 4D3YA 5H83A 3O7WA 3REGA 1E1RD 2ZIGA 2G1PA 1WZ2A 1GSHA 2D4AA 2QY9A 3IE2A 4MMZB 3GLQA 2E1RA 5H59A 4I4LA 4IIXA 1CNFA 4JIMA 4K87A 5CB4F 4QBKA 2WTAA 3B85A 2H4JA 1BKDR 3KSMA 5ALNA 4CI9A 4DARA 4OB8A 2DZDA 4U9IS 5LLSA 1GRVA 1E4VA 5EKTA 1KIMA 5JXGA 3VKGA 2D13A 4WCVA 1H4VB 4EPVA 1YR3A 3FTPA 3U48A 4GMGA 4RXUA 3ZDCA 4HMQA 1VJ0A 3DAGA 4H1TA 3DB1A 4N5HX 1H6BA 3DO5A 4X1IB 5A7FA 1GQYA 5BSGA 3EF0A 3DYIA 3TRJA 4BJ6A 4WVFA 1X7WA 3BRSA 4N48A 1AHNA 4DGSA 4IKPA 2A1UB 2D7JA 2EJBA 5DISB 4WXHA 4LZAA 1PI3A 3NDIA 2X3YA 3LQKA 3W5IA 3FRJA 4M9SA 5BOVA 4HAYA 3W9YA 4DBLC 5JD3A 3BRCA 5AM4A 1E62A 1CVLA 2VYQA 3CF6R 2BF4A 3KSBC 4G37A 2YWDA 4KQ1A 3HJFA 5EHQA 3O4GA 4DQVA 4M0KA 2B35A 2GPBA 1SK9A 4L6CA 5AVJA 2BPOA 2I71A 3OZBA 4DCOA 4B7ZA 5JROA 4HAWA 1A0OA 1H0KA 3AIKA 3PCXA 3OZIA 1E1CB 4EB8A 2DYKA 3V97A 5D1NA 4MARA 3UFBA 3JZAA 4YV7A 3C6XA 1L9KA 2OK8A 3SCZA 3CZMA 5DNYB 5EIAA 2AMYA 3CO0S 1QV7A 3RUIA 3SHTA 2EVWX 3L4BA 3MWJA 4YMWA 1CV2A 1WY5A 4M83A 4LF8B 1BH6A 3K0AB 5B30A 3QXJA 1NM5C 3DXYA 3L6CA 4QOHA 2OAEA 1UOOA 3JQ9C 3WBJA 2WQZA 5JBIA 2C59A 1CZLA 2O14A 2XVZA 5AHXA 4YRLA 2ZW9A 3EASA 1YZTA 4MVJA 5IPFA 2WKSA 1K5GA 3NC1C 2ZVPX 3IB3A 3RS4A 1DWUA 5LN1A 4MQ4A 3FDFA 4BVBA 4ND8A 4FDVA 3GRCA 3UXMA 3RFVA 3JQRA 4ZAGA 4RVCA 2TECE 4O4HB 3UIEA 1YU6A 3KSUA 4UM7A 5BQOA 5CLQA 4L4ZA 5E1MA 1AURA 4IY1A 5JZMA 4TL9A 1UOQA 4B3MB 1DQPA 4DOMA 2FN4A 4KKVA 4LYHA 4OUKX 5D7BA 1DRWA 5ERGB 1QZXA 2WJ4A 1N2IA 4FFOA 2CDAA 1YE3A 3VKWA 1T1SA 1XCBA 4K8OA 2IV7A 1JDJA 3K30A 3LQQA 5HKKA 4OLJA 4TV9A 2FR8A 2QN3A 3BXOA 1CR4A 4TKUB 3K1YA 5AHOA 4KH0A 5J5AA 5TMBA 2GD2A 1E5VA 4Y9TA 3M5CA 4BRWA 1FSSA 2WMDA 3QSYA 1G8KA 1WIWA 2WHPA 1XTPA 3EA0A 3DQPA 2WZQA 2R25B 4Z8YA 4B6JA 1FFYA 4H18A 5DLDA 3NXKA 4ENSA 4Z9YA 5KIAA 4Y7DA 3ANNA 3M1LA 1L4NA 2HLHA 3KBBA 3MS7A 4JKIA 4N6OA 5HBRA 5C1PA 5LP6F 4CETA 4U63A 3FPFA 2DPMA 3IXLA 5EINA 1R8SA 4RC9A 2O3QA 5E9QA 3NWBA 3QE3A 4DM7A 1YUMA 2C3MA 1E0AA 4W4TA 4PHCA 2R6CA 2AR7A 1RWMA 3T9FA 3N7UA 3UCEA 3ZV5A 4B76A 4EJFA 5HHTA 1OY1A 4TQGA 5ALKA 5EA2A 5F76A 5ALDA 3SNKA 3CR8A 2QGFA 2GNOA 2VG8A 4J76A 4P7BA 5L40A 4BATA 2V7VA 2BJWA 1ZFNA 3L8MA 3TZCA 4RXTA 4D7AA 1KKUA 1LPMA 3RABA 4HUTA 5I9BA 5EJFA 3CH7A 4O63O 1LB1B 1YCGA 3ZCSA 1Z2CA 4L5AA 2VNKA 4J4BA 5ALSA 2ICAA 2BKVA 2XNDA 3H2IA 3VHXB 4GMDA 1NXPA 1R0SA 3GWZA 1L7QA 1NPYA 2WWXA 1U4SA 5CA0F 3RK4A 3AR6A 4FYJA 3EXHB 1KC3A 4W9MC 1SIWA 3SYKA 3I09A 2Y1DA 3DVAB 4QNMA 4C4PA 3D7KA 2VDQB 2XYPA 1MB9A 2EBHX 3GDWA 3ILYA 4YP0A 4I50F 1S2NA 3DGFC 3O1JC 2FSVC 1MDBA 2FEMA 4XLZA 5JNUA 4ZVMA 1T2VA 1YC5A 1Z6YA 1AC5A 1WSAA 3FUXA 2HC9A 4OHXA 5A3JA 2PSHA 3PTZA 1UFQA 3VR3A 5HQ3B 1PW5A 1OYVA 1EVKA 3FYUB 4LJAA 4MUGA 4LXIA 1YQWA 1C29B 4LVCA 3AEQB 1IEVA 1B6GA 3B70A 2OZKA 3K6KA 4PLGA 5BMVF 2GD1O 1R0YA 1JR2A 1NBIA 1T1RA 4PZ9A 1E98A 1SC6A 3VA7A 1NOKA 3L0CA 2ZR8A 4GRDA 1R0CA 3I4LA 1HSZA 2GCEA 1M2OA 3AG5A 3B6IA 3EZ7A 3K0CC 1AA9A 1C30B 1CUDA 1JDUA 2R85A 5J4LA 5MGBA 4FNOA 1NMYA 3D59A 2PT5A 2Q1WA 4AYXA 3OTOB 5AVRA 4O4IA 4HEJA 2B8TA 1CHDA 2Y1FA 4MVJH 2HNKA 3WQRA 2KX7A 2VRCA 3PLRA 1M8GA 5GQSA 4UHJA 2NU9A 1P2GA 3DBLA 3B6ZA 4IPTA 3VSEA 5K6RA 1SQFA 2J9GA 1FS4A 4GT1A 3AM1A 2PMFA 2GDZA 3LQ1A 1QIJA 1V5GA 2WKWA 1SG0A 3L7LA 4KIJA 3ND9A 3RC9A 4EW2A 2OHIA 4J0CA 1ZL0A 1K4YA 1AS3A 1UR5A 5EOVA 2DBYA 3SZOA 4D6PA 5CP8A 1U2GC 2CFRA 1G8FA 2FKNA 1JQAA 1U0TA 5KHLB 2VNHA 4GBED 3IYLW 4NJEB 1EE1A 3P9ZA 1FFWA 2C00A 3A37A 5BQXA 2FEOA 1UBOS 5GJCA 1PG2A 1FX1A 4MPDA 1DRUA 2IBSA 1VBKA 1LK5A 3D8BA 3OFKA 4UMVA 4M0EA 5P21A 4P33A 1JSCA 1T8WA 2QRUA 3HWX1 3FTCA 1COWA 1M5UA 2Q6TA 3B2NA 3PB3A 4MS1B 5CM9C 4I4IA 4WZZA 3WL7A 5F64A 3RBZA 1JN0A 4D8VA 2BKEA 1PE0A 3O3MB 1NFQA 2RGEA 4NBLA 4BNLA 1ZXBA 5BRAA 3DE7X 3R3UA 3K8YA 1XEXB 3KPJA 3KYCA 3Q2IA 4P2GA 5G1PA 4TUYB 3CLSD 3OTGA 1XAHA 2OBNA 2RGBA 4JASB 5FO0A 5FNVF 5SY9A 1A27A 3U9SA 4LKOA 3BCRA 5FPSA 2JIZA 3WGOA 4CYMA 1J9GA 3ADOA 3AERA 4YWJA 2F8TA 1DE0A 3ZJYA 4QUKA 1W1WA 2VT7A 4UQOA 1KEKA 2PCLA 3EBOA 3BFJA 3ROXA 4HHEA 4ZEOA 2JCYA 2PS0A 4X7RA 1A5SB 3FDIA 3ZKWA 1CW2B 1N6LA 4LHEA 3COJA 1ES9A 2VYCA 3W8RA 4YJ3B 1OLXB 1X42A 1SC1A 4B85A 2I3BA 2YWXA 1ONBA 3AIMA 2NVWA 4TVSA 1KJNA 4HQOA 1KSGA 1YOVB 1QR6A 4PBTA 1RCUA 1LNSA 2C4VA 2O20A 1P0MA 3WXBA 5D8DA 1FFHA 1ZWLA 3PQ3A 3W5AA 2OV3A 1ACLA 4F71A 1H0HA 4Q9KA 4YMUA 1G2IA 2DCMA 4C6TA 3G88A 3GEDA 2AFIA 3QWBA 3W9SA 3SIWA 4UTOA 4N4AA 4M87A 4BBPA 3ZQUA 1GADO 3KL4A 5BPHA 1T8SA 2BGMA 3A6GA 1ULTA 1X1CA 3GXOA 2X58A 3H87A 3L5OA 5TIIA 1L7OA 3DDHA 2O50A 2W2QA 1N92A 3OURA 3BKWA 2GBFA 3ESBA 2F9FA 2PUHA 2Q5OA 5K3BA 1Y34E 4WZBB 5DIZA 3SJAA 4F11A 1VZ3A 4H35A 4FYXA 4PQGA 1JJVA 3A3PA 1IC6A 3MWEA 5FI0B 4YV1A 4MWBA 2O3TA 2WWYA 1B2LA 4ZVUA 3KS9A 3VV3A 3N7TA 3PD7A 1OLXA 3JVEA 3PHHA 3OLQA 5KVVA 3H1FA 1CPYA 3X1XA 4WNIA 2VNAA 1E7YA 4GLBA 2WSLA 4A6XA 1PVOA 4CMEC 1I36A 4BO7A 1P5FA 2D1TA 4BP9A 2E85A 2WWWA 3CTPA 3LQFA 1LX7A 3MRVA 4OYRA 4WBNF 1G5PA 5JBNA 2WD9A 2V0NA 3MTBA 3HKDA 2OZEA 1UPAA 3CVYA 1ENZA 1V0JA 2BFPA 3EG9B 1RDFA 2YHSA 1U1IA 2Z57A 3QVXA 4FS8A 3DHNA 1M1NB 4X8MA 3ZHBA 4B8YA 1SXGA 2FP3A 1M67A 4OI2A 3T7IA 5IK2A 3PYXA 4IKOA 5IYZF 4RD0A 3GGOA 1BE1A 1XZMA 3ILHA 4NV3A 2UV8A 2BOVA 2VP6A 4NZPA 3PQFA 4XVQA 3F97A 4FN5A 2G70A 4M7PA 3RYIB 4RETA 2QWXA 1VI2A 5BN3A 4FGWA 3GLGE 2OSBA 3TAHA 3TPCA 1E5LA 2RGAA 4UUMA 3ZN2A 2GGSA 4PGAA 5JH7B 5B2ZA 2FLKA 4KXFB 2PUGA 4GGMX 2ZZMA 1TO2E 2Q1SA 1NIPA 1F5NA 2IYUA 2R44A 2ZBEA 4WY5A 2AEFA 4TV8F 2CJYA 3T5MA 1GTMA 4UC0A 3PYMA 1D4ZA 3HFRA 3CZ9A 3PNMA 5JDCC 3CZAA 5CH8A 2NU9B 1XALA 4LI3X 3FBGA 4C6HA 1IZ8A 2RHCA 2YYYA 3H9UA 2Q4EA 3QTBA 3IAFA 4HP8A 3V8EA 5FTLA 2P9QA 3I2HA 1U3WA 3HP4A 4O4IB 1Y89A 3PC3A 4J1QA 4HPWA 2ZUSA 1J6UA 5FBZA 3ZZTA 2X6QA 1WDWB 1LPAB 5IEBA 5I7EA 4Z3DA 4L8LA 5IF9A 3DWEX 4WK4B 4KQEA 1YGPA 1E79A 3CW2A 1K8ZB 3BJZA 2PRIA 3C1TA 2HT6A 2JLAA 4WW0A 3S1LA 1YB1A 3CV3A 1Z75A 4E14A 1DX4A 2X2EA 3ORFA 4MQEA 2IHJA 1OTHA 2QL6A 3EUWA 4JOSA 3TZLA 2OC4A 3QMPA 5DYGA 4D9HA 4YLYA 1JDNA 5BQFA 1EFPA 4XQCA 5FOWA 1E64A 1WMSA 2GJ8A 2D3WA 4CLXA 1DUSA 2P40A 1PR2A 2PG3A 3WMFA 1G59A 5LBIA 3I30X 3JQCA 2QBYB 4E03A 1XVTA 5HUQA 5ISMA 3TLBA 3IQZA 2IE8A 4IJWA 4RA6B 4TZ0A 3LHKA 1AS0A 1MJ5A 3G1WA 2HLNA 3MJCA 2R96A 2VAMA 3MJRA 1QVVA 5I7VA 1ZVKA 4LV6A 3HZHA 1PJAA 4B09A 4OAQA 3LA8A 1O9GA 5LPNA 5KTOA 4EPXA 4ZOCA 4PLZA 1DELA 4UREA 2PKYX 3RVLA 4KUEA 3QX8A 1O6CA 4QDJA 3VH2A 3SYLA 4KWHA 1TADA 1W48A 3AKYA 3QK7A 4R54A 4TQ9A 4DA6A 1NFFA 1P7PA 1U7DA 1YASA 2QTCA 1XYVA 3DEIA 3OZXA 4X90A 5GOZA 1EJBA 4GI2A 4CHGA 2NVUB 4I2NA 4ROSA 4W1RA 3W05A 4W1SA 4WZAA 5EJ6A 3B5JA 4JDUA 3PPYA 2J5BA 1JHOA 5FTWA 3UPUA 2REBA 3OCCA 2GEVA 3AQIA 4X8OA 2X2FA 1VIVA 2ZZKA 2DHCA 1D09A 4G84A 4O2RA 1BEUB 2YJGA 3PEYA 2P77A 2WIGA 4P86A 1K5DA 2GBLA 2WJHA 3MINA 2P0EA 2VYNA 2QRKA 2PLRA 2J30A 5EZSA 2BRUA 2J07A 3AOEA 3I5AA 4UUAA 3W3ZB 2CLKB 1U7ZA 1XDWA 1ZH4A 5IAJA 1RWBA 1RKUA 1RM3A 3PNKA 2XWBF 2DP4E 4DQ0A 1WXFA 5E8JA 2UYQA 3ON5A 4LPSA 3VHLB 1U9YA 5LZ9A 3OHSX 1WMDA 4JOQA 3DGEC 5CNKA 1H2AS 4ZOAA 4NYMR 2C95A 2TS1A 2HX1A 1ZOPA 3IBTA 4DSOA 4X20B 1YJ8A 3PIDA 4LOIA 1V8BA 5AVOA 2O54A 3HVKA 5BWOA 5E2AA 4M21A 2E89A 2BMAA 1R4ZA 4ZT3A 3SY8A 5KSZA 3SIRA 5A62A 3EZGA 3K7EA 2C2KA 5KSWB 4KCGA 3K9WA 2WSMA 4BE9A 1KAEA 1EDOA 1PYDA 4FFWA 2RHBA 4O2BF 4RK6A 4I4TF 3E27A 2GI4A 3MUOA 4EGJA 3ZDDA 3H97A 1K6XA 1SH7A 4IUYA 3TUZC 1HYHA 2RARA 3Q9UA 2DSTA 4M1SA 5JD6A 3KQNA 1IMJA 2HSEA 1SPBS 3K4QA 3KZXA 1DG3A 3Q85A 4HNRA 3ZWNA 4ANFA 4ERNA 2ZRDA 3VU9B 4FWTA 1QVZA 1FTQA 2HZBA 1IQUA 4NDNE 4NU5A 3ZQJA 5HIKA 4RCZA 1Y63A 3W5UA 1ZUIA 5JAIA 3DMPA 1KP3A 2J3JA 3FBWA 4RY8A 3F98A 4L08A 1J0DA 4LX0A 1B41A 5JZ9A 2FZGA 3PGJA 2EFCB 4KDCA 5AP9A 2GN2A 4FINA 4Y6RA 1WX1A 3EBPA 3LT1A 3W90A 1PP4A 1VCNA 2ZRMA 3GFQA 3I92A 4MW7A 3K94A 5BV8A 4TLDA 1X14A 4NEQA 2I91A 4M3NA 4C7OB 3IURA 3TOCA 3WP1B 3LBNA 5JAMA 3VNUA 4DADA 2ZULA 4DJEC 3SE7A 6ABPA 3RTAA 1MX9A 4FFBA 4FW8A 5A06A 1X3SA 3VHQA 5D5HA 3D8NA 3GIDA 4PIVA 2FVXA 5C8VA 5J2UA 1TAUA 4P7GA 1U63A 2NXWA 5BT8A 5HUJA 5EGSA 3S70A 2FSVA 4O4JF 3C1UA 4J8PA 3G6KA 4Y3UA 1L5OA 3E7FA 2O8VA 4QOGA 1QRDA 3IERA 4YFVA 3NT5A 1JMVA 1UPFA 4REQB 4U7TB 1DGQA 5EHIA 2G71A 2WB4A 1YS9A 3GBPA 4BJ5A 1NLFA 2KHZA 4QGAA 3L1VA 3V9AA 3PE6A 4CLDA 3A10A 3J7TA 5A1TA 2WJIA 1XQYA 4FBMA 1JLKA 1QHNA 3KCQA 1XTZA 3PNYA 1PS0A 4N1AA 3UUFA 2BEKA 3VVMA 3ETCA 2F90A 2HRBA 4PO3X 3BC1A 4EHIA 4MX8A 2ZE6A 1UL1X 4CR7A 2PQ0A 3NG1A 2HYDA 1B74A 1WU7A 1WW3A 3K96A 5I7HA 1T5SA 1LNZA 3EVCA 4R1LA 2PXXA 1G8SA 3FPJA 2IEYA 4YO8A 4DQUA 1CEXA 4MW1A 4X1IA 2PD3A 3E4CA 2C4KA 2IW3A 3FLAA 2ZXFA 2E4YA 2J0SA 3HUDA 2DAPA 3JPYA 1XZNA 3UV7A 1FDRA 5FBKA 1KY3A 5FI5A 5A4FS 3MELA 2V6MA 5ED4A 5CYFA 4AP9A 1M0WA 1CZRA 2PJUA 3UN1A 5KSYA 3OOJA 5K0TA 1P1BA 3NT4A 3R7LA 3WFJA 1MGPA 2Z43A 1VCOA 2G7ZA 2YS7A 2J3LA 2I3AA 2TYSB 3A0UA 3NIGB 4DEYA 2OD2A 2P4HX 4EW6A 1ZPDA 3R5SA 5FOQA 2V7UA 3T9BA 4KRYA 1SCBA 1D2MA 3I34X 4U7JA 2L17A 3U31A 2QD2A 5IDWA 2WOJA 1DEAA 1N6HA 2CUTA 2H8KA 2V4ZA 3GEGA 2HGZA 3ITKA 1LXCA 3PVZA 4P3XA 4RMIA 1JIQA 3AZOA 3EIHA 4EGAA 1PWZA 2XADA 4A6DA 1UDXA 2YIVX 3QPAA 4JI1B 4Q9DA 4P80A 2D1SA 1Y4ZA 1KOFA 5ECGC 2BVNA 1ZRHA 5THXA 4Z5XA 1HO3A 3F8SA 2B5VA 2ZSDA 5FYQA 3VTKA 2CHGA 2PWBA 4WN9A 4EMBA 2V1UA 3ZU4A 5CDFA 3CLVA 5JMWA 2WG0A 1ODCA 5ED0A 1XEWY 2O2CA 2OSVA 2COKA 5IC5A 1N3LA 4GVXA 3IA7A 5EC8A 2BFWA 2OFWA 4TS9A 2WTBA 1LSSA 4CG1A 2PL3A 3WIBA 2H2FA 1A1SA 2YN0A 1AHHA 3EXEA 3G85A 3PGLA 1M75A 2JI7A 2RHOA 2Y05A 3MRTA 4HNGA 4ZKDA 4MWEA 1KAQA 4KHZA 5LWHA 3ZW9A 4NXNB 1KK1A 4NICA 3I61A 4DFDA 5LSAA 2RMKA 3PXDA 1WKBA 1WG8A 4L8FA 3AKDA 1J0CA 1E6EA 1KAOA 2XOEA 1FQKA 1DNPA 3QHAA 2EGGA 3HVHA 4H0CA 1T3HA 1VA5A 3RRMA 2RAFA 5IULC 3CLRD 3IAS6 3N0RA 1YL7A 4IOKA 1E2KA 3ZTWA 3VYSB 4NAUA 1XNHA 5C46F 1N4DA 2XCLA 3IAUA 3C3AA 5HW0A 5DEOA 1VE9A 4C05A 4GSYA 2PT9A 2FMXA 3J81A 2W8BA 5H82A 5ITSA 1MRZA 3HXQA 3N05A 3AIOA 2LXNA 1BD4A 1E2EA 1I30A 4AS1A 3C3XA 3ZDEA 2ZTUA 5TRTA 3MT9A 4ISBA 1XYGA 4ER3A 1DI0A 3KU4A 2DCUA 3I2JA 2CFSA 3PFHA 1U7PA 4GZ3A 2IXEA 3FVVA 4J94A 2ZIAA 4RJ2A 1AMUA 1K0UA 1O4WA 2AL7A 4HDKB 4B3TB 5LMCA 1CRLA 3H4IA 2WJGA 4MQFB 2HJVA 3ND5A 3WGUA 1DFIA 1K4MA 2GKOA 2SBTA 2WHQA 4EHJA 4DCSA 1C7QA 1XD8A 4JC0A 5DHFA 3INNA 3CMMA 3G3EA 5IUNC 4BLWA 2QD4A 3IAM1 3ME5A 1PT6A 4U3JA 5DE3A 5A9SB 3KKPA 2J9YB 1WVGA 2FI1A 4UM9D 4JI7B 3QFTA 4DILA 1WP4A 2WG2A 2XB2A 5BV0A 3R6WA 1S3GA 3QPCA 2J4CA 1M8JA 4QM7A 1JFFB 4D3XA 2CHVA 3P9RA 5CG2A 3W9BA 2C3YA 4LYEA 1NSTA 2G9ZA 4QUDA 3IIKA 5CB6A 3ZE1B 2ZRGA 4RABA 1R9GA 2H4FA 4XQ9A 1FLVA 2VWQA 4UXIA 5CBPB 4Q5IA 1E3SA 3PA6A 2PMKA 2IWHA 1SUDA 4BASA 5KYNA 4EJSA 2IUSA 5E1DA 1NMQA 1XXHA 3ILSA 1U0FA 5IDVA 1XA0A 1QYXA 1SBNE 4X1YA 2F8LA 1E9DA 5I51A 4EFKA 3GJYA 3LVQE 5ITWA 1TIBA 2ZIVB 2XSZD 1FW6A 1CJCA 3OQ6A 2CN1A 4AICA 1A9XB 3HA2A 1AGPA 4WFJA 5F7ZA 4MWCA 2VI5A 4P4TA 2Q0QA 2OZLA 4OQZA 4R2IA 4BTEA 3A0RB 2V3VA 5HPYB 3AF1A 3EMVA 3QKIA 5CXSA 2I6SA 3NETA 4G89A 1IBRA 1RVDA 3E0XA 4JIGA 1QYCA 4L50A 4Y7CA 3I5XA 1ULZA 2ZJ7A 3H9QA 3NR2A 4FJ1A 5KOYA 2VK4A 2XQVA 3ZHSA 3D6MA 4FYIA 1H8HD 4TLAA 2QE7A 4EQZA 3TZKA 2IDJA 4URZR 3RH0A 3W04A 1CKEA 4E6PA 2ZWAA 3IVRA 3I39X 2J09A 4J6FA 4V38A 1A5ZA 2PR2A 1ICIA 4GOXA 3U7QB 4QHTA 3L92A 3U80A 5CFMA 1E2UA 1HG1A 3ZJUA 2E49A 1G18A 2EL9A 1SUIA 1AMNA 4JZKA 2QROA 4QU0A 3DDOA 4QECA 2XUFA 4IUBS 3C6YA 5ALLA 3CB4A 2FGJA 4Y2UA 4OJQA 4JHXA 1LW6E 1I4TD 3DHEA 10MHA 1KJYA 1W29A 5JNVA 3W6PA 1GV0A 4MHTA 2D54A 4EKDA 4I0WB 2V6GA 1P9NA 2WFZA 1F48A 2CE2X 5F1KA 4DIUA 1MIHA 4G4JA 4PZPA 4MUEA 1FDUA 4RWEA 2ZSHA 4WTOA 3VXKA 1NJ1A 5JS2A 2WOOA 5LZ7A 4B43A 1YRLA 3GDHA 5TE9A 1LFAA 1NW7A 1TYAE 2JFGA 4M86A 3S40A 4AAYA 3IUJA 2SCUB 3K15A 1D07A 2QOEA 3R75A 1V35A 2DUNA 3F49S 4I1OA 1CFZA 1E32A 3CGGA 3KWJA 3ER8A 1VC2A 3QZUA 1TPZA 3KALA 3AM3A 3WFZA 3DVSX 2R5FA 2FZEA 3H0KA 7REQA 3O3OB 1II8A 3AUUA 4C06A 1TDJA 3BTVA 5GMOA 1F60A 4X1KB 4LCEA 2QZZA 4NSNA 1MAAA 4PO9A 6REQB 1FP6A 1FRQA 3ZE9A 5AI5A 1M6VA 5KTNA 2QX6A 2AUTA 3CRNA 3I05A 4RQUA 3RUAA 2IKQA 2I6XA 3C3YA 2HXGA 3KKMA 4ZZ2A 1II8B 1HE2A 3L0YA 3CUTA 4IFTA 5ICFA 3M3PA 4J29A 4LBWA 3HDHA 3RYFB 2B69A 2RBGA 1RXYA 2PK3A 1XJ0A 4Q7LA 4S2UA 3S7TA 3UVEA 5KQRA 1IHUA 1LLDA 2IYFA 2AOWA 4ZOEA 5IF3A 4ARZB 4TMTA 2WF7A 1FRVA 2Z0MA 2BEJA 1L7RA 5TF4A 2YHIA 3SF8A 3VU1A 4CM3A 4Z4EA 3DTVA 4NV1A 1M54A 2L18A 3NV9A 4M0DA 5FAXA 4EYGA 2MJLA 4YDSA 2DY0A 3ZS9A 2UYCA 1WDKA 3I9LA 4AQYB 1M0EA 4IX9A 1E9RA 2A5YB 1ZICA 2OV8A 3F9RA 4I5GA 4PPQA 4QNNA 4YAFA 3ZDXB 5A05A 4AF7A 3R2JA 1HNWB 2HQ1A 2PX0A 1Y1LA 5IEJA 4Y2SA 1C81A 1NT2A 4BAZA 4RVSA 3ANYB 1UJBA 3NIBA 3OPNA 3BTOA 5KWJA 2EQ5A 1JKFA 4KYUA 1N2OA 4QJ4A 5DM1A 4JXXA 4D99A 1RKQA 1KNXA 1JFRA 2OKCA 1OXMA 2IP1A 5EZ6B 1IIRA 1PU2A 4WOKA 5FNZA 4YAOA 3JVUA 1QB8A 5JDIC 3GUCA 5BSFA 3AHCA 1PVDA 5DCWA 3C16C 3JCZA 4ZVTA 2V5UA 1W0KD 4PRYA 4YGYA 4YRRA 3HYSA 2RJOA 3SKXA 4R41A 2BE9A 1NUQA 5FUWA 2BSQA 5DI9A 2JLBA 1Z5UA 1U6IA 2CXNA 2NSDA 4ID3A 4FCVA 4KNWA 3I9V6 1ZCBA 2N1BA 2O2YA 3HHEA 2QMUA 1DB3A 1R6UA 2QRJA 3CTMA 1KJQA 4DLWA 1DFGA 1DTEA 3DE6X 5LQMA 4P5DA 2HMYB 2C07A 5DULA 3BF7A 3BK2A 3FAZA 1MZPA 4DDTA 1DBIA 3IH5A 4F3TA 5TQ2B 4WK0B 4JMLA 4RH0A 3IDZA 1MJHA 3V6LA 4DZTA 1RZRD 2OGTA 2Q6OA 3NH6A 4IV0A 2PNJA 1AGYA 4WIAA 4BVEA 4N76A 4Q47A 5IXSA 3MS4A 2H29A 1E1YA 3IEUA 3K9CA 4ALNA 4DCTA 2D00A 2W2MA 4JEMA 1BW9A 3T95A 2I9KA 2FZ5A 2QJWA 1E8DA 2AEJA 3C6MA 4ZQFA 1NLMA 1AY0A 3R23A 3RFCA 3V8QA 4PBRA 2QPTA 2BI8A 3LDUA 3ANMA 2VLBA 5EJMA 1SGWA 1I5OA 3EA4A 5KU7A 1YVDA 2ZJZA 3O8QA 3HGTA 2B21A 4IWXA 2A94A 4HCJA 5SYMA 4AKHA 4Z1MD 3KX2A 2FPIA 2YX1A 5H0IA 5CNIA 4YI5A 2HSDA 3D3EA 3PICA 3N3AC 1CJVC 1SKUA 5AJHA 3L02A 4RKEA 5JPCA 2EKBA 2CE7A 1PK9A 3EMKA 4PSUA 3UA4A 2DUMA 3ZIAA 1TMOA 4CRWB 5H8WA 1AJEA 3O26A 2C5SA 2PV0A 1WSBA 3R9KA 2J3KA 4F8JA 4ZI7A 1VKJA 4MVJP 1C8LA 3D2BA 1GNLA 2XIQA 4YUWA 5HP4A 4RJJA 2B3TA 2XTJA 3FM9A 4MAMA 3QVOA 3D3NA 4DB2A 5JAPA 4L73A 2A4MA 3MGBA 2B25A 1CUJA 1KH3A 4I99A 2C7VA 3CUSA 1H2WA 2EEPA 4G0MA 4WCDA 4XSVA 5KDLA 4EHBA 2WYVA 1UBEA 1FDIA 4J9VA 4AIRA 1M0TA 3C3MA 2CFTA 4BFCA 5K8LA 1NIJA 4NARA 5M04A 1U2TA 2SHKA 2ZQ5A 5IVIA 1ZM9A 2WM9B 3NAQA 4LRXA 2PUFA 1QCYA 2VCHA 1HGXA 1F8FA 1EM8B 1SVIA 2UUPA 2VP3A 2WHYA 3HO8A 3OX3A 2FMIA 5EJAA 1GTJ1 4PNPA 2OV4A 2JGFA 2IU0A 1QK5A 1JIXA 3A9WA 3FFAA 4GMKA 4CKYA 3ONWA 4P7KA 3GFBA 1QZTA 3N2LA 4F9GA 2BEWB 2PZGA 2WPDD 4KXLA 5IMSA 1A5AB 3B6JA 1SEVA 1BVHA 1I3CA 1SHUX 3PUZA 5DYWA 3GK3A 4KRXA 5B1IA 3B6KA 3TIVA 3CLRC 5JECA 1ECLA 3RU9A 4YJHA 1UJ4A 2CLOB 1OT5A 2XEXA 3S5UA 3PFFA 3V7NA 3KTOA 2A9OA 1J2RA 4IL5A 3GFRA 2MOKA 4WOJA 3W7VA 1W52X 1FOEB 4G3XA 3BGDA 2Y6VA 2F1OA 5ALJA 1H2HA 1TQDA 4CR8A 3G2NA 3KYBA 4MRVA 3OD1A 2O7RA 2F1IA 3AKCA 3R9XA 4JQCA 4PLHA 5EIEA 2E4VA 5REQA 1Q1ZA 1TUIA 4ZYZA 1TFRA 4RSRA 1ADBA 1SCKA 4FFSA 1PYOA 4OQNA 4DUGA 3U3KA 2ORVA 1RHUA 2OYSA 3MIIA 5AW3A 1N25A 3M6IA 2FWNA 4JR2A 2B8EA 3UICA 4CBVA 3KSAC 1SVSA 2A9QA 2VSYA 2PO7A 2JFBA 1ODIA 4HX5A 2REQB 1R16A 2JHFA 1Q19A 2ECFA 4ALIA 1IRIA 1XLTA 2JI6A 3L6EA 4FZ3A 5ARCA 1Y4AE 4CTOA 2BGTA 2IDZA 5EHGA 3ZXXA 4F2HA 2A5JA 2H1RA 1TTTA 5E0OA 3KR2A 4DJTA 3A2KA 2JJYA 2V9PA 1GAWA 2OHOA 3PKIA 4KVGA 3RJ5A 2NM0A 3U3MA 4ND2A 1GQQA 3EB9A 4YRKA 1AZSC 4KACA 5FORA 2QPLA 3F6BX 1UWCA 4R9SA 1I14A 3BHNA 1RJ9A 3NX4A 4M9RA 1G20E 1XTSA 5BNFA 4B3DA 1QG6A 2FAXA 3I2YX 3CJQA 4QA9A 5B58T 1XD2B 4Y0AA 1KDPA 3DEKA 3KQOA 2XT9A 1MDFA 1TRHA 1DADA 1WXQA 2R6ZA 3MJ4A 4IQ8A 4C4TA 1E3WA 2B30A 4JROA 3QU9A 2NTVA 4JQYA 4WKPA 3ZWYA 1XOIA 3ZHOA 2QJTA 4RVOA 2FPLA 5JNRA 1M5TA 3AV3A 5TVKA 3MS2A 4OOEA 2ZUEA 2O19A 1ECPA 1GG9A 1PWEA 4MICA 5D00A 2B8JA 2ZIXB 5FTMA 3ZS8A 2DPHA 5G40A 4C3ZA 2ZB2A 2D1YA 3VPAA 3QVVA 4ZANA 3R9WA 4LEIA 1CUHA 1E94E 3G89A 2ET6A 3GCXA 3P7MA 1HYQA 2IY9A 2GYWA 2Z2IA 2Z95A 3KKOA 3PEFA 4LA4A 1V96A 1CD5A 1ZMOA 2QUJA 3GN2A 1YH3A 3R09A 5DHRA 3EIUA 3L7DA 5LB4A 1Y3FE 3EPKA 3ROKA 2QSUA 2XITA 3MYYA 4OHCA 1DPGA 4OI0A 1S02A 2Q5CA 3AY3A 5EIXA 2IS6A 1GR1A 3TIFA 4DVJA 4BWGA 1BXZA 2D2EA 1I3MA 5B3JA 3JARA 3BCUA 3O1IC 4Q6WA 4KSCA 5H9WA 1LPNA 4EWLA 4JV5B 4BPBA 3VKVA 1ZNYA 1UZLA 4NHEA 1J2YA 5AKIA 2IYLD 1YZVA 2I7DA 1BG6A 2OQIA 3E7XA 3IHLA 4I5FA 4NZZA 2GK4A 1J56A 2LKCA 4L0CA 2NV2B 4QX6A 3F5FA 2CD7A 2O2ZA 3OX4A 1XVUA 1BMQA 3QKWA 3VO2A 1HX7A 2Q62A 4JA2A 1K2VN 2HV9A 4PAMA 5HCIA 2XMCA 5JSKA 3SSMA 4A0QA 4DHEA 1LSOA 3A1FA 3D6AA 3EPRA 3H8JA 4RZIA 3ECSA 5F5NA 3X1DA 2G4CA 3ABQB 3L41A 4U5XA 4MQFA 4CF3A 4CQMB 3WI7A 3THOA 2BKLA 5K03A 4P7JA 1SVUA 3PRJA 1JG3A 2B1JA 4IVNA 3WIDA 1NR1A 2BDTA 2FG6C 3GYGA 1NRXA 4IH1A 2XCUA 3TRDA 5CD9A 4DJ5X 5LL6P 1WB9A 3NM6B 5M34A 2WK1A 3RVJA 3IBFA 3KD3A 4NBWA 4QO8A 4WEQA 2PWPA 3PL5A 4A23A 4J1TC 5JY6A 2DHRA 5AI8A 2GKSA 4BLOA 4POOA 2XI4A 4XUEA 2VF4X 3GPDG 3KEMA 4TXHA 5FULA 3ASZA 1LUAA 4LOLA 2YRXA 3CNEA 3KOYA 1QRSA 1XMIA 5AT1A 2VTBB 4I1YA 3QPVA 4KE9A 4IGFA 4HUJA 4PZCA 2F17A 1QAMA 2H07A 2W90A 4LXTA 2H3HA 2XH8A 3V2HA 4Q4JA 2I2WA 1JQ3A 1EM6A 3B2EA 3NWPA 5TQ0A 4YMLA 1P73A 1Z0KA 2QTBA 2GN4A 4RPLA 4H7DA 1W5AA 1YQQA 4ZCLA 2EYUA 4B3JA 1PX2A 1KVTA 2HA7A 1A77A 1NN5A 1VTKA 3DVQX 3A1DA 3WXMA 5B1EA 1PR4A 4ZV7A 2EL7A 4MO2A 1FNBA 5JYBA 1ZGZA 4TS4A 4Y2VA 1SN7A 4AJHA 2LE0A 2AUNA 1D2NA 2I55A 4LJRA 2OR3A 4XLTA 3R3VA 1Q0UA 5DW0A 2FR8C 1NX6A 2O1WA 3BBPA 3IRVA 3LIIA 1MB3A 1NOJA 1FFDA 3K92A 3GEMA 2OV2A 4BVKA 5EWMB 2X0FA 4B4VA 1YDWA 2EOAA 2J9ZB 2WF9A 2WF8A 2X4DA 1RP7A 3GGDA 1R5JA 4ND5A 4NATA 3RK0A 3U40A 1ABBA 5ER6A 3FSRA 1ODKA 3TKYA 3INTA 2WVAA 1DIAA 4U2GA 4KK3A 1A2OA 3N75A 2Z1MA 2GNAA 3VM6A 4BV8A 1O0BA 2B5OA 4Y18A 1KZYC 2PQ2A 4N7JA 3TTXA 2FMTA 3OICA 3F6YA 4AKTA 1YQGA 4FXPA 1GNVA 2PU5A 5JAUA 1V1MB 2H4HA 1F8UA 4UVHA 1FDOA 5LMUB 1N3YA 1P80A 1TC1A 3MPUA 4FMDB 1JDTA 2CJWA 4JSRA 1E2JA 3P32A 3PUHA 4QYWA 4UDOA 2B1GA 2I62A 2VATA 3HB9A 4Y6QA 2XGJA 2HMWA 1HDGO 3A1VA 3EMDA 3KVOA 3SVTA 3HV0A 3QNMA 1BVYF 4AMUA 1YE8A 2GN1A 3CA8A 4UASA 2J5KA 3PJDA 3UOAB 4RBNA 4AP6A 4RSMA 1DAEA 1NY6A 1UFOA 3Q6IA 2IJGX 4QXOA 4KLCA 3MEQA 4HLCA 5ITVA 2QQFA 4YREA 2CJFA 1EFCA 3A05A 4DXHA 2QMHA 2FWPA 4B6EA 2P0YA 5IM4A 1I2BA 1OFUX 4U9HS 3E35A 3DP9A 1ZS9A 3KL2A 1MEJA 3AGQA 1Q15A 2I6UA 3JAKA 4L4SA 2UZ3A 1S2GA 1RYZA 1TJPB 2CXOA 3WDMA 5YASA 3E1KA 1S8AA 4JNKA 1E0JA 4RHFA 1RC8A 5FWXB 2Y77A 3CISA 1Y81A 2GZ1A 2WM3A 3HUUA 5L51A 1B8NA 2HCJB 1EDZA 3KXPA 2RBKA 4FIZA 5HOQA 2I6TA 3OBBA 2D5IA 1NW6A 5FWYB 1M1YE 1FNSA 4RV4A 1BRTA 2PS1A 3KQSA 1R50A 4UEKA 4BGEA 3IPXA 3QVWA 1U5BA 1N8TA 3GFOA 5CX4A 3DMRA 4RK1A 1BDHA 2O8CA 3L7IA 2GZ2A 2JJ2A 1MAHA 3EC7A 5CK5A 4D8WA 4J7UA 2F4VB 3SJZA 4JU8A 2CJPA 5JVDB 1WLSA 2R1VB 2ZAIA 3ZI0A 5BXQC 1WBBA 3GLFB 2HHCA 1QE5A 5I7OA 1COZA 2ESRA 2WKPA 3KHKA 1XRRA 2EV9A 4XEHA 3ER9A 3OEHD 4UUPA 2Q45A 2QUAA 2J5RA 3FW1A 4HGNA 2JLYA 1F6DA 5IK2D 5IW8A 2D8MA 3MRSA 1CDEA 1ZKDA 1XKTA 1SXJD 4FGKA 3JS5A 4N03A 4B44A 2AOTA 1XYYA 3VYUB 4MULA 3HWRA 4C0LA 3T12A 1NAHA 3LRXA 3HKDB 3Q3VA 5M3BA 2O07A 3A1EA 2VAVA 3CCBA 4PR3A 1Z5OA 3FUUA 5KMGB 1D2EA 1C4OA 4CIXA 4JJGA 4P83A 4HDRA 4AZ3B 5LYJB 2GVDC 4JJEA 1L4MA 5LWQA 2IP2A 2W0MA 3WLQA 3AB3A 1PT8A 2RGCA 4PQEA 3TOXA 1FYWA 1XL1A 1BXRA 4HS4A 4OGFA 4IHQA 1XCJA 3ITDA 4FB5A 1LDMA 1LZLA 1JDBB 2EF0A 2ZJOA 4HDSA 4J3FA 4KFRA 4D9CA 1JVNA 1MBZA 1AZTA 1NBMD 2A0KA 1L5VA 2CXXA 1CQPA 4IKEA 4R7TA 5EJ2A 2O3RA 3TVYA 4B2IA 3B13B 1SO8A 2ZIZA 3EISA 4G2TA 4KMMA 3JX9A 3QPBA 5K3FB 3SXUB 4BFSA 3AEYA 2QTTA 4JJ8A 1B2RA 2PMEA 4BLSA 1OB5A 5L8VA 5KOHB 3G6WA 2QX7A 1T9HA 4DJDC 2FYTA 2PZLA 2VK2A 3JYQA 3A9VA 4QYIB 2IPLA 2G28A 1VLZA 2VPZA 2IYTA 3MSXA 2EFEB 5G0WA 3TN7A 1MR3F 2JFUA 4ESEA 1XZPA 5K05A 1FDWA 4PV7A 3ZIAD 2H0RA 4GMHA 2PMWB 1QX3A 2WM2A 4WBSA 4P34A 4Z7OB 4P84A 1IN4A 1DC3A 2PH5A 5JI2E 2IYOA 3WX0A 2ZI3A 1V8OA 2I6GA 3LHDA 4LDPA 3WL8A 1FSZA 4P6VF 3IJ5A 4HDMB 1JEAA 4NF2A 5KTSA 2GXUA 1G21A 2H85A 3ISVA 3F6CA 1KEEA 3HJRA 1YHYA 2Z5GA 5JE8A 3HCNA 5AR1A 2F3TA 2UU9B 2HUPA 4HT3B 4D9JA 4DG8A 3DCIA 3PG5A 2IU3A 4JOBA 4BVGA 4DMLA 2WAYA 1HNZB 3RODA 1ENOA 3GDFA 1VJRA 1YC2A 3A6EA 5C8YA 4F21A 2KLBA 2VNSA 1XJQA 3NOQA 3C6ZA 2MIIA 1F20A 1XEXA 2FA9A 3ELUA 3QFHA 4IMRA 3V8VA 4ZT5A 1PO7A 1I4EB 1SG6A 4K1XA 1BQ3A 5IUKC 5F98A 3BDAA 3GH3A 2NUTA 4EKEA 1JIVA 2EJCA 3IV9A 2EQAA 4RJIA 2FG7C 2Y0PA 3DBIA 1NZDA 1U2DC 4WY2A 2B9VA 2YN2A 4RA6A 2L0XA 3AYXB 3TI7A 4A8PA 1R6AA 5J1SB 1QP4A 3P9IA 1MV8A 1WOYA 1FQOA 1O96B 4IF4A 4M76B 5ELLA 3UM9A 4PC3A 3FOFC 4ZD6A 3ZLJA 1YAJA 3G9QA 2WAXA 1F4PA 4DWJA 3ICQB 4A1OA 4PG7A 2Y92A 1YZHA 3I01A 1ADGA 3PFCA 3W3AA 2ZUFA 4BQOA 1OF1A 9ATCA 4QUJA 2BDUA 2MINA 3BEDA 2UUCB 2NO6A 4H6WA 1TW3A 1Y4DE 4N47A 3IXMA 1XMSA 2PE5A 5F77A 1VIMA 3ORQA 3RAJA 3IQWA 4CKZA 2WQ7A 1NUTA 2X0NA 2AJLI 1AG9A 1G9SA 2VRCD 2EW2A 4YJ3F 2ZAMA 1DJMA 1VKNA 1XLTC 4LHYA 2GRJA 4DJAA 1FJGB 4XB2A 1A5BB 1KI2A 1POWA 5JXHA 3MAJA 4ALMA 5JWOA 4GKVA 4O2AA 1IVSA 2O48X 3WLFA 1N1EA 3NCTA 3RGGA 4EI9A 3K2BA 1D0SA 1OMOA 3NKLA 3OX1A 1V9CA 1NT4A 1B6SA 1R1DA 2KS6A 3LC7O 1DFHA 3K9NA 3QELA 4N8SA 5EIBC 5FA8A 5LJIA 2BM9A 2ZJYA 3IT2A 4KLAA 3U4HA 1HYEA 4HH3C 2JHAA 2YDYA 2JCVA 5JMPA 4FD2A 4KVZA 4UBMA 3THXA 1F2UA 4CMKA 3UGJA 3DEYX 2J0VA 3A4VA 4LC0A 4WLEA 1VP3A 3QMWA 3IUQA 3H2HA 1NVBA 2ACEA 4WK2B 1D5WA 4LNUB 1N9KA 2FP4B 4N12A 4OI1A 3ZXUB 2QRMA 3GBVA 3HCDA 4RUKA 1P17A 1W0JD 5ERYA 3ENVA 1P5JA 1EINA 3B20A 4G09A 1GFWA 3WDKA 4HXEB 1KMQA 5DOVA 4E46A 2O8BB 3OJCA 4CMBA 1BHJA 1QLWA 3EG9A 3GJXC 1KDOA 1ODLA 4UJ5A 2PFGA 3FMGA 1C2TA 1RIIA 2H17A 3D5QA 4K28A 3TLEA 4AG6A 1KEEB 3D1LA 5AW1A 1J5EB 1BDMA 1L4HA 4J43A 3V4LA 4DTIA 1N32B 2EKDA 4LYJA 3R77A 4CM8B 5DX1A 2O2DA 3RSSA 5FPKA 3ODPA 4QPJC 2Q9UA 3K1AB 5DCUA 4AY4A 5HR5A 3WYDA 1KMHA 2RK6A 3RVMA 4EFDA 1U2QA 2VBFA 1NULA 3DW1X 3VVBA 2Q3CA 2ETXA 2PU7A 1EWYA 2W11A 4GVPA 1KU0A 5T41A 1D1PA 2OCDA 4R0NA 3DXZA 1D3AA 3L0PA 5AUNB 3HKCA 2YWBA 1NW3A 3NBUA 1OIXA 1Q6YA 2BR3A 3O8DA 3WWYA 4CKBB 2HMAA 2VPIA 1QORA 2IYRA 4JT2A 3PI6A 1V26A 3U3XA 2NO0A 3HO1A 2OCXA 2OV6A 1PTJA 2H1FA 3LQ4A 3I62A 4K2HA 5K3CA 2A8YA 2ZBFA 2QVZX 2FF5A 4JC5A 5LIPA 1K92A 1MHTA 1U0EA 5C1BA 1I01A 2Q8NA 2P6OA 1ZL2A 5K3FA 3STYA 4NCBA 2XTNA 2OXEA 3SXUA 4DR7B 3EXAA 5L3ZA 3LKVA 2VHJA 1J9EA 4E07A 1KK2A 4K2AA 3ILVA 3LYHA 2ZJFA 3COSA 5JPIA 3BWDD 2Z9BA 1BZYA 1BMTA 3C4JA 4BUJA 3STUA 1CDDA 3H8WA 2AOUA 3CE9A 4YJ3A 4E6EA 2WVJA 2I34A 2GERA 3OOYA 4LRWA 5HMMA 1SBHA 3VSAA 2FX2A 1NY5A 1SUFA 1TKRA 1N5JA 1Z37A 3CYFA 4O2AF 4OM7A 5B58C 2P5SA 2B3DA 5JEEA 2CF5A 3RHTA 3L4EA 2XD4A 4V24A 4KQ6A 1J4AA 4B74A 4NV0A 1X94A 1T6XA 3M6FA 3Q7TA 2FXIA 4G8DA 3DAPA 4YJFA 2YTZA 1P4HA 3EHEA 1QIDA 3DBHB 3BB3A 4DLKA 1NSYA 5K2OA 3RADC 1NMSA 4LRQA 3ZEIA 1GGNA 3C97A 1E0DA 2WWHA 2JJ8A 5IC4A 1RZUA 3KYCB 4NJMB 4IXWA 4OHVA 3VO1A 1IN6A 3V7FA 3RTGA 3WGZA 3D4LA 4CKXA 3GMSA 4CE6A 4ND8B 4V1CB 1KXJA 4V0SA 3AEZA 2QJRA 3FHJA 3P2OA 1AIPA 4BFXA 5ELXA 3BTUA 3Q8KA 3P4UA 1D6NA 2QPOA 4QTXA 3RASA 1HR0B 2C2MA 2AKYA 1Q0ZA 2HBYA 1UZUA 1OBVA 1OFIA 2MTBA 3QV2A 4RANA 3R7NA 2GZMA 3I76A 5LM3A 2Z6UA 2GHTA 2R00A 3W34A 3FDZB 3D3WB 3VDXA 5C34B 4DPLA 2I76A 4YRGA 2PJRA 3OOWA 2PGXA 5E2IA 1I9CA 1PZHA 5FADA 1PJZA 2PEZA 2XZDA 2GUWA 3OZSA 1PNVA 1S2LA 2CKMA 3N0WA 3G9XA 5HKBA 2NUAA 2NUAB 1WHSB 2W58A 5A02A 2W43A 3QXGA 3WQSB 1KO4A 5KBYA 1JAHA 1ZCJA 3FKQA 4PRLA 5FLKA 3UJBA 1XWWA 5FLYA 4ATNA 1W30A 3DKIA 2ODQA 3WKCA 1B3BA 5IJ9A 3RUDA 1GSAA 2FUKA 1KAHA 1WCWA 1ZOIA 2H7CA 1AO3A 4JBHA 4UD2A 5AK5A 5AJYA 5K0EA 3HP1A 4EHNA 3BHMA 3FVTA 3LUKA 3ML1A 3UQYS 4MQLA 1Y8QB 2RFLA 5JBQA 4RF2A 2NSJA 3L8FA 2PR7A 1CLEA 1EVLA 2WWGA 1H3FA 4J3JA 2C03A 4M1KA 1VGVA 2PFKA 3VR5A 2IUUA 4HG2A 1ZD9A 1N6KA 1QANA 3O95A 4KMRA 1CR6A 1OZFA 5SZIA 1C4WA 1P33A 3UK1A 4D79A 3BWVA 5E6RB 3WNDA 3T0FA 1W4CA 4PS0A 4Q1VA 5H70A 4NJMA 1E4OA 4BZWA 5TMEA 2C3PA 1XPOA 1CIJA 2FOLA 2AZTA 2VOEA 4JR1A 5T8KC 4HDNB 3OJFA 3M2TA 2OBYA 3P1JA 3LPCA 3ORSA 4CL2A 3PUVA 1BYIA 3QF7A 3H1AA 1RAAA 5D51S 4CU2A 2C5EA 5TMPA 4EABA 1P0CA 2CEAA 4F56A 2YXBA 4NBNA 2GHIA 3CXUA 5HIMA 3ROTA 1CUCA 2AW5A 2WPDA 1CJUC 3H1PA 1MRNA 2KBEA 1U3VA 3D4IA 5T4BA 3N58A 8MHTA 3THYB 1IXRC 4PFJA 1RHQA 3GRYA 3HFGA 4Z7NB 1UBCA 1ZGGA 4I4TB 1N7GA 3WZLA 1JKJB 1VHDA 4GHWA 4JNCA 1W4BA 4CLOB 2QR5A 2XQJA 4EB6B 2YQ4A 3R6TA 3CMCO 3WGVA 3E5NA 4DLRA 1KERA 3GRKA 1M1XB 4KV9A 1YFKA 1QRTA 3A32A 1QXSA 4H7FA 1DTWA 2SECE 4U7PB 3NEAA 3OIWA 2GO7A 1E2GA 3WR5A 3JATA 3QG5A 4LDRA 4E5PA 1SKAA 2WIBA 2ZBUA 5J5VA 1YZNA 3QLVC 1SOMA 4KH1A 1LPSA 2OBFA 5H4GA 4DDVA 5JJIA 1A8PA 3NT2A 4OPMA 2UZ0A 1QRAA 4LGMA 4LJ7A 2BM1A 2DFDA 4ODIA 1P62B 5EFOA 1IOZA 1IPHA 1QIHA 2ZT5A 3JRXA 4GPZA 1VG8A 1WP9A 3PJEA 1P91A 2WHEA 2BCEA 4JYAB 2BEVA 2DWCA 2LRHA 3AM5A 3X0DA 4HGYA 3H5VA 3SBEA 1FVXA 5HRAA 2H7XA 5K3OA 3MT0A 1W85B 1EBBA 1VBMA 4DIBA 2Q3DA 4R8LA 3H2JA 1V71A 3UB3A 2RI1A 3HJAA 1ECJA 3MG9A 4KQGA 1DWPA 4WWHA 5KQPA 3DE2X 4Q01A 4C7JA 3WGQA 3COZA 1Q6ZA 4Q9IA 3KJQA 3RB8A 4LXQA 1I4OA 3VKUA 3PQ7A 1XTJA 4QODA 3KTAA 4P92A 3F5DA 1XPJA 3UWDA 2AS0A 1C4XA 2OCBA 4PYOA 5COAA 1IIBA 4AFNA 1P2VA 2WHPB 3CXRA 3HY6A 4RZSA 2C4MA 5JI3E 1X9HA 1ZHHA 4M9XA 5JYEA 4RIEA 3DFZA 5HTOA 3Q6MA 1KSJA 2ATEA 1P0QA 1YZFA 2EX0A 2Q3BA 2I4MA 1XA4A 2OWEA 4FZJA 2P3SA 4QPNA 4TV9B 4B35A 4U2KA 1Q2UA 2PH3A 1XEAA 4X63A 1OAOA 3WDSA 4ETIA 5KJ1A 3EGEA 2CL0X 1W7AA 3D3KA 4YACA 2PQ6A 1XLWA 4NK4A 3UW3A 5AOVA 2AFHB 2PS9A 2Q6LA 2GSDA 1XQ6A 2G36A 3CZCA 2P67A 2AQ8A 2B92A 2BELA 5IKOA 1Z2NX 2CDRA 1YQDA 3ID6C 1YJAA 2VSQA 4MVJD 2EAUA 1HT1E 5H3HA 4XVHA 3LK7A 2H48A 2GAAA 1Y33E 3V5NA 4BO3A 4DV2B 3WLEA 2X2OA 2SKCA 3C3WA 1ZO8A 2FWMX 3HE3A 4INAA 3FFTA 4MVJF 4DMGA 2ECQA 2P3LA 4X71A 2LCIA 1ADFA 3K6JA 3AUXA 5NLLA 5JNWA 2CMFA 3C1AA 3WE7A 1T9CA 1OOEA 4BP3A 1YT5A 2Q46A 2ZAGA 4ND4A 4IIJA 3K0AA 3DZIA 4RPIA 1U3GA 1LA2A 1X7XA 2JDIA 3ASYA 3C8DA 4Y30A 4BMOB 1VYVA 2VRBA 3NEYA 4QDKA 4TMYA 2WW8A 1PFGA 1CK4A 3VOAA 5AW0A 3QUBA 2H16A 1CE8A 2OGSA 1Y1SA 1JEEA 1EB8A 3D6FA 3H9EO 3WTBA 3E58A 3USZA 3IE1A 5LCXA 2N1MA 2WKQA 3SC3A 2WTEA 2H1VA 5SV2A 3EEYA 1UZAA 2VPYA 3GPIA 1YKFA 3LO8A 3E48A 3LW8A 3OIUA 2HU2A 3QQ5A 1FCJA 3MT8A 5EIWA 4MA0A 2YUTA 1PJ3A 4G0ZA 3M4JA 3F0TA 3U4CA 5IDQA 4M49A 3A58B 3E2MA 1B26A 1KDTA 2PKWA 5HFAA 2V58A 2A1UA 2H6EA 3IEMA 3R3HA 2Q1TA 2BHSA 3AJEA 3GUHA 5LJLA 1CP2A 3TL6A 3TL3A 1EWKA 3ONEA 3LLCA 3S3TA 3EN0A 2ORWA 1BS1A 2W2PA 4FHFA 4CM5A 3ZZMA 3VBEA 1ZM4A 2P41A 5LBTA 5D3MB 2WDZA 3WYBA 1A2BA 2V4UA 4HRXA 3F7TA 2RHRA 4JX8A 5JD4A 3R0VA 4PPNA 3V3KA 2HLDD 1BEEA 2FPPA 2PX8A 1ZNQO 1DKPA 4UHKA 1IU9A 2Y0CA 1XZGA 3MQ2A 1SUCA 1RZ3A 1YUNA 2ZI5A 3H75A 1FYXA 1R5OA 3D6VA 1RJ9B 3HI4A 4GOMD 4N49A 5LQRA 1DJPA 4EA9A 8LDHA 4D41A 2HREA 2C4HA 1L5QA 3MGAA 2JPDA 3ITEA 1QQ7A 5EL0A 4Q1BA 2A5GA 1V7ZA 2AG6A 1A8QA 4HRYA 1BE0A 3V2IA 2VDUE 4BS9A 5FXMA 1E58A 1RPNA 1DX9A 4UARA 3NVDA 2GEKA 3SF0A 4LZLA 1GOTA 1HE4A 3GAFA 1F7VA 3VOTA 2VF7A 3IPCA 1YIDA 2I1LA 4L74A 3K9GA 2EZ8A 1M7HA 2IE0A 2PPLA 2QX9A 3RU3A 4A8TA 1QE0A 3GH1A 2H9AA 2GJAA 4AN4A 3EDCA 4LZZA 3G2IA 3AFIA 2QZSA 3GJ6A 4QRDA 3NTQA 5CT9A 3AUFA 2VDOB 3FMOB 5KSPA 2QB5A 5HYVA 1HDZA 2IY8A 2KQUA 2AA3A 1UJCA 3OQIA 1LPOA 1GPYA 1Q95A 4WX2B 4YO7A 4KFUA 4YAEA 1HQKA 1Z36A 2MSNA 4K8RB 4HL6A 4XB1A 4JBNA 1CHNA 4ZRDA 4AO7A 3AF6A 3BK7A 4N3GA 3GN1A 4UUBA 3R74A 5AM2A 3N8IA 5JZSA 4FD3A 5CNMA 3AVPA 1XDZA 2OLJA 4HDSB 1J7JA 3HC7A 2JFQA 4MNTA 5I4IA 1BDIA 1TCBA 4DMCA 4IIJF 5BMVA 3E9QA 3VQTA 3KQKA 2Q28A 5ICEA 4QFMA 3B51X 2FOIA 2WMNB 1NVUQ 4HTAA 4HGZA 4Y6GB 3IQEA 1R2QA 1TU3A 1UM9A 2FX5A 3FF4A 3KM0A 4Q3OA 4AIIA 4HZUA 4LF5B 1DHRA 2A33A 3BXGA 3SZ3A 4PHGA 1JLHA 4LSWA 4KYTA 5C5IA 5K0LA 2QXYA 1XAIA 1GGFA 3D4BA 1UPXA 4E7PA 5F9FA 2ETVA 4OU4A 2CBZA 1W88A 2A5FA 3DD1A 1NUHA 1DO0A 4N5MA 1A8UA 2ECOA 2YRFA 3H3FA 5JO9A 4AJ4A 4ZYTA 2E4UA 1O89A 4MVJE 4Y2RA 1T35A 3GJQA 5EWLB 1F38A 1YULA 4YR9A 2XZOA 2FCRA 3I0MA 1B7GO 3PHLA 2WJ3A 3QFCA 1AS2A 3WB0A 3MCAA 4Z99A 2AZ4A 2O7QA 4JYZA 3VAYA 1QOZA 3DV0B 1FYFA 2NGRA 3R0QA 3GFPA 3GDOA 1U0BB 5GONB 4WNCA 1N8KA 2HFJA 3NIWA 3A06A 4ZPXA 5IT4A 4DXDA 4JVNA 4BV3A 2MMCA 3BWEA 1IK4A 4EHLA 2Y0BA 4Y2TA 1C9KA 1UT6A 5DSXA 1N2XA 3O31A 3D6TB 3PDIB 4KDFA 4RPGA 3GI1A 4ZV4A 1T9AA 2WSSD 3UK7A 1BROA 2DC1A 3LTEA 3B7GA 4HADA 4PM4A 2MDTA 4PZYA 1A7JA 4M2LA 4QVGA 2QTVB 4EUKA 4EYKA 3WMEA 3WGIA 3QEMA 3IHTA 1C3EA 1DEHA 3OZTA 4I3GA 1ORIA 5AM5A 3HZOA 3UXYA 1JALA 1ECCA 1GKYA 4BVHA 2Q4OA 1EDEA 2V9CA 5ECYA 4F85A 3H0CA 5AM1A 2RE8A 2I2XB 3IDOA 1Z0ZA 1RFGE 1SMKA 2L42A 1PRYA 2JEYA 2RHLA 3CNBA 3WICA 3WS7A 4OLBA 5I9MA 2XZLA 1C3OA 4LDZA 2GEDA 4COOA 4E88A 5FHQA 4PC1A 4LOKA 2HSJA 3Q8MA 1D03A 2YVLA 4KSBA 5KAMA 2QAIA 3TEJA 4E2FA 2O4UX 5L3VA 2ZIWB 3EZYA 3MZ0A 1EWQA 3BXHA 3UKOA 4JS0A 1ZRSA 4QGSA 2DFPA 3HSKA 4FDTA 1RQXA 4FLMA 1DTSA 1F3OA 2ZYRA 3PC7A 1QYDA 3SOPA 4DMMA 3QGMA 3ECCA 3VPCA 4Q9AA 3MRXA 4Q48A 1QHSA 4BQPA 5KNDA 1E3IA 1QRRA 1X0VA 3DL4A 2BTQB 2YVAA 3SAJA 1IBMB 1GZUA 5CB8A 4BO0A 2G0NA 2RB5A 1P44A 3AHFA 4KX5A 1Q3TA 3PT5A 3L4JA 3ESCA 2GESA 2FEXA 4DIDA 2QV0A 4EIWA 1VPWA 4V0MA 3PSHA 1X8KA 5AK0A 3G82C 1WAMA 4BGDA 5INTA 2O8FB 3OLZA 2CVFA 4J9UE 1AKRA 3IC5A 4RS3A 2X5KO 3INGA 3VO8A 4IJQA 3EC2A 2D2XA 1O9BA 2CFCA 3CBQA 1T10A 4PTYA 3ES9A 4DV0B 1EA5A 4L6AA 1MQSA 2G9NA 5H81A 1L7MA 5ARDA 1SULA 1IUOA 2NQ2C 3I4FA 3K9QO 1E1NA 4YJKA 4H2DA 2WABA 1Y9AA 2F3QA 4WI1A 2FQQA 4MIEA 3NVMB 4DCMA 1AN0A 1LC0A 1T9BA 3GZJA 3R4CA 3NHZA 3LCCA 3U7FB 2GK3A 1KIAA 2ISQA 2JLQA 4NU6A 1OC4A 1JJBA 3EA5A 3JQAB 4TTTS 3WLTA 4QFCA 1OAOC 1EA7A 1JKMA 4MMYB 1JWLA 4IEFB 3TZEA 2YFHA 4OEHA 3SC4A 2H1LA 1VSVA 4LE2A 4IIBA 3MFYA 4ZO9A 5DMHA 1C0PA 2UDPA 4FHGA 4XOUA 3D81A 1QKJA 2VZLA 4QRHA 3MBIA 1S3IA 2CB0A 4LN1A 2X8BA 1EP2B 1REQB 2B2NA 2B61A 1TYDE 1Z8DA 1Z0SA 1YIAA 2Z3WA 3ELWA 4J0KA 4L85A 2R0QC 2QL7A 3U7RA 4B0OA 1YFJA 5GOTA 3LD9A 4ZOLF 5EZQA 2OB2A 1MP0A 3IGFA 4OYYA 5KX5B 1O0SA 4Q12A 1I2ZA 1YFZA 2B2CA 4EUEA 5IYZB 2VXYA 1V11A 5KYXB 4WBNA 1AF7A 4QAQA 1OJ7A 3VZPA 1IUPA 3KXIA 4JLNA 5JALA 4W9NA 1YI1A 1GZ7A 3SMVA 4L0QA 1A8HA 1FZQA 1QO7A 3JQQA 1P9LA 2DJ5A 1U2DA 4ZTBA 4I4CA 4DQKA 1G9TA 2R751 2PYZA 2CL7X 4TVOA 2QMYA 2VTBA 2ZRPA 4RVHA 1GY8A 5AJVB 3W0LB 3PXCX 2M6KA 3UGTA 1IK6A 1DIGA 2C0PA 2VP5A 1T0JB 2XB4A 3MTGA 4BYGA 1X74A 3UPDA 4XWTA 1LSUA 5BXYA 2VHTA 3OFJA 3BRQA 1KH1A 1XZIA 1MOZA 4LYDA 2PBZA 1H05A 2PUBA 1KS9A 3U09A 4MCHA 4DCNA 3H11B 4BJ3A 4DC1A 4XD2A 1W94A 3R8CA 1Y42X 4DR2B 3PDHA 1W34A 4B84A 1ND5A 2XUJA 3AEXA 4GPAA 3VC1A 4F4CA 4X92A 3GRUA 3PD0A 4LDAA 3WG9A 4WY8A 4AX8A 2BGIA 2CSUA 1BVRA 3EIOA 5K3DA 2NUBA 4RK5A 3F71A 3CY6A 5AM3A 3IBCA 1WNTA 4C9BA 2LDBA 4ZVPA 2EBUA 1G4UR 3TIXB 4E2YA 4RH1A 5KKNB 4G5RA 2P8JA 3TE7A 1VB5A 3MQ4A 4FSHA 4HLUC 4BNVA 5CHYA 2NVOA 2C97A 4IWNA 3T6KA 4XUGB 3GZTB 4U2BA 5DN6D 2IS1A 1E89A 1G64A 1RM4A 3VMFA 1NF8A 3JWIA 1TGYA 1QO0D 3PQCA 2XOXA 1PR1A 3LUJA 3LUFA 4ASUA 1YCFA 1CX9B 3OM1A 5A5DA 2UZ4A 2FPWA 2C88A 2J7PD 1RC0A 4WDQA 4F45A 3DNFA 1TJ4A 3CPSA 1IONA 4WXPA 2DTEA 4MDFA 1WDTA 3RAPR 2P6RA 4ZODA 4ICIA 3LY5A 5K7SA 1E3QA 4OIFA 2RBEA 1D1QA 1T9ZA 3C5CA 2HO4A 2P9CA 4MRPA 5KYYB 3ZVNA 3I28A 1OKKD 4OQLA 1NYTA 1Q20A 2JC3A 3L7CA 4OTZA 3CPHA 3JD0A 4JU9A 4OAPA 4AUEA 3V4RA 1ZQ1A 3VPSA 5J5CA 1RP1A 1HQDA 4EJ6A 1R12A 1V39A 3QXSA 4WOCA 1ZVVA 3WSTA 1B6TA 5B1SA 4XUCA 1JKXA 3KZMA 3WLRA 4Z4CA 2HRDA 5BOSB 3K09A 1RWOA 4YDQA 1BMFA 1K97A 2CLSA 3SZUA 1U3DA 4YCJA 1G66A 5TQ0B 4AY2A 1EVEA 4R7GA 3ZE2B 3FHOA 4C0BA 3ETLA 3ZTTA 4CG0A 3W5CA 3PP8A 5TPWB 1ZITA 3G0GA 3HNRA 3TTVA 3ZZNA 4L3OA 1XRJA 2QXTA 4RHCA 2PZ8A 3O83A 1ACMA 4XRRA 2HFKA 4NENB 2V96A 4PLWA 4JP3A 4MPJA 4X44A 4ZA2A 5LOVB 2OKGA 1FU8A 3SFZA 2BJVA 3QI2A 2P2YA 3DTTA 4MXDA 4M7OA 1L7PA 4K6KA 3R3JA 5IVHA 3TS1A 1V16A 4ROTA 2ZETA 4U8GA 3NV7A 2AQKA 1XELA 2Q6KA 3L5KA 4KGDA 4QQRA 4DG9A 1M1YB 2Z09A 2Y1EA 2BCGY 4IFBA 3RVRA 1NLYA 1OAAA 1X7HA 2FSSA 2Y8EA 3BK1A 1XDDA 4G97A 1F6BA 1S0UA 4Q3BA 3TW4A 1DC7A 3F9IA 4ZYXA 2WNHA 2PN1A 3WKBA 4K9NA 4ZRNA 3GUUA 4PEVA 3M5PA 3U49A 4CNQA 3RQSA 3PV0A 1PX0A 2H9IA 1DIOB 2G6BA 2NZXA 3KVVA 4GL4A 4IZIA 4BQSA 4CMGA 2R8BA 3PYLA 4BOYA 2I3ZA 1ZVMA 5CTJA 3FGOA 2XNDD 1O7JA 3W6OA 4BEBA 2DPLA 3MJHA 4AUNA 3D9QX 2W6ID 3G13A 3I37X 3MWKA 2Q2OA 4C2UA 2OEPA 1E99A 1F8YA 4QTUB 1L8AA 3FI9A 4BMZA 3AL0C 2A9KA 5BNTA 1XF9A 4I3FA 4AG5A 2WIFA 1XN1A 3SLGA 2Z2KA 3ZWDA 4WA8A 2X5OA 3CZ5A 4JFAA 4MV1A 4XAQA 4RE6A 3SX4A 2GTIA 4J0JA 5I48A 2QLTA 3AEKA 4ZJUA 3DMDA 4HB4A 4POAA 1UMDB 2CMHA 3SHWA 3B9RA 3BE4A 1RD4A 1U6JA 4XJXA 4O3FA 1MO5A 3MCUA 2V98A 4DMHA 5EUMA 2RG1A 4EJ0A 3N70A 1JT9A 2ENUA 2QDKA 3IAHA 3SK0A 3PD1A 4GE3A 4HR7A 1ZH2A 3IDSA 3RHSA 2AHRA 4KQ9A 3RUEA 3SQDA 1EJ2A 1GVHA 2GCNA 3GAAA 3GZNB 5B4UA 4R31A 2OFXA 2Q4RA 1P5RA 3OEYA 1I1HA 4US0R 4X6LA 4ZCMA 2A0YA 1W6RA 1CJKC 2W2XA 4II3A 3BD6A 3U56A 3RVSA 1EHYA 1BNCA 3FR8A 3AMVA 1KO8A 5AVZA 4AY3A 4ZYLA 2ODBA 4LBZA 5JH7F 1JXAA 4Y9DA 2PIAA 2W2KA 4DGQA 3QA9A 2H11A 3LGXA 5JQGF 1Q5PA 1GUBA 2XUKA 3VBCA 3TD2A 1OV6A 1GA6A 2W6JD 2X22A 3KELA 4KV7A 5DHQA 3OOHA 5EYPB 1MW9X 1KR5A 1NR7A 1S3SA 3H1EA 5B1DA 3C43A 1UP7A 3PXAA 4PX3A 4Y8VA 5KX5A 2FZVA 3ZU5A 3TW6A 3M8KA 4YWHA 1EWTA 1SUWA 2GZHA 2WF6A 1FF9A 3DNPA 4OMCA 3CRRA 1RSZA 2IF0A 3VSCA 4BU0A 1U3UA 5J2UF 4JFRA 4ZCPA 3ANTA 4HMPA 3I01M 4M22A 2V7GA 2Y3IA 5CVCA 2X0DA 3TDMA 1EBUA 2Q5JA 2W6IA 3NHLA 4HUQB 4LISA 5F5LA 3I83A 3AUTA 2VP9A 5F3WB 1R37A 3JALA 3R7FA 3HXMA 4LQDA 5G0VA 5AO9A 3PE4A 4DUZB 2X7JA 4E4YA 1HTBA 4E08A 2VHZA 5WRFA 3T5CA 2UUAB 3D0RA 4GM1A 3KCNA 2CHEA 2NU6A 1UT8A 4EBBA 3VC2A 3UAXA 4B80A 4ZI7B 4WL0A 2COEA 2V59A 3IE0A 3IQFA 4NESA 2XW6A 1G8JA 3C3KA 2FFHA 2ONYA 2O7VA 2OQ2A 2NG1A 4RDXA 5CDHA 1DBSA 3E53A 1AB5A 5JUWA 2B2XA 4B3FX 1TM3E 2BZ1A 4UVIA 3WMGA 3ZCPA 3FFBA 1Q21A 4PLYA 1ILWA 2QVLA 2WE8A 5DWVA 2JIPA 2JAHA 1SCDA 2CCKA 3GPLA 2WRZA 4M37A 3C5EA 1JWBB 2VJPA 4O59O 2YV2A 1HE5A 5HE8A 5A5VA 3WV5A 5B3LA 4Z4IA 4GX1A 4GECA 3GCWA 4YX9A 4BX0A 4P7FA 4W82A 4GC9A 3SC6A 4JI4B 5KNBH 3EW9A 1BW9B 5KVSA 4WDRA 4L07A 3B1VA 3EGDB 3GG9A 2HTFA 2YFYA 1U9ZA 4G85A 3AW8A 1EGAA 9MHTA 4HFRA 1F8XA 1FXWF 2IZ5A 4PVDA 4CV2A 1DS6A 2MYPA 5JNTA 3TGLA 1ZEMA 3OX2A 2JGDA 1DCMA 4R6XA 4TTIA 5GM1A 1YNSA 1BKYA 1WNFA 2BTEA 1RMQA 5CFRA 4EG4A 2GM4A 1DAHA 2JCGA 3TRFA 2WR8A 1K75A 2G1JA 1RADA 3KLNA 4E7OA 1R18A 1X87A 1AKNA 4U7FA 5HA5A 4B8WA 5KEIA 5IH3A 1GLNA 3UWKA 4WXYB 3G8BA 1DJNA 1KO1A 4AZ0A 3WWOA 1ZG3A 4CGYA 1L5NA 4YGXB 3EY4A 3SI7A 4AC9A 3CJRA 4PIMA 4B79A 2HDHA 1STOA 3D5EA 4R68A 2XEDA 2O06A 1J24A 2JLWA 5I8ZA 1FLDA 1B0UA 3AWDA 3I32A 1HLFA 4JL6A 1BX1A 1SHTX 1F1JA 2WU1A 2EF1A 3L0DA 4OGGA 3UQZA 3L79A 3PZRA 3E15A 3DMTA 2G77B 3IRUA 4I9NA 3G9ZA 3TJZA 3DLCA 1Z5GA 6ADHA 2JIBA 1JTFA 3TLMA 1SELA 4FFNA 2Q2VA 4QATA 2Z4TA 3E05A 4HB0A 4RAQA 1BJRE 1PQ4A 3IPLA 3ZBPA 4D80A 5GADl 4HD8A 4FKMA 1W5FA 3BIXA 3FKSD 2Z6AA 5A5GA 2FPKA 3IULA 5EP1A 3T7JA 3W3AD 2VHYA 4OHRA 2P9ZA 4PYJA 1MF7A 3G0CA 2RB4A 2J41A 4FPXA 4JLBA 2PGJA 2OYRA 4OMDA 3ZX5A 1MT0A 5EZ5A 4ZCRA 1U0NA 2QXUA 3DE0X 1RLJA 3TSOA 2NZYA 2NZ2A 2LDXA 3IBGA 1GQFA 1KBOA 1QGDA 2F1JA 2FUCA 2FCAA 4GRAA 2E7ZA 2OD9A 4NPAA 2OXIA 1E3LA 1EQ2A 1U2GA 1AUPA 1I2AA 1U1DA 1VI5A 2GF9A 2VHCA 2GAIA 4OY3A 4Q93A 2DFLA 3QQPA 4AJLA 3HB7A 5LQKA 3UJ9A 4MRAA 3QE9Y 2YS6A 3BL6A 4HZUB 5JCJD 4G5GA 3L01A 3SHQA 6CHYA 2AMFA 2C8KA 3ICOA 5IBPA 3D7SA 5EMLA 3PITA 1M6VB 4ZC8A 5IBQA 1I7PA 1ZD1A 2OGWA 2ID7A 2VKTA 3MJDA 3UHJA 4R81A 5LYJF 2CZCA 3KBOA 1TU0A 3GPCA 2FMUA 1IOWA 5JCJA 3S2UA 5A0FA 1BWRA 3A9TA 2R62A 3HLYA 4MP3A 4NPCA 4JC8A 5ALZA 2BLNA 1KBQA 5JPDA 4HH4A 1M73E 3C98A 4WLNA 3EVEA 3WAJA 3HEBA 3E3MA 3QOWA 2LIVA 1NZJA 3P9PA 4REMA 5EESA 5T6MA 4MUIA 3D8TA 1EFTA 4FC7A 1UPTA 1XIVA 4L4XA 4P3OA 4WJLA 1WJGA 2V7XA 3Q7IA 4V0KA 3SG0A 4QRIA 2XRFA 3SYTA 1PV2A 1RRKA 2VEDA 5KYGA 2P75A 4D92A 5DKFA 2Z8YA 2A2ZA 1WD5A 3BMCB 5EE3A 2VSFA 5THQA 1IWOA 2BGUA 3DCYA 3QTTA 4D0SA 1NBME 2A0XA 5CU7A 3FLBA 5LBUA 2W6MA 4O0MA 1U0GA 2XUHA 3RNLA 1FFXA 3RT1A 2QX4A 1N1GA 4MLCA 4DS3A 4HVLA 1Y1PA 2X8WA 5D3QA 3UTDA 1E63A 4ZZIA 1JHXA 4MYDA 2BHLA 4X94A 1ONNA 4PC7A 3BIJA 4OHKA 1OX4A 3C45A 2I2BA 3AI1A 4TTAA 4UCFA 3VR6A 2E9SA 5ALHA 5IVPA 1WZIA 2H06A 4OV6B 5IUJC 5BW8A 3VSDA 3VU3A 2QW0X 3NB0A 3VR3D 2HH9A 4EEXA 4H7KA 4P81A 2QF7A 1AUXA 3A8TA 4Q4HA 1T4MA 4D26A 1K8XB 4BMPB 4PSVA 1LC3A 4NBVA 1C7ZA 1XTBA 3Q6NA 5ALPA 5C4GB 3SP1A 4NCHA 3QWHA 2C9ZA 4P9NA 5F7OA 1XXLA 1QG4A 4UM5A 5JS8A 1XVAA 4A91A 1W47A 1E9SA 2BFDA 1H9AA 1L5ZA 3EXIB 5FOXA 2HKIA 3UCXA 2G76A 2WA2A 5KHOC 2GHRA 2V3WA 2XYVA 1ZI6A 2XYHA 5KPDA 3DT8A 3IMKA 6LDHA 5KOJA 4BRUA 4OSEA 1ECFA 1FUEA 2BIFA 3B8EA 3CM0A 3ESRA 2C9BA 1VE1A 2II6A 2NTEA 4BRSA 3HWWA 1CNEA 3BWCA 2BM8A 4O1IA 2WYWA 3U9LA 1KZ4A 2FGKA 3A2MA 1J8FA 1HXHA 1VLQA 2GPAA 4FEAA 4QPZA 1CE8B 3K5HA 4OKNA 1XTTA 3RTBA 3NVKI 2JH3A 2ZSBA 3IP5A 3Q5EA 3I2GA 4B6FA 3HDGA 1G8MA 2OCGA 1NQTA 5J4VA 1A9SA 3RS8A 1X7GA 1Z45A 3DA8A 2CSXA 2OO5C 3L07A 1EVZA 1L4BA 4LHWA 3DEZA 1WPQA 1MB0A 2HIHA 2VPQA 3G2HA 3NANA 4F6LA 4Z7QB 4P93A 3MB5A 1Y9JA 3PTAA 1JEYB 4XTCS 4ZN6A 3LF2A 1TECE 3HYNA 1I1NA 5DTQA 3T5TA 3T9DA 3W2GA 4CG2A 3BJIC 4DREA 2RAUA 2XJ4A 1DKNA 2YIDA 4GR5A 3OPMA 5CLJA 4KO3S 1SCQA 4WAUA 3PC2A 3P20A 1DQZA