2WMNB

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
b'SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wmnB00
1G4UR 1GP2A 2G83A 1O87A 2QAGB 2WJYA 4ZO4A 2AFHE 4BECA 2ANCA 1Q0UA 2I1VB 3NG1A 3TSWA 1AKEA 1KTVA 2PMKA 4FIDA 4PSVA 2X19A 3GLFE 1A82A 1US8B 3NHBA 4NPHA 1DAKA 4MDEA 1ZBDA 4C0AC 2AK3A 4TMZA 4B33A 5LBIA 3UMRA 3BD9A 2B92A 1N5LA 2VPPA 4DT1B 2AKAB 2TMKA 3B2EA 2BEJA 5G3ZA 1VHTA 4IKEA 3LVQE 4FINA 1IN4A 3TE6A 2GK7A 2ZRCA 4DCNA 2JCSA 3A4MA 5FI0B 3RSOA 1OKKA 3FMPB 4Q47A 1QHHB 5KUTA 2QUZA 5GADl 4EPYA 4TLBA 1Z6GA 1BKDR 4JT2A 2GWHA 3TSZA 4EPWA 4BPBA 1KO1A 4AG6A 5HKKA 1W5TA 4M22A 1G3UA 5H68A 3DZDA 3RABA 2J0QA 4TL7A 1ZC4A 1I4DD 1YRBA 4B34A 1G8PA 2WZQA 2GXSA 2XZLA 3MWLA 1OHHA 2GXUA 3P27A 1U8YA 3FYHA 4Y0VA 1KAGA 4MRSA 3AVUA 4OHXA 3L82B 2D4HA 2D62A 4DCTA 1JR6A 3BBPA 1T3SA 2WWYA 1XTRA 3NHAA 3TMKA 1WBDA 4OI0A 5CDFA 4ACBA 5BWMA 3OESA 5F9HA 1N5KA 2BJWA 2GVDC 4XD7A 3T12A 1Z63A 3KJHA 4BRUA 1KI9A 2CCJA 2Q21A 2JLQA 2JLYA 3K70C 3U60B 1HT2E 2BC9A 2Q3FA 5JZVA 4C0HA 2ZRNA 3EWSA 1OXXK 1SXJD 1Z6AA 2OE2A 3LW8A 3CW2A 4LWZA 4DSNA 2FV8A 3EZFA 5EXPA 4Q1FA 2GK6A 2C8VA 5GJBA 3R8FA 3U7GA 1RYFA 4JBWA 2VIIA 3SJCA 2R2AA 2GZHA 3F5FA 3K9GA 3I62A 3U44A 3TH5A 5D3MB 1GRRA 2KE5A 3NBXX 3X1YA 2N1BA 4KI0A 3NBFA 4V02A 2VTKA 1KMHB 4PZLA 4ZV4A 1MOZA 4PC1A 1XPOA 2AD5A 4D4JA 3KXLA 3AVQA 1FMLA 5KSPA 4Q1EA 2F9LA 3SHWA 2RGBA 1AN0A 2ZI9A 2GJAA 1FNMA 1M7GA 2NG1A 3RS4A 3JVUA 1M74A 5A5GA 1U94A 3AKDA 2J45A 1VECA 1SGWA 4KLZA 1GITA 3K0AA 2REXB 4HB0A 4JIMA 2AHOA 2ZE7A 5CM8B 4BFUA 3AP2A 5JEDA 4OK3A 4B2PA 2RGNA 2RGAA 1ETUA 1YRAA 1YKSA 3RRMA 4A4DA 1G1MA 3SJBA 1E2MA 1FP7A 4MYCA 3UANA 3QEJA 1KNQA 4C2UA 2VHJA 1N6PA 2BCJQ 1UBFA 3GD7A 4OJQA 2FDCA 4PHHA 4GMXA 1AZTA 3KXKA 4PZZA 3AF2A 2ZSBA 2ASEA 4ESVA 2NO0A 3B1XA 3FFBA 3LRPA 2WWFA 3T1OA 4TYNA 1JECA 4C0JA 2KBFA 3S1AB 4CF7A 1Z07A 3R20A 2ERXA 3ZYCA 5CIQA 1MO5A 3NVAA 3UXMA 4DZZA 2XZOA 3A37A 2P5TB 5ELXA 3RRYA 1NF3A 5EP1A 2WAXA 3W90A 2V9PA 5BW8A 4JLAA 3SQWA 1KDPA 1SQ5A 2QPOA 2RGGA 1GRQA 4V0KA 1S96A 4MYUA 1G6HA 5KDLA 3U3MA 1EK0A 2A78A 3AF1A 1VCMA 4US1R 2ZR9A 1OYYA 4HZUA 5E7IA 2J9RA 2R6AA 1P60A 1QHIA 1E9SA 2RGXA 1G8FA 2WSMA 4P33A 2ATVA 4IHQA 3REFA 5KSZA 1OE0A 2XNSA 3B13B 4W7SA 4Q03A 4KITB 421PA 4D0GA 3CF6R 4M9QA 2ZJAA 4TWZA 4Q7MB 5EUQB 4EFNA 3QY0A 1XD8A 3IO3A 3SEAA 221PA 4WIAA 2UKDA 1VG9B 4C7OA 2ZYWX 2G1JA 3DM9B 4LOAA 4IXNA 4QGAA 4X8OA 1NLZA 1ZM7A 4CYMA 2H18A 2D7DA 4FMCB 2QORA 1G5TA 4TTPA 2C2HA 4DLTA 1FUUA 3GFTA 3DHWC 2VSFA 3EA0A 1G19A 5E95A 3R7WA 3LLMA 3KKQA 3BFKA 3RS0A 4S35A 5FBLB 5FUVA 1BYUA 3OEHA 5FBVB 1A1VA 2GVZC 5J5CA 1G17A 1EFCA 2A7QA 4DLXA 1CRPA 4W5WA 1IXRC 3IIJA 4NYIR 4TQUS 4WOPA 2W6JD 3T5GA 5BYJA 3QKSA 2EFHB 5J4KA 2JLWA 4ZKDA 3AVPA 2ZITA 4LJYA 2FFAA 3CO5A 5FUYA 4B73A 1CR0A 2FMXA 2H92A 2P6RA 2CBZA 2W6ID 4CIDA 2FSHA 3VR3A 1F2UA 5JEEA 4DVGA 4MQBA 4A2WA 1Z83A 3PEUA 4Q9HA 1DARA 5JI3E 1LS6A 3K70D 4QHSA 5FOXA 3FMFA 1QF9A 4A0RA 1FX0B 1NBME 1XMSA 1K5DA 2ZSAA 3WP0A 1CJUC 3LXRA 4HUQA 2A5FA 1U98A 3MSXA 4A36A 1XBTA 1OH8A 2BDTA 3U2QA 1TMKA 4Z8XA 4GDFA 1OH7A 2Q3MA 2BBWA 3SE0A 1X3SA 1X1SA 2W2XA 3SQXA 2LWIA 3LLUA 4NL4H 4US2R 3THOA 4MRPA 4B2IA 4TL8A 3IEUA 1G8GA 1MABA 4U7DA 4B3GA 1OW3B 2ZU0C 2XTMA 4TLCA 3BB3A 4RZXA 1HYQA 3IIKA 4M8NE 4M21A 4Q1DA 5HE8A 521PA 1FPMA 4HLUC 2P3SA 1TF7A 4LK2A 3TK1A 4PAOA 3JZAA 2N46A 2YC4C 3B1ZA 2RKOA 5GJWC 4PPQA 5DSZA 5J40A 2WJGA 4OI1A 2ZRKA 1R4AA 4BFZA 5AUPB 1Z0IA 5J47A 2ZSFA 5M04A 5JCPA 2BBSA 1J7KA 2C9YA 2F7SA 2DYKA 3AVOA 4JBXA 3ND9A 2MMCA 4KODA 3V9PA 5L3VA 3J81k 4M1TA 1TTTA 2Q6TA 2PT5A 2ODEA 1D2MA 4Z8YA 4DB2A 2QP3A 3A1UA 3B9PA 4MGZR 3AKCA 3EA5A 1CEEA 1E0JA 2GDJA 3VHLB 2X1VA 2GEDA 4HEJA 4P4SB 5B2ZA 5K8UA 2BMEA 2PJZA 3ZVMA 2Q9CA 3VKWA 2F55A 4DXAA 1MKYA 3DOEA 3RDPA 1T6NA 4EFMA 4ZI3A 5F98A 3CWZA 2C5LA 3GLHA 4B3DA 1UKZA 4I4LA 4ARZB 2Z43A 1Z8FA 3KFVA 4LC0A 5FUWA 2B6HA 2ZJ8A 3LX5A 3OFNA 4YDSA 4DHEA 2WPDD 4NU0A 4QNMA 4R98A 2JEOA 2X77A 1KJZA 3DMDA 4D4LA 4ITRC 5JFGA 3AVTA 2QGZA 4DLSA 2GEVA 5FBWB 1T3LA 1TQ2A 2FX3A 3LVRE 4EQ6B 1QHSA 4NCKA 4XH9B 4B6EA 4EDHA 1H65A 1TX4B 4LBZA 1P9NA 3K09C 1E9FA 2ZROA 3RYTC 3TBKA 5J4VA 2IL1A 1KO7A 3B60A 3C15C 3HR7A 3VR1A 5KSYA 1IONA 4CDGA 4CEIA 3PENA 4C2TA 1DELA 1BMFD 1N0VC 2AL7A 3QVUA 3W34A 1OV4A 5L3QB 5JJIA 1Z6TA 2CEAA 3NH9A 4RFSA 1DE0A 1ZC3A 2ATXA 2YVUA 1AIPA 2P2LA 5ANRB 3T34A 2ZR0A 1S1CA 1AGPA 2H16A 1R6BX 2CDNA 3LD9A 3PIRA 5HZHA 2IHBA 3EWAA 5IK2D 1TL7C 4Q4AB 1J2JA 3Q85A 1PUJA 3MWYW 4BEJA 2XXAA 1XMIA 1PJRA 1XTKA 3CRMA 2VA8A 1II9A 1JJVA 1RFLA 2PX3A 3LO5A 4JLJA 4MRVA 4POAA 3W3AA 3WRXC 2OXCA 3AQ4A 1VG1A 1MV5A 1V5WA 2YHSA 2P65A 4QL3A 4LYFA 4RD2A 1SXJA 1WDTA 4OI2A 3SU8A 4GZMA 3GFOA 2G88A 4B43A 2YKGA 3QBVA 4E03A 1KZGB 1W0KD 2KI5A 1NBMD 1FQKA 1E2JA 1G6OA 4BFXA 1E2PA 2Y8EA 2ZU6A 5B57C 2C9CA 2CJWB 1E2EA 1OFUX 2VO1A 3EC1A 4LBYA 4N0DA 3THXA 4RFVA 3BGWA 4MYTA 1OIWA 1SKYB 3CWQA 2VHCA 2OHFA 4Y0AA 3M4YA 4IEEA 1NVUQ 4KSCA 4XWKA 4OQFA 5CB8A 2HXSA 3L0OA 4ON9A 3SBEA 5DI3A 5KPDA 3PUZA 1G5PA 4BLQA 4PC7A 3NDBB 3LW7A 4NCHA 4GPTA 2DR3A 3P26A 4A0GA 1XU4A 4RD1A 1UM8A 4KAXA 2HT1A 3D3QA 3JZMA 4UXJA 2JLSA 2O52A 2NMVA 4B47A 4DLUA 1EGAA 4WXRA 1M34E 1FZQA 5D3QA 1BH2A 3MRSA 4PFSA 1MRSA 1SHKA 2IYZA 2ZREA 1A7JA 4MYHA 5EZ5A 3SFVA 3UK6A 4ZIRB 2DFNA 2WAYA 5KPJA 4KFRA 1XXHB 1QVRA 2B8TA 4G3XA 3AUXA 3C16C 3VR4A 3RANA 3QXXA 5TVKA 3RWMB 1DG1G 1HV8A 4S2EA 4HDQB 4B75A 1SVMA 4PX9A 3BAFA 2V54A 1ZVQA 4DJTA 2OV2A 3ZIAD 4JLBA 2XITA 3B8HA 1G291 4A6XA 4A2PA 1WBBA 2GEUA 1Y63A 1WF3A 1E79D 3IBGA 2NPFA 4BFTA 1ODFA 1KK0A 1TADA 3GLFA 1VIAA 4Q9JA 4HSEA 1ZNZA 4C0QC 4LV8B 4QM7A 4PAMA 2OBMA 4PQFA 4WXPA 4DUGA 3KJGA 2P0EA 3R8CA 2NTYC 2PCJA 3TUJC 2CE7A 2ERYA 2R65A 3PUXA 5FOWA 4JKYA 4YMTA 3U4QB 2XGJA 4TMXA 2CL6X 2XSZA 2Z4SA 3AP3A 4HYYA 2IS1A 2J7KA 1G4AE 5KU1A 2G0NA 1RJ9B 2BKUA 1P2VA 3K9NA 2Z83A 3QOFA 2QMEA 1JQJC 4IFEA 4WW0A 4QRHA 1VYTA 2D06A 3T15A 4CEHA 2ODWA 2ANBA 3GFPA 1KOFA 3GPLA 1Z29A 1IN8A 2VP0A 2YOGA 2OLJA 2CHGA 4CZ2A 1XPUA 1OB5A 3TW4A 4W9MC 1RYHA 3A36A 5H1YA 2IXGA 2BBOA 2QY9A 4LC1A 4N3NA 5H8WA 1XXHE 1UDXA 1U8AA 4LYJA 1M6NA 3A1VA 3BRWD 2YNMA 3BB4A 1DADA 1KO5A 2HJGA 5BYKA 4CEJA 2UZ3A 2W2VA 4D4KA 3QXJA 1ZUNB 3I32A 1TQ4A 2P6NA 3AF3A 1UADA 3K0CA 3K1JA 2RGCA 4Q01A 4N1AA 3CRVA 3AF0A 1PZNA 1QVAA 4JZKA 3CRRA 4HB2A 2GXAA 1JXOA 3PFIA 2QAGA 4LJ6A 3NWJA 4A8JA 2X8AA 3VX4A 3A58B 3TR0A 2VSXA 1HH4A 3I4LA 4LRWA 4R2HA 2QSYA 2F1HA 1CP2A 1YVDA 4GL2A 1CJKC 1YR6A 1KNXA 1US8A 2C77A 2WMOB 3WNBA 2ZE6A 1N6KA 1W2HA 1Z2AA 3LNCA 5AR1A 3ADKA 1LFDB 3ICEA 4DT1A 1KSGA 1QG4A 5P21A 4ZCIA 5G40A 1U0JA 3IUYA 3TJZA 2CVHA 3H4MA 1S3SA 3TNFA 1IY0A 2FGKA 2NQ2C 2HCBA 1F60A 3RRNA 5C4MA 1QHHA 2ZI3A 4LJ8A 2AR7A 2JATA 2JJ8A 1LNZA 4KFSA 3ADCA 3LQQA 2CK3D 4TMTA 4H9GA 4EUNA 4NDZA 5LD2B 2H8KA 1II0A 1W0JD 2AFIE 2YOHA 2FWRA 1VG8A 3OE7A 4I1UA 5B30A 2ZVQX 4AKIA 1U8ZA 5CYOA 3CX6A 2GXQA 1ZCBA 3KB2A 3PEYA 5DGXA 121PA 1CU1A 1GL9B 4D4MA 1HURA 1ZUIA 4OKSA 1GG2A 4NCNA 3V4FA 4BUJA 1E2FA 1OB2A 3MLEA 4LBVA 2O0JA 1E2NA 2PZGA 5JBQA 1OLOA 5AUOB 1YZUA 3AGQA 2C96A 1XB2A 2WIAA 4LYAA 5CJ2A 4BEBA 4FMDB 1ZJ6A 3BH0A 4JL5A 3IPYA 3DKPA 4ESHA 5AUNB 5L3SB 5FI1B 5L8VA 1XTJA 2ZVPX 5EP3A 3WRYC 3ZVNA 3QKUA 1G8YA 1W1WA 3A8TA 4OK5A 4UXHA 1W48A 3IEVA 4MA4A 2QTHA 3E1SA 4AG5A 3W8NA 3PQCA 3ZQJA 4PHGA 1VYUA 3B85A 3HYTA 4NYMQ 3W6NA 2RH5A 4F92B 2WM9B 4FWIB 3RRZA 1YHNA 2ZIAA 1ELOA 1TF2A 3AKYA 3VX3A 1OH5A 2ZI7A 3ZS9A 5TDHA 4IDQA 4EIWA 4GOKA 5JI2E 5DISB 2OCAA 3CR8A 3ZVRA 1KMHA 2I3BA 1BYIA 1KDTA 1U2RA 1HTWA 1XMVA 1SVWA 4V0LA 3U6KA 1B23P 3X1ZA 1S9HA 2HUPA 4JLDA 3EPHA 3EC2A 2JJ2D 3BE4A 1GNPA 2JDIA 3PEWA 2ZE8A 5AK0A 5SZHB 2H7VA 1N6RA 1E2DA 3EZ6A 4Q9KA 2F9MA 3HWSA 1EFUA 4QGGA 3SI7A 4ZI2A 2IYXA 2QQ0A 4C30A 2WPDA 4B76A 4ZDJA 5EE0A 1ZNWA 4JLKA 3GMTA 1T9HA 1X8LA 3H0KA 1H8HD 3GLIB 2FNAA 3MJHA 2IK8A 2J41A 4TLAA 2O8DB 3F3YA 3IHLA 2WWWA 3L2OB 3NC1C 1BIFA 2HV8A 4ACAA 1D6JA 2PZFA 2R9VA 2GCOB 4A6PA 2BJVA 1BMFA 4P0TA 2HT6A 1GRNA 4PQYA 5DHFA 3K70B 3WMFA 3QUSA 1NMYA 1ZW6A 3S1AA 3CUEF 1P3JA 1Q12A 2QNRA 4L8GA 4I81A 2I4IA 4TSFD 4ZDIA 3GLGE 3L8ZA 2WJIA 1EESA 3CX8A 3QPWA 1KK3A 3NEYA 5J4HA 1AM4D 2NIPA 2VLIA 4C0KA 4HLQB 4PO9A 1TF5A 1AJEA 2QPTA 4UJ3A 5EJEA 1DEKA 4P32A 4PAQA 5JWOA 1CBUA 3GCGA 3R9WA 2HLDD 1XTIA 2L0XA 1U0HC 4YXWA 3L0IB 4Z1MD 3HU1A 3QBTA 4Q7JB 2QZ4A 3EIQA 4DSTA 3I8XA 3RAPR 2XOKD 4DCSA 1ZM4A 3OHMA 3GEEA 4TT3D 2FGJA 2GNOA 4GMDA 1W0KA 3CRW1 3X1DA 5J4YA 3GP8A 1NBMA 4A82A 1EXMA 2F1JA 2V8OA 2PEYA 2V7QD 3B82A 3GJ8A 4K46A 721PA 3G0HA 3QSYA 4BLRA 1AQUA 1R8SA 1NVVQ 3C14C 1L7VC 3PCRB 5SZIA 3RS3A 2OZEA 1UJ2A 4YDHB 4LJ5A 3R9IA 2CLDX 2JLUA 4JLVA 4EFLA 3BIFA 3OF5A 4B3CA 1JEDA 3UWOA 4BLTA 5JRZA 3ZS8A 1T91A 1UEJA 4HAVA 3IPXA 1L4UA 1XEXA 1ESNA 1AK2A 2BEKA 2ZS8A 3EARA 4PHFA 4FCVA 3I5XA 2D3WA 3H84A 2VF8A 5K8LA 1NLFA 3A1TA 2AN9A 4M9SA 2Z0MA 1DBSA 1FTNA 1IHUA 3KQNA 1Z6XA 2O8CB 1E32A 4QJ3A 2WWHA 2V1XA 1QHXA 2ZRMA 2WWGA 4IOJA 1E9CA 4Q4JB 1YZNA 1L8QA 3FKSD 4J0QA 3ICQB 4JLPA 4DDUA 1ZUHA 3QXCA 2J0UB 1S3GA 1HA3A 3IHWA 4AI6A 4ABYA 2BBTA 2OAP1 1RRGA 4LJ9A 2FA9A 1LTQA 1S2MA 2JASA 4AYTA 3CM0A 1AS3A 3T35A 2R6CA 3OEEA 1S9DA 2C78A 3KKNA 4B48A 3GJ7A 3TAUA 5HPYB 4RKEA 2ZRAA 1KI3A 1LV7A 4WVFA 3EZ2A 1F48A 3RC3A 2ZRFA 2IBMA 4BASA 5CM9C 4LJAA 3U61B 4B35A 4EPTA 1XEWY 2IA5A 2RAPA 1PLKA 1OYWA 1TQDA 1E1QA 1HT1E 2V55B 1FX0A 2O8FB 4XSGA 5JJLA 5J4LA 2GESA 2DFTA 2A2ZA 4TQAA 4HB3A 4ZDWA 5FBRB 1G7SA 3OAAA 1JBKA 1VTKA 3FTQA 2XJ9A 3SFZA 2HF8A 3Q3JB 1ZD8A 2WTUA 2EWWA 2EYUA 4UKDA 3THYA 4FCTA 2YWEA 2JLVA 2QTVB 2RGDA 2ZPTX 3U5ZB 2WSSD 3F8TA 5FOSA 3KQUA 4OQXA 2VP4A 5AJXA 4IJMA 1E9EA 4L16A 4TTRA 4M1YA 1ZD9A 2XNDA 1NVXQ 4DKXA 2P67A 5K8TA 2ZETA 2O8EB 4BZPA 3M6AA 3LQRA 3LWNA 3PUYA 621PA 2GJ8A 4TMKA 2GJ9A 4I1OA 3NDPA 3NBYC 2ZI5A 1T5LA 3I73A 4MRNA 1JPNA 1KHTA 3PXGA 4GP6A 5FOUA 4EJSC 5BN4A 1W36C 1Z0JA 2IXFA 4JSTA 2OUKA 1I4TD 3ZQ6A 1SVLA 1J8YF 2VQSA 1MR3F 4JJKA 1NN3A 5JSZB 3EXAA 3ADDA 2VHTA 1JI0A 4Q9IA 4ILEA 3WBJA 5CK5A 4PHTA 3C8UA 4IW3B 2IEYA 3U7EB 2IS4A 3AM1A 1VCNA 1EX6A 3OIYA 1MO3A 3FMIA 2WOOA 4P4SA 4BWYA 2NZJA 3MG9A 4V0OA 1H8ED 2CL7X 4Q18A 1NN5A 4Q4HB 2ZJZA 3EPKA 1BOFA 2ECKA 4QBHA 3BOSA 5FTKA 5FTNA 1SULA 2QE7D 4IDHA 3SYLA 4ARZA 4NBSA 3DEFA 5EXSA 1N25A 2ZJ5A 2WJJA 1DPFA 1XD2B 2YJTD 4M9XA 4PC6A 5EZ6B 4NYJQ 2BOVA 3KKMA 2O0KA 2IYRA 1CJMA 2H5EA 2DB3A 4OHZA 1P72A 2CCKA 2R44A 4MKIA 1R0YA 5FBQB 2OT3B 1Q1ZA 3I3SR 4B74A 1JR3E 1ZYUA 4EQ6A 3U44B 3WHKA 1E0KA 2EU8A 3AUYA 4JYBA 4QGFA 4QJ4A 1Z0DA 3RS5A 1TAGA 2AKYA 2FE4A 1QHNA 4URZR 2ZRLA 2EWVA 1IOZA 1HEIA 2HEIA 2YINC 1LF0A 5L3QA 2BCGY 3KZ1E 1ZM3A 1C4OA 3MGCA 2H1LA 3QEOA 2DHRA 4NE2A 2HCJB 4MUBA 1KI6A 4JS0A 4KSBA 4RD3A 1M8PA 3ECCA 2AD1A 3G5UA 4Q4AA 4F91B 1IXSB 2CNWD 1R0ZA 1RW4A 2FZ4A 2DWPA 3QNUA 4Q1CA 1J99A 1YZGA 3N2EA 5KHOC 1PVOA 2ZRGA 4QHTA 1FW6A 5GJVC 4Q00A 2PT7A 3X1XA 3NTUA 1CXZA 5F9FA 4V0ME 1P73A 3ZVLA 3ZZTA 3NKVA 1N6HA 2IF2A 4DSOA 3SBDA 5JJKA 1NI3A 4LHVA 1F5NA 1LB1B 4RCYA 4LPKA 3U3KA 5CDFE 3CX7A 2QU8A 4JMPA 3VU9B 4F7WA 4UNRA 1E2QA 2F6RA 1E4YA 1KSFX 2OCYC 1Q3TA 2GZDA 2ZANA 1DAEA 4BLSA 1EFRD 4Q5IA 3ZJYA 5A0FA 1JNYA 3MWJA 4G0NA 4PPGA 1UBEA 1U9IA 1ZIOA 3IKJA 4DSUA 1QBKC 2JJ1D 4RD0A 1HE1C 1DAMA 2AXPA 3G82C 1XEFA 2QBYB 1T0HB 3BK7A 3QI2A 4C9BA 1UKEA 3L43A 1CR4A 1GNQA 2GHIA 2VP2A 4ZCMA 2GCNA 3QG5A 4IRUB 5B64A 2ORIA 2RGNC 3AP1A 1J8MF 1YQTA 3I72A 3QKRB 4HI0E 1G8HA 3QG1A 4LHWA 1G64A 4WA7A 4HDCA 1DAIA 4IDNA 3DO6A 3KJEA 1OIXA 3UKDA 4QC2A 5SZKB 3HPQA 3QF7A 3W6PA 4TMVA 4G5QA 4LJ7A 3AKEA 2ZYUX 4ZIRA 1H8HA 4OYHA 4WZ6A 3KL4A 1XXHA 4LZZA 1AKYA 4PANA 2J3EA 4B2LA 1FL9A 1DO2A 1HQYE 2F43B 3K9LA 3LX8A 4MGKR 5EP2A 2EVWX 2BM1A 1KSHA 3AVYA 4BQSA 4CRWB 1CR2A 3EIEA 2CLSA 4MUAA 2E1RA 3SR0A 4BE7B 3VNUA 4IDPA 4QBGB 4DIDA 5DLQC 4C0BA 3GJ0A 1WE2A 3GQBA 3QXHA 4DLRA 4X8HA 3R7WB 4M2LA 5KDDA 1N2CE 5JWHA 4Z54A 4D2IA 2BWJA 2HLDA 2GF9A 2WV9A 3K0FB 3T61A 4O3MA 1XWIA 3MCAA 5AJZA 5EE9A 4EPXA 3CNLA 2Q9AA 1QDEA 4QOSA 5CB6A 5C18A 2XOKA 4KYIB 1E0SA 2GAOA 2ZRPA 5CITA 4TT3A 4R7ZA 4I1SA 1CJVC 4HLDA 4O2LA 1J90A 3D6TB 2AX4A 1XCMA 3LY5A 4OHWA 4AK9A 3TGPA 3BERA 2QP9X 4QNRA 4A9AA 2XB4A 4OI4A 5JECA 1JR3D 4ASUD 1P2UA 2CXXA 3QPUA 3T1QA 2FPLA 1F2UB 2QROA 3X2SA 3Q8XB 1Z22A 4Q9LA 1TUEA 4QXAA 2KBEA 2PEZA 1YR8A 1R5NA 4P31A 1SHZA 3FVQA 2C9OA 3TQFA 3FFAA 4HUQB 2FF7A 2IUTA 4U5XA 1RC8A 3KQLA 1FTSA 1GAJA 1G3MA 5HKKD 1JEEA 3T5DA 1BO6A 1VIYA 3GJ5A 2OBLA 3WMGA 5HE9A 5SZJA 3TVDA 1GKUB 1V43A 4IVRA 4JT4A 3HJNA 4ZDKA 1NIPA 3C7KA 4C0SA 3U3OA 1XPRA 1OHHD 1GUAA 1HUQA 3ASYA 4B3XA 4MKFA 3K0EA 4O2RA 1G9XA 1MABB 1OXUA 3ASZA 3DDCA 2HJVA 3WHLA 3CKLA 2XAUA 3VAAA 1UBCA 2DWOA 2A5YB 3RNLA 4DLYA 1II8B 2AWOA 1DTSA 2ZUBA 4M1OA 3UWKA 1IY2A 1YZLA 3VR2A 2SHKA 4FMCF 4JLOA 4L9SA 4XD7D 2VYFA 2R6FA 4Q02A 1R2QA 2OBNA 1GDDA 4Q7LA 1Q1EA 5F2EA 3Q7QA 3KKOA 4AC9A 1WXQA 1UBGA 2IYYA 5IHPA 4A92A 1W4BA 3QVVA 3A4LA 4IFBA 4O0MA 4XJXA 3QF4B 2J87A 1E69A 2W2TA 4HAUA 1OSNA 3TUZC 2RHDA 2IYSA 1NMZA 2QMHA 2QM7A 1F2TB 3KTAA 1ZM9A 2GBLA 1UFQA 1W2GA 2OG2A 3AF4A 2VEDA 2QPAA 1Z0AA 1OH6A 1A2BA 4Q4LA 1NY6A 4E22A 2EFEB 2IEZA 3KFXA 1YZTA 2EW1A 3GEIA 4WZAE 1WCV1 3PJRA 4RY2A 3CRQA 4LJ4A 4HUTA 5EXXA 4AKHA 2R6DA 2GAAA 1SKQA 2YWFA 4QJ5A 5IRCD 5JS8A 4K8OA 1SKYE 2FG5A 3QQ5A 4C3ZA 5LB4A 1RVDA 2JA1A 2B7BA 3LXXA 1G20E 2NZ8A 4HLCA 2G9NA 3RS2A 3T1TA 3QE0A 4YQFA 1P5ZB 4G5SA 1GIAA 1JPJA 2ORWA 2A30A 3CF0A 3FPAA 4A15A 4RZ2A 3UG6A 4L15A 3GLGA 4V0NA 2C98A 3TW8B 1W4RA 3IBYA 3NXSA 3ZD7A 1U99A 4KV9A 2LKCA 4LI0A 1S1MA 2QM8A 5JS7A 5GVRA 4B3BA 1KY2A 2JGNA 1CKEA 4CVNA 1JAHA 2GKSA 4OHYA 5AJYA 3AV0B 5KSOA 4P4UA 1NY5A 1P4SA 3WXMA 1GNRA 4FN5A 3OIUA 1W4AA 5DYIA 4M1SA 4G01B 3MMPA 1DG3A 1W4CA 1EG7A 1H8EA 1XCGB 1HQCA 2G6BA 1Q3HA 2OFOA 4KU4A 4G5OA 1Q1BA 1D2EA 1ZD1A 4O25A 4Q7KA 1S4QA 5B58C 2V1UA 1CJTC 1YJ5A 2QE7A 3B1VA 5FTJA 2FFQA 3LBHA 2WHXA 1VCOA 3AGPA 1B0UA 1D9XA 5DO9A 1OT3A 2EFGA 3PUWA 4R2IA 4I1VA 1ZINA 1ZU4A 2V6IA 4KJZA 4IVQA 2W6JA 3VQTA 2PZEA 2ZRBA 4AYXA 3SOPA 1Z28A 2GJSA 3Q7PA 3P20A 3ONWA 2EFDB 1TPZA 2FFBA 2FSIA 4PO8A 4M53A 4IOMA 3MFYA 3LFUA 3NBZC 2W6IA 3THXB 3B6EA 5DYGA 1RPZA 1HY3A 1T3HA 3FKQA 5JWRA 1KGDA 1SVKA 4HAYA 2OESA 3CPEA 4US0R 4BLPA 4D6PA 3CF2A 1PLJA 4FXPA 1E96A 3RVBA 2CLCX 1LF5A 1R0WA 3FGNA 1OPXA 2YWGA 4M9ZA 1N6LA 1KIMA 1P2TA 5DI3B 3TVTA 2J0SA 4QM6A 3K9HA 1E2KA 2QG6A 4GT1A 2ZRDA 3QJYA 2FU5C 3P4YA 4RVCA 4UXIA 3FMOB 2G77B 2PX0A 4GSYA 2ZUCA 3BORA 4RKFA 2PMDA 2QAJA 1SXJC 3Q5EA 2IF0A 3OEHD 3E70C 3MUFA 4D0LB 3DL0A 2BMJA 2VP5A 5FR1A 3KQHA 3TUIC 5FTLA 1IY1A 1Z5ZA 3NIBA 2REOA 4BZQA 4HZIA 3CLVA 2BIFA 1WMSA 3RHFA 1NP6A 4PSKA 2QI9C 2WJVA 4CT4B 3W6OA 1OFTA 1NSTA 5EXTA 1ZRHA 2QENA 2FOLA 3B9QA 2KJQA 1EFRA 2DFLA 4V03A 1HE8B 3EZ7A 4XSHA 4TQ9A 1RIFA 3PEVA 1WB9A 1GFIA 2JJ1A 3QIAA 4LHXA 1T0JB 2GF0A 1A2KC 4JLNA 1D8TA 4DLVA 1CLUA 2FSGA 5E7MA 4M1KA 2O8BB 1N5IA 4G1UC 3THWB 1R5OA 2XJ4A 3ZDQA 4KCGA 3RC8A 1DO0A 4IXMA 4LHYA 5HTKA 3SDZA 5CYPA 4PR0A 5F3WB 3RWOA 1TEVA 4E09A 4TN1A 5KTYA 5D3MA 4F4CA 1GZSA 1YE8A 3HYRA 2O8CA 2J59A 2XTNA 3U7FB 1ONBA 1Q20A 4G5GA 1VYVA 3VHXA 3U3JA 4AKEA 4NH0A 3GJ6A 3BH6A 2J0UA 4TYYA 3ZGXA 4MDFA 1R7RA 1G41A 4KXFB 4UNSA 3B5JA 1VG0B 3IQXA 4HB4A 2REBA 5KDOA 2IXEA 2NO6A 3WNDA 4JVLA 2VP6A 1NVWQ 3CBQA 2X2FA 4GOJA 3HU3A 3GJ3A 4EKDA 2W00A 4YMUA 1OJLA 4JVSB 4LX0A 1XJ0A 2NO1A 5DI9A 1T4GA 4GI7A 4OK6A 2YOFA 2A5DA 3BJIC 3I61A 1QHGA 2FEMA 5JLJA 3A4NA 3ND8A 5DN6D 4DLWA 4DLZA 2O8FA 1KJYA 2QMOA 3N70A 3H2YA 3L0PA 5JRJA 1RRCA 3VKHA 3X1WA 5JHGB 2J5XA 1XJQA 2FPMA 5CJPA 3WBKA 1XTQA 1TUIA 2DY1A 1P9WA 1R5BA 4EPVA 1NN0A 2DFKB 4IOKA 4A8JB 4AWXA 2VL7A 2ZRHA 2FSFA 4UNQA 4DBLC 3ZD6A 1D2NA 5IK2A 1EWQA 1Z3IX 1NN1A 3TSOA 2ZM5A 4YLGA 1X86B 2W83A 3DOFA 1P6XA 4Q1AA 5FUXA 4P3YA 2O8EA 1JR3A 2RB4A 4ASUA 2IWHA 1KAOA 3OFND 3UMSA 3BFVA 4TYWA 2ZSDA 3AB3A 2QA5A 3EW9A 4FWTA 2ZXUA 1CS4C 4MKGA 4DRZA 2JLRA 3K0CC 4BFWA 3FHOA 4AKGA 1AGRA 3EZ9A 5JSZA 2OXRA 2Q9BA 1ESMA 1P75A 4D80A 2QAGC 2O0HA 2GTPA 3C4JA 1UKYA 4A8JC 3EPLA 2ZAOA 3FE2A 1KK2A 1G3RA 1ZCAA 2FFHA 2J1LA 3W3ZB 5FPKA 3GLIE 4C4PA 4V0MA 4CT5A 5FPTA 3UG7A 1IM2A 4PPFA 1T8TA 1PLLA 1ZNYA 2RMKA 4LGMA 1N0WA 4H1UA 4Q4HA 1KK1A 3DKVA 3M1IA 4BRWA 1G5RA 3MJRA 4DWJA 4TMWA 4WBSA 3SC3A 2OCPA 1U81A 3CNOA 3LH5A 1DOAA 1XD2A 2FN4A 5KNBA 4IEIA 4LY6A 4GOXA 5DIFA 4X8LA 1FNNA 4Z51A 1SVSA 4AY2A 4F4JA 1VHLA 1W7AA 3REGA 4QHYA 1COWD 2QN6A 5LDDC 3B78A 4HDOB 4F93B 2OM2A 4PQRA 1G21E 4F4IA 4XTCS 2JLZA 1N6IA 3ZIAA 4HLUA 4YMSA 4RD6A 4QBIA 5AWFC 3TRFA 3GEHA 2IYLD 1E79A 1KDRA 5FL7D 2OO7A 4EJSB 1W36B 4ZKEA 4D82A 1DAHA 4DC9A 3CIOA 2IS6A 1GILA 5BN5A 5TY0A 3Q5DA 2F3RA 4KLNA 1G3IA 1JXMA 4LDJA 1Z0FA 4UQOA 2FPKA 2VBCA 3CB4A 3SZRA 4RZ3A 5GVSA 2Q0HA 2PLRA 2FEOA 1K5GA 4YONB 2DWQA 5C2JB 3WP1B 1GL6A 2QQEA 2GETA 2HDNB 1EX7A 3ETLA 1Z6YA 1I4LD 2H17A 2MSCB 3LBNA 3LV8A 1E94E 4JSYA 5HCIA 4XWOA 5AJVB 1FFHA 1P9RA 6Q21A 1MH1A 4XWAA 3I5YA 1UAAA 3KQKA 2QP4A 4JBYA 3VU9A 1QRAA 2F3TA 3A1WA 2WVJA 4U00A 4DEXA 4ERNA 3AVXA 1DAGA 1KI4A 4RCZA 2J7PD 1ZNXA 2PH1A 4TTQA 4XTRA 2QRZA 4E07A 1KSJA 5UKDA 1E1RD 4LCBA 4R9UC 2WWXA 1KJWA 1KI8A 4FMDF 1K6MA 5CLQA 2J0VA 2J46A 2O5VA 5HCNA 4AIIA 1KI7A 2ZQ5A 2QBYA 4KFTA 1R8QA 1N6NA 1E9AA 3SS8A 3O8CA 3H1TA 4IDOA 4K81B 2QGNA 2MSDB 3AEZA 2KWIA 3T1VA 2YYZA 1G3QA 2ZAMA 4LHZA 4MGYR 3QKRA 1JB1A 2HXYA 3P1JA 3LDAA 4DUGD 2RCNA 2Z5FA 3K09A 4URYR 4ZCLA 4LBWA 4OBEA 2VHQA 4KYUA 2E9SA 4YC7A 4LV6A 4FMBB 4OQMA 2XSZD 2C95A 2NO7A 4MH0R 2LKDA 2PLFA 2NOAA 1YZQA 1E99A 3U6BA 2VSOA 1CF4A 2ZSEA 1XF9A 3B1WA 1E2IA 3O8BA 4LYHA 3E2IA 5G41A 5EE3A 2CMKA 3KDSE 1NJGA 2ZI4A 4CGZA 3CNNA 1D5CA 2F43A 1VCIA 2WKQA 1ZU5A 2NPIA 5FOVA 3BH7A 3IQWA 1OF1A 5TARA 4BLOA 1XTSA 821PA 1Y3AA 1XEXB 2IYTA 1YR7A 3HPRA 2Q3HA 2ZTSA 4OJKA 4URXR 3FB4A 2CK3A 2WWIA 1UEIA 4KVGA 2PCLA 2GRJA 2QL6A 1W0JA 3KUDA 3E5HA 2ZS9A 2W58A 5C4GB 4R71A 4XVUA 1P2SA 4GRAA 1TU3A 2WKRA 3MAAC 1W5SA 4KFUA 3DM5A 3WMEA 3K0FA 5EQTA 5L3RA 3V4RA 4GFDA 3ZH9B 1W49A 2IX3A 1Z47A 3EG5A 2ZI6A 5JMTA 2G1KA 4PPNA 3CR7A 5FPHA 5E4FA 2A3RA 3SN6A 2WKPA 4DB4A 1KY3A 1C9KA 2RHMA 3K0AB 3WYAA 3Q72A 2ZJBA 3C5HA 3AH8A 4URWR 2B21A 2IC5A 3LBIA 3P32A 4B6FA 3I8SA 1CRQA 2CVFA 4Q1BA 2W0SA 2XTZA 1SVIA 1XD9A 3SYKA 3U7HB 4NYMR 5EUMA 5FPSA 5E7JA 5KYKA 3T06B 4X8MA 3A6PC 2ODBA 4M4SA 4DDWA 5E3HA 3PR1A 4U02A 1KYIA 4NCIA 4KVAA 2FJUA 1Z0KA 2CJWA 3W5IA 4OL0A 3THYB 3OE7D 5BQ5A 1J70A 3IGFA 3TR5A 3VKGA 2CE2X 3NEJA 5K8IA 1WA5A 2Z4RA 3GJXC 1E2LA 1XP8A 5GJCA 1IN6A 4JLMA 3VMFA 4YMWA 4P4TA 2JJ2A 3BWDD 3D7MA 4D81A 4RSGA 3EASA 5BXQC 3UPUA 3LA6A 1UKVY 1II8A 2B8WA 2BKEA 2C99A 1AQYA 4FI3C 4CW7A 1E9BA 4AD8A 1R10A 1XRJA 1E4VA 2CL0X 2BMFA 4B71A 1X1RA 5HZKA 1ZAKA 1UF9A 1IN5A 4HZUB 1MT0A 5FR2A 2V3CC 5TB5A 2A5JA 1TEXA 1XFAA 3BB1A 2R62A 4OQNA 5DN6A 5EE1A 4W5JA 2IWRA 1XZPA 1ZP6A 3QF4A 5DNYB 3Q9LA 2JIZD 2A5GA 3LAWA 2WOJA 2EYQA 3CZPA 4XVQA 1CTQA 5FL3A 2OLKA 1F2TA 4C7OB 1XJCA 3DPUA 3MWKA 3WYGA 4M1WA 3GJ4A 4HAWA 2IUSA 1M2OB 3BFXA 4GNKA 1Q1QA 2ZJOA 1FQJA 1AS2A 1NIJA 4TSFA 3FDIA 3N5CA 4DDVA 1A4RA 3QKTA 1XX6A 2F1RA 3B7GA 4KBGA 2N42A 1W36D 1NKSA 2JDID 1A5TA 1RRPA 1WQ1R 2FZLA 1VPLA 1N6OA 4B44A 1NG1A 1T8UA 4Z1MA 1NKTA 1E3MA 4HAXA 5AJWA 1W44A 4C0LA 2VRWA 1I2MA 3QXSA 4A1FA 1IQPA 3A1SA 2OSBA 3PITA 3QKSB 4QBFA 1NVVR 4XIGS 3U4QA 4NKRA 1VDZA 5CK4A 1ZM2A 1G7RA 2D74A 5FOTA 4NCJA 4LV5B 1RJ9A 2V7QA 4WAUA 8OHMA 1L4YA 4QFMA 5C1BA 1QG2A 1JJ7A 2ZRJA 3HDTA 2NGRA 1S8FA 3I92A 1RKBA 4JL8A 2OFWA 1P62B 2F1IA 1GKIA 2BHRA 1UDWA 4JVNA 5A4JA 5HR5A 4AYWA 1TNDA 4IOLA 1GL7A 2WBLC 1OKKD 4PC3A 4NMMA 3H86A 2OFXA 1KI6B 1N0UA 1R0XA 2BV3A 4JJZA 1DAFA 4UNPA 4N0EA 3N2IA 2YC2C 3HU2A 2QRNA 2VH5R 2ZUDA 4URVR 1X8KA 3ADBA 3CH5A 3SYNA 1AS0A 5LB2A 5TXGA 4FD2A 1NSFA 2XX3A 5CIWA 5EP4A 4YXWD 3FKSA 1N3BA 1N5JA 4Q19A 5JCZA 4E5UA 5JHHB 2GILA 3KX2A 4II7A 4TZ0A 1OXTA 3ZLJA 4TYQA 1GVNB 1Q44A 1NLYA 2YWHA 2ODNA 1E2GA 2G3YA 4A2QA 4L9WA 1COWA 1Q22A 1XNJA 1FP6A 1MO6A 3U3RA 1Q21A 2LCFA 2VF7A 3BXZA 5KNDA 2BVNA 1IJFA 3W8RA 1M7HA 1KKMA 1OXSC 1ZIPA 1OXVA 3L0SA 4KO8A 2ZJ2A 3IILA 4NTZA 3CZQA 5FL7A 2CHVA 3R9XA 1IN7A 2IHYA 1E6CA 1D9ZA 2W0MA 3TQCA 1GKYA 1GOTA 2ONKA 3PVSA 4QGHA 4NZYA 1YZKA 4A0FA 2DCUA 3VTKA 4XVRA 3FWYA 3K53A 2AWNA 1KZ7B 2EFCB 1RE0A 3OZXA 2ZJYA 1LW7A 4QKQA 4DDTA 3KKPA 2WSSA 1FUKA 4HATA 2X2EA 2IYUA 3CPHA 2AK2A 1KI1A 3WY9A 2IT1A 3HP1A 4PC2A 2D7CA 2WICA 3UATA 3EPJA 3GLHB 1NJFA 3VR5A 3DVLA 3K8YA 1K8RA 1XCPA 1LY1A 1CIPA 4RJLA 1P7CA 5FTMA 1MRNA 1PUIA 1U9IC 2HF9A 1L2TA 3OEED 1GWNA 4BGDA 4WZBE 5KNCA 2HYIC 2J7PA 4G5RA 1E2HA 1E1RA 2GA8A 1JALA 2ZS7A 1GTVA 4RD4A 2GZAA 3BS4A 5L3SA 3UIEA 2IYQA 4KHZA 2C04A 1FOEB 4LUCA 3QPVA 3O8RA 3PV0A 1ANKA 4D0NA 2WMNB 4JYCA 3TKLA 3DZ8A 1E1QD 3KJIA 3W9YA 3EX7C 4D26A 2R6GA 1OFHA 3KB1A 3JVVA 2O8BA 1Z08A 3THWA 1F6BA 2YV5A 3TIFA 4CEIB 4Q48A 1O3YA 2MSEB 1P61B 3L8YA 3CPJB 3OAAD 2JAQA 2QT0A 4RFSB 4EAQA 1XZQA 4PSAA 1M7BA 5C46F 3K0SA 1XEWX 1WP9A 1KO8A 5LPNA 2ZYVX 5IF9A 2D2FA 1KDOA 1NL3A 2ZR7A 5FPYA 1OFIA 1FMJA 4BFYA 2XNDD 2I1QA 2XXAB 2K5UA 4TLEA 1E0AA 3WNCA 1LS1A 1YR9A 2QT1A 4GBMA 1NNEA 4NYJR 2E87A 1M1YE 1DVRA 3KXIA 1Q57A 4L5BA 4D25A 1EFTA 2ONJA 1TQ6A 2FH5B 2OAQ1 4DCVA 1KO4A 1SXJB 4DIEA 5DHAA 4TL9A 1RRFA 5IT5A 4PXAA 4W5HA 3QENA 1G7CA 4JL6A 5G3YA 3SJZA 2AXNA 2Z6VA 4HAZA 2VHUA 3GLHE 4KBFA 3ZZ0A 4BFSA 2UVQA 1IAQA 3GLIA 1GSIA 4UNNA 1X6VA 4QG7A 1U90A 3C5CA 4TZ6A 2WIBA 1U0LA 2O8DA 4Q66C 4IVPA 4JKIA 3FHCB 2QSZA 2GJKA 3O8DA 4OHVA 3FOZA 4TL6A 3SJAA 1W47A 3RSLA 2GCOA 4XOIA 2XEXA 1T5IA 3WYFA 4A0HA 1JAIA 2EQBA 3M0EA 4MKHA 1AA9A 4M0LA 1BS1A 1LVGA 5AUQA 1GM5A 2ZEJA 4MRRA 1E98A 2C03A 2QMUA 1TU4A 3VFDA 3P4XA 1X8JA 1XMJA 2V4ZA 3EIHA 3FHTA 1I2DA 4TLDA 4L4UA 2MMGA 1VMAA 1KI2A 2IS2A 2QTFA 3KUCA 2CNWA 2P5SA 3D31A 2IYVA 3HR8A 2CCGA 4LSGA 1IBRA 2B7CA 3AVWA 2H57A 3VR6A 1KKLA 3O47A 3ZZUA 2NO9A 4BZXA 4BFVA 3AVVA 3DMNA 1SVOA 2D2EA 2OILA 1YU9A 3RLFA 4GP7A 4URUR 1ZMXA 1IJEA 4YMVA 2JLXA 4ZPXA 5TV2A 2RGEA 4DCUA 3SHFA 4NYIQ 5BN3A 3D8BA 5KOYA 3KTAB 3PUVA 2YZ2A 1G7TA 4LPSA 4MITA 3OIWA 5KO2A 2KB0A 1WRBA 2R8RA 1SXJE 3UMFA 1QZXA 4GZLA 1QHYA 1CR1A 4I99A 3CH4B 3C41J 4PO1A 4PTLA 2DBYA 2QEQA 4RZUA 3B1YA 3SNHA 3OIVA 1G16A 2ORVA 4NP6A 1NMXA 2CHQA 3CONA 3GLFB 4TYPA 2BMDA 3V00A 4Q21A 2ZE5A 5FH9A 1JQLB 1XDBA 5G53C 4B32A 4OQLA 5TMPA 1AZSC 1DS6A 3EAQA 1EFHA 2XZPA 5CLLA 2P6UA 2OEPA 5EE5B 2BM0A 2PL3A 2UZIR 2KSQA 4Q4JA 4F38A 5DE3A 4FW9A 1EWRA 1MO4A 1PV4A 1SZPA 4AURA 3GLGB 1W46A 2ZYTX 2GCPA 3TLXA 1IXZA 2GBLC 4H1VA 5LD2C 2JIZA 1E9DA 1C1YA 1RZ3A 3RS7A 4JVMA 3VNVA 1KMQA 2HYDA 1OIVA 4CEHB 1VKJA 1E9RA 2ZRIA 1Z2CA 5FFMA 4PZYA 1NG9A 4NONA 2IW3A 2IUUA 1S0UA 5H70A 2A9KA 2OCBA 3PG5A 1F3OA 3MD0A 4MGIR 4UJ5A 2XB2A 3F0TA 3IDQA 2VP9A 1Z06A 4M1MA 3W5JA 3IIMA 2V6JA 2IYWA 2PBRA 4CEJB 1UPTA 4B3FX 4EJSA 3I1FA 3NH6A 4EPRA 2WJHA 2DPXA 1CULC 3IO5A 5IDVA 3TAHA 1G18A 2PJRA 4NHOA 4FCWA 4DEYA 3BC1A 1NRJB 3NC0C 5DH9A 2G0TA
chains in the Genus database with same CATH superfamily
3MQ4A 1E1KA 2G83A 4Q12A 1UBHS 2RIPA 3NG1A 2EV9A 2I1VB 1RQGA 1I33A 4FBLA 3PNQA 2CKDA 2BFCB 4G9EA 4NR0A 1F8XA 4PYLA 3RU9A 4JI7B 1V3UA 4PSVA 1EDBA 1SUSA 3WSTA 1IWPB 2VDLB 3GLFE 1PW5A 4NPHA 2P0YA 3K94A 4JP3A 5IF3A 4MDEA 4C0AC 1CRWG 3CXUA 4LY3A 4EG1A 4F4HA 2R00A 3QU4A 4CL0A 5LBIA 3HK2A 3UMRA 2B92A 4G1BA 1N5LA 2VPPA 2V6GA 4OXXA 3QV2A 4G4JA 1GA6A 3VPCA 4B45A 2GCIA 2PGJA 3NV7A 3OKAA 3DO5A 1R18A 2GK7A 3BJMA 5YASA 2RKWA 2XUIA 4WFJA 4CDNA 4HDRB 2JCSA 2OD7A 3KQTA 5FI0B 4BAGA 5GADl 1QHHB 5KUTA 2G7MC 4A03A 2BFEB 1IY9A 1Y1RA 3FJOA 2I7XA 3T7RA 5AW0A 1BKDR 2GWHA 5JBIA 3JASB 4WGFA 1USVA 1V8OA 1G3UA 3OTIA 5H68A 5JY6A 2D1SA 4KSYA 5CDGA 3UT6A 1MIOB 4KE8A 3FRHA 2VP3A 4AS3A 3L46A 4B34A 2ZWOA 3OZBA 2CB9A 2X0EA 1QYWA 2XZLA 3HSYA 3NI2A 4N01A 1OHHA 5ELMA 1U8YA 2TS1A 1D6SA 3PQ8A 2OD2A 2QV7A 4WK4B 5AI4A 5BSRA 4A6EA 5J43A 4TN5A 2XD4A 3V2IA 1LTHR 3VU8A 4ETIA 2A4MA 4MS4A 4IHKA 2Q2NA 2WIKA 2A0XA 1XTRA 4QPPA 3BFJA 2INGX 4F2WA 2HHLA 4J7XA 4N5IX 3GVHA 3T1HB 1ZJ4A 1DX4A 3GHHA 2R1VA 2PANA 3MT9A 4DNFA 4BWGA 4ZK6A 4CETA 5A62A 1Z63A 3B36A 3KJHA 4BRUA 2CCJA 2JLQA 3ZJVA 4XSVA 3G9TA 2P1ZA 5A02A 4QSHA 1KBZA 1P0CA 1R4MB 3JQAA 4X62B 2OWDA 3QELA 3SIXA 1CVIA 4R8RA 3UHPA 2PUCA 3I9V6 3UV3A 1PQ4A 2ZRNA 3BJRA 3EWSA 4CM4B 2FKAA 4CNBA 3GN2A 4LWZA 4C0XA 2G9UA 5HJEA 4Y1RB 4Q1FA 4ZAFA 1KL7A 1RXEA 4ZREA 1WUJS 5I8PA 3GLGA 4GEGA 4BNDB 4Q05A 4UBLA 2GZHA 2X0DA 4JU8A 1B8VA 1BW9A 2A1UA 2Y1CA 5EJ5A 1FTQA 4NU5A 3FYSA 1R1DA 3T5MA 2X3FA 4YR7A 1VE9A 1PDWA 3ESAA 4RZHA 1YDGA 2EBHX 5KNCH 2N1BA 1L1FA 1GYQA 1C7JA 2VQFB 1K7FB 3H5LA 3DS8A 4TTSA 3NRCA 2VWPA 3FSRA 4TQGA 3BSSA 3L1HA 3VHXB 1XP5A 3EE6A 1BZYA 3KCQA 3TMAA 4DYVA 1YF3A 3G9XA 1QF7A 2XECA 3AVQA 1FMLA 3DDWA 1GAQA 3HCFA 4ZU3A 4CLDA 3WLJA 3TG2A 2F9LA 3WQSB 2VQEB 1SOMA 1QIEA 3F5SA 1FNMA 4KI7A 1K4YA 2FWBA 1KU0A 2ZUWA 2QKYA 1M74A 3JVUA 3M4NA 1U94A 4EG8A 2JI6A 1OVMA 1HYHA 2A0UA 1VECA 4TXLA 4HVCA 5D7BA 4WNIA 1GITA 1PS9A 2ZLBA 3MGBA 5EJMA 4HTAA 3DW3X 3MJFA 1OD6A 2O3UA 2O7QA 4KR9A 3R09A 4V1CI 4XM1A 4A4DA 1G1MA 3GT4A 4MW7A 3CEJA 3N87A 4MCJA 4TTAA 1WUTA 4OJQA 3M33A 3QFCA 1AZTA 1JLSA 4CQLA 3KXKA 1FYFA 2E4VA 3AF2A 1U63A 2ASEA 1YJXA 4B17A 2PO5A 4MYRA 3OF3A 2B4KA 2GF2A 5DGDA 1PL7A 3E2PA 4QUGA 5G1OA 3J7TA 4MTCA 3OZGA 5BQFA 2CSUA 4TYNA 2XOXA 1VRWA 5ADUS 4B4WA 3ZYCA 2IGTA 2Z8YM 5CIQA 1MO5A 4RA6B 2ZTUA 2P41A 3JY6A 3ZHQA 3L8CA 4ZQIA 4JELA 4KN8A 3UC9A 1B16A 3RRYA 4XZ3A 2CHEA 2WAXA 4G4IA 4HQFA 3DE0X 4DN6A 4DV3B 4GI3A 3I0NA 2PKXA 4KN6A 4Y2RA 3KR1A 3AJ8A 4G1EB 4JQOA 1T9CA 4WTOA 2NZVG 5AVKA 2JHGA 3RG8A 4AJHA 4JR0A 1JAYA 2NU7B 3PDIA 1Q11A 3MYRA 5HFJA 4RK5A 1PO7A 4U6QA 5B3AA 4RDCA 4V0KA 1S96A 1YVEI 4L5IA 4IDFA 1EK0A 3RO7A 5K4AA 1TM7E 2GBGA 2Z08A 5EWMB 1C8VB 2OXIA 3ZCXA 1QZZA 4PW0A 1LRKA 1DC5A 3FN4A 5E7IA 4QNNA 3WS7A 3WLTA 5J2TB 1XO1A 2HLHA 1T8YA 3KUXA 4M83A 1H2EA 4R1TA 3DPSA 3NPMA 4IHQA 5JD5A 3T3NA 5KSZA 4IQ0A 4P8RA 2CXTA 4KITB 4RPIA 4M9QA 2ZJAA 3UJPA 5AHOA 2V7PA 3QY0A 5LQCA 4BB5A 3CX4A 221PA 4N82A 4BNJA 3F98A 4DV4B 2RDMA 4EF6A 4OP3A 1M2OA 4IXNA 2K6GA 1RBZA 3ZKAA 3SYTA 1NT4A 1FK8A 1K3UB 2CUKA 4CYMA 2HIHA 1L3IA 4EATA 2D7DA 5AVRA 2FAXA 5EPUA 3NASA 1XRSB 1TLLA 1ZJ5A 2VDQB 4GQIA 4HGQA 3HUTA 2C0PA 2VSFA 3HCPA 4P4LA 2QVCA 3EA0A 3OMXA 3OPYA 4ISCA 1C3JA 2GPYA 3L04A 5E95A 3R7WA 3PJDA 3SIWA 4HSGA 3RS0A 3MWDA 3ICVA 1OILA 4UU0A 4DNOA 2WFMA 4GYWA 3VA7A 1NF9A 1ONOA 1M76A 1ESCA 5J5CA 4EWLA 2PMWB 1G17A 3CN7A 1ILWA 1X7DA 3H17A 5ARCA 3W5AA 1IXRC 5DMHA 1NBOA 3B3AA 3EODA 1T3ZA 4M0DA 3CUWA 4UW9A 3SZ3A 5K3BA 3UMBA 4PZDA 3QKSA 2EFHB 1O8CA 1ZCZA 2JLWA 5K6AA 2X8BA 1T4MA 2WYWA 3M6LA 2JI8A 2P1DA 4GR4A 4DJEC 2GJ4A 1KQOA 1UC5B 5ALUA 3CLTC 1BHJA 3CO5A 4BB0A 1BCRA 3USZA 4B73A 2FMXA 1O0BA 1CEQA 3I64A 2P6RA 3FNBA 3QLUC 5DHTA 4MR8A 2GAFA 5SY9A 4LZJA 1GJRA 5A3SA 1PNQA 3G7SA 5EHNA 4LISA 4MR7A 1DARA 3JX9A 4FSXA 3UYKA 3PRHA 2H6EA 3A25A 3K70D 2DHDA 1U2TA 4HEA1 5HF5A 2QNIA 5C52B 2XKJE 1NBME 1MIHA 1K5DA 2EKDA 2I3GA 1NM5A 1CJUC 2R5FA 2RI0A 3HFSA 4HUQA 2SKDA 2A5FA 1U98A 4JWTA 4A36A 4K88A 1N2GA 1P77A 1IBCA 3F4LA 4BMYA 3U2QA 5CA1F 1KYZA 1X7WB 4Z8XA 6NULA 3VZBA 3KWLA 4KE7A 4YCCA 5JMWA 4D8XA 2C9BA 2J67A 2Q3MA 2W2XA 1X1SA 3CUYA 1C41A 1YGYA 4M1QA 3G49A 4TMYA 4LZWA 1LK0A 3KETA 2B1RA 1T3TA 3DE4X 1I7DA 5DWQA 4YQYA 2B2NA 1ENPA 1Z4KA 3CVJA 3C7TA 1ZFNA 3IEUA 4C4SA 4QRDA 3C4QA 4U2FA 5IXSA 5JNVA 2FUNB 4RLQA 3QUBA 1LJLA 4RBNA 4TLCA 4XWGA 1ZSYA 2J4DA 3ZQKA 2ZUFA 1Y9ZA 1GGMA 2I33A 3FPJA 3D6MA 5HE8A 521PA 3CO0S 4K9PA 3N75A 1Q14A 2P3SA 3X43A 1KAQA 1S7GA 5BSGA 5GGYA 3HBFA 4LK2A 3KSAC 3BAZA 4NQZA 1D7OA 4H17A 4TKVB 2JGJA 2A0WA 3ANTA 2RKOA 4X00A 4ND3A 5GJWC 1QIKA 1OPRA 3DDSA 2ZRKA 5AUPB 4DCJA 1Z0IA 2ZSFA 3TZLA 5HIKA 1J7KA 1MDBA 2F7SA 1RMTA 1I2ZA 1QVWA 1Z2DA 4JB2A 1Q0TA 3I5MA 1PG5A 4ZHSA 1JW9B 3J81k 4M1TA 1Q7GA 2VUUA 2Q6TA 4OEHA 4YCNA 4J2TA 3DV9A 3EMBA 2AB0A 2QP3A 3L92A 5FWDA 1O08A 2OA0A 5JNUA 5CYGA 1E0JA 1CUVA 4UATA 3IFSA 1RWNA 2X1VA 3NETA 5EERA 2V6MA 3WGMA 5BW6B 5K45A 5K8UA 3OT4A 1WDLA 2XBLA 1C4WA 2JGDA 1N4DA 3O84A 4DXAA 4Z9XA 1T6NA 5BXYA 1DFHA 3L7AA 2I91A 1K1EA 3NS7A 4DUZB 3D43A 1SFRA 4TSKA 4G36A 4D5GA 4LGYA 1QCDA 2Z43A 1T5OA 1Z8FA 2HA6A 3VDMA 3IODA 2XWBF 1JZSA 4MV1A 1A96A 1QE5A 2B6HA 1MHPA 3LX5A 1R4ZA 5SYMA 1G38A 3D3KA 3E8SA 2QL5A 2WPDD 2JEOA 2C82A 1RQNA 3UV6A 1VJ5A 4KPFC 3KQYA 5ITWA 3C3CA 1NFRA 5JFGA 3PYXA 3N8NA 4EYEA 1RLIA 1VLMA 1T3LA 1TQ2A 1O9GA 2HGSA 4MQFB 1QHSA 3DMRA 1KP2A 3OM1A 4H4EA 4NCKA 1R0LA 2G9ZA 1Q19A 2ZWIA 1BSVA 2KW5A 3GPCA 4WVFA 1G5IA 5M2QA 3ELDA 1L8XA 3DG9A 2IL1A 3EVDA 4RH3A 3T3PB 5BOSA 4CEIA 3PENA 1BS9A 3HKCA 4OJNA 5GM2A 3PDUA 5JJIA 4KQ2A 2Q41A 4CMHA 3GGSA 1U3VA 2B37A 2UUAB 1GCGA 1JQ5A 2ATXA 3HQ4O 4N5MA 5A7HA 5KVVA 3T34A 4KTVE 2VLBA 1S1CA 1ZR4A 2H16A 2JJQA 2CDNA 4L0CA 1M2KA 2Z95A 3OZFA 3WV5A 3Q98A 4Q4AB 3Q85A 4B6RA 1PUJA 3KHKA 1FFXA 1VL1A 3MWYW 5HVNA 3FDJA 4JB0A 2ZZNA 1PJRA 4U7PB 1L5KA 1NOKA 2JHCA 2PYIA 4ZICA 1II9A 1JJVA 4KDFA 2HADA 3C7DB 2OC4A 1B1CA 3LO5A 4JLJA 4MRVA 5TF4A 2PS0A 4DBZA 4EMBA 3MUNA 3P45A 3NOQA 2O14A 1CX9B 2P9HA 3FSGD 3SS9X 4F84A 1MV5A 3M6MD 1UH5A 4ZV7A 2YHSA 2V0CA 3SU8A 2NXJA 4ZTZB 2QDKA 4J0GA 1RJWA 1TZ2A 3WGOA 4CN9A 2GUWA 1JEJA 1PJAA 4QFDA 3QEKA 4BV8A 3HHEA 2GLUA 3K72B 1JIKA 3ER6A 1Q74A 1C1HA 1FDRA 2PIDA 1X80A 2EKQA 4FNAA 2XGMA 4IILA 4WZAB 2AEJA 1G6OA 3H9GA 1GPWB 4ALKA 1U1FA 4ZT7A 2JFZA 1E2EA 1G9SA 1OFUX 4LBYA 4QOFA 3ZJ4A 2VUSA 4QDUA 3KQSA 5I3ZA 4DDHA 2DLNA 3SWWA 4MYTA 3D5TA 3IV7A 3QY9A 4LS3A 4E5NA 3S4YA 1YA4A 1AF7A 4JD5A 2G04A 2OHFA 2VHCA 4IEEA 3V9AA 1O8BA 4OQFA 4XWKA 5CB8A 1U7DA 1AXGA 1ZW1A 4QO7A 3SBEA 5DI3A 1WQ3A 1WCYA 4KIJA 3BWYA 4YAWA 5E8JA 3JYNA 3MGAA 5B5SA 1G5PA 2X86A 3RFTA 2Q5JA 3WOHA 2VT7A 4PC7A 5DP1A 2IHNA 1AKWA 2IP4A 3JVDA 4QUDA 4A0GA 4CJXA 1DQRA 1XU4A 1ISRA 3ELBA 3KCNA 3GRAA 4RD1A 5BPHA 5I7VA 1UM8A 1GL3A 1JVNA 3D3QA 3JZMA 1ZOIA 2NMVA 1F0KA 4QE3A 2OKCA 4V2IA 2AZDA 4B47A 4KQ1A 3AOEA 1TECE 4PBTA 3IPRA 3FYCA 3LCJA 2AZMA 2DU8A 2V96A 5D3QA 4MYHA 4CL2A 3UK6A 3H5OA 3ILXA 1X7XB 3K30A 5FKJA 1Z56C 1ZA2A 4KFRA 5I7AA 1XXHB 3IAXA 3EFEA 3SX2A 1NZJA 2WR8A 1FDWA 5BW5A 2PXHA 3RANA 4YJGA 5BV1A 4RZIA 5FWXA 4TPKA 4ZVQA 3HMKA 2D2IA 2FMFA 1ACJA 5A04A 1RTKA 4B75A 1D6MA 1QH1A 4J3JA 3RQIA 4ANFA 4IGAA 4BQNA 4N4AA 4XGQA 3IT0A 3ANNA 3O75A 2XPCA 4BKQA 3BREA 4DJTA 3NYQA 4BO2A 2DLCX 2OV2A 3E22B 3A1EA 3ZIAD 1NJ2A 2XITA 1WBBA 3LUAA 5TQ2B 1X7GA 3KRTA 5DOZA 3A6HA 3N9IA 2AG1A 2Y66A 3ETNA 4B31A 1XEAA 5HIAA 1URPA 4U7JA 2EZ9A 4XGKA 2DUWA 1E1LA 1YA8A 1ZK0A 3A6KA 4EHIA 3ASUA 4BBZA 5FX2A 4EO7A 4LIPD 1RPJA 1VIAA 2WJZB 3ZE2B 5BMVA 3QWBA 1ZNZA 2BGNA 2XGOA 3H1BA 2C7QA 1OZHA 1J97A 4PQFA 1JHMA 1YOBA 5HZGA 1RNLA 2D0PB 2P0EA 1IQUA 1ID1A 3DNPA 3ET4A 4MP3A 2PCJA 1OA1A 4RGVA 3LLSA 3Q2OA 3LOQA 5E38A 2E21A 3TUJC 3NHMA 5EG5A 3PUXA 4LDZA 4JKYA 4BVHA 1OC4A 3K15A 1O0SA 1O54A 3HWWA 4HXFB 4PAGA 4TMXA 5F51A 3AP3A 4KACA 3T95A 2A1IA 4A8TA 4BTVA 2J7KA 1G4AE 3HA7A 4H7FA 2G0NA 5KU1A 2YZGA 1HYGA 3ZGZA 3EGXB 3UT0A 3VPAA 5AI8A 4IFEA 5A7FA 3EYAA 1QDUA 4YV2A 3HP7A 3T15A 2VXCA 4CEHA 3GFPA 1KOFA 4NECA 3MMXA 5F21A 1CFJA 4OY3A 4BC0A 5JAZA 1WW8A 1V1RB 3LGAA 2X15A 2NUTB 3B2QA 3QUCA 3CLSC 4BP9A 4WLUA 4KDCA 1OB5A 2WIFA 3EWNA 3O4HA 2FJPA 4W9MC 3LDUA 5H1YA 2YHUA 1JIXA 2I4OA 2VXBA 5ER6A 4O4LF 2NU6B 3M6FA 4BNVA 5EZYF 1V7QA 1N9GB 1CRLA 2YNMA 3C39A 4CQJA 1DADA 1XAIA 3R3JA 5ED0A 2FXIA 1RKVA 1L6RA 4INOA 2C2BA 2X5XA 4F04A 1KDZA 4PBSA 3K6JA 3KOWA 4OXIA 3WYDA 1GV1A 1UADA 2FPGB 4YJ2F 1NYTA 4ZYUA 2VAXA 4QT0A 4N1AA 1L8OA 3CRVA 3AF0A 3EZNA 1XF1A 4GPEA 3U7QA 1U3WA 1XRLA 3LIPA 3NT5A 4HB2A 3TKAA 3PFIA 1ORWA 5JSUA 1E9VA 2WIDA 2YV3A 5IVPA 1KXJA 5EXEA 3C2QA 2HIGA 3ZW7A 3MZ0A 3DQQA 3TR0A 4A8JA 3SNKA 4DA6A 2IZ6A 4LRWA 1H2YA 2GN1A 4DG9A 1YBFA 4EVSA 1DTEA 2X22A 3BGVA 3CZAA 4F7DA 1AX9A 1YVDA 1T3GA 3QOWA 1KNXA 4NFHA 4A23A 4DWWA 2F3UA 2RHTA 4WXEA 3WYCA 5LYJB 3LQYA 3EXFA 5FD8A 3LNCA 5AR1A 3ICEA 4RY0A 1ABEA 1YQQA 1M2VB 1YB1A 4DT1A 1KSGA 4F5DA 3LHIA 4LEIA 4OQDA 2VYVD 5P21A 3JQFA 4CG1A 3IKVA 3IUYA 3TJZA 5AVJA 3H4MA 3RVKA 4WERA 1DWOA 1P5FA 1Q92A 3P9NA 4J2OA 6LDHA 5EHGA 3KKKA 1RZRA 1IY0A 1QMGA 1V11B 5C4MA 1IWOA 2ZI3A 1WXEA 4CT0A 2AR7A 2EERA 2JATA 1LNZA 3ADCA 2MU1A 1CUXA 1MVNA 2FWJA 3NTOA 3B7PA 4NDZA 4QPCA 4W5RA 1W0JD 2AFIE 3MELA 3EDOA 3PNPA 3H18A 2H2AA 2ZVQX 5B30A 3PWSA 5CYOA 5AM0A 2CXUA 4AJJA 4AKIA 4NMHA 2J31A 5DGXA 3LTNC 1CU1A 3BK2A 1Y3BE 2I3DA 3GHYA 1SHUX 1QR6A 2WTAA 3ABQB 3G89A 4BUJA 5KTRA 1LBQA 2IBTA 1GUBA 2D4AA 1HDXA 1OB2A 3MLEA 1JKFA 1MOSA 5L53A 2W6NA 1Y37A 1B74A 1MCZA 3TXYA 1YZUA 2OOKA 3AGQA 2FPUA 1XB2A 3BF7A 4QVGA 2IV2X 1AO0A 4LYAA 3NORA 4ZO8A 2ECOA 4LRUA 3BCUA 4JL5A 2VSYA 5EKSA 1M2HA 3DKPA 4ESHA 3PQ3A 4FYYA 3GVXA 5FI5A 2H2HA 3U40A 3Q3HA 4BVJA 3I83A 2D8MA 3N0RA 5BSMA 5E3JA 3TX6A 3WRYC 3PXAA 2ABWA 2ZWPA 3QKUA 4IMIB 3T7SA 1G8YA 3R3ZA 4U2CA 1JEQB 1N77A 2NUPA 1GA1A 4EZIA 2VK4A 1LX6A 4QXRA 3IEVA 2D5IA 5JZMA 1LSUA 4LDRA 1YJBA 2F59A 4PRZA 3ZQJA 2VJLA 3B85A 5ECWA 4ZCPA 5J3JA 1EVEA 1UJ5A 3O2QB 4R31A 1R64A 3JVEA 2MSWA 4RPCA 3JQPA 4FWIB 3JTMA 5AVYA 4PLVA 2ZIAA 1ADGA 1ELOA 1TF2A 3AR4A 4MS1B 1GZ4A 3ZE8A 2LDXA 4TV8F 4XKJA 2OCAA 3DAYA 4R2WA 2EC5A 5LC1A 2QUJA 1KMHA 3I9KA 2VRNA 3N2GA 4F4FA 3P9SA 5E6SA 3W2FA 5LDHA 3KYCA 1UBRS 2VDRB 1KYYA 3HVJA 4ZO6A 4HV4A 4LMAA 1PZEA 1KFJB 2HUPA 3DE6X 3DMPA 4JLDA 4F3YA 3W4KA 1JF8A 3GEPA 3WRWA 3PEWA 2ZE8A 1QR2A 2Y68A 2J07A 3B6KA 4D99A 1OWMA 1I0LA 1XRPA 4CCYB 1E2DA 2EQAA 3EZ6A 3OZIA 2JAHA 1EFUA 1PJLA 2XGSA 4KDRA 1TO1E 1U4SA 2QQ0A 1VLHA 2PFKA 3OZCA 2WPDA 2R1TA 5AM4A 4L0QA 4ZZIA 1F2VA 1U1IA 3Q6MA 4EAAA 4MW5A 3EUFA 5C7LO 5K7SA 5EE0A 1WMBA 2Q3BA 1KYVA 2YJ4A 1VL8A 1Z16A 3GLIB 2FNAA 4AJEA 4DY4A 1EB9A 1I7LA 3IHLA 1F2DA 1BXRA 2C1ZA 3R7DA 1ORTA 2JFYA 3L2OB 2HMYB 4IXTA 4INAA 4N54A 1D6JA 2GCOB 1HK7A 2BJVA 2CHFA 3BILA 2H1HA 5KVCA 4R6WA 2X0RA 4NJEB 3K92A 5DHFA 4UTVA 3WMFA 1GZ7A 1NDQA 4PYIA 4QYXA 1NMYA 3WG9A 4AVYA 4ZJPA 2VJQA 3QFSA 3R23A 4F4UA 4TSFD 2I4IA 5B6JA 2WJIA 5CEEA 1EESA 1B6GA 2TSYB 3QPWA 1G8JA 3R0ZA 4EW1A 1V7CA 4RTLA 1E7QA 2L2QA 1QGUA 4C0KA 2YJ5A 1T4CB 1TF5A 1ZA1A 1K5HA 4GC5A 2QZSA 4JMLA 3UMGA 5G4KA 1V2GA 1CBUA 1IRIA 3N0VA 2A92A 2GN0A 3ESQA 3GGOA 4KH0A 5J63A 3R9WA 2FUCA 2P8JA 2V0GA 4YXWA 3MW8A 5C80A 2I7CA 1AU9A 5K9ZA 3AL0C 4Z1MD 3IAM1 3FSGA 4GX0A 4DSTA 4WBNA 1T9ZA 2DFVA 1E7SA 3PGLA 4N6OA 1EIZA 4R05A 3OHMA 3I58A 5IJWA 4OM7A 2BJHA 1OX4A 4RVUA 1A76A 5JUWA 1Y8QA 1M9NA 3GP8A 7REQB 3CNHA 1DBIA 2F1JA 3E3MA 3B82A 2AG5A 1PR6A 4H7PA 4K46A 4EO4A 3G0HA 3FXAA 5LWQA 5SZIA 3QSYA 1NVVQ 2VZLA 4FFWA 1EIWA 2OZEA 1UJ2A 4YDHB 3S2IA 4LJSA 1KIAA 4O1HA 4JLVA 4DPLA 4EFLA 1WPGA 4OHKA 4HPXB 4KX5A 5IASA 3U1BA 2K2QB 1O94A 2AG8A 2PH3A 2QM3A 3IP9A 2XDQA 3OF5A 1THGA 2IP2A 3IQZA 4X20B 4DMFA 3PZBA 3KLBA 1JEAA 3K5WA 3L02A 4OQYA 3RFUA 4RACA 1UEJA 2P9GA 5JRZA 2CDCA 5MGNA 2OO5C 1Y6GA 2BTEA 2R87A 1ESNA 3EARA 2X9QA 4X7BA 1BHSA 1FRNA 1U0FA 3JARA 3U7RA 3DWGA 4MCHA 3I5XA 1FYXA 2V6BA 4P92A 3P9ZA 4ZYXA 1PD0A 4RAOA 4QYWA 4AZ3A 3WHIA 1VOTA 3MRTA 5KJ1A 3SKXA 3PT5A 1IHUA 1NVAA 5L4SA 1Z6XA 3OX3A 4I1RA 3QVLA 3RUHA 4AWAA 4F3KA 2ZAYA 4QJ3A 3P0JA 4PXYA 1E9CA 2Q62A 2J3KA 3FKSD 4J0QA 3WNQA 4PVDA 1P0PA 4UCXA 4DDUA 5TX7A 2W4QA 4HWTA 3FHJA 1S3GA 1HA3A 2PGNA 3IHWA 5G02A 3ZKWB 4ABYA 4G56A 3GJTA 2FW8A 4Y6GB 1S2GA 2OAP1 3MUEA 1ML3A 3WGQA 2R2GA 1NURA 3U1VA 3PI6A 3FZGA 2ZTMA 3VVLA 2R6CA 2JARA 2C78A 4WOJA 1JLLB 2XUAA 2C7PA 3Q0EA 3ZQ4A 2EG5A 1OWPA 2GM4A 2IBMA 2PQMA 2R7NA 2PVCA 3IP7A 4JBIA 1BGVA 4LJAA 1XDDA 4HXGA 4B35A 4EPTA 4B7AA 2YN4A 2Z2XA 2FZKA 5GY7A 1OYWA 3X1KA 4WNCA 1IWBB 1E1QA 3LFHA 4IV0A 3R7NA 4FGUA 5AKIA 3HC7A 3K2EA 4D3FA 1F17A 3HO6A 3BF8A 5J4LA 5HCUA 1C9JA 1Z2NX 3PA6A 4JAVC 4HB3A 5CJJA 3V8QA 2WMYA 2Y4OA 2OB2A 1L7AA 4ZDWA 2G67A 3NP7A 4UPVA 4PEVA 4PRLA 2ZG6A 3KYIB 1K7CA 1D1TA 1HI9A 3DMYA 4MJLA 3WLRA 4CTJA 3FTQA 4D46A 3TIXB 2XJ9A 4LOKA 5HGJA 5KWEA 3Q3JB 1I7QB 3H42B 3K73O 1ZN2A 3SVZA 4Z4CA 4MV3A 2RGDA 4FPXA 3U0BA 3F8TA 5L9AA 1IM8A 3T38A 2B35A 4ECEA 1Z4QA 2VP4A 5FNZA 1JHAA 1RI4A 3EDCA 4IJMA 4L16A 4X6YA 4WNAA 3CGGA 3CCCA 1UC4B 2Q5OA 1FY2A 2C8JA 3DVQX 1NVXQ 4L07A 4M1YA 2G4CA 3HXQA 3TI7A 2BZ1A 2P67A 2ZIXB 5K8TA 1V2HE 2ZETA 2O8EB 2JW5A 3QWFA 1NJ1A 5ECGC 4UUPA 2I71A 2VDMB 3LQRA 3LWNA 3PUYA 4FUTA 3KQWA 3ZCVA 4TMKA 1LPMA 1R0BA 3T5PA 3DFKA 2P30A 1JPNA 3SDBA 3JTEA 4O4HB 5ED4A 4GE3A 4H08A 3B12A 3RVQA 4BNXA 5IJ0A 5I7UA 1WS6A 4JC0A 1I4TD 2A0FA 3AUSA 1SVLA 3NIFB 5JC8A 4L76A 1NN3A 2VPZA 2Q49A 3UWSA 4WH0A 3Q8LA 1YFLA 3A1FA 2J4CA 1GPJA 2IVZA 1KGSA 5P8WA 2HPAA 3F6PA 3PX7A 3TLGA 1MFZA 1I2AA 2ID4A 4WCFA 2IEYA 2MINB 2XUFA 3LP5A 5HJ5A 3ELYA 3AM1A 1VCNA 1KPGA 5GZ3A 4TKMA 2JVIA 1X0VA 3WGNA 4P4SA 3LM8A 2PX6A 2VQDA 4CG0A 2OWEA 2KX7A 2NZXA 1H8ED 2CL7X 4Q18A 1ZK1A 3SEFA 4Q4HB 2I80A 4WLVA 3CT4A 1AC5A 4UEQA 1Z45A 4AMYA 3VGPA 1JDTA 2OG1A 3OOWA 5U4QA 4IDHA 1GR0A 3IXMA 4Q9DA 2EBWA 5F7ZA 5D3KA 4NBSA 1X9HA 1UAYA 5LIRA 3DEFA 4N8SA 5E1MA 5IUNC 2VYVA 4DE5A 4RA9A 4TWAA 4M9XA 1YDMA 2FVXA 3ID6C 4NV0A 4NYJQ 1M54A 1KMMA 5CVDA 1W1IA 2C97A 4ZOLA 4OHZA 4REMA 4B81A 4JQYA 1P72A 4KW7A 4KXNA 4RETA 3BWBA 4ER7A 4JEMA 4JGGA 3PC8A 5CCBA 2RG7A 5FBQB 3VZDA 1Q1ZA 3DF7A 1JR3E 4QO8A 1T5DX 2JF0A 3WQBA 3WHKA 2D0DA 3F6BX 3GRZA 3OZDA 2XUJA 5BNWA 4C87A 2H5LA 5E6RB 2MR5A 2X1MA 4UMVA 3W77A 4I0WB 1WB5A 3PQ5A 3PPYA 5AESA 2UZ1B 3MT7A 3QJGA 1LQUA 1IOZA 1LH0A 2I0FA 4UE6A 5IN4A 2VXYA 4HCJA 1MT3A 3GUHA 2BCGY 3H8JA 3KZ1E 1C4OA 3MGCA 1VRCA 3QEOA 1PGNA 2GR9A 5KI6A 2DHRA 5IYZB 2JB9A 2Z6UA 2HCJB 4MUBA 2H59A 1BN7A 1KI6A 1HLPA 2ACVA 3EMKA 3GFSA 3LDHA 4RD3A 1U6IA 1WEKA 4C5AA 5JMOA 3F1KA 1XK6A 4LXQA 2XIQA 1IXSB 1M1XB 2FZ4A 4Q1CA 3AERA 4BU0A 1PVOA 3VOBA 1Z8NA 1OXMA 2GOYA 3IERA 2HAEA 1J0XO 1H2ZA 2YRFA 3X1XA 3NTUA 1I10A 3AR2A 3PCTA 3VR6D 4BU1A 5F9FA 2FSPA 2BHSA 1Y5LA 1FFGA 5EUBA 3FOFC 4BNHA 3Q6NA 1CQZA 1H23A 3HB9A 1D2AA 2EARA 3P2MA 1IC6A 4LHVA 3IQGX 4RCYA 2GPAA 3HJHA 3MMSA 5FFNA 5H3CA 5BYAA 4KIUA 1SC3A 3VU9B 1SC1A 4F7WA 2VKQA 4EG4A 3BGDA 1QGYA 2CGEA 3CHYA 1RQLA 2FP4A 2XRYA 2OZKA 2R751 4FR5A 1S89A 2V9ZA 2JBHA 5CT8A 4GVXA 3SSAA 3AF6A 1EFRD 1HZJA 2GZ2A 4Q5IA 1XA4A 4CIAA 2FN3A 4DARA 5KCZA 3N0TA 2P27A 4YS6A 4ZVOA 3FBWA 2YZ7A 1U9IA 2ZW9A 1ZIOA 3IAUA 3PPVA 4L8YA 3VTFA 1AQIA 4J90A 4KUHA 5EWLA 1QBKC 3IEKA 3WDSA 2AXPA 1DAMA 3LVFO 3SQNA 1N2BA 1PFKA 5KZMB 4EYSA 1Y48E 4DR6B 3TNLA 1B14A 2FW1A 2Q3CA 4R1UA 4EG6A 1YZHA 3BK7A 3GFRA 4J1TC 3EG9A 1MGPA 3FLBA 1UKEA 3IYLW 3L43A 4X24A 3IDAA 1NLMA 4XVCA 5B3LA 3QG5A 4RTQA 1GGVA 2ORIA 2YQ5A 2QXYA 3I72A 5CFQA 2OO3A 1G8HA 4QQRA 4OA8A 3A06A 1QWSA 4UUOA 2ADMA 5H4GA 2PA3A 5JH7F 4QC2A 1NWCA 2CF5A 4LRSB 3MOGA 1JJBA 4HTFB 1PEAA 5HRAA 3V7WA 3N6RA 1BE1A 4ZIRA 4R7GA 5K4HA 1P9OA 3RUDA 3WGYA 3BTOA 2J0EA 2DULA 3HJAA 2YUIA 4R0VA 5M34A 1C9YA 3A05A 2ICAA 3EVAA 3L9WA 4P86A 4ZT6A 2C2YA 3V55A 1K7SN 2YXLA 1T2EA 5FWNA 1WUHS 2J3EA 1HQYE 2W5UA 4GECA 2N3ZA 5IFKA 1UMDB 3ZY4A 4RTNA 1J0CA 1NE2A 1MEJA 1UJBA 3UGQA 4BQSA 4CCAA 5C8DA 1YIDA 1A69A 2Q6KA 3EIEA 3WK4A 1P2DA 5JY1A 3SR0A 1L1RA 3GFBA 5K0SA 1Z5PA 1CUYA 5AI9A 2Q3LA 3BXEA 3N76A 4B80A 1C9NA 4QBGB 1SWVA 3O4RA 1DLJA 1WE2A 3DAFA 5CLFA 2YJNA 4M2LA 3GUCA 5KDDA 3OLVA 4C4RA 5AKKA 5HIMA 3VKVA 3VZPA 3QEBZ 1P2GA 1TM2A 3K0FB 1SB9A 1MX1A 2FX5A 1X1AA 3ILVA 4B3HA 3V5NA 3MCAA 5EE9A 4EPXA 1BEEA 4QOSA 3WI7A 4RVNA 4KYIB 1CCWA 1PSZA 4K86A 1I2CA 5CITA 3A0RB 1JWBB 3HBAA 3O31A 2R85A 1EB8A 5EEHA 1L5MA 3I2YX 3NWBA 1UBOS 4O2LA 3UHAA 5TT1A 3FWHA 3D6TB 4QZVA 2LGJA 4FN4A 4OHWA 1EUZA 1T0BA 1K7XB 2BFBA 2ZB3A 4YMLA 2J4FA 4I7EA 2QP9X 1BCSA 4QNRA 4A9AA 2XB4A 3KS9A 4CM7A 2DBQA 5EZQA 3REOA 1N36B 3Q4GA 4NZMA 1GXSA 1P2UA 3ZHCA 2AR9A 2ZIZA 1CQIB 2CXPA 2OM6A 3BMOB 3GRKA 3HHPA 1D8AA 1Z22A 2HMWA 1NUTA 1SIWA 3LP8A 4RMJA 4B4KA 3EXEA 3FSJX 1RDFA 2AXEA 2WA2A 3H11A 4G6ZA 3H9EO 4G0UA 1NXPA 3RIMA 2C9OA 3TQFA 3D4OA 4MI6A 2IUTA 4O6VA 4YRLA 4WA8A 1EFVA 4OBXA 3RQSA 1GAJA 3DCNA 5KX5F 4ZALA 3UAYA 4IIFA 4P82A 3RIXA 4WVLA 1Z3CA 5E9QA 3WZLA 1Y9JA 4XIYA 1Y4AE 3TDNA 3S81A 1GKUB 4IVRA 1CDZA 4EHLA 4KGDA 1GU0A 1FP4A 4M8KA 4C0SA 1J56A 5F5NA 3WJ2A 3U3OA 4ZHQB 1RI2A 4KIFA 3CLTD 1GUAA 1L4MA 4QUEA 3RHTA 1DQNA 4RK1A 4O2RA 3K0EA 4B3XA 3D7NA 3MS2A 1Q0RA 2HJVA 3K1ZA 1XJWA 5MFZA 3TVYA 1VQ1A 3VAAA 2K2WA 1UBCA 4UZEA 3A7DA 2VJOA 1YCHA 1II8B 4D92A 4BOYA 5IAAA 5IKMA 1N75A 1LTKA 4V24A 4WKOA 4AJLA 1OR8A 3EIXA 4FMCF 1RABA 1CUFA 2HD4A 1QC5A 1K0UA 1ZD3A 4MARA 5C31A 1SCKA 5F2EA 1Q1EA 2VPYA 2ZJ1A 3AF5A 1U3CA 1UJMA 1ZICA 3GLUA 1CZUA 3H3FA 1KR5A 2BL4A 2NW6A 2IYYA 3DDHA 4HFMA 1RAFA 2CT8A 1L5GB 1ZLYA 2YS6A 2GUGA 2XH8A 3QVVA 1IXYA 1XZDA 2QTTA 3KPVA 2EP7A 4WJLA 1LFAA 1E69A 2PE5A 1IMJA 2JD0A 3LC1O 5EMNA 2GFIA 4M1ZA 4P3KA 5JDCC 3RSHA 4WUVA 2Q9UA 5J4HA 1F2TB 3AUUA 5FO0A 4QVKA 2ZCUA 1UFQA 1W2GA 1L7RA 4QLBA 1UBTS 2QPAA 3IHKA 1AUXA 5THQA 4FYPA 4Q4LA 4E5DA 1PZGA 2A57A 1HTBA 3GT0A 4RADA 4C3UA 3W5BA 3W9SA 1SOVA 4G1MB 1WCV1 4RY2A 1H2FA 2WV7A 1VHWA 3CRQA 4O02B 2BLLA 1WKVA 3HJCA 2F17A 5LQJA 4U7HA 4B82A 3M81A 4G1FA 3INGA 5AW6A 2GX6A 1Q91A 1ODIA 1SKQA 1TC1A 4OQ4A 3WLOA 1MJNA 1AHPA 3P9CA 3O1IC 4L7QA 3PBKA 1XQ9A 2X76A 7GPBA 1SKYE 2FG5A 3GRYA 2JA1A 3W1VA 1IZYA 4K6OA 5BWCA 4WWHA 2G9NA 4NEQA 5A3JA