4XH9B

Crystal structure of human rhoa in complex with dh/ph fragment of the guanine nucleotide exchange factor net1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
174
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVNSPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuroepithelial cell-transforming gene 1 protein
publication title A structural study of the complex between neuroepithelial cell transforming gene 1 (Net1) and RhoA reveals a potential anticancer drug hot spot.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 174
sequence length 178
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xh9B00
1N6KA 2O8BB 4U00A 1ZC4A 2IBMA 4LV5B 1ZCBA 3CLVA 4ZKDA 2O8FB 2IYLD 1Q1QA 2CCJA 4JIMA 4DRZA 4Q1AA 1F2TB 3WYFA 1HURA 1COWA 1N6NA 3IKJA 2PJZA 3TW8B 4II7A 1E3MA 1FP7A 2FZLA 2VIIA 2IW3A 1XEXB 2CXXA 3GLIA 1U90A 3QI2A 3NBXX 5G3ZA 3TBKA 5JHHB 1G3RA 3R7WA 4FCTA 1KO5A 3BIFA 3M6AA 4EQ6A 8OHMA 1WA5A 4OK5A 3QPWA 1M7HA 1FTNA 2LKCA 2XAUA 5GVSA 2ZREA 2R6DA 3VNUA 5LD2C 3OIWA 2IUTA 3QXSA 4GMDA 1WP9A 3ZS8A 4IXMA 2NTYC 2MSDB 4RZXA 4B2LA 1JXOA 2QTHA 3VU9B 3CNOA 4DLUA 3SYLA 4MYTA 2YJTD 4MGZR 2BBOA 2PLFA 5K8UA 1DS6A 4ZKEA 4BLTA 4ARZB 1AZSC 1XD2A 3ND9A 3BGWA 3UMRA 1VHLA 5EXXA 1JPNA 1CJKC 4QRHA 4QFMA 3QKSB 4GOKA 1KI7A 3E70C 3A1WA 2ZR0A 3U3KA 1DPFA 3GLGB 1NVXQ 3Q7QA 3VX4A 2IS6A 3DMNA 2FWRA 4BZPA 3AP3A 1AS0A 4HAYA 3ZVRA 2PLRA 4B75A 1L8QA 1BKDR 3DOFA 5IK2A 4PQRA 2A5DA 1R10A 2GNOA 2CL6X 5FOXA 1TF2A 1P61B 3A1SA 4WXPA 2J7PA 2VP4A 1FMLA 1NBMA 3X1YA 3ZZUA 1YU9A 3AVXA 4M1YA 1Y63A 3AKCA 3C5CA 3MG9A 5B30A 2UZIR 1SKYB 1V43A 5AWFC 4LC0A 1CU1A 4LYHA 4TMWA 3TNFA 4OK6A 1FMJA 1K6MA 5JSZA 1AZTA 3U7FB 1UBEA 1IJEA 4B32A 3RDPA 3TVDA 3AKYA 2QTVB 3DZ8A 2NPFA 1RZ3A 4JVNA 4HDCA 5GJCA 1S1MA 4D2IA 1AQYA 3NTUA 3QG5A 2YKGA 1D9XA 1ELOA 2Z0MA 2ZR7A 3KXLA 2WWHA 1PLKA 1M7BA 1Q1EA 3KUDA 3LXRA 4JL5A 1ZIOA 4Q9HA 5KOYA 3BB1A 1E4VA 2GKSA 5E7MA 1JR6A 2HXYA 1R5OA 2NZ8A 2PBRA 4ZIRB 3VR3A 3THXB 4LHVA 1NVVQ 2IUSA 1EESA 3L43A 2GK7A 2QE7A 4ZV4A 3BFXA 2A2ZA 4QBGB 3LAWA 3KQLA 1KO8A 4RVCA 3EA5A 4TLBA 5DYIA 4ZO4A 2IXGA 4MGIR 1E2HA 3DL0A 3TAHA 3EZ9A 4Q03A 3H4MA 3SU8A 5C4MA 2V4ZA 3A8TA 2EWWA 3EPKA 2Z83A 1BMFD 1NJFA 5FBLB 1UBGA 2W0SA 1PLJA 1JJ7A 4NCKA 3UG6A 3LW7A 4LBYA 3C8UA 2GEVA 2JLXA 2OILA 3NBFA 4NHOA 2QP4A 4TLAA 3TRFA 4BFUA 1MABB 4JJKA 3LQRA 4KJZA 1QZXA 3MJRA 4IDOA 4MRSA 2JJ2D 3TR0A 3LD9A 4TMZA 2O8CA 1TU3A 3TUIC 4AYTA 4JVMA 3IQWA 4FIDA 4LCBA 2HT6A 4PQFA 2QGNA 4HLDA 4CT5A 5FI1B 1OXXK 3FHTA 4BWYA 1XEFA 4TTRA 3PG5A 3SFZA 2BKUA 1ZNZA 5JCZA 4RFSB 1OH8A 2E1RA 3SQXA 1KJYA 1NSTA 5DO9A 1DAHA 4A6XA 1CJTC 5DYGA 4V0ME 3FMIA 3VR2A 3KB1A 3CWQA 4XWKA 3K1JA 1VCMA 1QHGA 1Z06A 1Q3HA 2F7SA 5HKKD 4TYQA 2ZE8A 2RGGA 3UG7A 3BH6A 4BECA 4RFVA 4LJ4A 2CHVA 3VR5A 2C9YA 5CK5A 1P5ZB 2FGJA 2WKPA 1GL7A 1ZBDA 1AA9A 1OT3A 1G3IA 1KDOA 3ADDA 2D06A 4LHWA 3I4LA 3CPEA 4NCJA 3V9PA 2WWXA 1OHHD 1N3BA 4NCNA 3IQXA 4A6PA 1ZINA 4LHZA 3MRSA 3RRMA 4EFNA 3QUSA 4Q4LA 1VG0B 4R2IA 2H1LA 1OXVA 1RJ9B 4I1OA 3LLUA 2CCKA 2VTKA 2WOJA 2PCJA 2G0NA 2QGZA 2IUUA 3TQFA 4JKIA 4AKEA 1XJCA 2CK3D 4YC7A 1JB1A 1N6OA 2QROA 1DAGA 1QHSA 1ZAKA 2QRNA 4D0NA 5CM9C 4B71A 2VL7A 1DE0A 4LWZA 1G20E 4BUJA 3E5HA 4LYAA 4CEIA 1GWNA 4KFRA 1SHZA 2ANBA 3W5JA 1E6CA 4RCZA 1MO3A 4FWIB 1ZM9A 3A37A 2VHTA 2GILA 4IFBA 1VYTA 4EDHA 1OFTA 1L7VC 3FHCB 1XTQA 2F55A 4EPTA 1E2DA 3BK7A 2Q0HA 2VO1A 2BMEA 2GXAA 3ZYCA 5FPTA 2ATXA 2HYIC 4DB2A 3O8CA 4FMDF 2QG6A 1KSGA 5FPYA 4C4PA 3R9XA 3EC2A 1RVDA 1G16A 1OXUA 2PMKA 1AM4D 4TMVA 1CJUC 4XWAA 1E2EA 3QOFA 1MRNA 3WHKA 1NVUQ 1BS1A 1TPZA 5FTMA 1TAGA 2D62A 5J4HA 1QHHB 2CDNA 4B2IA 5CJ2A 3KQNA 2ATVA 2WWWA 3AKEA 1KAOA 2ZE5A 5L3SA 1G5RA 4FI3C 1DVRA 3TSWA 1Z22A 4KHZA 2QM7A 1JR3A 3W3ZB 2JJ1A 1ZUIA 4ZI2A 3QF4A 1BYIA 4URXR 1R8QA 3KX2A 5G3YA 3L8YA 1ZD8A 2V8OA 1CF4A 2BMDA 3AM1A 2OAQ1 1Z0KA 2JATA 1TUEA 1WF3A 4JSTA 4RD6A 2ZETA 5DI9A 2VSXA 1KI6B 2X19A 3IIJA 1BYUA 2IHYA 1D2EA 4LV6A 4MA4A 4IEEA 3IHLA 4D0GA 2WWIA 2ZRFA 1TF5A 3FMFA 1EFRD 5TVKA 3ZZTA 2QBYA 5CM8B 3I8SA 3CNNA 4NYIR 4IRUB 2FF7A 1N5JA 4KU4A 1IOZA 1QDEA 2G1KA 2ZI7A 2ZPTX 2DWQA 3AQ4A 1VECA 5CLQA 4PSAA 1N0WA 4V02A 2XITA 1ZM4A 3ADCA 3B5JA 3BB4A 4TSFD 4R7ZA 5TY0A 2A5YB 3GFOA 4TL7A 3THYA 2Q3MA 1W2GA 2QI9C 4JJZA 2TMKA 2CHQA 2RGEA 3AVYA 3WYAA 2DB3A 2VHUA 2VP5A 1JECA 1N0UA 2O5VA 2JLWA 4P32A 3GLIB 4JT2A 2IYYA 3VKHA 3CB4A 3NIBA 3R7WB 5BQ5A 1XCMA 3R20A 3OFND 3WYGA 5L8VA 1N6LA 4NONA 4PFSA 4EPYA 1ZJ6A 2FDCA 4TL9A 4WZAE 4B35A 1QG2A 3KXKA 4Q4HB 4I1VA 4B3XA 2WTUA 2I1VB 4OL0A 1R7RA 3FVQA 3SZRA 2IS2A 1W2HA 5CB6A 5D3QA 1SGWA 2XB2A 2Q9AA 4Q4AB 5EP3A 2FSHA 2ZJAA 2JCSA 4OQNA 2JLQA 5FOWA 5JECA 2CNWD 1YHNA 1BMFA 4HLUA 4AG6A 2B7CA 2NGRA 3EIQA 2BDTA 4UNSA 4P4UA 5CDFA 3RRNA 4DCNA 2IC5A 4XWOA 2VPPA 2P3SA 4EUNA 1H8HD 5DN6D 1YZKA 4NCIA 1YZUA 4DLWA 4NMMA 3E1SA 1XBTA 2EFEB 2J0SA 1YE8A 5HTKA 3C5HA 1DTSA 4GZLA 1TQ4A 4PAMA 1VG9B 3D6TB 4HDQB 5JJKA 1UBFA 1OSNA 5UKDA 2EFHB 4GOJA 3CPJB 1J70A 4XSHA 2AL7A 3AGQA 2FEMA 5AJVB 2GF9A 2OCBA 4HAUA 4E07A 1I4LD 4OQXA 2N1BA 2ZAMA 2FMXA 5JSZB 2XSZA 1Z0AA 1PZNA 5EJEA 1AQUA 3WRYC 4HDOB 2FJUA 2IYTA 2BEJA 2G77B 2YV5A 2HCJB 3H86A 4QHTA 3PV0A 3PR1A 4DCVA 5DHAA 4PPQA 2HCBA 2W2VA 4DBLC 1XTSA 2WMNB 2F3TA 1E9EA 2GZDA 3FFBA 3IEVA 3QKSA 1E99A 2REBA 3KKPA 4BASA 4KITB 2NO7A 1N6HA 3GLGA 4DB4A 4OK3A 1ZYUA 3DM9B 2QAGB 1U9IA 1ZD1A 3H1TA 1H65A 3K70D 2DPXA 1R0XA 2XTZA 3EWSA 1II8A 1OHHA 3CO5A 4QOSA 2ZXUA 3U61B 3AF3A 3DPUA 4P33A 4MKHA 1TMKA 2ZYUX 3K09A 3KKOA 1X8KA 1ZIPA 1KK0A 1E2GA 3QKTA 3UMFA 2CLSA 2O0JA 4Q1DA 3OEHD 1GVNB 5JWOA 3I72A 2W6ID 1ZM2A 1GITA 2VQSA 2QA5A 2JAQA 4LUCA 1CP2A 4PHFA 3WBKA 4C0LA 4MYCA 2DWOA 4G5QA 1P2VA 4X8HA 3PCRB 1NSFA 2KSQA 3D7MA 3EASA 4ZPXA 1KI1A 4HI0E 1KMHA 5KSYA 1RC8A 4MKIA 1COWD 5CLLA 4M1SA 3I73A 5CITA 2BIFA 1G7CA 4RJLA 3RS3A 1G3QA 4DIEA 4D0LB 1NP6A 1DAFA 2WICA 2ZRBA 3K0AB 4QL3A 3RC8A 1SVWA 1JALA 3B2EA 4NU0A 4EJSB 4DLXA 1PVOA 1IN8A 1R5BA 2AHOA 4Q4JB 4P0TA 3L82B 2O8CB 1RIFA 1U8YA 4AD8A 3TGPA 1JNYA 2JA1A 2I4IA 3THXA 1T5IA 4PZLA 1CRQA 2O52A 1W36B 3BRWD 3NXSA 1KYIA 3ONWA 4UXHA 2ZUBA 2XNDD 4JKYA 5EUMA 5SZHB 2YZ2A 4LJ7A 1DADA 1VCIA 1E9FA 2QNRA 1EX6A 4WW0A 2IF2A 4IVRA 2JLRA 3TR5A 3SYKA 4NL4H 4B3GA 5JWHA 2MMGA 4JZKA 3I5YA 4US0R 2OM2A 4G5GA 1G1MA 1XEWY 4DVGA 1XNJA 2ZJ8A 3RLFA 1OH6A 3RS7A 4F92B 2OFWA 2GJSA 3B8HA 3B6EA 1SVOA 2NQ2C 4LBZA 4AIIA 4FMBB 2VBCA 1YR7A 1Z07A 4ACAA 2ZRPA 2ZSFA 1XPRA 2Z6VA 1KK2A 1ZU4A 1B0UA 2C04A 1HT1E 3CH4B 1E2PA 2VRWA 3ZQJA 3D8BA 2WJGA 1XMSA 3B1WA 1SXJB 5FL3A 4MRVA 1EFRA 5EUQB 1JBKA 1G18A 2J7PD 1HT2E 2BCJQ 521PA 4GDFA 3KJGA 3NHAA 2BOVA 1Q44A 2F6RA 2QL6A 4GBMA 5JBQA 2RHDA 1NL3A 4TMXA 2IXFA 3UK6A 1U99A 4TLEA 3N2IA 2UVQA 1E94E 2WAYA 2GJAA 2QEQA 1W7AA 1GM5A 3IEUA 4NYJR 4GNKA 1N0VC 4KBGA 1XP8A 1JI0A 1M6NA 3CRQA 4DWJA 4DCSA 1E9BA 3WMEA 3VR6A 1E9DA 4LY6A 4J0QA 2ZQ5A 4DLSA 2VP6A 2NO0A 4TL8A 3TUJC 2EYQA 3K9HA 4GMXA 4Q5IA 4D82A 3QEOA 2QM8A 1D5CA 3CKLA 4MRNA 2W00A 3BE4A 4B43A 3SBDA 3GCGA 1YJ5A 2QQ0A 4C0QC 4A2PA 3HR7A 2J0UA 1KO4A 4PO8A 2Z4RA 4JSYA 1TU4A 4XIGS 3NWJA 4DKXA 2MMCA 3X1XA 4KYIB 5L3SB 4A8JC 3ZD6A 1IJFA 2IYUA 4YQFA 4TQAA 1D6JA 1CBUA 2F1IA 2WSSD 3QQ5A 4Q47A 1XJ0A 1Z0DA 4BRUA 1WQ1R 5CYPA 5IF9A 4TQ9A 1NIPA 4KVGA 4X8LA 1NF3A 2CNWA 4C0HA 3SBEA 4ZCLA 1ZD9A 5FL7D 2IEYA 3WNDA 4DDUA 2ZRIA 4KBFA 2VYFA 1SQ5A 1YVDA 4JLAA 2J7KA 2QPOA 1OB2A 3TUZC 3VTKA 4IVPA 4JLMA 5H68A 4DEXA 3KJHA 1KKMA 2CHGA 3AP1A 1W5SA 2P65A 3ND8A 3GLHA 4RZ2A 3RWMB 3TLXA 3GFPA 4FW9A 4RZ3A 3MAAC 1W36D 3SR0A 5KNBA 1GRNA 3CX7A 4Q7MB 2A30A 3NH6A 4KYUA 5HCNA 2A7QA 3AEZA 4OYHA 3SI7A 4BFYA 4HATA 4DJTA 1KK3A 4DSUA 5KSOA 5H8WA 1E2NA 1C4OA 5JJIA 2QAJA 3RRYA 1KI2A 4QNRA 4M1OA 1RRGA 2JIZD 1M8PA 4QXAA 4ZCIA 1XPUA 3THYB 1MOZA 4XVUA 1B23P 2QPTA 3LA6A 2ZJ5A 3BBPA 4EAQA 4ZI3A 4Q1CA 2Z43A 3O8RA 1ZNYA 2GXQA 2ZJZA 4P3YA 2H92A 2CL7X 1R4AA 1XCGB 4POAA 3DKPA 5CIWA 2BM0A 2WIAA 5BXQC 1OKKA 1KI6A 3EPLA 2J41A 3VX3A 4WOPA 4P31A 1S4QA 3NH9A 1BOFA 3QNUA 4EKDA 2R6CA 1UF9A 3WP1B 2OZEA 1W5TA 4WBSA 1S9DA 1SXJD 4GT1A 4HLQB 3AP2A 2UKDA 3W9YA 1KTVA 1E69A 2PL3A 3LXXA 4KLZA 2IYSA 2HLDA 2QT1A 3X2SA 2C9OA 1CRPA 4IDPA 4Q19A 4RSGA 3A6PC 4B6FA 1W47A 4Q7LA 4Q7JB 2C96A 4YMSA 1KJWA 4NBSA 5JRZA 3PIRA 2ZRMA 4N0DA 2GAAA 2A9KA 5HCIA 1C9KA 3EPJA 3O8DA 4CEJB 1QHIA 5EXSA 4AC9A 2IYZA 3H84A 4EFMA 1CR1A 1G8PA 1L4UA 5DISB 5B57C 2VLIA 5DIFA 4Z1MA 2F1HA 5GJVC 4M1KA 1OB5A 4FXPA 4NYMR 4W5HA 1ZU5A 2B8TA 4M1MA 3FTQA 4US2R 2CLDX 5DE3A 1XZPA 1J99A 3B82A 3GPLA 3UATA 2V1UA 4B44A 4TT3A 1GNQA 1UFQA 2J59A 3CBQA 3EX7C 1U9IC 4OHVA 1KI4A 4PC1A 2AX4A 1EXMA 3LV8A 1D2NA 2ONJA 1D8TA 4KSBA 1LY1A 4HUQA 3IIMA 5CIQA 1VG1A 4Q4HA 1JAHA 1GNPA 2XNDA 4L16A 4GP6A 4ZCMA 4IHQA 4UNPA 3EG5A 2A5JA 3AVWA 5C1BA 3NVAA 3C16C 1O3YA 1QVAA 4TTQA 1GP2A 2RMKA 5FBWB 3TVTA 1G6HA 1JR3D 4Q4AA 4JYCA 1W0KA 3WXMA 2JJ1D 2BBWA 1CXZA 5EE5B 4QGAA 2NZJA 2NMVA 2ZS9A 4C0JA 2ZI4A 3ICEA 1GSIA 3NDBB 2ERXA 1JEEA 4D81A 2AWOA 4Q7KA 1G41A 3MWLA 3UKDA 2YWHA 4R98A 121PA 2NOAA 4XTRA 5FBRB 2NPIA 4ESHA 4TYPA 3A4NA 3DEFA 4B33A 4CW7A 2QT0A 4IW3B 3NHBA 4I1SA 1II8B 4Q1BA 1Z83A 1KO1A 5KO2A 4B74A 5CYOA 3S1AA 1N6RA 3ZVLA 2ZJOA 4S2EA 2JLZA 1FFHA 2QSYA 3PITA 1ZM3A 2D7DA 1Z47A 1NI3A 3U3RA 4GI7A 4OQMA 1KIMA 4QG7A 4B3CA 1IY0A 1E0KA 2DCUA 5FBQB 1VIAA 2AD5A 1TEVA 1K5GA 2OBNA 3H2YA 4Q01A 1LNZA 3BH7A 1OLOA 1GOTA 2YHSA 2W0MA 4IDNA 5EZ6B 1KMHB 3REFA 3GEIA 4KFTA 5KNDA 4UXIA 2C8VA 1A2KC 1Z6XA 3KQKA 3GJ3A 4IXNA 1GFIA 3RANA 2OHFA 1KZ7B 2V9PA 3RAPR 2WV9A 1KI8A 3MCAA 4JLKA 5LB4A 3KQUA 3EAQA 1KSHA 4F4JA 3M1IA 4Q9LA 2QAGA 3EPHA 1UKEA 1TEXA 3B7GA 2FA9A 2ASEA 4JS0A 2ZR9A 1EWQA 1S96A 3L0OA 1ZCAA 4PO9A 1WCV1 3V00A 4LJ8A 3C4JA 4F93B 1MR3F 2REXB 2RGNA 2ZYVX 3WMFA 3PUXA 4DT1A 3U7HB 1GIAA 1GL9B 1FNNA 2W2XA 3T35A 2EYUA 4Y0VA 2L0XA 1FP6A 2ZE6A 3BD9A 2G6BA 2WSSA 3RS4A 2PT7A 2VEDA 1ZC3A 3ZH9B 1W46A 3OESA 5EQTA 2G0TA 1F2UA 1OYWA 1NLFA 1NBME 4S35A 3RS5A 2BJWA 1ZM7A 2XJ9A 4PHTA 4B6EA 5FL7A 4WXRA 5TV2A 1S8FA 4MQBA 1AKYA 3THWB 4OI1A 1IN5A 2P6NA 4B76A 2IEZA 1EWRA 1XWIA 1JAIA 4QBFA 1DARA 2JDID 3K0AA 3O47A 3U3MA 3KXIA 4G01B 1T8TA 3PENA 1SVIA 4LPSA 4JL8A 4EJSA 3B1XA 4Q4JA 5KTYA 2WWYA 4A1FA 1N6PA 3MSXA 2ODNA 1A1VA 1MO4A 2CE7A 3EW9A 2V3CC 1E9SA 1DAIA 3HU1A 4XSGA 2ZRJA 3RVBA 2XTNA 2EFCB 2FPKA 2XSZD 1R0YA 3L0PA 3SDZA 2VHQA 4EPVA 2IYVA 1RYFA 3U44B 1Q3TA 1KZGB 3CRW1 1NLZA 3K0FA 4YXWA 1UJ2A 3ZVMA 1P75A 3LFUA 2GEUA 2JIZA 3Q5DA 1U0HC 1X8LA 3BXZA 4HAXA 4Q48A 3PVSA 2WZQA 3SNHA 1KAGA 1OXTA 3ZLJA 5IRCD 1TL7C 4A0HA 3PUZA 1KDTA 1T5LA 4M21A 4OJQA 2HJGA 1FPMA 1LVGA 2OBLA 5BYKA 3WMGA 2C2HA 2GHIA 3AVOA 3EXAA 3HJNA 3I8XA 4DDWA 3OE7A 4QBHA 3J81k 1VHTA 3VKWA 1II9A 2V7QA 2AFHE 3FYHA 4JL6A 3FPAA 2P67A 3FDIA 2LKDA 2R6AA 4PPFA 3U60B 2C9CA 2LCFA 1IXRC 2V6JA 1DG1G 2J0UB 2WAXA 3ADKA 1Z6AA 5EP1A 4EIWA 1SXJA 3ADBA 4QC2A 1CLUA 1XXHB 4LYJA 3GLFB 2WSMA 1ETUA 1S1CA 2QMOA 4AKIA 5E4FA 1E2IA 3DO6A 3EA0A 5A5GA 4FWTA 3I5XA 2BC9A 4WVFA 3QENA 1SVSA 2MSCB 1U81A 1S3GA 5K8TA 1UPTA 3IPYA 3QPUA 5FUXA 3P4YA 2IK8A 3REGA 4AWXA 1KNQA 1IONA 1G9XA 4UJ5A 2ZI3A 4IDQA 2OXCA 1GG2A 4XVQA 4MYHA 5HPYB 3HU3A 2REOA 2GVZC 5DNYB 2ZI9A 4P4TA 1IAQA 4KO8A 4EPXA 1T91A 3IO3A 4KVAA 2EW1A 1CR4A 1FTSA 1OF1A 1YZLA 3FE2A 1SVKA 3GLHB 3LX8A 5E7IA 2CE2X 1A5TA 2FOLA 5JCPA 4EPRA 3K70C 421PA 1DOAA 4F38A 5FTLA 5F9HA 4UJ3A 1ZNWA 3FMOB 3DZDA 1X1RA 5SZJA 5J4YA 3C41J 4B34A 4XTCS 3BERA 1E2LA 3P20A 2QQEA 4HB0A 3TJZA 1T4GA 2FEOA 1W4AA 4A0GA 1KI9A 4URVR 3IGFA 5SZKB 1HY3A 3UANA 1Z0JA 1D2MA 3QVVA 1LTQA 3GJXC 1E9RA 3GMTA 5A4JA 3IDQA 5JS8A 3EWAA 3HP1A 4PAQA 3W8RA 4CZ2A 3U7GA 4JT4A 3DM5A 4M9ZA 4GSYA 2QUZA 2VF7A 1H8ED 2NO6A 3F0TA 2WMOB 3DMDA 2WPDD 2ZRCA 2EU8A 3CR7A 3GJ4A 4ZDJA 2HDNB 2R9VA 5FTKA 3ZS9A 3D3QA 5FUYA 1G8GA 1L4YA 1OFHA 1LS6A 1I2DA 3OF5A 2WJJA 3EARA 4V0NA 4NZYA 3AVVA 2R6FA 1KMQA 2XZOA 1HH4A 4E09A 4NPHA 3U6KA 3FGNA 1E79A 1OJLA 2P5SA 5AJWA 4UNRA 1K5DA 2ZTSA 1SVLA 1ZNXA 1HEIA 2IL1A 5KUTA 4KLNA 1V5WA 3P27A 1F6BA 3TQCA 1HYQA 3BJIC 4HB2A 4XD7D 3UIEA 2PZEA 5BN5A 2OSBA 4US1R 3RRZA 2PCLA 1NN5A 4JLOA 1NN1A 1RFLA 5K8LA 1P9WA 3QY0A 3C14C 4D26A 1P2SA 4RZUA 4HUQB 1Z0FA 2BEKA 4KXFB 4A9AA 4EPWA 5FOTA 1N5KA 1T0HB 1PLLA 2WOOA 1Q20A 5DHFA 4MYUA 3AVTA 2ZEJA 1PUJA 3A36A 4QJ5A 5B2ZA 3VFDA 4M22A 3MLEA 1NLYA 3U7EB 2HYDA 1ESNA 1R5NA 2WJVA 3NEJA 2X2EA 3OIVA 4LJAA 2GTPA 1Z5ZA 3EZ7A 2IWHA 2GF0A 4NKRA 4BFZA 2J3EA 1GDDA 4C0AC 1UADA 3FKSA 4BPBA 4GZMA 3EZFA 4CEJA 3U3OA 2AXNA 4MGYR 4ZDWA 4TWZA 3LDAA 2EQBA 1LFDB 3KB2A 2OXRA 2IHBA 4FMCF 5L3VA 1JPJA 2ODBA 1OYYA 2X1VA 5GADl 2JDIA 3S1AB 1G8FA 2EFGA 3RNLA 2ODEA 3ASYA 5BN4A 1OH7A 2WJHA 4JLVA 3UPUA 1E98A 4C30A 1FUUA 2BHRA 3CNLA 3GJ0A 3AF2A 6Q21A 2B92A 2UZ3A 1HE1C 2YWGA 2QTFA 4PZZA 3T1QA 1QRAA 3WHLA 4A4DA 1EX7A 1KY2A 1ESMA 2PZFA 3CIOA 2OFOA 3CRVA 3IBGA 5F3WB 1LB1B 2X77A 1YZQA 1IY1A 3RYTC 4B2PA 4NE2A 1WB9A 4U5XA 1UDWA 1NMZA 3RS2A 5J47A 1E4YA 4NCHA 4HAVA 2XXAB 1L2TA 1XPOA 3MWYW 3WNBA 1P9RA 1NN3A 1OKKD 2CVFA 5J4LA 3LW8A 4LC1A 1VDZA 2QU8A 4IOMA 2C5LA 4H1UA 4ACBA 3AKDA 5TARA 2XX3A 5TDHA 3RS0A 1X86B 1VYUA 4HLCA 3IUYA 1DG3A 4JBXA 4IOKA 4TL6A 1GKIA 4DT1B 1VMAA 1NY5A 4EJSC 3ECCA 3KKQA 3WNCA 2J9RA 2HLDD 2AKYA 2D4HA 1R0WA 1TADA 2XTMA 4Q21A 2JGNA 1WBDA 1YR8A 1W36C 5L3RA 4DC9A 1Q21A 4ZDIA 4HAZA 2KWIA 5D3MA 1F2UB 4Q1FA 1YZTA 1J2JA 2FFHA 3KFXA 1RPZA 5IDVA 2ZUDA 1LS1A 2D2EA 3T06B 4FCVA 4QM6A 2ORIA 3GJ8A 4Z1MD 5JS7A 3NC0C 2VF8A 2OCYC 4YMTA 4GL2A 1DAEA 2W83A 2NO1A 3UWOA 1OPXA 4TT3D 2X8AA 2D7CA 2VSFA 4DCTA 3I3SR 1GUAA 3Q7PA 2BCGY 4BRWA 4LBVA 1E1RA 2XZLA 4CEHB 5HE9A 3GLGE 4I81A 4X8OA 4DSNA 1U94A 3IHWA 4AYWA 2I3BA 2C03A 1SXJC 2GXSA 5HZKA 4UNQA 1AK2A 2QRZA 3K0FB 5E7JA 2B7BA 1QHNA 3GJ7A 1W0KD 2ZU0C 1RYHA 3K53A 1WMSA 1NY6A 4C3ZA 1NG1A 4BFTA 3SJZA 1SKQA 4A2WA 1G7TA 1G19A 4KCGA 1XEWX 4U7DA 4M9XA 4C7OA 2C78A 4LJYA 2FNAA 1SKYE 2ZANA 3THWA 3T5GA 3KTAB 4LRWA 3TK1A 1PUIA 2OO7A 5J40A 2SHKA 2XOKA 4PSKA 3OAAA 5J4KA 4OJKA 1IN6A 1H8EA 1QHYA 1CTQA 4WIAA 3K0SA 2WPDA 3Q5EA 1SHKA 4Q00A 5KDDA 3RSLA 1E2MA 1KDPA 1MO6A 2D74A 3EIEA 5FTNA 3TMKA 3CPHA 1P72A 3U6BA 2FX3A 3AVQA 5DI3B 2WKQA 4JLNA 4LOAA 3U5ZB 4FINA 2BWJA 1W0JA 2ZSAA 4RD1A 2PT5A 5HZHA 4K8OA 1OW3B 2PMDA 1YR6A 2LWIA 3U44A 3QKUA 1P3JA 4BFSA 1CJMA 2CJWB 1IXZA 4LJ6A 3NEYA 4A82A 4ON9A 3U3JA 3ZGXA 3QBTA 4ASUA 4CDGA 2WVJA 2RGAA 1G64A 2YYZA 2ZJYA 4D25A 4LHXA 1Z2CA 2YOHA 4XD7A 1Z6GA 2X2FA 4YMWA 3CF0A 1EK0A 1UM8A 1XDBA 3KL4A 3PEUA 1AGPA 4DLTA 2QY9A 4PC3A 4F91B 2C98A 3IPXA 3IILA 2ORWA 1UEJA 3AB3A 4PQYA 4KAXA 3FFAA 5EXTA 3VQTA 2F1RA 3PXGA 1M74A 4O0MA 1XXHA 5B58C 4KODA 2N46A 4OKSA 3B78A 4AK9A 3GLFA 4CF7A 2K5UA 1AGRA 4HYYA 1YZNA 4D6PA 1Z0IA 3L2OB 3GFTA 5AUOB 2ZE7A 1NJGA 1VPLA 1I2MA 4ABYA 1X1SA 1US8B 1J7KA 1XB2A 4LX0A 5KPDA 2CCGA 1Z28A 3B60A 1WRBA 3I61A 3B1VA 2FN4A 4LJ9A 4IEIA 1E2JA 1G8YA 4M2LA 3M4YA 1Z3IX 4LYFA 2FFAA 3ZIAA 1AS2A 3NG1A 1EFCA 5JEEA 4N1AA 3CRMA 1CKEA 4RD2A 3CF2A 2V55B 1W48A 4V0MA 2O8DB 1UDXA 1E1QD 4PC2A 1PV4A 4A15A 4JLDA 1Z63A 2XZPA 1MKYA 3EIHA 3L8ZA 2BKEA 1VIYA 5KHOC 3K0CA 3SJBA 1MT0A 5FUWA 3Q8XB 4UQOA 1RW4A 1YZGA 3LVQE 3AUYA 3SOPA 3KDSE 4FD2A 1KOFA 2GZHA 1AKEA 5ANRB 4K46A 4YXWD 2ZS7A 4CVNA 2F43B 3I32A 1HV8A 2ZROA 2ZS8A 4LPKA 3TAUA 4TTPA 4R2HA 4QM7A 1NKTA 3CR8A 4DEYA 3CONA 3JZMA 2KI5A 2QMEA 2BVNA 2KJQA 3O8BA 2GBLA 2HJVA 4G3XA 4HLUC 4TZ0A 1G7RA 3BWDD 1GILA 2PEZA 2P2LA 2WHXA 2IWRA 3UMSA 3OE7D 2DFTA 2P5TB 3HU2A 1TQDA 4I4LA 2OUKA 2V7QD 4M9QA 1E2FA 4MUBA 1S9HA 2R62A 2RKOA 2ZRAA 1U8ZA 2OT3B 4RD3A 3TW4A 1T3SA 2ZJBA 2FFQA 4KV9A 1GNRA 5EXPA 1GAJA 1QBKC 2A5GA 3SE0A 3U2QA 5C18A 3PEYA 1G7SA 2GJ9A 2OV2A 4HZUA 3W6PA 1I4TD 1XD9A 1R0ZA 1KDRA 1ZW6A 1G4UR 1KKLA 2H18A 4JVLA 1E96A 2R44A 4L9SA 2OLJA 3QG1A 4QHSA 2IT1A 1Z29A 2ZRNA 3LBHA 1NRJB 5FR2A 4I1UA 4TQUS 4AG5A 4C2TA 4O2RA 4QGHA 4TMKA 4FMCB 3VHLB 2ZRHA 4M4SA 1FUKA 1FOEB 2ZIAA 1RE0A 4EFLA 1E9AA 4B73A 2MSEB 3CW2A 3LNCA 1TUIA 3IIKA 4ZDKA 5JI2E 3LVRE 1IM2A 3FB4A 1Q22A 1XU4A 2VA8A 3K09C 4MRRA 4DUGA 3QJYA 4OHYA 4OHXA 2F1JA 2PJRA 3SC3A 2DR3A 3MMPA 5DH9A 1AN0A 2E9SA 1DBSA 2VP0A 4KSCA 3W8NA 1P2TA 4BGDA 1KI3A 1W4CA 4KI0A 2ERYA 1XTRA 5JWRA 1MO5A 3DVLA 4NDZA 4B3FX 4D4MA 3BOSA 3EC1A 2GWHA 4R9UC 2GZAA 2R8RA 1A4RA 1MH1A 2OFXA 2P0EA 1KSFX 4MUAA 4RKEA 2PEYA 4UNNA 2VHJA 5DLQC 2BBTA 4A0FA 3QE0A 2W58A 1JEDA 4JMPA 5JJLA 4LJ5A 4K81B 2OEPA 4GRAA 4HZIA 821PA 1W1WA 3CZQA 2OBMA 621PA 1DEKA 1F5NA 3MWJA 2J0VA 2B21A 1T6NA 2F9MA 1ANKA 2ZAOA 1ZMXA 3FWYA 4Y0AA 3GLIE 3CM0A 1GTVA 3N5CA 4LDJA 5JRJA 4D4KA 3JZAA 5D3MB 3GQBA 3RSOA 2A78A 2WWFA 1XZQA 1OIXA 1E79D 1DO0A 1KNXA 2BMJA 3HDTA 4C0KA 3Q3JB 5G40A 1XRJA 3AVUA 5LD2B 4PC7A 1EFTA 2ZSEA 2AD1A 4IFEA 4RCYA 4U02A 5K8IA 3SQWA 3VHXA 4OQLA 2IS1A 3MGCA 4OI2A 2GCOB 1AIPA 1D9ZA 3T5DA 1GL6A 1K8RA 2YWEA 4L4UA 5CK4A 5TB5A 2W6JD 3P4XA 4TYNA 2XXAA 5LDDC 2ZRKA 2E87A 4CIDA 1OH5A 3PFIA 4Z54A 5BWMA 2DWPA 3GEHA 2PX0A 2G9NA 3R9WA 3PUWA 2GJ8A 4MDEA 2GRJA 4PXAA 1GZSA 5F98A 3I92A 2DFNA 4BQSA 1NN0A 1ZRHA 4ILEA 5M04A 2KBFA 5IT5A 5P21A 2OAP1 3K9NA 3GD7A 4Z51A 3QXCA 1ZVQA 5KDLA 3FKQA 3QEJA 3PEWA 1CJVC 2BM1A 4H1VA 3ZVNA 2RGBA 1TQ2A 1QG4A 1UBCA 1T0JB 2RH5A 1ODFA 2YVUA 3FKSD 3HPRA 1UKZA 4IJMA 4QGFA 3ZZ0A 4C7OB 2ZI6A 2JLYA 1IY2A 2YC2C 1Y3AA 2YC4C 5AJYA 5F9FA 2C95A 2FE4A 4Q1EA 2ZU6A 2KBEA 3KKMA 1T9HA 1NMXA 3A1VA 3JVUA 3EZ2A 4OBEA 3RC3A 2XB4A 5HR5A 3IBYA 3NC1C 2HUPA 1F48A 4WAUA 5EE1A 1RRCA 3OZXA 4AI6A 4BLOA 4G5RA 1E1QA 1FX0B 4V0KA 3OEEA 3DKVA 2EVWX 3LH5A 2FPMA 5FR1A 2ORVA 2GVDC 1A7JA 4CEHA 2RB4A 4MKGA 1MV5A 3G0HA 5JEDA 4C0BA 2IYQA 2IYXA 4MDFA 4IVQA 2VP2A 1Q1BA 3A58B 2AN9A 3OIYA 5FI0B 1TX4B 1ZUHA 3W34A 1LV7A 3X1ZA 4NYIQ 4BE7B 4JLPA 1MRSA 2NG1A 3C15C 4MRPA 1DAKA 2FSFA 2FSIA 2YINC 3B13B 1G4AE 4NP6A 3M0EA 4BLSA 5JI3E 3PQCA 3KTAA 2KB0A 2CLCX 2CMKA 1X6VA 2CEAA 3SHFA 1XTJA 4H9GA 4X8MA 1P7CA 1JXMA 4RD0A 2A3RA 1X8JA 2YOFA 4KFSA 4P4SA 2J0QA 4DLZA 4BLPA 3N2EA 5G53C 4C9BA 5SZIA 1KHTA 5DI3A 1DAMA 1P9NA 4G0NA 4DSOA 1S0UA 4JYBA 1FNMA 4KFUA 1W4RA 5TMPA 2XJ4A 3K0CC 3KJIA 1M1YE 4PC6A 1N2CE 4HSEA 4V03A 1GRRA 5EP2A 3ZDQA 2V54A 4LBWA 1UAAA 3K9GA 1NNEA 5FH9A 2CJWA 1CULC 4F7WA 4URZR 4G5SA 2N42A 1G6OA 4DDTA 1R8SA 4PTLA 5E95A 1XF9A 2R2AA 3QXHA 5FFMA 4M1WA 3R8FA 2QZ4A 1I4DD 3VR4A 3HPQA 2HF8A 2WBLC 2V1XA 2GBLC 3HWSA 4XVRA 2ZSDA 1OFIA 1C1YA 1OFUX 3GP8A 5KNCA 4DZZA 1NVVR 2R6GA 1XTKA 2H57A 2ZM5A 1E1RD 4LK2A 3H0KA 2R65A 2ANCA 3B9QA 2QORA 4BEBA 5EZ5A 4PZYA 2VSOA 1Q57A 2CL0X 3LBIA 4YONB 1GKYA 4ITRC 2O8EB 1Z6TA 4GPTA 1NKSA 4ERNA 2F3RA 3U4QA 1SXJE 3QKRA 2HF9A 2ZRDA 2YWFA 5BW8A 1LF0A 3I1FA 4HB4A 1JQLB 2D2FA 1E2QA 1US8A 2Y8EA 3CX6A 2P6RA 2IYRA 2XOKD 3OAAD 4DHEA 1IN4A 3QSYA 1IHUA 2FV8A 1OXSC 2HXSA 4TLCA 2VHCA 3FMPB 2C77A 5L3QA 5AJZA 2O8DA 2J5XA 4RD4A 4OI4A 3Q9LA 1BO6A 1CS4C 2RGCA 3NKVA 2PX3A 3GJ6A 3CWZA 3PUYA 3L0SA 3MJHA 1W0JD 1Z08A 3T1VA 2WIBA 3BFKA 4V0LA 4WA7A 4B48A 4LSGA 4IOLA 4HZUB 2ONKA 1KGDA 5F2EA 4B47A 3K70B 5H1YA 1P4SA 4DCUA 5FUVA 5AK0A 2JLVA 2F43A 1HUQA 2CBZA 3F5FA 4HUTA 2BMFA 4QKQA 2FZ4A 2QMHA 1XFAA 4XJXA 3T34A 2G3YA 4DLRA 5KPJA 3NBZC 5FOUA 2FG5A 4URUR 4ASUD 2D3WA 1M2OB 1S2MA 1CIPA 1F3OA 3MFYA 4A8JA 4YMVA 4F4CA 2I1QA 4OHWA 2IF0A 1IXSB 5ELXA 2FH5B 3BC1A 2W6JA 2ZVQX 3E2IA 1JR3E 4N0EA 2G1JA 2O0KA 1P62B 5TXGA 5FPKA 3RHFA 1ONBA 2ZUCA 4LV8B 2ZVPX 2G88A 1E0JA 1BH2A 4WZBE 3TIFA 4O25A 4BZXA 1XX6A 4XH9B 3ZD7A 2HT1A 1N25A 1QF9A 4Z8YA 2BV3A 3MWKA 1YRBA 4HB3A 1SZPA 2OLKA 5JMTA 1XMVA 1HE8B 3KJEA 2H17A 5KYKA 2DYKA 5J4VA 1UKVY 2Q3HA 4TYYA 1VCOA 4EQ6B 5H70A 1BIFA 1LF5A 2JJ8A 2OE2A 5C2JB 4ESVA 2ECKA 3R8CA 2QN6A 2H16A 4URYR 4AY2A 1WDTA 2OCPA 2ODWA 2H8KA 4XOIA 3ZIAD 1J8YF 3TSZA 2Q9CA 5JLJA 4A2QA 3K8YA 4BLQA 1RRFA 3VNVA 3JVVA 4D4LA 2GETA 4PO1A 4TMTA 1HQYE 5BYJA 4L15A 3CRRA 2IYWA 1UKYA 1T3HA 1YQTA 1XCPA 3LRPA 1XD2B 4Q18A 4AYXA 4O2LA 4Q9JA 3T1OA 2QAGC 2O8BA 3AGPA 3K0EA 1VG8A 1XJQA 4LGMA 1U0LA 4IOJA 4UXJA 3NDPA 2RAPA 3QBVA 5CJPA 3ZJYA 1JJVA 2JLSA 2O8FA 2OESA 4G1UC 1F2TA 2QP3A 2RGNC 4OHZA 4CYMA 5EE3A 2VP9A 5AUPB 2Q3FA 4C2UA 3TH5A 1FL9A 1F60A 1EGAA 2JJ2A 1NIJA 1XEXA 1W4BA 2OCAA 3MD0A 2WWGA 1E9CA 3W5IA 4GP7A 2O0HA 1WE2A 3A1UA 4IDHA 3P26A 4DDVA 2C99A 2GJKA 3CX8A 1IQPA 2RGDA 4MGKR 2J1LA 3QXXA 1G21E 4A92A 4A36A 4B3BA 1JQJC 1FW6A 3UXMA 1DELA 3Q85A 2FU5C 1E0SA 1E32A 3A4LA 3T61A 2ZYTX 4URWR 3X1WA 2XNSA 1NMYA 3VU9A 5EE0A 4PHGA 5C46F 4NYJQ 1XMIA 3ZQ6A 4QBIA 2AK3A 5CDFE 5JFGA 2AFIE 3B85A 3BH0A 1AJEA 4ARZA 5HKKA 1CEEA 3X1DA 1P60A 4BLRA 1N5IA 2GCNA 4E5UA 3ASZA 3NBYC 3WBJA 1YRAA 1AS3A 2H5EA 3B1ZA 4LZZA 4Z8XA 3SHWA 3T12A 5B64A 5G41A 3UWKA 1QVRA 2NO9A 5DSZA 4AURA 2P6UA 5FPHA 3HYTA 3KUCA 2PZGA 4JBWA 4QNMA 3RWOA 1YR9A 4M53A 4Q66C 3CF6R 5GVRA 4O3MA 1TF7A 2F9LA 4E03A 4W5WA 3N70A 4PPNA 3QXJA 1T3LA 3T15A 5AJXA 2EWVA 2GCOA 1P6XA 3L0IB 3QIAA 4PANA 3EZ6A 3HYRA 3AV0B 3LLMA 1WXQA 1Q12A 2JEOA 2FPLA 3BB3A 5HE8A 1EFHA 1FQKA 2CK3A 2ZSBA 2B8WA 2Z4SA 4Q9IA 4L8GA 3Q72A 4HEJA 4Q02A 3LY5A 1HTWA 4B3DA 4MITA 3ICQB 3BFVA 3AUXA 2W2TA 5AR1A 2WKRA 2IXEA 4DUGD 2DHRA 3V4FA 1EFUA 3TKLA 4QJ3A 4BFWA 4DIDA 2DY1A 1KO7A 2GDJA 4DSTA 4W7SA 1QHXA 1G17A 3VKGA 3P1JA 4N3NA 1G5PA 1RKBA 4HAWA 4WZ6A 2PH1A 2YOGA 4M9SA 4ZIRA 2GEDA 2WM9B 3AF1A 1Z8FA 1FZQA 4PR0A 1KK1A 2GESA 3R9IA 1P73A 3HR8A 3KQHA 1R2QA 1G8HA 4TLDA 3GJ5A 3AF4A 5FBVB 2DFKB 3W90A 3LQQA 1HA3A 1W49A 2V6IA 4P4SB 1IBRA 2WJIA 4GOXA 1FX0A 2AXPA 3AF0A 4GFDA 3QF7A 4UKDA 1XTIA 1Z6YA 4PPGA 2IS4A 4MKFA 1U8AA 3WP0A 2ZJ2A 2Z5FA 4YLGA 3AH8A 3KFVA 1MABA 3SS8A 4BZQA 3LBNA 5KSPA 2RGXA 2ZITA 2FGKA 1DO2A 4FN5A 2J46A 5KU1A 3V4RA 1Q0UA 5IK2D 4BFVA 5BN3A 2XEXA 2J45A 1CR2A 4M1TA 2GA8A 3GEEA 1FQJA 2ZRGA 1NBMD 3PJRA 1J90A 2AWNA 3CUEF 721PA 4OQFA 5FPSA 3SJCA 5AUNB 1TTTA 4CEIB 4RFSA 2QSZA 2NIPA 4I99A 4TSFA 3RABA 1G3MA 2ZYWX 1IN7A 4M8NE 1ZP6A 3T1TA 4D4JA 3VAAA 1TNDA 2RCNA 4TYWA 3KZ1E 3B1YA 3F3YA 4M0LA 2ZI5A 1NVWQ 5LBIA 2YNMA 3BS4A 4QJ4A 4NYMQ 3I62A 3LWNA 4E22A 4OI0A 1GRQA 2KE5A 3QKRB 1W44A 3W3AA 4YDSA 4DLVA 3U4QB 1G5TA 2JASA 3SN6A 2FSGA 4NH0A 1A2BA 4CRWB 1VTKA 3W6OA 3OFNA 2VH5R 3CZPA 2Q6TA 3CH5A 4FMDB 2XGJA 4AKHA 2QE7D 3F8TA 1LW7A 2J87A 5LPNA 1N6IA 3A4MA 3OIUA 2HV8A 4QGGA 5EP4A 4DXAA 1WBBA 1RJ9A 3TSOA 2BJVA 3G82C 1ZUNB 1NG9A 2H7VA 1OIWA 1VKJA 2CVHA 4G5OA 5DGXA 1M34E 1M7GA 1XD8A 2IA5A 3LO5A 5L3QB 2QP9X 1RRPA 3OEED 4W9MC 3AVPA 1VYVA 2Q9BA 5C4GB 3SEAA 3QF4B 2FFBA 1YKSA 2OG2A 3C7KA 4LI0A 3KKNA 1CR0A 5FOSA 1X3SA 4RY2A 4A0RA 2GXUA 1VCNA 5GJWC 1J8MF 4PAOA 4PX9A 5LB2A 2AR7A 3DOEA 1KSJA 3ETLA 1E2KA 2GK6A 1Q1ZA 3MUFA 4PSVA 4JVSB 1H8HA 4F4IA 5DN6A 1EG7A 2HEIA 3VMFA 1OE0A 4R71A 1T8UA 4CT4B 1SVMA 1XMJA 3B9PA 2O8EA 2GAOA 3SFVA 1UEIA 2QBYB 1II0A 1XXHE 3DHWC 1N5LA 5KDOA 4TZ6A 1S3SA 3FHOA 1U0JA 5EE9A 4A8JB 5GJBA 3G5UA 4JLBA 3GLFE 3BORA 4AKGA 4L5BA 2WJYA 3WRXC 3THOA 2A5FA 1QHHA 4CGZA 4DLYA 1KY3A 2AKAB 3TE6A 1OV4A 1Z2AA 3A1TA 1GKUB 3LX5A 2B6HA 2DBYA 3P32A 1G3UA 2RHMA 3IO5A 4L9WA 5FOVA 4YDHB 5CB8A 3FOZA 4FCWA 2Q21A 4JBYA 5KSZA 3WY9A 4NTZA 1TQ6A 1OIVA 1HQCA 2BBSA 2DFLA 3DDCA 5AUQA 3SYNA 3VR1A 2G83A 1SULA 1R6BX 221PA 3QPVA 3QVUA 4IKEA 3PEVA 4C0SA 1U98A 1O87A 1P2UA 5J5CA 4JLJA 4PHHA 4BEJA 4D80A 4RKFA 4Q9KA 5JHGB 3GLHE 4YMUA 4MH0R 5A0FA 4W5JA 3OHMA 5IHPA 2IX3A 3BAFA 3PUVA 5FTJA 5JZVA 2QENA 3W6NA 3K9LA 1KJZA 4QHYA 1U2RA 1G291 2JLUA 5E3HA 2EFDB 2QPAA 2GCPA 2AK2A 1E0AA 4LHYA 4TN1A 4BFXA 3OEHA 1PJRA 4V0OA 2W6IA 3D31A 2ZRLA 1A82A 2QMUA 3SJAA
chains in the Genus database with same CATH superfamily
2O8BB 1PSDA 1RLIA 3FF4A 2IELA 4EHFA 4ED9A 1UMBB 2RDMA 3CLVA 5EHXA 2FY8A 2ZQZA 3CSUA 3O7MA 3S4YA 4WBNF 1GZDA 2HM7A 2XCIA 1FC0A 2BGMA 4OIMA 1CNFA 2Q9UA 3ORSA 4MR7B 4ZOLA 1I7NA 1N6NA 5GONF 3IKJA 4EM6A 4B79A 3AXSA 1T1SA 3M7IA 1IC6A 4II7A 1QVWA 2Z1DA 3IJ5A 2XNCA 4RK6A 1HE3A 1I4EB 4LWOA 5EC8A 4ERXA 1APBA 1AHPA 5LU9A 1JSXA 1V71A 2QSJA 1YI8A 3OCJA 1VC2A 2IW3A 3U5TA 1XEXB 1O58A 4F84A 1W35A 3TBKA 3D6MA 1C9NA 3EBLA 3H19A 4ND4A 2O59A 4YAKA 4IDAA 4RYDA 2JCVA 1G0NA 1WA5A 5HRCA 3PI7A 3QPWA 1FFGA 3LT2A 5I7HA 1M7HA 1FTNA 3VDRA 5GVSA 4A91A 3IESA 4DLNA 2XZDA 2XKJE 5ERYA 3VNUA 4AJOA 1FRNA 4GMDA 5G0UA 1WP9A 2DR0A 5BMVA 5EWMB 4A7PA 5ALUA 5EL0A 3SVZA 1W87A 4G8JA 5CDTA 2SICE 3VU9B 1UQTA 2AR0A 2Z08A 4Y2SA 4DLUA 1RXYA 1IMJA 1FSZA 2ZCVA 3OUUA 3LCUA 4MGZR 2PLFA 4BCBA 4HH4A 2A1IA 4ZKEA 3V42A 4CKWA 3RG2A 3ND9A 2PL1A 5J2UF 3BGWA 1M2JA 3ORYA 3UMRA 1VHLA 1C81A 1UBOS 5EXXA 5BPFA 1RRKA 4L95C 1NQOA 1NZFA 3ZU6A 2JAHA 1YVRA 2IZ0A 2ZIXA 3A1WA 2ZR0A 4OJYA 2PXAA 3ZHSA 5KB3A 4NQRA 1DPFA 5F1YA 4BX8A 5BR4A 1MQ9A 3ICPA 5JFTA 3WK8A 4O8ZA 1I4WA 3JARA 3OP1A 2QV0A 3AP3A 4GI1A 4LYEA 5CGZA 3FWHA 3ZVRA 1FFSA 1LSOA 2PLRA 2Q8QA 4RJTA 4BYGA 3PXCX 1R64A 2OOSA 3B3JA 1ZK0A 2GNOA 3DA8A 4QYWA 3ODGA 1RKXA 1WMFA 2J7PA 2Q50A 4QJBA 2PMCA 3ZVKA 1JFSA 3ZNQA 1UJ4A 4Y2XA 1TYDE 2FQQA 2HO5A 2WT4A 3IMEA 3V1KA 2E5LB 1CU1A 2PK3A 4O4HA 4XWTA 4OK6A 1QGDA 1FMJA 1P1IA 1SC4A 2OTCA 1RM5A 3RDPA 4IS2A 2QDXA 5H9VA 2J3MA 1CYEA 1RZ3A 1M10A 1J9EA 1JW9B 2JD1A 5GJCA 3OQ6A 3RTGA 2AG0A 3C24A 3DB1A 3JRXA 5KYTA 3NVDA 3SF8A 4LZNA 5AW6A 2CVZA 1SCQA 3JAWB 4C5CA 5T7BA 1H4TA 3PFKA 5TQ2B 4N9QA 4YJ3F 3RREA 4DJFC 4QREA 5CB4B 3KKKA 2Z0MA 3AEKA 3KXLA 1QQ6A 3OD1A 1WXIA 1Y8AA 5AKGA 1RAEA 4BNMA 3I6ZA 5AVXA 2WHQA 5KOYA 3BB1A 3P71T 1E4VA 2UZ4A 1P17A 1ZZGA 1WSWA 2XMSA 1YVUA 1NVVQ 2IUSA 3T4EA 2QXTA 4QPPA 5C0OE 5A4DA 1LNSA 3IVAA 2QE7A 4HBGA 3OICA 2YN2A 4OKIA 4URHA 3K94A 4RCVA 5F5NA 3K0HA 4HGOA 3LAWA 3SK0A 5AESA 2Q5FA 3I39X 5T4HA 4AY6A 4A16A 2D6FA 2HPZA 3EA5A 1MT3A 2NU8B 4ZO4A 4ZMBA 4RSMA 5AOBA 3B3QA 3PNSA 4FD3A 3TAHA 4P81A 2Q3CA 5A5VA 4CLHA 3SU8A 3MIIA 3O73A 1K1EA 2H4ZA 4INPA 4BO3A 3DQPA 1IIBA 3EPKA 4M6WA 2Z83A 3LHDA 3D64A 1JJ7A 2IIQA 3KDAA 4FWBA 4NCKA 4AX8A 4BNXA 4GOND 1EP2B 1YBAA 2HF2A 2Y1XA 1ZVMA 4K3VA 1H6AA 2OILA 2R66A 3NBFA 4NHOA 4UOEA 1QONA 3FGPA 1GPKA 1MABB 3LQRA 4TXLA 1BHQ1 1QZXA 1UPAA 4WHMA 3SZOA 2P78A 2ET6A 4AF6A 5BWCA 5EG5A 2VT7A 1X19A 3LD9A 4TMZA 2H0RA 5DHQA 3IS3A 2JFUA 5C8YB 2FWJA 2AZTA 2QGNA 3G2PA 8LDHA 1T1GA 1IDOA 5FI1B 3KQYA 1TGVA 2W93A 5EJ4A 5IARA 3HZZA 1RAAA 3CJTA 1GCAA 1NSTA 2FWPA 3CZAA 4IVNA 4L4RA 2W37A 4A6XA 5JZSA 2AJDA 3R40A 5DYGA 4V0ME 3M6XA 3IV6A 2Y1DA 3CWQA 1JHAA 1JHPA 3RBAA 3AI7A 4H1HA 1VCMA 1JHYA 3STTA 1XJ5A 3DD5A 1Z06A 5A3VA 5THXA 3FCSB 2EHJA 2LBPA 1I3MA 1BTOA 3GUVA 3BH6A 3MJVA 1M67A 5ULLA 2HI0A 4N12A 2G82A 5JU6A 1O03A 2E3JA 5D5PA 1KDOA 4GL4A 3LFTA 4Z3DA 2Q5EA 1ZONA 1N9KA 1KQPA 1NWHA 1QQ5A 3GRFA 2FFJA 3I4LA 4DBLE 4CM8B 1T24A 2NXEA 1T4CA 3CKYA 3H9EO 2BGIA 1J39A 1ZINA 3GXOA 6PFKA 1VJDA 1DCFA 1R9JA 4ZVOA 1L5HA 1KZ1A 4BP1A 4EFNA 2GM4A 1LLUA 2RG7A 1VG0B 4G4JA 4R2IA 2H1LA 2ODAA 4ENSA 1VA4A 1N77A 1YAHA 2YFQA 1GZ6A 1U31A 2PFGA 3OOJA 5FLYA 2WOJA 2O8VA 2PCJA 4HQ6A 4C0XA 4F7DA 1TFUA 1JYFA 1XJCA 1DAGA 2HIGA 2WYWA 1DKQA 2FPOA 4G0MA 3DSRA 3SEZA 3ZHYA 1PVVA 2VL7A 4B71A 1DE0A 2O6LA 1EJ2A 4NNOA 3E5HA 1TJNA 2B9EA 1GGKA 3F5DA 3S3TA 1FVHA 1SHZA 4EKIA 1ZN2A 2ANBA 5HFJA 2C97A 2R86A 5IJ0A 4FKMA 4FWIB 5DT9A 1JHUA 1DCTA 1PR0A 3TZHA 1JG1A 1L5RA 1VYTA 4KGXA 5FV4A 2EKPA 3F1LA 1C3LA 2JNWA 1V9LA 2CYBA 3I1IA 2HD4A 1RQXA 1MGOA 1A9TA 4FFSA 1ZQ1A 4Y18A 5FPTA 2G06A 2ATXA 4MWCA 5CFZA 4MOWA 4ID9A 5EMNA 4DYHA 3O8CA 3FYDA 1KSGA 5FPYA 2DZDA 3RK0A 1B6RA 2X22A 3T7RA 2G5GX 3MTDA 1RVDA 1AM4D 1ZO8A 4GVXA 5DJ5A 2FK7A 3BIXA 3OVMA 3A3YA 3O84A 3TWOA 3TZCA 1MRNA 2VNJA 4BAGA 1O94A 2YIDA 1BS1A 2CMFA 2D62A 3HKEB 4BEVA 2CDNA 5JG7A 1Y1RA 4DABA 2HA7A 3NWBA 4C7KA 4ZVTA 1A0OA 1H1LB 1A4UA 2WWWA 2YUIA 2ZE5A 1ZUNA 2XKAA 3AKEA 1XELA 1S02A 1DVRA 2Z1NA 3H5AA 3TSWA 3KUXA 2GPJA 2L69A 2L19A 2QM7A 2AVDA 4JDPA 1Z5PA 4YAEA 5H5JA 3W3ZB 3GRYA 1XRNA 4ZI2A 1TA4A 1G8JA 3CUYA 4J7UA 1NMQA 4RYLA 3KX2A 2HMAA 3L8YA 2V8OA 3QVGA 3VBCA 2R8PA 1Z0KA 2PSSA 2JATA 3GAMA 3HKDB 4WFQA 4TKZA 2ZETA 4WNCA 3DOOA 2F00A 3IIJA 4LRUA 5LMZA 3KPWA 4CTMA 5K6RA 2FPXA 5KWEA 4F2DA 1TF5A 1ZJWA 1EFRD 5TVKA 3ZZTA 2QBYA 2FW1A 1E6EA 5CM8B 3Q8MA 3L7JA 4EO9A 5K0JA 4BP9A 3ECAA 4IRUB 1KFCB 2I54A 3VO8A 5IC5A 4EITA 1W581 4D79A 3PYMA 1GG8A 2B5WA 3O2SB 4NXMB 1VHWA 1N0WA 2P9QA 3DUWA 4V02A 1ZM4A 1Y6QA 5EN4A 1NVEA 3BB4A 5C3UA 5F52A 5TY0A 1TZMA 3GFOA 1IWPB 2VTEA 4YJHB 5E8JA 4F3NA 1NV8A 3W5DA 2O7RA 3RKSA 3AEQA 3ASVA 3QYAA 4Y1EA 1XAHA 3AILA 3GUYA 4JJZA 1JQEA 4DARA 3QX8A 4BNWA 2CHQA 1A76A 5IU6A 1V8PA 2PX8A 1PL6A 4QQFA 1IFXA 3GNLA 3L4BC 1CZOA 2X2OA 4IIEA 4Q39A 4JELA 5KYUA 4DY4A 3L4JA 3WSVA 3WNQA 1B1AA 2YASA 2YJGA 4W8OA 3GLIB 5B4UA 4JT2A 2C2BA 4X6LA 4R9SA 4YCMA 4ESOA 4PLYA 1QIKA 3EPPA 2QRJA 3NPMA 4GE3A 4WGFA 3GK3A 4ZAYA 3P9IA 3ZY4A 3G7SA 3WYGA 2CXUA 3P2YA 4NONA 4PFSA 3MJDA 4EPYA 3V48A 4C20A 5CG2A 4LKRA 3PHJA 2DRIA 2FZEA 3R0QA 1CWUA 1TT5A 2ECQA 2HKIA 3FETA 1CUXA 3KXKA 4LISA 3H4VA 4Q4HB 4B3XA 4QXPA 4OL0A 5IYZF 3HB7A 3M1LA 3C8DA 2XD9A 2JIMA 3WGZA 1K9VF 4FOPA 1VPVA 2P27A 2FFRA 3E4DA 4QYXA 2XB2A 5AKHA 1EIZA 4Q4AB 5LQCA 2GJ4A 2H0QA 1ZR4A 3WNVA 4E5NA 1R6AA 3O3OB 4A3SA 4DGQA 2JLQA 5FOWA 2CNWD 1YHNA 2I4MA 1BMFA 1QLHA 4FB5A 4AG6A 2B7CA 3EIQA 2DOKA 2BDTA 4R1NA 4I9GA 4ZQEA 5CDFA 3RRNA 1B8UA 1FMTA 3G7UA 3JQBA 3TW8A 2JCGA 2XV1A 4E31A 4PY2A 5DN6D 5JMOA 2H1IA 3VU0A 5KNLA 2X5XA 1Y7IA 4FE3A 5A6SA 3MBIA 4KAAA 3E1SA 5EEHA 3QLEA 3KLOA 4YY3B 1YE8A 3GPDG 1F38A 1LPPA 1ATZA 2DTXA 2Z8YM 1I6LA 1TQ4A 3ANYB 5HTKA 3W4JA 5MDHA 4HDQB 2OGTA 5FNVF 3V4LA 1OSNA 2V7TA 1VGQA 2O8NA 1U65A 4EJMA 1E4EA 3CPJB 1PJ2A 3MGGA 4Z4CA 1E5TA 2FEMA 1QCYA 3KL2A 1N92A 2N1BA 2PUAA 4MQ5A 1QE3A 4TUYF 5JSZB 2XSZA 2C5FA 5C37A 1VMKA 2Q27A 3I6MA 3WDKA 4KR7A 3D81A 1Y89A 3KFLA 4WN3A 1Y6GA 1GZ7A 2HCJB 3H86A 1L7OA 3KQQA 2BZ0A 3PR1A 1EVKA 4PLCA 2W2VA 4PPQA 2VBFA 2IRWA 1E9EA 3CY6A 3NM6B 2HJRA 2VDLB 3GA5A 3KKPA 4MMZB 1AB6A 4QODA 3DBLA 2M6LA 1BRTA 1Z62A 2FUEA 4KITB 1NBIA 3GLGA 1IUNA 3T5CA 1UBTS 4OK3A 1ZYUA 4PLWA 3AFNA 1P18A 3K70D 1XPUA 4RGQA 3NT4A 2IOQA 2YCBA 4CM3A 4QOSA 1EEHA 3CO5A 4AKSA 4BMDA 3U61B 2FJPA 4DQDA 2XTJA 1W85B 3DPUA 2J33A 1P5RA 1DIHA 2HMWA 1TMKA 5DYNA 3B51X 3EIWA 2VHEA 2R5WA 3K09A 1CB7A 1H0SA 5EIFA 3KKOA 1X8KA 1F51E 2A3NA 2P9CA 1UIRA 1FRVA 2WHRA 1R0CA 4X20B 3GFSA 4ZT7A 1GVNB 1PL8A 3D2BA 5JLAA 3ZCQA 4WQMA 4R54A 3FCUB 2FUG6 2C92A 3A6JA 1R00A 3IP8A 1UWKA 1CD5A 2JAQA 1CP2A 3H5RA 1KC1A 4PHFA 5TC4A 4TWAA 3WBKA 4MYCA 4G5QA 4BVLA 3D7MA 4RTQA 2GPTA 1KI1A 3G0OA 1KMHA 3DAFA 4M7WA 3TJMA 1QPZA 1Y8CA 4P34A 5CLLA 1DC7A 1G59A 3I73A 3PGVA 5LKAA 4C21A 4YRJA 5CXXA 5P8WA 3NOXA 4LDNA 1DAFA 1T36B 2WICA 3K0AB 5AW2A 4W4TA 3KSBC 3RC8A 3ANSA 1JALA 1V8BA 4NU0A 1PVOA 1AZLA 3LUGA 4Q4JB 2AHOA 1M1YB 1Y7HA 1A9YA 3B3FA 3L82B 3W79A 1XWFA 1U8YA 3HBNA 3PTAA 4B3MB 4G4GA 2EP8A 1JNYA 1RJFA 1YBMA 2L2QA 2OGUA 3O93A 5AHXA 3RRJA 4ZHQF 3THXA 2IIBA 3O3NB 3PB3A 4HJRA 5JVDB 4P5DA 1QCCA 3F4LA 3IAEA 4QOGA 2C84A 2VWGA 3ONWA 4NZZA 5JSYA 5U1PA 3GZ4A 3A9UA 2RC6A 3WYDA 1UBMS 3V7WA 1K97A 5C81A 3S2GA 3QMPA 1HETA 1FNSA 3D2CA 1G0OA 1KJJA 4E1AA 2IF2A 2CKMA 4WNAB 4ZQIA 4MUMA 1T6BY 1JWBB 1RU3A 4B3GA 2WIDA 3TINA 2MMGA 2W6MA 1JDNA 4TV8B 5EVCA 3ZHUA 1A4IA 5L3SA 3I5YA 1YF3A 1EZ4A 3PC6A 1FDUA 4KBYA 4BN5A 1FXUA 2ZJ8A 5FEMA 1WLSA 2HNKA 3CNHA 3KSDO 4MV4A 5BVGB 1OH6A 2FPWA 3HJAA 1TIPA 3B8HA 3KM0A 5GM2A 4AIIA 4LBZA 1WTCA 2C4NA 5EJ6A 1YR7A 3MUNA 3ZEAA 2ZSFA 1NXQA 1XPRA 1ODLA 2Z6VA 4OP3A 2Q45A 1IHDA 1KK2A 4GLOA 3EW7A 4I7EA 5HA5A 5TEWA 3PRHA 1COZA 2VRWA 3L18A 4WXHA 1IY9A 1QYWA 2C9DA 2WJGA 1XMSA 3B1WA 4HFJA 3OOYA 4OQPA 3IQIX 5FL3A 2F67A 2BCJQ 3A2KA 4GEGA 1Y1PA 4QAQA 3DHVA 3ZV3A 4KZKA 3FWKA 5JBQA 1F17A 2CC2A 3I5MA 1V9CA 3VR5H 4CJXA 3BPSA 1FMCA 1P3Y1 1U99A 3N2IA 1SB9A 1FDRA 3BE6A 1XZIA 2P5UA 1N8SA 4YQYA 1GM5A 2M6KA 1KS2A 2I3GA 3VYRB 1JH8A 4KBGA 1A8QA 1FTQA 1XP8A 3CRQA 4BJ1A 4BLVA 3H1GA 4MYRA 4DWJA 1QTIA 4PYOA 1WCIB 4B8YA 3PTLA 1T1EA 1N32B 1E9DA 4LY6A 4J0QA 4YYEA 4DMFA 3N1UA 4LCJA 4DLSA 2VP6A 2NO0A 4DG5A 5CA1B 4Y2VA 4BNHA 2EYQA 4J1SA 1YDWA 3M1YA 4HYQA 3OZVA 2QM8A 3EISA 3BRQA 4Y1RB 5T8KA 2NM0A 4AZTA 1WOYA 1D5CA 1Z35A 2R8OA 4MKXA 5DBFA 1WCXA 2W00A 3EIUA 3V8PA 4MO2A 2CLHB 3LTEA 4LHEA 4JCCA 1QIIA 3NJRA 5AI8A 1REQB 2WWTA 1NDUA 1CX9B 3QLVA 3NUGA 4A2PA 1ZR2A 2Y05A 3CT4A 2JGRA 2JVJA 3K0BA 1TU4A 3IT3A 1E1LA 5L3SB 1DKLA 1QNFA 5DXAA 4A8JC 2ZJ4A 4DV2B 4RA9A 2TMYA 4JI5B 4YAIA 4YQFA 4TQAA 1D6JA 1CBUA 1L5YA 2F1IA 3ZE8A 3TGLA 2CNOA 4IEFB 3BCHA 4BRUA 5IF9A 4FSXA 1NIPA 4TQ9A 4B6SA 1IVNA 5KYXA 5LR6A 2A0YA 1PDVA 2EKDA 4C0HA 2YUTA 1LVUA 4YRAA 4M54A 4JFRA 1U2ZA 1ZOLA 5L7WA 4OMUA 4KBFA 5IAEA 3ZN2A 3QW2A 5ICGA 1H9BA 5BMOA 3D43A 1YVDA 4IDGA 2DAPA 4DPLA 2P6PA 1AXEA 4DTIA 2OV4A 3CVUA 1ZGZA 2PIDA 2YZGA 2BRUC 3CKMA 1I6MA 4NS1A 3ZE6A 1BZYA 4JI8B 3I23A 1U8CB 5E6SA 4TYMA 9LDBA 5D87A 3AP1A 1N2OA 1GQYA 3UC5A 3ND8A 2JGFA 3TLXA 4MQFA 4JOSA 4R9VA 3ZWAA 4OU4A 4JUBA 2X3YA 3I76A 2IPOA 3RSZA 3TOVA 4AJLA 1ONNA 4QDOA 5AVYA 3FM9A 1P2FA 5EKXA 1EWYA 1WW8A 4KYUA 4OYHA 5HCNA 5TPWA 4FQ5A 4HATA 3EVFA 1QVVA 4Q3EA 4XVHA 3WBFA 2ZPAA 1B1CA 4GGOA 1KI2A 1EEXB 3RRYA 1NOKA 1RRGA 1NGSA 5L4SA 4QRIA 4PSDA 5DBEX 3K6SA 4IAOA 4I6JA 3THYB 3D4PA 4C5BA 3OCZA 2EJWA 2V6FA 4XD2A 1KR2A 2W71A 1L4KA 4YHBA 1ISRA 3AOEA 5E1MA 2GBFA 3WK5A 2I2CA 3MXTA 4WLOA 3T3EA 3RR2A 1NSYA 2H92A 2CL7X 1R4AA 2MTBA 3ZBTA 2WMDA 3GFBA 4XE5A 3DZIA 3IUSA 4JB8A 5KVSA 1QCDA 1WMEA 4I4TB 1OKKA 3KVVA 2J5RA 3FSGD 3IERA 4YACA 3KVOA 4WOPA 1ZH6A 1LK0A 3OQPA 1WSBA 2X7XA 2YFKA 2YWRA 3HGMA 1VB5A 1U2DA 1W5TA 1Z25A 5C1PA 3OO0A 3A05A 1A50B 2ZBEA 3V33A 1E69A 3WL3A 4CF4A 3LXXA 2HLDA 3X2SA 2C9OA 3N8DA 1OILA 3TTUA 4H1TA 4EW2A 1YJBA 2OORA 4COOA 1WKVA 3D7LA 2XW6A 3R7DA 4YMSA 3VPBA 4ZOLF 3N2KB 2MYUA 1MD9A 3SP1A 4Z3KA 3F4KA 4LXHA 2GSWA 5CYGA 3RVSA 5EXSA 4CEJB 1PBNA 4EFMA 3BN3A 2P0AA 3WL5A 5GM1A 1G8PA 2AT1A 2OKCA 1IEXA 1E89A 2WHEA 1L4UA 1L7AA 2Z58A 3NHYA 2VLIA 3UHFA 2X0KA 5GJVC 1M5RA 1UXIA 5IXSA 1OB5A 1WO8A 2ETXA 4H17A 1PCXA 3GPLA 2V1UA 2O57A 1GPAA 1FFAA 2G76A 4EGAA 5CXUA 2VN8A 4LRYA 1T5DX 4X94A 3LY7A 2XUHA 5LQUA 1U0EA 3LV8A 1PR2A 3H3FA 3GNSA 2OBFA 3BXGA 5CIQA 3FSRA 1VG1A 3A0UA 1VHQA 2VK2A 4JWTA 4KZPA 5J2TF 1JAHA 5CEJA 1NUHA 2NAFA 2YZMA 4KQKA 4FLMA 4UNPA 3MQ2A 4BIIA 4DOMA 4ISCA 5JAQA 1HFKA 3M6FA 3GAFA 4OQEA 4JUIA 1O3YA 5FBWB 1GP2A 2EEZA 2FUKA 1EFKA 4HGPA 4KPFC 1G6HA 1QGAA 2FLWA 2Z6QA 3WXMA 3B2QA 2H6EA 2BBWA 1CXZA 3G79A 4HMPA 5EE5B 4B1FA 2B4AA 1QH9A 2NZJA 4ROTA 2NMVA 4UFNA 1SAYA 1VFPA 2AWOA 1G41A 3BGSA 3WAJA 2YWHA 4R98A 3WIUA 1MTOA 1L7QA 1XWWA 2P9ZA 3DPSA 4RKRA 2HGZA 4XTRA 3IAFA 3RYIA 3CLSC 4ESHA 4YV1A 4NV3A 5CDSA 1PJZA 5LKRA 1VM6A 1NMEA 1BVRA 1TIBA 2BFBB 4I1SA 3L8DA 4TZTA 2DY0A 3BICA 5D5HA 1Z0ZA 2B25A 3E53A 2ZIWB 4JC5A 3HBJA 4TKVA 1FFBA 1GA4A 2PJUA 3ZVLA 4B40A 2AVNA 2CXQA 2QSYA 2NO5A 3IMFA 3I01M 5LQNA 1SOVA 2D7DA 2F8MA 1Z47A 4HNSA 4CBVA 1NI3A 2CMDA 1ZH8A 1X80B 3DOIA 2V65A 1SPBS 1VIAA 2AD5A 3O9ZA 4G25A 1K5GA 5KTRA 1U11A 4HX2A 3V8RA 3ZBQA 4YRNA 1L1FA 5CNIA 2D13A 5ALKA 3WWDA 3DDNA 1GOTA 1DIOB 4IDNA 4OXIA 4S1PA 3R75A 3REFA 4EFKA 4Z7JA 2I2FA 2QZ9A 4BX3A 1XVTA 3Q9SA 1X9IA 1P4RA 1Z6XA 1AKRA 1X7YA 1GFIA 2DG2A 2Q3EA 1F6WA 1KZ7B 3V8BA 4C0WA 3HKBB 3ROTA 2WZDA 2Y4OA 5LIRA 3MBOA 5LB4A 2WAOA 1RFGE 3EAQA 3M6VA 1KSHA 1ZESA 2I1LA 3QWFA 4Q9LA 1XK6A 3R3XA 2G4LA 3PHGA 4FDMA 4JS0A 5TQ0A 1S96A 3GMDA 1EP3B 1ZCAA 3L0OA 1ZLXA 4OXQA 4TVBA 3BWMA 2CFOA 1MR3F 1NBOA 3C4JA 5EZQA 4AJIA 4F93B 2YMPA 1FX1A 1Q74A 2RAUA 3CFYA 1FNNA 3JATA 4PRLA 4GO1A 5DTEA 4H1WA 5ABPA 4ID3A 1H1DA 2YN4A 1UJBA 1SOMA 2EYUA 2Y2UA 4J0DA 4KKVA 3FGZA 2FEKA 3DTTA 2G6BA 2Y93A 4G9EA 1QRRA 1AKQA 2WSSA 1FJGB 2XRFA 1ZC3A 2BDEA 1B6SA 3G1WA 2WF6A 3DLTA 5EQTA 1CY8A 5D84A 3UK2A 5KX5F 4A8TA 2BJHA 4S35A 3RS5A 3L06A 1ZM7A 2DKOA 3JYPA 5DGHA 4W1QA 1S8FA 3E3LA 4MQBA 1AKYA 1OAOA 1N2HA 4DBZA 4GR9A 2H11A 1O0SA 5EMKA 2YNMC 4GI5A 2JDID 2IVFA 3SKXA 5ELLA 2Y3IA 3U3MA 3CEAA 4NDNE 3ZTTA 4BO6A 1SBHA 1NULA 1XHFA 3JSAA 3PHBE 4P54A 5A3JA 3HVRA 3B12A 3RUCA 3VZPA 4EJSA 2W8BA 3CS3A 3DMRA 1FSPA 4A1FA 1N2CA 2UUOA 2VPXA 2ODNA 3U4IA 4R05A 3SHVA 1ZICA 1A1VA 4HP8A 1DAPA 1BCRA 1E9SA 1DAIA 2MSKA 3MT7A 4WJZA 4EX7A 3LRXA 4KGZA 5JFOA 2ZRJA 2ZUWA 1ZA2A 3ICVA 4CLOB 3ROFA 1GGFA 4HV4A 2ECPA 2XTNA 3L0PA 4MSUA 2OD2A 1RYFA 3WMWA 1Q3TA 1Z7BA 3H9GA 1O5IA 2AZ4A 4A5SA 2MINA 4KIGA 2R6ZA 4JU8A 1PD1A 1UJ2A 2HV9A 5D6NA 3ES9A 5BVHA 4Q48A 5IJZA 4L57A 1XZAA 2Z3WA 4YRCA 1IM5A 1OXTA 3FRJA 4QTZA 3ZLJA 1QS0A 3F74A 2BF7A 5HILA 3QE2A 1TL7C 5F77A 1KDTA 4OJQA 2HCFA 1RAGA 3QA9A 4I4NA 1P0PA 3JQDA 1ORHA 5I9BA 1XZDA 2WUVA 2JGIA 4Q3LA 2OBLA 3OG9A 1MAUA 1U7PA 3QBJA 4L5AA 2C2HA 1TVEA 2PXXA 1H23A 2YCLA 3AVOA 3EXAA 3HCEA 3I8XA 2PMEA 4EARA 4DCOA 2I87A 1ENYA 5EZYF 1OPRA 2OHOA 2OBBA 3A3PA 4L5CA 4QBHA 3B5EA 4QO7A 3DL2A 1AV6A 4FILA 2V7QA 2AFHE 4JL6A 1HDZA 4TM8A 3ANNA 5FPPA 4PPFA 4ZK2A 4KO4S 2LCFA 1DMRA 4DDHA 4RAQA 4E5DA 4EIWA 3ADBA 1EXNA 1TECE 5K51A 1RAFA 6REQA 4TS1A 3G8DA 1XXHB 3PDCA 3KCQA 4IL5A 2QL9A 4LYJA 1CNMA 3SC6A 4IMJB 3VV3A 4D5GA 5I6DA 1GFSA 2JKVA 1KDZA 2WSMA 3A9SA 1ZMRA 2O5EA 2QMOA 4XGQA 3DE6X 4D99A 1YWGO 3PF8A 3EA0A 1HG1A 4MVJF 4FFNA 5DRTA 4BMVA 4IXDA 4DILA 3I5XA 3ZV7A 4QOHA 4WVFA 4UM8B 2XGGA 2XVAA 3D6AA 5CEFA 1SVSA 2MSCB 1U81A 4K6MA 3G0IA 5FUXA 2H65A 4JJGA 4C2AA 1RMYA 1KNQA 1BVHA 5G1PA 2HMYB 2K6GA 1FBNA 3ICWA 4IDQA 1ORVA 1YO6A 1D2RA 4HDSA 5KYNA 4O2BB 1XMQB 3AUKA 1KFBB 4MWDA 3THRA 5DNYB 4FR2A 4HDNA 4BYMA 1KBQA 3EEIA 3M6WA 4R6XA 1H5NA 1IAQA 1RTKA 3HB5X 3AJ8A 1PFWA 1L8XA 4KR0A 5IAJA 3ABZA 5CAEB 1QO9A 1SOUA 1DRUA 1ZGCA 3R1IA 2AC7A 4KGVA 1A5TA 4NFHA 3TQSA 3RVDA 2WV7A 4BMSA 1TZBA 5FTLA 4YVFA 4AF7A 5JCJA 4IILA 4C4ZA 3QELA 3D0RA 3BMCB 3DZDA 3FMOB 2X13A 5SZJA 5BQFA 4DUZB 5M3BA 1GSOA 2R751 2UYYA 3BERA 5BUZA 2OL4A 3DTVA 3P20A 3E4CA 2QQEA 3TMYA 3QYFA 4GPEA 4IGFA 2OAEA 2XQFA 3PNQA 2QHXA 4NV1A 4UW9A 3RQIA 2PX2A 1NVBA 4PZUA 1BHJA 3JZIA 4A0GA 4D3ZA 4URVR 3DMYA 3UANA 5AXAA 3GT7A 4WKOA 2Q6VA 2OORC 3C6QA 2F8LA 2OB1A 1JTEA 3RKRA 5ESXA 1GN8A 1BE8A 3CIFA 4I50B 5IUNC 3GCDA 1K7CA 4UBOA 2VS1A 3IDQA 4I5EA 3FG9A 5KYWB 5DP2A 1W5FA 4O2AA 1ICIA 2HMUA 3OZTA 2X14A 4JT4A 4UD2A 2VYVA 4WNYA 2RJ3A 3TTTA 5KNBH 2GBGA 1XCLA 2OUIA 3WNZA 1H8ED 4DA7A 2NO6A 2GZ2A 1HXHA 4EYGA 1EWTA 2VDMB 2XBLA 4BQNA 2H59A 1AUOA 1TM1E 1PDWA 1YZHA 2R9VA 4EMUA 5FTKA 5DM2A 4L28A 4ZI7B 1C30A 1NW9B 3HFGA 4X1IB 3LY9A 3SXUA 4BO1A 2JGJA 2XWSA 3SX2A 1AY0A 1NE2A 4P86A 1QH1B 4V0NA 1Z0SA 1CFJA 4NZYA 5DBGA 4ZAZA 3TNLA 1YB4A 4PG8A 4A73A 1CR6A 3U6KA 2HUNA 1JILA 2O07A 3TRKA 3WKEA 5EPUA 3LDFA 4B0PA 5AFSA 5CBPA 1U3TA 1QGOA 1ZH2A 2MDTA 4UNRA 5JNRA 4AMVA 3ICCA 3VR6D 4ZZ0A 1AN9A 1BX3A 1MJGM 4ZP1A 5LMUB 1SVLA 3AR2A 1A98A 1PO7A 1K88A 4GDMA 4MP3A 5FBKA 2NQ8A 1TK9A 1DTWA 1HYQA 2RH9B 2VHWA 4XD7D 2E48A 4X44A 2GPNA 2PCLA 3L02A 4LNHA 1NN1A 5G02A 4CI0B 5E4TA 4S1TA 3QY0A 4L8FA 4BTVA 2A9VA 2CSUA 4GXQA 4N03A 1Z0FA 4KXFB 1GTZA 4FXOA 2LD4A 4N8EA 4L1KA 1GPNA 1N5KA 2QYTA 2A9RA 1JKJA 1TJ3A 3TLCA 3FTNA 3TRHA 1Q20A 1FS6A 1LFAA 1GKKA 3AVTA 1PUJA 3RIGA 4M22A 2ERCA 4N0MA 3KP1A 2Z30A 3VUEA 1NLYA 4EB8A 2HYDA 4EI9A 1ESNA 2WJVA 2BN4A 4FFWA 4HEHA 1YUNA 4LJAA 3EZ7A 4TXHA 2GF0A 4BFZA 2C3UA 3TDKA 1S3IA 1BCSA 3ZE7A 5C7LO 3A06A 3S7ZA 3ELUA 3FKSA 1MOPA 1XDWA 3RH0A 3VDQA 3WRXA 3U3OA 5U4QA 2AXNA 1NQWA 2AFIA 2IZ5A 3B7PA 4NC9A 2FWIA 4TWZA 1THTA 3H99A 4AO6A 5ISMA 4E7OA 3LDAA 2QTBA 3KB2A 4LVOA 4FPXA 3DMGA 4DMGA 5L9AA 5LNK6 3KOMA 1UMCB 2ODBA 2X1VA 4PYIA 4BBZA 4EJ2A 4G0UA 1RT9A 2ODEA 3F6SA 4MWEA 5EYPB 4JLVA 3UPUA 5F9FA 3UCXA 4BS9A 4P3OA 1LU9A 1E98A 1WB5A 2J5BA 4NBRA 1QP0A 1LWOA 2DUJA 3F9RA 4M99A 2QUAA 4KQWA 4KQIA 3TG2A 1Z2PX 2UZ3A 3NT5A 3K9BA 1OX4A 4KAJA 4MWSA 4YP9A 1XKXA 4TSRA 4AZ0A 3WHLA 3Q4GA 1QX3A 1M0WA 3JVDA 5ALXA 1K92A 2OFOA 2A0UA 4HZGA 5F3WB 2XBUA 1GGJA 1YZQA 2PANA 2X77A 3G5MA 3I09A 1GPMA 5SV2A 3ZLTA 2WNHA 3SXPA 9GPBA 3CCFA 1L7DA 4NE2A 4DJEC 1KA9H 4PYRA 2JKYA 3MELA 4ZODA 4QQNA 1E4YA 2YX1A 3DWGA 1JTFA 4ARSA 5BSGA 4QZVA 5IDWA 1N0HA 2VATA 4WSOA 3N75A 3MWYW 3WNBA 3HB4X 2VKQA 3LW8A 3HUUA 3UAGA 1VDZA 4IOMA 2P69A 2VZEA 4H1UA 3TQHA 1HG0A 1FPQA 2C5AA 3N0TA 5AHOA 5DYTA 1C9EA 3EEFA 4HLCA 5BQ3A 2O3JA 3KSRA 4CM1A 1MIHA 4JBXA 2G5PA 4TL6A 1VMAA 1NY5A 2HRRA 4BRZA 4EJSC 3WRVA 1PU2A 2PIAA 2J9RA 1QUEA 1T13A 2Z2YA 1PJTA 3DGEC 4WLNA 2I76A 4HK4A 2ZUVA 2XTMA 1R0WA 3FZYA 1C1DA 3B70A 4HN2A 3QLUA 1AH2A 2Y1FA 1SIBE 1W36C 3QVMA 5L3RA 5JBIA 4M86A 2DBVO 4ZDIA 5ENZA 1F2UB 3N87A 3AERB 1DOHA 3EZLA 3U3XA 1U3WA 2WM3A 2FK8A 4J3NA 4Q0MA 3U9LA 4EKYA 5H16A 5IDVA 3T06B 3RC1A 1GEEA 4D45A 3TLJA 3VOBA 1JSZA 3NYQA 4Z1MD 1ULHA 2HWKA 2YJNA 2WEKA 2OCYC 4KMMA 4Q9AA 4PLFA 4ZOAA 1K7SN 2JFWA 4OQQA 3ZWCA 4CKBB 3F5MA 4GMGA 4U9UA 4R7GA 4TT3D 2J6HA 3T4XA 3ZY6A 9ATCA 4KR6A 2CD7A 4GZ3A 4LTNA 4CNQA 5LJLA 1NTRA 1YQEA 1LBIA 3I3SR 4DXDA 1P1RA 2BCGY 2DWUA 4UATA 3OLXA 4LBVA 2VBGA 1W1IA 5DK4A 4BRWA 2JFNA 3TZLA 3GLGE 2XZLA 1U94A 4KIFA 2B9VA 2PMBA 4AYWA 1KYVA 1QTNA 4JI1B 2GR9A 4HS9A 3WQBA 2VWHA 4HPXB 3ZQ4A 3N3AC 4HAOA 4L3OA 4UTXA 4W5OA 3LIPA 4HFRA 2WIGA 4AQDA 2QRZA 1O6ZA 4WY8A 5E7JA 2B7BA 5EMMA 3KQSA 1QHNA 3GJ7A 4AY5A 1W0KD 3G8BA 4M37A 2V7XA 2PQMA 2FG7C 4M9CA 1WMSA 1JPVA 2Y0EA 1Y3BE 4AZ3A 1G20B 4JXZA 2KMLA 3WWEA 1ZVJA 5FNZA 1ODSA 3W8EA 4RGBA 1SKQA 1F0YA 1G7TA 2XTAA 4L0DA 4OPMA 4A2WA 1KY4A 1EUQA 2EJTA 3B7WA 4BV2A 3O75A 4M9XA 4PLGA 2QW1A 4UEWA 3VJLA 5B7GA 4QOEA 3THWA 5BSVA 3T5GA 3TZQA 4LRWA 4ZGGA 3VH1A 2C5SA 3P9PA 2XOKA 3ETJA 3N28A 3OFKA 4LG1A 2C2ZA 1LBQA 3H83A 1KWKA 1ISHA 1H4QA 2HEGA 1CTQA 1U2GC 1ZRNA 2JBHA 4HEA6 4I3FA 3DLHA 4Z9XA 2COKA 5FCDA 3BD6A 3ESYA 4Q00A 3RSLA 1T3GA 4YDRA 1KDPA 5H3CA 1XHEA 4AZWA 4RTSA 2D74A 3EIEA 5FTNA 3TNDA 4CKEA 4ECAA 2E4AA 3CPHA 3B1FA 2I0FA 2WKQA 1BQ3A 4JLNA 1H05A 4LOAA 5EJFA 1D1TA 2OSVA 4FINA 3ZDRA 2ZSAA 3X43A 4KPUB 5HZHA 4K8RB 5ALFA 3V4OA 3K2QA 1Y37A 1OGYA