1Z08A

Gppnhp-bound rab21 q53g mutant gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
160
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 160
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z08A00
2ZRDA 1V5WA 3AB3A 4YONB 3T15A 3AGQA 2WKRA 2XSZD 4US1R 5DNYB 2PJRA 3EPKA 3VX4A 2DBYA 1UJ2A 2NPFA 1KO5A 2R6AA 2EFCB 4A9AA 2WBLC 5H68A 5JMTA 3HJNA 4LHVA 4BUJA 4CYMA 5BXQC 5L3QA 3TVTA 3KUDA 3TKLA 3ZQ6A 4C2TA 1Q1BA 3DVLA 1JQLB 4LJ9A 4B3DA 1YE8A 4JLAA 3S1AA 5KSPA 4WA7A 3AVXA 4B3CA 1G21E 3R7WA 4B71A 4E07A 1U0JA 5KDLA 1CTQA 5FL7D 3KQLA 2XTMA 5GJVC 1TU3A 3I92A 1J90A 3DM5A 4M1YA 5EE9A 4HSEA 2ZU6A 3ZVMA 2AKAB 3CF0A 4PFSA 1W1WA 2ORWA 1COWA 1AK2A 1CJVC 4UXHA 3CR7A 4I1VA 1P2TA 3OHMA 2RGAA 1W4BA 3CRRA 1GNPA 2CCJA 2ZJOA 2VHUA 1ZM7A 4Q1DA 2P6UA 1KHTA 1QHNA 4HLUA 2TMKA 1CJKC 4B34A 4OBEA 2AFIE 4XJXA 2IWHA 1U0LA 4C9BA 2BMEA 2F1RA 2C99A 2VIIA 5BYJA 2F43B 2GDJA 1J70A 4D4LA 3BB4A 3O8BA 1ZCBA 4KLNA 5DISB 2XAUA 3IGFA 4A2QA 4EUNA 2NOAA 1KSHA 1DAKA 2OBNA 2PH1A 3MAAC 4LC0A 4M1SA 1DAFA 2KSQA 2LCFA 1SVSA 3MLEA 4DLYA 4LJ5A 1AN0A 1E2NA 1XMSA 2PMKA 4PC7A 4ZCMA 1R0WA 5DGXA 3CX7A 3O8CA 1Q57A 5FUXA 1DAMA 3W6OA 5G3YA 1F2TB 1HQCA 3LXXA 1G5TA 1T91A 4LY6A 1ZW6A 4OI2A 4TLBA 4US0R 1MO3A 1ZM9A 4PQRA 1N0VC 1Z0IA 4MKHA 3VU9A 1DADA 3CZQA 1G3QA 2RGEA 5DE3A 5GADl 4AKEA 3L2OB 3BC1A 1KI1A 3RRNA 3EPLA 1XEFA 2FFBA 2GTPA 4B47A 3IPYA 3THOA 5KTYA 4RVCA 4XOIA 1XD9A 1ZJ6A 3ICQB 2GRJA 2D4HA 4C0QC 3AVPA 4Q4HA 3TRFA 3ECCA 4PHHA 3B1XA 4M2LA 1W36B 2BBSA 4KVAA 2GXUA 3HPQA 4NCHA 4HLUC 4KITB 2ZE6A 4IVQA 1N0UA 2KBFA 3BE4A 4GNKA 4GRAA 3U44B 3ZLJA 1GSIA 3N5CA 3X1XA 1IQPA 1YZUA 4E09A 4IJMA 2QY9A 2NG1A 4LOAA 5DH9A 3K70B 2GK6A 3A4LA 2QMEA 4LK2A 3X1ZA 2VP9A 1X3SA 1VYUA 2VHQA 1W4CA 2P0EA 2WJIA 3LW7A 4BFUA 1RRCA 3EG5A 2NO7A 4KXFB 4QM6A 1OFHA 4MRSA 4GOJA 4D4KA 2DFNA 5E7JA 4CEJA 3TBKA 3VNUA 3RSOA 1XEWX 2V6IA 4GPTA 4RZ2A 2P6RA 3LX5A 4RZUA 3GJ3A 4BRWA 1NN3A 2WKQA 4K8OA 4P0TA 1QG4A 2Z4SA 2J3EA 4X8OA 4KYIB 1XTSA 3I3SR 2WWIA 3MG9A 1OH8A 5FI1B 1MABA 3IBYA 4M53A 5CK5A 4V0ME 2QBYA 3RWOA 1GFIA 5FUVA 4MDEA 2EQBA 5E95A 4BFVA 4CIDA 3EPHA 1S9HA 1E3MA 4LZZA 4YDHB 5FOUA 1U8YA 3RLFA 2F55A 1F2UB 2REOA 3FHOA 3IIMA 4KYUA 3REFA 1PJRA 1ZAKA 2FSIA 3CRMA 4JL6A 1D9ZA 3OAAD 1M7HA 1OPXA 4CEHB 1LY1A 3OIWA 3Q8XB 721PA 1E9SA 1FUUA 4CGZA 4DXAA 5JWRA 2B8TA 3QXJA 2QQ0A 3B1WA 2XGJA 2FEMA 4AIIA 3N70A 2G88A 3DMNA 4KHZA 1P6XA 4HLQB 4HATA 2W6JA 4DT1B 1NLYA 2X8AA 4ZIRA 3B5JA 1COWD 4C7OA 1U9IA 1YR7A 4MRPA 3W8NA 4AYWA 4YLGA 1M74A 2REXB 3BB3A 2FDCA 2VQSA 3QF4B 3AV0B 4IDOA 3AKEA 1B0UA 3IIJA 3IUYA 3MWYW 2G0NA 3SI7A 4ERNA 2O8BA 2F1JA 2JCSA 4F38A 4BECA 2ONJA 3GLIB 1AGPA 3I5XA 1W44A 4HZUA 2ZYVX 3L0OA 4BLOA 4P33A 3L0IB 4C0JA 2BV3A 3QXHA 4XWAA 4UNRA 2PBRA 1VG8A 2CLSA 4UJ5A 1W46A 2DWOA 1N6LA 1ONBA 1QVRA 1A5TA 2IHBA 4LJ4A 4DDUA 1FTSA 2O8FA 1GRNA 1HTWA 3FYHA 5E7IA 1K8RA 4RJLA 2BM0A 3QG1A 2IXFA 1CJTC 1JBKA 2JLYA 1E0JA 1E32A 1NN5A 1JECA 2A30A 3DO6A 1TF7A 2FE4A 4WIAA 1Q21A 3QKRB 1SVMA 3MWKA 4PSAA 1NG9A 2D2EA 4AK9A 1NL3A 4JSTA 2ZRPA 3BFKA 2WJVA 4PAMA 4DLTA 4ESVA 1ZM4A 1NSFA 2FF7A 1G3IA 1U9IC 4WOPA 3AVVA 4PZYA 4HAVA 3RS2A 5AUPB 5JS7A 4DDVA 5G3ZA 3CPHA 5FTLA 4PO9A 5FPTA 4BLPA 4JVNA 3CNOA 4Q7MB 1CXZA 3U3KA 3LW8A 4LGMA 2OZEA 2WZQA 2YVUA 4BWYA 2A9KA 3KKNA 3GLHA 2BIFA 3TSOA 1UADA 3C41J 1GKUB 2IW3A 4PSKA 1T0JB 2A3RA 5FBVB 1UDWA 1B23P 4N0DA 2HJGA 5GJBA 4FMCB 4ZI2A 3FKQA 2YOFA 1O3YA 4B48A 5FOVA 2P67A 4KCGA 4KFRA 2IS2A 2QM8A 3OZXA 4XSGA 4HYYA 4B6FA 4FWTA 4QBGB 2BBOA 5A5GA 4NH0A 2PZGA 3MJRA 1KY3A 2JIZA 3P4YA 5AJWA 2X2FA 1BO6A 3I8SA 2EYQA 3T1VA 1XEXB 2EVWX 2GETA 1IBRA 1ESMA 4N3NA 4TWZA 1U8ZA 1E2HA 2YJTD 4Z54A 2A2ZA 1RC8A 5KU1A 2ZE5A 2WICA 1E2MA 2XITA 4OHXA 4LYJA 1QHIA 4MGZR 3QI2A 2KBEA 2ZE7A 1XCGB 4DEYA 1Z6AA 3U6BA 4R9UC 2CXXA 4DLRA 3BBPA 1YZQA 4RD1A 2V1XA 1L2TA 2D3WA 1DELA 3CRVA 4JKIA 1E99A 3QKSB 4I81A 3K0AB 2FGJA 4M1WA 2R62A 4HI0E 4DSNA 2QENA 3W5JA 4DUGD 3DMDA 3J81k 2E9SA 5AUOB 5HKKA 4KV9A 1HT1E 1NBME 2ODBA 2JLRA 1Q3TA 4O2RA 2IUTA 1YRAA 2H57A 4IDQA 4DCUA 1T5LA 2ZR0A 2XXAA 2IYWA 4URVR 5J4LA 2BOVA 2C8VA 4X8MA 4QBFA 1YZGA 1Z47A 3ZD7A 2P65A 5EUMA 3OE7D 4D0NA 2O52A 2W6JD 3ADKA 2WSSA 4DCTA 4I1UA 1E4VA 1I2DA 1OXTA 2J7PA 1N6HA 3CONA 4QJ3A 2XJ9A 4MUBA 2ZRJA 1E9BA 3PEYA 3JZAA 3WP0A 1E98A 1EG7A 2B21A 2IF2A 4O25A 4DB2A 1P9WA 4JIMA 5DI9A 5EXTA 2V3CC 4QNMA 3VKWA 1YR9A 5KDOA 4LJ6A 4A8JA 1XTKA 1P2UA 5DLQC 2OILA 3MMPA 1TQ4A 1AQYA 3RDPA 1E2IA 1G5RA 5JWHA 1Z2CA 4HB0A 4L8GA 4A15A 2CK3A 4PX9A 1L7VC 1R5NA 1W0JD 2V7QA 2CJWB 5FH9A 4FI3C 2GEDA 3LFUA 4DJTA 1KJYA 2HJVA 2ZJYA 5J4VA 3Q7QA 2MSCB 2A5YB 2IEYA 2OG2A 2FZLA 2ZSDA 2KJQA 3LLMA 5FOWA 2ECKA 4JJZA 1IN5A 3U61B 1E1QD 3LO5A 3SR0A 1K6MA 3VR2A 1NI3A 3CNNA 2IF0A 3PQCA 2D2FA 4QGHA 2QE7A 1UBGA 1XF9A 5JJKA 3EZFA 4YQFA 3P20A 4A0FA 3JVUA 2ZIAA 3PUVA 3MGCA 3KB1A 5HCNA 3B6EA 1XX6A 3CW2A 4P4TA 4DRZA 2RH5A 1N6OA 2UKDA 4QHSA 1P2VA 4IHQA 1TAGA 2I4IA 3EXAA 3C16C 3RYTC 4F4CA 2BDTA 2Y8EA 1ZBDA 2QEQA 4HDOB 4A8JC 3JVVA 3AUYA 3WHLA 3A37A 3VR3A 2P2LA 2ZSEA 5CM8B 1G8FA 4ACAA 1YZKA 4Q4LA 2ZSBA 5L3SB 2WPDA 1OXVA 5FBRB 2IS4A 2GCOA 4I4LA 5A0FA 1NF3A 3EC1A 4LBVA 4QHYA 5EP4A 3VKGA 1QF9A 4ZDJA 3HYRA 1N0WA 3SC3A 1M1YE 1G8HA 1KDTA 4OQMA 2OLKA 2L0XA 3NVAA 1Q1ZA 4PC3A 1U0HC 2AX4A 4GMDA 2WWGA 4BLSA 3VAAA 1NVUQ 2GXQA 1AJEA 3QUSA 4Q18A 2XZOA 5FUYA 2HDNB 4A4DA 1W0KD 2NIPA 4KAXA 4A92A 2ZRMA 5F3WB 1DE0A 3DPUA 3H84A 2XJ4A 3Q7PA 1G7CA 3CIOA 1CRPA 3WMGA 2IX3A 2CCKA 1FZQA 4DSOA 4CRWB 3THXB 4NYMQ 2OM2A 2WWXA 4IXNA 2VYFA 2H8KA 4Q1BA 3TGPA 5A4JA 1GWNA 4URZR 1Z08A 2ZVPX 3AF4A 1Z22A 2ZRBA 3AF1A 4XH9B 4ZCLA 4R2HA 4OI0A 1OHHD 4OHZA 4PSVA 1I4DD 3SYLA 3LQQA 5CB6A 1PLLA 3K9GA 5EE3A 2AL7A 2GZAA 4JT2A 4ZCIA 4V0MA 5J40A 1H8HA 2KWIA 3P4XA 5HKKD 1S0UA 1BIFA 5JBQA 4J0QA 1EFHA 4GZLA 1SVOA 2ZYWX 5E7MA 4FN5A 3B7GA 3OEEA 5B30A 1DG3A 2PCJA 2HLDD 1P60A 5ANRB 2Q3MA 3RRYA 1W5SA 2GEUA 4Q7JB 3IEVA 3A4MA 4LHXA 1GKIA 2OXCA 4S35A 5EJEA 2BMFA 4TMTA 2NQ2C 4OK6A 2J7PD 3EIEA 5SZIA 3RVBA 3R9XA 4AKHA 3R20A 2GZHA 3HU2A 3B1YA 4D6PA 1OT3A 1ZD8A 3T35A 4JLVA 3H0KA 3FTQA 4V0NA 5IDVA 1F2TA 2ZUBA 1VTKA 1XJCA 5G53C 1G5PA 4E22A 2JDID 3K0FB 3RHFA 5F2EA 4HAZA 2YHSA 4PZZA 1G17A 3UIEA 1ZVQA 3RNLA 4QOSA 3T06B 1IHUA 2KE5A 3A1TA 3K09A 2J41A 1KYIA 1DTSA 1W47A 2J87A 4CDGA 4O0MA 2CK3D 3SQXA 2C96A 2J7KA 2XZPA 2V7QD 1JR3D 3U2QA 3FFAA 2ZJ5A 1LTQA 1IN8A 2WM9B 3MSXA 4JZKA 1O87A 5FFMA 1QHYA 3U44A 2QSZA 2DB3A 1QBKC 2VHTA 4NDZA 2QE7D 4GP7A 1HA3A 3QPVA 1KO1A 2X2EA 5CYPA 4MH0R 4ESHA 2OCBA 1P7CA 2ZSFA 3CPJB 2O0HA 4BRUA 3THWB 1TQ6A 4M1MA 3K1JA 3L82B 3LWNA 4V0KA 5BN4A 2O8EA 4D81A 1MO5A 2N46A 2EU8A 1CKEA 4I99A 4HZIA 3U4QA 2FFAA 3K53A 2RGCA 4TYPA 3A8TA 1FQJA 2FJUA 4NCNA 4PXAA 2IUSA 1N6NA 1YR8A 4ACBA 1WCV1 2Q9BA 4CEIB 4QGAA 3FDIA 2OAQ1 5AUQA 4DBLC 4HLCA 3C14C 2CLCX 5KPJA 3SJAA 1P61B 4B2PA 5DIFA 3H4MA 3K09C 4JVLA 2BBTA 2W0MA 3NDPA 3LVRE 3VR5A 1XCMA 3IHLA 4BFXA 5JRZA 1EFTA 3PFIA 2DY1A 4PC6A 4GZMA 1G64A 1IM2A 5GJWC 2GJ9A 2FFQA 4EJSB 1W36C 2G83A 5JLJA 2QTHA 4MYHA 1E2PA 2X1VA 2F1HA 2OFWA 2QQEA 3HDTA 1F2UA 2PLRA 1Z0FA 2OT3B 3IQXA 2JLZA 1AGRA 2GK7A 5JRJA 3QNUA 1DARA 3WNDA 5AJZA 5KNCA 1XD2B 3CBQA 2JA1A 2ASEA 1U94A 3ZS8A 4M1OA 3NBXX 4WXPA 4CEHA 4BGDA 1W4AA 1MR3F 1X1SA 3AP2A 1KI6B 1E2GA 4Q01A 2YC4C 3NBFA 4TL7A 2HYDA 1T3SA 3RC3A 3QKUA 4W5JA 5BQ5A 2C5LA 2OSBA 2WHXA 1G3UA 1GG2A 1E0SA 1JXMA 1Z0AA 3LBIA 4LV5B 5H70A 3T5DA 3CH5A 4DT1A 2PT7A 2EFEB 3P26A 1AS3A 2ZS8A 1NN1A 4BEBA 5D3MB 1FX0B 2Z43A 2RAPA 4OJKA 3GJ8A 1XXHB 3QF4A 4BZPA 1Z5ZA 2Q9AA 2ONKA 1WMSA 3NBZC 2PMDA 4GL2A 3VTKA 1ZINA 4B2IA 1W5TA 3L0SA 4MGKR 2WKPA 3EA5A 2MSDB 4HAWA 4DLUA 2C9OA 3ZS9A 3GLIA 1UDXA 3Q5DA 4Q5IA 4U5XA 3T61A 1ZP6A 2RGXA 1IJFA 121PA 1R10A 1AQUA 1FPMA 2XB4A 1XZQA 4Q9LA 1VCOA 1NBMA 4C0HA 2D62A 2JLXA 4V03A 4QM7A 1KK2A 2EFHB 1CF4A 3LA6A 2ORIA 4GMXA 1XU4A 2ZRIA 3SE0A 4LSGA 3CPEA 3Q3JB 2V6JA 4QJ5A 3ZZ0A 3B60A 3EA0A 4OQLA 4B74A 1FOEB 1N6KA 2CNWA 4OHYA 4Q9HA 2ZETA 3TLXA 2A7QA 4FMDB 1E0AA 3DOEA 1R7RA 2OXRA 5EP2A 2CDNA 2FZ4A 2JJ2A 4DDTA 3ONWA 3T1OA 3WMEA 2IXGA 1SULA 4JVSB 4GBMA 4MITA 3LVQE 2O8CB 4YMWA 4EQ6B 3L0PA 4MGYR 1W36D 2LWIA 1SZPA 1F6BA 2Z83A 4IEIA 3BRWD 4URWR 5KDDA 3GJ0A 4IOJA 1ZUHA 4PC2A 2IT1A 1YHNA 2ZR7A 2ZI6A 1KGDA 1Q0UA 4Q7KA 2PX0A 3F3YA 4IFEA 4Q4AB 4D0GA 3KQNA 4BPBA 1YJ5A 1Z6YA 4V0LA 3EWAA 1TNDA 1RE0A 2IBMA 3FE2A 5FI0B 1SKQA 4XIGS 2RGDA 4LJ7A 2YWEA 4RFSB 3WMFA 3X2SA 2WWYA 2HEIA 5L8VA 4TQ9A 2WOJA 3IIKA 2ZRCA 4Q1AA 4PAQA 4OK3A 4OJQA 1QHHB 3KFVA 1D2EA 4GI7A 3E2IA 4G0NA 3ND9A 2D7DA 2GJ8A 2IYSA 3R8FA 4UNQA 4DHEA 4MKGA 3V00A 5GVSA 1GITA 1XEXA 2QMOA 2ZR9A 3BERA 1E69A 2ZRLA 4JYBA 2GXSA 2HUPA 4S2EA 1A4RA 1UPTA 2W83A 3L8ZA 4BFZA 1N3BA 1E96A 1HV8A 1XXHE 4PPNA 4BFTA 1MV5A 4KU4A 3WNBA 1RKBA 4XVQA 1IN7A 4HUQB 1PLKA 3TVDA 4U7DA 1E4YA 1D6JA 5KHOC 5KOYA 1G41A 3AVTA 1XTIA 4EFLA 2GVZC 1II8B 1X8LA 3CWZA 2R65A 3K0AA 3QKSA 4MKFA 1NRJB 3I61A 3U7HB 2WJYA 4IDHA 1ZU5A 5CK4A 4IOLA 4NP6A 3I72A 2OCAA 2ZS7A 4ZDWA 3DDCA 2ZUDA 4LHZA 2J0UB 3MD0A 5HTKA 2JJ8A 1ZM3A 4A0GA 2OE2A 1CJMA 3MJHA 4DIDA 2IXEA 1TUIA 4EFNA 3LAWA 4RCYA 3C15C 1CLUA 2CL0X 1M34E 3LQRA 1J7KA 2QZ4A 2RGNA 3DEFA 3EZ9A 2ZPTX 4RKFA 1EXMA 2W2VA 3A1UA 3DZ8A 4DSUA 5DSZA 1RYFA 5C18A 3NDBB 2QT0A 4B3XA 3GFOA 4F4JA 1QG2A 1WBBA 2W6IA 5CIWA 1XMJA 4XVUA 3K0CA 4K81B 3TQFA 1GDDA 4C0BA 3C5CA 2BHRA 3PEUA 2QTFA 2F9MA 2BKEA 3TW8B 1LFDB 2JLUA 1BYIA 3FMIA 2AK3A 4QL3A 2ODWA 2V1UA 3KXKA 3LNCA 1BKDR 3R9IA 5HPYB 4OQNA 1EGAA 2NMVA 2X77A 4A6XA 3IHWA 1GAJA 4DDWA 2G0TA 4NYIR 2OUKA 4XTRA 2CJWA 1LV7A 2ZSAA 3CUEF 4U00A 1S1CA 2QUZA 4A0HA 4EPVA 4GOKA 2EWWA 2FGKA 2AN9A 4B6EA 1KK0A 2YNMA 1R0YA 1Z06A 1KI8A 4HAUA 4W5HA 3CX6A 4DCNA 3CM0A 1Z3IX 2C04A 4B73A 2YWHA 3AKYA 2XNDA 3KTAB 1G16A 4ZDKA 3O8DA 2CNWD 1F5NA 4HB4A 3H1TA 2RGNC 2G77B 3GEIA 2B6HA 2A5GA 4JLPA 1IXRC 2OO7A 4AI6A 5AJVB 4JLBA 2JJ2D 4A2PA 2ZITA 4E5UA 4EKDA 4Y0VA 3EX7C 3V4RA 4C0AC 2HXSA 2R6FA 1G7RA 2V54A 2Q9CA 3K0CC 3HWSA 2QG6A 1UEJA 4I1SA 3N2EA 2XZLA 3EIQA 3VR1A 5C46F 4HLDA 2HCJB 1CR1A 3TQCA 1Z6GA 2Q3HA 4DCSA 4L9SA 3D3QA 1ODFA 2LKDA 2ZRGA 2GESA 5CDFE 4JLKA 5L3SA 1P9RA 3H86A 4CF7A 4JLOA 3CLVA 4KO8A 2DFKB 1US8A 4US2R 4FMBB 3RS7A 2ODEA 2BM1A 4ASUA 5J4KA 3SOPA 1XJQA 2NO0A 1T5IA 4I1OA 3SJZA 5EE0A 4JBWA 5HE8A 3KKPA 5J5CA 3BOSA 1G7SA 3I62A 2XNSA 1E9EA 1LNZA 1HY3A 3CNLA 1GL6A 2FX3A 1AIPA 2IYLD 4D82A 1GRQA 3GJ5A 4M1KA 3FHTA 1FNNA 2KI5A 3AKCA 4G3XA 4RCZA 5G40A 2CHQA 2HT6A 3U7FB 1TMKA 5DN6A 3THXA 4LJYA 3EC2A 2ZYUX 2F7SA 3Q72A 3ZYCA 4D2IA 2J46A 2GF0A 2IEZA 3F5FA 2ZRHA 4QHTA 3ADCA 5B2ZA 1GL9B 4MUAA 1E2EA 1TPZA 3R9WA 1SVIA 4ZKEA 3EARA 3IO5A 2VRWA 3QXXA 3AGPA 3WNCA 1G4UR 4TYQA 1EESA 1DAIA 1IY2A 3EW9A 1DAHA 4PZLA 1OFTA 1J99A 2O0JA 1G20E 2YV5A 2ATVA 1CR2A 3UMRA 2AWNA 1T9HA 1EWRA 4EFMA 1P73A 2XOKA 2A5JA 2PZFA 2ZAMA 1AM4D 3AVQA 1VYTA 5SZHB 1K5DA 4KSBA 2WIAA 1OXSC 4QNRA 2E87A 4W7SA 3SBEA 3C7KA 3KZ1E 1AKYA 1OJLA 4G5RA 4OI4A 2GKSA 4QC2A 4B32A 1RJ9B 4F4IA 2JAQA 2VF8A 4UNSA 4TL9A 4EPXA 3QF7A 4LPKA 1U2RA 1ZM2A 2BBWA 4AYTA 5FR2A 1UKVY 1IXSB 2F3TA 3PVSA 2C2HA 3FWYA 1YQTA 1G291 3K0FA 5FBQB 3B8HA 5J4HA 1GUAA 2C9YA 2WVJA 4LX0A 4W5WA 4Z8YA 3NC1C 3AM1A 3ND8A 4GOXA 1P2SA 4Z8XA 4PPQA 1FTNA 5F9FA 2GAAA 4QBHA 1IXZA 2EWVA 2QP3A 1G8GA 1X86B 4YXWA 3SYNA 1GTVA 3D8BA 5D3QA 2ZJ8A 1EFCA 3Q9LA 4MYUA 3FOZA 1NNEA 1JJVA 5TDHA 3CRW1 2WWWA 3QSYA 3SU8A 3REGA 3BFVA 1RRPA 2JASA 3RSLA 5BWMA 1I4TD 5JEDA 2ZREA 4GDFA 5AJYA 3A4NA 4E03A 4X8HA 1JAHA 4DVGA 5TVKA 2RGBA 3SFZA 3SYKA 4KFUA 2QPTA 1P9NA 5JJIA 4QKQA 2RHDA 3L8YA 3KKQA 1OFIA 5CJPA 3RANA 5K8UA 2ZM5A 1UFQA 2J0VA 2EW1A 2ORVA 3AKDA 3MFYA 3PIRA 3THWA 1EFRA 2XB2A 4QJ4A 4KI0A 1OYWA 1YZLA 1R5OA 2N42A 3PV0A 3BB1A 3A36A 4NBSA 1TTTA 3SDZA 1SKYE 1T0HB 2C78A 1PUIA 2PZEA 1D8TA 3T5GA 4CEIA 1Z0DA 5CLLA 5SZJA 4II7A 3ZQJA 1JB1A 1J2JA 1XP8A 3M6AA 3H2YA 4M8NE 1N6IA 1JALA 1ZD9A 1TUEA 2VA8A 1Y63A 5JEEA 1IY1A 4ZO4A 1ZNXA 3NHBA 1WDTA 1W48A 4R2IA 4JVMA 2PEYA 5AWFC 3W9YA 1GNQA 2OHFA 3TSZA 3T34A 2VTKA 2ODNA 1ZUNB 3GMTA 5EXPA 3MRSA 4ASUD 1XPRA 4EJSA 4U02A 1KY2A 1G3RA 4PQYA 3B78A 4TYNA 3LXRA 3BGWA 3KB2A 1DG1G 5EUQB 1P62B 4TMXA 1QHXA 2QL6A 5JCPA 4F93B 1XD2A 1D5CA 3L43A 4CT4B 4TT3A 4RD0A 4EPYA 2H92A 5CB8A 2QBYB 2FPKA 4G5GA 5FTNA 2J5XA 1LS1A 3UKDA 1JAIA 1TEVA 1F3OA 1VHTA 1S96A 1X1RA 4TMKA 5JECA 1FW6A 4QGFA 4NYJR 2KB0A 1XNJA 4POAA 1R0ZA 2VP6A 3K9NA 2HT1A 4RD4A 1J8YF 4M4SA 1YRBA 1KZGB 4IOMA 3M4YA 1PVOA 4JMPA 1P72A 2B92A 3PITA 4HDQB 3RWMB 3W3AA 1Q44A 4Q7LA 5JCZA 4URYR 5D3MA 4LWZA 1FX0A 1IY0A 4D0LB 5KPDA 1LF0A 1XXHA 5CITA 5TB5A 2QGNA 1XTQA 3HR8A 2XTZA 3LBHA 4CVNA 3QQ5A 4OHVA 1JEDA 3G82C 4TSFA 4TTQA 3HP1A 3QXSA 1FMJA 2B8WA 3ETLA 5FPSA 2XOKD 3T1TA 2GWHA 5FBLB 3V4FA 3SEAA 1RRFA 3TR0A 4EJSC 2RB4A 3AQ4A 3X1DA 1H8EA 3U7EB 5HZKA 2BMJA 2O0KA 5KNDA 5LBIA 2ZRKA 4H9GA 3GQBA 1XPUA 4QXAA 2FWRA 1E2FA 3PJRA 2I3BA 3SFVA 4PTLA 2JIZD 3T12A 4B35A 3TUJC 4B3GA 1TF5A 2N1BA 2VEDA 3NXSA 5JZVA 5LD2B 4HB2A 1E9CA 2GJAA 2MMCA 2ZJAA 3PUZA 3I8XA 2ATXA 3TR5A 621PA 4GFDA 1S4QA 3W5IA 4NONA 5K8LA 5B57C 5K8IA 2GA8A 3UG6A 1R8QA 2GJSA 3GEEA 2HF9A 4YXWD 5UKDA 4D25A 2QGZA 5P21A 2O8CA 1NMZA 2BVNA 2YWFA 1KIMA 3FHCB 3FMPB 4P4UA 2YWGA 1SGWA 1KJWA 4LYAA 4LJAA 1JNYA 1CBUA 4PHTA 3R8CA 3GJ7A 4FD2A 4XD7A 1F48A 3SBDA 4DZZA 4TZ0A 1ZIOA 5CYOA 2FFHA 3U3MA 2Q3FA 4RD2A 3RABA 4AYXA 2F43A 1Z6TA 1X8JA 3BJIC 1I2MA 2VP4A 4KBFA 4KBGA 4Q4AA 5JHGB 2WV9A 2ZJBA 2IHYA 3SZRA 2ANCA 5JI2E 2QTVB 2O8DB 2FA9A 2UZIR 3ZDQA 2BJVA 4Q9IA 1E1RA 3WYAA 2WSSD 1EFRD 4RFSA 4DSTA 2RHMA 3IO3A 1Z28A 4MRRA 4TQUS 4B3FX 1QHHA 3D6TB 2A78A 4C3ZA 1E2QA 3GFPA 3TAHA 4BQSA 2ERXA 1XD8A 1HURA 1OXUA 2A5DA 1Q22A 4G5OA 1HH4A 3Q85A 4JLDA 2QP4A 2XEXA 3KKMA 3TJZA 3KXLA 4NTZA 1R8SA 1N5JA 1MRNA 1RW4A 4ON9A 3EZ7A 4TYYA 3CF6R 1F60A 3NEYA 3VQTA 4Q1CA 1BYUA 2BKUA 3WHKA 2FPLA 2CLDX 2J59A 1MRSA 2AK2A 2NZJA 3UXMA 3CH4B 4HUQA 2ZQ5A 5IK2A 1TQ2A 2OV2A 2O5VA 5CDFA 4MYCA 1Z07A 3FFBA 4BZXA 3D7MA 2VL7A 1Q12A 1ANKA 1II8A 4M9XA 3D31A 3BORA 4CT5A 1KNXA 1IN4A 4OI1A 1KSJA 1HEIA 1G1MA 1SVWA 3I73A 4JL8A 5KSYA 5JJLA 3LDAA 1NVVR 3OESA 3QKTA 4TT3D 5BN3A 2J0UA 5FL7A 2IYVA 5JSZB 4AURA 2QAGB 2WMNB 1M7GA 2PCLA 3EASA 4Q4JB 3SS8A 2OAP1 3AF3A 5FTMA 5J47A 3RAPR 3KDSE 2EFDB 1WQ1R 4JLMA 1KO4A 1P3JA 4AY2A 4AKGA 1XB2A 4FCVA 1TEXA 5FUWA 3BAFA 3SN6A 1NLFA 2GXAA 1PLJA 4LRWA 4URXR 1YR6A 4A2WA 1ZC4A 2WWHA 1Q20A 1FQKA 3F8TA 2IUUA 3FKSA 1UBCA 4M21A 5TY0A 4DLXA 1NKSA 3BWDD 4ZDIA 2JATA 2ZJZA 2VO1A 3BH7A 5GVRA 1X8KA 4TTPA 4G5QA 4MKIA 4TTRA 1WP9A 4TSFD 4A1FA 4JLJA 2WPDD 4FIDA 1KI3A 4W9MC 1AA9A 5FOSA 2IK8A 1TADA 1TF2A 3LBNA 2VLIA 8OHMA 2ZYTX 2YZ2A 1H8ED 2DCUA 3WY9A 4H1VA 4B76A 4HUTA 3K0SA 1KSGA 1IOZA 4MRVA 4IDPA 2ZI9A 2QN6A 5C1BA 5C2JB 2QSYA 1SXJB 4A8JB 3PENA 3NHAA 1AS2A 1WRBA 3B1VA 4KLZA 1CR0A 1NMYA 3DL0A 3LD9A 5HZHA 2UVQA 4C2UA 2NGRA 5C4GB 1GP2A 2H17A 5FOXA 4PAOA 5CLQA 3DOFA 4LV6A 3K70C 4NPHA 1D2NA 4JBYA 1CRQA 2QMHA 2VP0A 4RSGA 3KTAA 3X1YA 1KMHB 4A0RA 1KDOA 3B1ZA 3KJIA 1J8MF 1DO0A 3QOFA 5HR5A 2IYQA 1DAEA 1NP6A 4ILEA 1TU4A 3CZPA 1OB2A 3AVWA 2VBCA 4MDFA 1KI9A 4DLSA 5EE5B 2VSXA 1L8QA 3QVVA 2K5UA 4RFVA 2ZU0C 1DPFA 3ASZA 5HE9A 1AZSC 3UANA 3OIYA 3UATA 2NO6A 1H8HD 4QFMA 3Q5EA 3NKVA 1CR4A 4XD7D 2HYIC 2FH5B 1N2CE 4C0KA 1I4LD 2DYKA 3OEED 2BEJA 4P4SB 1KDPA 3B9PA 1ZYUA 4LYFA 2W58A 1R2QA 2HCBA 4FW9A 4QGGA 3BXZA 1OXXK 1GVNB 5KUTA 2CCGA 2J45A 1E1RD 4C0SA 3C5HA 3PEVA 5LB2A 1NIPA 4R98A 1RPZA 3QIAA 4TLDA 1DAGA 1QHSA 1QVAA 4AWXA 5KYKA 1KK3A 3VFDA 1FP7A 4L5BA 3KL4A 2Q0HA 4YMSA 1N5KA 1VIYA 4UJ3A 4L4UA 4NKRA 1N6RA 4Y0AA 3QKRA 3GLGB 2QMUA 5L3RA 821PA 4TN1A 1A82A 1XCPA 1W49A 2BMDA 3NC0C 4ZPXA 1JR6A 2IYYA 3EZ6A 4P31A 4PHFA 2PJZA 2DR3A 4JYCA 2VPPA 4P3YA 1CULC 4Q19A 4B75A 2FN4A 3P27A 2AFHE 4UKDA 1UAAA 5IK2D 3FGNA 2CEAA 3OAAA 1AS0A 2JLVA 1UEIA 3U3JA 3ZGXA 1OKKA 1FUKA 1R4AA 1RVDA 2IA5A 5EXSA 1W4RA 4PR0A 2J1LA 1BH2A 1CIPA 1E9AA 1R5BA 2Q6TA 1MKYA 2DPXA 1X6VA 1S3GA 1XJ0A 1VPLA 3CWQA 3E70C 3HU1A 4G5SA 2MMGA 4HB3A 3KJHA 2OCYC 4JS0A 4TL6A 1ZRHA 3QENA 421PA 3KJGA 3U7GA 3RC8A 1SXJE 4JL5A 3K70D 1YKSA 4PO8A 3A1SA 1T6NA 2P5TB 4IRUB 4DLWA 1VKJA 3N2IA 5EP3A 3TAUA 1V43A 4KFSA 1ZC3A 5F98A 3EWSA 5IF9A 4NCIA 2QROA 2AD5A 2HF8A 3KXIA 4X8LA 1E0KA 2A5FA 1IONA 1RJ9A 4A6PA 1JR3E 1VHLA 4FCWA 3I32A 4MRNA 3FKSD 5EZ5A 1G18A 1NY5A 4MA4A 3SJCA 1D2MA 1E79A 1XMVA 1SVKA 3CR8A 3VR6A 5TARA 3SJBA 4BFYA 3A58B 4F91B 521PA 1VMAA 3GLFB 1P5ZB 2ZE8A 1WB9A 1BOFA 1Z6XA 2W00A 4PANA 4NYIQ 3UPUA 1KNQA 2CL6X 2AD1A 3VNVA 2CHGA 2Z0MA 2ZI5A 1E9RA 2HV8A 2IYTA 4XTCS 3WYGA 3PUWA 1TL7C 2D74A 3ZVLA 5DI3B 1QZXA 1S8FA 2NO1A 3GCGA 4YDSA 3B9QA 4TLCA 3C4JA 2H18A 3TW4A 2F3RA 4EAQA 4RZXA 4M22A 2FMXA 2ZS9A 3WBJA 2QI9C 3BD9A 3EAQA 2VP5A 5AR1A 5BYKA 2D7CA 2Z5FA 3QBVA 2H16A 5FTJA 1E2JA 1JEEA 2IC5A 1M8PA 2QNRA 3X1WA 3OIUA 3GLGE 2AKYA 3U6KA 3TIFA 1TX4B 2BEKA 4IXMA 1VG1A 4NE2A 2ZAOA 4DIEA 3WXMA 1CU1A 3QVUA 3FMOB 4IDNA 3AF0A 1KSFX 2BWJA 3GJ6A 2ZI4A 2CVHA 3UG7A 2G1KA 2DWPA 2OFXA 3E1SA 4XWOA 2R6GA 1PZNA 4B3BA 2QRZA 3PR1A 4FWIB 2O8EB 3CX8A 1XFAA 5EZ6B 2CE2X 3NBYC 4A82A 1ZNYA 2CVFA 1UBFA 1G6OA 3LX8A 1YZNA 4GP6A 5KSOA 3U4QB 4WZ6A 1R6BX 1VCIA 2GHIA 1N5IA 1CS4C 5K8TA 1LVGA 1NBMD 2WAYA 2W2TA 3GP8A 1MOZA 1NJFA 2Z6VA 4FMCF 4P32A 5EXXA 4ZV4A 4HAXA 3AH8A 5L3VA 3PCRB 2NZ8A 5H8WA 1E6CA 1G4AE 3OFNA 2ZRAA 1VDZA 4ARZB 4BLTA 5AUNB 1KZ7B 3CF2A 4TMWA 3WP1B 1G3MA 3RRZA 3TE6A 5FOTA 3BK7A 2ZROA 3ZH9B 5DHFA 4IVRA 3THYB 1T8TA 4RY2A 1OE0A 4O3MA 2XX3A 1QRAA 3QJYA 5CM9C 3TNFA 1CEEA 1NN0A 3AP1A 1NLZA 2YOGA 1QDEA 4UNPA 4YMUA 1G6HA 2G3YA 4PC1A 3WBKA 1DVRA 1L4UA 2DWQA 2JEOA 2RMKA 1R0XA 3FVQA 1D9XA 3NIBA 2VH5R 3SHFA 2CMKA 3ZD6A 3A1WA 3KFXA 3FPAA 4DUGA 1T4GA 3GLFE 1A2KC 3BH0A 3HU3A 1OKKD 3HPRA 3IPXA 2ZRFA 4H1UA 1OV4A 4L16A 4YC7A 1GKYA 2JLSA 4CZ2A 3SHWA 2JLWA 1KJZA 3SNHA 2AR7A 1GIAA 1RZ3A 2DHRA 1Z0JA 3IKJA 3OE7A 2QM7A 1NG1A 4GT1A 2F1IA 2QPOA 4QRHA 1XBTA 3MUFA 4LI0A 2UZ3A 1G9XA 4JSYA 2CL7X 4LV8B 5KO2A 2GZDA 2MSEB 2GAOA 1T3LA 1OLOA 1P4SA 3RS0A 3WRXC 1LS6A 3PEWA 3TSWA 4TMZA 4YMTA 2PX3A 4EPRA 1EX7A 2IS6A 1GNRA 4JLNA 3GFTA 2P5SA 1E79D 2IL1A 1GL7A 2WSMA 1OSNA 3BS4A 3ASYA 4OQFA 5EP1A 5LB4A 4TZ6A 4BLRA 1QHGA 1SKYB 4OYHA 3UWOA 2VSFA 1W0JA 1Z0KA 2WIBA 1A2BA 1W2HA 3JZMA 3E5HA 1C4OA 1JPNA 1YU9A 3LRPA 5GJCA 3CO5A 3T1QA 1DO2A 4LDJA 5BN5A 3ZVNA 4TYWA 3IILA 2JGNA 4TLEA 4M9QA 3PUYA 4D26A 3GJXC 3FMFA 3ZZTA 2J0SA 4URUR 4WBSA 2IYXA 4LBYA 1E1QA 2OCPA 2GJKA 3CB4A 5L3QB 3KX2A 1GM5A 3G0HA 1VG0B 2W0SA 3S1AB 3R7WB 3QY0A 1SQ5A 5FTKA 4Z1MA 1OF1A 2PT5A 4TLAA 3MCAA 1RFLA 1Z2AA 2GEVA 3U3RA 1Z63A 1IAQA 1GOTA 1KO8A 3DHWC 3U60B 4B2LA 1S9DA 5DYGA 4Q47A 1GILA 1ZNWA 2OFOA 3HYTA 4WXRA 2O8DA 1ZD1A 1SHKA 3B85A 5EQTA 2C77A 4IFBA 2D06A 1Z83A 2AHOA 4ITRC 2ANBA 3U3OA 2GF9A 1S2MA 5FPYA 4JJKA 1NIJA 1RYHA 3VMFA 1VCMA 3I4LA 3ADDA 2W6ID 2EYUA 3G5UA 1OH6A 5LD2C 2ZI3A 3RS3A 2ZRNA 4BFSA 2YYZA 3CRQA 4GSYA 1WF3A 3QPWA 2QORA 1KOFA 3F0TA 4NZYA 1TQDA 4OK5A 5H1YA 4D4MA 3A6PC 1KAGA 2SHKA 5E4FA 2FV8A 3K9LA 5FPHA 2IS1A 4ABYA 2Z4RA 2H7VA 4WW0A 4AKIA 4ZKDA 4JBXA 1OB5A 3KQHA 4D4JA 1W0KA 1GRRA 1JQJC 1FFHA 4R71A 2GBLA 4QBIA 2IWRA 2V9PA 4EDHA 1CJUC 2NPIA 2ZVQX 1KI7A 3VU9B 3NG1A 2WWFA 1T3HA 2CHVA 3OFND 221PA 4NMMA 4ZI3A 4WAUA 1Q1QA 4UXJA 1N25A 1L4YA 4NYJQ 2XNDD 2RGGA 4HAYA 5TMPA 5FL3A 5JSZA 1U90A 3DKPA 3RS4A 2QAGA 4Q4JA 1XTRA 2GILA 4Q4HB 3U5ZB 4B33A 2CE7A 3BIFA 4NCJA 1PV4A 1OHHA 3ZZUA 3GLIE 4G1UC 1DS6A 4UNNA 4AC9A 1VCNA 1WXQA 2LKCA 5BW8A 2P6NA 2V8OA 4Q1EA 1OYYA 1KI2A 4Q66C 4FINA 1FP6A 1WE2A 2OEPA 2QT1A 5EE1A 4DLZA 4AG6A 1YZTA 4LBWA 1G19A 5FBWB 1T8UA 2B7BA 3DZDA 4IVPA 1MH1A 4DKXA 1II9A 2FNAA 4EIWA 2HLDA 4XWKA 3C8UA 3AF2A 2F6RA 3UWKA 2C98A 1JI0A 4XSHA 4CEJB 1CP2A 1HUQA 1NKTA 2GBLC 3NWJA 3AVYA 4PHGA 4L15A 4DCVA 4JKYA 1E2LA 2G9NA 4EPWA 5JWOA 4V0OA 5M04A 2YINC 3EZ2A 1SXJA 2JDIA 1IJEA 2IYUA 3SQWA 1ELOA 1MABB 2FSGA 3BH6A 3NH9A 3AVUA 5CIQA 3K0EA 3PXGA 2QAGC 3M1IA 3NTUA 4XVRA 2Q21A 1NY6A 2H1LA 5FR1A 5F9HA 4LPSA 3QPUA 2ZUCA 4N1AA 1KI6A 3AUXA 3EPJA 1SHZA 1UKEA 5DYIA 1XPOA 1Z8FA 1JR3A 1KMHA 3PG5A 2C95A 3QXCA 1II0A 4HDCA 5DN6D 3ICEA 5G41A 1W2GA 3LH5A 3ZJYA 3DKVA 1HT2E 2FEOA 1OIXA 1JPJA 1NJGA 4OKSA 4OQXA 1K5GA 3VKHA 1NMXA 3UK6A 4BFWA 3IDQA 3LV8A 1XZPA 4MYTA 4TQAA 2WTUA 3HR7A 4DC9A 5JHHB 1ZMXA 3O47A 3OIVA 4IOKA 4MQBA 4Z1MD 2FU5C 1OIWA 4UQOA 2PL3A 4BZQA 1ZNZA 3QBTA 3GPLA 1NSTA 2REBA 4LCBA 1VYVA 4N0EA 4NL4H 4P4SA 3FB4A 4IW3B 1UM8A 4ZIRB 5KNBA 2JLQA 1BMFA 1XWIA 3B82A 4C7OB 2FG5A 5CJ2A 3P32A 3K9HA 5IHPA 4FXPA 3TMKA 1JJ7A 1KAOA 5C4MA 1E9FA 4MGIR 1SXJC 1VIAA 2JJ1A 2O8BB 4CW7A 5KSZA 2QU8A 1A1VA 4HZUB 4KVGA 3RRMA 3K8YA 3VX3A 4Q03A 2WJHA 3M0EA 2C03A 4DWJA 3W90A 4RD6A 4Q9JA 1AKEA 1DOAA 1US8B 1NVWQ 4B44A 3GLGA 3QEOA 4LHWA 3I5YA 2O8FB 2ZEJA 4Q48A 4G01B 2WMOB 1FMLA 4WVFA 4Z51A 3MWLA 1UKYA 4PO1A 1C1YA 3OEHA 1WA5A 5SZKB 2FSFA 4M9ZA 3VHLB 4EQ6A 1U81A 5FPKA 4RZ3A 1LW7A 5JI3E 1KO7A 5JS8A 4KSCA 1MO6A 4NU0A 4UXIA 2J9RA 1NVVQ 1SVLA 2QA5A 3IBGA 4LBZA 4DLVA 1E2KA 1XTJA 2GVDC 2GCNA 2OESA 2OBLA 2QP9X 4BE7B 2R2AA 4QG7A 1MT0A 3NH6A 2F9LA 3QG5A 4V02A 1XEWY 5LDDC 1ZU4A 2BC9A 2YOHA 1DEKA 3ZIAA 5B58C 1XMIA 1ZIPA 2ZANA 1KTVA 4C0LA 3AP3A 1M2OB 1Y3AA 1DBSA 4D80A 2J0QA 2RKOA 2H5EA 3GLHB 2WAXA 1YVDA 2I1VB 1M7BA 2IYZA 5AJXA 1ETUA 2BCGY 5TV2A 2EFGA 2P3SA 2HXYA 3UMSA 5E3HA 4LJ8A 3TH5A 1RRGA 1MO4A 4DEXA 3TK1A 3KJEA 4WZAE 3GLFA 5TXGA 1UKZA 4DB4A 4WZBE 2NO9A 2V55B 2XSZA 4NHOA 2G6BA 1HE8B 4AG5A 1KK1A 5HCIA 3OF5A 3O8RA 5DI3A 3GJ4A 3KQUA 2VF7A 1UBEA 1SXJD 3A1VA 4TL8A 1W7AA 4AD8A 4C30A 4OHWA 1VECA 4OL0A 2NTYC 1OW3B 2WJJA 1U99A 3GD7A 4Q00A 3LY5A 1Z29A 2WJGA 3B2EA 1EX6A 2RCNA 2AXPA 4NYMR 1C9KA 2OBMA 4IKEA 4RD3A 4PPGA 1AZTA 4M1TA 4L9WA 4O2LA 5IT5A 4LUCA 1EWQA 1E2DA 2E1RA 1VG9B 3ZVRA 2VHCA 4NCKA 2W2XA 4Q02A 2GNOA 3I1FA 2OLJA 1S3SA 4FMDF 3RS5A 2R44A 2X19A 1LF5A 2BJWA 3GEHA 1ZUIA 2AWOA 4F7WA 1FL9A 2YKGA 3KQKA 1E94E 3NEJA 1ZCAA 2XXAB 2VSOA 3V9PA 5AK0A 3IQWA 3KUCA 4K46A 1NVXQ 1G7TA 2VHJA 1BS1A 4A36A 3QE0A 5LPNA 2AXNA 2FPMA 3IEUA 1HYQA 1M6NA 3PUXA 2FSHA 1BMFD 2B7CA 3W8RA 4F92B 4BEJA 1G8YA 5JFGA 3UMFA 1H65A 2ZJ2A 4M0LA 2ZXUA 3ADBA 3BFXA 3WRYC 2XTNA 1KKLA 2IYRA 2JJ1D 1KDRA 4Q9KA 3CKLA 1E9DA 3W3ZB 2ERYA 1G8PA 3P1JA 2G1JA 3AVOA 2V4ZA 3QEJA 2DFLA 4ARZA 1OH5A 1HQYE 4BASA 1U8AA 2QRNA 4R7ZA 2FOLA 2R9VA 1GZSA 4M9SA 3THYA 3GLHE 4HEJA 1KI4A 3VHXA 1KKMA 1EK0A 1HE1C 3KKOA 4YMVA 3TUZC 4KFTA 3OEHD 1UF9A 1U98A 3DM9B 2QPAA 3AEZA 4LHYA 4IEEA 2R8RA 1RIFA 1N6PA 1OFUX 2CBZA 2I1QA 1WBDA 1S1MA 2BCJQ 1ESNA 3B13B 6Q21A 4Q21A 1N5LA 4C4PA 5IRCD 4RKEA 4KJZA 4B43A 4KODA 2GCPA 1XRJA 1PUJA 1JXOA 1P75A 4TMVA 1Q1EA 2ZTSA 1A7JA 4FCTA 2PEZA 3EIHA 2PLFA 5B64A 4PQFA 2VP2A 3ZIAD 4JT4A 3LLUA 2C9CA 1XDBA 2WOOA 4Q1FA 3W34A 5DHAA 3MWJA 3W6NA 4EPTA 4LC1A 1OH7A 1Q3HA 5J4YA 1FNMA 3VR4A 2QAJA 4PPFA 2GCOB 1EFUA 4BLQA 2DFTA 2YC2C 5DO9A 2R6CA 1LB1B 3W6PA 4LYHA 3WYFA 1IN6A 3TUIC 1KMQA 1OIVA 2ZI7A 5ELXA 2R6DA
chains in the Genus database with same CATH superfamily
1JA9A 2G9ZA 3CNBA 5D85A 3UFXA 3AB3A 1XRMA 1NNSA 4YONB 4US1R 3GVPA 2LDXA 4XIYA 5TRTA 2PJRA 1DJLA 2DBYA 1Y5LA 1KO5A 2CLFB 3F47A 2EFCB 4A9AA 2FWBA 1U9YA 3HKDA 5H68A 2N1MA 3B6IA 2A86A 2WM3A 4XASA 1H6CA 4LFCB 4CYMA 4ER7A 5A62A 4W5QA 1GEGA 5FJJA 4CPDA 2RHJA 1USGA 4LOJA 1DX9A 4JLAA 3S1AA 4YP9A 5KSPA 4V1CB 3AVXA 4B71A 4MGHA 3K1ZA 4E07A 7REQA 5IWCA 1CTQA 2C2XA 5KHAA 1L6IA 3IBTA 3U1BA 2COEA 2ZWIA 4JB2A 1DI0A 2GZ1A 5GJVC 3I92A 3HHEA 3ESXA 4KMMA 2NQ8A 1C0IA 3R3VA 4BNHA 2VZLA 2AKAB 3BEOA 2Y1EA 5F35A 4E32A 5FAKA 1VE3A 4RVGA 1K9VF 4EG7A 2D5CA 1J1ZA 1IHXA 2NTVA 2YDYA 4RF4A 4WXYB 1U1GA 2O5CA 1EHIA 1KZYC 2AR0A 1EGHA 4EFKA 1QHNA 4JOQA 3II6X 2WUEA 1V9SA 2IZ1A 4INOA 2KYRA 4B34A 1T5TA 2AFIE 4M0DA 4OBEA 1XT6A 1QCYA 4AP5A 4C9BA 2BMEA 1IAVA 1NI4B 1RYEA 1YS1X 2O06A 2F43B 2VIIA 5KKAA 3V3TA 4A03A 4FGKA 4FFWA 3K1TA 1J70A 3DQZA 4YAWA 4D4LA 3BB4A 2GCEA 2GOYA 2OWEA 2R8XA 3IGFA 4CM4B 2JGLA 4XJTA 6REQB 1KSHA 3MN1A 3IE1A 4YT5A 4QQFA 2KSQA 4YCJA 4RACA 3A11A 4F6LA 4Q4CA 2CV2A 3R9XB 1E2NA 4PC7A 3DHEA 2J4CA 3NW9A 3OUTA 4KXVA 3COJA 3L0ZA 1IHYA 3W6OA 1Z8NA 4MEAA 1F2TB 1I3CA 2TECE 4ZO9A 5JXGA 3CLRC 2VQEB 3WLMA 2YX1A 1WVGA 3M1LA 4MZDA 1ZM9A 2OQ2A 3RVKA 5BWOA 1DTEA 3N2ZB 1E1DA 4UUPA 2PLWA 1NXWA 3PWTA 2YS6A 1DWOA 4X7PA 2RGEA 3K6RA 1PVDA 3MW8A 3R24A 5CFRA 4LNHA 1J2RA 2HRBA 3RRNA 4U2EA 4DXDA 3OCUA 3R3XA 4B47A 5KHLB 5FD8A 3BGDA 4EJ0A 5KTYA 1LPSA 4RVCA 2QZPA 5FFNA 3RIEA 3U4AA 3D2LA 3N28A 1JIVA 3FNFA 4UE3S 3CLHA 4ZVSA 3N74A 3AR3A 5D51S 3LM8A 1W36B 2BBSA 2GXUA 1ABEA 3HPQA 4LOLA 2CFTA 1KIAA 3LFTA 4FFSA 1V9LA 1GV1A 3A0RB 2MSKA 4O5AA 3ZLJA 5M2QA 2YTZA 1GSIA 3ADOA 4IXDA 1DV1A 4RANA 2GFHA 1QK3A 1UZMA 3NM4A 1VMDA 5TNXA 3SZ3A 4EZEA 1T6ZA 2NSDA 2NUPB 1AGNA 4Y2XA 3SYRA 5K0CA 4UUBA 3WK7A 5BR1A 2A0UA 5D01A 2W71A 1NVGA 4MVJM 5HZMA 3DUFA 4CCWA 3H4IA 4L5YA 1E64A 1U9CA 3WGZA 2SKDA 3OQIB 1PJZA 6ADHA 2WJIA 3GBSA 4TN5A 3EG5A 1NASA 1UZUA 4R4JA 1ESCA 4YUXA 2PFKA 5E7JA 1G60A 5KYXB 3JWJA 1RS0A 2QRQA 3DO8A 2GYUA 2D8MA 4ILKA 4IIBA 4NNJA 1X94A 3QVMA 2GYVA 2P1RA 5JT1A 2Z08A 3EDCA 1FXWF 4NENB 3WDSA 1EU1A 1VGVA 2WKQA 3HCAA 4IJKA 4YP5A 2ZB7A 2QI9F 3EXG2 4X8OA 2PLNA 3EY4A 1PT6A 4DQUA 2R751 1PL8A 2YH2A 4KR0A 3AOEA 4M53A 1X0VA 5CK5A 2GI4A 4P08A 4RK4A 4FYKA 4QG3A 5FUVA 1OBOA 4W7IA 3M9WA 2OFFA 1XF1A 4CI9A 3EPHA 3KYJB 2GHQA 3TTYA 4GOOD 2Y99A 2C7RA 1YKFA 3NYQA 3IKTA 5A5EA 4CKBA 3W2GA 1O95C 3REFA 1ZAKA 2FSIA 1K0UA 4B46A 4IHAA 3Q7EA 2XECA 1E7MA 4P80A 3H5WA 1C9EA 4D3YA 1OPXA 4OFWA 1QH1B 7MHTA 5LQAA 1QFSA 4G9GA 4XGIA 1TTHA 2ADOA 4P5PA 1E9SA 5KB3A 3LOQA 3H5TA 4CGZA 2Q07A 1E3LA 3QXJA 4QUHA 5CLGA 1BGVA 3MWEA 3A3KA 2FEMA 3AERA 5BQPA 2HX1A 4AIIA 1STOA 3H5RA 2JFQA 2G88A 3PFNA 4EL0A 1I14A 1PV1A 1ST3A 4HLQB 4R0VA 3STXA 2DKOA 2GZMA 1NLYA 2FPGB 2NTJA 5COAA 2X8AA 3JR7A 4MW4A 1B6GA 2Y0CA 2QYSA 3CPSA 3SICE 4LFAB 4BO2A 1E5XA 4AYWA 2YZMA 2ZVJA 3O92A 4C89A 2REXB 3IRUA 2ZIEA 2FDCA 5EQJB 4IDOA 4RQBA 4KHPB 1B0UA 2YXNA 4YX9A 3QH4A 3PNLA 3SI7A 2UU9B 3TL3A 4LQCA 1DX4A 1NFQA 3BWCA 3RW9A 3H1FA 3JD1A 1K5PA 1H6BA 1ULUA 1YMQA 2J5RA 2VJMB 2H1HA 2BV3A 3QXHA 3OU6A 1SCUA 2JAUA 1VG8A 2PZBA 3CS3A 1O94A 1QJCA 2JH8A 3HKBB 3VDNB 3X43A 1NULA 4TKUA 4EW2A 3A2MA 1HGXA 1ONBA 3QE3A 3O95A 3BRSA 1FTSA 1ZMTA 1K8RA 2YIVX 4H4CA 4O0LA 3DBLA 3QG1A 5DTMA 3R8XA 1RMYA 3TPZA 2E1PA 1QPZA 2O9JA 4X63A 2BZ1A 3G5TA 4N76A 1E32A 2I2DA 1OXBB 2R8YA 3EGEA 3DO6A 2CF5A 1E3WB 1T4CB 2AW3A 2JJQA 4MW6A 3S70A 4JI3B 2ID7A 3QKRB 1GQSA 3EAFA 2WA1A 3AY3A 2LTAA 3DGEC 4MUNA 4XSVA 4X65B 1NG9A 2HC9A 1NL3A 2R97A 3HRKA 4JSTA 1I80A 3EEOA 2ZRPA 4U3JA 2DWUA 5JQGF 3RVQA 4E5PA 1F5SA 1SBQA 4ESVA 1ZM4A 4PYJA 2EZTA 1I1OA 2HF7A 3ZWMA 2GRAA 2FRDC 4AFNA 3LDUA 5JFOA 1L5HB 5JS7A 4YCAA 3N86A 1PSDA 3U3ZA 3M9LA 4K9KA 4WNCA 4PO9A 4J0IA 1Z6PA 2WZCA 1ND6A 4MWEA 1Y6FA 1EXWA 3KQWA 1R3UA 1PTJA 1M2OA 4Q7MB 3U3KA 3K9FC 1C0KA 3FDXA 3WJ2A 3EFEA 2FWMX 4YLEA 1P6UA 2A9KA 1B3RA 2OZLA 5IAKA 4Z3DA 2HLHA 3GDGA 2YFKA 3HA2A 4NU5A 1WMBA 3VRHA 5HHTA 2B1QA 2W2KA 4QARA 4WGGA 4DAEA 4EI2A 1W88A 4ZI2A 2V7PA 2YOFA 2GBGA 1FMTA 1O3YA 3G9TA 4KLRA 3UMMA 4D99A 1U2DC 4Q6WA 3BPSA 4WK4B 1KMNA 4KNYA 1PK7A 4KR6A 2Q1UA 2HHCA 2Q4DA 2G1PA 2AV6A 3SX2A 4N3BA 1LK0A 3H8VA 4HYYA 1VBNA 4XJSA 2FPPA 4BE9A 2WUGA 3DKIA 3ISJA 5LMCA 5A5GA 1I7LA 2WAAA 4CR8A 4MQUA 1KYWA 1J9EA 3P4YA 4M38A 5E1MA 4MUXA 4BMVA 2PKYX 2EYQA 3RHSA 5IKMA 2IHVA 1XEXB 4CL0A 2GETA 3D3JA 1FMFA 4MV3A 5TGDA 3T3EA 1LNSA 2VKTA 2YJTD 2BF4A 4OHXA 2GERA 3FNBA 1GQFA 1QHIA 2X40A 1N34B 4CE6A 1YIOA 3SC2B 1YJ8A 4M0EA 4ALKA 4EHFA 1Z45A 3Q5GA 2BFBA 2O1XA 3R7LA 3OX1A 3L5OA 3W79A 3CRVA 2FMKA 4RF2A 2G71A 3KAQA 3QKSB 4I81A 1ESEA 1VHJA 4O4HA 1DJOA 4YRFA 1L4LA 3TIXB 3MGGA 2W90A 3KSZO 2QENA 1M1YB 3BJZA 1CUXA 3QNWA 1WCIB 3EK2A 2FMHA 3MUNA 3P94A 4LGYA 4DUGD 4MO9A 1WTAA 3PC8A 4A10A 1HT1E 2Y6UA 2PNFA 1GSOA 1NBME 2JLRA 2OB1A 2Y1KA 2IUTA 4A7PA 4OQZA 2KMLA 1NPYA 2XYPA 2ZR0A 4RPKA 2P4SA 1YQEA 2BFEB 2PXCA 3EZGA 2D2VA 3OM0A 3IBSA 1AHIA 4R8MA 4UAGA 5T6BA 2XCTB 1PJ2A 3P0JA 2W6JD 1EVYA 4PTZA 1CCWA 3MBIA 3ZJUA 4C08A 1I2DA 2F4NA 2JHGA 2IV7A 1JI3A 1N6HA 2XJ9A 1JHUA 1LLQA 3I04A 1PNQA 2I55A 3H75A 1DQNA 1PWHA 3CFYA 3WP0A 4NV0A 4DB2A 1QV9A 2QM3A 1B3BA 3ROKA 1F8UA 1POXA 3M4ZA 4JIMA 4OB7A 3QEMB 3QM1A 4Z0HO 2CMGA 3UMJA 3PHLA 3VKWA 2XMBA 4AX8A 4F4HA 1HFKA 3ZWPA 3PKJA 2ONCA 1TQ4A 3G1UA 3UPDA 1GTSA 3RDPA 2BFWA 4CFSA 5CG2A 2G17A 1GTMA 4HB0A 4L8GA 1P7ZA 2QLFA 4PX9A 2YIJA 2BDEA 2AFIA 2L2QA 3C1UA 1K2VN 2V58A 4DJTA 1EDBA 2IPOA 2HJVA 4DJJA 5J4VA 3D6UA 4DY6A 4GGPA 3NHPA 2OG2A 4G81A 4GXRA 3ZE0B 4ZVPA 1L5SA 1UMBA 1QLWA 3GJQA 5L45A 3SR0A 2C3PA 1K6MA 3TTUA 1NI3A 2DZDA 3CNNA 2VTDA 2D2FA 3OZRA 1SO8A 4O3FA 4X84A 5DRYA 3AY6A 4RIGA 4KRFA 1NMEA 2R84A 4YQFA 1HXHA 4NX2A 4ZEXA 2H2IA 4A0FA 3VNAA 5LCXA 4JI7B 1PBTA 4GL4A 4JXJA 5FKJA 4ZD6A 5C81A 1J8QA 1T6BY 4HXEB 4PLPA 3O4VA 1T5HX 2X41A 1CX9B 1RI2A 1Q0HA 2RH5A 3E27A 3F7TA 5LQRA 4MKXA 2DWCA 3HCDA 3R3JA 5AM0A 3TQRA 3HEBA 4DQKA 2R11A 2ZT6A 1YO6A 3N76A 4PE5B 4QHSA 5G4KB 4C1NA 3PNOA 1BGXT 1LPMA 1TAGA 2AG6A 1FNSA 1CYDA 1WHTB 2QWXA 1E7QA 2BDTA 5EJMA 4K28A 3C4VA 2Y8EA 3WV4A 3I9V6 2QPLA 3QXGA 3JQ6A 4JGIA 4HDOB 5KMGA 4A8JC 1T35A 3BCRA 1NXSA 3JVVA 2IIVA 3T0GA 3Q10A 3T1NA 3DTNA 3JATA 1CDZA 1G8FA 1YZKA 3ADPA 4M6WB 4CQMB 2XMCA 4Y6RA 2WD7B 2WPDA 1PS0A 2IS4A 3S8EA 2H4FA 1RHJA 2VNKA 3HYRA 1CUYA 4O4LF 4QICA 4URFA 1M1YE 3W8DA 1SUDA 3ZG6A 1X1AA 3ETCA 2OLKA 4K05A 1N2ZA 1T9ZA 4ZTZB 3MMXA 3OPYB 1A88A 2WWGA 4RHFA 5B37A 4WNAB 4BLSA 1NVUQ 2GXQA 1EX9A 2PGLA 2YMLA 2Z8YM 4O8ZA 3U3DA 1AJEA 1SUAA 3INGA 1R0SA 1U5CA 1XLUA 3I1YA 2W98A 3IV9A 1AURA 1N2JA 3NJ8A 1KBQA 2CJFA 2Q5EA 3Q12A 5FUYA 1PT8A 1PQYA 3SOZA 2GQ0A 2WP8J 5KTNA 4EF5A 2ZRMA 4TS3A 3EXHB 3ILXA 1C7FA 2H59A 2YXLA 3KYDB 1CUAA 4EI7A 1CNFA 1YFZA 4ETNA 1T8SA 1ZESA 5BO5A 1DSSG 4CLDA 4WZZA 2CCKA 2ONYA 2RHCA 3AR2A 3G49A 4CRWB 4EEZA 4DS3A 4RTQA 1TW2A 4V1CA 3ZE8A 2PNJA 3RYFA 3TGPA 5HOQA 1GWNA 2AHRA 2JFXA 1Z08A 3CNQS 3KV1A 4ZCLA 2JD1A 3H9CA 3DOOA 1RAAA 1FRFS 3FUXA 1OHHD 3PGVA 4OHZA 2GNAA 4PSVA 4BNXA 3LQQA 2GJ4A 3SKYA 3GFBA 4D8XA 5EE3A 1H1DA 2GZAA 4LY0A 2YIMA 4EW1A 3AL3A 5J40A 1H8HA 5EEGA 4F1JA 2AMYA 2KWIA 1TRHA 3H2IA 4I5EA 1XMXA 5HKKD 1CY1A 1MPTA 5BR8B 2PK3A 4E14A 5JBQA 1HFEL 1UK7A 4ZVOA 2ZYWX 2G06A 3DV9A 1H69A 3B7GA 3OEEA 5B30A 3JD0A 2RAVA 1NI4A 3C1OA 2RI0A 4C7BA 4FEGA 2WP0A 4ZREA 3HXPA 2F64A 2Q3MA 3WL7A 1UXJA 2CLKB 5KI6A 2GEUA 4L50A 4U7TB 1OA0A 1GKIA 1EG2A 1IY9A 4CM4A 4DA4A 3MQFA 2OHIA 1D1PA 3NI2A 4FFDA 4S35A 4TUYF 3EN0A 2BMFA 3A6HA 4TMTA 3NATA 5SZIA 3EIEA 2IP1A 3R9XA 4AKHA 3R20A 2GZHA 4X94A 1QO0D 3HU2A 4WXMA 1PZMA 4D6PA 1OT3A 1ZD8A 4ZZ3A 3PK0A 1E20A 2B37A 4JLVA 1SB8A 4R83A 5IDVA 1ISMA 1F2TA 1J49A 2ZUBA 4E2ZA 3B51X 1KH2A 4HNRA 3RHFA 3GP3A 3CCFA 5B6JA 1ZVQA 4I4NA 1Z34A 2GARA 2JLCA 2H2GA 3TQHA 3CXUA 3I9LA 1XQWA 1H4TA 2VT2A 2GN1A 2Z2IA 1GZ7A 1G8MA 1K6EA 1WVIA 2J41A 2CXUA 1NU6A 3K09A 5H3HA 4CDGA 4O0MA 3TZEA 4WECA 4Y98A 3G6WA 1IE3A 5K7SA 4OLAA 3CURA 3RJ9A 4GIBA 1LWNA 4U6NA 2C92A 3LC1O 3GH3A 1YB6A 3DZIA 3RJZA 4L0QA 3SLRA 1FNBA 3U1TA 5JXWA 4WCDA 3ME5A 1LTQA 1VPDA 2WM9B 3R0XA 4RHEA 1SB9A 2QSZA 3EODA 4PYKA 2VHTA 5JE8A 4JDUA 4MWTA 1AMUA 4YJ2F 1O54A 2AJBA 2BGTA 5JZ9A 1SJ9A 3HB7A 3L6CA 1RCTE 5HOEA 3WLRA 2NUPA 3QJGA 5B4TA 4D6XA 2X2EA 5THQA 1Z4MA 3MCZA 1QBGA 4K9NA 4MH0R 1LLCA 1Q2XA 3FETA 1E1CB 2OCBA 1D4ZA 2ZSFA 3EDYA 3CPJB 3MIIA 4N7MA 3RVPA 4JUFA 1EP1B 1H2EA 4R3WA 4IAOA 2H4YA 3BFJA 3K1JA 3L82B 4D81A 2N46A 2EU8A 1CKEA 4I99A 4JXZA 4BNKA 3Q7RA 4YO7A 1PZGA 2X9NA 4PXAA 5AKZA 2G8LA 2CGEA 5HFNA 4CEIB 1E92A 1OOEA 4EL5A 2RARA 4LXGA 4YBRA 4AMYA 4N40A 2VBGA 4ARBA 2WUDA 4NENA 4DBLC 2CLCX 3AJ9A 4O1MA 4OFBA 3NHMA 3BF8A 5E7QA 5REQB 1RP7A 1VJ1A 2BBTA 3E3LA 2V7UA 3ONNA 3ZC3A 1REQB 3IHLA 3QVJA 4TXNA 4BTLA 3PFIA 2DY1A 3ZGVA 2PVSA 5FO0A 1RJEA 2FUKA 3OHSX 4PC6A 3ZGOA 1WXXA 2ZJFA 5L9AA 5GJWC 5LNK6 2RBGA 5TF0A 4JI0B 5JAPA 1RLIA 4ZO7A 3DD5A 4ZOBA 1HRKA 2G83A 2OGUA 5LQDA 1N0IA 2X1VA 2OFWA 4IHJB 1WS6A 1TKAA 2HTFA 3HDTA 3BDVA 3MJ4A 5TPZD 1K1EA 1P4HA 2OT3B 1V7ZA 2JLZA 1BVHA 1AGRA 5JRJA 4HN2A 1DARA 1XRRA 3WNDA 3IB3A 5JPCA 2BKXA 5KNCA 2JA1A 3GJYA 1UDAA 3NYRA 2A67A 2I9KA 3ZS8A 4X7BA 1QH1A 3CCCA 4WXPA 2GO1A 4G8CA 2XDQB 4PNHA 1X1SA 5EJAA 4CETA 1P0QA 2BR5A 2DQZA 1WPQA 2J9XB 2XUKA 3BL5A 2AJLI 1U02A 4O2BF 4TL7A 2DAPA 3RC3A 4YMHA 4Z4GA 2PH7A 3WKCA 1CIVA 4RK1A 1JXMA 3FPBA 4XR4A 2DJIA 4EH1A 3CH5A 1BXZA 1GT6A 3ESQA 4FUQA 3RAGA 3UOAB 1Z5VA 4EGCB 3F3SA 4Z5XA 2FPGA 1C7EA 1E8MA 3C8DA 3P26A 1RI1A 2ZS8A 4EKEA 3B9BA 1ZN8A 3OZEA 3PVCA 3Q87B 2JC3A 5D3MB 4M88A 3ZHQA 1MX9A 5EJ8A 4MXDA 4J3NA 4XLTA 5EIAA 4OLHA 5HK9A 3GJ8A 3TO5A 2VJAA 1JKIA 3AEXA 5FV7A 2IOFA 2Q9AA 1KMIY 2ONKA 2AOXA 4AAYA 1NQUA 2PMDA 3VTKA 4MGKR 4ZVRA 3J81A 3BD7A 1I10A 4FSXA 3OQ1A 4PGAA 2C9OA 4QZVA 1RYBA 2FR1A 2BM9A 3A14A 1KZ9A 3MT0A 4Q5IA 2VJMA 5J59A 4WOKA 2RGXA 3T61A 4F9TA 4PGMA 1Y8CA 3I12A 3TECE 3CVYA 2YQ4A 1LRKA 3EA4A 3HKBA 3SZGA 2G9UA 1ADJA 1QFJA 1FPMA 2XB4A 4KP7A 4MARA 1WB5A 3GQBB 3PQ4A 2Q4BA 1BVUA 1NBMA 2MYPA 2D62A 3P0FA 4G65A 2NXNA 2JLXA 4CR7A 2TMGA 1WETA 5E2AA 5JD3A 4G1EB 1CF4A 3DR5A 3G2NA 1H3NA 2Y1GA 4GH5A 4OGLA 4ZOAA 5LQNA 1VLMA 4CHGA 5A2QA 1E3WA 1T4CA 2XGOA 3PQ7A 5I9NA 1DJNA 2ORYA 4WKNA 3IVAA 3PCTA 5ESDA 3RF7A 4A6EA 3ZZ0A 5IC4A 3B60A 4EELA 1VE6A 3NHSA 3PDIB 5CJJA 2HA7A 1QH9A 2CNWA 1ZUWA 2A7QA 4P3OA 4FMDB 4DNPA 3I6MA 2XKBA 2WF5A 3DOEA 1E0AA 4DMHA 2X3YA 4K6MA 5EP2A 3ONWA 3T1OA 4LDZA 4UTPA 4EYSA 2IXGA 1SULA 1F3LA 4JVSB 1YWGO 2J4FA 3DEHA 1L5HA 3ZV3A 3M3PA 1SVNA 2PL1A 4GBMA 4NFYA 5AK3A 3L0PA 2Q5OA 4LYGA 1S8AA 2LWIA 4B8ZA 3CVWA 3M33A 1SZPA 1WCYA 2HPZA 2VUHB 5I4CA 1UBNA 2AH5A 3M1AA 3U48A 1SK9A 4MPRA 4WINA 1N5RA 3H9UA 4IOJA 1EE1A 3QP9A 5H5JA 4HY3A 4PC2A 2XT9A 3RTEA 4LVNA 1X13A 3R3SA 1PFGA 1W0CA 1Q0UA 5CXUA 3DYBA 3BIJA 2QL7A 1KC1A 3DS8A 3F3YA 3KLNA 4BPBA 1U3VA 1PJ4A 1R5JA 1YJ5A 1Z6YA 4RO0A 3CEAA 4V0LA 4EG5A 5I6DA 1NMQA 2IBMA 4WLEA 3FE2A 1VCHA 4TSKA 5FI0B 3GOHA 4UNIA 5KTPA 2YWEA 1RLOA 1HYHA 3KETA 4TQ9A 2GPWA 2WOJA 2OR3A 2ZRCA 3JWEA 4H0NA 4A1OA 4OK3A 4HTAA 1QHHB 1IZ0A 1D2EA 1FA9A 3PNVA 3W78A 1LCIA 1NU8A 5EIBD 3ND9A 4PAGA 5ECYA 1ZJZA 1GPYA 2GJ8A 4Q3OA 5AIBA 3R8FA 1RP1A 4J2OA 4MKGA 1O6GA 4U2FA 2W70A 4OSPA 3LZDA 2IBTA 2HTEA 1XEXA 3S6JA 2FMIA 2C59A 1AB6A 2ZRLA 3BERA 3ZDZB 2V0GA 2Z09A 3F7NA 3Q8WA 1RYDA 3L8ZA 3LE8A 2H2AA 5CXSA 4RGYA 1N3BA 2DSNA 3EDOA 4DY4A 3R09A 1HV8A 1Y1PA 3HCNA 3RTGA 4Y6OA 3SC2A 3GFFA 2DTEA 1WCWA 1Z5GA 3LC0A 5DSXA 3OI7A 2RCYA 4GVXA 1E4YA 3H2JA 3IA2A 1KPIA 1RAHA 2J3IA 5AW3A 3HCOA 1OBHA 2IKQA 4RJ2A 1Q95A 1X8LA 3QKSA 3CWZA 2R65A 3I61A 3U7HB 4WY8A 1NRJB 5KWVA 2WJYA 1RHKA 2CDBA 5CK4A 4F5YA 1M1YA 1RXCA 1WCIA 8AT1A 4LHZA 1CNEA 3MD0A 4JJ8A 4KE8A 1AO3A 1DCMA 1I2BA 1RYYA 2I1LA 2NZXA 3EUAA 3H0EA 2PAFA 3H83A 3MJHA 2O19A 5K4AA 1G5IA 2IXEA 4YREA 4I14A 4A0QA 2N0SA 3LQRA 4RSRA 1CZHA 2BFEA 3K9BA 4QDJA 4XM1A 1C41A 1GGEA 3OQ6A 3FOEC 4EG6A 3M3DA 1VLZA 3EZ9A 1QGED 1VP9A 3DZ8A 1XHFA 2ODPA 3FPJA 1H0RA 1RYFA 5SV2A 4KWHA 3NTLA 4ZU3A 2QT0A 4Y6PA 4F4JA 3FF4A 1YA6A 1BN6A 3FVWA 4BJ3A 4R9NA 2YJGA 4KUHA 5YASA 3I9V1 3TF5A 1JIKA 5B12A 1HNNA 4INPA 4IDGA 1B2LA 1WBJB 3QEMA 4MLDA 1WXHA 2FF5A 3MMNA 2YVLA 2F9MA 3PEUA 3PNBA 2BKEA 4IMIB 3TW8B 2JLUA 1FTWA 1BYIA 3FMIA 2AK3A 4J0GA 2C8JA 1E3JA 3R9IA 2V03A 5E3JA 1MB0A 3FPGA 4BUZA 3TVYA 1CDEA 5IT0A 4A6XA 1G20B 1BC5A 1MIHA 2G0TA 3EQ2A 4NYIR 2WDPA 2BLLA 1NVBA 5L3SB 4UU8A 4FB5A 4A0HA 2F00A 2FGKA 3GEBA 1JR4A 2YQZA 3MCTA 1KK0A 1K98A 1R0YA 1EBUA 1MUUA 3CGGA 4PZAA 3ZHUA 3ELWA 2A1IA 1YIAA 2BP7A 1DNPA 2C5AA 1F8FA 2D5LA 1UBSB 3CX6A 1VL8A 3KYIB 3K92A 5DM1A 3SVZA 3BA6A 2GSWA 3JZDA 2JNWA 4MCJA 2IIPA 4X1OA 2FPWA 2HMVA 3KNZA 4HB4A 1BHJA 3A4YA 4PFQA 3TS1A 1T4MA 1EMDA 2G77B 4RA9A 3TX2A 1COZA 3M6WA 3QTTA 4FZVA 5HTOA 4JLPA 4KQKA 1QJ4A 4HEHA 3CRZA 5AJVB 2JJ2D 1QK4A 2VOEA 4KW7A 3W0LB 1QZUA 4GBED 2BONA 2P9GA 3RFXA 2XMSA 1A8SA 4F96A 3ZIUA 3V4RA 2ZAIA 3CTMA 4EUHA 3TNJA 1KMMA 3DB2A 4UHBA 1DUVG 2Q9CA 4F84A 5G4KA 2WJWA 4N41A 4EUKA 1U2SA 2XF8A 1WHTA 3EIQA 3HJUA 4J4HA 5BSHA 4YPOA 1X8XA 1U3TA 4HLDA 2HCJB 4ZYWA 2JH3A 2QTMA 3AOEC 3D3QA 2Y1FA 3HUFA 3K35A 1GA1A 4F60A 5CDFE 1IWPB 4GMFA 4M6WA 2FWNA 4CQMA 5BOSB 1P9RA 3JAMA 1GTG1 4UU7A 1ZICA 4ARIA 2CKDA 1MJGA 3ESZA 4JLOA 4X6XA 3B5EA 3N9IA 3EW7A 1LV8A 3EVFA 4MUIA 5B1YA 4PAWA 4NZOA 4US2R 5FNZA 3RS7A 3KWLA 2C4TA 2ODEA 5J4KA 8MHTA 2PD6A 2IKSA 1ABBA 3M8KA 4F72A 3OPYA 2JLAA 1H2YA 4I1OA 3M6LA 1XYYA 4WNAA 5CLHA 2WMYA 3ZNNA 4RH1A 4L27A 1MG5A 3CKKA 5CIYA 4J43A 1RVV1 2CD9A 2AS0A 5LA6B 1KETA 2FUCA 1ID8A 2D1QA 5DBIA 1DWUA 1LNZA 1H9AA 1HY3A 1ULHA 2MYUA 3E6AA 3NOOA 4R2WA 4U39A 5HZGA 2O2GA 4OO3A 4NCXA 4Y1RB 1UXIA 1ZXXA 3GJ5A 2VDPB 1FNNA 1VE5A 1OX6A 2KI5A 1Z2DA 2XQKA 3BYZA 3HWWA 3JWGA 3JYOA 3KYDA 4L6CA 5G40A 2HT6A 3BA1A 3EEYA 3MOGA 4OXRA 2YVQA 4WPGA 1YE3A 1GPNA 1TGVA 4IR7A 1A9RA 4LXTA 1UP4A 3QPDA 1H3FA 4GS5A 3D02A 3Q72A 4IJVA 4LCEA 1CRLA 5IABA 4BATA 1VPEA 5ALEA 2ZRHA 2H0RA 3G5LA 4MUAA 1EDOA 1P8JA 4GI5A 1E2EA 3CX3A 3R23A 4I6EA 2XRZA 3R9WA 5AK6A 5GM1A 3GYGA 2CVPA 3IO5A 1KJJA 3AJ8A 3AGPA 4JQSA 2WYHA 2JAXA 2QS9A 1GL3A 1H5NA 3O91A 4F4DA 1WXIA 1U1DA 1DAIA 3REOA 1JZQA 3EW9A 1LJUA 3JYHA 4Q3CA 4XGRA 2CUNA 1G20E 4WUTA 5GOZA 1GARA 4ND5A 2XRMA 5AI4A 2AWNA 1QIIA 3E05A 1YBFA 3UF0A 3UMRA 4YS6A 2XCOA 1CUGA 5BORA 3KU4A 4WMLA 3HP4A 4GYYA 4RZSA 3AVQA 3OPXA 3TG2A 5SZHB 3OTIA 4QBKA 5EINA 1U2EA 4CKEA 3C5VA 2VJBA 2E87A 2KLBA 1OJLA 4G5RA 4R1TA 4H1WA 1DKNA 1HG0A 1EHCA 1XZCA 1F6WA 3GLQA 4HNTA 2VBFA 5BN1A 1YS4A 2X0JA 2ZB3A 4OJTA 3ZE7A 4H3HB 1G5QA 2VAMA 3VH2A 4UBLA 5A4MS 3PI7A 4AYTA 2ZWVA 2PFSA 5FR2A 3UV3A 3PVSA 1Y1SA 3CVJA 2XHZA 1KE1A 3TZKA 3RYCB 1VBMA 1EBFA 2VPZA 2WAMA 5FBQB 3V5NA 3LT1A 4XDYA 1RM4A 4IQFA 3O74A 4LX0A 1XQ1A 2V4MA 1DUIA 4W5WA 3NC1C 4I8XA 3AM1A 2LCIA 3IUQA 1FFSA 4E21A 2JD2A 5LNK1 2GAAA 3A3YA 1Y6JA 5TC4A 3ZOZA 1IXZA 3QVWA 4DREA 5JSUA 1O97C 1FP4B 5DLEA 4YXWA 2C54A 3E15A 3GG2A 1TYEB 3T41A 2ZJ8A 5IULC 1EFCA 3Q9LA 3FOZA 2WC1A 2HMWA 3LUBA 5BPHA 3PGA1 5EL0A 3REGA 1RRPA 4E12A 3TSAA 1ZVVA 1FYFA 3U4CA 2JGJA 1Z2PX 3PR3A 3OQNA 1VBKA 4X8HA 2C94A 1HL7A 2B3DA 2J3DA 3ZCVA 4CLOA 1LH0A 1VRCA 1VGRA 4KFUA 5EHZA 2QPTA 3MWDB 5KOHB 4MMXB 2X13A 3UGJA 1E1CA 2FCRA 4OXNA 2ZM5A 2FFJA 5AJHA 2H1CA 2J0VA 3DXYA 3X2EA 2PMEA 1ZD4A 1EFRA 2YHIB 4YRRA 5HUJA 1LPAB 2BGIA 4X6UA 3FLAA 4L5JA 1R5OA 4FHGA 3W04A 3SNKA 1HNZB 3Q0TA 1PUIA 2Z4TA 4OP1A 5ESXA 4FYPA 4CEIA 4Z4FA 3M6VA 3SDSA 2QN7A 1JB1A 1W93A 4L07A 3C43A 3MD9A 4JQOA 2NT3A 2I4RA 2Q5JA 1DFHA 4FPXA 5REQA 1Y6GA 1BE8A 1UINA 2VA8A 5JTUA 1GKLA 1IY1A 4ZYXA 3NHBA 1P81A 4YALA 1REQA 5KEIA 1W48A 3W9YA 3K71B 2DVMA 3TSZA 3A1FA 4G0YA 3Q3EA 4H6VA 2P9YA 1LX6A 1ZUNB 1FUIA 4L9RA 1CQZA 3GMTA 3MRSA 1SCKA 3FCSB 5D6OA 3N6RA 2C2KA 2PO7A 2PRSA 4DM3A 1A8PA 3DEKA 4HX5A 3OA2A 5JQGB 1SHJA 2FDXA 3M34A 3QNMA 1W85A 3H1AA 3PC8C 3LXRA 4IHJA 3SFTA 3WR5A 4TYNA 2W2NA 5NULA 1WM1A 4RVSA 4TMXA 2QL6A 5ALLA 1KYTA 5E9WA 5KCMA 3QUQA 4XWTA 4DMMA 5BV1A 4H7HA 1M0EA 2OHGA 3OKAA 3DOUA 5CT6A 3L43A 4BGVA 4AMUA 4DJEC 4RD0A 5CB8A 2H92A 2F3QA 4DQLA 4G5GA 1EGVB 1LS1A 3UKDA 2XDQA 1X1RA 1JAIA 2BFAA 4TMKA 3DMPA 4HQ6A 5ALTA 2L69A 1XNJA 5A0TA 4HYQA 1U0EA 3HYSA 1SMKA 4ZARA 3WOHA 3G9UA 3OM8A 4U0JA 4PF1A 1DBIA 1ZW1A 3PNYA 1AMOA 3M4YA 2B92A 3Q0IA 1NWCA 2FZKA 2RHBA 4KNVA 1E3SA 3RWMB 3V2HA 4AM8A 4Q7LA 1U7ZA 5KTTA 3MJCA 4PN3A 5JCZA 1Y6QA 5D3MA 5AP9A 2Z2YA 1ORHA 1K63A 2P3LA 1IY0A 3EZYA 2BDUA 3BSYA 3ENVA 3T3GA 5CITA 3ZHCA 5TB5A 2XTZA 4NXMB 1T36B 5KS2A 1TKRA 3ZNQA 4OHVA 1LK5A 3QEAZ 1WKVA 1L4EA 3HDGA 4D3DA 1WW8A 3IQEA 1FMJA 1GZ6A 2B8WA 4JXKA 1U2ZA 4ZQCB 1FYEA 2XOKD 4OP3A 5FPSA 3T1TA 5FBLB 3V4FA 4MNTA 2G28A 1VI5A 2PGXA 3C3EA 5HBRA 1YRHA 4YPVA 1DP4A 3HYNA 3B1FA 3IMEA 4FC7A 1V47A 2VCHA 1TYZA 2CLHB 2NU7A 2JJYA 3LWDA 4QDTA 2Q1WA 3Q15C 1L7OA 1ZEMA 1JX6A 3GQBA 1GGFA 3SF0A 4QXAA 2FWRA 4KTTE 5A5VA 2QTBA 4OF4A 3O75A 2E5FA 3JYQA 4YAUA 3GMIA 4B35A 2A9OA 3TUJC 4NK5A 2XQJA 1GLNA 2HSJA 3CUKA 5AIAA 1GXSB 5TMDA 5JZVA 5LD2B 1MAWA 1U1EA 3FYSA 4GWKA 4Z49A 3A6KA 2ZJAA 3DHVA 3I8XA 4C06A 2XNCA 3VKUA 4I8DA 2ATXA 3U09A 2EF0A 3TIVA 2EBHX 2GPSA 621PA 5AW7A 4B85A 5CU7A 5AI8A 4AJEA 5B57C 2GA8A 3WLHA 3GEEA 5SYAA 1N32B 2M6SA 3GPDG 4M83A 4X71A 1M8KA 4WFQA 1FDVA 3FHCB 3FMPB 1JDVA 2E4VA 2HK6A 2YWGA 5GY7A 5BSRA 5AW5A 4E33A 5BWBA 4LJAA 2HD4A 3PLNA 1JHAA 4RIFA 1Q7BA 2CXOA 3GJ7A 5EYPB 4XD7A 3KSMA 5JSKA 5TMBA 2D0IA 3KOUA 4TZ0A 4NZNA 1O9GA 3GLKA 3OKPA 3VPCA 4N8EA 2C4WA 1F20A 4AYXA 2PSJA 4ZZ0A 5IZ4A 4MMZB 3L6OO 3WWPA 4EUFA 1FUYB 2FN7A 3KQUA 1X8JA 3BJIC 4YWHA 3T0IA 5LLDA 5L7WA 2ZWAA 4UAUA 1NLUA 3LCJA 4FT4A 1PFWA 2QTVB 5J2UF 5ALJA 1DIHA 2UZIR 2Z2XA 3DMGA 1E1RA 1X1BA 1GPKA 4DSTA 1QP7A 2OTCA 2CMDA 2X4LA 4PX5A 1UH5A 4JBGA 4R1MA 1QHHA 2A78A 4C3ZA 1KE2A 3BICA 1ZIXA 1Y5IA 2ERXA 4FQ5A 4OKIA 5GGYA 2YFQA 4N65A 2A5DA 4M1EA 3JARB 3TMAA 9LDBA 3OZSA 3W9SA 1O8CA 1HH4A 2A33A 1X2EA 3Q85A 1Y3CE 4J1SA 3TJZA 3MJTA 1RQGA 4P5DA 1R8SA 1CZKA 2BSQA 1DTWB 1MRNA 2H9AA 4TYYA 3EZ7A 4X95A 4D0SA 3NEYA 2EBWA 2HPHA 3OCXA 3KJQA 2BKUA 3R6TA 2GD6A 3FF1A 4LZOA 1RCFA 1Y3BE 2IU3A 4MAFA 4NEGA 5CPBA 1YASA 4MAMA 2AOUB 2PA3A 1BG6A