4NJEA

Crystal structure of pyrococcus furiosus l-asparaginase with ligand
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
182
Chain Sequence
MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus
total genus 55
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4njeA00
1O7JA 3ECAA 2HIMA 2P2NA 5CBPA 1ZCFA 1WLSA 2WT4A 2HLNA 1JJAA 1JSRA 4PGAA 4R8KA 4R8LA 1WNFA 1WSAA 1JAZA 5I4BA 5I48A 1HG0A 5I3ZA 3NTXA 5HW0A 1DJPA 2P2DA 5DNDA 5K4GA 4NJEA 4ECAA 2OCDA 4RA9A 1HFWA 5DNEA 1NNSA 2GVNA 1IHDA 3PGA1 1DJOA 4Q0MA 5F52A 1HFKA 1HO3A 5DNCA 1HFJA 3NXKA 4RA6A 1AGXA 5K45A 5K4HA 2D6FA 2WLTA 1JSLA 2JK0A 1HG1A 5K3OA 1ZQ1A
chains in the Genus database with same CATH superfamily
2J59A 5JANA 3DZGA 2XTNA 3OCXA 4C2AA 3KR1A 3QWBA 3DG9A 4KLZA 5F33A 4JKYA 2QN6A 1O89A 3WGTA 5CNMA 2ZPAA 4H1VA 4BZXA 3LDFA 2HJRA 1R37A 4RKFA 3QX3A 1FQJA 3KB8A 2VDWB 3UWMA 1JWLA 4YQYA 3TVYA 3S7TA 3Q3EA 3R40A 4JIMA 4NCHA 4E5VA 4ENPA 1AT1A 3IVGA 1PKXA 3I42A 1ITZA 2R8YA 4GRAA 5D1NA 2YJZA 3EVNA 4Z86A 5LQSA 2C07A 5LOVA 1VHJA 1C9NA 3QVSA 5DRTA 1W581 2JHCA 2G1UA 3L0DA 4IZOA 4X44A 3IGFA 4X85A 2AJTA 4A2PA 2NO6A 4HI0E 2W70A 2Q3FA 2KB0A 3ZZ1A 5BN1A 1XD2B 4HVTA 1JL3A 2W58A 2ZANA 1TJ4A 1UP6A 3LBNA 1A8PA 4LSZA 4OBEA 4DZZA 4F86A 3IV7A 5KU7A 2G25A 1R00A 4ZJYA 1XDSA 2G82A 2YC4C 3O4GA 3QKIA 4CTOA 2W2OA 3NPMA 1I2CA 3GRPA 4IOJA 3WLNA 3PENA 5A2QA 2HXGA 3N5CA 3HJAA 4IAOA 4ENWA 3T7TA 1N92A 1TD9A 1UKCA 2GVZC 4RESA 4RTMA 1P3Y1 1S3FA 1H9CA 1Z8DA 1DUVG 3DULA 4X71A 4EK9A 4J29A 1U0BB 3RRZA 3GOQA 5HFAA 6ABPA 4RANA 4KAXA 2I34A 4BJ6A 5TGDA 3VR5H 1FLNA 1TAHA 1FYEA 1U7WA 1LVHA 2ATCA 4UQOA 4ZQIA 4ZCSA 2O3QA 5KYWA 2O6LA 2IF0A 1RM5A 2Y76A 5DWQA 5FTWA 3U2QA 1HE1C 2IELA 5I7WA 2P90A 2XD4A 4ML3A 2PWAA 2P2LA 4K86A 2BHTA 4URYR 4NDZA 3SG0A 4D9GA 4C6RA 4LRWA 3RFVA 3P32A 3PWSA 4BBJA 4KPUA 4A3SA 1EVEA 2A67A 2X9NA 3AXTA 2F2TA 3LI2A 1JHRA 2VJNA 3PCTA 3QLTA 2VZ8A 3UWOA 5E6SA 3UJAA 1V47A 1GQQA 5KC9A 1Q7GA 5BRNA 3N2GA 5HKOA 2P1RA 4RIGA 1TF7A 4FEYA 5ERXA 3SOZA 2XUZA 1PR6A 1NVGA 2ZSKA 1E9VA 1BN6A 1H2EA 5EXPA 4C0HA 3RTBA 2YXEA 4OQDA 3GUHA 5F78A 3IRVA 2BMVA 4QQ8A 4FFWA 1ORHA 5IZCA 2P4HX 5EI5A 2GFHA 4HNSA 4HRYA 2PQ2A 2VNJA 4B3CA 3LX4A 3KUCA 1NJGA 4P7JA 3B7WA 1F8YA 1PR1A 4I8XA 4LVCA 2UXDB 4OUKX 2DLNA 4GVPA 3VPSA 1FUYB 1M34B 4YV2A 3IUBA 1Y5NA 4G23A 2FKAA 4N12A 4WBSA 5KDLA 3G49A 5AVZA 1CHNA 2JCYA 4B7UA 4U5XA 1QRAA 1KI1A 4U2KA 4RD2A 3BHNA 1QC5A 3FWKA 3I9MA 3EZYA 1SIUA 2BTOA 1U7OA 2C5FA 3D1VA 4YACA 5CH5A 2CLMB 3PSHA 4JJ6A 2GERA 2JZOA 3PNKA 2EP5A 2FVXA 1NC1A 1SPBS 2GM5A 3UFXA 2O7RA 1K4YA 1IXKA 4N82A 2MYPA 3RASA 1DUIA 4Y2SA 3FMVA 4PY2A 2NOAA 5J4YA 4D9KA 4AZWA 1AKTA 4U63A 3H3FA 2HO5A 2A0FA 3Q0TA 3C4VA 4RVNA 5ALYA 3VO2A 3ZYZA 2YDXA 2VG8A 1L5OA 2VFAA 3FKJA 3F97A 2GVNA 1I01A 2JIOA 2V59A 3AYZB 3SX2A 4AUEA 4GECA 1A9RA 1D7OA 2Q29A 5HK8A 1U2PA 2W2KB 4FZJA 4YQFA 3NXKA 4D96A 5B6JA 1DDGA 4IIEA 2IH5A 1XMVA 1RCTE 1SELA 2C7BA 4H77A 2BF7A 3BRWD 1KI9A 1NIJA 1VA4A 2WSSD 2XCUA 4O08A 2B83A 3UGTA 4E12A 5I4CA 1VYVA 2FEPA 3B9QA 3L5KA 1HSZA 1ECLA 1YRWA 3LT0A 2P9GA 4J0IA 4QLOA 4UNPA 4C4YA 4F21A 2A1IA 3QWAA 3TTWA 2CZCA 4ZC8A 4X20B 2BDTA 3PITA 1M2GA 4JB0A 4NMMA 1GAQA 1QP8A 5LMZA 1D6JA 4OEHA 1NLMA 3QKWA 1EUQA 1M6HA 4CQMA 1FJHA 4E21A 4EFDA 1FS6A 1X87A 3OQVA 3R3YA 3KUKA 2YMMA 3DAGA 4ND8B 4RKRA 4B32A 4FX2A 1ZM7A 3VX3A 2OK8A 2AOUA 4EA6A 4F96A 2E4YA 1P44A 2NUPB 2W71A 3GO4A 4BLWA 1HKUA 4DA9A 2P78A 1YUNA 3K30A 2AOXA 5FL3A 2I6GA 5KQRA 3P0IA 3HBFA 3NYQA 5LZ2A 3TZCA 4CPDA 4G4SO 4EHFA 4Y9UA 2J87A 3HEAA 3AV0B 2NTVA 1U4NA 4F5YA 2C04A 3VR2D 1TEHA 1DWQA 3OZVA 1M74A 5JFTA 2OV1A 2YXDA 5FFMA 3CJTA 1GFZA 3AZQA 4N41A 2BI7A 5SYAA 2BFMA 4UQLA 1PTKA 3VU8A 2CMHA 2MMGA 2ZJ2A 4QHSA 3V55A 2XGSA 4DSAA 2ZWOA 1QDEA 3EFEA 5ELXA 1PT7A 1PEKE 1PS8A 4O2AF 2A3NA 3RSHA 4RK1A 2NVUB 1V71A 2PRKA 2X76A 1X80B 1Z9BA 1KO5A 4O0MA 4H7HA 3TOXA 1WF3A 5AK5A 1YIDA 3B1KA 4FR5A 4J16C 3QVKA 4JLUA 1CVIA 2M6LA 3B78A 3W9UA 4DM4A 3P5BA 4W5RA 2GYWA 4KTTE 3STHA 1QIIA 2HFKA 2VP3A 1L5VA 3ENNA 3LQKA 4GWGA 1P91A 1UPAA 1P4AA 2E4XA 4LKRA 2Y1FA 4LHYA 4BXOA 4X1KB 3BJZA 4GL4A 5CCDA 4KJXA 4TKMA 3SC4A 3DF9A 1G9TA 4EFLA 3AKZA 3FI0A 3A0RB 1RMYA 2QYHA 4HQKA 1TIPA 1BFUA 5ITSA 2C7VA 1CNMA 1FPQA 3OUZA 5L6LB 3DMHA 1IZ9A 2NADA 1R64A 2V7WA 3BFVA 4LW8A 2Q6KA 4DV1B 1YVPA 1QYXA 3OIDA 3C8MA 1DJOA 5KNDH 3C7AA 2AUNA 2JHFA 3RBZA 5ED4A 1H2WA 4Q1VA 4XTRA 4YROA 4DJFC 1VMEA 5CITA 1Y7PA 5DMHA 2X5JO 5I9LA 3A6FA 3LCUA 1EZ4A 2B20A 1TJ5A 1KDYA 2IS1A 4XIJA 2WPNA 2NO9A 3I45A 4JLDA 3F46A 1WDWB 2J48A 5T4HA 1QRUA 1ZGHA 4HWPA 1ND5A 1EU1A 4I81A 4J2TA 2PV7A 5D51S 4K88A 3H0CA 3E5MA 5F21A 5KOHA 2Q2WA 3W5IA 4RVCA 3HKDA 2WTNA 2BI8A 1LPNA 1HFWA 1QHIA 1K7SN 2I66A 1NTOA 1O03A 4J07A 1YCHA 4UXHA 4DDMA 3I2GA 3L7NA 4Z0HO 1LI5A 3C45A 5B53A 1YCFA 1VB5A 3LTNC 4C7JA 3KT0A 1H6DA 2Z2XA 1M9NA 3TZHA 4KNYA 3HJFA 3FUVA 4HG2A 1CZKA 2DFDA 4ZGWA 3V7NA 2R1VB 3A1WA 3C3PA 1NBME 1NQUA 3D9QX 2JEZA 1LPAB 3ZWXA 1Y0BA 4R05A 4UAGA 3WYNA 4BAUA 4EMBA 5B64A 3M82A 4WE3A 3RROA 3T3PB 1Q50A 3CVXA 1ISJA 4IS3A 2JIMA 4HDNA 3GLSA 4Z8YA 1QF7A 3O90A 2QL5A 1Z25A 1EM6A 4ARVA 1TGVA 4NZ9A 3SYNA 1FJGB 3C3EA 4PE5B 2H65A 3KPUA 4ALMA 2J3JA 5FDFA 1Z75A 1NVWQ 1LPBB 1E1RD 3D1LA 4QEKA 1TUEA 4P3YA 4YXWD 4GLBA 4JT9A 5BN3B 1I1NA 2ZZNA 2P4UA 1GRCA 3DMTC 1SHJA 3ZW8A 3BRSA 4OMFG 4Q18A 4BFYA 3INGA 4FK8A 1ZM9A 2OO3A 4Z5XA 1RU3A 3EF3A 3IBTA 2NUAB 3UF0A 1RYMA 5CM9C 4NENB 4FIDA 1VECA 5JVDB 4A6XA 5KYYB 3QX7A 2FPLA 4DCVA 5KDDA 4GBMA 2ZWIA 1O0BA 1P18A 1XZNA 2O3RA 4U2DA 5J1TB 4J9UE 4BNTA 5DU2A 3RGWS 3PWTA 5AVVA 1SULA 2IOFA 2QSZA 3R3WA 4MWZA 4L50A 3RV4A 1M5RA 1QX3A 3IDQA 2BV3A 2YVQA 4CM8A 1BS1A 1E2BA 1O94D 3MIIA 2Y2UA 4RVFA 1DCKA 5DRYA 1RIFA 3RS2A 3JAWA 1QPBA 4UBLA 1YZNA 1P75A 3LT2A 4PX3A 1L0BA 2C9CA 1F2UB 2EKBA 3IP9A 3LVRE 4WZBA 3R7SA 3SFZA 4XLLA 3LHDA 4CT5A 2FCAA 1JIUA 2J45A 2DTXA 4Y2JA 2CXRA 3MMXA 4RPIA 3U4QA 3VZDA 1AS0A 2DGDA 4WOJA 2BJVA 3B6IA 1RJDA 3TECE 1PQ4A 2OMKA 2IS6A 4HVCA 1E7SA 1KMIY 4JI0B 2WEKA 2Q1SA 5JH7A 4G1VA 5C1BA 3RRJA 2PKQP 3LL4A 4YX9A 1PSWA 1Y1QA 3CUKA 1IY1A 5TSDA 4D9HA 5A4KA 5KC8A 3WQRA 3DNPA 4KGDA 4ER7A 3LRTA 4CL3A 1TTQB 1KXZA 2B1GA 2VIIA 5EUQB 2NUTB 4I6JA 3BA1A 3IKTA 3NAMA 1BX3A 2OHFA 1RM3A 4G6ZA 4PS1A 4PX5A 4RMGA 3ANLA 3K1AA 3I4CA 4OK5A 4XFJA 4EH1A 1MTZA 4AKEA 1U0RA 4DCOA 2XWSA 1RAEA 1XLVA 2II6A 3N9IA 2GT1A 1FMFA 1S3IA 3GLIB 3CTPA 1C0PA 5KYUA 2RCNA 1T9CA 2ECOA 3T5GA 4FYPA 1XZLA 3JVVA 3WB0A 2JS7A 1KA9H 2QE7D 3R8CA 1QWOA 1Q20A 2O5VA 2VR1A 3JQFA 1WZIA 4L0DA 4H6WA 3VYSB 4E3ZA 3U3JA 3D4NA 1DADA 1GSHA 2N47A 4JC0A 1NXQA 4N5DA 5EWJA 4WBNA 4WXRA 5J4VA 4B2LA 4CG0A 3NM5A 4FKBA 3F9CA 4U2GA 4LXUA 721PA 3GRAA 4F3YA 3DGEC 1YQUA 3I9KA 5ARBA 3RANA 3QXGA 5KEIA 1H69A 5BUSA 4P3PA 2JFOA 1J8YF 4NOLA 3SC6A 3UAVA 4YRZA 2IYWA 1NOIA 1X0VA 3GXOA 1ZS9A 1QAMA 2L17A 2V4ZA 1VIMA 4J9VA 1U65A 2AV6A 1TPZA 2FJUA 3PUZA 2JGFA 5AM0A 5JD5A 1GTL1 4R7ZA 1O5IA 4B71A 2NO4A 5CYGA 4BKPA 5LOVB 5LMUB 4RABA 5CB0A 1GFSA 1NTRA 1ZISA 1RP7A 1Z2EA 4JOCA 2H31A 1G8SA 3SM9A 3OFJA 1NW5A 3ABIA 1ZO8A 2Q6OA 4OI1A 1RYHA 3TKAA 2JGDA 5LSAA 4BMOB 2LZ0A 4Q7JB 4DC9A 4QQNA 4FZ3A 4DHWA 1H85A 3RRFA 1VHLA 3JQAD 4U9HS 3T3OA 3LXXA 5FUVA 1G8HA 4LJ6A 4ZKDA 2O8EA 3CUSA 1GWNA 5JVDF 2W8BB 2CMFA 3R6GA 1FDUA 3PQFA 2X8AA 3SJUA 3ST7A 4RVGA 4L4YA 4U5QA 1A4RA 3DO6A 3KJFA 3UWDA 4KIJA 3A26A 3H9UA 1HQDA 3NU1A 3IP6A 2O59A 5KS2A 2ZYRA 5KYWB 1U2DC 3N53A 3NHSA 5CD9A 2GFIA 1WPXA 2PGIA 1YJ8A 4TQGA 1BVYF 2QHXA 4MW0A 3TOZA 3VPGA 2HNKA 4MW1A 3ZE0B 2VDQB 3KV1A 4TTRA 4UBIA 1O5TA 4P7KA 2Y0DA 4M9XA 5LLSA 5JSYA 4D46A 1Y8ZA 1THTA 1U8UA 4WX2B 3T12A 1F8FA 2EARA 1JG2A 2I0FA 3QLVC 3L18A 4IWNA 2A0KA 3MN1A 1Q12A 1DI0A 2QXYA 1JAHA 4L08A 3HYTA 4W82A 5E6SB 5KSPA 4GP7A 4CIDA 1FPMA 4WKCA 2DWPA 3MWJA 3VJLA 3A6KA 5EMHA 2GS9A 3EIOA 3N2GB 4S24A 3BDIA 5IM5A 2YH2A 2ZS7A 1SZPA 4ZT5A 5DTMA 4DR7B 4OBXA 4OLHA 4H17A 2NW6A 1RZ3A 1W5BA 4Q4AA 1NKSA 3CCCA 1HEYA 5K3BA 2WWRA 4RENA 4BLVA 5CLJA 5GTDA 4K0RA 3OZEA 1SB8A 2JIZD 3RIHA 1KNXA 1XTTA 2OV4A 4KFCA 3ORRA 1YVUA 3C1TA 3S28A 3JYHA 4L0MA 3WMXA 1V3QE 2FKNA 2JG3A 4G86A 4RPGA 4C5AA 2AOTA 4D41A 1FNCA 5BWNA 1JYFA 1YB1A 2BR5A 3WBJA 5T8KC 5FUQA 4E33A 1FDRA 2VBFA 4BLTA 4IHKA 2C5GA 3KTDA 1IH8A 3TSCA 4B6EA 2CFOA 3NM4A 2CHVA 2Q21A 4U39A 4G1BA 3P0HA 4XJTA 4DA8A 2BMDA 3L7OA 1K7CA 3WTCA 3GT3A 2Q6VA 4IXWA 4EEKA 1V5IA 5LKAA 1SVUA 1BRMA 1WUTA 3ROGA 1Z07A 4BV9A 1H9AA 1NF9A 4N39A 1E0AA 1UF9A 4KPFC 4DQXA 2KBFA 3UFXB 4I9FA 5ERGB 4DJTA 1V1MA 3H1TA 2DBQA 4CCYA 3DPUA 2D13A 4KGVA 3ANTA 3W2IA 1W44A 4M7RA 3FA2A 4KQJA 6PFKA 1I94B 1RPNA 1XDWA 1QQTA 2V1UA 5AVQA 3MOSA 1CRWG 3ANXA 5LOVF 1ULUA 3FNQA 5HNKA 4Z9FA 1E66A 4FFPA 1U0FA 1X7DA 4MSUA 4ITVA 1Z2NX 4NU6A 5LWQA 1AE1A 2BTEA 2VSYA 3ETJA 3EFBA 2J67A 3H6GA 1N33B 2BDUA 3K9BA 3FHOA 1ZOPA 3AY7A 4QDXA 1Z0ZA 1HT3A 1ST3A 3S2YA 1ZZEA 1KP9A 2YIVX 4D56A 1KWKA 3GGOA 1XEXA 3EZXA 2B4AA 2WJYA 5EXTA 1C7QA 4D6PA 5CA1A 4NBVA 4N6GA 3GBVA 4EJ0A 3JYOA 1PZMA 2OPHA 4E5UA 4UTVA 1LBHA 1Z4JA 3PUKA 3DKPA 3EHEA 1ONPA 3L8EA 3NAQA 4FHFA 1T9AA 4A03A 3BOSA 3CZ9A 2H5EA 1GGKA 2AOUB 3IURA 4AZ0A 4EB0A 1BHSA 2KBEA 1NP6A 5KI6A 1R16A 4LS3A 1FP6A 3PPWA 1B43A 1GGFA 3QU7A 4GGOA 4WY5A 4BUCA 4BQEA 1PQYA 2OUIA 4UPVA 3OJWA 1C8BA 4DDTA 4B3MB 3MTIA 3CY6A 2JFNA 1L5ZA 1I2BA 3GIDA 1UH5A 3QE0A 5CT5A 3NHRA 2QTFA 3RUFA 3KZVA 3TRIA 5BVHA 2FEWB 1BX1A 4OCZA 5AHXA 1NOKA 1KK0A 4OHOA 1NW7A 1CY4A 4ECEA 4NBUA 1GADO 4NYJQ 4Q7QA 1FNNA 2F8SA 3T41A 3BHIA 2ZTSA 2PA3A 1NYLA 5ISMA 3WA7A 1X0XA 1EQUA 3HNPA 2WPDA 4NZPA 3JALA 2DBVO 4KCGA 1Z68A 2ZTMA 5DSTA 2FSGA 3RUIA 2HQOA 1S3GA 3TRJA 4Y98A 1YR7A 3KUDA 2Z3VA 4OPMA 4R5HA 1KDRA 3RJTA 4ZO6A 4BWFB 1XA4A 3L4SO 5ANRB 3R2JA 3FUXA 4CIWA 5MN4A 4TL7A 3Q4GA 1U2QA 1C81A 3AF5A 4DDHA 4E2WA 1D8TA 1HDOA 4MVJF 4BPBA 1MX5A 1LZKA 2IYLD 2X2EA 3N07A 4NAHA 1EFTA 4MW4A 4PONA 5E2IA 2W90A 3NOXA 1EDEA 4HOYA 1B93A 4OHBA 4KIGA 2EX4A 4L4ZA 3JQRA 5FA5A 2X5XA 5EJ8A 4BXOB 5BR4A 2R79A 4PGHA 4RA9A 1GFWA 4Z0TA 1Y8RA 2RC5A 3OZDA 2QN3A 4KSCA 1U0SY 2D2XA 2ECKA 1ENYA 1TZ2A 3HBJA 4QPPA 3QE9Y 1O97D 1QMPA 3L7LA 1PW7A 2PMEA 2ZJAA 1V1JA 1OVMA 3NHWA 1KU6A 3AJDA 3OQ1A 1JG6A 2ZAIA 4IFBA 4LA4A 4LSWA 1K3FA 4QU0A 1R18A 4ZVQA 1U1GA 2ZUCA 1LW7A 3WOHA 1MW8X 2WM2A 2YX1A 1GYPA 1H1LA 2M9MA 3PV0A 4BGDA 2H2DA 3LBIA 1HDRA 3D8NA 1SOAA 4XM1A 1A76A 3DOIA 3FHCB 1XN4A 2E49A 3GGCA 1ZVKA 3OM0A 3OBIA 1M5TA 5DEIA 3WO0A 3PGVA 5B1IA 1HT1E 2C59A 4DV6B 3DMPA 3PFNA 5TGZA 2E4ZA 1NF8A 2AX3A 3K5WA 2P6PA 4I7EA 4JVLA 4UEKA 1RYDA 2UYCA 2J0QA 4HBGA 3FDZA 4QPJC 2ZUTA 5DHSA 4AO7A 3RC8A 3OM9A 3D02A 2VH5R 3DZCA 3R7AA 2C42A 2B30A 2JFXA 2X9VA 1A2OA 2LD4A 3HCCA 3I34X 1K6JA 4BJ5A 3AVTA 4R54A 5AJVB 3JSXA 1AH2A 3EH2A 4MWTA 5U1PA 4JB3A 4QTUB 2H07A 5KOHB 4PPGA 3OH8A 1WDKA 4FX5A 1E79D 1Z36A 4Y9TA 1CJTC 3HKDB 4QQFA 5IWCA 3VV2A 3U5TA 3WIEA 3DE1X 4YN3A 3ZE7A 2HADA 1QG0A 2AG6A 3MM4A 1ISFA 4G85A 4GPEA 1DDIA 1NUAA 1VCHA 4J16A 1C3JA 4MP8A 4NDAA 1JQDA 1TTTA 2QEQA 1QZTA 2GCIA 4XVQA 3VU9A 4KXVA 2KPOA 4D4IA 5IM4F 5HCUA 3SIPA 4AK9A 3CISA 1OAKA 2C3PA 3UM9A 4ER0A 3UYLA 4G0MA 4QLBA 5DBFA 3HFGA 5C5IA 4OA8A 5AOAA 1LQUA 2DQ4A 3U9TA 4O5OA 1CUGA 1PBNA 1ZL0A 4C76A 1F51E 1MV5A 1SUCA 1EAYA 1E4EA 1T9ZA 1W5TA 1G2PA 3OX3A 4MUMA 3HFJA 4X7PA 3TQHA 4DMRA 4C3ZA 4XX1A 1MOZA 5LLTA 1DUSA 1HDEA 1RWOA 3EWAA 3RUPA 4EDFA 4P3OA 2BIFA 1YDFA 1FFSA 3WV4A 1X7XA 1YGYA 2P0YA 4NBSA 1IEXA 1J2UA 1UOPA 4RC9A 2CKDA 3IMCA 1ORIA 3COVA 3X1XA 3DE2X 1X1SA 4ARIA 3HQ4O 1MO6A 3Q40A 3U0BA 5K8CA 4F5DA 1GSOA 2C88A 5DNVA 2CGEA 2OBMA 5K01A 4WXMA 1JR4A 1A9PA 3HRIA 4ZVUA 2IP1A 4UTOA 3QPUA 1J06A 3ZIUA 4S1TA 2F43B 1RD4A 3ODGA 1K4MA 2ZBGA 3WLAA 4EQ6B 4C89A 3KELA 2FF5A 3MCAA 1ZK3A 3N2LA 3DE4X 5A03A 4KO4S 5ADHA 2GZAA 4FBLA 2W6QA 3DE5X 2FR0A 2MJLA 4PTLA 1V6CA 1YWGO 3DWGA 4HB0A 4AZTA 5IULC 2DWQA 4B46A 3FB1A 4B83A 1CRZA 3S1AA 2Z4SA 4WFIA 4KLAA 4ND1A 1NYTA 2VJCA 3DAYA 3JAWB 2OGSA 1KXJA 1QMGA 3UXHA 2OQ2A 3KX2A 3RBAA 3K5HA 4N18A 5EESA 3MUEA 3D64A 1GKUB 2KSQA 4WZBB 2LV8A 4JI5B 1C29B 4KO8A 1JB9A 1D2MA 2QT0A 3QX9A 2XRFA 1DKQA 5CYPA 1VOTA 1Y4AE 4QELA 1JLSA 1GKLA 1S7CA 1WMSA 1TQ6A 3QFFA 1Q0LA 2JI6A 3MQ2A 5BPFA 2GN8A 3IV6A 5DOVA 5K8UA 2PGDA 4GYJA 1SHUX 1ZNQO 4LHZA 1FXUA 5BSVA 1ZUNA 3OCWA 1QIEA 3K4HA 4PLWA 1OBHA 3L6DA 4JLVA 1TA0A 1R4ZA 2JD2A 3H11A 1DIRA 3M8KA 3PC6A 3IPAA 1QH0A 2VK1A 3QF4B 2BGUA 2QY6A 4G07A 3N28A 4GVLA 1RWKA 1JSCA 1YB7A 3DMTA 4F2PA 4GOMD 1UJMA 1O6BA 3PYMA 1XSEA 4G81A 4NBWA 5IMSA 4S04A 2GJ4A 4MJLA 2E6UX 5CB6A 3OU2A 2Z56A 1IZYA 2AK2A 1RKBA 4KXFB 3CNNA 1UXHA 4D9FA 3V8QA 2OAGA 3FLEA 4FB4A 4PLGA 2B3TA 1JU3A 2E4VA 1YDMA 2BN4A 2YWCA 5CLIA 5FKJA 5IKMA 3I2JA 4KNVA 3BILA 5KYTA 1E0JA 5ALMA 3UG7A 3MSXA 5BOSA 3WK7A 4WBNB 2V45A 3CLRD 4JB8A 3ECAA 3Q3CA 4XGQA 3TJMA 2VQEB 4YUVA 1M2OA 1VPLA 2CNDA 3AKDA 3ND7A 2RGEA 4FBGA 3GLFA 2HLHA 2JHPA 3IDZA 2W7TA 3ESAA 5EKXA 2QL7A 2XOXA 3G7SA 3PDJA 4PLCA 2C5EA 5AJWA 3T3MB 3EPRA 3DNMA 2SHKA 4BECA 3SZRA 2XT0A 4W9RA 4FFVA 2JLYA 1P3JA 1Z0DA 4JMPA 3HWSA 3V9PA 3A3KA 3NP7A 4R9NA 3R3XA 1ZPDA 3T3GA 1YDHA 3HZZA 3WNDA 8GPBA 1KAHA 5KPJA 5I7EA 2GBFA 1GEGA 1W4AA 1RWNA 2GPAA 2QK4A 5AJHA 2GEKA 5B7GA 1E7YA 1ZHHA 3DYIA 4XGKA 2QU8A 5FTJA 2NYAA 3KYIB 5FWNA 1TMYA 1XZPA 1FQKA 4XR4A 3GROA 2PUAA 5E8RA 2A9OA 3SVLA 1PTJC 2XT9A 1LSJA 5CT6A 1DLJA 5FWYB 3ZBUA 1O0SA 2JGDB 4Z4QA 4P0PB 4GI3A 4LMRA 4QUIA 1GGVA 2DPLA 4OAQA 4PCLA 2CBGA 4ZYTA 3IBSA 4KO2S 2O8EB 2K87A 1F38A 3RK1A 5BNTA 2XQJA 3L6UA 4N76A 3GFQA 3LCCA 1E2PA 3IAFA 1ZD9A 3PRHA 5F7ZA 3W05A 1WY5A 1XT6A 4MAMA 3NWEA 4QPZA 1BE8A 2I4LA 3K2IA 5K51A 4HN2A 4BAZA 3PI7A 4C4XA 1DCFA 4LHXA 3UAXA 3L8HA 1DKMA 3VXKA 5I9IA 4RLFA 3U7FB 4DG9A 4CIAA 1H0RA 1G21E 4S1VA 4CL0A 4OSEA 1E0SA 3H1EA 1UBEA 4UTRA 4BL5A 1K8QA 4LJ7A 4ZIRA 1P0IA 3ZY3A 5CA0F 2JI8A 3UHPA 4JYZA 3TXAA 3HXMA 4WKGA 1P80A 1XJWA 2FZKA 4IMPA 4AMBA 5LZ4A 3COZA 1SRQA 1WF6A 3O8BA 4TRMA 3CG0A 4U6SA 1ABFA 2F67A 4II7A 1EWKA 1QB7A 4KIFA 4CIXA 1GILA 4GX5A 4EX7A 4I9NA 2O8CA 5DK6A 1WDTA 3I1IA 3QFTA 5BYBA 1SD5A 2I2CA 4LRQA 2SKEA 3MT0A 4MV6A 3RYFB 4FNAA 1UBOS 4YCSA 2ACVA 2GFQA 2OGWA 4O25A 2J32A 2O48X 2Q8PA 4XX0B 1Z2AA 3RSQA 1L9XA 4TXJA 4I3HA 3K9FC 2P7HA 2F1RA 1XVVA 1P5FA 1BGWA 2HX1A 1RPTA 1QHSA 2AF3C 2R1ZA 4LJKA 4MH0R 1GZSA 1H22A 1U0NA 4N1AA 3ZE8A 4IMJB 1HLFA 1UBJS 3AUXA 4Q3OA 3PXGA 4F45A 3ETGA 2UYYA 2I76A 2HRQA 2W4MA 1Z6ZA 4N40A 2HJWA 3WBBA 1D2NA 2Q99A 3JTEA 3HY3A 1G5TA 3PUIA 3C14C 1RRGA 2VN8A 1GPWB 3PUYA 4JOSA 4R0VA 1ZY2A 2AOTB 1VCMA 2UYQA 3PHLA 1P1JA 3W1EA 2CZQA 2GBGA 3SHTA 1KYYA 4CTKA 2CNLA 3AGPA 1BTOA 1GU1A 1U7UA 3GMTA 3V1UA 4WBNF 4CR6A 1O96A 4Q7KA 3LPMA 3SZ3A 4RZXA 1Q6YA 1L3CA 4Y9SA 1ZCAA 2VRWA 1H8HA 3BD9A 1K0FA 2HHLA 3LKZA 1W1IA 1PR4A 2IPNA 1R8XA 5B1SA 5JSZA 4H7IA 1U2DA 5IK2A 3AERA 2QYOA 3IA7A 4UBJA 3GVXA 3AHJA 5JUWA 1E9SA 3RVPA 1V1MB 2QJRA 1E1CA 2XDWA 5CB4B 4Y0AA 1Z5NA 3VH1A 3K0KA 3NETA 2MCFA 3PQ8A 3D6JA 2ETVA 3PT5A 2XCQA 2Y77A 3IQHX 1M6NA 2CW5A 2PKCA 4B9EA 1I7SB 1QRDA 2WNIA 3O75A 3QLUA 2ZUUA 1N1MA 1EWQA 3QLVA 1TI7A 3WMGA 2HDHA 1EWYA 1H65A 4E5YA 4D0LB 2BFWA 5FBKA 3UGQA 2LWIA 4NBNA 4HLNA 1ECCA 3AR8A 2XY4A 4I0WB 4DBLC 5BN4A 4PPQA 4YCLA 4DMHA 1TLFA 2BW0A 3LDAA 4YGXB 5GWXA 4H7EA 4C3VA 1ZESA 2BSAA 3NT4A 3UKOA 3W5CA 4XDZA 221PA 3E2MA 2O1WA 4JJ4A 4OQMA 1Q1ZA 3KCQA 1XEXB 1YVEI 4YAIA 1US8B 2ZB4A 3NBMA 5CA1B 1C9KA 4C7MA 4PWYA 3AR3A 3LRXA 2XMCA 3EZ9A 4FE4A 3TIGA 1E1QD 1X1EA 3SSMA 3RAJA 1E3SA 1TD1A 4GXTA 4ED9A 2PZ8A 3HZRA 4FE3A 3CRNA 1UOEA 1V11A 3DTTA 4KE8A 4XD2A 5T8KA 1EPUA 3NPAA 2QV0A 4AZ0B 1M66A 2GSWA 4RVSA 1LLUA 5DNDA 4B3FX 3HCRA 3MWDA 1C7FA 4L5CA 5J3JA 4MV5A 1EFLA 2X3FA 3D2BA 2PWPA 2Q2OA 1H2XA 1W4ZA 4DT1A 3NASA 4MX8A 1ZNYA 3GGGA 1H3FA 2VRBA 3OE7D 3R5SA 2QW1A 1CZNA 4KQ9A 2JF0A 5BVHB 4CMHA 2C7GA 4I1UA 4RPHA 4C7VA 2G4VA 1N4DA 4CUZA 2QRJA 3KEOA 2NP6A 4KJZA 2OQVA 2PUTA 1A8QA 2JGRA 3FNRA 3LKBA 2JDID 5TDHA 5B3JC 1LS6A 1Z4IA 2CHFA 5EY5B 3JALB 1JJVA 1N0VC 1VYUA 2PMDA 4ZQCB 2HA2A 4BNFA 4C4PA 3GJRA 1VB3A 2DR3A 3SHOA 1Z17A 1WQ3A 2WJZB 3AB7A 5EEHA 4LECA 2DUNA 1IXSB 2FFAA 2Q7OE 3F6EX 2XA9A 2ZZKA 2H7YA 4UARA 2PKYX 4LZPA 5ETJA 1JT9A 5F2NA 1T4GA 1UM9A 2V58A 2WWTA 1VBFA 5ICMA 1LVUA 2FUKA 2ZT6A 1C1HA 3T1HB 1SIBE 3D6FA 4JLSA 3ZVNA 3PX2A 5DB4A 1EINA 4FNGA 4RA9B 4GP6A 4K03A 4EPVA 1XCLA 1N2ZA 2QG9A 3MF4A 2YJ3A 1KS9A 3KM0A 3FX2A 4Q9IA 2A5GA 5K0ZA 5DF1A 2DP4E 3KL2A 1X9GA 3H7IA 3IE0A 4CCAA 2J07A 3PNPA 3IXLA 4OGGA 3V2HA 5CCBA 1C7RA 3EYWA 5A3QA 1Y33E 3MOIA 4C7KA 4PV7A 3AF3A 4V0ME 1VJDA 2F4VB 1H1LB 1CUBA 2AJBA 2B8TA 2P1DA 3BWCA 5CVUA 1DV1A 1FX0B 2NZJA 4YLYA 2R8XA 1KBOA 2PLRA 3OQOA 2B0CA 2IA5A 2Q9BA 1SG9A 3GNTA 4MYRA 3TTUA 1I2MA 2Q7XA 2B2XA 2B0JA 2ZOSA 5H80A 1VRWA 5DJ5A 3PHIA 3MCZA 5LBUA 1E4YA 3FNIA 5BW8A 1PWEA 1RZVA 3H2IA 3NYRA 5LNK6 4C7OA 4XPIB 4WJKB 2BFFA 4D9IA 3FDZB 4J0EA 3AKYA 5ENZA 3CRVA 2DLDA 1W0CA 1XQ1A 3O1LA 5FUYA 4D6YA 3PNBA 2VOEA 3I9V1 2I1LA 1ADYA 4RGBA 3PHHA 5AJYA 3BS4A 4BMVA 3L6CA 1U0OC 1P7VA 1NVBA 2EZ8A 2VHYA 3FHLA 4DC1A 1N5RA 1ZITA 4CM7A 4DLYA 4MDEA 4F4CA 4O4LB 2OYCA 5A7FA 2PL5A 1KZGB 4DE5A 2J0UA 2VDKB 3C5CA 1UUFA 1G16A 1NZFA 2XYVA 4DNXA 4JEUA 1QFSA 1DTWA 4QUDA 4E32A 1HE8B 1FBTA 3GUYA 4AY4A 2C5BA 3FNEA 1E6MA 5CPFA 5I7RA 3P9YA 5CA1F 4RQBA 1SC4A 2UVDA 4CM4A 2JGMA 2P40A 1F7UA 2CSUA 4IDEA 3WK4A 2XMRA 1NN3A 1N0HA 1DHRA 1A0OA 4B43A 4GYKA 3E3LA 1N8SA 3ZDAA 3ZCSA 1RQRA 1G8JA 1W85A 2Q5IA 1V39A 3I28A 3I8OA 4K26A 3RKUA 4DSZA 3IQFA 3ZDRA 5C18A 4M83A 1E4EB 5DNWA 1X8JA 3FOWA 2FHPA 4RQAA 5AKJA 2J3LA 2W6OA 4DUZB 2ORVA 1YJAA 3G5UA 1DCMA 2EBUA 2VPQA 3I0NA 5J59A 2Z98A 2NSHA 5CDUA 1Z2OX 4IV5A 4M54A 3U40A 4BEVA 1UWCA 2ZJ5A 5LQKA 3L4JA 5HCIA 1CFZA 2X7XA 4C4RA 1XMIA 2AMFA 4PC2A 5CLFA 2WHYA 2HWXA 2XBLA 3B53X 3LC1O 2XCRB 5ULLA 3R7FA 1WUYA 1TPYA 1JN0A 2G36A 3I83A 4R2LA 3O2SB 1UP7A 5HKKD 2BGMA 3LPAA 3AV3A 4I1IA 5AKZA 1P6XA 3B20A 3RJ5A 2W2NA 4W4TA 3GRYA 3W6PA 4YK7A 3FTQA 1IWPB 3FZGA 4QJBA 3KLMX 5AICA 4B3RB 1MT0A 3E9YA 4KYTA 1G5IA 2Z1MA 1PFWA 3AUAA 4UD2A 1M1YE 3IP3A 1BWRA 1X6VA 5F1YA 1TA4A 3GJQA 5B2ZA 621PA 3GIWA 3HYRA 3QFCA 4PSVA 4Y6LA 3ZHRA 1JJBA 3F5QA 4FCWA 4BFLA 5I4KA 1YH3A 1PJRA 2HAEA 3S1AB 5LQDA 4YR9A 4L9SA 4DDUA 3SN6A 1F12A 5DLEA 2W42A 2E0IA 1PT5A 1U3TA 3VZSA 4KPYA 3ABRB 2FB9A 5I3CA 5JCZA 2EOAA 2VWPA 4OUDA 5BV8A 4RVOA 4D9BA 1LDMA 3MILA 4O1MA 4PC3A 2PJRA 2UZIR 2FG7C 4K9KA 1VKOA 1T8TA 4WHMA 3RJ9A 3GJ4A 1T1JA 1KSGA 1KMMA 3SR4A 3QY0A 3IB3A 4X95A 1N9GB 5HBRA 1J49A 1TW3A 5T4FA 3USZA 1Q16A 1ZUNB 3OTHA 5JEEA 1MA3A 1YE5A 3JD2A 2ZXEA 2C7RA 3EXHC 2RIRA 1PZEA 2AXPA 3G9XA 4TYPA 3B7GA 1C3LA 1U7DA 1GPNA 3WB9A 3H11B 5DP1A 2VUHB 4D42A 4ZHSA 1H5UA 1SVMA 1PJLA 5I8PA 1VZ3A 3DV9A 4UTZA 4EJSC 1USUA 4A91A 1WZEA 2PZKA 3VPHA 2EATA 4K2HA 4V39A 2JAOA 3QYPA 1NATA 5TF0A 5KHAA 4O4LF 1S8FA 5E0OA 5BV0A 3O8RA 3FZQA 1NUHA 3C8UA 1HPLA 3V7UA 1YD7A 4UPEA 4LDNA 4CKYA 4XWWA 4HYYA 2I71A 2G09A 2IHBA 3H1PA 3WLEA 5BOSB 3IH5A 3MWFA 5E2AA 4X91A 3RUAA 1M2OB 4BFUA 5HE9A 4ZEWA 4PO8A 1XK6A 1TZKA 1EDZA 4ZOEA 3WHIA 1WWKA 1IPHA 5EXEA 4PCVA 3AWDA 2G80A 1H4QA 1ZOIA 3GJXC 2ZDGA 4FYKA 1BZYA 4Y3UA 4J2HA 3UAYA 3UHJA 1C4XA 3EQ6A 1N5JA 4QQKA 1KYIA 1NE2A 2IU0A 4RTOA 1WHTA 4IL5A 5LP6C 1S2DA 2HMYB 3BHJA 3DS8A 3ELBA 4FOLA 3WKEA 5KVCA 2Q4OA 3QKRB 4II3A 3VR4D 4BFCA 3INNA 4I9GA 4RZHA 3MAJA 3MYYA 4LOIA 5BV1A 5ECGC 1NN5A 5AVTA 3SWWA 2FFHA 2PGOA 3AINA 4GZ5A 4J0CA 2D4HA 2G5CA 3Q7EA 4CHGA 1FFWA 2IX9A 2RBKA 3PBKA 4QBKA 4ARUA 1GTJ1 1QGED 1NPYA 1QTRA 1WVIA 2D5CA 2C2XA 3ZY2A 5JNSA 3PLAE 3MOGA 4FKZA 3F1LA 1F14A 2AQKA 2K6GA 1QU2A 3FKQA 3PFBA 4PGGA 5AP9A 2K7ZA 1Q1AA 1C9JA 1MCZA 2QLLA 3PK0A 4FW9A 4MJ7A 1PYGA 1UINA 3KOWA 1FB5A 5EJGA 1KL7A 5I7UA 3LYAA 1SC9A 3HL4A 4EARA 3NV7A 4OXYA 4PYIA 5D3QA 4CG2A 4US0R 1AF4A 3FVRA 1RJWA 3BG5A 4B6PA 1IN5A 3HSKA 1Y6JA 3PGLA 3OPNA 4GNRA 4QDJA 2GO1A 1CIVA 2CB9A 5B58C 1O95A 1S2IA 3E22B 4CCWA 1LDGA 2G5GX 3DEFA 3G0HA 1AGNA 2P9TA 4FZ5A 3BIWA 3UUGA 1MB3A 4X3OA 3EXEA 2PYDA 3KKZA 4I55B 1GL9B 4HLUC 4WLFA 3T4EA 4RTPA 2GJKA 5ECWA 1RWBA 1NC3A 1Z08A 4PC7A 1QO7A 2YN0A 5EIBD 3SNKA 2OQRA 4FHEA 1YBMA 4JI6B 4FNOA 2FN8A 1P7WA 2NPIA 4S2EA 2WF7A 4M8KA 1OASA 4E70A 1HC7A 2CKMA 3LPCA 4IY1A 1SKYE 1VBNA 2PYIA 2WE7A 1TJYA 2D1QA 2JCGA 2QM3A 2WIGA 2C2MA 3LUGA 5EMNA 2O8CB 3RKRA 4DWWA 1E4OA 3JYPA 3MWYW 1OBVA 1O7JA 2WAAA 5M5BA 2X41A 1EJ0A 4HRVA 4WIAA 4X61A 4GX0A 4KODA 2R85A 4QEDA 4BO7A 4E5SA 5EIHA 1JU9A 3GJZA 4OQ4A 5KNCH 2J9ZB 3IOCA 3LUBA 5BV2P 4MEBA 1PTJA 2KWIA 1C8VB 3LWDA 1YJ5A 2NP7A 4N03A 2R2GA 3AR5A 3EGXA 1FFAA 2XCSB 3EAFA 1JDZA 3EEOA 4DR6B 1RYZA 4UJ3A 3BICA 4Q7MB 2QP4A 3F4KA 3NVDA 1UAYA 5CCXA 1IFXA 2PUBA 3FCCA 2MYTA 3T4XA 3V1MA 3TL2A 4EQZA 4FGSA 1YXMA 3KOXA 4PYOA 4B7ZA 4P33A 1NLZA 5C8XA 5ICSA 2F8TA 2QG4A 2Q41A 1O96B 1DO2A 4M55A 4TROA 3WRXC 1QYRA 3DONA 1XAHA 1MAUA 2AWOA 4PLYA 1YZUA 2DWUA 2ERCA 4PZPA 3MGKA 1YZYA 3T15A 2D8AA 1L4GA 3MQFA 1EK1A 3AERB 1OSNA 3AM5A 3KDAA 4KC0A 4OY3A 4X24A 3ZWMA 2FUG6 2CLHB 2H4XA 1IY2A 1T8RA 2R1TA 1Z26A 2X5NA 2MT9A 1LBSA 2R6R1 3AHFA 2O7QA 1H66A 4AJIA 2D0OB 2W6MA 2E21A 4L4UA 4EFNA 5HRUA 1E1CB 2X2OA 3BWYA 4MO9A 3QIVA 4JLPA 5ALFA 4A26A 2LCIA 3MJSA 2XAAA 4B7CA 2FJ0A 3UOGA 4EJ6A 3F49S 3KVYA 4GPTA 2ABWA 3UTDA 1SHLA 1ZM2A 4A8TA 3U4CA 2CYCA 3A1UA 1HXHA 4EG4A 2Y0CA 4NESA 5ITZB 1KEPA 5BN4B 2GPWA 3CPEA 2O0KA 3HG7A 4FNMA 1J8FA 4TS4A 3U16A 4HYQA 4L85A 3MWLA 5LBTA 1TU0A 2BUCA 2MYUA 3PICA 4BEBA 2B35A 4OHPA 4JBGA 2B7LA 1RRPA 1UBKS 1GUAA 3OPYI 1Q0TA 1JKJA 1FRVA 2CCGA 4LDAA 3C7TA 3TOVA 5IN5A 2A86A 3MJRA 1O0CA 2VHZA 4L73A 4UVDA 1JR6A 5HOEA 4WY8A 5DISB 1TM7E 3PVZA 5B7PA 1Z6QA 4AFNA 3KYDB 5AJUA 4GPD1 3IAS6 5K2OA 1PQPA 3AF1A 5CH3A 5ALRA 2PZFA 5BQOA 3HN7A 2Q6LA 3SZOA 4B35A 5A4MS 1WP9A 2BBTA 2ERYA 1KK1A 2IHKA 1YAHA 4I55F 1GRRA 3OZFA 4LWOA 4PICA 3VJKA 5B1EA 5L7WA 1W96A 1P2DA 1XZBA 2CE7A 1E6KA 1E3TA 4ZAFA 3RS7A 2YMPA 3CX3A 4LZJA 4ZEOA 4DT1B 2RG7A 3P2OA 3TQOA 1MJGA 2ZWVA 3H9BA 4NHOA 1HEIA 5FRDA 4BWGA 2RGWA 2H16A 2V6BA 3OIFA 4A2CA 3EEBA 4U6QA 3G89A 4BVAA 2ARKA 1SU7A 4JASB 3G0BA 3DZFA 3GJ8A 1CYDA 2G71A 4FFRA 3NC0C 3P9XA 1MEEA 5SV2A 2J0EA 2A4MA 4LNUA 2D0PB 2GXSA 4G8CA 4XLTA 4B87A 3FZYA 1SBZA 5CBPB 4Y2QA 1B16A 2FSVC 2GEFA 2JCSA 2ZWMA 4ER3A 5DTIA 1USKA 4CEIA 4M8SA 1L3IA 4F4IA 3L9WA 4DQ0A 2H4FA 3UENA 2J0SA 3TPFA 1OH7A 2E2WA 1OT3A 1T4DA 4I2VA 5BY2A 2P11A 2D06A 5F7JA 3EOZA 3T7RA 1DGQA 1WXEA 5KO2A 4IHJA 5FOWA 4BVHA 1UQRA 4L8YA 4PX9A 2PCLA 1UM9B 3O0DA 2CCKA 1QQ7A 1TKRA 4JUBA 4Z4CA 2PCJA 2WWIA 1ZLXA 2FMXA 3GRZA 4NATA 3N7TA 2WAXA 3USCS 5IKXA 2GHQA 1P5HA 2D1FA 2F1IA 3E9MA 2O7VA 3Q0EA 1VJCA 2HQRA 3A31A 3PNLA 2PPVA 3Q3GE 3UOWA 4XVUA 2LIPA 2I03A 1ORVA 4YT8A 2DERA 3COJA 1ZD1A 5ADWA 4QT4A 2BAGA 1UQUA 2PD6A 3KKPA 4HS4A 3TCNA 3UT5A 4B17A 3ER6A 5JS8A 1PNRA 3Q5GA 3RVSA 3SS7X 2FNAA 1U7HA 2A9QA 3LYUA 3DFMA 1NXVA 1JG7A 3GH1A 3MFQA 4NCNA 3GAZA 5AK4A 4CMCA 3U09A 4BCCA 9MHTA 2HSJA 5LC1A 4QO8A 3SFTA 2PSEA 2H2FA 5JSQA 1QQAA 2AI2A 4LY0A 3V2GA 1VLJA 1H0KA 1MD9A 3I4LA 3W6ZA 1SZJG 1FYXA 1BDHA 1UXJA 1ZN9A 4C6HA 4EECA 2BFFB 4RY2A 3EGWA 5K8JB 2NX2A 3DMGA 3WGIA 2QBYA 4CM6A 5K8LA 4AYTA 3RT1A 3RVQA 2IYAA 5CB8A 1GQYA 5LZ8A 4A82A 2HZ7A 1E1NA 1Z5UA 1KYQA 2Q3BA 4H08A 4K1LA 3RVBA 3N1UA 1PO7A 1BFDA 1I2DA 2IUSA 3GT4A 2R87A 3GEGA 4NU5A 4QOHA 4AS1A 4Q1DA 2EW8A 2ZI3A 5IT9A 2JFVA 3JV7A 1ZVJA 3P4UA 4LBWA 3AEXA 4HNAA 5HJ5A 4A15A 4ZMRA 5A5DA 1M5UA 1UC4B 3TNFA 1DTWB 5TMEA 4HGYA 1PEYA 1ADBA 4OH7A 4TLDA 1OLXA 1MABB 3DLIA 4G5SA 3SKYA 4F3TA 3PFGA 1RI1A 2BKXA 3U44A 4Q39A 2EDCA 3PX7A 4CM4B 4MKIA 2FWJA 2WT8A 3BIFA 1C7ZA 4BVLA 1EK5A 4NZZA 2VK8A 3VNSA 4PFKA 2W48A 1W85B 3UUEA 4POAA 1XYGA 3ENWA 4N7JA 3DMDA 3AUSA 5EVCA 5TMBA 1PV2A 1MNAA 1RQ2A 2ZBRA 4TTAA 4B3TB 4YBRA 2FW9A 2F4NA 1MN6A 4C0JA 2DRIA 1EG7A 4ABYA 2AN4A 1U11A 4YREA 4G09A 3ACDA 4UFOA 1DQYA 4EOGA 5TT0A 3WA6A 3CB2A 5C8VA 1U1EA 3BWVA 4IGAA 4A6EA 1GA6A 3WVNA 4D45A 3AF0A 3T7SA 5B30A 1F8XA 4MYUA 2JLBA 1TFUA 2A5DA 1NZJA 2OZLA 3FTPA 1C8KA 1ESZA 1K7FB 2VYVD 3FKSA 3FPBA 3W77A 5K0BA 5KPDA 2NAFA 2JFQA 4WDQA 2AVDA 2REQA 3HUTA 3L0YA 4URWR 3A9SA 2PUJA 3HYCA 2YVLA 5BNFA 1Z6YA 1O8CA 4FLEA 4JJGA 2BRUC 1N1GA 5J5VA 3UV7A 2C2YA 3KC2A 3C39A 1X1AA 4MKFA 1OLSA 3VKHA 1X19A 2WF5A 4IYRA 1PLKA 4BB5A 3JVDA 1HDCA 4ZVPA 3JD0A 3C6KA 4PAWA 1QFXA 2F1OA 2WJ3A 4WK4B 4UNRA 5GJWC 2FY8A 3DSRA 3SVZA 1SCNE 3IVCA 4L6AA 4LDPA 4OFBA 4BQFA 3C16C 5BNWA 1KDTA 5J2UB 4Z1OA 2OXRA 4MUGA 1QQBA 4JBLA 3BK2A 4YY3B 4B74A 3TTTA 1Y7TA 1ZINA 1EQAA 1ZRNA 4MULA 5K6TA 3KJEA 4OUDB 4F46A 3VC2A 3L4KA 4PAQA 3QENA 4QL3A 4L3OA 2A58A 3ZJYA 5L3QA 4WADA 2ECPA 2NSDA 5FFNA 5IHXA 2IZ0A 5GJBA 4WNCA 2FGKA 5UKDA 4F6RA 2H5IA 4BX0A 4KH1A 4H59A 1D1PA 3CH5A 1N3YA 1ODSA 1F6DA 1Y5MA 2Q1TA 3D4OA 4HAUA 3ZY4A 2PFGA 3QE2A 4G4SP 2QD1A 3PZRA 2Z5FA 3SGLA 4HB3A 1MORA 4RY9A 5D1HA 5IANA 3HXOA 5JCOC 1OKKA 2JIPA 3STWA 5AKYA 3S7ZA 1O3YA 3H1AA 3FF4A 4HH0A 4JBYA 2XF2A 4ISCA 3W2TA 1F2TA 1U31A 3IULA 3WYEA 3OPMA 3H0EA 3L84A 3CNQS 2GH1A 3BTOA 1SXJB 5A1JA 4W5OA 5IDYA 5JPCA 1O9GA 1T13A 3EGOA 3Q6NA 5P8WA 2WTBA 3UVEA 1USVA 1U0HC 2H29A 3P2MA 4P84A 4P82A 1XPJA 5E1OA 1QPZA 2FPXA 2AH5A 1CEXA 1BX0A 4DVJA 1EVYA 4TT3D 1HNZB 3BM5A 3TFOA 2PSHA 2BM0A 1ZMOA 3CX6A 2Z4TA 4U9IS 3UK1A 3ML1A 3RU7A 5D2CA 1ZR2A 3WLLA 3ADCA 2XA1A 1EX9A 4ZCIA 2Y1LA 2VSNA 4YT4A 4I5FA 1V3UA 5KSWB 1G0OA 4EW1A 2X0FA 2QRVA 2J3KA 3TW6A 3BQMB 3P9RA 4OXQA 3U80A 5DLYA 4WVFA 4ZQEA 3VNVA 1P2GA 2YRWA 3W3AD 3FUWA 3FUUA 1K8ZB 1YFZA 2C99A 2H1IA 4DMKA 3STVA 1LQ2A 4EABA 1X7ZA 5JQWA 2ORYA 4KLNA 4H31A 3WIDA 4A9AA 1TOAA 2ZFUA 3ADPA 1W30A 2X0IA 4FMCB 5JSUA 4ZQHA 4LDQA 4IF4A 1XFAA 5TS3A 4U8HA 1HLPA 4US2R 3IR7A 1G63A 1SMKA 2X1VA 1Q3HA 4RTLA 3IIIA 1E99A 2GVDC 2RGRA 3GB9A 2P2NA 1Y5RA 3H3XA 2V8OA 1DKUA 2FOLA 3DZJA 2VBGA 2OP1A 1ZR4A 1AGYA 5KMGA 1GUZA 1VRVA 1D1TA 2IDKA 2A88A 3UBMA 1KORA 1XC7A 2PS0A 1LNSA 1KVTA 2Q0XA 3D8UA 1O94C 5LUAA 1WS6A 2IEIA 3R23A 3V9AA 4AUNA 4MWCA 3L8MA 1P1IA 1W4BA 1KVRA 2I4TA 3WBKA 3EXEB 3L92A 4C5BA 4BE9A 3OIVA 1BW9A 1VHDA 5J2UF 1USGA 2VC2B 3HVIA 1OFUA 1XX6A 4V3CA 4GWLA 3KZCA 5BSMA 1RI3A 1KMCA 3H16A 4GKVA 3N6VA 5DN9A 3U61B 3I73A 1M0TA 2OZEA 3IUJA 2HPVA 4IIDA 3II6X 4Q9AA 4RORA 1CB0A 2ST1A 4OJKA 1KAMA 1WSBA 3SM3A 3FTDA 2R7LA 4RK7A 1XHLA 1N2XA 5LP6A 3NTUA 1CR4A 4DMGA 1A9YA 2XWQA 1CHDA 3NHPA 3QVLA 4CKWB 3TUZC 5LIPA 3ZY5A 3HR7A 4GPZA 4BTLA 4B7XA 3BIJA 4ALJA 4DV7B 2Q5OA 3OUTA 2I8LA 4U7JA 3JX9A 4OX9B 4F5EA 3FDJA 1T4CB 1F48A 3AI7A 3LHSA 3DDUA 4PFSA 5INTA 5JXIA 2AC4A 8AT1A 1AGXA 3P96A 4XJXA 4GRIA 5IDQA 1WCXA 2HKIA 3EGXB 3O0TA 3HVKA 4FILA 1FP2A 2NQ8A 3A11A 1NG9A 1HDGO 3DOHA 1MVNA 1QV6A 1Q0SA 3FGPA 1XZHA 1V4NA 3NIFB 4H16A 4MGZR 2BHNA 3PNQA 3S27A 5DOZA 2XEXA 2HSGA 1FU4A 2WIKA 2TMYA 2WWXA 3DMRA 1G4UR 3N8HA 4LJSA 4LX8A 1NF2A 2PUFA 1TVKB 3AK4A 5A62A 5IAGA 2H59A 3Q1KA 5CVEA 2X0NA 1IK6A 4C0AC 5BMVA 5K4GA 4ZT4A 2WV9A 4RFSB 5ESXA 1QONA 2HXYA 3THXA 4ILEA 4JCCA 3I5XA 3BHMA 2GDJA 1SUSA 2I33A 3PGA1 4S2UA 3PT9A 4HLUA 4FB5A 4YV0A 1BYIA 3KKMA 1JEYA 3E3NA 3LWBA 5ALGA 4TV9A 5KNCA 3I6MA 2XNDA 2R1TB 1ZSYA 3A6JA 4BYMA 4L72A 3DDHA 1NBMA 1QU3A 4HJRA 4DOMA 5DGIA 2XV1A 1G42A 3QFRA 2ZLBA 4GR9A 3IL2A 2H92A 4EO9A 3OPYA 1T6ZA 5EJ9A 4MPRA 3SBEA 4FMCF 5I51A 3K8OE 4Q3AA 3ZI4A 3HWX1 4FYHA 5IKOA 1SWWA 3ZWKA 2WYOA 1SKAA 2HHJA 3U7QA 1EUZA 2V9PA 3TLJA 1V5GA 3WIUA 4UZEA 3PIIA 1GPDG 4YC7A 5ALSA 3E5HA 3OICA 3MCVA 3DP7A 4MPPA 4LVOA 1PLJA 5MF6A 3CNHA 4YWHA 5KB3A 4M6WA 2CUZA 3EMDA 3HP7A 4D3FA 4HVLA 3I3SR 3N0RA 2BHSA 1XELA 5I8ZA 4DR5B 3LO5A 1JKJB 4NH0A 4UMVA 2HBYA 2B8JA 3JPYA 4YFVA 1U4SA 2PZAA 4UEOA 2JASA 3BMNB 4E1VA 1IB6A 1CY0A 3ZWAA 2AMVA 1HT0A 3CWZA 2WP8J 3R0QA 5E7JA 5LZ5A 5CIYA 1OILA 2C3OA 1G20B 4TLLB 4LHEA 4G9GA 4ZOLB 3HA3A 2Z8YM 1EP2B 2FP3A 4MMZB 1UMBA 3UWPA 3NHKA 4O2BB 3TFWA 4Y2VA 4IUDS 2X13A 3WRXA 3A6PC 3SHFA 4QXAA 4MVCA 4KQXA 3IR6A 2PSFA 4FLMA 3SC3A 3GP5A 5CEFA 1W0KA 2JGNA 5IUNC 3OQNA 2P9YA 5KAPA 2G9UA 2CXOA 5DHTA 4F4JA 2LE0A 2VZ0A 3WQHA 1AZWA 3KYBA 3AFHA 2ZAMA 4IIUA 4BLSA 1HT2E 2FN9A 1PIWA 1Y1LA 2ZP1A 3DYVA 3RG8A 1Y6ZA 4BVEA 4LNUB 1VE3A 4R6WA 5EMMA 3R8FA 1GRNA 2AUMA 4KK4A 3WB1A 5KYKA 1WSDA 4K6GA 1Z15A 2FPGA 2GBCA 4NBTA 5KJCA 2GRAA 1DXOA 4XZ3A 3ZKAA 1ZOOA 1XQ6A 1YACA 1ZUWA 2EKDA 2HWKA 2I2BA 3DE0X 3EEIA 3OJLA 3I9JA 4HAWA 2VZLA 3ZHTA 3AL0C 4UBNA 1B00A 2W6JD 3WK9A 4IO0A 2Y67A 1QQ5A 4DGSA 5JAUA 2DZDA 4QVKA 2BFAA 2GWHA 4IHJB 1AQUA 2PO5A 5GV8A 1QUFA 5BYJA 1A5SB 2PA0A 3IQGX 3OF2A 1VKRA 4EX6A 1MAAA 2CVPA 4HQ6A 2Z09A 3E1GA 4HN4B 2GTHA 2BZSA 1J2JA 1FFDA 2CLDX 1SVKA 4ZA2A 1RLIA 1L4MA 3EQ7A 3AR9A 3ZGNA 2YKGA 1YOVA 3T38A 2FTKE 4FFDA 2DPYA 3UT5B 3EEQA 5A0VA 4Z54A 2UYGA 2AMYA 1NX9A 3LUCA 4JX9A 1LV7A 1P0PA 2EIXA 4TTTS 1ZEJA 1ZICA 1YFLA 1FDSA 4B6OA 2X3YA 3LMKA 3GA5A 4Z8XA 2B4TO 4XIYA 3DZBA 1R4AA 4ZPXA 1IHYA 2FMKA 4DARA 2CDRA 3DO8A 4EELA 2GYUA 2Q6TA 4OF4A 4EHLA 4P1ZA 5AR1A 5LYJA 5EZYA 1K8YB 2V54A 3RH0A 5F5XA 3TD6A 5JQGA 1M2VA 2DFNA 3WLMA 2FSVA 4YRLA 1CK4A 3B1ZA 2CLIB 2OLKA 1UPBA 3I8SA 4BMNA 4BRWA 4QDOA 4WD3A 4E2YA 4MMYB 3OJXA 2QTGA 3RWOA 2QORA 4OA5A 1QH8A 4F06A 2H4HA 1DKPA 2GF9A 3FJYA 4HX5A 4BZWA 1NP3A 3ZVKA 2VWQA 5T64A 1M6EX 3FYUB 4IGIA 3ZH2A 1ESCA 1RRKA 2JFFA 1QKKA 2VDPB 3QQPA 3ETLA 3SZGA 5LU8A 1OLXB 4NJEA 4BQSA 3L2OB 1X8LA 2E89A 3U44B 2P5SA 4Q6WA 2DR2A 1J21A 4NNJA 3AIOA 2VXCA 3JQ7A 4OLJA 1A7KA 1RRFA 1VPEA 4ZOLF 3NHZA 1NNI1 1MRZA 3NHAA 4HPJB 4C2TA 2I9PA 3L4EA 2CLEB 4O2BF 3BTVA 3D4IA 3PC7A 1M33A 5DGTA 1GL3A 2VYNA 1JHPA 1U8EA 3A7DA 4M9UA 1P5RA 3GF4A 2WV7A 4ROTA 3R9XB 2FSPA 5CJ2A 1CS0A 1YHYA 1DAPA 1T0IA 2XXAA 3BXPA 3CEHA 3TQFA 2HSZA 5MFZA 4IF6A 2D1YA 4PYJA 4LBVA 3ANMA 3EZ7A 4K5QA 3IQXA 2GAAA 3MGAA 1M6VB 2AZMA 2O23A 4I99A 4CFYA 3IQZA 4XYGA 4BMXA 5B2EA 1DT3A 4MVYA 1EHIA 1DL5A 2HA5A 4JA2A 1HQYE 1MEOA 2OZLB 4RMHA 1NPDA 2V5AA 1U9IA 2SECE 5AVOA 5IBCA 3WK8A 4OBWA 3Q8KA 2GGSA 4M8LA 2VQ6A 3JZIA 2REQB 2X22A 1YNOA 5HUHA 1ZJ4A 1D2GA 2JA1A 4RAQA 4TMTA 4ZVOA 2PRSA 4FVTA 3BRWA 2YHUA 5IXSA 3TXXA 1H2RS 1H8ED 3CF6R 4ITUA 5JECA 5JTTA 2BHRA 4E5KA 4IHJF 4W99A 4GOOD 3ILSA 1CY8A 2GB4A 4QDZA 2ORED 1I1OA 2CUKA 3DO5A 1XTBA 1U5BA 2GUGA 5ESRA 1U99A 1Y80A 1Q1BA 1SR8A 3TD2A 1JDNA 1O97C 1MENA 3D3EA 1NQXA 1CUSA 4BNNA 4ZGBA 4A36A 3PTLA 4GBGA 2FETA 4U02A 2KI5A 4HGPA 4BVGA 2VWGA 4QFMA 2WD9A 5IBRA 3WNQA 2X40A 5K3FA 3IMEA 2G17A 2W22A 4DLTA 3ZE6A 3A58B 5KVSA 3L01A 4W5NA 2WG0A 3L4BC 4H3VA 1P7ZA 2X6QA 2QXTA 4FDAA 4Q3EA 1GV0A 5AKGA 1WZ2A 1V37A 3OI7A 3BC1A 5L3QB 1GLVA 1Z0UA 3CPSA 1S5PA 2Z3ZA 3L5OA 2FW1A 4JYBA 4BO2A 3BSSA 3X3HA 3K5PA 1DOAA 3REFA 3VR2A 3V8RA 1MHPA 3WO1A 1P74A 3M6UA 1WDLA 3IESA 3TRFA 2BVNA 2PBLA 3FM9A 6AT1A 2V7UA 5CX1A 2JAUA 4RHCA 4Y0VA 3QBVA 4PZZA 3CW2A 5B3LA 5JS6A 1FRNA 1OXKB 2GNAA 2ZRFA 5IAAA 2IZZA 5AD1A 1NHWA 3G1UA 3ZJUA 3NTOA 2CHEA 3I5AA 3HUEA 4JJEA 1F2TB 4KBYA 3OC6A 1ZXBA 2FWMX 1FVHA 3HBLA 4Y8VA 3CC8A 2RH4A 4JVMA 4J75A 1FA9A 4JSRA 5ICGA 1DNPA 4RHYA 4ZU3A 3SIRA 3ETEA 3H5AA 4JU9A 2OLJA 3A4VA 2A1UA 3PF9A 2BRUA 4Q93A 7REQA 3H8VA 2XDYA 2NMVA 2DPXA 3F6CA 3RNLA 3AR2A 2Q5EA 1RWXA 3HV0A 1ECGA 3G5LA 5IFLA 1CF2O 3H5WA 2GK6A 1X7GA 1FZQA 4QKQA 1LW6E 1HGXA 4U0JA 2X9LA 5HILA 1GP2A 2IIVA 3I6IA 1VQ1A 2R6FA 3KQQA 5LXTB 2DQKA 1ESEA 3G17A 3SQXA 2QN1A 4RJTA 2YZNA 4I14A 2QRVB 4MWGA 3UK7A 1TGYA 1P19A 2CYBA 2G67A 2CNBA 2ZULA 1ODIA 1AGPA 3A2LA 4E07A 3V8PA 1ZZGA 2XVAA 3U3MA 1N5LA 1RR6A 1W4CA 1X7ZB 1SOMA 2V03A 1W34A 4E03A 4NVRA 4ITRC 3RVRA 3BBLA 1R3DA 1ZH2A 3D8BA 1F6WA 1S8AA 2WZCA 3L0PA 3B3QA 3PEUA 3TZ6A 1FY2A 3KQOA 4C4ZA 1KZ1A 5BW4A 2C7OA 5EIFA 3HNRA 1TM2A 3I72A 5TE9A 4DXDA 2D3TA 1T3TA 3H2KA 4DLUA 4AW9A 1Q95A 4ZCPA 3OY2A 3EAQA 1I3MA 3DEHA 3RABA 4KXMA 2XUQA 4I19A 2PN1A 2WJAA 3A6LA 4N8DA 5TV2A 2QNBA 4LV8B 1MHTA 2PVPA 2EW1A 4V03A 5CYFA 2AG8A 1Y6FA 1RHMA 2G9VA 3EC2A 1IJFA 1ZD2P 3AHGA 3EXIA 5TGTA 3ILXA 5IJ9A 2KX7A 3U4MA 4LGYA 2NNLD 5DO9A 1KS2A 5FUWA 1Y82A 5B3AA 1EHYA 4KRGA 1BS2A 1FK8A 4ENRA 1EFPA 5KMGB 5E3JA 1XTJA 3ACBA 2DM6A 3AQIA 3HB9A 3UV6A 5IF3A 4UU1A 3L82B 2J3MA 4RVHA 4X93A 4KAAA 1BMQA 3Q15C 4GE0A 4V24A 1RZUA 5DWDA 3K05A 2W6PA 1HOTA 1Q19A 5DSZA 2O06A 4F56A 5HXAA 2I7CA 5A6VA 1TAQA 3GA7A 1LXCA 1QYCA 3HM9A 4UM9B 1BW9B 2PS1A 1AS3A 4MYTA 3WRVA 1U9ZA 3N74A 3AC0A 1EWTA 1Q0PA 1S02A 2EFGA 2HHAA 1UR5A 1JFFB 2I4OA 2WJGA 3H83A 3OFVA 3P94A 4P4UA 4ATNA 3E03A 5I7FA 2HIHA 1T6NA 3G5TA 4JUIA 2O2YA 4BB0A 1UC8A 1B76A 3GLHE 2ZI9A 1U81A 3JQBC 4G24A 4IYJA 1ZRMA 4FD3A 2OM2A 4O8CA 5CK5A 5NULA 5JHHB 3SDBA 2W2QA 4A10A 2PMWB 2QYSA 4EBFA 1E1RA 3QKTA 2P6RA 4X3CA 2AD5A 1KI3A 1Y63A 3ZV4A 1ATIA 5SYMA 3HZOA 1B8PA 3LFTA 3WLTA 1DPFA 2C4UA 5DCLA 1Q7CA 3AX6A 1V3TA 4TOIA 1O6FA 4DYHA 1UKVY 1XZEA 4RF5A 1I10A 3ANSA 3DJFA 4EUFA 3X43A 5AXBA 5BXQC 3G9ZA 3A32A 1AK9A 1OXSC 4H1UA 5ICEA 3KB6A 2IZOA 1OI2A 3CT4A 3RIEA 5ICCA 2LRHA 5EUCA 1PL7A 2REBA 3L1VA 1MXFA 3KOMA 2GK7A 4PRYA 3UFBA 4Q3DA 2WIFA 3HSYA 3M6WA 4NZYA 1D2HA 1AUXA 2UXBB 4G2NA 4LC0A 3CLRC 1WMAA 3KXPA 5KJFA 1NW4A 2PRYA 4F4UA 1R9JA 4OX9Y 2HB6A 3AFOA 4X92A 1YJXA 2P75A 4TKVA 1J42A 3D59A 3BJIC 3U49A 4PNHA 2IXAA 4O4JA 3DOUA 3D2AA 3THXB 2JJYA 1Q83A 2VPTA 2WVGA 2XADA 3CYFA 4QIHA 1GT6A 3ZCRA 4CL2A 4P86A 2NVOA 3EG5A 3MW8A 4RCVA 5HF6A 5LXTF 4ZALA 2RD2A 2OP0A 4CHTA 2CSXA 2WQZA 1TF5A 3M9XA 1JEYB 2I2XB 4TV9B 3NJRA 4LJ8A 5K0JA 3GFTA 3H5VA 2IUEA 4HX9A 4B33A 1QBKC 2IOHA 4QYTA 4V0RA 3CE6A 1A7UA 2HCTA 4F3NA 3BD7A 1L1FA 5CM2Z 4D74A 1Z74A 1U2EA 1VE6A 1ZGZA 1B1AA 5AIAA 4JODA 4Y2UA 5HYVA 2EQ5A 1ZJJA 1DEOA 2WM9B 3PD1A 1MXHA 3OPYB 3W6UA 1QRSA 3DQPA 2AKEA 5F12A 3OPXA 4MPTA 2IFTA 3B5IA 3HJUA 4WNYA 1NAIA 5GQSA 3HXPA 1Z3IX 1HORA 4EF5A 1CQPA 3U7QB 1F60A 2CBXA 5AJTA 2HZBA 5IH3A 3O9MA 5ADUS 2ZTHA 4V0OA 3EIHA 1W4RA 4LG1A 2H8GA 4YASA 1CUHA 1OH6A 4BN5A 2M1ZA 1NDQA 4I36A 4ZHQA 4NCIA 3PRJA 1M0WA 3ENVA 3FVVA 4LWZA 2ERXA 3TH5A 1SBIA 1DS6A 4EW6A 2EKLA 3CZAA 4NABA 5LD2C 5HDQA 4J7UA 4DDVA 4TKZA 1WE2A 3ZLVA 3G02A 2IYOA 2NXEA 3I09A 1UMBB 3TDNA 4HZUB 4RX1A 3TLXA 5CDGA 1KKMA 2GCOA 2D6FA 4HH4A 3LWZA 3MVEA 5DV9A 3AP2A 4BLOA 1D6MA 1XHFA 4DNFA 4HDRB 4OI0A 3E27A 4MRSA 2KYRA 4EB6A 1DRVA 2HRBA 4EI8A 4R7GA 5T6MA 2FLVA 1N78A 4IUYA 1UKYA 2EZTA 1Y3AA 2C0PA 3L49A 4QATA 4R1TA 1Z6PA 3GFSA 4KBFA 4Y6QA 1RDFA 4CQLA 1Y3CE 3RARA 3WWEA 3ENKA 2OOKA 3ZV3A 5C5CA 1JVSA 2R9VA 2FPGB 4PNPA 1E3LA 1UPCA 1M72A 3QOXA 1GKKA 3F8WA 4MVJM 3D2LA 1OI4A 3E9DA 5FYDA 2VATA 4ENSA 4L7VA 2RGDA 4IDPA 2E4WA 4B48A 1Z8HA 3EJ6A 3LZCA 1JBQA 2JK1A 1WPGA 3LJKA 3LLVA 2ODWA 3L02A 1WD5A 3WIBA 4DLNA 3FLMA 5L51A 5A05A 1YKFA 1FNMA 1FRZA 3X1KA 2B78A 2W2MA 1UBHS 1Z82A 3IIMA 5LN1A 2JZCA 1SAYA 5ELMA 4XVRA 3ZK7A 1Z33A 4QD3A 2RK3A 3ZQJA 1IXYA 1YA4A 1ZRSA 5DI3B 3MD9A 5CJJA 1NVKA 1T1GA 3BBPA 3NTXA 5BSGA 2TSYB 4TRRA 3ZCTA 3GN1A 3ZGZA 3I12A 3ZGVA 5IDXA 1OE0A 1YOVB 3FIUA 3O92A 4K05A 3A6GA 3FOCA 3GFRA 3ETHA 3KVVA 1QXSA 3QPAA 4X63A 4EKNB 3A28A 1OFUX 2WFAA 4ZYUA 5FPTA 3WMRA 3WYCA 2BFBB 5JZMA 4DWOA 2HUPA 2RBGA 3GPDG 3BFPA 2OXTA 2XB8A 2ZKLA 2QX4A 3N2IA 4BP8A 4IVNA 1N9KA 4Q7EA 1JR3D 2PWZA 4K9OA 5EZYB 2I7DA 3SS8A 4UU0A 1O2DA 1ZNXA 1I4WA 2OE2A 3M4XA 1JECA 1M2VB 1W8IA 4YCJA 2WLSA 4JGGA 3PQDA 2R60A 5EXSA 3FTEA 1PJ2A 1ZIPA 5TX7A 4Q9KA 4F5WA 1OLOA 5EWLA 3OEHA 1Y37A 2YHAA 4R9VA 4J90A 2HA4A 3HN2A 3H99A 3IVAA 4JJIA 4UOZA 1QH8B 4I50A 2Z1DA 3NGLA 3RYCB 2PKWA 1TMGE 4ZTZB 1POWA 2PYZA 2JIZA 1P1BA 3T9CA 2XB9A 3N86A 4I4CA 3DAPA 5CH8A 5LUBA 4D4KA 3DC2A 1LJLA 1NVTA 1L2TA 3VBEA 4EG5A 3W5JA 5AKLA 5AKXA 1OJ7A 4NJEB 3KYCA 1IHXA 1MQAA 2I2AA 4AX4A 1DG3A 3QXHA 4ACAA 3DEAA 1J09A 1YSCA 3DHWC 4NG4A 4D81A 3PEEA 2V65A 5IVIA 1EH5A 1OWLA 2INGX 2QW8A 3ZG6A 5EMJA 2O8NA 4R8VA 2OSBA 2A9JA 2F3UA 4UCQA 1KK2A 4YRTA 2L0XA 2AC7A 2AR9A 2PTGA 4YMIA 4HK4A 5JRJA 1F3OA 4FYVA 4YAOA 1GG5A 3GJ7A 4TWZA 4BX3A 4NECA 3Q8MA 4BKMA 3FWYA 3FLAA 1OX5A 1TO6A 4J6FA 5J4HA 3CUTA 1SXGA 4CF4A 1M0SA 2PWYA 3AVUA 2XXAB 4UU8A 3GUCA 4TRNA 3T06B 2CVHA 1G21A 1T8YA 3FD8A 4MYSA 1VL1A 3H05A 2ZBPA 4FQ8A 2KLHA 4U3JA 3TLZA 1PGJA 1BOFA 4OGKA 5KTMA 4H6VA 4X7BA 1MAHA 4HQ0A 3OCJA 5D01A 4C78A 1H6AA 1UDRA 1L7PA 3LECA 3K8YA 5IVHA 1G7CA 1JBKA 1WLSA 4RVDA 3WBFA 2POCA 1COWD 3KEMA 3W04A 2QM0A 1E61A 1JZQA 2HPAA 3EZ6A 3LFHA 2WJ4A 4NE7A 3UMJA 3AG5A 2P9HA 3T8YA 3KJQA 4LSGA 1X1CA 1HE2A 1CG6A 1CJMA 2JL1A 4TXMA 3LW8A 5ALEA 1J5XA 2W2PA 2VXOA 3DP9A 4BX9A 2L2QA 3DXYA 2B5OA 1U5BB 3HBMA 3IFSA 4J1TC 1IZ0A 4YT5A 5AJZA 4UUNA 1GKIA 3RSOA 1X7YB 1U7TA 5ARDA 2QOEA 1JA9A 4A2QA 4YXFA 4OI4A 1WXGA 2ONKA 4K1XA 1M1NA 2BEJA 2BYTA 2CXTA 3JD1A 2C1EA 2W00A 3L7IA 5K3FB 2BR4A 3ZW9A 2BL4A 2DKOA 1V8PA 1DIAA 1Z37A 3EFOA 3WLHA 1W46A 1SHKA 5DNYB 2QPOA 4NNPA 5FJJA 2NU6A 2ODBA 4GBJA 4Y2RA 1IWBB 1AXEA 1P2TA 3B1WA 3I8XA 1VE1A 1E2KA 4ENQA 3ME5A 4G0ZA 2B8EA 5EIAA 2MIIA 4WCFB 2H1SA 3C41J 4PBTA 4FS3A 1QP7A 1DSSG 5DW0A 1N57A 2D4AA 5EFZA 2YFYA 1I24A 4RCYA 5CX1B 4KITB 4ZGGA 5IFKA 5EIEA 5EZYF 2G0TA 1RACA 1D1SA 3SBOA 3W9YA 3ZVLA 2VXBA 4DCUA 1TKCA 2JCBA 3WR5A 3DZIA 2ZJFA 5ESWA 3S5UA 5C4IA 1KDPA 4IEEA 3K73O 2PLNA 3KSZO 1NVVQ 4BWVA 3PGJA 5IU6A 2XMPA 4Q12A 4QDTA 2PUVA 3FGZA 4UHCA 1E5TA 1G3QA 2QAJA 2B92A 1RJFA 1XKQA 4JL6A 4DQKA 3OKPA 1HYGA 3AFMA 1OXXK 3RVNA 7REQB 2PT6A 3T9EA 4FHGA 4DSOA 4RZ2A 1Q0UA 1YRAA 2GPJA 3BXZA 4WKBA 5CW1A 2C1ZA 3HC7A 4CWAA 1NVMB 4DXHA 4EJ2A 1IMOA 4IQ4A 1VCNA 2EBHX 4DLVA 4LISA 4A16A 4MZDA 2IHNA 4CKCB 3CLTD 1GQOA 3PU6A 4RM3A 5FX2A 4OKSA 2GNOA 3AU8A 5EN4A 4K2AA 2YRXA 4HEA1 4Q19A 4QLAA 3TO5A 1U6KA 2YRFA 1WDMA 3E7PA 1BHO1 2YUTA 3W5DA 4R40A 5BVGA 4KB5A 2SNIE 1V5FA 5AESA 2QJFA 3IMFA 4QUHA 5D3ZA 2YICA 2VJPA 4LJYA 4TMYA 1B8NA 5F2OA 3ZS9A 1GSAA 1XZ8A 2G0AA 2VUUA 5F7OA 2WZDA 1E2NA 1PR3A 4PLTA 2YMQA 3IUEA 2XTAA 4C0WA 2YYAA 1EK2A 4O33A 4JZYA 2YY6A 3GT0A 1R66A 3ZDDA 2PKQO 2X4GA 3BKXA 2X6TA 1IY0A 2ILVA 4R69A 2FA9A 2JB9A 2WRZA 4R1PA 1GYRA 2P5UA 5FWXB 2R68A 2GZRA 1X70A 2UZAA 5FPKA 5HF5A 1Q22A 3EXIB 1E79A 2NV6A 5IJ9B 2IUYA 1J23A 1A72A 1CUVA 3IPYA 2QM7A 1B41A 3E7FA 3LPDA 4YJFA 3KOOA 1ISIA 1EFPB 3F5SA 1BFKA 1AX9A 1XVAA 4R3UC 1GFIA 3DOEA 4N47A 1ID8A 1I7NA 5FR1A 4P54A 1HZJA 1T26A 1BRTA 2AN3A 1BOOA 2XAUA 4TKVB 2YBEA 3T1OA 1BWSA 1CEQA 3IAAA 2O50A 4RQTA 2D5BA 2I4MA 2G1PA 2B69A 2GN0A 1Y1PA 4P53A 4PG6A 2FGJA 3RQSA 3TYXA 1SK9A 1GPH1 1Z62A 4D25A 4TMKA 1ZVMA 2GR9A 4P7BA 1D6NA 1I6LA 4Z9XA 2XZPA 3NHLA 2OV6A 2AQHA 3BTSA 2EWMA 3D3JA 1VP3A 2ZIZA 1XOIA 4IZ6A 4B4KA 4B3GA 1EJBA 1LSUA 1EEXB 1RIIA 3WAGA 1E2LA 4GG1A 3R6WA 2Y1WA 3AYXB 2B1JA 2F48A 1SOVA 3B89A 3ZV6A 1EVLA 3GVPA 1B6GA 1KMNA 2V3CC 3RK0A 1YCGA 3HB0A 1UMDA 1R4NA 3ET5A 4KREA 3RHSA 2Q50A 5C52B 1TYDE 1JXMA 2X4IA 2GEVA 4O4IA 3MA0A 1LBTA 1NLYA 1XZAA 2GM3A 3MJDA 3NTRA 1PN3A 5LA6A 4R8RA 3L0CA 2PSSA 4XCXA 3V6LA 1YKSA 4CLHA 1W6RA 2QN8A 4R1SA 3ZNQA 2O2CA 5HJ2A 3DT9A 4QXRA 3T94A 3OMLA 3OWHA 3PJEA 4B44A 2ZRQA 4PYLA 3MWGA 1L7QA 2A92A 1ORWA 1YBHA 3U1TA 3UAOA 2R6DA 5L6MB 4RMIA 4BMDA 4JAVC 2POQX 3VO8A 1VJTA 1E9BA 2QW0X 1PP4A 2W8ZA 3H5RA 1S4QA 3O4HA 4AAYA 2HJGA 3D3WA 3OKCA 5BWOA 4CYMA 4LNHA 4EG0A 2A9KA 3A1FA 4INZA 4MW2A 4O4JB 1N7IA 3H2ZA 1ZCBA 1RVV1 1GTMA 2JFWA 4JYMA 4TSFA 2B7CA 4ZT6A 1EWVA 3R5KA 3RO7A 1Q21A 1WEKA 1VMKA 2VQSA 3TRKA 4EZBA 3CVWA 2QZPA 4GC5A 4WTOA 1OXMA 1XAIA 1P2UA 1N0UA 3BIOA 1WUJS 1ZXLA 3SLKA 3GX1A 3ZS8A 1IVSA 1JDUA 5CIWA 4JIGA 1R0WA 1D9XA 1TVMA 1CUJA 4IJ5A 3WWYA 1TC2A 4IMRA 4M1YA 1AA6A 2O2SA 3JQBA 3L6EA 4NICA 1G8GA 4FOSA 4D79A 3OAAD 3TZQA 1CEEA 1KHHA 1MAWA 3COWA 1YL7A 5JPIA 3C43A 3SYMA 1YT5A 3QV2A 2H5LA 3C3DA 4DANA 1K7YA 1KSFX 3BRCA 5DASA 5GPBA 2KS6A 5DYYA 5E7QA 4D9CA 2NNWB 2J9RA 3VR4H 2C98A 4CKEA 1RRVA 1J1UA 3VSAA 5FLXA 1SXHA 3CZQA 1NN1A 4DA4A 5E9JA 1PFUA 1PV1A 4L2IA 3NBFA 4DCMA 4C88A 3VVLA 3GEBA 3NT5A 4DRYA 1OR8A 1UM8A 2HYIC 1RVDA 1ZX1A 3EIEA 3ORHA 1Y9AA 1DTSA 2XH8A 4KOEC 4Z4IA 1RLUA 4YJHB 5L7YA 5EIBC 1A95A 4M9QA 4PHFA 4XA8A 3KETA 4KN6A 3T95A 1JR3E 3PJFA 4MVJP 3HI6A 5HKAA 1VJ5A 3WADA 2IHYA 1RLMA 4EB6B 3CX7A 3FBWA 1IJKA 4OK3A 1HMPA 3L6RA 1YQDA 3DDSA 4TKLA 3KBBA 5I7OA 4F7WA 3PTAA 2XVXA 3IPXA 1Y8AA 3OQPA 2VHWA 4WFKA 4XCQA 4E1AA 5T3YA 3WLQA 4D43A 4GL2A 1G2IA 3HXLA 5LNK1 4YAKA 1PQUA 2FEKA 2ZR7A 1IUOA 2BGLA 5JASA 2WJVA 4WCVA 3V3TA 3VZCA 5CDFE 3AW8A 5HCNA 1NLUA 4KV7A 4NCKA 5JXHA 4KIUA 2UZ1A 5E9AA 1KY3A 1P4HA 2VKTA 4MK4A 4RTSA 2ODAA 2Z8ZA 3LA6A 1PT6A 3OUUA 4KO1S 5AK6A 1BH6A 3MT7A 3QFSA 3TR5A 3VR6A 3ZH9B 4DLKA 1UJ2A 4P34A 3DLAA 1TQ8A 5CAEB 5AI4A 4CI9A 3JASA 2ISCA 3CQ9A 3GZJA 2Q5QA 1YCDA 8ATCA 4TWJA 1ZUHA 4G4JA 2HCFA 3T54A 1HNXB 4LXYA 4FINA 4UJ5A 3U9SA 3TE6A 4CDGA 4HYTA 1NSYA 4NPCA 4J0HA 4QG7A 5BWCA 3WAJA 1B0UA 4I46A 1LWOA 5CXUA 4X1IA 1Q1GA 3DTVA 4MDYA 1KKLA 1G8KA 4O4JF 3WFIA 1VLZA 5ALPA 4BHTA 4RAOA 3UC9A 1K7XB 4D9JA 4FDMA 3W5BA 3T9AA 1M8JA 1MZPA 1EXWA 4QXMA 3LXMA 3IBFA 2H7VA 3JYLA 4INOA 4J4HA 4ZRMA 5KTOA 4CIBA 4IRMA 1CVRA 2A7QA 1A2BA 1V4VA 4XSGA 4K3VA 1UKZA 2PZLA 3OOJA 1BGXT 1MQ9A 3WLJA 4CG1A 4WK6A 2IH2A 1Z13A 1ZP6A 1QIGA 3NEPX 1G6KA 5KOIA 1KEWA 2EJUA 2XXBA 3OTIA 3W2GA 4YDSA 2PZEA 4RK5A 4UHJA 1MEJA 1Z6TA 1PJ4A 1JSLA 4ZYWA 5EWLB 5TJHA 2FSSA 2BP7B 3ZU4A 3ULKA 4TWAA 3RK4A 3U31A 1R0XA 2YQ4A 3AR7A 1A88A 3LP6A 1JMKC 4I50B 4AN0A 2H51A 4KR0A 1WAMA 4H7FA 2P9CA 6REQA 4XM2A 5LL6P 1DC8A 5KREA 3KLPX 1W93A 4HDAA 4MP3A 4WLUA 3VPXA 2FG5A 1E5DA 3KVRA 1Y34E 4FT2A 3AJRA 1J22A 1VGQA 2IPOA 1V43A 2C96A 2DJIA 2F9MA 3KXDA 3KYCB 5A3RA 4QU5A 4DCJA 2WNHA 2XGMA 4JWKA 3QJYA 1KKUA 4KGZA 1L1QA 2Y3IA 5KBYA 3GHYA 4AL4A 2QN2A 1EFHA 3EUAA 2ICAA