1Z08A

Gppnhp-bound rab21 q53g mutant gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
160
Chain Sequence
b'AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-21
molecule tags Protein transport
source organism Homo sapiens
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
total genus 53
structure length 160
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z08A00
1GL6A 1KY2A 4GP7A 4LBZA 2HDNB 3RAPR 3P27A 3V4FA 1W36D 1JAIA 1X1SA 1E9AA 2X77A 4B75A 3MJRA 2JLZA 4XWAA 1D9ZA 5JSZA 5KDOA 1ZUNB 1Z6GA 5F9FA 4FN5A 1XU4A 3GD7A 4Q9IA 5L3SB 3VR2A 4EJSC 3QKTA 1VECA 3ADDA 5CDFE 4I1VA 5LB4A 4BEBA 1C1YA 4DC9A 2VP6A 5LDDC 2XNSA 4B2IA 3ZVMA 5ELXA 2ODWA 2IA5A 3ETLA 1NJFA 2RCNA 2RGAA 4UKDA 3S1AA 4AWXA 4DLRA 4BZPA 3OFNA 2Z5FA 1N6PA 2VBCA 3A1TA 3W6PA 1VHLA 2ZRCA 4WBSA 1CP2A 1QDEA 1D2MA 1E2PA 4JLVA 1D2EA 3VMFA 4RVCA 3KTAA 4Z1MD 5BW8A 1JALA 4C7OB 1EFCA 2QAJA 5J4KA 4KYUA 1Z6YA 4Q1EA 3RSOA 1DTSA 4LZZA 4PXAA 1M2OB 2C9CA 1KI3A 3O47A 1EGAA 2BKEA 4O3MA 3RC8A 2VRWA 3QOFA 2R44A 2FGKA 3VU9A 1TUEA 3FDIA 1ONBA 2IXEA 5FOVA 1GRQA 521PA 3AVVA 4DB2A 1XTRA 8OHMA 4N3NA 3G82C 1XRJA 4QHYA 4MGYR 3EZ2A 4IDOA 4TMVA 1P62B 1WB9A 4QXAA 4HEJA 2OEPA 3IQWA 4EPYA 1IOZA 2O0HA 1J90A 5CJ2A 2C96A 3F3YA 4YMTA 1FQJA 2O8FA 5DH9A 2H18A 3X2SA 4G0NA 2FPKA 2PLRA 4AYWA 1G1MA 4POAA 1CJUC 4A8JA 2EYQA 3FOZA 1IN4A 5HZHA 4C30A 1N6RA 1CR4A 3NBFA 2P65A 2X1VA 3TVDA 1FFHA 2RGNA 3EG5A 5FOXA 4YXWD 1Q1QA 4LYHA 5J4YA 3RSLA 1T8UA 2OAQ1 2DBYA 2CL6X 5H70A 1IY0A 2AD1A 3QJYA 3U44B 3CUEF 1GIAA 2AX4A 1RC8A 2FA9A 1Q1EA 2V1XA 2JLUA 4BLOA 4U00A 1Z63A 2XGJA 4EPRA 1OLOA 1E94E 4MRVA 4FI3C 2OAP1 2NG1A 1KI6B 2OCBA 4B44A 4FMBB 4D4MA 2HF8A 2QORA 1IONA 3B7GA 3FKQA 3L43A 1W2GA 1OYYA 5FL7A 1OYWA 3H4MA 4HUTA 3F5FA 3SEAA 2ZM5A 1NN0A 4ARZA 2JJ8A 2WSSD 5L3QB 1R5NA 2BJWA 2VIIA 1VTKA 3C14C 4TMZA 3QBVA 1P4SA 1EFUA 4OK3A 2RB4A 2CL7X 5FTMA 4BFXA 1R5BA 1O3YA 4R2HA 1A1VA 3NDBB 3B1YA 1U94A 2BIFA 2OBNA 2GESA 4EJSA 4OJKA 5JCZA 2XOKD 1AQYA 3ADKA 3THXA 2QE7D 1E2KA 3ZGXA 4BE7B 5LBIA 1NIPA 4AYXA 3W34A 5HZKA 4AY2A 2O8EA 2ZREA 3FKSD 4NU0A 1OH6A 4JL5A 4IFBA 5J40A 4LHWA 4C4PA 3LRPA 421PA 3DOEA 1E2LA 3E1SA 4PPQA 3PEWA 4FMDB 2D3WA 1Z0FA 4PANA 1JNYA 3K70C 5J5CA 4II7A 3IIMA 1EXMA 1XB2A 4IOLA 3GJ0A 1MV5A 3A1UA 4OK5A 2JASA 4CGZA 121PA 3VFDA 4ZV4A 4DJTA 3AF0A 4DB4A 1VIAA 1O87A 5KUTA 3LV8A 1W0KA 4A9AA 4BFYA 2ZRFA 4DT1A 3Q5DA 1JR6A 4AKGA 1DAMA 3CWQA 1BIFA 1BKDR 3TLXA 1FX0B 2D62A 2MSDB 4KBFA 5JSZB 1LFDB 1YZGA 1VCNA 3BS4A 4YXWA 1VG1A 4Q9HA 2OSBA 2ZROA 3K0CC 4DLZA 2FFHA 4LYFA 4DLSA 2F1HA 3QSYA 5EXXA 2Y8EA 4GRAA 2NTYC 1EFRD 1KSHA 3HR8A 4OJQA 4A0FA 5FPYA 1HE8B 1YJ5A 5EXPA 4ESHA 4FW9A 3THWA 1MO5A 2GEUA 3BERA 3KUCA 4JT2A 3QBTA 1OHHA 3Q85A 2FSGA 4CEJB 1RJ9A 3CONA 3SNHA 1NLZA 5FBQB 2WWYA 4KBGA 3EWAA 3C15C 1Z0KA 1DAFA 5JZVA 3BH0A 3PUXA 2WWFA 4G01B 4NYIQ 3T61A 221PA 2G0NA 2CLCX 3MLEA 4PC2A 5EZ5A 4US2R 2PT5A 1GZSA 4DBLC 1E4YA 3PUZA 1UKEA 1D9XA 3QG5A 1GWNA 3QXXA 5FTNA 1KDOA 1R0XA 2A5JA 1E2FA 2ZRAA 3GLIA 1WCV1 3C7KA 1WBDA 1ZM3A 1WRBA 4C2UA 2WWWA 4MYTA 1UF9A 2WAYA 4XSHA 3LNCA 1IJEA 1XCGB 1XZPA 3EWSA 4RFSA 5KSYA 4JSTA 2XOKA 5EE1A 4A2QA 4V02A 3K8YA 3O8BA 5C2JB 4QM7A 1KI1A 3EW9A 1QVRA 4XVUA 1DG3A 3R8FA 2Q3FA 2ONKA 1ETUA 1VPLA 2OHFA 4FXPA 3RRNA 4C0QC 3PEYA 4MA4A 5HE8A 2ZSAA 1G5TA 1KMHB 3NTUA 4IOKA 1E4VA 3C5CA 2GHIA 4A8JB 3R9WA 4LGMA 1Z0JA 3P1JA 3UG7A 1MO4A 4F38A 1K6MA 3AVYA 1OIVA 5FUXA 2DPXA 2WWIA 3OE7D 4OQFA 2ZS7A 2WHXA 3U3RA 1G6OA 2RAPA 1AZTA 2KI5A 5BWMA 4URVR 5EQTA 4UQOA 3NH6A 3TBKA 4QL3A 2WIAA 2BMJA 3WYGA 4PSAA 1KI8A 5JCPA 4DLTA 1MR3F 1NVXQ 2QSYA 1M1YE 5A5GA 4TT3A 2OXCA 2O8EB 4Q66C 1E9EA 4M53A 2GJSA 4IXNA 2IS1A 3BE4A 4XD7D 1KI2A 3J81k 4TMWA 4M4SA 3QKSA 4AD8A 2VHUA 2O8CA 1QRAA 2KB0A 3BWDD 2R6GA 4K46A 4GOJA 1CIPA 1P3JA 1NVVQ 2CCKA 4W5HA 3R20A 1YKSA 4MRNA 4Q1AA 4BFVA 1R0WA 1W4RA 2WPDD 2QTFA 4M8NE 2DYKA 1IN7A 4LC1A 1H8HD 1E1QA 2R6FA 4ZDKA 2XB4A 1G291 2AHOA 2YWEA 1P7CA 2ZR7A 1GRNA 3AV0B 2PZFA 1RYHA 3KQNA 4B6FA 2ZJAA 1N0VC 2GK6A 3REFA 5J47A 1CBUA 4ZCIA 3T06B 3SFVA 4YMWA 5DN6A 3U3MA 2ODNA 2XTMA 4ACAA 1MO3A 2HJVA 5EXSA 2ATXA 2QMUA 4LJ6A 4IDQA 2IF0A 5TDHA 3ASZA 2IYZA 4NZYA 2C95A 3ZDQA 4GL2A 2XNDD 2W2VA 3PJRA 4X8LA 1G7TA 1P5ZB 1AKYA 2QP3A 3PUYA 4M21A 1JEEA 1XD2B 2FPLA 5KYKA 2ECKA 2W6JA 1DELA 4BASA 2JAQA 4RFSB 2WM9B 2HT6A 1NSFA 1QHGA 2EFGA 4CRWB 1QHYA 3UMRA 3SFZA 1OXSC 3TUIC 5B30A 2VHCA 3TVTA 3LD9A 3NHAA 1RFLA 1T0HB 4JVNA 1SHZA 2DHRA 3PG5A 2BEJA 3U3OA 2FG5A 2WWGA 1GTVA 2IUTA 3CF0A 1PLJA 4BEJA 1GL9B 1Z06A 4DLWA 3SI7A 3EIEA 2ZETA 1Z29A 3AQ4A 1KO8A 1MRNA 2IS6A 4A8JC 1P9WA 2C2HA 3TUJC 3UATA 1E99A 2GXQA 4NDZA 4Q4AA 4DUGD 2XB2A 4WIAA 4DCSA 2ZSDA 4DT1B 5G40A 3O8CA 4Q1FA 1ZD8A 3GLIE 4Q7JB 1QHHA 3AM1A 3K0FB 5DSZA 2B6HA 2AKYA 2QEQA 2A5GA 4R9UC 4DDTA 2G1KA 4PC6A 5CB6A 1HQYE 1CJMA 1OF1A 1Q1BA 2ZU0C 3LH5A 1OXUA 3MFYA 3AKCA 1NL3A 1E9BA 1U9IC 5EXTA 2LKCA 3QXCA 2IWRA 1NMYA 1GP2A 3RS4A 2RGNC 1CKEA 2FJUA 1LVGA 4DLVA 4CZ2A 3B60A 2Q3HA 3PQCA 2JA1A 1W47A 2VF8A 3CPEA 1N6LA 3BRWD 3QE0A 4QFMA 4LJYA 1XD8A 2V8OA 3AF4A 2J0VA 5DHFA 1P2UA 2WJIA 3NBZC 1FUKA 1XTKA 3VQTA 2QUZA 5FOSA 3ICEA 4NH0A 2XZOA 2XITA 5JWHA 4FWIB 3I4LA 1G3MA 2D2EA 4HLCA 1JJ7A 1GITA 2EYUA 3ZQ6A 4KJZA 4XIGS 5EP3A 2BBOA 1G7SA 1E79A 4XWOA 1Z0AA 2JJ2A 4GZMA 3U7EB 1E1QD 2IUUA 1D5CA 1NJGA 4B73A 4ITRC 2W00A 2ZPTX 1GKUB 1L4UA 3AGPA 2PJRA 1E9RA 1G8YA 4C0HA 2AL7A 1JR3E 3A8TA 1TPZA 1DEKA 2KBEA 2JATA 2QTVB 2YOHA 2OXRA 1W2HA 1DG1G 2WAXA 2C03A 4HUQB 4M9ZA 4NYJQ 1YVDA 4NCNA 4RZ3A 1J99A 4LV8B 5LD2B 4LJ8A 2EFCB 4LJ7A 5FTLA 2VTKA 1XMVA 2ATVA 5KNCA 2DCUA 1YRBA 4D82A 2F7SA 1G8FA 1R5OA 2QAGB 1MH1A 2QPAA 3EZ9A 3PEUA 1ZP6A 3WBJA 4QGHA 5FPTA 3G0HA 2OT3B 4U02A 1FP7A 3DVLA 3IIJA 4NL4H 4TLCA 3LQQA 4DZZA 4OQLA 1AKEA 4GI7A 4NBSA 3RC3A 2CE2X 3K9HA 3FMFA 3FMIA 3RRMA 3TSZA 3DOFA 1SZPA 1Q12A 3LA6A 1IXRC 1U8AA 3MG9A 1MO6A 2QU8A 2V54A 5B2ZA 2WICA 3U60B 3G5UA 2IYLD 2WSSA 3DZ8A 5D3QA 3GCGA 1E2NA 5DI9A 4JT4A 2GETA 3ZZUA 4TZ0A 3B8HA 2HCBA 5JRZA 1RYFA 1ZC3A 3CRVA 5EP1A 2XX3A 2QROA 3K0CA 4WW0A 4RY2A 1T9HA 2CJWA 2R6CA 3IKJA 2J0UA 5FTJA 4L9WA 1HY3A 2ZI4A 4C7OA 3OAAD 4EQ6B 1W49A 1F2TB 1F6BA 1XF9A 2PCJA 3SR0A 5JJLA 1W5SA 3TR5A 3F8TA 1PVOA 4DCVA 4JVLA 1A82A 3Q7PA 3KXIA 4WVFA 1FNNA 2J87A 1EFTA 2J7KA 1CR1A 2ZI5A 5ANRB 2GBLC 3IBGA 2DY1A 3CKLA 621PA 1PUIA 4OK6A 4OI0A 4F4CA 2NO6A 1NN3A 5HKKD 3WP1B 2BM0A 1R8QA 4LJAA 4Z1MA 4FD2A 1HT1E 1KNQA 2TMKA 2NO0A 3KXLA 4HDOB 1Q1ZA 3N2EA 4X8MA 3V00A 3A4MA 4RKFA 3T35A 1F48A 2F1IA 2FEMA 4NP6A 4ERNA 1UBFA 2I1VB 2Q9CA 1MABB 4Z8XA 4RZXA 5IK2D 4XSGA 4ZDJA 1CRQA 1KI4A 1V5WA 1P60A 4IKEA 4IHQA 2QA5A 4BFWA 4F4JA 4H9GA 2GTPA 3LBHA 2X8AA 3CH4B 3X1XA 3ZVLA 1HEIA 4P32A 3CRMA 4S35A 2F1RA 4BLQA 5DISB 4LYAA 4TLDA 4R7ZA 3ZZ0A 1XMIA 2DWPA 2EQBA 3KB2A 2VQSA 1K8RA 2ZJZA 1ZNWA 5JI3E 5L3QA 4ZDIA 1TQ2A 1OFHA 2H7VA 5DE3A 3TH5A 4U7DA 5B58C 1K5GA 1JB1A 3WYAA 4OBEA 4BLTA 1G8GA 3HYTA 3RRYA 4YMUA 1COWA 3P26A 4JLMA 3MRSA 3THXB 2R6AA 1UADA 2H8KA 4TSFD 4CEIB 3NDPA 3CR8A 2EWWA 1KO5A 1ZIPA 4HAYA 2YJTD 2VP5A 4JMPA 4NCJA 1P2SA 5H68A 2PZGA 4QBIA 1W5TA 2ZUBA 3SZRA 1W4CA 2A9KA 3THYB 4DCUA 2GZHA 4TTQA 4UNPA 1XPOA 3A6PC 1XEWX 3VX3A 1VKJA 1Z6XA 1JQJC 2FE4A 2GCOB 1NF3A 2EU8A 3B9QA 5BQ5A 2CJWB 1NY5A 2BMEA 1UKVY 1Q20A 4BLPA 2DWOA 4JBYA 1XJQA 4E5UA 3GLHE 3L0IB 3MUFA 4Q9KA 3TRFA 1I2DA 5EP4A 3ZD7A 1FZQA 3NC1C 3SS8A 1OB5A 2PT7A 3MWLA 4CT4B 4HUQA 2B92A 1S96A 3U4QB 4XWKA 3LLMA 2ZI9A 4L9SA 2YWFA 2BM1A 1QZXA 3O8RA 2REXB 4GZLA 3QXSA 4MRPA 2D74A 3VNVA 3FE2A 3LW7A 1NLYA 2JGNA 2QGNA 5AK0A 1XTIA 2C5LA 4JYBA 5FUWA 2NO9A 3PV0A 4MKFA 3CF2A 4C0JA 3OIYA 4QHSA 4V0MA 2CEAA 3B5JA 3SDZA 1MKYA 1T0JB 2AK2A 3GLHB 1ZNZA 1KDTA 3QEJA 4PZYA 4BPBA 3SN6A 2XAUA 4PO8A 4C0KA 4DEXA 4KITB 5TY0A 1SXJD 3KL4A 2O8DA 2GXUA 1LF0A 1DAHA 1QHHB 1KNXA 3AVTA 2EWVA 1VIYA 3EASA 1TADA 2ONJA 1N3BA 4IJMA 3QEOA 2QPOA 2XSZD 2ZI3A 2IYSA 1QHIA 3E70C 4LDJA 4Q4AB 4A82A 1U8YA 3W5JA 3AKYA 4BUJA 3IIKA 1VG0B 5TXGA 1JXOA 3FFAA 1B23P 4TWZA 1LS6A 1GVNB 1KJYA 4LHXA 5JECA 1CULC 3I8SA 2J7PD 2QPTA 3H0KA 2Z6VA 2AXNA 2A30A 3ONWA 4FMCB 4HB2A 4IOMA 3AVQA 4FMDF 4PO9A 5E7JA 4KFRA 3QQ5A 1NBMA 4IEEA 2KSQA 3EZ7A 1ZRHA 2AK3A 2H5EA 1SKYE 3ECCA 4D0GA 3EC2A 4MGIR 3IEVA 2H92A 3U6KA 4KI0A 4EPWA 2VH5R 1GDDA 4GNKA 2KE5A 2Q9BA 3EPKA 1H8EA 3EC1A 4KAXA 5H8WA 3ICQB 3TJZA 1E98A 3NXSA 2ZRBA 4EAQA 2IX3A 2ZRIA 3HP1A 3BD9A 4DIDA 4IOJA 3QXJA 2LCFA 5DI3B 3WP0A 4CW7A 4BFSA 1CJVC 4NE2A 4LJ4A 2JLWA 1KK0A 4B33A 3LFUA 1VYVA 3AH8A 1CR2A 2JJ2D 1RPZA 1SXJC 2V7QA 3IPXA 3LX5A 4RD6A 5AUQA 2IYQA 1ZW6A 4DKXA 3UPUA 4M2LA 3MSXA 3RNLA 1Q21A 1G4UR 2VHQA 3AF1A 3Q72A 3ZZTA 2G6BA 1DAEA 1KY3A 3GLIB 4QJ3A 5FTKA 1OIWA 4B3DA 3OHMA 3ZH9B 4A0GA 2A5DA 2QAGA 4DLUA 5JJIA 4GMXA 3QF7A 1G5RA 2REBA 2VP2A 4PQRA 3BC1A 4GT1A 3L2OB 1L2TA 4QGAA 4DDVA 3EAQA 3MD0A 4TL8A 5CB8A 4Q1CA 3V9PA 3MWYW 5JHHB 4RCZA 3BFKA 4AC9A 2QBYB 1SVSA 4B74A 5FOTA 2RGXA 4LV5B 1JPNA 2O0JA 3TSOA 2ZE5A 5JMTA 1XDBA 4KHZA 1VCOA 1EG7A 1NVVR 1JPJA 3T1TA 4HDQB 2ZRDA 3NVAA 5GVSA 3DZDA 2H17A 4L16A 1KK3A 1WDTA 3SBDA 4MDFA 1X6VA 2QQ0A 2B7BA 3QKUA 4Q7MB 3K09A 1KAOA 3HR7A 3KKMA 2FFQA 2A78A 2ZRKA 3FPAA 4LY6A 2ZE6A 1DADA 2W0SA 1FOEB 1W0KD 3ND8A 4I4LA 2OILA 1I4TD 1IN6A 4ZO4A 4L4UA 3AF2A 4R98A 4TT3D 5EP2A 1FL9A 5KHOC 3K09C 4Q21A 1NY6A 3DPUA 3IHWA 3E2IA 4V0NA 2P5SA 3DM9B 3SJZA 1ZMXA 2CNWA 2CDNA 3A1SA 1HA3A 1T6NA 2WMOB 4BZQA 1MRSA 2ORVA 2OFOA 2Z0MA 1WBBA 1JECA 2BHRA 3SBEA 5C4GB 3A1VA 2WJVA 2YINC 3ADBA 3TQCA 1H8HA 4OHZA 2CCJA 4Q02A 1AK2A 1ANKA 1BH2A 3I3SR 2QL6A 3SYLA 3VHXA 1GNPA 4ZCMA 2P5TB 1GG2A 5GVRA 3CO5A 3T5DA 4KU4A 4BGDA 4D4KA 4KODA 4DCNA 3KKPA 5HE9A 4G5SA 3B1VA 2FWRA 3IPYA 1AGRA 4GOXA 2H1LA 1II9A 4D80A 4PO1A 5DN6D 4UXJA 1NBME 4JLOA 3B6EA 2IXGA 4QJ4A 3BH7A 1R7RA 3AKDA 4RJLA 4EIWA 2JLRA 2YC2C 2J9RA 4WAUA 1XEFA 5FL7D 2DR3A 1Z2CA 2R9VA 4AURA 1WQ1R 3GLFB 3VKGA 4X8HA 5JI2E 1IAQA 2IYVA 4IVRA 3GJ5A 2WVJA 4C0BA 1II8A 1OSNA 4TZ6A 2W6JD 3QENA 4L8GA 1PLLA 2IS4A 1P6XA 4QHTA 1GL7A 2ZTSA 3KFVA 3I32A 4JL6A 1JR3A 3TW4A 1NRJB 2GA8A 3LBIA 2FH5B 3MGCA 4GBMA 3TKLA 2ZJ8A 2QP4A 1XZQA 3SE0A 2FMXA 3DO6A 4JYCA 2ZRPA 1HE1C 3T1VA 5FBVB 1A7JA 1W48A 4Z54A 5DNYB 2GEDA 4DUGA 1NN5A 1W36C 2ZSEA 2FPMA 3BK7A 2PMDA 1DOAA 1DARA 1X8JA 4G1UC 5DI3A 1J8MF 4MKHA 1TAGA 1KI9A 2OCPA 4MYHA 1OH5A 1E32A 2IYXA 3ASYA 1SVMA 4G5QA 4M1SA 4Q4HA 4QNMA 4WXPA 1S3GA 4EPXA 2ANCA 2FU5C 4P33A 4B71A 4YONB 1JEDA 2ZS9A 5TVKA 4BFTA 2OBLA 2V55B 1SGWA 4URXR 2Q21A 4XJXA 4AG5A 2CK3A 5HKKA 5F98A 2W83A 2EFDB 4HAXA 4PSVA 3NBXX 2WSMA 4TL7A 3K1JA 721PA 4F4IA 2F55A 3D31A 4LBVA 1E9DA 2GCPA 5EUMA 2EFEB 2ANBA 4Q7KA 1XFAA 2IW3A 1PJRA 4W9MC 3AF3A 3K0AA 3K0AB 4LBYA 4LI0A 1JAHA 4UJ3A 3QF4B 3ZLJA 4E22A 3OEEA 1U2RA 3SYKA 1OXTA 3U3KA 5JLJA 4UNNA 2ZRGA 4AYTA 4MKGA 5EE0A 5JS7A 2QBYA 3CZPA 3WMFA 1GFIA 4HB0A 3RS7A 2Q6TA 4FMCF 3WBKA 4Q01A 4US1R 4LCBA 3RHFA 1AN0A 2V7QD 4JS0A 1N5KA 2ZJ5A 3IO3A 2QTHA 2ZJ2A 2OFWA 2KBFA 5UKDA 1UBEA 2NGRA 4YDSA 3ZIAA 4B76A 4C3ZA 4D6PA 2E1RA 4YDHB 4I1UA 3GLHA 5EE9A 4M22A 1N5IA 2VEDA 3KKOA 5G3ZA 1X3SA 5BYJA 1PUJA 3W3AA 1ZU5A 1XEXA 2IYUA 3LXXA 1M74A 1IBRA 3GLGB 2L0XA 4AIIA 3MWKA 2FN4A 2QI9C 4JLKA 3BAFA 3OF5A 2AXPA 1F60A 5KU1A 4V03A 1E9SA 1T3HA 2E9SA 1G20E 2CVFA 2GRJA 2WKQA 4DWJA 4F92B 1CF4A 1Q57A 1E1RD 4JBXA 1ZC4A 1E1RA 2NIPA 3GMTA 4Q1BA 2HV8A 1G6HA 4CIDA 3BH6A 2H57A 4GP6A 4EDHA 3FWYA 4DRZA 3L8ZA 5KO2A 2QRZA 4MH0R 4OQMA 4BRUA 1EFHA 2QMHA 4TTRA 2IXFA 2CHVA 2P6RA 1XXHA 4EPVA 3UXMA 2YZ2A 4BFUA 3BOSA 3MJHA 2OESA 1SVOA 3OEHA 3R9XA 1HTWA 1E0SA 4HLUA 3CX6A 4TQAA 4RZUA 3GLGE 1IXZA 1LY1A 2FGJA 1AZSC 4JJZA 3ZQJA 2PLFA 1OXXK 2QT1A 4MRRA 4MYCA 2Z83A 1C4OA 4QNRA 3TNFA 2O8FB 2X2EA 4HSEA 5FOWA 2NPIA 3A36A 3W3ZB 4B34A 3EPHA 2XEXA 2WWXA 2ZITA 2ZXUA 2ORIA 5G3YA 4LUCA 3CPJB 1YE8A 3AVOA 4XVQA 3L0SA 4W7SA 1SVWA 1F2UA 1UEJA 4KFUA 4PHFA 1KSFX 5AR1A 2W58A 2VPPA 3HPRA 2F6RA 5AJXA 1SKYB 3GEHA 1W1WA 4C0AC 4B35A 1E9FA 4D0LB 1N5LA 2BBTA 1Z6TA 3OFND 4US0R 4C0SA 3RANA 4PC3A 1S1MA 1SULA 2BBSA 2CE7A 2MSEB 3CW2A 3TAUA 1G8HA 4EFLA 2AR7A 3GPLA 4OL0A 3ZVNA 4PPFA 1QF9A 3BB1A 3TIFA 1Z28A 1U0JA 1PLKA 2WV9A 2C78A 4JKIA 3AUXA 2J0SA 4RKEA 4DSNA 4I1SA 3L8YA 5E4FA 4GFDA 1VMAA 4OHYA 2ERYA 1YRAA 2FFBA 4RZ2A 2QG6A 2WJJA 3OZXA 3TAHA 3W6OA 3M6AA 2CLSA 4P4UA 1QHXA 1V43A 4EUNA 2JJ1D 1BS1A 5DLQC 5IDVA 2NMVA 3QVUA 4PAQA 1Q22A 3RLFA 2E87A 1NNEA 3I5XA 5FR1A 2FFAA 4YQFA 3KTAB 5F9HA 2HT1A 1IQPA 4M1WA 3EARA 5K8UA 2QMOA 3JVUA 3QKRA 2QZ4A 4P0TA 4P4SB 3WMGA 4EKDA 1YR9A 4LHZA 6Q21A 4WXRA 4F93B 5F3WB 4Q47A 3S1AB 2IBMA 4Q4HB 2J0UB 1G41A 1WA5A 4FWTA 4HLQB 2OLKA 2ZJYA 1N0WA 1VYTA 4DHEA 1DVRA 2ASEA 5KPJA 1HYQA 4JLNA 3VTKA 4OQNA 3UWKA 4B3FX 1H65A 4N0EA 2FV8A 3C41J 5L3RA 1QG4A 2Q9AA 3EIQA 1EFRA 2J45A 4IEIA 2IYRA 2V6IA 5AUNB 2GCOA 5G53C 5LB2A 2F3TA 2DWQA 1OPXA 1U8ZA 1NSTA 2IHYA 3NG1A 3PUVA 2FEOA 1MT0A 1YR6A 1ZCAA 5DGXA 3DMNA 5EE5B 1C9KA 3PENA 1RRPA 3ZS9A 1RW4A 3AVWA 5KSOA 3GJ7A 2I1QA 1KJZA 4AKHA 3OIWA 4JVSB 3FHOA 4M0LA 4RFVA 4AG6A 4DCTA 2OZEA 3KQHA 1OIXA 3B13B 3P20A 3BFVA 2A5YB 3WNBA 3KB1A 4KXFB 4EPTA 2IS2A 2NZ8A 2ZJBA 3LVQE 4PAMA 3FHCB 3SJCA 1A5TA 4ZPXA 3NEYA 2WMNB 4GOKA 4F91B 3KKQA 4K8OA 2QP9X 1SXJE 3NEJA 4JL8A 2QQEA 3RS2A 2BJVA 4Q03A 3UG6A 1E3MA 1OFIA 1U9IA 4B48A 4QJ5A 3GLGA 4A2PA 1N6NA 2HLDA 3LVRE 4C2TA 3CWZA 1E79D 2HLDD 3CF6R 4BECA 3GP8A 1UDXA 5D3MA 5D3MB 1SXJA 5J4HA 1X8LA 2GNOA 3AP1A 3B85A 1AJEA 5AJYA 1R0YA 2XZPA 2ZYWX 4A92A 1RIFA 3OE7A 1X86B 2VSXA 4M1OA 4Y0VA 5F2EA 1U99A 4TTPA 2OG2A 1U0LA 1Z22A 2XZLA 1TTTA 3WNCA 5CLQA 1SXJB 1KZ7B 2GZDA 3QNUA 3CX7A 2PEYA 1ZD1A 3GLFE 2B8WA 3B78A 1T3SA 4GPTA 1I4DD 1JI0A 3WHKA 3Q8XB 2JIZD 4PTLA 3B82A 1NBMD 2V4ZA 5CITA 1FW6A 3LAWA 3U3JA 1M8PA 1UBGA 4MITA 1AGPA 4WA7A 4Q9LA 1NKSA 2GXAA 3QG1A 5CLLA 2ZYUX 1Z83A 2V9PA 2OCAA 1R10A 3H86A 4MQBA 3UMFA 1XJCA 2P2LA 1XCPA 3B9PA 3TUZC 3VAAA 4D4JA 1A2BA 3I62A 3M0EA 5EE3A 3I1FA 2HUPA 3VR5A 2XXAB 1JQLB 4RD3A 5GJCA 1Z08A 1G3UA 3IDQA 5AJZA 1OFUX 5KSPA 3W5IA 1OJLA 3QY0A 4Q4JA 5C1BA 4NYMQ 1T5IA 3DKPA 4UJ5A 4NYMR 2A7QA 1M6NA 3ZIAD 5P21A 3X1ZA 5M04A 3N2IA 4PAOA 4ZI3A 3WRYC 4KCGA 1B0UA 2G1JA 4MUBA 2ZVPX 4MGKR 3RRZA 2WJHA 3L82B 4JZKA 2PEZA 4TYQA 2GILA 5KSZA 5SZKB 2OCYC 2OLJA 2OFXA 1RRGA 2EW1A 2ZI6A 3NBYC 5KTYA 4W5WA 3EIHA 1T3LA 2D7DA 5IRCD 1G18A 1AA9A 4ZI2A 1DS6A 3TGPA 1KSJA 1OV4A 4Q19A 1P2TA 4R71A 4IDPA 2FSHA 3THWB 1GKYA 4B3XA 2UVQA 4LOAA 3TR0A 1UPTA 5FUVA 3VNUA 1TMKA 1XTJA 1Z0IA 3LDAA 5E95A 1BMFD 1LS1A 3N5CA 1NI3A 2O8CB 1SVIA 1IY2A 1TF7A 2C9YA 5TMPA 4JIMA 4P3YA 1SKQA 2FZ4A 4EFMA 1XEXB 3PCRB 1BYIA 4V0ME 4ZKDA 1DE0A 1G16A 2R2AA 2Z4SA 3A58B 4LSGA 4PHTA 1XD2A 3GEEA 1KK2A 2AD5A 1RRCA 1J7KA 2ZSBA 1YZNA 4Q5IA 1Z8FA 1Y3AA 2GF9A 2ODBA 2KWIA 2G83A 3FMPB 4A0HA 1WXQA 3H2YA 3CRW1 1HUQA 4YLGA 2C98A 2GDJA 2YVUA 3Q9LA 3RS0A 5GJBA 5GADl 5HTKA 3CRQA 1UKZA 1VCMA 1MOZA 2CNWD 4Q4LA 4IDHA 1P9NA 3EXAA 1DBSA 2IEYA 1KJWA 3QPUA 3CH5A 1R2QA 2DFKB 2YV5A 2GF0A 3KQLA 4DSOA 4ON9A 3FHTA 4YMSA 4ZIRA 2GJKA 2ORWA 4NMMA 4R2IA 2JIZA 2OE2A 4I1OA 3RWOA 4LK2A 5CK4A 1UKYA 1XEWY 2ZANA 3SYNA 1XWIA 1TU4A 4NONA 1ELOA 1VYUA 2ZAOA 4QBHA 5L3VA 1GAJA 1UFQA 4A6XA 1CTQA 1KMHA 1LW7A 1NKTA 2CHQA 4NYJR 4TLEA 3LWNA 3O8DA 5FR2A 4TL6A 4OYHA 3R7WA 3GLFA 2AFHE 4PHHA 3GQBA 3NC0C 4FINA 3IILA 1M7HA 4V0KA 3UANA 2J3EA 1ZBDA 2JLVA 4BLRA 2XNDA 4TMKA 5HCNA 3R7WB 1N6HA 1OH8A 2UZ3A 4XVRA 1KMQA 3FYHA 2DFLA 4MYUA 4QG7A 3U5ZB 4M1YA 4CEHB 2PCLA 1ZYUA 3MWJA 1ZUHA 1SVKA 4KLZA 3REGA 4KLNA 2JLXA 4A15A 2V3CC 2EFHB 2H16A 3MCAA 1TEVA 1X1RA 4TQUS 2MSCB 1FUUA 1L4YA 3BXZA 2P67A 3EPJA 3R9IA 2LKDA 1M7BA 3Q5EA 1L7VC 3GJ6A 4URWR 2LWIA 1VHTA 5H1YA 1W4BA 4ARZB 2HXYA 3D7MA 3IGFA 3GJ8A 5CJPA 3T15A 1YHNA 1QHSA 4Q9JA 4D4LA 4OI2A 5AJVB 4XTRA 1IN5A 1ODFA 5KDLA 3FTQA 4ABYA 3SQWA 2IUSA 1LF5A 4TYNA 1R0ZA 2OO7A 3UK6A 1ZJ6A 1GM5A 2ZYVX 2O8BA 3JZAA 1S0UA 2CVHA 3T5GA 2I3BA 4B2LA 3V4RA 5FH9A 1N6IA 1E96A 2JEOA 5FPKA 4V0LA 1P73A 2VYFA 3KJEA 1T8TA 4LX0A 3HU2A 1XNJA 3B1XA 2FZLA 3T34A 2HYIC 2SHKA 3CZQA 4LHYA 2F9LA 4N1AA 3QVVA 2YWGA 2ZRHA 1TF5A 3BJIC 4NCIA 3C8UA 5SZIA 1G21E 4QOSA 5KNBA 3SU8A 3H1TA 3RS3A 3QPVA 2IC5A 1KDPA 1S9HA 2B21A 1D8TA 3Q7QA 5J4VA 4ASUD 1E0KA 3EZFA 2O8DB 2GK7A 2RH5A 4TN1A 5B64A 1FX0A 3GFPA 2VP4A 3C5HA 2MMCA 4O25A 4UNRA 5FUYA 4QGGA 4I99A 1P72A 5C4MA 2GAOA 3BB3A 1KO1A 1PV4A 2O52A 3DDCA 4KO8A 3D8BA 4URZR 1G7CA 3TE6A 4TMXA 4RD2A 2ZE8A 1UM8A 5JWRA 3DM5A 2QAGC 1ZIOA 2WPDA 3CR7A 1P2VA 2F9MA 4X8OA 3K53A 2XJ4A 4TYWA 1RZ3A 3CNLA 3AP3A 4CF7A 4H1VA 1EX7A 1TL7C 2R8RA 4KFSA 4UXIA 4DVGA 3AEZA 4IDNA 4FIDA 1N5JA 4LHVA 1BOFA 1FTNA 1D2NA 2FSIA 3OIVA 4QBFA 4D0NA 1BO6A 3A4LA 5JRJA 2WOJA 2ZQ5A 2ERXA 2VSFA 3K0FA 4RD0A 1R8SA 3HYRA 4TL9A 4E07A 4NCHA 3QUSA 4HAVA 1G9XA 4HDCA 1N25A 2C77A 3NHBA 4JVMA 4S2EA 3ZJYA 3RS5A 3KQUA 3AKEA 4PR0A 5AWFC 2C99A 4DLXA 1QBKC 2W0MA 3HPQA 1VG8A 4B32A 3U7GA 1H8ED 3JVVA 1LNZA 2ZR9A 3LLUA 2J1LA 3U61B 1FP6A 1TQ4A 4HB3A 4O2LA 1FNMA 4DIEA 1F5NA 2P0EA 3PXGA 3IBYA 4B3CA 1GNQA 5KOYA 2ZI7A 3NIBA 1G3QA 2HCJB 5FBWB 3RYTC 1W44A 2F43B 1ZAKA 3HU1A 5HCIA 4TSFA 3TSWA 5HR5A 2IYWA 3ADCA 5CDFA 3QI2A 4L5BA 4JSYA 4OHXA 5FBLB 4ESVA 2CHGA 2Q3MA 2GZAA 2D2FA 3KFXA 2W2XA 1KO4A 1OXVA 4G5GA 2HJGA 3H84A 5LD2C 4KVAA 5B57C 2HYDA 5L8VA 4QM6A 1CRPA 4LC0A 4KVGA 4P31A 3WHLA 2DFTA 2BWJA 4PFSA 2K5UA 2DB3A 5DO9A 3PUWA 2VP9A 4LBWA 2VHTA 4XH9B 2AWNA 1U90A 1WP9A 2YWHA 3AB3A 3I61A 4CEIA 1Z47A 1PZNA 1E9CA 5CIWA 4B3BA 4BLSA 4A36A 2O5VA 3ZS8A 3HWSA 1FTSA 1II0A 2GWHA 2QM8A 1OW3B 3PVSA 5FPSA 2IYTA 4NYIR 3WRXC 1KIMA 1DO0A 1OKKD 2ODEA 4RD1A 3MAAC 2WZQA 1E2IA 1KDRA 2RKOA 1BMFA 4A2WA 2QM7A 1NG9A 5L3SA 4GDFA 2F1JA 2I4IA 2PH1A 4PSKA 3VR4A 5IT5A 2J41A 3OIUA 1FQKA 3AGQA 1U81A 5IF9A 3DL0A 3K9LA 1SQ5A 2J7PA 5BXQC 2NZJA 4PX9A 1J2JA 4GSYA 1K5DA 1VCIA 4MGZR 4K81B 4NHOA 3T1QA 2YYZA 1NMZA 2QMEA 4EJSB 2JJ1A 2PX0A 3BORA 3NH9A 5TV2A 5CM9C 3UWOA 4D81A 2NO1A 3SC3A 2VA8A 1JBKA 1G8PA 1YZQA 4AI6A 1N2CE 2AWOA 3QIAA 1E2JA 4A4DA 2QGZA 2ZRLA 5JEDA 1IXSB 5JJKA 3PR1A 3PFIA 1TF2A 2ZYTX 3R8CA 4MKIA 4HAUA 1NMXA 1U0HC 2ZSFA 2RGCA 2JCSA 3AP2A 1E6CA 2F3RA 2PMKA 1NLFA 3VHLB 4B3GA 1S8FA 1COWD 2UZIR 3FB4A 5JS8A 4HLUC 4O0MA 4TMTA 1KHTA 2BC9A 4A6PA 1NN1A 3U7FB 3CNNA 1ZUIA 1XP8A 2VO1A 3X1YA 3GJXC 3ZYCA 4NTZA 5SZHB 2ZE7A 1TQ6A 1ZM9A 5DHAA 1Y63A 2P6NA 1NG1A 2HEIA 2VHJA 5CIQA 2WBLC 3TW8B 1KZGB 1XXHE 2WIBA 4P4TA 1AS0A 1M7GA 4AKEA 2A5FA 4HYYA 4Q48A 3U4QA 4GMDA 5E7IA 2ZEJA 2OUKA 1J8YF 1W4AA 1XD9A 1OHHD 3DKVA 4CEHA 1II8B 3CBQA 3MMPA 3TK1A 1IJFA 1IY1A 1DAKA 1YU9A 2C8VA 821PA 5IHPA 1S9DA 1CLUA 4QC2A 4JLPA 2JLYA 1ZNYA 4PQYA 2BCGY 4E03A 4Z51A 1RJ9B 1FPMA 1E0AA 3U2QA 5KNDA 1G3IA 2JDID 3RWMB 5AUOB 3W8RA 4Z8YA 2QENA 4IRUB 1KK1A 4TLBA 4HZUA 1ESMA 2IWHA 3UKDA 4KYIB 3KX2A 3ZD6A 4DSTA 4PPNA 3PITA 1J70A 3GJ3A 3K0SA 4IVPA 4IVQA 3RDPA 1S2MA 3DEFA 3THOA 1YZLA 5CYOA 3X1DA 4B2PA 3SHWA 2A3RA 2RGEA 4JKYA 1CXZA 1DAIA 4LPKA 1TU3A 3OEED 2B8TA 2GAAA 2GJAA 2GKSA 4WZBE 4PPGA 5JFGA 2BCJQ 3E5HA 2RHMA 4G5OA 1XPRA 1BYUA 1ZM2A 1R6BX 4LV6A 3PEVA 1ZU4A 1S1CA 3RVBA 4TYPA 1R4AA 1Q3HA 2RGGA 1OKKA 1RVDA 1ZD9A 1ZVQA 2RHDA 4M1MA 1RRFA 4Q1DA 3EPLA 2IYYA 3KDSE 3D3QA 1EESA 1G7RA 1N6KA 4MRSA 3AVXA 2V6JA 1Z0DA 2IF2A 1NVUQ 1KYIA 4LJ5A 3DHWC 1LV7A 2ZRJA 1CU1A 2YHSA 4G3XA 2RMKA 2YC4C 1E2QA 1GKIA 4UXHA 3UMSA 4D26A 1E2DA 5J4LA 2RGDA 4YC7A 4IW3B 2BV3A 5DYGA 4Q7LA 2FNAA 1WE2A 2JLSA 2FDCA 1OFTA 1ZNXA 2XJ9A 4L15A 1L8QA 4ASUA 1AQUA 4OHVA 1GOTA 2RGBA 3QF4A 4QBGB 2FSFA 3VX4A 4EFNA 2G9NA 4DEYA 5FFMA 3K70B 1ZM7A 3N70A 4LPSA 3LQRA 4MUAA 3CLVA 1EK0A 1DO2A 2C9OA 4LJ9A 4PZLA 3CIOA 1E2HA 3B2EA 3I5YA 1T91A 2WKRA 1ZINA 1GRRA 2GXSA 4PC7A 1X8KA 4JLJA 5G41A 3EZ6A 3T1OA 1A2KC 1EX6A 3CM0A 4Q4JB 4A0RA 4B47A 4JLBA 3K9GA 2ZJOA 2JDIA 1NVWQ 3W8NA 3WMEA 1YZUA 3OEHD 2NPFA 3SQXA 3U7HB 5A4JA 3ZVRA 4EQ6A 2YOGA 4QKQA 4V0OA 4OKSA 1JR3D 1QG2A 1UEIA 1Z6AA 2WJYA 3T12A 4CEJA 1P9RA 3X1WA 1GNRA 2JLQA 2BDTA 4FCTA 4CYMA 1JJVA 3VKWA 4DDUA 4RD4A 2AFIE 1CR0A 2QRNA 3HJNA 2VP0A 2VF7A 4M9XA 1GUAA 2N46A 2F43A 3FVQA 2AN9A 4TYYA 2N1BA 2VL7A 2CLDX 1T5LA 1N6OA 3P32A 3FKSA 1I2MA 2BOVA 3VR1A 5AUPB 4JLDA 2WTUA 2GVDC 1ESNA 1NIJA 1F3OA 3HU3A 1EWQA 2D4HA 3IQXA 4D2IA 2FX3A 4XOIA 4DXAA 1YZKA 1FMLA 5FBRB 1RE0A 2PZEA 3IO5A 5FPHA 5EJEA 4OQXA 2R65A 5C46F 1KI7A 1LTQA 1DAGA 3HDTA 3BBPA 4NCKA 5IK2A 1IM2A 1P61B 4IXMA 2QE7A 3KKNA 3U6BA 3FGNA 2HF9A 4G5RA 1HURA 1WMSA 5TARA 3C4JA 2N42A 1MABA 3A1WA 3C16C 3W6NA 1UAAA 5C18A 2BEKA 2GEVA 5HPYB 2Z4RA 4W5JA 1SHKA 3SOPA 4D25A 1S3SA 5DYIA 3EX7C 1W46A 2FF7A 5CK5A 3D6TB 1SVLA 3KJGA 4XD7A 3BFXA 2IK8A 5AJWA 3CX8A 3TMKA 5BN4A 5BN5A 4BWYA 3A37A 1YR8A 5K8IA 1XTSA 2W2TA 2ZR0A 5SZJA 4URYR 5K8LA 2A2ZA 4CT5A 3VKHA 4HZUB 2CK3D 3LX8A 1RKBA 1Z5ZA 3KJHA 3P4XA 4U5XA 4UNSA 4N0DA 5FOUA 3RABA 4I81A 4QRHA 1TQDA 3LY5A 3OESA 2J59A 4H1UA 4HAWA 4MDEA 3B1WA 3SJAA 1ZCBA 3LBNA 3CNOA 1Z3IX 1OT3A 2OBMA 1AIPA 1XMJA 1YZTA 2NOAA 1HV8A 4WZ6A 1S4QA 5E7MA 2ZUCA 2REOA 5E3HA 2WWHA 1W0JA 2R62A 3LO5A 3WNDA 5JWOA 1HH4A 3K0EA 3QKSB 4NKRA 4ZCLA 3CRRA 2AKAB 4M1TA 2PX3A 2QN6A 2WOOA 3THYA 5FL3A 5FI1B 2Z43A 2BKUA 4OI4A 1W36B 2IEZA 1I4LD 1NP6A 1Q0UA 2YNMA 2ZU6A 3SHFA 1US8B 1US8A 1KGDA 2MMGA 3LW8A 2IHBA 2C04A 2Q0HA 4C0LA 2J5XA 2R6DA 4NPHA 3L0OA 1G64A 1VG9B 3EA0A 5CM8B 3BGWA 4FCVA 2IT1A 1QHNA 1Z07A 1G5PA 2PJZA 4M9QA 3UIEA 1DPFA 1G17A 3GJ4A 4LYJA 4O2RA 1OB2A 1UJ2A 1FMJA 4URUR 4ZDWA 1IN8A 5GJWC 1WF3A 1ZM4A 3QKRB 1AS3A 4P4SA 3SJBA 4HLDA 2X2FA 1TEXA 4TQ9A 2X19A 2ZAMA 3AVPA 3DMDA 3VR3A 2BVNA 1HT2E 2KJQA 4HI0E 3P4YA 1XCMA 4Y0AA 4QGFA 2ZRMA 4JLAA 2D7CA 2ZRNA 2PL3A 3NWJA 4RSGA 2XXAA 2WJGA 5EZ6B 3OAAA 1KAGA 3A4NA 3IHLA 4M1KA 1W7AA 2P3SA 3F0TA 4KSCA 1YR7A 4TLAA 5A0FA 3W9YA 3AUYA 4WOPA 4E09A 3KUDA 4RCYA 1UBCA 4ZIRB 4LRWA 3WYFA 4YMVA 3VR6A 2BMFA 2XSZA 4JJKA 3I73A 2G88A 2NQ2C 4ZKEA 3QPWA 2G77B 4HB4A 4C9BA 4CVNA 2QSZA 2ZIAA 2GJ9A 3Q3JB 3CPHA 1D6JA 1E2MA 2ZVQX 3K70D 5EUQB 3GEIA 4BFZA 3W90A 2W6IA 2PBRA 1KKMA 1KO7A 2HXSA 1KTVA 5GJVC 2CCGA 3BIFA 1Q3TA 5LPNA 2W6ID 2G0TA 5K8TA 1XPUA 3KXKA 2J46A 4B43A 3L0PA 3PIRA 2YKGA 5JHGB 2VLIA 3LXRA 2BBWA 2DFNA 4BZXA 1XJ0A 1CEEA 3I72A 1IHUA 1CJKC 2CMKA 1HQCA 3I92A 4HATA 1EWRA 1GSIA 3FMOB 3M4YA 2CL0X 3AVUA 3B1ZA 1OH7A 1T4GA 4LWZA 1XBTA 4J0QA 3WY9A 5TB5A 5JEEA 3NKVA 2OV2A 4BQSA 3KJIA 4OHWA 2GJ8A 4PC1A 1JXMA 4M9SA 4ACBA 2XTZA 4AKIA 5DIFA 3JZMA 2D06A 4Q18A 3TQFA 2V1UA 1AM4D 2UKDA 4Q00A 2QNRA 1CJTC 1G3RA 3FFBA 5JBQA 3GFOA 1E2GA 1G19A 1Q44A 1AS2A 1TUIA 1XXHB 1M34E 2P6UA 3BB4A 3ND9A 3VU9B 2CBZA 1E0JA 2WKPA 4JBWA 1F2TA 1YQTA 4FCWA 1XMSA 2OM2A 3I8XA 4PQFA 3KQKA 4UNQA 2ZS8A 3QXHA 2GVZC 1XTQA 4AK9A 2O8BB 4DLYA 1W0JD 4ILEA 1VDZA 1KOFA 2O0KA 5KDDA 1G4AE 4DDWA 2ZUDA 4HZIA 1XX6A 3WXMA 4KV9A 4KFTA 5BYKA 4WZAE 2G3YA 3K9NA 2B7CA 4BRWA 2QT0A 2QY9A 4XTCS 1CS4C 1KKLA 2NO7A 2GBLA 2XTNA 2IL1A 3CB4A 1UDWA 4A1FA 1KSGA 1LB1B 3IUYA 1TNDA 4IFEA 4PZZA 4KSBA 1F2UB 1N0UA 1OE0A 1KI6A 1GILA 4OI1A 5FI0B 3EA5A 1P75A 3GFTA 1U98A 2CXXA 3KZ1E 5BN3A 1A4RA 4F7WA 5CYPA 2EVWX 2GCNA 4DSUA 1Z2AA 2BMDA 2J0QA 4PHGA 4CDGA 3U44A 2VSOA 3IEUA 2YOFA 1E69A 5KPDA 1TX4B 2FOLA 3M1IA 4HAZA 1QVAA 4B6EA 1E2EA
chains in the Genus database with same CATH superfamily
1KY2A 3NORA 4GP7A 4KQEA 3RAPR 4XDGA 2AUTA 2QRVB 2XHZA 3GLUA 4F45A 1Z8HA 3BDVA 3LKZA 4B3TB 1X1SA 3R6GA 2BZSA 2X77A 2QR3A 1XMQB 1NR7A 3EVFA 4B75A 2V8BA 2AJTA 1K7EB 2JLZA 5NULA 5D5HA 1A71A 2BLLA 3IEKA 4OBWA 1Y8RA 4RVUA 3G85A 5HBRA 4CMEA 5KDOA 3I5UA 3R4CA 2HEGA 4FN5A 1XU4A 3GD7A 3JD2A 4CE6A 4EJSC 5GOZA 5CDFE 1AG9A 1YR2A 4DPKA 1QVWA 3EZXA 2EKPA 2XNSA 2GPAA 5F5NA 2EP5A 3WYEA 1PW7A 3S1AA 1NJFA 3RODA 1DT5A 1IHDA 1PGQA 3ZHCA 4CL8A 5G0WA 1M2OA 3ZCPA 4JLVA 1ULAA 5DK6A 3VTZA 4RVCA 1AMOA 1XQWA 1YMQA 1SQFA 3BHIA 1OPRA 3KTAA 4FGJA 5REQB 1B74A 2HD4A 1W6RA 1BH6A 2QDKA 1XDDA 3CUUA 3RSOA 4LZZA 4X7RA 3LQ2A 3BRCA 2IUFA 1M2OB 2C9CA 4L9RA 2CZCA 1MOSA 1EGAA 2BKEA 3O47A 5DF1A 3TCXB 5CA1F 4O3MA 2VRWA 1SB8A 4WNAB 2Q41A 3QOFA 1EDOA 4Q05A 4YRPA 2FGKA 3IPLA 4FFVA 1PSDA 5CBPA 1ILEA 3FDIA 3PL5A 1JHVA 4RYLA 1N2SA 2B8JA 4J03A 3UV6A 3NHWA 1CUHA 5IKOA 4B4UA 4EUEA 3AVVA 4DB2A 3SIPA 8OHMA 1SXIA 4UTXA 3WIDA 5JYBA 4I4TA 5DYTA 4TUYF 1DTWB 3G82C 3DEAA 3X1KA 4CCSA 2Q5EA 2PGNA 3VV2A 3K5IA 1OI7A 3KPYA 4HEJA 1DDOA 1TD1A 3IQWA 1XLWA 2IQ5A 2J9YB 4DOMA 1NRWA 1WXFA 1IOZA 4HNRA 2LD4A 4A6EA 3BJEA 4QDTA 1N92A 1LPNA 2C96A 2ZZKA 3I09A 5CJ2A 1DQZA 2VXCA 2WT8A 3PD0A 4KQ2A 3NCTA 4JBLA 4W8HA 4KIJA 1YRHA 2H18A 1NPYA 3MCZA 4WLUA 5K3SA 1DX6A 1ZEJA 2JFZA 1G1MA 4A8JA 2EKLA 1Y5IA 2EYQA 3H4IA 1TCAA 2X5JO 3JR7A 4U2GA 4WEQA 4C30A 1N6RA 4WCDA 5MGNA 3FF4A 5AIAA 3EFHA 3ZLTA 3EG5A 4RA9A 4OHBA 1BD3A 3NUZA 4YXWD 3AI1A 3K96A 3U7QA 4BMYA 1OVGA 4AO7A 3DMHA 2RFLA 4FMPA 3CCCA 3M3HA 3I6QA 5J1SB 5IN4A 1ZWLA 1IY0A 1M6HA 1QF7A 4CL0A 2HU7A 4WKGA 3OLVA 1GIAA 4GDMA 3F90A 2FA9A 4J0JA 2FUEA 2V1XA 1GQYA 1ZGJA 4DG8A 1Z63A 2C2OA 4M8IA 1B15A 3EVCA 2QUBA 2OAP1 4FGLA 1KI6B 2AYYA 2FCRA 2HF8A 2QORA 1W96A 3EAGA 5F77A 3I5AA 2JFNA 3PC7A 1IONA 1A72A 3FKQA 1LV8A 2C58A 3H4MA 2MT9A 3F5FA 1E8MA 1ZO8A 4NEHB 2GBFA 3OWOA 1NN0A 2FG7C 4ZJUA 3ML1A 1OQAA 2JJ8A 4B6JA 1UH5A 3HS3A 3VZCA 3TX6A 5JCJD 1ZGZA 2RIPA 2CXNA 3BJZA 3CLUC 4HAOA 1KP9A 2DTXA 4P08A 1QANA 1XQXA 2RB4A 3NJ4A 4JDPA 3LSYA 3TL2A 1CETA 1O3YA 4R2HA 3L6OO 3P2KA 4GM4A 3VZRA 1HDRA 2GPSA 3JY6A 4IXWA 1WMFA 3B1YA 2O6HA 4IZIA 1UMKA 3IT3A 1JA0A 5JR3A 3IA7A 1J25A 4PFQA 3DBRA 4AYXA 5E7QA 5LYJB 4H7DA 3IUNA 4OAPA 5D86A 5DM1A 2O8EA 4OHMA 3PKZA 4JL5A 3ZJVA 2ZLBA 1XKQA 4RW0A 3SJUA 1WCWA 3X43A 4LHWA 2PRZA 1XAHA 5LXTA 1T35A 3K9QO 2OBYA 1WQ3A 3E1SA 5K51A 4CM3A 4K88A 4CKBA 4FMDB 1D6MA 1JLRA 1CQXA 4ES6A 1JNYA 4O4HA 1WSDA 3WRWA 2GAFA 5HBGA 3E81A 2Q1XA 4HF7A 4IOLA 4NEQA 3D8TA 3LCVB 4OQEA 4P7GA 4PY2A 4X1KA 3T7CA 3GJ0A 3IKTA 5KVQA 5LXTB 1K66A 4OK5A 4CGZA 1RI5A 1H2AS 2JI7A 3H65A 3HEMA 3IAM6 2VPIA 4TRNA 2X0DA 4AX4A 4LNAA 4C07A 4ZV4A 5JVDF 1L4NA 1R3UA 4UREA 3WIOA 4DB4A 1JHRA 1VA5A 1Y80A 3DDSA 1BE0A 4K0RA 4E2ZA 1L4LA 3H0CA 3LV8A 4JQOA 4CMGA 4A9AA 1X7WB 2ZRFA 1QCYA 3K05A 4M87A 2YN4A 3CWQA 3ZHQA 2EP7A 2VT7A 1SCQA 4NAHA 3BS4A 4CFZA 3QX8A 4FFOA 1VG1A 4FE4A 4YXWA 3O84A 1F20A 3C24A 4NU8X 4DUZB 2FFHA 2PKEA 2F1HA 1K08A 2TMGA 1BX3A 2R6JA 3K30A 4GRAA 4C03A 2NTYC 4XE5A 1EFRD 9LDBA 2WU1A 1DJMA 5FPYA 1D6SA 1HE8B 1BVYF 3HCOA 3WWPA 3E0XA 1PEKE 3F78A 2FYTA 4ARIA 3WK6A 3QBTA 1F8GA 3PTLA 1BZYA 3F6RA 2FSGA 3ETJA 3P52A 3CONA 2WWYA 4TS4A 4O8ZA 3EWAA 2WWRA 1Z0KA 2R7AA 5JZVA 1UMBA 3BH0A 4FZ3A 3AESA 1FVXA 2J5KA 4I19A 1T2AA 1JMYA 3W1WA 5FAXA 2CLCX 4CG3A 1AUQA 1IZYA 1INLA 4MCJA 4WEOA 3U56A 5EZ5A 3BCRA 5JBIA 2BZGA 1Z38A 3BD6A 1TO1E 3VAYA 3P2JA 4H3VA 4TMYA 3VZPA 1GWNA 5HS6A 3QXXA 4LDPA 5FJJA 3E9DA 4CPDA 5CCEA 3SG0A 5KTPA 2A5JA 4M99A 2Y1GA 2ZRAA 4YRCA 1JDVA 1VKOA 3C8ZA 4MPJA 3ROPA 3NAGA 4IF4A 1YVUA 4MYTA 1TM7E 3R9KA 3W5UA 2I7TA 1H4SA 2B20A 5D6OA 3LNCA 4ZI7B 3FCOA 5DT9A 3OA2A 3EWSA 4RFSA 2HNBA 2XOKA 4V02A 3O8BA 1KGSA 1TUGA 1YB4A 1MB9A 3AOEA 5IS2A 2DZDA 4UEQA 3ZK8A 3N05A 1JQDA 1QZUA 1NU6A 3TZEA 2AN5A 3BSFA 3PEYA 1BDMA 5JC1A 5HE8A 1DFGA 1QSGA 1G5TA 1KMHB 3GLQA 1XVIA 5BP7A 4UUAA 3FDZA 5KYUA 3VPBA 1P5JA 1Z0JA 3AQIA 1TI7A 2PS0A 4L4SA 4F38A 1E4OA 3V97A 1BQ3A 5KSWB 2WAAA 2Z6AA 2O2YA 4OQFA 2P9HA 2HSJA 2Q1UA 1L7XA 3LUFA 2GLTA 3TXYA 3BK1A 1EE1A 3ENQA 1AZTA 2H48A 3OLXA 4BL5A 5BWMA 1XMOB 4URVR 3E9MA 5EQTA 2Q07A 3DA8A 4EG3A 1YB6A 1FYXA 4CLOB 2BMJA 2VNHA 2QTVA 4LZNA 1C3JA 2CC2A 2WSIA 1BFKA 2YIVX 1V9CA 2OXCA 4FFDA 4Q66C 1E9EA 2GJSA 2EJBA 3D4PA 5EPUA 5EEHA 5BVGA 2IS1A 2HMUA 2CLOB 4IDDA 3ILHA 3QFHA 4M4SA 5B12A 3KU1A 4KRYA 2VHUA 4RKQA 1UR5A 5JDIA 3BWDD 4H08A 2R6GA 3DEJA 1PG2A 2WJ3A 4GOJA 4NG4A 1P3JA 4X3CA 2QVXX 4GYKA 1R0WA 1UFVA 1DT3A 3H87A 1DTEA 3B12A 1Z4LA 1YB7A 4M8NE 1H8HD 1MO2A 2R6FA 4Q4DA 5E1MA 4BNXA 2XB4A 1EFAA 2QW1A 2YWEA 2CHEA 3OTWA 4WUTA 5ADWA 3AV0B 2PZFA 3F8SA 3KQNA 1MZVA 1VLZA 2P2SA 3JQ8B 3P9KA 4HH3C 1YQDA 1I6LA 1GAEO 3G0IA 4ZYYA 4FDUA 3LUDA 3UQZA 4AVYA 2O5RA 3RT1A 1CBUA 1U6KA 4ZCIA 3DGEC 3VKUA 2FFJA 3IT0A 2IU0A 2W7TA 4EMBA 3MWFA 5H3LA 1PSZA 2XTMA 5JSYA 3AJ8A 4Y9SA 2ATXA 1VJ5A 2C9DA 2NVUA 2QMUA 2QRUA 1GGEA 2IF0A 2DSNA 2YNMD 3ASZA 3DZCA 2GYUA 2IYZA 2JANA 3VHQA 1QK5A 2HQSA 5KCMA 5HZGA 5EWJA 1ZHOA 1FXUA 2XNDD 2W2VA 2PG3A 3NIWA 3FOAA 2IV3A 1LBIA 1RQRA 1UMCB 3PJRA 1JYEA 4X8LA 5BOSB 4EUSA 1VI6A 1I9CA 3FWNA 4PRZA 2IZZA 4NFHA 1Y3FE 4R2XA 1JEEA 1XRRA 3GK3A 4PBSA 2W6JA 4BASA 4LRSB 2JAQA 1P1RA 1Y3BE 3BUSA 3C7DB 4QDXA 2WM9B 3ICVA 5MFZA 2AC7A 4R7TA 3NNSA 2AZ4A 4E21A 1LX7A 4EHHA 3HKCA 1QHYA 3UMRA 3VNQA 4C6HA 4J2TA 5U4XA 4WINA 1OXSC 1JTFA 2XMZA 3ICWA 1KR5A 4JX8A 1Z4MA 3LD9A 1RFLA 3A9VA 3AUJB 3PG5A 4R7GA 4DCJA 5COQA 4KX5A 4F60A 1PGJA 1R8XA 3CF0A 1SK8A 3G9TA 3PFWO 4CMIB 3HM2A 1XZIA 3NHLA 3V8MA 4DNFA 4QLOA 4DLWA 2JJYA 1C50A 2IDJA 2ZETA 3AQ4A 4R2KA 2GBCA 1X14A 3M4JA 1KO8A 1MRNA 3H3FA 1BDBA 4BMCA 5K7SA 2FPXA 1FYDA 2VJDA 3C3XA 3CT6A 4NDZA 4DE5A 2PGJA 3DAYA 5ELMA 4DCSA 2YMPA 1N2JA 6ABPA 2YZ7A 3JRWA 4QJBA 2D54A 3JR3A 4Q1FA 3SIWA 4Y9UA 4MR9A 1Q0PA 3UA4A 5JSQA 1PZEA 4YCAA 1SO8A 3NOQA 2A1UA 4R9UC 1TYBE 2QD4A 3D81A 3E1GA 1E62A 2D2IA 2ZU0C 2ZYRA 3LH5A 1Z33A 1OXUA 3MFYA 2O5EA 4EDFA 3N7AA 3AKCA 1NL3A 4R81A 1E9BA 1C3LA 1ZA1A 1U9IC 1UMBB 5EXTA 3RKSA 1AKUA 3QXCA 1DHTA 4L0CA 5IYZA 5FT9A 1NMYA 1Y6JA 3BXEA 3DCYA 4RXUA 4HMQA 1IZ0A 5KAPA 1TZBA 1LVGA 1P19A 5EYPB 4DLVA 1FDUA 4BAUA 3N74A 4O0LA 3B60A 3PQCA 4ZD6A 1YACA 2VF8A 1BU5A 3BRWD 4C01A 3FX2A 4LJYA 3UM9A 3MUOA 1N7IA 2BAGA 1USUA 3AF4A 3DYBA 5DGIA 2W2KB 4H15A 1P2UA 5DHFA 2WNIA 5B5SA 2QOEA 4CV1A 2O7VA 3VYVA 2ZUFA 1JG7A 1XTKA 4U6QA 4KXVA 1M5TA 4KIUA 2FSSA 3ZXSA 4JT8A 1YK1A 5LZ5A 3H5RA 1W0CA 2A9OA 1MFPA 3O2JA 4FWIB 3I4LA 2JGDA 1G3MA 1KZ9A 2NV0A 3OCXA 3QVSA 4XQ0A 3AZQA 2QQFA 3OCVA 3ABIA 3G2QA 5KWVA 1EGHA 3GYGA 5EP3A 2BDUA 4E2WA 1N9ZA 2Y9PB 5AXDA 1XZHA 2FQWA 3TZCA 1Z0AA 2QW8A 2CLEB 4XWOA 4UD2A 4EI8A 4UQLA 1JGTA 4OM8A 1D5CA 5IULC 3IFSA 4MGEA 4BVHA 3BG5A 4AP9A 2QVGA 2VVTA 3LDHA 5DXAA 1L4UA 1Z62A 1UKAA 1IMJA 2BCEA 1N4AA 3RTDA 5KYUB 4JXXA 2PJRA 1BGXT 2BRUC 5CXQA 3RKRA 4C0HA 2AL7A 3A8TA 4XD2A 2O3UA 5DGHA 5CFRA 2YOHA 3WQQA 1SBHA 2WAXA 3QLUA 5K01A 4KI7A 3BFJA 4YAEA 4FHDA 3Q0EA 1ZIDA 2C4UA 2X2PA 1IBLB 1YVDA 4NCNA 4DF3A 5B7GA 1J99A 2M6RA 4LJ8A 3TGWA 1VJCA 5ARBA 1X7ZA 3U3ZA 3L7OA 3LX6A 2VTKA 4P34A 1WP4A 1MNAA 1NU8A 2XUOA 4M7WA 4D82A 2E6KA 2FUG1 2C54A 2WABA 3G8BA 4YRGA 3GJSA 1R0KA 1MH1A 2ACVA 3DTTA 2ZJ0A 3EZ9A 3PEUA 3UPTA 2YVAA 1NQOA 1R0CA 2OT3B 2WF7A 3CURA 2RBEA 4U6SA 3RJTA 3Q3HA 2BMVA 4TLCA 4NL4H 1R0SA 4BGUA 4C7BA 2ZGVA 4DZZA 5TPZD 3E7XA 4FHZA 3FMIA 3DOFA 1SZPA 1QC5B 2OGWA 2V74B 2DUNA 1BHSA 1KZ4A 2AE1A 1U8AA 3BDIA 3MG9A 1I5OA 2RHHA 3EOBI 3QBDA 4Y1RB 2VC2B 2DM6A 3VR4H 3LWBA 1Q7BA 1U3TA 2C2BA 3G5UA 3TOVA 3DZ8A 3U3XA 1JIQA 1GUYA 1LK5A 2EHDA 1DJPA 5ALLA 3CRVA 1ZC3A 4J3NA 2CNLA 4WECA 1PZFA 3K0CA 3R40A 4JCOA 4PFKA 3D1JA 1DXHA 1EX1A 1HY3A 1VCHA 1T3TA 4A0SA 2GLUA 3SR0A 1F2TB 1EFPB 2PCJA 5DNUA 1W5SA 2WZBA 1ZA2A 2I29A 3QPCA 3DFFA 3W5IA 1A76A 4PYIA 1OLUB 1R9NA 3GU3A 1VXOA 4JVLA 3WB0A 1VJRA 1KQOA 4LNUA 4AJPA 2E4WA 4UE2A 5EQFA 1W4ZA 3KXIA 1LZLA 4WVFA 1UJ4A 1SCKA 2A94A 4BNYA 1BQ4A 2J87A 2J7KA 1NV9A 1OTYA 3OEWA 4BN0A 4ER7A 3M2PA 3O8OA 2OG1A 3CNEA 5JMWA 1PUIA 4F4CA 1U2QA 2AG0A 1U6JA 5HKKD 3A2KA 1Z26A 4EHAA 2XWQA 5C8ZA 2BM0A 1R8QA 4LJAA 1DFHA 4U39A 3ZN2A 2F00A 3OQNA 2OWEA 2BSXA 3HGTA 3VXKA 1IH8A 2NO0A 3V00A 1Q1ZA 5CDYA 1RQPA 3GMIA 3PYXA 2FEMA 1SQSA 4IM7A 2WYWA 2I1VB 2Q9CA 3HDJA 3KSMA 3KSAC 5ALEA 2RBKA 2V9CA 4NC9A 5IK2D 4F6RB 4ZDJA 1AKTA 1CRQA 5E1DA 3ZHOA 4EZBA 4IKEA 3G2NA 2X9GA 4O4JA 4R8KA 3DXFA 2H2DA 3IQIX 2WMDA 3UT5A 3LBHA 4LWPA 2JK1A 1G9SA 4MINA 1V26A 4UPVA 1W4LA 2EKZA 2BJHA 3WDKA 3ZVLA 4PLZA 3HWX1 5EJ9A 4E88A 5FD8A 2EQ5A 4ZJYA 2IH5A 2O2ZA 4PZEA 4AQYB 3IJPA 3N8HA 2X6TA 2WIDA 3QX3A 4OO3A 4N40A 4R7ZA 2DWPA 4MVJP 2EQBA 4DR5B 3V80A 2F62A 3H1BA 2XW6A 3BKXA 5HMLA 1L5OA 4D3XA 5DHPA 2B69A 4OJTA 2CXPA 5ALDA 2FY8A 2PFGA 1XZNA 1LPMA 2Q62A 3C7AA 2OO3A 3P7MA 5EIFA 2OZLA 5JDIC 4BFLA 6LDHA 3KEMA 2H8KA 1UM9B 3KETA 3HA7A 4ZGWA 1KO5A 1M0SA 1ZIPA 3PDCA 5AK4A 1G6Q1 1GGMA 4JMPA 2FMFA 2RHGB 2ZJFA 3OZAA 4KE7A 1I8TA 4R1LA 2ZUTA 2WFAA 3FR7A 3UCFA 2EP8A 3ZWNA 3SZRA 4BU1A 3DTVD 5ITSA 2EC5A 2PX4A 4W1PA 1NQXA 3F47A 4HXEB 2J48A 2GZHA 2VATA 2XWPA 4UNPA 5CTJA 5B6IA 1VKJA 1Z6XA 1T4MA 4RPJA 2ZJ1A 3L4JA 2GCOB 3R3WA 3I6ZA 4ZT7A 3U4CA 5M29A 3STVA 3U16A 3L4BC 5HZMA 3B9QA 5D51S 4O33A 5LZ7A 1GUBA 1NY5A 2R8YA 1UKVY 2QRMA 3IAHA 4BVGA 3BYZA 2R4UA 1JQBA 1BCRA 1XJQA 2VJKA 1BXGB 2YV4A 2B2XA 2HMWA 5IT0A 2YWCA 3OOEA 1QYCA 4UU1A 1QM5A 2JCYA 2I2XB 3IQEA 2Z30A 4Z4CA 3NC1C 1UBKS 4I55B 1Z4JA 3AEQA 5JAZA 1OB5A 2D1YA 5TNXA 1BJTA 3MWLA 3FCYA 1F0YA 1Q11A 2Q8PA 3IKVA 4XWKA 4DV7B 3FPGA 2C5AA 3E05A 3O8RA 4HWRA 1LH0A 3QXSA 1GKKA 2D74A 5FA5A 5C8YA 3SDBA 4ZHSA 2CFOA 1BA3A 3BQ9A 3FE2A 2ZDGA 1NLYA 2JGNA 4L3VA 1QAMA 4KBYA 5JISA 3EISA 4FCCA 2Q50A 2QLMA 3DONA 3PHLA 4GPBA 3N75A 5FUWA 3HP4A 2G9UA 3K2EA 4C0JA 1VI5A 3W2FA 3T9FA 4C78A 1NXTA 3N0XA 4QHSA 2C7OA 2WR8A 3FYUA 1AF4A 3B5JA 1ZXXA 3PNOA 3QUQA 1T0JB 1E7RA 4C4OA 3S1SA 3AT1A 3TPFA 3SN6A 3IV6A 4DEXA 4MQFB 5TY0A 4U7WA 1W5BA 3P2MA 3G23A 5CB4A 2GXUA 3K0BA 4B8ZA 1LF0A 1SD2A 1QH9A 1MXFA 3FI0A 3QLUC 1JDPA 2HRQA 7REQA 2O54A 2VTBA 3IDFA 4X54A 3AVTA 1FYWA 3CWCA 2ONJA 1UWVA 4BQRA 4IJMA 4Y2QA 4MWSA 3M5PA 2PWBA 4Z4QA 3Q12A 3BGIA 2C2MA 4F96A 1U2DA 1SIWA 3GUCA 1BXRB 2NXEA 3HXKA 1U8YA 3W5JA 4BUJA 5C3UA 1VG0B 1FFSA 1JXOA 3F6SA 4C3UA 1LS6A 1RCTE 4CKWA 1KJYA 4DV5B 1CULC 1NUPA 2IHZA 3ONWA 2AXNA 1E6UA 3RUHA 2XVXA 4EB6B 3QQ5A 1EZZA 4UDXX 3GEGA 4FJ1A 5JJCA 4MDYA 4BKOA 2MWMA 1VZ3A 5CLFA 2H92A 3U6KA 3IXQA 4EPWA 3O4FA 5ITZA 1ZHFA 1Z0UA 3JQGA 4PFJA 1H8EA 1UJNA 2OFPA 4KAXA 4PIMA 5HQTA 5EMHA 5AESA 2MYPA 2ZRIA 3HP1A 3EQ8A 1JN0A 3BD9A 3M4NA 4YRMA 1SKBA 4MW1A 4N3CA 1RXUA 2EGHA 3L7AA 4TXHA 4W6QA 1ZR4A 5HKOA 4CQLB 3WP0A 1MVOA 1PX0A 2PX8A 1TJPB 4BUZA 2JIOA 4AZSA 4DCPA 3G1UA 2BGLA 2QN3A 1GGHA 2C97A 2YDYA 3WK5A 1Y6GA 4BVLA 2XH8A 3OM0A 3AH8A 1CR2A 2JHGA 1UBHS 2PL9A 2ZXEA 5SY4A 2IFTA 2QW0X 3KFLA 3DAHA 4DKXA 2IYQA 3L7BA 5E8JA 3UPUA 4M2LA 3MSXA 1YBVA 3B2QA 3H5LA 5KNBH 2VHQA 3AF1A 1E3TA 3GX1A 4QU0A 3D4NA 3HFJA 4IJKA 4I3HA 3FUVA 3RVOA 1SBNE 5ALUA 5FTKA 2D5LA 5FHQA 3OX1A 4AICA 4A0GA 2A5DA 3O1LA 4DLUA 5KIAA 5JJIA 5BRAA 1D7AA 3QF7A 4KLAA 3OT1A 1NONA 2H1SA 4MW2A 2ARKA 1OBCA 2VP2A 4PQRA 4WLEA 5CPBA 1NJ8A 5ER9A 4BWVA 1IEXA 1L2TA 2B7LA 3EAQA 1PS9A 1OU0A 1RZVA 4QGAA 4Q1CA 4TL8A 1RC1A 3V9PA 5A1JA 5JHHB 3PRHA 4AC9A 2QBYB 3CZ9A 2PWZA 1KA9H 3O9VA 1Y1KE 2HPVA 2PMFA 2C4KA 1FFAA 4LV5B 4RLSA 4EY3A 5IEBA 2K6GA 1YQWA 3UNXA 5ERXA 1XDBA 2P9QA 1QH0A 4RVGA 4IQ0A 3UAXA 4M8LA 2HN9A 2PRSA 4WOBA 2O2EA 2ZRDA 1WLYA 2DUWA 2BFPA 2X0KA 1L4GA 1U7UA 1VJ0A 3PDUA 2VXOA 4LZWA 4YVFA 2CT8A 3ILVA 3H1AA 2ISCA 3K32A 1RZRD 4NU6A 3QKUA 4Z0NA 1KJ8A 4Q4JA 2M6LA 3KKMA 4KAFA 2GD0A 2TMYA 4B80A 3HVRA 2RC5A 1PVDA 2DUMA 2ZRKA 4ALIA 1FYFA 1T10A 4IVNA 1DADA 3P97A 2RG1A 1PJSA 1EHYA 3I2JA 4UHCA 7YASA 3ND8A 1IEWA 1PR3A 3INTA 5DBEX 1HORA 2B4AA 4HNUA 1I4TD 4ZI5A 1IN6A 1NE7A 1RQGA 2VBGA 4GX2A 3SNKA 1LQ2A 4FDVA 3FWHA 4KL8S 4ZRNA 3JQAB 3SQMA 4Q21A 2PSDA 1SOUA 3W05A 3DPUA 3G89A 3GT3A 5KYXB 4FYYA 4KRGA 4V0NA 5EXDA 2MSNA 3SJZA 4GXNA 3EIXA 1SK9A 2H4FA 2V0GA 4PXSA 3C8HA 2QX9A 1TA0A 1HA3A 1UT5A 2PVCA 5EZYA 1G8AA 2OCIA 3O3MB 3RTAA 1DNPA 4Z4FA 1MRSA 2VDPB 2NPOA 1NASA 3G0BA 3GIDA 2BHRA 3LP5A 4MVXA 5DM2A 3SBEA 1J9EA 3A1VA 5L40A 1WBBA 3UAYA 2QL9A 3C7TA 2YINC 2DLCX 3TQCA 1NW4A 1H8HA 2BI7A 2G5PA 2RKWA 4HS4A 3LPLA 4TKUB 3N1UA 1BH2A 3FPEA 2QL6A 1Z7BA 3VHXA 2JA2A 3GPIA 2JIBA 3PNBA 2F4NA 4UHKA 4EKEA 3VRHA 4KODA 1UKBA 1TVKA 2VDOB 2HDWA 1NZFA 2QX7A 4J43A 5F52A 4MA0A 2FN7A 4M49A 4KQFA 3FSGA 2YZKA 4P2GA 4HFMA 2YVKA 2QJRA 4UXJA 2ZIEA 4RJ2A 1OT5A 2ASVA 3CKYA 4ZCQA 1XVTA 4BP8A 1I01A 3IRUA 5TT1A 1ZL2A 2DU8A 2NVWA 2AN3A 3E8SA 1R7RA 3AKDA 4HH0A 4REQA 3D6MA 3UJPA 5FL7D 1EDBA 1KETA 2DR3A 2R9VA 4IX1A 3A04A 4FILA 1WKBA 4X8HA 3TRHA 6AT1A 2VI5A 2AEFA 3DBHA 4IGAA 3T7TA 3LOQA 4LI3X 1CHNA 4Q4CA 3TGPA 4Z4HA 1MC8A 4R5HA 3FLEA 3A7EA 3SKYA 5JBNA 2W6JD 1P4HA 4HH4A 3PHJA 3OIDA 3A6FA 3B9RA 4RGQA 2IS4A 2J5BA 2ON6A 1GL7A 1LLQA 3KFVA 3QH4A 4HQLA 2C07A 4MI1A 4JL6A 3T0GA 3TW4A 1NRJB 2I6SA 3LBIA 5I7HA 2FH5B 4LJRA 2GN6A 3IRVA 2PWAA 4GAEA 1M2FA 4J2OA 3RGWS 1HRDA 1N33B 4ZVUA 1DLJA 2QP4A 4H7IA 1U9CA 4MWZA 4JOCA 1GPBA 5FB3A 1A7JA 2PTHA 5DNYB 2PMCA 3CGGA 1W36C 4X6YA 2FPMA 3E5NA 1AX9A 1DARA 1GD1O 4LOKA 4YO7A 1PGOA 2YL2A 3RIHA 1O1YA 2IJGX 3OE5A 4EB0A 4XQEA 2PH3A 3ESYA 2HADA 1IZ8A 4LF9B 1TQ8A 2QIOA 1BW9A 2FPPB 4N7BA 5CIYA 4J0IA 1OH5A 3SM9A 1E1KA 1TRKA 1UDAA 1SVMA 4Q4HA 1FF9A 3H5NA 4FLMA 4QNMA 3TFQA 4EVQA 3IB6A 4WXPA 1KE2A 2IHNA 2R68A 1S3GA 3UXEA 1UEXC 4P33A 1Q7EA 1UPUA 3HO8A 4IIJA 2I78A 4B71A 1OGIA 1R9GA 1N2ZA 3QRWA 5TVKA 2ZS9A 1MPXA 1Y3IA 1POWA 2WNSA 2FZCA 4Y2SA 5EWMA 1CDDA 3P4UA 4BX8A 4KIWA 3F9CA 4AMUA 1SGWA 2O3QA 3R6TA 3KYBA 1JJFA 1O4WA 4C87A 4I0WB 2CK3A 4F04A 5HKKA 2W6QA 4CLRA 4A8HA 3WDMA 2WSMA 2QMYA 1JRLA 5FWXB 4Z4IA 4D43A 2DJ5A 4ZCRA 5MDHA 4PG5A 1VHQA 3STYA 2XTJA 1CD5A 5EUMA 3DBRB 1AA6A 2C2KA 3QMWA 1AHHA 1ZZEA 1JHQA 2ANBA 3EWIA 3G6KA 3IP1A 1YVEI 4FFBB 4W9MC 4ZWNA 4ZYTA 4EJ2A 4XVHA 3UK7A 1A8UA 3AF3A 3ER6A 3K0AB 1OMOA 3LHFA 3D6UA 4UJ3A 4CLEA 4ZT6A 4L5IA 2V6FA 3TLBA 2H1IA 2IELA 4QOIA 1OXTA 3D3NA 3U3KA 2EEPA 3PC4A 4AYTA 5JLJA 1E7YA 2PZBA 4MKGA 5EE0A 1NF9A 3LUJA 2P69A 4XGNA 4K40A 1QB7A 3TD6A 3QTLA 3TQSA 2B8NA 4DCCA 2QBYA 3QITA 3ROQA 4BQPA 2PBZA 1JLKA 2QSJA 4AP6A 4US1R 5KMGA 4YP9A 5HVNA 2Q28A 4BNMA 1I2AA 2VH2A 3KQPA 1N5KA 3HADA 4JD5A 3FPBA 2QTHA 2X2OA 4NZZA 2VCEA 4TRRA 1QFZA 4Z0HO 4N8SA 1UBEA 3OFVA 2HA7A 5M34A 4B76A 3UJ8A 5IM4F 2QYOA 4I4NA 5TSDA 4D6PA 2A86A 4OP3A 3O74A 1CJCA 2W6MA 2PRIA 1JS1X 1N5IA 3B48A 2D1RA 1TKRA 4M22A 4MI3A 4R8LA 3ZEIA 1CDOA 5G3ZA 1X3SA 3A6HA 1PUJA 1XDGA 1ZU5A 1LQUA 1RKVA 1E3SA 1YC5A 1QFMA 3QVOA 1EBFA 1L7EA 2PX2A 2WU0A 1E5QA 4C43A 1XEXA 1SRRA 1X74A 1XCOA 3RJ9A 2L0XA 1CF2O 3MERA 3MWKA 2QI9C 4JLKA 1FA9A 3E2PA 4RELA 4TZTA 2AXPA 1F60A 1UC5B 3QM1A 2WKQA 3STUA 2CVFA 4F92B 4YT4A 3QFFA 3V55A 3Q7TA 1UQRA 4DR3B 1WXDA 3STTA 4S1TA 1ZC4A 1F38A 3JYHA 2B99A 4BO1A 1E1RA 3OSUA 3GMTA 2Y1EA 4D3SA 4OIFA 2QU7A 1GARA 4EG0A 2H57A 4X66B 4MR8B 3D7LA 1KZ1A 4EDHA 1M6VA 1D07A 4LOJA 3IV9A 4EG6A 2QRZA 4MH0R 3JWIA 1EFHA 3EXEB 3UB2A 4UUNA 3DSRA 3JARA 2AFHB 1XU7A 4EY5A 4HDSB 3BOSA 5JXIA 2W22A 3JWPA 3T7IA 4Z7JA 4JITA 3T41A 1HTWA 4RX1A 3LC7O 4MVJI 4RZUA 4PLFA 2Q7OE 2BFOA 1AZSC 4JJZA 3HKEB 3ZQJA 3EXEA 4I5EA 2ZBDA 3QOYA 1T6XA 2YHBA 3A1CA 1FJ2A 2NSLA 2BRUA 1E4EA 1AHNA 2JAOA 4E5DA 2R4TA 1PJBA 2QVYX 2AKEA 4YALA 3EPHA 4LRYA 3AUAA 1P3Y1 1F4VA 2WWXA 4O5AA 4FXOA 2BKXA 1K97A 1P33A 3AVOA 4UUBA 1MV8A 3WZMA 1NDUA 1ST2A 2IQIA 3JD1A 4FC6A 4XIIA 1KSFX 1YCFA 1G2IA 4BS9A 1BWRA 4E7PA 2LIPA 1WXGA 2VPPA 1Q3KA 3HPRA 1W1WA 4OL9A 4ZOLB 3ZCTA 1IPHA 2CLIB 3DFMA 4AUKA 4DMUB 1XV5A 1SD1A 2PXAA 2W6NA 4IIHA 1CY2A 2A0WA 1BHQ1 1HKHA 1G38A 3M6FA 3BJRA 3H83A 3RANA 4PC3A 1PT9A 1S1MA 2BBSA 5I4IA 5KYNA 1GT6A 1THZA 1G8HA 1WVMA 5GM2A 2FSUA 4OL0A 1CJBA 4WMLA 1JKJA 4XUDA 1RYBA 3WAJA 3PFFA 4HD8A 3W2IA 4UBKA 1ML3A 4RCVA 1PLKA 1U0SY 4GKBA 1U28A 4MS4B 3HSYA 3VI3B 3CSDA 4RKEA 1CK4A 4DSNA 1WXXA 4GFDA 4WGGA 1KPIA 2OHOA 5TJ9A 1UPAA 3N2LA 2QG6A 2WJJA 1CFZA 3MS7A 2XLCA 3OZXA 4RA6A 3AC0A 4UVHA 3BHNA 3W2EA 1QHXA 1V43A 1ZN2A 4EUNA 5DLQC 1J2UA 3PDJA 3SOZA 3EUAA 4PAQA 5T64A 4YQFA 2C8JA 3UMYA 4OHPA 2RSLA 2HT1A 1IQPA 3IUPA 3RV3A 4PW0A 3AM5A 3EARA 5K8UA 1B0PA 1YI1A 5DOVA 3VSCA 4P0TA 1K63A 3JVUA 4P4SB 4NR0A 3WLTA 3ZDXB 3P5SA 4EKDA 5HUJA 5F3WB 3MEQA 2W2KA 4WXRA 1X2EA 2IBMA 1ZI6A 3W9UA 3P94A 1FFYA 1D8AA 3RK0A 2ID4A 2QD2A 3CNHA 5FI3A 3EDYA 4YACA 2O6LA 2ZJYA 1TO2E 1VYTA 2FWNA 2IZ0A 4DHEA 5PNTA 2ASEA 1KFJB 1K0UA 1VIMA 1HYQA 2V9ZA 1WPGA 5EVJA 1ONPA 4OQNA 5HF6A 3UWKA 4XYLA 1H9CA 3RVJA 2Q9AA 5LIRA 2WILA 3H6HA 3WGIA 1OILA 4CMEC 1D2GA 9ATCA 4ZICA 4TTIA 1IBKB 5G53C 2PGDA 4LSZA 4BO3A 1NXPA 2D8MA 2DWQA 3HO1A 2JAXA 4R8VA 2FEOA 2ZUEA 2ZYGA 4Y2VA 1MT0A 4N47A 4UM5A 4YS6A 1YR6A 2VEOA 2OYCA 5K8JB 5DGXA 5EE5B 3OG9A 1C9KA 3PENA 1GPH1 1RRPA 4RPIA 3RSQA 4R2JA 1UWLA 2P41A 1N1GA 3AVWA 5KSOA 2Y1KA 2PUVA 4II2A 5JPIA 1ZESA 4RIHA 5ALRA 1OIXA 1DHRA 3VZBA 4P98A 1APBA 2A5YB 2R48A 2WU4A 2NZ8A 2PXHA 2ZJBA 2GAIA 2DPLA 4ZZIA 4YBRA 4PAMA 3AL2A 3FHCB 3GZNB 1A5TA 3S2ZA 3SJCA 2UYHA 1VGRA 2WMNB 4LJKA 4OBBA 2JGRA 3OBIA 2IIPA 3A6LA 2HMVA 4AJOA 1GTJ1 5I7OA 1U6IA 4V0QA 4EHJA 1YKFA 4ETIA 3NEJA 2ZT6A 2QQEA 3FWKA 3RS2A 1U4OA 2IHJA 2BJVA 2V7XA 1XWFA 2BEWA 2ECQA 4LQDA 3KJQA 5JCXA 1QDUA 4G8DA 1E3MA 1T2VA 1W35A 4WZAA 1L1QA 1WABA 3D8UA 1NV8A 4ILKA 1LA2A 1U02A 3LVRE 3PCTA 5A4KA 1LX6A 2R3SA 3CJRA 4MZXA 5AM1A 4ARAA 1BU8A 1DWOA 3OF2A 4HAIA 4WOCA 4C5CA 1P8JA 5D3MB 2A92A 1X8LA 2PLAA 3AP1A 2XZPA 4A92A 1RIFA 1X86B 2DWUA 1KTIA 4YHHB 1K2VN 3LT4A 1A8SA 2RKBA 3B1JA 3LS2A 2OG2A 4M0KA 4TTPA 3RSSA 4E08A 4F71A 1A3CA 4B40A 2XZLA 3QHAA 3N5KA 1G66A 1KZ7B 1U0EA 2QLBA 3QNUA 4J90A 2IITA 2P2GA 5IUNC 2O3SA 1KVRA 1U3GA 1NOIA 1WV1A 1I2CA 1NM5C 2FB9A 3GA7A 1MAHA 3R3JA 4UBJA 4PTLA 2YWXA 3JQRA 3MWDB 2JKYA 1A5AB 3L8HA 1TYZA 4WI1A 2OCKA 1SXGA 1QYXA 3IKMB 1BE8A 4MITA 4DANA 2O8NA 3QG1A 4YT5A 3G5MA 2A9JA 2QRJA 2VBFA 2ACWA 2Y68A 3ZOKA 4ND1A 1K68A 1EE9A 2EJCA 2M6KA 2V9PA 4KN6A 5C8XA 2YBEA