4XH9B

Crystal structure of human rhoa in complex with dh/ph fragment of the guanine nucleotide exchange factor net1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
174
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVNSPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Neuroepithelial cell-transforming gene 1 protein
publication title A structural study of the complex between neuroepithelial cell transforming gene 1 (Net1) and RhoA reveals a potential anticancer drug hot spot.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 174
sequence length 178
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xh9B00
2B7BA 3BS4A 4KCGA 2CE2X 4J0QA 4GFDA 4LJYA 4BRUA 3LDAA 2HCBA 2JJ1D 3VHXA 1KDOA 4QJ5A 3NG1A 2ZROA 3AVUA 3ZH9B 2FSIA 2ZJ8A 1NMYA 3TGPA 1FPMA 2JCSA 3WNCA 4JBWA 1ZCAA 1OXVA 1FMLA 3D8BA 4RD6A 2LKDA 3A37A 4K81B 2FFAA 1L4YA 4RZ3A 3NTUA 1WB9A 1XPOA 3OF5A 4IXNA 1KI3A 3BWDD 5HE9A 3Q7PA 2A3RA 2D4HA 2F1IA 3A4LA 1D5CA 1B0UA 4Q1EA 1AGRA 5FTMA 4EJSA 2DWQA 4LHZA 1SULA 1XXHA 1NG9A 1Q1ZA 3UMFA 3QIAA 4ZKDA 1Q3TA 1EFRD 5F2EA 1GKUB 3ZD6A 4AYWA 1XEXA 4GDFA 3HYTA 2YYZA 2DB3A 4B47A 3QBTA 4KSCA 3KQKA 1RE0A 4KI0A 1AK2A 2UVQA 2JA1A 4GSYA 1G7RA 1KDPA 2A30A 1IJFA 3RS2A 2QROA 1H8EA 3V00A 4URVR 5H68A 4MDEA 1TF2A 2RGNA 2V9PA 1X3SA 3B7GA 4NYIQ 1ANKA 1SZPA 8OHMA 5FPKA 1HTWA 1ZMXA 4EFLA 4Q9IA 4BFVA 1L8QA 2FZLA 2P67A 1NNEA 1M1YE 1OYYA 1U0JA 3NC0C 2WTUA 3AVOA 2F43A 1DAIA 4RD4A 4P4UA 5E7IA 1HQYE 3LA6A 2AL7A 5BYJA 4OQNA 2ZYVX 3B85A 2WPDD 2YWFA 3KZ1E 4WBSA 3FOZA 4M0LA 1T4GA 4S2EA 3LO5A 3PQCA 3ECCA 2ZJYA 1YZTA 3BB1A 1QBKC 2GDJA 3DHWC 2YC4C 3QPUA 4CW7A 1R7RA 5D3QA 1RVDA 5E7MA 4PO8A 1JEEA 2ZE5A 4PHTA 3NHBA 5JZVA 1A1VA 4YXWD 1F2UB 1GKIA 1G21E 4DLRA 1LB1B 2IWHA 4C9BA 3B1VA 1YR7A 2ZRGA 1NN5A 1SVWA 4QHYA 1SGWA 4GBMA 3PUYA 5DHAA 4B6EA 4GZLA 4OI2A 1YZQA 4PQRA 2HYIC 2CEAA 4WXRA 3UKDA 3SHWA 3VR5A 2IS4A 4TQUS 2CL0X 1MO5A 5TY0A 5L3SB 3CX7A 4TZ6A 1ZM7A 2A78A 3WRXC 2O8FB 2C2HA 2ZAOA 1D9ZA 3UWOA 2NPIA 1FX0B 1T8UA 2K5UA 1E9RA 1NRJB 4A2PA 2ZE8A 3OIWA 2ZRJA 1UEJA 3AVTA 4PSVA 1OXXK 5FUVA 4UXHA 4FMCB 4AWXA 3AVVA 1KO8A 2GEVA 2IYQA 3CPHA 4WZAE 3R20A 4IOMA 3R7WA 2DFNA 5TVKA 3SQWA 1XF9A 4TL6A 1UBGA 3PFIA 2QTFA 2H1LA 4DSNA 4AI6A 4PAOA 4IRUB 5CK4A 1TUEA 5GJCA 5L3QA 2H16A 1NN3A 2C5LA 3FMPB 3BRWD 3B9QA 3KQLA 2QM8A 4B3DA 2H57A 4JKIA 4QM6A 5DISB 1M8PA 4QM7A 2W6IA 3CWQA 4NE2A 1G9XA 2Z6VA 1JJ7A 3UMSA 2C78A 1W44A 1Z0JA 3Q5DA 5FBWB 2Q9AA 4B32A 4YDHB 5JECA 2B6HA 1TF7A 4JVSB 1TL7C 4JSTA 4YC7A 1P7CA 1GP2A 2A9KA 2XZOA 2VEDA 3LD9A 5CDFE 1R8QA 3PEUA 3FFBA 1AZTA 3GLIE 2WKQA 4LK2A 1UJ2A 3PIRA 3E1SA 3KKMA 4C0BA 3NDBB 4XSHA 3L43A 4EQ6A 3CONA 5G40A 4CZ2A 2DFLA 4KLZA 2O8DA 3TAUA 1N6KA 3SJBA 3B6EA 3Q3JB 4HAXA 2W6JD 4CT4B 3PR1A 1A4RA 2W0SA 3W5JA 2PCJA 2AD5A 1XJ0A 3FVQA 4AKGA 1YZGA 3IQWA 1XZQA 3QF4A 1ZM2A 2ZRHA 2R6CA 3DKVA 1W1WA 5G41A 5DNYB 4FWTA 1OV4A 1MO4A 5IRCD 2QBYB 1KO5A 1RRGA 2IYYA 3PJRA 4XTCS 3EZ9A 3GLFE 4NZYA 4DDTA 3AF1A 4FIDA 3NIBA 4OBEA 3BAFA 2OCAA 4TMVA 4TYQA 1OH5A 2D2EA 1II9A 2NMVA 4IXMA 3ZGXA 5BXQC 1PZNA 2GXQA 2I1VB 5HKKD 1BOFA 4OL0A 1KK2A 1W46A 1S2MA 3REGA 4JL5A 1OKKD 1KJYA 1X6VA 2QMHA 2FWRA 5J40A 4DLYA 3K09A 1BMFD 4EPRA 1G8HA 1IXRC 2J1LA 4KFRA 3CLVA 2IL1A 4IDHA 4TL8A 3MUFA 1ZYUA 2JEOA 1NVVR 2FG5A 3B82A 5JFGA 2GJAA 3KKQA 3UK6A 4GP7A 1ZNXA 3V4RA 2H5EA 2BM0A 3T12A 1PV4A 3LY5A 5IF9A 5IK2D 3BD9A 4IFEA 1W4RA 3JVVA 3L0PA 2C04A 2GNOA 3CIOA 3LV8A 4RD1A 5ELXA 1LY1A 2ZRMA 1E9CA 2XOKA 4A0GA 2GCPA 4MYHA 1OF1A 1EXMA 4L5BA 4M9SA 4QBGB 2AHOA 3R8CA 3I1FA 4HYYA 3KQUA 1YKSA 4C0AC 5L8VA 2QTHA 2TMKA 1AQUA 4HI0E 1SVIA 1IJEA 4MITA 4C0LA 4UXIA 3AF4A 4DC9A 2YOHA 3SDZA 5CJ2A 1DE0A 2BJVA 3BFKA 1W4AA 3EZ7A 1KKLA 1Q1QA 3IKJA 4F91B 2GILA 5BWMA 1OYWA 5CLQA 4PQFA 3IPYA 3TUZC 5SZHB 4V0NA 4PHHA 1ZJ6A 1BYUA 2IYVA 2YVUA 4GOKA 1UKZA 5E95A 3QI2A 4GMXA 2VSXA 1E9BA 3T35A 5HPYB 1NMXA 1NKTA 2IA5A 3GD7A 4LWZA 5JEEA 3VU9B 221PA 2NO1A 5J4KA 1G5TA 1LF5A 1YVDA 1TUIA 1U99A 4TYPA 1NN0A 1XTSA 2FFBA 2RGEA 1AKYA 4RD0A 2GVZC 2EFGA 4MKGA 4M1WA 2WHXA 3CBQA 3CO5A 5FOWA 4E5UA 3QKTA 2O8FA 2QAGB 1CJTC 1P60A 5KOYA 1PLJA 4H1UA 1AZSC 2CL7X 1E94E 1HE1C 4US1R 5K8LA 1G3IA 2GBLC 2Q9BA 3Q72A 4ERNA 1TX4B 4WIAA 3FHCB 4DCVA 2NO6A 3OE7A 1DO0A 1KSHA 2AFHE 2RGGA 4W7SA 4PPFA 1QG4A 3C15C 4PZYA 4YDSA 5LD2C 2CDNA 3ASZA 2NZ8A 4AKHA 5F9HA 2GF9A 1JR3A 4POAA 3KJHA 5KDOA 3KB1A 2HT6A 2V3CC 4TLDA 1Z0FA 3B5JA 4YLGA 4BRWA 2H92A 4KBGA 2R6FA 2VA8A 4TT3A 3WYAA 2F1JA 2YHSA 3RWMB 2WJJA 2CL6X 2ERXA 1KTVA 3OEEA 2Z4SA 4QGHA 4JYBA 4LY6A 2OBLA 4RZ2A 2JLRA 4AYXA 1W0JA 3CUEF 4OKSA 3PUZA 1W36D 5TDHA 1YRBA 3M6AA 3QXCA 5EXXA 1W0KD 3LXXA 4GRAA 5BN4A 3KKPA 4D26A 1LV7A 3CZPA 3ADDA 3THWB 4URYR 3CRMA 1S96A 2UZIR 5LB4A 4TSFD 5IHPA 4WA7A 3K0CA 2C03A 3MJHA 3UG7A 3ZIAD 2QPOA 3THXB 2FNAA 4MRNA 5LPNA 1N6RA 1NJFA 1IN6A 1RRFA 5IDVA 4F4IA 4Q1DA 1T3HA 3BH6A 3PENA 3SJCA 1ZAKA 3BFXA 1E2FA 4JKYA 3SYLA 1B23P 1P4SA 1ZRHA 4URWR 4DWJA 3EPKA 4ZDWA 1KZ7B 4ZO4A 5JBQA 1JR6A 1IBRA 1TEVA 2AD1A 3U4QB 5FPTA 2Z0MA 2HDNB 1JXOA 2V7QD 4HDCA 2WVJA 3RANA 2MMGA 4JZKA 1ZD1A 3I8SA 4P33A 5FOVA 4EFMA 2EYQA 3B1YA 2ZI6A 5AUNB 1N6PA 2WOOA 1SHKA 4TL7A 1F48A 2EU8A 2QUZA 3P1JA 1R4AA 1RRCA 1EFUA 4M2LA 4HUQA 4TLAA 3RABA 1SXJA 1OE0A 1W48A 4I99A 3DOEA 2E87A 2ZUBA 5GJVC 3VTKA 4Z1MD 3QG5A 1N0WA 4GP6A 3JZAA 2HUPA 2KE5A 5EE9A 1W36B 2RGDA 1PUJA 1T3SA 4LYAA 3AVYA 4JYCA 5HCIA 2GAOA 2ZU0C 3SS8A 4B76A 5HR5A 1G8YA 1KHTA 2X2FA 3CRQA 4V0MA 2AXPA 1NN1A 4LJAA 1ESNA 2ZS8A 1G7CA 1R6BX 2V8OA 3QPVA 2IUSA 2PEZA 3K0FB 1OPXA 4MKHA 1E9DA 1R0YA 2QRNA 4W5HA 4D2IA 1ZU4A 3K9NA 3UXMA 3W8RA 2A5YB 4G3XA 3U6BA 1TEXA 4BLTA 1XU4A 3E70C 1YZUA 1XD8A 4I81A 3KQHA 3GLHB 5M04A 2P6RA 3HDTA 4BASA 1NP6A 3TW8B 4B34A 2QENA 2Q6TA 1PUIA 2LKCA 2WKPA 1OH6A 4BLQA 4JBYA 4KFSA 2WIAA 4NU0A 1SKQA 4ITRC 4HSEA 3QXJA 2DR3A 2OEPA 1VHTA 2BMDA 3M1IA 2F7SA 1G41A 1KNXA 2BDTA 1E1QD 3CH4B 1GAJA 1KMQA 4EKDA 2O0JA 1J99A 1SVOA 1KKMA 1E2PA 3BB3A 4Q4HA 1VCIA 3OAAA 3CPEA 3S1AB 5FOTA 2ZM5A 2JJ2A 1I2DA 4HDQB 2GTPA 2BV3A 5LB2A 1CR4A 2IHYA 3FMFA 5FBVB 3SYNA 3VR4A 2GXSA 4ZCMA 4O25A 3AKDA 2DCUA 2QAGA 2HLDA 1W2HA 2ASEA 4RFSB 1DO2A 1OFTA 2CHGA 2LCFA 1N6IA 1KI7A 1KY2A 2VIIA 2WMOB 4Q48A 4I1VA 1E0SA 3WBJA 2HJGA 5TARA 2GJ8A 3SE0A 3A6PC 1VG8A 4LHVA 1EESA 3EZFA 4I4LA 3DO6A 1KMHB 2F3RA 3CNLA 4XWOA 3ONWA 1N2CE 2WSSD 5B64A 1JEDA 2P0EA 2DPXA 3GQBA 1P2TA 5JLJA 2OG2A 3PG5A 1E2GA 4Q5IA 3I8XA 4B3CA 3GLGB 3QEJA 2B8WA 1DTSA 4MGYR 1YU9A 2WICA 2IYXA 3NC1C 4NYIR 4RKFA 1OLOA 1KSFX 1ZW6A 2KJQA 4H9GA 3HJNA 4K46A 4BFSA 1XBTA 2IF2A 4FMDF 5FH9A 3SQXA 2DWPA 1VIYA 2V1XA 2BBOA 4PR0A 1Q57A 2PMDA 4PC7A 2WZQA 3LQQA 2V54A 4NMMA 1S1MA 3PEVA 3B9PA 2P3SA 2ZI3A 3MJRA 3EWAA 2P65A 3SBEA 1CS4C 5BYKA 5JRZA 3THWA 4HLQB 4PO1A 3QVUA 2IYSA 3BH0A 3NXSA 2IBMA 2REXB 2ZR9A 2DBYA 4PX9A 4ZIRB 1P75A 4Q1FA 3U6KA 2BHRA 2C99A 2ZE7A 3THXA 2W00A 1E2QA 1NG1A 4BFYA 1KJZA 3U7GA 1OT3A 2ZRPA 3GFTA 4F93B 2FF7A 2ZITA 2A5JA 2PJZA 3QKRA 3ZS8A 2WSMA 2PLFA 3CB4A 1NIJA 5CM9C 2FMXA 2JLSA 4Q4JB 3ZS9A 1JBKA 3BH7A 3X1WA 1U90A 2QM7A 3QPWA 2PX0A 2XNDA 1ZIPA 3GJ3A 1E0JA 1M34E 1OHHD 2E1RA 3CRVA 2JLVA 5SZJA 2BKUA 1N6OA 2EFEB 3B1WA 1AIPA 1TU4A 3WMGA 1JECA 1G6HA 1PLLA 3E2IA 5B2ZA 2VF8A 4KITB 5FL7A 2GESA 521PA 1PVOA 5D3MB 2ZRNA 5C46F 3EIQA 1G3UA 4OQLA 1ZCBA 3WRYC 3ZYCA 3RS4A 1SHZA 3X1XA 821PA 1ZINA 3OEHD 1HH4A 1IN4A 4PPQA 4PC1A 3CX6A 3EA0A 2J3EA 1E2IA 4B2IA 1Z07A 3PEWA 2BMJA 2QNRA 1AQYA 4II7A 5KNCA 3VR2A 3JZMA 1DAMA 1WMSA 121PA 3LBIA 5C18A 2QTVB 5FTKA 2QT1A 2F1RA 3AF2A 4BZPA 2J7PA 2B8TA 1HY3A 1MH1A 2AX4A 2ZE6A 3TSOA 2P5TB 3HR8A 2JJ8A 3OFNA 2O8CB 2V6JA 1E79D 4TMKA 5HCNA 1VG0B 2RGAA 1KNQA 2Z43A 4IOJA 5JWOA 3D31A 3NEYA 1IQPA 3U3JA 3MG9A 1DOAA 4K8OA 4BFTA 2NOAA 3OIUA 3NBXX 5AUOB 2ATVA 3KJEA 4E22A 2D7DA 2PBRA 2CCKA 4NYMQ 1KO4A 1JI0A 1AJEA 2VYFA 2EQBA 2WWIA 2ORIA 4HZUB 4V03A 1M2OB 4US2R 3C14C 3SHFA 3SBDA 1J8MF 3GLHA 2W58A 2WWGA 4FWIB 3RRZA 5AUQA 3ZVMA 1C9KA 1N0UA 2ZRFA 4QL3A 1G16A 5AJWA 3X1YA 4ABYA 5K8IA 4LV8B 1CJUC 5FUWA 4QXAA 5HZHA 4XVRA 2BEKA 2FGKA 3L0IB 1RYHA 3LW7A 3C4JA 2OCPA 1OFIA 2ZVPX 4DSUA 4DBLC 3GJXC 5J4VA 4QC2A 2C95A 1U94A 2FU5C 5JCPA 3S1AA 2PCLA 1NI3A 4B6FA 1II0A 1NY5A 4DXAA 4YMWA 4KLNA 3ADBA 3CX8A 4Z8YA 4D81A 3SZRA 4U02A 4CEJB 3EPJA 3TRFA 2JAQA 4M1SA 2J0UA 2G9NA 1QVAA 3UG6A 2IX3A 3W6OA 4OJKA 3BB4A 4PTLA 4WXPA 3EZ2A 1DAGA 3D6TB 4RFSA 2ZSAA 2QSYA 1QHYA 2R8RA 3SNHA 4HLUC 1A2KC 1E9SA 2OXCA 4B43A 1XPUA 4M1YA 4M4SA 1M7HA 3A1WA 5E7JA 1A82A 3KJGA 1KI6A 3M4YA 1XRJA 5FUYA 3K0EA 3AVXA 1Z0DA 2BIFA 1Z2CA 1KMHA 4IDPA 4LBZA 1Z06A 1GFIA 1S0UA 1F2TB 1W2GA 4LOAA 3K9GA 4C30A 4DIEA 5GVSA 5SZIA 4LBYA 2QGNA 1EX7A 5E4FA 4C2UA 4MYTA 3GLGA 2R44A 1D2NA 4H1VA 4OHZA 5C4MA 2J9RA 1XEWY 2R62A 2XJ9A 3MWLA 3F3YA 1Z08A 5FFMA 5DLQC 2JDID 2XTMA 4QBHA 1FOEB 4A4DA 1IXSB 3VR1A 1VECA 2ZEJA 3EPLA 1HEIA 2D2FA 3DL0A 4QHTA 2B92A 3KTAA 5JI2E 4NONA 3N70A 3GMTA 2EFCB 4R2IA 3IO3A 4HB0A 2HEIA 2QN6A 2C9OA 4KAXA 1ZNWA 4UNNA 2JLZA 2P6NA 4ZPXA 4MRSA 4F7WA 4ZIRA 5JSZB 2EFHB 2EYUA 1II8A 4QG7A 1IN8A 3L8ZA 4LYJA 1T3LA 3EPHA 3HWSA 4XJXA 5KSPA 5AJYA 1JR3E 3EC1A 3GP8A 2BBWA 4EJSC 2JLXA 2W2XA 2OCBA 1CJMA 2RHDA 3NHAA 3TR5A 4MQBA 3MLEA 2QPTA 1H8HD 4FD2A 3RS5A 2ZSBA 3EG5A 3HPRA 4DLSA 4HLCA 4GZMA 4M1TA 3MCAA 1KIMA 4TQAA 5D3MA 4UNQA 2DHRA 1UF9A 3KUCA 1ZBDA 3P4XA 1N5IA 1NSFA 4ILEA 5TB5A 2RGNC 1E2KA 1X8JA 2R6DA 2D06A 3N2EA 3OEED 5LD2B 4OI4A 1MKYA 5JMTA 4Q9HA 4ZCLA 2NGRA 4M21A 1CTQA 1GILA 1Z0IA 4OHWA 3U60B 5JJIA 2CNWD 3MAAC 4CEIA 3FYHA 4AG5A 1WA5A 1JJVA 4C0HA 5FTJA 4O2RA 2QP9X 3MRSA 1F3OA 1CJKC 4LHXA 3TVDA 1DEKA 4FINA 3WHLA 4Q9LA 2EVWX 3IUYA 1Z83A 1ZD8A 5LDDC 4NTZA 1UKVY 1U8ZA 3CM0A 2WAYA 2WJHA 4N0DA 4C2TA 1K8RA 5DN6A 3RC3A 4N1AA 2O52A 1BIFA 2O8CA 3B13B 4TTQA 2IXEA 3X1ZA 2OFXA 4PAQA 2YZ2A 3N2IA 3SU8A 1E9EA 2J7KA 1AKEA 4TMZA 3ND9A 3NH6A 1XD9A 4D4KA 2VP5A 2I4IA 1XPRA 4PC2A 1JAIA 5A4JA 4JJZA 2X1VA 4ACBA 1Q12A 1XCGB 4JJKA 4HZUA 4TYWA 3MWKA 4GNKA 1EFHA 4RZUA 1HQCA 2JATA 2EFDB 1JAHA 1JB1A 2J0VA 4C0KA 3PVSA 1VCOA 2WV9A 3IIKA 4PQYA 2OFWA 5CITA 4D0LB 4EPVA 1SXJE 4O3MA 4KVAA 1EWQA 2OE2A 4DCUA 4G5QA 2GAAA 1UM8A 3K1JA 3LXRA 5JWHA 5J4YA 1JQJC 3G5UA 2EWVA 2ERYA 3CRRA 1BH2A 4KYUA 2ZS9A 4JLJA 1P3JA 1Z6TA 4GI7A 2FSGA 5JI3E 4IVRA 1NMZA 1AS0A 4V0KA 4DLVA 3IEVA 2XTZA 5DYIA 4V0ME 4B48A 5J4LA 3LVQE 3OZXA 3SYKA 2GJ9A 2VSOA 1GKYA 1YR8A 2QE7D 1COWA 2XTNA 3ZZUA 3CF2A 4CEJA 3OIYA 1U2RA 4MH0R 4QBFA 2ZUDA 2FSFA 1AS3A 1D9XA 2FEOA 1DG3A 1E69A 4HATA 1NVWQ 3O8BA 3A8TA 3DEFA 1KI9A 1XTQA 1XX6A 1UBFA 1J7KA 2J5XA 4R9UC 4WZ6A 3Q9LA 4KYIB 3LH5A 4DKXA 3IQXA 1V43A 1E1RA 4U5XA 4B73A 2BBSA 2WJIA 4QGAA 1F2TA 1FFHA 1JALA 1OH7A 5EE1A 5EP3A 3TSWA 4NCHA 1KO1A 1P62B 2VQSA 5KDDA 3TIFA 4OHVA 1IY0A 1E2EA 3H2YA 4BFXA 2IW3A 5DIFA 4X8HA 2EW1A 3HP1A 5FTLA 1ETUA 2DYKA 4A36A 1Z5ZA 4XD7D 5CB8A 3OAAD 4LDJA 5CIWA 2VP0A 2HF9A 2CLDX 4WOPA 1T6NA 3ADKA 3DDCA 1SKYE 1EK0A 1V5WA 3UIEA 4ASUD 5JSZA 3KX2A 2JJ1A 5FI1B 2J46A 4ZKEA 4RD3A 2FFQA 4LJ5A 4BEJA 2CK3D 3GLIB 1D8TA 4TTPA 2NZJA 1OXTA 1L7VC 1KY3A 4NL4H 4GOJA 2ZXUA 4IFBA 2BWJA 4D80A 2QL6A 2QMUA 1ZUIA 5JS7A 5DI3B 5KYKA 1FMJA 1OIVA 1CKEA 3R8FA 1XMIA 2BC9A 3QXSA 3TBKA 5KNDA 3BBPA 4IKEA 5JHHB 1GRRA 4IDQA 3VAAA 1XZPA 2GBLA 4DEYA 2ZRIA 4BLPA 3AKEA 1RZ3A 1F2UA 5FPYA 5BQ5A 1T5IA 1CR0A 1GM5A 1Q3HA 1FZQA 1HUQA 1XEWX 2DFTA 3D7MA 3GLFB 3ZQ6A 1U8YA 3W3AA 4UJ5A 2XSZD 4AIIA 3U7FB 1NLFA 3FFAA 1EFRA 1SVKA 3KQNA 2IYZA 1Z29A 5KU1A 2ZSFA 1R5OA 3R9WA 3E5HA 4NBSA 1DELA 5AJXA 1XNJA 1G3RA 5ANRB 5L3SA 3NEJA 3QOFA 1KO7A 4EPYA 3AM1A 3SJZA 3KXIA 1E2LA 1FX0A 1J8YF 4DCTA 2ZVQX 3RSOA 2ZRBA 4MYUA 4PPNA 2VTKA 3A1TA 3FE2A 3QXXA 3GJ5A 3KJIA 4A82A 2R9VA 4PC6A 1IONA 1T8TA 2OAP1 3C7KA 3QY0A 2FPKA 3AGQA 2PX3A 4OI0A 3AV0B 4XWKA 4Z54A 1WP9A 3T06B 3LQRA 3U3RA 2HF8A 3V4FA 1GNRA 3B1ZA 3KXLA 3A58B 4F4CA 1Z28A 2WWFA 1WQ1R 2XNDD 3RYTC 1CRPA 5KSYA 3MWJA 3WNDA 1E3MA 2MSDB 4PZLA 3RRNA 1GVNB 2WPDA 4E03A 2MSCB 1DBSA 1XD2B 2BCJQ 4GT1A 4UJ3A 3FKSD 4FCVA 4WVFA 1G3QA 2RGBA 2O0KA 2JIZD 1KI1A 1O87A 4RJLA 4YXWA 2DY1A 1X8LA 3FHTA 2KBEA 2OXRA 3CR8A 1DADA 3F0TA 3WP0A 4TYNA 3Q85A 2ZRCA 4M8NE 3ADCA 2J87A 4MKIA 1DARA 1OB2A 1UPTA 2NG1A 2KB0A 3DMNA 2FZ4A 1P2UA 2IHBA 3EA5A 2FPMA 4A1FA 4A15A 4OHXA 1GL7A 4Q7LA 4MYCA 4PAMA 3P4YA 1BYIA 4PSAA 4D4JA 2QMEA 4D82A 3U2QA 1A2BA 2G1JA 1TTTA 3L0OA 2J7PD 5CIQA 4Q1CA 3G0HA 2AWNA 2BJWA 3I3SR 3ICQB 2CLCX 2PZGA 2GCNA 1CLUA 4LHYA 2AFIE 2QBYA 3OFND 2AK3A 5AK0A 1P2VA 4N0EA 5B58C 1MO6A 1X8KA 4OK3A 1FTSA 1WE2A 2QU8A 3KFVA 3IIJA 2IXFA 3HU2A 1HT2E 3ICEA 1VCNA 4DRZA 5JJKA 2WAXA 4UKDA 3R9XA 3SJAA 4DLTA 5KHOC 5BW8A 4BFZA 4I1UA 3LLMA 5KSZA 3DMDA 4RSGA 2Z5FA 1E32A 2VHCA 5B57C 2FDCA 2ODBA 2ANCA 3SEAA 3X2SA 5FBQB 4DUGD 4XOIA 1NBMA 3I92A 4HB4A 4G01B 1EFTA 3K0CC 3RHFA 1TQ2A 3A1VA 5L3VA 3BIFA 4Q18A 1KDRA 1D6JA 1XTRA 1G18A 2ZS7A 4PANA 4W5JA 5A5GA 2GETA 1FUUA 3C5CA 3FPAA 3FMIA 4UNPA 3LAWA 3FB4A 1IY1A 3FGNA 3IEUA 4NYMR 2CVHA 4P0TA 2XZLA 4NYJQ 2CJWB 3L2OB 3MFYA 1W47A 1G7SA 1RFLA 2NO9A 1Q0UA 2VBCA 1IN7A 2ZJBA 4MGKR 3W9YA 2ZIAA 1Z47A 2ZI4A 3IPXA 5EP2A 1KSGA 3I61A 4XSGA 1JPNA 1ZU5A 4A6XA 5HTKA 5CDFA 3WBKA 5E3HA 2ATXA 5J4HA 3EX7C 2AXNA 3PUXA 2H8KA 3BC1A 3GLIA 4ON9A 2FPLA 2W6JA 4DHEA 5DO9A 1XXHE 4XH9B 1E9FA 2N1BA 3ZDQA 1FP7A 3U61B 1EWRA 2ZJ5A 1NF3A 1ZNYA 3AP3A 4CRWB 2ODEA 3KXKA 1SXJC 4LHWA 4BZQA 3DM9B 3KKNA 1NVVQ 3EASA 3GFOA 4E09A 1XB2A 1UKEA 1KJWA 1E4VA 2OSBA 5CLLA 2Q3HA 1KK1A 2FH5B 1MABB 4EIWA 3K0AB 3ZVLA 4EPWA 4V0LA 3VU9A 3KFXA 2FFHA 3LBHA 3GLFA 2XAUA 2KI5A 5HKKA 2VHQA 1H65A 4BUJA 4DDVA 2ZJOA 5EJEA 4FMDB 1E4YA 4TLBA 1RYFA 2ZI9A 1NLZA 1H8ED 2IF0A 1K5GA 1BMFA 2PZFA 3F5FA 4JLAA 2H7VA 4QJ4A 1X1SA 2ZTSA 5C1BA 3QXHA 3P26A 4BE7B 3FHOA 2G88A 1E9AA 1JQLB 4AD8A 4MUAA 5FOUA 3TJZA 2P6UA 3QKSB 1MOZA 2CCGA 3QVVA 1P9NA 3AKYA 5GJWC 3VR6A 3V9PA 5IK2A 4DVGA 4FI3C 2Q9CA 3VX4A 2OV2A 1J70A 3PCRB 2IS6A 1WRBA 4ZDJA 1T0JB 3F8TA 1QDEA 1XEFA 1MO3A 2RHMA 4LJ9A 1GNQA 5G3ZA 1GSIA 1HURA 3TQFA 4FCTA 2HJVA 2AK2A 4GOXA 4ESHA 1F60A 1UADA 3LW8A 1CULC 2ZJZA 2YKGA 4P4TA 4RCZA 4DB4A 3U3OA 1RRPA 1Z6XA 4CF7A 4C7OB 3JVUA 1F5NA 2DWOA 2QT0A 2ZETA 2XEXA 2H18A 2PLRA 4LJ6A 4PHFA 1W49A 1U9IA 4YMVA 4MGZR 3RRYA 3SC3A 1OSNA 2C9CA 1P9WA 4B33A 2EWWA 2O0HA 1HV8A 4HAZA 3RSLA 1CXZA 4C0SA 4OHYA 4W5WA 4JBXA 2C77A 2QAGC 3LRPA 1UDWA 4L15A 1KI8A 3QG1A 4PHGA 4HLDA 3QBVA 1E2MA 3W5IA 2OHFA 2PH1A 4OJQA 3NVAA 5F98A 4X8LA 1KK0A 4URXR 1E99A 2CXXA 5FOXA 1KSJA 4XTRA 1QHIA 3AF0A 4CEHB 3L82B 3K53A 1UBEA 4JS0A 4LZZA 4P31A 3TUIC 4ZDIA 3CKLA 4JIMA 4MRRA 1FNNA 4FXPA 4WZBE 1BS1A 1QRAA 4UNRA 2G6BA 1XFAA 1IOZA 1P73A 2BM1A 1VCMA 2IYLD 3H0KA 4JLBA 3U4QA 4BFWA 3NH9A 3W90A 4M22A 4HAUA 3GJ0A 5JWRA 2F43B 3HU1A 2YOGA 1NKSA 4JL8A 3VQTA 4C4PA 2Y8EA 1TU3A 4B75A 4G5GA 2VF7A 3EAQA 5GVRA 2NTYC 4BGDA 2W6ID 3EWSA 3WXMA 4AKEA 2IK8A 4QHSA 5K8TA 1OFHA 3AP1A 3TW4A 1ZC3A 2GK6A 1G7TA 2GXUA 1E2HA 1DVRA 4NHOA 4ARZB 1P5ZB 3Q5EA 3QE0A 5TV2A 1A7JA 2GXAA 4Z8XA 4B35A 2GEUA 4Q03A 3GCGA 4JLVA 3NBYC 4MUBA 1WF3A 2WWXA 2ZRLA 1A5TA 4KFUA 4LCBA 2IUUA 1W0KA 3T5DA 1TQ6A 4MGIR 3GFPA 1GOTA 2IYUA 4U7DA 1LTQA 4IJMA 4Q7KA 3WMEA 2FOLA 2WKRA 2C9YA 4TMTA 3AEZA 4TSFA 4URZR 2Q3FA 3U3MA 4Q66C 2REBA 5DSZA 1LS6A 5AWFC 2VLIA 3K0FA 1P6XA 1FL9A 2OCYC 4Q7JB 3OESA 2X19A 3L0SA 2OBNA 1R0ZA 4F38A 2RMKA 2BBTA 4GPTA 2LWIA 2QI9C 4HEJA 4V02A 3CWZA 4B3FX 2QY9A 3LWNA 5EUMA 1FW6A 3BE4A 3A1SA 4G1UC 3VKHA 3BK7A 3T1VA 2OZEA 3LX5A 1TF5A 2ZREA 3N5CA 4PPGA 1SVMA 5GJBA 2SHKA 4R71A 3SOPA 1ZIOA 2QRZA 3KB2A 3U7EB 4BEBA 5EXPA 1E1RD 5EZ6B 2V7QA 1LNZA 5L3QB 1XTJA 2QMOA 1GRQA 1XMSA 4FW9A 4YONB 2HV8A 4LPKA 4DDWA 1G291 1NVXQ 2X77A 1NY6A 3ZZTA 2FE4A 5KSOA 2QSZA 4DDUA 3GEIA 2NPFA 1EG7A 1GTVA 1NLYA 1QHGA 3K0AA 4LGMA 5UKDA 4M9QA 1IXZA 2VH5R 1G8PA 3CR7A 2Z83A 4R2HA 1M7BA 4EUNA 2AKYA 4IEIA 5KDLA 2QP4A 3VFDA 1NL3A 2FV8A 4CYMA 3K70C 4Z1MA 2VRWA 4QKQA 1KOFA 4C0JA 1DAEA 4HB2A 1YZLA 1ZD9A 3RVBA 3RLFA 3WYFA 5H70A 2J0QA 1WBBA 1U81A 1QVRA 1Z0AA 3SR0A 4D25A 1Y63A 2CBZA 1EGAA 2BMEA 3QKSA 3ZLJA 4M1MA 2ZJAA 2XOKD 4B3BA 1HE8B 3FKQA 1US8B 3WYGA 4EQ6B 3ZQJA 1QHXA 2O8DB 3SN6A 3H86A 1G1MA 2Q3MA 3DVLA 2D7CA 3AB3A 3HR7A 3NWJA 4Y0VA 1R5NA 5LBIA 1S9DA 3VR3A 4W9MC 1ZP6A 4IOKA 1N5JA 5DYGA 4Q7MB 1Q21A 1UEIA 3QF4B 4A8JC 5FBLB 2GCOB 2UZ3A 5DHFA 3HYRA 2YWHA 2QA5A 1WXQA 3REFA 4C7OA 1HYQA 4MRVA 3TAHA 3KKOA 1OIXA 1R10A 1Y3AA 5JCZA 1QHHB 1UDXA 4QOSA 5AJZA 2HXSA 4OQXA 4A2QA 4A92A 2CLSA 4XVQA 4LC0A 4LRWA 2G83A 3D3QA 3FTQA 1UBCA 4P32A 2G1KA 4HZIA 1GITA 2OBMA 1XJQA 3QJYA 2HXYA 3CNOA 3CF6R 3BFVA 3KDSE 3TH5A 1E1QA 3GJ7A 1P61B 3O8DA 1MR3F 4U00A 2RGCA 1S9HA 4IW3B 4DCSA 2OILA 1I4LD 4KJZA 4LJ7A 621PA 2IS2A 2OLKA 4JLMA 4D0GA 1N6LA 2CMKA 4TZ0A 1I4DD 1XCMA 2HYDA 2QZ4A 1L4UA 3QEOA 4QRHA 4CEHA 3VKWA 4BLOA 3K0SA 2J41A 2BMFA 2XGJA 1N3BA 3EZ6A 1ZM4A 4AK9A 4X8MA 4JT2A 3OE7D 1W7AA 4Q4JA 1OIWA 3CH5A 4ZV4A 3RDPA 1AGPA 1MV5A 3EARA 2A7QA 4NP6A 1R2QA 4G5RA 4Q4AB 4RCYA 4PSKA 4BLSA 3J81k 4QNRA 1W5TA 4IDNA 1JR3D 4Q1BA 3B8HA 1Q44A 1R5BA 1KYIA 3T1OA 1MRSA 3DOFA 3EIHA 5BN3A 3U7HB 4R7ZA 1QF9A 4EPXA 4B74A 4TLCA 1WBDA 1YR9A 2F3TA 1N6NA 2GWHA 2P2LA 4TT3D 1CJVC 1KK3A 2WSSA 2H17A 2ZI7A 5KTYA 4HAVA 3O47A 4ZCIA 2GZAA 4YMTA 2IS1A 5KPDA 1QZXA 2FGJA 2YC2C 3P32A 1KDTA 1W0JD 4A0RA 4ARZA 3DZ8A 1ELOA 1X86B 3AVQA 4E07A 1OB5A 4PXAA 4YMSA 4Q01A 2A2ZA 4IVQA 5CM8B 1ZC4A 2ORVA 4LX0A 1G3MA 2N42A 5AJVB 3UMRA 1XTKA 3H1TA 1CR2A 2JLWA 2QQEA 1CF4A 3IHLA 2OLJA 4KO8A 3EXAA 4RY2A 4NCNA 1PLKA 4BPBA 4JSYA 4TWZA 2GZHA 2AR7A 4RD2A 1Z6GA 4FMBB 2WM9B 1YZNA 1XDBA 4BWYA 2JLUA 3GJ8A 2O8BB 2XNSA 3C41J 1VG9B 4HAWA 4UNSA 4WAUA 5FTNA 4NH0A 3C5HA 1I4TD 4Y0AA 1C1YA 2ZANA 1AA9A 3I5XA 4OQMA 4QNMA 1ZM9A 2F9MA 1N5LA 1C4OA 2NO0A 2XXAB 1GZSA 2ZRKA 4V0OA 2A5FA 3Q7QA 2PT5A 1OHHA 3A4NA 1GUAA 3CPJB 2NIPA 4A6PA 1E0AA 3K9HA 5DI9A 1UAAA 1DAFA 1VG1A 1LVGA 1NBME 3QNUA 4GL2A 2IXGA 4ESVA 5KUTA 3LVRE 4CDGA 3EIEA 3EW9A 3PV0A 4EAQA 2ODWA 5EE0A 4LYHA 3ND8A 3VKGA 3I62A 1CIPA 2XITA 3AVPA 1ESMA 1NBMD 3PITA 1M74A 1SXJD 3OEHA 2ZYWX 4JVNA 2PMKA 1KZGB 4Q9KA 3AQ4A 2JGNA 4MRPA 4N3NA 4QBIA 1KAOA 1XMJA 4TTRA 4XWAA 4KFTA 3TQCA 1UKYA 2OESA 3U44B 4FMCF 2WWWA 4P3YA 4EPTA 3T1QA 3IO5A 2ZSEA 4JVLA 5FR1A 1FQKA 2NQ2C 1XWIA 2BCGY 2R6AA 2REOA 1US8A 3L8YA 3U5ZB 1E79A 5CYOA 4FN5A 2IYTA 3B78A 3BGWA 4M53A 2D74A 4KSBA 2VO1A 2GA8A 2C98A 5EP1A 2GVDC 4LJ4A 3AUYA 1DAHA 5FI0B 1LS1A 4F4JA 2GJKA 1TAGA 2F1HA 2CVFA 2GCOA 3KUDA 3QQ5A 1N5KA 5CJPA 4NYJR 1AM4D 4F92B 1FTNA 2ZUCA 4YMUA 4LSGA 5J47A 1CU1A 1QHHA 2MSEB 1LF0A 2V4ZA 3K8YA 3TSZA 2YINC 4JVMA 4A0FA 4TYYA 1ZUHA 1E96A 3PUWA 4DLXA 721PA 3A36A 1G20E 2A5DA 1IY2A 2XB4A 2GJSA 5EP4A 5B30A 2JJ2D 4HUQB 2W2TA 4OK5A 5P21A 3GEEA 1SXJB 3BERA 4PFSA 3QF7A 4Q4LA 1U0LA 1VTKA 1ODFA 3OHMA 3I72A 2WJYA 1RKBA 1T91A 2FJUA 3QSYA 1K5DA 2GHIA 1VMAA 5A0FA 1CP2A 3LNCA 2VSFA 3C16C 2HLDD 1RJ9B 2E9SA 3BORA 3RS7A 2BEJA 2N46A 2W0MA 2G3YA 4D4LA 1E0KA 1X1RA 3UATA 5KNBA 4Q4AA 2RCNA 1G19A 2VL7A 3RNLA 5EZ5A 1SVLA 3NBZC 5CB6A 2IEZA 4Q02A 3K09C 4NDZA 4DSOA 1G64A 4XVUA 2A5GA 4CVNA 4KXFB 4P4SB 1E6CA 4DEXA 4R98A 3CZQA 2O8EB 1DAKA 2O5VA 2RB4A 4Q9JA 1W4CA 2OUKA 2W2VA 4DT1B 3AF3A 1GDDA 1U0HC 1VYUA 5G3YA 1W4BA 3KL4A 4DLZA 2IEYA 2JASA 3X1DA 4BLRA 4DCNA 2PZEA 1RC8A 2QEQA 3CW2A 2BOVA 2JDIA 2CE7A 2JLQA 1YJ5A 2C96A 4A2WA 3ZD7A 4PZZA 1G5RA 4EDHA 4DB2A 4B2PA 4G5SA 2CCJA 2YOFA 1XJCA 2GKSA 5DGXA 4Q4HB 3VHLB 4LBVA 1K6MA 2VHUA 4TLEA 4QFMA 3PXGA 1QHSA 4AC9A 4C0QC 4RFVA 2L0XA 1OJLA 1J2JA 2ZR7A 4JLPA 1VIAA 3QENA 5TMPA 5EE3A 4RZXA 3QUSA 1NJGA 4AY2A 2V55B 1Q20A 5EXTA 2O8BA 1YRAA 4TMXA 2RKOA 4JMPA 4OQFA 4TMWA 4G5OA 2AWOA 3TNFA 1JPJA 2PEYA 2ODNA 4X8OA 3FDIA 1Z3IX 1SKYB 5FL7D 2PJRA 1YE8A 4C3ZA 2XXAA 1H8HA 2OFOA 2Z4RA 2F9LA 4Q1AA 5FOSA 3NKVA 3A1UA 1G8FA 2GF0A 2YWGA 2WIBA 1CBUA 1E98A 1IAQA 2ZRDA 4PO9A 5F9FA 5FPSA 1SVSA 1IHUA 1OXUA 1E2NA 4A9AA 1GL9B 1G8GA 5HZKA 3MWYW 5IT5A 2GEDA 3MSXA 4CT5A 5L3RA 3W34A 2XJ4A 3WNBA 2G0NA 1RW4A 4NCJA 6Q21A 4JLDA 4Q19A 4NCIA 4UQOA 5JS8A 1Z8FA 3UPUA 4GMDA 5J5CA 2IWRA 2FX3A 2XZPA 4CGZA 1W5SA 3C8UA 2CNWA 3IBYA 1EFCA 4IOLA 4UXJA 3IIMA 1FUKA 4BFUA 2ZR0A 3B60A 2HCJB 2P5SA 4L9WA 1D2MA 2R2AA 4DLWA 1N25A 1HA3A 3TMKA 1S8FA 3ZZ0A 3U44A 1R0WA 1ZVQA 1N6HA 3MMPA 5EUQB 3K70D 1Z63A 1KAGA 2WJVA 1LFDB 1YHNA 4TN1A 1QG2A 5FPHA 2ZYUX 3T61A 3T1TA 2WWYA 2WBLC 3GEHA 1Z0KA 4M1OA 1PJRA 4L4UA 4D0NA 2JLYA 3GLHE 3QKRB 1G4AE 3RC8A 2F6RA 2ECKA 5CYPA 3RWOA 2YWEA 2VHTA 3IILA 1FP6A 2ZI5A 5DE3A 2VP2A 2UKDA 1MT0A 4NKRA 3TK1A 3O8RA 3THYB 2CHQA 1VYTA 2ZYTX 1ZUNB 4JLKA 3O8CA 3WHKA 1Q1EA 3H84A 2FA9A 3DZDA 1DG1G 4LC1A 3AH8A 1WDTA 3P20A 3PEYA 1Z6AA 2Q21A 4TQ9A 2QORA 3THOA 3UANA 2KSQA 2D62A 2J59A 3NDPA 4M9XA 2ANBA 3AGPA 3PUVA 3TE6A 1CEEA 1CR1A 3ZVRA 3WP1B 4EFNA 2X8AA 4JL6A 3VX3A 2RAPA 4BECA 5CK5A 3LFUA 2OAQ1 5EXSA 1GWNA 5JEDA 3A4MA 4AKIA 2R65A 4MA4A 2G77B 3FMOB 3ZJYA 4B71A 4RVCA 2GZDA 1TADA 2QE7A 4BQSA 1RJ9A 3LLUA 4O2LA 2IYWA 2WWHA 4KODA 1U98A 2QGZA 2ZJ2A 3HPQA 3HU3A 1Q22A 5C4GB 3DM5A 5DI3A 2AN9A 4ZI3A 1OFUX 1S3GA 2G0TA 4I1OA 4KV9A 4L16A 4ACAA 3GLGE 4OYHA 5JJLA 3K70B 1Z6YA 4URUR 2VPPA 3B1XA 2RGXA 3I4LA 2ZQ5A 3TLXA 4RKEA 2VP6A 3GJ4A 1Q1BA 5FR2A 2YJTD 1AN0A 1M6NA 2GRJA 2KWIA 4OK6A 4P4SA 4B44A 4B3GA 1WCV1 5AUPB 2O8EA 4S35A 1KI2A 3AP2A 5F3WB 1O3YA 2ZRAA 4IEEA 1CRQA 4DT1A 4DSTA 1S1CA 1OKKA 4ZI2A 2YNMA 4B3XA 2C8VA 1AS2A 3AKCA 1RPZA 3GPLA 4QGGA 1TMKA 1NVUQ 1U8AA 4A8JB 3QKUA 4M9ZA 1XP8A 3SFVA 1ZNZA 4YQFA 2WOJA 3AUXA 2QAJA 2ZPTX 3IHWA 3BOSA 4XD7A 1E2JA 2QQ0A 4DZZA 3IGFA 1GRNA 1P72A 2W83A 1T5LA 3MGCA 2Q0HA 3NBFA 4HB3A 2FN4A 2IUTA 4L8GA 1IN5A 2J0UB 5G53C 1VYVA 2I1QA 1S3SA 5H1YA 4ASUA 2I3BA 2VP9A 4CIDA 3GJ6A 4XIGS 2MMCA 1TQDA 4KU4A 4NCKA 2CK3A 3TVTA 3BJIC 3MD0A 4LYFA 3T34A 4B2LA 4JLNA 3EC2A 2WMNB 3DKPA 1T0HB 1HT1E 1TQ4A 1M7GA 1KI6B 2CHVA 4IHQA 4AG6A 2B7CA 4LV6A 3OIVA 5GADl 4PC3A 1VDZA 3FWYA 3WMFA 1XD2A 4L9SA 3RAPR 4EJSB 1XXHB 1KGDA 2GK7A 3RRMA 4DJTA 3W3ZB 3TR0A 1Z22A 1XEXB 1YQTA 1E2DA 4G0NA 2WJGA 5FL3A 4LPSA 1TNDA 1FNMA 1OH8A 2XSZA 3VNUA 5K8UA 2VHJA 3B2EA 1BKDR 3T5GA 3CRW1 5H8WA 2BKEA 5C2JB 5EE5B 2DFKB 4D6PA 3KTAB 1NIPA 3I5YA 2HT1A 1BO6A 4D4MA 3SFZA 1DPFA 3I32A 1F6BA 2AKAB 2J45A 5FBRB 2ONJA 1NSTA 3R9IA 4JLOA 3U3KA 2V1UA 5BN5A 5DN6D 1G6OA 2QG6A 3ASYA 3LBNA 4QGFA 2J0SA 4KBFA 3ETLA 4OI1A 5TXGA 1DS6A 1II8B 3CNNA 1LW7A 4QJ3A 1L2TA 4WW0A 1G5PA 3VMFA 1VHLA 1U9IC 3BXZA 1IM2A 3DPUA 2IYRA 4LJ8A 3CF0A 2PT7A 2D3WA 4IDOA 3WY9A 3AVWA 1QHNA 2FSHA 1YZKA 1P9RA 1OW3B 2ZAMA 1YR6A 3THYA 1R0XA 4NPHA 1UFQA 2R6GA 1RIFA 2ONKA 1ONBA 2XX3A 3W6PA 4Q21A 4LUCA 4Z51A 3W8NA 2F55A 1GNPA 3IDQA 1EX6A 1KI4A 1XMVA 3P27A 4A0HA 2X2EA 2XB2A 3FKSA 1VPLA 4I1SA 2QPAA 1N0VC 1T9HA 3T15A 4DIDA 2JIZA 4HDOB 1R8SA 3IBGA 5HE8A 5EQTA 5FUXA 3ZVNA 2YV5A 4LBWA 4M1KA 2PL3A 2CJWA 3TUJC 3M0EA 2OO7A 3LX8A 3K9LA 1JXMA 1COWD 3ZIAA 5KPJA 4CEIB 2FEMA 2OM2A 2ZU6A 2VP4A 3H4MA 2OT3B 3TKLA 4Q47A 1MRNA 4MDFA 1G4UR 4Q00A 3UWKA 2ZSDA 4JT4A 2B21A 3R7WB 4IVPA 1D2EA 5AR1A 1Z2AA 1OXSC 1G17A 5DH9A 5KO2A 1GL6A 4AYTA 4LV5B 1TPZA 1GG2A 2QP3A 4KHZA 4DLUA 4HUTA 3RS0A 4TL9A 1J90A 4BZXA 3G82C 4LI0A 4HAYA 4ZDKA 1W36C 1MABA 4HLUA 421PA 3RS3A 3SI7A 2KBFA 3W6NA 3Q8XB 1FQJA 4MKFA 2V6IA 1S4QA 2IC5A 2ORWA 3I73A 5SZKB 4DUGA 4O0MA 3VNVA 1SQ5A 4US0R 1JNYA 2BVNA 1XCPA 1P2SA 2IT1A 4KVGA 1I2MA 5JRJA 5JHGB 4FCWA 2RH5A 1VKJA 2NO7A 1ZM3A 4AURA 1GIAA 4A8JA 1XTIA
chains in the Genus database with same CATH superfamily
1ZUWA 3BS4A 3KD2A 3SS9X 3LDAA 3G2MA 2JGKA 2HCBA 2VT2A 3EVAA 4MVJD 4PLHA 2VPWA 4S1OA 3WGLA 1KDOA 5F4ZA 5CLJA 1DJMA 4QJ5A 1KZHA 2HF2A 4JOCA 1AVTA 1ZS9A 3WGJA 1TK9A 1Y89A 2IV3A 1JYEA 4MPDA 1NMYA 2GCIA 4E30A 2JCSA 4NOJA 2JFGA 3L5KA 2O7VA 3P9NA 4FDUA 4PX2A 1AZLA 3O1HB 1UWCA 1HFJA 3THRA 2I8AA 4RD6A 5IKEA 4YT4A 4ETNA 1GQQA 3WLFA 5HQTA 3FLAA 3OJEA 3ZWXA 1WB9A 4BO7A 2BFMA 4IXNA 1NYTA 3BWDD 4NBUA 2A3RA 4G1FA 4I6EA 5LYJB 5F12A 4Q1EA 1ORWA 2BFDA 2HO5A 3O7WA 4MI6A 5FTMA 3RK0A 2X1MA 5KWEA 1H5UA 4LHZA 5DNCA 1NKVA 1Q1ZA 4F4HA 3W3AD 3CLRD 4I5FA 1N5OX 1Q3TA 2I8LA 1GKUB 3BYZA 4X66B 3V7WA 4AYWA 2XAAA 3HYTA 3S2YA 2OCKA 4OYYA 4LTDA 3K9CA 3QBTA 2QUIA 4KSCA 1PX0A 2FEWB 4S24A 2NYAA 4R2MA 1UBJS 2RHOA 2Z8ZA 1WUHS 4C88A 5BNWA 1GN9A 2GM4A 3SE7A 1CYDA 1O94A 3PLAE 4TVOA 3RS2A 1ISRA 1L9KA 2MYUA 1SY7A 3DTNA 3V00A 5H68A 2X0FA 4MDEA 3D2LA 4P93A 1V5FA 5BUQA 2X86A 4MX8A 2I99A 3E82A 3B7GA 3R7LA 2PH5A 1TGYA 2Z56A 3E3LA 1U31A 4OKIA 1HTWA 1V4VA 4CXMA 1AUQA 1L8QA 1JX6A 1OYYA 3NC0C 2W2KB 2RJ3A 1DZIA 2WNSA 5IAKA 5B1YA 5HM6A 3AVOA 1NBEA 3NGLA 3P96A 1ODKA 4U7FA 4EHAA 1QZZA 2NTEA 2RHTA 4LE2A 1DRJA 3B1FA 5KINB 1CRZA 2CXTA 1ID8A 4LMBA 5DLYA 3F4LA 4JB0A 4WCDA 1KEVA 5BUZA 2NSJA 1BOOA 3MCUA 2QVLA 1C81A 4NFHA 1GD1O 3LO5A 2RG7A 4P8RA 1FTGA 1T24A 3ROMA 5KKNB 5CFPA 2DTXA 3BB1A 5IKMA 1QBKC 1FMFA 1OBVA 1V8ZA 2YC4C 5DMXA 3QPUA 1BX0A 3DR3A 3QVTA 1R7RA 1A50B 1RVDA 1PWYE 4K9QA 4GGMX 2ZE5A 2JIPA 3PJDA 3NHBA 1A1VA 3A2MA 3FPSA 2BUAA 1JSLA 3HNOA 2JZOA 4QFBA 2G0AA 3DJYA 3OPMA 5CNJA 2G4CA 2DLDA 1UZLA 5A0VA 1MEEA 4ZAZA 3CLUD 4QHYA 1SGWA 2YY5A 3PUYA 4GBMA 4D44A 4OI2A 3JAKA 1SIUA 3N07A 4FDLA 4I46A 3TZBA 1XHLA 2FWPA 1AXGA 3FR8A 2RJNA 4RC9A 3OMLA 1XPJA 2OBXA 1Q0PA 1Y1LA 5L3SB 1U0EA 2A78A 3RJTA 2O8FB 4RKRA 3WE7A 3P0RA 2C2HA 4RA6B 1D9ZA 5E6SB 1I6MA 4ZEWA 1DXQA 1BFKA 1U2ZA 1J0EA 2ID4A 2YDYA 4BC0A 2RGUA 1E9RA 4GI5A 3PDJA 2VNAA 2R8OA 2ZE8A 3OIWA 2XUKA 1SQFA 1YQ9A 3DEKA 4AWXA 3FIJA 4UXHA 4V1CA 1BGWA 4MIEA 1KO8A 2IYQA 2G5GX 3T7TA 1QIFA 4CL2A 4RM2A 3ZHOA 3ZCPA 2OGUA 3CKMA 3MAJA 1GLGA 4GGOA 4WLEA 1UJNA 5TVKA 3SQWA 4TL6A 2MINB 5KJ1A 2YXDA 4DSNA 4F5EA 1DCTA 3C43A 3AI3A 1F4PA 4PAOA 1R0SA 3TNLA 5DNUA 1HDIA 4TYMA 1IUNA 3G9ZA 2C1XA 1B73A 2Q1SA 2ZIXA 5A5VA 1GNSA 4HDRB 3KQLA 4MR9B 2QM8A 3HBJA 4H18A 4B3DA 1R0BA 1I1QB 2H57A 3TKAA 2PXHA 5C1OA 5DISB 3AINA 3RVDA 1M8PA 4QXOA 3CWQA 3GFVA 2Q2QA 1SIOA 4EB8A 3PDWA 4NE2A 2Z6VA 1A95A 3F2IA 4JUDX 2XF8A 1B1AA 4MQUA 4O4HB 1W44A 4OQEA 4JC5A 3EIFA 2PZ8A 2Q9AA 2W6MA 5A9SB 5LM3A 2VFAA 3JTMA 3FDZB 1TL7C 5HNKA 1TUGA 1P3Y1 4MVXA 4I66A 4NECA 4AZ0B 5J3JA 3B5IA 1U3VA 1GP2A 1UC8A 4FX2A 4IIDA 1WZUA 1XCJA 1DAOA 3IMEA 2BEWB 2BGJA 4IDDA 1PZGA 1DBQA 3LKDA 2OBYA 2Y1FA 2WWYA 1AZTA 2ERCA 4DY4A 3WGIA 3LCCA 3PIRA 1M5UA 3E1SA 1ST3A 1J0DA 1SK9A 2WIDA 5E2AA 4LFCB 4XSHA 1TKCA 2ECFA 4Q82A 2Z2ZA 5DULA 4ZWNA 3GDFA 1JG1A 2YIVX 3CONA 4QGBA 5G40A 3V8BA 1L8AA 1OVMA 2WU4A 4XVHA 5CG2A 1NMEA 2CUZA 3SJBA 1EWYA 1MC4A 2WA1A 2EZ9A 1ISPA 3I6MA 1DJPA 4IUCS 3ZWVA 3HJUA 3R76A 4FHDA 4B17A 1RRMA 1UFOA 1ECGA 3H1BA 2GN9A 2ZPUA 3SZOA 1XZQA 4L73A 1IATA 4TRMA 4LI3X 2ZRHA 2R6CA 4S12A 4FWTA 2YXNA 1KO5A 1RRGA 4N82A 3EZ9A 3GLFE 4AMUA 3K7EA 3RTDA 4CKCB 4BP1A 1JWAB 1N3YA 3GDGA 4DJ5X 5TRTA 4QUJA 5TGDA 1PS9A 2HBZA 3NIBA 2PS9A 3O6VA 4WE3A 1TD9A 4NABA 2HK9A 4TMVA 3KSUA 1DX6A 2D2EA 2P41A 3AJEA 3NEPX 5BXQC 2I1VB 3NS7A 3REGA 1QK3A 4CKXA 1CFJA 1KJYA 3O2JA 1OPRA 3EBOA 1ZVJA 1BAPA 2AOUB 2QMHA 2FWRA 5J40A 3DOOA 5E9QA 4MW1A 4ME6A 1CVLA 1IXRC 3MINA 4AULA 4L0DA 3EGIA 2FWMX 2JKYA 4I6GA 2A14A 1NI4A 4C76A 1JXQA 2FG5A 1ORVA 2XB6A 3B82A 1CE8A 3GVCA 3WL8A 2GJAA 2ZB2A 4F85A 3NPAA 5TJ9A 2H5EA 1RHKA 4IQ0A 3VR6D 3KQQA 4F7DA 1ODSA 2AJBA 1KOJA 2BM8A 4HDKB 4GS5A 3QNWA 2P2YA 1ONNA 5B6JA 1YQXA 4RV9A 1F7VA 2C04A 3OQPA 5CPBA 1E8NA 5FNVA 1VHJA 2POCA 1Z26A 1E9CA 1EZZA 3WGZA 1YV9A 5I01A 4MYHA 1EXMA 3DL2A 4M88A 2HEGA 4MHTA 1JH8A 4IQGA 4MA0A 4M9SA 3W77A 4XCVA 2O06A 3I4CA 2FUG6 3TQTA 3KQUA 2PPLA 4C0AC 5EFOA 5L8VA 4LXGA 2TMKA 2Z1NA 3MOIA 1JZQA 3PVCA 2H9IA 4HI0E 5LLDA 2OK8A 2CNNA 3AR8A 2YZNA 1Y3CE 2IE8A 3H5WA 5IVPA 3U4HA 4UXIA 3AF4A 4HX5A 4X0EA 4RZHA 4HC4A 2MIIA 1W4AA 2XYQA 3GGPA 1AXRA 2ZTHA 3WMRA 2Q1UA 1AOXA 1DIOB 1TPYA 3TUZC 1LWOA 3ESDA 4V39A 1EVZA 2FQQA 2I4MA 2PX4A 4PHHA 2BLLA 1BYUA 1B6RA 2I71A 2YVUA 3I6IA 4CG1A 3QI2A 4C20A 4GMXA 4ZOEA 3FHJA 4RHCA 5G1NA 2EZTA 5HPYB 4EUEA 5HUJA 4LWZA 2PAAA 7GPBA 1R88A 2NUPB 2DR2A 4TV9B 1G5TA 1LF5A 1JBEA 4TYPA 3CA8A 1LU9A 3IBFA 1UJMA 3ZKAA 1J09A 1XTSA 2FFBA 3H19A 4FZJA 4ZJZA 2LV8A 5AXCA 2EFGA 2XGMA 3OFJA 4WBNF 1XNHA 2E49A 1Q50A 2WHXA 4GHWA 5JAUA 5JC1A 3QKTA 1WMAA 1CJTC 2H9YA 3N8GA 2WAMA 1H66A 1HLDA 2PRSA 1E94E 2X4LA 1E4EB 4PFKA 4US1R 3ZWQA 3Q72A 4R5MA 4ERNA 1JS1X 1T5BA 2EEZA 4NV0A 3WFIA 4ZMSA 2VZ8A 3RCBA 3WMXA 1YF3A 1L4LA 1HYBA 1KSHA 1TW3A 3KAPA 2QM3A 4U3JA 1DGQA 1U7WA 2O6LA 4NCXA 1SC3A 2I4OA 5FQOA 3WK6A 4L0CA 4H6XA 3Q1LA 3ACCA 4LQCA 4YDSA 3REOA 3HKDB 3AF5A 3MGAA 3M3HA 4MCJA 1F14A 3KJHA 2BONA 2OFPA 2CXPA 2HT6A 3I0ZA 1DRVA 3W8DA 1Z0FA 4AMVA 4HWKA 2BHTA 4JZYA 1FNSA 2C5AA 2OSVA 3HDVA 3L4BC 2R6FA 2VA8A 4TT3A 2YWBA 5E6RB 3DL4A 1L1QA 2PUTA 2WJJA 5GIOE 3IL2A 1FJXA 4Y2HA 1T2EA 3MJEA 3VUFA 2XCRB 1I0IA 5EPOA 1C3OA 4FFBB 2DCMA 5E9WA 4FPXA 1EDZA 2JLRA 2XYPA 1FS5A 3RFFA 3CUEF 3WYCA 2N0SA 5B7GA 1BD4A 4OKSA 1EU1A 3DQQA 3QXCA 1VIMA 1SRQA 5B37A 1KZYC 3CCCA 2DHDA 4MP8A 4UDXX 2Q28A 1N0IA 3HN7A 1XTZA 1LV7A 2PRZA 3CZPA 3IKLA 4GOMD 5I7UA 3THWB 2SKDA 3BTOA 4TSFD 1JJFA 4FD3A 3K0CA 1X92A 1FJGB 2R79A 4I50F 1QC5B 3N7UA 3MJHA 1PEKE 3QJGA 5DOZA 5KVQA 4DRXA 2IHZA 9ABPA 5HJEA 2PX8A 2YMQA 5F23A 1NJFA 4UHFA 5IDVA 5F4BA 4Q1DA 4WFIA 5IU6A 1T3HA 1J07A 5B4VA 1NXWA 3ROEA 1P81A 2OD9A 1UQUA 4PX5A 5F2OA 4BNXA 2VN8A 4OTZA 4QULA 1CHNA 4GG1A 2HMYB 3SYLA 4D43A 1P4SA 3EPKA 3C5WP 4ZDWA 3E1GA 4O4JF 2PMWB 1Z82A 5JBQA 5ALEA 4J0GA 3D8RA 3AIIA 4IYJA 1TEVA 4L4YA 2LDXA 2ZAGA 2GZ2A 1Z6PA 1XV5A 4FQ7A 3OZWA 4KTVE 5FPTA 2JFYA 2V7QD 4KQGA 3T9EA 1OI2A 1LJ8A 2XYGA 1CQWA 5TX7A 4BV8A 5FOVA 3TX2A 4U6QA 2R2GA 1ZZGA 1K2VN 2CLKB 2ZI6A 3NOVA 1J2RA 3DC2A 4FB4A 4YJFB 1GZ4A 3OLXA 1SHKA 2LR0A 1C29B 3P1JA 5FT9A 3BDVA 1IWOA 3RIGA 3T3IA 4JC4A 2ODAA 2V4UA 4HUQA 4OP1A 4WKNA 4O1MA 1G2PA 4LMAA 2E87A 3VTKA 1E6WA 7YASA 3OUUA 2AI3A 4QPDA 2X5OA 5FWYB 1VBKA 2PR7A 1SG6A 4HBZA 1J6UA 1QGYA 1YCDA 3A7DA 3DE6X 2RGDA 1BXZA 4QRDA 1X74A 4R8RA 4B4OA 4LSWA 1MC1A 2B98A 3E7PA 4JYCA 2XDQB 3AVYA 3AXTA 3QWIA 4RJ2A 3LOUA 2MT9A 3KVYA 2AXPA 1J1IA 2I55A 4JT9A 4YHBA 2RHRA 1ESNA 2JFUA 3FH0A 1PWXA 4OHMA 1JBQA 4E5NA 2IUSA 2PEZA 2QVYX 4C4YA 4QPZA 4FEEA 4E5SA 2QRNA 2WIKA 5K0CA 4YJ3F 1KJQA 1NVTA 1IMJA 3G1WA 5KQPA 2J4CA 2HR1A 4WUVA 4HNHA 2OCXA 2RARA 3K9NA 1N2XA 3W8RA 6YASA 3U6BA 1I4EB 1TEXA 3GA0A 4P3PA 3JQ6A 1KY4A 2XMBA 3EC7A 1A04A 4UBMA 4UU0A 2NP7A 1WLYA 2H0RA 3UKOA 3X2EA 3IVGA 4QOHA 2JVKA 4I81A 3KAJA 2QE6A 2EJTA 4QQRA 4RNDB 1JIQA 4ETIA 4F8YA 1J9GA 2P6RA 2A7XA 2QVCA 1A9PA 2R00A 1LDNA 1NP6A 1GCIA 2G25A 1M33A 2VCYA 3IURA 3TW8B 3UC9A 1PSDA 2Q6TA 1J2EA 2AVDA 1X70A 1SKQA 3O8LA 3OZIA 1AKUA 3Q3HA 4ITRC 2H2WA 4KE6A 3I6YA 4NEGA 4CGYA 2CZCA 1Y34E 2BGUA 2EWMA 3P9RA 1VHTA 3M1IA 4FE3A 4UVDA 1O7JA 3RKSA 3W0LB 3N7AA 1A3CA 5B2EA 4ALIA 2O0JA 1J99A 1SVOA 3RAGA 1C3VA 1E2PA 5JXIA 4BATA 3AEYA 2PQMA 3CPEA 5FOTA 3S1AB 2M2IA 3JWPA 3ZXSA 4HO1X 3H65A 1KPHA 1RQRA 3G6WA 3H2HA 3TBFA 3ZE0B 4AQDA 1WW8A 1JA1A 2BV3A 2QTWB 5KNDH 2WYOA 3QWBA 5KOHB 1O94D 3FPCA 5TPWB 3SYNA 3IRUA 1UEXC 2GXSA 4KXYA 1RIIA 1T9GS 4INZA 3JQ7A 4F3CA 2VXCA 1S02A 4H7JA 3AKDA 5AXAA 2DCUA 2QAGA 1R6AA 3LL4A 4RFSB 3VSBA 5C8VA 4DBVO 1OFTA 4LYGA 2CHGA 4H59A 3NTXA 4I9NA 4S1WA 1IUOA 2O3RA 3EZYA 1ADCA 1ZGZA 2EERA 1LA2A 2QHXA 4YRMA 1NDHA 3KR9A 3NBUA 2YQZA 4LZPA 5AI5A 3SE0A 3D4LA 1Q2XA 3FZYA 4FBMA 5BSRA 2Z9CA 3N6VA 3CVWA 1L7PA 2YVQA 4KLCA 4AO6A 1EESA 2I29A 2X42A 3HXPA 1PBTA 4XWOA 2BD0A 4AZVA 1W5BA 2ZUUA 3ZX5A 1LK0A 1GTL1 2B1RA 4F2GA 1JEDA 1UFVA 2G6TA 4M38A 3GQBA 2XUAA 1P2TA 4FT2A 4KDEA 5JLJA 4DUZB 1JG2A 4Q5IA 1N4AA 3NYQA 5AM4A 4HWRA 5IYZB 3HKEA 3TFOA 3BIXA 2XCSB 4LDQA 2OHOA 1TB4A 1HT0A 2FFJA 4K46A 3O4GA 4MVJI 3F5FA 2DWPA 1VIYA 1BG6A 2Z57A 3C4QA 5KWIA 5EIXA 1Q57A 4GPIB 5DHRA 3HUTA 3LO8A 4PC7A 3EXEA 4R54A 1Z3CA 2WZQA 2OAEA 3EDQA 4H6VA 4KP7A 1S1MA 5LZ7A 5DX8A 3B9PA 4EQZA 2XWJI 3QWFA 1MHPA 2E5LB 2P65A 1WABA 5CH8A 2OVBA 4C6TA 1CS4C 1BHQ1 1DKRA 1LPOA 4D97A 3JQAA 3KC2A 1WXFA 4BE4A 4COKA 3K4HA 2IYSA 3UV7A 2X9LA 3NXSA 1JPUA 3A3OA 4FIZA 3GCDA 1BN6A 2C99A 1C9JA 1I9CA 5TIIA 3U7GA 2OC4A 1OT3A 1D1SA 4F93B 2JI7A 1FFDA 3X3HA 2C57A 5AVWA 4IHKA 4FYXA 3ZS8A 2PLFA 1ZMBA 4M99A 1NIJA 3OLVA 3WGOA 1PBNA 3PTAA 2NU6A 1J1ZA 1K92A 2QM7A 2QTGA 2ETVA 2PX0A 3I1JA 3VVBA 1ZIPA 3BCUA 4LRTB 4KQMA 4RF3A 2E1RA 4Q9NA 3CRVA 2ZIEA 5I3CA 4B3MB 4DR4B 5TS3A 4RY8A 2Y76A 2O2ZA 3EQ7A 3R77A 1ZW1A 1JECA 1G6HA 1PLLA 3E2IA 3IELA 5B2ZA 3WR5A 3WMGA 4NJMB 4G0WA 1P33A 2VSYA 2BTQA 4HDNA 1PVOA 2H1OA 2ZRNA 1BMQA 3EIQA 3WGKA 1G3UA 1WHSA 3ZE6A 5K6TA 3PC8A 3UUWA 2HA7A 1AA6A 3DONA 1ULZA 3GUUA 3PCXA 1KVUA 5J63A 3RS4A 3S5JA 1GQFA 3QJ5A 5EJFA 1YCHA 5I9BA 4C4RA 3AFNA 3DJFA 4GLOA 2PMFA 1CEXA 4WK2B 4RF2A 1AKNA 2QVGA 1HXHA 3WIDA 2YMPA 1E7YA 3PEWA 3UAZA 4OQZA 5AJHA 4C4OA 1DFGA 2QSUA 5HOEA 1M10A 4J94A 4MQLA 4Q6BA 4WA8A 1U8TA 5H83A 1VMKA 2BH9A 1DAMA 1WMSA 121PA 5C18A 2EL9A 5AHKA 4PYQA 5B4TA 3AEUB 4AZSA 1CUUA 1C7EA 3I9LA 1Y8QB 3CSUA 1NP7A 3OQHA 4M0DA 3AF2A 1RYNA 4DWOA 1H9AA 4NU6A 1D7OA 3PTLA 2GSDA 1PFKA 1RQ2A 1HY3A 3H2KA 5F73A 3TTSA 3VSCA 3WA6A 2ZE6A 2NZYA 3TSOA 1S2GA 2XE8A 2DETA 2JZNA 4C2AA 1KWGA 4PY2A 2C2KA 2WWTA 3VYTB 5ER6A 5HCNA 1EUCB 1GPMA 2A9PA 1KNQA 3TX6A 1KEPA 1XZHA 1UXIA 3OTHA 1IQPA 2H29A 4NENA 4NXNB 2WJAA 3JVEA 1QCYA 4R0NA 4G36A 4YQZA 1DOAA 5HRUA 5HTOA 4BFTA 2X6TA 4FYYA 3KJEA 4FS3A 2CLLB 4GYJA 4Y6LA 4N0MA 4NYMQ 3SKYA 4CQMA 5BN1A 1AJEA 3PRHA 2ZTMA 2XKBA 2EQBA 1Y1RA 1FQOA 2AC4A 1M2OB 2H4WA 4L6IA 5DRYA 4ZAGA 5L3QB 3SHFA 4RPGA 1MLDA 2W58A 4HS9A 4LNAA 5PNTA 3DLHA 1GQSA 2VUIB 3O2SB 4QXRA 4YB8A 1UBMS 1CJUC 3L7AA 4FU0A 4FS8A 3OJLA 4JI8B 1N0HA 1GCAA 5AOCA 1K8QA 2FGKA 4RHUA 1RYHA 3KT6A 2ODQA 1OWPA 4M83A 1PR1A 3QFTA 4HPXB 4QDTA 1PJ4A 2I4RA 4UATA 4X92A 3T7IA 3AFHA 4UW9A 4K05A 3TLAA 4EENA 1U94A 3NATA 4EP1A 5JCPA 2WLTA 1II0A 4ZVQA 1ODCA 1EGHA 5IAAA 1BC5A 1VE6A 4PGFA 4D81A 1C4KA 3A25A 1SCKA 4M60A 1AURA 1CQIB 3DTYA 2J0UA 2VPTA 5JMPA 1HL3A 1GZUA 3AIKA 5DOVA 4OYRA 3UG6A 2FUEA 3PSAA 3M3DA 4D8VA 4PFQA 5M3BA 4WXPA 3EZ2A 3KSBC 4HFNA 3RFCA 5HKLA 4BQPA 2QSYA 1C7ZA 1QHYA 4HLUC 1A2KC 4B43A 3LPDA 4M1YA 5LWHA 2GAFA 1G63A 3A1WA 1WUKS 4R9RA 1AQ6A 3EMBA 3DLBA 1EDOA 1UAYA 2RAFA 5GMOA 2N9UA 3FNGA 2ISCA 4LNUB 2GEBA 1X42A 2IEGA 1P45A 2VHYA 3B9BA 3EE6A 4MQ6A 1KMHA 4IDPA 4F4DA 1Z06A 1QKKA 1S0UA 2H2HA 1EVEA 1XKTA 1XC7A 2YCLA 4LOAA 1U7XA 3RIYA 3T5CA 4C43A 1QFSA 1RRKA 1XLVA 4DIEA 4F84A 1F2DA 5FAKA 4MP3A 4DQLA 3T5AA 1T4CA 4IJ6A 3OJ0A 4PYOA 5E4FA 5GONA 3GLGA 1YS6A 2QN9A 2RONA 5C4MA 4ZO7A 4F6CA 3KQMA 2XJ9A 2Y1OA 3GEBA 5A3VA 5HEKA 2GM9A 2CBGA 1GFSA 3IQIX 3NYRA 1FOEB 3VNRA 3O03A 4A4DA 5I7VA 1N1EA 3TTYA 1XJWA 4QHTA 3EHDA 2MSKA 4QYTA 3G23A 4BO9A 3N70A 4LJKA 1XR3A 3AOGA 2G80A 4HNSA 4KTTE 1YVUA 2NU9B 3WHPA 5C81A 4GBJA 4RVFA 4Y2GA 1DKLA 1TFUA 2GYUA 2YWDA 3HDJA 5DTQA 3RUCA 3ZY5A 2HEIA 4KAXA 3FX2A 3JQGA 3ZIDA 3EFOA 2BFFA 2V9CA 1UOPA 1ECLA 4ZPXA 5IC6A 4LXYA 2CYCA 2ECOA 1QIIA 3F97A 2EYUA 5U9CA 3WLHA 3N2KA 1QRUA 1GEEA 1T3LA 3HLKA 4ZP1A 4EUFA 3EPHA 1FA9A 4XJXA 1E1DA 4JDPA 4AX8A 4EJSC 2YHUA 2JHPA 2OCBA 2RHDA 2VEOA 2W2XA 1U9JA 4HMOA 1KYTA 3CO0S 4KW7A 1AXEA 1NNI1 3GG2A 4DADA 2J33A 5IDXA 4RSMA 1FYXA 3WRXA 4YP1A 4BQNA 2WFLB 4J6EA 4BWFB 4EI9A 3DFIA 4DLSA 3ZEAA 2M98A 3TEFA 3NHUA 4M1TA 3KWMA 3MCAA 1KIMA 1NX6A 4AF6A 3G89A 5D3MA 3ZV4A 1SBIA 2OECA 4UNQA 1UF9A 3EYAA 4GPAA 3P4XA 1K7XB 4WOKA 1N5IA 1YVPA 1T2NA 1U1GA 5H7XA 3FRHA 1AKWA 2GLXA 3ZDXB 2HWWA 2PZAA 4NR0A 2H1CA 2R68A 3EMKA 4J7AA 4CKEB 1B15A 4OGFA 3GT0A 4ZCLA 2NVUA 4UUNA 1J49A 3BK2A 1P4GA 1R64A 1KBZA 1XQYA 1Z2EA 1JJAA 1ZL2A 2CXOA 3IOEA 4ZT6A 2C0CA 2ZTLA 4D9BA 1GDHA 4H7FA 3JXEA 4BZZA 3TQIA 3MRSA 3TVDA 3PQ6A 4LF4B 2WU3A 4Q9LA 3ZWCA 1Z83A 1ZD8A 3ISJA 2W4QA 1XZBA 3VYVA 1UKVY 1NW3A 1XMPA 3ZQ4A 4B6GA 3MCTA 4N0DA 1K8RA 5JT1A 1C5KA 3FYUA 4C3OB 4IILA 3OA2A 2AE1A 4QWWA 1V45E 3B13B 4IIXA 4AJHA 2FLWA 3CB2A 3DH0A 1YGPA 4HV4A 4KN8A 4NBWA 1H85A 1JT2A 1RC1A 3ND9A 4WZBA 5JY1A 3G2PA 3VH1A 1R9GA 1GTZA 1XD9A 1UJ4A 1M1YB 2B99A 3D3KA 1JAIA 4NBKA 5CNIA 1RMTA 2QZSA 2PL1A 5FAXA 4GNKA 5FUQA 3BIJA 3FIUA 4F11A 4BV2A 2VZEA 1MG0A 4RK4A 3PVSA 1WKCA 1RHQA 1YE5A 4BNIA 3ZH2A 4D0LB 4OBBA 3LCRA 3UUGA 3ABOB 5A71A 3D81A 1Y8RB 3CGGA 1OTXA 3NBMA 3OCZA 1EWQA 2J3MA 2J07A 4DCUA 4G5QA 2GAAA 3PQEA 1PNOA 3MTIA 1VSVA 5DK6A 5CTJA 3CRRA 1N77A 4JLJA 1F4VA 1P3JA 4QD3A 3L8HA 3HDGA 3IEVA 1AS0A 4IZIA 4V0KA 4DLVA 5A6SA 5B5SA 4B48A 4KGXA 2TS1A 4GLFA 4KVZA 4BNMA 4D0RA 4BB9A 4MIKA 2VSOA 3SZGA 1GKYA 1YR8A 3OQIA 4WASA 5J58A 2CEKA 1XJ5A 4G4GA 5KOJB 1VL5A 2H1SA 4QBFA 4D98A 1NV8A 5T57A 3GZNA 4QODA 4B1FA 4DE5A 5BOVA 1MFPA 2FSFA 4QPJC 1D9XA 3ON5A 2FEOA 5KYNA 1JIKA 1E62A 1I5RA 1THZA 2WF5A 4HATA 4Z0TA 2OR3A 1TQ8A 4MWTA 5JYBA 1SUSA 1NXXA 3ZV5A 3ORYA 4EHHA 1P0IA 3G49A 5DXAA 3WL5A 3LH5A 4TV8A 4CM8A 3BM5A 1JTVA 3E9QA 3N0XA 3O0DA 4QFDA 4U5XA 4WZAB 5IJ9A 1OLXB 2RGRA 1PL8A 3UMCA 1FFHA 1XIVA 1JALA 1WG8A 3ZDAA 4KR0A 5MN6A 1PR3A 1FLNA 2BFPA 3I34X 4WESB 3TSWA 4HPWA 4EW2A 2X5NA 4TWRA 3HXOA 1AF4A 1XCLA 3D6HA 4NCHA 4ZMBA 1P62B 4UUPA 3EG9B 2VQSA 1C1XA 4X94A 4Z99A 1EFPA 3K6KA 2DUNA 3TIFA 2HJSA 1FW8A 4HGRA 3ZGVA 1NUSA 4BFXA 3AEKB 1U3DA 3IQHX 1R0CA 1TAUA 4I9HA 4O2AF 1DP4A 1MXFA 2OTCA 4X8HA 5E4YA 1ZKDA 3SLKA 5FNZA 3WJ2A 4P35A 3UK1A 4V24A 4RQUA 4DA7A 2DYKA 3E22A 3NHSA 4XD7D 3PC6A 3ZE9A 4W1RA 5ALDA 4LDJA 3NUQA 5CIWA 3BXPA 1VC2A 4F9FA 5KQRA 2FPIB 4RTRA 5EMNA 2HMTA 4ZRNA 5K8VA 2AYXA 3KRTA 4PYIA 2L19A 1EUDA 4GNRA 1Y6ZA 3A3NA 5HQ3B 3TZCA 2FR8C 1EBFA 4WOPA 4CPDA 4L4SA 4OJTA 3QELB 1WTAA 4WBNB 4JYAB 1SKYE 1EK0A 1GA1A 1UXHA 2B5WA 3N76A 2G7ZA 3KX2A 4QDJA 4ARUA 3BWBA 5JSZA 1XPRA 4U9UA 2JEYA 3BMOA 3G5AA 2XVYA 3AJAA 5LQSA 3WLSA 2NZJA 2OO3A 1URPA 4NL4H 3W05A 2O6HA 1DWUA 1Q19A 2BWJA 4MDYA 5K0NA 4D80A 4WOBA 1EI9A 5IANA 5L51A 3K8ZA 2F3PA 2QMUA 3AHIA 4E15A 5BRAA 5EHNA 1SG9A 3EYWA 3GO4A 2JHGA 1RQGA 2BC9A 3TBKA 1RQXA 1SUCA 5TSDA 2OB2A 5JHHB 1GRRA 4EECA 1WUYA 2V9ZA 3PGJA 4Y2VA 5FDFA 1I01A 4FWBA 5K05A 5BR1A 1OUMA 4D9KA 1RZ3A 4FFNA 4NATA 4HQNA 1T5IA 2QJTA 3D7MA 1PYDA 4TTVA 1Y1QA 3GP3A 1XAJA 3U7FB 5CU7A 3WISA 4ZHQF 4QRIA 1R5OA 4RIFA 3R9WA 4NBSA 2DKOA 4L4XA 3MBIA 5AJXA 1XNJA 1G3RA 2DPGA 5ANRB 3WBBA 1SIBE 4TLLB 4EPYA 3CTPA 3V2GA 3TG2A 2ST1A 3KXIA 1MNQA 1Y7IA 1ZCFA 1FX0A 4QT0A 3ZJVA 3WOHA 3GIDA 4HOYA 4E2ZA 3A1TA 2QX8A 3LKVA 5KC9A 3AJ9A 2AOTA 4FFVA 3TRKA 2RE8A 3BEDA 1MT3A 1NR7A 2HLHA 1RCFA 1W85B 3FFXA 1NASA 4I5GA 4I50B 3QRWA 1V5GA 4KIWA 3MRTA 5ALWA 3COWA 5KJEA 1WDLA 2EJBA 4A82A 4F4FA 4J9VA 4WXMA 3OQOA 3C7KA 4RE5A 5DNEA 1TCBA 4G5FA 1Y37A 1SEPA 2EX0A 1NBIA 1WP9A 3PZBA 4RK1A 3V4LA 5KS2A 3EJ6A 3D5TA 2HF8A 1PFVA 1TU0A 3M6IA 3V4FA 1GNRA 3KXLA 1X80B 1T2FA 2D3TA 5J2UB 1DJOA 2GPAA 4ZAVA 2W6ZA 4KH0A 4AJOA 3RYTC 5LLTA 4NVRA 1TVEA 4G0MA 1CRPA 3MWJA 5K3FA 2DFVA 4O4JB 3WNDA 1WR8A 1YCFA 1Z7YA 5T6MA 3RRNA 1GVNB 5JNVA 3GBSA 3GUZA 1AMOA 3COPA 4Z3OA 1K3UB 4AN4A 2MSCB 3OZDA 4PRZA 1JDPA 4EUKA 1TZBA 1XD2B 1Z12A 2XKAA 3TCKA 3TTWA 4D46A 4LJRA 1G3QA 1OX6A 2CJFA 2RGBA 3IR5A 4IICA 2MSWA 2WHPB 5EEHA 3KEFA 2AB0A 1O87A 5CA1A 1DO8A 1V1MA 3C4VA 5LP1A 1B0AA 1CCWA 4CMEC 2JGEA 1IG0A 3RU3A 5JPCA 4PNHA 3GGJA 4BN5A 4ZEVA 1DADA 1HDCA 5IG2A 3VZBA 1JXAA 3SKVA 4F0JA 4WFQA 4M8NE 4EYOA 3BCSA 1RR6A 2WP0A 3B70A 4ZOLB 4A15A 2AI2A 3HRHA 4EABA 3FCCA 1QIEA 1H1LA 9LDTA 5LNK6 1N36B 3A0UA 1WSBA 4OHXA 2RBEA 4MYCA 1H2WA 3P4YA 4D4JA 1ZD4A 3TRDA 5CX4A 2G1JA 1ATZA 4D1YA 1Z13A 2VZ0A 3M9XA 5LNK1 4OXYA 4PM4A 4Q1CA 3C7AA 1U5BA 2I4LA 2P2NA 3KEMA 3OZAA 5CB4F 2CLCX 2PZGA 1C30A 2WZBA 1MW8X 1MG5A 1I3LA 2HMAA 5EWJB 2AK3A 4U8HA 5F1YA 1JL3A 5B58C 3JCZA 1K0FA 3HWX1 4OK3A 1RZRD 3GFFA 1IK4A 3VDQA 4YJ3B 2BHSA 2IXFA 2BMAA 3HU2A 3DEIA 1K7EB 1I5EA 4CLOB 4BFZA 4DG5A 3OO0A 2JGDB 4XUEA 3FWPA 3DMDA 5BW8A 5FWNA 1Y3HA 5B6PA 4ND1A 2BAGA 2ANCA 4FX5A 3C6MA 1TCAA 4YUAA 4DUGD 2WTNA 2WE7A 5JASA 1SHJA 4OUDB 4HB4A 1U3FA 3W5HA 2X7XA 3IEIA 4CM5A 3PHJA 2CZQA 1XLTC 2Y6UA 1KDRA 1D6JA 5AJUA 1G18A 2VBFA 1CRWG 2JIRA 4YCMA 5DYNA 4QLOA 1RXVA 4V1CI 1FUUA 5DWVA 3DXXA 4ZOBA 5U4XA 1R50A 4B45A 2OHJA 3LCVB 4HK4A 5SYMA 2C7GA 3RU2A 4NYMR 5CAEB 2J48A 2CVHA 5CVEA 3T4EA 2XZLA 4PG6A 1U8EA 2V5UA 3D4OA 3L2OB 2UZ1A 1W47A 2ZWOA 1RFLA 2NO9A 4HY3A 4Z0NA 1MJGA 4AJ9A 2IH5A 3GJSA 2PWAA 3L7NA 1ECCA 4O4LF 5FRDA 1SXGA 4Z9YA 3QHAA 2ZI4A 3W9YA 3WWOA 1OV6A 4X9XA 2O3QA 4U9HS 1JPNA 3ESXA 1YO6A 5CDFA 3AB7A 1IHDA 2ATXA 5IEJA 1U6IA 7AT1A 2Z58A 3WXBA 1CUYA 1Z8HA 3ESCA 3PUXA 4NESA 5EXEA 4MCAA 2FPLA 4ON9A 4AN0A 1VI5A 2W6JA 3GLIA 4W1SA 2FLKA 2ILTA 4Y9DA 1ZK1A 1E9FA 1S2DA 2N1BA 1FP7A 2PD3A 4G0UA 4P86A 4FEYA 1KJIA 3R0XA 2R84A 2AMVA 1TMOA 3NLLA 3AP3A 1ZH6A 3T7SA 2CD7A 2EKPA 1KP2A 4LHWA 1MQAA 2P90A 4MYRA 3DEHA 1UOEA 2VYVD 3EASA 3GFOA 3J80A 5E0KB 1UKEA 1KJWA 2B61A 3JATA 5DMHA 1Z5GA 1OI7A 3I01A 3UOAB 4DV1B 1MABB 4H08A 4LY9A 1WMDA 1NV9A 3HUDA 2MSNA 4OBXA 4EPWA 5BSKA 1OILA 5DT2A 3EOBI 3KFXA 3HBNA 3LBHA 4PYNA 3WDSA 3PFKA 4D41A 1NBWB 4IIUA 1MC8A 3FMGA 3QZUA 1X7ZA 4HNGA 1H65A 1RI4A 1XDSA 2Q3JA 4JYMA 4DDVA 2R1TA 2RI6A 5KNBH 4YY3B 2Y2UA 2IPOA 1ORHA 1W88A 4GYWA 1RYFA 4R05A 1WD7A 1H8ED 2D59A 2IF0A 1V3TA 1BMFA 2PZFA 2I78A 1OZAA 1OCEA 1X1SA 2P79A 2XRMA 2QY6A 3QXHA 3CT4A 2DXIA 3FHOA 1Z5VA 2YFKA 3USZA 1CEYA 3VDRA 1QJ4A 3RFVA 2ON6A 4BIIA 4AICA 4XQ0A 5DM0A 2BEVB 2P6UA 5B1IA 3QKSB 1MOZA 4AZ3A 5GJWC 1XELA 1QGOA 3N2GB 2XUGA 1RTTA 4DVGA 2C7OA 3JWHA 2Q9CA 2OV2A 3UM9A 3A9WA 2EGGA 4HHEA 1MNAA 4LJ9A 1Q7EA 1KQPA 3E0XA 1GNQA 2J09A 4FGZA 5FPQA 3SM9A 5DXJA 1TIPA 5FI3A 3OJCA 1YRYE 4FCTA 1HORA 1WVIA 5H80A 3AIOA 5CYGA 1UADA 3D8HA 5BMVA 2YKGA 3NTVA 4PN7A 1Z0ZA 1N1MA 5IVIA 4C7OB 5JJ5A 4O8CA 3HO6A 3JVUA 1F5NA 1E7SA 2QT0A 2ZETA 2H18A 4FEGA 3WLKX 1DRUA 4PF1A 6GPBA