4HL6A

Yfde from escherichia coli
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
375
structure length
375
Chain Sequence
b'KGPFEGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQSLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEINPRLIYASSSGFGHTGPLKDAPAYDTIIQAMSGIMMETGYPDAPPVRVGTSLADLCGGVYLFSGIVSALYGREKSQRGAHVDIAMFDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFDVFNTQDKPITICCGNDKLFSALCQALELTELVNDPRFSSNILRVQNQAILKQYIERTLKTQAAEVWLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLIEAGGIMMPGNPIKISGCADPHVMPGAATLDQHGEQIRQEFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YfdE
molecule tags Transferase
source organism Escherichia coli
publication title Function and X-Ray crystal structure of Escherichia coli YfdE.
pubmed doi rcsb
total genus 122
structure length 375
sequence length 375
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.8.3.19: CoA:oxalate CoA-transferase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 4hl6A02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 4hl6A01
2GCEA 4HL6A 2VJNA 1PQYA 1P5HA 1VGQA 1T3ZA 1VGRA 1PT8A 2VJMB 1XVTA 1PT5A 2VJQA 2VJKA 2VJLA 2GD0A 1X74A 1XK7A 1XK6A 2GCIA 2G04A 1Q6YA 1T4CA 2GD2A 2VJMA 1Q7EA 2VJOA 1T4CB 2YIMA 2GD6A 1XA3A 1PT7A 2VJPA 1XVVA 3UBMA 1P5RA 1XA4A 4ED9A 1XVUA
chains in the Genus database with same CATH superfamily
1H1LB 4EPYA 4IZ6A 3GZ4A 1LRLA 3S8MA 1RXIA 1UMCA 2IDJA 2ZXFA 3JQGB 1Z6AA 4N82A 5JCOA 4DJ5X 4REMA 4YRJA 3R74A 1P9OA 3DOUA 5KAPA 3NIFB 1H22A 2BBSA 3H1BA 2GD1O 4CL2A 1U3WA 3K2EA 1IPEA 1FU4A 3LLVA 4IG9A 1P75A 4LA4A 4F2WA 2PUBA 1E98A 4HJXA 3DXZA 4IAOA 2YICA 1QYCA 4IX9A 2C5SA 4L0CA 2QIOA 4X85A 1EXNA 3HZOA 4PLFA 5A3QA 2WT4A 2E18A 4TYNA 1DU4A 1OSNA 1V7ZA 4MVXA 1OGJA 3TR5A 5AH0A 4AD8A 4ZANA 5KVSA 3I09A 1THTA 1FUUA 2FZGA 3EXHC 3MZ0A 2R4QA 1CQZA 1H5UA 4P5PA 1A5AB 1PKEA 3FI0A 2ZRJA 1KQGA 2J0EA 2M6RA 4KX5A 4AURA 3SFTA 4I4NA 4RHCA 4YX9A 5J4LA 5JASA 1BEUB 1O8BA 1XQVA 3ADKA 3N76A 3UJAA 3ACCA 4O2AF 5AVJA 2ZUFA 4RTJA 1MIHA 2PNJA 2WI8A 1TU0A 2DWPA 1QTRA 3NLLA 3OP4A 3UAWA 2DHRA 3JASB 4AMBA 1U81A 4YJ2A 4BPBA 2HRCA 4UQOA 1DJPA 2OBMA 5IARA 1JIXA 4UHJA 1UT5A 3M5DA 1P74A 4K9OA 3O6VA 3J81k 4QICA 3K6JA 4RENA 3HWRA 2NU6B 4JI3B 4QGHA 4XSHA 3TZEA 4HLQB 1KZ6A 3CCBA 4ZVPA 4C4RA 2WJVA 5K3BA 3A1WA 2P9JA 4B45A 3F6RA 3D0KA 1VPDA 5F2KA 4LHZA 3JTMA 4Q82A 1V7PC 3FJ1A 3UUWA 2BMFA 3GUCA 3QA3E 2NZ8A 4ARAA 2AFHB 4LF4B 1XVUA 3MCWA 4IDGA 3PWZA 1SA0A 3NYIA 2R751 2Y0BA 3KOZA 3L8CA 5KNDD 1S7CA 2PZFA 2WIBA 3SLGA 3O31A 3UV7A 3U4QB 2KHZA 3A4LA 4JLNA 3S81A 3RBAA 1LF0A 3TBFA 2IUYA 2BEWB 1LCIA 3UYLA 3WLSA 5CLJA 4QDXA 3EQ2A 1ADFA 3WO0A 4OHYA 3IAM1 1VHQA 4XEUA 3WK7A 5JWHA 1U5BA 5JSYA 3ZS9A 2QRUA 3NUZA 3P4XA 4QWMA 2P1ZA 1N33B 1UKAA 1JR3A 2F3TA 3IEPA 4NV0A 3WX0A 4AP5A 1MENA 3W3AH 5FI3A 5D5HA 2Q0SA 2VA8A 5FNVB 4C6RA 1NR1A 2P6OA 2ZXEA 3S28A 4CM7A 3IEKA 4F96A 2BF4A 4RHEA 3VYWA 4BNTA 4BHTA 3T95A 4G3XA 1GSHA 2QUZA 2Z5GA 5TQJA 2IW3A 4XVUA 2QTGA 4QUKA 2YOHA 4JODA 3ZDAA 3LVQE 2ZUTA 4J76A 5EIEA 1NNUA 2HSEA 3CUWA 3U4GA 1QAQA 2JAQA 3LK6A 4B87A 2EL7A 4NATA 2UZ0A 3K2BA 1UBFA 1U0BB 4YUYA 4BNVA 3AUYA 1V1JA 1TC1A 5JATA 3AYXB 8GPBA 2OO7A 1PEDA 2E5LB 2IBTA 4A8PA 2X9LA 1XK7A 1QFMA 1Z63A 3A28A 3BWBA 3E7WA 2C78A 3PJEA 4MGHA 1MV5A 1S8AA 4CM4A 2XV1A 4FDUA 4D9FA 4FX2A 2FW9A 3OEHD 4L3WA 4DA6A 3U7EB 4N3CA 3QX7A 4NE2A 2NYUA 1S2OA 1VJRA 2G72A 4ZVTA 1RZRD 3ORRA 3WRYA 1FFSA 3O03A 3CR7A 4WI1A 1M0WA 5AM3A 1X39A 4TTSA 1HZZA 1A8SA 4PSAA 3UJCA 3DW1X 1A3CA 1T6NA 2WUEA 3QTBA 2JNWA 2VSNA 4M86A 4CMKA 3EVTA 4JLVA 3HY6A 4P80A 5LJIA 3ERCA 1R8YA 1V2HE 2W2KB 1AB6A 3DW3X 4MUIA 5K3DA 3EDYA 1DO2A 2W5UA 3ETNA 1K7EB 1M2NA 3C3MA 1P3DA 2NTYC 2REXB 2D7JA 2GFQA 2YUTA 1R0CA 4NBWA 5LBTA 3L5OA 3RK1A 5LQKA 4QUIA 3X1DA 1K98A 4OB6A 4EAQA 2FUCA 1W49A 4I81A 5HYVA 4BX3A 4PX9A 5TT1A 5FYDA 5C2JB 2V1UA 4JAVC 5EIHA 5JC1A 1VMIA 1QRRA 1SXJA 1MLDA 1P45A 1W2HA 5B1HA 4TX1A 1KIMA 3RS3A 2CE2X 2FQQA 2BJWA 2JJMA 2XA1A 1TQ8A 3ICOA 4IDPA 4OQQA 4P3XA 4KNVA 5D00A 4AJIA 4KQ2A 4DIEA 2HL6A 4OUDB 3K0HA 4ASUA 3CVXA 1CF9A 1NDUA 5CLLA 3ZVMA 2XEXA 3DO6A 3RSOA 4OJMX 3GEDA 1WXGA 4FINA 1II8B 2YHBA 3AU9A 3AH8A 3DBIA 1NW3A 1F2DA 1YVRA 5CIWA 1AKTA 2WU3A 3C3YA 1H2XA 4HPXB 2IU0A 5TEWA 1JR3E 3T3OA 3EEFA 2XUFA 1IBSA 1Z2DA 3L1JA 4FC7A 4I9HA 1P29A 2ZANA 2XLBA 4FOSA 5EQDA 3HMQA 2A5YB 1NOIA 3FAKA 5FTMA 1B0UA 3O38A 3I6QA 3V34A 1VI2A 5KSYA 4PHCA 2AYXA 2PYZA 2AEJA 5FA8A 3KKLA 1YZYA 3A6FA 3PXEA 2EGGA 2QT1A 4Q16A 5HF8A 3UENA 5K6RA 2VP5A 4IX1A 5SYNA 3HR4A 1M0TA 3EPPA 1OKKA 2JGDB 2ZJZA 1X7ZA 5ALVA 1KTIA 5BSHA 3HA7A 2GNOA 3EQ9A 4R3NA 3T99A 4DLNA 1ZLXA 1F7VA 2QL6A 1UJCA 1N4AA 5I7EA 3IEVA 3OWXA 3L4EA 3KAKA 4EUFA 3B2QA 2E4YA 3ZQJA 1G4UR 3VR4D 3I52A 2O8CB 1FFHA 1KY3A 2AJCA 4XEHA 3VNAA 1GJRA 1PR0A 5I9MA 4LJ7A 4E11A 2R5WA 1OZ0A 2O1XA 3H5RA 4G63A 3VRHA 2VDRB 1XDDA 1U28A 1P0FA 1J8QA 2PVSA 2WKWA 3FTQA 4LTNA 4RSRA 4WCFB 1K97A 4ZALA 1D0VA 2Y1KA 1C4XA 3CIFA 1E3QA 3D9QX 3P9QA 4EQ6B 1S2DA 1VPWA 2J3IA 1V8BA 1SHLA 3GFVA 3MJVA 3SMVA 2QROA 2G36A 2P3LA 3MNFA 3V42A 4PGAA 2NU9A 3Q1KA 1F1JA 5DGIA 2D5IA 3DYIA 4W7HA 1GLNA 5FCDA 1DTSA 3E2IA 3E7FA 4IIGA 4BLQA 4HLNA 3L06A 3N2KB 1P1BA 3AKYA 1C9DB 2FMXA 3HCFA 4R84A 2JCSA 1X7WA 1MABB 4GOND 3LT4A 3COZA 4DWWA 1E4VA 1X6VA 1EHYA 1H94A 2PKEA 1RP1A 3NM6B 1JHMA 4X1YB 4CF5A 3NBAA 4DSNA 5KCZA 4NX2A 1XKLA 4L5AA 5KSPA 1R8JA 2JEZA 2XGGA 4CTNA 3W2GA 4PSUA 3HSKA 5AM2A 2Q5IA 2CSXA 3KJEA 3D0RA 1KJNA 1E92A 2BI8A 3DOEA 4ND5A 5GQSA 4CLEA 1ZH4A 1P2SA 2HK8A 4H15A 3AJEA 1PJRA 4GLJA 3JAMA 3C3KA 3OTWA 4N5HX 4PO1A 1NQ5A 4YFYA 5BYBA 5T41A 1ZGBA 3INRA 1UBJS 4FNGA 3DZ8A 5KYNA 1ZQ1A 5IKOA 2B5OA 2AOTB 3GDHA 2OCYC 1K8YB 1TLFA 3A6LA 3LG2A 4B7XA 3DKIA 2VC2B 2GQ0A 1WHTB 1HE2A 5J5CA 4BEVA 2FW1A 3CLRC 1DCTA 5HKAA 4MUKA 2V7QD 1QG0A 4AY5A 5ITVA 4U1RA 3SKVA 4NEQA 4INPA 1JLSA 3DNMA 4RKEA 1HTTA 4M0KA 3EZXA 1B3RA 5G0UA 4DNOA 1L4MA 5JFTA 4PYOA 5MFPA 5H68A 3N2KA 1U7XA 2CK3D 2WWRA 4EG0A 3ZWWA 4RHFA 3TI7A 4DLZA 3DR3A 4LNAA 1FJ2A 4QGBA 5F23A 5IYZB 4JS0A 2VI5A 1YU9A 4B35A 3NEYA 3RSZA 4JLSA 1Y6QA 4YROA 2HA6A 1UEXC 1JRLA 3OFND 5G0VA 2VO1A 1JE0A 4TL9A 3ZWAA 1N1EA 4MVJF 3T0FA 1GDTA 2I1LA 3OLYA 4ZVQA 1KZ9A 2FPGB 1KQNA 4HAVA 1G1MA 1IL0A 1KS2A 1ZVJA 4BLPA 5CBPB 2GWHA 3VAYA 3VDNB 1KI3A 4TRJA 4Z51A 1ZAYA 2ZJ6A 4KQ6A 3EEYA 2WLTA 3FUXA 3N2NA 2HY7A 3B5EA 3WYGA 4OG2A 1GCGA 3PVZA 5BWBA 5DZSA 4DWJA 5K45A 1IEXA 1KR2A 4P36A 3TR6A 4LQDA 4IIDA 5HK9A 1B1CA 1DFIA 2WD8A 3C8MA 2D0PB 1CEYA 2CHQA 4HWGA 5HUHA 2Q7XA 3A36A 2IXBA 3JWJA 1KYTA 4A15A 1L7BA 1CE8A 2DJ5A 5SICE 3WQSB 2ZJOA 1F8YA 1TA4A 4PXYA 1RKXA 5CFNA 1ORRA 2ZXUA 2WTUA 3LUAA 4HVTA 2FPIB 2I7TA 1HH4A 3PEVA 5B5SA 1Y6RA 2VJPA 2H1RA 4QLAA 1U8ZA 4EQZA 2CEAA 2HJVA 3FJOA 2OXTA 1XRJA 1W88B 3NJRA 4IKOA 2GH1A 2DSNA 2P6NA 4Q4HA 1EFVB 1KEEB 3RASA 4XJSA 3WDMA 3ZU5A 3ZQ6A 1EP1B 1YE5A 1WQ4A 4IWXA 4Q4CA 1YV9A 1GQOA 3FUVA 2XTAA 4F3RA 4XIGS 3GP5A 1Y9EA 2CLSA 3NFRA 3GGCA 4GLBA 3H9UA 4NH0A 2ZTSA 2X5XA 3AEYA 3KQOA 1DMSA 1CVRA 1TD9A 4Z4CA 2GEFA 5KSWB 2CZQA 3VR2D 1ST3A 1QFXA 2RGGA 1BEEA 3LQKA 3U1BA 5CGQB 1N5RA 3YASA 4LOLA 1XVVA 1KMIY 3O74A 4M0UA 3RC8A 3VNUA 3B8HA 3EIEA 5EJGA 5JVDA 1U7UA 1M2VB 4MWSA 4NZYA 1JMYA 1U0EA 6AT1A 4U8HA 2OTCA 4C4ZA 4G0YA 2N0SA 2VBFA 4Y2SA 4FEAA 4YWHA 3C6QA 1XCBA 1XTKA 2D2FA 2NPFA 1BGXT 1YZUA 3QNUA 4JJEA 3PYMA 4QNNA 4RSGA 3T54A 2OGWA 1DAPA 1WCYA 4BQFA 5JTTA 2XXAA 2BHSA 1KSGA 1TZJA 4HB2A 8ABPA 2X22A 4U63A 4UUAA 1XXHE 1XNHA 1D0IA 3DLCA 2JGLA 3VISA 1CC1S 1QFZA 1MEEA 2DFLA 2PQMA 3KR2A 4Q66C 5CPFA 4G07A 4TKUB 1YJ5A 3FWZA 1DAOA 4H1WA 2QU8A 1BROA 3HE3A 3BWYA 5D3ZA 1J90A 4HXEB 5BW4A 7REQB 3LQRA 4WESA 2L17A 3PR1A 4HDRB 4Q0MA 1HE3A 4GKAA 3SLRA 4Y9UA 1X1SA 1C29B 2GVDC 1ZOIA 2CNBA 2G09A 2FWJA 2I8CA 2W2TA 4B84A 2JFYA 2O57A 2OORA 4IF6A 4JB2A 5C53B 1RZRA 1L6RA 1NBMD 2JA2A 2WMDA 4D43A 5AHOA 3LP6A 4CMJA 4FOTA 4DLXA 1OYOA 1UQUA 1ZK1A 3BEOA 4FYXA 4QXOA 1T3TA 1U0RA 4ZO4A 4YQEA 3ZKWA 1KYYA 1U8TA 1W9MA 2PMBA 2ZRLA 2Z04A 4F8YA 2CVHA 3CKKA 3F6YA 4L5IA 2OM6A 2H5IA 4TGLA 4YJGA 4YP0A 4BVFA 2V6GA 1KK3A 2XCIA 3IQFA 4DRXA 3ULKA 4DCPA 2BHLA 4V0SA 1E9BA 4TV8A 3OQPA 5EJMA 3GDOA 3JYPA 4LVCA 2WB2A 1VPEA 3TDNA 1M7HA 2IHNA 2G3YA 2IUSA 2X19A 4JC4A 4B4VA 4RGQA 2XDYA 2PT6A 3OEWA 2PX6A 1YZGA 2J3EA 4NSNA 1K2VN 1CTQA 2MYPA 2P4EA 2XGMA 4RANA 2FX5A 1RXCA 1N2GA 3T5GA 2YKGA 1CYDA 4QU5A 4GGMX 4IDDA 4HXYA 2PZAA 4MW4A 5L45A 3NTUA 2D1RA 4RIGA 3W9YA 3PUVA 1EGMB 3LT1A 4JXJA 4D8TA 2HJ9A 2X4IA 4MR8B 3SYRA 1NPYA 5SZKB 3C3AA 2C29D 1AOXA 3ZIDA 1LEHA 1CW2B 1HDGO 1P6XA 4QATA 2GETA 4W9NA 5AWFC 1FLVA 1S89A 2DPXA 1S8OA 2PSEA 4A8JA 1AQUA 2JJYA 2UZ3A 3GEIA 5TRTA 4DA0A 3BN3A 3PX3A 5LKAA 4OATA 5C7IO 3WRVA 1Z15A 4L08A 2OO3A 3C1TA 3ZLBA 3AVYA 1JGTA 1HY3A 1QUEA 2WE7A 3ENKA 3CT4A 3JALA 3M4NA 1DFHA 4PLCA 2X1VA 3CUYA 3FY4A 3KB1A 4IRXA 4S24A 3O9MA 1PDWA 4CEIB 4WAUA 3JAKB 4FSHA 3VPDA 2B7LA 5FBWB 3GARA 4ZQFA 1G8JA 2CBXA 5KKAA 3TZ6A 1M8GA 5KYWB 2JHCA 4FJ2A 5BY2A 1VIYA 2KX7A 3L0IB 5LP6C 5DYTA 1N32B 1ECLA 4W8OA 4FFSA 4PGGA 1ZITA 2ZIWB 4FHGA 1CNEA 1RZVA 1JU9A 4H4EA 4NDZA 4ZOCA 2Q8NA 3FSGD 2G17A 1Z34A 1LK0A 2NAFA 2VRWA 5F21A 3H0KA 4HS4A 2RC5A 3WMGA 5IWAB 2OCLA 2K5UA 2QV7A 4C20A 4L5YA 3N58A 1RABA 4YCAA 2I4MA 3ITKA 1U2RA 3B1VA 5I5EA 2PXXA 1WZ2A 2OQVA 5IVIA 4AO7A 4HPWA 1XVIA 2QVCA 3EOBI 3I6YA 5BR7A 1MGPA 4DHEA 4RK6A 4KR7A 4HWOA 1M1YB 4GPTA 1Y5NA 3GLVA 3QBEA 5H83A 4DVGA 5J3JA 1MC4A 5BSRA 1XT6A 5AJVB 5TE9A 2HGSA 3OF3A 3NWOA 4I1IA 4OP3A 4QQRA 4ZODA 4YMGA 1QTNA 3F3MA 2G5PA 4IJWA 1L4LA 4YO7A 2M98A 2ZT8A 4M83A 4NIMA 2FPUA 2J7KA 2NUTB 1SQ6A 2ZBDA 4RJKA 2FU5C 3INYA 1YBFA 3IUMA 4WV3A 3W2FA 4RTPA 5JSUA 5I7OA 3LO8A 4MDYA 5LOVF 3SYLA 2QVYX 3BYZA 3CNHA 3CX6A 1YHYA 5DSXA 4AT1A 4S05A 1J8VA 3MA0A 1PT8A 4M53A 2NOAA 1EAYA 3TE6A 2QGFA 4QASA 4HT3B 2BZSA 3D5EA 1JW9B 3HB4X 4C5CA 4RIIA 5DNAA 3FHTA 1CIJA 1XQWA 2CDRA 3KELA 2ERXA 1KARA 2XADA 2GK6A 1GPBA 3KZOA 1XZLA 3QBVA 2QLFA 1ZESA 4Z8XA 3KZNA 1ZIYA 1XDZA 2J5RA 1EFKA 3OIVA 2FVYA 3LXXA 2BGRA 3DHNA 3D8NA 2FRDC 5L7WA 2AB0A 4F60A 1AGNA 4TTIA 1HBJA 3B6IA 4RW0A 2UUCB 4CIXA 1J56A 4JYPA 4B6GA 4UM9D 3TFQA 3REGA 4L95C 1CERA 1EZ4A 3M9XA 4BEJA 5CX1A 4UTVA 5BW8A 2ZZMA 2IHTA 2H4ZA 3HV2A 4OA5A 4HB3A 1G7CA 2AG8A 2EGUA 3G79A 2DQSA 1KP3A 4MP6A 2O14A 3THYA 1VLVA 2YBEA 2RIPA 1OT3A 2XY4A 2DM6A 3JW8A 1U2PA 4JQOA 4WY2A 5CJPA 1F8GA 3MOIA 4YH1A 3JARB 2FEOA 2VHUA 3CG0A 4E22A 1VKZA 3RIHA 3LLSA 2VK4A 3K9QO 3VPFA 4CEJA 4Q1EA 5J58A 4FR2A 1WSBA 4YP1A 4KV9A 1BOFA 5JCPA 1R8QA 1RJFA 4PSCA 1JEQA 2ZI3A 5E4YA 5KX5B 2LNDA 2PU5A 1RI4A 2P2YA 4RA6B 4Y8VA 3V00A 4RU1A 3O3CA 9LDTA 1AKUA 1G6HA 2PJUA 2RGUA 3QFSA 2CDCA 4QFDA 1OA1A 3TFOA 3PWKA 4UVGA 4Q6WA 4IH9A 1NJ1A 3TMKA 4CWAA 4O4IB 3FSRA 3CUSA 5AQ1A 1N9GB 2GHIA 3E3NA 3O82A 5A3VA 1SUCA 2YIJA 4GP9A 4G23A 1JHZA 3G2KA 4I5FA 4UMDA 1VL1A 4DCJA 3KFXA 4G1BA 1XTVA 1UIMA 1QNFA 4KO2S 3GEBA 4IGEA 4QOEA 5EPUA 5BW5A 3WK6A 2H9IA 5K6AA 4IFIA 4R1UA 3ET5A 5ALTA 5INTA 1GRQA 2AGVA 3RWOA 1PG2A 3QELA 4OHBA 4QPCA 1QZTA 3RUFA 4ABYA 2BDTA 4X44A 1HI9A 1W73A 3PNPA 3AR8A 4D0LB 4RLFA 2C1XA 1QYIA 4HNGA 2Z2XA 3L7BA 1DDOA 5LCXA 1TJ5A 2YWDA 5JU6A 4H6XA 2TMYA 1RIIA 2VJNA 4PLVA 2RHBA 1WZEA 1AUQA 1Z22A 1FDOA 1R5BA 2OG1A 4ZTZB 1KDRA 2ZBPA 3U9TA 4UHDA 1CEXA 4DL9A 2VAPA 2IIVA 4ZK2A 2A35A 3QVLA 4H7DA 5TMDA 4QXMA 4DLTA 5HKBA 1GNPA 1U3VA 1WDWB 1ML4A 1DC8A 1C1XB 4DMUB 5IUJC 1FFCA 4V0OA 3S5JA 1L5RA 3OLZA 4RO0A 4OI4A 4I19A 2FEXA 4P7FA 2OCIA 2QGNA 3RC2A 2J3JA 3RBZA 1S3FA 2J09A 1LDGA 2NNWB 3DOIA 2JGMA 4I1OA 3MINA 5AI6A 4WNCA 3EBOA 1U7HA 3S7TA 5CAEA 2QM8A 3UGQA 5IAKA 1W0KD 4JT2A 4KREA 3VSCA 1RI1A 4MQ4A 1IB6A 4K9PA 1V25A 2BZGA 1U8AA 1X8XA 5GAJA 4IDCA 2XKBA 4TN1A 5T7BA 4ZCQA 1NSTA 2FGJA 2PL3A 2ZRAA 4JZYA 4QHYA 5CDHA 1SKBA 4KUGA 2OCAA 3WZLA 2R6R1 1X1QA 3NB0A 3PK0A 3VZBA 5A3JA 2F9LA 5FTWA 4OQYA 1XZQA 2RIRA 4HNHA 4KP7A 1DBSA 5HR5A 2P6RA 2P9ZA 2PMEA 4PZLA 2LPMA 3BXHA 3LBHA 1Z4JA 3BGOS 1XMQB 3BHNA 3A2LA 3K3PA 3DWIA 1SUAA 5HFNA 2VZ9A 3W2EA 1K4YA 3ZZTA 2B9EA 4DAEA 3U4MA 1Z0SA 3CRW1 3UKDA 1FUEA 2HK6A 4ZARA 2I3BA 1XDBA 2VL7A 3BFKA 3AUAA 1DO0A 1SUIA 3DT9A 3EFBA 3FWYA 4GGPA 4NYJR 5JMPA 4G0QA 3SS7X 1QRUA 4IUBS 1Z6PA 4RY2A 5AXCA 1Q17A 2H2GA 1J9ZA 2VHEA 5ENDA 1GCAA 3OIDA 1JZSA 1G6Q1 1WDMA 3AU8A 3KSBC 5U4XA 1UJMA 2I2BA 1JQBA 4LHYA 4D9NA 1FNNA 1R0RE 3WLQA 5K0TA 2KPOA 4G0XA 3QVOA 1U3FA 4BKPA 3DE4X 2P41A 1OGYA 3ZGLA 1XTIA 1R5NA 2YMMA 4TYWA 3E1KA 2VZ0A 4KLZA 1C1YA 1U2DA 3NX4A 5AYVA 5HUQA 5FUQA 2FB9A 1BXZA 3HNPA 4IJMA 5B1YA 2QN8A 1VKNA 3RUEA 4DG9A 3GVCA 4H2DA 3Q3HA 2JD1A 1JIVA 4NQZA 4MS3A 3KPVA 3TNYA 4KFTA 3MLBA 3L7DA 5KTPA 3HO6A 2IPOA 4JQSA 4R6XA 1KO4A 1A2OA 2VA9A 3MYRA 3OHPA 4IIFA 1YRBA 4TLMB 5A7HA 4EX7A 2ZVJA 3AONB 1QHFA 1U98A 1AE1A 2B0CA 3CGWA 1UPUA 3N39C 4FDAA 5T6BA 4M38A 5C3MA 4UQPA 3PT5A 3BMCA 4OBEA 2J9FB 3PDIB 3PC7A 2Q1UA 1X1DA 2EC5A 4PNZA 1II9A 3HV0A 2B4TO 2CF6A 4FSDA 1CJUC 3W05A 1P2GA 4K2AA 2R6JA 1J39A 1I3NA 3UMJA 2GZHA 4WK2B 2ZWMA 4M8SA 3LA8A 3WIOA 4X1OA 5IKPA 2LCQA 3DO8A 2XMQA 2ZRDA 2X2PA 4XGKA 3QKRA 3NZEA 2JD0A 4MRMB 5HRAA 4L7QA 1YQQA 2C7BA 4A8JC 4RKQA 5K8IA 1JG4A 1DTWB 3KWFA 1KK1A 1YT5A 1DAMA 1YB2A 4U7JA 5M2QA 3R9WA 5LD2C 1Z2CA 3MHPA 1P5RA 4TTPA 1A9QA 4REQA 4JXKA 3EIUA 4PSKA 3IJRA 4MQ5A 4C76A 5THXA 5CDYA 2Y0PA 2UU9B 3WGQA 2G07A 3CRNA 4JLWA 3RJMA 3JATB 2H1OA 2C4HA 2GWRA 5FFFA 4G0PA 1V16A 1DJMA 4KXFB 2OHFA 4BJHB 1C0KA 1HL7A 1Q0HA 2XMCA 3JAWA 5SY6A 3D6UA 1TTQB 2BE9A 4ZJUA 5CB8A 4YQFA 4EF4A 4A92A 4HNAB 1UZLA 3GJ3A 1GZ6A 1NW7A 2BGKA 2IA5A 3KKMA 1VLHA 3MCZA 4K03A 1VJTA 2I7XA 4P22A 4ZZ2A 1K8QA 1IY1A 3RFTA 2IZ1A 1ILEA 4F97A 2XAUA 2NO4A 4H1TA 4PZCA 5A4KA 1MUUA 1YR2A 4B3JA 1J2UA 1KI6A 2ST1A 1HYEA 2AC2A 1FRZA 1HE4A 2PFSA 2V7VA 3CLUD 4P84A 2PA0A 3SXJA 3L01A 5JD6A 1XCMA 2VSXA 4KODA 3I9KA 3DZDA 5IMBA 4BLOA 3TTVA 5A71A 3T35A 2JJ1D 3ZEIA 1PJZA 3MQ2A 4IIVA 4W1SA 4I08A 2J30A 4Q4AB 4WOKA 1IDOA 2JGAA 3P4YA 1GY8A 4TL7A 4EKGA 1UK9A 1BQEA 4DJJA 3DV2A 4FYKA 5K0EA 4ZEMA 5JANA 4CM6A 1SQGA 2BFWA 2WMOB 4ZKEA 3D31A 4B71A 4K6FA 3V48A 2IXGA 4CI9A 3SKYA 3NV9A 2JGJA 4LI0A 2HMWA 1Y4DE 3BIFA 1GQSA 2C7GA 1DMRA 1MQ8B 5ER9A 2QTCA 3SZRA 2XUHA 1SC9A 3ZV7A 1O5OA 3HUUA 5DHFA 3IUSA 1FVFA 1P9WA 1DIHA 4KAJA 1OZHA 1U02A 2QN2A 4IJKA 4F0JA 4WZAB 3HQ4O 5G4LA 2IDKA 1W5AA 1LDMA 3BK7A 3RH0A 4MPJA 3GEEA 4BOYA 2I2AA 4N39A 1D8AA 1V4VA 3LBFA 4BV9A 2H3EA 3U49A 4K26A 2QD2A 2PUDA 1GZ3A 1IJKA 2GX6A 3M6VA 2MINA 1NJGA 4Z1MA 1HQYE 1C2TA 4C0LA 2GUWA 4CG2A 4YUXA 5I45A 2Z3VA 3OY7A 4S2EA 1E59A 1IN4A 3EFEA 1DG9A 1XEWX 1N8KA 4LRUA 1JH8A 5TNXA 3JQAB 3TLEA 1ABEA 2OQIA 2QN7A 3T4XA 3K1JA 3WSTA 2Q2NA 1UDXA 1C9NA 4ARVA 4DG8A 2OCKA 3VQTA 2HQ1A 2WQ7A 5AKEA 2OLEA 2J87A 3BRCA 2X0EA 1VRCA 4X7RA 4JEUA 3SQNA 2Q5OA 5BT8A 3AZPA 5SY9A 3RF6A 4MB6A 4QBKA 3OPYB 4U2GA 3V4SA 3DTNA 1SWVA 3L0CA 5BV1A 3M70A 3ZXYA 2HPAA 1F6WA 3WG9A 1H6BA 2QAGC 3SE7A 1F8XA 4KQWA 1AS3A 4HRYA 2QKYA 1KO7A 1V5GA 3V9AA 5KNBA 2XYHA 3KUDA 4BJ1A 4ZEOA 3AHEA 2WZCA 3Q5EA 4PLGA 2HCFA 1OB2A 4IDNA 4GAEA 3R7WA 3FLMA 1P1CA 1ZGCA 3R7FA 4R7GA 4O4LB 1MTOA 2BJHA 3A04A 4TMKA 1AF7A 2W8BA 1HMYA 3IH5A 3CPJB 1Q7EA 3PU6A 2ZIVB 4ZEXA 2FWPA 2R86A 5AW3A 3S2UA 4WLEA 1ZA2A 2ZE8A 4BNHA 3PITA 1UPCA 2BFEA 3F7OA 4TLDA 1KFKB 1RC1A 1KBQA 2XF8A 4ODIA 2O2YA 3IPRA 4BP3A 2FRVA 4ZFNA 5BNTA 2ECKA 2V98A 1X80B 1G8MA 1IBLB 1TX4B 3S5UA 1IH8A 1O4VA 2X7XA 3DE7X 1JQJC 3UPDA 1EG2A 2NACA 3GEHA 1SC4A 4R8RA 3RIEA 1QP4A 4PZDA 2CUKA 4HDSB 3S1SA 1Q0TA 4CF6A 3CGGA 3AGPA 2A88A 1E32A 2F43B 4D9IA 1A9YA 5EE9A 3GRKA 1IJBA 2W2PA 3VMFA 2ORED 3LKVA 1J06A 3A1FA 3P0IA 1UC9A 4M9QA 5GJBA 2PZLA 4G5FA 2ZRQA 4P58A 3IJ5A 3MJHA 3HZRA 5BVGA 3I2HA 2IOYA 1M6VA 1YC2A 3CEPB 3ICPA 4WY8A 4JZKA 4RVUA 3U3XA 3U60B 5DT9A 1HA3A 3HN6A 4RTNA 1YK0A 4JQYA 4BEBA 1EE9A 4G5YA 1NFFA 1H2AS 3AY0A 4Q3OA 3O2QB 1HFJA 3UN1A 2XT0A 1UOPA 4Y2JA 5JDCA 3U1TA 4V0NA 1MQSA 1G5TA 2H59A 2X40A 4Z54A 1L7VC 2R7LA 1P1FA 2GHTA 2RH8A 3U3RA 4BN4A 3JVUA 3EC2A 3AI1A 2UUPA 3D5TA 2A78A 1EJ0A 5G02A 1E1KA 1W4RA 2R1UA 4M1QA 3DG9A 4ZOBA 1G5IA 3S7ZA 4DLBA 3OTIA 2Y99A 2GKOA 3SR0A 1G59A 4KQ1A 1FRFS 4QOJA 5I7FA 2LP4Y 5ARBA 2X76A 4H6WA 3HBFA 2F9FA 1DC3A 5EG5A 4N48A 1PJ4A 3W04A 3K8QA 1O94D 2KM1A 3ETEA 3BF7A 3BC1A 3HXMA 1N1GA 2R1TA 3X43A 1LK5A 2NO1A 2W0SA 5CPBA 3KTFA 5YASA 4Y67A 2ATVA 4EFDA 1G66A 1MG5A 1YNOA 3RC9A 3T15A 4XWOA 5I9LA 3HM9A 1OTYA 3EEQA 2VDPB 3K15A 1CUVA 1Y4AE 5EQJB 5MN6A 1XMXA 1NDQA 1YJAA 2IZOA 3O8LA 3GRCA 3PNBA 4ID3A 3JXEA 5LZ5A 4Z2AA 4DC1A 4XUCA 5PNTA 5CEEA 1BXGA 4IXTA 4WBNB 5FBQB 4XASA 2RH9B 3ANMA 4M1WA 4WZAE 4INJA 4HZUA 5FLKA 3KJIA 3G5MA 1T5LA 1JA9A 4NU0A 1DKQA 5K1ZA 2FR8C 3W34A 1P0PA 4Z3OA 1P4GA 1MO4A 2D7CA 3QUSA 1N9ZA 3M5WA 3PIRA 4JDUA 1T1JA 5CCDA 4LJ4A 1LTHR 5J43A 3GBPA 3ZZ1A 1C3VA 4V1CA 3T41A 3PG5A 3ESCA 3EJ6A 4QPDA 3GQBA 4C7VA 3MC1A 5BNWA 4TV8F 3TTUA 2F1HA 3WSWA 4PQFA 4M1KA 3G9QA 3A6PC 3W2IA 4XVHA 1XZDA 2F1IA 3U0VA 1SKAA 1QH1B 3NNSA 1SKUA 2HNBA 2X14A 1GCOA 4DMCA 3OVMA 4DSZA 1GT6A 2Q6VA 3A2MA 1KVTA 1YFZA 2X7HA 3BZUA 2VQDA 4QU0A 4G9GA 3TQSA 1UINA 4S35A 3AF4A 3IUNA 2VKQA 4M9XA 5CITA 3HACA 3H84A 5AOCA 1YAHA 1MQAA 1PAUA 3WWYA 2OILA 4YP5A 1DE0A 3VU1A 2XZLA 1L5FA 2LBPA 5HTKA 3BIWA 4Z9AA 1TYBE 1NVGA 3W2TA 1MB4A 3RRXA 4KKVA 3UMGA 1VYHA 4MQLA 2FWMX 1I4EB 1T13A 2FNAA 3FUCA 4MQEA 4O2BB 2OFXA 4D82A 3GLFB 3P2MA 2P5TB 5FWYA 2JIOA 2OYRA 2PWZA 5I3CA 1IMJA 4HQ6A 2H65A 5GVSA 1NP3A 4AP6A 4X97A 3EB9A 2C3UA 1KS9A 3EXFB 3QHQA 3KPUA 3LC2O 5CURA 4A4DA 1VCMA 5C4IA 2JB9A 1NU8A 2QZ9A 3ZWCA 5GGXA 3A1VA 3MGKA 4FGUA 4RIEA 2LTAA 4OI1A 4TKUA 4CG3A 1B23P 4LYFA 4NBNA 5J47A 1WD5A 2HUNA 3HDQA 2QXUA 1SIBE 3DJYA 1E0SA 4RD2A 3L1VA 4IDQA 1R0YA 1UKBA 1HYQA 3TXYA 4AF6A 4UPEA 4IMJB 1YACA 3HRHA 4GM4A 1LXCA 3HCBA 2KJQA 4YVFA 1P33A 3MTAA 121PA 1I4OA 1KZ4A 3IUPA 2DR2A 1QB7A 5LQDA 4NENB 3E61A 1RHUA 5JIBA 2RAUA 4P4LA 2X8BA 3EGEA 3MRTA 2FUG6 4IXNA 2XYGA 3FPLA 3JRWA 4IZIA 4Q05A 5KNBD 3Q0IA 3RFXA 3ZKWB 1NUQA 1XRMA 1ORDA 1J7KA 1CJMA 5IT0A 2HSWA 3EHEA 2E1RA 3NTLA 1N7JA 5FYQA 5C0OE 4DIMA 4YUZA 4Q02A 3T9EA 4AJ9A 2WOJA 3I58A 5BYAA 2ESRA 4BAGA 3KQNA 1PV2A 1U3GA 1QV6A 3B3FA 2LDXA 2PG3A 1T26A 1S6YA 1E3EA 1FTQA 4EVQA 3M49A 1MX1A 3P9SA 3C3CA 2HT1A 1D2EA 1AURA 2AC4A 2Z09A 3B9QA 4GI7A 5KTRA 2VP0A 1RAIA 4Z99A 3ZE0B 4MMYB 3SEAA 4DWVA 4C2UA 4FOOA 4HUQB 2XE6A 1LDYA 5IKXA 4G4IA 3PNVA 1W93A 3LWBA 4AJ1A 1DWQA 2CLLB 2PQ6A 3IO3A 3IRVA 3WKAA 2HN9A 2ZSEA 4L27A 1JVSA 2WT8A 2AXQA 2ZSUA 4P0TA 1SBQA 3IVAA 1IRXA 2FMFA 3QY9A 3TQIA 5KOIA 1TZKA 3JRNA 1QH8A 4M4SA 1UC5B 4ZDIA 1DXYA 2GERA 3UHOA 3R3HA 4B3CA 2FSUA 2V6BA 4C0XA 2V7EA 4I6EA 3ZU3A 4DZZA 4L07A 2IPLA 5FO1A 3O9ZA 3HI6A 3FD8A 5B58C 2X9GA 4Z4FA 1AV7A 4KXWA 3PGJA 4R83A 1DEKA 1LC0A 3B36A 3V8PA 1Z4MA 1SXPA 1POWA 3DC2A 1T5HX 3F2IA 3WAKA 3SSNA 2R7KA 1VRWA 4P81A 4U00A 5DN9A 4FR0A 2J7PA 2ZP1A 4F11A 2YV1A 5ILQA 4DSTA 1QHYA 4DCGA 3I5XA 2J6IA 4GR5A 3HKEA 4FTWA 4FYIA 2QUBA 2IYNA 4DLVA 5TIIA 1WABA 1WSAA 3PQCA 4QD3A 1P62B 4XQ9A 3DAFA 1J4AA 4OAOA 5F5NA 4FWIB 1ADCA 3WNCA 1U1IA 3DMPA 1HZZC 2H1FA 3NGLA 3Q8MA 1VZ3A 2BGTA 2Q8PA 2YFQA 4AKHA 2CDAA 5F76A 1N2EA 1V6AA 1XZFA 5DV9A 2COKA 1Q77A 1DAGA 2A84A 4P5EA 3I2KA 4RMHA 4B32A 5JNUA 1VCIA 3AL3A 3TZHA 5KU7A 4LK2A 4O6VA 4C0HA 1MFPA 2GASA 4N4AA 5AKIA 4KR3A 2G9VA 5JAZA 3DOJA 5C8YB 3WBBA 3NKLA 2AW3A 1IDN1 1ADBA 2IDZA 3ISJA 1L1FA 4HY3A 1RQNA 3FWPA 3HVJA 3JQ6A 1MCZA 5E9WA 3CZMA 4ZOLA 2BMVA 3TVDA 1S1CA 2B61A 1VPVA 4OVKA 2VHYA 4XDYA 5IYZF 1UFRA 4RK4A 3B12A 1JPVA 3ZWPA 4E51A 1E0AA 4FDMA 1UKCA 1J97A 3ELBA 3L04A 4D42A 2QBYA 1W48A 3UMMA 2NSLA 2BMEA 4EI2A 1OAKA 3HPQA 5EERA 2C00A 1G17A 3I53A 2P91A 5HKLA 4DNPA 4JY7A 3HPRA 3LIPA 2RHDA 4HG2A 2X4LA 2YVQA 2G80A 1H1TA 1GXSA 3TRHA 3UA3A 4WADA 3R3WA 4D45A 4X20A 2QW1A 4RVFA 3JYNA 3JVDA 3KHKA 4YAJA 4EG6A 3O3NB 3QLJA 4W6ZA 1RXEA 2FPOA 1WCV1 3QE0A 1AKNA 1Z5NA 5AJYA 3UWSA 3NC1C 5CG2A 2I9KA 1NJFA 1BXRA 1XLWA 2O7QA 5T8KA 2O8NA 1CUZA 4R1MA 1NW9B 1QE0A 1DB3A 3LBYA 3LW7A 4GX1A 5U4QA 3E7XA 3TPFA 2QTVA 3WGIA 3NOQA 1QM5A 4Y9TA 4CKEB 1FS5A 3CUTA 3R6GA 4MDFA 2QTRA 1WJGA 2RK4A 2IY9A 1YMUA 2Q3JA 1P4SA 1RKVA 3E1SA 5DVZA 5F1YA 2EJCA 2ODQA 2Z1NA 1PS0A 2C5BA 2VLBA 3MIIA 2ZIFA 1XMPA 5HBGA 4RPKA 3HP7A 4P7JA 3KEMA 2HHCA 1SCNE 1U2SA 1KPHA 1JR4A 3RARA 3M6WA 2W2MA 1EWYA 4RDIA 1BJTA 1ZVMA 1WMSA 2HJRA 2Z3ZA 4B3IA 4TLCA 3U1VA 4DV3B 3A26A 5T3YA 3M6UA 3VVCA 3W5HA 3BH0A 3PD0A 4KFCA 4QUDA 1P18A 2R8EA 1LLFA 2VF7A 3X1WA 3IQGX 4MJ7A 3RM3A 4IQ8A 1ZDMA 2C8JA 3QV2A 2R4TA 1XLTC 1NSFA 4Y9RA 1GTRA 4MV0A 2PGJA 1R4AA 1FVOA 1FBNA 3QXHA 3U3KA 5BNIA 1IOLA 4MS4A 1E3DA 3AEXA 3OQ6A 4BQRA 4YRBA 1IUKA 3ENNA 4WZ6A 3OQIA 4LF7B 4KYUA 5BQ5A 3OQBA 1J2JA 5BNFA 3V4PB 3RHSA 4UBJA 3TAHA 3NHUA 2O20A 3UAYA 2YJ4A 3EQ7A 5ITZB 2AYYA 3ZDFA 4HX9A 3LGAA 4F2HA 4CKBA 4QTUB 4W5HA 4AS3A 3LBAA 1E3LA 4OJYA 5H82A 2OKGA 4IHAA 4BMOB 1HFKA 1NLUA 2R96A 4K8OA 1E1YA 3ZCXA 2G5CA 1C3JA 2AFVA 1VE1A 3CNOA 4E5DA 1PUXA 3T7JA 1H8ED 4CIYA 2VJMA 3V1MA 1DXHA 1XU9A 1SHKA 3EC7A 3OZGA 2GPWA 2IVZA 2Z5VA 4CCSA 2WMYA 4ETMA 1DCFA 1VE6A 3D6NB 1SBIA 2XKAA 3KYDA 3QWFA 4J03A 3UNXA 3DONA 1OB5A 5LXTB 3HJBA 4KUEA 5KVCA 2R6FA 2HDWA 4G5XA 3K0SA 1BVYF 4Q9IA 1IY9A 1M8PA 2PH5A 3N7UA 5CDFA 1PYDA 4CDRA 2BMWA 1DJNA 4TYYA 1VGRA 1XTBA 2P4SA 3GFRA 3R40A 1HT1E 4D8XA 5ARCA 1T2AA 5KTNA 3FPEA 5B57C 2CL0X 1RPJA 1GNRA 3F8TA 1I0ZA 3SQMA 1EUCA 5B64A 4LVOA 1SVLA 1JKFA 1VJGA 3ZJ4A 1SCAA 2B7BA 3AOGA 4DOMA 2R4UA 4RXUA 3EVZA 4U6NA 4IHKA 2Q5LA 4KFSA 3WRWA 2PS9A 1T0HB 4EJ0A 4DPMA 1VSUA 1EE2A 2LGJA 5A5DA 2VOJA 1KOJA 1TTHA 2A0KA 2AVDA 2FSVC 2FUNB 1Q0QA 2QTNA 4CM1A 1GFWA 3BFPA 1U4SA 3GIDA 2ISSD 4ZPXA 2PDAA 5F51A 1HYGA 4PLPA 5I8WA 5CVVA 3IP7A 5CA1F 1WOMA 3MTBA 1P7WA 4CIAA 5L4SA 1EH5A 1O9GA 4KVAA 1GUFA 4Z4HA 1TYCA 1W44A 4M6WB 3PI7A 1EM6A 1RYNA 3EGVA 4NK4A 3E48A 2J48A 1YOVB 4LV8B 1QZXA 4DNFA 4ZI2A 1KDPA 2IYVA 2IOQA 3AUTA 3BORA 1CY6A 3EJWA 3GLHA 3Q9SA 4ROTA 5FLEX 3ZHZA 4US0R 4D0RA 1ONNA 1V3TA 1A2BA 3PFHA 3AB7A 5FNVA 2ZWIA 4U2FA 3DDZX 3ZN2A 3FCUB 2G0NA 2Y0CA 5F7XA 3SHOA 2BJVA 5JCJA 2LUOA 1L5KA 4PPYA 1TUEA 3U5TA 4AVYA 2XSZA 4V0LA 5DI3A 4LDRA 1OCEA 7GPBA 1U2DC 1QK5A 3CINA 2FSIA 4ZVNA 3PR3A 2QVZX 3PA8A 1D1SA 2GCEA 3KKNA 3QE2A 2DUMA 2PUWA 4QUBA 2CV1A 2VOEA 3L02A 4QLBA 5BR4A 2H85A 1FS6A 2I71A 1EUDB 1BTOA 5IX8A 1LNSA 3FZGA 3LOQA 3W3ZB 1KO1A 1L4UA 3OCZA 4LXGA 2B4QA 2CNLA 2ENUA 2VNAA 3DVAA 2VTKA 4ZVOA 2JFGA 2XWPA 3T7KA 2BFAA 1C7QA 4FC6A 4LCJA 1O9BA 3ECCA 4ALNA 4C05A 5CCEA 3ADBA 3IL2A 1YOVA 3SIRA 3U61B 3WV4A 4KRFA 2LIPA 3L4BC 1CULC 2OYSA 2PLAA 2NO0A 3KSZO 1EUQA 1UC8A 3VVBA 3I4FA 1YVPA 3R5HA 4DV2B 2XGOA 2F67A 4FHEA 3GXBA 1DL5A 3AQIA 3IBGA 2XXBA 1B42A 1ONBA 1XD9A 1OYVA 2IIQA 3E9CA 3M6MD 1ABFA 3B20A 4MV1A 3R0QA 1I2CA 4DUGA 1CDDA 1SC3A 2HRBA 4GSLA 1U4OA 1XJWA 2P4UA 4FD2A 5CXQA 3OMLA 4UNRA 2C77A 4DDWA 3QJGA 3L8YA 1XZAA 2W00A 1B26A 1FP6A 4ZYWA 4WK0B 4H4CA 1I3MA 2FSFA 4O2AA 3V33A 5MF6A 3KS9A 3A14A 1R0ZA 2R84A 1JDVA 1Z4KA 4FQ5A 4L1KA 4QUGA 4LFBB 3O8QA 1E6CA 2LV8A 4H27A 3RD5A 2IUEA 1IK6A 2D2XA 5A6VA 1JQEA 2JGNA 2P9BA 1MAUA 3P32A 2X5JO 2ZYVX 1XIVA 3Q3EA 4QJ4A 4YP9A 4DKJA 5KS2A 3ICQB 1IU9A 2OZLA 5FR2A 4K2HA 5FQOA 4GOKA 2AMJA 4QG3A 1L5HB 4PAWA 5K3FA 3AL0C 4KNYA 4KQEA 2JLUA 1TOAA 2A58A 5L3QB 2MWMA 1NQUA 5IDYA 5TLSA 5AVTA 2WNHA 4NOJA 3TH5A 3LD9A 3I0NA 1NVEA 2ATIA 4RIFA 4XOUA 3TRJA 2JGIA 3CKLA 3D3NA 3HO8A 4HGNA 5AJTA 1LSSA 2B8JA 2FW6A 3LHFA 3X1KA 3TIVA 4JJ8A 1VDZA 3QXCA 1O94A 2FEPA 4P0QB 4PN7A 3SSAA 1Q7CA 2D3WA 2PIAA 3CVYA 4L4UA 3EGDB 3F47A 4MKIA 1ZM9A 3G0BA 1RI5A 3CLTD 4ENPA 3LRTA 4U7WA 4U0JA 1LDBA 2VH1A 3KTDA 2VTVA 3GMTA 1G18A 3ANTA 4J3FA 2PK3A 2W48A 4O5AA 4OK5A 3H11B 1RYDA 1G5PA 4OXIA 1BCRB 4KFRA 3O8CA 2BTOA 1NYTA 2HBZA 1ZN9A 3G2OA 5FJJA 4MA5A 1YCGA 1NG1A 2QP9X 4YN3A 4ZYZA 3S8EA 5KQSA 3IXQA 1Q22A 4ONEA 2QV0A 2VPZA 3HKBB 2Q9CA 4DF3A 1ZL2A 1EWKA 2YWCA 1XDWA 2VJDA 3F5DA 3T9AA 5H16A 4DCUA 1B8VA 3LHDA 1F14A 2EG5A 2XLCA 5AHKA 1PV4A 3H04A 2H7CA 1CCWA 3FN4A 1EZZA 2G7ZA 1I2ZA 1S2GA 2OE2A 3A4TA 3IKLA 3NFYA 4QU9A 5AW9A 4B0PA 3MS4A 4BAUA 1L7PA 4HEJA 1DBVO 5DM2A 2FWNA 2WTNA 5EJAA 5HQTA 4MTCA 2JEYA 2HU7A 1G6KA 4PF1A 1OPRA 3QE3A 4MKHA 1FYEA 1WX1A 5BQ3A 4K0KB 4KR6A 1X1TA 2WVGA 4J0FA 1XD8A 2Y1FA 1FTGA 2QZPA 2R8RA 4I4IA 5ESWA 2LVBA 3W5CA 1HUQA 5EN4A 5IH3A 1IZYA 1BFDA 1JIIA 2QJTA 1AF4A 1E4EB 5JNSA 5KSZA 1RI3A 1RD4A 2OZKA 3H99A 5F9FA 2VQEB 1QX3A 2EFDB 3QX8A 4HSEA 1GG5A 4NU6A 1L9XA 1Z88A 5BSWA 1SVOA 1MABA 5TV2A 4OHCA 1MN6A 1QMGA 1V3QE 4FZJA 4RWZA 4DGSA 1Z5WA 2I6FA 1TCBA 1YDWA 4HTFB 4TQGA 1WB4A 4LPSA 5F3WB 2QPTA 4NBKA 2FH5B 4LYAA 1VB5A 2QIPA 3PPXA 1AXRA 4L9AA 2PKYX 3STWA 3KKZA 3ASVA 3DLIA 4JLBA 1NRXA 2YJ6A 5GIPE 4QOSA 4RVDA 4F5ZA 2EXXA 4PTYA 3EXIB 4YRPA 4DADA 3GWZA 4Y98A 3E9ZA 3N59A 1XTPA 1AC5A 2QLBA 2VF2A 3A1UA 4TT3A 2A4KA 3RVLA 3TLGB 3AQ4A 3A70A 2ONKA 3CEMA 4R2XA 4BTVA 3KSUA 1V1RA 1N2JA 5D85A 2A7QA 2FK8A 5KVVA 1P7ZA 2I6GA 1M7GA 4AKEA 2IQIA 1K5DA 3AR7A 1KEZA 2DPGA 3I1JA 2XMGA 4UE3S 5ALNA 2VJOA 2B5WA 4X24A 3OUUA 3P9KA 1CRQA 3EZYA 2G67A 3MWKA 4R2LA 3SM3A 3RAJA 5BQOA 2Q9UA 2RSLA 5A1TA 1YQ9A 1JPUA 4BO7A 1FFYA 1CQIA 4XDHA 4YA6A 4RPHA 1WHSB 1T1GA 2WJYA 1IVYA 3F6BX 1LJLA 4JC5A 4UHBA 5K0CA 3IAM6 3BE4A 4V2IA 1HRKA 4QAQA 2GBPA 3N6RA 1NP7A 2CXOA 1NVKA 2RH4A 5CYOA 5DXAA 3UJNA 3HO1A 4Z0NA 3MN1A 2E55A 1UKEA 2DR3A 4OPMA 5EINA 2BGLA 1ND5A 2F8MA 4LYYA 1GSIA 3RTDA 2EFYA 2ZJ3A 3TLGA 4KL8S 5B53A 1ZH0A 3P4UA 3A3NA 5DRYA 3RVDA 1CRPA 3NDIA 4MO9A 4OQNA 2R6HA 3D8RA 4UFPA 3DEAA 5IUKC 3AL2A 1YI0A 3JS5A 3OKPA 2XGJA 5DPMA 3K09C 4MQFA 4CRWB 4R8MA 4Q4HB 5BP7A 3O0TA 2FR8A 4EB3A 1LI4A 1YJQA 2VWPA 3R3SA 3H2JA 3NU1A 1W88A 2ZE7A 3GA7A 4L4ZA 1E3TA 1U1EA 3IT2A 2GB4A 4MI3A 1YJBA 2Z2YA 3KG2A 3KEOA 4QO8A 3GQVA 4WOPA 1RRKA 1IJEA 3SJCA 2A5JA 2XI4A 2GBCA 1ZOLA 3TDKA 5HRUA 4UUMA 3UB2A 5JAMA 2YINC 1VYUA 4TZ6A 1NJ5A 5HZGA 4V0RA 2CWWA 2FYTA 1QIHA 3ME5A 4GLOA 3O83A 3PICA 4RL4A 1JILA 2IS2A 4L2IB 2NQ8A 3PX2A 4PG8A 3KVRA 1NRWA 2H2FA 1ZIOA 5L3VA 3B6EA 3ESZA 1UMBB 5CB4F 1H4SA 1YS7A 2PWAA 3AWIA 2HFJA 2X8LA 4CL0A 1PVOA 2ATXA 3KQLA 1T8WA 1ZCJA 1KMQA 1E3IA 1FFWA 2BM0A 4J9VA 1NBIA 1AUXA 3DDCA 4PSDA 4BJ6A 3MB8A 4BNFA 5IN4A 4MVJG 2I3GA 4Z6KA 2FPKA 1QGOA 5JISA 3N70A 5CM8B 3UJ9A 3HB5X 4KBYA 3RNLA 3OY2A 1ULZA 3I01A 3IJEB 2H4FA 4ZT2A 3R8XA 1MGOA 3SGLA 8MHTA 3TJRA 4CKCB 1QR6A 1X42A 4A1FA 1W36C 2GAIA 1OHHD 3LKZA 5AQEA 2WF7A 1VLMA 2X6TA 1P2VA 3SPXA 2BFFB 1W4ZA 2CK3A 2XUZA 1WP9A 3F5MA 1LLDA 1S4MA 1XAGA 4NRDA 5B30A 5E95A 2ZAMA 3CZ4A 3NM4A 4C4OA 5JARA 5ICGA 4MGZR 2XSZD 3ER9A 1C7ZA 2W83A 4H3KB 1SBHA 5BMVA 4D97A 1UBLS 3L9WA 1E2EA 1WF3A 3A1EA 4KHPB 4R31A 2G4LA 3SD7A 2YR0A 2K7FA 1NW4A 3UW1A 2RI6A 4XDZA 4F4JA 4JMLA 5ERGB 1N2HA 3X2SA 1C1DB 3S0JA 2L0XA 1LX6A 1PJCA 5CVCA 1QORA 2GAOA 2AWOA 2FCRA 4KN8A 3WHIA 4DMLA 3MMSA 1RJ9A 4ENUA 2AOWA 2NW6A 1YQXA 1I13A 3SHVA 5IAEA 4CMAA 4AQ7A 1IIRA 1E0KA 3ABSB 4UXJA 5FHQA 1RPZA 3C8ZA 3QI2A 4W8HA 1BIFA 3NBKA 4H9GA 3D1VA 1Y1PA 4I46A 4JVLA 4IINA 3TZLA 1N6HA 4O2BA 4OHKA 1FNSA 1AZSC 5AOBA 3HDTA 3EXHA 5HM8A 1U2ZA 4IIJB 4LNUA 4BNJA 2XUQA 5DWQA 3WGOA 3ONDA 2IYUA 1BVUA 3EXEA 3H1TA 3OO0A 5F35A 3LC1O 4ZT4A 4XWKA 1NF2A 1TXGA 3T7TA 3T7RA 4PBSA 5CT5A 4GO1A 2C82A 4JVMA 1XMSA 2FAXA 3FPFA 4E2ZA 2PM8A 2Y67A 2ZR8A 5A02A 3MFQA 7MDHA 5JYBA 2C1EA 4IJ6A 4QPZA 4QECA 3LDHA 4JYMA 2OORC 1JG1A 4EKEA 1F12A 1OWOA 3NC4A 2C0PA 1M2OA 5CHYA 1Z3IX 2WYVA 3O1LA 3GHYA 4K87A 2X0RA 2WF5A 2HXGA 3P71T 4Y9DA 3JQRA 1VL5A 4AL4A 1FLDA 2A5DA 3H1EA 1RQ2A 5SZIA 2EJVA 1EP2B 4E5PA 1AY0A 3DXXA 3CTPA 3G9TA 3H5VA 2CW5A 3OJWA 4GC9A 4MR9A 4ZT5A 2HQSA 3CV3A 4QDJA 4JI4B 2VYVA 4G09A 1H4QA 3K71B 3VZSA 3FB4A 4MI9A 4MB0A 4KAFA 1DBQA 4N6OA 4YREA 2A2ZA 1PSDA 3CN9A 4FBLA 4K46A 4PLYA 3T7CA 4D81A 4QXQA 3LSYA 3NT5A 2YRWA 2QTFA 4MUJA 2V0CA 3K0AA 5SZJA 3ZW7A 1KEKA 1XK6A 4JP5A 3FOWA 3UGTA 4KGZA 1SRQA 2XOKD 4PWYA 4IF4A 2NU7A 4F84A 4J7AA 1E2BA 4JNCA 2GHRA 4YRIA 2WWXA 4PAGA 2FGKA 3O92A 4EAAA 3H2YA 2Z2IA 4YJ3B 1QH8B 4S0ZA 2W90A 3H13A 3H3FA 1CB0A 4R2IA 3U9LA 4EW6A 2DMRA 3HFRA 3VPXA 4FKBA 4Y1RA 2Q0XA 3R2JA 1SCJA 4ZTUB 2HIAA 2R8OA 3DTVA 5A4FS 1FU7A 1QPGA 3H8JA 5DYYA 4D4IA 5F9HA 4PFQA 3ZCVA 1KU0A 5JBIA 3V7YA 3UPUA 1ISGA 2H0AA 4F38A 2X86A 3QPBA 1SXHA 1PNOA 4P5DA 4FYYA 1JMVA 4UNIA 5IS2A 4GPZA 3RYHA 4AZ3B 2V3CC 4C9BA 2IUFA 4D9BA 1KMHA 3WO1A 4G4GA 3H1AA 1JG2A 1BMTA 3EG5A 4UEOA 3H17A 4WUTA 2CYAA 3TINA 2ZIXB 4DEYA 4P3KA 2NAPA 1QS0B 5A03A 2Q49A 3AB8A 1YB4A 4NBRA 2NYRA 2ERYA 3UAGA 4YCDA 4D0SA 1M34B 4JUFA 3MQFA 2NUTA 4JP8A 5C7LO 3I0ZA 5DJ5A 5B37A 1R4ZA 1WCWA 4E09A 5MGNA 3L8FA 3CPHA 2OSBA 3JD1A 2WFLA 4KLCA 4Y0AA 4ZHSA 3U4DA 3HH8A 3BJRA 4RESA 5IM4F 3G88A 2FPLA 3BSWA 2DUWA 1DGQA 1NLMA 1NF8A 5DBFA 1GPAA 1PQUA 1JTEA 2UKDA 5A9TA 1IG3A 1T15A 1YULA 1YUMA 3MMZA 4LVNA 1JEYA 5HNKA 1LBEA 5C8YA 5GMOA 5ICSA 1CXZA 2NV2B 4NZNA 1I24A 1PCXA 1XROA 2B94A 1WRBA 4YMUA 2X9VA 4ZAXA 1NUAA 3DZCA 3ZV6A 5J2TF 1XZIA 1YR7A 1GNTA 3KOWA 4REOA 3I5MA 4TOIA 1DX9A 2GK7A 3V8BA 5DBGA 4XLLA 1ZC4A 4BIMA 3K09A 1XTRA 3CYFA 1G8KA 3KWLA 3CZ5A 3MD0A 5AIBA 5J2UA 2EOAA 1OASA 1BKDR 2CJFA 3UHFA 4X5OA 5EIBD 1SBNE 2JLQA 4H4DA 3KR1A 4KB5A 1BX1A 2VATA 3DZJA 3TECE 3WK5A 3L4KA 1QQBA 5A0VA 1J1IA 1UDBA 3C15C 3KJHA 3NAMA 3BQ9A 4HGOA 4P53A 4YMWA 2DU8A 2QP3A 1ODCA 5LQJA 4MVJA 2A59A 1OE0A 3T61A 3G02A 1A9SA 1E5VA 1M7BA 3GD5A 1QHEA 3IP5A 3LA6A 4MKZA 4WUVA 3BAZA 4YK7A 5FUXA 3RSFA 2R97A 4DCVA 4E5SA 4CKWA 1IWOA 1E69A 3FBWA 3P2IA 4F06A 2BV3A 4QFMA 3X3HA 5BVHA 1CR4A 2HW8A 4MWOA 3PNMA 2ZJ1A 3TL3A 4JLJA 4MEJA 1D2GA 3UFBA 1N9GA 4NF2A 4BFZA 3UATA 4ER0A 4JQCA 1UBMS 2F7SA 4P4NA 5B55A 1ZM2A 2FEAA 2DETA 3OJFA 3QMWA 4F4CA 4EFMA 1NA5A 3TTTA 1W19A 4UM9B 3W7VA 3G85A 2Y2UA 1J70A 4D8VA 4JSRA 3USZA 3GRFA 3W1VA 3GPLA 1H1DA 2HOQA 2VXBA 3B1YA 3M89A 5LSAA 1SG6A 4Q3BA 5J2UB 1UPFA 2CXSA 4MYCA 5JAPA 1RQXA 1O89A 2DWOA 3QELB 4V02A 2LKCA 3A3PA 5EMJA 5H81A 4B3RB 3BTOA 1C3XA 1OX4B 2PAFA 4GPD1 2XTZA 3L0YA 3PX7A 5CIQA 2YMQA 3IUYA 3LXRA 3A6ZA 4C7MA 3AMVA 1VL0A 1UBUS 2YNMD 1G8PA 1UFQA 1EDZA 3QEAZ 1FDWA 1O6GA 3GC6A 1A50B 2PS1A 4JBYA 3TD2A 1TA9A 2JGEA 4MS4B 4RH1A 1W29A 5KO2A 2JG3A 5LZ2A 2YQ5A 5CM9C 4UTRA 2QW8A 1DNPA 3GAZA 3VFDA 2W6NA 3PEWA 2FSPA 2M6SA 1J8FA 3LOUA 2C5LA 2JEOA 3O8OA 3P9RA 2IV3A 3SCZA 2FZCA 5KJCA 2ZUVA 3CUKA 3N7TA 1MT3A 4QGSA 4PRLA 4QBIA 2FP4A 2DPMA 4R2WA 4LYEA 3OQIB 3TK1A 5LMZA 1QX4A 3EPJA 4FGLA 4CTJA 1Q7BA 2YWFA 3JZDA 5T6MA 3E8XA 4IVNA 4LSZA 4EYKA 3PXDA 3NVMB 3TIGA 2C7QA 3HXPA 5FBVB 1XMOB 1GZSA 2UAGA 3K9LA 4TZTA 5G4KA 3GZJA 2EJUA 2A8YA 1CKEA 2IX3A 4K81B 3V55A 3V4ZA 1QCDA 3SF8B 5AXDA 4CQMA 2AOUA 1BSVA 4KLAA 1VI6A 3LH5A 1U0JA 2R8XA 3ACDA 4KJZA 3S3TA 3BSFA 4I4LA 2QLLA 1WPXA 2J3DA 3CZRA 1FMJA 1Y7TA 2Q4BA 5JLAA 2ZYWX 1EDBA 3BMQA 1C7IA 3FHJA 3R5TA 3VSEA 3LW8A 5JJCA 3ZY5A 4EABA 2BEVB 4F85A 1RYYA 5I7WA 1LW7A 1KJ8A 4HK4A 1SHJA 1VIDA 1ECPA 3D4NA 3H2SA 2JGFA 2G1JA 4O25A 3VHXA 4D3XA 4TWJA 1ZGZA 2IHUA 2UZ1A 3CW9A 3LO5A 2YXPX 4RNDB 2WHQA 1L3IA 1ZRSA 1L7DA 2B1IA 4IEFB 4RQTA 2PO5A 3C1OA 3F49S 2JW5A 3VR6H 3GFPA 2ZROA 2AUMA 1X9GA 4B6RA 3ZHBA 2BKLA 2UVPB 1UK6A 4WDRA 3G6WA 2YYZA 1AUVA 1VG9B 2ZYTX 2XODA 3O73A 3RQSA 1UDAA 4ILKA 3ZWKA 2C54A 3S1LA 4AZTA 3N75A 3P2EA 2E7ZA 1TM5E 5K0SA 4MS3B 3RUHA 3S99A 3BICA 1HL3A 1T9CA 4ZT7A 4ZVRA 3RIMA 3MEQA 3RJZA 1DP4A 3H4MA 4MW6A 5DM60 2QTWB 1XQYA 3T3MB 4WJZA 3CC8A 2B37A 2GFHA 1M2WA 3KNZA 1D9ZA 3BMCB 3ND5A 1N1MA 3TOVA 2DFVA 4RKFA 4DM7A 1TAHA 3VPAA 2DUJA 1UAAA 1EG7A 3GU3A 5KOHB 5GONB 4JKYA 1L7NA 3N8IA 5EESA 3NIDB 1KE1A 4ZYUA 4TQUS 3CX4A 1NVVR 3W8FA 2NTJA 2IYXA 1LX7A 4TS9A 1II0A 5DHRA 5DGDA 5A4JA 2G25A 3HR7A 2OHGA 5DSTA 5AVVA 4ROSA 4WT7A 2PUFA 1IZ9A 3D4PA 4LISA 3OZCA 4PGFA 4PZAA 5F3RA 2HV9A 3EZLA 1S3IA 3DEHA 4FYPA 4MUYA 4P7BA 2WFAA 2GXQA 4QQFA 4WZBA 4XH9B 3WC4A 4F6LA 3LUPA 3L6OO 1CZHA 1UAYA 3NHBA 4Q3AA 1UPTA 5A9SB 1B15A 5AVQA 2BRUA 3MUEA 5TGDA 3RS0A 3EULA 5E0KB 3HY4A 1Q84A 3GCZA 3ONWA 1TEXA 1SNYA 3DVAB 3S2EA 4FKMA 5LP6A 4CXMA 3AM3A 4PYIA 4L0MA 4I2VA 4DR1B 4UU7A 2WM3A 4EKYA 2D3TA 2RMKA 2W6JD 2IEDA 1X38A 1CVLA 4QU8A 5DK4A 2ZQZA 1FEZA 5DO9A 5FWDA 4GD3Q 2QR5A 1OPXA 2JD2A 2QJFA 1OBVA 3LFTA 4B75A 3D43A 2Q5HA 1ESZA 1WPRA 3OJOA 1QHIA 4N7MA 3E9RA 4I14A 4YXFA 4DXAA 4UXHA 4KQHA 4LE2A 2QM3A 1C9EA 2A1UA 2AFRA 1JFLA 4MPRA 4L50A 1GPWB 1TUBB 3PENA 1JYSA 3R4VA 4MV6A 2NZWA 2HLHA 5DOZA 1VGVA 3WL5A 3THXB 3HGQA 1U1CA 4LZWA 1ZRMA 5H0IA 3O4VA 3O93A 1QK3A 1YRAA 2FEMA 3H2HA 1X19A 1GKKA 2H1VA 2ZTUA 4EEZA 1PFQA 3ZGYA 2G5TA 3EAFA 1W87A 2IZZA 3FNBA 1CVIA 1M9NA 4O4HA 2AFHE 5JR3A 1NNSA 3KLBA 5DX1A 3M1IA 2DH6A 1Y6JA 3DV9A 1H4VB 4CGYA 3IAS6 3K8ZA 1DX4A 4YHBA 4W1QA 3HRKA 3TEJA 4WD3A 4JXXA 2Q7OE 4ZRNA 1AK2A 3AR5A 1I33A 2WOOA 2WAXA 5C3UA 1ZJYA 4RTMA 1J49A 3U7HB 1P6UA 2CGEA 1WM1A 3HL4A 3O0DA 1Q6ZA 3DULA 5IHXA 3TM4A 3D54D 2MINB 3TBHA 3WXMA 4ZO7A 3TLAA 2OMKA 2J33A 2P65A 3BTUA 1E7RA 5EP3A 3VHRA 4F45A 1SGWA 2VUIB 2WNSA 1BOOA 2ZOSA 4GMHA 3IA2A 2JDID 2G8NA 3ACBA 4I4TB 2BFOA 3H6KA 4L8WB 4MINA 2IVFA 4WZBE 5CFLA 1P0MA 1YR9A 3IXLA 1DADA 1W4CA 5CAEB 3LMKA 1PD1A 1PUJA 4JL6A 4F56A 1X7WB 5FI5A 1SXGA 4J07A 3NDBB 2NUAB 5DX0A 2PSDA 1WUHS 3ICWA 3DE0X 1XNRB 4MKXA 4XLTA 1XCGB 1T24A 4E7OA 3WHKA 5B6IA 1CY1A 1V96A 3DPSA 4M1TA 2A9KA 4RHXA 2XQGA 4ACBA 2OGTA 2QUKA 3CRQA 2EG9A 4U6SA 3L6EA 1QOPB 1EDEA 1PNTA 2BEJA 3UMFA 3GO4A 4CM8A 3GLGE 3CF0A 1E6EA 1IN5A 1EGAA 1UQTA 5BSTA 3AEZA 1ZD8A 4QYTA 4LV5B 3EOZA 3KFLA 4I66A 1KVQA 3K72B 4CMIB 1SCUA 4PR3A 3ND7A 1ZS9A 5EZYB 4HC4A 4BBJA 1SUPA 4FI3C 4YECA 4JK3A 3L6CA 3GJ0A 2HRQA 4DEXA 2DG2A 4OM8A 4R81A 3SHWA 3QNMA 4XXHA 4ENVA 2BKVA 3SEFA 1G5RA 1TLLA 2OD7A 4PICA 3ELYA 4UM7A 3VZCA 2QMEA 5DF1A 5FOUA 1XDUA 3VKHA 3CF6R 2R3SA 3DF9A 3ISVA 3JZMA 2PUTA 3MYYA 4ZU1X 5B36A 1PD0A 3Q72A 1QDEA 1UBCA 2MSNA 1XCLA 5JPIA 4P3PA 1D6MA 4FHCA 3BSSA 4XPIA 5AJHA 3T1YB 3QKWA 2QZJA 4JL8A 1FE8A 4LEIA 1H9CA 1QSGA 2ZE6A 1SZPA 2D1TA 4F2GA 2GPYA 1ABBA 2G82A 4JB3A 2CMGA 3AKCA 3H9CA 2GSDA 4W5QA 2CXPA 4TXNA 2C03A 3NWBA 3WDSA 1NYRA 2CYBA 3H2GA 4BQEA 2IP4A 1ITZA 4BNNA 2W8ZA 2AXPA 5GPBA 2IKQA 2VP6A 2JAOA 3NONA 2I6QA 1KI1A 1M6HA 2J5QA 3DAHA 3NKVA 5E7QA 3IR7A 3BZBA 3RFFA 1YZFA 3AM5A 3E27A 4LHSA 3WNQA 3LTNC 4GM0A 2ONZA 3AJ9A 2O2CA 3NBUA 4E5MA 3MGAA 2O7NA 4KBFA 1Y34E 3IMCA 3AEQA 3PT9A 2REBA 2QJWA 3NVAA 5B1DA 4F2PA 1MOZA 3F3SA 3WIEA 1ZH2A 1WXXA 1E2PA 4NOLA 2JFZA 1BW9A 2DFPA 5KJ6A 1EVYA 5AVYA 3KDAA 2QHXA 1MX5A 3HYCA 5KWSA 4WJKB 1MJGA 1SO8A 2AT1A 3D6JA 4FLEA 1PUIA 4GVXA 1KBZA 4TRRA 1KI9A 4A10A 2QSJA 4S1OA 2O8EA 4J29A 3ICVA 4N0DA 4E46A 4DV5B 4PQEA 4QNMA 4JASB 1UC4B 1XC7A 1RKUA 2WDPA 4N5DA 1GPJA 1VFNA 4O4HF 1I0LA 4DCNA 4CHTA 4QKQA 1KP2A 4HYTA 3ETGA 1WB6A 3KZVA 4M89A 1GKUB 1CLUA 3NBZC 1EX6A 3RS9A 5ALWA 1BXGB 3TUJC 2ZB7A 2C58A 2F3PA 3NJ4A 2BKEA 3FMIA 5GJWC 3CR8A 1U0LA 5ADVA 1DC7A 3FYDA 2HDHA 3EQ8A 1GLVA 4TVBA 3RUIA 2GZ2A 5IKMA 3ID6C 4D56A 3UFXB 2CCKA 2VP3A 5KKNB 3NANA 4Y6QA 3HJTA 3IE2A 4B8YA 4F5DA 4QA9A 1K9SA 4KPUA 4D9MA 4HQFA 3RKSA 4FWBA 3QRWA 4DMRA 2EKLA 5A5EA 1Q0ZA 1PIWA 3R7DA 3U16A 4DV6B 3QKIA 3GLTA 4R40A 4RD3A 2RBKA 4BCCA 1VHTA 5HS6A 1CIVA 1XPUA 1DJLA 2F1JA 3UHAA 4AYXA 2YOGA 1N25A 4H0NA 3BS4A 5FULA 4UTPA 1L1EA 3RKRA 5CXXA 4C0SA 1UXJA 2EYUA 2E2WA 3DB1A 4YCBA 4Y2RA 3ZCSA 4F3YA 2ZM6B 1PZGA 4LXYA 2FJ0A 4UAVA 1W7AA 1FK8A 1BS2A 1PL6A 3FYUC 3M6LA 3HYRA 4O0LA 5G3YA 2WIJA 3C8HA 3DNPA 4B76A 4BX9A 1M5TA 3DBHA 4Q3EA 1A9RA 3OPVA 3A6GA 4URZR 2R68A 1DC6A 1SJ9A 3L41A 4EK9A 4GBGA 3SBOA 4HNVA 1ORVA 1MO3A 1N3LA 1EUZA 2RGBA 2PUVA 3PDJA 2JKZA 2EEZA 4R8KA 3WLHA 5EJFA 2FMUA 3HXKA 4DLUA 1KZGB 3OZSA 2VKTA 1H9AA 1NBEA 5KQGA 3U56A 1CR1A 1T1EA 2H63A 3KXPA 4XIYA 3ESRA 4AY3A 4E6PA 3HYTA 2BW0A 5HTOA 5JXWA 1VJ1A 4H7KA 3E9QA 1Y48E 1HM5A 2FR0A 2KS6A 3LF1A 2ASVA 4EKDA 5LUAA 1KI4A 1E60A 1SFRA 4J0CA 1MOSA 1SU4A 5NULA 1ESCA 4GQBA 1HLFA 2V4UA 2CDBA 5FUVA 3E5RA 4MQ6A 2JGRA 4BMVA 3ODGA 5HVNA 4GL2A 1WQ3A 3MJDA 2F1OA 1TADA 1PR4A 3HB9A 4FE4A 3NS7A 4I5GA 1IHPA 2ONYA 1CS4C 1OTHA 2DKOA 2VPXA 3SZGA 4CM9A 5LLTA 2FTKE 1G1AA 1KFJB 1I14A 2WF6A 3K94A 2HSDA 2OR3A 1T91A 4DDUA 1E7SA 3OQVA 4DMFA 1X9HA 2BLNA 3ZCUA 2YOFA 5JS8A 4GPAA 3EUEA 1RLMA 4OO3A 4OM7A 5D7BA 1U90A 3W6UA 1LW6E 2EZTA 3VR5A 5U1PA 4FUTA 2BBOA 2WWTA 3LF2A 2IY7A 5DI9A 1AKEA 2NPIA 2G1AA 4G25A 2X0DA 2G04A 3QVTA 4JENA 4BLWA 3GVPA 4P0PB 3FPKA 4J43A 1JEDA 4GUDA 3R9XB 5EOVA 3KAPA 1ZXBA 1S2LA 1ZY2A 2ZVDA 3C39A 4Z49A 5I4KA 3OKCA 1P4AA 2CMKA 3QM1A 3RLIA 2RKBA 4BGDA 1O2DA 2AEMA 3WE7A 4BC1A 4KN6A 4RDXA 3VPSA 2E3JA 2H16A 3U37A 3WB9A 2W2XA 2VDQB 2GHQA 4FMBB 4EG7A 5IBQA 4I5IA 2C20A 3RS5A 1IZ0A 3L7CA 4DDMA 5KSOA 2OCDA 3FFAA 1GUBA 1Q74A 3DZGA 5DIFA 3FLAA 6Q21A 3KDPA 5IT5A 1T29A 2IZ6A 2DHQA 3OIWA 5I9IA 2AN5A 2WJIA 2OOKA 2OV3A 3HJRA 2ZZNA 1DVRA 3IUEA 5F5LA 2ZJ2A 3EODA 4MZXA 4LJ8A 4MMXB 5I7RA 3BAFA 1HT0A 2A33A 2H4WA 4CN9A 2DEUA 1LZKA 4TZ0A 2ABWA 4MUMA 5EP2A 2I7CA 4EG4A 1A1VA 2HXSA 4C4XA 4I3GA 2PGDA 5L3ZA 2NSYA 3WNDA 5EE5B 3R9XA 1J0BA 1GUZA 2HHLA 4ZT3A 3R76A 2PTGA 4ECEA 3HXLA 1TZMA 2W9XA 4Q00A 3G2LA 4BS9A 2C9YA 1PGOA 2GO7A 1W35A 2UVDA 5CFRA 4X93A 1NN0A 1PW5A 1ZRNA 2F17A 2RB5A 3U09A 4QVGA 4QTZA 2ZRHA 1ZRHA 4QAJA 2Z4SA 1M73E 3T5BA 3W1EA 4EPXA 5CT8A 3K1YA 4AO8A 2NNLD 2OXIA 1PS8A 3KWJA 1E1QD 3OCYA 2FW7A 4NARA 5BSFA 3C6KA 5L7TA 3N05A 4FZRA 4W9NC 2VRCA 2EAUA 2CT8A 2IYRA 1IULA 5L4NA 1DKMA 5FPPA 3ROGA 1YAJA 5EIWA 3FMOB 3VZDA 2I7VA 3H1PA 2ZBFA 4OK6A 3U4HA 2L18A 5LZ8A 4D74A 4D6XA 1Z0DA 5CJ2A 3ODPA 2QD3A 4Z9FA 3TKAA 5IF9A 1W36D 1FFXA 3ANSA 3HB0A 1WUTA 2ADMA 5DNWA 3IMKA 1QS0A 1DCMA 1GYQA 1SC1A 1XZMA 4D4GA 4KRGA 1OAAA 1Y5RA 4KE8A 3P1JA 4UCFA 3FR8A 1BS1A 2KE5A 1YGPA 3CLKA 5EWLB 1MTZA 1L8OA 4C4AA 3OECA 1KH2A 1NNEA 2GAJA 1UL1X 1A8UA 1XKQA 2OD2A 1DAHA 1JBKA 3LPDA 4FFVA 2A1TS 2QNRA 3W4IA 4E15A 1OY1A 5IG2A 3VNVA 4MYUA 5JUWA 4RKRA 3B51X 1CNMA 1CWUA 3ADDA 3KQPA 1Q16A 2BVNA 3GCGA 3GJ8A 1QGYA 2QD4A 4LYJA 3WGUA 5HPYB 1Y3HA 2DT5A 3JD4A 1EB9A 3H65A 2ZU6A 4BXOB 3WMEA 1PR6A 4G0VA 3P0RA 1RXWA 1XDSA 1E96A 3HCDA 1VPTA 3LPCA 3TSZA 5DX8A 4OXQA 2P1DA 4X7MA 5G1OA 2D7DA 2HPVA 1Z28A 1WXDA 3TGPA 3OC6A 4JUCA 3C14C 1TU3A 3ZG6A 2PX4A 2ILVA 2QQFA 5DHTA 3BMOB 4TV9F 4TYQA 4RA9B 4TQAA 2CUZA 3D8BA 1HKUA 3AF6A 2HQBA 1FFXB 1DFGA 2QA5A 2WT9A 2YTZA 5E6SB 5T4EA 4ARBA 3L1IA 4R2MA 1YFJA 1WXIA 4HWPA 4QXAA 4UU1A 3X2FA 3ZHOA 1Z5OA 4XQ0A 2VHXA 4A0GA 5A5GA 1V39A 1DUSA 3UAXA 2H92A 2VIIA 2H9AA 1T4MA 2VVTA 5K3SA 4I8XA 4KKXB 3OT1A 1T0PA 4RACA 4RL6A 4DANA 1SQSA 2CJWB 3HEAA 1WE2A 3NWEA 2VPYA 2WTBA 4Q4JB 2F9MA 3GFSA 3JD3A 3W4KA 2QMZA 3QSGA 1YA6A 2JLWA 1YBMA 2H8GA 4ZDJA 1RFGE 3H5NA 4BXOA 4FIZA 3NALA 3HGMA 3LDUA 5F1PA 5DNVA 2PYIA 1A9XB 3AVTA 2GEUA 1IZZA 3WR5A 1F51E 1K8XB 3UIEA 5IXSA 3GJ6A 5K0LA 1PVVA 1BDBA 2FQ1A 2NYVA 3ESXA 4FBMA 2ZUDA 4HATA 4UVHA 4WBSA 1NPTO 1SOAA 2QRKA 2P40A 4GBJA 4M9ZA 3SN6A 5JCJD 5JALA 2IYEA 4MHTA 2PH1A 4FD3A 1W8DA 2WD7B 1G291 3U44B 1JZQA 1QG4A 2YJ3A 3MWLA 2IOFK 3SM9A 3LHIA 2DTEA 3WYAA 1K27A 4BP9A 1ZWKA 2BTQB 3FVWA 3ZJYA 4ID9A 4KQGA 3HLTA 5IJAA 2WPNA 1M1XB 3DAOA 3MD9A 3VVMA 5EXSA 1QLHA 2RAFA 1ZVKA 2RI0A 4K86A 4NPHA 4ICIA 5B3AA 1Y33E 1XL0A 3PQDA 4OK3A 3AW8A 4UUPA 4Y2TA 2FW0A 3AF1A 3CZCA 3TZBA 3N28A 5HRCA 3ZK8A 1B8NA 2QL9A 2XDAA 1T9DA 1XRRA 2W0MA 1I6MA 2GCGA 3TLXA 1KIAA 2AI1A 3OFNA 1DWOA 4ALIA 4EW2A 4ZT6A 1DOAA 5CFOA 1PP4A 4IO1A 3UJDA 2AE2A 2ZM5A 4QT0A 2EKPA 5DYIA 1L1QA 1TB4A 1Z2PX 2P0YA 2O19A 1E62A 1UCFA 2QB5A 4KR0A 4OGFA 3L40A 3SNHA 1HMPA 1T5DX 3AUUA 3EH2A 2XNHA 4NKRA 4HAIA 4TXMA 4DARA 5AK5A 5GZ3A 4PEVA 1XNQB 5JJBA 1PNQA 4M7RA 3ER8A 1B2RA 2QRZA 3RTBA 1JF8A 3T5AA 1T3SA 3KB2A 1Y37A 4IGKA 4BMPB 4V3CA 1T2DA 3PPIA 1SCQA 5LDHA 2CXRA 3QY0A 3O8BA 4GRIA 1UMCB 3CMCO 2GK4A 4HFMA 2EP8A 2EGHA 1LC3A 2R2AA 3GRZA 2PMCA 4O02B 1MX9A 3AY7A 3MCTA 1M2KA 4KWEA 2V55B 4MCHA 5KYUA 1CJVC 4A23A 1WDKA 3AJRA 4UHEA 3RYCB 1SAYA 4N5IX 1QHHB 1L5LA 4HXGA 1YZNA 3BL6A 1ZWLA 3LXMA 4HO1X 2AWNA 4OBWA 3WHLA 5K8CA 2JCYA 4PNPA 1Q19A 1E5TA 2H7VA 4FWTA 1QGZA 2BI4A 4JGIA 1IQPA 3WYBA 1UZUA 1KEWA 3M3HA 3ESDA 1N6NA 1XD2B 4N8SA 5A05A 1PE0A 3NKFA 2X8JB 5FBZA 4BRZA 4U3JA 2BEUB 1TZ2A 4FJ1A 5LR6A 2AJTA 5EUBA 2GJ8A 1P7YA 4NMHA 3RANA 3BJMA 5C35A 5LP6F 3JQQA 4NZZA 3BDIA 1DTEA 5FAKA 4IHJB 4JGBA 4CKBB 4KU4A 1V4BA 4OJKA 5DB4A 1FXSA 3CLTC 3GN2A 2VHTA 2Q2WA 4HNRA 5DI3B 1T0UA 2QG9A 4U4AA 1UBKS 3K1AB 4LSWA 4O08A 3UMCA 1GUDA 1UBRS 3COPA 1G3MA 4RXMA 5CW1A 4G0MA 4GMXA 4H35A 4MV9A 4CQMD 1GL7A 3JYQA 4YCJA 5IWCA 2XVYA 4TMXA 5EQTA 2HUPA 1M10A 2GM5A 4UDOA 2VZEA 3G5UA 4RH3A 1B8UA 4YCCA 1DDGA 4XKJA 2IGTA 2G9NA 2F59A 2QRJA 1K0UA 1YBHA 3ZE9A 4F9FA 2BEWA 2JH3A 2O0JA 2C9BA 2Q3BA 1EM8B 3I39X 1GRCA 3NJ8A 5HZHA 4EJMA 1JYEA 2C2HA 4G56A 3I1IA 2FUKA 2NM0A 1NR7A 1VJ5A 4L02A 4LJSA 5IVHA 4F8EA 1EWQA 3QU9A 1YR3A 1QWOA 3AESA 1U6JA 2HKIA 4RETA 1GDDA 3CZ9A 1D6NA 3WL6A 4P7KA 3PFBA 2IU3A 1OI4A 1QFSA 1ZO8A 1XVTA 4DLAA 5ALPA 5T57A 2GPBA 3A7EA 4W4TA 2GEJA 2CMDA 1LF5A 2WNIA 1JKJB 4X92A 4C3UA 4M0PA 4MLZA 3KWMA 3IQEA 4N0PA 4OI0A 1BN7A 1O96B 3RW9A 4NCNA 3N7AA 3SICE 1RRCA 2BI7A 3EFOB 5AUQA 1FXWA 1ZG3A 1Y7HA 2X1MA 4UASA 3CB2A 4FDTA 5AO9A 5KNDH 3IR6A 1A5ZA 3FYSA 2QDKA 3O8QB 1LSOA 3K6RA 5JTUA 2Q4OA 1RYMA 2NT4A 3CCFA 4MLDA 3OFSA 3VOAA 1UPAA 4D3SA 5HIIA 1J42A 3BWMA 3N9IA 5D84A 3HJAA 4NZPA 4BV2A 3NHSA 4RK5A 2GJSA 1H6DA 2EZ9A 2FDRA 6REQA 3PR2B 1EIWA 2XUAA 2BGIA 3QFHA 3T1VA 1PFKA 2ZVPX 4B74A 4C29A 3F97A 1DG3A 1WCIB 2ADFA 2BDEA 4OQXA 1MBZA 3IB6A 1BKSB 1FRNA 3WLRA 2H11A 2C7VA 3CX7A 1YDGA 1DRWA 1KGDA 3BILA 5KYGA 1GGEA 3P7MA 3EW7A 2HEGA 1UEIA 4WA7A 8LDHA 1JS1X 2VDOB 4EGSA 3QVKA 4P3NA 1UT8A 5F2OA 4L8FA 4MVJE 5IBRA 2XWQA 5JRJA 1ZD9A 5LYJB 1F2UB 1U0TA 1CR6A 4LZLA 4C7OA 3HC7A 1JXOA 2V5AA 3VR4A 1IQUA 2QXYA 1NHWA 3D5QA 2WPDA 3IMGA 2I4TA 2UDPA 5LPNA 2JI6A 4L74A 1CRWG 2ETXA 1Z0FA 3QSYA 4OFBA 4JUIA 3C70A 2FLVA 5AI8A 2F1KA 1KOLA 2BDUA 2G71A 5JDIA 1JQ5A 3BRQA 3L1KA 4FCVA 3HA2A 2XCLA 5KYYA 2NVWA 1F0KA 1D2RA 1PFWA 2PL1A 2X5KO 4DA8A 4W63A 1II8A 1ZUNB 2PVPA 4I55B 1ZCFA 5DSZA 1TJYA 1I51A 2DLNA 1XDGA 2EP5A 2HF7A 4DIKA 1LLUA 2YL2A 3DL