2WMNB

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
179
Chain Sequence
b'SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
molecule tags Cell cycle
source organism Homo sapiens
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
total genus 56
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wmnB00
2PJRA 1C9KA 1WXQA 2IXEA 4DUGD 3A1WA 3QKSA 5HTKA 1MV5A 2FPMA 1VCOA 5FR1A 1NG1A 2DWQA 3LW8A 4XD7D 1E2PA 2VP2A 4IXMA 4P31A 1TUIA 4OHXA 2WV9A 4Q1FA 3WYAA 3LX8A 5GVRA 1KO1A 2GHIA 1E9DA 4U00A 5H8WA 4AURA 1XEWY 4L9SA 5JWRA 1MO3A 3ZS8A 2FSFA 1N25A 3C16C 3QI2A 4NZYA 1XEXB 5FUWA 5E7IA 1PUJA 1U0JA 1VDZA 3KTAA 3LBIA 4TYNA 3ZLJA 1FOEB 3KQKA 3OFND 2GJKA 4GP7A 5KDDA 2VSXA 4N3NA 1JR3D 4W5JA 2HYIC 2J7PA 2PZEA 1G5TA 4A0HA 3B9QA 2FFAA 2ZYVX 1IN6A 1BS1A 2J41A 4OKSA 4A2QA 1DAFA 4IOMA 3WMFA 4D25A 1NSFA 2O8CA 4N0EA 2WMNB 4FMCF 4M9SA 3DPUA 1S1MA 2ZPTX 1X8JA 3H86A 3SR0A 4YC7A 4KFTA 3ZGXA 2GJ8A 4EFMA 5J4KA 2D74A 3ZVNA 2VSFA 3TLXA 1P62B 1KAOA 1X8LA 4PZZA 2WICA 5IDVA 3OEED 1LV7A 1EWRA 2C9OA 3OIVA 1KMQA 1B23P 2A3RA 4IDOA 1W4AA 3KKNA 2ZUCA 4LJ9A 4OQXA 4XWKA 4FWIB 2JDID 2OCPA 3VX4A 3CX8A 1G6OA 2C03A 2VP4A 2W2TA 3TMKA 2IA5A 5AJZA 1T6NA 4Y0VA 4TMVA 4JLNA 3GLIA 4LJ7A 4S35A 1E3MA 2JJ1A 1XFAA 2H92A 2QU8A 4NP6A 1KDTA 1OH5A 4P4SA 521PA 4G01B 4MYTA 3MG9A 4HAVA 4ZCIA 1ZM7A 3KQHA 4EPWA 1OIWA 4DB2A 3P27A 3RS2A 5FBVB 1SKQA 1JR3A 1AZSC 4KLZA 1CR0A 2Q6TA 1T3LA 2R6FA 3CKLA 2J0UB 3AVTA 4K8OA 4QJ3A 2P0EA 2XGJA 2YWEA 2KBEA 1Z08A 1W5TA 2VIIA 3G5UA 2ZRFA 3H2YA 1Y63A 1LS1A 4Q66C 4WIAA 1FPMA 2AHOA 1RRFA 3PR1A 2QUZA 3TE6A 1FX0B 2ZXUA 4DB4A 4Q9LA 2REOA 4ZCMA 1YU9A 1XX6A 2ZJAA 3A1TA 4A4DA 4RVCA 3Q72A 1JPNA 1II8B 1LY1A 2EVWX 4YQFA 3OEEA 1TUEA 2YWHA 3CR7A 4KV9A 4RCZA 4LPKA 3MWJA 2Z4SA 4UNSA 2G77B 1TEXA 3X1WA 4KYIB 3RSOA 4UJ3A 2F3TA 5JRJA 2JLWA 2DYKA 2F1JA 2DY1A 4HEJA 4C0HA 4LYAA 4PQRA 4BLTA 1J70A 3PUYA 1IN7A 1IJFA 2DCUA 4F4IA 3KTAB 1C1YA 1DO2A 2WJVA 3CRMA 3LDAA 4DLUA 3VTKA 5F98A 2A5YB 1BYIA 5AUPB 4RD3A 2F9LA 4BRWA 5DGXA 2ZSEA 1QZXA 1W4CA 1KIMA 3RS4A 3HR7A 4I1VA 4XH9B 5D3QA 4BFYA 5JZVA 1P61B 3CF6R 4EPRA 3IPYA 5G41A 5DH9A 3OIWA 4B2IA 2IS4A 4QKQA 5JLJA 4DBLC 1ESNA 2B92A 1IXSB 5SZJA 2AK3A 4IHQA 2ATVA 2J7PD 4HUTA 2P6UA 3X1ZA 4Z1MD 4Q7LA 1ESMA 3EIQA 4DLXA 2YOGA 1JECA 2L0XA 4E03A 3KFVA 4NYJQ 3RRNA 2F9MA 2RAPA 4EJSA 4FWTA 1TPZA 3LXXA 2R44A 5GVSA 3PJRA 3BJIC 2VHQA 5AUOB 3SFZA 4HAZA 5JJIA 2YJTD 3A8TA 4R2IA 2FE4A 4OYHA 1SQ5A 2QM8A 1MO5A 3I72A 4QNMA 1G18A 4C0KA 2FEMA 2XX3A 1L2TA 2WJJA 5DN6D 4TQAA 3AVUA 2PJZA 5GJVC 421PA 4CDGA 3DMDA 3CF0A 5AK0A 2PEYA 3U2QA 2JLYA 5JS7A 4AYTA 2JLVA 2OV2A 3AKDA 2W83A 5DI3B 3UATA 1HEIA 2A78A 2KSQA 1VTKA 5FI0B 5CM9C 5J4VA 3BB1A 2XOKA 1OFHA 2CCKA 1SXJC 2J0QA 3EXAA 2AD5A 1W0JA 4IDHA 4BE7B 1WQ1R 4HUQA 2KJQA 4HLQB 4PQYA 3PEVA 3TRFA 3HU3A 2O8BA 5LBIA 4FMDF 1OHHD 3UG7A 1OB5A 1COWA 2GCOB 2WIAA 3ZZ0A 2GVDC 4LHYA 1E6CA 1N6RA 1Z6AA 1AKEA 2JJ8A 3V00A 3SBDA 1US8B 4V02A 2XTNA 4MKGA 3B8HA 5TV2A 2QPTA 4KJZA 1KSHA 4I81A 5CJ2A 3BORA 5F3WB 4EDHA 2GJAA 4M53A 3WYGA 1ZC3A 2YNMA 4MGYR 3RVBA 2WOOA 4URXR 4O25A 1R5OA 1VPLA 4LBZA 1JQJC 1S3SA 5F9FA 1RE0A 4X8HA 3X1YA 2IL1A 3R9WA 3MRSA 3X1XA 1DPFA 1NN0A 3IEUA 4IVRA 4BFXA 1IAQA 1QHIA 2XXAA 2RMKA 4FIDA 2K5UA 5DIFA 1SGWA 4UXHA 2A5JA 1KTVA 4LJYA 3DKPA 5CYPA 2AWNA 1FW6A 4DT1B 4DHEA 3QXJA 4JLBA 3A4LA 1DO0A 4XJXA 5AWFC 3AVVA 3AVQA 2DFNA 2ZS8A 1ZBDA 1RVDA 1YJ5A 2F55A 2AXPA 1VHTA 3VR1A 4IW3B 4RD6A 2ZI4A 5LPNA 3X2SA 4QGFA 4RY2A 3K70C 5AUNB 1Z29A 1CR2A 4RJLA 3L43A 1TEVA 5E7MA 5C4GB 3U4QB 3R7WA 4BLOA 3U3KA 4WAUA 1ZMXA 2WVJA 2PCLA 2WMOB 2IYRA 3EIHA 2P6NA 1MKYA 3K09C 2EFEB 3A37A 4M1WA 1GKYA 4DEYA 3BGWA 1MRNA 2AR7A 2YOHA 4LC1A 2CHGA 2IUUA 3HU1A 4FCWA 5KNCA 5KSPA 1RYHA 2ZS7A 4XD7A 1W4BA 1PUIA 2BIFA 3ZIAD 1NMYA 1YZLA 3Q5DA 4TQ9A 3P4YA 5FR2A 1UAAA 4BFUA 3K9LA 4HZUB 1KAGA 4EFNA 4HSEA 4LV6A 5EE3A 1OE0A 4DCTA 3RRYA 3LNCA 4ZDIA 2N46A 4LHVA 3WNDA 4YMTA 2G9NA 4QBFA 2OSBA 3TR0A 2GAOA 1P75A 2Z83A 1HUQA 2QM7A 3VNUA 2REBA 1XJCA 2ZAMA 2BEKA 4KU4A 3JZAA 4JYBA 3LH5A 4E07A 4JL6A 1N6NA 1ZNZA 1VCMA 3LD9A 3SEAA 1EX7A 2IYZA 4A2PA 1UFQA 3FYHA 4YLGA 2P5SA 1UKVY 2OG2A 1FTNA 4IRUB 4WZBE 4IFEA 1P73A 2RGBA 2X2FA 2C9YA 2WKQA 3A58B 4PHGA 3IBYA 3MCAA 4LV5B 4UQOA 1CLUA 5K8LA 1SVIA 2JJ2A 1E79D 1N5LA 2IXGA 5DI3A 3B2EA 4NH0A 2O8DA 1E4VA 1ZCAA 2ZJ8A 3NTUA 1ZCBA 3EASA 4AKEA 1S4QA 5F2EA 3NDPA 1KDPA 4A82A 3CRW1 2LKCA 4B43A 2PX3A 1J8YF 4ILEA 5FOTA 1N0WA 2D2FA 2G0TA 3W5JA 3ZQ6A 1CKEA 1XPUA 2D4HA 1WBDA 2PEZA 2P2LA 4U5XA 4C0QC 1DAGA 4Q5IA 1Z22A 3RLFA 1S9HA 1U0LA 1Z6TA 5FPHA 3UKDA 4ABYA 1AS2A 1WA5A 1ZNXA 2ONKA 4B2PA 2WPDD 5HE8A 2BBWA 3TIFA 3GLHE 4JVMA 1SXJB 1GM5A 2W2XA 4MITA 2QA5A 1OFUX 4OHVA 2J5XA 4CRWB 1N0VC 1R0YA 1W47A 3FMOB 1NY6A 4UNRA 4DSTA 4GMDA 2W6ID 2XSZD 4A1FA 1LTQA 3FOZA 5B64A 2I1QA 2NO0A 4GZLA 1KI4A 2ZVQX 4URWR 4DRZA 3DEFA 4V0ME 3A6PC 3B5JA 4C3ZA 2VO1A 2YWFA 4Z51A 1ZAKA 2IHYA 1KHTA 1TF7A 4HI0E 2HJVA 4Q9HA 4BZXA 4PQFA 1FZQA 2C95A 3AP3A 4DT1A 5FBWB 4LHZA 1N6OA 4NPHA 2WSSD 3I3SR 4OJKA 1GP2A 4LJ4A 2ASEA 2FFBA 1ZUHA 1HY3A 2PLRA 5EP4A 5CDFA 3AF0A 4BEBA 3VHXA 3LVQE 2PZFA 2FJUA 1AM4D 1IONA 4MYHA 1GL6A 3AF1A 1G8GA 4ZKEA 2BWJA 3PG5A 3KZ1E 2HXYA 3I92A 4PX9A 4W7SA 1P4SA 5HKKD 1E2HA 3F8TA 1VHLA 2QN6A 2Z43A 3K0CC 4NU0A 4X8LA 4CZ2A 5IT5A 1EFHA 1GL7A 4PXAA 4ZDWA 1GIAA 4DIEA 3TUJC 1W2GA 3KKMA 5DYGA 3PCRB 4JLOA 2DB3A 2VP5A 2NGRA 3VKWA 1XXHA 3WNBA 4B76A 1OB2A 1RW4A 4AKGA 1E2MA 4NBSA 2V54A 1J7KA 4GT1A 5FUVA 3RABA 3B85A 5FTLA 4CEJB 3KXKA 2LCFA 3AP2A 4IEEA 2GRJA 2VEDA 2IWRA 2WIBA 2ZI7A 2R2AA 2RCNA 1FQJA 1Z0DA 1PLKA 2WWYA 1NI3A 4PR0A 4Q4AB 2BBTA 2XSZA 3D7MA 4A0RA 3CRVA 3VR6A 4M1YA 4NONA 2AL7A 4BZPA 4CYMA 1E32A 4JVNA 1KSJA 4JT2A 2H5EA 1GRRA 4IXNA 3DZ8A 2A5FA 3W34A 1W36B 2ORVA 2FWRA 3RWOA 5JFGA 3QJYA 2VHUA 4TMWA 4P33A 3MAAC 1YVDA 5JECA 3NHAA 2NQ2C 3K0FB 2BEJA 4UKDA 2DBYA 3VR3A 4TT3A 1QHGA 1GL9B 5CDFE 3EX7C 1V5WA 3TSOA 1RJ9B 2VHTA 1TQDA 2EYQA 1KI1A 3U44A 4AKIA 3KL4A 3A1VA 2F1RA 1UEIA 4BRUA 1TTTA 1OH7A 5L3VA 2WWFA 4HATA 5DHAA 2XXAB 3IGFA 3CIOA 4GP6A 4B44A 2F43B 4HAWA 1NKTA 1WMSA 3C41J 1DE0A 1OXSC 5KSZA 1Q20A 2ZRHA 1BYUA 3CF2A 4W5WA 1WCV1 5E4FA 3DZDA 1GVNB 2ANCA 2QG6A 2MSEB 3BAFA 4KYUA 1U90A 4GOKA 4B2LA 2AFIE 1U9IA 3TH5A 1QHNA 1S3GA 3R20A 3ZVRA 5DISB 1NIJA 2ZS9A 3IIMA 5LD2C 4LK2A 3RS5A 4WXPA 1NBMD 4QC2A 2QMHA 3CPJB 1HYQA 1V43A 1JAHA 2FPLA 4HAYA 4LI0A 1E2KA 4Q21A 4ZCLA 2ANBA 4F92B 2DFLA 4LYFA 4NTZA 2CLCX 3HYTA 4J0QA 3T15A 1HQYE 2A2ZA 2BHRA 2GZHA 1YR6A 1FMJA 1F2TB 4US2R 2PBRA 1TQ6A 4PC2A 4RFVA 3E5HA 1SHKA 2QROA 3I73A 1I2DA 4F4JA 1BO6A 4Q9JA 1QHHB 4P4TA 1UADA 2IYSA 3KKPA 2HXSA 4MGKR 5AJYA 3B60A 2Q0HA 2BJWA 2VHCA 1YZGA 4EPXA 1XD2B 1KI7A 2OCAA 2HLDD 1JXMA 2GBLC 5FBLB 1XPRA 2ERXA 2PCJA 2BDTA 1GNQA 2QPOA 5CB6A 2OCBA 3I8SA 1BMFD 5CK4A 2G1JA 1G7CA 3FKSA 4AG6A 3M4YA 4NYIQ 3G82C 4ZO4A 2WWXA 1JR3E 1FQKA 2IBMA 4M22A 3U3RA 1L4YA 1VMAA 1T91A 5HCIA 1FP7A 2ODBA 1YZTA 3LXRA 1RC8A 4URZR 2EWVA 1K6MA 5DYIA 2ZSDA 1UKEA 1GKIA 3FKQA 2IT1A 3A36A 2WSSA 2VRWA 4N0DA 2IEZA 4BPBA 3GLIB 4KHZA 1A2KC 2XTMA 5KNBA 1AGPA 2ZUDA 4JBXA 1NMXA 5FBRB 4DIDA 3A1UA 3EA5A 3QF7A 4NCKA 4LHWA 1X3SA 4WXRA 4TL6A 1T0HB 4MUBA 1XRJA 2WAXA 3AKEA 1KKLA 4R9UC 4TMKA 4IOJA 4C0SA 5KPDA 2YC2C 1E96A 4YMSA 3PITA 2QAGC 4M21A 2G6BA 2J87A 2W0MA 3HDTA 4FMCB 2ZR7A 4P0TA 3SN6A 4ITRC 5TARA 4FW9A 1Q21A 4TQUS 4WBSA 1EG7A 4OK3A 3B78A 3CUEF 3ADDA 3CNNA 3C5HA 4AYXA 2EQBA 3CBQA 5ANRB 5FPSA 1XTSA 5JHGB 3EW9A 1II8A 3EZ2A 4D2IA 2KWIA 1Q3TA 2FOLA 1IN8A 3U6BA 4H9GA 1T5LA 3IHLA 5KNDA 1OFTA 2FZ4A 2MMGA 1KJYA 1G3QA 1DG1G 4CVNA 1E2NA 2RGXA 3MWYW 3T1VA 4C30A 4BLQA 3IIJA 1LNZA 4JMPA 3TUIC 1KNXA 2WWGA 5EXXA 5ELXA 5DE3A 5DLQC 1IY0A 4OQMA 4B74A 3EZ7A 1NSTA 3WHKA 2AXNA 2WOJA 1QHHA 1CJMA 3SI7A 3CRQA 2W2VA 4PSVA 4RCYA 4RFSB 4F91B 2H17A 3D3QA 4Z54A 2G83A 3K0AB 1G7RA 2R6CA 1EK0A 1MR3F 3EARA 3IPXA 4P4UA 4Q4HA 2CLDX 4CW7A 2XB2A 3QF4A 1IN4A 3MFYA 4ASUD 3REGA 3B1VA 4Q03A 1YZQA 5FH9A 1G19A 1S1CA 3A1SA 2O8EA 3GJXC 2TMKA 3M0EA 3CPHA 3THWB 3U5ZB 3BH0A 3VNVA 1G8FA 5JWOA 4JL8A 4A36A 1FL9A 4TLBA 4BFVA 4Q7JB 4B35A 1Z83A 3GEEA 2A7QA 4LDJA 2OESA 3RNLA 5SZKB 3K70B 2O8FB 1QF9A 2ZJZA 5DHFA 2FSIA 1Z6YA 1QHSA 2B6HA 4A92A 5CIQA 2ZYTX 4RZ3A 1ANKA 1AQYA 4IEIA 3HPQA 4X8MA 1KK3A 1OH6A 2IWHA 2AD1A 5C2JB 2A30A 2RGNA 3FB4A 5LD2B 3QXXA 1VG8A 3TNFA 3TW8B 1T3HA 2WJYA 2P5TB 4KI0A 4JSTA 3KFXA 1E94E 1GDDA 2HF8A 4RKFA 4IDPA 1VYTA 1AN0A 5L3QA 2RGEA 4G5RA 2GBLA 2VHJA 4NE2A 3VR4A 3SQXA 2JASA 3P20A 3FMIA 3O8CA 2WBLC 2VF8A 1IOZA 3FE2A 3NDBB 2R62A 4MUAA 3QKRA 1X6VA 4Q1CA 4QJ5A 2BKUA 3SYKA 2H8KA 2ATXA 1M6NA 1ODFA 5BYJA 5B57C 3R8CA 5K8UA 3PUXA 3B1YA 8OHMA 5KHOC 3SU8A 1XCMA 3B13B 3LRPA 4MYUA 3UWKA 3IDQA 1PJRA 3PUZA 2QQEA 2FFQA 4LX0A 4B32A 2SHKA 4XVUA 4AWXA 2YC4C 3BH7A 3W6OA 4V0MA 4FINA 5H68A 1JI0A 2BV3A 4HZUA 3UPUA 1OH8A 3FFAA 1GZSA 3LO5A 1UDXA 1UKYA 1F60A 4FXPA 3AKCA 3C14C 4LJ5A 1GG2A 5J47A 4H1UA 4TL9A 1H8ED 3D8BA 4DZZA 1EFUA 2HYDA 3QG1A 4K81B 4ZV4A 3IQWA 5EXPA 2QAGA 4QHYA 4TZ6A 4TMTA 2EFGA 2FNAA 2J9RA 3EWAA 5GJWC 2I3BA 2PLFA 4BLSA 5KDOA 4TYQA 2OAP1 2I4IA 3FPAA 4ZI2A 4MRRA 5FL7A 3N2IA 1OF1A 4Q4HB 4AIIA 1D2EA 4WZ6A 3OEHA 1VIAA 2B21A 5E95A 2H7VA 3WRYC 2GKSA 4DCVA 5KSYA 2OILA 1Z07A 1KI6A 2VLIA 1OW3B 1T8TA 4D81A 4YMWA 4PAQA 1Z6XA 5GADl 2ZRPA 3QKUA 5J4YA 1XJ0A 5C4MA 3I61A 1RIFA 3PQCA 4MGZR 4KCGA 2ZE5A 1TL7C 1P2TA 5LB4A 3GJ0A 1XNJA 2O52A 4EIWA 1W0KD 2NO6A 2VP0A 1MT0A 2X2EA 3QKSB 4HB2A 4TN1A 3TVTA 2V8OA 1R8QA 5KDLA 5AJVB 4MRNA 4XVQA 1PLJA 4HB4A 1HE8B 3GJ4A 4D26A 1HQCA 3HYRA 4V0KA 4JBWA 2XNDA 3CONA 1P9WA 3PV0A 1C4OA 2BCJQ 3IUYA 1ZD1A 4KBGA 1XTRA 3ZD6A 2OHFA 3U7FB 4JS0A 3O8DA 2W6IA 2HUPA 4C0AC 5G3ZA 2ZJYA 4PAMA 4TZ0A 4Q1DA 5C1BA 4V0NA 4B3DA 5L3SB 2YOFA 3IKJA 4BQSA 2OBLA 1N3BA 4JIMA 5EP1A 4A15A 2IXFA 4BFTA 1CF4A 4ARZB 1X1RA 2C77A 1E1RD 1VYVA 4QBIA 3PEWA 1ZM4A 2ZRJA 4EUNA 2OFWA 3EZ9A 4IDQA 2JJ1D 1G21E 3VMFA 3KKOA 4M1KA 5FL7D 3RRZA 2GZDA 3U7EB 4GL2A 2QL6A 3FWYA 1IXRC 4C0BA 3KB2A 2IS6A 2R8RA 2GESA 1LF5A 1KI8A 1JAIA 3K0AA 5FOUA 3PIRA 3SJZA 5HR5A 5KUTA 2JIZA 3QKRB 2HCJB 3PEUA 4TL8A 4DLWA 2CK3D 3TGPA 1XJQA 1W48A 1E9FA 4ON9A 4PZYA 5CYOA 4FMBB 3SJAA 3ADKA 3MWKA 4QG7A 3SHWA 5JI2E 3LLUA 1VIYA 1DARA 3L8ZA 4LJ8A 5JJKA 4H1VA 2GEDA 2ZVPX 1CR4A 3QXCA 1XXHB 4KVAA 5L8VA 4HZIA 4S2EA 3WY9A 4YMUA 1N5KA 1M7GA 2PMKA 3AB3A 5D3MA 1D8TA 1XTJA 4EAQA 5KYKA 1S2MA 1JPJA 2IUTA 2ONJA 2ZRBA 1E0JA 1UBFA 3GJ7A 5AJXA 4U7DA 3KQUA 4EPVA 3E2IA 3QBVA 4LJ6A 4F38A 2XZLA 1X86B 4HLDA 3H84A 4OQFA 2QAGB 2KB0A 1AA9A 4TTPA 4WW0A 1D6JA 1SZPA 1MABA 3BK7A 3KXLA 2IYTA 1B0UA 2ZIAA 4DKXA 3SOPA 4A2WA 3A4MA 5FOXA 1UM8A 2FDCA 1CIPA 4Q9IA 5GJCA 4JLVA 1OKKD 1ZJ6A 1GSIA 2W00A 1F48A 4I1OA 2C99A 2V1XA 3GJ8A 3OFNA 1TU4A 4UNNA 2RHMA 5FPYA 5KPJA 4G0NA 4DVGA 1T8UA 3RYTC 2QSYA 4L5BA 1AJEA 1DAIA 2OM2A 4NKRA 4KAXA 2Z4RA 4Q47A 4JLKA 2FSHA 3D6TB 3V4RA 2YWGA 1JBKA 1OLOA 3Q9LA 1F5NA 3QKTA 3GLGE 3GLFE 1ZM3A 1K5DA 2PL3A 3KKQA 2JIZD 2IS1A 2FZLA 4GDFA 4L16A 5K8TA 1PLLA 3D31A 2HDNB 2IYQA 2YYZA 3NH9A 1EGAA 4AKHA 1YZUA 1SVWA 5J5CA 4YMVA 4WVFA 4MKFA 4OI1A 5FI1B 4CEJA 3AH8A 2ODWA 2YVUA 2PH1A 3PFIA 5FTKA 5JRZA 3GEHA 3MUFA 1LS6A 221PA 2W58A 5G53C 3U3JA 5JCZA 3RC8A 1HE1C 1SVMA 4OL0A 1E4YA 1P9RA 1TQ4A 2GCPA 3LA6A 2FPKA 4YONB 4ZI3A 4AC9A 1QHYA 1KO8A 3IBGA 3Q7QA 4W9MC 4OI0A 2QAJA 4B33A 1Z0FA 2J45A 1XEFA 4C7OB 2XNDD 2JLXA 3KQNA 2VYFA 3MWLA 1VG0B 2WWWA 4NHOA 5EP3A 3THYA 4PC7A 1E1QD 5L3SA 2J0VA 4R2HA 2PT7A 4RZXA 1GWNA 4DEXA 3B6EA 2ZEJA 3OE7D 3DM9B 3EPJA 3CWQA 1OXTA 5J4LA 4QXAA 4XTCS 5DSZA 4GRAA 1OXXK 1YRBA 4C0LA 1F2TA 1S96A 2B8TA 1VKJA 4ASUA 1DAEA 3Q5EA 1E2FA 3SYLA 2R65A 4C0JA 1G5RA 2JA1A 2RGAA 4PZLA 1XCPA 1OSNA 1Q1QA 4LYJA 3TAHA 2C5LA 1T5IA 1COWD 4CEIA 1H8EA 1G3MA 2J1LA 2QGNA 2IYXA 2ZI6A 4Q4JB 4ERNA 3EWSA 4LZZA 5IK2D 2CHQA 3O8RA 1TAGA 1TADA 4EJSB 2A5GA 2R9VA 3GEIA 2XZOA 4QGAA 3ONWA 1VECA 3V9PA 4IFBA 1Q57A 1BOFA 5EUQB 1CS4C 4LHXA 3RC3A 5FPKA 4HB3A 2QQ0A 2B8WA 4LCBA 5JHHB 4MRSA 2OCYC 3UG6A 1E2GA 2XEXA 4NDZA 2H18A 2R6DA 1NN5A 3T35A 2BMFA 3QQ5A 1NVXQ 1U8ZA 5FOWA 2RH5A 1ZM9A 5UKDA 2HEIA 5P21A 3S1AB 2IX3A 4B3CA 4JKIA 1G3RA 5EXTA 4GBMA 2O8BB 2QGZA 4PHFA 3HR8A 4KSCA 1E99A 1LFDB 4YXWA 1LB1B 1R0WA 2MSDB 2V6IA 3DHWC 2QENA 5CIWA 1D9XA 4RZUA 1N5IA 2X8AA 4O2RA 4A0FA 2ZE7A 3FDIA 4DLRA 1SVSA 5EZ5A 2WAYA 3U7GA 3EIEA 4TYYA 3SZRA 1GNRA 1J99A 3GLHB 3WRXC 2Y8EA 3ECCA 3RDPA 4V0LA 3FHTA 4Q01A 1WP9A 2A5DA 2FH5B 2ZRAA 5FUYA 2ZYUX 2J3EA 2FGJA 4BLRA 1TX4B 1AZTA 3X1DA 2ZUBA 5BN3A 5JSZB 2WJGA 4DCUA 1DEKA 3BB4A 3RS0A 1PZNA 4B75A 1P2UA 2ZRCA 4ZDKA 2BBSA 1Q3HA 2QP3A 4QGHA 1U99A 3TVDA 1E2DA 1ETUA 1E1RA 4TTRA 2D7CA 2CL7X 2D3WA 3T1OA 1NBME 4DJTA 2N1BA 1A5TA 1G4UR 2EYUA 3FMFA 2FG5A 2ZU6A 1I4TD 2G3YA 3LQQA 1YKSA 2CDNA 2MSCB 2R6GA 3GP8A 2C96A 1IY1A 4UXIA 3AVOA 3GLFA 2XITA 1KOFA 2VBCA 1D2NA 2JLQA 3K9HA 3OEHD 4KFSA 4Z8XA 2E87A 1G3IA 3QNUA 4CF7A 1G6HA 1GFIA 1FNNA 3ADCA 4LV8B 1NMZA 4OQLA 2QTHA 3I1FA 2ZJOA 4NCIA 2VL7A 3QVVA 4KVGA 4MKHA 4QHTA 1YZNA 4PPNA 4EQ6A 4CEIB 1ZU5A 3G0HA 2QTVB 2FEOA 1EESA 3BWDD 3QXSA 4BWYA 1IXZA 1OYWA 2D06A 3QOFA 3CW2A 2GXQA 1WE2A 4TYPA 3ZZTA 2QRZA 1G291 3P1JA 1M34E 1P3JA 1XEWX 3BC1A 4LBVA 4DLSA 4ACBA 1NVWQ 4G5GA 1IBRA 2RGDA 2ZTSA 1F2UA 2IYUA 4HUQB 4KO8A 4LYHA 1N6PA 2QMUA 3H1TA 1QBKC 3QF4B 5TVKA 2IYYA 1E69A 3ZD7A 1UBEA 4KODA 1I4LD 2DFTA 3T5GA 1EFCA 1XCGB 3BH6A 3KJHA 5GJBA 1Z0KA 121PA 5KU1A 3GCGA 1XZPA 1Z5ZA 4EPTA 2JLRA 4G5OA 4CT5A 3IO5A 1WDTA 3LVRE 4DCSA 2QORA 2FN4A 2J7KA 4I1UA 1XXHE 1DOAA 1MABB 4LJAA 4UJ5A 4R98A 5FTJA 2NIPA 2OUKA 1E9CA 1G5PA 4UNQA 4MGIR 3LV8A 3ND9A 4JLAA 2KBFA 1KJZA 4DSNA 5B2ZA 2GCOA 4BFSA 3CX6A 2Z6VA 4P32A 2X19A 1CBUA 2ZETA 1Z06A 4RKEA 2VP6A 4IOKA 1II9A 3CNOA 1Q1EA 5CJPA 3RANA 3UWOA 2WWHA 1NBMA 2OXCA 4XWOA 1KO5A 2F1IA 5FUXA 2NOAA 2LKDA 4JBYA 2RGCA 2CHVA 1KZGB 4QM6A 3ZJYA 3IEVA 1M74A 2CCGA 2ZJBA 4JVSB 5AR1A 2WPDA 2IF0A 3C15C 3RHFA 1SXJD 4PFSA 3DM5A 2GF0A 3CH4B 1FUUA 2VPPA 1EFRA 3W3ZB 2BM1A 1MRSA 1YR8A 2OZEA 2UZIR 3K8YA 2ZRMA 1AK2A 1KI9A 2RHDA 3UK6A 4QL3A 3NWJA 5HZHA 3J81k 4LC0A 2EU8A 4XSGA 1R2QA 3JVVA 1XB2A 1MH1A 2C2HA 1IY2A 1UPTA 3DMNA 1H65A 4XTRA 2XNSA 3N2EA 4E5UA 4AI6A 2FMXA 1U2RA 2GJ9A 2PZGA 1GOTA 5HZKA 2WJIA 2ZSAA 5JEDA 5TMPA 4OI4A 3VKGA 3WP0A 3FKSD 3SDZA 1E2IA 4GOJA 3QEJA 1WB9A 1U94A 4ESVA 1E9BA 1OT3A 4TLDA 4BZQA 1Q44A 1JQLB 3JVUA 4DDWA 2GCNA 1DBSA 4TMZA 5BQ5A 1XBTA 1XMJA 3QG5A 4Q4LA 4C2TA 2KE5A 3GJ3A 4DSUA 5HKKA 3PXGA 2ZSFA 2UKDA 1GTVA 2BBOA 1UJ2A 2IYWA 2RGNC 1ONBA 1SVLA 2AWOA 4D80A 4MRPA 1H8HD 3K1JA 2ZRGA 1QRAA 3PUVA 4WA7A 1NVVQ 2FX3A 4M9XA 4US0R 2GWHA 3K70D 1VCIA 4MKIA 4CEHB 1TF2A 2ZRLA 1R7RA 3OAAD 4RD1A 3OZXA 4IJMA 4TTQA 3SNHA 821PA 5CITA 5HPYB 1SXJA 3KUCA 3SFVA 1G7SA 1VCNA 5EJEA 1NLYA 2CNWA 2NZJA 3MJRA 4O3MA 3TKLA 2BMEA 1KMHA 1SKYE 1W46A 1NL3A 2BMJA 1XDBA 1S9DA 4PPGA 3TUZC 3ASYA 3VR5A 3NIBA 2CEAA 3S1AA 2JLUA 3GD7A 3BD9A 5E3HA 3GLFB 3HPRA 3BERA 2EFCB 4W5HA 2DWOA 2OO7A 4BUJA 3DOEA 2QNRA 4UNPA 2HT6A 4Q00A 1LW7A 2GK7A 3QXHA 3CLVA 3CO5A 4LBYA 1P6XA 4PPFA 4D0NA 4DCNA 1CTQA 5J40A 2YKGA 3EC1A 2O0KA 1YZKA 2Q3MA 1F2UB 2NPFA 3CNLA 1G17A 1D2MA 3FMPB 3SS8A 2G1KA 721PA 1JR6A 1G4AE 1M7BA 3BXZA 4HAXA 4D4JA 5FOSA 3I5XA 2Q9CA 4GZMA 1Z6GA 4GSYA 1I2MA 1CR1A 4AD8A 3M6AA 4Q1BA 1F3OA 2ODNA 3WMEA 4BASA 2PX0A 1MOZA 1N6HA 3EG5A 3Q85A 4PHHA 4CEHA 2VF7A 1L7VC 1RFLA 3PEYA 4QJ4A 3E1SA 2ZQ5A 1CEEA 1E0AA 2FSGA 2BC9A 4MRVA 1Z8FA 3QUSA 1NRJB 4Q7MB 3WXMA 5BW8A 3CM0A 2WM9B 1JJ7A 3WBKA 1W0JD 4DLTA 3GJ5A 3I5YA 2QRNA 1KY2A 1MO6A 3SQWA 5LB2A 4G1UC 4KLNA 3T5DA 2J0SA 2ZI3A 1AS0A 4M1SA 2N42A 4OBEA 4MYCA 4GI7A 4PSAA 2YV5A 1OJLA 1CXZA 2C78A 2JATA 4NCJA 4C9BA 2CJWB 2DPXA 2WWIA 1CJKC 3CWZA 1WBBA 2NO1A 5D3MB 3LAWA 4G5SA 1JXOA 2ZI9A 1RZ3A 5EE0A 4Q4JA 2CXXA 1A82A 1DELA 3TR5A 4QM7A 1BMFA 1CJTC 1WF3A 5FPTA 2YZ2A 1UEJA 2G0NA 4FN5A 2Q9BA 5H1YA 2CL6X 3L0SA 1HT1E 4B6EA 4R71A 5B30A 1W44A 1N0UA 2GF9A 4BFZA 2CCJA 1E2EA 1FNMA 2G88A 4JJZA 4FCVA 2ODEA 4V0OA 1NJGA 2ZAOA 4P3YA 3DKVA 2NO9A 3GMTA 1OV4A 4HDOB 1QDEA 3CPEA 4ZIRB 4RD2A 5G40A 4B47A 5DN6A 1A1VA 2P6RA 4GOXA 4JL5A 2NMVA 2FU5C 4G3XA 4EKDA 3U7HB 4U02A 2FA9A 3AF2A 2AN9A 5BWMA 4M9ZA 5JMTA 1XPOA 2QMOA 1QHXA 3ZS9A 4FCTA 3AM1A 3W6NA 3BE4A 3NBYC 1Z0AA 5A5GA 4C4PA 1XD9A 3RS7A 3R8FA 3CRRA 1O87A 1AKYA 2BM0A 2HCBA 5K8IA 1GRQA 2J0UA 3NXSA 2ZRKA 4YDHB 4F7WA 2CLSA 4L9WA 2GAAA 2MMCA 4PC1A 1SXJE 3U61B 6Q21A 3WP1B 2QEQA 3BFVA 2IYLD 5TY0A 3TSWA 1E2JA 2NG1A 1A4RA 2GA8A 4QFMA 3REFA 3W5IA 1IN5A 5JCPA 5JSZA 2CNWD 4Q18A 4NL4H 4ZKDA 1LVGA 2ZJ2A 2ZI5A 3H0KA 2IS2A 3ASZA 2ZE8A 1W49A 2HLDA 2ZROA 2OBNA 3ETLA 1JNYA 3LY5A 3I62A 3KJEA 2Z5FA 2ZRDA 4DDTA 1U8AA 1Z2CA 4LUCA 4KFRA 1A2BA 4URUR 4E09A 3OF5A 1W4RA 2V7QA 2VP9A 1AQUA 3B1ZA 4B48A 1YHNA 2REXB 1XP8A 1ZVQA 3R9XA 3NBZC 2XB4A 4TYWA 2V3CC 3MMPA 2GK6A 3K0CA 4MDEA 2D2EA 4B73A 1R8SA 3QIAA 2BJVA 3VHLB 4URYR 2V6JA 2BVNA 1GKUB 3CB4A 1ZU4A 1E9RA 2ZSBA 3AVWA 3A4NA 1H8HA 1CJVC 4A8JC 1G20E 1Q1BA 4CT4B 5EQTA 2BMDA 2EFDB 2ZRIA 3NEYA 4M8NE 3R7WB 2XTZA 1KDRA 1E0KA 2ZITA 4JSYA 5SZIA 1US8A 3SJCA 5HE9A 1XD2A 3MGCA 1DG3A 5CK5A 4DLYA 4BGDA 4JLMA 1OHHA 1KO4A 3THWA 1KI3A 1G16A 4M0LA 2OXRA 4II7A 4OK6A 1GITA 1EFRD 4RZ2A 3VX3A 4ESHA 2AK2A 3QPWA 2C8VA 1VYUA 2E1RA 1P2VA 1DTSA 3V4FA 1XTKA 4KSBA 4PC3A 4A8JB 3GLGA 2ECKA 3Q7PA 1NLZA 1OIXA 1KZ7B 1U9IC 1NIPA 3IQXA 1SVOA 4Q19A 5CLLA 1W1WA 3T06B 1XMSA 3ZZUA 3VKHA 3SHFA 3O8BA 1E2LA 2QTFA 2NZ8A 1N6LA 1WRBA 4ZDJA 5L3RA 4DDVA 3RRMA 3WMGA 2OT3B 4HLCA 3K53A 5J4HA 2OFOA 3BFKA 4PC6A 2HT1A 1KSGA 1KSFX 2IEYA 4I1SA 3WBJA 4EJSC 1HURA 1RKBA 4I4LA 2H16A 4IOLA 2ZR9A 1IQPA 1ZM2A 3NEJA 2GNOA 4URVR 4DXAA 3SYNA 1FTSA 1GILA 3IILA 4L8GA 2B7BA 2QY9A 4OK5A 1U0HC 4IVQA 2GILA 1BKDR 1NY5A 4CGZA 5DO9A 4XIGS 2VSOA 1KDOA 3K0FA 1AS3A 5JEEA 4DLVA 1YR9A 4PAOA 1RJ9A 4OJQA 3TBKA 3U3MA 3CZPA 4PANA 3WNCA 1IJEA 1JALA 2R6AA 5FBQB 3W8NA 3C8UA 1JEEA 2ZR0A 1J90A 1K8RA 1NKSA 3RS3A 4F93B 3E70C 3FHCB 1Q1ZA 2KI5A 3T61A 1JB1A 1YQTA 4FI3C 1BIFA 3AEZA 4P4SB 3NHBA 2CL0X 1UBGA 2UVQA 2ZU0C 3IO3A 3W9YA 4DDUA 3LFUA 3HWSA 2HV8A 1T0JB 1T9HA 3QENA 3TJZA 1Z47A 2AKAB 2V1UA 2XZPA 3QPVA 4PO9A 4I99A 4PSKA 1CU1A 1W5SA 2QT0A 3F3YA 4D6PA 2FV8A 4M1MA 4A6PA 1TF5A 1OKKA 3ICQB 4NYMR 4GNKA 3W90A 5H70A 3N5CA 2BOVA 3K0EA 5FFMA 4BFWA 3CZQA 3C5CA 2C98A 1G7TA 2ZE6A 3U44B 3AVXA 4GMXA 3C7KA 1P9NA 4EQ6B 4DSOA 4LPSA 2CK3A 2DWPA 3NBFA 4OHYA 3CH5A 2NTYC 1DS6A 1E9AA 4KBFA 3TQFA 3GPLA 3O47A 1X8KA 3NH6A 3AVPA 4MQBA 2JJ2D 1G8PA 1ZIOA 5JBQA 2RB4A 4E22A 3B1WA 3THXB 3EZFA 3L82B 4RD4A 4Q9KA 1ZUIA 3L2OB 5CLQA 4L15A 1XD8A 1OIVA 1R5BA 2ORWA 3UMFA 3OIYA 3W8RA 1NNEA 4D0GA 3THOA 3KB1A 1ZYUA 4O0MA 4TMXA 4CIDA 2JLSA 3W3AA 3NBXX 2OBMA 1KK0A 3OAAA 4XVRA 4B71A 3B9PA 2CMKA 5IK2A 1LF0A 5AJWA 3L0OA 4PPQA 4QOSA 2ERYA 4TLAA 3ICEA 3K09A 3ZQJA 1P2SA 4Q48A 5JI3E 5AUQA 2QPAA 1G64A 4PTLA 1IHUA 2ZANA 1ZP6A 3UIEA 3AV0B 1ZINA 3SBEA 5BN5A 1NVVR 1RYFA 2J46A 1PV4A 4AY2A 1KO7A 2IHBA 2B7CA 1UDWA 3N70A 3Q8XB 4QBHA 3ZIAA 1KKMA 3U4QA 3LQRA 3ZYCA 2XJ9A 1E79A 3HU2A 2O8CB 3M1IA 1PVOA 3PUWA 4TT3D 2VH5R 2GVZC 5B58C 1P72A 3I4LA 1TQ2A 1NVUQ 3FGNA 4HAUA 4LWZA 2FFHA 4EPYA 1UKZA 2ZREA 4JLJA 3VR2A 4TSFD 1TMKA 1N2CE 2H1LA 3UXMA 1NG9A 1U8YA 3T12A 5FOVA 3MD0A 4OI2A 1GAJA 2RGGA 1W2HA 2WTUA 3AQ4A 4US1R 3SJBA 3KUDA 5JS8A 1CRPA 1RRPA 2F6RA 1R4AA 3TQCA 2JEOA 2QP9X 2GXAA 4XOIA 3BFXA 1HTWA 3L0PA 1Q12A 1XEXA 2GJSA 3AF4A 4Q4AA 1E9SA 4HLUC 4ACAA 1NP6A 3RWMB 3PENA 4ARZA 1X1SA 2NO7A 1M2OB 1S8FA 4B34A 1S0UA 1KJWA 1U81A 4QBGB 1R0ZA 2P67A 4C7OA 2AKYA 2CE7A 4MA4A 5FL3A 1N5JA 4KXFB 4TWZA 1Z0JA 2GTPA 1J8MF 3TK1A 3C4JA 3KX2A 4AK9A 3P26A 2IF2A 5BXQC 1SULA 2HJGA 3THXA 1E1QA 3BBPA 1EWQA 2UZ3A 1QG4A 1AIPA 4XWAA 1RRGA 4DUGA 5IHPA 4NCNA 1NN3A 1ZW6A 1HA3A 3DOFA 1G1MA 2OLKA 1KI2A 2RKOA 1I4DD 4NYIR 5KO2A 1SVKA 3U3OA 1E98A 3F5FA 1IM2A 4DC9A 4LY6A 1RRCA 3FHOA 2F3RA 4LGMA 5IF9A 4A6XA 3B7GA 1Z28A 4FD2A 4OQNA 3LW7A 5EE1A 3EZ6A 3I8XA 1ZD9A 1Z0IA 3LX5A 3TW4A 2YHSA 2JLZA 1FP6A 4TLCA 1UF9A 5EXSA 3ZDQA 3LLMA 4A8JA 4IKEA 4D82A 2CVHA 1HH4A 2QSZA 3B82A 2V7QD 3Q3JB 5C18A 5E7JA 1J2JA 3K9NA 2QBYA 1EFTA 1R0XA 1CRQA 3GFOA 1SKYB 2Z0MA 2A9KA 3AUYA 1O3YA 3VU9B 1TU3A 1U98A 1GNPA 2QT1A 4JVLA 5KOYA 4OHZA 1Z2AA 2VA8A 4Z8YA 2GDJA 3T1TA 4RFSA 3BB3A 3H4MA 621PA 4BLPA 2V4ZA 2ZM5A 2Q3HA 1YR7A 1XU4A 1QVAA 3OE7A 1G3UA 3F0TA 4RD0A 3LBNA 5IRCD 3QE0A 1E2QA 4WZAE 1DVRA 4Y0AA 1DAMA 1E0SA 1W36C 3HJNA 1EX6A 1II0A 1OPXA 2CBZA 3ADBA 3U60B 1XMIA 2GEVA 3QVUA 4K46A 2IYVA 4OHWA 3AGQA 4X8OA 3UMRA 3VQTA 2C9CA 1QVRA 2W6JA 4JT4A 3EAQA 3WHLA 4BECA 4FMDB 2PMDA 4DWJA 3UMSA 2CVFA 5A0FA 3ZH9B 4IDNA 4IVPA 3QEOA 4LBWA 4QHSA 3ZVMA 1RPZA 2O0JA 2O8DB 2GZAA 1BH2A 1DAHA 3AKYA 4D0LB 2AFHE 2O8EB 1HT2E 1ZC4A 1XTQA 2J59A 3GFTA 1Z63A 3K0SA 3I32A 4GFDA 2DFKB 2D62A 1G9XA 3DO6A 3BS4A 5EE5B 3GQBA 2VTKA 4KFUA 4Q7KA 2WKRA 1P5ZB 3VAAA 1GUAA 3OIUA 4ZPXA 3HP1A 1XWIA 1ZD8A 2EFHB 4EFLA 4HLUA 5KSOA 3RSLA 3SC3A 4O2LA 1Q22A 3KJIA 4JYCA 4B3BA 4RSGA 1CJUC 1K5GA 5F9HA 2HF9A 1XF9A 1XTIA 3EA0A 2C04A 4M1OA 1KYIA 3THYB 2P65A 3EPKA 5JWHA 3EC2A 5CM8B 1N6KA 4YXWD 1OXUA 4L4UA 5A4JA 1AGRA 2QE7D 2GETA 5BN4A 4MH0R 1VG9B 5DI9A 1N6IA 4NCHA 5FTMA 1GRNA 3L8YA 1G8HA 4HYYA 2JCSA 4M1TA 3QPUA 4N1AA 1KK2A 2BCGY 3TSZA 4TL7A 4A9AA 4NYMQ 4PHTA 3W6PA 1NLFA 2OLJA 3IIKA 3K9GA 2Q3FA 3NG1A 3RAPR 3GFPA 1KGDA 4M2LA 3GJ6A 4D4LA 2XAUA 1JJVA 1ZRHA 2WZQA 3AGPA 3EPLA 2ZJ5A 2E9SA 4Q1AA 1CP2A 5SZHB 1A7JA 1NN1A 1Y3AA 3CR8A 4JKYA 3SE0A 2PT5A 1M1YE 3FVQA 3NVAA 2VQSA 2H57A 1FFHA 1TNDA 3BOSA 5FTNA 5TDHA 3WYFA 2P3SA 3EPHA 3BIFA 2O8FA 1OFIA 1XMVA 3AUXA 3DL0A 5EUMA 3R9IA 1FUKA 1XZQA 4LRWA 4TSFA 1YE8A 1ZIPA 2FGKA 1NJFA 3QBTA 3GLGB 3DDCA 2IK8A 1HV8A 4G5QA 5CB8A 2QI9C 5BYKA 1D9ZA 4JLDA 1ELOA 4MDFA 2JDIA 1D5CA 1ZUNB 1CULC 5G3YA 3ND8A 3T34A 1E9EA 2GEUA 3VFDA 1KI6B 3QSYA 2WHXA 4M9QA 5KTYA 2Q21A 2OEPA 3PVSA 1YRAA 2QBYB 2QMEA 3T1QA 1DADA 3AVYA 4B3FX 1KNQA 2AX4A 2F1HA 4GPTA 4NMMA 3LBHA 2EW1A 2NPIA 2ORIA 1ZNYA 2QE7A 2XOKD 2XJ4A 1W0KA 4LOAA 1M8PA 2OE2A 3IHWA 2ZYWX 3UANA 4AYWA 4BEJA 4POAA 3KQLA 2OFXA 2IC5A 5TXGA 2WJHA 4NYJR 1JEDA 4PO8A 1FX0A 2LWIA 4YDSA 1T3SA 3GLIE 4D4MA 4M4SA 2CE2X 2F7SA 2GXUA 2I1VB 4PO1A 1R6BX 1Q0UA 3AF3A 3JZMA 4V03A 1ZNWA 4D4KA 4JLPA 2V9PA 3KJGA 1OXVA 2EWWA 4DLZA 2O0HA 3MLEA 4F4CA 5TB5A 1KMHB 1F6BA 3MSXA 4B6FA 3KDSE 5C46F 2FF7A 2GXSA 1FMLA 1VG1A 4ZIRA 2WSMA 3QY0A 2X1VA 3P4XA 4A0GA 3CX7A 1DAKA 2ZRNA 1M7HA 2IUSA 4Z1MA 2V55B 3P32A 5HCNA 3VU9A 2OAQ1 4UXJA 4B3GA 1W7AA 1Z3IX 2X77A 4HDCA 4JJKA 3AP1A 5L3QB 2W0SA 2D7DA 1T4GA 1KK1A 3KXIA 5EZ6B 2JGNA 2IW3A 4QGGA 1SHZA 4C2UA 2JAQA 3B1XA 3MJHA 3DVLA 3LWNA 4WOPA 5JJLA 3NC0C 1R5NA 5EE9A 1EXMA 3BRWD 4XSHA 3ZVLA 3GLHA 4B3XA 1W36D 1R10A 1P7CA 4HDQB 2DR3A 4TLEA 4QRHA 1MO4A 3FTQA 1L4UA 4Q1EA 2BKEA 5LDDC 2CJWA 4R7ZA 2DHRA 5M04A 2W6JD 5EP2A 2YINC 1NF3A 3OHMA 3TAUA 2O5VA 2WKPA 2Q9AA 2QZ4A 1QG2A 1G8YA 1KY3A 3L0IB 1L8QA 3NKVA 3FFBA 3NC1C 1G41A 4Q02A 4QNRA 4HB0A 4KITB 3OESA 4AG5A 1OYYA 1UBCA 5DNYB 4LSGA 2QP4A 4JZKA 2F43A 3U6KA 1P60A
chains in the Genus database with same CATH superfamily
5LN1A 3AEKB 1VJ5A 4EKNB 2A4KA 3D1LA 5E7QA 1T0BA 1CUWA 1LXCA 1YSCA 4AULA 1MV5A 5FR1A 2DWQA 2VP2A 1TUIA 2AFIB 4F1WA 1RKXA 2DKFA 1X7ZA 3LX8A 1QJ4A 5GVRA 3GRPA 4AY3A 3GNTA 4RDIA 3W05A 2HA3A 1SKAA 2JKVA 4AURA 5NLLA 1XEWY 3OPYA 4L9SA 3R0VA 5ALJA 3PRKE 3WGIA 5DP1A 4NZYA 3QI2A 1YU6A 2FW8A 4Z3KA 1XEXB 3SLKA 1QTNA 1ULUA 3HKBA 5TPZA 1IVNA 1LVUA 1VDZA 2CXRA 4IYJA 2DTDA 3RKRA 1U6IA 2QU7A 2C5BA 4HGNA 4NE7A 3OFND 4GP7A 4KXXA 4OYYA 4XWWA 1R4NA 5BMVB 1MJGM 2WG0A 4W5JA 2HYIC 3ETCA 2Q0SA 2J7PA 2OK8A 2PZ8A 2H0AA 7ADHA 1GFZA 1G5TA 1L0BA 1QK4A 2HU5A 2OB1A 1U0FA 2P9GA 3PPYA 4RV5A 4CTNA 3VYVA 1PT9A 1T2FA 2AG0A 2HLNA 1FTWA 4D9KA 5F78A 1PJAA 3NOXA 4H3HB 2R1TB 5A4AA 1Z4LA 3JAKB 1VHWA 4UAUA 2J41A 4CFSA 2ZK7A 3C3EA 3M5PA 4IOMA 2PFSA 3WMFA 2PH3A 2QTZA 3HGMA 2QMYA 1QTIA 2O8CA 3N6RA 4I9UA 2WMNB 2OP0A 3BL8A 4FMCF 5HDBB 4BAUA 1PDOA 2ZPTX 2JVIA 3DZGA 4MMZB 3ZGXA 2GJ8A 1W0CA 2CNOA 4OQZA 1PDWA 2FPIB 1AMUA 3OEED 1H2BA 4UBNA 4D9JA 1EWRA 3GGCA 2Z8YA 2P68A 5B6IA 3W3AD 4YV1A 3OIVA 5AKHA 1KMQA 2VCHA 1O2DA 4KWHA 2A3RA 4MTCA 4QDXA 2AOVA 5EERA 1NUHA 4BB0A 5HNKA 4IDOA 1W4AA 3RSGA 2OK7A 2Y0EA 3LG2A 5KTMA 2W2LD 4KGXA 1CG6A 1ZI6A 2TS1A 5JXIA 5LOVB 2OCPA 1V3TA 1U04A 5FA8A 4QASA 2C4WA 2GCIA 1G6OA 1KWKA 4O4JB 2C03A 1EK1A 3U26A 3TMKA 3QMMA 3JQAB 3LQFA 1E4EB 5AJZA 5JE8A 3BL5A 2OV4A 3QITA 1NV8A 5H9WA 1U2ZA 3FCUB 4RJJA 3NFRA 4CNBA 3FDZA 5FX2A 4JWKA 5FFFA 4DJEC 4S35A 1DFIA 4BX0A 1KZ9A 1ORWA 2JJ1A 2WKWA 2A35A 3C6KA 5LQMA 3ZTTA 3PFWO 1O0BA 2BFCA 4JEHA 5FT9A 1OH5A 1P2FA 2BFEB 4GYKA 4R41A 3EXIA 2X9LA 2R25B 1OX6A 3FCCA 2GBCA 3RU2A 4MYTA 1VFNA 1ZM7A 1E7YA 2PPVA 1OIWA 3BIOA 1SKQA 1GUBA 1AZSC 2J67A 3B6JA 3QZUA 2Q6VA 4ZREA 1T3LA 4Y0NA 2RK4A 3F2IA 1O4VA 2J0UB 4K8OA 1MJHA 2BGLA 2W6MA 1KIAA 3AUFA 2YWEA 3M1LA 1XTPA 2FFRA 2ZBPA 4KE6A 4OBWA 3WA6A 3OE1A 3H2YA 1Z13A 5DBEX 4YK7A 1IB6A 4CR7A 1FPMA 5JC8A 2QJOA 1GU7A 5DNWA 1UBJS 2QUZA 3B6IA 3KE8A 1RD4A 1DUSA 4LVOA 2PMCA 3JQGA 4Q9LA 4D9HA 2W2KA 1KU0A 2ZSUA 3AFOA 3AY6A 3L7AA 4ZCMA 1G2PA 3H5WA 2ZJAA 3A1TA 3OCUA 4A4DA 5E38A 4F3KA 1LY1A 3O0DA 3UPDA 2DE0X 4X1YA 2W2PA 1DC7A 3HP4A 3MHPA 1VJTA 4KV9A 4N41A 1Z34A 1UUFA 4L02A 3UAXA 1C1XA 4B45A 1C5KA 2YFHA 3D7RA 1UM9A 1I4WA 3HB5X 2FEPA 4OQYA 1Y42X 2R3SA 3RSOA 3RT9A 4YIHA 2BFNA 4KQXA 4CKCA 1UQUA 2HMVA 2F1JA 3Q0TA 1GJRA 1NI5A 1PEKE 3Q5GA 4CCAA 2B36A 2G9QA 4ENPA 1QGZA 2FDRA 3I04M 3PUYA 1SC6A 4QD3A 3TTYA 3ZK7A 4EL5A 2GD6A 4PW0A 1DX6A 4HVTA 4F4IA 4U8GA 2H4FA 1WUYA 3F78A 3L18A 4HDAA 1BMTA 3AFMA 4PY2A 5DP2A 4I4IA 1QPBA 1UL1X 4INJA 4Y2JA 3IXMA 4ZGWA 4N76A 2IHKA 1CPYA 1O8BA 4U7WA 3BXOA 4BNKA 4F9FA 1RZRA 1WCXA 1I0IA 1HE3A 3AONB 4G86A 1WAMA 1QZXA 2JFXA 1KIMA 3KAJA 3HR7A 4I1VA 3KHKA 4XH9B 5GM2A 5TPZD 2B8EA 1NXPA 3MTGA 2Q27A 3CF6R 4WXYB 3LUPA 3PNSA 1LPMA 3OIWA 1FXWF 5DH9A 1O6ZA 1SK9A 3CW8X 4QKQA 3W7AA 5U4XA 6ABPA 3CEAA 2YY5A 5F73A 1D2CA 5KCMA 3AEKA 5SZJA 5DJ5A 4TN5A 2MCFA 2J7PD 5LOVA 4F3RA 1RPJA 2P6UA 3QH4A 4C7VA 3E81A 1R8YA 4DLXA 2YOGA 4EG0A 1JECA 1TZ2A 3REQA 3HP7A 3FUWA 1HFJA 2J30A 3AUUA 3NHJA 4IKOA 1BG6A 1IHPA 1TPZA 2R44A 2WVGA 3E3MA 4OA8A 4CL3A 4ZVQA 5CPBA 5JJIA 2VOJA 2FE4A 5FP0A 4UDNA 5IVIA 3ZU6A 4ALKA 1NXWA 1JILA 1LJ8A 3HM2A 3S28A 2G5CA 2H08A 5LKRA 4RAQA 3E7WA 2WD9A 5L40A 3EC7A 2RHCA 1EVYA 1XZHA 2WQ7A 1MTOA 3AVUA 3UWMA 421PA 2JLYA 2FMHA 1FMFA 1V1RB 3DA8A 4AYTA 2OV2A 1REQB 2W83A 4QDZA 5DI3B 1OBOA 5T41A 1JT2A 1HEIA 2A78A 3DDHA 3G2MA 4AM8A 2WNIA 4B9EA 4CG1A 4QGSA 1NRXA 1X9GA 2XOKA 3WDSA 2FN9A 1B0ZA 1V6CA 3AF5A 3BUSA 3F7MA 4TTAA 2J0QA 2CD9A 4AW9A 4OATA 4BE7B 3EOAI 1FS6A 1V25A 2KJQA 2KLHA 3G5MA 1IPFA 4HLQB 3HU3A 4HUQA 5FBHA 3TRFA 4TRMA 2O8BA 5AVSA 4P0QB 4YMIA 4ETWA 2GCOB 2GVDC 4LHYA 1TIKA 3THSA 1YOVA 1E6CA 4QUDA 1L5NA 3IPRA 2XA1A 2OCIA 4P53A 5IUKC 4X7BA 5IDWA 1JHZA 2MOKA 3BRQA 2QPTA 3QQPA 1DKRA 1KSHA 1TEHA 1WABA 1K5PA 2IP2A 3CZAA 1FBTA 4YJGA 5CP8A 4E5DA 5AW4A 1P0QA 3FYSA 3KB8A 2PXXA 1HDRA 3LT4A 3OZFA 3R77A 1FDOA 4HSGA 2XT0A 4J03A 4AMBA 5F9FA 4YQEA 4X8HA 3TKAA 3R9WA 4DLAA 3X1XA 1GD1O 1XZ8A 3IHTA 1XVVA 3I45A 5KS2A 3A3OA 4QPJC 4MXDA 3GUZA 2YW9A 3DEIA 5DIFA 4Z3DA 4OX9B 1O77A 1R4NB 1PJCA 2CXNA 3DFZA 3DKPA 1NX6A 2QN3A 3FGZA 4DT1B 2EQ5A 5MN5A 2ZIGA 5KTOA 2P9BA 2C0CA 4O2AF 1AO0A 4G63A 4XJXA 5I9TA 3AVQA 4LY0A 3BX1A 1PT5A 2NUTB 3IBTA 3VTAA 1UOPA 3CLTC 1DNPA 3GU3A 5ER9A 2O57A 1RVDA 1OFVA 3KB6A 1SBIA 5AIAA 1VHTA 3R0QA 4BMOB 4IW3B 2OCDA 2ORYA 4J4BA 5J5VA 1ILWA 1PTJA 2ZI4A 5CX4A 3K70C 3WDLA 5AUNB 1PUXA 5LLDA 1CR2A 4RJLA 2EARA 5IHXA 1TEVA 3HCAA 1P31A 2DWCA 1XZJA 2HBRA 2FRDA 2Y1EA 2VPZA 3GJQA 4BCCA 1C8VB 4BLOA 3FROA 3U3KA 4WAUA 1E8NA 3QFHA 1ISPA 1ZMXA 4YJ2B 4BNGA 2WMOB 1V4NA 2IYRA 2V6FA 3EIHA 5ALWA 1FDWA 1LSJA 1MKYA 4DEYA 3A37A 4M1WA 4B3SB 3H5TA 3NWPA 4G9GA 3ZHTA 3SWWA 4AWAA 1MIHA 4F0JA 1AQJA 1USUA 2AR7A 3OJWA 1ORRA 3AR7A 2A58A 1JG3A 2P9JA 1I2BA 4FCWA 4LTNA 4Q6BA 2CV2A 1OA0A 1YHYA 5AVKA 2Q5HA 3Q5DA 4M89A 1Q3KA 1Z37A 2HHAA 3II6X 3K9LA 4TKUB 3NW9A 5IW8A 4ZAXA 1JDPA 4YP6A 1L4KA 2CEKA 3LNCA 1LK0A 2OQVA 2N46A 4R1NA 1CFJA 2H4WA 3TR0A 3H99A 2XYGA 2C1XA 2YZGA 1O54A 3G5LA 4HFJA 5IPFA 3DLHA 3COZA 3JATA 4D5GA 3UV7A 5EMKA 4F8JA 3I01A 3JZAA 4JYBA 4E07A 1VSVA 1ZNZA 1VL2A 2BPOA 2O7RA 3LD9A 5ITVA 2P7HA 1VI6A 3QV1A 1J5EB 2OG2A 1A9TA 1EZ1A 4KNWA 3ESCA 5F33A 3CVJA 4C78A 1T0IA 1ULSA 2IU3A 4AO8A 1JU4A 2C8LA 4BP9A 2AN3A 2WM3A 4QEKA 2JJ2A 4U0KA 4B6GA 2AIRA 2R97A 2EKQA 1WW8A 3RUFA 4YWJA 5FWXA 2XBLA 4NK4A 3ZY5A 2O8DA 1E4VA 1ZCAA 2WTNA 3UK1A 3ZBPA 5GGYA 3CRW1 4P5EA 4YRDA 2QL7A 3R3UA 1JKXA 2YMQA 4QECA 2D2FA 3UHPA 3WIBA 2QB5A 4BN0A 5IKMA 2V6MA 2RBEA 1PWXA 1XPUA 4L3WA 4NIMA 1WBDA 2D4AA 3RLFA 4Q5IA 1C2YA 1S9HA 1Z6TA 5HUQA 2QUHA 3ORFA 2I8CA 4GYYA 4ODIA 5JYBA 3U4MA 4JI3B 3UOAB 3TIFA 5HE8A 2BBWA 2PA3A 3KYCA 3NUZA 4DKJA 4B3MB 3H05A 4HWTA 4DILA 2R7LA 3AESB 3H2KA 4OUKX 4MITA 2IYAA 2ZYHA 2ZDQA 4OHVA 4CRWB 1ZVVA 1W47A 5CB4B 2JHAA 4UNRA 1PK9A 2BEVA 3VR0A 2XSZD 4BL5A 3PS9A 4CU2A 3QU4A 4S2UA 1XG5A 2R85A 3A9WA 1WULS 3NB0A 1K4KA 3MGKA 1PBNA 2X8JB 5DM60 3UQYS 4CUKA 1DZIA 2PZAA 4OH1A 2GR9A 2I9PA 2I7VA 3B5JA 3DNMA 2YWFA 3P9PA 5EOVA 4ZJUA 2HHHB 3O75A 1U2PA 1ZAKA 3BYZA 3Q6MA 4Z51A 2VT7A 4BPRA 4IIBA 5KNBD 1T2AA 1HRDA 3KSUA 2P7IA 2C95A 3AP3A 5FBWB 3EGDA 4BLVA 4D45A 4C0AC 1PIWA 4FZJA 4OJKA 1TT5A 4RYDA 3LZCA 1QDUA 2AQ8A 4NFYA 3ZY2A 1EEHA 1MAAA 2ENUA 4N03A 3VHXA 1P5FA 3SYTA 1AM4D 4MYHA 2ZWOA 4PQGA 1GL6A 4TV9F 3E3NA 3TMAA 4RUKA 2BWJA 3KZ1E 4AZ3A 3I92A 4QIHA 4U2DA 3WJAA 2GZRA 3K0CC 2QN6A 4L0DA 4PG4A 2ZUFA 1XIVA 4G0QA 3ZUGA 1O58A 3UUEA 4CZ2A 4K0KB 3CRZA 5TLSA 1GIAA 2VT6A 3JY6A 3JQ9C 3GUVA 2X7XA 5C7IO 2OP1A 4G1BA 2OHIA 2YN4A 2Y1KA 1FQOA 5ALOA 3AEQA 3A27A 5KJCA 4TUYF 2NGRA 3WNBA 4B76A 2ALJA 3KQOA 4ZO8A 1SPXA 2FRDC 2N1MA 2WWTA 3I0NA 3QTTA 4PZ9A 4E32A 3FPLA 2PVCA 5TJHA 3M8KA 3WL5A 1TLLA 3AHIA 4NBSA 1SXIA 1J7KA 4CEJB 4L8FA 3KXKA 3M2TA 5ESRA 4IEEA 4W8GA 5K3CA 5L4NA 2PXHA 4RU1A 5AIBA 4X6XA 2WIBA 3ZHQA 1BE8A 2BR4A 2I71A 3GOQA 2R2AA 2RCNA 1FQJA 3H0EA 4LFCB 1UT6A 3SIXA 1PLKA 1ETHA 1T9AA 1NI3A 2Y1CA 3MTIA 4NARA 4PR0A 5C31A 2J6HA 3D7MA 2CW5A 2BGUA 1IRXA 4H1HA 1IJKA 1HFKA 2PGXA 2G9RA 1ISGA 3BGSA 3GFGA 1DRWA 2AG1A 2NLOA 3BPSA 4M1YA 4LF4B 4ARUA 1PZEA 1G63A 1BS9A 3NTQA 1WXIA 3FNEA 4JT2A 3T3NA 1GRRA 3QWBA 2HJWA 3NWBA 3DZ8A 4OMUA 1MIOB 4DAOA 1W36B 1V37A 2L19A 2X5JO 2WIDA 1Q0SA 3QJYA 5CVDA 1KVQA 4OU5A 2Z1MA 4P33A 1B00A 1Y1PA 5JECA 3TM5A 3K0FB 1E6KA 4Y1RA 5THQA 4A10A 1YVPA 2PJUA 3OF2A 4EQZA 2YRXA 1QHGA 2LUOA 1RAIA 4OY3A 3EX7C 3SSOA 1T1JA 2BCEA 4CL0A 1RJ9B 3HRKA 4E11A 2JGDA 1T1IA 1OAOA 3D4BA 3NVKI 1SXHA 1A4XA 4OL9A 1MG0A 1KI1A 2X8WA 3KYJB 3A1VA 1KZ1A 1X1QA 5LA6B 1UEIA 3EFBA 4MI6A 3QVSA 2WWFA 1AK9A 4HATA 4ZVNA 2CF6A 3CIOA 3F3MA 3FR7A 1HZZC 2EKZA 2VCEA 2NNWB 4MB6A 1ZGBA 3H2HA 1JAZA 3C41J 3OPQA 1OXSC 5CVTA 4LGVA 1BYUA 3DZDA 1GVNB 4DPLA 2B35A 4XYLA 2PRIA 1GA4A 3CVWA 3GK3A 5FUBA 1U90A 1AG9A 1ORTA 1M1XB 2SCUA 2V7TA 1DRKA 2W2QA 1JBQA 1YUMA 3UTCA 4B2LA 4FXOA 2V7UA 3Q9NA 1QHNA 1EK5A 1QGAA 2FK8A 5DSTA 4ZMBA 2F8TA 2C4HA 1X77A 3LGXA 3F4BA 2D00A 1CRZA 3ND6A 3RI3A 1EWYA 3ZWQA 4F86A 1P1FA 2XF8A 4MMXB 4Y6QA 3SX4A 4FOOA 4LEIA 2DHEA 3GCWA 3N58A 2V7WA 4TS1A 1V8BA 4U63A 4WXPA 2H1VA 1T2VA 1DINA 1SUCA 1YI0A 4YCNA 4J6EA 2ON6A 2XCSB 4PGFA 4FOLA 5DWDA 4ZCLA 1NHGA 4LF9B 4EGAA 5DWQA 5E4YA 2NTEA 5D8DA 1NP3A 1D4ZA 6NULA 2DFLA 3IALA 4IIXA 4LYFA 2K2QB 2YMMA 5AK4A 1L5GB 1SXPA 2E4AA 1CX9B 4YAOA 1J49A 1HQYE 1XTZA 3WXBA 4G0ZA 3MBKA 4ZDKA 4US2R 3E8SA 3TMYA 1ENYA 1TQ6A 3GMSA 2KS6A 1V45E 3E5HA 4N54A 3R75A 4J0HA 4GEGA 5CLHA 5KKAA 4I4TF 4A6EA 4DV3B 1I2DA 3G2QA 3HCRA 3MS7A 2AZ4A 1TFRA 4Z3OA 1EE9A 2RAVA 4BJ5A 1SD5A 5GONF 3HTXA 3IR6A 2OBYA 2HXSA 1IDN1 1YD7A 3MWEB 4GBGA 3CN9A 4R16A 2QKYA 4DMKA 4EPXA 5EQJB 1ESEA 1KI7A 1U7HA 1JMYA 1BCRA 2OCAA 3VXKA 1CUDA 2Q5QA 4KPGA 3AT1A 1OAAA 4J7CA 5FBLB 1T6BY 1Y98A 3SZGA 3RSFA 1NW5A 1W52X 3W1EA 1UC9A 2OCBA 5CK4A 2VT2A 3KVNA 3NIGB 1TMGE 2WQZA 1G7CA 2QVZX 4IGIA 2H06A 3FKSA 5TF0A 4AG6A 3KFLA 3M4YA 5DNAA 3RFVA 5DMXA 3D81A 1GDTA 4KH0A 1QKIA 4RA9B 4ZO4A 5BOSB 4XB6B 1L4YA 1X7DA 3R76A 4BO0A 4NU5A 4QAJA 2CXOA 1YQXA 2ODBA 5KJEA 3GELA 1CNEA 1XLUA 2D13A 3SF8A 4ZVRA 4URZR 5C8ZA 5I47A 1K6MA 2VUIB 5KYUB 2J4FA 2ZSDA 1GKIA 1K7XB 1DWUA 3C3MA 3FKQA 4Y2HA 2PKQP 2WSSA 2VRWA 4DVJA 2IEZA 3WLMA 1P5RA 4V39A 4C14A 3QU2A 2R4QA 2XTMA 1AGPA 2X5NA 4GGOA 1NMXA 5FBRB 4F5WA 2CXHA 1KOGA 4XQ0A 2COEA 4D46A 2QLJA 4MYSA 2IE0A 1CUBA 2ERCA 1XRJA 4EBBA 4HDMA 3SPXA 2YXBA 2V5AA 2WHRA 4YPVA 2XHZA 3GYGA 1CUFA 4IOJA 1L4NA 4JJIA 1M73E 4UCXA 5ER6A 3WWPA 4W1SA 4C0SA 2B2CA 5HHTA 2YC2C 3VA7A 5HGJA 1E96A 4F11A 5IJ0A 4M21A 3NTLA 1JIIA 2J87A 2W0MA 3A32A 1H23A 1RJGA 3ANSA 3FHLA 4KC0A 3B1FA 3E61A 4FMCB 4II2A 4PLCA 4PZEA 1ZN9A 3SN6A 4AZSA 1NW8A 4HQ6A 3IHKA 3V8RA 1W6UA 1JB9A 4HXEB 3B78A 5FWYA 3DE0X 4AYXA 3C5HA 4PIMA 4QOJA 3CBQA 4LX8A 2V7PA 2FR0A 3A9CA 4M0UA 3JQAD 5JHGB 3NNDA 3PTZA 3U9SA 4X7PA 3RH0A 4EA8A 4YJ2F 1NUSA 1PJ8A 5KYWB 1L3CA 2E4XA 1IN8A 2IKQA 3GT4A 3LBFA 1NPYA 3QGMA 5TMDA 3U6BA 3CC8A 4WN9A 3RBVA 1GNSA 1OFTA 2G8NA 4A0QA 1KJYA 1BH6A 3G2PA 1XDSA 4DA8A 1DG1G 1E3WA 2LDXA 1YK1A 2PL5A 3MWYW 3EOZA 5IF3A 4C30A 3KJNA 4IO0A 3K5PA 1ZOPA 3KEFA 4MV1A 3IVAA 1NQ5A 4PHCA 4BLQA 1QFXA 3TUIC 5A4DA 5EXXA 5DLQC 1QO0D 3PRYA 4N6NA 1UT8A 4OQMA 4GPEA 5HUJA 4E51A 1OREA 1M2VA 2VPXA 3KP1A 1GUZA 2IDJA 4HN4B 4NECA 4HNRA 5J2TF 3A0RB 3SI7A 3E22A 3AHEA 2W2VA 4WINA 3PQ5A 2GAFA 2G83A 4DUZB 3L6EA 4MCIA 2BP7B 2CLMB 1I3MA 3QSGA 4K6OA 3JZDA 1MR3F 4CF4A 3IPXA 4P4UA 4Q4HA 2CLDX 2IFTA 2R00C 4MEBA 1PL0A 3FUCA 3NJ4A 1CCWA 3QF4A 5AOAA 5KJ1A 1ESCA 2C7OA 1QYWA 1RJDA 3B1VA 5J2UA 5FH9A 1G19A 3B48A 4R2WA 1VLVA 3A7DA 3GJXC 3GHYA 3TPZA 1IWOA 3TAXA 4I5FA 1F8YA 2Q07A 3RD5A 1NRWA 4JOCA 2I4RA 3CPHA 4RVOA 4BKQA 3BH0A 5DEIA 5JWOA 1V9CA 3PHIA 4BFVA 1ZCJA 3WKCA 4HG2A 4YJGB 3GEEA 1U4OA 2R87A 3BKXA 3I4FA 1DQPA 1T8WA 4MLZA 2EX1A 4QEDA 3RNLA 2GD1O 2ZJZA 3DZCA 3ZHVA 2B6HA 3A2NA 2C5FA 4B8WA 3ZDRA 2B78A 4P35A 4RZ3A 4B3RB 1KK3A 4IJQA 3EGCA 1SQSA 2AD1A 3GGPA 3KUKA 4XW2A 5C2JB 2Q6OA 1FJHA 5AJHA 2QW0X 2B99A 2WJ4A 4WK2B 3TW8B 3C6QA 1T3HA 4X3CA 5EJ9A 3RV3A 1QO7A 3KFXA 1ABBA 3L49A 3MD9A 4Q15A 4RKFA 3E9CA 2H6EA 2I4MA 1AKQA 2RGEA 4NG5A 5B1DA 2CBGA 4J75A 4QXRA 3SQXA 3SZMA 1ODTC 2JASA 2XF2A 4MWTA 1U1FA 3JV7A 3P20A 1H94A 1Y4AE 1ZG3A 4ND1A 3HRHA 2WBLC 3GL9A 3KV3O 3QFFA 2JLBA 3BWVA 3L1UA 5BQ3A 2BKUA 2ACVA 1LQUA 2ATXA 4ZQCB 1OZHA 1M6NA 1ODFA 1ZSYA 3PHJA 4BNMA 4F21A 4ER7A 5B57C 5BV1A 5JH7F 3KWMA 5COQA 2KMLA 2NV6A 3ZGYA 1XCMA 5I3ZA 5COBA 3LRPA 5CBKA 1T4CA 3EGVA 4I1YA 1TEZA 4D4GA 1LPSA 3IDQA 3W8FA 3PKZA 1AK1A 2ACEA 2FFQA 1YFLA 2NM0A 3VOBA 4YUVA 2PGDA 4L5IA 2O19A 5DB4A 1CY4A 2YC4C 3RUAA 1AQLA 3ZZNA 3DFFA 3VYRB 2BEWA 2VR1A 2YIMA 1OH8A 1KORA 2ZPAA 3DCJA 1ND5A 1UDXA 3LO5A 2V7BA 1G5HA 3LCUA 4PG5A 4S1NA 5AI4A 1JMVA 3C14C 3IKVA 1GG2A 4ZYXA 3E9QA 4H1UA 5CYFA 3Q40A 4X65B 4EG7A 4JP3A 4K9QA 2XKKA 3FOFC 1FUEA 3PGVA 2GHQA 1QIGA 3IQWA 2JBAB 2QZJA 1H0KA 3KJFA 4UD2A 4ZU3A 3DAGA 3NLLA 4P82A 4RNCA 4S1TA 5CCXA 2XECA 4TZ6A 7REQB 3EXEB 5IVDA 4CKBA 5KDOA 3DS8A 4NZNA 2P9YA 4BNVA 3RFFA 2YH2A 1KRWA 4ND8B 4D99A 3FPAA 4IJUA 1ZXXA 4HNQA 5FL7A 4AZTA 4YJHA 4Q4HB 2QZSA 4WZ6A 4XE5A 5DTJA 3OCZA 2R60A 4OOEA 3MLAA 4JY7A 2P27A 4YR9A 5BMVA 1BXKA 3I05A 1YMQA 1AHIA 1Z6XA 4HTFB 4N6OA 4ZCSA 5IM5A 5CRIA 3L4JA 3IFSA 3MMXA 1B42A 4KCGA 1KC3A 2SECE 3BWCA 1RAAA 2AN5A 3FYUC 1W0KD 2VUUA 2PUBA 4C4AA 4N40A 1X1TA 4S3MA 2XMZA 3GGSA 1XHFA 3A06A 3Q3HA 4HB2A 3TVTA 4AN1A 1IUNA 3E5NA 1OROA 4MRNA 3ZCRA 1PLJA 1PR5A 2AFIA 2R68A 1HDZA 1XQYA 2W2LA 4OGFA 4E21A 3UN1A 1V1JA 2BT4A 2BHLA 3OT1B 2GXAA 4JBWA 1WD7A 5TJ9A 4HVLA 3FLBA 1XTRA 1Y4UA 4DG8A 4JS0A 4J4TA 1GZUA 2ZB7A 4G0VA 1BMDA 1KAQA 1YS9A 5G3ZA 1P2GA 4J2TA 1KMNA 3FPEA 3G7SA 4LFBB 4OHOA 4V0NA 4B3DA 5L3SB 3GAMA 2YOFA 1LDEA 3FWPA 4BQSA 3ESQA 3LHFA 4LKRA 5EP1A 3S1SA 4A15A 1FTGA 4UM9D 3ZE2B 1CF4A 3O8OA 2C77A 4DFDA 1FLDA 1I24A 1NDQA 3NS7A 4RESA 1X80B 4QBIA 1M5TA 1ZM4A 5AW3A 4OSEA 1TCAA 3A6ZA 2ZRJA 3LSYA 4G5FA 4PYNA 2PWAA 4GZ5A 3RAGA 1XT6A 3KKOA 3JAKA 3U7EB 1TTPB 3DTVA 5CNMA 3DKIA 4FHZA 3FWYA 1UPBA 3B1KA 4IUYA 4ZK6A 1LF5A 4LYEA 4BQPA 1EVLA 3K0AA 3FCAA 3KQVA 4GWLA 4BQQA 1OCEA 2Q7XA 2RDMA 3ZV4A 3PKIA 3QKRB 1U28C 1P0MA 3RC2A 3V2IA 3W2HA 3PEUA 3RVOA 1DTEA 3TL3A 5CDYA 5T7BA 1PHPA 2V0NA 3WV4A 1XJQA 4ZU6X 1FSPA 1W48A 4PZYA 4YT4A 5JI2E 5K0JA 4XPIA 3ADKA 3SHWA 4QATA 3SYRA 1VIYA 3HYCA 4LJ8A 2ID9A 1I8TA 3GEGA 4H1VA 4OO3A 1YB5A 4EB0A 1CW2B 4UATA 2GEDA 2ZVPX 4JI1B 2NWQA 4LXIA 3FOEC 1P81A 2KM1A 5CFOA 3RTCA 1XXHB 4KWEA 3MCVA 3ZCSA 3DWEX 4G84A 3UWSA 3WY9A 5BSFA 4WUTA 1DQRA 3O38A 2IV3A 2XDWA 4H77A 3R0IA 5FNVA 1D8TA 2B5VA 3PXAA 1L5KA 3ZNQA 1QE0A 1OI4A 3UYKA 5BNZA 1MB2A 1PP4A 3ELUA 3GRKA 4R8KA 3W8EA 1UBFA 4KXVA 4DNOA 5FPQA 3KQUA 2BUAA 3E2IA 2WHYA 4DIBA 1X86B 4OQFA 2QAGB 2VLBA 1AA9A 4TTPA 1D6JA 3BK7A 4PLYA 3I28A 3B1JA 2IYTA 3KR0A 4FZ5A 4PIVA 3SC2B 3T9EA 1U6JA 2HK7A 2Y27A 4A2WA 2IEGA 4DKXA 5K99A 3WQHA 3BWXA 1G8AA 4HDSB 2R8XA 1MB4A 2CLOB 1GSIA 2HWYA 1F48A 1T9GS 2V1XA 3A6GA 3GJ8A 2RHMA 3FBWA 5IDXA 2FZ5A 1JA9A 4TWJA 4FHEA 3I42A 2I5PO 2O2IA 4I66A 4MJ7A 5H0IA 3TB6A 1WR8A 4XZ3A 4C7KA 3DHEA 4DR2B 3V4RA 1JBKA 2NZUG 1OI3A 3Q9LA 5MDHA 4KYTA 3GLFE 4X85A 3DCNA 3L0BA 2JIZD 2DHQA 3T7DA 1RYNA 1NR5A 4IR7A 5CR9A 3WLFA 4LGYA 4EGQA 2W7TA 3D31A 2IYQA 2HO4A 2YYZA 1PT8A 1WM1A 3KZXA 3U81A 4AJ1A 1YZUA 3ZN2A 3CVXA 5T4EA 1U0NA 1JAXA 3CLRD 4OI1A 3W5HA 1I9CA 3T5AA 3R3SA 4C3OB 1XHLA 3VOTA 1KC1A 5FLYA 3HADA 2FG7C 3DD5A 221PA 2IXBA 5JCZA 4JB3A 4WY5A 4BMSA 1YCFA 1LDNA 3O3NB 4ZN6A 4AC9A 2W71A 1KO8A 3IBGA 3UCEA 3RFTA 4U7JA 5ES3A 1DKNA 1N9KA 4RFLA 2J45A 2YHIA 4C7OB 2NVUB 1P2BA 2XNDD 3N05A 3KQNA 2VYFA 2JLXA 1ND6A 3EEIA 5H3CA 4X7MA 5T4HA 1VG0B 5L3ZA 5EP3A 1TA9A 3IBFA 4GVLA 5HDQA 1E1QD 3JQ8A 4JJFA 3X1YA 4DEXA 5CEFA 2A88A 2H31A 2J5KA 2ZBEA 5LZ8A 4GC9A 4R6WA 2NQTA 3EPJA 4H7IA 1RRKA 1D0SA 4AP5A 3TQRA 3FNFA 3LUCA 4QXAA 2HOQA 2GTIA 2QL5A 3NAMA 4KR2A 1F2TA 2B8TA 2R86A 2XA2A 3K8OE 4DQUA 3PTAA 1RMYA 3Q5EA 5JDIA 1PVDA 4JH0A 1CB0A 1GGHA 2JA1A 5KTTA 4M0DA 4C4TA 1MIOA 4CN9A 5CT6A 1OSNA 1S2GA 3DOUA 4YRCA 4LRTB 4U6SA 2WSBA 4ZYUA 4UOEA 5K4GA 2QX4A 3C45A 1X2BA 2GLTA 3EDRA 5AJTA 5IK2D 2IHNA 1TAGA 1D1QA 1TADA 2PAAA 3WO0A 2XZOA 2Q6IA 1XTBA 4TMFA 1NC1A 2RB5A 3ONWA 1N2GA 3OQ1A 1KMCA 5DXAA 4DYHA 1NW7A 4NNOA 4HFMA 4KN6A 1Q57A 3V9PA 1BOFA 5K5EA 2GPYA 1HX7A 4NWIA 3ZHUA 5ALZA 4LHXA 1LJUA 3PR3A 2FQXA 1IOLA 3VC7A 1Q7TA 3I1JA 4RVGA 5DM2A 1VHDA 3LVFO 4KH1A 4AMZA 3HH8A 4MW7A 4O4LF 2MTBA 4O4HA 3PWZA 2X0KA 2R6DA 2A0UA 5JPIA 2XUGA 1OZAA 1QYRA 2PSJA 3E82A 1U8ZA 4JN6B 3ZHZA 1W25A 3D3KA 1RU3A 1NFFA 1ZM9A 2HEIA 3EVAA 3EFHA 3LC0A 1GQYA 1U7OA 3L7DA 3E5MA 3M6VA 4TWIA 4D3YA 3A4IA 2HK9A 1G3RA 3LC1O 4N9WA 2JH3A 4WSOA 2QX9A 5DM0A 1DRJA 2O8BB 1RMQA 4BMDA 4PHFA 3HR8A 3GVIA 4L6CA 4IJKA 1D5WA 2V6IA 5ESDA 1TK9A 5IBRA 3QHQA 1G2OA 4RZUA 1ES9A 4P58A 1J1IA 2WSIA 3TSAA 4H17A 1Q2XA 2BGGA 1QZZA 1R66A 3FMVA 3MMSA 1D1SA 1D6SA 4ERXA 3FDIA 4O4LA 3EIEA 3SZRA 3TW6A 5LYJF 2R7AA 3NRBA 4XX0A 5DM70 5FPPA 3C7DB 3FHTA 1HK7A 3IBSA 2I6SA 1ZLYA 3SEZA 2ZYUX 1I2ZA 2LXNA 2EEPA 4JROA 3H7IA 1PZGA 3X1DA 2WK1A 2HMWA 3G8CA 4NI5A 1S2IA 4MUKA 5EWMB 3DQQA 2CLLB 3M4XA 1Q3HA 2A1UA 1RWNA 3FPGA 4QGHA 1U99A 2HW8A 1T9DA 4GYJA 3RBAA 1AXGA 2D7CA 3M82A 1EP1B 4I9NA 2D3WA 4OB7A 1JR4A 3LC7O 3T1OA 4CLXA 4GKJB 2JKZA 3JQCA 2PZLA 3WJ7A 1O08A 3RYHB 2FG5A 2R5WA 4RV4A 1Y7HA 2CMDA 2FPPB 2Q4DA 3LUDA 3ROXA 2ENWA 3SIRA 3K7EA 1KXZA 2QN8A 2RC6A 4L4SA 2I33A 2NZYA 3GLFA 3HB4X 3OZ7A 2VBCA 3FOAA 4PGHA 2JLQA 1UAGA 3I9MA 3OEHD 4Z8XA 2E87A 4GWKA 5JAUA 1G6HA 1GFIA 4UMEA 3ADCA 1UK8A 5ICMA 3F9RA 2FW0A 1MJGA 2VG8A 4NBUA 3J81A 2DUNA 2NTNA 3EXHC 4OQLA 5EMLA 4Z7NB 2Y67A 4RAOA 4NCIA 5LDGA 5DNCA 4JXZA 2VL7A 5T8KA 1LRJA 4QHTA 3TFWA 1T34A 1ZU5A 1B7GO 3IEMA 1Q1NA 2VDOB 3BWDD 2DVMA 2LTAA 4GAEA 4AJIA 2Z8XA 2X1MA 2PU5A 3BJRA 1Y80A 3ZZTA 4F6CA 2BTEA 4FB5A 1HDEA 3HSYA 1G291 3G2IA 4XIIA 4I9GA 5FWAA 2NW6A 3T8YA 2IZ0A 4MVJG 1M34E 3MFQA 4LBVA 2P2ZA 4ACBA 1NVWQ 3ETGA 2R6HA 4H08A 4RH1A 3OQMA 4MR7A 1F2UA 1XDGA 2CVPA 4YT5A 4LYHA 1M8JA 5JCJA 1N1MA 4RHCA 2QMUA 2Z5VA 1LC3A 5I7HA 3QF4B 1K6EA 1L7EA 3AR2A 3T95A 1C0KA 1ORIA 4UD6A 5JDCC 2NUAB 5IZ4A 3AJ9A 4J1QA 3LVBA 1UOQA 1NUPA 4GBED 5GJBA 2HPAA 2VH1A 3BFJA 5KU1A 1VQ1A 3JVEA 4N5HX 2D1QA 2XKBA 5CT8A 4KJXA 4DCSA 2FN4A 3RFXA 2VATA 3C3YA 4Q3BA 2IZ5A 3G9XA 3U49A 1MXHA 4FI3F 2HA4A 1QOPB 2GM9A 2YXDA 4W82A 4KN9S 3AYXB 1BWQA 3H5OA 4H15A 2AEJA 5BSHA 1OUMA 2QX6A 4L7VA 5F4ZA 3H2ZA 1HE5A 1YS2X 4ZZ0A 3RG2A 1V8ZA 1E7RA 1KJZA 3P52A 2HSZA 3JD3A 1IY9A 2PSHA 2FWAA 2XWSA 1V5FA 3CX6A 5KQPA 5EIXA 5DT2A 5U1PA 1XRRA 1OBCA 2ZETA 4RKEA 1DBPA 3IAFA 1SCNE 3PGA1 4O6VA 4H3SA 5P21A 5D6OA 1RWVA 2EW2A 2FPUA 1NXQA 1GFWA 1HQKA 3C6YA 4Y2YA 1DU4A 3CNOA 4FYVA 5CJPA 3RANA 2J3HA 1B8PA 2WWHA 3GCZA 3UWOA 1E1MA 2OXCA 3ZNPA 4AO6A 1B1CA 3D02A 1G6KA 5FUXA 3V48A 3AKZA 3FR8A 1XK6A 3HUFA 1X7WB 2ZJBA 4JVSB 3IUBA 4NESA 4TYWA 2O5RA 1JG7A 2C61A 3CH4B 1R0SA 2QLFA 5JPCA 3NM6B 3BT7A 2GDZA 3ANYB 5JBIA 1MRSA 4YHBA 2Y4OA 1R9GA 3GDOA 3H83A 1U31A 1LWOA 3OZRA 2AJ8A 2IKSA 2RHDA 1EBFA 5K0LA 1KZ6A 1CUZA