2WMNB

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wmnB00
3RRMA 2CJWA 1KMHA 5GVRA 8OHMA 1KK3A 3R8FA 3LO5A 1J90A 1E0KA 1NLYA 1G18A 5EE1A 1TQ6A 5LB2A 4DLZA 2QPTA 1RE0A 2AFHE 3VU9B 4TMZA 3PEYA 1YJ5A 4CGZA 3DOEA 1E2FA 1U8YA 4B47A 2OCBA 1IM2A 1E69A 2JLUA 3I62A 1A82A 2JEOA 4JZKA 3CW2A 1U81A 4URVR 3GJ3A 1CEEA 2UVQA 2CVHA 1W0JD 3P26A 5EQTA 4IOJA 4B71A 3QPVA 1CXZA 4IVPA 4CEIA 5CIQA 3HPRA 4B6EA 1KDRA 1KGDA 2G0TA 2C8VA 5HE9A 5GJVC 1TEVA 5JEEA 3EZFA 1J8YF 1NJGA 4TQAA 1IJFA 3DDCA 1QVRA 2PT5A 3EWSA 1OIVA 3LFUA 4G0NA 2Q9CA 3L0OA 4LYAA 3RANA 3BFXA 2ZITA 1Z2CA 4WW0A 2GRJA 4P4TA 5JHHB 2UZIR 5JJLA 2R9VA 3KXKA 1OXXK 1UFQA 1ZUHA 1KIMA 3OESA 1IOZA 4UJ3A 5CLQA 2ONJA 5DNYB 3CNOA 5KDDA 2R44A 3EPKA 3DM5A 3JVUA 1XD2A 2HLDA 4WZ6A 4KLNA 4XSHA 4D0GA 2JGNA 5CYOA 4ZIRA 5JCPA 1TADA 2PLFA 1P6XA 1ZM3A 4MRVA 2IEYA 2CL0X 2FSHA 2F1IA 2FFAA 2V6JA 4CT4B 2QMEA 2ZS8A 1KHTA 2WSSD 3GLFA 4DCVA 3FMPB 1E1RA 4HUTA 3NVAA 5L3QA 4GL2A 2VEDA 3EX7C 5AUOB 1BMFD 2G6BA 2KWIA 3GFPA 4WOPA 1E79A 1HE8B 2A5YB 2OT3B 4R98A 5KYKA 1R8SA 3U7GA 1XMIA 2JCSA 1JR3D 2BCJQ 4KV9A 2QAGB 1NMYA 3QENA 1FTNA 4RZXA 3LX5A 3TVDA 1GG2A 2V1XA 2CLSA 1XXHA 2YWEA 3DMNA 4Q1AA 2OV2A 2VP2A 4XOIA 2DWPA 4FWTA 2NO6A 2VIIA 2O8DB 1KSGA 4KCGA 2E9SA 2ZROA 3ZQ6A 4O2RA 3W3AA 2JATA 2AWNA 2UZ3A 1JXMA 3K0AB 3VNUA 3VHLB 3C14C 2BVNA 3IKJA 2VLIA 3ZVMA 4EPYA 4ARZA 3ZS8A 4R2IA 5JMTA 4KU4A 3B13B 1Q20A 1OFUX 5DHAA 2WWWA 4PAMA 1VKJA 3ADBA 3UWKA 5FI1B 4OHYA 2WTUA 1L8QA 4PSVA 1W4BA 3SEAA 4NH0A 1BO6A 3MWKA 1J7KA 1N5IA 5CB8A 2GAAA 3FFAA 2J45A 4LYFA 4BLRA 4IFBA 3CH5A 4V0ME 2MMGA 3MG9A 5FUWA 1JR3E 2OESA 1KKLA 4Q19A 1UADA 3VMFA 2BBSA 2WVJA 4KHZA 4N3NA 3NG1A 3K9LA 1U9IC 1D5CA 2GAOA 4FXPA 4DRZA 2HYIC 3AGQA 2J5XA 3PEVA 2WWXA 3A37A 1IY1A 2CCJA 5LD2B 3P4XA 3R8CA 1NBMA 5K8LA 2MSCB 3O8DA 4NTZA 5HZHA 2HF9A 5DHFA 1Z08A 2G1JA 2ATXA 3VNVA 4GRAA 2VP4A 1SKYB 4DDUA 3RSOA 1L4YA 1YZNA 1W46A 2ZIAA 4PO9A 1G8FA 4ESVA 3X1XA 1WMSA 3SHWA 5LBIA 4M21A 4TQ9A 1QRAA 1ZC3A 5FUXA 3W8NA 1FNNA 1QHNA 2ZS7A 4JL8A 3RRZA 1KDPA 3U3KA 2QM7A 4YDHB 4BFWA 2AR7A 4YDSA 3LLUA 3SI7A 4LJ7A 4TN1A 1GL7A 1I4DD 1R10A 2HLDD 3EIHA 5FI0B 1E2EA 3RHFA 4DB4A 2XZOA 3K0CC 5C4GB 2ZTSA 4MRPA 2GNOA 3RNLA 5JZVA 4BFXA 1ZNYA 5FPSA 4UNQA 3HU2A 3FYHA 1BYUA 1Y3AA 2QP3A 4Q4AB 5DYGA 1Z0FA 4ESHA 2VYFA 3QKRA 1TU4A 5J5CA 4FW9A 2Q0HA 1C1YA 1ZP6A 5CM9C 2A30A 2D7CA 4EJSA 2BMJA 1N25A 1E79D 1DO2A 1MR3F 2YKGA 4Q66C 1KSHA 1XCGB 1X8KA 5FBLB 5CB6A 3RS4A 3TNFA 2PH1A 1G3RA 2B6HA 2F1JA 1CR2A 3K0FA 1GSIA 4OJQA 5JBQA 1MKYA 1M7BA 3THWB 3K53A 2PBRA 521PA 1J70A 3QEOA 4LX0A 2BEJA 3K70D 1JXOA 3D3QA 5EE5B 1ZD8A 1A2KC 3B1ZA 4KBFA 3TQFA 2D74A 2GZAA 1NVVQ 4HB2A 4PHHA 1Q12A 2W6JA 2W0MA 5G3YA 2JJ2D 2R8RA 3BBPA 2CCGA 4DEYA 1PVOA 3QQ5A 5L3SA 4IDQA 1YR6A 4C2UA 5FBVB 3GLFE 4TZ6A 3GLHB 2REXB 3UMFA 4B2PA 1UKEA 4LHYA 4LJ4A 3TAHA 2VBCA 3SOPA 5FL7D 4RSGA 2RAPA 1OFHA 1CR1A 2P5TB 4POAA 4G5QA 1MH1A 1F2TA 4D82A 3WMFA 3T1VA 4GFDA 4JVSB 3OIUA 4NCIA 1NIPA 2F43A 1E2HA 2J3EA 3CPHA 4Q7MB 3R9IA 1XCPA 2F3TA 3NBXX 5DN6A 1XXHE 3FFBA 2PJZA 2ZI6A 4UXHA 3L8ZA 5FOUA 4W9MC 1F3OA 1E2LA 1L2TA 2BHRA 3P20A 3NKVA 3QBTA 2QE7D 5LPNA 2IYQA 1SQ5A 2V54A 1E1QD 1IXRC 1JAHA 3WP0A 1E9RA 1LB1B 1NBMD 5L3RA 5JS8A 1P5ZB 4RFSB 3LVQE 4DLSA 4EPRA 5J4YA 2MMCA 1L4UA 1Z22A 2J9RA 5FOVA 4NONA 4CEIB 4PPNA 4HZUB 1Y63A 1P2SA 4PC7A 3AVTA 3QXXA 4IDPA 4F4JA 1XNJA 1HA3A 5KTYA 3THYA 4CEHB 1R5NA 4Q1FA 3QSYA 2WWFA 1CJTC 1DOAA 1VCIA 2EU8A 3SBDA 1OH5A 2VP5A 2XJ4A 3IIMA 1Q3HA 3LLMA 3AGPA 1E4YA 1R0WA 2XOKD 3KTAA 4P4SA 1HQYE 3SFZA 2GETA 4CW7A 1KO4A 4KXFB 4N1AA 3CZQA 3QF4A 4B3FX 5H8WA 4QGGA 3ZZUA 1E96A 4IJMA 1N0VC 1KO5A 2NGRA 2IYSA 3O47A 4NHOA 3Q5DA 4Q47A 1L7VC 2QTFA 1Z8FA 4URYR 1NN5A 3X2SA 1NBME 3UG7A 3D7MA 5JEDA 2QNRA 4B35A 3EG5A 5AUPB 3CO5A 1ZD9A 3EW9A 2YINC 3QXSA 2WWYA 2ANBA 3IDQA 2JLWA 1X8JA 3C7KA 4LI0A 1XD9A 2ZSFA 5J4KA 4TYNA 3EWAA 5IDVA 4EDHA 1F60A 2QQ0A 1OLOA 4A0HA 1DADA 4HAUA 2FG5A 2ODNA 1OJLA 1FP7A 2WBLC 4V0KA 5KO2A 1IY0A 1NN1A 2YWFA 1Z28A 3KDSE 5JWRA 1GRNA 3RS7A 4WAUA 3CONA 2FNAA 3BB4A 1X8LA 2G9NA 4EQ6B 4DLRA 2FH5B 1G19A 2C9OA 1D8TA 4HLUC 2W6JD 1C4OA 1ZNZA 3BJIC 5FTNA 3TMKA 2ANCA 3Q7PA 1KNQA 1JPNA 3M1IA 2I4IA 3FKQA 2BBTA 2IYWA 2QA5A 2GVZC 2IXEA 3SS8A 4MGIR 5BXQC 4HDCA 4P32A 4AG6A 4TSFA 4JLJA 1XTIA 4JBXA 4LZZA 4NCNA 3U3MA 3UANA 3K0EA 4TLAA 4ARZB 5KOYA 1H8HA 1Q57A 3IHWA 4EFMA 1UF9A 2ZM5A 4L5BA 1GKIA 1MT0A 1GKYA 2A5DA 5DSZA 1R0ZA 5C4MA 1DO0A 3CNNA 4TL6A 3EPHA 2NOAA 3WYAA 1KI1A 2N42A 2X8AA 3U3RA 4B73A 4PHGA 4A6XA 1U0HC 2BC9A 4NZYA 5FR2A 1AZSC 2GBLA 2VTKA 5DH9A 1KMQA 1D6JA 5AUNB 1G7RA 4LDJA 1NSFA 1U90A 4RZUA 3W8RA 4LV8B 1G7TA 1G6OA 2B8TA 2OBLA 1HT2E 3T34A 1VCNA 3K0SA 3PJRA 4X8HA 3LXXA 2NTYC 3F8TA 2AKAB 2ERXA 4LV5B 1U8ZA 2D62A 3DEFA 4LJAA 2OUKA 3AKCA 2ZUCA 3RS2A 4JL6A 5FOSA 2QG6A 1UBCA 4QHTA 5DIFA 3CF0A 1HEIA 2IXGA 2ERYA 2OXRA 3IPYA 5AJWA 3PG5A 3EZ7A 2CDNA 2HUPA 4BZXA 2D2EA 3I1FA 2IBMA 5JHGB 3QPUA 3CNLA 4FINA 2GWHA 2QROA 2C9CA 5CM8B 3EZ2A 2J7PD 1NVUQ 1OV4A 2ZRNA 3LD9A 2Q3FA 4CRWB 4DDWA 4JT4A 5JI2E 1VIAA 3UK6A 3Q9LA 1YR7A 2ZI3A 4YC7A 2OBMA 3GD7A 3B1YA 3ZD6A 2O8CA 1MRNA 1FX0A 1ZU5A 2P2LA 5E4FA 1OW3B 3TGPA 4TZ0A 4Q4HB 2CL6X 2XJ9A 3ZJYA 3THXA 1QBKC 2ZSBA 3TR0A 3L43A 3WNCA 3Q72A 4B3CA 1DBSA 1JEDA 3C4JA 3QKRB 1DAKA 4YQFA 3SJBA 5IHPA 2GJ9A 3CR8A 2RGAA 5TY0A 5BN5A 4QNMA 5FTJA 2F9MA 2R6DA 1MO5A 2NO7A 3AVQA 1XPUA 3SZRA 3VR1A 5DE3A 4B3DA 1NIJA 3ADCA 1A4RA 1J8MF 2CE7A 1KAOA 4Q4JB 1OT3A 3TW8B 1Q1ZA 1LW7A 4KAXA 2NPIA 1KK1A 1RYFA 2FZLA 1LS6A 1CJUC 2JDID 5H70A 4JLNA 5EUQB 4JJZA 3VR5A 4A36A 4DDTA 5AJYA 2LKDA 3AVXA 3PXGA 2O8FA 1W4AA 1XEWY 1MO4A 1GFIA 1HTWA 1JB1A 3P27A 4NCHA 1DAEA 2YC4C 2JLXA 3K9HA 4A1FA 1WBDA 1YRBA 4AWXA 2ZSAA 1WE2A 3SFVA 4EFNA 1RRGA 2P6RA 2CVFA 3A1TA 4KFTA 1E9FA 1NVWQ 1G1MA 2WICA 4LYHA 3Q5EA 1OIWA 4KVAA 2ZSDA 5FTMA 5EZ6B 4NKRA 2GXSA 2ZXUA 2IS1A 4HATA 1YRAA 5J4LA 3VAAA 3TUJC 4B75A 3CM0A 4C0HA 4C0SA 5JSZA 2XNDA 1XF9A 2ZI7A 1OHHD 1ELOA 3VKHA 4WIAA 2ASEA 1W36D 2NO9A 5E7JA 3WYGA 1P9WA 1VYTA 2A5GA 4E5UA 1NG9A 3AQ4A 3AF4A 2XZPA 3S1AA 1E2PA 1S1MA 1XD8A 5JJIA 4IXMA 2H1LA 2I3BA 1N2CE 1X3SA 2IS4A 4U7DA 1T4GA 4GMXA 1M7GA 3KB2A 1F2UA 1G20E 2FSFA 3EA0A 4TMKA 3LH5A 3AVVA 1XEXA 4NCKA 1G3QA 2Y8EA 3HR7A 4IOKA 1ZJ6A 4II7A 2CK3A 2Q21A 4QGAA 1FFHA 4CZ2A 1P75A 4Q1CA 4KITB 2JLYA 4FCVA 1NMZA 4DUGD 1TU3A 1GAJA 3L82B 4J0QA 1LS1A 1SVIA 2YOFA 3EIQA 2FGJA 1Z5ZA 1Z29A 2RB4A 5H68A 4C2TA 1W0JA 1KZGB 1G7SA 1QG2A 2ZETA 1FTSA 3SQWA 3DOFA 4BFUA 5FBQB 4WVFA 5LD2C 2DWQA 4B3BA 3W5JA 4UKDA 3SYKA 2N46A 2XSZA 3VKGA 2RGDA 2A9KA 3GJ7A 2DB3A 1IN5A 1ZD1A 3KTAB 3T1TA 1AJEA 1LY1A 4TLBA 5KDOA 2ZRAA 4P4UA 4MKHA 3QF4B 4MUBA 3TR5A 5KSYA 2GJAA 1G5RA 1SULA 1Z47A 2YYZA 4Q48A 3AVUA 3ZVRA 4A2PA 1RJ9B 5EXXA 2HT6A 2FPLA 3EZ9A 1NL3A 4EPXA 4KSCA 4LHXA 3WNDA 5CJ2A 1BH2A 2FX3A 2O8BA 3FKSD 3OEHA 1P4SA 5C46F 3RC8A 1SXJC 3GJ4A 2P67A 4U00A 1G5TA 2OZEA 2R6GA 3TUZC 1YKSA 2QUZA 3GLIA 4DT1A 1NVVR 1OSNA 3OZXA 4KYIB 1A1VA 4AKIA 2A5JA 2IYRA 1KK2A 4LJ9A 2WSSA 2VA8A 3LX8A 4JVLA 3LRPA 1XBTA 3ZZ0A 3MSXA 4V02A 4DLWA 4RKEA 3N2IA 4RD1A 4B32A 2BDTA 1YZQA 4BFYA 5K8IA 1KJWA 2H17A 5CK5A 4M4SA 5FOXA 1FL9A 1ZIPA 2Q3MA 3OFND 4V0MA 5IRCD 2F9LA 2ZANA 1OXSC 3IQWA 3X1ZA 4F93B 2CEAA 2B21A 1KZ7B 2LCFA 4AIIA 1OE0A 4XD7D 4BWYA 1W2HA 2WPDD 1E9AA 3HYTA 1A2BA 4TLCA 4CYMA 3KZ1E 1OH7A 1G9XA 4Q18A 1HE1C 2ZYUX 3K09A 1Z0DA 3B7GA 3N70A 3MRSA 4G3XA 1S96A 4Q9KA 2BM1A 2OM2A 4YXWD 1ZUNB 2YOHA 1CF4A 4ITRC 4NL4H 4M1TA 1SVMA 2YZ2A 2V55B 4FCWA 2QM8A 4L4UA 3KQNA 3IGFA 4GI7A 4QOSA 5FBRB 2H57A 1G41A 4DLVA 2HT1A 1UBGA 2RGCA 2XTZA 2NO0A 3TSZA 2AD5A 3CB4A 3CH4B 5CJPA 1G64A 1QHGA 4KLZA 3MCAA 2F1RA 2H92A 1TNDA 3E5HA 5HCIA 1K8RA 2RGEA 2WAYA 4HI0E 2AFIE 2ZJ5A 1W7AA 4OHZA 4IFEA 2CK3D 1YVDA 5B64A 3AB3A 1YZUA 1PLLA 5FPKA 2DBYA 1CKEA 4V0OA 4RVCA 4BRWA 1SVSA 4M53A 1KI6A 4KVGA 3AM1A 4E03A 2W2TA 3R20A 1CRQA 2J0VA 2JLVA 3K9NA 2R2AA 5EP1A 3ASZA 4IDHA 1W4CA 3AKDA 2AL7A 2GK6A 3RDPA 2XSZD 2W2XA 4MRNA 1N3BA 4IOMA 2C03A 5G53C 4PO8A 4XJXA 1AM4D 3H84A 4QC2A 3SE0A 2IK8A 1XMJA 5BQ5A 3X1WA 1US8B 1XTSA 2GCOA 5DGXA 4AI6A 4DLYA 5FPTA 2J1LA 2ZAMA 1DAIA 2IUSA 2QSYA 1MABB 4ABYA 3CWZA 3MJHA 1H65A 1VG9B 3CF6R 4L15A 3R7WA 5J40A 1M6NA 2IYXA 4AG5A 1FUUA 3R9WA 2ZUDA 3KL4A 4S35A 1CJVC 3OEHD 4DXAA 2IYUA 1GITA 3FGNA 4IRUB 2IUUA 2BJWA 1E9BA 4G5RA 2R65A 3PUZA 4JLBA 2JLRA 2ZRIA 1MO6A 4GP7A 4HB4A 1S2MA 3WMGA 4RY2A 3L0SA 1NKSA 2HEIA 2HYDA 4IXNA 4V03A 3E70C 3GFTA 3ND9A 3GLGA 4HLDA 2ZRLA 2ZJ8A 4FMBB 4Q1DA 2UKDA 1RRFA 3OE7A 2YWHA 3I61A 2WSMA 1JAIA 2FEOA 3QIAA 5DI3A 3V00A 4DBLC 4BFZA 1J2JA 4XVQA 3C15C 3HP1A 5C18A 4EIWA 1J99A 1FMLA 3U7EB 2C5LA 2O8FB 3KQHA 3DPUA 3T5GA 1XTKA 4BLOA 1QZXA 2GZHA 1KSJA 2GZDA 4QG7A 1E9SA 4NYIQ 4Z51A 4O2LA 2EFHB 1VIYA 1W5TA 2F6RA 2IA5A 4CDGA 2DHRA 1Z0AA 4DSTA 4CF7A 2OILA 4GNKA 3LBNA 3VR6A 2HV8A 2GF0A 1FNMA 3TW4A 4A2QA 1KY3A 4BLQA 3SBEA 2JJ2A 3VX3A 4GZMA 3GLIE 2IWHA 1DG1G 1CU1A 4E07A 5HCNA 5TB5A 2CLDX 3B6EA 1WF3A 2ZREA 1G8YA 1TMKA 2P65A 2RKOA 2ZR0A 2ZU6A 1OPXA 3SJZA 4A0GA 4PSAA 2GXAA 5FL7A 5CIWA 1JQLB 1YZTA 1DAMA 2EW1A 1I4TD 1FOEB 4TLDA 5AUQA 3ADDA 2RGBA 2O0JA 4MYCA 3WBKA 1II0A 1GL6A 1JQJC 2ZR7A 3HYRA 5LDDC 4BFSA 1COWA 1TF2A 2JLZA 2XNSA 4A8JA 4GOKA 1RFLA 4LSGA 4PPGA 3REFA 1TUIA 2A2ZA 1N6PA 3AF0A 4FD2A 1KAGA 2QE7A 2WJGA 4HAYA 1S0UA 5KHOC 3OAAD 4KI0A 1E1QA 3SDZA 3GPLA 3U44A 4A92A 3JZAA 3CRQA 4HUQB 4JLAA 1IXSB 3H1TA 4R9UC 4FMDF 2NIPA 4P0TA 2ZI4A 5F9HA 4AKHA 4BQSA 3FDIA 1K5GA 1H8ED 2QGNA 4ZPXA 3TLXA 1S9DA 3LQRA 1TEXA 1EFCA 4PR0A 1LFDB 1KO7A 1R5OA 1CIPA 3TK1A 3C5HA 3ZYCA 3B1VA 1W2GA 1NSTA 3PUVA 4ZCLA 4ZDJA 4BRUA 1Z3IX 1MO3A 5FOWA 1PLKA 2XOKA 3B9PA 2OHFA 3SU8A 3TIFA 1NJFA 1SXJB 1G3UA 1P72A 3ADKA 2WJJA 1IN7A 4CEJB 1QHXA 3MJRA 2XXAB 3BERA 1NLFA 1P73A 1SGWA 2O8BB 4KBGA 2QPOA 4QJ3A 2VHTA 5E95A 2JA1A 2GKSA 2WWHA 4B33A 4DZZA 1OH8A 2TMKA 3HWSA 4PC3A 4DVGA 3OEEA 3REGA 1XPRA 1EWRA 4F7WA 3B60A 2E1RA 4D4LA 3OE7D 1R8QA 4MQBA 4PHTA 1P2UA 1N6OA 1SVOA 1E2QA 5JWHA 5BW8A 4PQYA 1XPOA 1Z6YA 4YLGA 4NU0A 1VG8A 3WP1B 5FPHA 4EJSC 1VMAA 1IBRA 4RD6A 1R2QA 1DS6A 2IYZA 3TH5A 2ZJBA 2W00A 3PCRB 4M9XA 2YWGA 2HJGA 2V7QA 5F9FA 2EYQA 1Q3TA 1II9A 1CBUA 1V5WA 3QEJA 2VSXA 4NYMQ 4D2IA 2AKYA 2GK7A 2WIAA 2IT1A 2QP9X 2VRWA 2QTHA 4BEBA 5TDHA 2BIFA 3DHWC 2YHSA 3VR4A 2WV9A 2GCNA 2QI9C 4WXPA 4HLQB 1Q1EA 3QXJA 2P3SA 3KUCA 4DSUA 4DDVA 4HB0A 2IYYA 1ZUIA 2GXUA 5AJZA 3GLGE 2CHGA 3B78A 4Q9HA 4Z8XA 5EXSA 3TVTA 4AYWA 5F98A 1ZBDA 2DFNA 1QVAA 2WKPA 4UNNA 1KI8A 2O8EA 2ZJOA 4JS0A 1K6MA 1KJYA 1AGRA 4EPVA 3V4RA 2CJWB 3TSOA 5A5GA 1KMHB 4KJZA 1AK2A 5JS7A 2V4ZA 1UEJA 4TT3D 3T06B 2OFXA 3JZMA 2MSEB 4BZPA 2IS6A 5GJWC 5KNDA 1COWD 3DKPA 5D3MA 1X86B 3AKYA 3CR7A 2ZRJA 1P9RA 3T35A 5FH9A 5EE9A 4A2WA 3H4MA 4BPBA 4WXRA 1OKKD 4O25A 1Q21A 1S9HA 3FTQA 4NDZA 2OCPA 4YMVA 3P1JA 3OHMA 2C99A 1GILA 1UEIA 4TYPA 3QI2A 5AR1A 2WJVA 1DE0A 5SZJA 3WNBA 1RW4A 1Z6XA 4X8MA 1RRPA 1AKEA 2HJVA 2ZJYA 4MRSA 2SHKA 3R9XA 5TVKA 1W44A 1XZQA 2D2FA 1CJKC 3B82A 2PX0A 1Z07A 2NPFA 1E4VA 4LCBA 2VO1A 3UIEA 4DB2A 2P6NA 2GESA 3IPXA 2BWJA 4RCZA 4B48A 1P2TA 1ZINA 4Q7LA 5EJEA 4LWZA 4Q21A 2KE5A 4B74A 4WA7A 3FPAA 4PZYA 2XAUA 2QENA 3KQLA 1LV7A 2V9PA 4OYHA 1ZVQA 4B2IA 3LW7A 4UNPA 1LVGA 2VHUA 1II8A 2J7PA 5HR5A 4I1UA 1ANKA 4MDFA 2WM9B 1XD2B 1GIAA 3I8SA 4OK3A 4XWKA 4TL7A 4YMWA 2QQEA 3SJAA 3UPUA 4Q1BA 3CF2A 4ZIRB 2QU8A 2KI5A 2FOLA 3OEED 4B3XA 4DC9A 1IN4A 1FZQA 2IYVA 3GJ0A 3GLFB 4GZLA 4JJKA 5L3QB 2FZ4A 1BYIA 2IYLD 2PZGA 1ZAKA 1JECA 1R5BA 3A4MA 5JI3E 1N5LA 2XB4A 3LAWA 3AUXA 4RKFA 4BEJA 3QKSA 4JLDA 3BRWD 4OHVA 2F3RA 4CT5A 2V7QD 4HYYA 2OG2A 4XWAA 2WJHA 1DELA 1YZLA 4Q03A 1TTTA 2QTVB 5EUMA 2FU5C 4PZLA 1XXHB 1E94E 3HPQA 2J7KA 1KKMA 2JDIA 3K70B 3BXZA 1VPLA 3T1OA 3H2YA 5HTKA 3BH0A 3E1SA 5B30A 1E2DA 2R6CA 3KJIA 1CR4A 2LKCA 3PEWA 5P21A 4UNRA 2XGJA 4EFLA 3FMIA 5C1BA 1HH4A 1Z6GA 2G3YA 2Z4RA 2ZRHA 3EAQA 2C98A 4JYBA 3U4QA 4TMVA 1QHHA 4US2R 3VR2A 2ORVA 1Z0JA 3RC3A 2RGXA 3AP3A 3PQCA 4QBGB 1Z0IA 2X1VA 2JJ1D 4JBYA 1RVDA 5E3HA 1HV8A 5FTLA 3QXHA 5KPJA 2VHQA 2CNWD 2GJ8A 1E0AA 1OHHA 4P3YA 4LHZA 1OB2A 5GVSA 1EG7A 1AQYA 1W4RA 3G82C 2ZI9A 3L0PA 1E2KA 3B5JA 2GBLC 4A8JB 4NYJQ 3I4LA 5A4JA 1ODFA 2WKQA 4QNRA 2P0EA 2PX3A 3EPLA 4XWOA 1KO1A 1FQJA 2X19A 3RS3A 3BD9A 2QZ4A 2VP9A 4W5WA 2Q9AA 2CHQA 5TXGA 3T12A 3B1WA 3IQXA 5E7MA 3WYFA 1U2RA 1R4AA 3VKWA 3RYTC 4D0LB 4OHWA 4IVRA 1G17A 4AKEA 2C77A 4DUGA 4NP6A 1GZSA 1GNPA 5D3QA 4XH9B 3LBHA 3Q85A 4QRHA 2N1BA 2AXPA 2QSZA 4Z8YA 2G1KA 1JR6A 1GTVA 1ZNWA 1G8HA 4UXJA 4Z54A 3NBFA 5CLLA 3QG5A 1PUJA 1AS2A 2K5UA 1D9XA 5DLQC 2FWRA 3RS0A 4B6FA 4B76A 3F3YA 4DSNA 5KU1A 2ZYTX 3A36A 3NBZC 1G4UR 1EGAA 2ZQ5A 4ZI2A 3GMTA 1IJEA 4BFVA 2R6AA 3LWNA 1JJVA 1N6LA 1OB5A 1GM5A 5GJCA 2AK3A 2QBYA 4QM7A 1ZYUA 1N5JA 3CRRA 2HXYA 4M1WA 1GP2A 3FKSA 1NN0A 1N0UA 4QBFA 4EJSB 3ICQB 3KKOA 2ONKA 2HXSA 1DEKA 4HDQB 4LYJA 4NYIR 4JVMA 1UJ2A 1F5NA 4EAQA 1G3MA 2QAJA 3K0FB 4LJ6A 1T3LA 4IDNA 3QY0A 4TMTA 2FMXA 421PA 5AJVB 1E98A 1QHSA 3DZ8A 3H86A 3SC3A 1D2NA 1HUQA 2KB0A 2GHIA 3WHKA 4A9AA 4DHEA 4UJ5A 4MDEA 4JL5A 4TLEA 5FUYA 4TQUS 4LHVA 1XX6A 3MWYW 1GL9B 4GT1A 2BV3A 3OFNA 3MWLA 1CJMA 4RZ3A 5EE0A 3FHOA 3KFXA 5L3SB 1XJQA 3VFDA 4ZDIA 4DIEA 3AEZA 2JJ8A 2BMDA 4IVQA 1VECA 1ETUA 1UBEA 4XD7A 2WPDA 3C41J 1N6RA 1VTKA 4PX9A 3Q7QA 3FHCB 3TJZA 2WOJA 5DI9A 5HKKD 5JRZA 2QAGA 1WXQA 4JMPA 2ORWA 4YXWA 1O87A 1VCMA 1F2TB 3QBVA 2GDJA 1VHTA 4H1VA 2A7QA 1EX6A 2V6IA 1KJZA 3NC1C 2F43B 4MUAA 4UQOA 3NDPA 4M1MA 4PC6A 1UAAA 2GXQA 3ZVNA 1XMVA 4K8OA 3K0AA 4OI1A 2EWWA 2C9YA 4W5JA 2WWIA 3UXMA 4U02A 1FW6A 2VF7A 2P6UA 1OFTA 3K9GA 2G0NA 2FPKA 3AVWA 1GWNA 3CWQA 4LJYA 2AN9A 2HF8A 4AYXA 4US1R 3GCGA 4U5XA 1NLZA 3CRVA 1N6IA 5FPYA 4W5HA 4ILEA 2VSFA 1OFIA 2VHCA 1NMXA 5G3ZA 2XX3A 3BWDD 2GTPA 3THYB 4AURA 5BWMA 1KDTA 2X77A 4G5SA 1G7CA 3B85A 1HT1E 3O8RA 4CIDA 3QKTA 3LV8A 1Q1BA 4P4SB 2ZE7A 3T1QA 4PO1A 2D06A 3EC2A 3ZVLA 4OI0A 1II8B 4ZCMA 3EASA 3GJXC 1F6BA 4TL8A 1B23P 1T8UA 4MRRA 4PTLA 1ZW6A 1X6VA 3E2IA 4GMDA 1QDEA 4Q4LA 1XTRA 3U2QA 1KI7A 4AK9A 5EXPA 2WAXA 3KQUA 2OAP1 1TF5A 1ZM2A 3NH9A 3D6TB 4D4JA 1NNEA 1TAGA 3FMFA 2PMKA 3PUYA 2NZJA 3GQBA 4HAZA 2XITA 3KFVA 1NY5A 3PR1A 1BIFA 2GJKA 3GEEA 2FE4A 4Q9IA 4TMXA 1Z6TA 4DIDA 2BCGY 4PSKA 3A1WA 2JIZD 4GSYA 4NYMR 4BLPA 3GJ5A 4LRWA 4Y0AA 2ZJZA 1W0KD 3G5UA 2OBNA 4ZV4A 5F3WB 3EZ6A 1ZM7A 4ZDWA 4C0QC 1XB2A 2REBA 3QKSB 2H16A 4ZKEA 3DL0A 4NCJA 1WP9A 2X2FA 3QE0A 4E22A 2ZRBA 3BH6A 3SR0A 4G1UC 2ZE8A 4LC1A 1T0JB 3CPEA 2WOOA 4R7ZA 4O3MA 4L9SA 3IUYA 5SZIA 1AS0A 2Z43A 4KO8A 3TQCA 4QJ5A 4Q4AA 2CLCX 1XZPA 2BJVA 2WKRA 4IEEA 2W83A 1Z6AA 2W6ID 3HR8A 4URXR 2OCYC 5LB4A 3BB3A 2OEPA 3W6OA 1EXMA 2EFDB 3Q8XB 1Q22A 4XSGA 2RGNA 3L2OB 1R0XA 1DAHA 5KUTA 3CX8A 1NP6A 2D3WA 4A82A 721PA 4CVNA 4MYTA 1TQ2A 1N5KA 1WDTA 4GP6A 4A0FA 2QL6A 1QHHB 1UDWA 2CBZA 4JLVA 1AN0A 4ASUA 2CE2X 2JLQA 3UMRA 2YV5A 3AKEA 4B43A 1CTQA 1A5TA 4Q9LA 3BC1A 3K09C 2ZE5A 3CPJB 4C7OA 1RC8A 3VHXA 3A1VA 6Q21A 5FTKA 3DZDA 2IW3A 1XJ0A 3FOZA 2FN4A 2J0QA 4JSYA 2J87A 1W1WA 1WA5A 4I81A 3NBYC 3PFIA 4R71A 4HB3A 1W36B 1G6HA 2C78A 4NBSA 4LV6A 2AWOA 1GRQA 5DYIA 4DJTA 2NZ8A 121PA 1DG3A 2EQBA 2Q6TA 2A5FA 2GCPA 3N2EA 1YU9A 5JRJA 1E0JA 3WBJA 2VH5R 3O8BA 4KSBA 4ZDKA 2VHJA 1WQ1R 4MA4A 3EIEA 1BS1A 3NXSA 1EFRA 3IEVA 3B1XA 1MRSA 2LWIA 5E7IA 1UBFA 4N0DA 4Q7KA 4KYUA 2B92A 2QGZA 3OAAA 3PEUA 4LC0A 2FSIA 5TMPA 1DTSA 3WMEA 1ZU4A 5FBWB 4C0JA 4GDFA 1FMJA 1AZTA 3ZIAA 3VX4A 5HZKA 1P60A 1RYHA 1T3HA 1XEWX 1NKTA 2YOGA 3RWMB 1HYQA 2PL3A 3J81k 2FPMA 1U94A 2NO1A 5TARA 1A7JA 1QF9A 1VYVA 3A1UA 4S2EA 1E99A 1H8EA 3ZGXA 3KKNA 3QXCA 4RFSA 3IHLA 2C04A 3I32A 4G5GA 1VHLA 4TTQA 1ZNXA 1P61B 2EFEB 3TKLA 1EFUA 4HZUA 1FUKA 2BOVA 2ZYWX 2L0XA 2O8CB 1FX0B 1SZPA 1GVNB 1M2OB 2BM0A 5KSOA 2IL1A 3THXB 4FMDB 4CEHA 2KBFA 4LBYA 1KI4A 2FF7A 2WHXA 3V9PA 2QBYB 3G0HA 2ZRMA 2Z4SA 3FE2A 1XCMA 2VF8A 2WMOB 2ZRDA 3MMPA 2ZJ2A 2C96A 1SXJD 4LK2A 2W0SA 2ZRGA 2EFGA 5HPYB 2R62A 1FQKA 4W7SA 2GEVA 3W5IA 2QMHA 1T5LA 2YJTD 2H7VA 1U0JA 2IF2A 4WBSA 4URUR 5AK0A 3SNHA 1C9KA 5BYKA 2DFTA 1HY3A 3HJNA 1TL7C 3AF2A 1TQDA 1M34E 5FR1A 1Z0KA 4R2HA 1S4QA 1VYUA 3BIFA 4DLUA 2ZRKA 2QMUA 3NDBB 1R6BX 1YQTA 1KI2A 1S8FA 1Z06A 2WIBA 1CR0A 3QVVA 1SKYE 4UXIA 1N6KA 2EWVA 3NTUA 2NG1A 3L0IB 3X1YA 3CKLA 2PZFA 4FCTA 3GP8A 1AGPA 4JLKA 4ASUD 1QHYA 1UKZA 1MOZA 4LUCA 3K70C 1ZC4A 4NMMA 5EP2A 1T9HA 2FFQA 3RRYA 2W2VA 3BGWA 4EQ6A 2IS2A 4NYJR 1XTQA 5JSZB 3JVVA 2MSDB 2CCKA 3CBQA 2PCLA 1G21E 2ZI5A 3NHBA 1SXJE 1OH6A 4LPKA 1VDZA 4D25A 3KXIA 4X8LA 5CDFA 5IK2A 5J4VA 2CXXA 1W49A 3L8YA 2J59A 3AP1A 4YMTA 1P3JA 3S1AB 4TYWA 2PT7A 1VCOA 4Q7JB 2O52A 2REOA 4H9GA 4RCYA 4TT3A 1S3SA 3UMSA 1DAGA 2E87A 2OXCA 1F2UB 4MGKR 3MD0A 2KSQA 1XEXB 2ZAOA 3RSLA 3M4YA 1EFRD 3K8YA 3AV0B 1TQ4A 1OKKA 3FB4A 2WWGA 3CLVA 2A3RA 1XWIA 3NIBA 3LVRE 3TBKA 4DCUA 4HAWA 3T5DA 2B7BA 1ZCBA 3EA5A 5AJXA 2DR3A 4JVNA 4A8JC 1IONA 2KBEA 3ZIAD 2IWRA 4M22A 4DCNA 3OIVA 1U9IA 3GEIA 4JSTA 4FMCB 4LGMA 2VP0A 4TL9A 3MFYA 3BS4A 3A58B 4F92B 2NQ2C 3D31A 2HCBA 4F91B 3EPJA 1MV5A 1PJRA 3F0TA 2GILA 2GEUA 2Q3HA 4QXAA 3W90A 2PEZA 2ZVPX 5CITA 5L8VA 3IBYA 4ZI3A 3A1SA 1JNYA 3KUDA 3KX2A 1E3MA 3LY5A 3RS5A 3Q3JB 4DSOA 4QJ4A 4YONB 4LPSA 4B34A 3GLHE 2WJYA 5JJKA 4V0NA 4Q5IA 4V0LA 2CL7X 4KODA 1EFHA 3P32A 3AP2A 1JALA 3ZH9B 621PA 1OYWA 3OF5A 2GA8A 2FFBA 3F5FA 1XEFA 3K0CA 4K81B 1G16A 4EKDA 4UNSA 3GLIB 4DT1B 1EESA 1G4AE 3IO5A 3W6NA 1AS3A 4US0R 2AHOA 1ZM4A 2CHVA 3KKQA 4BGDA 1NN3A 3DMDA 2Q9BA 1CRPA 4GOXA 3A6PC 1WBBA 5KDLA 1RIFA 1QG4A 2J46A 5JWOA 1G3IA 2RHDA 2ZR9A 2YC2C 3QNUA 1JEEA 4Q4HA 3V4FA 1JPJA 3MUFA 4B2LA 5JCZA 3O8CA 1E9DA 2YVUA 4NPHA 2OFWA 4LBZA 5FFMA 4BASA 1YHNA 3BH7A 4JYCA 4ACAA 1E1RD 3AUYA 3PVSA 1S1CA 5EZ5A 1EK0A 4C0LA 2QT1A 4M0LA 3LBIA 4PFSA 1OXUA 3IIKA 1KDOA 2RMKA 4LOAA 3KB1A 3I73A 3EARA 2I1QA 1Q44A 4QHYA 4D0NA 4A15A 4OHXA 4HAVA 3AF3A 2DWOA 4OQMA 3ICEA 5EP4A 4Q4JA 1GDDA 1XFAA 4A6PA 2QP4A 5IK2D 4TTRA 1XDBA 4C7OB 4C9BA 2VSOA 1E2NA 1R7RA 1M7HA 2RGGA 1SVWA 4D80A 4PZZA 1Z2AA 3I5XA 4JLPA 5KPDA 1F48A 1P9NA 4XTRA 1OF1A 4MYHA 5SZHB 3SYNA 3LQQA 4FMCF 4DKXA 1ZM9A 4NE2A 5EE3A 4FI3C 2BMFA 2DY1A 2JLSA 2JJ1A 3W6PA 2F7SA 3VTKA 1RKBA 1LF0A 1ZCAA 2VP6A 4RD3A 2CNWA 2FFHA 4TTPA 4KFRA 2PLRA 4X8OA 1CULC 4L16A 4C0AC 2QRZA 2PZEA 4B3GA 5FUVA 1DAFA 1KI6B 1NI3A 3BAFA 1U8AA 4OJKA 3FHTA 4LY6A 1T8TA 2JAQA 2O0HA 4URZR 1G291 4M9SA 1RZ3A 3NC0C 2OLKA 4ZKDA 4BE7B 4JLOA 1KSFX 3OIWA 4OI2A 2BKEA 3LW8A 1T91A 5CDFE 4QKQA 2OCAA 4D6PA 1M8PA 5KSPA 5TV2A 1E9EA 4JKIA 2GCOB 4OBEA 821PA 1ZRHA 3I72A 1AIPA 1XU4A 5B57C 3U3JA 1RRCA 4HDOB 2BMEA 1LNZA 4IW3B 5A0FA 3BOSA 2FA9A 2IHYA 1IN6A 1CS4C 2QMOA 3R7WB 2ECKA 4TMWA 2Z0MA 4AC9A 2R6FA 3KXLA 2ZE6A 3N5CA 4G01B 5KNCA 2D4HA 1U98A 2FSGA 1R0YA 3WXMA 3K1JA 4HSEA 3CX7A 4OQXA 4PC1A 1XTJA 4I1VA 3VR3A 3TSWA 3ZS9A 4Q02A 1PZNA 3BORA 3QKUA 2DYKA 1D9ZA 1OIXA 3GLGB 3P4YA 5HE8A 1M1YE 4M1SA 1E0SA 2HDNB 4MGZR 3B8HA 3MWJA 3ONWA 4XTCS 3OIYA 5DI3B 3RRNA 3WRXC 4F4CA 1RJ9A 4AD8A 1AQUA 4JIMA 4M1KA 5G41A 3PUWA 4AKGA 1PLJA 1GKUB 1DPFA 2DPXA 2G77B 2ZRCA 4F4IA 3U61B 1U99A 4PXAA 3KJEA 4L8GA 3WRYC 1AA9A 4Y0VA 4EUNA 4D81A 1W5SA 3SQXA 3GJ6A 4M9QA 1YZGA 3H0KA 4YMUA 2IX3A 1SHZA 3CZPA 2VL7A 4OKSA 2WZQA 3RVBA 4JT2A 3ZLJA 2F1HA 4FN5A 3I3SR 4HLUA 1BKDR 1M74A 3RWOA 4PHFA 1KK0A 1NY6A 3EXAA 4A4DA 3IILA 3ZZTA 3FVQA 5IT5A 1QHIA 2GVDC 2IF0A 1LTQA 2QORA 4MKIA 2FEMA 5ANRB 3ZQJA 3ZD7A 2RCNA 3GEHA 3EC1A 4QGHA 5HKKA 3QVUA 3TE6A 2J0UA 5BN4A 1W48A 2P5SA 2WMNB 4Z1MA 1NF3A 2BEKA 3HU3A 4LBVA 2AK2A 1X1SA 2V8OA 4I99A 3UG6A 2XTNA 3I8XA 5L3VA 4GOJA 1NG1A 3LDAA 3NH6A 4EPWA 5GADl 2NMVA 1JBKA 3MLEA 3C16C 3UWOA 1P62B 1IY2A 4XVUA 3BK7A 4OK6A 4PQRA 3RAPR 3T15A 1W36C 1UDXA 2GJSA 4B44A 1E2GA 1B0UA 2IC5A 3U60B 3U44B 3PUXA 4IHQA 1IXZA 1WCV1 5DN6D 5G40A 1OXVA 2C95A 4RZ2A 4ON9A 5SZKB 2IUTA 2RHMA 3IEUA 4G5OA 4LJ8A 2QRNA 1BOFA 2I1VB 3A8TA 3AVOA 1UM8A 4HZIA 3VU9A 4PQFA 1VG0B 4ZO4A 3DM9B 2QT0A 3U6KA 1SVLA 1YR9A 1Q1QA 4PPQA 4OQNA 4A0RA 4ERNA 5JLJA 2H8KA 2Z5FA 1D2EA 2CMKA 5DO9A 1I2MA 1P2VA 2GEDA 3ETLA 3U5ZB 1TUEA 2V1UA 1E2MA 1XMSA 2G88A 2O5VA 2Z6VA 1HQCA 3M6AA 4IDOA 4M1OA 3WY9A 3HU1A 3KJGA 3LXRA 1E9CA 4F38A 4C0BA 1V43A 1T3SA 1RPZA 3B9QA 2ZSEA 4H1UA 2OLJA 4AY2A 3QPWA 2VQSA 3CUEF 3TAUA 1XP8A 1US8A 2ZJAA 2D7DA 5J47A 4C0KA 3X1DA 1KI3A 4HAXA 2ZS9A 1N6NA 3RLFA 4C4PA 1TPZA 1MABA 2BKUA 2DFLA 5K8UA 4DLXA 1ZMXA 5UKDA 1GNQA 2ODEA 1YZKA 3PIRA 1GRRA 1ONBA 2H18A 3QJYA 4M2LA 4PANA 4C30A 3SJCA 2FDCA 1S3GA 2JIZA 2FJUA 1PV4A 1W0KA 3VQTA 3QF7A 3LNCA 4QL3A 1IAQA 1I4LD 1JJ7A 3UKDA 4TYQA 3BFKA 2ATVA 3MAAC 3QG1A 4P33A 4RD2A 5CYPA 3ZDQA 3AF1A 1CP2A 3C8UA 2QPAA 3LA6A 3DO6A 1DVRA 1N6HA 1X1RA 2XTMA 4OQFA 4PAOA 5J4HA 3FMOB 3SHFA 4I4LA 5IF9A 4WZBE 2W6IA 2XB2A 2C2HA 5JECA 4KFSA 3I92A 3MGCA 4HEJA 1UPTA 3QOFA 1Q0UA 4MITA 2IYTA 1T5IA 1P7CA 1YR8A 3I5YA 1EFTA 2J0SA 3CX6A 2IEZA 3W34A 4AYTA 5BN3A 1TF7A 1UKYA 4I1OA 2ZRPA 2KJQA 1Z83A 2O8EB 4OQLA 1DARA 2J41A 4P31A 4Z1MD 5K8TA 5KNBA 3DVLA 4MYUA 4DWJA 3ECCA 3FWYA 3U3OA 4JKYA 4TSFD 1SVKA 1Z63A 3THOA 4BLTA 2O8DA 2PMDA 5B2ZA 1W47A 1XJCA 2QAGC 3UATA 1H8HD 5M04A 5D3MB 5GJBA 4BFTA 4DLTA 2OE2A 3ND8A 4L9WA 4PAQA 1UKVY 3AVPA 1IN8A 4MH0R 1KOFA 2ZYVX 4QGFA 4XIGS 3PITA 4BECA 4QM6A 4QBHA 2ZUBA 2ZVQX 1E32A 4RD4A 3GFOA 2B7CA 4FWIB 3CRMA 1IQPA 1OYYA 1NVXQ 1CLUA 3WHLA 4QBIA 1KTVA 2AXNA 1JI0A 3QUSA 2JASA 2YNMA 2XZLA 1SKQA 1GOTA 4I1SA 1ZIOA 4BLSA 1WRBA 4URWR 2FGKA 4JBWA 4D26A 4IEIA 4OI4A 4Q00A 5H1YA 3BE4A 1GNRA 2GF9A 2PCJA 1E2IA 5JFGA 4OK5A 2QY9A 4MKFA 221PA 2PJRA 1G5PA 2WJIA 3U7HB 4RJLA 1D2MA 5KSZA 3D8BA 4BZQA 1LF5A 4XVRA 1T0HB 4RFVA 4BUJA 5DISB 3NEYA 4DEXA 2ODBA 5C2JB 2ZRFA 3AH8A 2V3CC 4QFMA 5EXTA 1YE8A 4LJ5A 4QHSA 4HUQA 4C3ZA 1TX4B 1PUIA 4FIDA 4LHWA 4HLCA 4Q1EA 1I2DA 4WZAE 2QN6A 2ZPTX 4OL0A 3KKMA 4GPTA 3TUIC 5FOTA 4Q9JA 2X2EA 2IHBA 2ZEJA 3KQKA 3SN6A 2HCJB 3TRFA 1E2JA 4Q01A 4DCTA 1O3YA 1VG1A 2A78A 4M9ZA 5CK4A 2W58A 2B8WA 2ODWA 4TWZA 3AVYA 2QEQA 2PEYA 1EWQA 1SXJA 1HURA 1OXTA 1KNXA 4CEJA 2F55A 3KKPA 2RH5A 2XXAA 3U6BA 4D4KA 5ELXA 1G8GA 3M0EA 3U7FB 2DCUA 2ZU0C 4GBMA 4JLMA 1KI9A 3PV0A 4M1YA 1G8PA 4O0MA 4PC2A 4ACBA 4LBWA 4EPTA 3DKVA 3PENA 2O0KA 4D4MA 1FP6A 1KO8A 2BBWA 1XRJA 2H5EA 3W9YA 2BBOA 4YMSA 1KY2A 3T61A 1IHUA 1AKYA 1ESMA 5F2EA 4ZCIA 2IXFA 2OO7A 1NRJB 1K5DA 1U0LA 1EX7A 2EVWX 3C5CA 3U4QB 2Z83A 2RGNC 2ORIA 1BMFA 2DFKB 3THWA 4MGYR 3SYLA 4DCSA 3GJ8A 1KYIA 1SHKA 2XEXA 2EFCB 3IBGA 1E6CA 4M8NE 4IKEA 3CIOA 1JR3A 3RABA 3W3ZB 2AX4A 2J0UB 4MKGA 1GUAA 5BYJA 1T6NA 2OAQ1 3KJHA 4KFUA 4N0EA 5B58C 3IO3A 3HDTA 3ASYA 1N0WA 3A4NA 5AWFC 2FV8A 2G83A 2OSBA 3BFVA 2VPPA 3IIJA 3NEJA 2OFOA 2XNDD 4TYYA 4E09A 3BB1A 3B2EA 4K46A 1FPMA 3GLHA 3NWJA 4IOLA 4RD0A 3CRW1 2AD1A 3NHAA 5EP3A 1WB9A 1ESNA 2EYUA 5FL3A 3A4LA 4PPFA
chains in the Genus database with same CATH superfamily
3RRMA 4LF4B 3U48A 4HDRB 3AXSA 4JJ6A 2VRCA 4ZQCB 5EIAA 1VL8A 1KK3A 1ULZA 4AQYB 4I6GA 4MKXA 4HGYA 1NLYA 2XWQA 4FSHA 4ZTBA 1PG0A 3ZE1B 6REQA 1IM8A 1JAZA 2AFHE 2XQIA 3A04A 4HVAA 1GTZA 2WJAA 3CR3C 3D2AA 1YJ5A 1DBRA 1ESCA 2J5KA 2VWPA 4P4LA 4BTLA 1E2FA 1JPVA 4B47A 4PCAA 1HK7A 4NXMB 1H4VB 2JLUA 1D07A 1YK1A 4URVR 2CKMA 1W5EA 5DX1A 2CVHA 4BCBA 3O2SB 1P4RA 4B71A 3OLQA 3QFTA 4OM8A 1Q19A 4IVPA 2G1AA 1L7EA 1Z8DA 3N8HA 4UCXA 3TN7A 3WL3A 5IUJC 5CIQA 1RE1A 4JT8A 3W0LB 4EGJA 2IE0A 4DA0A 4D74A 2DHQA 2FKNA 3OQMA 5GJVC 2C20A 2TSYB 1J2RA 2H06A 5EGNA 3DDCA 4YAEA 2WAOA 4G0NA 1OIVA 3LFUA 3RB8A 5K3OA 2OBFA 1NNSA 2X14A 4AKSA 1THTA 2ID7A 2W9XA 5E4TA 1J0XO 4B7CA 1QG0A 1OXXK 3F5QA 3TZLA 1PFVA 4R6WA 1S01A 1QKKA 2X8LA 4Z3KA 1TM5E 1ZUHA 2PH7A 1DQYA 4UJ3A 5CLQA 3ZZMA 3E0QA 3EPKA 2FN7A 2W2LD 4PFKA 3OTGA 3JVUA 4MA5A 1P8JA 4CI9A 1SOAA 3DXXA 2O7VA 4C7KA 3CVJA 4F72A 5B1YA 5KJCA 3N07A 4ZIRA 2OO3A 3H16A 4UZFA 2IV2X 3OZTA 2PLFA 4LYGA 4MR9A 4IYRA 5HM8A 2D8MA 3WKCA 4MRVA 4BDTA 2WTBA 3RYFA 1VE1A 4EZBA 4YWJA 4AUKA 1TEZA 3CLRD 1FTGA 2FFAA 4FDMA 1Y6ZA 3FETA 2QMEA 4G24A 1KHTA 1HL7A 1Q3KA 2MWMA 4J49A 4WLUA 3JQAB 3FMPB 3GLFA 2UXBB 1ZJYA 2FTKE 5L3QA 2VEDA 5DTMA 2HNAA 4WUTA 1B26A 4GL2A 2WILA 2E4UA 1C0EA 2QTNA 4C7BA 2B1GA 3JQEA 1BMFD 1FMFA 2R96A 2XE8A 3KKKA 3OIDA 4EYSA 3HDGA 1NMQA 3OLWA 4JA2A 3TPZA 3TQTA 1LX7A 1NUHA 2NZWA 1XMIA 5BN3B 1ISJA 4KV9A 3QEBZ 4RZXA 2QAGB 1NMYA 1S02A 1FTNA 3QENA 3LX5A 2RH4A 3PD1A 3I2HA 4JBGA 4WFIA 3KLNA 1JPUA 1RLMA 4KXUA 5AHRA 1YO6A 4YROA 4DCJA 2CLSA 3PRYA 4KQWA 4Q1AA 2BFWA 4ARCA 1GAXA 2VP2A 3CQ9A 2DWPA 1WP4A 1PWXA 1YZVA 1JA0A 3LUKA 3TLCA 4FWTA 3E58A 1KSGA 2VT2A 2ZROA 1WUKS 5AM3A 2OLEA 5J2UA 4HNTA 1EM8B 4TKZA 1CUCA 3UB2A 4XIIA 3VHLB 1OBOA 8AT1A 3MIZA 4WFJA 1P0PA 1F1JA 3JU3A 2XT6A 3RKSA 4ARZA 4H1TA 2IITA 2PO7A 3RC2A 3S28A 3LM8A 5EJIA 4BMOB 3IIEA 5LJLA 3V48A 4HZGA 4YYZA 3AB7A 3KJNA 4O2BF 1R4NB 5JMTA 1E63A 1YC2A 3OUZA 3AO0B 3A7EA 1T2FA 4O5AA 3UMYA 1KIFA 3P0EA 4BNTA 4INZA 5HSGA 3GX1A 4EW6A 1GPLA 3X1MA 3UWKA 5FI1B 5C3MA 4CIBA 2Y4OA 3FR7A 3FZYA 1DEHA 2X1LA 1R6AA 4RK6A 3UHPA 2OBYA 1BO6A 3K9CA 4FT4A 3LVFO 1J7KA 2GLTA 4HNVA 1V8BA 2GAAA 2J45A 1VL6A 3FZGA 1GV1A 1DCFA 3BMXA 1QXSA 2HBYA 3OJCA 4GVPA 1P7ZA 3IJEB 3PSAA 1IUKA 3AUFA 4IFBA 2WY2D 4WESA 3TW6A 1N77A 4Q19A 3KIPA 3PF8A 4UFOA 4ERXA 4YRNA 4I55B 4GI1A 4ILKA 2WVJA 4N3NA 5FT9A 1AOXA 3VMFA 1U9IC 4IBOA 3HUTA 2CVQA 1UXHA 4BV2A 3AGQA 3RREA 1IY1A 4ESOA 3GRRA 3MQFA 4PYKA 2I4NA 2ISQA 3DAOA 4PGFA 3ZUPA 4CN8A 1TUGA 1VB5A 4DABA 4RKRA 3T5TA 1RQPA 5DHFA 4DVJA 5K45A 1MC4A 4RA9B 3TWOA 1Z08A 1EFVA 2PKRA 4WOBA 1VSQA 1SKYB 3ODPA 2WQ6A 1MEEA 3DGFC 4HTFA 4L57A 4F11A 2YQ5A 2JBAB 3E9NA 4J1QA 5C31A 3IELA 3JYPA 1N4DA 3MS7A 4ESVA 2IKSA 1JKJB 3SHWA 5LBIA 2A84A 1GHTA 4PLPA 2N9UA 1HXHA 2R5WA 3GQBB 1JG3A 3ZU2A 3FG9A 4C29A 1AGXA 2ZS7A 1WWKA 4JL8A 4OU5A 5KYYA 4BFWA 4YDSA 2VXYA 3LLUA 2XMRA 4QOJA 4HJXA 1OI7A 5HIIA 2ZBRA 1I4DD 1B43A 2FUCA 2I8AA 4IIGA 5JAIA 3L0YA 4QLBA 3MCVA 1XK7A 3RHFA 1BGXT 2PV7A 2ZTSA 4O1MA 3FNFA 4XD2A 3L9XA 5JZVA 5LVAA 3JQ9A 3FM9A 4M0CA 2R1UA 3PXXA 3SVZA 4UNQA 3HU2A 3HXOA 3FYHA 5K3FB 5ALYA 5DYGA 2RG1A 3GOQA 3LYAA 4M1ZA 4B7XA 1OI2A 4GP9A 1KAHA 4IYJA 1TU4A 3ZV6A 4ZICA 1TLTA 3QX3A 3SZ3A 2FPOA 3WB0A 1JFFA 4EX7A 4WEOA 1RD4A 3TXYA 3CEAA 4D98A 1BCRA 1N25A 4E5DA 3T52A 4QDKA 2G40A 3WB2A 5K0LA 1Q74A 5KQPA 4YR7A 5CB6A 5EPUA 2EIHA 3JYLA 5ELLA 3G1UA 5FI3A 2JK0A 3RS4A 3J80A 2EEZA 4MV3A 4O4HB 5E2IA 1J24A 1M1NB 4EG0A 1M7BA 1A04A 3EGEA 4M1EA 1YONA 3LUBA 3ZE2B 5CEEA 3U4AA 3K70D 1RBQA 1JXOA 3VHXB 3D3QA 3GG9A 1ZD8A 5E38A 1UXKA 1QQBA 3TQFA 2D74A 3O26A 4PHHA 4JASB 4HRYA 1Q12A 4ZAYA 3LQ1A 2G08A 5G3YA 4CG2A 3SE7A 4MVJH 2R8RA 5C37A 3BE8A 2AEMA 2W6MA 1UANA 2IHUA 4YJ3A 4XWWA 2IPAB 1RI5A 1K8ZB 2X0KA 5L95A 4IDQA 2PKXA 4N5HX 5F7ZA 5KYUB 2IEGA 1P9LA 4RTPA 3KSMA 2O5CA 4TZ6A 3WAJA 2REXB 5BNTA 2FJ0A 4W8HA 1UKEA 3PEFA 4RPKA 3OVMA 1MVOA 5FL7D 4RSGA 1CR1A 4Z0TA 3NT2A 4UW9A 3V55A 4ND8A 4POAA 1MH1A 1F2TA 2AG5A 4GFDA 4JVSB 1E2HA 4DIKA 4Y2PA 1J6UA 2G9QA 3CPHA 3ONFA 5BOSB 3T9FA 5A4KA 3OICA 3PB3A 1NFQA 5IG2A 2E37A 1X1EA 4LRYA 3P20A 1JZQA 3QBTA 1ORRA 2WQZA 3C3CA 5A1JA 5IDXA 2YTZA 1LJ8A 1OYOA 5AK5A 2AF3C 3I30X 1VJ1A 3OE5A 2QLNA 1H22A 3JAWA 4B17A 1V7QA 4DLSA 4EPRA 3NBMA 4YRSA 1CYEA 2J48A 4F1JA 4X7RA 1JDNA 2ALJA 3IQGX 4CEIB 2ZIUB 3RT7A 3L7AA 3T3OA 4FDUA 1YBHA 1S4MA 4NFYA 4RIHA 5EXDA 5IDYA 5GONB 4UTZA 3WC4A 3FY4A 3RUHA 4IDPA 3WJ7A 4FB4A 1CUXA 2GH1A 3L3BA 4N9QA 2VP5A 2XJ4A 3I09A 4I50B 1QR6A 3VOAA 3DTTA 4O4IF 5A06A 1R0WA 3QM1A 3KTAA 4P4SA 2W43A 4QODA 4EMUA 3AHFA 4HSGA 3HWX1 3QF4A 5K3AA 3ET4A 1U0FA 2PMWB 1N0VC 3BXGA 1KDYA 2Z2XA 3NATA 5EJFA 3ANTA 3RVPA 1E5VA 3ZOZA 3IUEA 2WPNA 4CTOA 4Q47A 3MEQA 4X7PA 2OZKA 3BF8A 2C97A 2IV7A 1Z8FA 4URYR 2ODQA 4RQTA 3DP9A 2XD9A 4C5AA 1NBME 3SOZA 3DE6X 2C2WA 1GSHA 3LG2A 1HLPA 1OU0A 3UG7A 2QNRA 3EG5A 3GQVA 3AG5A 1ZD9A 3EW9A 3NBUA 1HFJA 3O4IA 3QWIA 5K3DA 3RUIA 2WWYA 3IDQA 5KTMA 2IXDA 5SYNA 3RFVA 2JLWA 4LI0A 1XD9A 4Y6QA 4QGSA 5GINE 4V24A 3URMA 1C1DB 1N7GA 3V7YA 3EWAA 5JAOA 4QEZA 3KR0A 3GIDA 4CKWB 2YIVX 1T4CA 1P3DA 2DUJA 1IY0A 1NN1A 3R5KA 4IJKA 4DRXB 3QLUC 1GRNA 5DLDA 2XODA 2CV0A 2PTGA 1LVHA 2XBUA 3CONA 3JQGA 2VTDA 1OLXB 3NEPX 4EQ6B 4GPAA 5LL6P 4PLHA 3M82A 2P9HA 1G19A 1LLCA 3WYNA 4LJLA 1V0JA 3NV9A 1C4OA 1P0MA 4LOHA 4XB6B 4NBTA 4N8EA 3CB2A 1BA2A 4OB8A 1WEHA 2GZ3A 2Q4BA 3LHKA 3S1SA 1GGKA 1VRWA 1QPBA 4FEYA 1WXGA 5BXQC 4MGIR 3HV0A 2E3JA 1A9ZA 4NPCA 3EYAA 3Q2OA 4P32A 4AG6A 1QAOA 4LZZA 1JDBC 4JX8A 3K0EA 4CM1A 3T5PA 1T35A 1H8HA 3R5TA 1FPQA 3IHWA 2D0IA 2YV2A 4J1NA 3E53A 1K7YA 3BCRA 1V8FA 1YE5A 2OWDA 2QKYA 3TNJA 3NHJA 4BO9A 2UXDB 1QBGA 2AOUB 4UHEA 1GKYA 2H2WA 4RMHA 5C4MA 1IDOA 4OLJA 1DO0A 4TL6A 3L6CA 2N42A 2X8AA 1ID1A 1Z33A 5CRIA 3EWIA 3LOUA 3TPFA 2A1IA 3FF4A 1AZSC 4D3SA 3USCS 2DUUA 1EP2B 2NZYA 1KOLA 4GLJA 4WLOA 4UTRA 3LC1O 4PG8A 3JS5A 1U0SY 5AUNB 1G7RA 1VHQA 3G0IA 2H3EA 2QTWB 4LDJA 2NVUA 5TGDA 1U90A 3F67A 2C4KA 3K16A 2B8TA 2BFDA 3RYHB 5JANA 3AUSA 4YI3A 5KTNA 1WUYA 1UZLA 4X8HA 3F8TA 1NPDA 2W8ZA 3E9ZA 4OA5A 5F5NA 4U2EA 1XCBA 4F6LA 3AKCA 4ENUA 2H5IA 1Z2DA 4CKEA 3I6ZA 2VCYA 3DNPA 1UBCA 2UXCB 1TT5A 2ZYDA 1LC0A 3CF0A 3FYCA 4LJSA 2IXGA 1JLLA 2R5FA 1OROA 2PO5A 2AW3A 2CDNA 3D3WA 3EZ7A 2HUPA 2AJBA 2WM3A 2X0NA 3LP8A 4PGMA 1TD1A 1B73A 3LK6A 1V2GA 4JP3A 4CKXA 2XBLA 2CFTA 3O95A 1IPHA 4RDXA 4BU1A 4EKIA 4DV2B 1HBJA 3JQPA 4UEOA 3R0QA 4WCFA 4O4LB 2JAPA 1NF2A 5CM8B 3L7NA 1CY8A 3PUJA 4UBNA 3T3PB 3IA7A 3JAKB 5JSYA 5T41A 4FR2A 1YHZA 3GJRA 5HFJA 3I5MA 1Q1NA 3CISA 3CSSA 4CRWB 3ACCA 4DDWA 2HNBA 3W4IA 2NUTA 2PMBA 2XADA 4HDKB 3TG2A 1A5SB 4G26A 4R8VA 3ASVA 4UD2A 4UBMA 5DHPA 2ZI3A 1E7YA 4Z4GA 5F2NA 2OBMA 3BMOA 3B1YA 4ZTUB 1JR4A 1FX0A 1O94A 1P1FA 1X92A 1ZU5A 4UEQA 2X6QA 4Q4HB 3TGPA 4L9AA 2XJ9A 1KE1A 4ENSA 1RWWA 5BW4A 1Y7IA 2W6NA 4QXPA 4EW2A 4QA9A 1A8QA 2P4UA 3QU5A 2ZTLA 3ZD8A 1NXXA 1WTAA 2B8NA 3PI7A 4V2UA 4OREX 4GKVA 3COPA 1RMQA 2GLUA 1YIOA 1J22A 2J4CA 3II6X 3LQ2A 1ZIXA 2RKWA 4LSWA 1CUEA 4MKRA 4UBKA 3RTDA 4G5HA 3NIWA 3D0KA 3ZCSA 5I01A 3AOGA 1AZWA 1XQVA 4YP9A 4LZOA 1H85A 2VT3A 4WBNB 1AHIA 1BZYA 3FOFC 1XPUA 3WNVA 4G0YA 2SCUB 3VR1A 5SYMA 5KX5A 2J0EA 4UUBA 3RW9A 2PWPA 2IU4A 2OTCA 3AERB 4X97A 4Q4JB 3W2GA 1OY1A 2YHIB 4D5GA 1M2JA 2NPIA 1DHRA 4PYNA 3UMGA 3LUCA 2L18A 3CVOA 4JJZA 4DSZA 3QVMA 4ZCRA 1Z56C 4YT5A 5AJYA 2G9RA 5HTOA 4YXFA 5EIXA 4URFA 3V4SA 3Q0IA 1YQQA 1BRTA 3P27A 3WWDA 2YC4C 4D1YA 2VDQB 3O8NA 5DEOA 4DAEA 2YMPA 4K6GA 4PGGA 4YR9A 1SK8A 2X86A 4A1FA 2I4OA 2NX2A 4UUPA 3T3IA 2ZSAA 1WE2A 3SF8A 1RRGA 3C45A 1RAHA 4BQNA 3A1TA 3V1LA 2ORYA 3ZR4B 5HXAA 2ZTMA 4LYHA 3NIFB 3KPVA 3RKRA 2ZXUA 2QVLA 3SQOA 5ADVA 2IS1A 3ZHVA 2PUBA 1U2GA 5J4LA 2G80A 3IP5A 1SUBA 1IY8A 2BT4A 3CM0A 5GIPE 4YQZA 5MHTA 4G1FA 2DAPA 3SD7A 2PH3A 1M8FA 2D5IA 3WWYA 3HLYA 2V7WA 3A9SA 5JRDS 5KNLA 2R86A 2DERA 1HG0A 2P6OA 3C97A 4UUOA 5EIWA 2JGEA 1NG9A 4CIAA 3AF4A 3AZPA 3HVHA 4YI5A 3RODA 1E2PA 5AKGA 3S1AA 2YNMC 1GG9A 4IXMA 2H1LA 2I3BA 2J09A 4FNOA 4LYEA 2YZ7A 4TWJA 3ZBTA 4AZWA 4D44A 4U7DA 3UY4A 4CNQA 2TMDA 3KB2A 2FSFA 2D7JA 2YJ5A 4ODIA 5C1DA 1RPJA 1ZSNA 4F2WA 3AVVA 4XJTA 2M1XA 3C3PA 3ORHA 4JBHA 4Z4HA 4NCKA 1R6UA 1G3QA 2Y8EA 3HKCB 4H4EA 4G97A 5F12A 1ZJ6A 2EBWA 2Q21A 1FFHA 2JLYA 2VA9A 2VTEA 1HT3A 4Q1CA 4YRKA 5EJ9A 5KYXB 4G4JA 4DUGD 3EJ6A 1GAJA 3L82B 3MWDB 4DNPA 3UK2A 4GUDA 2YOFA 3EIQA 4PZUA 3K5IA 2IIVA 4EYEA 1QP7A 4I9GA 4AZ0B 5JNVA 1PWHA 2RB4A 3TZCA 3MSCA 3TXXA 1W0JA 1KZGB 1G7SA 1QG2A 1H9CA 1FTSA 2AC7A 1AQ6A 3CNBA 3K1AB 1B41A 3M3DA 5EWJB 3SQWA 5LD2C 5IKPA 3NR2A 4XDZA 2VF4X 3SYKA 4TUYB 3TLZA 4BO5A 5C5DA 3VKGA 2RGDA 1XO1A 1EFDN 1NI4A 4ZARA 3B3FA 1NXSA 1W581 3SYRA 5KREA 1TECE 1AJEA 4NV1A 4CUKA 4PN7A 4P4UA 5ALIA 1NZJA 2GEJA 3PU6A 1M67A 1YJXA 4QYIB 3TTSA 3C0KA 5JAZA 2ZULA 3GBVA 2CY0A 4GLFA 4RNDB 3VM6A 4D9KA 1R9NA 2HL6A 1A1SA 1Z47A 5DBFA 2YYZA 4Q48A 1LNSA 4OFXA 3AVUA 4X92A 4A2PA 1MJFA 4D8VA 2X4DA 3F8WA 4WKBA 2HT6A 2WYIA 3EZ9A 3MOGA 1Y1PA 3HDQA 3OU6A 1Q7RA 4JJEA 5ES4B 3GG2A 5LKRA 4NQRA 3ENQA 5CJ2A 2FPPA 1HSZA 3HA3A 2O8BA 3FKSD 1E0DA 3REQB 5HHTA 2GN4A 2WP8J 4M9RA 5HRUA 1VJGA 1G5TA 2FMHA 2OZEA 3A6EA 5K3SA 1Z3CA 5HGJA 5KU7A 4R2KA 2FFRA 3TUZC 5IPFA 2XI4A 1NE7A 3ZCRA 4R3WA 4ZCQA 2QUZA 1GD1O 1NVVR 3TTTA 1NFFA 3H5VA 3OZXA 3P9XA 4P2BA 4AKIA 4KWHA 3WADA 4LJ9A 2IP4A 3ZWNA 1R4MA 2RSLA 5JV5A 3AUAA 3U4HA 5MGBA 3LX8A 1RAGA 5K0FA 4E5MA 1USKA 3NBQA 2LCQA 4UOZA 2ECOA 3TM5A 1RWNA 4RD1A 3T9BA 2BDTA 4P81A 1WCIB 4EJ0A 3NGLA 2I91A 2XA2A 3ED5A 2ZB4A 2EDAA 3NHPA 4FFBB 5EL0A 3S7TA 2JKYA 2XW6A 4G8CA 2ZANA 1JDBB 3N53A 4RJ2A 2CEAA 2B21A 1KZ7B 2CWWA 2R85A 4QQNA 1AA6A 3EGWA 1JMVA 2IHVA 2WPDD 1L4GA 3E8XA 2Q0SA 1A2BA 3T3DA 2X8WA 3LQ4A 1G9XA 1OH7A 2H1CA 2I7TA 1EM6A 3A9CA 1FS5A 1FFXB 1JZSA 2ZYUX 3BULA 3N70A 2Q5FA 4DS3A 2NYAA 3DT8A 3K1ZA 5B6PA 1QANA 1H2HA 3M6MD 2OM2A 4Q9KA 4DCPA 5KTTA 1CF4A 3FOCA 3MMXA 3QUTA 4ITRC 3FPSA 4C6TA 3O1LA 4KP7A 3UHJA 4FCWA 1OZFA 5KIAA 1ISSA 1OAOC 1A8UA 5REQB 2YASA 1JDZA 1V1MB 1ABFA 4CV3A 1G41A 3BWEA 1UBGA 3GGGA 2HQBA 3PNKA 1SJ9A 1Y7LA 2NO0A 5GOZA 5A7GA 3ZTYA 2VHYA 1BD4A 4O1HA 1SBTA 5K4AA 4HX2A 4YFYA 3RCBA 3RQSA 1Z9BA 3MM4A 2ZIZA 1I4WA 3C7CB 4HX9A 3E5HA 3PICA 2CKDA 2GO1A 5AVOA 5HCIA 1CQPA 3G0DA 5IYZF 4DREA 4EB0A 4FBLA 3E7XA 4OHZA 1YVDA 4IMRA 4L4RA 4U6QA 5D86A 3AB3A 1YZUA 1QDLB 3QP9A 2Y1DA 3AM1A 1KI6A 3RT9A 4BJ5A 1S5PA 3OTIA 3W9BA 3EDRA 4ER5A 2QLLA 2REQA 3R20A 3NV7A 4LZLA 1R8XA 4BO1A 1B8PA 1E1DA 3GP3A 5EP1A 5AOAA 4JI2B 3K31A 2GFIA 3RDPA 4RHFA 5JPCA 4GC9A 3W06A 3S6JA 4HWKA 4WKOA 4XX0B 4PO8A 5JNSA 3DE1X 2I7DA 1F4PA 5H4HA 3SE0A 1TYZA 5IKOA 4S1NA 4ALNA 4AI6A 1ECJA 3W1EA 4DLYA 5FPTA 3ZHRA 3ODGA 2YCBA 2J1LA 1BDBA 3KJXA 2TRSB 4E5SA 1DAIA 3ZE6A 1WXWA 3QLTA 5T57A 1QIGA 1H65A 3GMIA 2BFCA 5GTDA 2IYXA 1DMRA 1XTTA 2J4FA 2JGDA 4FJ1A 4E46A 2ZUDA 5HKBA 3TIIA 3EBOA 1GTSA 4RYLA 2KHZA 2WR8A 4BNVA 2QW0X 3KR1A 5HIKA 4G5RA 2R65A 3UJBA 1B42A 4PSDA 3SM9A 1PGQA 4ZCPA 1TZKA 1VJTA 3PJGA 1NM5A 1OD6A 4GP7A 3FSEA 2ST1A 3K94A 5KTKA 2PS9A 1BEZA 1FTWA 3L0SA 2HEIA 2HYDA 3GFTA 2XMZA 3ND9A 4R7GA 4B82A 1R74A 4COOA 4BMCA 1FJGB 1WHSB 1J25A 1LWNA 4RABA 2RHWA 2VWHA 3ENVA 1GT6A 3BYZA 1IBLB 1DRUA 3DMGA 4BGVA 4XXHA 1LSOA 3BFPA 3I61A 4KAFA 5DI3A 4AICA 3V00A 3DMFA 4DBLC 2A6PA 4LE2A 1WSWA 1GAEO 3NRBA 3WLAA 3C15C 5CT8A 3HP1A 4E5VA 4EIWA 3H17A 1J99A 2VT7A 5MFPA 3AYXB 4ZP1A 3BSYA 1XZAA 1OVMA 4NIMA 1KYVA 4KOAA 4R68A 1OZAA 1KSJA 1N1GA 4QG7A 1TC1A 3L05A 4CCYA 3JTEA 2XEDA 4NYIQ 3X0DA 1NXQA 1VIYA 3FDXA 2F6RA 4Z51A 4PO3X 5EWLB 4EGCB 2QD4A 3L7OA 3LBNA 3BJEA 1ESEA 3MNFA 4BY9E 1VZ2A 2QX7A 4BLQA 4G0OA 3S2EA 1ENZA 1XOIA 3C5VA 5IMBA 3FCAA 3HVUA 1JV2B 1L5YA 1ACLA 3EVBA 2PZBA 1SCNE 2O20A 4EUSA 5FORA 3VU1A 5HCNA 3HRKA 1KH2A 2ZREA 4AG5A 2ZU6A 4JJFA 1MFZA 1UOEA 3ADOA 4KN9S 3AHHA 4YB8A 4B3JA 3UJ9A 2AFVA 2AI3A 1M2EA 3UFXA 1DQNA 1DAMA 1ENYA 4F3TA 1A69A 1FOEB 1I4TD 1YDHA 3GLKA 3IUBA 2W5UA 3NP9A 2RGBA 2O0JA 3VGJA 5EIBC 4A5SA 4CFSA 3NUQA 3ETEA 5FWYB 2ZR7A 5LDDC 2Z2IA 3OQIB 3IESA 4M87A 4QU9A 1TF2A 1XUOA 3HJFA 1RFLA 4PPGA 2QUIA 4TMYA 1VMEA 4WD3A 1JE0A 3AF0A 4FD2A 2ZP1A 3I37X 3TRHA 4CF4A 1PV1A 2OVFA 4DPMA 2J9FA 4JUFA 4W7HA 4R54A 4CLEA 1RTKA 4NFSA 4Q1VA 3M6IA 1IB0A 2JW5A 3ZPXA 2R60A 5DU2A 4GGPA 4FOSA 1HQDA 4F5WA 1M9NA 3OJXA 3PYXA 4P0TA 1L1RA 2NIPA 2ZI4A 4G2NA 4AX4A 5F9HA 3FDIA 4QU0A 1CWUA 5BMVB 3U1VA 4C4OA 2IBTA 4R8MA 3EGXB 3GNQA 3TLXA 4EL0A 5AT1A 2ZCUA 4B3HA 3DOJA 3BHJA 4PR0A 4GSLA 1G6Q1 1LFDB 1KO7A 1LPSA 3CT4A 5FJIA 3WS7A 4EEXA 2BH2A 3S4YA 2NTEA 4CQJA 3GH3A 3TMYA 3C5HA 2XWPA 2P79A 1C3OB 1VBFA 1W2GA 2Q1UA 1YSCA 3NKFA 4FE7A 5G0UA 4YPVA 2K87A 2FP3A 1CB0A 1Z3IX 5TC4A 4CCSA 1T13A 2VYND 4LISA 3ZLVA 2XOKA 3WDLA 1QTRA 1TO1E 2OHFA 3B9PA 3HZHA 3L6BA 4M7OA 3FCOA 4Q05A 5ULLA 3TIFA 5FV7A 3WZLA 4AJPA 1NW7A 1K88A 5BR7A 4QUJA 1WPGA 4CEJB 2EXXA 3PD7A 2P78A 1I51A 5HA5A 1RQGA 1AG9A 5DM2A 1Q7TA 1EG2A 2CWDA 1MB0A 2BE9A 4QJ3A 2VHTA 2Y1FA 2GKSA 3FWHA 2WWHA 4DZZA 1L5SA 4QE3A 4BV3A 1KBOA 3HWSA 4BNLA 1FS4A 1E3TA 1UC4B 1G66A 3JQ9C 2HK9A 3OEEA 1RP7A 3REGA 5JMWA 1YOVB 3U4IA 4TV8A 1VI5A 4EMTA 5F1YA 4O4IB 1R8QA 4MQBA 3E3LA 1SBIA 1N6OA 1DQRA 2QT9A 4IEFB 4PQYA 3IR6A 3U5TA 4NBUA 2BFMA 4BQFA 4JI6B 1NXWA 2H1IA 2XZTA 3L4BA 4QPCA 4I8XA 5FPHA 3FGZA 1O95A 2G09A 3GZ4A 3M70A 1BVUA 2JGAA 5FFFA 2WJWA 3EEQA 3UICA 1JKFA 4R40A 4I6EA 1SN7A 4D46A 3QIVA 3U81A 1BJTA 1DS6A 2GAJA 1U04A 2IYZA 5LA6A 1WW8A 2HXGA 3PCRB 1UWLA 3W7VA 3WGMA 5F9FA 3OE4A 2EYQA 3BIXA 1II9A 4OYRA 5CFPA 5TS3A 3ZIDA 1Y81A 4EGFA 2AKYA 2GK7A 2IT1A 2NU6A 2P6MA 2QP9X 2QTHA 2VRWA 5C53B 1ZIDA 2O7RA 4KZPA 2BIFA 5TDHA 1URPA 1ND6A 2NSYA 4IH4A 3NCTA 1RABA 3PR2B 2HM7A 3O3OB 3MQ2A 3IKTA 2RAVA 2P3SA 4DSUA 4HB0A 2IYYA 4H7PA 2GXUA 1DBIA 2E4YA 4K6HA 2ENWA 5AJZA 1N5RA 4HNUA 4J2HA 4Z8XA 5EXSA 3EYWA 4UU8A 1ZBDA 3HU5A 1QVAA 1KQPA 3F2VA 5HBRA 4KV7A 2FSVA 7REQB 2GPJA 4JS0A 2Y99A 2AMFA 4EF6A 2Q2VA 3D0OA 1SAYA 2VJAA 4UVHA 4Y30A 2GTIA 4MJXA 3V46A 3WVNA 1BH6A 5A5GA 1E3SA 4R5HA 2V4ZA 2XUDA 3VOBA 4WKNA 2AJ8A 4FHEA 2NAPA 3WLFA 2OFXA 2OV1A 2MSEB 3JZMA 3R0IA 4B3MB 2ZZNA 3IBCA 2V0CA 3DKPA 3HADA 3Q4GA 4JJ8A 2ZRJA 1P9RA 4DCMA 5FH9A 2YXPX 4AF8A 5EE9A 3F97A 1EJ2A 1T8RA 4JJ7A 3T5CA 3KALA 3WLJA 4WXRA 4B1FA 1AB6A 1SD1A 1KETA 1S9HA 2GBCA 4JC8A 2OCPA 4KNYA 3REOA 1U7HA 3JWIA 2ZBVA 1UK8A 4INJA 1GILA 4ADSG 3AF6A 2SKCA 5DIZA 3ZUGA 4ZJPA 2IRWA 2GHTA 2DC1A 1KXZA 1RW4A 3WNBA 1QYDA 3RAGA 4C4XA 1RRPA 1WABA 1WKVA 1XVTA 2RJNA 2V97A 3AIIA 5JDIA 2OCLA 3RJTA 2SHKA 1TIBA 1IXKA 1X42A 3EF1A 3F6SA 3OZDA 5TVKA 3AI2A 1QH0A 1J56A 3MJFA 4YJHB 3H99A 1C7RA 2Z04A 1NNLA 2OV4A 2P6NA 5EJ6A 2PG3A 5AK6A 3IPXA 5IVDA 4B48A 1ZINA 1O58A 4XYBA 5CXUA 5EJEA 4B7AA 1S8AA 1Z8HA 3E5MA 1KWKA 3ME5A 4PZYA 3ABZA 2QENA 3K9FC 3KQLA 1MNAA 2EG9A 3TTUA 2V9PA 5DK4A 3A7DA 3WGTA 1G63A 2BM9A 3Q1LA 1N7JA 2V6BA 2CB9A 3WICA 3U62A 5LU9A 4TXLA 1YDEA 5HR5A 3UH0A 4X6XA 4XLLA 4BYMA 1M3SA 3I8SA 1GIAA 2GM4A 4RKQA 1E5QA 4MV4A 1UXJA 2FYTA 1LTKA 3MAGA 4DR2B 1XZDA 2AG1A 2AUNA 3UT0A 4ZIRB 2QU8A 2IPXA 3OEED 3PFKA 4UNIA 1XSEA 1ZKMA 4MR9B 1Y6JA 4YCBA 3TSCA 5B2EA 3ZXUB 2ZT5A 1NBEA 3RYFB 4BGEA 1K7SN 1QH8A 1JJIA 1FZQA 4BE9A 3GJ0A 3L8GA 4G25A 1BMQA 3WRXA 3GLFB 1RIIA 4GZLA 4JJKA 5L3QB 3EMDA 2FZ4A 4P80A 2A1TR 3KUKA 2JFOA 3VPAA 5KOHA 2JB9A 1W19A 3Q98A 4ENVA 1EDOA 1SUAA 4JP1A 2XMPA 4LWQA 5L9AA 3R3UA 3HEAA 1YZLA 2IGBA 3O03A 2OD7A 1G2QA 1M54A 2QRVA 5EUMA 3OX4A 4RORA 1HMPA 4KQXA 3HLKA 2R7AA 3JQBA 2M6KA 1QZTA 2ZUFA 3RE1A 2H4ZA 2JDIA 1U1CA 1P7PA 2FCRA 4KOEC 4D92A 3K70B 1IK6A 1G20A 2NSLA 4JI7B 4AZVA 1NUSA 3IE2A 5ALSA 2INGX 5ERXA 3ILVA 3LECA 5J2UB 2OY0A 2ET6A 2OYCA 4CODB 5P21A 1Z5GA 5B36A 2ACVA 1IQ0A 2PJUA 1B6TA 2Z4RA 2ZRHA 3BXEA 5C1BA 3KZVA 3UTDA 2ISCA 2O4UX 3AHCA 4JYBA 3GT3A 3KVVA 4TMVA 4DSAA 5FJJA 3RPEA 1XZCA 2BD0A 1GQYA 5D5PA 4RY8A 2B61A 4N0PA 2MYTA 1JP7A 1XA0A 3OU7A 1PKXA 4G07A 4E32A 2C9ZA 2RGXA 3AP3A 1X7GA 2HSZA 2X1VA 5E8RA 5EINA 5K0TA 2QVGA 2VHQA 2QIPA 2YV4A 1E0AA 1OHHA 1UJ6A 5DM70 3KETA 1JSCA 3GB9A 1EG7A 4W1QA 3EQZA 1RPTA 4WESB 5IHXA 3B5JA 1PEYA 3X1KA 1ZH8A 3N0RA 2PRKA 3IAAA 4FONA 4A8JB 1CF2O 2PX3A 2CMDA 3ORSA 5AW4A 4MW1A 2PANA 1AC5A 1FQJA 4EA8A 3T4PA 1AUOA 5DT2A 5BT9A 1RADA 2QAIA 1RAFA 2VP9A 5EKTA 1GL3A 3T12A 4G89A 1I0ZA 5CVEA 1RJFA 4JVOA 5F33A 1CV2A 3VYTB 3KELA 4GYWA 4RTQA 4D0LB 4OHWA 2ZATA 4P3PA 4MGEA 3IMCA 4Q3AA 3J81A 1R16A 4GM4A 4HTFB 4J1SA 5IJAA 1GZSA 1HKUA 5CU7A 2PZLA 2VXCA 3P0IA 4RKWA 1PFKA 3LBHA 3Q85A 2AXPA 4LW8A 2QIOA 3THRA 4D9JA 4IDBA 3EDOA 4ZOCA 1R37A 1RM5A 2IX9A 1GTVA 1JMYA 4MVJE 2WSYB 2IZZA 3OD1A 5TGTA 2GPAA 3ZEAA 4Z54A 3QG5A 4WCFC 3MTDA 4GBGA 3D3EA 3KYDA 3RRJA 3T99A 1EQUA 1QK3A 2R68A 1MORA 2W7TA 4GOOD 5DLQC 2R7MA 4ALLA 1DLJA 1SK9A 2A0UA 3HQ4O 5C7YA 4PCVA 5D1HA 1LFAA 1EJ0A 3F3YA 3HA5A 4B6FA 4B76A 3N2KA 5KU1A 1TCBA 1UUFA 2JGIA 4L8FA 4H08A 3I2JA 1IJEA 3LF1A 4BFVA 3KTFA 3LWNA 1YB7A 2Z9CA 1JJVA 1EP3B 1NQAO 2IGTA 1L5GB 2BTQA 1GM5A 3C3JA 4QM7A 1F8XA 3NNNA 1O94C 2A9OA 3N6VA 1C9DB 3NHRA 4E14A 1PL8A 1WZIA 4HDNA 1GP2A 1WCYA 3H04A 1BCRB 3CX3A 3K2IA 1KDZA 5CA1A 2HXSA 3DDNA 3MILA 4C4TA 5AFSA 5G0SA 1MV8A 3WLPA 4CQNA 3U40A 2VAMA 3O93A 2RGUA 3H1EA 1G3MA 2QAJA 4NE9A 3I9V1 1Y9AA 3BD6A 3PXCX 5AVXA 2FMXA 1POWA 3WLTA 5PGMA 6ADHA 1BVRA 5AJVB 1QHSA 1YZYA 4ZVTA 4B5LA 7ADHA 4R0NA 3SC3A 1HYGA 1HUQA 3WHKA 3NDIA 4C89A 5JISA 2A92A 4UJ5A 3EDYA 1VYHA 1L7NA 3WFZA 2GSDA 4LDNA 4BNWA 3HUFA 1Q2UA 2EZUA 2PSHA 3OFNA 4G0MA 4PV7A 3MWLA 3KSBC 1CJMA 4YJ3B 2PD3A 3HFGA 3KFXA 3RBVA 4GQAA 4KWEA 1XJQA 3R75A 3VFDA 3FWKA 5HQTA 5K8JB 1ZDMA 2JJ8A 4A16A 2VDJA 4J0HA 1C4WA 1MUUA 1QIDA 2PZMA 4PONA 2YH2A 1RMTA 2HNKA 1FFYA 3OU2A 4PX9A 2O3SA 3Q7QA 4IDGA 3FZEA 2WOJA 4EB6A 2IUFA 4MJ7A 2AR9A 4N18A 4EUHA 5JRZA 2VDWA 4YAOA 2ORWA 5AVSA 3C3KA 4ND8B 1F2TB 2DUNA 3TFQA 3L7YA 1T9BA 2A7QA 3EZGA 1XVUA 5AXAA 1DIGA 1KJZA 1TE2A 1TZBA 2VJNA 4MIEA 3ROXA 1U2GC 2A88A 2PUHA 3ZHOA 3CTMA 4F85A 1A0OA 3NDPA 4M1MA 2QB5A 1M33A 3HUDA 1UP7A 3DEIA 2W4QA 4BZWA 4DCOA 3K0AA 3EFOB 3CF4G 4OP1A 2EWWA 3ZBQA 2C9YA 3H2GA 5TEWA 4U02A 3WLQA 4CG0A 4TVKA 2VF7A 3IUSA 4Z4EA 2WIKA 3MS4A 3K9GA 1AK1A 2GR9A 1GWNA 2JKVA 1FJHA 4HP8A 2XCOA