1Z08A

Gppnhp-bound rab21 q53g mutant gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
160
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
total genus 53
structure length 160
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z08A00
1CP2A 1RRCA 1UKVY 5HZHA 3I1FA 3D3QA 2Z6VA 2C98A 1E9EA 2Q9BA 5BN3A 1W36B 4DB2A 4LJ4A 4YMSA 4ESVA 2JLRA 1ZBDA 2ZROA 4B44A 4JBXA 5SZIA 1NVVQ 4OL0A 4JKYA 3VKWA 1WE2A 2RGNC 2ODWA 2GCPA 2D7DA 4LPKA 4LYJA 5JSZA 5KNCA 4A6XA 4XWOA 3WYAA 2VLIA 2XZLA 4U02A 2R6FA 4WOPA 4WVFA 5FBWB 4K81B 1G8GA 2ATVA 4B33A 1AM4D 3LO5A 3NH9A 2ZRCA 4G5SA 1E2GA 2EU8A 5DN6A 2HV8A 1CJVC 1G4AE 2V6JA 2I3BA 2GK6A 1E2DA 2VP9A 3FWYA 3PEVA 3IEUA 3LLUA 2J45A 1VCIA 2G9NA 3KZ1E 4DSNA 2EWVA 2WPDA 3WYGA 3GEIA 2IXGA 5H70A 3SDZA 4D0NA 3TUJC 3K9LA 1CU1A 4LYFA 1SVIA 1X8LA 3GLFB 2R6DA 1YJ5A 1FP7A 5EUMA 4PC3A 1E2IA 4DB4A 1EFRA 1ZM7A 3TJZA 121PA 4E03A 2GZHA 1AN0A 4PPGA 4TL9A 1G41A 1ZM9A 5SZKB 2VP0A 2EW1A 4NKRA 2DR3A 2YWGA 4PSVA 2IS2A 4LJYA 2HDNB 4JIMA 4PO8A 4Q7KA 1CR2A 2VQSA 3SJZA 3ZS9A 4M1KA 5FBVB 1K5DA 3U3RA 1DAIA 2KSQA 2HLDA 2JEOA 4DCUA 4XWAA 1U98A 1AS0A 1WF3A 3U7EB 4MYHA 3QOFA 4XD7D 2IT1A 1NJGA 2GJ9A 4LHYA 4NTZA 4HLUA 4GBMA 1N6LA 3OZXA 4LBWA 1DAHA 1L4UA 2RGBA 2VH5R 1Y63A 4TQ9A 2OFOA 5FUYA 2GJ8A 5K8IA 1JXMA 2R6AA 2YOGA 1NMZA 1N0UA 1P7CA 3I3SR 3K9NA 3Q85A 2DFKB 2ZRGA 3BS4A 3TIFA 3WRYC 1N0WA 1VDZA 2RKOA 2ECKA 1P75A 2SHKA 4L4UA 2FEOA 2ZEJA 4BRWA 2FV8A 4C0LA 5DGXA 2W6JA 4M1MA 5FBLB 2BDTA 3U4QB 2ZRIA 5CITA 5ELXA 2OHFA 1P2UA 1E2QA 1GNQA 4ACAA 3KKPA 4AC9A 2I1VB 4YLGA 4DUGD 1II8A 2J46A 4E07A 3IBYA 5CDFA 4BFUA 2OM2A 3PXGA 5C4GB 1RJ9B 5GVRA 2VHQA 1Z47A 2VEDA 4JLJA 1E4YA 3PUWA 1N5IA 3EWSA 5CB6A 1MO5A 5FBQB 1TPZA 5FR1A 4BPBA 2WICA 3QQ5A 4A4DA 1JNYA 3W6PA 3D31A 2W0SA 2F43B 4PSAA 1TF2A 3BFVA 4BLRA 4W9MC 5TDHA 3LBHA 3UATA 1L7VC 4LBVA 4RCZA 5CIQA 2HF8A 4XVRA 2AKAB 2BM1A 2B7CA 4OQXA 1GP2A 2WKRA 3M6AA 1UBGA 1NRJB 5A0FA 1G16A 4AWXA 5CLQA 2HUPA 1E1RD 2BIFA 5FH9A 3KXLA 3IIMA 1W2GA 3BD9A 3K9HA 2FFBA 4TWZA 4LYHA 4Q1EA 4JLDA 2O8DA 1DAEA 2B6HA 4DDUA 1D9ZA 3B6EA 1COWD 4G3XA 2DWPA 2MSEB 3WBKA 3KQUA 3O8RA 1G3MA 1E6CA 2QUZA 3QPVA 2J0QA 3L0IB 1XPOA 1W0JA 2HCJB 1QHIA 3TSWA 3ZD6A 1F2UB 1G64A 1TAGA 1F2TA 4N0DA 3UWKA 1XMSA 1WBDA 3THYA 1XB2A 2CLCX 3OF5A 3GP8A 3KL4A 1GRRA 3PUVA 1RJ9A 3QENA 4NYIQ 1EFRD 2WTUA 4ZPXA 3IHWA 2ZAOA 2O8BA 1XX6A 3R9IA 5HE9A 4CZ2A 5IT5A 1ZM3A 3GLGA 3U4QA 2ONJA 2DYKA 2L0XA 1Q3TA 4FN5A 2X1VA 3KQLA 3AP1A 3CNLA 1W36C 2C95A 1BKDR 4PPQA 3SC3A 5FOTA 1AJEA 2XNDD 3RVBA 3TVDA 4M1SA 3MWYW 4Q1FA 4P0TA 1OXVA 1RPZA 1XEXB 2CVHA 4Q03A 3Q3JB 2WWXA 1G291 1R8QA 1XJCA 1PZNA 4ARZA 1VG8A 4HATA 3L82B 1GRQA 4B76A 3EC1A 4F38A 2JJ2D 1JQJC 1R5BA 1QHHB 4DLZA 2NIPA 4L16A 4AG6A 1WP9A 4P3YA 2PBRA 4XWKA 4MQBA 1SVLA 2ZSBA 5TARA 2FJUA 4US0R 4DZZA 1G7TA 3ZDQA 1U9IC 1ZIPA 4WIAA 3ZQ6A 2OT3B 1M7BA 1MR3F 1FQKA 3EZ6A 4M21A 4F4IA 2XAUA 1W47A 5JMTA 4BEBA 2Q6TA 2NO1A 5KNDA 1Z06A 1FQJA 5EXTA 2P5TB 3KXKA 2ZI4A 2ODEA 1NKSA 5EE1A 1A5TA 4CEIB 3NEYA 1OH8A 1MKYA 1YR7A 3AF4A 4KFRA 2C9YA 5G3YA 3R9WA 4PC2A 1W49A 2QP9X 1PLLA 4MKGA 3CWQA 5FL7D 3ZD7A 2P6NA 2ANBA 5B2ZA 2DWQA 4FMDF 4MGKR 3VX3A 1I2DA 2IA5A 3IEVA 2RCNA 1KK1A 4JKIA 1OIXA 1SKYE 3P32A 1M2OB 2QMOA 1A2KC 1YU9A 4JLAA 1U8YA 3UIEA 1E32A 4BLOA 2QSYA 3FKSA 5AJVB 4D4MA 1R5NA 2PJZA 1H65A 2O8FB 3SN6A 1IN8A 2REOA 5GJVC 2AFHE 3Q5DA 1P3JA 5C46F 2WKQA 1TADA 4D4JA 4DLTA 4B3XA 1JJ7A 3EIEA 3TUZC 1CEEA 5AJWA 1S3GA 3TAUA 1Z0DA 2FSGA 3SJCA 3U3JA 5JSZB 4R2HA 2JA1A 2EFCB 3VFDA 2RAPA 3DZ8A 3MD0A 4HB3A 4QHYA 4UXIA 5E7JA 1FX0A 2X2EA 4CT4B 2H18A 4B73A 2IUTA 2IWHA 1A82A 3W90A 1WXQA 3KUDA 3G82C 4OHYA 3OAAA 3TSOA 4Q00A 1E1QD 1GAJA 2LKCA 3DMNA 4D26A 1RIFA 4HB4A 4B48A 1TU4A 1MH1A 4ILEA 3PUYA 4PXAA 2O8BB 1W1WA 4KYIB 1G6OA 5D3MB 1CIPA 1OPXA 3EARA 4HZUA 3WHKA 1R0YA 2R6CA 1P61B 1SVKA 4NZYA 3DEFA 1R10A 4IVQA 2ZR0A 1VYTA 3A36A 5LPNA 3UXMA 5KSPA 1AK2A 2ERYA 2QGNA 4PTLA 1HE1C 2VIIA 3BE4A 3NEJA 1KDRA 5G40A 3KFXA 3U3OA 2V9PA 3LRPA 4DT1A 4ARZB 3TE6A 1VKJA 2PMDA 3KKNA 4DEYA 2GCNA 1KSHA 2AD5A 4GT1A 3W6NA 4AURA 5EE0A 2CE2X 2Q3MA 1XCMA 1XXHE 4BGDA 5JCPA 4W5WA 1OXUA 2ZU0C 3LBNA 1SXJE 4B3BA 3L0SA 4IFBA 3Q72A 3T12A 5JWRA 4QM6A 4HAZA 3RRMA 4Q4LA 1W7AA 3NH6A 3HU1A 1E79D 4MGYR 4MYTA 1KO1A 4TL6A 4NYMQ 1QRAA 2ZJBA 821PA 3QVUA 3KDSE 1BMFA 2D62A 2GJAA 4BFTA 1GL7A 1D5CA 4PSKA 4TMWA 3H86A 4LCBA 4QFMA 4LSGA 4C0KA 4C0JA 4ZIRA 4M1TA 3CF6R 1R0XA 4JLNA 1QVRA 2QI9C 3QEJA 4LJ7A 1NKTA 3P1JA 3HYRA 1NI3A 3HYTA 2NZ8A 3CNOA 4GZLA 1ZRHA 4GPTA 1JB1A 1XMVA 4CT5A 3E5HA 1I4TD 1E2JA 4EJSB 4FINA 1NN1A 5DE3A 3FFAA 2DY1A 2OXCA 4JBWA 3SFZA 3PCRB 1MT0A 4OK3A 2GA8A 3BGWA 4BFSA 3VKHA 1R7RA 4IOKA 4L15A 2YVUA 2QA5A 1G21E 4PR0A 2Z43A 4AYXA 4JL5A 2PZGA 4EFLA 2CHGA 2IC5A 4X8OA 1NSTA 3QKUA 3IIKA 4GNKA 3VX4A 2ZVPX 3CX7A 3N70A 5AUOB 1MOZA 2DBYA 2WPDD 2GTPA 4QGFA 3GFTA 3GLHB 1HA3A 2ZPTX 4HZIA 4PZLA 4TMKA 4EFNA 4KXFB 2GXAA 1OXXK 2CLDX 3C4JA 5DYIA 3SNHA 3AP3A 4NCJA 5JLJA 1P5ZB 5H8WA 2X77A 3K8YA 4RZ2A 4A36A 4A2PA 4BFWA 3B5JA 4QNMA 4EKDA 1OV4A 2JJ1D 2UZIR 4R2IA 1CKEA 2J0UA 1QG2A 1YZQA 1H8HA 1NG1A 1XTRA 1VHLA 1ZUIA 1QG4A 2VHTA 4FMCB 2J5XA 1KKMA 4GI7A 3TW4A 3U2QA 3TUIC 5FPHA 721PA 2W2XA 4PC7A 3ZZ0A 1SXJA 4MA4A 2J41A 2J7PA 3A58B 3A8TA 3CRVA 3MWJA 4LY6A 4XIGS 4A0FA 2PZEA 3OFND 4OI2A 4EQ6B 2F1HA 4WBSA 3F0TA 1GOTA 5EE9A 3QKRB 1F6BA 1KO5A 1P2VA 4RD0A 4Z8YA 3T1OA 1RC8A 2HEIA 1NVWQ 1AGRA 4OHVA 2GEUA 5HKKA 1E9BA 3ZIAA 3FMFA 2WWIA 1KI3A 3RS7A 2ZM5A 4HUQA 3DL0A 1US8A 4PAOA 2G1KA 2P67A 3VR4A 3BFXA 4R7ZA 2ATXA 3AVWA 2QAGB 3B82A 4B6FA 1ZU5A 1ZIOA 4Q1AA 3SYKA 1J70A 1LB1B 2PCLA 1NG9A 4GOJA 4WZBE 4TMZA 1XEFA 1AQYA 1PUIA 4PANA 2KBFA 2Z4RA 5DHAA 1QHNA 4AD8A 5TB5A 1E99A 4NYMR 3QXHA 4V0OA 3K70C 4H1VA 3JVUA 3LVRE 3I73A 1FNMA 2B21A 3AF3A 4URUR 3QG5A 1BMFD 4V0NA 5JECA 4U5XA 1OH5A 1S2MA 1DBSA 3W3ZB 3QE0A 1Z29A 1NN5A 3GD7A 4M9XA 1GG2A 3TAHA 5CYOA 3U60B 1GKUB 3ASYA 3A1UA 1YR8A 3BRWD 3VQTA 4QC2A 4QJ4A 1UF9A 1GDDA 4Q9LA 4YMTA 5EJEA 4O2LA 4EPYA 5CLLA 2BJVA 2IS6A 2R62A 4KODA 1AS3A 1UEJA 1X86B 3FTQA 1MO4A 3EIHA 5CJPA 4TMVA 3FHOA 4LJ9A 1DEKA 3EX7C 3DZDA 4M0LA 4EPVA 3FPAA 3THOA 1XTSA 2GZAA 2VHCA 3AKDA 4MGZR 2QE7A 5P21A 4MRNA 4IRUB 4O0MA 3U3MA 3AF2A 4IJMA 2AKYA 2ZYUX 2KE5A 3FDIA 4MKFA 1LW7A 5DIFA 1Z6YA 2ZI6A 1KTVA 3PR1A 3A1TA 1WDTA 2ZTSA 4E09A 2IWRA 1J2JA 2IYTA 3U6BA 1PLJA 2RGNA 4UNSA 1Z63A 2O8FA 4DVGA 2ZRFA 5FOWA 4LBZA 2P65A 3I5XA 3ADBA 3OIYA 4ZI3A 4WW0A 4F93B 3AVUA 4JLKA 2IXFA 1JQLB 2ZSEA 2AR7A 1RE0A 4KCGA 3GJ0A 4OQLA 4A8JB 1Q20A 4A8JC 4P32A 2I4IA 4CW7A 5K8UA 3CB4A 3FE2A 4RD1A 2PX3A 2F3TA 5JJKA 1Z0IA 2ZQ5A 4HAVA 3QI2A 5HCIA 2VSOA 2VP5A 2WJYA 3MG9A 3ETLA 2FPLA 4AK9A 2BJWA 1YZGA 5LB2A 3W5JA 2YYZA 3A37A 2NGRA 1E0JA 1NLZA 3UMRA 1OKKA 1VG0B 1O3YA 2AN9A 2QBYB 2FG5A 4RCYA 4JSYA 2JIZD 5JI3E 1P2TA 4OKSA 5JWHA 1OFTA 1NN3A 5BQ5A 2ZANA 2V55B 4DIEA 2GRJA 4WZ6A 2GESA 1XWIA 2OFWA 5L3RA 4FI3C 4LX0A 1AS2A 4PQYA 2WSMA 3T61A 4IOMA 3L0PA 3ZIAD 4A15A 3Q5EA 4IDPA 5FTJA 1LS6A 1XTKA 2JDID 2GK7A 2GHIA 2WWGA 1Z0JA 4NCHA 2FE4A 4EIWA 4C0AC 3MLEA 1N3BA 1Z22A 2G77B 3DM5A 1HY3A 1T91A 3PQCA 4GOXA 1ZCAA 3IBGA 1Z8FA 1Z0FA 3KKMA 2C96A 4MGIR 3ZVRA 1KI6B 1XMIA 1JEDA 2QP3A 3PV0A 3L2OB 2PZFA 2QTVB 2DFLA 2FGJA 5KSOA 2G88A 4BZQA 1HURA 2GNOA 2EFGA 4DKXA 1DVRA 3AM1A 1CXZA 4LRWA 3T1QA 2E9SA 3PEWA 2JLYA 1A1VA 1KI4A 1ZU4A 3A4NA 4KU4A 2NPFA 4TZ6A 3CPHA 4DCSA 3LDAA 4TYWA 3FMIA 5HPYB 5TXGA 3IQWA 4Z54A 5A5GA 1PLKA 1D2EA 2ZR9A 3CWZA 2OSBA 2ZU6A 1KO7A 1P62B 2QM8A 2ZJZA 2YHSA 4LHVA 2PL3A 2C03A 3ONWA 4EJSA 3R7WA 3O8DA 3RC3A 4V0ME 1WB9A 4DSUA 3QUSA 1UFQA 4ASUD 4DLUA 2QAGC 1IN4A 2QM7A 4NCKA 1NLFA 2F1JA 2HYIC 4DLVA 3LX8A 2OG2A 3NXSA 3C5HA 2IYZA 1COWA 1FTNA 5JJIA 4LV8B 5GJBA 1IQPA 3P20A 5KHOC 4QHTA 3SZRA 2UZ3A 1T6NA 5G53C 1N5LA 1QHYA 2XZPA 3NC1C 4JL8A 1CRQA 3FMOB 1CR0A 4Q4JB 4POAA 5G41A 1EXMA 3MGCA 2BOVA 3GJ7A 2WIAA 4I4LA 3GJ3A 1JAHA 4ZIRB 4YXWD 3P27A 4TL8A 1H8HD 1E9CA 3U7HB 1IOZA 2W83A 5B64A 3QVVA 5BN4A 1HEIA 2QPOA 3LD9A 4V02A 2JJ1A 2DFTA 3SFVA 1G8YA 2PH1A 4OHZA 3K70D 2D2EA 4C0QC 2ZRKA 4DBLC 3RWOA 4C7OB 4Z1MD 3VMFA 1RZ3A 1ZINA 4JLMA 4IVPA 4AYTA 3RNLA 2H7VA 1QHGA 2XSZD 3VKGA 1NJFA 1FMLA 2QMUA 3NG1A 4C0BA 3W8NA 1KJWA 2O8CB 3THXB 2JCSA 4HDQB 1XD2B 4DLSA 5KDLA 2V54A 5EQTA 2IS4A 4DCVA 4YQFA 1DELA 1CR4A 3NIBA 1KOFA 4NE2A 3KKOA 1XEWX 2PMKA 1C1YA 3AF1A 3U7FB 3EZ2A 1KI6A 1ESNA 2OEPA 2MMGA 2IYSA 3ZVNA 3K0CA 1VG9B 4JLOA 1UBFA 4P4SB 4KLZA 2R2AA 4MUAA 5FI1B 1E1QA 4EPXA 4OHXA 621PA 1OFIA 2B8TA 2IF2A 3OAAD 4AYWA 3UANA 4IHQA 1IM2A 3KKQA 1E69A 1P9RA 5FTMA 1T3HA 1WRBA 3IHLA 2AD1A 3SJAA 4D0GA 3SJBA 3CM0A 4I81A 1SVSA 1YZLA 1EK0A 2VYFA 3FKQA 3IDQA 3U61B 5D3MA 3VR6A 1E2MA 1SGWA 3NBZC 3EA0A 4QBGB 1NF3A 4QRHA 3REFA 1YRAA 1PUJA 2O8EB 1E79A 2V4ZA 4Q7LA 3A4MA 3LA6A 2XITA 2C78A 1UPTA 1E4VA 4GZMA 2FSIA 1BIFA 3GFPA 2ZETA 2WWFA 4PFSA 4TMTA 3REGA 2X2FA 2A7QA 5JEEA 1R6BX 3DDCA 1CS4C 2RGCA 1OHHD 2C5LA 2ZRBA 3KJEA 2RGDA 1AZTA 2RH5A 3KTAB 4D80A 1AZSC 4BZPA 4JS0A 3IPXA 3FB4A 5A4JA 4P4SA 1VIYA 2QORA 1I4DD 1VCOA 3RYTC 2RMKA 1HTWA 1LY1A 2BV3A 4M1YA 2BBTA 3AF0A 2FOLA 2ZRDA 3GMTA 2RHMA 5JJLA 5B57C 4UKDA 3PUXA 1OF1A 1T8TA 1TTTA 2KBEA 1N6PA 1Z28A 3K0AB 4XH9B 1IBRA 5CM8B 2KJQA 2N1BA 1OFUX 3G0HA 1Z6XA 1KZ7B 2JJ2A 4G5OA 5JS7A 2BBSA 3QEOA 3EPJA 5AUQA 4MITA 3AVPA 1N6RA 1YZTA 5H1YA 1GL6A 3EASA 2XEXA 4ZO4A 4QM7A 3P4XA 4LWZA 2ZRHA 3TQFA 4G5RA 1M1YE 4U7DA 3HPQA 5J4HA 5F3WB 3ND9A 4GOKA 3DOEA 2XNDA 3ZGXA 3THYB 3EZFA 2NO9A 3CZQA 3PFIA 1C9KA 2FEMA 4Q02A 1P2SA 1DG3A 4NU0A 4TT3A 5FPTA 3ICEA 2XTMA 1KMHB 3LV8A 4PQFA 5JWOA 1OHHA 2E1RA 1ANKA 2VP6A 3LNCA 2ZYTX 3KJIA 5JHGB 4W7SA 3SE0A 1IY0A 5IK2D 4HLDA 2BCGY 4NPHA 2YV5A 3GJ8A 4I1SA 2AFIE 4Q4AB 4OQNA 4Q5IA 3RHFA 4F7WA 2QSZA 1G9XA 4TN1A 1P60A 3E70C 2QGZA 1TEXA 1E9FA 3IGFA 1Z6TA 4PHHA 4A2WA 3PJRA 1RYHA 4LYAA 1DO0A 1ZM2A 5FOUA 1VHTA 3HR7A 4M53A 1XJQA 2BEKA 3NHBA 4JSTA 2GETA 1Z2CA 4H1UA 5JEDA 5EXPA 5BXQC 5LB4A 1DO2A 3TH5A 1Q0UA 3TNFA 3QF4B 4WXRA 4G5GA 4F4JA 3I32A 3HPRA 4KFTA 1NMXA 1XRJA 4C0SA 4CF7A 4LHXA 4B34A 2LCFA 4HDOB 1R4AA 1U2RA 2AWNA 1II0A 2AXPA 3I8XA 3E1SA 1ZD9A 3KXIA 4URZR 1TQ2A 5HCNA 3QKSA 5CM9C 2VHUA 4CRWB 4J0QA 1A4RA 1K5GA 2FF7A 2Q9AA 4FMCF 2WVJA 3SQXA 3BFKA 5TMPA 1CJMA 5FFMA 2RGAA 4DC9A 2C99A 3BJIC 3QPWA 2GDJA 3HP1A 4EDHA 5FPKA 4CYMA 2YOHA 1R2QA 1FUUA 4KFUA 3B8HA 2H5EA 1CULC 1Z6AA 1GUAA 4RZXA 4LDJA 3KFVA 2C77A 4OI4A 2H57A 4PO9A 3QBTA 4QOSA 4DUGA 1VPLA 2XOKD 2ZIAA 1NIJA 2WM9B 3T34A 4N1AA 2ZS7A 5EP3A 4DJTA 4P33A 4Q4HB 4O3MA 1E9SA 3TW8B 2EFHB 4HB2A 1ZC3A 3BB3A 3UWOA 2FMXA 3GJ5A 4NDZA 4V0KA 2O8CA 3LX5A 2ANCA 2GBLC 2C9CA 3WNCA 2TMKA 1T8UA 2A78A 2JLZA 3FHCB 2QZ4A 3VU9B 5CK5A 2Z0MA 3WMFA 4E5UA 2KI5A 2YWHA 3K1JA 5BN5A 3SS8A 4QHSA 1XMJA 1G3QA 2VP4A 1XCPA 4R98A 1OYWA 2ZRPA 4B3DA 1XTQA 4QBFA 3NC0C 1OW3B 1ZNXA 5C18A 3AP2A 4FWTA 1D2MA 1Q12A 1YE8A 4M9SA 3W9YA 1FTSA 3UPUA 4HYYA 2X19A 4DIDA 2A5DA 3M1IA 1Q44A 2NTYC 5JS8A 1JAIA 3OIUA 2BCJQ 1TQ6A 3QG1A 3I61A 4NBSA 5HZKA 1IXRC 2OLJA 4DSTA 1TX4B 4KI0A 1ZD1A 3AGQA 2FU5C 1LF5A 1T0JB 3QY0A 4HSEA 1TQ4A 3RLFA 3M0EA 3KQHA 3ZVMA 5F9FA 5AJXA 3TK1A 2XOKA 3BH7A 4GP6A 4B6EA 2G6BA 1KK3A 5FUXA 2WIBA 1GKIA 3PITA 2ODBA 1P9WA 3FHTA 3KQNA 1YZKA 3EW9A 3BERA 2OCAA 2YKGA 3A6PC 4Z1MA 2IF0A 4YMUA 1U8ZA 1G18A 1SVOA 4FXPA 4MDFA 2GAAA 3UK6A 2GF9A 1E9AA 3Q7PA 1XTIA 1KI9A 2IEZA 1MRNA 2JJ8A 3K0EA 5JI2E 4US1R 3GEEA 3MJHA 1ZNZA 5KSYA 1XJ0A 4OJKA 2XTZA 2HJGA 4NP6A 1W46A 3KJHA 4S35A 5BYKA 3L8YA 4D82A 2WWHA 5JCZA 2OILA 4C7OA 4UJ5A 3RANA 3TRFA 3MUFA 5L3QA 1GKYA 4M2LA 2WJJA 1F60A 4ZCIA 1DAFA 1G20E 5KNBA 2ORIA 1XPRA 4JVMA 4RFSA 1VYVA 1KI2A 2IYWA 2QY9A 1W5TA 1X1RA 4AIIA 1WBBA 5JBQA 1ONBA 2REXB 4A82A 3LVQE 5EP2A 5F98A 1O87A 1P4SA 1EWQA 1W36D 1N6KA 5K8LA 4V03A 2WOOA 3CONA 3L0OA 4A0HA 3LXXA 3RABA 1CJKC 2CCJA 2G0TA 1G5PA 2IBMA 2OCBA 1GVNB 1E94E 1P6XA 2CL0X 2YWFA 1OKKD 2OBMA 421PA 3F5FA 4TYQA 4CEJB 1IN5A 1HQYE 2WMNB 4BECA 2XX3A 3GJ4A 2ZR7A 1KDPA 3CRQA 1Z0KA 4ABYA 1FUKA 4PZZA 4PZYA 2ZJ8A 4MRSA 1BOFA 1D2NA 1KGDA 3H84A 4FCTA 5FPYA 1XFAA 4JBYA 2CL6X 3ZS8A 2IUSA 2ZRNA 1N0VC 4L5BA 4ZCLA 3JZMA 3K0AA 1OXSC 2W2VA 1AGPA 4HAXA 1YZNA 4HAWA 3IO3A 2VL7A 1CF4A 4TYYA 1PV4A 2V6IA 2PJRA 5KSZA 5FTKA 221PA 4Y0AA 1UM8A 4RKEA 2QPTA 3LLMA 4TSFD 1TF5A 5DO9A 1I2MA 1XF9A 4S2EA 2FNAA 3CR7A 3T5GA 3HU2A 1AKEA 1R5OA 5EUQB 2JLWA 2NQ2C 1KNQA 4MYCA 3FFBA 4LV5B 1XD9A 5AWFC 4UNPA 5CJ2A 1JPNA 3KUCA 3C5CA 4Q9JA 3ZLJA 3MWLA 2AK3A 2GBLA 1RRFA 3WYFA 4LUCA 2JLXA 1G19A 2YINC 4KSCA 2XGJA 2I1QA 2E87A 1Z3IX 3CUEF 3QF7A 3EA5A 4RD3A 3RRYA 3BH6A 1MV5A 3ZZTA 5JRJA 2PT7A 1QHXA 1SVMA 2GKSA 2OUKA 2H16A 1KI7A 2GVZC 2R6GA 2CK3D 2P6RA 3QXCA 4OI1A 1G4UR 1YKSA 1NP6A 2XB4A 2ZREA 2YC4C 3L43A 1HUQA 2EFDB 1G8HA 2XNSA 3B78A 5IRCD 1M74A 4QJ5A 2DB3A 3OEED 1GZSA 2IYYA 4IW3B 1CJUC 2ZS9A 4OI0A 1UKYA 5KDOA 4PC1A 8OHMA 3MCAA 4FD2A 1HE8B 1T4GA 3LQQA 3W6OA 4A6PA 1JPJA 2QT0A 5FPSA 2G3YA 1HH4A 3ICQB 3KQKA 5B30A 5SZHB 1AIPA 1JR3D 3OEEA 2UVQA 3F8TA 3IILA 3RDPA 2GEVA 2JASA 4TL7A 4FMDB 1N6HA 2CDNA 1Z6GA 1KMQA 3VTKA 1EFHA 2VSFA 4IEIA 4BWYA 1E9RA 1S1CA 2CK3A 4BE7B 2FX3A 4HLQB 2EYQA 4BLQA 1I4LD 4AKHA 3THWB 2A5FA 4C4PA 3RC8A 4A2QA 1CLUA 2JAQA 1G7CA 2W2TA 1QZXA 2ZXUA 3PEUA 3LY5A 3A1SA 4G5QA 4KVGA 1OIVA 2ZI7A 4QBHA 4F92B 3SBDA 1NN0A 4X8MA 4BZXA 4LHZA 4RD6A 3MMPA 4US2R 1K8RA 5TV2A 2NPIA 4W5JA 1F2UA 1BH2A 2QU8A 1L4YA 1CJTC 1TQDA 2D06A 2O0JA 3H1TA 1N25A 5IHPA 4WA7A 4AKEA 1B23P 1W0KD 2VF7A 1P73A 3LWNA 2ZI9A 2XSZA 1SXJD 3BH0A 3LAWA 4ON9A 1GRNA 4IDNA 1W4AA 4RVCA 4UXJA 2YJTD 3X1XA 4UNQA 2ZITA 1LFDB 2PLFA 4IEEA 2GCOB 2AL7A 4G0NA 4TSFA 4Q7MB 3U3KA 5JHHB 3GLIE 4GL2A 4AI6A 5HE8A 3AEZA 3CNNA 4HAYA 4MRRA 1D8TA 3ADKA 4D81A 1U99A 4DHEA 2OFXA 1L2TA 1G3RA 2FN4A 4JMPA 3DMDA 3W34A 4JJZA 4LI0A 2DCUA 1XNJA 3I62A 1F48A 3K09C 2IUUA 3WBJA 1ZC4A 1K6MA 1RRPA 1YQTA 2O8EA 3WP1B 2CNWD 4HLCA 5HR5A 4PHTA 5GJCA 4JZKA 3MSXA 3RS3A 4XSHA 4UNRA 1Q1EA 3QIAA 2C9OA 5J5CA 1XTJA 1F2TB 4Q48A 4TTRA 1OXTA 1NVUQ 1UKZA 3C41J 1GITA 2DFNA 2IYXA 4OYHA 3AUYA 4LC0A 1EESA 1MO3A 4DXAA 4N3NA 1TUIA 4C0HA 1JECA 2JATA 4ZKEA 4C9BA 1M6NA 1VCNA 4GMXA 4MH0R 4ASUA 1C4OA 1T5LA 5HKKD 4IDHA 2LWIA 4RD2A 3JZAA 2P3SA 1Q3HA 1U94A 1US8B 2VRWA 2Z83A 4Q01A 1XDBA 2W0MA 1CRPA 1DAGA 2Q0HA 3AKCA 4NHOA 1DAMA 4LGMA 2GXUA 2ZI3A 3LBIA 1BO6A 4GFDA 3NHAA 1FL9A 2O0KA 4PQRA 3OE7A 4YDSA 2QNRA 5C2JB 3LH5A 4Q9IA 1L8QA 3WNDA 1Q21A 1JJVA 2BMEA 1G7SA 4C2TA 4WAUA 1CBUA 3TR5A 1VMAA 4DLXA 1DE0A 1RFLA 1RYFA 4FW9A 4M9ZA 5AUPB 1HT1E 2HF9A 4YC7A 2N42A 1ZNYA 2XJ4A 4B2IA 4BLPA 4K46A 4BEJA 2V1UA 2FA9A 3N2EA 1SKYB 3CO5A 4PX9A 1NBMA 1XU4A 2IS1A 2F6RA 3TGPA 3QPUA 3ECCA 2JLVA 3QXSA 3TVTA 4XVQA 1KJYA 2QRNA 2CE7A 2D3WA 2B92A 4RZUA 2FDCA 1U90A 1RW4A 4Z51A 3AKYA 4BLSA 2OCPA 5FTNA 1KDTA 2BKUA 3R7WB 4LHWA 4QNRA 3GPLA 2P5SA 2QG6A 4QXAA 2FSHA 2A3RA 2R65A 2V8OA 3DOFA 3RS2A 3ZJYA 3GLFE 2JIZA 4OQFA 5J40A 4ZKDA 1E0AA 1OH7A 2ZRAA 4O2RA 1FPMA 1V43A 2WJVA 4DRZA 3B1YA 2R8RA 2BMJA 2PEZA 5CYPA 1JR3A 2GF0A 4NYIR 4B3CA 2AX4A 2ZYWX 2J1LA 2KB0A 4A92A 2F7SA 5SZJA 3R20A 1GTVA 2DHRA 3BBPA 5IDVA 4KBGA 3A1VA 3HR8A 3V00A 3BXZA 2REBA 3FGNA 1YR9A 1S3SA 4Q4JA 1EX7A 3B2EA 1GILA 3FKSD 4I1OA 1A7JA 1NL3A 3H0KA 5FOXA 3C15C 3CX8A 5FBRB 4DDTA 2O8DB 4OQMA 1JR6A 3ND8A 4Q18A 3O8BA 4M4SA 3AVXA 1ZAKA 5LD2B 2MMCA 1KY2A 3J81k 4GDFA 1YZUA 2Q3FA 1DAKA 4ZDJA 2QTFA 5J4YA 5DI3B 3B1WA 4L9WA 3BAFA 1W4CA 2QAJA 3PENA 5EE5B 1J8MF 4OK5A 2RB4A 2C2HA 3SR0A 1YRBA 2W6IA 3A1WA 3WY9A 2K5UA 3TLXA 3WMEA 3ZZUA 1KK2A 5KYKA 4PAQA 4Q1BA 2CJWB 3PVSA 2EYUA 2GXQA 3DVLA 4D25A 1M7HA 2FGKA 3D7MA 2AHOA 2ZSDA 3B13B 2F9MA 5M04A 2ZS8A 3DPUA 2XXAA 1XEXA 1KHTA 4AKGA 4UQOA 1OSNA 2WJGA 1U0HC 3LXRA 2QQEA 2H92A 3SI7A 3Q7QA 2FZLA 4E22A 2CMKA 1KI1A 1Q1QA 1S1MA 1ZUHA 5FOVA 4ESHA 5KTYA 4RFVA 2EWWA 4XJXA 1XBTA 3BORA 3VHLB 1SZPA 3C8UA 3FYHA 1DOAA 2ZE8A 5E3HA 5CDFE 5GVSA 1SXJB 4TYPA 1J7KA 1R0ZA 5AJYA 4JLVA 1N6OA 2QPAA 4M9QA 3G5UA 2J3EA 1TL7C 4YONB 1Z2AA 1Z5ZA 2NO0A 3AGPA 3IO5A 3W8RA 4PHGA 2VBCA 1KY3A 1QBKC 1Z83A 3O47A 1H8ED 2A2ZA 2H8KA 2CVFA 3GCGA 3IKJA 3FOZA 2PT5A 4KV9A 2A5YB 5G3ZA 2XB2A 4KSBA 5BW8A 4DEXA 4CEIA 1N6IA 5DH9A 3WHLA 1UADA 4UJ3A 1H8EA 4B3FX 2NZJA 2YZ2A 4PC6A 2F3RA 2OXRA 2OO7A 1E0KA 1JI0A 2GAOA 2XTNA 3KB1A 3U5ZB 3CRW1 2J59A 2JLSA 3B85A 2VHJA 3LFUA 4TQUS 4F91B 3CBQA 2O5VA 3MRSA 4PO1A 3R9XA 3M4YA 4GSYA 4M1WA 2BEJA 2IEYA 1D9XA 4GRAA 2WWWA 4FMBB 2PCJA 4QBIA 3NTUA 1IHUA 4DLYA 3EZ7A 4YDHB 1DG1G 3TQCA 1W5SA 2WJHA 4K8OA 4P4TA 2J7PD 1KAOA 1NNEA 1TF7A 2NMVA 1RKBA 3C7KA 4RFSB 1HQCA 2CJWA 4KYUA 1KDOA 1G3IA 3BB4A 1LTQA 3SEAA 5L3SB 3B1ZA 1V5WA 4LZZA 1DARA 4FCVA 4XSGA 1Q1BA 1Z08A 2OBLA 1J8YF 4JT2A 5B58C 3ZYCA 4HLUC 2ZJ5A 4KLNA 4OBEA 4TLBA 2EQBA 1M34E 1EFCA 1XXHA 1OH6A 3X1ZA 4JJKA 3THWA 4EJSC 2ORWA 3K0FB 2OLKA 2GJKA 2A30A 1IAQA 2FFQA 2PX0A 2OE2A 1TEVA 2BMFA 3C16C 5EZ5A 1VIAA 1XEWY 1ZCBA 4A9AA 4Q19A 5AJZA 4LV6A 3SU8A 1WQ1R 2P6UA 4B71A 3EZ9A 2GEDA 2IYQA 4NCNA 4B2PA 1UAAA 2OAQ1 2CL7X 4FCWA 5E7IA 1KO4A 5BWMA 1OJLA 1X8KA 4RJLA 3I5YA 3IQXA 1KMHA 2JLUA 3D6TB 3EWAA 3B9PA 2WOJA 2DWOA 5DYGA 4DT1B 2C8VA 4KFSA 3THXA 1KAGA 5FOSA 3AUXA 3I72A 1E96A 1KSFX 2VF8A 3TMKA 1IN6A 1XD2A 1U8AA 2CLSA 4GP7A 4ZDIA 4NYJR 4KAXA 1UKEA 5L8VA 1TMKA 2QP4A 3Q9LA 2KWIA 4Q1DA 2J0SA 2ZJOA 3U44A 1OYYA 1S4QA 1IN7A 3UG6A 3R8FA 3KX2A 3CW2A 5J4KA 3GLGE 2HYDA 3VHXA 4JL6A 3FMPB 3S1AA 4EPWA 4KVAA 3EC2A 3QKSB 3K9GA 1X6VA 1E1RA 3LW8A 5LBIA 3RSLA 3DKVA 3L8ZA 3IPYA 2HLDD 4Q66C 4FIDA 1JEEA 1W4RA 4DDWA 1XZQA 1UDWA 2IHYA 2IXEA 2J7KA 2JGNA 4X8HA 4UXHA 4QGHA 2WHXA 5AUNB 6Q21A 1II9A 2AK2A 1S96A 2GWHA 1YHNA 1KI8A 2CEAA 2GXSA 2RHDA 2FFAA 3CRRA 4ZDKA 1G1MA 4B3GA 1ZNWA 5AR1A 2Q9CA 3HJNA 2CHVA 2FWRA 4DSOA 2ZJYA 5CIWA 2B7BA 2QENA 4WXPA 1E2PA 1E2EA 1UEIA 5FUWA 4I1VA 4NH0A 1ZD8A 3X1YA 3QSYA 2HXYA 1HYQA 3B1XA 5H68A 2F43A 4B47A 4R9UC 1U0JA 1UJ2A 4V0LA 2YC2C 1DS6A 4Q9HA 2IW3A 4B2LA 3RS0A 1T3LA 4IOJA 4LOAA 1EWRA 4RKFA 3HWSA 5JRZA 2VPPA 1N5KA 2W58A 1BYUA 3OIVA 4D2IA 3AQ4A 4KJZA 2ZJ2A 3I8SA 5E95A 1KSGA 3EAQA 2WKPA 4H9GA 3SOPA 2LKDA 2CHQA 2PEYA 1SKQA 3AVQA 3OE7D 1G17A 4TQAA 4C30A 4ACBA 1ZMXA 3I92A 1XXHB 4C3ZA 1FOEB 4LJ5A 3DHWC 4XD7A 5J4VA 4QGGA 4DLRA 4IKEA 4B32A 1RVDA 2D2FA 4TTPA 4TLDA 1G5TA 2A5JA 1JBKA 4QL3A 4XTRA 1S8FA 1UBCA 3K53A 3GLFA 3H2YA 1FX0B 1GM5A 3FVQA 3QKRA 5JFGA 3TR0A 3CF0A 1NY6A 4MKIA 4Q9KA 4DCNA 1QF9A 2Z5FA 3DO6A 5GADl 2N46A 1SHKA 2MSDB 4BRUA 4PHFA 2WAXA 1W4BA 3KTAA 2BWJA 2QL6A 1T5IA 4NL4H 2P0EA 1ESMA 5DI3A 1X8JA 3QBVA 4HB0A 2NO7A 3GJ6A 2O52A 2O0HA 1DTSA 2X8AA 2ZE7A 5EXXA 5FL7A 3QXXA 5BYJA 1AA9A 2QMHA 1EX6A 3LW7A 1VTKA 4TT3D 1E9DA 1KZGB 5KO2A 3Q8XB 4AKIA 1E2LA 5IF9A 1T9HA 4NCIA 2IX3A 2ZSAA 3P26A 1GWNA 4Q47A 4LBYA 3U6KA 1W44A 4LJ8A 3RSOA 4RZ3A 2GVDC 2QN6A 2R44A 1F3OA 2XJ9A 3WRXC 4XOIA 3MFYA 2ZRJA 3CH5A 3X1WA 2QQ0A 1KJZA 3V4FA 2WBLC 4MRPA 3SBEA 2VP2A 4BFXA 3BB1A 4OHWA 4OJQA 1Y3AA 2WJIA 2BBWA 2GILA 4HZUB 2V1XA 3K09A 5DISB 5DLQC 4URXR 4GMDA 3VR1A 3NWJA 4PAMA 4Q21A 1WMSA 2HXSA 2IYUA 2DPXA 1J90A 2J87A 2F55A 1W48A 2QEQA 3O8CA 2QAGA 1OFHA 5K8TA 3ZVLA 1X1SA 2W6ID 2JDIA 2WSSA 1KK0A 4M8NE 4PPFA 5KUTA 2ZRMA 3WXMA 3WP0A 1WCV1 3MWKA 1TNDA 2IYVA 3RRNA 4EUNA 1ZW6A 1GNPA 1SXJC 1J99A 4BFVA 1GIAA 1XD8A 1G3UA 3SYNA 4JLBA 1A2BA 3K0FA 4KHZA 3EIQA 4RD4A 3CX6A 4RSGA 1FNNA 3K0SA 2ZUDA 4TYNA 4C2UA 1GSIA 1W2HA 1II8B 3VR5A 1Q57A 5AK0A 3AH8A 2IHBA 2HCBA 4TMXA 1W0JD 1NLYA 3BC1A 3SHWA 1KO8A 2IYRA 2OCYC 2WZQA 2CXXA 3U7GA 3X1DA 4CEJA 5KPDA 3CZPA 3EG5A 5ANRB 4AY2A 2OBNA 2QTHA 3NBXX 3SYLA 1LV7A 3B7GA 4O25A 3B1VA 1FFHA 1M8PA 2V3CC 4IOLA 4PPNA 2UKDA 3W3AA 4JVNA 4P4UA 4XTCS 3AVTA 2HT1A 5FL3A 3OEHA 2RGGA 3OHMA 3QXJA 1NIPA 3NDPA 3CLVA 3B60A 1PJRA 2EVWX 1DADA 4LPSA 4V0MA 2P2LA 1ODFA 1Z0AA 2FZ4A 2ONKA 3EXAA 1FW6A 1E2NA 4AG5A 2QROA 4BFYA 1D6JA 3GFOA 4G01B 1G6HA 3HU3A 4CGZA 4G1UC 3SQWA 3HDTA 5C1BA 4NMMA 4B74A 4DDVA 1G7RA 4D6PA 3VR3A 4NYJQ 4UNNA 1OB5A 3QJYA 4II7A 5CK4A 3K0CC 3T06B 1P72A 1YR6A 2XZOA 3B9QA 3PEYA 4KO8A 1Q22A 3QNUA 1NBMD 4ZDWA 3BK7A 4IFEA 1KNXA 3OIWA 1E2FA 4L9SA 3I4LA 4A0GA 2BHRA 4A8JA 3EPHA 4D0LB 2W6JD 1BYIA 3T1VA 5FTLA 3GLGB 4KITB 1EG7A 3BOSA 5EP1A 4EFMA 3GLHA 4QKQA 5F2EA 1E2KA 4QG7A 1DPFA 1P9NA 1R8SA 2WWYA 1ETUA 3CH4B 4EAQA 4TLCA 4I1UA 4YXWA 2J9RA 3CF2A 3X2SA 3TKLA 3ADDA 2VA8A 4Q1CA 5FUVA 1JXOA 4IXNA 4B43A 2FH5B 4JYCA 1OIWA 2IL1A 521PA 2J0UB 3WMGA 5LDDC 5F9HA 1CTQA 2ZE5A 4DLWA 3RS5A 2AWOA 2ZYVX 4YMWA 3NBYC 4M1OA 1E2HA 4JLPA 2ZRLA 1QHHA 4NONA 3IIJA 1IJEA 1VCMA 1OB2A 1T3SA 1XCGB 1S9DA 4TTQA 2V7QD 2ZI5A 2WV9A 3GEHA 4EPTA 4I99A 1FP6A 3CPJB 2OV2A 5L3QB 3N5CA 3RS4A 1E98A 4JT4A 1S0UA 4HDCA 3VAAA 2GJSA 4X8LA 4CEHB 1F5NA 1OE0A 1ZP6A 1VG1A 2NO6A 3OESA 4LJAA 2F9LA 1IXZA 1CR1A 1NBME 2C04A 4N0EA 4MKHA 3RRZA 3RWMB 3GLIA 2BKEA 2CNWA 4MRVA 4ZV4A 1EFTA 2VTKA 2CCKA 2WAYA 4U00A 3R8CA 1E0SA 3K70B 2FPKA 3DKPA 3OFNA 1R0WA 3NBFA 1YVDA 4JVLA 5EZ6B 2F1RA 4ERNA 2OZEA 4M22A 5EE3A 5JZVA 2ZE6A 4Y0VA 1GNRA 1PVOA 2D7CA 2CBZA 1KIMA 1TU3A 2Y8EA 2YWEA 3PIRA 3QF4A 2XXAB 5DN6D 1Q1ZA 5KU1A 3PUZA 3CKLA 1AKYA 1KYIA 4JVSB 5FR2A 1EGAA 2VSXA 3GJXC 4DCTA 1SHZA 4EQ6A 2FSFA 1MO6A 4IXMA 1JALA 5EP4A 1NVXQ 2H1LA 3V9PA 4LJ6A 2FPMA 2R9VA 1G5RA 4CVNA 3GLHE 4EPRA 1M7GA 1AQUA 1ZJ6A 2G83A 3CRMA 2QT1A 3TBKA 1T0HB 2VO1A 1LF0A 4WZAE 4Q4AA 1KKLA 3MAAC 2ZSFA 1B0UA 2BM0A 2EFEB 4BUJA 5KDDA 3UG7A 4HUQB 3NVAA 2OESA 2IYLD 3LQRA 4IDQA 4IDOA 1G8PA 3P4YA 3RAPR 3NDBB 2WMOB 2PLRA 2ORVA 5C4MA 1VYUA 3EPKA 4R71A 1RRGA 2J0VA 1HT2E 1MABA 1NMYA 1WA5A 4OK6A 1JR3E 3AKEA 2HJVA 4FWIB 4DWJA 2H17A 3KJGA 4P31A 1N5JA 2V7QA 5TVKA 1OLOA 4TLEA 4BLTA 4ITRC 5KPJA 3CPEA 2NG1A 1BS1A 1LVGA 3MJRA 2HT6A 2MSCB 3OEHD 4IVRA 2ZUBA 5L3SA 4CEHA 4MYUA 1LS1A 5DHFA 2YNMA 3CR8A 1GL9B 1NVVR 4MUBA 1XP8A 2NOAA 3CIOA 4HI0E 4Q4HA 2Z4SA 3ADCA 3BWDD 4URVR 2OAP1 2B8WA 5E4FA 4A0RA 2BVNA 2F1IA 5LD2C 2RGEA 4HEJA 1HV8A 1U0LA 4ZCMA 1Z07A 4KBFA 2IK8A 5TY0A 2W00A 4HUTA 3EPLA 1TUEA 3T1TA 2CCGA 5DNYB 1ELOA 2BC9A 1S9HA 3IUYA 4TLAA 3H4MA 5EXSA 3TSZA 1ZYUA 3GQBA 4A1FA 2YOFA 2ODNA 1GFIA 3JVVA 4B35A 4TZ0A 4LC1A 3UMSA 5DSZA 4QJ3A 1ZUNB 4JYBA 4QGAA 4F4CA 4CIDA 3E2IA 1W0KA 2QE7D 4D4LA 2A5GA 3C14C 1UDXA 4B75A 3GLIB 5E7MA 4BQSA 1NSFA 4BASA 1NY5A 3VU9A 2ZUCA 3KB2A 3DM9B 1OT3A 2WSSD 2QRZA 5GJWC 4CDGA 4XVUA 1IONA 2A9KA 2D4HA 1U81A 4W5HA 3ZQJA 5DI9A 3AVOA 2GZDA 3PG5A 1X3SA 4URYR 3S1AB 1IJFA 3A4LA 3N2IA 1XPUA 1G8FA 3WNBA 3SHFA 2JLQA 2ZVQX 3T5DA 1SULA 5L3VA 1ZVQA 3U44B 1ZM4A 2G1JA 4L8GA 3AVYA 2QMEA 5J4LA 4YMVA 1FZQA 4RY2A 3UKDA 2D74A 3D8BA 1IY1A 1IXSB 1SVWA 3T35A 2RGXA 1N2CE 3UMFA 1MRSA 4ZI2A 2ASEA 1KSJA 4LK2A 4MDEA 2GCOA 3VR2A 1E3MA 2ZAMA 3ASZA 2G0NA 2QBYA 1N6NA 1QHSA 1U9IA 3AB3A 1MABB 2BMDA 4Z8XA 2AXNA 2BBOA 3AVVA 5HTKA 2FFHA 2ERXA 1LNZA 2ZJAA 3ZH9B 3VNUA 5J47A 5UKDA 3BIFA 5IK2A 2Q21A 3F3YA 3NKVA 4URWR 4D4KA 3V4RA 1FMJA 4Q7JB 3VNVA 5D3QA 5CB8A 1XZPA 1UBEA 3QKTA 1QDEA 1VECA 3AV0B 5FI0B 1IY2A 5KOYA 2Q3HA 3W5IA 4BFZA 1EFUA 1QVAA 4HAUA 1SQ5A 3T15A
chains in the Genus database with same CATH superfamily
4KNWA 2NVBA 2ATCA 1ND6A 1SZDA 4EY5A 1EGVB 3L8DA 3D3QA 3FFTA 3WGYA 3WLTA 4IMPA 3DEHA 2BM9A 3ESXA 3FZNA 3IAFA 4MYSA 1J97A 1ZBDA 4WNAA 1U2ZA 4LXIA 5IZCA 1NVVQ 3O1JC 2AHRA 3H5TA 3LY8A 3QXGA 3BRSA 2ZTMA 1H4TA 4NI5A 4EJMA 2GCPA 1XYVA 1LJLA 3DPIA 4ZAGA 2PRJA 3FWNA 3HJCA 4LYJA 5JISA 1HG1A 1UZUA 5KJFA 4RK6A 1QH1B 3TLKA 2DBZA 5TSDA 1SQSA 2VPTA 4DR1B 4WOPA 3QPDA 1RKQA 2IOHA 1JV2B 3EXHC 3HCDA 5JPIA 1BD3A 1NR1A 2Z30A 4QUHA 2Q1WA 3LO5A 3VHRA 4AJKA 3NH9A 1P8JA 1U0FA 2VJPA 4FYMA 1BROA 2HV8A 1T9GS 5CVTA 3GRKA 2GK6A 4QXMA 5HKAA 4HDKB 1SKAA 1VQ1A 2J45A 4QQ8A 1TZKA 3ZBPA 4AXBA 3DF9A 5KVAA 2RG1A 3PD1A 4ZT3A 1FSPA 1BS9A 1NM5A 1SK8A 1WMAA 3WYGA 1XJ5A 4B6GA 4FYPA 3AFOA 3TUJC 1FUEA 1PFQA 3DMRA 3SC6A 4Q82A 2MSLA 4EITA 2R6DA 2GM4A 2PG3A 1P2FA 3WB1A 1E2IA 4BJ1A 3IH5A 3D3EA 1EFRA 1UBJS 3FCEA 3R3XA 5LXTB 2GZHA 1AN0A 3GZ4A 1Y5RA 4F5ZA 3EEOA 4TL9A 1RE1A 3KAJA 4PG5A 3TNJA 5I7EA 2BSAA 1USKA 2HKIA 2BZ0A 2Q4RA 1JKFA 4WOCA 2IS2A 1J06A 2YWGA 4OUDB 5LP6F 1VM6A 3CEMA 3NM4A 4JIMA 2X8BA 2VQSA 3GPCA 4C6TA 3U3RA 1QNLA 1MIOA 4F91B 1XALA 3OTGA 4BL5A 2XLBA 4KQIA 1ESZA 3D6UA 1A9RA 2HLDA 2Y1LA 4OVKA 5KNBD 3LY9A 3G6WA 3M34A 4M0FA 3U7EB 4BO1A 3ZV4A 4MYHA 1PFYA 1NVMB 2BTQB 3CN9A 4OHPA 1HI9A 3UAGA 4EVSA 2J9FB 1T5HX 3LCRA 5CLFA 4LBWA 3PTZA 4MSUA 2VH5R 1WF6A 1I5OA 2AQ8A 3CMCO 3EQ6A 5D01A 5EWJB 1C5KA 4CMGA 1D2HA 3HU5A 2R6AA 4ZT5A 4IMRA 3CG0A 3Q85A 4F9TA 3WTBA 1J1UA 4IIJB 4KN9S 1Q6YA 3NM5A 3ROEA 1N0WA 3WRYC 1TEHA 3ITDA 4GMFA 2O3SA 4C06A 1V1RB 3HEAA 2JGDA 1P75A 1PNVA 2ZWOA 3LIIA 1QYCA 4HYQA 3TYXA 2ZEJA 2FV8A 4V39A 2W6JA 3K9BA 3FRHA 3T52A 5K2MA 3ZWCA 2OHFA 4YJDA 4DG5A 1GNQA 5ELXA 4XEHA 4CUJA 4AC9A 4OJYA 4G5FA 4YLGA 5DM1A 3K6SA 4BO2A 2PD3A 1PFVA 3O74A 2ZKIA 5A0TA 1N2HA 3A28A 3IBYA 5CDFA 4E07A 2M6LA 1HDOA 2OM2A 3HN2A 1PFGA 3GB9A 2EZTA 1EVQA 1OZFA 4JJEA 3UFXB 5GVRA 1Z47A 2VEDA 4K9SA 1DLIA 4U6NA 1TKAA 3CNQS 3L7OA 1E4YA 3X1KA 3EWSA 2DBRA 3Q2IA 5L7YA 3TS1A 4RIGA 2YWXA 4PCAA 1MO5A 2O1XA 1TPZA 5FBQB 3D43A 1DC8A 2WICA 4AZ0B 1WHSA 4LWOA 1JNYA 5GV7A 3W6PA 1N1EA 1ZK3A 2CLOB 2F43B 4HQNA 4IAOA 3BFVA 4FU0A 3W9SA 1G55A 2OQVA 1HNXB 3PGLA 2LR0A 3VHQA 2J30A 2ODAA 4FFBB 4ZO6A 4ZANA 1RXUA 2AN5A 2OKGA 2HF8A 3GNQA 1M54A 2BM1A 4CMJA 2B7CA 2A0YA 2EBUA 2W6QA 2WKRA 2E85A 2WSLA 3D8NA 3ORHA 1UDRA 2IHKA 4AWXA 1V5GA 3ASVA 4N0MA 3OVMA 5CLQA 3OOJA 4AB1A 4LF5B 1HL7A 4FBLA 5FH9A 4KQJA 3COSA 3IIMA 1TZ2A 2PBZA 5IJXA 4CM1A 1T3ZA 2WHYA 4KWIA 5IC5A 3K9HA 4O4JF 3S2ZA 1Q16A 3A7DA 4FKBA 1AUXA 3KWLA 3KLPX 4BTVA 1ZZEA 2I7DA 2B6HA 3E61A 2J6HA 1AHNA 1FYVA 4QNNA 1V4VA 3O3CA 5E9AA 4BP9A 3O8RA 1UUFA 1G3MA 3MJVA 2QUZA 3L0IB 1OWOA 4QYXA 5ALNA 1ZN2A 1W0JA 3LT4A 4KXLA 2HCJB 4R05A 3I01M 4PCVA 4XA8A 4PZEA 5ALJA 3UAZA 4YJHB 1OX4B 5DLYA 4RVUA 3RU2A 5BWCA 3OF5A 4ZYXA 3TZHA 3AIIA 1A9ZA 3PUVA 2YMQA 4MKZA 3QENA 4L4RA 1HTBA 4P22A 3TGWA 4YP0A 4XFJA 4X20B 5HE9A 3OE1A 3UMMA 2OV1A 3U4QA 2ONJA 2L0XA 4FN5A 4JJFA 1ZVJA 1RJDA 4BNKA 5G02A 4B3MB 2PTGA 4KNYA 5ECYA 3AP1A 1W36C 2C95A 3SC3A 1NF9A 1KYWA 3MTGA 4MVJP 2ABWA 3QE4A 4P0TA 5FLYA 2P1RA 1NVAA 3GFQA 3KPWA 1B16A 4IQ4A 4Q03A 3WGMA 1R8QA 1N2XA 1XJCA 4GZ3A 1KPGA 2FZ5A 2Z3ZA 4MVJM 4DPLA 5HFAA 3VPDA 2XT6A 4BQOA 2O5CA 5CEFA 1EVJA 1V45E 3BIOA 3MUEA 1R27A 1XRRA 5EPEA 3IDAA 3DWGA 4DLZA 2NIPA 4RPKA 3TX6A 3L84A 4AG6A 2ZZNA 3E9CA 1UBTS 2PBRA 3L7IA 2C3OA 4P3YA 2DXIA 4PYKA 2ZSBA 1FK8A 1XIVA 4US0R 3ZDQA 2CLIB 1U9IC 1HYGA 2HCFA 3D1LA 2EZ4A 3C87A 4XFKA 1NHGA 1SY7A 2OL4A 2XAUA 4M21A 5JMTA 4BEBA 2Q6TA 1UOPA 5F64A 5IABA 3PLRA 1E5LA 4YRJA 3GA0A 2E0IA 1A5TA 1R8JA 2CUZA 1XCBA 2X0EA 2QV7A 4KFRA 2FPPB 2JFVA 2QB5A 2YV4A 3ETNA 3MMNA 3AFMA 3STHA 2OCIA 3V8QA 4II2A 1PLLA 2I2XB 3UJNA 2P6NA 2ANBA 1JDJA 2DWQA 4MPDA 4V1CB 1I4EB 3W05A 3CKYA 1QTRA 1VE1A 5BT9A 1CERA 1PW7A 5K3DA 3CVYA 1F7UA 2FG6C 4FILA 1LX7A 1K1EA 2QMOA 1A2KC 3JAWA 3L6OO 3OM8A 4O29A 4BFCA 1LLCA 9MHTA 1ZVVA 1U8YA 3UIEA 1E32A 4OTZA 2QSYA 3ADDA 1R5NA 4XSVA 1H65A 2O8FB 5BXYA 3UTDA 3H6KA 2QWXA 3S5UA 5CNKA 3OQIB 3Q5DA 5CAEA 1TADA 4YUWA 4TKVA 4OMUA 1JJ7A 4KIJA 4L0QA 1E3IA 4M6WA 2ECFA 4YWJA 1CEEA 4BMNA 3SJCA 1W29A 1M67A 2DLCX 2V59A 3VDMA 1GYQA 2EFCB 2WTAA 3GRFA 3DZ8A 2N0SA 3AETA 3GA5A 1L1EA 1FX0A 1UKCA 2XAAA 2PGAA 1EI9A 1DJLA 4B73A 2ALJA 3PX2A 3RUEA 3KSRA 3A7EA 1CUIA 1HMYA 1WXQA 2JH9A 3TSOA 4DYHA 1QU2A 4D26A 1WKVA 2VUSA 4HB4A 3G8YA 4PXAA 2O8BB 1W1WA 4J1SA 4LTNA 4FMPA 4KYIB 3CB2A 4HZUA 3L8FA 3C5VA 4REQA 3W3AH 4BX9A 3FDXA 1KVRA 3D7NA 4NZYA 1I7QB 4G6ZA 1IUNA 1SEVA 3VPFA 1QE3A 2XQJA 5A6SA 1YJBA 4ZYTA 1LTKA 2BFDB 3KU1A 3UXMA 2ERYA 1IHOA 2QGNA 3HJFA 1WHTA 2PO5A 5AKZA 1HE1C 1MIHA 1VJ1A 3BD7A 4H16A 3COVA 3PGXA 2A35A 5T6BA 1KU0A 1UK8A 3PNMA 4I2VA 4MINA 2V9PA 1RNLA 4BHTA 3I9MA 1VKHA 2H06A 1D1SA 1KU6A 2O7RA 2PXCA 3NBMA 3PPIA 3PT5A 4N7MA 4YAFA 3G2OA 3S2YA 5EEHA 3U7QB 4C87A 5KWVA 3LCVB 3N53A 2AD5A 1V9SA 3WJAA 3R5KA 3OLWA 1F9AA 3JYNA 4NY1A 4BGDA 4FFSA 5JCPA 5KOJB 1Y82A 4INJA 1V7ZA 2PUBA 1YCHA 1ZESA 2Q3JA 3OFSA 4J2OA 5ALLA 2AEMA 3J7AC 2CB0A 2CXSA 1ZONA 4WKCA 3TLCA 5JWRA 5K4HA 1I2BA 2CMFA 1KVQA 1L8AA 5BORA 3EFHA 3K72B 1TCCA 3MRVA 3RRMA 4BRWA 1W7AA 3PB3A 3ZJTA 3NH6A 1JDPA 5BQOA 1OLSA 1A95A 3IVXA 3PYMA 1KO1A 1N3YA 4TL6A 3UJBA 5EWLB 4KWEA 4JQSA 2D62A 1Z74A 1P17A 2ODTX 1YH3A 3EPRA 3KWJA 4B3HA 1F0KA 3RTDA 1RQGA 3CF4A 4QWWA 4D74A 3H86A 3BCHA 2XE7A 4LCBA 3L79A 4X7RA 4LSGA 4C0JA 1L5HA 3RNOA 1XQ1A 3CF6R 4PVCA 4UARA 1QCDA 2VCHA 5TJHA 3EXHA 2Y9MB 1DT3A 1NKTA 2NZ8A 2XOXA 3CNOA 1ZRHA 4GZLA 5ERGB 4JJAA 2UVPB 3ELYA 4BNDB 2HZBA 3HCRA 1E4OA 1I4TD 3IE1A 1YAHA 1E2JA 4INAA 2FDRA 1N1DA 3F6CA 4HQFA 2BGIA 2YXNA 1AGYA 5DE3A 3FFAA 4H7FA 1SU7A 2OXCA 4JBWA 1BW9B 1K8ZB 3IALA 3N8IA 3K6SB 4ZAVA 3BGWA 4M1ZA 4BFSA 3VKHA 1M72A 3SXPA 1G21E 4L57A 1WIWA 4OXIA 1RWPA 4PIPA 1Z4IA 2PZGA 5FTWA 3QVGA 2GI4A 4YLEA 1A9YA 2X1HA 1YKFA 3HNPA 3T9CA 4F72A 3QKUA 4Y2HA 5EKUA 1KJQA 1TJ4A 2EGUA 3IIKA 1TVCA 1OWLA 3NJRA 3N70A 5EGNA 5IKOA 5C8YB 5JZ9A 1U8XX 1GFSA 1ZH8A 1WBJB 4QGFA 4JASB 1X7HA 4ZJPA 2JFGA 4K6KA 3Q7TA 4HZIA 3E9ZA 4HY3A 1O96A 3UWSA 4KXFB 2B9VA 2CLDX 3C4JA 5DYIA 3SNHA 1YASA 2FRDA 3AP3A 3B38A 2LBPA 2I03A 3K8YA 3NQ41 2A9RA 2OY0A 4GVPA 4NBVA 4WK4B 5CURA 5L6MB 3B5JA 1G38A 1GPUA 3RSSA 1VLJA 3D0RA 2K87A 5EWJA 1OV4A 1EZZA 1A2QA 3IHTA 3BGSA 3JSXA 4YTEA 5LFAA 3NR2A 4TSFD 1AUVA 1NG1A 4NU0A 3TW4A 1FNDA 3LKBA 3C1UA 3O8OA 1XVAA 3IT0A 4GQIA 5FPHA 4DDMA 1NKVA 721PA 5HK9A 1P0IA 4MA4A 4KJXA 2W11A 2J41A 2J7PA 2R86A 3CRVA 2JFFA 3MWJA 5F2KA 5M04A 2PZEA 4EQ6B 4Z9YA 4RPGA 1O95A 2IYPA 5HILA 3IDFA 5AYVA 3ZHSA 1GOTA 3ZGLA 5EE9A 1C8BA 3G8DA 3V6LA 3WIVA 1XQYA 1F6BA 1P5JA 1P2VA 1F8YA 3KO8A 1DDOA 3S2EA 3SQOA 1XZDA 3STUA 3T1OA 1Y8RA 1K06A 4AL4A 2AC2A 4XDZA 1CZKA 3VPSA 4BVJA 1RC8A 4I1RA 3V6MA 4OQ4A 1E9BA 1GD1O 2I7VA 3ONVA 1LDNA 3RS7A 4JQCA 4HUQA 1KEVA 1CE8B 1RKXA 3DL0A 1QVWA 3HEBA 3K4QA 4PAOA 5DYNA 5LXTF 3KT0A 4EMBA 3OE4A 4GBGA 3LY7A 4JB0A 4YFYA 3WLJA 1PNQA 2QAGB 3B82A 3ZE2B 2RG7A 5JW6A 1LSOA 1BFDA 2ECPA 4ZTZB 5CDHA 4RYLA 3A6GA 1SNYA 2G71A 2R85A 4DIMA 4B2YA 2I2FA 1J2UA 2PCLA 4GOJA 3M4JA 4P92A 4WZBE 3ZGXA 4BNJA 5TMBA 1XEFA 3SM9A 3UTCA 1BJRE 1R66A 5IKEA 3SIRA 2E37A 1CVLA 1O4WA 3K70C 1BMDA 2VDLB 2AE2A 4NMXB 5IH7A 1TQ8A 2XA1A 4BLUA 4DREA 2A9JA 1S2MA 2Z8XA 1DBSA 1OH5A 3OJCA 3BX1A 1Z88A 1KYQA 1YJXA 2NVOA 3M8KA 4Q1VA 4UVHA 4JI1B 3IKLA 1K9VF 1U0GA 3JQDA 3TAHA 1GKUB 3ASYA 4TWIA 4E4YA 4EZIA 1UOQA 3HEMA 4KWCA 4YRAA 5JYBA 3VQTA 3CZ4A 4DV3B 1YDFA 3DMGA 3N2NA 1U3FA 2MDTA 1UF9A 3B53X 1JIJA 3AOEA 3FNQA 2AUNA 4QTZA 5K05A 4Q9LA 5EXEA 2JGAA 1Y9ZA 1Z45A 2OGZA 3DVRX 1JFFB 4G24A 1UJCA 3ZWVA 2HQSA 1TD1A 5FD8A 3NYIA 3WL6A 3CQ9A 3KL2A 4MEBA 4P9NA 3IQEA 4ZOCA 4JCOA 4ZT6A 1AS3A 3C1TA 1X86B 3FTQA 2X0DA 3UK1A 2Q1SA 3VZPA 1XR3A 2P6PA 2P1DA 5CJPA 4LJ9A 3O0TA 1CFJA 2Y68A 2XKAA 1ZJZA 4JMLA 1D6SA 3EX7C 2BDEA 2FR8C 2ZT6A 1BCRA 2B1QA 4EPVA 5BWNA 1V9LA 2I22A 4WQMA 2BF4A 2A6PA 5FNVA 3DOJA 2PGXA 2HC9A 5DGTA 3ABIA 2ZPUA 1WCWA 2X8JA 1THZA 2LGJA 2VHCA 3AKDA 3D8RA 3R5JA 4PTZA 5CPFA 5DK6A 4ZCSA 4UAUA 2EHDA 3ROGA 2BTQA 3WIEA 1PDWA 3NM6B 3HQ4O 4ZZ3A 3WIOA 5CBPA 1MB3A 3OLYA 1SCBA 4WBNF 1UCFA 3I64A 2QU7A 3A1TA 1WDTA 1J2JA 2OBBA 1QKIA 1U8EA 2FQQA 2HGZA 3ON5A 1LBIA 2O8FA 4FHCA 1CUBA 3IPRA 4AQYB 2B0CA 3GUVA 2ZRFA 3I5XA 3KAKA 2R5NA 1HT3A 2QTMA 4Z9AA 2B99A 4ZI3A 2B4AA 5DSTA 3VZCA 1CUJA 4QU0A 4JLKA 3UMYA 2ZSEA 5AVKA 4D4GA 2AR7A 4RWEA 4XJVA 1J24A 1JKIA 1G42A 2HMVA 3DYIA 3EVFA 3JPWA 3V3TA 2ZB8A 2I4IA 2JHCA 4KLAA 2GARA 3S8EA 1KPHA 3Q0TA 1FDRA 2EERA 4FC6A 4HX5A 1ACMA 4ZEWA 3QFSA 5HCIA 1KEWA 1SBIA 2ZWPA 1R88A 2VP5A 3E1GA 3FYUC 3MG9A 5DHPA 4EKEA 2HHLA 3IR7A 1L5RA 2NSDA 3T5BA 1VMIA 1TLLA 2IH5A 4ZFNA 3QVXA 4JFAA 1V3QE 1UH5A 3UMRA 1VG0B 5K1ZA 3WICA 1PL8A 4R1OA 2YJGA 1YFKA 2VK1A 1G9SA 5FORA 2ROQA 3LWDA 5KYUA 4I19A 1P2TA 2CBGA 5JI3E 4OKSA 4BQNA 3P2MA 1NN3A 4KXXA 5LDHA 2V55B 3HMQA 1Z7EA 4YP9A 5YASA 2IFTA 1AD2A 1C0KA 2G0AA 3KK0A 5T67A 5MFPA 2V6BA 3FLEA 1GKKA 1UQRA 2OBFA 3FI0A 4FI3C 5J63A 3SVLA 3UBTA 4KIUA 4F3TA 5JSYA 5FHQA 4A1OA 3ZIAD 4C2BA 1EZ1A 3L0PA 5E9JA 5DT2A 3H8VA 4LA4A 5KREA 1YS1X 2FW6A 4UTRA 1LS6A 5HQTA 2GK7A 1M6EX 3CYFA 4Z49A 1PWEA 4ID3A 4F86A 2FE4A 3DMTA 3KKKA 5B4UA 4S0ZA 4C0AC 3ZK8A 1WWKA 3R6LA 1BXGA 2OB2A 2IY8A 5CBKA 3BE6A 3U4MA 5JVDF 3RH0A 3ENKA 2BMWA 3JYHA 1Z0FA 3KKMA 4MGIR 2AW5A 3OZDA 4L07A 4YCDA 3ZVRA 2K2WA 1JEDA 3X43A 2XTJA 4G0PA 1JU3A 3PV0A 1JHRA 4DE5A 3UAYA 4O2BB 3P0RA 1SM4A 2QJFA 4DV4B 3ITEA 4KO4S 1EJ2A 1NOJA 2ZJ4A 3G79A 2V4UA 1RI2A 4TV9A 1HURA 4ZVMA 2GNOA 4O63O 4G23A 4IICA 3FUTA 4DKXA 3LOUA 5BUQA 1V3TA 3PDUA 5D86A 1KI4A 2A88A 4MVYA 1M2FA 4PIVA 5DBHX 2PT6A 2B25A 3M6FA 4DG8A 2GHRA 2WKWA 3TQHA 3AJAA 5HPYB 2JIMA 3IQWA 4CTNA 2AMJA 3ZY6A 3HFJA 4REQB 4U3JB 1E20A 1VBFA 5ALEA 1PLKA 4RTKA 3AIMA 3I2GA 3CWZA 3OU7A 3ZYZA 2FVYA 1V5EA 2ZU6A 4C4TA 4ZEMA 4NPCA 2ZOSA 4RNDB 2QM8A 3EFOA 2ZJZA 2SKCA 1UBMS 2PL3A 1L7NA 3C48A 3O8DA 1QR2A 2AJDA 1Q5PA 4G4IA 5AO9A 8LDHA 5ICMA 2ZZMA 3V1YA 4PAGA 1WB9A 4GPZA 1LBHA 3SZOA 5U1PA 1UFQA 3TD2A 4E5KA 2YX1A 4DLUA 1E1KA 3SNKA 2I3AA 1IN4A 2YZ7A 4ALJA 3UO8B 4TXMA 4DY6A 5LZ7A 1SUSA 2YWDA 3OF3A 2IPAB 4U6SA 3Q7EA 3H2ZA 2OG2A 1NVTA 5BNIA 4HWPA 2IU0A 2HV9A 3FGOA 2BI8A 5EAIA 2ZSKA 1FTWA 1C3EA 5DBGA 2XIJA 5KHOC 4MV6A 2UZ3A 3DFMA 2R4QA 5FA8A 3HN6A 1YA8A 1NDQA 1CR0A 4Y6GB 4FKZA 5G1OA 5G41A 4POAA 5I7AA 1EXMA 2QJRA 3MGCA 4BZZA 5IU6A 1AO3A 1I1NA 2J5BA 4I4LA 2DHDA 1KEUA 1SRQA 2JRCA 4DV6B 2GB4A 4ENVA 3GRYA 5EZQA 4TL8A 4BVHA 3P4UA 5IYZA 5DGHA 4ZVSA 4MB0A 4P3PA 1QBGA 1KBZA 3CVWA 3M3HA 2X5KO 3QVVA 4RKRA 3VR0A 4UREA 4V02A 2ACWA 2DFTA 4Z4HA 3WKAA 4XM0A 1G8YA 2PH1A 4OHZA 2D2EA 3BA6A 3DOUA 5IMSA 1HMPA 4DBLC 3MTDA 3SXJA 4C7OB 4Y6OA 1PD0A 1PTKA 2DQKA 2EARA 2Y0BA 4AYTA 1S7GA 2AYXA 2H7VA 1QHGA 3M70A 3VKGA 2JFZA 2QMUA 3NG1A 3W8NA 3OUUA 3F6YA 2VDJA 4IF4A 2P41A 1KJWA 4N0QA 1O5IA 1NATA 2I4MA 3R3VA 1H1TA 3O4RA 3RARA 2QLJA 5LM3A 2JCSA 3OO0A 1Q91A 3CTMA 4HDQB 1G66A 3U0BA 3DVAB 4RWZA 4E31A 1DELA 1CE8A 1QVZA 4CI0B 4NE2A 5F12A 4DLBA 1XEWX 1YFLA 1WU8A 3KVRA 1XZAA 2DKFA 1X9IA 1JTVA 1KI6A 3EZ2A 4M6WB 1O96B 2MMGA 5E9QA 1OX5A 1MJGA 2W70A 1JXQA 2IYSA 3WGJA 4E5VA 3ZVNA 3K0CA 4QG3A 1F38A 1WMEA 3THRA 4P4SB 3D9QX 2LTAA 4KLZA 3EQ8A 4PQEA 4UBIA 3VTZA 4M0MA 4AJHA 4MUAA 5LMNB 1SELA 1E1QA 4NG4A 4KEAA 4UE6A 1VMEA 4EPXA 4ZMSA 1K08A 1J00A 1OFIA 3FYCA 3HH8A 4RK4A 2XBUA 3WJ1A 4KDFA 3GU3A 4G4SP 3B20A 4GOND 2Q5LA 4P4GA 4M9RA 4Y8VA 4UFOA 1GAXA 1FSSA 2AD1A 3IHLA 4XQEA 4V3BA 3SJAA 4D0GA 5KTPA 3PYXA 3S6JA 1SVSA 1LRLA 1VE5A 2FRDC 3JZIA 3KPJA 4DJJA 2COKA 4EAAA 3VR6A 1E2MA 3NBZC 3EA0A 3JARB 1NF3A 1LH0A 1TIPA 1U7XA 4QRHA 5CPBA 2H1CA 3CIFA 1PUJA 2Q3BA 3KQTA 2NTJA 1XU9A 1UK6A 2WHPA 3I53A 4HGPA 1SHJA 4Q7LA 4XEUA 3A4MA 3FW1A 3BRQA 1T2UA 2XITA 3WAKA 1QVVA 2GD0A 2Q28A 2X6QA 1E7QA 2VJOA 4QDXA 5U9CA 3GLVA 5I7FA 3P2JA 3O9MA 3O7MA 4Y2UA 3KR9A 3FSGA 3EHDA 3JYLA 5THXA 1PX2A 3REGA 4D97A 4A7PA 1T0BA 4UM9D 1OHHD 4ZI5A 4CLRA 3HGTA 3C7DB 2XVAA 3S28A 1JG4A 4WGGA 3W5SA 6ABPA 1M6YA 1AZTA 2DX7A 4OV6B 5H3LA 4D80A 3ESAA 1DGQA 4BZPA 4D9CA 3K32A 3FB4A 3LC0A 3OIFA 4IFIA 2W37A 4ZQHA 3F5DA 1BX0A 3S1SA 5A9SA 2Y3IA 1GUBA 4XIJA 2WJAA 4AJEA 2G1PA 1LY1A 4JOQA 2Z09A 3P9RA 2BV3A 3WJ7A 4B6RA 1SIBE 3AF0A 4F9EA 4CV3A 2ZRDA 1CFZA 2FOIA 2IPOA 3CUWA 2NPOA 3GMTA 3BRCA 3GI1A 4L6IA 1T8TA 5JBNA 5EMMA 4QO8A 1ZGAA 5BOVA 3K0AB 1Z28A 5CM8B 4MQEB 1IBRA 2TYSB 4ZVNA 1FYFA 1W96A 5ECGC 2DWUA 1U7WA 2A3NA 1K27A 1OC4A 2H6EA 3LVFO 5EJ2A 3G0HA 1Z6XA 2A67A 2O7QA 5IT9A 2UZ4A 3B51X 5K8VA 4IIDA 4IPTA 2FJ0A 2BBSA 3QEOA 3T0GA 5AUQA 3WKDA 1I7SB 4UBNA 2R0QC 5FI3A 1N6RA 2Q3DA 4YRFA 5HIIA 4ZYVA 3DFZA 5LLTA 5H1YA 4RTRA 2CNLA 3FOBA 3AM5A 3RBAA 4B85A 4JYMA 3HDHA 4WLVA 2ZRHA 4HJRA 4IJUA 4DUPA 4G5RA 4EG3A 3OURA 3NKFA 4IYJA 2WQ7A 4XYGA 3EXFB 1P1JA 1WVMA 1KEZA 2YUIA 1PP4A 4R2KA 4W1RA 2AQHA 2OHGA 4K9KA 2QYSA 1GTG1 1ZN7A 1FDUA 4FOLA 3C3WA 5JWOA 3LV8A 4RORA 2P2DA 3DOHA 1OHHA 2XUDA 3OQ6A 4L9AA 4DIFA 1MDBA 2JC3A 1LBTA 2NQTA 2ZYTX 2OBYA 1Z0ZA 1P1BA 1M1ZA 3WL7A 4N8EA 1LWNA 1JYSA 1DUIA 1WMDA 3OJEA 4HDKA 1XZKA 3R9XB 1QP8A 4NPHA 2AS0A 3HVIA 2IE8A 5MHTA 1O8CA 3OA2A 4QAJA 3RHFA 4H35A 2C0QA 2YW9A 4F7WA 4AT1A 4LXGA 1JAZA 3TXXA 4OM7A 1E9FA 4RJJA 4C5AA 1UJ4A 4L2IA 3OLCX 4H27A 3S0JA 3PJRA 1BKYA 3DDOA 3K7EA 4LY0A 3MT7A 1VHTA 2JLBA 3HR7A 2BEKA 3T7SA 3UMCA 2GETA 1RCTE 5CCXA 1BWRA 4R6XA 5JEDA 1Y8CA 2Q8NA 4OBWA 4G0YA 5EXPA 5ALVA 5BXQC 3T1HB 1ZVKA 3DULA 2EATA 3KKEA 4MJ7A 3NTQA 2RARA 3QV1A 3PE4A 2AEEA 1CLEA 1SWVA 3U4CA 1ZA1A 4BVEA 1RRMA 4F4JA 1T9GR 1K6XA 2J48A 1NMXA 1Z4PX 4FNGA 4KVZA 4JI4B 1ZLYA 1TE2A 1ZGGA 3H1BA 2LCIA 2LCFA 3K96A 3AFIA 1JJAA 2AWNA 2BHTA 1UANA 3OQBA 1XQXA 3E1SA 3VKVA 2EGGA 1PI3A 5CVDA 4URZR 1JS1X 2O7SA 5HCNA 5LQJA 3QKSA 2NZ2A 5CM9C 2GN6A 1VGRA 4I4NA 4J0QA 1A4RA 1K5GA 2FF7A 3BMXA 2WDPA 3CHYA 4R2MA 5F2OA 3I4FA 1O4VA 2WVJA 4D9JA 3GIWA 4ER3A 5CCBA 3AUSA 5TMPA 3KYIB 3K5PA 5CEJA 2QTZA 1APBA 3BJIC 2ZVDA 4DSAA 3HP1A 3ZHRA 2WUGA 2TMGA 2YOHA 4ZZ2A 1R2QA 2PJUA 5C8VA 3R41A 4OGGA 4PZUA 2HQRA 1GUAA 4NV3A 3SKXA 1PR2A 3WR5A 4LDJA 4YH1A 1QX4A 3GVCA 3JY6A 3FOEC 1KH1A 5GONF 4B5LA 2HADA 3BXHA 2WU4A 3N39C 1VPLA 2ZIAA 1JTFA 2WM9B 3T34A 4MWOA 3O26A 3VOSA 4RLHA 2ZS7A 1UBHS 1UR5A 1PT5A 2MTBA 1U0NA 4KDRA 3SKYA 1E9SA 1JQ5A 2RKWA 2EFHB 3DT9A 4BQRA 3BB3A 4NC9A 1NFRA 3C8DA 3NGXA 1QMPA 2FMXA 2RK6A 4HDNB 4NDZA 2E5WA 3LX5A 1VGQA 4FGJA 2GBLC 1L5YA 4XLZA 4O8CA 1EUDA 2HOQA 1EGMB 1T10A 3INTA 2E55A 4IYRA 1X0VA 3KUKA 4EBBA 1L7PA 3LBYA 5CK5A 1HZZA 1X8XA 1Z75A 4TVKA 1TRKA 3WMFA 4KN5A 2KI5A 3K1JA 3UM9A 3P2OA 2N9UA 1EFVA 1SUCA 2VP4A 3QLUA 4J7UA 4NRDA 1VRCA 5ESRA 1Y34E 4B3DA 3WYDA 2XVXA 1E5VA 1PCXA 1ZNXA 1HDRA 4FS3A 2WU1A 2YFYA 4NU6A 3AP2A 1WLSA 3SF0A 4N54A 1Q0HA 4LSZA 1L8LA 3CE9A 4JB8A 4OXNA 4CBVA 1RJWA 1Y5IA 2XA2A 1RTKA 3RG2A 5AW1A 4GKJB 1M83A 1R9JA 1Q44A 2YN2A 4RGQA 1L1FA 2NP6A 2D5CA 2BCJQ 4LZWA 1NT2A 3RI3A 2UYCA 3JD2A 5J3JA 1Y6GA 3MRXA 1TYZA 2VNHA 5GGXA 4OSOA 5LOVF 2YZKA 5CU7A 1RLOA 2OLJA 1GJRA 2BH9A 3I37X 1U4OA 3UHJA 2DR2A 1TX4B 4KI0A 4Z7JA 1ZD1A 3X1MA 2XVMA 2AYZA 2FU5C 3G7NA 5EYPB 5GZ1A 2LZ0A 5THQA 3W5CA 3L77A 1T0JB 4U9IS 4LNUA 5ADUS 2Z04A 1TQ4A 1MH9A 3W2FA 3ZVMA 1E89A 1GZ6A 1ZA2A 1F6DA 2A94A 3CO0S 4U2EA 2G6BA 4DRXA 3DR3A 1GKIA 3GVIA 4IY1A 1SXHA 1P9WA 1OX4A 1KVSA 3HL4A 4F6RB 3GFBA 4UEJA 1KY5A 3PNQA 1TU0A 3ED5A 2OZLA 4RC9A 3EEQA 4DM7A 1GA1A 1VDMA 3BERA 3IOEA 3AQIA 1EQUA 1T8SA 1J0EA 3DBIA 4H7PA 1T5BA 1W25A 3QWHA 4K6MA 3TW6A 3FAZA 3L5OA 1EEXB 1MB9A 5FFNA 2O2ZA 3F6RA 2GF9A 4O2BF 1E9AA 5BVHB 4YRPA 3V1MA 3EDMA 1DV2A 1XTIA 3W78A 5KI6A 1U31A 3TSWA 2GN4A 1NR5A 3MJHA 4Z3OA 3MWEB 1XJ0A 2Z2ZA 5CYFA 4YO8A 1NHWA 3T9AA 2CVOA 4FZVA 3TR6A 4C7OA 4N76A 4UJ5A 3OP1A 2BY4A 2H48A 2BEUB 3IESA 1WSBA 2CFTA 3O75A 4V0QA 3JZFA 5B3LA 1Z5OA 1G20E 2ORIA 3GRRA 4RFSA 3GG2A 3NRBA 4UVGA 3AI7A 3HP4A 2DUMA 4R3UC 1T6ZA 2GLTA 2J67A 2QW0X 3G8CA 4AG3A 4INOA 3HADA 1M3SA 3E53A 4RE6A 1BGXT 1JHAA 1TGYA 1ZN8A 1ADFA 3M6WA 3GL9A 1FMTA 1D03A 5BNTA 4LF6B 1UBSB 2A0KA 3C7TA 3DQZA 2C4MA 3PPVA 4V03A 4M7OA 2R68A 4WNAB 5ARCA 5ARBA 2WOOA 1MQ9A 4CLHA 4P08A 3D1JA 1ZNQO 3E7PA 1KXZA 2R25B 4MIKA 4NVRA 2B2XA 1N0IA 2H1VA 2NWQA 3T5CA 1OKKD 4BDTA 4CMHA 5K0ZA 1RP7A 1NVBA 4AX8A 3ZE1B 3OWHA 5JSHA 1GGHA 2Y27A 1NBAA 2JGKA 4BV8A 3H2JA 1O89A 3M5DA 3OQMA 1KDPA 5KYGA 1FUKA 2O2GA 3HZRA 4PZYA 2ZJ8A 3EOBI 2RAFA 4R01A 1KGDA 2QZZA 4G2NA 3ZIDA 4YRCA 4BDSA 4IJMA 3A11A 1TT5B 5G4KA 3IQIX 3RRFA 1PJTA 4ZCLA 3JZMA 1WCXA 1ZICA 2H2FA 2W2VA 3K0AA 4BJ6A 1NNSA 4ALLA 1V16A 1KZ4A 5AKHA 5LQAA 2W2LA 3M5WA 3WQQA 3CVVA 2B1RA 2IYNA 2WD8A 1GSAA 1Z6QA 5K51A 4RKEA 2PLWA 5CAEB 2QPTA 1MNQA 5SY4A 2BFBA 3GQVA 3OECA 4FGWA 5DO9A 4BPRA 1Z39A 3ACCA 3KPYA 4P5PA 3Q87B 4E3WA 1NVKA 1TA0A 5JOQA 1AKEA 2BD0A 5IAKA 1B8PA 1DX4A 1Y7HA 5ILQA 1IE3A 3TQOA 2NQ2C 1PR5A 3U49A 5AWFC 4UNPA 4OLJA 1B0ZA 2PZKA 3C5CA 4Q9JA 2AK3A 1BX1A 2ZJ7A 4Y2YA 3EFEA 1PWYE 1L5ZA 2ZIGA 3EVZA 4QO7A 5JY1A 1PS9A 2VDMB 2IEGA 5I4BA 2XGJA 1OWNA 4AY4A 1SKUA 3FCSB 3QF7A 2KLBA 4L22A 1LPMA 4X66B 5H7XA 4CM3A 3BH6A 4BNUA 1QCYA 4LHSA 3ZZTA 2OUKA 4FHEA 2GVZC 2J9FA 2X5NA 4GLLA 4R69A 4TWAA 1Y5MA 3G2JA 4TV8B 5E4YA 1UBOS 1UT8A 3JATB 3UQYS 3MS4A 4PRKA 1PGNA 3MS2A 5AFSA 3RFCA 1WL8A 5IJAA 3PFGA 5L4NA 1QPZA 1W4ZA 3GMIA 2O05A 3B78A 3LHKA 4HNSA 4FONA 2AG6A 5AJUA 1JXAA 1JDUA 4IW3B 4B6OA 3GUUA 3QPCA 3ODGA 1JPVA 3GYGA 1P4RA 1A9QA 1PEAA 2JLYA 3LUGA 3R75A 3QE9Y 1E1YA 1VE9A 1L5LA 4LY9A 1CR6A 4P58A 5KOJA 2Q07A 5B30A 1E1DA 1FFSA 2B98A 1I6WA 3H5WA 4NATA 2J6IA 3OJLA 1HQKA 5FWYA 5HFJA 2ILTA 1E3QA 3RDPA 3WSTA 2GEVA 2JASA 1N2GA 3LQYA 4JBNA 4JP2A 2CDNA 1SKBA 1Z6GA 4MUFA 5EJGA 5P8WA 2DPHA 2NT3A 4I8IA 2VSFA 3VTKA 4BE7B 2WHQA 2CK3A 1UKBA 2GS9A 5BV8A 2ZIFA 4JAVC 1WV0A 2C5GA 3WTCA 4BJHB 2A5FA 3U1BA 5TQ0A 3BL5A 4N3AA 4AKHA 4C4PA 3G5MA 3FD8A 1NFQA 4LTMA 2D7JA 1MZVA 3O84A 3CG4A 2QQGA 2X3FA 3GBVA 4X20A 3TZCA 4F92B 1ZEMA 1JKXA 2C5FA 5JNRA 5KVVA 2CDRA 4PGHA 3QNWA 4RD6A 4BZXA 5CD1A 3MMPA 1FFEA 4EZEA 4HRAA 5AXBA 1K8RA 1NW6A 2I2DA 3AEQA 3E3OA 5G0UA 1N5DA 2NPIA 4W5JA 4DCJA 1L4YA 1T6BY 3KJXA 4NULA 1C7FA 3R5XA 4W5OA 1DNPA 2UZAA 3TTWA 4DTIA 2XSZA 5CMLA 3LAWA 3ICVA 1GRNA 4RVCA 4H7HA 2YJTD