1Z08A

Gppnhp-bound rab21 q53g mutant gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
160
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-21
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 53
structure length 160
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z08A00
5C46F 4HB3A 1KJWA 4JL8A 4X8LA 4Z8YA 1G7RA 2VP9A 4K81B 1GKIA 1IN7A 5EZ6B 1E94E 3AP2A 4MUBA 4HSEA 3ZZ0A 2WAXA 1IN6A 1VDZA 2FH5B 2R8RA 1XPRA 1KY3A 4G5GA 2RH5A 3I5YA 1IY2A 5JEEA 4MYHA 4A4DA 1W5TA 3GD7A 1U8ZA 2OEPA 5CYOA 4EJSA 2PMDA 2XNDD 5D3MA 2R6AA 2OFWA 4M9QA 3HP1A 1T6NA 4S2EA 1YJ5A 4AYXA 3K0CA 2ASEA 2JATA 2AL7A 4AK9A 4NP6A 3U60B 1PUIA 3U3KA 3WMEA 3DM9B 2NIPA 3RDPA 1NMYA 1TQ2A 2UVQA 1NBMA 3EARA 2WKPA 4D2IA 4ERNA 1EFRD 3WP1B 1J7KA 1R7RA 4X8MA 1JXMA 4ESVA 3NWJA 1XZPA 2WJHA 3THWA 2WV9A 1XD2A 1W7AA 3I8XA 2J0SA 2RGAA 3KXLA 2HT1A 4JLDA 4QGHA 3AF4A 3OEEA 2IS6A 3EIHA 1XB2A 3R7WB 2ATVA 3FWYA 2ZETA 4Q9HA 3BERA 4DSOA 2ZM5A 1T91A 2MMGA 1WE2A 5IK2D 2AHOA 2ZEJA 3U61B 2CDNA 3CH4B 2WMNB 1XJCA 2JGNA 4G0NA 3C5CA 2F3RA 3OEHD 4QHYA 2PJRA 4B44A 3LD9A 5J47A 2ZR9A 4HLUC 5J4VA 1TADA 3K9GA 2GZHA 3S1AB 3ZGXA 3K53A 3K0CC 3WBKA 4U00A 4WZAE 3SFZA 2FDCA 4XOIA 1Z83A 2JIZD 1M7HA 4BLTA 2H17A 5CDFA 1YZKA 1WRBA 1FQKA 1NY5A 3EZ2A 5AJXA 2ZROA 2ZRLA 5G40A 2OESA 1VPLA 5CLQA 1S8FA 4JVLA 2DFTA 3EA0A 4AG6A 1QDEA 2EFEB 4AKHA 1QF9A 2K5UA 5JS8A 1NNEA 5FBLB 4MYCA 4G5SA 4TQ9A 4DT1B 4D26A 1I4DD 2D2EA 1KSHA 2GJ8A 1KSFX 2Z4RA 3N2EA 4TSFD 4DB2A 2O8EB 4QG7A 2V1XA 3SBDA 2QUZA 4JL6A 2D74A 3PVSA 3J81k 3QSYA 2GEUA 3N5CA 5B64A 3GJ5A 2G77B 1Z2CA 2YINC 1W4AA 4UNQA 4BLOA 1Z47A 2HUPA 4PO9A 2GESA 3WBJA 1R4AA 3D3QA 4QXAA 3P20A 2A5DA 4L15A 2VP5A 3NG1A 4LRWA 1WMSA 4ZPXA 1NKTA 5JLJA 1QRAA 2WOOA 2Z0MA 2P67A 3AH8A 3W5IA 1FL9A 3VKHA 1ZU4A 2ZI5A 4W5JA 1R10A 5E95A 3GPLA 2A2ZA 1V43A 4GBMA 2PZFA 2F1JA 2RGGA 3H2YA 2ZJYA 4JLOA 4UKDA 3B82A 2QPTA 4EQ6A 5CIQA 1E69A 3BXZA 1KMHA 1NVUQ 5GJWC 1CBUA 2AXNA 5SZJA 5CDFE 2FSGA 1W0JA 4TYNA 4IVPA 1GWNA 1ZBDA 1P75A 1U2RA 1A82A 1DO0A 1CJVC 3A1SA 4IOMA 1CJTC 4Q21A 1KOFA 1Q12A 1SXJD 4RFVA 2ZSFA 4P31A 4PPFA 1F5NA 2GJAA 1E2FA 1M7GA 4HLQB 4YC7A 5LD2C 1J90A 4IJMA 1T0HB 2LCFA 3CKLA 4M9XA 2CJWA 2FJUA 1SKYB 2F3TA 2FSFA 4LJ9A 3SJCA 4D81A 5C2JB 3QXSA 4PAQA 3DL0A 3HWSA 4HATA 4YMUA 5EP3A 2XNSA 2A78A 4BLQA 3GFTA 3BGWA 4GP6A 1IXSB 2AKYA 4Q48A 2QZ4A 1MT0A 2I4IA 5DN6A 5TVKA 3TR5A 3QVVA 3L8YA 5UKDA 3EPHA 3GMTA 4D0NA 4C2UA 4ACBA 4XVUA 2ZVQX 4O0MA 4TT3A 1DOAA 4ASUA 4B2IA 4BLSA 3AVUA 1CU1A 1Z2AA 2EFGA 4WZ6A 3PUVA 1KDRA 3QY0A 2PT5A 1JEDA 1R5NA 1D6JA 5A4JA 1TF7A 3CO5A 1UDWA 4N3NA 1G8YA 3R9WA 3ZQ6A 1JBKA 4JVMA 4RD4A 2YC2C 2A5JA 1PV4A 1NVVQ 3X2SA 3I3SR 2XEXA 1GL6A 3IKJA 4LUCA 1DE0A 2QT1A 2GA8A 4LV5B 4QGFA 5LB4A 3DPUA 1FX0A 2B6HA 3TGPA 2ONKA 1Q57A 1T3HA 1Z0DA 3ZZTA 1GNRA 1NL3A 5AK0A 1KJYA 1QVAA 2A3RA 3PQCA 4L9WA 4DSUA 4HZUB 2VEDA 4JLBA 1W49A 1O87A 2QEQA 2RMKA 3VX4A 1KNQA 1IXRC 2QP3A 1CR1A 3W6OA 2XOKD 1II9A 3LV8A 1EESA 2SHKA 4NDZA 5TB5A 4ON9A 4DVGA 1QZXA 2ZRAA 1E1QD 3NH6A 4LPSA 4P32A 3UWOA 4CYMA 3OIUA 4E09A 5EUQB 2ANBA 4GDFA 1M8PA 2YKGA 2A5FA 4FI3C 1DAIA 4F93B 4QNRA 5L3VA 4X8HA 4I1SA 1TF2A 4DRZA 3CLVA 1ZINA 3ZYCA 1AS3A 1RRFA 4KO8A 3WNCA 4KV9A 1DADA 1R0ZA 2WHXA 4BWYA 4HDQB 1UKZA 1OIXA 2WJJA 5H70A 1OKKD 1JR3D 1E9FA 2QPAA 4OKSA 2W6JD 4Z54A 2PZEA 5FPKA 5FL7A 2NPIA 1CJKC 2OFOA 4RD1A 4M1TA 3RSOA 3LQQA 3MUFA 2ZRCA 3B8HA 3TK1A 1FP7A 5JRZA 1JJVA 1IY1A 2ZITA 2YC4C 1OHHD 4Q4HB 2BV3A 2BBSA 4CIDA 3T1QA 4E03A 1M2OB 1UM8A 3QPVA 1RRPA 1LS1A 2FFAA 3SZRA 4DUGD 4WZBE 1R5OA 1LNZA 1PVOA 2J7PD 2ZYTX 4FD2A 4IXNA 1UKEA 3NBYC 4M1OA 2RAPA 1GAJA 3CRRA 4BASA 3P4YA 2BWJA 2GXQA 4YMWA 1E0KA 4F4IA 2QP9X 3NEYA 3BIFA 5F9FA 3P32A 4FINA 4LV8B 1W4RA 1RFLA 3QJYA 1SXJB 3EZ7A 1X8JA 2QY9A 3EC1A 3IIMA 1W4BA 2C8VA 5JSZB 2IYRA 4MKFA 2ERYA 2BOVA 1N6KA 2VLIA 2IF0A 1Q1EA 2GCOB 3CH5A 3VQTA 1ZNZA 2WJIA 4QBHA 4QBIA 5HTKA 4ZI2A 4Q4AA 1KY2A 3K0FB 4HAVA 4ZKEA 5FUWA 1CF4A 2IUSA 2VHTA 1XMSA 1FOEB 4JYCA 3PCRB 4JBYA 3T61A 1XTIA 1XXHA 4XVRA 1MABB 1AQUA 1ZNWA 1ZIOA 1QHHB 3D6TB 5H1YA 3CWQA 1E2DA 2IEZA 1OXVA 4FIDA 2A30A 3K0SA 2B7CA 5JZVA 4L4UA 1CLUA 1T8UA 2PCLA 4UNNA 4B48A 1XRJA 1OF1A 3OFNA 4E5UA 1KTVA 4IEEA 2GTPA 2QAGB 5KTYA 1QG4A 2C2HA 5CK5A 4C0SA 1E99A 1PJRA 1E2NA 1U81A 4QGGA 3THXB 2IXEA 1EXMA 4HB4A 1JQJC 1II8B 4TYYA 3VR3A 3O8BA 3EC2A 2KB0A 3GFPA 4R2IA 2G1KA 2HJVA 4CZ2A 1KO5A 2GZAA 2OHFA 1VCOA 2WJGA 4AD8A 3NHBA 4PC2A 5KPDA 3HU1A 1S1CA 3TIFA 3SI7A 1Q1QA 5IRCD 3W5JA 1KK1A 2DBYA 1HURA 4LWZA 4BECA 4DLSA 2V8OA 1P3JA 1SGWA 1E4YA 1XJQA 2Z5FA 3VR1A 1E96A 4A0HA 1QHSA 2RGEA 2RGXA 5KYKA 3GJ7A 3R20A 1CTQA 3DM5A 2F1RA 4TQAA 4M22A 1E79A 1IN8A 3IQXA 5IT5A 1U0JA 3N70A 4IHQA 2WMOB 1XTSA 4A0RA 3Q72A 1IXZA 3W34A 1ESNA 1FP6A 1IBRA 2J45A 4A0GA 1KO1A 3BB3A 1XXHE 2IT1A 1G21E 2BMEA 4I99A 3BD9A 4EIWA 2CLCX 1RJ9B 4LJ6A 2FFQA 4X8OA 4C0KA 4HDCA 4IDHA 4KYIB 1JEEA 3EPKA 3PG5A 4OQMA 3LLMA 3FHOA 3N2IA 1S2MA 2ZRBA 3LFUA 3MRSA 5ELXA 2CE2X 4IKEA 4Q47A 3EZ9A 1Z0FA 1U99A 5DISB 5KNBA 4GP7A 3FHCB 3LBIA 2PLRA 1W47A 1WA5A 2ANCA 4AC9A 3HR8A 5HPYB 3M4YA 5CLLA 5KNDA 2WIAA 4V0NA 5EE1A 5DI3A 1Z6AA 1QBKC 1ZIPA 2J1LA 2NO1A 2QE7D 2YJTD 3GJ6A 3LRPA 3I1FA 3Q5DA 4PSAA 3X1DA 4NBSA 4KVGA 4WVFA 2GVDC 2LKDA 1EFCA 2G0TA 4LPKA 2OXCA 2G3YA 3AVQA 2F55A 5JJLA 1Z6XA 4EFLA 3R9XA 4KITB 1AKYA 1TX4B 2GXUA 2P6NA 4YXWA 3TAHA 1G5TA 2QORA 2ZI9A 5FPHA 3CNNA 1G7TA 1Q3HA 1E98A 4FMDB 4YMSA 2WWGA 3VU9B 2QG6A 2HCJB 2GJSA 4M1KA 2GETA 4WXRA 1OYYA 1E2LA 3GJ0A 4MRRA 4IDOA 4CEJB 3MD0A 4URUR 3SQXA 4A8JA 1NVWQ 4LK2A 2Q9CA 3SYLA 1ZMXA 2OE2A 1GUAA 4IVRA 1MRSA 3H1TA 1COWA 4AWXA 1E9BA 3DEFA 2ZE8A 3OE7D 2JAQA 4RKEA 4ZDIA 2WJYA 4ILEA 5BN4A 3V4FA 5HR5A 3AUXA 1SKQA 2PMKA 2VO1A 1U90A 1RYFA 2X8AA 3AKEA 3LWNA 1G8PA 3ZIAA 4OHWA 2OBMA 4RFSA 2BBOA 1ZUIA 3QVUA 3RC3A 1GRRA 3UMSA 2JLYA 2EFHB 2ORIA 3LVQE 1FMLA 3C8UA 4ABYA 4UNRA 4R9UC 1XMIA 2XJ9A 2V9PA 5GVSA 5EE3A 1PZNA 2ZSAA 4LBZA 3UMRA 3B1ZA 1SKYE 5FFMA 3FFAA 1E6CA 4BLPA 1AJEA 2J7KA 1OW3B 4NYIQ 1TEVA 5A0FA 2KWIA 1P2UA 2GAAA 3CR7A 4PHHA 4LOAA 1KAOA 2QM8A 3AM1A 4OHYA 2C9CA 3VR5A 1XP8A 1Z0IA 1JAHA 2IS4A 1LV7A 1W36D 4O3MA 2RGDA 1BH2A 3WY9A 1IJFA 1LY1A 3LBHA 4IRUB 4GPTA 1KO4A 1T8TA 1KK3A 2JLRA 3P26A 4Q4LA 4A8JC 3X1WA 2B21A 1EX7A 1Z0JA 1G17A 3SJAA 3QXXA 2OT3B 1YR9A 2C9YA 1NN1A 2GBLC 1NIJA 521PA 3K9NA 1AQYA 3KQNA 2WKRA 2ZUBA 2JDIA 2OM2A 4MA4A 5KSPA 4BFWA 2D06A 2DFKB 4KSCA 2BCJQ 2WTUA 3I4LA 1PLKA 3UG6A 1XCGB 2PZGA 3QF4A 1XPUA 4MITA 1SVOA 1J70A 1JPNA 1T4GA 4PTLA 4LC1A 4Q4HA 2G88A 4LJAA 4Z1MA 4DLRA 4PFSA 1E3MA 1ZD8A 3QKUA 1K8RA 3VAAA 2X2EA 1XWIA 2WSSA 1TTTA 1DG1G 1G8HA 3IIJA 3JVUA 3QE0A 3RS7A 3DO6A 5L3RA 1RPZA 4OJQA 4DCTA 2KSQA 3GJ8A 5M04A 1PLLA 2AR7A 1D2EA 4GI7A 4YONB 1R0WA 1DPFA 1FMJA 1MKYA 2IBMA 4LJ8A 5EP1A 1RW4A 1XBTA 3BWDD 3SNHA 4OK3A 4Q00A 1E9SA 2CK3A 4P4SA 2GRJA 4CGZA 1YZLA 3CW2A 4POAA 5JSZA 3DMNA 3A6PC 5AJWA 2GCOA 3AF0A 1JI0A 1UPTA 4IOJA 2REXB 3GLHB 5DHAA 5EE5B 1M74A 3K70B 2RB4A 3KJIA 1E2GA 1E9RA 3CF0A 3O8DA 4U02A 4F92B 1AS0A 3KQLA 4KAXA 3NKVA 1QHHA 3EWSA 2OCAA 5SZKB 2QN6A 3QG1A 4AYTA 1XZQA 3K09C 3DDCA 4PXAA 1Z29A 2Z43A 2J46A 2QAGA 2Q9AA 5F9HA 1OH6A 2HYDA 3U6KA 1H8HD 1S4QA 2LKCA 4PAMA 4EPWA 4QBGB 4F7WA 1AKEA 3FKQA 2JJ1D 3C5HA 2ZJ2A 1II8A 4Q7LA 1Y3AA 1W0KA 4IDPA 5EXTA 5SZIA 3U3MA 1OXTA 3FYHA 2OZEA 1VIYA 3A1UA 2DWQA 4M1MA 421PA 5CM8B 1J99A 1FUUA 4NCNA 3NC1C 4A6PA 3U4QA 2FU5C 1KI6B 2O5VA 2X1VA 3EZFA 3IGFA 1NF3A 3ZLJA 4B73A 5JHHB 3W3ZB 3DZDA 2ECKA 1D5CA 4OL0A 4A9AA 1HTWA 4G5QA 4M21A 2QROA 3QKTA 1P2TA 1X8KA 4JL5A 2N42A 2JJ2A 1FNMA 1DAEA 1GSIA 2O8BB 3QKRA 4LYAA 1OV4A 1KI2A 1RYHA 3ZS8A 4GOKA 2PH1A 1W36B 4NCKA 1JXOA 5AUPB 1L2TA 2QSZA 5FTMA 1ESMA 1EX6A 3Q7QA 3RWOA 2B7BA 2IXGA 3CNOA 1P73A 4IDQA 3SYNA 4Q1BA 2VP0A 3VHXA 4Q9JA 4LBYA 3TLXA 5FOWA 1CR0A 5KDOA 3NH9A 3QQ5A 4LJYA 3ZVNA 2H92A 3NBXX 2R6CA 4DLXA 4JKYA 3AVWA 2GEDA 4DSNA 3GJ4A 3QXJA 4Y0VA 4PC3A 2H8KA 1L7VC 5EXXA 3MWJA 3RRYA 3U3JA 4YQFA 2NOAA 2J87A 1G19A 1E32A 2XX3A 4MGKR 1FW6A 3U7EB 2OLJA 5AUNB 1NVVR 2IS2A 2UZ3A 4XD7D 3TKLA 2FEOA 2O8DA 1YR7A 1E1RD 2H1LA 4O25A 3BRWD 1N6RA 2VTKA 1DAGA 3CPJB 1GVNB 4LZZA 1U9IA 4NPHA 1P61B 2QPOA 2Z6VA 1VG0B 3G5UA 2J5XA 2MSCB 2NG1A 2W00A 3VU9A 1LF5A 2CHQA 1C9KA 2IYUA 2PT7A 5L3QB 1P60A 1XCMA 2CNWA 2VSOA 3A1WA 4Q9LA 4EKDA 5CYPA 4IFBA 2VH5R 2IL1A 3NVAA 2ZE6A 3SR0A 2NGRA 2MSDB 3MCAA 4NMMA 4DCUA 2DFNA 3MLEA 4ITRC 1TUEA 3AVYA 1BYUA 1HT1E 1BS1A 1P5ZB 3NBFA 3PUWA 3ND8A 4JBXA 4XWAA 2C95A 1DG3A 1MO6A 1SHZA 2GHIA 3RWMB 4EJSC 3SJZA 2NTYC 5JHGB 2XZOA 3QEJA 1NG9A 4CVNA 1ZRHA 4LDJA 2VIIA 2AWOA 3AVTA 3CRVA 4OJKA 3GLIA 1A5TA 3K0AB 4TTQA 2WWIA 2OAP1 4LI0A 4TLAA 2GK6A 4B71A 5FR2A 1XNJA 2MSEB 4D80A 1D8TA 3W6NA 4Q4JB 2ZIAA 3TUIC 5LDDC 4GSYA 2RGCA 4CW7A 1JR3E 2HF8A 2BIFA 4PR0A 5AWFC 1N6LA 1GP2A 2BBTA 1KDOA 2VF8A 2IYWA 5KNCA 3GJXC 3I73A 1OH7A 4NH0A 4WXPA 1XD8A 2ZRKA 4S35A 3FTQA 4UQOA 1RRCA 1KZGB 2ORWA 4H9GA 4C0HA 4P4TA 1UBEA 1U0LA 4JYBA 4QFMA 4FMBB 2F6RA 3QKSB 5G53C 2OV2A 1FQJA 2QT0A 2Y8EA 2ZJZA 2E1RA 3IQWA 3FOZA 4HZIA 2CCGA 3A4MA 1VIAA 2DWOA 3KFXA 5KPJA 2GZDA 1NIPA 5KU1A 1E2JA 5FR1A 1VG8A 2R62A 2FWRA 1E9AA 2XTZA 2W2XA 5FBVB 3B78A 1FPMA 2CCKA 1T5LA 4TYPA 4TYWA 3F5FA 4L16A 3P4XA 1S3SA 4O2LA 3GLIE 2ZI6A 2PX3A 1ZC3A 2BMDA 4PPNA 1ZM4A 2J0UB 4LYFA 5HE9A 2BM1A 1LW7A 1NI3A 3RAPR 4BFVA 4LBWA 4NCJA 4BZXA 4ZIRB 1A4RA 1SVSA 3WHLA 1CP2A 3F0TA 1NMXA 1ZAKA 1N0VC 3E5HA 2QL6A 1XDBA 4BFXA 1F48A 2ZXUA 1I2MA 4MYTA 3IBGA 2AFHE 4GL2A 2W2TA 1ZNXA 2REOA 2DYKA 1N6NA 1B23P 2ZRFA 2IYXA 3B1VA 1OLOA 2GDJA 2J0VA 2WAYA 3H84A 4TL9A 4FWTA 4LHXA 1V5WA 4LCBA 1DAKA 3AVXA 4BRUA 1H8ED 1KGDA 3BH7A 1HA3A 2HLDD 3QF7A 2W6ID 3LBNA 3EXAA 2WPDA 1W48A 3KJHA 4US1R 3UK6A 3HU3A 4C7OA 2OLKA 3X1ZA 2P0EA 1K5GA 2ZREA 3IEVA 4W5WA 5HKKA 3A8TA 4AY2A 2RGNA 5JS7A 3U44A 1E9DA 2QI9C 1CRQA 4B2PA 1EWQA 4UJ3A 2CLDX 2B8WA 2BKUA 4OK5A 4NZYA 1WBDA 1NKSA 3BB4A 5EP4A 2OCPA 3BS4A 1J2JA 3U2QA 5D3QA 2C5LA 1NN5A 3IPYA 4HI0E 3OZXA 4J0QA 2G9NA 3GEEA 3QPUA 3OF5A 2BDTA 3AB3A 3H0KA 3NHAA 3KUCA 5JJKA 1N5KA 1HEIA 2WWFA 2BC9A 2GILA 1MO5A 1DAFA 1MRNA 4EAQA 4ZO4A 4OHXA 2ODBA 3JVVA 4CEIA 2AK2A 2YVUA 5IHPA 2KJQA 2QTHA 3M1IA 1HE8B 2ZRIA 4DKXA 4JZKA 1OYWA 4D4JA 1DARA 2QMEA 3RRZA 2GF0A 3HR7A 4OQFA 2GNOA 3W6PA 1M1YE 3NIBA 3OAAA 1ZM9A 4RZXA 4UNSA 3G82C 2VP6A 2EU8A 1Q0UA 1P2SA 2FGKA 2ZI3A 1EFTA 4LGMA 2FX3A 5G3YA 1GITA 1KI6A 2H18A 3UIEA 4BE7B 3RHFA 2A5YB 2EFCB 2AWNA 2L0XA 3TR0A 3TH5A 4Q7MB 4H1VA 1OB5A 3QEOA 4OBEA 4LHWA 2FZLA 2RGNC 4PSVA 1UBGA 3BBPA 1XEFA 2VF7A 4URZR 3RRMA 5BYJA 2KE5A 5HE8A 621PA 4OQNA 1RC8A 1JALA 1KI4A 1HUQA 3MGCA 3GLHE 4MRPA 4DLTA 2O8BA 3LXXA 5DE3A 3L0SA 3EWAA 2VYFA 3T34A 3AVVA 2BVNA 4AKGA 1EFUA 2WICA 3ZVLA 4B32A 3CRQA 1XEWY 3KXIA 2C03A 2ZRDA 3DKPA 3PR1A 5BN3A 1BMFA 4KFUA 4PQYA 3GLGB 4OQLA 2PBRA 1MOZA 3NC0C 3B9PA 4Q9KA 4C0LA 2GKSA 1N5JA 1BIFA 1UDXA 4TTRA 3G0HA 1J8MF 2X77A 1LB1B 2X19A 2QM7A 2WBLC 3CB4A 2VHJA 4CEHB 3VKGA 4BPBA 5A5GA 1OFIA 5TXGA 2ZVPX 3KQKA 1US8B 3AV0B 1NBMD 4TLBA 2IWRA 3NEJA 2ZI4A 3I92A 5J4LA 1NLFA 1N6PA 1TL7C 4PPQA 1E0JA 3ONWA 3L2OB 2CHVA 3FKSA 2VRWA 2NO9A 4B75A 2FPMA 2GK7A 3K1JA 1MO3A 4DDVA 1WP9A 1A2KC 3L8ZA 1T0JB 2C96A 2JEOA 2WWXA 1F2UB 3SN6A 4ARZB 5KO2A 2O0KA 3E1SA 1FZQA 3OEED 3MG9A 1N3BA 3AKYA 4MRNA 4RKFA 3DOFA 3K9HA 4GNKA 4TZ6A 3HDTA 4G5RA 3R7WA 1XF9A 4KLZA 2X2FA 4MRSA 1S1MA 4NYIR 3U3OA 2A9KA 3AUYA 1ZU5A 3QI2A 1G3RA 4QKQA 5JWHA 2AX4A 4HLCA 3RS5A 1F3OA 3EASA 3QIAA 1WDTA 1T3SA 1N6OA 2D2FA 2V55B 3AF2A 3Q9LA 4RZ2A 5KOYA 4OK6A 4D25A 1EK0A 1P6XA 4EPTA 2V4ZA 5FTKA 1LF0A 4QHTA 1GOTA 4Q1EA 5JI3E 2PEZA 1NY6A 4C0QC 3EAQA 1OIWA 2ZSBA 3S1AA 2ERXA 5TARA 3IBYA 1HV8A 4Q1CA 3E2IA 4KFRA 5J5CA 4TYQA 1N0WA 3CWZA 4JVNA 2D7DA 2FZ4A 1N0UA 3RC8A 5KUTA 1G64A 4DSTA 1IN4A 5LB2A 4QHSA 4DHEA 4Q4JA 4ZV4A 2HV8A 2D3WA 3IDQA 2RHMA 3GFOA 5JWOA 1E2HA 2IEYA 2XZPA 2EFDB 1IOZA 1SULA 2W0SA 3RRNA 1YZTA 1LS6A 3THOA 2AXPA 3LVRE 1GM5A 1SVMA 2CVFA 3IIKA 1YZNA 4P3YA 2Q21A 1P72A 2D62A 5KHOC 4DT1A 5P21A 1XD9A 1RZ3A 1KDTA 4TLEA 2O8EA 1YR8A 1VCNA 3EIEA 2FFBA 1DBSA 2VHQA 5B57C 3VHLB 4F4JA 3ZDQA 2OILA 4WOPA 1N6IA 3AVOA 1WXQA 4JSYA 4D0LB 2JLSA 2O8FB 3LDAA 2H57A 1JJ7A 2A5GA 2R65A 5FPYA 4Q7KA 1X1RA 4KJZA 1OXUA 2F9LA 4OI1A 5ANRB 1BYIA 3GJ3A 3WHKA 1NN0A 1VHLA 3AGQA 3EW9A 4HAYA 1LFDB 1LTQA 3TAUA 4JT2A 4WIAA 2J0UA 4URWR 2H5EA 3ASZA 2ZR7A 3C16C 4B74A 2VQSA 3V4RA 1ZM7A 2VL7A 2QQ0A 5EJEA 1W0JD 1ZCBA 3PEUA 4B3DA 2DB3A 5AJYA 2O8CB 4R2HA 2DPXA 3T1VA 3WP0A 1R8SA 4RY2A 1JNYA 3F3YA 3NTUA 4LBVA 5FUVA 2BHRA 1OIVA 1U8YA 3V9PA 1KHTA 3UWKA 3T1OA 4BLRA 4OHVA 4RD0A 3T35A 3QUSA 2XNDA 1CXZA 4JJKA 2QGZA 2EWVA 5J4KA 4PO1A 2XSZD 821PA 1NVXQ 2FSHA 3IO3A 1CR4A 2W58A 4FCVA 3KB1A 1A1VA 8OHMA 3T5GA 4UNPA 1ZVQA 1OSNA 3AKDA 1M6NA 3SQWA 3VR6A 1UAAA 4LSGA 4RZ3A 2IHBA 2I1QA 4ZCLA 2OUKA 3TSOA 1G3IA 1GRQA 2ZQ5A 4V02A 2G1JA 2ZTSA 4F4CA 3FMIA 1G7CA 1EFRA 2GCNA 3A4LA 2ZSEA 4ESHA 3ADCA 1PLJA 5DN6D 4FW9A 3QXHA 1MV5A 4QL3A 2OAQ1 3ZS9A 1N6HA 1S3GA 4TT3D 5CITA 1IONA 1S96A 2NQ2C 4KCGA 4ASUD 3KQUA 1UKYA 2QMOA 3IILA 1G4AE 2H7VA 2YHSA 1P7CA 1G291 1R8QA 4NYMQ 4JLAA 4HAWA 1G7SA 1UF9A 2IYQA 3BFVA 5HCNA 2QP4A 1ZD9A 3H86A 3TVTA 1Z0AA 2ZS9A 5IK2A 1OFTA 3KZ1E 2RCNA 2GEVA 3RVBA 4Z8XA 1GKYA 5LBIA 1IQPA 4UXIA 1Z63A 2OXRA 1BKDR 1ZYUA 4DXAA 1DO2A 3OEHA 3KQHA 2IA5A 5BQ5A 2J59A 5BXQC 4ZDKA 2V1UA 1P9RA 4M9SA 1DELA 4LJ4A 1E2IA 4P4UA 2AD1A 4NL4H 3MMPA 5JEDA 4DCVA 5FUYA 4HZUA 1EWRA 3O47A 3B13B 2Q0HA 3MWLA 4TMZA 5EP2A 1HQCA 2JIZA 2VSXA 4HLDA 1P9NA 4MGIR 4YLGA 2ZYVX 2VHUA 3KL4A 3WNBA 4D0GA 2BEKA 4MDEA 2P3SA 5AJVB 2JJ8A 4US0R 2ZU6A 4EUNA 3ICQB 3HPQA 1Z5ZA 1VYVA 4EPRA 4C0AC 1MH1A 1NG1A 3B1WA 4CDGA 5GJBA 2W0MA 5LD2B 1OH8A 4ZKDA 2VSFA 3B6EA 4PHFA 4TWZA 1P4SA 5FI0B 1K5DA 3U3RA 4D6PA 3KX2A 5K8UA 2WWHA 4XWOA 4AKEA 4TSFA 5BYKA 4FWIB 1AZTA 3RS4A 2OG2A 5FH9A 3AF1A 1GILA 2F43B 1TEXA 3U7FB 1C4OA 2QBYB 3VNUA 1K6MA 1G18A 3KTAB 6Q21A 4QM7A 2YV5A 2ZI7A 2OSBA 2D4HA 2HCBA 2IXFA 3AVPA 4HAXA 4Q66C 5FBWB 2IUUA 4A82A 4QOSA 3X1YA 4DLZA 3HPRA 4EPVA 1GL9B 5FL7D 1DVRA 2G0NA 4IOKA 1QHXA 4V03A 3SHFA 2YYZA 4LHZA 1XTKA 3W8NA 3X1XA 5BW8A 3QNUA 1WQ1R 4ZI3A 1W5SA 3LLUA 4K46A 1AM4D 4C9BA 1II0A 4XIGS 5CB8A 4A92A 1VCIA 1AZSC 1QG2A 4KBGA 1AGRA 1XFAA 4YMVA 3REFA 1KMHB 1G3UA 3L0OA 3LX8A 1CULC 4MKGA 4DC9A 1DTSA 1Z6YA 3GLFB 2WSMA 1E2KA 1AA9A 2XTNA 4QJ5A 2ZPTX 3A1TA 3NBZC 4XWKA 4ARZA 3FVQA 1F2UA 5L3SB 2P6RA 1P62B 1SXJA 2FF7A 2FN4A 2O0JA 4NCIA 2P6UA 1EFHA 1OJLA 4UXHA 5JCPA 3TUZC 2DHRA 1YU9A 4FMCB 1JB1A 2OCYC 4Q1AA 4BUJA 1F2TB 3C7KA 3GQBA 5C1BA 2CJWB 3Q85A 4NU0A 1NRJB 4QNMA 5EZ5A 4BGDA 1KKLA 1KYIA 1KAGA 2DFLA 3K0FA 4DB4A 2Q3MA 1NSFA 2GJKA 4TQUS 121PA 2E87A 3K9LA 4KODA 1SHKA 1M7BA 2JLUA 1YZUA 4DIEA 3QXCA 1CJUC 1E2EA 1MABA 1P9WA 1ZM3A 1U8AA 4B3FX 3IUYA 1UEIA 4P33A 3IO5A 2D7CA 4GRAA 2EYUA 4A2WA 1L4YA 3OFND 5K8IA 1XCPA 2NO0A 1UBCA 4C3ZA 1E4VA 3THXA 1NJGA 3UANA 1HH4A 1GL7A 4HYYA 2EYQA 4DLUA 4B6EA 4AKIA 3A36A 5C4MA 2IK8A 3PXGA 2CXXA 1Q1ZA 4D4KA 3TW4A 2QGNA 3QBVA 3SU8A 2ONJA 4MKIA 1SXJE 3B5JA 3SJBA 2F7SA 1Z22A 1J8YF 3VFDA 2ZRPA 5L8VA 1W46A 2OBNA 3L82B 1G5PA 3LW7A 4GMDA 4M4SA 4XTRA 3DVLA 3EPJA 4F38A 3H4MA 2JLWA 1IM2A 1KDPA 1XTJA 2FNAA 4V0MA 3ZQJA 4AYWA 3RS2A 2XB4A 1XTQA 2I3BA 4Q7JB 5K8LA 2BCGY 1T5IA 5EXSA 4URVR 4CF7A 5C4GB 1E79D 2EW1A 1VG9B 3EIQA 3JZAA 1RVDA 4XH9B 5DIFA 2JA1A 1OFHA 2O8FA 4L9SA 1Q20A 5IF9A 4B35A 3ETLA 2XOKA 4NTZA 1I2DA 2YOHA 4D4MA 1E1QA 1RJ9A 4JVSB 3LH5A 4R71A 2QRNA 2IX3A 2XAUA 1D2NA 1D9XA 1ZNYA 3DKVA 3QOFA 5TV2A 3LW8A 2CE7A 5AUOB 2FFHA 3NDPA 1VHTA 3GCGA 3TQCA 4BFTA 3ZD6A 3SOPA 2QAGC 1D2MA 5DNYB 4DCNA 2J0QA 2CBZA 5CJ2A 5IDVA 1ETUA 1JQLB 4GMXA 2QMHA 3TVDA 4NHOA 2O8CA 1L4UA 2CL6X 2J9RA 3QG5A 1YR6A 1HT2E 3PEVA 3I61A 3PUYA 1TQ4A 3UMFA 4OYHA 3DZ8A 1OKKA 1JR3A 4C2TA 3B1XA 2W6JA 4NCHA 3CRW1 4LY6A 3ZVRA 2E9SA 2CCJA 1HQYE 1VG1A 1AIPA 1W2GA 1Z0KA 1I4LD 3MJRA 4HLUA 3SFVA 4G5OA 2QNRA 1OHHA 4KI0A 4MUAA 1IHUA 3CONA 4KU4A 4V0ME 4YXWD 5GJCA 3PEWA 5J40A 4URXR 2B92A 5TDHA 3SEAA 4DUGA 2ZRJA 2MMCA 4KVAA 4MRVA 4DWJA 4PC1A 2HXYA 2C04A 2J7PA 3LAWA 4Q1DA 3U5ZB 2OBLA 1E0SA 4PC6A 4PX9A 3CF6R 1X86B 4KLNA 1CKEA 2P2LA 4GOJA 3UG7A 4CEJA 1E2MA 2GJ9A 3KXKA 4TLDA 1R2QA 2GVZC 4LJ5A 1W1WA 1ELOA 2QAJA 3KJGA 1ZP6A 3TUJC 1XU4A 4TL6A 1UADA 3FDIA 3K8YA 4IVQA 1COWD 3OHMA 1KI3A 4I1VA 3CZPA 3PITA 2C98A 2TMKA 2QRZA 3UKDA 2ZSDA 1WB9A 2CL0X 4M2LA 5H68A 3ZIAD 4KBFA 2PJZA 2QTFA 2R9VA 2VP2A 4Q4AB 1TNDA 3PIRA 3PFIA 4RD3A 4W7SA 1YKSA 2YWHA 4E22A 3SE0A 4MGZR 1AK2A 4A36A 3TQFA 3CIOA 1XXHB 1VTKA 4Q5IA 1SVWA 2Q9BA 3QENA 4IXMA 2LWIA 4G01B 1NLYA 1OXXK 1W4CA 2R6DA 2IC5A 4O2RA 4HUQB 3WYGA 1TQDA 4JLPA 1U9IC 2OFXA 4G1UC 3T1TA 2JCSA 4JJZA 3LXRA 1NBME 3C14C 1N5LA 1X6VA 1HE1C 4AI6A 4WW0A 2HF9A 2G6BA 2H16A 3K0EA 4KFSA 2BM0A 1WCV1 3SHWA 3A1VA 2J41A 3L43A 1VECA 1GRNA 1C1YA 4TL8A 5G41A 1NLZA 2DWPA 2ZR0A 5FUXA 1SVKA 4LV6A 4NYJQ 4OQXA 2QA5A 2V3CC 1OPXA 1RKBA 1KK0A 5JJIA 2Q6TA 3FHTA 3EZ6A 1KI7A 4A1FA 2KBEA 2V7QD 2NMVA 1QVRA 1P2VA 3NXSA 4B43A 5CK4A 2F43A 2QBYA 2JDID 3T5DA 4CT5A 2AD5A 3KTAA 5EE0A 3TJZA 4YMTA 1SQ5A 4JLKA 3IPXA 3ECCA 3WRYC 3FMOB 1G6HA 1LVGA 3AF3A 1VYUA 4LJ7A 3O8CA 1KO7A 2YOFA 4RSGA 4B3XA 1IN5A 3MSXA 4R7ZA 2ZAOA 4PZYA 4V0OA 1ZC4A 4Z1MD 1O3YA 2DY1A 2ZRHA 4B76A 1IJEA 2IWHA 2WSSD 3HYRA 3ZZUA 1GFIA 4A0FA 4BFSA 2N46A 1Y63A 1WBBA 3MWYW 3U7GA 4LYJA 4TMKA 2P5TB 3GLFA 2IYTA 4I1OA 1M34E 3MWKA 1GTVA 1IAQA 2IYZA 3HJNA 5JCZA 4BQSA 5L3SA 3PUXA 3UPUA 2QE7A 3CPEA 4QRHA 5DI3B 3RS3A 4AURA 3ZVMA 4CT4B 4M1SA 1G5RA 2FGJA 2CK3D 1KSGA 2QU8A 1YVDA 3RLFA 4JIMA 4PHGA 1F2TA 4TN1A 2XSZA 5F3WB 4NE2A 2C77A 2OO7A 4Q1FA 2RGBA 5FL3A 1AN0A 3BJIC 3D8BA 4EPXA 2Q3HA 3WYAA 2ZJOA 2VBCA 3FE2A 3BAFA 3GLHA 3P1JA 1U98A 4QC2A 4TLCA 2UKDA 3CNLA 2WM9B 2ZJBA 2B8TA 2JASA 2HT6A 1D9ZA 4IFEA 4M9ZA 3I32A 1KI9A 4YDSA 4E07A 1CS4C 1YE8A 1UBFA 3KKQA 1ANKA 4UJ5A 1ZCAA 1X1SA 2DCUA 2NZJA 1EG7A 2GCPA 4A8JB 1KSJA 4TMXA 1RE0A 5BN5A 2JLZA 4F91B 3TBKA 4JLJA 4XTCS 2ZJ8A 2JLVA 1UJ2A 3OE7A 5BWMA 2N1BA 2NO7A 4V0LA 2HXSA 4U7DA 3RYTC 3C4JA 5FBQB 3LQRA 1W0KD 5J4HA 3GEIA 3MJHA 3GLFE 5CB6A 1G41A 3AGPA 4I4LA 4IEIA 4PHTA 5B30A 4RFSB 4N0DA 5CM9C 1UEJA 4JKIA 1Z07A 1FNNA 1KK2A 2QTVB 5HCIA 2ODWA 5E7IA 4EDHA 2XGJA 2QSYA 3FGNA 4PPGA 5JRJA 4EFNA 1E9CA 2AFIE 1F6BA 3BH6A 1KNXA 3WMGA 3LNCA 4FCWA 1Q22A 4Z51A 4QJ3A 4W9MC 3LA6A 2CEAA 1FTSA 4P0TA 1G8FA 4HAUA 2YZ2A 4PQRA 4TMWA 2JJ2D 4JSTA 1S9HA 4A2PA 1GNQA 1KMQA 5AJZA 4C30A 4B3CA 2C78A 3K70C 4Q9IA 1KIMA 1Z8FA 2JLXA 1DEKA 1YZGA 3CUEF 1AGPA 1FFHA 2P5SA 4L5BA 3WXMA 5LPNA 5FPTA 2BJVA 3EA5A 3I72A 1SVIA 3U6BA 1SZPA 2ZE5A 3EPLA 4Q02A 1DS6A 3IEUA 4A6XA 5AR1A 4DLWA 2V6JA 1W44A 2F1HA 1OFUX 2BMJA 2FG5A 2ZANA 4B33A 5AUQA 1TU3A 3IHLA 1XMVA 1QHGA 4BEJA 3HU2A 4I1UA 4NYMR 2ZJ5A 3L0IB 5FOTA 3Q7PA 1DAMA 3TW8B 1XPOA 4DIDA 4M8NE 5E7MA 4GZMA 3WNDA 3QF4B 3RANA 3NDBB 4QGAA 5F98A 3PUZA 4JLNA 2ODNA 3OIVA 1WF3A 1Q44A 2ZRNA 4LHVA 1VMAA 2IYSA 4ZDWA 5L3QA 2XB2A 2PL3A 2FPLA 3B1YA 2CNWD 3LX5A 1EGAA 2ATXA 3AQ4A 3PJRA 1GNPA 2ZAMA 4KHZA 4EFMA 3AEZA 1A2BA 3DOEA 4GOXA 1W36C 1FTNA 4W5HA 5CIWA 3CR8A 1R0YA 4JLMA 2C99A 5B2ZA 1GZSA 4A15A 1TUIA 1TF5A 3KUDA 2ZS7A 1TAGA 4OI4A 4P4SB 3FMPB 5F2EA 4BFYA 4TMTA 2CL7X 4QBFA 3ADBA 2WKQA 2AKAB 1Q3TA 3K0AA 4FN5A 3JZMA 2IYLD 1TMKA 3ND9A 3PENA 4DJTA 1Z6TA 2FE4A 2XXAB 4AG5A 1RRGA 4TL7A 2YNMA 4A2QA 1BO6A 3ICEA 1G8GA 2P65A 2PEYA 1W2HA 1MO4A 4GFDA 1QHYA 1JAIA 3CF2A 3THYB 2Z83A 3MAAC 4ZDJA 3KKNA 4DLVA 3FFBA 3AP3A 2OCBA 2XJ4A 4PC7A 4KXFB 5HZHA 3I8SA 4H1UA 2HDNB 4V0KA 4M53A 3ADKA 1VKJA 3BH0A 1UKVY 4ZCIA 4HUQA 4RCZA 2FSIA 4MDFA 1ODFA 4PZLA 3BOSA 1U0HC 1CJMA 1VYTA 3QKSA 4JT4A 5JMTA 3I62A 3REGA 4XSHA 1H8HA 5FBRB 1TPZA 1E2PA 2JJ1A 3ZD7A 3CX6A 1ONBA 4TMVA 2VA8A 2IUTA 1Z08A 4IOLA 1ZM2A 4D4LA 3BFKA 1XEXB 3CZQA 5DYGA 4B3GA 1KI1A 1NJFA 3CM0A 4B34A 2ZYUX 1OXSC 3CRMA 3R9IA 3TSWA 3U4QB 4L8GA 1CR2A 3BK7A 4Y0AA 3VKWA 1G1MA 1L8QA 5JBQA 1ZD1A 4MQBA 4Q18A 2FMXA 3L0PA 1OH5A 3TSZA 1JR6A 5J4YA 4ACAA 2PCJA 5K8TA 2VP4A 5FOUA 3VX3A 2W2VA 1CIPA 4C0JA 1Z28A 1GDDA 3U7HB 4RCYA 2GXSA 4ZIRA 3A4NA 1XMJA 3VR4A 3EX7C 2HEIA 4URYR 3QKRB 3D31A 1Q21A 2V54A 5EQTA 5JWRA 1NP6A 3M6AA 3BFXA 4HB0A 4N1AA 3GEHA 4QM6A 1HYQA 4BZPA 4B2LA 5GJVC 4OI2A 2XTMA 1IY0A 1MR3F 4FMDF 2IYYA 2IS1A 4FCTA 5FOSA 3UATA 4EJSB 1Z06A 5KSOA 1N2CE 3W3AA 3GP8A 1RIFA 4WA7A 2O0HA 1NN3A 5D3MB 1E2QA 2NPFA 4C4PA 3T15A 1YRAA 3TNFA 3DMDA 5H8WA 1ZW6A 1NMZA 4XJXA 2QENA 2XITA 3P27A 5DH9A 4NKRA 4XSGA 2YWEA 4OHZA 2HJGA 3DHWC 4UXJA 2YOGA 4B3BA 4HUTA 2WPDD 1TU4A 4IW3B 2ZS8A 3KJEA 4JLVA 1KI8A 3OIYA 4TTPA 4RZUA 1CEEA 3QBTA 2Q3FA 4XD7A 5HKKD 1R0XA 2IYVA 3IHWA 1ZUHA 2EQBA 2EVWX 4XVQA 3THWB 1E1RA 2EWWA 3FB4A 2O8DB 1XD2B 2WVJA 3RSLA 1U94A 4C0BA 2GXAA 3B85A 2GF9A 1G16A 2GWHA 2O52A 4PANA 3K70D 2WIBA 3C15C 4ZCMA 2PLFA 1F60A 1Z6GA 5E4FA 3Q8XB 3WRXC 3W9YA 3C41J 2ZUCA 3BB1A 2IF2A 2WJVA 2F9MA 5FPSA 4FXPA 3VNVA 2F1IA 1YRBA 2VHCA 3VTKA 2WZQA 2BKEA 2WOJA 2ZYWX 4BZQA 3B7GA 3TE6A 2GBLA 1TQ6A 4YDHB 5DYIA 1H65A 3UXMA 3CBQA 4Q03A 2R44A 1N25A 3AKCA 3GLIB 2R2AA 1ZUNB 3OAAD 3TMKA 3ZH9B 2YWGA 5DHFA 4KYUA 1T9HA 4OI0A 1G9XA 2J3EA 2W83A 3MFYA 5FTLA 2R6FA 2WWWA 4AIIA 1E9EA 1PUJA 5DO9A 3SDZA 5E7JA 1OT3A 4BFZA 1XJ0A 2BMFA 1OB2A 4R98A 1HY3A 2BEJA 4K8OA 5DSZA 3SYKA 3BORA 3TRFA 4LYHA 5FOXA 2FPKA 4M1YA 3EG5A 5B58C 4QJ4A 2ZRMA 2FA9A 3A37A 3T06B 3BE4A 1N5IA 3RS0A 4HDOB 2C9OA 4RJLA 3LY5A 2R6GA 5G3ZA 1Z3IX 1G6OA 4LX0A 4TZ0A 1G3MA 1JECA 1Q1BA 4PSKA 5FTNA 2WWYA 3GLGA 221PA 3FMFA 2KI5A 2IW3A 1BMFD 2Z4SA 3V00A 3KFVA 1CRPA 1XTRA 3W90A 2NZ8A 4MH0R 4U5XA 1X8LA 2ZJAA 3BC1A 4PAOA 5KDLA 4PO8A 4CEHA 4EPYA 3R8CA 4M0LA 2JLQA 4M1WA 1JPJA 2V7QA 2REBA 2IHYA 1FUKA 4B6FA 5JI2E 2ZRGA 1US8A 4PZZA 4RVCA 4EQ6B 4FMCF 3PEYA 4MGYR 4PQFA 5FOVA 3KKPA 5GADl 3KB2A 5DI9A 4DZZA 4GT1A 3FKSD 4NONA 3O8RA 4DDTA 3HYTA 4DEYA 1DAHA 4BEBA 2YWFA 5DGXA 5FTJA 2AN9A 1GG2A 4II7A 2HYIC 2ZU0C 3K09A 1X3SA 1R5BA 5KSYA 3CPHA 4KFTA 3M0EA 2UZIR 4MKHA 1G20E 3W8RA 4DLYA 1G3QA 1A7JA 5E3HA 1GIAA 3T12A 4JBWA 1S9DA 1H8EA 3VR2A 3PV0A 2NO6A 2HLDA 5TY0A 2ZUDA 2W6IA 3GLGE 1XEWX 4LHYA 3SS8A 2FOLA 3CX7A 3A58B 3KKMA 3AP1A 3KDSE 2PX0A 4HEJA 3D7MA 3Q3JB 4I81A 1KKMA 5EXPA 5FI1B 4C7OB 1ZJ6A 1KJZA 2I1VB 4US2R 4DBLC 3E70C 3OIWA 2BBWA 4BFUA 3U44B 3WMFA 4NYJR 5JECA 1YHNA 1VCMA 2DR3A 2XZLA 5DLQC 1T3LA 2ZE7A 3B9QA 3WYFA 2CMKA 1YZQA 3Q5EA 1B0UA 4G3XA 3QPWA 4Q01A 2XXAA 3R8FA 5CJPA 3RABA 3I5XA 5SZHB 1KO8A 2QQEA 2GAOA 2RKOA 2V6IA 3OESA 4JMPA 5EUMA 2AK3A 3VMFA 1AS2A 4B47A 4HB2A 1NSTA 3F8TA 5GVRA 3SBEA 5EE9A 3THYA 4RD6A 1I4TD 2FEMA 4WBSA 5TMPA 2CLSA 4DDWA 2CVHA 2ODEA 5HZKA 2CHGA 721PA 4GZLA 1BOFA 3ADDA 4IDNA 4DCSA 1KZ7B 2A7QA 2ORVA 3B60A 1YQTA 4HAZA 1SXJC 4DEXA 4DDUA 4CEIB 2VPPA 1QHNA 3ASYA 1FX0B 4N0EA 4KSBA 2RHDA 1QHIA 1R6BX 4LC0A 3B2EA 3FPAA 3RNLA 1XEXA 2FV8A 2QMUA 5C18A 1E0AA 4JS0A 1OE0A 4Q19A 4MYUA 1G4UR 3ZJYA 3LO5A 2KBFA 3SC3A 2BJWA 5JFGA 5KDDA 4D82A 4CRWB 4WAUA 1GKUB 3CX8A 1S0UA 1XX6A 4RD2A 5KSZA 2G83A 1SVLA 1UFQA 4BRWA 3KKOA
chains in the Genus database with same CATH superfamily
3Q3CA 1KJWA 4X8LA 2IIPA 5JAIA 3HKCA 4DXDA 3QA3E 4LXUA 3ED1A 3PDJA 5FOQA 4GKVA 2VNSA 4JGBA 3AP2A 4MCHA 1YRLA 4HSEA 2WAXA 1KBQA 1VRCA 4GKBA 4CHGA 2QN2A 1KY3A 2NN3C 2UZ0A 4CKWA 3AERB 3AF6A 4Z4EA 5FTWA 4C88A 4KI7A 4CKEB 1U8ZA 2OEPA 4R1QA 1MNQA 4IDGA 4WLUA 2JI4A 3L0CA 4DXHA 4BQNA 4WL0A 3HBAA 3IOBA 3EUEA 1MW9X 1YTLA 3LQKA 2QVZX 4M9QA 3CISA 5TE9A 3ZEAA 4EH1A 1QRTA 2ATCA 2Q9UA 3TFWA 3VPBA 4WZAA 1H1LB 3CC8A 4NP6A 1AA6A 1EB8A 2Z2KA 4PLFA 3WMEA 2OUIA 5C37A 5BUCA 2VOJA 1NMYA 1JKXA 2UVQA 3DDZX 3EARA 2WKPA 4F12A 1PGJA 4UOQA 2W4QA 1HMYA 1BEUB 4CUKA 1DV1A 1EFRD 3AEUA 1R7RA 2TYSB 5E4YA 3AUKA 1XZPA 5AI8A 3LCRA 1YR1A 4AT1A 4QLAA 3PGA1 2NNWB 1I2AA 1VOTA 1JXQA 4BN0A 3V97A 1HC7A 3KXLA 1UBMS 3ORFA 4GDMA 2ASVA 4JLDA 2HT1A 5LWQA 2OB1A 4DNOA 3WOVA 2IS6A 3B6KA 3IBTA 3DE2X 3P19A 5L40A 4HVCA 4RM2A 4MYRA 2H7CA 3KR1A 4DGSA 2X9QA 5ALNA 3BERA 3AM5A 4FOTA 4JHLA 4DSOA 3ZDXB 3I01M 4EJMA 3CJQA 5HKOA 3DTNA 2FJPA 2ZYRA 4NF2A 3D3EA 1TFRA 1WW2A 4E51A 2WMNB 1GZVA 1VHDA 1IOWA 5AP9A 3BL8A 2DPMA 3E5MA 4G0NA 4DR4B 3BXXA 4INPA 2YXEA 3OEHD 4A27A 4BXOA 3S2FA 2WFLA 5KYUA 4AUEA 1RXWA 4LGVA 1LNQA 2X5OA 1IM5A 4LWOA 4RL4A 4B81A 3ZGXA 2VA9A 4KACA 4EKNB 5CEFA 1IEVA 4WZAE 5KOJB 2P4UA 2XA2A 3AIOA 2WIKA 1XA3A 5F9MA 5AYVA 1JHZA 1Z83A 4ZYXA 1M7HA 2VJBA 3BMCA 3S2YA 2QD4A 1YZKA 1DV2A 4O1HA 1B8VA 1WRBA 3EZ2A 4XYGA 5AJXA 4IO0A 3ZCRA 4JI5B 4H35A 5CLQA 5KNDH 3SZ3A 4JVLA 3TWOA 1MIOA 1S8NA 2Q5IA 4AG6A 1GYRA 3DQPA 1AKWA 1QDEA 3LP6A 2ZBFA 2ZLBA 4X1IB 5FBLB 2GAIA 3DAOA 1AB5A 2RHBA 2VKTA 2X76A 4QQFA 2OBBA 1I4DD 3NETA 1JB9A 1JJAA 4KPUA 1WOYA 4Z3KA 3SZOA 4S1TA 3RIHA 3HCRA 2ZT5A 4DB2A 2GM4A 2X0EA 2V1XA 1IZ0A 2UZ1B 1L5NA 5DN9A 2GEUA 1WHSB 3R5HA 2X3YA 5B64A 1FFXA 1Z2CA 5SY9A 3EEOA 4JMLA 2X8JB 1YA4A 3C1UA 4BNZA 2OTCA 1GTRA 8MHTA 2FEPA 4AF8A 4DNQA 1ORRA 1U6IA 4ZOCA 3NG1A 5CH5A 4LE0A 3ROKA 2Z0MA 4Z0NA 1EGQA 2P90A 1X42A 5K3SA 1JR2A 4EW2A 2B3DA 3R3JA 3RASA 5BSWA 3M9XA 1DBQA 5JCPA 1IQRA 2GRAA 3GPLA 3QBDA 1M1UA 4I5EA 4IIDA 5DM1A 1JWLA 1THTA 2P1ZA 2F1JA 3JALA 4DREA 4Q1VA 4UKDA 2GRUA 3B6IA 4TZTA 3EZLA 3UFXB 4EQ6A 4P86A 3IUQA 2NZ2A 1E69A 3K4QA 3KTOA 4J07A 1GPUA 4BVEA 4L9RA 4HEHA 1C80A 1CY7A 1NOJA 3WMXA 3UFBA 1E20A 1ZBDA 3B53X 1FFYA 2R3SA 3NATA 3OI7A 3SHTA 3OQBA 3T4EA 2Z30A 3WAJA 4IOMA 1U8XX 4XJVA 5T3UA 1Q12A 3AXSA 3VA7A 4P31A 3JYPA 1UR5A 4KIJA 3AOGA 5CXQA 4HLQB 1QDUA 2JCXA 2C3PA 2XQKA 1H2YA 3K16A 3O83A 4FX2A 1CZLA 4GYWA 4QRDA 1R0LA 2P3LA 4JH0A 5JISA 1VKRA 3CKLA 4ZVQA 3EOZA 1PU2A 2CJWA 5I9IA 1P1CA 4KMOA 4F06A 4FKBA 4FZJA 1MJ5A 1C3EA 3KR9A 2UUCB 1C4KA 4HATA 1QPGA 5HOQA 2A78A 3EXHA 2VWQA 5CFOA 4IV5A 4W5NA 3AV3A 1XRMA 1IXSB 4R9VA 1D1TA 1KS9A 2GZSA 1PJBA 1ACMA 2CJXA 4CMKA 1MT0A 3AU8A 4K03A 4EF6A 4G85A 2GQ0A 5DN6A 3HVUA 3EPHA 1LA2A 5I7SA 4ACBA 1Y4SA 3Q6IA 3O7MA 4O0MA 4Q0MA 1KEUA 1DOAA 1U2DA 4ASUA 3GFVA 3OF2A 4B2IA 1Z2AA 4N3CA 2D13A 3OPMA 5GINE 1LLQA 3UWDA 1DI0A 2HW8A 2DQYA 1JIQA 5DEOA 5A4JA 2W2MA 3DR5A 1I13A 1DEAA 1LDNA 1N9ZA 1UDWA 3BFPA 5DFAA 1RDFA 3MHPA 4N3NA 1B3RA 1ZH2A 1JBKA 2HPHA 3RGWS 3ETHA 4JLUA 3WQRA 3ZQ6A 1CRLA 4DANA 2DU8A 1H2WA 1WDKA 4YAGA 5THKA 3F8SA 2XEXA 4EI2A 2R4QA 3KOMA 2PKQO 2QT1A 2CZGA 1RJDA 2GA8A 2YWDA 5LB4A 3P0FA 4I50F 3HLYA 1FX0A 4D98A 3T54A 2HKIA 3HBLA 2ONKA 4DCGA 2R7LA 3QITA 4E5KA 1SQGA 1MO2A 1GNRA 3IP9A 2VPWA 1FE8A 1IBKB 1ORIA 1JQEA 2AZTA 4KWEA 1L4LA 3LFTA 4R6XA 5BSKA 3VC1A 4N76A 4L9WA 3UB3A 4DSUA 3DCJA 1RRMA 1Z75A 3CVJA 3LECA 4JLBA 1D5WA 3EXEB 1U7UA 5IT9A 4BGVA 2QEQA 3VH3A 1GV0A 3GZ4A 3LF2A 1HFKA 5KOHB 1U6KA 1TVKA 4L7VA 2ZYHA 5JCJD 5TB5A 2RJ3A 4ON9A 2JIBA 3NCTA 4MPDA 5JO9A 2PWZA 1C9NA 3KELA 3IOYA 5A9SA 1FEZA 2JARA 3MINB 3GZTB 4NBKA 4GZ5A 4P84A 4A0QA 2YKGA 3N28A 3E4DA 4AY6A 2ZZNA 3L4EA 5IBPA 1DAIA 2ECOA 4H77A 4F93B 3QXGA 2JEZA 1XJ5A 5KTKA 2Z5GA 3V4OA 2EP5A 1RHJA 1ZRSA 1J2RA 1ZINA 5ALFA 3GGDA 4OCZA 1YA6A 4KPYA 1U3DA 2WFAA 3KJZA 4OQZA 3WGNA 4LGYA 4QUBA 3A3PA 3FFXA 4CCAA 5C3UA 2J8ZA 1PL6A 4TLMB 5BV2P 1QQBA 2HHCA 3AUFA 1XYGA 3RIYA 2G4VA 3AERA 3CT6A 3N5KA 1OIXA 2XVZA 3NDIA 2Z8YM 1KJNA 1PNQA 2QPAA 4YCBA 4ZZ2A 4S05A 1K3FA 1NQTA 1L0BA 2PL5A 2V74B 2W6JD 4BVHA 1E58A 3A6ZA 4Z54A 2XPCA 2JZNA 3MT7A 1TXGA 1U28A 1UJNA 2QMZA 1V8BA 5JRZA 1PR0A 3F6SA 1SEPA 4WWHA 1IY1A 2ZITA 4BNWA 3GVPA 1H1LA 2BBSA 1DFHA 3EEIA 4IQFA 3QVXA 2G08A 1UM8A 1U2GC 1RRPA 1Q0RA 1JFFB 1LS1A 2FFAA 3F47A 3QPVA 4DUGD 2GASA 4ZVPA 3EFEA 3QK7A 1PVOA 1FVHA 1TM3E 3P97A 4Q39A 4DPKA 1GO2A 1KAHA 1XALA 1RTKA 3QMVA 4ZAVA 4QU8A 3G9XA 2B4KA 4MIKA 3FCSB 3R0VA 3MERA 1RQ2A 3VZQA 4BASA 5LL6P 1BG6A 2BWJA 3LWDA 1NR5A 1HYBA 1F51E 4HV4A 2OZKA 2QP9X 3NPAA 1G55A 2OCLA 3R0ZA 3NEYA 1RFLA 4IM7A 3R7BA 3KEMA 3ZE9A 4XR9A 2I91A 2QY9A 2PS0A 3TMYA 5LQNA 4MR9B 3IIMA 4U9IS 4QBKA 2IYRA 3IERA 2FSSA 4WOKA 4X1KB 3RUFA 2ERYA 4ZWNA 1XNQB 4D9MA 1J9EA 2GCOB 2PXXA 1U3TA 3VJKA 1LEHA 2JGIA 2YHIB 4WCVA 3MCVA 2IYFA 5JTUA 1JEJA 4ZKEA 6AT1A 1LSJA 3FMGA 2VWPA 2XA1A 3I5MA 3NWEA 1GEGA 1T4CB 4JYCA 4Y9UA 1REQB 3QTBA 1P5JA 2H29A 3H5OA 1FMFA 1XLUA 1ZK0A 1I4EB 2HADA 3IUMA 3H0EA 2X40A 4RPGA 3WC4A 3ZTTA 5CNJA 4U2FA 5HIKA 2IEZA 1OXVA 1SCAA 3IAFA 4UBKA 2B7CA 3T3GA 2QZZA 4UHEA 1C1XA 4B48A 2VK8A 4AN4A 3OFNA 3K0BA 5DDIP 2QAGB 2AN3A 1QG4A 4ZARA 5KEIA 5KTYA 5CK5A 4HC4A 4N7JA 5U9CA 1SCNE 2FPGA 3THXB 2IGBA 2IXEA 3RJZA 4O4LA 1O6ZA 1II8B 2QYSA 2F9FA 1ZVJA 2JW5A 2QPLA 3GJTA 3M6UA 4MVJE 4LFBB 3EC2A 5ER6A 2I7VA 4MX8A 3NHRA 3Q8LA 2JFFA 4MQ4A 3Q9UA 1ZSYA 1KO5A 4BV8A 3IVGA 2OHFA 2FWBA 1WSAA 2V4UA 2R96A 3TQQA 1VKNA 4IF6A 3CINA 1YB6A 1CHNA 3QE4A 3SI7A 1Q5PA 3S8MA 5K3EA 2I29A 4P93A 2DBYA 4BECA 1HURA 3R3ZA 2JL1A 1XJQA 3F49S 2UZ1A 3OC0A 4BO9A 2RGEA 1PS8A 4I46A 5B7GA 4RVFA 3GJ7A 2HCFA 3IVXA 4ZZ3A 1SBZA 2XWJI 1RKXA 3DM5A 4RVHA 4C7KA 3CLSC 1Z68A 2OD2A 4QSHA 4ZVLA 3N70A 4IHQA 2HSGA 2WMOB 4YVFA 2X9VA 4TXLA 2YNMC 3RYHB 3VYVA 3CW8X 4UDNA 1FP6A 1IBRA 1UDCA 1J8VA 1IWPB 1F8UA 1G6Q1 2QHXA 1JU3A 3LPMA 3BD9A 4UQLA 2OZLB 4GWGA 1PVDA 5DHTA 10MHA 3KEGA 1HX7A 4X8OA 5JD4A 3RUPA 2GN9A 1SPXA 1PG0A 3IP7A 4X24A 1VMEA 1MOPA 3PG5A 2AEEA 3RVPA 5HIJA 2QYTA 2NADA 3H9EO 4IKEA 1XZKA 2COKA 2YWCA 3EZ9A 1PWYE 5LLSA 2F8MA 5ESXA 3L7KA 4GP7A 1FC0A 2ANCA 3ZGVA 1YCFA 3T9BA 4C76A 3HR8A 3OE4A 4Q3AA 2QVGA 5KNDA 3EBOA 4RS4A 3L4KA 5JADA 2AQKA 2WIAA 5COBA 5DI3A 1N4DA 2QE7D 3MZ0A 2YJTD 2NVWA 3C48A 4J0IA 2WV7A 5JAOA 1TKRA 1XNHA 4NBSA 1ZVKA 3QSGA 3ADOA 2VFAA 5LJIA 4ILKA 2B1IA 3AVQA 1NVEA 2V7GA 1IJBA 1RPTA 2O5RA 4PLZA 5JCOA 5HG0A 3ANXA 1ZSNA 3ZJ5A 1LPPA 3TR6A 4ZCTA 5F2NA 2GXUA 2WE7A 3FPFA 3IPRA 3K6SB 2ZI9A 2WTXA 1NDUA 3IURA 4Q93A 3E7XA 1BU5A 2ST1A 3EGEA 4JT8A 5DT2A 4RXMA 3VU9B 5I7OA 3LS2A 2VK1A 3VBEA 4RPCA 3GIWA 3FPBA 2GETA 3I0MA 4LX8A 1JUDA 1NVGA 2ES4A 3WQBA 3U7JA 5CH8A 5HFAA 3H1AA 1K2WA 4IDOA 1ABEA 3MD0A 1I3CA 1JG1A 3NHMA 2J5QA 3SYLA 2UVPB 1ZMXA 1EA5A 1O94C 2FETA 2J0EA 3H1TA 3DVRX 5LM3A 1NUPA 4NBVA 1COWA 2ACWA 1E9BA 3QZUA 5AT1A 1I5RA 3RSGA 2XCIA 1PGQA 2B0JA 3P9ZA 5AICA 3MYYA 1L1RA 3GOQA 3K1AB 4Z9XA 2P2SA 3UJPA 5HR5A 3AUXA 3T95A 1M6WA 2PMKA 1U90A 1ZRNA 3AKEA 1H1TA 2ID4A 3G7SA 4WDRA 3EGVA 2C7PA 3ZIAA 3LQYA 3TS1A 4OIFA 4UMEA 2SKDA 3UJNA 4JNKA 4LTMA 1RBQA 2JLCA 4FE7A 3HXQA 3UMSA 2JLYA 5CA1B 2EFHB 2I6GA 4Z7QB 2ORIA 5IKPA 2O3UA 3C8UA 4ABYA 4UNRA 2ACVA 2VZ0A 3M49A 3HFJA 3TLKA 1J8DA 3FDXA 5GVSA 1GG8A 2ZSAA 3RFFA 3B1ZA 4JX9A 5T3YA 3FFAA 4B7ZA 5ICCA 5D3ZA 3H8JA 1TEVA 5A0FA 1SPBS 4DSZA 4YJGB 3EXEA 4DCCA 3P9PA 3HEMA 4GI5A 5DM70 1O6BA 1C8LA 2ATIA 2I03A 4KR9A 4L57A 3CRNA 1E8NA 1XP8A 3DOOA 1LV7A 1UFVA 1KIFA 1FYWA 3HXMA 1SUFA 1UXJA 4GQAA 1IJFA 3WY9A 2PXCA 3UW3A 1T8TA 3G1UA 4ZQBA 2GBGA 1MNAA 2B21A 2JGLA 4Z5XA 5U4XA 4EG5A 1G17A 2FMFA 5L4LA 5AQEA 1CY2A 3FZNA 1YIAA 2OT3B 1YR9A 5JYBA 5COQA 3U39A 2R1VB 3MT0A 1A4UA 4JUAA 2L69A 4FONA 1P4GA 1I7LA 3CH6A 3BQ9A 3DNPA 2CT8A 1LPNA 3C6BA 2OM2A 3S6JA 1LPOA 4OH1A 4MV8A 5E8JA 2HIHA 5GONF 1YKGA 2C2BA 1HSZA 1SB8A 5KSPA 5CLFA 4NE9A 4HFJA 3NHKA 2D06A 2DFKB 5F5XA 3ZGYA 3Q15C 1CB7A 1V47A 1D2GA 2XZDA 2BCJQ 3GX1A 1AQLA 1PLKA 3FW1A 1XCGB 2I5PO 3OOHA 4TWAA 3WIOA 1M8FA 1SVOA 3PKZA 2XMDA 4I3FA 1JPNA 5C1PA 5HKBA 5DULA 1YS6A 5AIBA 3DL4A 4Z1MA 4P5PA 1QFYA 4EX6A 5EC8A 2YJ5A 5SYAA 3VAAA 1LW6E 4UTVA 4K6CA 3T41A 1MIHA 3UXHA 4CDNA 1IZZA 1TTTA 3I6YA 1UMDB 4RDCA 1KWKA 2H06A 2C5GA 2O8EA 3TLBA 3IIJA 4DMMA 3HNRA 3QE0A 5AQ1A 3DO6A 1NLMA 2VUSA 1OZHA 1Y9ZA 4MTCA 4CR8A 4V39A 3CH7A 3GJ8A 4GI7A 4GO1A 1M1YB 5M04A 4MUEA 4OU5A 1B4DA 1QIKA 1BQEA 5LVAA 1XBTA 2FKAA 5FWNA 1VSUA 1EKXA 3B5EA 4I9FA 3TW6A 2PUGA 1N2XA 2C88A 3VZBA 4PRKA 4IHJB 2FI1A 4MI6A 1E9SA 5CLHA 4MR9A 2GRJA 2GPTA 4HDNB 2D0OB 4CLOA 3UM9A 4X1KA 1HLFA 4QVKA 1J22A 5JH7B 3DVQX 5K2OA 4UM8B 1XQ6A 1RYNA 1J8QA 3DMNA 1R6UA 4BCDA 2Y0EA 1OBFO 2GCOA 5DBFA 3A6PC 4PYRA 3KYIB 3V48A 3KPVA 4BO8A 4BCCA 1GVHA 1N2BA 2C8KA 3EG9B 2JJYA 2WINI 3WKDA 2F8SA 3PTAA 2CYBA 3LJKA 5DHAA 1VKHA 1A76A 1T4CA 3QWAA 1DLIA 3H2ZA 1CE8B 2VSYA 3KJIA 1E2GA 2Q6OA 5EHGA 2XRMA 2FN3A 1AS0A 2RH4A 1P0MA 2W2LA 2O2XA 2HLNA 2AW3A 3EWSA 1I3OA 3ABIA 2QN6A 3LBFA 3DDSA 3MIIA 2XE4A 5EIBD 3QLUA 3P2YA 3K09C 1Y98A 3HVJA 4NK4A 3TOCA 4CQLB 4BN4A 1Q7EA 3JARB 2H65A 4PXAA 4ATNA 3RU9A 3RRFA 2QAGA 1M66A 5F9HA 5J2UB 4B8YA 1RZVA 3FIJA 3PHIA 5I7AA 2HYDA 3U6KA 2AB0A 4PAMA 1BS2A 3NLLA 3GUCA 4ONEA 4QBGB 5HMMA 1TIBA 2JJ1D 3GCZA 3C5HA 3HV2A 4UVHA 1II8A 1DBPA 5D84A 4F3TA 4IDPA 1S5PA 1MJGM 4IWXA 5EXTA 3W2EA 2CXHA 1VIYA 1FFGA 1EHIA 2Q3EA 1E89A 2X1MA 4OB6A 4YJDA 5IAKA 1A72A 1J99A 1C0EA 1KFEB 4NCNA 4A6PA 2PDAA 3PRJA 2FU5C 1KI6B 1FNSA 4Y6LA 1CFZA 2XADA 3ZLJA 4BNGA 1EUCA 3I9V1 3AHHA 3COYA 5ITWA 4I1PA 2ECKA 5F73A 3IIEA 4CKBB 1D5CA 2D2XA 3PJGA 4GRDA 4B3IA 5DVZA 3KPYA 3DGEC 2WZDA 3VVCA 1NJ5A 2CYAA 1NNSA 1D07A 5M29A 4F21A 5I7VA 1FNMA 1DAEA 1GSIA 3QKRA 1HDZA 3NS7A 1B73A 2PUHA 1JVNA 3DJYA 3GEMA 5LP6C 1C9EA 2XNKA 1KI2A 3EHEA 1NGSA 4FPXA 4ND1A 5HF9A 4YT8A 2EAUA 2YMPA 2OZLA 3I0ZA 5JNLA 1VSTA 3FBGA 3NKLA 5AIAA 1FVXA 3RVSA 1QFJA 3MFQA 5JD3A 5FTMA 5CVEA 1EX6A 1C9YA 3BD7A 2R68A 2R4UA 3I2JA 3WMWA 2BHLA 3KOOA 3C8ZA 4R2LA 3BCRA 1MDBA 2PRYA 2OO5A 2XKAA 4LOJA 5K03A 4Q1BA 3TPCA 3KSZO 4LBYA 5H4GA 1CR0A 3ZVNA 3HKDB 2V7UA 1FZTA 2Q3BA 1YQWA 4DLXA 3IT1A 1BDMA 1TCAA 2H8KA 1LRLA 4WN9B 4GLOA 4Y2JA 5AKHA 1G19A 2XX3A 1PL7A 1QIDA 3MUNA 3QYJA 4IIHA 4L6AA 4MGKR 3HJFA 3F4KA 2OLJA 3QFCA 4JI0B 1SK8A 5CHEA 2P4EA 2R00C 3KP1A 2QM3A 3TKLA 5B5SA 2O8DA 1NI4B 2O06A 1TCBA 1JIXA 3H8WA 1EQAA 4HQNA 3GGGA 1N6RA 3QIVA 3K6SA 3HCNA 2X13A 3PCXA 1Y8AA 3NHSA 3PFBA 4MVJM 2WJZB 4HMPA 1UBUS 3NIDB 2Z6QA 2Z6VA 1BGVA 1P18A 2J5XA 1R0KA 1H2RS 2MSCB 3WNQA 3CEPB 1AV7A 3VU9A 4H7EA 2CHQA 4Q6BA 5EWLA 5IRCD 4EKDA 5CYPA 3MUEA 4HDRB 3WI7A 3NVAA 4DLPA 2YASA 4C1BA 1OXBB 3JQ9A 4KDFA 4EUFA 2MSDB 4DCUA 5KCZA 1QZUA 2FKNA 4YRRA 1P5ZB 3GCXA 3HNOA 1OYOA 2DWCA 1HORA 5KJCA 4MVJI 1OJ7A 2XMRA 4JASB 1MO6A 4OUKX 3RWMB 4WJLA 3JQAD 4WKBA 4RIHA 2A3NA 2NTYC 4JDUA 1ULAA 2JCBA 4MVYA 4V3BA 1EFAA 1E1LA 3QVLA 2XWBF 3CUWA 3JX9A 4GC5A 4B3HA 2EJWA 4YCDA 1KVUA 2JFHA 1E5TA 2MHCA 5JOQA 3NNNA 4LI0A 5FR2A 2ZPUA 3KKLA 1SURA 2I2AA 1W73A 2GEFA 3F6BX 2HPAA 3FVVA 3TINA 3LUCA 4IIBA 2ZIAA 4BMPB 4BO0A 1ZSVA 3WTCA 4NMLA 2HLPA 2RGCA 3BHIA 3CHYA 1R74A 4PR0A 3WWZA 5KQSA 1UWKA 1GP2A 2BBTA 2VF8A 4OLFA 4YHBA 1VI2A 5ILQA 1A9XB 3CVVA 1FBTA 3HS3A 4WXPA 1XD8A 2FQWA 2PD6A 1DDIA 2C59A 3Q5GA 5DM0A 1E3EA 5J1TB 4BMCA 5K3CA 4F6RB 5K20A 4P4TA 3O9VA 4HS9A 5AM1A 5CEJA 5BXYA 1TM7E 3PKJA 2ZRQA 3S4YA 4B0OA 4FMBB 5BW5A 3CZMA 4JBNA 3WSVA 2IZOA 1FQJA 4FS8A 3AHDA 2KS6A 5K0SA 1L4GA 2Y8EA 3WQQA 3S27A 4BNVA 3ROZA 2CDBA 1BMTA 5AKIA 1DBIA 2PAFA 1G42A 2VCYA 3DHEA 1UL1X 3VR6H 3CX3A 5DYWA 1N3LA 1TC2A 1O5OA 1MZVA 3P9SA 2OGZA 4UPVA 1Y8RB 5FR1A 1EQUA 2VT7A 4K88A 4I4IA 1SM4A 2FWRA 2XTZA 3HGMA 4RDIA 2P77A 2W2XA 4L6IA 1SU6A 2CCKA 1T5LA 4Q4DA 3RJMA 1H2ZA 3ISTA 1JSZA 1TD1A 1WQ4A 4TVKA 3KZXA 4Z7NB 4JU8A 1AUVA 3QY9A 2J3KA 2ZI6A 3FTPA 1ZC3A 4INZA 4WFQA 4B4OA 3OFVA 4ZYTA 2J0UB 4LYFA 4MULA 5HE9A 2XUPA 2G1UA 3LX6A 2G1AA 4JUBA 2Z8XA 4LBWA 3WHLA 4RENA 5L7YA 3MTGA 3HDHA 2ZWOA 2Y93A 1N0VC 4P58A 3TB6A 1IMJA 2V5AA 3CZ4A 2Z4TA 2NZVG 1VSBA 3ZWMA 2PA0A 4BFWA 2FZ5A 5CXXA 1HZZA 2P35A 3GDHA 5F5LA 4GL2A 2YVLA 1ZNXA 3LT4A 1EU1A 2DYKA 1PEDA 3FYDA 2JFZA 4K26A 5A62A 2Q5QA 2ZRFA 5DJ5A 4KREA 1E3WB 1UMDA 3C6XA 2J0VA 1VL5A 2WAYA 2H4FA 3WZMA 3H84A 3HM9A 1IM8A 2VP3A 4TL9A 1Z8DA 3T7KA 4CMAA 3KZOA 2Q1YA 5EMNA 1PT6A 2P0AA 1XV5A 4INOA 1KGDA 4YBZA 1ZR2A 3B48A 5J3JA 1M1YA 2HLDD 2D6FA 1UDAA 3LBNA 1JRLA 2A67A 1L7XA 4RV4A 4YR9A 1W48A 2J48A 3KJHA 2EFJA 4US1R 3HU3A 4U0KA 3UK6A 4JP1A 3V9AA 1KWGA 4Y9TA 4IHJA 1XPJA 2J3HA 3DA8A 3HSSA 5K0NA 1MXFA 2ZTMA 4HDNA 3IKVA 5D1NA 5HKKA 3U44A 2C3YA 1E9DA 1CS0A 2QI9C 4B2PA 1EWQA 1R4MB 4HWRA 2IY9A 1W93A 2B8WA 2JFNA 3RVOA 3OLQA 3UUFA 4UFPA 1HO3A 1SMKA 3KLMX 2IOHA 1VJ0A 1VC2A 3BS4A 3GJYA 4RHEA 1J2JA 3LBYA 3TLGB 2CFIA 4ID9A 4D42A 2ILVA 4HNUA 3AYZB 5CTJA 4QOJA 3DVSX 3D7KA 4OHFA 3LT5A 4QVIA 7AT1A 1UBRS 1XDZA 4IRMA 4P4NA 4YAIA 5IT0A 3H0KA 3NHAA 3V8BA 2FPPA 1SOMA 5C5DA 1CQIB 3KUCA 4NZZA 4TGLA 4WKPA 2BSQA 1ODKA 3UAGA 1L7RA 2WWFA 4WXHA 2GILA 1TE2A 1MO5A 3EEBA 3T7DA 5BUSA 1GGMA 3ANLA 1M2FA 1MRNA 2XGGA 5DXAA 5HFNA 2P11A 1CIJA 1Z7BA 3QTLA 1TIKA 4ER3A 5IHPA 5IXJA 5JQGB 1TM4E 4MV9A 4DARA 2P1DA 2ZRIA 1MF7A 4DKXA 3GZNB 3WWCA 4MIYA 1OYWA 1QG0A 4L2IB 2QN3A 2W6OA 3ZI4A 1ZAYA 2P2ZA 1T0PA 3RT9A 2XUAA 1UBHS 2GF0A 2W8BB 4OQFA 2GNOA 4WUTA 3UPDA 1M1YE 3NIBA 4DYVA 4RZXA 1LGYA 4IFIA 2CZQA 4HWGA 4WK2B 1UOEA 2EU8A 2LGJA 1A7KA 2JS7A 3AI1A 3FBTA 2QLJA 3CIFA 2ZI3A 4YGXB 5K3AA 2ZWVA 4QUIA 5BOVA 1GITA 1KI6A 4L0MA 1ZGAA 2X2OA 3RHFA 2OBFA 3HYCA 5K51A 2L0XA 3ZY5A 2B9VA 2CY0A 3SHVA 1ILEA 3NGMA 5AHRA 4LHWA 2FZLA 4BNHA 5A0TA 1KBZA 2VF7A 4G84A 4RFLA 1SU7A 4UVGA 1TT7A 4UU1A 3WS7A 3W9UA 3WRVA 1AGYA 3U5TA 1KBOA 5E9AA 2KE5A 4G6ZA 4EY8A 2P2NA 4NE7A 4OQNA 5HE8A 1XAIA 3HGTA 1KI4A 2QUIA 1HUQA 4HL6A 4ZOLB 5CX4A 5IVHA 4DLTA 1G20B 1ZN8A 2J3LA 5DE3A 3EWAA 2C5BA 1XLTC 4UBLA 2GN6A 1BDJA 3IAUA 3HMQA 3EGDA 4PYNA 1ZIXA 2PSDA 2FX5A 2NW6A 3CRQA 1SD1A 4FOLA 2C03A 2ZRDA 2R1UA 1CY4A 3PR1A 1BMFA 2PD4A 3OOJA 3UJAA 3WHKA 4G5YA 1VL2A 4UAUA 3RLIA 3T0GA 1FK8A 3D8SA 4Q9KA 2Y4OA 2WG0A 3S29A 1N5JA 1UDXA 2C7VA 4TTRA 5ADVA 1J8MF 3OZFA 1W25A 3B52X 3FYUA 4W1RA 3CB4A 3IUBA 2VHJA 4CEHB 1TB4A 1FU8A 2O3SA 3ORSA 5JSKA 3BIOA 5A5GA 3FR8A 3TGLA 1C7ZA 4BTLA 1B76A 1GFWA 1R8JA 4WN9A 3RSCA 1U3UA 4KJXA 1O95C 4ADSG 4RE6A 2IWRA 3HJBA 1XZLA 2ZI4A 1NLFA 1N2HA 1N6PA 1TL7C 1CZRA 1X2EA 3FSGA 3LSTA 3F74A 5AW4A 3FKSA 4KXWA 1RYEA 2VRWA 3T5MA 3PD0A 2GK7A 4R5HA 1MO3A 5GMOA 1WP9A 3L8ZA 2WD7B 3K8ZA 1T0JB 4EEKA 3ANNA 3SN6A 4BN5A 3PJDA 3RUEA 1BCSA 1ZMBA 3I9KA 2IHUA 2B6NA 3L41A 1FZQA 2J3MA 1UP4A 3OEED 4JQYA 4M55A 4MRNA 2OCIA 3RARA 2XDAA 2FXIA 1G63A 2Y1OA 3MTJA 3S2GA 5BNFA 1P0QA 3KD2A 5KWVA 1MQAA 2P9HA 4HDRA 2F59A 1LWNA 1YH3A 3OZVA 4EG3A 3TD9A 1G6KA 2A4MA 3IE2A 5BSRA 5SV2A 3RS5A 4FB4A 3QIAA 5EWMB 2D2FA 1QK4A 2V55B 3MJSA 3IDAA 6ABPA 1XYYA 4ZAXA 1W4ZA 2RI1A 4ZAGA 2E55A 1KZ4A 1JQ3A 4O59O 2QD5A 1LF0A 1JDPA 3G8BA 3LUJA 4M99A 2BEWB 4HNAB 4QHTA 3PC8C 4BU0A 2PEZA 1NY6A 4E2WA 5DGTA 2OBYA 3ZDZB 1QLWA 4C0QC 1JAXA 3VUFA 3T1HB 3M81A 1XMQB 3S1AA 2WNSA 2VNKA 2ZSBA 3A9WA 2J5BA 1DINA 1KPGA 5J5CA 4JVOA 5CT8A 3ZHYA 4F5ZA 3T3NA 3WWEA 1N0UA 4PY2A 5KUTA 3RC8A 1G64A 1USKA 2WNHA 4PBRA 1NXPA 4A26A 4ZV4A 1NUTA 5ALPA 3ZH2A 4RQAA 3WJ7A 4OMUA 5C8YF 5FCDA 1AGNA 4WBSA 2XIJA 1SOUA 3O5AA 5TQ0A 1YE5A 2FUEA 2YIMA 2XZPA 2YQ5A 4RNCA 5FEMA 4ARCA 1N8TA 3GWGA 2ZUWA 2NV0A 3U7RA 1EVIA 2NP7A 1UMKA 2V6BA 1SULA 1A9XA 4HQLA 3RRNA 1UCFA 4R1OA 1YZTA 3THOA 3ZWVA 1XMPA 2HPZA 4I1RA 1Z62A 5LOVA 4O2BF 4MICA 2R6JA 3DZIA 5KHOC 4JXXA 1Y3HA 2WF6A 1PWXA 4BQQA 1XDUA 2W9XA 5P21A 2V6FA 4YJ2B 1JNXX 1XA0A 4BV3A 1SZDA 2LPMA 1MLDA 1VCNA 1UP7A 1QIIA 1KQPA 5B57C 3FZQA 4FHGA 1RWMA 2YYSA 4HWPA 5LZ7A 4HTAA 1TT5A 3DTVB 2Q4RA 3W2IA 3HABA 3AVOA 1WXQA 1HWYA 1KIAA 1IAVA 1NW8A 5FYDA 5IASA 4EYSA 1ABBA 4Q7KA 2QRKA 2QUKA 2P8JA 4KJZA 4N0PA 4N8SA 4F71A 4GIBA 5LUAA 4NCAA 4FT2A 4PLYA 1BGWA 2IYNA 1KERA 3GJ3A 4OVKA 1NN0A 2FW6A 3B9RA 1YQXA 1X39A 1ZZGA 4KWTA 2IVFA 2J0UA 4IF4A 4URWR 3DF7A 1TKAA 2Z9DA 4MPRA 2A0KA 5AM2A 1FBNA 1QQAA 3ROPA 1EP9A 2HRQA 2YJ3A 3AUJB 5JDIC 4W5RA 2QVXX 3JPWA 4MCAA 3SX4A 1WOMA 3KVYA 1Y3FE 2QUJA 1GT91 4G5XA 2LRHA 4P4GA 5DBOA 1FJ2A 1QGAA 4R2HA 1EDZA 1PZMA 3QFHA 4TX1A 5AM4A 5SY6A 2AI2A 4EGCB 3WP0A 5GIPE 4ZYYA 4RY2A 1JNYA 4BVGA 3SX0A 3DPSA 2BHRA 1VGRA 2EBHX 3G2IA 1U8YA 4PGMA 1QFXA 2ZJ1A 1P19A 4G5FA 1Y5RA 4OHVA 1VHJA 2I76A 3RYIB 1O03A 3B3FA 3F9IA 3L46A 2VZEA 4KTVE 3U4MA 2EWVA 4AWBA 4C29A 4AJIA 2H4ZA 3NP9A 821PA 3FUVA 4B5KA 2EJVA 3C85A 1GPMA 4X7PA 3Q6MA 3KAPA 3SD7A 1PWEA 3AKDA 4X00A 3R23A 3VR6A 1R6TA 4RZ3A 1WPRA 4GYKA 2I1QA 1T13A 5AKGA 1W87A 3TSOA 4WLNA 1G3IA 5LU8A 4LECA 4V02A 1NMQA 2Y27A 3AYXB 1AK9A 4X0EA 4KR6A 2GCNA 4BZWA 2BFCB 3GEPA 3DOUA 2J33A 3BL5A 2GAJA 3EOAI 3P9CA 5CU7A 4KE6A 4Q3CA 4FW9A 1EUQA 1QRSA 2FUKA 2QDKA 1FLVA 2OAQ1 2H31A 5I5GA 2P9JA 5FLEX 3CKYA 4TT3D 3K8OE 1S96A 1USUA 2WVAA 4C4YA 3COWA 1LXCA 3I09A 1G4AE 2N9UA 2C3UA 2PKYX 3R3YA 1P7CA 4WOBA 4YASA 1TU0A 2YIVX 1R8QA 4A73A 4NYMQ 4GM1A 2EKDA 1Y6QA 3N6RA 3GDFA 3CZCA 1UF9A 2IYQA 1DLJA 2JF0A 4QUJA 1CQIA 3B5IA 1NZFA 3VO8A 5I7HA 1OFTA 1R50A 1T5BA 3KZ1E 5GTDA 2Q1WA 3CG4A 3S8YA 3RRXA 3LO8A 3KL2A 4UXIA 4HFNA 1V5GA 4V2UA 3P94A 5BQ5A 5JQGA 2J59A 5DHQA 2WF7A 1Y8QB 4ZDKA 1P9RA 4CFZA 3GZNA 4X6UA 3ET5A 2Y1GA 4L2IA 3EPPA 4ZT4A 2PUCA 2YV2A 2W8BA 3QE2A 3OOYA 3O47A 3QV2A 3ETGA 5FKJA 2VCEA 1A7AA 1ZGBA 2JIZA 2VSXA 4N5DA 4G36A 4MGIR 7REQB 4YLGA 5ELLA 1IQ0A 1O5TA 1R16A 1UC9A 2V65A 4U63A 2HO5A 4EA6A 3KDAA 3WNBA 3ND5A 4G1VA 2I2DA 3EGXA 5AJVB 5AVKA 4M1EA 3LC1O 1SU8A 2CFCA 4KGDA 3PTZA 3TN7A 2MOKA 4RIEA 4C0AC 1MH1A 2P3OA 2N75A 2IV7A 3WR5A 1VFNA 4PSCA 1GARA 5GJBA 2O05A 4BGEA 4F1KA 4WK6A 1PYOA 3ISJA 4TWZA 1P4SA 4UBMA 5FI0B 3TRDA 1EVJA 2WWHA 3H6GA 5FULA 5IAJA 4MINA 3FDZB 4GM0A 4AKEA 6CHYA 1RQGA 2P9YA 2PFGA 4M98A 2IUEA 1WW8A 3K32A 4WEQA 3R77A 2PKXA 4H0CA 3ZDDA 1OV6A 2Q5FA 2WJPA 2JHCA 1ZWLA 2XVAA 3MAJA 1G18A 1U5AA 3WKEA 3VNUA 3IX7A 4DR6B 2FQQA 4HAXA 2HCBA 2IXFA 3AVPA 2X1HA 3Q88A 4ITUA 4Q66C 5FBWB 1RCTE