1Z08A

Gppnhp-bound rab21 q53g mutant gtpase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
167
structure length
160
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
total genus 53
structure length 160
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z08A00
3P1JA 4IFBA 2GZAA 5B2ZA 4PC6A 4MGZR 4B2PA 2IEYA 5CM9C 1WQ1R 3LX5A 2I3BA 2NGRA 1JR3A 3T1VA 2ZYUX 2HXYA 3BFXA 4DB4A 2ZJ2A 4RY2A 2EWVA 4JLBA 3K0FA 4XVRA 1KKLA 1RRPA 1YHNA 1M7BA 1M1YE 1UBGA 3RABA 4V03A 3B1ZA 3VKHA 5BYJA 3KKOA 1PVOA 3PUWA 2WAYA 4QG7A 1M8PA 4GI7A 4P4UA 4HSEA 3H4MA 1BYUA 1NSTA 3VNUA 5SZJA 4DLTA 1N0VC 1ZUHA 3LY5A 3M4YA 1UEJA 4HAZA 1MR3F 4QNRA 5KOYA 4Z8YA 2N42A 5H1YA 3EPKA 2AX4A 3TR5A 1Q1BA 2DWOA 2W6ID 1QDEA 2JCSA 2NZ8A 5DI3A 3B85A 1T4GA 1NVWQ 3TK1A 5KNCA 2G0NA 1N6OA 3EZ6A 2QP9X 1IXRC 5HE8A 3SQWA 4KU4A 4LYJA 4EFNA 5KYKA 3O8CA 4US0R 1YRBA 3TUJC 2IL1A 2AXNA 2R2AA 2ZROA 1UBEA 3V9PA 1UDWA 4PSVA 2ZSEA 1N0UA 1KK2A 3WP1B 1OFHA 4E03A 1YE8A 4EJSA 4GFDA 1W7AA 2F6RA 1A7JA 2YOGA 2PZEA 2DB3A 4LJ8A 4DIEA 4EPRA 3MG9A 4IOLA 1ZNXA 4LOAA 1WBBA 3PFIA 5LPNA 2GDJA 4QBFA 1TTTA 1YR6A 1KJZA 4CYMA 3AM1A 1GZSA 4B3DA 1LVGA 4P4SA 1JNYA 1BIFA 1J8YF 2OILA 4XTRA 4CVNA 3FTQA 5FR2A 1K5DA 1KI8A 3IBGA 1OIWA 3K0FB 4JIMA 1NN0A 4JLPA 1ONBA 2BMFA 2ZJOA 1TADA 2DFTA 4POAA 3CRQA 1QHGA 2FN4A 4BASA 4PHTA 3AKCA 1HYQA 2H5EA 4KFTA 4ZCLA 1OSNA 2WMOB 5C1BA 4US2R 3RLFA 2H57A 5J47A 4HZIA 4K46A 3U4QB 4PO1A 2JASA 1MRNA 1NN5A 3U44A 1ZJ6A 1NP6A 3GJ4A 2OO7A 621PA 1RRFA 2O8CB 1UBFA 1TQ6A 3OESA 4N0EA 5GJCA 4JVNA 4Q48A 1VPLA 2WZQA 4D82A 2X2EA 2WJGA 3CX7A 4TT3A 4C0JA 2R6GA 2HLDD 4DLVA 1QHHB 3VKGA 2FGJA 121PA 1CU1A 4B3XA 3Q5DA 1II8A 3A58B 2V3CC 3GFPA 1E3MA 3GJ5A 2AD1A 1XTQA 2RH5A 2Z0MA 4C0QC 3TQFA 1W36B 3GCGA 4HAXA 5TMPA 2IBMA 2WKPA 2FFQA 4K81B 4DSNA 2OFOA 2WM9B 1XJ0A 1MRSA 3I92A 3KKPA 1KDTA 4URVR 5DI3B 4PAQA 1P9NA 4B6FA 4Q9HA 2QORA 2ZSBA 4EUNA 1IN6A 1AIPA 4QJ4A 1G1MA 4FWIB 2QSZA 4D81A 5DHFA 3THWB 5CYPA 3QNUA 2E9SA 3U3RA 2VP6A 1XMVA 3LLMA 2AK3A 4HEJA 4QOSA 4ASUA 3EZ9A 4Q4HA 4B3GA 1II8B 2CHVA 3DZ8A 3HU1A 3LFUA 2GEDA 2OCBA 3FFAA 1Z63A 3U7FB 4KITB 2HJVA 3PITA 4RZ3A 1G8FA 3NG1A 3EW9A 4NBSA 4PHGA 3W6PA 4BUJA 4M1SA 4D80A 5IK2D 1LNZA 5JRZA 1K5GA 1V43A 4L5BA 4HZUB 1NSFA 1XD2B 4NCHA 2PX3A 1DELA 3HYRA 4WXRA 2F55A 4GRAA 5E3HA 1XPRA 4B44A 2O8EA 1U90A 2CL0X 1ZIPA 1FP7A 4JLAA 1ZINA 2ZRIA 3QPUA 4DCVA 1ESNA 3UATA 4A0RA 4V0OA 4OHYA 3EG5A 5JEDA 3FYHA 4G5QA 3SJAA 2PX0A 4MYTA 1P5ZB 4DLUA 4IVRA 2R6CA 4EPXA 3CIOA 4LJ5A 2V1XA 1FFHA 3OF5A 4IRUB 4ACAA 3LA6A 5JI2E 1J7KA 2OBLA 3CF6R 2DHRA 4HLCA 2FFAA 2QE7A 3QF4A 3U5ZB 4IEEA 1CP2A 5DLQC 3U7GA 2QNRA 2ZE6A 2WJHA 4EPTA 3DKPA 1VMAA 2XNDD 3LBNA 1F48A 2GZHA 1CR1A 1PJRA 4JT4A 4Q4AA 1S3GA 521PA 3D8BA 4LY6A 4BRWA 5B64A 1EFRD 3C4JA 3WHLA 3THWA 1CJUC 2IS6A 1ZM7A 3IO3A 3ZZUA 4D4JA 2EWWA 1ANKA 2GETA 3I32A 5CIWA 3ZD7A 1F6BA 1L7VC 1AN0A 1XNJA 4TQAA 4XWAA 3QBVA 4RD0A 3RRZA 2FEMA 3X1DA 1RIFA 3I61A 2OUKA 1U0HC 1Z6AA 4C7OA 4QKQA 2R6FA 3TSWA 3IPXA 4DDVA 1AGPA 3NXSA 2F1IA 4LHXA 4TYYA 1NRJB 4DLYA 1ZM9A 4R2HA 4ARZB 5L3SB 1N5IA 1IY1A 1Q1EA 2FSFA 3ND8A 2JLSA 2ZYTX 1E1RA 1XJCA 3L0SA 2AR7A 2QQ0A 1IXSB 2O52A 1G20E 1G41A 1TUEA 1ZM4A 3QF4B 4Q1AA 3ZD6A 2NO7A 1FTNA 2FWRA 1U9IC 3A4MA 1WDTA 2XXAA 3MJRA 1R8SA 2ZETA 4DEXA 2ZRDA 421PA 2XEXA 3SJCA 3ICEA 1E2GA 1N6HA 3LVRE 2Z6VA 3A1VA 5A4JA 3MAAC 3BB4A 1XD8A 4KLNA 2J0UB 2GEVA 1OPXA 5CB8A 4ARZA 3I73A 4PANA 3CF0A 1GRNA 1FMJA 2F9LA 2JJ8A 4QXAA 1M74A 4TZ0A 4AYTA 4O2LA 1TL7C 1TEVA 4GZMA 5GVSA 1YZQA 3K0EA 2UZ3A 3FMFA 1YR7A 4GDFA 3P26A 1MO6A 3SYNA 1A1VA 2CVHA 3KJEA 1DS6A 4M9ZA 4AY2A 3X1XA 2YNMA 3TVTA 1E4YA 1AZTA 4AC9A 2GBLA 4DLXA 5DN6A 1OF1A 3ADDA 2XX3A 3WY9A 1FNMA 2WWWA 5DSZA 4L4UA 4PC3A 1RRGA 4AYWA 2QZ4A 2ZI9A 2ZJ5A 1NVVQ 5CB6A 3Q5EA 3WMEA 1UDXA 4AG5A 3P27A 3B1YA 4TMZA 2NMVA 1NJFA 2IS1A 1BH2A 1EX6A 1KO8A 1R4AA 4C30A 5E7MA 3K8YA 4PAMA 1SZPA 2ONKA 2GXUA 1PLLA 1JXOA 4B47A 5G3YA 3IDQA 4JBXA 5JMTA 4U7DA 2R65A 5AUQA 1AGRA 1WBDA 1KHTA 1AA9A 4XIGS 2GAAA 3Q7PA 3QKRB 2ZRKA 1B23P 1WRBA 3VR6A 2YOHA 3NDBB 3ASYA 1W46A 2FSHA 1TF2A 1ZUNB 1EGAA 4P3YA 4ZCIA 2J5XA 1IAQA 2GJSA 2W2XA 2WPDD 4WXPA 1WE2A 2QAGA 3U7EB 2BEJA 4GPTA 1JALA 1NL3A 4WA7A 1CTQA 4HLDA 5HR5A 3PXGA 4ZCMA 1Z06A 3QUSA 2Z83A 1IY0A 1IHUA 5J5CA 4CDGA 4EPYA 4Q7MB 1G7RA 3KZ1E 4NU0A 2D62A 2WOOA 4B35A 1XFAA 2XTMA 5CITA 2BBSA 2IUUA 3CRW1 2RGGA 3QEJA 3QG5A 2WOJA 3IGFA 4TL9A 1SVIA 5E7IA 2C2HA 2JJ1D 3G0HA 2CL6X 1KAOA 3BFVA 1J90A 4BE7B 3BFKA 1W1WA 3IIJA 5LBIA 4GOJA 3EIEA 4TMVA 2ZANA 1LB1B 1K6MA 2O5VA 3Q85A 1HV8A 2QPOA 3K9NA 1DEKA 1CRQA 2IT1A 4HLQB 4Q1EA 5FTNA 3W8RA 4D4KA 2L0XA 3TW4A 4RFSA 4QM7A 5AWFC 4MKGA 1NF3A 3AVQA 1KZGB 1UKVY 1EFHA 2MSEB 3CX8A 4OK6A 2YC4C 4FCWA 4Q4JB 2AXPA 1SKYB 2QTVB 1GKYA 1ZRHA 2LKDA 1YZLA 3MSXA 2UVQA 3GJ8A 5CJ2A 3GJ0A 1IJEA 2WWYA 3PEVA 4ZDWA 4JLNA 4XVQA 4OK5A 5KSZA 3B13B 3RC3A 4NH0A 2FNAA 2WIAA 2ZI3A 5EUMA 3QVUA 1D2EA 4KJZA 4LHWA 3ZVNA 4TL8A 4CEIA 4JJZA 4RVCA 1MO5A 3P4XA 3NDPA 3RSOA 2D4HA 1Z2AA 4B2IA 4D6PA 4TYNA 1G8HA 1E9DA 1I4TD 2HCBA 5DHAA 4I1SA 3QOFA 4F92B 2EQBA 1O3YA 5A0FA 4GL2A 1P62B 2OEPA 3CZQA 1UKYA 3MWKA 2ORVA 3KXLA 3CBQA 2DY1A 2OFWA 2G83A 1W4CA 2RMKA 3QKUA 5EP2A 2BVNA 1FX0B 3MLEA 4CGZA 2XTNA 2V9PA 2VPPA 4IOKA 5L3SA 3HPRA 2OM2A 3EA0A 1W4BA 3CZPA 1E94E 2BMDA 2JDID 4XWKA 2XB4A 2QRNA 4UNPA 3P4YA 1DVRA 4ASUD 3C7KA 4M9QA 4QGHA 3AVXA 4PZYA 4IDQA 3ZIAD 2ERXA 1QVRA 5GJVC 1OIVA 1W36D 2DFKB 1OH8A 1BS1A 3UK6A 4K8OA 2RAPA 1UFQA 2VHUA 3A1SA 1T9HA 4FINA 1ZP6A 1AZSC 1H65A 1XCMA 2J0VA 2LCFA 3BGWA 3K0SA 4OHXA 2PJZA 3CPJB 1G291 4OKSA 4A4DA 5JBQA 4YMTA 1YZUA 1C9KA 2ZRFA 2ORWA 2W2TA 4PPGA 3E5HA 5TB5A 2P5SA 4C0AC 1UKEA 2VL7A 3UWOA 1EG7A 3CPHA 4WZ6A 5EXTA 4E07A 4GSYA 3QXHA 1XDBA 1H8EA 5AJXA 3CRMA 1RJ9A 4R7ZA 4FXPA 4KCGA 4LX0A 2GXAA 1N6KA 3SQXA 3NEYA 1Z22A 2OE2A 1DE0A 2C5LA 2I1QA 2C98A 3JZMA 3QQ5A 4BEBA 2HV8A 4M21A 1E6CA 1XTIA 3X1WA 3M0EA 2RGXA 5FL7A 5JLJA 1IN7A 1XTJA 2FOLA 3ADKA 4Q18A 1TX4B 2HUPA 4F91B 3PIRA 1KI7A 3BJIC 1E2HA 1UEIA 2O8DB 3QKRA 2GF9A 2IYWA 3RVBA 3AGPA 2ZRLA 3U7HB 4PC7A 1HT2E 1G3QA 2XGJA 1IXZA 5CK4A 2VP9A 2ZTSA 4LBWA 2FGKA 4NE2A 4YMSA 3GEHA 1S9DA 3LAWA 2VA8A 1RFLA 2VHQA 4DKXA 1JQLB 1E0JA 4N0DA 3AF0A 4LBVA 2QM8A 1D2NA 4LPKA 1L2TA 2P6NA 4Q9JA 1NLFA 3A37A 5EP3A 3AVUA 4O3MA 2A5FA 2XZLA 4Q4AB 3M1IA 2IYZA 4M1MA 5EUQB 1N6LA 2PZGA 5KSYA 1NY6A 4OI2A 4DC9A 5HPYB 5JJLA 1EK0A 1HE1C 1ZD1A 5EE1A 3TUIC 4EFLA 3P32A 4A6XA 2NQ2C 1X8KA 3W8NA 4JKYA 2JLYA 2C96A 1H8HA 4JL8A 1BMFA 4S2EA 2RKOA 4UJ3A 3LBIA 4NYIR 1OFTA 4JS0A 4P31A 4LYAA 4XTCS 6Q21A 5FPTA 2VSFA 5D3MA 1VG8A 1N2CE 4GOKA 3J81k 4BLPA 2V6IA 2P6UA 2BWJA 4HLUC 3R9IA 5EE9A 4MQBA 4P32A 4RKFA 2ZI7A 2BC9A 3ECCA 3DDCA 5FPHA 3LV8A 1N6NA 3ND9A 1QHIA 4H1VA 3ZJYA 4Q4JA 1W0JA 4JLJA 2RGEA 2WHXA 4KBFA 1P9RA 4E5UA 2MSDB 3UMSA 4TYQA 1KO7A 5JZVA 3QJYA 2DR3A 3IKJA 1GAJA 3VFDA 1OH7A 3MMPA 5EZ6B 2XOKD 1JAHA 1NVXQ 5DYIA 4DLZA 2PLFA 5C46F 3NBFA 3OE7D 1QG4A 1U94A 1NKSA 3W34A 4MITA 3UG7A 5BN5A 1QHSA 4HDOB 1SVLA 1VHLA 1CJTC 1E1RD 1T3LA 1Z47A 4RFVA 4NL4H 4H1UA 3T15A 4M2LA 2WWFA 1WMSA 4NTZA 4UNSA 4OI1A 2CCJA 2HYDA 3PJRA 2O8FA 3WBKA 1TU3A 1O87A 3ETLA 4TYPA 1VG0B 3V00A 3ZYCA 1OT3A 2WSSA 4UNRA 3UMRA 3IPYA 5BQ5A 3KQUA 1KMHB 3DPUA 1GP2A 4IDNA 2IUSA 1G8GA 3DMDA 3K0AA 1B0UA 1XEXA 2NZJA 3HU3A 4D25A 1U0LA 1MV5A 3SDZA 1E2EA 4RD6A 2GXSA 3R9XA 4X8HA 2ZSFA 1AKYA 1NIPA 1QG2A 3HR8A 4TLAA 3SHWA 3THYA 2OXRA 1SKQA 4NYMQ 1LS6A 4P4SB 2WJIA 4URZR 4UXJA 4YDSA 4MYHA 2TMKA 1CBUA 2BBTA 4CEHB 2FPLA 2J46A 4KYIB 1JPJA 2GBLC 4DB2A 2FE4A 5SZIA 3AUXA 1A82A 3RS0A 1XB2A 1GRRA 2GVDC 3WNCA 2QENA 1KK0A 2J45A 5FPSA 4D0NA 1P3JA 2V6JA 1E2QA 1UBCA 2HJGA 2DYKA 3EA5A 5AR1A 2QMHA 2O0JA 2VIIA 4UXHA 1GL7A 1SVKA 3A1TA 3GLGE 3FHOA 2AFHE 4Q19A 1X86B 3NEJA 5FH9A 3KKQA 1KIMA 1FQKA 2YJTD 4DDTA 2P5TB 4JBWA 4C2UA 1OW3B 3EWAA 3K70C 2GF0A 1AJEA 2J7PA 1WXQA 4RD4A 5FFMA 3AF1A 3AKEA 4MRVA 5HCIA 2W0SA 4Q9KA 2X19A 3DVLA 3BOSA 3RRNA 5E95A 5HKKD 1WF3A 4IDOA 4OJQA 1FMLA 2KJQA 1VHTA 2ODEA 2ZJ8A 4OQXA 3R9WA 1PZNA 2JIZD 3GLGB 4CT4B 1XTSA 1HT1E 1T8TA 3SJZA 3SN6A 1VTKA 3MWJA 4YLGA 1C4OA 3E2IA 1FW6A 2P67A 3ZS8A 3VU9A 2CLDX 1X1SA 3C5CA 1T0HB 2RGNC 1GNQA 4RFSB 3Q9LA 5B57C 1LW7A 5BN3A 1NVVR 4QBHA 3L0PA 1TUIA 4G1UC 1IQPA 1G18A 2ZI4A 4M1WA 3GJ7A 4HAUA 1RKBA 2BMJA 4DLWA 3GQBA 2GTPA 3IIKA 2NPIA 4M9XA 1LV7A 3SYLA 3VR1A 3CO5A 1KZ7B 2QA5A 4XSGA 2BEKA 1F2UA 2OG2A 4YXWA 4CIDA 3RHFA 4ZKDA 2J0SA 4CW7A 5JEEA 3A36A 2ZAOA 4B2LA 5IF9A 2VP5A 5JJIA 5TVKA 4LWZA 2ZYWX 4LBZA 4B71A 1A4RA 2WMNB 3GFTA 3RDPA 5C2JB 3SR0A 1SXJC 2X8AA 1P2VA 3B1WA 2J9RA 4TSFA 4M1KA 2CL7X 4OHWA 1P7CA 3MD0A 3Q8XB 1VYTA 4RD3A 2KE5A 2ZI5A 2WJJA 3DZDA 3Q7QA 4LSGA 2CLCX 1NY5A 3KL4A 3TSOA 3GD7A 4FMCB 3FHCB 1E2FA 4M22A 1HTWA 1PUIA 3F3YA 5KTYA 1Z2CA 4B3CA 1QF9A 2Z5FA 2VP4A 4PC1A 4PZZA 3AVYA 2CXXA 3A4LA 1US8A 2F43A 2NG1A 3IEVA 5FOVA 3W3AA 4AURA 4W9MC 2RGCA 4L9SA 2DBYA 2MSCB 2HCJB 4W5HA 1TMKA 5B58C 3OEEA 3B7GA 5D3MB 1IBRA 1II0A 3ZIAA 3MGCA 1E9CA 3L8ZA 4ZI2A 4IVQA 3BB3A 4C2TA 3M6AA 2GEUA 3BK7A 4OL0A 4RJLA 2KBEA 2VRWA 3ZH9B 5L3QA 1OH6A 4FIDA 4Y0VA 2QROA 2VO1A 2FZ4A 1LS1A 4JL6A 5E7JA 1D9XA 2VTKA 3BS4A 5FTKA 3GFOA 2F1HA 2AN9A 4PPQA 1YR9A 4IKEA 4ZKEA 3TIFA 2REXB 2W2VA 4UNNA 3SHFA 2JLZA 1AKEA 2JLXA 1GG2A 3RS4A 1DAIA 2O0KA 2C9CA 1KJYA 4BRUA 1E79D 1R5BA 1XEWY 3WRXC 3WNDA 1GWNA 1COWA 2GK7A 2IHYA 3GLHE 3PVSA 2W00A 5DISB 2GJKA 3I62A 2R6DA 1G5TA 3CH4B 5JWOA 4MDEA 4MUBA 2QT0A 4DT1B 4PQYA 1D5CA 2PL3A 3K70D 4IXNA 3FE2A 3TAHA 1E4VA 2D2FA 3D3QA 3K0AB 3OFNA 4IEIA 5LB2A 2W6IA 4LYHA 4J0QA 4QBIA 1JECA 4Z51A 5LB4A 5JWRA 2GXQA 4UJ5A 2BV3A 2FF7A 4PO9A 4IDHA 3BH0A 4V0ME 4AD8A 1W44A 3I3SR 3CH5A 4M9SA 4OJKA 1II9A 2B8WA 2RGBA 3CF2A 5FR1A 4D0GA 1KO4A 1UADA 5FTMA 2C8VA 3EWSA 1N5KA 1KMQA 3U61B 4E22A 2J87A 5FUXA 2KWIA 2OAP1 5FOUA 4DUGA 2F3TA 1R0YA 3AUYA 4KODA 1Q3TA 2Q6TA 2XNSA 4C0SA 2A7QA 2EVWX 2QSYA 3RC8A 4NCNA 1G7TA 4A2WA 1E2IA 4NYJR 5CDFA 2OLKA 1P60A 4PFSA 4KO8A 3MWLA 2WAXA 2WIBA 1R0WA 3AP1A 2PMKA 4IHQA 5B30A 3GMTA 3K09C 1D8TA 1Z0AA 3TNFA 3EC2A 1OIXA 4RZ2A 3EASA 1GSIA 1YU9A 4WZAE 2GILA 2RHMA 1KYIA 1G7SA 2KSQA 4TMWA 1MABB 5J4YA 3ZQ6A 2HF9A 2VHTA 3SEAA 4QFMA 4BLOA 4DSUA 3VR2A 2OV2A 4LHZA 1KI1A 1KJWA 2ZQ5A 2JAQA 1Q1ZA 3CW2A 1Y63A 4NYMR 4UNQA 1Z0FA 3PCRB 3FHTA 3EAQA 4M1OA 4LJ4A 1Q3HA 4UXIA 2A5DA 4YMVA 2XJ9A 3PEWA 4Q21A 3EIQA 2NPFA 3S1AB 3U3JA 2NO9A 2X1VA 1OH5A 4HB2A 4HZUA 4X8LA 2JEOA 4MA4A 3REFA 3FFBA 5EXXA 3SS8A 3QXCA 2XNDA 3P20A 1Z07A 5JECA 1EWRA 4EQ6A 2UKDA 3QEOA 2IXGA 3AF2A 4GMDA 1NIJA 4N3NA 2EFHB 4B3FX 3H0KA 5KPDA 4B73A 3MCAA 5FTJA 2V4ZA 4BGDA 4C0HA 4MRNA 5EJEA 2J41A 3L82B 2O8DA 1KI6A 3JVUA 2IF0A 1P61B 1KDPA 2ZJZA 3CRVA 1G4AE 1MABA 1QHHA 4IW3B 1E0KA 4TT3D 2ZUDA 3BORA 3A8TA 3KTAA 4NP6A 2V54A 3SOPA 3Q3JB 3U4QA 2D06A 4O25A 4HAWA 3TAUA 3TE6A 4OQLA 5AUPB 2WWIA 2O8CA 4ZO4A 2V7QD 1TQDA 2YWFA 3AP3A 1L4YA 3KJGA 4B76A 3O8DA 1ZYUA 2OT3B 1W47A 1RJ9B 1OXXK 3KFVA 1XEXB 4XJXA 3QIAA 4YQFA 2ZRGA 3ZVMA 1RRCA 3T5GA 2FSGA 2R44A 2IYSA 3H2YA 1SULA 1YZTA 1R6BX 1G9XA 2G1KA 3ONWA 3NBXX 5FBQB 2XTZA 2FMXA 1RVDA 1HQYE 3QKSB 721PA 2QTHA 2K5UA 4Q4LA 2WICA 5FI1B 4HUQB 3SBEA 2JLWA 3LQQA 4A0HA 3I4LA 4BZPA 1KSGA 5HZHA 4G5OA 4EJSB 1E9EA 4TN1A 2EW1A 5CYOA 1XZPA 4DSOA 4N1AA 3T1OA 2GCPA 5JJKA 1UF9A 1HQCA 5G40A 4ZI3A 5FI0B 4LDJA 4GBMA 1BO6A 1S4QA 1A2BA 1P2TA 2C03A 2VHCA 4FI3C 4WVFA 3GLGA 2XOKA 3LRPA 1W5SA 1I2MA 2ZS8A 3RS2A 2GA8A 4FWTA 4JVMA 4Q02A 2H8KA 3T34A 1E79A 2GHIA 1G6HA 2YC2C 3N2EA 5JRJA 2NO1A 1G19A 1AS0A 2NTYC 4PX9A 3QVVA 2A30A 1XCPA 2ZVPX 4OBEA 5J4KA 1DAGA 4LJ6A 2O8BB 2D7DA 4I1OA 5FPYA 2OCYC 2EFGA 2ZI6A 4A8JA 2H17A 2B21A 5J4VA 2D7CA 5LD2C 5JCPA 4PSKA 1AQYA 1NLZA 2J3EA 1J2JA 4D0LB 1AM4D 3V4FA 1JQJC 1F2TB 1XMSA 4AG6A 4ZV4A 1CF4A 5H68A 1JR6A 5ANRB 3C15C 4CRWB 3ZZ0A 3IQXA 4M1YA 4Q00A 4TLDA 1FUUA 2QI9C 1W5TA 2JLQA 4V0MA 2QMEA 4R71A 5FUYA 1XEFA 1E9BA 4QHYA 4XOIA 5K8IA 2ECKA 2HEIA 2A78A 3PV0A 5TXGA 1XXHE 5IRCD 4M53A 3BC1A 4NHOA 4OQFA 3S1AA 4QGFA 3RS7A 4Z54A 2ONJA 4PR0A 2A5YB 3F5FA 1EXMA 4KHZA 4CEJB 1E99A 1ZM2A 1Q57A 3ZDQA 3AV0B 1G7CA 2C78A 3GLHA 2Q9AA 1RYFA 4Q1BA 4EPVA 1OV4A 2ZAMA 2A9KA 4XH9B 1G6OA 4JLKA 3U6KA 2QBYB 2SHKA 3T61A 3KQNA 1OLOA 4C9BA 4CEHA 3AF3A 4AKEA 4OK3A 1CEEA 1D2MA 1SXJA 3OEHD 3UWKA 1BMFD 2D74A 2H1LA 2VP0A 2QPAA 1NLYA 3EARA 3DKVA 1P2UA 1ZCBA 1R5OA 5KU1A 3REGA 4GT1A 2JLVA 1F5NA 1N5LA 5DN6D 4TTQA 2ZITA 1CULC 2EFDB 5DYGA 4PXAA 2PMDA 4HYYA 4MUAA 3GLHB 4ESHA 4HI0E 1CR2A 2XSZA 4BLTA 4BFTA 1HEIA 2Z4SA 4KVAA 2PLRA 3HP1A 5G53C 4AWXA 3PEUA 4F7WA 1DAEA 4HB3A 5BXQC 1LF5A 3LLUA 4W5JA 2X2FA 4F4IA 4TTPA 4V0KA 4WBSA 1ESMA 2QN6A 4NCIA 2FJUA 3OHMA 4GP7A 1NJGA 3N70A 1L4UA 1XTKA 4RZXA 2G1JA 1DAFA 3NHAA 3TVDA 3VX3A 1EFRA 4TTRA 3A1UA 5CJPA 1X1RA 2Z4RA 5HE9A 4OI0A 3B5JA 5K8LA 1UAAA 1VG1A 4DCUA 1TF5A 1Z29A 3WMFA 2CLSA 2XXAB 2ZM5A 2BOVA 1WP9A 5SZHB 2G88A 3O47A 2ZE8A 5FBWB 4A0GA 4D4MA 1TU4A 2ORIA 3DM5A 1LF0A 4A8JC 2WWGA 4JLMA 4D26A 5J4LA 4M0LA 1G4UR 4A82A 4G0NA 3R20A 4IVPA 2P2LA 4MRRA 2Q0HA 2VSOA 1KKMA 2Q9BA 1P73A 4JJKA 4R9UC 3BD9A 3CLVA 4LBYA 3KUDA 1IM2A 4LGMA 3NWJA 3OIUA 3VQTA 3VTKA 2C9YA 4KLZA 1FZQA 1J8MF 5FBLB 1ZAKA 1U2RA 4CEJA 2FU5C 3BERA 3HDTA 3W90A 3GLIE 5KSPA 1U99A 4B48A 1OFIA 4JT2A 1CXZA 4JVSB 2G6BA 5IK2A 4Z1MD 4HUQA 4JKIA 4AKHA 1QZXA 2ODNA 2AK2A 2ZU6A 4ABYA 4IOJA 3B8HA 4PSAA 5KPJA 5CDFE 3IEUA 1J99A 2JA1A 4JLOA 3B1XA 1NMXA 2E87A 3BH6A 5IT5A 3KXKA 1DO2A 3RAPR 2FDCA 2REBA 3RNLA 1HY3A 3AVOA 1HUQA 2E1RA 2DCUA 1U8AA 3H1TA 1TQ4A 3KKMA 3VHLB 1GVNB 4KXFB 4TZ6A 2G3YA 2QU8A 3EPHA 2FFHA 1D6JA 4A8JB 4EIWA 5JS7A 2GZDA 1Z0KA 3T12A 3BRWD 4BFWA 3B2EA 2IF2A 4JL5A 1IN5A 3VR5A 3HJNA 3PR1A 3U3OA 4FCVA 4F93B 2OFXA 1IN4A 2JJ2A 2J0QA 1SQ5A 4IDPA 3K09A 3QI2A 1F3OA 3X1ZA 1JR3D 3ZZTA 4KFRA 3ZVRA 4FCTA 2D3WA 3UIEA 2BJVA 3AKYA 3TMKA 1JAIA 2IYRA 3LNCA 4RZUA 4DJTA 1Z6YA 5HZKA 3U6BA 1E96A 2AFIE 2ATXA 2BDTA 1ZCAA 4Z8XA 1HE8B 3FOZA 2HDNB 4U5XA 3U60B 5C18A 4GP6A 2B92A 2QE7D 1ZMXA 1YRAA 5L8VA 2GK6A 2XJ4A 2WWXA 4NONA 2ZREA 1FPMA 1X6VA 1EX7A 4PQFA 1KI6B 3WXMA 5JI3E 1F2TA 1VCIA 1X8LA 2BHRA 3T1QA 5K8UA 1XD2A 4NMMA 4EQ6B 1KDOA 5K8TA 4TYWA 1YR8A 1QVAA 3RS5A 1OHHD 3GPLA 3OIVA 3NKVA 4A92A 1GIAA 2ZR9A 1CJKC 1PLJA 1KAGA 1SXJD 3OEHA 1M34E 5EE0A 5KSOA 2ZSAA 2OBMA 3C16C 3TUZC 2C95A 3BIFA 1DTSA 4LV8B 3I5YA 4G5RA 4QNMA 2PZFA 3H84A 2V55B 1W2HA 4MDFA 5DE3A 4M4SA 4QJ5A 5KUTA 4PAOA 1T3SA 3KB1A 2R62A 2FPKA 1XMIA 2ZRHA 3GEEA 4TMKA 1P4SA 2FV8A 4L15A 5TARA 2O8EB 2GCOB 2QAGB 2QUZA 4TMXA 3ZS9A 4F4CA 2ZUCA 5HTKA 4H9GA 5J40A 3FPAA 1E0AA 1CIPA 3TJZA 1L8QA 1DOAA 4OHVA 3QY0A 4II7A 2QY9A 3GLFA 1OYWA 1SVMA 2WJVA 2ZRAA 5EE5B 2CCKA 1Z0DA 4G5SA 2AKYA 2YWEA 2GJAA 4OI4A 4FMDF 3QXSA 2BM0A 2IYYA 3KTAB 3MUFA 4HDCA 4I1VA 4RCZA 5EQTA 5KDLA 5SZKB 3RRMA 1U98A 3I8SA 1QHNA 2WSSD 4S35A 5JSZA 2XSZD 4EFMA 1MO3A 2BBWA 1EFUA 4TLCA 3DEFA 2Q3MA 3THYB 2O8FB 1KGDA 4Q1FA 1JJVA 3SJBA 4BFZA 1KY3A 2CHQA 3CNNA 1KSHA 4KVGA 4FMCF 2XZPA 2A2ZA 1F2UB 3KKNA 2IA5A 2ZRCA 1SGWA 1W4RA 4D2IA 3TR0A 3UKDA 1VIYA 3R8FA 1DARA 4Q7LA 5DIFA 1KO1A 3FVQA 1Z83A 1KOFA 1G8PA 4URXR 2PEYA 4WOPA 3O8BA 3OZXA 4LZZA 4KSCA 2QGNA 2FG5A 2XZOA 2JGNA 4I81A 4TLEA 4EPWA 1KNQA 2IYQA 1DADA 4Q7KA 4LUCA 2IYLD 1NG1A 1E9FA 1GKUB 3KXIA 3AF4A 4ZDIA 1KSJA 4PHHA 1P72A 2GCNA 2FSIA 2I1VB 1W36C 2LKCA 4US1R 3NH6A 3UG6A 1TNDA 2ZU0C 4LV5B 2QEQA 4YMUA 4O2RA 1ZW6A 5CLQA 2DFNA 3U44B 5BWMA 1J70A 3CRRA 3QXXA 5GVRA 1FP6A 4OYHA 4IXMA 4JYCA 5CM8B 3HR7A 5JFGA 2I4IA 4GZLA 3I8XA 2RCNA 3LXXA 4XD7A 3T1TA 1SVSA 1MKYA 2W83A 2OESA 2ODWA 3C41J 1EFCA 4ON9A 1D9ZA 4MKFA 3BBPA 2CVFA 2MMCA 1QBKC 5TDHA 4KFUA 3SC3A 3C5HA 1E9RA 1GRQA 2R9VA 1S0UA 1OKKD 1S8FA 4Q1DA 2QT1A 2IYUA 4JVLA 3V4RA 3A4NA 4AYXA 4WAUA 1DAMA 3CPEA 2KI5A 4ITRC 2JLUA 3RWMB 3AH8A 4AI6A 2AHOA 3PUVA 4U00A 2ZRPA 4DVGA 1QHXA 4AIIA 5H70A 1U9IA 4BFSA 3FMOB 4LJYA 5F2EA 4NYIQ 1XWIA 1KI9A 3AKDA 1I4DD 3B60A 2ZRNA 2GJ9A 2B7BA 2VQSA 4B34A 1NI3A 2B6HA 2HT1A 2VHJA 1NG9A 2PJRA 4ZIRA 1NVUQ 1GDDA 1QRAA 4JSTA 2QRZA 2PT5A 2VEDA 2PEZA 2G0TA 2W6JD 4JMPA 4XVUA 5DNYB 3WYGA 5DGXA 3UXMA 1NMZA 3OAAA 2ANCA 3RS3A 3IBYA 4LJ9A 5FBRB 1UPTA 3B82A 1G17A 2ZE7A 2EYUA 4EJSC 2FH5B 5JWHA 4YMWA 3N2IA 4V0NA 3IIMA 1WB9A 3F0TA 4DRZA 3IHLA 1CS4C 4ZPXA 2DFLA 1U8ZA 4RSGA 3I72A 1XMJA 1ZD8A 4O0MA 3WMGA 2WKRA 2AL7A 1JPNA 1K8RA 4RKEA 3BB1A 2C77A 3A1WA 4TQ9A 3PUYA 1E1QA 1G8YA 2F7SA 4G01B 3FMIA 2BCGY 2ANBA 1T91A 2WVJA 3WYFA 4DZZA 3EZ7A 2RB4A 2IHBA 5IHPA 1CR4A 2H92A 3SFVA 3TRFA 1ODFA 1UJ2A 1Z28A 3IUYA 1YKSA 4RCYA 2IW3A 1JEDA 5EE3A 3IQWA 4FN5A 2IWRA 4A9AA 2QPTA 1EWQA 4L8GA 3ZVLA 1E2DA 1E69A 3UPUA 4PTLA 3ICQB 1KSFX 3K1JA 3UMFA 3C14C 1FNNA 4E09A 3MWYW 3TSZA 1EFTA 4C0LA 5EP1A 2BJWA 3T35A 4B33A 3VR4A 1KI2A 4Q4HB 3TBKA 5BN4A 1XPOA 1TQ2A 1XPUA 2HLDA 1P9WA 2OHFA 2ZUBA 4HLUA 3TKLA 5DH9A 1S96A 1W0JD 4A2QA 4MRSA 4ZIRB 1NBME 4CT5A 1AQUA 1COWD 4A1FA 1BOFA 2IK8A 2YWGA 2CK3D 2ZJAA 4QJ3A 3G82C 4QRHA 4JLVA 2OLJA 4QGGA 4TSFD 5JHGB 2ODBA 2AD5A 2OAQ1 5DO9A 1KDRA 2GWHA 1Z8FA 1VCMA 4RD1A 1PV4A 3K70B 1ZU4A 1OXTA 2PH1A 4DUGD 2P65A 4A36A 2ZSDA 5FUWA 4BFXA 2CDNA 2VH5R 1OB2A 4LK2A 5H8WA 2J59A 4AK9A 4DDUA 1XTRA 2MMGA 3VU9B 5HCNA 4DSTA 2HF8A 1YVDA 4M1TA 2CHGA 2WWHA 3B9PA 1E32A 4ERNA 3QPWA 1FOEB 4Y0AA 1ETUA 4Q9IA 2C9OA 5AJWA 2XITA 1HURA 4BLQA 1SHKA 1Q0UA 3F8TA 4B75A 4B3BA 3N5CA 3EZ2A 5AUNB 3FKSD 3SU8A 1E0SA 3DOFA 1N3BA 2IC5A 4P4TA 1BYIA 2Q21A 4XD7D 2W58A 2ZS7A 1GM5A 1PLKA 1G21E 1N25A 2DPXA 1JJ7A 4PQRA 2HYIC 4CEIB 3PQCA 4MH0R 3RSLA 2CE2X 2EYQA 3RANA 4GNKA 2RHDA 4Q5IA 1XJQA 3U3KA 2CCGA 1P2SA 1OXUA 5KNBA 1R5NA 3OEED 2F1JA 3K53A 1Y3AA 3W3ZB 3CWZA 1KK1A 4XWOA 1DAHA 3ZQJA 1P6XA 4B74A 1VYVA 1CR0A 3PEYA 3NC0C 2GAOA 2YZ2A 4KBGA 4KYUA 3G5UA 5KO2A 3NTUA 1AS3A 1M6NA 4QL3A 3D7MA 3T5DA 2FPMA 4CZ2A 4DBLC 4F38A 5AK0A 2Q9CA 3BAFA 4TMTA 5L3VA 1W0KA 1H8HD 3BH7A 1UM8A 1IY2A 3ADCA 1ZC4A 2W0MA 5TY0A 1UKZA 3KUCA 1EESA 4C0KA 1G3RA 1KNXA 4V02A 2YINC 1ZVQA 2ZVQX 4TQUS 1CJMA 3E1SA 3GP8A 2YHSA 4P33A 2P0EA 4YC7A 3IO5A 4URWR 1KO5A 3SI7A 2HXSA 2IXEA 1G64A 4X8OA 1G3IA 2QG6A 2RGDA 4LHYA 4Q66C 1RZ3A 5FL3A 1XRJA 3LW8A 2VLIA 3FKSA 5FOSA 3WRYC 3ZGXA 4V0LA 3O8RA 2QTFA 1TPZA 3THXA 2R8RA 1MH1A 1DPFA 4I99A 4DWJA 5AJZA 5A5GA 2P3SA 821PA 5F98A 2UZIR 3EZFA 1NN3A 3PG5A 5AJVB 3FMPB 2V7QA 2GCOA 4DHEA 3KB2A 3LXRA 3TLXA 5F9FA 4WIAA 2ASEA 4F4JA 4HB0A 5G3ZA 1Q12A 4FMDB 3THOA 2OXCA 3LVQE 4IJMA 1ZNWA 3QXJA 4BECA 3FKQA 3QE0A 1N5JA 1ZC3A 3W5JA 1M2OB 4X8MA 2KB0A 2ZR7A 5F3WB 4LYFA 3LBHA 1T3HA 2QAJA 3NVAA 2AWOA 4A6PA 1MO4A 1OKKA 4DLRA 5J4HA 4HAYA 2YYZA 4LJAA 2VP2A 4Q9LA 3U2QA 2WPDA 2IWHA 2IX3A 2ZE5A 2BIFA 2JLRA 4PHFA 2JATA 5EXPA 3RWOA 3TGPA 2CNWA 2ZRJA 2GESA 4NDZA 3W5IA 1YZKA 4TWZA 2REOA 1S3SA 3CWQA 4MYCA 1OFUX 3GLIA 1NBMA 1W2GA 5GJBA 4JBYA 4I4LA 2JIZA 3AQ4A 5F9HA 2GVZC 4JYBA 4BZXA 3H86A 3RRYA 3LD9A 4HATA 3WHKA 2NOAA 1OYYA 5FBVB 3I5XA 3U3MA 2BBOA 3TQCA 1YZGA 2IYXA 4HAVA 1Q22A 1WA5A 1GFIA 3AVPA 5LDDC 1OB5A 3DO6A 2LWIA 1ZIOA 4TLBA 5DI9A 3QENA 2BKEA 2N1BA 1VIAA 5E4FA 2C99A 4QHTA 3SFZA 3CB4A 1Z0JA 1YZNA 2KBFA 4Q03A 5KNDA 5D3QA 3L8YA 1NMYA 1KMHA 4BWYA 3T06B 2A5JA 3NC1C 1VCNA 1Z0IA 1S2MA 1U81A 3OIWA 5ELXA 3SNHA 3K0CC 1A5TA 1OJLA 3AGQA 1KI4A 2J0UA 3L43A 2HT6A 3LH5A 2ZYVX 4MRPA 2FEOA 2NO0A 3CNLA 3KQKA 4PPNA 1RC8A 1IN8A 4I1UA 5KDOA 4PC2A 2JDIA 2OZEA 1IOZA 4ZDJA 1G3MA 1Z3IX 2VYFA 2ZR0A 3JZAA 2A3RA 4FW9A 1S1CA 3GJ6A 3VR3A 3R8CA 2QAGC 4DXAA 4A15A 4LC1A 5UKDA 1IJFA 2JJ1A 3CM0A 4JSYA 3OFND 2Q3FA 1JB1A 4KAXA 2ZJYA 2J1LA 5FL7D 2ZPTX 1DO0A 3L0OA 4OQNA 3TH5A 3WYAA 2WTUA 3CKLA 1DG3A 1XZQA 3GJXC 4UKDA 4EDHA 5JS8A 2WSMA 1T6NA 1GNRA 2A5GA 3MRSA 4NZYA 2AWNA 2OBNA 4BLSA 4DCSA 3AEZA 1SVOA 4ESVA 2FFBA 1XBTA 2BKUA 3I1FA 1W0KD 5P21A 4P0TA 3LO5A 1U0JA 3K9LA 4QGAA 1LTQA 4AKIA 1E2NA 1PUJA 1Z6GA 3W6OA 2IS4A 4YXWD 3LWNA 1P75A 2H16A 4GOXA 4L9WA 3HPQA 4URYR 3NHBA 5IDVA 2QP3A 1S1MA 1US8B 2F43B 3CNOA 3UANA 4IOMA 4OHZA 1VKJA 2H7VA 3EC1A 2F9MA 3CONA 2EFEB 4IFEA 3AVTA 1GITA 3ZLJA 1E2JA 1GTVA 3BXZA 1GL6A 2CEAA 2ZJBA 4DIDA 3GLFE 1HH4A 1W49A 2FX3A 4RD2A 1FX0A 4U02A 2NO6A 3EX7C 2AKAB 3NBYC 1MT0A 3A6PC 3VHXA 4BFYA 1LY1A 1YJ5A 3W6NA 1SHZA 2CJWB 3AVVA 1N6PA 3MJHA 1ZNZA 1RW4A 1R10A 3BWDD 4HDQB 2QBYA 1ELOA 1G16A 4WZBE 1WCV1 5L3RA 2VF8A 2WJYA 2D2EA 4LV6A 3GEIA 2Y8EA 5CK5A 1C1YA 1T5IA 1X8JA 3LDAA 3QPVA 4MGKR 2OSBA 1FUKA 3ASZA 5M04A 1VDZA 4MYUA 1KK3A 1U8YA 4YONB 1VYUA 5FUVA 4NYJQ 1RE0A 4DCTA 5C4GB 2PCLA 3AP2A 1RPZA 1XF9A 3X2SA 3K0CA 1CKEA 3WBJA 2YOFA 3B1VA 1TEXA 3LW7A 3MFYA 5FTLA 3CX6A 5EZ5A 3GLIB 4Q01A 3VKWA 3KQHA 2EFCB 1GUAA 2IUTA 3OAAD 4HB4A 1R0ZA 2ZRBA 3JVVA 2CE7A 2IYVA 3DMNA 1T8UA 4PZLA 4NCJA 4Q47A 5BYKA 1CLUA 1ZD9A 2QMUA 2DWQA 2YV5A 1ZU5A 3QKSA 3SYKA 3FB4A 1E1QD 2RGNA 1Q1QA 1OE0A 4R2IA 4A2PA 3AVWA 1M7HA 4B6EA 2GRJA 4DCNA 1XD9A 2Z43A 4KV9A 2CK3A 4DLSA 2EU8A 2XB2A 5TV2A 1VECA 1XXHB 4R98A 2H18A 4BEJA 2OCPA 1M7GA 1KY2A 4MKIA 3LX8A 5GJWC 3RYTC 2IXFA 2WKQA 3OE7A 3PUZA 5LD2B 1JEEA 4C4PA 1G3UA 3AB3A 5JSZB 4KFSA 3FDIA 3QSYA 1QHYA 5FOWA 4MGYR 3B6EA 3L2OB 3B78A 3GJ3A 4TL6A 1VCOA 1GKIA 1V5WA 3BE4A 2IEZA 5CIQA 3VNVA 2VSXA 3GLFB 4BQSA 4BLRA 1NKTA 2QMOA 4AKGA 4UQOA 3KJHA 4QHSA 2ERYA 3C8UA 4GMXA 1FL9A 5EP4A 2ZXUA 3NBZC 3K9GA 2O0HA 2N46A 1GILA 2F3RA 1DAKA 2GNOA 1DBSA 2O8BA 2CJWA 1ZUIA 5AJYA 3L0IB 1TF7A 4YDHB 4BFUA 3EXAA 2QGZA 2YVUA 1Q44A 1JBKA 1NN1A 2VF7A 4W7SA 1JXMA 2IYTA 1AS2A 1JI0A 3WP0A 5JHHB 5KHOC 1W4AA 2PBRA 3OIYA 3QG1A 1N6IA 1T5LA 2ZIAA 2G77B 3HYTA 2B7CA 1E2LA 2QP4A 2ATVA 1Z6XA 3DHWC 5HKKA 1A2KC 1E2PA 1H8ED 1XEWX 1Z5ZA 5CLLA 2G9NA 4EAQA 2IS2A 2GJ8A 3CR7A 3FGNA 1CRPA 2QM7A 4HUTA 1Z6TA 1GNPA 4Z1MA 4W5WA 1OXVA 3CUEF 1Q20A 4A0FA 1SKYE 1R0XA 2ZRMA 4NKRA 4DDWA 3D6TB 2PT7A 4KSBA 4MKHA 1S9HA 3E70C 3PUXA 1I4LD 3QF7A 2V8OA 4NPHA 2RGAA 3QKTA 3SZRA 1E2KA 4C0BA 4BFVA 1NNEA 3EPLA 3PENA 2J7KA 4LI0A 4C3ZA 3D31A 2C04A 3KQLA 1E9SA 2R6AA 3R7WA 4LHVA 4QC2A 1Z08A 2B8TA 2CNWD 2W6JA 3EIHA 5GADl 2BM1A 1FTSA 3NIBA 1E98A 1RYHA 3KX2A 1DG1G 1R7RA 2J7PD 1N6RA 4WW0A 2GKSA 3DM9B 4DEYA 1JR3E 2YWHA 2QL6A 8OHMA 1MOZA 4LC0A 2P6RA 2VBCA 1Q21A 3K9HA 5KDDA 1E2MA 1SXJB 221PA 3HU2A 3HWSA 4D4LA 1GOTA 3NH9A 4BZQA 1G5PA 1OXSC 4B43A 2FZLA 3SBDA 4LPSA 4G5GA 1R8QA 1XCGB 4ILEA 3LQRA 4KI0A 3W9YA 3KJIA 2ZS9A 2WV9A 4PO8A 4URUR 1BKDR 1ZBDA 5G41A 3R7WB 2BMEA 4XSHA 2X77A 3TW8B 5JCZA 1N0WA 1E9AA 3B9QA 3VAAA 3THXB 3KFXA 2JJ2D 5FOXA 4ZDKA 5BW8A 3VX4A 2CBZA 2DWPA 1SXJE 2XAUA 1SVWA 2NIPA 1TAGA 3ADBA 4ACBA 3DL0A 5EXSA 1AK2A 3KDSE 2ZEJA 4JLDA 4PPFA 1XP8A 4Q1CA 4OQMA 3IILA 5C4MA 3EPJA 4JZKA 5L3QB 1LFDB 4TL7A 1FQJA 1X3SA 2OCAA 1I2DA 3QBTA 4LCBA 4C7OB 4Q7JB 3WNBA 1R2QA 4B32A 3FWYA 1F60A 1GL9B 2FA9A 4L16A 4FMBB 1OHHA 1XX6A 2YKGA 2QQEA 4QBGB 5FOTA 4CF7A 2BCJQ 5FPKA 1VG9B 1YQTA 1XXHA 2Q3HA 1XU4A 1W48A 3X1YA 2WBLC 1HA3A 4EKDA 1ZM3A 3IHWA 1CJVC 4M8NE 1ZNYA 5AUOB 2CMKA 4QM6A 2V1UA 3SE0A 3VMFA 4BPBA 1G5RA 4DT1A 4FD2A 4LJ7A 1NBMD 3DOEA 4G3XA 2F1RA 4LRWA 1IONA 3CR8A 3Q72A 1T0JB 1KTVA 4NCKA 1KI3A 4MGIR 2PCJA
chains in the Genus database with same CATH superfamily
3H8JA 3WICA 3HDJA 1QNFA 3P1JA 4J1NA 2I2WA 1HZZC 5DN9A 2HC9A 4J4TA 2D5AA 1OAOC 2GI4A 3EOZA 3H5RA 2GZAA 4ZOBA 1P77A 4PC6A 2YIDA 2ODQA 3WVNA 2I62A 3NBUA 2IEYA 5CM9C 3LX5A 1RHRA 4DBVO 1DL5A 4GOMD 1PJAA 3BFXA 3UC5A 3RYCA 3RE1A 2VZ8A 4RY2A 3D6NB 4DQXA 5BYBA 1F06A 1UK9A 2ZBEA 4V03A 1ZOSA 1MQ9A 2XQVA 3JCZA 3FJ1A 5BYJA 4FI3F 3KKOA 3UOWA 3B2QA 3F3SA 3CKMA 1VRCA 3MOSA 4P4UA 3ISVA 4D0SA 5CCEA 1YA4A 2YNMD 3C43A 5ALPA 4EBBA 2A14A 5ES4B 4XXHA 3WE7A 4O02B 2OWEA 3P0IA 1QHEA 1TZCA 1WY7A 4RM3A 4OB6A 3K2QA 2N42A 3JSAA 5H1YA 3G6KA 4UZSA 2WMYA 2R4TA 2QB5A 3GRZA 1MC8A 1QDEA 2JCSA 2WIFA 1VL0A 2NZ8A 4NOJA 1OUMA 2JA2A 4KZKA 4Q3DA 3MJDA 1D0IA 1NQOA 3UK0A 1O6GA 3TK1A 4PYRA 1RKVA 3OBIA 1DWQA 5HE8A 2OZPA 4KU4A 3VKFA 4OH1A 1QAOA 3T7DA 4EFNA 3B6MA 2FXIA 4TXJA 4BLVA 2D59A 1H2AS 1X1DA 2IL1A 2XODA 2A9JA 5DU2A 3SEFA 3DGEC 4PSVA 1USWA 3IQGX 3WP1B 3PR3A 4YP0A 4RULA 1O9HA 4IIVA 3TF5A 2A0FA 4R84A 2CLIB 2F6RA 2Y0EA 1TEHA 3ZNNA 1W7AA 4NV1A 2XMSA 3FF1A 2LPMA 1GDHA 4IOLA 4LOAA 3AOEC 3QMMA 3DLCA 1GXSA 2QD4A 3PFIA 5ITZB 1R15A 1CZLA 4C1BA 4CYMA 1T15A 1YDGA 1R5JA 4FNMA 2G71A 3DHVA 1CUCA 1R8YA 1TLTA 1NBIA 3FNQA 3LT5A 2Q28A 4KLCA 4AJOA 4QUHA 5KYWB 1OIWA 2HIHA 3A32A 3K0FB 3PNBA 1NN0A 1GAWA 5AMXA 2BR5A 2BMFA 4LYYA 4C4TA 2O5RA 1J8FA 3KKZA 1ST3A 2R86A 1EFPA 1VHDA 2HV9A 1HYQA 2H5EA 4IIGA 1T0IA 1T0PA 4QGSA 4O2AB 4FNAA 3OQNA 5F23A 1WMAA 3HJBA 2VDVE 4JR2A 4K46A 3DGFC 5EQDA 4PO1A 5F73A 3U4QB 2JASA 1MRNA 2QUIA 2AG1A 5TRTA 5I47A 1ZJ6A 4IDEA 2C54A 3GJ4A 2NT3A 5LYYA 2BFCB 5E7QA 621PA 5ENDA 5T64A 3RVRA 3FSRA 5AIAA 2X22A 4UATA 5D5PA 4Q48A 4TSKA 2WZQA 5DNAA 1Q11A 2HSWA 1IC6A 4TT3A 1J2RA 3OUUA 1UKAA 1JI3A 1Q1GA 3KDAA 3S55A 4L2IA 4BZZA 4MWZA 2REQB 3FPSA 4EHNA 2B98A 1NW3A 4B3XA 4MRMA 1Q91A 4BB0A 4I19A 4UPEA 2GCEA 1UR5A 2QJOA 3GT3A 4V2UA 4YAOA 1E3MA 2IEGA 3EJWA 2E85A 2RH5A 1XTQA 2Z0MA 4ZXFA 4C0QC 3E5MA 2ZM6B 1W36B 2H54A 4QOGA 2HSZA 4UD6A 1SOUA 4CTKA 1KFJB 4HFRA 2WKPA 3A1NA 1X3LA 4I3FA 4IIFA 5K01A 3IBTA 1QK4A 1XJ0A 3ZY5A 4TUYA 1KDTA 1TUBB 3M5PA 1P9NA 4B6FA 3ETGA 1XLTA 2ZSBA 4Q9HA 3P0RA 3LXMA 4BMSA 2I6TA 1FNBA 1PCXA 4KNWA 4U39A 1V8BA 3U3RA 4CMHA 4HEJA 2AK3A 4BNZA 4L4XA 3LQYA 1Y6FA 4Q4HA 4B3GA 2WVGA 3HU1A 2QYTA 2W6OA 3ET5A 3GUVA 4MV3A 4OHRA 5JYBA 3GI1A 4KITB 4F2PA 1G8FA 1SKUA 4PHGA 1DKMA 3DTTA 4BUJA 2Q4TA 4M1SA 4D80A 5DXAA 2HU2A 2FWPA 4KTVE 5JRZA 1K5GA 4YFVA 1SRRA 3DL4A 1JQAA 2HU8A 3LZDA 3T7SA 2P79A 3UB2A 2YVQA 5KREA 1DRVA 4E15A 4L95C 1DQPA 3KZCA 2IU6A 3DNPA 5LZ7A 1UMDA 1HL3A 4GRAA 2F55A 4B44A 1PWZA 2CL0X 1ZIPA 1IBCA 2H2FA 3REOA 4RK0A 4W63A 3GJQA 3M82A 4CV0A 3UATA 1N1MA 2XB9A 2L17A 5LXTA 1DEAA 3RYCB 1RWNA 3VSAA 3ILXA 2P69A 5DASA 3E3OA 5JEDA 3SJAA 4MYTA 3GRCA 3X1KA 1N7HA 3DVQX 5IKMA 2AG6A 3EVZA 4EPXA 2OQ2A 3KTDA 4LMPA 2V1XA 4R68A 1G2IA 2EFYA 2G8LA 3F9IA 4KX5A 1SIOA 3N8NA 3DLIA 3ND5A 4XZ3A 2P4SA 3RWBA 4MP3A 3WLEA 3KT3A 4GU5A 1BKYA 1BJRE 2OBLA 1B8VA 1GCAA 2ZIZA 2XE7A 1I6MA 1JYEA 5DM4A 4L0DA 3A4IA 5DTQA 1USKA 4OJTA 3DMRA 4GLJA 4HRAA 4N12A 5CXSA 5FCDA 3WGHA 1U1IA 5DLQC 3KQWA 2O4UX 2I6GA 3V1TC 3VH1A 1CZHA 1BH6A 2IDKA 2WJHA 4JBGA 4EPTA 1NVKA 4CPDA 3LBNA 3SXPA 2GZHA 1RADA 3G0GA 2J6IA 4LY6A 5FWNA 5D6NA 2GPWA 2QI9F 4DRXB 1CJUC 2G5CA 3L4BA 4YIKA 1Y5MA 4XM0A 4N47A 1K7EB 3CLSC 1PKXA 1ANKA 2EWWA 1T1JA 5MGNA 3UJDA 1NHWA 1DC8A 4IQ4A 4WXEA 5CIWA 1RAGA 1WHTA 1H6AA 1C81A 1JVBA 1XNJA 4H0NA 4N65A 4UDYX 1CQJA 4WJKB 3X1DA 3RRZA 4CR6A 2FEMA 3Q8MA 2B5VA 4R5HA 1RJWA 2ZULA 2JJMA 3AJAA 1IRIA 5J2TA 4ZGBA 4F6RB 1N0IA 4Z2AA 2DJ5A 3WMXA 4PWYA 4R1PA 1AGPA 1L5MA 3N2KB 2HPVA 2X9GA 2OXEA 3NKFA 3NXSA 4ZYYA 3MJSA 3EUEA 1KEVA 3DLTA 4TYYA 1ARZA 2DQZA 2PKEA 3PWSA 2I9PA 4GUAA 1GN8A 1UP6A 3DKRA 4FSHA 4R2HA 3OLCX 3UAGA 4LF6B 1N5IA 2NV6A 2FSFA 5LXTF 2ODAA 3R3SA 1E6LA 4GD3Q 3SSAA 4BO9A 4DA9A 3NPMA 1PRYA 1P4AA 3LFHA 2CFOA 5A06A 2AR7A 1TUEA 3O2NA 1G20E 1G41A 4E94A 2XMRA 2B4AA 5E9WA 4TVSA 1FTNA 1K08A 1WDTA 3A4MA 4K26A 4Y6QA 3N2NA 4Y2HA 4JP3A 4L3WA 4M7RA 4NZMA 3C1AA 3ZU6A 3S1LA 3SJCA 5AW6A 4MKZA 2Z6VA 2ECQA 3N2KA 1I2ZA 4X94A 1JYFA 3M6VA 4K6FA 4KLNA 4M6WA 2J0UB 4F8EA 1OPXA 3EXG1 3FCAA 1KR5A 4ZU3A 4QUKA 1E8NA 1RQRA 1T2VA 1TD1A 1YIOA 1GRNA 2C57A 1THTA 2ZBFA 3LPNA 4ODIA 2J3MA 5DLPA 2O2SA 4HNAB 3W1EA 4WVFA 4TZ0A 1MG0A 3QU7A 2RBGA 1TL7C 3Q8WA 4GBGA 4GZMA 4TKZA 2OV3A 1NRXA 2UZ3A 4LMAA 4PO3X 4RHCA 5CPFA 4OGLA 2R7NA 4C89A 1N2CB 2OQRA 5IC4A 3P26A 2I4TA 4L85A 1ZO8A 2XNCA 2H4ZA 4IFIA 1YBFA 2CVHA 5FKJA 3D6FA 1DS6A 2F67A 1EQUA 2VG8A 3IV9A 3CTMA 2X1HA 5IC6A 4FYVA 1AZTA 4DLXA 2P7HA 5C3MA 4W5RA 1P2BA 2XX3A 5ALEA 2GRUA 1N5DA 5E9JA 5HS4A 1J2TA 2WWWA 2FLWA 1J9EA 5DSZA 3JQDA 4X6LA 1FNDA 4O8CA 5DEOA 1RRGA 4HNTA 3PA6A 4AYWA 5CHYA 3IVCA 3D2CA 5MFZA 2QZ4A 3QHPA 5BR8B 4OBXA 1NVVQ 3HA7A 3Q5EA 4AG5A 2PUHA 2QRLA 4EHKA 3ZYZA 1PR5A 2K2WA 5I7VA 3HCNA 3ROMA 3UJCA 4D92A 2IS1A 1YHYA 2A9VA 5ILGA 1KO8A 1SD5A 1Z7EA 4KEAA 4FPXA 3K8YA 4B4VA 2EEPA 2Y1DA 2I34A 1WUHS 3ZK9A 4RV5A 2GXUA 2OY0A 2YBDA 4I5IA 4JBXA 1ODSA 5DKFA 3DOJA 1SG0A 5DP1A 4IX1A 2CDCA 2KHZA 1SXGA 3KE8A 5FYQA 1AKVA 1V2GA 4HY3A 5ITSA 1WBDA 1KHTA 5B1EA 3HUUA 5DCUA 1SC3A 1BU5A 3GBPA 5A7GA 4N41A 3Q88A 1E3JA 2XD9A 1J2EA 1SU8A 1Y82A 2ZRKA 1MGOA 2V59A 4YCBA 4XOUA 4ZQIA 3VTFA 2R25B 1PWYE 2PN1A 3H83A 2FPIA 4MDHA 4EUHA 1HDOA 2FSHA 1TF2A 4P3YA 1EGAA 3PYLA 5JG7A 1D4OA 1QJCA 2J5XA 2Q8QA 1MAHA 1CB7A 4MB0A 4XB1A 3S7ZA 4DNXA 1OT5A 2WPDD 3NRCA 1WE2A 3GK3A 3T3IA 1YF3A 2P6PA 1B6SA 3WZMA 4EA9A 1E58A 2R11A 3OOJA 5D1NA 4KLAA 3HB7A 4KN5A 5TGZA 3SICE 5TIIA 1EX1A 2I2XB 3FTDA 1EG2A 1M1ZA 4QJIA 2FPRA 4JJGA 3WKEA 4Q7MB 1DDOA 2ZSIA 5BQ3A 1GTG1 2D62A 4DFDA 1PL6A 1LVHA 1XFAA 4LOIA 1W5BA 2AXQA 1L9KA 2IY7A 3GXBA 3MWEA 2Z4TA 3CRW1 3BGSA 1YR1A 1WUJS 2WOJA 5T5QA 4LDZA 1GTMA 1G5FA 1SVIA 2NSJA 4M98A 1HOTA 4EUEA 2H1HA 4GQBA 5KNCH 1KAOA 3H2HA 1L6IA 2CNKA 3BFVA 1J90A 3M7IA 4BE7B 3TI7A 4MR8B 3R40A 2YJ3A 1HQKA 3TDNA 1GCGA 4ETWA 3V1MA 1LB1B 2YHIA 3CJTA 1VM6A 2INGX 3PXBA 4ECEA 1DEKA 3U3DA 3WJAA 3TKYA 1QGZA 4GM4A 3W8RA 4MOWA 3TW4A 1TYEB 2BEWA 1BFDA 3LY7A 2VXYA 1Z7GA 4PRKA 5KKCA 1EFHA 2O2XA 1L4HA 2AC4A 2VYQA 2GN0A 4HC4A 5ALSA 3SF8A 3GZNA 4OK6A 3ZCUA 4YIHA 3UCEA 2YC4C 4FCWA 5ALZA 2C2OA 2X0FA 5A05A 4X90A 2D5BA 4LNUB 1M8KA 2QTVB 3FB1A 4EG4A 4OVKA 1A7KA 2R5NA 3GJ8A 1RJFA 5CJ2A 2P6OA 3PRHA 2Q4RA 3C2QA 3FOAA 3F8WA 3KVNA 3AZPA 2Y1OA 4OLHA 4X00A 1GR1A 1X1CA 4XVQA 1HI9A 1ZGJA 5KSZA 2QMYA 3HCOA 1RLTA 1BDHA 2WIAA 2ZI3A 4H60A 5EUMA 5KWIA 1NC3A 3IMKA 1D2EA 3QVUA 4I4TA 4KJZA 4Y2JA 1AMNA 1FRVA 4RWZA 1MO5A 1N75A 3P4XA 4L8VA 4OB8A 2J9ZB 1Z2AA 2AHRA 2JPDA 2XZTA 3C1TA 4P93A 3U4AA 4J2TA 4D6PA 2Y0PA 5CH8A 2J3LA 1RQ7A 4X6YA 1TCVA 3KSMA 2YMPA 4PQGA 5DHAA 4AUKA 4CQMA 4OPMA 3QOFA 1JHXA 1J1UA 1WX1A 4FYHA 4K6GA 2RC5A 4DMFA 1CE8B 5E3JA 3FCEA 4HWOA 4HD8A 2EZ8A 1GDTA 5A0FA 1FBTA 1P62B 3KQMA 3MWKA 3PZBA 3U7HB 3KXLA 1GPH1 2NW6A 1XE3A 3GP3A 5LA6A 4AX8A 1QFXA 1W4CA 2RMKA 5EP2A 1FX0B 3CW9A 4KR0A 4RHEA 3DLPX 5JSKA 2X3YA 3HPRA 5C1PA 1WUTA 1W4BA 4PYNA 4ZQEA 2F00A 1YCFA 2QL7A 2BMDA 1WSBA 1TJYA 4UNPA 1AF4A 5HDBB 1UIMA 3C7KA 2RAVA 3PDIA 3B8EA 3FZNA 1CEYA 4F9FA 4KPGA 4E5DA 2WB2A 2NX2A 1QVRA 4HQNA 1DLIA 4II2A 1NDUA 3ZWAA 4YJKA 2GN6A 2XYGA 5EESA 3D0RA 3RYIB 4R8MA 5IXSA 3MSCA 1DIBA 5BUCA 3JVIA 1UPUA 5K6RA 3G5MA 3UUEA 3L7CA 1G8JA 3HGTA 5CVUA 1AZSC 1GU1A 1H65A 2LCFA 3K0SA 1LC3A 5IT4A 3BL8A 3SIPA 3N2LA 4A4DA 5JROA 4WESA 4TV9B 2HX1A 2IPXA 1YZUA 1C9KA 4A2CA 3QBEA 4C5AA 3AY3A 4F4HA 5I7SA 3LX4A 1LWNA 2VBGA 2P5SA 3E5HA 4G07A 1UKEA 4BQEA 2IH2A 4WZ6A 3L05A 4MW4A 3PQ5A 4KQGA 2SKCA 2J3JA 5A1JA 3QXHA 1WV1A 4QA9A 1F9EA 3QOWA 1P3DA 1H8EA 5AJXA 1TKCA 3CRMA 4H6VA 1JEYB 1RJ9A 3W5UA 3TZLA 1FVFA 4E11A 5L9AA 2IV7A 2XE4A 2JB9A 3SQXA 4UBIA 4D1YA 3VPAA 4E4RA 1Z22A 2PSSA 4QQKA 3ZKWB 3ZE9A 2OE2A 1UPFA 4OHBA 2C5LA 3T9BA 2C98A 4CTMA 3ZU5A 3HDHA 3TBFA 4M21A 3PI7A 1E6CA 4EITA 5EIXA 3JARB 2H1OA 1SU7A 2L42A 2N3ZA 4ZVNA 5FL7A 2X0KA 1LLCA 1G0NA 2EF1A 4IBOA 2Q5JA 1ZN2A 5JLJA 1MNAA 3ADKA 1S02A 2HGSA 1EA5A 4Q18A 1XQ9A 1YIAA 2J8ZA 2V6GA 3GOHA 3PIRA 3QELA 4M55A 3LWBA 1LUAA 1E2HA 4RGQA 4RL4A 3D6UA 3QEMA 3TXAA 3LRXA 3ZHTA 4IEFB 1GEGA 1Y3FE 1XVUA 4PC7A 1DKOA 1HT2E 4J3FA 1GA1A 2HA4A 4L8WB 1G3QA 5JQGF 2BGKA 4EYKA 5E1DA 1EBBA 4CETA 3AI2A 4YMSA 3WL4A 2C5HA 4P2GA 3K5WA 3X43A 1QDUA 4DMCA 3MILA 1JQLB 3PTAA 1JFSA 5EHQA 1A96A 3AF0A 4LBVA 4R3WA 1PFGA 3WO1A 2X15A 4Q9JA 1KKUA 1S2DA 4ND8A 4UVIA 4J1TA 2AUTA 5EYPA 3UQZA 4HEQA 4O3MA 2PUAA 3DDSA 2AMFA 3K5IA 4X6XA 3UHFA 4RTRA 5EUQB 4WD3A 3GNSA 2VYVA 3RSGA 1YK1A 3FLAA 1BMDA 3DVAA 4V1CI 5KSYA 2VQEB 2OCDA 4JB2A 2XR1A 4MMXB 1TVCA 1VBFA 4UPDA 5JJLA 1EK0A 1ZD1A 1LX7A 4LA4A 4EFLA 3L79A 1XGKA 5B3KA 1J5PA 1DX6A 3SF0A 4DA0A 1PAUA 5IVHA 1LU9A 2C96A 4HNQA 4S2EA 1T0BA 2RKOA 5CW1A 4F1JA 4HVTA 4KPYA 3WIOA 1OFTA 2JEYA 1FQOA 5FPTA 3EQZA 1P91A 3BZBA 3I01A 2DCMA 4FXOA 3G2NA 4KMOA 5D51S 3ZNQA 4N3BA 5JUWA 5JTUA 2V6IA 2X5NA 1QCYA 2BWJA 3BDAA 1ZOOA 1U3GA 2H2WA 4KIJA 1WXHA 4RKFA 2XWJI 1OCEA 5BW4A 1DXYA 2B94A 2OENG 3O38A 4E30A 1PFKA 3L6CA 4H1VA 3RQSA 5F7XA 2DWCA 2ZK7A 2WHXA 4KWTA 2WVAA 4BTVA 1XZFA 4NPAA 4UBOA 4B8YA 4E5UA 1AV6A 1QGAA 1QKJA 1W8DA 2MSDB 1JTVA 1KO7A 1SWVA 5JZVA 3ZDXB 5KQGA 1P1BA 2HLNA 1OH7A 4CQLA 5DYIA 2OG1A 3WV5A 4LCEA 3P9YA 4DLZA 5C9ZA 3ACDA 4G4IA 3UCXA 3I6IA 1UC9A 2O6HA 5J2UB 1RXEA 4BFCA 4BQFA 1X7XA 1QFJA 3EOAI 4IV8A 4HDOB 4ZOEA 5HOQA 2EBFX 5J58A 3QMPA 1SIBE 1CJTC 1E1RD 5HIKA 4EY6A 3JASB 5EL0A 1E5VA 5IDQA 2Z6UA 4F3CA 2WWFA 3L7OA 5HF5A 3RTGA 2CCJA 4WEOA 3W8DA 2O3QA 4BC1A 3ETLA 4MWBA 2CDAA 4TYPA 3DFMA 3ZYCA 3AESA 5ALYA 3NMUF 1OT3A 5CYGA 1L6RA 5CR9A 1EDEA 2P3OA 2UYOA 3UMRA 3KQUA 1KMHB 3DPUA 1GP2A 3BA6A 2FSUA 3RPEA 3V80A 2R5WA 3URMA 1XEXA 4NCXA 1AKWA 1FUYB 4PYKA 3HU3A 4LRQA 2D2XA 4F86A 1U0LA 4KUHA 1NBWB 4RNDB 3I9FA 4HBZA 3SDZA 1WMFA 4UAJA 4BNNA 2GXSA 3BIXA 3GO4A 4KRYA 1Q77A 3WGMA 3R9XA 1NIPA 3TLKA 3SHWA 3T1YB 3UFXB 1GO2A 4P4SB 2NVWA 3OY2A 3PKIA 3MT7A 1M83A 4MYHA 5JASA 2ZP1A 2POCA 3TNLA 1R0KA 2R85A 1D4ZA 3H19A 4CEHB 2POQX 5C8VA 1OR8A 2CWDA 2GBLC 3PFWO 1HQDA 4O1HA 5SZIA 3RS0A 5KTRA 3O8OB 1XB2A 4L72A 2GVDC 4YMIA 3ONEA 5KMGB 3O8NA 4U0KA 3NVKI 4QQNA 4D0NA 1SG6A 2J45A 1DLJA 2WV7A 2QUBA 3AHGA 1NW5A 3BEOA 4RJIA 4OJYA 4KTTE 2DYKA 3QVGA 4O2BF 2J30A 2OOSA 3OO1A 4O3FA 1GL7A 2NQ8A 1PTJA 1KXZA 1UWVA 3F2IA 3H9JA 3GN1A 2VRCD 1DT5A 1U04A 3OQ1A 4V3BA 3RHZA 4CLXA 5BRJA 2NZUG 3C5VA 3UFXA 5FH9A 2YMLA 1QAMA 1KIMA 4J29A 2AV6A 3AW8A 1FQKA 1A2OA 4MA5A 1OW3B 2ZCUA 4CQMD 4B4DA 3SDSA 3VTAA 3K70C 2GF0A 2Q5FA 3FW1A 2NQTA 1JSCA 2Q1XA 3IRVA 4ZJUA 2X6QA 3E8SA 4GPEA 2BFFA 1MV8A 3A3OA 2GM3A 4MRVA 5HCIA 3MWEB 4KMMA 4ZT2A 4TKVA 2AEEA 1N5OX 2XVZA 1PJTA 2XYQA 3NFRA 3NTOA 2X19A 3PQ7A 4OU5A 1Z25A 3GFFA 1IOVA 3DT9A 4C6RA 4GM0A 5E95A 5IXJA 1WF3A 2VDWA 5FORA 2AOVA 1XRNA 2ZJ8A 3B1FA 5JE8A 5IVDA 1PZNA 3DMGA 1I32A 5AOVA 5HCUA 1T8TA 3SN6A 2F9FA 1VTKA 3LUKA 1RZUA 3E2IA 2P2SA 4MUXA 3PKJA 4LTNA 3R8XA 1FW6A 1YB7A 3BTUA 3JQAA 4HQFA 3NTQA 3ZWQA 5TT1A 3OCXA 1YDWA 4QUJA 3SM3A 3WDSA 3CLRC 3DBHA 2HCRA 1T0HB 1AUVA 3ZIUA 4NQZA 3GRPA 2OCGA 3UENA 2V97A 3G2JA 1QHFA 4IQ8A 4UU8A 3C85A 3CUVA 1XK6A 4BX8A 3GB9A 1INLA 4KQEA 1G18A 1RWWA 2HTEA 4F8YA 5T8KA 3K30A 5GAJA 5A04A 2HI0A 1BS9A 2EC5A 1TLFA 2PZKA 3CVJA 3GQBA 1KEZA 1YC5A 2NPIA 3KPYA 3OUTA 1KZYC 1LV7A 3AI1A 1QIDA 3C3MA 4REOA 3WC4A 3JQ6A 1KZ7B 2YVKA 3P52A 3EUFA 1GPAA 4NG5A 5CGZA 4V1CB 2OO5C 4N6NA 2WMDA 3ANMA 3PC8A 3ZDYB 3EXEB 3RHFA 4ZKDA 1APBA 1XO1A 4EEXA 1GPUA 8AT1A 5IASA 5IF9A 5JYDA 1O6BA 1K86A 4LBZA 1BWQA 1O94A 1XHEA 3BMCA 3ENVA 1A4RA 2WMNB 3ESDA 3RDPA 1RWBA 1TYDE 1BWPA 4PE5B 5L53A 2B1RA 3WGJA 1OYOA 3B1WA 3KPWA 5EPOA 1OZAA 1QOQB 4M1KA 3AOEA 3CMMA 3B52X 4HDKB 5FEUA 3MD0A 4J7XA 4DAEA 1VYTA 2ZRQA 4FKMA 2ZI5A 3DZDA 1IUPA 3Q7QA 2CLCX 5C7YA 4KBYA 3CBGA 4OSPA 2OV8A 2SICE 2O6LA 3LO8A 5BWBA 5E6UB 1PDVA 3EXFB 3GD7A 5KB3A 3PPXA 3PDWA 3FHCB 1TFRA 1E2FA 2PBFA 4L4ZA 2OPHA 1NUUA 1HTWA 3F3YA 4FZJA 2GTHA 3PX7A 1AO0A 1Z2CA 5BUQA 1IMJA 4KR9A 1OC2A 1QF9A 1Y34E 2VP4A 3B48A 3IR5A 3C6QA 5T3UA 3TTVA 3M6UA 1R00A 4DR4B 2GAJA 3HSKA 5IM5A 3F6RA 4M0MA 3KYDA 3P2MA 1US8A 5B1HA 5JD6A 2VJLA 1XRMA 1CYDA 1C7JA 2RGCA 2GERA 3GLTA 1CT9A 2OCKA 3DNFA 1I8TA 4X7MA 1GG5A 2IYNA 1VIVA 4FEGA 2VNAA 1IBRA 5D3MB 1II0A 3C8MA 4QTUB 3JR3A 5D1HA 3VISA 4CU2A 5ALLA 4F12A 4ZZ1A 3L8ZA 4DTCA 4ZI2A 5ALOA 3RC2A 2FN7A 2BGUA 4EAAA 1MZPA 2BY4A 3GELA 3GT7A 4OL0A 2N75A 3WGYA 4CF3A 5AXBA 3GT0A 2VRWA 3QVLA 4JUDX 4NV3A 2HOQA 3E23A 5AKHA 4D98A 1JP7A 3ZQUA 1XZAA 5DM2A 3CH7A 2PDAA 1P5JA 1D9XA 2AZ4A 2YICA 2F1HA 4PPQA 1OFUA 2ZGVA 4JUFA 2H48A 5I7HA 4UVHA 2W2VA 4KREA 1F51E 5G4KB 1YZFA 1AKEA 2GT1A 3KS9A 4D96A 1GG2A 1IDN1 4LHEA 4Z9FA 1ZMRA 4HG2A 5H9WA 4JWTA 3A6LA 4P6VF 4GR5A 5TQ2B 5HKAA 5LZ4A 4OYLA 4BRUA 4F56A 1XEWY 2GYWA 1L7QA 3PL1A 1GHTA 1GWNA 2IHYA 3GLHE 3RVLA 3UW3A 2JL1A 3PVSA 2DUNA 1P4RA 4PLYA 4RH1A 3JPYA 5DISB 5I3ZA 1IQRA 4REMA 4UQPA 4EF4A 2GJKA 3DOHA 2R6DA 1G5TA 3CH4B 1MAAA 1VPEA 3PHIA 4XW2A 3ROKA 2D1FA 5KKAA 4IXNA 1RXWA 4N7MA 3FE2A 4RGBA 3V7NA 3Q12A 5CVCA 4DGSA 1GUYA 2W6IA 4KR7A 4J0QA 4C2AA 3SK0A 1TMGE 3OE1A 4DQLA 4OXNA 2GPJA 3BL6A 1H42A 1W85A 1GZUA 4S1VA 4IDHA 2E5FA 1J4AA 1O5TA 1TVMA 3IAXA 3WS7A 3CVYA 1CEEA 4FQ7A 1NLMA 5FR1A 4DWVA 1GUDA 3PC8C 4DGQA 4LFAB 4PSUA 4MR8A 1U0BB 4RY0A 5FTMA 3EWSA 4AJ9A 3ZJTA 3JQFA 4ARSA 3GRKA 2OA0A 4BKMA 5BVHB 5ESWA 4E22A 3SIRA 4LSZA 2F3TA 3AUYA 1OLXB 1I3MA 2OV6A 2Q6TA 4R81A 4F5DA 2QJFA 1GRVA 1L3BA 2EX1A 2QSYA 2WTXA 3K2EA 2J6BA 4NCNA 4F71A 4ZMSA 5J9FA 2A57A 2E0IA 2G5GX 1X7ZA 3RKSA 3QPAA 4KO8A 4MJXA 1CX9B 2HMVA 1FRFS 3IP7A 1R0WA 2Q0SA 3AP1A 3U9TA 3VDQA 5CIYA 3OPYI 3PHGA 4EMSA 2PMKA 3QUCA 4IHQA 3W5SA 1EUCB 4EY4A 1GPJA 1D8TA 3OTGA 1TYCA 3UT0A 2KS6A 4HQLA 5A62A 1H2ZA 1QQ5A 3IKMB 4RZ2A 1MX1A 1YU9A 3EASA 4WZAE 3UA4A 1UXHA 1TCUA 5EKSA 1Z5OA 1KYIA 5HW0A 2EZ4A 1QFSA 4MQEB 2MSLA 4D9GA 3KPVA 1NX9A 2BMVA 3SEAA 1OMOA 3I5UA 4EGFA 1PQ4A 2WIKA 1NAIA 3BD7A 3VPCA 1ADFA 1S7GA 4LHZA 1JLLB 1KJWA 3AYZB 1YRYE 1Q1ZA 1ID1A 4LSWA 4MQ5A 1RHJA 4Z2YA 4QXPA 4QPJC 1AT1A 2GK4A 1N3YA 4YMVA 2A5DA 1QLHA 2XJ9A 3PEWA 3E3NA 3EIQA 2NO9A 3DAFA 4WT7A 3TD2A 4X8LA 5KZMB 4L78A 4KAJA 3SS8A 5BSHA 4Y2VA 5BSKA 1EWRA 3FLMA 2HNAA 1JZQA 3HUDA 3QEOA 1OVGA 2IXGA 1H66A 3P0JA 4H16A 4UUQA 3RTBA 3KZXA 4MR9B 3H0KA 5KPDA 2HB6A 4FX2A 4FLFA 4JDUA 2UYGA 2CLFB 4P7FA 1KH3A 3EEOA 3RBVA 3IQHX 3L1IA 4OU4A 4EI7A 1CZKA 2GZSA 2OTCA 1PNVA 1ZN9A 4M0PA 5MF6A 4K9KA 3ACBA 3I6ZA 1AQLA 5BSUA 2Q2WA 2W2MA 1RSZA 4IW3B 2L2QA 3O75A 4FLEA 4TT3D 2ECPA 1A77A 3UAZA 3EXHC 4DR1B 1XZEA 3L4JA 2ODTX 1JWAB 2PGOA 3HYSA 4HGZA 4A7PA 1TM3E 2HBZA 4R2KA 4JXZA 4UARA 4AN0A 4OQLA 2P90A 2O8CA 4ZO4A 5BW5A 5U9CA 3FZGA 5JY6A 1VB5A 2P75A 2Q6OA 2YWFA 3M6IA 1RJ9B 1OXXK 3DF9A 2HSJA 1XZIA 3ML1A 1U8FO 4WZAB 2DT5A 2JAOA 3A9WA 3EHDA 3H2YA 2JIPA 1NUTA 2ZCVA 4TVOA 3RFVA 5BY2A 4MMYB 1R6BX 1OVMA 4YRBA 4IHKA 4UHFA 5K4AA 4DE5A 2FMXA 2CZQA 1RVDA 1Q14A 5KTTA 2GK3A 1G42A 1PS8A 1Z4QA 4PQEA 2SECE 4Q4LA 4QD3A 2PAFA 4W1SA 4XDGA 3OZ7A 3B3FA 5FEMA 3V48A 3U39A 2WICA 5IDWA 3MTQA 3HRHA 1DCTA 1EJ0A 1I6KA 3LQQA 3FWPA 4MKXA 4YQEA 1HNXB 4HWPA 4G5OA 2G80A 4TN1A 5CYOA 4N1AA 3WWCA 2ECOA 2GCPA 3RBAA 3UC9A 1S7CA 5JJKA 1T1RA 5G40A 5IJAA 4JT8A 3VH2A 4ZI3A 1YE5A 4GBMA 3H5WA 1BO6A 1S4QA 3MPOA 4ARAA 4TVBA 5BVGA 1U80A 4F06A 4WMLA 3KXDA 4AY6A 3H9QA 2HL6A 3AEKB 2QV7A 4FI3C 3WL3A 1DRUA 1PZEA 4ND8B 5A3VA 1AB5A 2FSPA 1R6VA 2GA8A 3ZK7A 1VFPA 4EHIA 3ND6A 4JVMA 4Q02A 2H8KA 2XIQA 4QASA 1LI5A 2GHIA 2HRBA 1FDUA 2YC2C 1KETA 3EMVA 3HXKA 3KLNA 3N2EA 1R0SA 1NU8A 3P2EA 4MHOA 5JH7B 5FADA 4H1WA 4U7HA 1VLVA 4PX9A 3LP8A 1XQ6A 1XCPA 4TGLA 4PONA 2X86A 1TPYA 3SQLA 2H1WA 3UWSA 3VZSA 3DD5A 3OWOA 1ECFA 2H5JA 1Z26A 2YJ4A 3HRIA 3P9KA 4L9AA 2V7EA 3JW8A 1MEJA 2VC2B 1C30B 3DB2A 4B80A 2XUAA 2B21A 2B4RO 4H2DA 2D7CA 4JJ8A 3VC2A 5JCPA 3QFHA 2WQ7A 1QVVA 2MR6A 3MINB 2J3EA 2WSYB 4D0LB 2GRAA 5AHOA 1ZSYA 1BXRB 3OF2A 2I3ZA 1U2DC 1MU0A 1K8ZB 4D44A 4UMDA 4MIEA 1XMSA 3GGCA 4TV8F 4AG6A 4YJ2A 1BDMA 1I7DA 4Y9RA 1R0RE 1YQWA 3B2NA 4KIGA 2BLLA 3N0TA 5KC9A 3LP6A 1VIDA 3FNEA 3QNWA 3ZZ0A 2ZT6A 1N2IA 4OEHA 5LL6P 3BXEA 1Y4SA 2JLQA 2QI9C 5CX1A 3T4EA 4QBKA 5KQLA 1AH2A 5FUYA 3OJFA 3SKXA 4QHYA 5K8IA 5KHLB 2ECKA 1JSXA 5LM3A 4B3SB 1GZ4A 1VC2A 2JD2A 3HL4A 4OFBA 3JYQA 2A1UB 2VWQA 1U3TA 1E62A 2G70A 4J7AA 2M98A 2C4TA 3BC1A 3IOBA 4C78A 3S1AA 4QGFA 1K1EA 5JJ5A 5J2UA 1T8PA 4OAQA 3F5FA 1D2RA 3L7JA 4G84A 1IVNA 5JZOA 3C1UA 3R6GA 1XHFA 3AR3A 5BMOA 1ZM2A 3AV0B 2OL4A 4NZOA 3ZHQA 1RYBA 1YQ9A 1I3KA 1L5YA 4RS4A 1V9LA 5AKKA 2EERA 4RCVA 5JO0A 1P18A 3G8AA 2PBLA 3N39C 3C5WP 2QBYB 3LOQA 4E5MA 3PRYA 1H6DA 3QIVA 3GFBA 1KP3A 4XIFA 2Z2YA 3EFBA 2XMQA 4AKEA 4V38A 2D2VA 4Q82A 2I9KA 1D2MA 3OEHD 3UWKA 4EJ2A 5LKAA 2O3UA 5A0TA 1D7OA 5FT9A 3Q2IA 4P81A 1HOXA 1HDEA 5A3QA 3R9XB 4MK4A 2JGLA 1F5NA 3R4VA 1KJ9A 1MBZA 2HKIA 3NB0A 2ZITA 5DYGA 1TJ4A 3NANA 4PXAA 1Q3KA 5CB4F 2IP2A 1KXJA 3WR5A 4ZYXA 2B4TO 1I1NA 4H4CA 4BLTA 4BFTA 5JZSA 4TWAA 1HEIA 4Y2GA 2Z4SA 3UUGA 3MTIA 3TXYA 4X85A 1P5HA 4WKBA 3WIUA 1AQIA 3FOCA 1SUBA 1J1ZA 1DAEA 4B6GA 4HB3A 4F7WA 4F4IA 1U31A 4AG3A 5JXIA 1BWSA 1CG6A 3OHMA 1SC1A 2MU1A 3PDCA 3NHAA 1IMOA 5E38A 4GR4A 1EFRA 1Y3HA 4NAHA 4RF3A 5CVVA 4CKEA 4Y2QA 3BJRA 2RHLA 4GM1A 4QVIA 4XVCA 1NT2A 1TA9A 4TLLB 4EYEA 2Y99A 2H9YA 2VWPA 3K9CA 3VPDA 2A9QA 4XCQA 3WMFA 4PCUA 1HZZA 3UOGA 4KIFA 4JYPA 4LW8A 2BOVA 4P5DA 4UHKA 1JTFA 4BNWA 4CLRA 5SZHB 5BNWA 3DLBA 5D00A 4GKKB 1XR3A 2BFBA 2F3QA 1EFVA 2HHLA 2Q5IA 2Q29A 2ZE8A 1ZVVA 3DONA 5LBTA 3J7AC 2ORIA 3SSNA 2YN2A 1HNZB 3PA8A 3IA2A 3VV2A 3UY4A 5EJ9A 1HYGA 1K92A 5JZMA 1PZMA 1NR1A 3PHCA 4D26A 5J4LA 2Z9DA 3WISA 2C5GA 1Z0SA 3FPLA 5AM1A 3PLAE 3R20A 3F6SA 1B1AA 5HNKA 2Q0HA 3INTA 7ADHA 3RRFA 4CMEC 3ROPA 4MLDA 1LQUA 3DCNA 3NOXA 3F3KA 1KKMA 2IPLA 2Q9BA 1I80A 3C3WA 3L1HA 1U63A 4YAFA 3LFTA 1N2HA 3NWJA 3OIUA 5D3ZA 3UPDA 2AW5A 4X7RA 3STHA 4ZMBA 4C3UA 3F1LA 3PXDA 1U2RA 4CEJA 1FUEA 5FUQA 1C7IA 2IQIA 3GLIE 1E1LA 1I3LA 2XVMA 5KSPA 1OFIA 2CVOA 1Q0LA 5JADA 5JV5A 2XBUA 4RQTA 5DHPA 3AEXA 3QITA 4M87A 3CUKA 2C3OA 2XZDA 4IZHA 4CM4A 3FNIA 4HUQA 4JKIA 2CJXA 1ZIDA 2AK2A 5LMCA 2G06A 2AA3A 2F59A 1FTQA 3LZCA 4Y1GA 1L1QA