4HL6A

Yfde from escherichia coli
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
375
structure length
375
Chain Sequence
b'KGPFEGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEINPRLIYASSSGFGHTGPLKDAPAYDTIIQAMSGIMMETGYPDAPPVRVGTSLADLCGGVYLFSGIVSALYGREKSQRGAHVDIAMFDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFDVFNTQDKPITICCGNDKLFSALCQALELTELVNDPRFSSNILRVQNQAILKQYIERTLKTQAAEVWLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLIEAGGIMMPGNPIKISGCADPHVMPGAATLDQHGEQIRQEFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YfdE
publication title Function and X-Ray crystal structure of Escherichia coli YfdE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 122
structure length 375
sequence length 375
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.8.3.19: CoA:oxalate CoA-transferase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 4hl6A02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 4hl6A01
1XK7A 2VJQA 1Q6YA 2VJOA 1P5HA 1XVVA 2GD2A 1Q7EA 2VJNA 1XVUA 2GD0A 2G04A 4ED9A 1X74A 2VJMB 1PT8A 2GCEA 2YIMA 1PQYA 2VJLA 1XA3A 1XK6A 2VJMA 2GCIA 3UBMA 2VJPA 1T4CB 1VGQA 1T3ZA 1XVTA 1XA4A 1PT5A 1P5RA 2GD6A 1T4CA 2VJKA 1VGRA 1PT7A 4HL6A
chains in the Genus database with same CATH superfamily
3MD9A 1KMNA 4GR5A 3X2SA 2HNAA 3K4HA 3ZWCA 4I1OA 3EVNA 1H2XA 3SYTA 4IOKA 1Z06A 4KREA 1HZJA 4KAAA 2OBFA 3NJRA 3WWPA 2H1LA 5HZMA 2PPLA 4ZCRA 3F90A 2PU7A 1VE5A 4BQQA 1P45A 4JJAA 2AJ8A 2HK6A 3H86A 3PA8A 1Y8QB 1KSJA 3GCDA 1BO6A 4EGJA 2GSDA 2I7TA 1J5EB 1N6RA 3NOQA 4IXTA 3RI3A 4DWWA 1JWAB 1L5LA 3V9PA 4NZPA 2DWUA 2OBBA 3M9LA 4MV6A 3UKDA 9ABPA 5DBEX 1KJZA 3JR3A 3N07A 4BN4A 5DSXA 2XF8A 4GMHA 4R0VA 2ET6A 4QDJA 5IJAA 1G2OA 4DSNA 5EJFA 3H1FA 2PCLA 2R4UA 3DBLA 1JXMA 5LUBA 4KP7A 2F3SA 5SYAA 2HCFA 2TYSB 4G0YA 1DI0A 1U11A 2NV6A 1WB5A 1JBEA 4D4LA 3WDKA 1YL6A 5LDGA 4P36A 1XLUA 2AI2A 4UMVA 2Z6UA 2FN9A 3P45A 4QYXA 1A77A 1IN4A 3FSGA 4UPDA 5I9NA 2AUMA 2EG5A 2J6HA 3M6FA 4IJ5A 1DKMA 3B8HA 5D51S 1N4AA 3R7NA 1MIHA 1CEQA 1KDTA 1EPUA 2C3UA 1CFJA 2DFKB 2FFJA 3QE0A 3SKXA 3ESAA 4ZU6X 4F11A 5GTDA 1EFTA 1XEXB 2O2JA 3TDKA 3AEYA 1A7AA 3HGQA 4B6GA 1E9SA 3THYA 2DPGA 4C7JA 1E9AA 3FUCA 5K0NA 3T7KA 4A6EA 4QUIA 5JPIA 1VOTA 4BKPA 2QBYA 1JT9A 1Y6JA 3ENNA 2PEYA 3G2LA 3OT5A 4JA0A 5KVCA 5CVDA 5JNSA 1C14A 1CV2A 3IVAA 4FGLA 4BNXA 5CBPB 1ZL0A 2RH8A 1XUOA 2ZBDA 5FA6A 4FDLA 1MH1A 2Q4OA 4I4NA 3ED1A 3QITA 4AO6A 3WP1B 4KIUA 4CZ2A 3ZHVA 2XQJA 1I80A 1MO2A 1RYEA 4ETNA 4FHFA 4Q7MB 3RTDA 2O0LA 5BRNA 4KG7A 1LBEA 1ZN7A 1NG1A 3KU1A 4GSLA 3WL5A 4DY6A 1LI7A 2NN3C 2H9AA 4QUAA 3BGOS 2FPRA 4TL7A 5DV9A 3RBVA 1C7QA 1JDBC 1NP6A 1Z34A 3GXBA 3O83A 5EE1A 5G4KA 3T95A 2YQZA 1Y6QA 4KRGA 5KYUB 3RK0A 4MLZA 4QPCA 3VYWA 2GM3A 5DYYA 4CUZA 4TM8A 4MKGA 1M76A 3IQIX 5DEOA 1MO6A 4BVFA 3FVRA 3PNOA 4U2GA 1XNRB 1KQ3A 3KLPX 4C30A 2YINC 3TQSA 4LOLA 3TYXA 2DSNA 4GPZA 4HYTA 4OL0A 3H87A 2WFMA 3ST7A 5BXQC 2OORC 4RKYA 1MNQA 1WQ1R 2P11A 1SCAA 3C3BA 3LFUA 2DLCX 5GM2A 2OYCA 5DULA 1NVFA 4LYDA 2O3UA 4RIFA 4X1YB 4LYHA 1IMOA 1KSGA 1OTHA 5I7HA 5E6SB 2I8AA 2UVQA 4ARAA 3KBBA 1KQPA 5E9WA 4RTOA 1IDOA 1M7GA 2BYTA 2R8ZA 5EOVA 1BDHA 2ERYA 3U26A 1DRJA 3ELWA 3AUSA 2JA2A 3TQCA 3OZUA 1X1AA 3KKQA 3ILXA 4Q4HA 3BD9A 2ZR0A 1ND5A 2FW6A 1ZSNA 2WV7A 4L76A 2NO1A 1F6BA 2BFCB 4NCJA 1D2AA 1GAJA 1UWVA 1BTOA 3K8QA 3NIWA 3SI7A 1OZAA 1E6WA 3SN6A 5JDCA 3CUEF 4GM0A 4ZT7A 5D86A 3E2PA 1PJ8A 2R6HA 2B2NA 3HCEA 3O5AA 1C9JA 4DLBA 1ZS9A 5HCUA 3HSKA 2RH9B 4FZ3A 5TPWA 5AVWA 5AOBA 5FPTA 1BKSB 1VE1A 1CT9A 1NM5A 3A1NA 4LKOA 2BSAA 4KR7A 1NULA 4FYWA 3BWDD 3EMDA 4HG2A 4DKJA 3KXPA 4P4GA 2XKJE 2IHNA 2REQB 2VF4X 2JASA 5DHFA 1RBQA 3VOSA 4L1KA 3NBYC 1E2DA 4PWYA 5ECGC 2VSXA 3EGVA 5DISB 2C4WA 1LPBB 1I2CA 5EPUA 1HT3A 1V8OA 4CM9D 5JNRA 2B83A 4JK3A 4K9QA 1QH0A 3LI2A 4PLWA 4R31A 4GL2A 1GGKA 2CY0A 4JJIA 1IG0A 2J0UA 3L6BA 2FWRA 2P3QA 3EA4A 1YJQA 3K8YA 3N0RA 4K7JA 4DHEA 4QRHA 1GZHB 3OE1A 4LOJA 4UMEA 4BNZA 1Y8ZA 2X40A 2IVFA 4Z9BA 2PZAA 2BY4A 3GIWA 4JASB 3K0AA 3RDPA 1XK6A 5K8CA 1I7SB 5FI3A 2Q2WA 2Q4TA 1EA5A 2X42A 4J6FA 4WLEA 1BDBA 3S8EA 1VHTA 4M9ZA 1YRBA 3GNTA 4Q9HA 3NR2A 3DLIA 3SPXA 4N0DA 1A4XA 2Q3EA 4H1HA 4QVGA 1XTBA 3ZVLA 4BGEA 1LSSA 5JY1A 2NVUB 3TZ6A 1TIPA 3ZE2B 3HRIA 1DAGA 3Q98A 3GVXA 2DPLA 3D7LA 1ECPA 2IUEA 1K5GA 1CP2A 1OFVA 2MYNA 4UKDA 1AKEA 1QG2A 3K5PA 3VPCA 3ASYA 3DS8A 4TYMA 2HK8A 4QDXA 4J0KA 4Y30A 3QKWA 4KWCA 2PLWA 2AE1A 2XGOA 3KVRA 3C8MA 4P5EA 1ZSYA 4LOHA 5AW9A 3D8TA 1M67A 3I6MA 4FDUA 2H6EA 4O4HF 1DZ3A 1Y8RB 4A6DA 1KI6A 3H7AA 4ND7A 2OCLA 4UAVA 2H5EA 5CX1B 3GRYA 3IAM1 1J7JA 2FXVA 4LCEA 1XZCA 4NI5A 1PV2A 1JVNA 1LU9A 3E7DA 1C4XA 3IOMA 3ILHA 3R8XA 4YLYA 3NHFA 2KPOA 2FN7A 4PZUA 4NX2A 3SJAA 5BR8B 4RPHA 2AEFA 2XVYA 4EYGA 1DO0A 4ZGGA 5M04A 3IBYA 3ZVKA 4HB4A 3WFJA 1Z12A 3H2JA 3WDSA 1AKRA 2RGXA 4QOGA 3WLTA 4RVDA 4JEUA 2GTPA 4C0WA 2QI9C 4P4NA 4P0PB 2CLIB 5REQB 3WYCA 2ILTA 2O50A 4IWNA 3LUBA 3OX4A 4RHCA 2IHTA 4TMFA 2XDWA 5E3JA 3ZWYA 1KEVA 2CSUA 1KXZA 2QT1A 4BQPA 3QELB 3BEOA 4G8DA 4HGZA 2JJ1A 4U5QA 5L9AA 4COKA 5B1YA 4FYXA 1Z07A 4YYEA 1TPYA 5B7PA 1DE0A 4JLBA 1WPQA 1X7HA 9MHTA 1TU0A 1WB4A 4INZA 1DP4A 2C5GA 3EQ6A 2WU0A 3KHTA 4N7BA 3F97A 3OZRA 3UVEA 4A82A 2MYUA 1M0SA 1ZIPA 4TWZA 5KJ1A 4UUBA 4F3NA 3T15A 4G1MB 1ADBA 2VG8A 3UXYA 3LP6A 3PD0A 1YC2A 4AZSA 5HYVA 1G8KA 2X5JO 4FTWA 1SUIA 2GCIA 1W1WA 4Z99A 2X7XA 4UUMA 1INLA 2BLLA 1FL9A 1TM4E 3OQIB 4Q3NA 2XR1A 3LIIA 1H1DA 2O59A 3HLTA 1TZBA 1V3TA 5C34B 3BIJA 4YRRA 4F04A 1WCYA 2WUVA 1G0OA 3LC0A 1TFUA 4BP9A 2JLUA 2WWRA 1BYIA 2AG1A 3DHNA 3FOWA 2WA1A 3DEHA 3RVPA 4J0JA 4KE8A 2J07A 4U0KA 5HW0A 4FOOA 4B2LA 3WLQA 2DU8A 2GN9A 2PXCA 4YJ3F 4UTNA 3V4LA 4C88A 2PGIA 3RC9A 3MFYA 1EGQA 1C50A 3VJMA 4CKBA 5FKJA 4JV5B 1V6CA 2QPAA 5LXTA 5IVPA 2RHCA 3QWAA 1IHOA 4EW6A 4BGDA 3T1HB 1RCTE 4GIBA 4OYYA 3ZW9A 4OLFA 4IQ4A 4OXIA 2YZMA 3KLNA 4G8BA 2NU8A 5LC1A 5F7JA 2ZBFA 1P74A 2Y1DA 1XZJA 3DGFC 5BSTA 1SG9A 3OD1A 2A9JA 2PUHA 4G8JA 4A0FA 5GV7A 3MTJA 4HAZA 1II0A 5JSZA 4HEA6 1ZRMA 4LA4A 5AI0A 5IWAB 1YJ8A 4KAXA 1XFAA 3TBKA 4QDKA 3KD3A 1QFXA 3Q8KA 1NASA 1UBEA 3I5AA 3B5JA 2H5JA 3NIDB 3WIBA 4DCUA 2Z5GA 1SZDA 1PNRA 3HJNA 5DT9A 4A73A 2JHGA 4QVKA 3KELA 1NUUA 4RZXA 4ZQGA 3UMRA 4P7FA 4YLEA 4XYLA 2ETVA 2DVMA 2O0KA 1QGED 3RG8A 5ETJA 3QV2A 3NUZA 4ZODA 3R5SA 2X4IA 4TVBA 3PJGA 3DZKA 3EDQA 3FPCA 3ZHBA 1T4CB 4BZPA 2EXXA 2ZRBA 4M1ZA 5KCMA 1GKUB 3BXFA 1T0JB 2EGHA 4GOJA 2AG8A 3WYBA 2B1GA 3D7KA 3GROA 3AHDA 3L7MA 3ZBUA 2JGEA 4AK9A 3ADPA 2XYQA 1Y80A 1SPXA 1Y7TA 1Z5UA 1JEAA 1EXNA 3HU1A 3KFVA 4MWTA 2GJ9A 2O6HA 1LV8A 5DZSA 1Z33A 2EERA 1SZPA 2IZ7A 1A9XA 2HNKA 1X7WA 2AN9A 3FSGD 4KJXA 4LRWA 1PTJC 3IIIA 3NALA 4G24A 4U3JA 1U7XA 4EFKA 4KXUA 1R0LA 3BVPA 3PIDA 1BC5A 3D0RA 4FFMA 5JQGF 4RFVA 4CLOA 1T43A 2EX1A 4OUKX 3FPKA 2J48A 2JAUA 4MVXA 5DYNA 2W2NA 2W2KA 2XA2A 4IDCA 4Q9IA 4AZ3B 5TGZA 4D8YA 3F73A 2B4YA 4D9FA 1GFWA 3QWIA 3P97A 4MVJF 4UOEA 1QBGA 2GEVA 4PPNA 3AVOA 2E5WA 5EIWA 3T12A 5HHTA 4DB4A 2UXBB 3BE8A 1XMPA 4UVDA 1P1FA 1I10A 2W6MA 1RD4A 3M6VA 5TNXA 1RM0A 4LMRA 3IPYA 1L7OA 4GRDA 4B9EA 1BDIA 1Z7YA 1N57A 1QCDA 1CNEA 1HYQA 3JD4A 4YWJA 2EOAA 1VECA 4NBVA 2VDKB 3I6BA 3M81A 2DUWA 1L0BA 1ZJJA 2ESRA 2OP0A 4IXNA 4PZLA 3ZGVA 4EUSA 3U4GA 3B2QA 3P5SA 2DGDA 3EVFA 3LC7O 3FRHA 3N9IA 1KK0A 1M6VA 2H7YA 2K2WA 5A6VA 1R6XA 2Y05A 2YN4A 4I5EA 2JARA 3C5HA 3BJMA 1BROA 2QNBA 5BQ3A 2FR1A 2WJJA 1F8YA 3WYEA 1L9XA 1RRMA 1TA0A 1OQAA 3QUAA 5CNJA 1KJ9A 3TQFA 2HEIA 1NG9A 4IILA 4FNMA 4I4TF 4XCXA 1I01A 1Y9ZA 2G80A 1P1IA 3JARB 4B3SB 4ZYTA 5FLEX 3PJDA 5AVKA 4EPWA 3UAGA 3NX4A 3NHYA 2P75A 4DYDA 4LEIA 4JAVC 4DARA 1OAOC 1DTWA 1QPGA 2FYTA 1TO2E 5E3IA 1KTIA 2PUTA 4XTCS 4F2WA 3LMKA 1KI9A 2OD2A 4AKEA 1KVQA 3DE0X 2G8NA 2P79A 2EV9A 4FI3C 3NU1A 1GUZA 4WNYA 4D79A 1VP9A 4RV4A 2PKQP 3S2IA 5C35A 5JS8A 1L5RA 2BI7A 3E81A 2OG1A 3CH7A 3EVAA 3G17A 1P75A 3WWZA 4GXNA 4KLNA 4RSMA 1HNXB 1FU7A 2GRUA 3KPJA 3L8HA 2EHJA 1IWBB 4R2HA 3AIOA 1DKNA 2I3DA 5BUZA 2ZCUA 3GGOA 4FIZA 3WGKA 3ZV6A 2COEA 5CAEB 4ZO4A 1MB4A 4D9KA 4LOKA 4G5QA 2WHQA 4NK4A 5FWXA 2FW9A 3VBCA 1QYRA 3BL5A 3NOOA 3JZDA 5AT1A 4KQHA 3TVTA 3JSAA 3CZ5A 3RU3A 1KDRA 4HQ6A 3ZTYA 1MB2A 2X1VA 2CF5A 5KOHA 1KRWA 4MJ7A 3EHEA 2GZRA 5ALSA 3WY9A 2DP4E 3IEVA 1NUHA 1YHNA 3IO5A 5JROA 1XTZA 3BXGA 1RRKA 3MJSA 5D6OA 4Z9FA 3CVXA 4KXFB 4M9UA 5I9LA 5G1NA 1EHYA 4R1UA 3BWVA 4C7VA 1H8EA 1U0LA 3PC8A 4HEQA 2RH5A 2X0RA 2Z57A 2JI9A 3K31A 1KDYA 3BREA 1BS2A 1CPYA 2L82A 2Q49A 3KSMA 5ITWA 3C4VA 4PLYA 4D5EA 2UYCA 1Q0LA 2NUTB 4I2NA 4JITA 2Q29A 2VAMA 5DYTA 4NEQA 5A62A 5HM6A 3T9BA 2I0FA 2IL1A 3N2GB 4F7WA 1OB5A 1EFDN 3MLEA 5BYBA 4J1TC 4ALLA 2HPZA 5GADl 4D42A 1TVEA 5SYMA 5BYKA 3I92A 4WFJA 3UT6A 3EDRA 4GP9A 2QD2A 4H4EA 3VSEA 3TFOA 3HZRA 3OKFA 1CUHA 1NW8A 3UO8B 3GAFA 4GNRA 4Q47A 1JTEA 1E7MA 2I4OA 4EJ0A 3O0DA 3ICEA 4B80A 1OIVA 3ENKA 3L0YA 4QD3A 3ZDAA 3LW7A 2XYPA 5C5EA 3GJSA 3I12A 2EZ8A 2IEYA 3GL9A 1CERA 1GPDG 3DO5A 2C4MA 2QWXA 1AB5A 3GLRA 3INGA 4LV5B 5JJKA 1EM8B 1QRAA 3BE5A 5BVHB 3LUKA 2PKRA 1J8MF 3SXJA 3GDOA 4NCAA 1BS1A 5CDSA 1FXUA 3L4KA 4EI7A 3BGVA 3KLBA 1X80B 2H4YA 2H07A 5IARA 5JO9A 5BOVA 3AP3A 7ABPA 3K3PA 2FZCA 2FUG6 3A28A 4B3RB 2OENG 4LXTA 2DBQA 1HMYA 2BGMA 3O9VA 1JE1A 4PINA 3H97A 1SHKA 2OZEA 2WYUA 1GGMA 4EIWA 5F1PA 1TLTA 2W6OA 2NAPA 3UIEA 3LUCA 2Z2KA 4FW9A 3R4CA 1H0SA 1Q50A 2OMEA 1EJ0A 2C4HA 2QZ4A 4GXQA 3ROXA 4CIAA 2CVQA 1KVTA 1PR5A 1Q21A 2OCIA 2QZJA 4PSDA 1R3UA 4NMXB 5IKOA 3R7SA 1ONPA 1XAHA 3PFFA 1P2FA 1PGNA 1W36C 3E8MA 3F5QA 1CQPA 1EQ2A 1QS0A 2O8FA 1KZ6A 3O03A 3SFTA 2XUFA 2AXNA 5GZ1A 2TMKA 2RIPA 3QK7A 4WECA 1FS5A 2EP5A 4F92B 5I4KA 1HF3A 4PU0A 1M33A 3HDTA 3TGLA 2VJYA 3GX1A 5FUWA 1ABBA 1LQTA 2Y0DA 3RTAA 2AFIB 1SURA 2ZG6A 2ZPUA 1ZBDA 1C9NA 1J24A 4WN9A 2GK7A 1L5KA 1DT5A 2RB5A 2HIHA 2YHIA 3N8HA 1S01A 1ISPA 1I13A 3L9XA 4FMDB 3QVMA 2D3WA 1BMQA 2AQHA 1DQZA 4R3UC 1NN1A 3AH8A 2PZJA 3C6YA 3L1JA 3N3BC 4LHWA 4XWKA 1XD2B 4Q39A 4PZEA 1UDWA 2QVLA 2OGTA 3JWGA 4AX4A 2ZUVA 4NS1A 2UDPA 4BV2A 3BEDA 3ZE0B 1YAJA 2CMHA 3HN7A 4PZCA 1XCLA 3WLKX 1VA4A 4Y0VA 1ARZA 1QV7A 3NEJA 3K8ZA 2QRGA 1KYXA 2WBLC 1GQFA 3HB4X 3JRNA 3WBKA 5BMVF 2RG7A 3HKDB 2X7JA 4GC5A 4TLBA 4QXOA 2VT2A 5DBIA 4M87A 1BXKA 2R7LA 2G04A 3ZHXA 3AOGA 3WJAA 1RHUA 2KM1A 2Q45A 3NOXA 5AIAA 2XKBA 3T5PA 4JWTA 1U04A 2R6R1 5LQNA 1JHPA 1TKBA 4AY2A 1JHMA 2ALJA 2FN8A 3AFIA 1I2BA 3BAFA 3ESQA 3GJ5A 4ND4A 3WHKA 1FYDA 4YQFA 5F3WB 2X5OA 4LGVA 4M0MA 4C6HA 4RESA 3GDFA 1KQOA 1O95C 3DDHA 4RTJA 1FIUA 4KGZA 1G63A 1PX2A 1IN7A 2Z0MA 4TT8A 1M34A 4YK7A 3VZSA 2FSGA 5ECDA 4D6PA 2YJNA 3BZBA 3L18A 2Q9CA 5AM5A 4EMBA 3LT0A 3PCXA 4KXMA 2QRVA 4HNAA 1XNJA 3IP7A 2GLTA 2G77B 4FXOA 2D54A 4ZXFA 4WZBA 2AFHE 4GKBA 3L7BA 2ZRAA 1Q2UA 3W04A 3TQQA 2IVZA 4HLNA 4S1WA 3E9EA 5EWLB 1VMAA 2PQ2A 3TLYA 1FFCA 3IKLA 2VNIA 4UXHA 5ALMA 3FX2A 1WBDA 1GRQA 2R6FA 4JH0A 4NBKA 3LPNA 2QLBA 5I7UA 4CLHA 4B84A 1QUFA 2YYAA 3UTDA 3D5QA 2ZDHA 4NH4A 1ULBA 4BZZA 1E2KA 2C7GA 1TEXA 2CLHB 4BO0A 5IH7A 3PEVA 3B89A 1TJ3A 4Z4EA 2EJTA 3IPRA 3AKYA 4GI2A 1P9LA 2XZLA 4Z54A 2A1UA 1A95A 2VATA 4HCJA 2JD1A 3UICA 3OCWA 1NT2A 3FTDA 3KR0A 3IEXA 2I4LA 1R66A 1U3UA 1KAHA 1YL7A 1P2GA 3L0ZA 3CNNA 4O5OA 2OVFA 4F2DA 5BSWA 1MHTA 2ZKLA 1H5QA 1JQDA 4YJGB 2Y6VA 4Z3DA 2O7RA 4AP9A 2BGIA 5FBHA 1RI3A 3DAPA 3ZU5A 3ABOB 5KYGA 4JNKA 5FHRA 1RBYA 2WTMA 3C3PA 2JLCA 3U7RA 4YY3B 4WSOA 5AM2A 1O94A 3RKSA 4A0SA 2GESA 1XE3A 2GJ8A 2JGDA 4ZVMA 2FOLA 2FQWA 3PDWA 4WXMA 3ZKWA 2DETA 4C6SA 3G5UA 4B4VA 2X9VA 3EPHA 3ZY5A 1U2SA 1YNOA 1CJBA 3GH1A 1YT5A 1M66A 3HBJA 3QW4B 2ZRCA 4Y6OA 1GU0A 3T99A 3K6SA 3R7WA 4OQXA 1W8DA 3WAKA 1KY3A 1YB4A 4JI3B 3DWGA 5EP4A 3WK5A 4CLRA 5LLDA 2H7VA 1HZZA 1F2TB 2WDPA 2WHYA 2VS1A 4RDIA 1BVUA 5F1KA 3VGJA 4DA8A 2C54A 3LOQA 4GQBA 2UYYA 1GN8A 5CG2A 1IB0A 1QGYA 2FPKA 4KL8S 2PUJA 2E6UX 3MTEA 3ZDYB 1DV2A 1X8XA 3F7MA 2CHGA 4ZQCB 4JOQA 5A06A 2LNDA 2W83A 3AY7A 3BFJA 4PX9A 1HE5A 1U94A 5K8JB 4DIOA 1CIPA 1Y1RA 3KQQA 5AK6A 1U1EA 4TQAA 4B40A 1FDWA 1ISMA 1SY7A 1T0HB 2J3HA 2AFHB 2J9RA 3QXCA 5AI6A 5EKUA 4BNUA 3HCFA 3EB9A 4MR9A 2YWDA 2ZRKA 1ST3A 3EVGA 3NW9A 5ICCA 1KRHA 3T3HA 2BD0A 4U63A 5B36A 1T0IA 3JQ7B 1F3OA 3LYLA 4EABA 5J1SB 4CKXA 4HZUA 5KWSA 1D5WA 1SC6A 3O3CA 1LY1A 4HAYA 4C06A 2BHLA 1Z7GA 4YPFA 1T5SA 4A3SA 1CEXA 2ZKIA 3ECSA 3JPYA 1EAYA 1F0NA 2P2DA 1B2LA 3KAKA 4O2AB 1SXJA 4LZAA 4MUFA 3LKZA 4LG1A 4QRIA 4AYWA 4EPXA 2ZB7A 2W2QA 4A0HA 4X9XA 3ADBA 5JU6A 1ZD2P 3TTTA 3T1TA 2NO9A 1FQJA 3ZUPA 1XTUA 3DDSA 2WF5A 4W5RA 4MUIA 2OOKA 3WA6A 5EJ4A 2P78A 3GRUA 1JSZA 1NLUA 4N7RA 3ZCRA 4AICA 1JKMA 5CFLA 3QXJA 1K7CA 3FBGA 4H2DA 3BGWA 3EJ6A 5HE9A 4J2TA 2BFBA 1MGPA 1OR8A 2B92A 3VO2A 1KBOA 2J3JA 1X3LA 1RTKA 2FWAA 3DEIA 3LPLA 4RPCA 4CEHA 3D3NA 2JIDA 4AMZA 3QPVA 4XUCA 3FWYA 1L5NA 3DKPA 5CB6A 3Q9LA 2WABA 4ZI7B 1VRWA 1DG3A 1DRWA 1PK9A 3H5VA 1E94E 3IBTA 3K7EA 3NT4A 1RFLA 2ZJOA 3OTGA 3DE5X 3P4XA 3QE4A 3QKSB 1CUFA 4JCCA 4M6WA 1XZAA 4LECA 1E0AA 4YNBA 1G4AE 3B13B 3ZDRA 3MG9A 1GTMA 4Q03A 1GQYA 3MQ4A 4PNPA 2B8TA 3C5WP 3DV2A 4PYKA 3UAOA 2ONYA 3BMCB 1UZMA 4GOOD 3MJHA 1NA5A 1T8YA 3TCNA 1PFVA 3L6OO 5KI6A 4YALA 4R8VA 3R76A 4UBOA 3UFBA 2GPWA 5JY6A 4RELA 1TMGE 1YU6A 3VKHA 4TRMA 3I4LA 1MVNA 2Y8EA 4V0MA 2VQ3A 3N86A 2X86A 3E1KA 3IQWA 1AMUA 4UFNA 1F5SA 4GC9A 4FCTA 1TQ8A 3SBEA 2A3RA 1NSFA 2JA1A 1PZNA 1T8WA 2PQMA 4M0EA 5J63A 5CA0A 1KERA 1R8JA 1W5AA 1ZMBA 4RCZA 4W1RA 2FWNA 5DF1A 2XOEA 4M3NA 3DV0B 5GJVC 1SUSA 2BOVA 1UJ2A 1SJ9A 4NJMB 3R7DA 3TNDA 1SK9A 2ZT8A 2PX0A 2Q9UA 2RC6A 3I5UA 4IDGA 4HPWA 4XIYA 3WRWA 3IEMA 3VX3A 1NVBA 2EF1A 3JVUA 4PQRA 1CIJA 1RJDA 2NU9A 3FSEA 3O2NA 3RS9A 3U80A 4DBVO 1YULA 3SE7A 3QX3A 1QQAA 1KNQA 1YONA 2WNIA 4EJSA 3DE6X 5FOUA 1PNQA 2YFYA 3URMA 5EHNA 2FWMX 1WVMA 3K0CC 3OCCA 4EQ6B 5H8WA 5AKZA 4GX2A 4LXIA 5C32A 5KDDA 4M88A 2UXCB 2C9DA 3PPWA 4URYR 1BG6A 3U3RA 1E1MA 3PPYA 1AXEA 3DBRB 2PKEA 2QRLA 4IJQA 4QPPA 4Y2QA 3E9YA 2MSLA 1AE1A 3Q41A 4ZRMA 1XC7A 1I7LA 3WHLA 1FLVA 4RK5A 4AKSA 4ZCQA 1AKMA 4GBJA 5I7SA 4NY1A 5E6UA 1T6YA 2J3EA 4WGFA 3ZGXA 2Q7DA 1UJBA 4U7WA 1OCEA 2B7LA 2ZB2A 3AMVA 3ILYA 4UHFA 1J1IA 2G76A 2IE0A 1X87A 3O6VA 5EQDA 5TGTA 1EDBA 4D02A 2CJXA 1HM5A 3FUUA 4D98A 3AK4A 4NNPA 2VCEA 2VJOA 4YDRA 3T5TA 3NHSA 4I46A 4XJXA 3T7DA 4ID3A 4CF5A 1VBMA 3EZ7A 1CYDA 2H4WA 4W5NA 2Z5FA 3OLQA 4DPKA 3HA3A 4LJSA 5FJJA 2YJGA 1LF0A 2JFWA 5JD5A 3S68A 4DG9A 2OHGA 3CVYA 3DTTA 4R2JA 1K89A 4K8RB 4KFCA 1QCZA 2G25A 2I3GA 2PTGA 5KSYA 2DHDA 2C3YA 3IOYA 3QE9Y 4P54A 5GGYA 4EA8A 3M6LA 5B4UA 1IUOA 3BA6A 5DK6A 1XRLA 4JB8A 1J70A 1M2WA 1D4OA 3F7TA 3HWSA 4G0PA 3P19A 5F77A 4IHJF 1N1GA 2YOGA 3WLOA 1Y1TA 4LWZA 3V1MA 2N3ZA 1BOOA 1ZI8A 2O1SA 3BF8A 3GFOA 3QMWA 4K9OA 3JSXA 4XI9A 2PZGA 1Q6YA 1NI4A 1Z25A 2IYXA 3WGMA 2DOKA 1WZCA 1E5TA 1UZAA 4D57A 5C51B 5IS2A 1NUTA 1O9HA 1YQDA 3DXXA 4BAZA 2IZ0A 2XGSA 4ZYVA 4EG0A 4TKMA 3MWJA 3O8OA 3JRXA 4KMRA 3RWMB 1A2KC 2RE8A 3QPUA 4YIKA 2Q6KA 1G3RA 4Q5IA 3KEQA 2X8BA 3ORRA 4PXSA 4D81A 2ZB3A 1FP4A 2HDNB 5FOWA 5I8ZA 3AI1A 4BCBA 1ID8A 5BURA 1PSDA 1SUFA 2ZETA 3L0OA 3PITA 1ZJ6A 1OLSA 4GOMD 3VR5A 1FNSA 4CL8A 5ILQA 1KOFA 2V5UA 3K0EA 1NSYA 2YWHA 3HFSA 1BN6A 3QHAA 4NFLA 3V7YA 5JFOA 4ZU1X 4DCVA 2C9MA 4G81A 3KYDA 1LJUA 4Y1RB 1RADA 3IR6A 1KY4A 2VI5A 3A70A 4DWOA 4RZUA 5A03A 4INAA 3ZIAA 1C7IA 2ID8A 1G1MA 4TV9B 1RHRA 1EGMB 2G08A 4BEVA 2V55B 4MHOA 1NF3A 1YRQA 1VIDA 2B7CA 4N7MA 4O2BB 2GEKA 2B5OA 1HE4A 5LQMA 4XARA 1GZ5A 4RIIA 5DBFA 4REOA 5DHQA 4URZR 3MGKA 2JGNA 5HIIA 2WWVD 4B44A 2ZS7A 3D7RA 2IPXA 3GAZA 3PQCA 1UOQA 1Y48E 1C3LA 3KD2A 1W85B 3RVLA 3TNFA 3BIXA 5K3DA 2JAPA 4AIRA 1BA3A 1H0HA 1S0UA 4Z0TA 1BIFA 1R4AA 5ES4B 1BMDA 1EK1A 2I7CA 3E23A 1WHTA 4I55A 5AQEA 3NZEA 1DXHA 4HNRA 1HQDA 4P4UA 4BBPA 4LF5B 2EATA 2CUNA 4AP6A 5CLIA 1P5HA 2O54A 2A9KA 2JCSA 1TZJA 1ZEJA 4PC2A 4U5XA 1ZUHA 1K8ZB 2QVXX 3KEOA 3MT7A 5DYIA 5FPPA 4F6RA 5JVDA 2IXAA 5HP4A 1J1UA 3C24A 5AKYA 3D6TB 3QEOA 1JBQA 4H1TA 2HHAA 4X6LA 3KQLA 3OIDA 4YREA 1O4WA 4ZT4A 4CIWA 4MOWA 4MV3A 3AHCA 3PNVA 4RKQA 5I8PA 3RSLA 4JYBA 5I3CA 2OHFA 3FOEC 4INOA 2ZT7A 3CH6A 3L7IA 1AHPA 2FEXA 5L4LA 1FUUA 1OILA 2WKWA 4ZGWA 2G88A 3A6FA 4RVSA 3BULA 5TMEA 4DMUB 1PFGA 3R3VA 2OTCA 3UK6A 1UPXA 1GAWA 1QNLA 1G3MA 2DPYA 3ABQB 3LK6A 4QBHA 3TLJA 4ETIA 2HDHA 3VOAA 5A3JA 1Q17A 2Z1NA 3GLQA 1HURA 4A92A 2EJCA 4MQMA 4XYBA 3M6AA 2WVHA 5LMZA 2OVBA 2EFGA 3QLEA 1VP3A 3JR7A 4RTQA 3SE0A 2WD7B 3X1YA 4FSDA 2EYQA 1XZKA 4WLUA 5IDYA 3WMEA 4E15A 3ZDDA 1LPSA 1WTAA 3FXAA 1QHXA 1T2NA 1ZA1A 1U0JA 3CW2A 1H4TA 4RF4A 5ANRB 1UBCA 4PGGA 2FHPA 5EXSA 1TMOA 3DMYA 3L4SO 3NIFB 4Y67A 3JQ9C 2FZ4A 2NUAB 3NT2A 3KJEA 2ES4A 3C3AA 4XB2A 5GP1A 4G5FA 3FCEA 5FEMA 1XBTA 3DZHA 3LLUA 2X13A 4O4JA 1SCDA 1U0NA 1OX4B 3GG2A 4FC7A 3P2KA 1ZR4A 3B60A 1G41A 1ORIA 3FWNA 3HJHA 3KJZA 4MVJH 1L3CA 1FCJA 2HHCA 4H3VA 4NBWA 4YDHB 2IOHA 3U7JA 2VSOA 1L5FA 1RQ2A 1O54A 1W4AA 1CUIA 2DTXA 1N2ZA 3CPEA 4K26A 1OXTA 2AZTA 1PJQA 4FUTA 1OD6A 4XGQA 3JALB 4JVOA 2HQSA 1MO5A 4WEOA 1F2UB 4CQLA 4NKRA 4IWYA 1NIJA 3DZIA 4PLVA 4RX1A 5AJVB 4HGYA 3OIFA 3KWMA 1NNI1 1X7XA 2QRKA 3EFOA 4OU4A 2IS4A 2AXPA 1ADFA 3AEQA 4E6PA 4F5ZA 2WYVA 5AHKA 1E4VA 1O89A 3FHCB 3O3OB 4WI1A 3OJFA 1DPFA 2H4XA 1BVRA 1C5KA 1E3SA 2XZPA 3NVMB 3R20A 3EG5A 5KKAA 3UJBA 4RLSA 1XQ1A 1LFAA 4JA2A 1D1TA 4NDAA 2XMCA 1KFCB 4MQ4A 5TVGA 3W8RA 1K3TA 3CRMA 4XQ0A 1ZZEA 1JFVA 2RGCA 3R9XA 2RK6A 1MABB 2QLNA 3P7MA 3ZJVA 1QHYA 1UJ4A 5FWYA 5JAZA 4ZCIA 2HRDA 1VM6A 2O1XA 4PGMA 4ZPJA 4EPYA 4C04A 2ZROA 3BL8A 1S4QA 1K6JA 4QM7A 3R40A 2VQSA 2P4UA 4QBFA 1PJCA 5F3RA 4PG4A 2V6JA 3GLIA 3EPPA 1G16A 4L7QA 2PKCA 4YMHA 2ZE7A 1VI6A 3GFQA 2CYBA 2EKLA 2WHEA 2O5VA 3SLGA 1CB7A 3DOOA 1TZCA 2FN4A 3DHYA 4FDTA 4HR7A 3BMNB 5CT5A 3H9JA 2VJCA 2EW1A 5EYPB 5CEJA 2JLVA 2UZ1A 1TZKA 4XX0A 3E0XA 2REBA 4JQOA 4DIUA 1U0FA 3C3WA 3Q7IA 2W90A 5NULA 3WA7A 3ANYB 3BHJA 5EE9A 4F4HA 3FTQA 4ZV4A 1NR7A 1SHTX 2KB0A 4NYMR 1U63A 4YUVA 5NLLA 1IC6A 4BVJA 1JIXA 3QTBA 2H2IA 4E3ZA 1X8LA 1MC8A 2PMKA 3R5KA 2DQSA 5B3JC 2P0YA 2R00C 2C7OA 3CF2A 4HNGA 1KRXA 1U7OA 2AF4C 5AUOB 3E22B 3E3LA 1HX7A 3EIEA 1SVOA 1EINA 2C9CA 4YJ2F 4P4LA 2ODAA 4QT0A 3ZY3A 2PVPA 3PKIA 5KVAA 1JSRA 3VKGA 1Z6QA 1F60A 2IUTA 4FLFA 1Q7TA 3LSTA 3JD2A 4FDMA 4FT2A 3ZOKA 1QZ3A 5KU7A 2CLEB 3HABA 4Z53A 3SR4A 5CDTA 2C3PA 2QUBA 2Q21A 1X8KA 4I9FA 2NSDA 1G6HA 4NG5A 1ZVVA 2GD0A 4F21A 4JI7B 3Q40A 4DQKA 3C16C 4BFYA 4UE3S 4EEZA 4E51A 5IDWA 2MHCA 1PT8A 1PJLA 2C2BA 4M1KA 4PHTA 4EECA 2N47A 3NDIA 1AQ6A 1NBHA 3Q0EA 4N0MA 3KFXA 1R0ZA 1D0VA 5LYJF 3JATB 2JLZA 2YVAA 1PD0A 1Z0JA 1Z2AA 2EFEB 4AS2A 3MB5A 4XD7A 2QTFA 1MA3A 2GTIA 3ZGYA 1J09A 2FZVA 4TL8A 2Z30A 2O14A 5B7NA 5LU9A 4GAEA 3K0FB 4KK4A 2I4RA 1R8XA 1TQHA 2FG5A 2X9GA 1G21B 2RG1A 3FFXA 4Z9XA 5IJWA 3U4CA 2CUZA 1GGNA 2PX2A 1LRKA 3RRFA 3FAZA 3ZWOA 1T8PA 4PYLA 1H4VB 2NPFA 4GYWA 1G4UR 2A84A 3X1ZA 4I36A 2NP6A 4F5YA 2AR0A 5A3QA 5D2CA 5GOTA 1Q12A 2YWRA 3CA8A 3GT0A 4I14A 4YCNA 2VNAA 3LO8A 3V4SA 3AVWA 2BGJA 4M1MA 4Q4AB 3EZXA 3TS1A 3JASA 4BWVA 3O1HB 5HJ2A 2J3LA 3ED5A 5TV2A 1DTSA 4OB8A 3LCMA 3WICA 1KYTA 4R5MA 2GNAA 2OHIA 1H05A 2H06A 4Q93A 1Z3CA 4OI2A 2XNSA 2VP4A 3B38A 3GWZA 4QU9A 5FADA 5CW2A 1PBTA 2CN1A 3DKKA 4G84A 2NYRA 2OC9A 5DI3A 5A3VA 4D82A 2CXXA 1UEJA 1ZGGA 4KQ1A 1XHLA 4JBNA 1Y89A 4WZAE 4O02B 4QNNA 5AP9A 3VTZA 3K2IA 2PXAA 1GZ3A 3R0XA 5BN3B 3ZJTA 1ATZA 1N7IA 1CZHA 1Q1BA 3ZQ4A 1J2YA 1QFZA 3AVTA 1O6BA 1TVKB 4GKAA 4UBKA 5FOSA 1E7WA 2F3RA 2GZMA 2PGXA 1NV9A 3PQ6A 5C3MA 4MLCA 4N82A 2WM9B 3IUSA 4LXXA 4X7PA 2C5SA 1Z3IX 3BKWA 3IXQA 3Q3IA 4RHYA 1ESDA 2Q4DA 4US2R 3KALA 4GOXA 1VKOA 2J31A 4B1FA 1U2TA 1BFKA 4A2WA 4O63O 2R84A 1CNFA 2OORA 3MM4A 4TYPA 3OO0A 2OK7A 1QHHB 1RXIA 5AJZA 3O4VA 5ALWA 4HFMA 4O25A 2UVDA 4R1SA 1ZD8A 1WUIS 3WQQA 2VOEA 3GNSA 3SDBA 1EDZA 5FRDA 4QTUB 4BQEA 3VAYA 2R48A 4BYGA 3B3AA 5DNVA 4HNVA 2Z2ZA 5TXGA 5JNTA 5JPDA 3AEUB 3RYCB 5BNFA 1T5TA 2QE7A 3KEGA 3O74A 4ZICA 3WTBA 5DW3A 3QFSA 4FVTA 2Z04A 1QRUA 5CJPA 1TW3A 1CK4A 1SCIA 1T3TA 4P83A 1NRIA 4DMLA 4YT8A 2K5UA 4W9MC 2A86A 4O4IF 1C0KA 3I6YA 3RUDA 5KJFA 1MAUA 4ZZ0A 1GRRA 2FFRA 5DSZA 2V0GA 2YJTD 4NHEA 3P9ZA 1N1MA 4G41A 3BBPA 4QVIA 5EWJA 3ZD6A 1LVUA 3SD7A 5B3LA 4J0DA 3SSAA 4YRAA 3RADC 5C8ZA 3I83A 2E18A 2TSYB 2VUTA 3EGCA 3QF4B 4GECA 5IN5A 2GTHA 1N78A 3MPUA 2AOVA 4OJQA 7REQB 2C5HA 3DNFA 1NXSA 1Q7RA 2GERA 4XJSA 1C41A 1H0RA 2B2CA 4OM7A 5KBYA 1HDOA 4P6VF 3O8QB 1CRQA 1L5YA 1MENA 1YOVA 2XE8A 3FF4A 1NQXA 1Z26A 2EQAA 3MTIA 3MWKA 4IDPA 3SZOA 4BNTA 4GVPA 4PRYA 2IH4A 1ZAYA 3GZNB 1WVIA 1RXYA 1XMXA 2VDLB 2X3UA 3FMPB 1SD1A 3FPFA 2X15A 2AOWA 1C9DB 3UHPA 4PEVA 2DBYA 2W58A 3HJRA 4BMYA 5TT0A 4BP1A 4IFIA 1J23A 1Q3TA 3H8JA 1Q22A 4HAVA 2E1PA 3LQRA 4J16A 4AJPA 3S55A 3PSAA 3WGGA 1TCAA 1EWKA 5KSWB 4OQDA 4WZAB 3P9XA 2P69A 4D43A 3WADA 2BCJQ 3EIOA 4UXIA 3DDCA 3WGJA 1I4DD 2HADA 1LPNA 2QF7A 2WNHA 3DBHB 5H68A 1DIRA 2ZBRA 1GSHA 1W47A 2V54A 3ROFA 3RS0A 2PUAA 2H00A 4BQFA 1YB7A 5H1YA 1W36B 1KK1A 3OE4A 3T7AA 1KSHA 2WYOA 4FILA 5IYZA 4HBZA 3D6JA 4P35A 5EINA 5DGIA 1YQWA 1YR1A 1T34A 1OC2A 3QQ5A 5JJ5A 1U1IA 2JCXA 4KRXA 1AXGA 4OLJA 2WVAA 1ZWKA 2C03A 1K1EA 1RQNA 2Z95A 2ADFA 2ZUBA 3UV3A 4KQ9A 4QQKA 3CINA 1KC3A 3IESA 1SN7A 2Q07A 4D4KA 3EDYA 4M99A 4IRUB 4G01B 4OHKA 1IYZA 4OJYA 3VNAA 4BNIA 2OHVA 1CLEA 1N7HA 1WD5A 1Z35A 2G1JA 1XELA 3I4CA 4Q66C 1TD9A 2C4NA 1IVNA 2PJUA 1H2YA 3PENA 5BQOA 4TVOA 4CYMA 4L2IB 5DP2A 1M6WA 1QAQA 3DCNA 4QASA 4XASA 3VXKA 2P6PA 4U1RA 4FM9A 1OFUX 3M7IA 2XPCA 4EVRA 4UCFA 5B58C 2D0DA 3HTXA 5E7IA 2WV9A 3P9KA 1ZK1A 2OGZA 2PT5A 3CX6A 3K9NA 2ZAMA 2HQOA 3ETHA 1QAOA 2C99A 4GW3A 5I45A 5K0GA 4ZAVA 3SHWA 5HQ3A 2XB9A 4CN9A 4WRRA 2B98A 1WS6A 3C6MA 2KJQA 4WOJA 4QSHA 5HUHA 5F7OA 3UG7A 2PRYA 4AJ9A 5AVXA 3CTPA 2FKNA 2A2ZA 3GU3A 2ONZA 4QPNA 4D26A 1V3QE 1ENPA 1NJ2A 2PG3A 3L1IA 1PFUA 1Z74A 1RMTA 3DM5A 1NLYA 4EITA 2ZRHA 1QU3A 4RGBA 2H9YA 2ZIUB 4UMFA 1G6KA 2EC5A 5B1DA 3GJXC 2QG6A 1V8PA 3GEIA 4GLOA 3I9V6 2XF2A 4WERA 3A10A 3PNSA 1U6KA 4O2RA 1MX3A 2IUUA 2F55A 2GT1A 3A7EA 2DKFA 4NCXA 5D01A 3ROGA 1A88A 5AHXA 4LZZA 2O5CA 2OCYC 2Z4TA 3H42B 3B70A 3QU9A 4X7BA 4E7PA 2NUPA 2RHGB 3L8ZA 1ODJA 2B5WA 2I65A 2QJWA 3NHPA 4G4GA 4IF6A 3SGLA 2BE9A 3FUTA 4X61A 2NV2B 1K7YA 4HY3A 1IWPB 3GFBA 1DEAA 4LJ9A 5AKLA 1GAQA 3W9YA 3CUTA 1QGDA 4EA9A 3H5TA 1MOSA 2ZRMA 5TGDA 4WVLA 4DYVA 2GBFA 4HV4A 2BRUA 1WKBA 1LNZA 2I2XB 2R5NA 3NM6B 4OJKA 5HKOA 2J08A 2Q8NA 4LC9A 4NCHA 3WC4A 2Q5EA 4IAOA 4MS1A 3VX4A 4YAKA 3HNOA 3OHMA 2DTEA 1E1RA 3P0FA 4JMLA 4CN8A 5E9AA 2NZXA 1C1XA 5AR1A 4LE0A 3IB6A 4AMUA 4US1R 3FMFA 2D7DA 4X94A 1IY2A 3ZTTA 4LFBB 2GBPA 3G79A 1E2PA 1I6LA 5LIRA 4NC9A 4MYDA 3FB4A 3UW3A 4BIIA 4M0DA 1JLLA 2V3VA 3GD7A 3EQ8A 3T61A 4AJ2A 4CMIA 4CWAA 3DFKA 3JTEA 4KQGA 3PU6A 4L5AA 1VPWA 1HNZB 2BKAA 4CM1A 4PIPA 4XOUA 4DCNA 5C3UA 3SXPA 1A5AB 1MO3A 2XYRA 4TS1A 1SBIA 4ENWA 1H94A 4PC1A 2ZCJA 1DKPA 2XVAA 4YO8A 2DWCA 3AVQA 4ZALA 3RJZA 1ZOPA 2ZDGA 3DCJA 3O1IC 2G3YA 4JELA 3ZWDA 5H81A 2OZVA 2WUDA 2EWMA 2OZLB 3QI7A 5B4TA 2IP1A 4G26A 3AOEC 5C9ZA 1JYEA 1S3SA 2JF0A 4FOTA 1EXWA 1X2EA 4RADA 4WJLA 4RMNA 2JLBA 2E49A 2WAOA 1N3IA 3E48A 4QHSA 1RZUA 3ECCA 2DFTA 2FPMA 3K5WA 4GS5A 4D3FA 3W7BA 4ZTUB 1N6IA 3R7AA 1ULTA 1BE0A 2HN9A 3Q11A 3TDMA 4DDUA 1TKCA 2G71A 1AG9A 4MSUA 3TZLA 3ZVRA 3JVEA 5IW8A 1ISIA 4WA7A 4CIVA 2PE5A 4B81A 2B6NA 3AW8A 3IERA 4N5HX 4BAGA 4PCUA 4JGGA 3UKOA 3SU8A 2PZMA 2J6CA 5CB4B 5KS2A 1QUEA 4G0VA 4GEGA 4CKEA 3LCVB 1XALA 5LA6B 1R0BA 2X1MA 1JKIA 4TKZA 5JSQA 1SCUA 5GQSA 5GY7A 1ZD9A 1ACLA 2JCYA 2BGNA 4NYMQ 3AGPA 3ZY6A 1FUKA 3GEMA 3O2JA 1CFZA 2G8LA 1XKQA 2VUSA 2FQXA 5CA1B 2C9ZA 2HA5A 3FTNA 2BCEA 3CLUC 4UU7A 1CETA 2QTMA 3BH6A 3T0FA 2XZTA 4ZOAA 2DFDA 3I3SR 1KK2A 2QM7A 1P4AA 4U0JA 3GA0A 3QU5A 1TMYA 3FF1A 3QFCA 2VUUA 2UUCB 3WNBA 2JHPA 3QNUA 1J6UA 1JAZA 4A7PA 5IJ9A 3EFHA 1G9SA 4ENTA 2IH2A 1H5UA 3H5WA 5CFZA 4ZGBA 3U6BA 2GI4A 2YICA 3QUBA 2RHOA 4J0FA 2L19A 1G0NA 3R6TA 5JCOA 4CDNA 5B6IA 3QENA 1Y1KE 3IB3A 1OW3B 4O4LF 5CD1A 2VZ8A 5CCDA 2XMSA 3KTOA 4RZ3A 3SEFA 4BNGA 2GWHA 1YB2A 2X4GA 3LLVA 3DMTC 4BUCA 4G1CA 2PS0A 1T24A 4WOCA 3TI9A 2I87A 4BNVA 5ARBA 1FU8A 3BE6A 5CLHA 1PJ3A 4CEJA 3HUDA 1F7VA 3DHEA 3V8RA 1TAGA 3BSSA 2EQ5A 4JDUA 2BFOA 4HEA1 2HHLA 4OQNA 4PRKA 3E9RA 3VZQA 4BC0A 4TTSA 3SHOA 3W2GA 5HKAA 1VJCA 3I32A 4H27A 3K1TA 3OMXA 5FT9A 4CV0A 5IBPA 2WD8A 4F3YA 1KZHA 1R8SA 4BKMA 3GC6A 2NYAA 4NH0A 5EZSA 2FG7C 1S2IA 1HY3A 1YL5A 2OGSA 5COBA 3S6JA 4K9DA 1WETA 4IHQA 2XHEA 3ZD7A 3G0DA 4F86A 1PJ4A 3TTXA 1X15A 1L4FA 2GK6A 1KJJA 2P9TA 4X3CA 2NZYA 4AJKA 5JJIA 4M2LA 5JHHB 1OXVA 2QE7D 4JGBA 1G9TA 2V1UA 1CE8B 2ZBVA 2WWGA 4KPFC 1JRLA 3LE8A 4RLQA 4OGLA 3AYZB 1A4UA 3WL7A 1TYEB 5CG1A 4DAEA 3STHA 1R9NA 1DL5A 3QBDA 2OV2A 2XDYA 1XU7A 2JLWA 4X3PA 3QUTA 3L77A 1L7QA 3PL5A 2NACA 3MOIA 5C4MA 1AMOA 1Z5OA 2EARA 3B1ZA 2F17A 4D74A 4HD8A 1JEQA 2OD7A 4XWOA 5TPZA 2W8BB 3TTYA 1I7PA 1BNCA 2CNWA 3B7GA 4WCVA 2GAFA 5L7TA 3THOA 1J25A 3QLTA 2IUFA 4CTNA 4DJ5X 1CZLA 3H1EA 2VDNB 2VRNA 1W76A 4XAQA 2F3QA 2GWRA 4JKIA 3TJRA 3CUWA 2J9FB 1O2DA 3F5DA 4G5XA 3FNHA 4PZDA 3K5IA 1DLJA 3IDFA 5AHRA 2W43A 2OOSA 2YYSA 3FUVA 1DU4A 3SDZA 3AEXA 2OUKA 1E3WA 3AXTA 4F1JA 1Z6AA 3GB9A 1HSZA 2AOUB 4O1IA 1EA7A 3PTAA 1KFJB 4CR7A 2JBHA 4RDXA 2CNDA 4C21A 4LXUA 1DXYA 2XUGA 4QOEA 4C4XA 1DKRA 2J33A 3VDRA 3BICA 5IM5A 4TT3D 1HFKA 2BPOA 2AVDA 4FFWA 4J3JA 1NUQA 2O5RA 3P0EA 2GF0A 1XSEA 3RBXA 3RRNA 5KYKA 2MINA 4K6MA 4KYVA 4QUHA 1E2LA 1EWQA 1SBNE 3OESA 1VJDA 3QG5A 2OA0A 4HDRB 1SC9A 4RQAA 2OO5A 1M1YE 3S2ZA 4C87A 5CEEA 4KLZA 4NXNB 3AHJA 3NTUA 3B1JA 5CK4A 4HDSB 1P8JA 4JUDX 3V00A 4BUZA 1KHTA 2RAPA 3OLWA 5CT4A 3RS8A 2Y4NA 2BHNA 1RYMA 1XYYA 4MUEA 2HWXA 5K51A 5KJEA 1MOPA 4BFTA 1IJKA 3PVSA 1VL5A 3JZMA 5CH3A 4R3NA 2Y92A 1APBA 4UNIA 1LDNA 1S9HA 4MRPA 1JEEA 1G8YA 4N9WA 5HFAA 2R65A 1FQOA 3R6WA 1A5BB 1M5UA 3AX6A 4P0QB 1FZTA 2OILA 1KYQA 3LZCA 2PFGA 4B8WA 1WUTA 3R5JA 3RS3A 2H2WA 1Z8FA 2DCUA 2AYZA 4FX5A 4OEHA 3UMGA 2QQFA 1OLOA 5JCJA 4OQEA 3ZGLA 1B76A 3WLEA 1NNSA 3SVLA 1RXCA 1OASA 4ZDKA 5J2UB 1E1QA 1M2VA 1LJ8A 1P3Y1 1E1CA 2V7VA 3LHKA 3FR7A 1ZP6A 4KK3A 5ES3A 4QC2A 4AW9A 4F8JA 3VNUA 3DH0A 2WTUA 1G2QA 1FTYA 3D8SA 1AURA 5KC8A 3PEYA 1NYLA 4ER5A 3KP1A 5TRTA 3JRWA 2RKBA 4JBHA 2YX1A 1GUBA 5ED4A 3OI7A 3ONVA 3EGXA 1KXJA 1NY5A 5DHAA 3B8EA 3EG9B 3Q9SA 4Z8XA 2ZVPX 4V02A 4GZLA 4N5IX 3DZ8A 4ZZIA 3PWTA 1XPJA 2XOXA 2F48A 4RPLA 3TIXB 3CCFA 1EUZA 1I5RA 2GS9A 2QUKA 3ANSA 3DPIA 3H2SA 3KJIA 2PRSA 2ZUDA 4Y6PA 2HPVA 2WMNB 3D64A 1GU1A 3IFSA 1CSEE 4MV1A 3EISA 4PGAA 1KJ8A 5JNWA 3IT1A 1DUVG 4FX2A 4NS4A 1U28C 2D59A 4MTCA 3VSAA 1M7BA 2YJ4A 5TR9A 2ZZMA 3VR1A 2AX4A 2Q4RA 3SSNA 4Y2SA 2HTFA 3ESRA 4G09A 3IGFA 5L40A 4YRTA 4QZVA 2XQGA 3OOSA 4MICA 1VYVA 2EF0A 4ER3A 4KVZA 5FNVB 3DCYA 4S1OA 1JR2A 4WCFC 4ITVA 4QJ5A 3FOCA 3NP9A 1GL9B 2ZYHA 3VNBA 1MQ8B 3A1TA 3UN1A 4I50F 4R2KA 4ZCSA 3RHSA 4DGSA 4KYUA 4TV8F 5GONF 1T5HX 4N40A 1MUUA 4G85A 1T2AA 1NQTA 1YDWA 2BT4A 4IIUA 2EWVA 3E9ZA 2X0FA 5JZSA 1AKTA 2V0NA 2E48A 1W25A 3A1VA 3T4UA 4TMYA 4GYKA 4LOIA 1JG7A 4XDZA 4BDSA 2H4JA 3FBTA 5LP6A 5CH5A 3JPWA 3N2IA 5PGMA 4CCYB 2HQBA 2JJ2A 3ICOA 5K3EA 2C78A 3ORQA 2IYTA 2KBFA 4XPIA 3LT1A 4RTMA 4FFVA 4CMGA 1D3AA 2A30A 2FUG1 3CF4G 4GUAA 4KBGA 4GPTA 1Q11A 4MAAA 4ZVOA 2QGZA 1JBKA 2OV1A 3B2NA 4NPHA 4EB6B 1BZYA 1N34B 3L3BA 1L1QA 3A4LA 3VO9A 3DLAA 1IDN1 1WTCA 1DT3A 1QGAA 4D8VA 1G291 1E6CA 3K20A 4KO8A 1KJYA 4OI4A 4UM7A 3H6GA 4UUAA 1RMYA 2Z8ZA 2OY0A 3L8CA 4RHXA 2BLNA 1NW4A 1Z62A 4O0MA 1W0JA 3ZZNA 4D0SA 3E9CA 3SYKA 2RI0A 3ON5A 5IG2A 5C31A 1OFTA 1TLFA 1N2OA 3AR7A 3IUBA 3NT5A 4LVCA 4ZXPA 5AW5A 3HC7A 1C8LA 4WJZA 2VN8A 2KHZA 4RL4A 5LJIA 1JVSA 2VJAA 3OCZA 5EJAA 2AYXA 3PHHA 4LMPA 3PVZA 1CDOA 4IQFA 4PCAA 3VPHA 2PLRA 1SQ0A 2NXWA 3IP1A 2ZS8A 4EG6A 1NRWA 2ISCA 4JKYA 1GL3A 5IHPA 1RYFA 3AETB 2Y9MB 5LR6A 1XZPA 1BMFD 4NJEA 4UXJA 1PDWA 3V7FA 3AINA 4CIBA 3H9EO 1CBUA 2JZNA 3A7DA 5IUJC 2N42A 2ZS9A 4QUKA 4FC6A 3KEFA 4R16A 4PZAA 1PYDA 3PHLA 2RHTA 2C57A 2BFAA 1XEAA 2ZRPA 3BERA 2CVFA 1VJ0A 1ELOA 3SIRA 1N5KA 4S12A 4TL9A 1BCSB 3OEYA 1BQ4A 3DO6A 4JLSA 1YIOA 2ZWAA 3PE6A 3FCYA 1VG0B 4CGZA 1JR3E 5EWMB 1NZJA 1P72A 3HCBA 3REQB 4TVKA 4HVAA 5E1MA 4WK2B 1E9EA 3OF3A 1PYOA 3DEYX 3NUGA 4KFUA 2OFOA 1W52X 3QGMA 3GYGA 4KE6A 4DR5B 2I2AA 1JV2B 3EIFA 4P22A 4I1PA 4XWAA 1KO8A 4FN5A 2IEBA 4L4YA 2M6KA 4Z7NB 4CNBA 3UMCA 2YKGA 5E4TA 3WWYA 2GLXA 4LF4B 1KGSA 5IDQA 1PWZA 3LPAA 5EIOA 1EVEA 1JQJC 5T67A 1QZUA 4JU9A 4CL0A 2EEZA 3OMWA 1XEXA 1RCUA 4DXAA 2BHSA 4F3RA 2WD9A 2RAFA 3B52X 3F0TA 2D0OB 4KC0A 1RAFA 5AJUA 4UDXX 4RJTA 4YUXA 1E9BA 2FRXA 2Y1WA 2B36A 3HV2A 1D2HA 2AWOA 1FFAA 1QB7A 3GPDG 4KOEC 2ZVJA 1B8PA 3OLCX 3T7JA 5AUQA 4YAUA 4MA5A 1EXDA 2VAXA 1NX6A 4YAFA 1AO0A 1Y1SA 3FNBA 3HZHA 5JAUA 3O84A 2RC5A 1NVWQ 3GFSA 2C8VA 3ZE8A 4LJYA 3FFWA 1J5XA 1YB6A 2X2PA 1PJ2A 5JECA 5GZ6A 4ANFA 2VQFB 4Z1OA 1QYDA 1JJFA 4N76A 4LJ7A 3F1KA 1PR4A 1XQWA 3M5DA 4KPGA 2C7RA 2CGEA 2FP4B 5FYDA 3RYIA 1T8UA 4PHCA 1QZZA 1FBTA 1YS6A 5KSOA 2VP5A 1X8JA 3MJDA 2NLOA 2OV8A 3O4FA 1I94B 1YH3A 3K2BA 4IIVA 3RYTC 5BOSA 1V35A 3JQGB 2KSQA 2D8MA 4BZQA 2HLHA 3W8DA 1YQEA 1B23P 4BDTA 2A5YB 2WWFA 1V16B 3BTVA 3KO8A 5BNZA 3M3HA 2VHEA 2B61A 2JIRA 4HUTA 2CJYA 3HA2A 1L1FA 4A5OA 1M6HA 3BXZA 3Q12A 1XTKA 3FWKA 5AVVA 2QSJA 3DBVO 1GLGA 1Q0HA 2QX7A 2PH5A 3C6BA 4RD2A 3FROA 4XIJA 3VR2A 4DUGA 4ZIRA 1KU0A 4DFDA 2NU6B 5LMUB 1JB9A 3LVRE 4MEJA 4ADSG 2WRZA 2VO1A 4WKGA 5AW4A 1Y3CE 3G9XA 4DSTA 5A9SA 1KZ1A 3CONA 4GPEA 3I01M 2FR0A 4IIBA 1IU9A 1RLJA 2YHBA 3FLMA 1HDZA 1ZIXA 4P93A 3GLHB 3UK7A 1S5PA 4BLQA 3PC4A 3NPAA 5MF6A 3HFGA 4AJOA 2EBHX 3ND8A 5EIBC 3TBFA 1KQGA 1N2CE 3AZPA 4G9BA 4MI6A 4DEVA 3QX9A 1RQPA 2F1IA 5IHXA 2Y9PB 3N53A 1VZ3A 2V7GA 3OEHD 3S5UA 4FB4A 3Q5EA 4PLPA 2Q3LA 1R6TA 1YR7A 1QAMA 3A2MA 2VPQA 1KDVA 4DA9A 3O8DA 2XCLA 2XSZD 1E62A 2IPOA 4P7GA 4EMSA 2WM2A 3I9FA 2DG2A 2FOXA 2V5AA 4FZRA 3SKYA 2DT8A 3N5CA 2REQA 4Y6GB 3LY5A 1HBJA 2ZUEA 1I1HA 3LA6A 3FTEA 1I9CA 1XVVA 4LJRA 4OAOA 5FR1A 3N7UA 4IIFA 1LK7A 4IZHA 3TW0A 1WDWB 1HK7A 4A1FA 4BB9A 2CHUA 1TPZA 3I28A 3SJ7A 1NC3A 1MD9A 2EG9A 3BJZA 2A0WA 2IP4A 3DP9A 4QU8A 4V3CA 5IX8A 5JRZA 1AMNA 1GG8A 5JWOA 3H0EA 3ZE1B 1G17A 2BE7A 3V4OA 4JY7A 3P9RA 3PGA1 2BZ1A 1V37A 1KO7A 4D96A 3HKBA 3UMJA 1W19A 3ZI4A 2YCBA 5EP2A 3C98A 1YZLA 4DZZA 4EI8A 4Z7JA 1FA9A 5BSUA 5A1JA 2IELA 4OHZA 2D3TA 3OU7A 2JJYA 4X60A 1GSIA 2Z2JA 1SOMA 2NTJA 4BC1A 5IPFA 5J2TA 2XE7A 5FUVA 5EP1A 4QGAA 4TKUB 5JW6A 4YJFA 1TT7A 3TIFA 5ARDA 1WSBA 3LPDA 1BE1A 2C4UA 3EWNA 2FPSA 3W06A 4CKCB 5J4YA 5C4IA 4AF8A 3MPOA 3T5BA 1DX4A 1NVGA 2HA3A 2PGDA 3D3QA 3AERA 3F6PA 3CWZA 4P31A 5CTAA 1A4IA 3OF2A 2V5VA 1XRNA 2Q1XA 5CT8A 5FTJA 1VPLA 5SYNA 3RS5A 2RMKA 3CR3C 3KQTA 1VLQA 1GJRA 3V42A 3EY9A 1W1IA 1LEHA 3Q5GA 1BDJA 2F4NA 2JKVA 4YGYA 1IXZA 3WKAA 3D6UA 1HNWB 1USIA 2HO4A 3EIWA 1S9DA 4LRQA 3SSOA 2XT6A 2HIGA 4IDOA 2AA3A 5HFNA 1FLNA 4GLLA 3VR0A 3VU9B 1W36D 3M3DA 1P2UA 4D97A 1Y8RA 1XU4A 4C4PA 3DCIA 3EUAA 1KU6A 2KW5A 2H2AA 4R7GA 1N2CB 1HKHA 2PL9A 2XWPA 3TL2A 5K6RA 1AK9A 3TD6A 1Q2XA 3U7EB 4QJIA 1U1CA 1O4VA 1RLIA 3JY6A 3MS7A 1EIZA 4DNPA 3FDJA 4TVSA 5JRDS 3G1WA 1DELA 1P39A 4IDEA 4RGYA 3S7TA 4KXXA 4B2IA 4MUGA 3CVUA 1BCRA 1YIAA 1VG1A 2HPAA 4JKOA 3AUXA 4YRDA 1O5TA 3CFYA 5IM4F 1CQXA 3E8SA 3A6KA 3ZQKA 2NG1A 3L5OA 1E1DA 4N5NA 5KTSA 4LYEA 4FT4A 2OGWA 1ECCA 4Q4JB 5FA5A 3RRBA 4O3FA 3N39C 3GQVA 2BSXA 2HJWA 4E5YA 3GAAA 4GRAA 4OGWA 5KNCH 1C3XA 1XLTA 3KQPA 1HC7A 4ZRNA 3QG1A 5K3FA 3V6MA 2JFYA 1FSZA 4NTZA 2ZANA 4ZCPA 4DBLE 4C4AA 4C22A 4WBSA 2GVNA 1TO1E 4LRUA 1ZJWA 3DUFB 2VK8A 1EP9A 1KP2A 3KKEA 3C1UA 2CYAA 4J0IA 5IAEA 4DREA 1P9WA 4KRFA 1E5QA 4KVFA 4WLFA 2V59A 2JRLA 4XVRA 1DC6A 3OJEA 5CLFA 4CDRA 4EGCB 2ZWVA 3VR4H 3G2HA 5MN5A 2NX2A 2O3QA 3E3OA 2ZSEA 1QIKA 3CH5A 2JJ2D 1U5AA 3OQPA 2WG0A 1T25A 4TYYA 1ULZA 3HY6A 3I5YA 1N8SA 3L8FA 5BQXA 3OWHA 3SQOA 1A7JA 4XQCA 4A9AA 4J2OA 1W5EA 1ZITA 5FTMA 5FPYA 3V4FA 2VQDA 1WSWA 2EDCA 3BSWA 4X90A 2J30A 1O87A 2HTEA 3GFPA 4HDQB 4M55A 1HFJA 1FXSA 2W4MA 3JQAB 3IKTA 1QZXA 1O95D 1T1GA 3E05A 1YIDA 3GYBA 3AIKA 4I8IA 1K6IA 3DR3A 4QEZA 2VWHA 1XJCA 1VDZA 1WCIA 2RGRA 1X2BA 1YS9A 4KIJA 1P4JA 4EAAA 2X2FA 4KN6A 5ELLA 3FOZA 4NBSA 3F8WA 2NP7A 4P4SA 3DZGA 2J46A 2FW7A 4M8SA 3HU2A 2XGMA 1AGYA 4OSEA 4B7XA 2Q6VA 4XLLA 3QVVA 1IZ0A 2WJ3A 1WWKA 2P9HA 2QMOA 3AB3A 4H6XA 2TMDA 3IXMA 4W6ZA 4O5AA 5JARA 4QYIA 4RLFA 3H4TA 3V97A 3S2GA 1WU7A 1GPNA 3ERCA 2J85A 4AKIA 1NBAA 2PUDA 5ICGA 3WRYA 1YZNA 5BT8A 2QQ0A 4UPEA 3MWEB 3T52A 1TADA 1ABEA 3AT1A 5K4AA 3OQNA 1TCBA 2QN1A 2NU7B 3WYNA 5BWCA 1FRQA 1ZCBA 4I99A 5BQ5A 1W2HA 3OOEA 4HFRA 4JP8A 1QCYA 2BKEA 4C7BA 5B3AA 4G97A 4MGIR 3U44A 1AN9A 5ECYA 2JFQA 4B4WA 1DIGA 5TMBA 3N2NA 4GRIA 2W0MA 5DW0A 4AIIA 4DMCA 3LXXA 4UMDA 5B6JA 2OO7A 3THWA 5AKJA 4UBIA 1SVSA 2N1BA 4FR5A 2G0AA 2O1WA 1LK0A 3CW8X 1C7FA 2GPTA 3W2IA 4ASUA 4ZHQF 1TF7A 4MUHA 3DVAB 4HGRA 2Z98A 4XRGA 3JQ9A 4Y1FA 2R8EA 3CX7A 3KPYA 1UMDB 2WIBA 1Q92A 6REQB 3GRZA 1XZ8A 1KDOA 3ZZTA 1JFLA 4X6XA 4Y1EA 5HR5A 2AXQA 5LLTA 3DLBA 3TKAA 3UB4A 1JU4A 2H1SA 5A05A 1TCCA 1RRGA 4MWBA 5C4GB 4B3JA 4D45A 1ML3A 3AVUA 2C59A 3LY8A 4UREA 3SKVA 3SM3A 2SNIE 1J22A 5ITZB 5K2OA 3IOCA 2G09A 3HO1A 1H22A 4TRJA 2ZXEA 3N2KB 1ULHA 4N12A 4MVJI 1I7NA 3JQCA 4C0HA 4E11A 2QQGA 4O33A 4EI9A 1LGYA 1X6VA 3UWPA 2C7VA 3QBVA 4PANA 3ND5A 3IVMA 1C8VB 4IY1A 2GPSA 2G07A 1QKJA 3SHFA 2FEKA 3SZMA 2IU6A 9ATCA 5IEBA 1EFRA 2H18A 2LE0A 2NO0A 3WNVA 3NOVA 3TW8A 2C1ZA 2OQ2A 3LH5A 3AM1A 3LWZA 5KYXB 5FV4A 4S1NA 4YS6A 1W5TA 1KEEB 1JWLA 4LZNA 1ZFNA 4JYMA 1YB5A 4BFSA 4G8CA 3WAJA 1SIWA 1M7HA 4R5HA 5J5CA 1ZGCA 4XW2A 4C7OB 1QZTA 4G0QA 1GPKA 1CQIB 1Y6ZA 4S0XA 4LK2A 4TLCA 2GRJA 1C0PA 1GGJA 3GN2A 2B9VA 2Q99A 3PQ3A 1KYVA 3WNDA 1IUKA 3TLCA 2AS0A 3KX2A 3ONDA 3H1GA 2NXJA 4QU0A 1XZIA 4RD3A 4WBXC 2H57A 3RF6A 4MWZA 1KOLA 3HCWA 3B6MA 4INPA 2VQ6A 1G5HA 4BKQA 1VXRA 4QFBA 3GRKA 5HOEA 3L8YA 3Q87B 4L9RA 3B9PA 3VQTA 2FGKA 2GYUA 3OA0A 3L0IB 2EX0A 2BKVA 3CN9A 1YRYE 2QP9X 5EHIA 1E18A 1FS6A 1FPMA 3RIHA 5A1TA 5DP1A 5ILOA 4HDKB 3WZ2A 1U3GA 3DLCA 1R8QA 4JYAB 1MB9A 1GZVA 3KT3A 2QE6A 1O03A 4NYJR 4ZD6A 2IHZA 2RJ3A 3RFFA 4D0GA 4RHTA 4F71A 1F9AA 1AA6A 2ZAOA 4EI2A 1FFHA 4QELA 1AKQA 2H1CA 1KZ4A 1II9A 3LCRA 5B3JA 1CW2B 1W4ZA 2HF8A 4G9GA 3TRFA 2WIKA 3DYBA 3I9JA 4NULA 2R79A 4F91B 5DKFA 4HKTA 1XAGA 4KI0A 4UD6A 1AQUA 4PS0A 2E21A 1E8DA 3BKXA 4P32A 3ZHOA 5I3ZA 2QAGC 1U9IC 3AWIA 1CYEA 4CVNA 1KI4A 1U99A 4DL9A 1V1MA 2DPXA 3BIWA 4WFQA 5AK3A 1NT4A 3W2FA 4ZMBA 1QHNA 3IE1A 4LN1A 3E53A 3ZBPA 2HU2A 3LDUA 4MRSA 1V3VA 5A4IS 1RZRD 1KH1A 5T4FA 3BH0A 2X9QA 4GDMA 1P7PA 4TMTA 1S4MA 2NZ8A 3DF7A 4NPCA 2R8BA 5TB5A 1FP7A 3R9IA 5KTOA 3P26A 4EHJA 3BRCA 1R8YA 1SBHA 4R0MA 2WLSA 3HNPA 4CFZA 3DB2A 3AL0C 1HTTA 2IZZA 3WIEA 3Q8MA 1XNQB 2II6A 3C0KA 3RUFA 1Q1AA 1NBME 121PA 3TD9A 4A8TA 5C5DA 1O97C 5DSTA 4BBAA 4G6ZA 1L5HB 3MUOA 4J3FA 5DYGA 4I3FA 3K9WA 3W5DA 2IYZA 4OU5A 4NNJA 4RY2A 2GBCA 2Z9BA 3GLFB 1BW9B 4QODA 3CVWA 2VP6A 4Q02A 3PF8A 3V3TA 1LH0A 3DJYA 5H59A 1BKYA 3KYIB 4B45A 4D9NA 3H3JA 5KYXA 2G5GX 1P77A 1KO1A 1MJNA 2D74A 5BVHA 3B3GA 1A96A 3IQEA 5LZ2A 1EVQA 3P2EA 2ZBGA 3HGMA 2CB9A 2J8ZA 3C97A 3GPIA 3HKCA 4OFWA 4YO7A 5AKKA 3T0IA 3UOAB 4I4IA 1NPYA 2X2EA 2CHEA 3D1VA 5KQLA 2HHHB 5A0TA 1TA4A 1ZNZA 3L7OA 1OKKD 2FFQA 4X92A 4RC9A 1OZFA 3VGPA 5AKEA 3NAZA 4MQLA 4DT1B 4PV7A 1ZHOA 1KL7A 1XRJA 1USWA 3IV7A 2YFQA 5AKIA 3D8RA 5JISA 4EFDA 1J97A 1VJRA 1AV7A 1IY8A 1N3LA 1RI1A 2HO5A 2P1RA 3L0SA 5GJBA 4JYCA 1K5PA 3KEMA 1L5OA 2QJTA 2CMKA 2IW3A 2JCBA 4CTMA 4FFRA 2CK3D 1NMYA 4B3HA 5I4IA 2XJ4A 3GEBA 5J5AA 3WO1A 1VL8A 1SHZA 4PYMA 1GA1A 1LI4A 4QARA 5DHSA 5ESDA 3ZI7A 1ESCA 1SCKA 4G1FA 3BXPA 1Y9AA 3TMKA 5ABPA 1N5RA 1R9MA 3AFHA 3LP8A 4G4JA 2E5LB 1K2WA 4PTYA 2P9YA 4PPYA 4JC8A 3KT0A 1V7PC 2WG1A 3SYNA 5LU8A 4EL5A 1W4RA 3EGEA 2FJUA 2EYUA 1WDKA 2YWFA 3DV9A 4K40A 3IA7A 2IU4A 3T1VA 4ZMSA 4J7XA 4Z86A 2I22A 4R84A 3PNBA 3S99A 1EFPA 2NQ2C 2WQ7A 4DPLA 1HE2A 3O8RA 2V9CA 3FD8A 2KBEA 3JD3A 4KDEA 5J9FA 1S2OA 2F8MA 2RDMA 4WIAA 1V2HE 4JI5B 1QG6A 3U3KA 3ZV4A 3ZWWA 4O3MA 1AJEA 2AFRA 4MYCA 2QLJA 1CZUA 1FVXA 1FTQA 3EXFA 3ZDQA 4ESHA 2WK1A 2ZI3A 5IBCA 4CBVA 1POWA 5BNTA 1E89A 3TQHA 1WHSB 4FD3A 2I8CA 4NHOA 1M2OB 3MWDA 3NVDA 7YASA 3AM5A 3PR2B 3IJEB 4JENA 4L4RA 1TVCA 3HKDA 4Z0PA 4R98A 4AG5A 2PXXA 3OCXA 3IT2A 2ZATA 1VIYA 4J1NA 2PZFA 4C1BA 4M9CA 3IRVA 1TOAA 5DGDA 1SBYA 2BFPA 3B9BA 2H8KA 4QBKA 3FFBA 4B3XA 4I1SA 1L5ZA 2QYTA 2UZIR 3IP9A 3H2ZA 4NBUA 1GO2A 3HG7A 1XI2A 2ANBA 2WYWA 4V0OA 5EMJA 3WWEA 4P0TA 1ZCZA 4DDVA 2VYVA 3CSDA 4WOPA 5FTWA 1DBVO 2GNOA 4MH0R 5CNIA 1JN0A 2LR0A 3QP9A 3U39A 5CDHA 2IEDA 4KWEA 3PL1A 5EEHA 1Z29A 1CEYA 3ZG6A 1YBHA 2D4AA 1N3YA 4H1UA 4ZEOA 5IC6A 3MRVA 5F5NA 4YRZA 4ZYLA 1NF9A 1U8XX 1ISHA 1L8OA 2HOQA 5T3UA 1F0YA 3WX0A 1M8JA 5AM0A 2VT6A 3EPKA 1JIJA 1UMBA 3U3DA 4A8PA 2HD4A 5DTRA 5DVZA 3TZHA 3PFNA 4BN0A 4QUBA 1I1NA 4CQMD 5LB4A 3G68A 3GRFA 3M5PA 1J0EA 3FMOB 2B3TA 1ZW1A 4B6QA 1B6TA 1IOLA 1KSFX 2WTBA 5K0EA 3IEUA 1LF5A 3EJWA 2FPOA 1WY7A 4W1PA 2YXPX 3IP8A 2BFWA 2C9BA 3HEMA 3NTRA 4W9NC 4ZKEA 3FLEA 3UYKA 2YUIA 1ZJZA 1JMKC 5KOJB 1C3OA 3G8CA 1S2GA 2ZE8A 1YQGA 2V7BA 4CI9A 1I4EB 1BRMA 1SR8A 4YAWA 1CVIA 2G36A 1FTWA 2Z8XA 4Q1FA 1IEXA 1UXGA 3A3OA 4D46A 1XZQA 3G5MA 5AW1A 3FHOA 2PLFA 4D3ZA 5FOVA 2O7VA 3R8FA 2AJBA 4FYVA 4QE3A 3TOZA 4IQGA 2QT9A 3JZAA 4DDTA 2FLWA 4YUYA 4RV5A 5I8WA 2OM2A 1H65A 3EPRA 1EH5A 3GJ6A 4G9EA 4WCFB 3O0TA 4OHCA 4HBGA 1IIRA 2VHWA 4H7IA 4UDNA 4YEDA 3BPSA 5D00A 1IRXA 3L92A 1FNBA 4ZTZB 1TC1A 4CQJA 3NB0A 3H1AA 2DHEA 1N3BA 1REQB 4F9EA 1V6AA 4LS3A 4O4HA 4POAA 5I5EA 1OV4A 3BWEA 4L8YA 2QD3A 2C77A 1R0YA 1F0PA 4KMMA 4AKTA 2DECA 3MMPA 3KTAB 2HFKA 5K1ZA 3MMZA 1CP3A 4OYRA 2JFFA 2PX8A 2R1UA 1IXSB 1HSOA 3RODA 2YHAA 1YA6A 2AZ4A 5LB2A 2AZDA 3K2QA 1SOAA 4C0LA 3C3DA 3LM8A 2GX6A 2UUOA 4DLWA 2I7VA 2PS3A 3GVPA 3U3JA 1JF8A 4X20A 4DXHA 3COVA 3LYHA 3QNMA 3URKA 1P73A 1ZCFA 1F2TA 5CT9A 4PNEA 4OHBA 1HDYA 4N8EA 4BNHA 4IL5A 2AG6A 3QIAA 1ODSA 1UH5A 3W6PA 5KTMA 3NO4A 3W5CA 4L8GA 2GCGA 4OQZA 1L3IA 1EFRD 1YF3A 2PBFA 4WKBA 3IKJA 3S70A 4EEKA 2GM5A 2QRZA 3A9RA 4AZWA 1KF0A 3AVYA 1U2ZA 1P7CA 1Y3FE 4URUR 3DDWA 3AJ9A 4LYAA 4WWHA 1KO4A 1OYWA 1VQ1A 1JDVA 2QTHA 3EVZA 4Y2PA 3ROTA 3ZOZA 2CFIA 3MGCA 2PSFA 1BEZA 2X1LA 3PT9A 4GT1A 3NHRA 1Y5LA 4YX9A 1TUGA 5ALUA 5JCZA 2VVTA 3E7XA 4UUPA 4CEIA 2H3HA 5ENVA 5DM60 2PV7A 3BGSA 4J49A 5IC5A 3ETDA 4DIFA 2WJHA 1QMGA 3JQ7A 3GH3A 4U2EA 3M33A 5JATA 3PQDA 1IZZA 3BMQB 5F73A 4EY4A 1PKXA 2E4ZA 1HDIA 5KNBH 3RPEA 4JQYA 4G0NA 3NV9A 2WYIA 5KYNA 2E9SA 3B3JA 1BGXT 2C4KA 1NBEA 3WGTA 3A2KA 3FZEA 2RD2A 5EJ7A 2D62A 4F9TA 2ACWA 2MIIA 1RWBA 1TO6A 4LCJA 1QVAA 4LY3A 4B35A 4HFNA 1J2JA 1FLDA 4K81B 3CIOA 1SG6A 3KSUA 3NETA 4E07A 1J39A 5H4GA 3EGDB 1Q74A 2PBLA 2IXEA 5I9IA 4ILKA 1WDTA 2ZUCA 5EP3A 4ENRA 4LXGA 4Z3OA 4YJ3A 3EFEA 1FVOA 3KXKA 1P0CA 3NWJA 3RUPA 1KS2A 4HEJA 4WKNA 1SU4A 3A05A 3MAJA 4IVNA 4OF4A 4YTEA 1LWOA 3JD0A 1NVVR 5D1NA 2JC3A 1XOIA 3SX0A 4DEXA 2X0IA 3ZXUB 3OT1B 3NP7A 3D43A 4JSYA 5TE9A 3WWCA 3NHWA 1RWKA 1MZPA 1ECBA 3ICCA 2WFLA 2XAUA 3UUWA 2JFOA 2RBGA 3ZE6A 5C8YB 3P8ZA 4JI2B 1ST2A 1IY0A 1HE1C 3IPCA 3VA7A 4PG8A 1E3IA 1PUXA 4NK5A 2ZZNA 1P0MA 2IXBA 3EF0A 3L49A 3CUSA 4WBNB 2VFAA 5CXSA 3G2KA 5LZ5A 1JKJA 3IBCA 5AWFC 3UK1A 3L40A 4I81A 2I66A 3V33A 4DRXA 2VHZA 3QKRA 4AM8A 2ZIXA 2XBMA 2R4TA 3D2BA 3Q10A 2HYDA 5JQGB 3BMCA 1B8VA 4HJXA 5K99A 1A9YA 2E6KA 1N6KA 1U2RA 9GPBA 3AUKA 3I9V1 5IEJA 4H4DA 2PX6A 3KAPA 1ZOSA 5EIFA 3IUEA 3O75A 4YCSA 2E4YA 2WSIA 4X41A 4JLWA 2CJWB 4Q24A 4E2YA 5LOVF 1RM5A 1X70A 1KGDA 3KFLA 1O96B 5CK5A 3TB6A 2G67A 4TUYF 1G38A 1T5DX 1V5GA 1Z6GA 4BNFA 4MYTA 1H3FA 1ILEA 3I37X 5GZ3A 4NYJQ 3VHLB 5LD2B 1NM5C 3GFFA 2OQRA 4BJ3A 4URFA 4X97A 5CYFA 1NUAA 4EY5A 5LWHA 3RHTA 1SVKA 1X7GA 2ZYGA 4DLPA 3VZBA 4HN4B 1XQYA 2GZSA 2EKQA 2AWNA 1QRSA 3QE3A 2H2HA 4X00A 3FN4A 3E7FA 1GFIA 1XZHA 4DM3A 2H1OA 3CWCA 1D5CA 2QW8A 4TS4A 1CNMA 4MRAA 5BRJA 1J21A 2CL0X 3JCZA 4OI1A 5FDFA 5JQGA 4OSPA 5K6AC 5L53A 3DEAA 2JBAB 4XM0A 3KDPA 1VMKA 1UEIA 1E3JA 1TGYA 4LISA 1B00A 1I1OA 1S3FA 2LUOA 2YCLA 1L4KA 1U1DA 3UXHA 3ZXXA 3A36A 4BO2A 2ZJZA 4MVJA 3OBBA 1IHUA 5C5IA 5BSFA 1Z0FA 1BJKA 1GXSB 5GM1A 1Q1EA 4CUKA 3MINB 3JD1A 4C7MA 4MVJG 3LRPA 5FTNA 3KS9A 5ECWA 5BUQA 4DM4A 1N0VC 5C52B 2D1RA 5T7BA 4HQRA 3PUXA 2P67A 3TEFA 4CPDA 3HMQA 2R97A 3QLUA 3R5FA 2Q6TA 3PUWA 4K88A 1OV6A 1BH2A 4C03A 3LRXA 1NYRA 3JQ8A 4GMXA 3TLXA 4Z4FA 1TT5B 1W29A 1P3JA 1QO9A 1R5BA 2XA9A 3BJIC 4TSFA 2R6JA 1DUIA 2QX6A 3MVEA 4J9VA 1TCUA 4JU8A 5IU6A 2O4UX 2DHCA 3R24A 2GLUA 5DEIA 4YP9A 1W2WB 4FN4A 4MWSA 4RIHA 3TLGB 1PJAA 5IT0A 4S05A 5FPHA 3CKMA 3F3SA 4X1KB 1J9EA 4I4TA 4LGYA 5HUJA 2W71A 3NH9A 3HBLA 3PC2A 4WAUA 2ZSUA 1AM4D 3I0ZA 3Q7TA 4D92A 1C1DA 4IFEA 4WADA 5U4QA 1ZM3A 3HY3A 2JLYA 3QVSA 1EAMA 1W2GA 3HA5A 1J8YF 4XSGA 4D56A 1M0TA 2G4LA 5JQWA 3FY4A 4GYJA 1C0IA 1JHAA 4NWIA 1OREA 3I1YA 2P65A 5H70A 5ALNA 3QSGA 4E08A 3I72A 1A04A 1ZU4A 3Q8LA 4DADA 1PP4A 1G7SA 1P2DA 1XZNA 4TWRA 2QJOA 1THMA 4A8JA 1FRVA 3DMFA 1ZC4A 4JL8A 3N0XA 4M49A 2D5BA 5ALOA 5UKDA 3UBTA 2GF9A 2QYOA 3HN6A 3R6DA 2WF9A 1KAEA 1RIIA 1L4GA 3IILA 4LJ8A 3L8MA 4AY5A 1NVDA 1QH8B 2ZRDA 2GARA 2VHVA 2HSEA 3S1AA 1HNNA 4B85A 1W87A 2JVKA 2MMCA 2F3PA 2WG2A 2FA9A 2XUPA 3LT4A 1M0EA 2ORVA 3C85A 1SC1A 4GL4A 3SX2A 5KCZA 3CS3A 4B8ZA 4TV9A 3SQDA 2YIMA 3LQKA 3TVYA 1G5RA 1BHO1 1TM2A 1G9XA 1DBQA 4F4IA 4JI8B 1X86B 1TU3A 4W8GA 2BMEA 2EHDA 1THTA 2I6QA 1SEVA 3MYRA 2PPVA 5ALGA 2AYYA 1CUZA 4NBNA 4MGHA 1IONA 3D8NA 3RRXA 1OF1A 1LPAB 1O8BA 1G6OA 2INGX 3DSRA 3NCTA 4OOEA 5AOCA 5H7XA 3TLKA 5C7YA 1OMOA 2PFSA 4IOJA 5HKBA 5HGXA 3QH4A 4RA6B 5T6BA 1U3DA 4DXDA 1DZIA 1Q1GA 2F43A 1Q3KA 2H1IA 2IYVA 4W99A 5EXPA 3DMDA 2Z4SA 1OI3A 3IQHX 5CFNA 3QU2A 3BJRA 4BLVA 1M10A 5ALFA 5JPCA 4RFLA 1XTVA 3HUFA 4MLDA 1D1QA 3NIGB 4K05A 2SBTA 1CDDA 2YZ7A 3CX8A 3ZS8A 1H9AA 3BFXA 4R68A 3I23A 5FJIA 4DRYA 2C3MA 2P9GA 3JQAD 2Q3DA 1K86A 1YDGA 2EL9A 3R5HA 1JIUA 1NYQA 1DAEA 2WM3A 3CR