4XH9B

Crystal structure of human rhoa in complex with dh/ph fragment of the guanine nucleotide exchange factor net1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
174
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVNSPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuroepithelial cell-transforming gene 1 protein
publication title A structural study of the complex between neuroepithelial cell transforming gene 1 (Net1) and RhoA reveals a potential anticancer drug hot spot.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 174
sequence length 178
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xh9B00
4MUBA 2QMEA 4M9QA 4HB3A 3R7WA 1N6NA 3VR1A 1M6NA 1UKZA 4HAWA 5FPYA 1TQDA 2ZSEA 1KI6B 2ZI3A 4OHZA 1ZNYA 1LF0A 3H2YA 1KDPA 2OILA 4PANA 4GI7A 3CR8A 4M1KA 2Z83A 4NHOA 1U2RA 2BHRA 2W2XA 3A4MA 3LXRA 3CUEF 2NO7A 5EZ5A 3AVTA 2ZRBA 5H70A 1HH4A 3BH7A 4MITA 4XWAA 5HKKD 1PV4A 2DWOA 5FL7A 3FWYA 2XZPA 1U9IA 2C99A 4JLPA 3U3MA 2J46A 1AKEA 3UANA 3U7EB 3BBPA 1AQYA 3ADBA 4L9SA 4HYYA 221PA 1MOZA 1Q20A 5TV2A 1IN6A 4DSUA 5CB6A 1XNJA 1MO6A 3A4LA 2WJJA 4OL0A 3SN6A 4PPFA 3CB4A 2ZRAA 2G3YA 3MJHA 1VECA 1O3YA 3GFOA 1ZCBA 3GEEA 3NXSA 1S2MA 4ZCLA 1WDTA 1P6XA 1UKVY 2AKYA 2PT7A 4Q9JA 2DYKA 1XEFA 3V9PA 1QHYA 1R5OA 1NLYA 2OHFA 3T15A 1KO4A 1X8LA 1AS3A 2ZRFA 3MG9A 1VCOA 3KUDA 1FNNA 3EWSA 2QPOA 3D6TB 2OEPA 4LJAA 3BFXA 4AC9A 1XMSA 2ZYVX 1CJVC 4ACAA 1W5TA 1ZNXA 4GOJA 2BM0A 2CK3A 4Q7JB 1M34E 2YOHA 2Z43A 4HAUA 5TDHA 4LJ4A 1YZKA 1MRSA 3I3SR 4A8JA 3SJZA 4L5BA 2A2ZA 3TSZA 2QSZA 1YJ5A 1ZINA 2VF7A 4Q00A 2V7QA 4MRPA 3OEHA 3UXMA 1VG0B 3VR6A 5FH9A 3ZD7A 2GEDA 3KQKA 1XD2A 3EAQA 1NL3A 2ZYUX 2AK3A 4H1VA 1CJMA 4GMXA 1UDXA 5DISB 2ZYWX 3QG5A 1FQKA 3EARA 4D6PA 1M8PA 1W4RA 1Z0JA 2IF0A 3FOZA 3P27A 2J5XA 1ZD9A 3E5HA 3ZD6A 1HT1E 2G1KA 3QBTA 3FMFA 3KXLA 1FTSA 3FKSA 5SZJA 2ZI5A 2WPDA 3ZZUA 1AM4D 3CPJB 3ONWA 4OHYA 1E1QD 2VRWA 4URYR 5DI3B 4UXJA 4BLPA 1CU1A 2F7SA 1KJYA 1DOAA 2GXQA 3T35A 4O2RA 1UEIA 2NG1A 3V4FA 1TMKA 3LQRA 3EZ2A 3OIUA 2BV3A 2JJ1D 2WBLC 1J90A 1H8ED 2GCOB 2P3SA 4R9UC 2ODWA 5KSOA 1E9BA 3U4QA 5JJKA 1NN5A 4DLTA 4YMSA 2JLZA 2OG2A 2XSZA 3I5XA 4DSTA 4NCHA 2JA1A 3W3ZB 2VP4A 1OW3B 2XJ9A 5HE8A 2C77A 2BBOA 1E2JA 1HYQA 3DMNA 5AWFC 4BQSA 1NMZA 5E7MA 1G8PA 2D62A 3AEZA 1K5DA 1L4UA 2ONKA 3IIKA 3T12A 4NH0A 3LNCA 3BIFA 2F55A 1GKYA 3K0AA 2ZRDA 1I4DD 3AP2A 4LK2A 4TQ9A 2FFAA 2YWGA 3QPUA 4CEHB 2ZI6A 4QGFA 3GJ5A 3SYLA 1TNDA 3TR0A 3W6NA 4KBFA 1R8QA 5D3QA 4M9SA 2WWWA 2WAYA 4WA7A 1NJGA 4XH9B 2GF0A 3Q3JB 4IDPA 1KO8A 4UJ3A 3W6PA 1U90A 2V54A 2G88A 3O8DA 2NZ8A 3C7KA 1E94E 1Z8FA 2IXEA 1SXJA 2GCNA 1KSGA 5BW8A 2F43B 1CRQA 3VR3A 4D0GA 3BXZA 1GILA 3GEHA 2RGDA 2ZTSA 2XGJA 3A1UA 2ODBA 4FXPA 4CZ2A 1KAGA 4X8MA 1Z83A 3GLIE 3AH8A 1II8B 2PMKA 4DCUA 3CO5A 5B30A 4I1VA 2GWHA 1KSJA 4LYHA 5E3HA 2NQ2C 4ZO4A 3A1SA 3BE4A 1GVNB 3A36A 3SQWA 1UBGA 4MGKR 2XTNA 1FMJA 4LI0A 1S9HA 2AXNA 3TKLA 2RHMA 4DLWA 1XJQA 5DE3A 5J4KA 2IYXA 4OQMA 4BZXA 5CIWA 4C2TA 2R65A 1QBKC 1E2LA 2GBLC 2ZSDA 1P2SA 3CWQA 1A1VA 3BS4A 4OHVA 4OHXA 2I4IA 5JRJA 4WBSA 3B1YA 4YLGA 1COWA 2MMCA 2IHYA 1QVRA 4IEIA 4QNMA 2O8DB 1L4YA 4B6EA 5KPDA 2ZRGA 1F2TB 1Z6TA 3IQWA 3THXB 1Z0IA 4N0EA 2BMFA 3AKCA 4ZPXA 5BYJA 2F9LA 4P3YA 4Z51A 1W5SA 3PEWA 3CF6R 2YWHA 2WWXA 3TK1A 4JLMA 4OK5A 1NVWQ 1KY3A 5DHFA 1YRBA 2R8RA 2PMDA 2VEDA 3AVWA 4KLZA 4IFBA 2HF8A 2WJGA 3X1ZA 1KJZA 1JEDA 4IFEA 2ZR7A 4D25A 2FSGA 3OIVA 2JATA 3FKSD 5G53C 3PIRA 2GILA 5F9HA 2A5DA 3PUXA 2FGJA 4IJMA 5FOWA 3B5JA 3C16C 2BCJQ 1G1MA 2HDNB 4ZCIA 3AVXA 2UVQA 2EWVA 5EP4A 5EXTA 1R0WA 1AS0A 4Q7LA 3NG1A 3QG1A 3WRYC 4RJLA 4BFZA 4TQAA 3KL4A 4I81A 1LW7A 2IEZA 4IDHA 2BBSA 3I61A 2JGNA 3K0EA 4TN1A 2HLDA 1W46A 1XX6A 3AF3A 1XF9A 2QMHA 5C2JB 3FMIA 2GXUA 3H84A 1XXHE 4B71A 4BRWA 2ZM5A 4RD3A 4UXIA 1RRCA 1N6RA 3WYAA 5DSZA 1W7AA 4D4LA 1ONBA 1IOZA 3GLHE 3L8YA 1UPTA 4LJ9A 3L0OA 1US8A 4FCTA 4NYMR 3GLGE 3EZ7A 1MR3F 3ZVNA 4B2LA 2RKOA 3WNCA 3QY0A 2H5EA 2JDID 3UK6A 5HE9A 3HU1A 3R9WA 2HYDA 3T34A 1ZNWA 4QBFA 1G17A 4IOMA 4EPRA 3SHWA 4A6PA 3L82B 4C0QC 4BE7B 2BOVA 4F92B 1JXOA 2FZ4A 3OESA 3PCRB 3ZQJA 1A2KC 4LV6A 4DCVA 4OQNA 2GTPA 1GUAA 2OUKA 4D0NA 5L3SA 3CZQA 5FR2A 2ZI9A 1DG1G 4QJ3A 1GP2A 4Q4HA 3QVVA 4V02A 4X8HA 2WMOB 2NGRA 1T5LA 3REFA 4TTQA 4TL9A 4V0ME 2J59A 4DLUA 2IA5A 1II9A 2QENA 1R10A 1S3GA 4HAVA 1I4LD 2IS6A 2JJ2A 3RWOA 1XTKA 5FI1B 2XNDD 2GJ8A 5SZKB 1YHNA 3UMSA 1KHTA 3ZIAA 4LCBA 4C9BA 3KFVA 1GNQA 4O0MA 1YE8A 4WZAE 5G41A 3J81k 5BN5A 1AA9A 1BOFA 3U5ZB 2A78A 3CX6A 5KSZA 4A0GA 1G21E 1VYTA 2EVWX 3NKVA 4OI1A 2XEXA 3PEUA 1G3UA 4JYCA 1XPOA 1E3MA 2AFHE 3EZFA 1DO0A 1JR3D 5BN3A 3T5GA 4JVNA 1S1CA 1CIPA 2PEZA 2ODEA 2VF8A 3EA0A 4DB4A 4KFRA 2V4ZA 4Q5IA 3ZDQA 1KYIA 2IXFA 3GJ6A 4F4CA 3EIEA 4GSYA 1OIWA 1PUJA 4LDJA 2OFOA 4A2WA 1XD8A 4GL2A 2C2HA 2W0SA 3MAAC 3N2IA 3SS8A 1IN4A 4IOKA 3FGNA 4TYWA 5JWOA 3C15C 4L9WA 4PHGA 1ESMA 4DIEA 5HPYB 2FDCA 1NIPA 1WBDA 2REXB 4EQ6A 1NF3A 2CVHA 4LYAA 2RGXA 4PPQA 1KNXA 1WXQA 2F1JA 2J1LA 4QL3A 1P62B 1T4GA 4P0TA 2XOKD 2HXYA 1QHIA 2WJHA 3T1OA 2PEYA 4B3BA 1KDRA 1CTQA 2V1XA 2B8TA 4ZCMA 3GCGA 4PAQA 1RVDA 4IVPA 2D4HA 4PC7A 4CDGA 2PL3A 1WMSA 2QL6A 2C8VA 2CE7A 2QM7A 3CKLA 3EC1A 3H86A 4AURA 4AI6A 2IUSA 4A8JB 4TMVA 4UJ5A 4C30A 1UADA 2B92A 2IYLD 2OBMA 3QKRA 4PHHA 1W0KA 4QNRA 2QSYA 4TMKA 4A0HA 4URVR 1ZYUA 2EFHB 2VPPA 5FOSA 2GK6A 1U99A 2VSXA 3RSOA 2V9PA 1CR2A 1BMFA 2O8EA 4TMTA 2Q9BA 2HUPA 5B57C 4WVFA 3K0CA 5DO9A 4U02A 1QVAA 1ZM3A 3N2EA 1ZUNB 2Q3HA 5TB5A 2G6BA 2G83A 5DYGA 1XCGB 3JVVA 5J4YA 1E0AA 4HAZA 2QG6A 1HE1C 1DVRA 1M1YE 2H1LA 2ZEJA 1QHNA 1FOEB 4DHEA 2P65A 3W8RA 3K09A 2GZHA 2QTHA 1QHXA 4JKIA 3BFVA 1HUQA 2HT1A 4ZKDA 5B64A 1TQ4A 4B75A 3B85A 4KODA 2VP6A 4LPSA 1EX6A 1U8AA 3TUZC 2PZEA 5LBIA 1E79D 3VR4A 2QNRA 2WHXA 4GDFA 3TH5A 1N5LA 3LQQA 4PFSA 4PZLA 4CEHA 5FTNA 5JI2E 2IC5A 3U4QB 1D6JA 4C0SA 3QF4A 3H1TA 4TZ6A 1YZGA 2VP2A 2ZIAA 3D8BA 1VHLA 3VNUA 2PCJA 2AD5A 3QJYA 4KV9A 4US0R 1N0UA 3OEEA 4C3ZA 2C98A 1RKBA 1KMQA 4TL6A 3UG6A 1GM5A 3K0AB 3LV8A 2C9CA 1XP8A 4DLSA 3KQUA 2WM9B 2IS2A 2UKDA 1RYFA 3BD9A 3FMPB 4CVNA 4EFMA 3LBNA 3L0PA 1KKLA 4QJ4A 1X6VA 1NY6A 4K46A 1ZD1A 1CF4A 1J7KA 2QU8A 2KJQA 2ZRNA 4Y0VA 1SXJB 4EJSC 4Q9LA 3LH5A 2PLFA 4BFVA 3A8TA 4G5GA 4PSAA 5FI0B 4ERNA 4Q9KA 3NHAA 4ARZA 3GLFB 3I73A 4D0LB 5IK2A 4GBMA 4TL8A 4JT2A 2YYZA 3RRYA 1N2CE 4YQFA 1OH5A 1NI3A 4L15A 1VIYA 1Z47A 1E2MA 2QZ4A 2ONJA 2ZRIA 3CX7A 5AR1A 1DEKA 3K70C 4QHYA 4BWYA 1E9SA 1OH6A 2FSIA 3TSOA 5JJIA 1QG2A 4YC7A 4F4JA 3CNNA 2NO6A 3LLMA 1RZ3A 1KMHA 5F3WB 3CH4B 2P6NA 3U6KA 2ZSBA 2PH1A 3PUYA 1AGRA 4M1MA 3EPHA 4JLDA 2BIFA 2VP9A 3RLFA 1N6PA 4Z1MD 4P33A 4BGDA 4IOJA 3GLIA 4JIMA 3MSXA 3SQXA 4ESVA 4FMCF 2PT5A 3DO6A 3SZRA 3DDCA 5FBLB 4AKGA 2YV5A 2ZJ2A 3B13B 2FH5B 3CRVA 1JB1A 1XFAA 2D2FA 2NZJA 4TYPA 4BLRA 5J4HA 3QENA 4D81A 4RD4A 3UMFA 1IXZA 3U44A 4BRUA 5AJVB 2HJGA 4JJKA 1XJCA 3K9HA 5D3MA 4Z8YA 1M7HA 4D4KA 5DNYB 3SJCA 5EE3A 5KTYA 1YRAA 1G6HA 3VKGA 4UXHA 4LBWA 1XZPA 4KU4A 1WB9A 1NVUQ 5FOXA 1AKYA 4IXMA 3DZ8A 2X1VA 2NIPA 2P5TB 2H18A 1NVVR 2REBA 4DUGA 4DEXA 2HCBA 3B1XA 4RCZA 2ZITA 4Q1CA 3LRPA 3TJZA 2WWFA 3KXIA 4FWIB 3VHXA 4JLVA 1K5GA 5GVSA 3N70A 5FUVA 2P67A 4MRSA 3T06B 1IN5A 1BH2A 1YQTA 2LWIA 3DMDA 1Z0AA 1JECA 2ZREA 4CF7A 3HJNA 2D2EA 2FEOA 1GTVA 3U3RA 4HATA 4B44A 2WSSD 2BMJA 1VYVA 4IDNA 4IKEA 5JSZA 5J5CA 2AXPA 3V00A 4F4IA 2HEIA 3OEED 1E2GA 3PITA 4QBHA 2IF2A 1OPXA 3DHWC 5EP2A 5B2ZA 1E0SA 2OESA 1U81A 2PX3A 3ZVRA 4D4MA 4NYMQ 5FTMA 2EFGA 3NBFA 3X1YA 3WP1B 3O8BA 4I1OA 3B60A 1E2QA 3HYTA 4HLCA 3ZQ6A 4BFYA 4DZZA 2ORWA 2ORVA 4M1WA 2WMNB 1Q12A 5KDDA 2ZE6A 4I4LA 3QQ5A 5F2EA 1S0UA 4IOLA 3LAWA 3KZ1E 5FOVA 2WWHA 3K9GA 1JI0A 4LJ5A 5L3RA 1T8UA 3LO5A 1NBMD 1T5IA 4ZDJA 4JLJA 4M21A 5BYKA 3RDPA 1DS6A 4BUJA 2O0KA 4HUTA 1HEIA 2IUUA 3GJXC 1UBEA 1XXHA 2XTMA 1ZM2A 3PR1A 5L3SB 2LCFA 1TU3A 4U00A 2NOAA 4Q4HB 1A2BA 2QTVB 4AD8A 1E2PA 1RE0A 1P2VA 2N42A 3GLHA 1E9CA 4U7DA 5EXXA 3GJ0A 4TLDA 2XTZA 1CRPA 1AQUA 2GDJA 3DEFA 3MLEA 2NO1A 2QQEA 3CONA 4WOPA 2FPMA 3CRQA 1E2IA 3O8CA 1XDBA 1ZM9A 1TUEA 2QT1A 4M53A 3HU2A 5C4GB 2AL7A 2G0TA 4LC1A 2IEYA 1SKYB 2JLSA 3LX8A 2A5GA 1EFRA 4FCVA 1RRPA 1Z6XA 1U98A 4NZYA 1XPUA 5KYKA 4DRZA 3KUCA 3TGPA 2FMXA 2ZAMA 1GOTA 4Q1EA 4QHTA 4U5XA 1EWRA 3QEJA 2QAGB 4W9MC 3KKMA 4XOIA 2GESA 2DFLA 2ZETA 3CBQA 4V0MA 1OHHD 1VG8A 1G7CA 3T1QA 4DDTA 1VYUA 1RJ9B 4M1TA 3OHMA 1IN8A 1YZQA 2AFIE 2QMUA 1NN1A 5F98A 4M1SA 1T3SA 3X2SA 5ANRB 3B7GA 1NG1A 1CR0A 2XNSA 1VDZA 3CW2A 3MCAA 3OIYA 1S8FA 4XVRA 3A4NA 4NL4H 1Z29A 1LNZA 5EE5B 2GA8A 1I2MA 2BWJA 2QI9C 4MRVA 1IQPA 3D31A 3JZAA 3QI2A 3ZYCA 5CYOA 2OFXA 3SE0A 1KI8A 4LZZA 4BFTA 3MD0A 4RY2A 2OCYC 4CEIA 4LHZA 4OYHA 3ZS8A 4XSHA 4AY2A 2GJAA 4EQ6B 1ZMXA 3AF4A 2QROA 4M9ZA 5CLLA 5C1BA 4JT4A 4NCIA 1YR8A 3KKQA 1U9IC 4TLBA 4ZIRA 1TEVA 5K8UA 1T3HA 1UKYA 3VR2A 2WVJA 2C9OA 5JLJA 4PTLA 1OT3A 2YWEA 1X8JA 1A82A 1HQYE 3QKSA 3QF7A 2ZJYA 2CXXA 4I1SA 1G16A 4JBWA 5GJBA 5G40A 3EC2A 4M9XA 3ND9A 3QEOA 2XJ4A 4PHTA 3TAHA 2JLYA 5B58C 3WHLA 3LXXA 1XCMA 3QKRB 1KNQA 4MRRA 2ERYA 2FFBA 1G6OA 5CDFA 5KUTA 3CRMA 4HB0A 4CEJB 2FEMA 2J0UB 1FPMA 2O8EB 1C1YA 1DBSA 1ZD8A 5TXGA 1N5KA 4IDOA 4G5RA 4Q18A 3D7MA 1UF9A 3TMKA 1EXMA 1B23P 2IS4A 3B6EA 1PUIA 1XBTA 1E98A 3F3YA 3MJRA 2V6IA 2V8OA 2Z4SA 4JZKA 4W5WA 1DELA 2B6HA 2ZE5A 3Q7PA 5FPTA 3WNDA 4QKQA 2DCUA 1R0XA 1IY0A 3AVQA 2GVDC 2R6DA 1CEEA 1KDTA 3KXKA 1N6HA 1CS4C 1ETUA 1G3MA 3IKJA 2VSFA 1Z22A 2FSHA 3I62A 1P9WA 4MQBA 3THWA 3AVUA 3LDAA 4Q02A 3EPJA 2J45A 2ZRLA 4QRHA 3SR0A 5HR5A 2QBYA 5JJLA 4B34A 5E4FA 3BK7A 3RS7A 1NKSA 2N1BA 1XCPA 4RKFA 2AK2A 5DN6A 1OB2A 3I8XA 4JLAA 4BLTA 4PXAA 3QF4B 2DFKB 3AVVA 1EESA 2Q9CA 1M7BA 1W47A 1IJFA 2JIZA 1D2MA 4JBXA 2GXAA 2ZJ5A 4PC2A 2E9SA 1M7GA 3IGFA 4C0BA 2A5JA 4DXAA 3CLVA 5FL7D 2YZ2A 1KY2A 3KDSE 2GRJA 2ZRMA 4WZ6A 3PEYA 2SHKA 2OLKA 3FDIA 4LJ6A 3R8CA 1MABA 2IW3A 3HR8A 2GBLA 3I1FA 4RCYA 1NNEA 1LF5A 3ADDA 2QN6A 1P60A 3GLFA 2F1RA 4DWJA 1SVOA 5DIFA 5K8TA 3OIWA 1HA3A 4Q47A 1KO5A 2RHDA 5H8WA 4ZDWA 3VFDA 1AN0A 1M74A 1A4RA 3SU8A 3FVQA 4XD7A 1KTVA 3CZPA 1LFDB 4JL6A 3QXJA 2WWYA 2XXAA 1W4AA 1R0YA 4KJZA 4LHWA 3Q9LA 2ZYTX 2CNWA 3RSLA 3BH6A 2ZRCA 3F8TA 4HZUA 5CJ2A 4MH0R 1RPZA 4PQFA 1XTRA 4M1OA 4RZXA 2C78A 2Q9AA 2ZVQX 5JEEA 2FWRA 1G41A 1W2HA 2VO1A 4OK3A 4OK6A 4DLXA 1G3IA 4B48A 4ARZB 1H8HA 4Z8XA 1HV8A 2H92A 4A36A 4XTCS 5A5GA 2CK3D 1QHGA 3IIJA 4BZPA 1OLOA 2ERXA 4TQUS 1QF9A 4LHYA 5GJWC 5KDOA 4RVCA 5AJWA 2V7QD 2DFNA 3OEHD 4IVRA 1SXJC 4BFWA 4B6FA 1XMIA 4E09A 3KFXA 2F1IA 4PAMA 3FMOB 3NC1C 1KMHB 1DO2A 2IWRA 3IPYA 3HPRA 4LV5B 2G0NA 2JLUA 3I72A 5DYIA 2IYRA 3SBDA 4CIDA 1G5RA 4KO8A 1UKEA 4URWR 1Z6AA 4ILEA 4Q01A 2HV8A 1Z28A 3NDBB 2WPDD 2WJVA 4FCWA 4ABYA 5L3QA 3GLIB 3LLUA 5E7IA 1R5NA 2VYFA 3EA5A 4M8NE 1AIPA 4GMDA 2GK7A 4NYIR 3LW7A 5EXPA 4AG6A 3C5CA 4A9AA 3VU9A 1G291 1NVXQ 1QRAA 2H8KA 3GJ7A 3KKPA 1JNYA 2NO9A 2BM1A 4S35A 3KTAA 3HDTA 3U44B 2YC2C 3OE7A 2OAQ1 2GAOA 1DARA 4RD1A 1AGPA 1IXSB 5D3MB 1BYUA 1X1SA 5JFGA 1OV4A 1FX0A 5FPSA 4JKYA 2XSZD 2ZS7A 4YMWA 1PLKA 4KSBA 4QGGA 5JEDA 2EYQA 3M4YA 4BLSA 1GAJA 1XJ0A 4P31A 2DFTA 1R2QA 4BECA 2JCSA 4GFDA 3KQNA 3M6AA 1KO1A 3AUXA 3IBYA 5KPJA 2W2TA 1SULA 3SBEA 1KZ7B 5HTKA 4ZI3A 4LRWA 4F91B 3SYNA 1OFIA 1NSFA 3OAAA 4QGHA 3WMFA 2DY1A 5DLQC 1E2DA 2IYVA 3CNOA 3IO5A 1ANKA 1F48A 1G64A 2JLQA 5JSZB 5CJPA 4CT5A 1E2NA 1K8RA 2FOLA 2C03A 3NHBA 4B35A 2O8CA 1C9KA 4EPWA 3RAPR 1VCNA 1F5NA 2ZRJA 4KHZA 3ND8A 3R9IA 1A5TA 2OLJA 1EK0A 1SXJD 4B76A 1CJUC 1EWQA 2MMGA 4Q19A 1GZSA 4Q4LA 5GJCA 1P72A 3GFPA 3LFUA 3W6OA 1ZM4A 2IYUA 1VPLA 3NEJA 3T61A 3WP0A 2FU5C 1ZU4A 4N3NA 2B21A 1EFUA 2W00A 3GQBA 3UMRA 1GL6A 2TMKA 4JJZA 3DOFA 2FSFA 4TSFA 1UM8A 4JVSB 1IONA 3GD7A 4XD7D 3C41J 2JLXA 2O8BA 4C2UA 4ZI2A 3FFAA 2PZFA 1XXHB 2IYSA 2QP9X 4A0FA 4QXAA 5EE0A 1DTSA 1V5WA 4ESHA 3GLHB 4V0OA 1Z3IX 3F0TA 1GDDA 1ZRHA 1H65A 2CL0X 2CL6X 3C4JA 3PUWA 3UWOA 2QAGA 4PC3A 3KJIA 2ZROA 4E07A 2J0SA 2OAP1 1ZJ6A 2J3EA 2X2EA 1QG4A 2YC4C 4D82A 5CLQA 1COWD 4MGIR 3MWKA 4YXWA 3MWLA 1RJ9A 2EFDB 1NP6A 4I1UA 4FMCB 5JBQA 4OI0A 4AYTA 1TEXA 5LB4A 1ODFA 3ZGXA 1G19A 4BFXA 3I5YA 4N0DA 2YINC 5JCZA 2Z0MA 1F6BA 1PZNA 1FW6A 1ZM7A 1EG7A 2IK8A 1XB2A 3DM9B 2HCJB 521PA 1KI3A 1W0JA 3OZXA 5JWRA 1Q0UA 5G3ZA 2YHSA 5H68A 3LX5A 3VAAA 1N5JA 3TVTA 3RANA 3IUYA 3QVUA 4D2IA 4Q9HA 6Q21A 5TVKA 3ADCA 2CCJA 3R9XA 4LJ8A 3CH5A 1KI1A 2RGCA 5FL3A 4ZDKA 4KFTA 2QQ0A 1Q1QA 1U0HC 3I92A 4JMPA 3IILA 2ZR9A 1NSTA 2KI5A 2RH5A 2J9RA 1Q44A 3THYA 1YKSA 4ASUD 1G4UR 4LSGA 4JVLA 4R7ZA 3I8SA 4OI4A 2HLDD 1DADA 1C4OA 4NONA 3WYFA 2C96A 3X1XA 4Q7KA 4L8GA 4CEIB 3AUYA 3GPLA 1ZC4A 2ZUCA 4Q9IA 4ON9A 1GIAA 1L8QA 1XWIA 1W36D 3L8ZA 4PSKA 2J7PA 4DCTA 1JXMA 1E9FA 2JLRA 4AKEA 4G0NA 4YONB 121PA 1E32A 3ASZA 4NTZA 3K9NA 2AHOA 4ZKEA 4CEJA 2Z5FA 2A5FA 3CIOA 2J0UA 2V55B 1ZIPA 2X77A 4KYUA 1YR9A 4ZIRB 2IX3A 1L7VC 4Q21A 4URUR 4RZ3A 5AUNB 1T6NA 3K0FA 3KB1A 1PVOA 3H0KA 3DL0A 2R6AA 1KO7A 3QKSB 4UNRA 4RSGA 3IO3A 5KNBA 1NN0A 3GFTA 2QGZA 2ZSFA 1N6OA 5DH9A 5H1YA 3BOSA 4BEJA 4Z54A 1J2JA 1R0ZA 1YR7A 2KB0A 1E9EA 4YDHB 4CYMA 2MSDB 2JJ8A 5FTJA 3GJ4A 3EPKA 3MUFA 5CB8A 3PG5A 1OJLA 1RFLA 2ZI4A 4LOAA 4NDZA 2J0VA 4POAA 4JLNA 3BB3A 5IRCD 1B0UA 4TMXA 3ADKA 1IJEA 1P73A 3K8YA 3U3OA 1DPFA 4C7OA 4EUNA 2QRZA 2GF9A 4LV8B 2JJ2D 5EE9A 3W34A 5ELXA 2FFQA 4BFUA 4NBSA 4R2IA 4ZDIA 1ZBDA 4OKSA 3RS3A 2IL1A 821PA 2GZDA 4DT1A 3UG7A 3ZIAD 4AKIA 4PSVA 3SOPA 5FBRB 2B8WA 4KSCA 1RIFA 4EAQA 2RAPA 1T3LA 4EJSA 4M0LA 1ZNZA 4G5SA 3PVSA 3QE0A 4PZZA 1GNRA 2CBZA 1DAHA 3L0IB 4FIDA 4OJKA 5AK0A 4GT1A 4MUAA 3THWB 1FMLA 2ANBA 5P21A 4FMDB 2QBYB 2AN9A 2ZR0A 1OH8A 5A0FA 1Z08A 4EPXA 3PJRA 2WOOA 1NMYA 4GOXA 3KQLA 1QDEA 2GETA 2IXGA 2ZANA 4LHXA 1E2EA 1MO3A 4OJQA 2G77B 2AWNA 4DB2A 1GG2A 4QM7A 3G5UA 2W6JA 4EFNA 3WY9A 1GRQA 4TT3A 1G8GA 3IHLA 4M2LA 3Q7QA 3K09C 4IHQA 3CX8A 3LBIA 2ZE7A 5TMPA 2ZJAA 1WQ1R 3ZZTA 1P2TA 5KSYA 3TAUA 1W2GA 3F5FA 1DAMA 1MRNA 2QE7A 5AJZA 3PEVA 4Q1DA 1LS6A 1J8YF 3BB4A 5GJVC 3U7HB 1MABB 5AUPB 3OFNA 4RKEA 1AK2A 1X1RA 2OBNA 2UZ3A 3RC3A 1JR3E 1Z0KA 2R6CA 4X8OA 1OB5A 1P75A 2FZLA 2XZOA 3W5JA 2N46A 4P4SA 4LX0A 2KBFA 3HYRA 1O87A 1U0JA 5KDLA 4PO8A 4DDUA 4PO9A 5BN4A 5JZVA 1D9XA 3EZ6A 4A15A 1YVDA 1QZXA 2DWQA 4PAOA 4TLEA 5KSPA 4AYXA 4II7A 4EPYA 2XXAB 4F93B 1GKUB 1UJ2A 3AGPA 4G5QA 4QGAA 1VG9B 4HZUB 2EU8A 2GHIA 3B9QA 2LKDA 3RRMA 4HLUC 1XEWX 4Q1AA 2XAUA 1NKTA 1YZUA 3U61B 1UAAA 5J40A 2K5UA 2FGKA 1YZLA 3CF2A 3RVBA 4TLCA 2YOGA 2QAJA 4B32A 1DAEA 2FE4A 4JL8A 1WE2A 5DGXA 3SEAA 2IYWA 1OIXA 3U60B 4V03A 4LGMA 1OH7A 3TW4A 4TMWA 1W0KD 5JECA 1JBKA 4JLBA 3C5HA 5HKKA 4L16A 3U7FB 3VMFA 1IN7A 1Q21A 2PZGA 1OIVA 3MWYW 1IM2A 4O3MA 2YJTD 2QEQA 1OYYA 4BZQA 4D80A 1BMFD 1D2NA 1VHTA 4IXNA 3GP8A 2HJVA 4G5OA 1AJEA 1LY1A 1Z2AA 1T0JB 4MGYR 5JMTA 2QGNA 1MKYA 1L2TA 2RGBA 3LA6A 3TUJC 4A6XA 1XTQA 2VP0A 2XB4A 4Q4AA 2BEJA 4NYIQ 4XJXA 5AUQA 4QOSA 2AR7A 5L3QB 4NE2A 2RGNC 1LTQA 2CHGA 5DI9A 2D3WA 3VHLB 1OFTA 5GADl 4RD6A 4E5UA 2X19A 1N6KA 1P3JA 1JPNA 3VU9B 3DOEA 3KQHA 1P9RA 1UFQA 2Q0HA 2W83A 3AVPA 3KTAB 1N6LA 5HZHA 1Q57A 4KFUA 4YMUA 1FX0B 1GITA 4EPTA 3BWDD 3IIMA 4AWXA 1GSIA 5KNDA 2DBYA 2R6GA 2CL7X 3THOA 3CNLA 2XITA 2Y8EA 4F7WA 2OSBA 2QA5A 3BB1A 4NKRA 1OKKA 1GRNA 3UATA 1ZIOA 3B1WA 2E1RA 3NBZC 1A7JA 1RC8A 3AM1A 1W1WA 4NCNA 4W5HA 2ZSAA 4UQOA 4HZIA 2WZQA 4AKHA 2CVFA 4DC9A 1GWNA 1Z07A 1YR6A 4MGZR 2H57A 3RS0A 2VHCA 1WBBA 3LBHA 2QPAA 4S2EA 1Y3AA 4A0RA 2IHBA 1QHSA 2W6JD 2ZUBA 1TL7C 1R6BX 4M22A 4TWZA 1LVGA 2EWWA 1G5PA 2PLRA 1E1QA 1Q1BA 3KX2A 5FBWB 3TQCA 4TYNA 2O8CB 2PX0A 3IDQA 3KJGA 4IRUB 2ATVA 4D4JA 1X3SA 4RZ2A 1KIMA 2QE7D 2YWFA 1HY3A 2WV9A 4OQXA 1N0WA 3FHCB 4LBVA 1R5BA 5CM8B 3TW8B 1N5IA 2GNOA 2ZS8A 1H8EA 1F2UB 3P26A 1J8MF 1XTIA 4J0QA 4RD0A 2VBCA 3X1WA 3GLGA 3IEUA 1X8KA 1XEWY 2WOJA 721PA 1G20E 1LB1B 1GRRA 5IK2D 3WMEA 3IEVA 4O2LA 3A58B 1BS1A 1JQJC 1UDWA 1W48A 3DKPA 4R71A 3B1ZA 4RFVA 2D7DA 1OXVA 1M2OB 2GJ9A 1VCMA 2O8BB 3FYHA 3K53A 2OO7A 2HF9A 4MKHA 1CKEA 3W90A 4HB2A 5J4LA 4LBZA 3QOFA 2GCPA 1S3SA 1XTSA 4H9GA 3SJAA 3TR5A 3A1WA 1OYWA 3RS2A 4FMDF 4NYJR 1ESNA 3TQFA 2QP4A 4MYCA 4B73A 4US1R 1SVIA 4PZYA 4US2R 3AGQA 2P6RA 2IYYA 1NG9A 4M1YA 4CW7A 5JRZA 1FUUA 1OXSC 2IT1A 2ECKA 621PA 1RW4A 4HLDA 1Z6GA 5DHAA 4UNNA 3QXHA 4P32A 4B33A 4HAYA 4WW0A 1YU9A 2VA8A 4MYHA 2IYZA 1S1MA 2OCAA 4JL5A 3EASA 4LJ7A 4LY6A 4YDSA 1VMAA 4MYTA 3LD9A 1VCIA 5SZHB 2BKEA 5KNCA 4P4TA 4G01B 4ITRC 3NTUA 4EKDA 4HUQA 3VNVA 2L0XA 4JSTA 3M1IA 3QSYA 3U2QA 1R4AA 4TTRA 4WZBE 4B3DA 1IXRC 1G5TA 1QHHA 1FFHA 1KSHA 1E96A 3OF5A 1VKJA 3ZLJA 4BLQA 4K8OA 3RABA 1SHKA 4DUGD 2WIAA 4EPVA 2FG5A 5K8LA 5EXSA 1TTTA 2IWHA 2KBEA 3QPVA 1E0JA 3ECCA 4Q7MB 1G7RA 3V4RA 4KVGA 3U6BA 2CLCX 1IY2A 3AP1A 3U3KA 1W49A 4DCNA 1TQ2A 2ZU6A 1XU4A 3THYB 3HR7A 4QBIA 1XMJA 3B8HA 3JVUA 4DSOA 2WIBA 2ZPTX 4AYWA 1OKKD 1WRBA 3ZJYA 4F38A 2GEUA 2C95A 3PFIA 3SNHA 1HQCA 3DPUA 3PV0A 4NCJA 2J7KA 3AF2A 3RRNA 2PBRA 4DIDA 3CM0A 3REGA 3B82A 1KGDA 3NVAA 4EDHA 1G8HA 3GJ3A 1GL7A 4DLVA 2F1HA 5KOYA 1XEXA 2WJIA 4W7SA 3WMGA 4DBLC 1ZP6A 2G1JA 1P5ZB 3K0FB 4NP6A 4GP7A 4RD2A 3KKNA 3O8RA 3VKWA 1NLFA 2VIIA 4XVUA 3P4YA 4TMZA 4V0KA 8OHMA 5JWHA 4A8JC 2VQSA 3HWSA 1AZSC 3T1VA 2GEVA 4DJTA 2QPTA 2P2LA 1ZUIA 1K6MA 3MWJA 4MDFA 2NMVA 2Q3FA 2BDTA 4RZUA 1VIAA 3A1VA 3QUSA 2A3RA 5JS7A 3W3AA 4RFSA 2MSEB 3UKDA 1NBME 1SVSA 4DLZA 2GKSA 3NDPA 1OE0A 1G9XA 4C7OB 3A37A 4FINA 4LPKA 1NRJB 4A1FA 1NIJA 2CJWA 2ANCA 2J87A 2OXCA 2AD1A 3RS5A 4KBGA 1TF2A 1ZC3A 3TBKA 4DT1B 4H1UA 5KU1A 2V1UA 1Z2CA 2C9YA 3GEIA 1JALA 2H7VA 2BMDA 2W6IA 3RS4A 3TUIC 5TY0A 4EJSB 2XZLA 4LC0A 3MMPA 4WXPA 3UWKA 3KJEA 1EFRD 5LD2B 4C0HA 4EIWA 1P2UA 5FBQB 1G3QA 2JDIA 1R7RA 3EX7C 2EW1A 2VHJA 2G9NA 2VLIA 1NJFA 2REOA 4A4DA 2P5SA 4HDQB 1OF1A 3FTQA 4LJYA 4TYYA 1HTWA 3C8UA 4LUCA 5BWMA 1S4QA 1G7SA 1Z5ZA 4JLKA 1W36B 3VR5A 1GKIA 1Q3TA 4HDOB 3E2IA 1TF7A 5JHGB 1ZAKA 1WP9A 2B7CA 1U8ZA 3K70B 1BYIA 2ZI7A 5BXQC 2WAXA 4XWKA 5HZKA 2DWPA 1D5CA 1E9AA 4C0JA 1IAQA 4R98A 2B7BA 2RGEA 2WJYA 3C14C 5J4VA 3FB4A 1E69A 2BMEA 2PJZA 5FBVB 2WTUA 1VTKA 4Q4JA 3WBJA 1U94A 3NC0C 2J0QA 5IHPA 1Z06A 1EGAA 2OCPA 2RMKA 1U8YA 3BJIC 5JHHB 1Q1ZA 3SFVA 1SZPA 3QXXA 1WA5A 3QKUA 2BBWA 1E2HA 2P6UA 4PX9A 4V0LA 2ATXA 2XNDA 4QC2A 4P4SB 2ZE8A 4B74A 1OXTA 1X86B 2FFHA 2VTKA 1D2EA 1FP7A 2GAAA 3L0SA 1J70A 1OFUX 3FHTA 2DPXA 3CRW1 4GRAA 3EG5A 3SC3A 2OXRA 1XMVA 2CLDX 3GJ8A 4X8LA 5EJEA 5C18A 4XWOA 4MKGA 2QRNA 3EIQA 3IPXA 2ZRPA 1EFCA 1WCV1 2CLSA 1MH1A 3QXCA 4JS0A 1UBFA 3EXAA 1JR3A 2J41A 2VSOA 2O5VA 2UZIR 4HI0E 4KYIB 5L3VA 1LV7A 2Z4RA 4QG7A 2GJKA 2GXSA 2FPLA 2Q6TA 1CR1A 1KK3A 1KK2A 2IUTA 2V6JA 2FF7A 4IW3B 2OFWA 1SVMA 4R2HA 2IYTA 1D8TA 2BVNA 1CLUA 2FV8A 4FD2A 2X8AA 3GMTA 5J47A 3TIFA 2BCGY 2YVUA 3RNLA 1I4TD 3QXSA 4LYFA 3R20A 3WXMA 5FPHA 4LWZA 1TADA 2BJVA 3TVDA 5EUQB 1NVVQ 4Q4AB 3U3JA 2OE2A 3HP1A 2EQBA 2EFCB 2E87A 4MKIA 5JI3E 2O8FA 4PQYA 3BH0A 4D26A 4I99A 1KKMA 3S1AA 2RGAA 3MFYA 4JVMA 3MRSA 2IBMA 1JPJA 4YMTA 1T9HA 2JLWA 4QJ5A 3AVYA 2XOKA 3AF0A 3T1TA 1KOFA 4E03A 1OFHA 3ASYA 2ZXUA 5LB2A 4JLOA 3PQCA 4A82A 1PLJA 2GJSA 2Q21A 4E22A 4KVAA 2IYQA 2RGGA 3BGWA 4JBYA 2HXSA 4TTPA 5DN6D 1NY5A 4O25A 1KK0A 4ZV4A 5F9FA 2KE5A 2AX4A 5AJXA 1EFHA 1OXUA 2VP5A 1Q22A 3IQXA 4Q1BA 4URZR 2F3TA 2JIZD 4DDWA 1TU4A 3BERA 4NMMA 1JAIA 4PHFA 5A4JA 2RB4A 3CWZA 2ZRKA 2VH5R 2W6ID 3E70C 5HCNA 5C4MA 1IBRA 3BAFA 4Q1FA 3AKDA 1E9DA 2ZAOA 1XPRA 3NH6A 3KJHA 3VQTA 2CCGA 5EQTA 1N0VC 2ZVPX 4KLNA 1F2UA 3B9PA 4XTRA 3TE6A 5AJYA 1LS1A 5G3YA 3CPEA 3E1SA 1NMXA 3WYGA 4AIIA 2ZJBA 2R2AA 1PJRA 1I2DA 3AVOA 4IDQA 5IDVA 2ZUDA 1F3OA 1G3RA 1II0A 3A6PC 4B43A 4N1AA 2F3RA 5FUWA 3H4MA 1W36C 3A1TA 3P1JA 4HAXA 4WAUA 2R44A 2XB2A 4DCSA 4MKFA 4Q03A 4PPNA 4LHVA 3NWJA 2YKGA 2CNWD 3PUZA 3W9YA 2O0JA 3QPWA 4W5JA 1JJVA 1E79A 4XVQA 3TSWA 4CT4B 1GL9B 1KI6A 1IHUA 2MSCB 3NBYC 3DZDA 3GLGB 1H8HD 2NO0A 3BORA 1Y63A 3HU3A 5HCIA 3TRFA 5FTLA 4Q48A 3RC8A 1GFIA 2P0EA 1JAHA 1N25A 2F9MA 3B2EA 2YNMA 4G1UC 4HB4A 4PPGA 4B2PA 2YOFA 2QT0A 4BASA 1IY1A 2W2VA 2BKUA 3PENA 4GZMA 2ZJ8A 4AK9A 5M04A 3W5IA 1KJWA 1MO4A 1Q3HA 3R7WB 2R6FA 4NYJQ 1P9NA 1OSNA 3Q72A 4NCKA 3LWNA 3EPLA 2Q3MA 1J99A 4P4UA 2FNAA 3CR7A 5FUXA 4UNSA 4TLAA 1EFTA 4UNPA 2H16A 1P7CA 2WWIA 1CJKC 1ZCAA 5C46F 3QBVA 1G7TA 1SVWA 2WWGA 1GNPA 3R8FA 2V3CC 1PLLA 2FN4A 1R8SA 1E4VA 2F6RA 2OM2A 4XSGA 1E0KA 4TYQA 5AUOB 1XD9A 3IBGA 1E99A 3QIAA 3ZS9A 1Q1EA 1JEEA 4MRNA 1JR6A 3OE7D 1TF5A 1T0HB 3LW8A 1ZVQA 1SGWA 3RYTC 4HUQB 1BIFA 2CMKA 2VHUA 3I4LA 2QAGC 3T5DA 3NEYA 1QHHB 2OT3B 3MGCA 2ODNA 4QBGB 1T8TA 2D74A 2NTYC 3QNUA 1CXZA 1VG1A 1KSFX 4OQLA 5CDFE 1U0LA 1W4BA 2ZRHA 3LVRE 2KSQA 3AF1A 1SVKA 2C5LA 3AB3A 1AZTA 5IT5A 3Q85A 4GNKA 4URXR 4CGZA 4BLOA 1DE0A 1XZQA 3P4XA 4PC6A 5SZIA 3G82C 1CJTC 4DLRA 3KKOA 4C0KA 1W44A 3OAAD 3AP3A 3FE2A 3L43A 3PUVA 2QP3A 3Q5DA 1WF3A 5KHOC 5FOUA 4C0AC 2QUZA 3W8NA 5CITA 1SQ5A 2CEAA 4Z1MA 1XTJA 1E2KA 4L4UA 5DI3A 2WSMA 421PA 2HYIC 1TX4B 3ICQB 1NN3A 2I3BA 1KI9A 1OXXK 3RWMB 1E1RA 3P20A 3DM5A 1XD2B 1UEJA 2A7QA 3BRWD 4JSYA 1FNMA 4KXFB 1SKQA 2VL7A 2GCOA 4FMBB 1XEXB 4JYBA 1G8YA 2EFEB 1N6IA 5FTKA 4LBYA 3WBKA 3SHFA 2JAQA 3VX3A 4TSFD 2KWIA 2I1VB 2OBLA 5K8IA 3ZVMA 5EP1A 1Z0DA 4MYUA 1SXJE 2ZQ5A 3Q8XB 5LDDC 5LPNA 3TNFA 2R62A 4PO1A 4BEBA 3WNBA 3B78A 2ASEA 4K81B 3ZZ0A 3SDZA 3GLFE 4PQRA 3VX4A 5JCPA 2DHRA 5CM9C 4EFLA 4KCGA 2RCNA 3AQ4A 4DSNA 4OQFA 2QTFA 3JZMA 3KB2A 4RFSB 4BFSA 1KZGB 4NU0A 3K0CC 3VKHA 1FUKA 2WSSA 3I32A 4C0LA 1TUIA 4MDEA 2OZEA 3NBXX 2CHVA 4B3FX 2CJWB 1ZUHA 4HLQB 3FKQA 4YXWD 2CDNA 4ASUA 4DVGA 4OHWA 4FI3C 1V43A 2XX3A 4A92A 1Z0FA 2A5YB 5E95A 3ICEA 5CIQA 2F43A 2WKQA 3NIBA 1P61B 4HLUA 2AWOA 3U7GA 2OV2A 4B3GA 1TQ6A 4Q66C 1ZW6A 4ACBA 1TPZA 1HE8B 2C04A 2VHQA 1YZNA 1W0JD 3ZH9B 4QM6A 2NPIA 1NBMA 1KI2A 1ELOA 1II8A 4HSEA 1G8FA 4IEEA 4WXRA 3L2OB 1W4CA 2BBTA 2FX3A 2X2FA 5GVRA 2BEKA 4LYJA 3SJBA 1SVLA 3UIEA 4M4SA 4OBEA 1RRFA 2LKCA 2QMOA 1Z63A 5FR1A 1AS2A 1MV5A 2JLVA 2O0HA 5LD2C 3QKTA 3G0HA 3VTKA 2OCBA 4Q4JB 1CULC 1D9ZA 1P4SA 4IVQA 3UPUA 2CE2X 3K9LA 3BFKA 1TAGA 4UNQA 3N5CA 2ZU0C 1S9DA 3AV0B 4GPTA 1KAOA 2O52A 5BQ5A 2RGNA 2H17A 3DKVA 1T91A 1DG3A 4YMVA 5EUMA 5L8VA 4FWTA 5CK4A 4KAXA 2O8DA 1HURA 4WIAA 2J7PD 3K0SA 1F2TA 1FTNA 1UBCA 1FQJA 2Z6VA 3THXA 5KO2A 1EX7A 4TZ0A 1NLZA 2D06A 3LVQE 5FFMA 1YZTA 2QY9A 4HDCA 4OI2A 4DEYA 2WKPA 4AG5A 3AKYA 1KK1A 2A30A 1XRJA 1CP2A 3CF0A 1Z6YA 2ZJOA 4CRWB 4A2PA 5FPKA 2BJWA 5EP3A 1OHHA 2CHQA 3WRXC 4TL7A 2BC9A 4Y0AA 3PXGA 3WHKA 1RYHA 5FOTA 1CBUA 1E1RD 3CPHA 3HPQA 4QFMA 2EYUA 3D3QA 4DLYA 1JJ7A 3Q5EA 2W58A 3EW9A 1G4AE 3K1JA 3SI7A 1FL9A 3SFZA 4G3XA 3SYKA 3ETLA 4DKXA 4GOKA 2FJUA 2I1QA 2W0MA 1KI4A 4C4PA 3B1VA 2FPKA 1RRGA 4FN5A 2O8FB 2ZS9A 1E4YA 4KITB 1E9RA 1E6CA 1DAIA 1JQLB 2HT6A 3S1AB 4BPBA 4MA4A 3EIHA 4GZLA 1BO6A 1BKDR 3EWAA 2VHTA 4HEJA 1MT0A 2A9KA 4KFSA 5TARA 4FW9A 1MO5A 5IF9A 3O47A 2AKAB 3AKEA 3RHFA 2ORIA 5FUYA 1F60A 2PCLA 4B2IA 2ZJZA 1S96A 5CK5A 2JEOA 1SKYE 1ZU5A 4XIGS 4TT3D 4QHSA 2PJRA 1G18A 3P32A 2QM8A 3NH9A 3ZVLA 4NPHA 5CYPA 2NPFA 3K70D 5E7JA 5UKDA 3CRRA 1US8B 1CR4A 3FPAA 3M0EA 1KDOA 1KI7A 1FZQA 2QORA 4PC1A 4PR0A 4B3XA 3TLXA 2D7CA 1E2FA 3OFND 2JJ1A 2DB3A 2R9VA 3FHOA 3LY5A 4V0NA 1HT2E 3EZ9A 2DR3A 2WKRA 4KI0A 4GP6A 4UKDA 4DDVA 2CCKA 3IHWA 3X1DA 2JASA 1DAKA 3BC1A 3FFBA 2GVZC 1SHZA 1N3BA 2GZAA 1DAGA 5EZ6B 4A2QA 4B3CA 5JS8A 3DVLA 2IS1A 4B47A 1DAFA 3RRZA 5EE1A 1FP6A 2FA9A 2WICA
chains in the Genus database with same CATH superfamily
4MUBA 2QMEA 4WLFA 1K7SN 2HXGA 1CS0B 4S0XA 3QFSA 3TEMA 5AVWA 3PC8A 4G0WA 2IKQA 4G97A 4P9NA 5FPYA 1TVKB 1O1YA 1Z33A 3CRZA 2R11A 1L9XA 1GQYA 2ETXA 2TMGA 2ZI3A 4HVAA 4GI2A 3IPCA 1GTZA 2H2IA 2JH3A 4PANA 3CR8A 3GG2A 5LZ2A 4O4HA 2FR8A 2Z83A 2ZBQA 3FPSA 2EARA 1U2RA 4AZ0B 1DWPA 4HOYA 1JXAA 3AVTA 1ETHA 1ZKDA 3BH7A 4OHUA 3U9SA 4F1WA 1Z5UA 3QHAA 5HKKD 1I2CA 1I14A 3FWYA 3GLVA 5JAUA 1KQ3A 3O2NA 5HIKA 2C99A 3DD5A 4RLHA 5HGJA 3ZCQA 2Y1LA 3KSRA 4JLPA 5DF1A 2BHSA 4Q34A 3U3MA 3P8ZA 3ADBA 1A8PA 4J94A 3ZJTA 1O95A 3M82A 1JWLA 1TDJA 1MOZA 3KQYA 3K6KA 3DCJA 4LXIA 3OKPA 3EF0A 2GPWA 1DT5A 5HIMA 5LP6B 2W6NA 1TYZA 4D02A 3WHIA 1U5BA 2R48A 4PLHA 5JYBA 2UDPA 5C8VA 2YFYA 2ZRAA 2G3YA 3WJ1A 2GM4A 2XKBA 3QU5A 1WXFA 4L51A 1ZCBA 3CGGA 4ZCLA 1L4NA 1NULA 1E5VA 5CCDA 1KWKA 2AKYA 4I1YA 2XA1A 5H59A 4LRTB 3UWPA 4TVOA 3ZX5A 2XOXA 2ZTMA 2JFUA 1HDEA 1QHYA 3PYXA 1IEXA 4DA9A 1J42A 2XEDA 3DKRA 2EL7A 3RG2A 1ZPDA 2O2ZA 2R8YA 4TV9F 1AS3A 2V6GA 4N5MA 3MG9A 4EHAA 2DUUA 4UOZA 1OBOA 3HJTA 4RTSA 3A1NA 1B8OA 4M6WB 5FQNA 1VE6A 5JH7A 4LJAA 3BFXA 3NASA 1TKRA 3EH1A 4Q7QA 1V45E 1CJVC 1X74A 1YIDA 1ZGGA 1KJNA 3DMPA 4RWEA 4GOJA 4DXDA 4Q7JB 1R0CA 2YOHA 2PBLA 3F46A 3QVMA 4LJ4A 4QWMA 4N7MA 1WPXA 4LN1A 4OHBA 4CG0A 2WP8J 1GPWB 4YRIA 1LRLA 3M1AA 1ZINA 3EVTA 3KXDA 5FH9A 5JAIA 5JPDA 3DUWA 2GEDA 5A5EA 3K0BA 4J2TA 3EUEA 4H1VA 4GYYA 2VQ3A 3TLKA 4GE0A 1G5IA 1KH2A 2AJTA 1C7IA 4M3NA 4QA9A 1RADA 3NHKA 4B6PA 1P9LA 1V6AA 2J5XA 3R0VA 4UHHA 1NDQA 1MPTA 4OM8A 5ALDA 1JPVA 2VHWA 3SZMA 1HT1E 2Z1MA 4M0MA 1NAIA 5F23A 1FTSA 1Z13A 2QTCA 1A5BB 3GGSA 1WD5A 4OHYA 3M4XA 1ZY2A 3HNRA 5CAEB 3HRKA 4URYR 3NRCA 8ABPA 1S2OA 2I8CA 4C1BA 4JYPA 1CU1A 1KZ6A 1KJYA 1NQOA 4FE4A 3T35A 4O2RA 1H22A 4MVXA 5CVJA 5FWYB 3S68A 4ZOQI 5EERA 5JCOA 3JQPA 3MTBA 1G6Q1 3V4FA 1IDN1 2CF5A 2BFFA 2DF8A 2H3HA 3A6KA 3LQRA 2WBLC 1J90A 2DKNA 2GCIA 1B6TA 2BM9A 2ODWA 2A14A 2OD2A 1E9BA 3FW1A 4J29A 5KSOA 3MPOA 1NN5A 4S2UA 3U4QA 4G4JA 4MS4B 4H18A 1LNQA 3MGKA 4YMSA 2OG2A 5C7OO 4CMCA 1DWUA 2EJUA 3GT0A 2I22A 1QP0A 4B3IA 4E5PA 1LVHA 1WQ3A 3T3NA 2ONYA 3U48A 3W3ZB 4TSKA 4CM8B 5HE8A 3C5WP 4YV0A 5KMGA 3HL0A 3BMQA 1HYQA 1AKRA 1U2GA 1G8PA 2J3JA 1K5DA 3IIKA 3SZ3A 1BCSA 1V96A 2C2ZA 2VJDA 3BIFA 3C7DB 2CVZA 1GKYA 2AW5A 3KD2A 2ZRDA 2HU7A 1E66A 1VRWA 1JQ5A 4NH4A 1B8PA 4G65A 4W9NC 1LLCA 4QGFA 3GJ5A 3SYLA 1TNDA 2I2CA 3CEHA 4OD0A 4TVSA 3SKVA 3PYLA 1KPHA 2WAYA 2D2XA 2NZWA 4WA7A 1NJGA 4XH9B 2QUAA 3DV9A 2OHOA 3Q3JB 1V9CA 3DL2A 3L1VA 3K4HA 2PRKA 3GDGA 1J9GA 2OO5C 4ZCQA 5ESWA 5ELMA 2CLOB 4U2BA 1VI6A 2G88A 4KPUA 3E81A 3AK4A 3OZIA 4MWSA 1SBYA 1YJXA 4Y18A 4ZYXA 2IXEA 4QEKA 1C8BA 1SXJA 3I12A 2GCNA 4MGHA 5BW8A 3UK1A 5C35A 1CRQA 2PWYA 3ANNA 3P9QA 3VR3A 4D0GA 3FPCA 3OY2A 3EOBI 4EP1A 4CMKA 1T8PA 3A14A 1JBEA 1UKBA 2YRFA 1L7XA 4QODA 1GILA 2J3KA 2RGDA 4GOND 4MPTA 3U4AA 5KNCD 3PNPA 2RGRA 4F8YA 4FXPA 4KOEC 3FZNA 1IUPA 3SM3A 4UQLA 1IZ9A 2I3AA 3F1KA 4ND6A 1NUAA 2GVNA 3I0NA 1CY6A 3QV1A 2DGDA 4JT8A 2OXIA 3N8KA 3VGJA 4LJRA 1JLHA 3OMWA 3P9NA 4AT1A 3VNRA 4HDAA 3A1SA 1P91A 4MVJD 1GVNB 1BXZA 1QYDA 1UBGA 4C7MA 2II6A 3UNXA 4MGKR 2XTNA 1Y4DE 1JLSA 4LI0A 1K6JA 1E18A 5H5JA 1H93A 4B2YA 5D1NA 4GR5A 3ZIDA 1XJQA 3OLVA 4O3FA 4DZRA 4KR6A 4OQMA 3TQOA 4JC5A 3YASA 1QBKC 2GBLC 1RQ2A 1CVIA 4QELA 3VYUB 4BJ6A 2Z2JA 3CWQA 4E14A 2UYYA 5KC9A 3LHKA 4FDVA 1CK4A 2J3LA 1C9MA 1HSZA 3GGJA 3B1YA 4I7EA 1UPCA 4R6XA 5JIBA 2ZT6A 3BDVA 3VO2A 4CQLB 1QVRA 3VOTA 5F5XA 3ZCPA 2WF7A 4A26A 1RQRA 1FVOA 4HEA6 3THXB 3VR6D 4Q1VA 3VO8A 1CQXA 1N8SA 5BYJA 4YUXA 3KEQA 3RVDA 4DR5B 3JV7A 2JBAA 4L3VA 3VI4B 2QPLA 2ZTHA 3CF6R 1H0RA 2YWHA 2WWXA 4GXNA 5A4KA 2OM6A 3HUFA 1JLLB 1GU7A 4KLZA 4Q9DA 2HF8A 3TXXA 2OKCA 3X1ZA 1BH6A 4JC4A 4UBMA 1KJZA 4AECA 5BVGB 5JQGA 5LP6F 1UJCA 4H3VA 3OIVA 5T6BA 3FKSD 1QIJA 2R1TA 1BNCA 5F1PA 5G53C 2CV0A 2FGJA 3FYUC 3VOBA 1LBTA 3V34A 1ST3A 2HDNB 2BTQB 2C2WA 2EWVA 3IPAA 3UV7A 4XFJA 1EQAA 2C92A 3EA4A 4AZVA 1SZDA 1ODTC 1RHMA 3NG1A 3PK0A 3U19A 5E6SB 1N36B 3G68A 3LXUX 4Q3LA 3A25A 1IXKA 4PSCA 4U4AA 5EWMA 2B9EA 1KR2A 3K30A 5AJUA 3AOEA 5K0NA 3K05A 3T38A 4DG9A 4HV4A 4CLOA 4MQFB 3HEAA 1NYRA 2BBSA 4MK4A 3VPHA 2LZ0A 2JGNA 3I61A 3FPFA 2C1ZA 3QI7A 4KIFA 1QK4A 4L57A 3J7TA 1BZYA 5EJIA 4F6LA 5CDTA 3B9BA 3UPDA 1IPFA 5G02A 5KYWA 4B71A 3H84A 3LCMA 3GMIA 4EH1A 2E6KA 1P2DA 4UXIA 5DHUA 1N6RA 3FYDA 3WYAA 3ZWQA 3VRHA 1GO2A 1XT6A 3IPLA 4N3GA 5DSZA 4YYZA 3SKXA 1W7AA 1CDZA 1T2NA 4QPPA 3K8OE 1D1SA 1DRKA 1UPTA 5FLKA 1J21A 1UT6A 4FUTA 4NYMR 4RADA 3TCXB 2VYCA 1BA3A 3U7QA 3ZV3A 1ZLYA 1RKUA 3OZBA 3QFHA 2H5EA 4J0JA 3DLBA 3CE6A 4U8HA 3R9WA 1AO3A 2AIRA 4L7QA 4QBFA 3K72B 4YMHA 2F1OA 1G17A 4HGYA 4DYHA 1O9BA 1BHJA 1ZWLA 2LVBA 2WR8A 3IQGX 4FEYA 3RTGA 1FU4A 1RQNA 4QDTA 1ZISA 4QDKA 3L82B 3O7WA 2W6PA 4RV9A 2HLNA 2Y1XA 1LBSA 2BOVA 2JVJA 3PIIA 5CFZA 3ENVA 1RYNA 3DHYA 4XIYA 1ONNA 3WWCA 1Y5MA 4OQNA 4YS6A 2QHXA 2ZI9A 4TS9A 2L82A 4QJ3A 3SSNA 3QVVA 2QTVA 2ABWA 2WA1A 1YZFA 4LDZA 2JZCA 2NGRA 2GPTA 2Z2IA 4C21A 4GOOD 2O3RA 3LIPA 1Z12A 4YT2A 1ENYA 2QENA 4HNHA 4OUDA 1R10A 1S3GA 3TOSA 4DS3A 1GAXA 3N1UA 3OH8A 4DM4A 5K0JA 4R3WA 1V26A 4CMGA 1BW9B 2QR3A 4J4HA 4GZ6A 3HA2A 1KHTA 3H87A 1PT5A 4C9BA 3INYA 4PYLA 3L4BA 3UT5A 2CZGA 2NSLA 1GNQA 2C2MA 4N5DA 2R84A 4DBLE 2AZ4A 4KG7A 4GRIA 3ORQA 5H83A 3QVOA 4D4HA 5BN5A 1HO3A 1BOFA 2BFCB 2CNKA 4ZA2A 1P7WA 2QMQA 3ZK7A 4MLDA 2OC4A 1VYTA 3DR3A 4Z53A 1SD2A 3FOFC 1JA0A 2XEXA 3EXG2 4KAAA 4Z49A 1K97A 2VYND 2AFHE 1PGJA 3EIUA 3EZFA 4WESA 2JFXA 3SICE 3T5GA 4MVJI 3HFSA 4JVNA 5BV8A 3BL6A 1DB3A 4AFNA 1LKZA 2BFBA 2YJ6A 4EI7A 3KIPA 1B42A 2B82A 4EUHA 2HA7A 5BV1A 3QWAA 4O29A 4XQ0A 1LSSA 4I1PA 1R3DA 4K6GA 4BHTA 3ZKWA 4C3VA 2A5LA 3RIHA 2BZGA 3FLMA 1SUFA 4OXNA 2HWWA 1YFZA 1SH7A 3RF7A 4FIZA 1BKYA 1L5HB 5IMSA 4ARCA 1R6UA 5TJHA 5EJ6A 4GL2A 4J3FA 2C2HA 3OEWA 2B35A 2YTZA 4GOMD 2DSNA 2ZBFA 1ZG3A 1JF8A 1W4ZA 2YCBA 3H11B 4BVKA 4IOKA 4ARIA 4KMOA 2R1UA 4RIEA 1JT2A 3P71T 5CNKA 4B85A 3ZGNA 2PY6A 3I2GA 1K4YA 4DIEA 3IA7A 3P96A 2XIQA 4C01A 1CX9B 1R6DA 3TB4A 1KBZA 1J49A 1WKBA 1XAIA 3EN0A 1G59A 1L6IA 1P62B 3PQ5A 1YMVA 2CXOA 3AF5A 2HXYA 3BK1A 1NBHA 3IQIX 3K0HA 2PEYA 5EC8A 1KDRA 1XQ1A 3UF0A 4P80A 3UW3A 1MH9A 2ZB4A 1QH8B 4IVPA 3FUXA 3HJAA 3N6RA 1QYCA 2A0WA 2BR5A 5GZ6A 2BFNA 5JMPA 1M6VB 2QL6A 2DECA 5T7BA 4Y2SA 1QRUA 4Z9YA 4AURA 4Z0PA 5EZYA 1VDMA 3ROPA 4AI6A 2AFVA 3G2NA 4UJ5A 4X63A 1PZMA 1L7RA 2D5AA 2X7XA 4PHHA 1SC1A 3V8RA 1BU5A 4URVR 1DTEA 2IEIA 3BK2A 4FDMA 4PIPA 2YRXA 4OOEA 4RVUA 4S1TA 4AAYA 3IOMA 1C0PA 1QLJA 2VSXA 3G3EA 3CSUA 1BMFA 6YASA 3C1AA 1DOZA 1Y34E 1G60A 3LX6A 3IR6A 3CZRA 5B57C 3SXJA 2AMLA 3BMNB 1LLUA 1ORRA 4BCDA 3N2EA 4YECA 1YA8A 2M32A 4OHCA 3BTVA 3RVPA 4AUKA 2FG7C 2G6BA 5BQ3A 3AL0C 5DYGA 2GASA 3JVVA 1PL0A 3H5AA 4HAZA 1A8SA 3JQ8B 1R9MA 5AVOA 3W4JA 3ZY4A 4V0SA 3NV7A 3IKMB 1A2OA 1JQAA 1EVEA 2GAIA 3BJEA 3IUEA 3LC0A 4IH1A 4L6IA 4O1IA 4PLZA 4RQTA 3CVVA 3NMUF 2XB6A 1JMKC 4ZKDA 3CF4A 3ZUPA 5B64A 4B75A 3AEKA 5AVZA 1GUBA 2CFSA 3MWDA 2PZEA 5LBIA 1UBHS 3IEMA 3TH5A 3LQQA 2QW8A 4HUJA 5I5GA 5SYMA 2EP8A 4HCJA 2XDYA 3JQQA 4FFDA 2I29A 1L5QA 5LMUB 1NM5A 4J7XA 4INOA 1X9IA 2JZOA 2NT4A 1N2JA 4H2DA 1E3EA 2DQYA 2FEPA 2OFFA 2YNMD 3OEEA 4JA2A 5GQSA 2PUCA 3AR8A 1GDHA 1SCKA 5ALUA 4AIRA 1RKBA 4QU9A 1JLRA 1FYFA 4HL6A 2JD2A 2ZYHA 1TC2A 1ONOA 3G1UA 3JQ9A 3K0AB 3GEPA 2C9CA 4EMUA 3CCBA 3KPUA 5JADA 3KQUA 1K5PA 1JH9A 3RCBA 4TWIA 4KPEC 2IS2A 4L4SA 1A7UA 5MGNA 2B4KA 1FTYA 1CFZA 2Q6LA 2UKDA 3FF4A 4G26A 3NT2A 4IMPA 2PM8A 3LUKA 1FFAA 4NBKA 3Q7RA 1HL3A 1VPTA 3HEBA 3LBNA 3ZOZA 1X94A 3DOOA 4F3NA 1CUAA 1HMPA 2BI7A 5GZ3A 1LI5A 2DPHA 3HMKA 1J00A 4MTCA 3VVBA 4M87A 3TQHA 1CY8A 2MSWA 2Z58A 3SX4A 5ALZA 4BVAA 5JFOA 4Y0VA 4F2PA 2AJCA 3WLSA 3BIJA 1KU0A 4LHSA 4Q9LA 3SQOA 1OGJA 3A8TA 5EIBC 1IBMB 4K9DA 2IU0A 2IW1A 2EEPA 4I46A 3TNLA 5I8PA 2N75A 4DHWA 1QKIA 3AONB 3LT1A 3EGIA 1XU9A 2VHYA 2XPCA 5BUSA 2XRZA 2VDUE 4V2UA 4D43A 5L6LB 1FS6A 2IZ7A 3PD1A 1AOXA 1QIDA 4EG1A 1W9MA 4TGLA 1NI3A 1QIHA 4XPZA 1E2MA 2ONJA 2E4XA 3GYBA 1IEWA 5WRFA 4B9EA 3S27A 4TX1A 3IAEA 5IJXA 2YN2A 4ZEMA 1R0LA 1OH6A 3W5DA 1QG2A 2HMUA 2G6TA 1IZYA 2CD9A 2NO6A 4XWYA 1YB6A 5GGXA 1JLMA 1WDLA 1DJPA 2P6NA 3FCSB 4YP1A 3V4VB 4I5GA 2QLLA 4GM1A 2IFTA 1FUIA 3GLTA 3ZD8A 5KB3A 3JYNA 3AI3A 1N3IA 2RG1A 4HDRB 3EG9B 1GEEA 3BJRA 1UP7A 2R8BA 5DM60 4JP2A 4RTLA 3GLIA 5LUAA 4G85A 1D1PA 3SQXA 3EE6A 4JIMA 1VFNA 3LY8A 4LS3A 4DARA 1NBOA 3DO6A 4Q37A 1WM1A 2XHZA 2GBIA 2IEBA 4UEJA 3OE5A 3CUKA 3P0EA 2YV5A 2XIJA 3GNTA 3T0FA 2X9NA 4RM2A 2FH5B 4NSNA 1JB1A 1SBZA 2D2FA 2NZJA 1ZK1A 2Z1DA 4FR0A 3TDNA 2B1JA 3LQFA 2W6QA 4IIUA 5G2OA 3GXOA 3UMFA 1IXZA 2JVIA 3C3AA 2R97A 4IWNA 1VL2A 2NZVG 4BRUA 2X0DA 1XJCA 5D3MA 4Z8YA 1KGSA 5REQA 3R5SA 2WU4A 3AC0A 5SYAA 2G9QA 3TLJA 4BBZA 5DNYB 3FIUA 5EE3A 1A69A 4MWEA 4H31A 4QOEA 3MLBA 4BO5A 4ZOBA 1XZPA 4J0GA 3SKYA 2GDZA 5FOXA 4CM3A 4IXMA 1AQIA 2NIPA 1G2OA 5JNVA 2FN3A 4DEXA 4DUGA 3B1XA 3E9MA 3MJSA 3PL1A 4RCZA 2ZITA 4PIMA 1QMGA 1E4EB 1Z0ZA 4GEGA 3TJZA 1JFVA 4OB6A 4BNKA 1SIOA 3Q6NA 3VHXA 3JASA 4HXEB 3VYRB 4R8SA 3V4LA 1LBEA 3CHYA 4MUMA 5BURA 1K6IA 2QZSA 5AESA 1PFKA 2Q6VA 2JG3A 3S2FA 1BJKA 1Z0AA 2GBPA 3GEGA 3LDFA 4MI1A 3IA2A 1K8ZB 3C0KA 1OBHA 4MAFA 2QLFA 2P9BA 2Q4TA 4KC0A 2R751 4HATA 4B44A 2LCIA 4IKEA 1V35A 3KKEA 3PF9A 1XTBA 3UK0A 5DGTA 1RHUA 5ALFA 5K1ZA 1Q77A 4FPXA 4CR7A 4TKUB 1UJMA 2WWRA 3IV7A 3V00A 1P5JA 2HEIA 5KYXB 1RLMA 4BFYA 5DCWA 3ZVRA 5K6AC 1V37A 2PX3A 3V97A 3STHA 3I37X 4D4MA 5B6PA 3OKAA 2EFGA 2PFSA 3NBFA 2OGSA 3ZJ4A 4D0RA 1ZGCA 5ICGA 4Y6RA 3B60A 1V4BA 1KYTA 2P3LA 1ATIA 3AESA 3FXAA 4AJ2A 3N2KA 4M1WA 4XB1A 3UVEA 5SY4A 2NW6A 4FBLA 5I9MA 3V8MA 1BX1A 2CLLB 5B7PA 5CH3A 4K5QA 3E9CA 4IRMA 3AEUA 2QG9A 3JQDA 1F4PA 1UAGA 3HI4A 4HNVA 2M6KA 1ACJA 4K6FA 1PJTA 2XUKA 4U9UA 3RDPA 2VCHA 4BUJA 2PMEA 3GJXC 3T4UA 4TQGA 3FN4A 1XXHA 3H8SA 2PGXA 3E27A 4HPJB 1OZAA 4HGNA 3UICA 1NXWA 5IT0A 4QFBA 3U4CA 4UULA 3RC1A 1RABA 5KI6A 5KBYA 4Q4HB 3S55A 3IJEB 2R47A 1K63A 3EK2A 3EXIB 1REQA 2QUIA 3GLHA 4GXTA 5I7VA 1TUBA 4U7DA 1JEAA 5E1BA 2XWBF 5EXXA 4TLDA 4DG5A 2OMKA 1IC6A 2Q5JA 3L7MA 5EKUA 3EPRA 3P2MA 4IGKA 1CYEA 2FRDA 4IAOA 3RTCA 4LHEA 1IUOA 3X2FA 4WOPA 2FPMA 5C81A 4ZZ2A 1JDVA 3O8CA 2D1SA 1MTZA 2QT1A 4M53A 4Y2PA 2HM7A 5C4GB 2H9IA 1VP9A 4A7PA 5F73A 2FR1A 4MP8A 2IEYA 3TLYA 2JLSA 1I0ZA 2B0JA 1SJ9A 3U13A 3ZD9A 1SXPA 4TWRA 2WB4A 3A2KA 4GX1A 1O0BA 1F8XA 4MQLA 2YHAA 4QBTA 5ALGA 4DV6B 2JFWA 2A9JA 4MMZB 2VUUA 4GZ5A 1VL1A 3IJRA 3NDRA 3TGPA 3N7TA 1PEYA 5IBPA 1EWRA 4W9MC 4XOIA 4BNGA 4H7IA 3ZJUA 2XV1A 3IRUA 5ALOA 4DDTA 4D6XA 1DCMA 3OHMA 1ISHA 4P81A 4HVCA 3DBOB 1NN1A 4ARUA 4ZGWA 5F98A 4WCDA 4O0LA 1PJLA 4KR3A 2B98A 3CUUA 1RPAA 2HK8A 5KYVA 1QBGA 3B7GA 4FFWA 1QVWA 3OZFA 3OIYA 4G0OA 2O2IA 3FPEA 2ZUVA 1EA7A 3A4NA 4MZDA 4DNOA 1C7JA 3TIIA 5KTTA 4NFLA 1W52X 4MRVA 4RZHA 4R1LA 2PUJA 3PNKA 3JZAA 2SCUA 4OMDA 3SE0A 4HAIA 4LZZA 1GNVA 3CUWA 3A3YA 4FNGA 2YJGA 4E30A 1SOMA 2NU6A 3MTEA 1G21A 2OCYC 4G5XA 4TOIA 4EKGA 3MRVA 4MWCA 3SXPA 1H3NA 4Q93A 4QG3A 3O6VA 9MHTA 2TMYA 1HGXA 4MJ3A 2GN4A 3M6FA 3L7DA 5KVQA 3MJEA 4HSGA 2QROA 2ZLBA 5CLLA 2XDQA 2Y6UA 1V1MB 1SG9A 3LK7A 3JWIA 1QFXA 1YR8A 5AQEA 4TLBA 2FEWB 1G2PA 3ZG6A 4IDFA 4O4JA 4F3YA 3WO0A 2C9OA 5J2TB 5F5LA 3FVRA 4PTLA 1JTFA 4JR1A 2YWEA 3LRTA 5CU7A 4YTEA 1D04A 5GJBA 5U4XA 1EGVB 2J4FA 3JQGB 5G40A 3G88A 4LECA 4MMYB 1YQXA 2XJ4A 1XWFA 2B4AA 3GUCA 4PHTA 5FORA 2JLYA 1IULA 3ZEAA 1HOXA 3MRTA 3ODGA 3EHEA 3JARA 1XCMA 3KJXA 3DKIA 3LXXA 3QKRB 1A4UA 1R74A 1BXRA 1BGWA 2ERYA 3BM5A 1GQ2A 2FFBA 3OHSX 4G8BA 4H7PA 4QQ8A 5K2MA 3LTNC 5CDFA 4D3DA 4JUIA 4HB0A 2JGIA 3HE3A 4KFCA 1C1YA 4QGBA 4Y2GA 3QEBZ 1TTPB 2YQ4A 2ADFA 2GPNA 3SHOA 4Q18A 2Y1CA 1TJ3A 1B23P 1ZO8A 2P1ZA 5DHPA 5JNUA 3B6EA 2JZNA 2OECA 3FSGD 3NWBA 1SOWA 4RIGA 7ADHA 4X20A 2H2HA 2BGUA 2OHVA 2OSVA 4UEKA 1AB5A 2BYTA 1CG6A 4Q3EA 2Z4SA 4EEXA 2G4LA 4W5WA 2B6HA 5GV8A 1LFAA 3WNDA 1SG0A 1QX4A 2IUFA 2WLSA 5AFSA 7REQB 2OA0A 1R0XA 2I03A 3F4LA 4W99A 1N2OA 1MX1A 2GVDC 3AVQA 2WYOA 3VOAA 2HW8A 1KY4A 1EFPA 1XRMA 3FTNA 3IKJA 1GZ7A 2CMFA 5AKYA 3QEMB 4JUAA 2Z3WA 3EVDA 5B1HA 2J45A 4QT0A 3RUIA 4DNPA 5HR5A 2BFDB 3ELUA 5E4FA 1A0OA 4Y98A 2I3GA 3BK7A 4P7JA 3PA6A 5EHNA 2ZJ1A 3ZWMA 5DN6A 4DUZB 1OB2A 3L1IA 2AK2A 3D0KA 3I8XA 3ZI7A 4BLTA 1C5KA 1EESA 3KSUA 4AY3A 3OPNA 1Q7CA 3NAQA 2ZJ5A 1M7GA 1BFKA 1USWA 3DVAB 4ZT7A 1UOOA 1W6RA 3GRCA 1M1YA 4X7BA 1KY2A 2PGAA 4YI3A 1VPWA 3KDSE 4TWAA 2ZRMA 5JO0A 5LFAA 5CLJA 1ZCZA 2AW3A 2O8VA 1BHSA 3WL4A 1NFRA 2OLKA 3C6XA 3R8CA 5GIPE 3Q9NA 2IW3A 2HL6A 3B6IA 1NTRA 1JG3A 3EFOA 2BHTA 3QLUA 5DYWA 2RH8A 3FWPA 1LF5A 4IQ0A 1NNEA 1P60A 3OLQA 1UBOS 5DIFA 4IDEA 5EJAA 2CW5A 3ZXUB 5KYUB 1GPBA 3BMOB 3MT0A 5I9TA 4Y67A 2YFHA 3OLXA 1F0PA 1QLWA 3E9YA 1ZH4A 1AKUA 2NXWA 3SU8A 2CLKB 5BOSA 3CUTA 4XD7A 4EO7A 4HMPA 4XRRA 1XZFA 3V42A 2JAPA 4JEMA 2YIJA 2I78A 3A7DA 1FY2A 3PC2A 2WWYA 2XXAA 4LHWA 5LIPA 1ECBA 1PJCA 2X6QA 3UW1A 3W8DA 1M3SA 3Q9LA 3HQ4O 1S3FA 2C5EA 2W71A 1WTAA 2ZRCA 4PLGA 4MH0R 3BSSA 1PFGA 5IU6A 3OMLA 3D8TA 4PQFA 4MCAA 4HTFB 4RJJA 2C78A 2O7VA 2P3OA 5ESRA 1G41A 4OK3A 2ZUTA 1ODIA 1ZMBA 1ATZA 1Q83A 3I2YX 3G8CA 3PFNA 3BIWA 1AB6A 4NVRA 4Y9RA 2PZ8A 5BNFA 3UGQA 4BV2A 1E7YA 4P2BA 3VNBA 3MMXA 4DPKA 5A5GA 3USZA 1XMPA 3H2GA 1OLOA 2AR9A 2ERXA 3SX0A 1RC0A 3R7BA 5CDUA 4E5MA 2RC5A 5GJWC 3QGMA 3LX4A 4L5CA 5EHQA 2O6LA 4I4NA 3HJFA 5AJWA 4BEWA 3GDHA 3VDMA 3KBBA 3ORSA 4IVRA 4F9EA 4QYSA 1EHYA 1O7JA 2YX1A 2XT6A 3GROA 3H05A 2OHGA 4OAQA 3UZUA 4BFWA 1LRKA 1FFYA 2KMLA 3V6MA 5CNJA 3FMOB 1PSWA 2IWRA 1DO2A 2VN8A 1E6LA 2PTGA 4ED9A 3IP1A 2VG8A 3MMNA 4OQQA 4GG1A 3FVVA 4CIDA 1KAEA 5J23A 3T99A 3TTWA 4EX6A 3GPIA 4ILEA 1QRSA 1SBIA 1WUKS 4CETA 1EHIA 4FX2A 4C5AA 5E7IA 3EA5A 1E59A 3NNDA 4GI1A 4M8NE 2Q4RA 5A05A 2I2XB 1C29B 4PG7A 4CE6A 1KEKA 5KO2A 5EXPA 4AG6A 1N0HA 1DWOA 1PKEA 4H3HB 4Y1EA 5KKAA 1QRAA 1UAYA 1VJCA 4PSUA 2BM1A 2JJMA 1JTVA 1TJ4A 2BP7B 1CE8A 1H9BA 2X0KA 2UV8A 3HDTA 4LC9A 5LQKA 1KXZA 3TZCA 1QGUB 1QX3A 1XAHA 1C9EA 1COZA 1DARA 2OAQ1 3JR3A 3OE7A 1AGPA 1IXSB 3QH4A 3AY6A 4O8ZA 5FPSA 3N6XA 4YMWA 4CR8A 4FBGA 1GA1A 1RAHA 3VH4A 3NHFA 1Y6FA 5JEDA 4FN4A 5ITZA 4LRUA 2BZSA 2Q49A 2EYQA 2GD2A 2NVOA 2XZTA 1C30A 1XJ0A 4J91A 4P31A 4BN0A 3LT4A 3KQOA 3OM9A 3IP7A 1U3VA 4GFDA 2LCQA 3S4YA 3IAAA 1GAWA 1SBNE 4QPCA 2ZUSA 2X9LA 5B3JC 3CG4A 1B8NA 4NOKA 2DWUA 3RYHA 2BEVB 2NYVA 4QXMA 4G1BA 2QD1A 3NHJA 2XB8A 3BAZA 4LVNA 5B2EA 4JJGA 4OU4A 5J2TF 1K88A 4QGHA 3WMFA 2DY1A 1E2DA 3OZ7A 1FYWA 5DGDA 3WFZA 3HYNA 1FQWA 1TLTA 5JSZB 1L5WA 3EGXB 3LI2A 2Y0PA 4CT5A 1WU7A 3TOCA 3NHBA 4RVDA 1H3FA 2CUZA 4V39A 1O03A 4KHZA 2O2CA 1VA5A 3R9IA 3VTAA 2C7PA 1A5TA 2QYSA 2O06A 1EK0A 3GH1A 3W05A 5KYYA 2R7LA 3FDZB 4W6ZA 2QD5A 5GJCA 4CKEB 5H3HA 4RYLA 1L7DA 1HT3A 1P72A 1QCDA 3GFPA 5BT9A 3RJMA 3RTBA 2Y4NA 1FLDA 3NEJA 3WP0A 1T0BA 2FU5C 4OLJA 4RJTA 1ZU4A 3LQYA 2B2NA 4N3NA 1EFUA 2O2JA 3CTMA 1DBWA 3UMYA 3EGDB 1GL6A 4QJBA 4RVOA 4JJZA 3AHGA 4BC0A 3DOFA 3OOYA 2E4AA 2OFPA 1E6WA 5A9TA 1QO7A 3F49S 1S2GA 4PYIA 4GW3A 3REQA 2JGDB 3B36A 4D9EA 1YBMA 3G2JA 2VDPB 2CZCA 2V97A 1N2HA 4R83A 3KNZA 3DXZA 4HRVA 1MQAA 1HLPA 3OECA 3FFAA 2PZFA 1J6UA 1JJIA 1L4MA 3H0CA 2V3VA 4V1CA 3O03A 1M2EA 4M1EA 4A0FA 2HK7A 1WXWA 1BWSA 3S28A 4X65B 3L0BA 1DTSA 1V5WA 4GC9A 1KARA 1SURA 3LLCA 4P5EA 4Q39A 1V11A 1M2KA 1ZBQA 3TINA 1EP9A 2WVGA 1ZJ5A 3DB2A 3MS7A 1H65A 3P52A 2CL6X 3UWOA 3KJIA 1Z4IA 4KQXA 1EK2A 3RVOA 3HVKA 1RYEA 4PR3A 3WL8A 3U1VA 4D82A 1EFLA 4H4CA 3CUYA 5E1OA 1IB6A 2EFDB 2PUEA 3ADPA 4RHXA 1OYVA 4E11A 1PKXA 1QMPA 3MIZA 1ODFA 4QOIA 1IVSA 3ZGXA 1N5OX 3JALA 5DTQA 1A9SA 1V9LA 4N0DA 2Z0MA 1F6BA 3DTVD 2VHZA 1EG7A 1L4KA 5CCBA 1CF9A 1XB2A 3AILA 3DM9B 1NT2A 2HCJB 3CEJA 3RRFA 3F73A 1ZRSA 5LC1A 3OZXA 2I5PO 3EUAA 2YHSA 1JHXA 2WEKA 3LX5A 1FNDA 2Q3DA 2PX4A 1IB0A 4I19A 5TC4A 3IUYA 2NXCA 1GNLA 3QVUA 3RANA 3WWEA 2LE0A 3FSEA 4F4DA 4LNHA 2BM8A 2YZMA 3LYLA 4RZQA 2YHIB 3FCAA 3EF3A 3S2EA 5TVKA 4D2IA 6Q21A 3G2LA 1XRNA 1AGNA 1Z0SA 2WF9A 3OT1A 4X1YA 5CDHA 3ADCA 1P0MA 2CCJA 2BZ1A 3IQHX 4LJ8A 1H2EA 2RGCA 5AW2A 4G5HA 2AEFA 1U0HC 4K1LA 3K6RA 3EYAA 4JMPA 4QNNA 4XJTA 2BAGA 4DWOA 2ZR9A 2PKWA 3MCVA 2RH5A 1J5EB 4FXOA 3SIPA 1D0SA 1IDOA 1C7FA 2J9RA 2ZW9A 4UTNA 1VQ1A 2W6MA 4M54A 1YKSA 3THYA 1EKXA 1JT9A 1G4UR 4HRYA 3IR5A 4E31A 4R7ZA 3I8SA 3Q7IA 4LZPA 1EUYA 3DFKA 1C4OA 3N8DA 4NONA 3WYFA 5LP6C 3HSYA 1YSCA 3UB3A 4F4FA 5B12A 4CEIB 4KX5A 1G0NA 3U62A 3OE4A 2ZUCA 1OASA 4Q9IA 1GIAA 3UO8B 1W36D 1AH2A 2N47A 3WO1A 3L8ZA 3PXBA 3E9QA 1YB4A 1ORIA 2JJYA 3DP7A 3BGOS 1JE1A 4MV1A 4PRKA 1DTWA 3ANMA 121PA 1Y1QA 4OSOA 3BTUA 2AHOA 2AFIA 1OLUB 1J5XA 2A5FA 1NNUA 4BWGA 1X3LA 3L49A 4Q21A 5K3FA 3ZJVA 3QOWA 3EDQA 3GBSA 4PVDA 1EM8A 3GCWA 1RLIA 5BWCA 5KCZA 3TLBA 5FNZA 2RHHA 2GSWA 4EECA 5CYFA 4MHOA 1W59A 3I62A 4UNRA 1F0YA 2I80A 2X0FA 3KT0A 3GFTA 5THKA 1KH3A 5DH9A 3OU6A 4WKPA 2HA0A 5DMHA 3B1FA 5CT6A 4WNCA 1R0ZA 5IHXA 3LRXA 3I2IA 4RAQA 1GVHA 1E9EA 1KETA 1E2UA 1TZKA 3DT8A 3LU1A 2JJ8A 3MUFA 5LQAA 3H0EA 3TRIA 4BDTA 1Z6PA 3UC9A 2I76A 1U2DC 2ZI4A 1FSGA 1RAEA 4UM9D 2J0VA 3ZTWA 4R1MA 5A5FA 1A5SB 5D3KA 4FFRA 3TDMA 2A1UB 1B0UA 1J20A 3COZA 4TMXA 1Y6RA 1IJEA 2HJWA 3K8YA 4A5OA 1P80A 1DPFA 4DBVO 3AVXA 3N0TA 1H0HA 3TD9A 3TXYA 1F8FA 3DE1X 3F74A 5H7XA 2FUEA 2JJ2D 4NCBA 5ELXA 3H5TA 4R2IA 5IZCC 3H2HA 4LSMA 4HZGA 3MMZA 821PA 2E4ZA 2DQ4A 5HUJA 4AKIA 3HL4A 3FMVA 4KSCA 4CV1A 1XHEA 2QTTA 3GELA 3P94A 4DQXA 1VXRA 4EAQA 2YJ3A 3DEKA 4FMPA 3QE3A 1K7CA 1GNRA 1VKRA 2X42A 3L0IB 3DBLB 4KKVA 4PZZA 3ID6C 1I4EB 2OWDA 4GT1A 4ZI7B 5JSHA 2EG9A 3THWB 2I6GA 1FMLA 2O5CA 3MXOA 1Q95A 2C88A 5A0VA 3F1LA 3EEBA 3L7AA 4YCLA 1SXGA 2JIMA 1RP1A 2M6SA 5A0FA 1NMYA 2FUG1 3KS9A 4YRMA 3LBYA 4GYJA 1HNZB 2Q1YA 2XMGA 3E35A 1GR1A 2HSDA 4MV9A 5DXJA 1YJAA 5EIEA 2XUDA 3Q3HA 3DTNA 1I6LA 4TT3A 1PK9A 1W73A 2XGMA 3JQFC 5KJFA 1MC5A 3CX8A 3PF8A 5CD9A 1DKOA 3F5SA 2ZJAA 3FNBA 5T4BA 5JDCA 1LWNA 2ZIXA 1P2TA 5LQNA 1W2GA 4FSXA 3EGCA 3BGIA 3EOZA 2QE7A 4D8UA 3BB4A 5JROA 5GJVC 3OFNA 2IOFA 5FDFA 4IQFA 2R4UA 4G86A 1ZVVA 1AK2A 3S5JA 1Q19A 1NT4A 3D59A 2IEAA 2UZ3A 1JR3E 2R6CA 2A9FA 3TQIA 1RI3A 4NMLA 3CLTD 1Y80A 3E5RA 3W5JA 1Z5NA 4WHMA 4P7BA 4LX0A 2DLDA 4PHCA 4ZAGA 1GN8A