3AHCA

Resting form of phosphoketolase from bifidobacterium breve
Total Genus 323
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
323
sequence length
802
structure length
802
Chain Sequence
VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
total genus 323
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA01
2WVHA 2JIBA 5HYVA 2JGDA 3EXHC 2G28A 1DTWA 4KXXA 1YD7A 1AY0A 3AHJA 1UPAA 1T9BA 2OZLA 2BFDB 3OOYA 2EZ4A 3HYLA 3M49A 3M6LA 4RJKA 2UZ1A 2Q5OA 3EXG1 1W88A 1RP7A 3AHDA 4KXYA 2BFFB 5EJ6A 3AI7A 4RJIA 5EJ4A 1YHZA 2J9FB 4KXUA 4K9LA 2C3YA 2Q29A 1OVMA 3M7IA 1T9AA 1IK6A 4MPPA 1TKAA 2Q5QA 1X7WA 2BFDA 3AHFA 1OZHA 1POXA 2FN3A 3AHGA 5FEMA 1KEKA 3LQ4A 2EZTA 2V3WA 2G25A 2BFFA 5AHKA 3AHCA 2VBIA 2J9FA 2UZAA 2VK1A 1ZPDA 2XTAA 3E9YA 2C42A 2IHVA 2BEUA 3EY9A 4GPEA 3FLMA 2XT6A 2PDAA 1Z8NA 1X7YB 4QELA 3IAFA 1BFDA 5ESDA 5IMSA 2IEAA 3MOSA 2PGNA 1TKBA 2IHTA 1UM9B 1PO7A 1L8AA 3EXG2 2AG0A 1GPUA 4K9OA 1QGDA 1OLSA 1TRKA 1WCIB 1YHYA 4WBXC 3JU3A 3AHEA 3F6EX 3UK1A 1PI3A 2AG1A 2VK8A 1QS0A 4K9MA 5I4IA 1U5BB 2VBFA 4D5EA 1POWA 2QTAA 1X7YA 1V1MB 1X7WB 4JUFA 1UM9A 2C3PA 5HGXA 1UMDB 2Q5LA 1NI4B 1WCIA 1V11A 2O1XA 1W85B 2VJYA 3ZHQA 2W93A 1R9JA 1YI0A 1NGSA 3LQ2A 2BEWB 1X80A 2Q27A 5K2OA 4GM4A 4JD5A 2C3MA 1U5BA 2IHUA 1V1MA 4MZXA 2BEUB 1UMBB 4JUCA 2PANA 1UMDA 3LPLA 1NI4A 5K6TA 3EXFB 3ZHRA 1OZFA 1W85A 4JU8A 1ITZA 1V5EA 2BEWA 2BFEB 3ZHVA 2EZ9A 2G67A 2NXWA 1B0PA 2QTCA 2XT9A 1OLSB 3EXEB 2R5NA 5EJ7A 3HWX1 1UMBA 1QS0B 1JSCA 4Q9DA 3DVAB 3D7KA 2Q28A 2BFCB 4MPJA 4ZP1A 2WVAA 3EXFA 2O1SA 1T9CA 4KXWA 2BP7B 2WVGA 2EZUA 2BFEA 2JI6A 2R8PA 4K9PA 2C31A 5K3SA 4GP9A 2VK4A 2DJIA 1YNOA 4FEEA 1V5FA 5I5EA 4RJJA 1OLUB 1V11B 3EXEA 3L84A 2Q5JA 2JLCA 1X80B 3EYAA 3F6BX 3DVAA 5C4IA 4FEGA 5ERXA 1TKCA 1T9DA 2BFCA 1PVDA 2X7JA 4C7XA 1OLXB 3EXIB 1UPBA 3FSJX 3OE1A 2BP7A 1OZGA 5EJAA 2R8OA 5EXDA 3DV0B 3AHIA 5EJMA 1OLUA 4GM1A 3IAEA 5EXEA 1X7ZB 4KGDA 5HJEA 4JUAA 4COKA 2C3UA 4C7VA 5DGDA 3DUFB 1YBHA 1OLXA 3EXHB 3EXIA 1UMCB 1Q6ZA 4MQ5A 3KOMA 3EA4A 1PYDA 5I5GA 1V16B 2VBGA 2FWNA 1N0HA 3DV0A 4KXVA 1MCZA 2E6KA 2YICA 3FZNA 4QQ8A 2JI9A 4K9NA 4K9KA 2JI8A 5I51A 1X7ZA 1X7XB 2EZ8A 3ZHUA 5K6RA 1YI1A 2JI7A 3DUFA 3ZHTA 3RIMA 3EXHA 4JU9A 1V1RB 5EJ5A 1UMCA 4GM0A 2BEVB 1QPBA 4QPZA 2BFBB 1V16A 4JUBA 1Y9DA 4GG1A 4MPRA 4K9QA 2C3OA 3UPTA 3AHHA 5HHTA 1X7XA 2YIDA 2PGOA 2JGDB 3HWWA 4XEUA 5ERYA 4JUDX 4D5GA 1UPCA 3ZHSA 1V5GA 2JLAA 1V1RA 2Y0PA 1DTWB 2BEVA 2OZLB 2BFBA 2UZ1B 3M34A 5EJ9A 5DGTA 1W88B 5EJ8A 3LQ1A 5DEIA
chains in the Genus database with same CATH superfamily
4XGKA 3VVLA 3WVNA 4BNDA 2HIAA 3PSAA 1CDZA 2ZUDA 2QLLA 1X8JA 3ABRB 3IDOA 3IOMA 3BK7A 2JFGA 4XB6B 4YMLA 2WYVA 2ACWA 4ZCPA 2X22A 1VGRA 2NO1A 1QF6A 2OXFA 3PQ7A 2JIZD 1IB6A 4UM7A 1S89A 3OH8A 3JSAA 3KSMA 1V4BA 3BJRA 3CW2A 3KFLA 4WKPA 3TAUA 2DR0A 3DYVA 2X76A 4ZOAA 1RLOA 3PJFA 2ZRKA 3NVDA 1Z4IA 3FFBA 3KJGA 4J9UE 2NVWA 4UCQA 2A9FA 5LYYA 5KQLA 3W6UA 1SVNA 1NYTA 3B78A 2EZ4A 2LCFA 2Q6KA 1RNLA 2RC5A 3EH2A 1X9IA 3QV1A 1KO8A 1GVHA 2QN2A 1EUDA 4MWCA 5EIBD 5TVGA 3WBFA 2AVDA 5EMHA 3K4PA 4RCYA 5JNTA 1QQ7A 1SEVA 3PX7A 5KQGA 1F0KA 2FE4A 3EOZA 1XZAA 2ODTX 2O0LA 3KHTA 1PNQA 4X7RA 3EXG1 4TS4A 4ZT4A 1WTAA 5CM9C 2CVFA 2FSSA 4P34A 5J4VA 1BWSA 2B8JA 1FSGA 2VP9A 3G2KA 4TT3A 3D59A 4E1AA 3OM8A 3DDCA 4PC6A 5DXAA 1U8ZA 2DZDA 4UZSA 4F8YA 3FMIA 1BOOA 3M3PA 4IW3B 5B2FA 5KVSA 4EUFA 1G3RA 2XZOA 1TRHA 4BAGA 1J0CA 3GGGA 4N76A 1VGVA 2W43A 1UKEA 2B4YA 2W6NA 1ZD5A 2GEBA 5EVJA 1G64A 2QTGA 1XXHB 3C48A 4WESB 5LOVF 3I53A 1NQ5A 2FZVA 3PPXA 2P40A 1SWVA 2RG7A 4HWRA 3IJ5A 2L2QA 4EZEA 2PKYX 2QNBA 1E5LA 1R0CA 2AIRA 4IQ8A 1JKMA 2AG5A 3QKRB 1M2GA 3H6HA 4JP2A 5ELLA 5I9IA 3IVRA 3CTMA 1IHOA 2VG8A 3H99A 1V9CA 1RRCA 4GSKA 5A9TA 4EM6A 5JI2E 1AQLA 5C35A 1Z2OX 4G1FA 4DJDC 1POXA 1U5AA 3AEQB 3KC2A 3H5OA 2FUG1 3D43A 3AHGA 4QZVA 2D7DA 3BULA 1JSLA 3D1VA 1ZOIA 4RK1A 4QYIB 5J58A 5G0TA 1FJXA 3BFVA 4OB8A 1NBWB 1PQUA 3ONNA 3F71A 2Q21A 4QQNA 3AVXA 3AR7A 1DMSA 1LFDB 3ND8A 3JW8A 3NV7A 1H3EA 1Z39A 4LY6A 1FZQA 2G88A 1NPDA 1JE1A 4PO3X 2M98A 3FBWA 1F60A 3L8ZA 4YRIA 1T0PA 3PZBA 2YH2A 1ISPA 2ODBA 3H75A 3DBIA 4POAA 5CH3A 1O97C 1DQZA 2WIBA 1JJIA 1ZN7A 4L27A 4Z9YA 5IUKC 5IW8A 4C76A 4AX4A 5BN5A 4XWTA 4CDMA 1W46A 1TM4E 3D3NA 2GDZA 4HGRA 5FAKA 2PBFA 4S12A 4JVOA 4BKPA 1V25A 4QFDA 2ZVDA 3EWNA 1U0OC 3NETA 1OE0A 5KAMA 2FV8A 1U0GA 4U39A 3Q3EA 4XTRA 2JH9A 4H6PA 3H1AA 1F20A 3MIZA 2RCYA 3OUUA 1BS2A 3G2LA 2O3SA 2PRZA 4EARA 4CM9D 1Q20A 2R86A 2WM8A 3CXUA 3FJ1A 1Q5PA 1R6AA 2YS7A 1VBKA 4R3UC 2NPOA 3FKQA 4EG3A 4C7OB 1ZUD1 2XNSA 1FPQA 4JCCA 4KXMA 3U49A 3R2JA 3W06A 4DCUA 5CAEA 3AVUA 2IYUA 4XWYA 1DLIA 1ZMBA 2C8VA 4KTTE 2Q1SA 2WRZA 2HF9A 3BXFA 3CPEA 3TFQA 3NBFA 5ABPA 3DL0A 1V39A 3TCNA 2IHTA 2AL7A 1DADA 3LDAA 2CMKA 5F3DA 1XRPA 1L8AA 5ADHA 1HQCA 1IUNA 1DEAA 2FW9A 2VJAA 3KHSA 4MRMA 4RFSA 3RTGA 3WGJA 2UYQA 5BMVB 2RGRA 1B16A 1GN9A 5B1EA 2QS9A 1XG5A 2ZTLA 2CXRA 3GGOA 1XRJA 3JZFA 3P96A 2IVFA 2DP4E 1QHSA 3G2OA 4LZOA 5GGYA 3OFKA 1J1UA 4IY1A 2ZJ0A 1CX9B 1LTHR 2OHIA 3P0RA 3U0VA 4AY4A 1QO0D 1D0VA 1Z37A 3UAVA 4F1KA 2QVBA 3FMFA 1DU4A 4KI7A 4ZKEA 4MR9B 1NPTO 1Q21A 1CUSA 2Y3IA 3T4XA 4WUVA 1PV4A 1YVUA 2ZRDA 1U0RA 4OUDA 1A9YA 4RACA 4ALJA 2Q9BA 3VISA 4KE9A 3AR9A 3CG0A 3PNVA 5A1TA 4LTNA 4C4ZA 1N1GA 1DIRA 4GBED 4ZAGA 5BRJA 3ESBA 3VX4A 3HJFA 3A58B 3C3MA 5FL3A 4MVJA 2RKOA 4ZVUA 1VIYA 3V4LA 1U81A 2YHUA 3D4BA 2HSGA 2ZWOA 3BFKA 4RY8A 5ED0A 2WKRA 4Q9LA 2ZI6A 4B6GA 2AW5A 2FPUA 4ZCLA 4GMXA 3D6HA 2WYWA 4EMBA 5CDYA 3ASZA 2OV6A 1YKFA 5NULA 1EK1A 4HL6A 1UMDB 3MTJA 4KOAA 3KEMA 3KDSE 3U1VA 5CEEA 2HNKA 1FYFA 3RVKA 3RODA 2W7TA 4J3NA 3WHPA 1QYCA 1W5AA 2ORYA 1S96A 2WTEA 1U0HC 5FPKA 5EZYB 2CF5A 4P3OA 6CHYA 4OVKA 1QDLB 3GVXA 4YVFA 3PKZA 3BWEA 3QFCA 2OLJA 2AOVA 3CLVA 3IOBA 1R9JA 4Q4HA 1YI0A 3DZFA 5AW9A 2UVDA 1ZHOA 3LQ2A 3F67A 1QH0A 2GF0A 3C8MA 5C5DA 1CYEA 3ACCA 1DIHA 1Z17A 2GLXA 2Y76A 3B13B 1PBTA 3ROXA 5KNCH 2XDAA 5GZ6A 4TS1A 1R6DA 4JYPA 1UZLA 4DR4B 1U63A 4C3UA 1MH1A 1XFDA 2AE1A 2CFTA 1T8YA 3D7LA 1T4GA 4MZXA 4F2GA 4WACA 1QP4A 3FNEA 3NHMA 2PX6A 3GEBA 3KU1A 4WN9B 3W1WA 5CBPA 2UUBB 3DWIA 5JJKA 1G291 2WABA 4X3PA 1XQ1A 1NP7A 3UQYS 4UNIA 1F4VA 1BQ4A 1T5BA 3ZJTA 3BIJA 1RABA 2PANA 2R751 1QHIA 4ZC8A 4ZI7F 5K8LA 2EGGA 5LWQA 2O8EA 4XLTA 4NC9A 4QVKA 3VH3A 3WB9A 1F51E 1Y7TA 4R0MA 2H1IA 5HX7A 4HAWA 1J2TA 1KY3A 1Z88A 2GCGA 3HBJA 3M3HA 3OFSA 4JLDA 3RKRA 3VBEA 4C87A 1FP4B 1SNYA 5AK0A 2FHSA 2A0UA 2JBWA 2YMLA 4CEJA 5A4KA 3VAAA 2PWAA 1FSFA 4JR1A 4WOBA 4XKJA 4F4CA 4U7TB 3AJAA 3EGXA 1P7YA 4FFPA 3A8TA 2EZ9A 5LLTA 1PJAA 3OPYA 2R00C 1EZ1A 1OX5A 4REQB 1QR2A 4R1QA 1NIJA 4EY4A 5DMXA 5IBPA 1SXJD 1TL7C 4MDFA 5KS2A 3VR3A 3DFFA 2MU1A 2VBCA 2B25A 5FTWA 4ZCMA 5IJZA 4MW5A 4W9NC 3SU8A 4DN6A 3KUKA 5B2ZA 4LGCA 2G17A 3F3SA 2FFRA 4JVMA 1KE2A 3ESRA 3L0OA 4TYNA 4HDRA 4FI3C 2FGJA 3LY9A 4WT7A 3UB2A 4Q9DA 3V34A 1KRXA 4R8MA 3QU5A 3SYNA 5JS6A 3CYFA 2PS1A 3K09C 2Q28A 3COYA 4M0UA 4BOYA 1KOFA 2DBQA 3BXOA 3HRKA 4ZRMA 3IE0A 3IXQA 1VDMA 3EH1A 3CE9A 4L9AA 4AJHA 4HD8A 1H5NA 3R7WB 5C1BA 3H9UA 4YK7A 4YDQA 3OWHA 5HTOA 1FFYA 3AV0B 1P0CA 1UJ6A 1WF3A 3HS3A 1AQNA 3LWZA 1E0SA 1R5OA 4GXQA 1UBEA 4EKYA 4A8JA 2E5FA 5HIAA 3O95A 3ZE2B 1ZO8A 3E18A 4J2OA 3LYLA 4MCAA 1TCCA 1X2BA 3FPJA 4QU9A 4Q3OA 5EXTA 1LPOA 1SBZA 5JSKA 1I0LA 5I5EA 2IU3A 1KY5A 5MF6A 3DMNA 2ZYRA 2B2NA 3EXEA 1E2HA 2YUTA 4GX2A 4M6WA 4ZDWA 1HL3A 1HLDA 3WGVA 1C7QA 1OIWA 3I2GA 4YP5A 1DRWA 2IYNA 3TQOA 4EW3A 3BEOA 4B85A 5AVYA 3LNCA 3BS4A 3CZCA 1PFWA 1W0JA 4DCOA 1E9RA 1S3GA 4F4IA 4J0KA 1ESEA 1ZGGA 4PBRA 2CSUA 2V6IA 1I1QB 5DCYA 2HDHA 2X6TA 5EXXA 5DBIA 2YR0A 3VR6H 2AXQA 4NPAA 1HYGA 2AYZA 3KJFA 2LTAA 2OFPA 3T3EA 4CQMD 1WPQA 3BRCA 4CQNA 4Q18A 3UN1A 3QVGB 2QP3A 1E9BA 1PJ4A 1ZRSA 3C16C 5EMKA 4MRSA 3V4OA 4DWJA 3A4VA 4UPEA 4XCVA 2CHEA 3OIFA 1GWNA 4MKHA 3GROA 3IT3A 4ZMRA 4JXXA 2OLEA 2R47A 1UC4B 4IVPA 4XWKA 2K6GA 3LFUA 3LG2A 2FPSA 4F7WA 2DWOA 2P2DA 1B00A 1E92A 1L5ZA 3DKKA 3NBYC 4IDDA 3DEZA 3UV3A 1GZ7A 4NAVA 3K1AB 1ZITA 3QXCA 5C52B 3R3SA 4RM2A 4E08A 2OY0A 3WMFA 5IHXA 4KKVA 1PZFA 3EX7C 3H9CA 4LC9A 3GQBB 5CCBA 2Q0HA 2ZLBA 4BB6A 16PKA 2DKFA 1UT8A 2C5EA 1DG9A 3Q9LA 5JYBA 2QR5A 3W8EA 2JFBA 5J9FA 1QBKC 1O89A 1UFOA 5EZ6B 3RSQA 5K7SA 3OESA 1E9EA 2VSQA 4TTQA 4OUKX 4IG4A 1EFCA 2OYRA 3RBZA 4BZQA 4DZZA 1Z26A 3LHDA 2EQBA 4EYSA 2D5AA 2IYVA 3N8GA 4JJ4A 2WMDA 3GEPA 3WK6A 3EA4A 2EKQA 4J76A 3UV6A 3WQRA 4DIOA 3NOVA 4NS1A 5DF1A 3ES9A 1S8NA 5FEUA 1W2GA 2J33A 5FORA 2VSXA 4QFMA 1J5PA 1ZC3A 1XALA 1HE8B 5L4LA 3NC4A 4KVZA 2ONKA 3KKMA 3WKDA 1JECA 1NRJB 1SG9A 4NABA 2EP5A 1UP4A 5KNBD 3GZJA 3QH4A 3A70A 4RD1A 2BGKA 2HA0A 3THYB 1PDWA 1MMFB 1WHTA 2YN4A 4UULA 1GU1A 1IUPA 3UFXB 5A9RA 3WNZA 4P81A 2LWIA 4BMDA 4RMIA 5AQ1A 5KOHB 1WCWA 1W8IA 2WM2A 3VR5D 5K8VA 3P9CA 4XWWA 1OFTA 4P4UA 3CCFA 5TR9A 5DNVA 1DAGA 3U4DA 2QMEA 1NJFA 3T7TA 3AY3A 2JFZA 1X7XB 2ZQ5A 3VPBA 4PU0A 1EK6A 2QTFA 1B1AA 1CLEA 3D6NB 1X74A 2I5PO 3EMBA 3BRWA 2OBXA 3M4NA 4Y2GA 1T4DA 4D9HA 9ABPA 1KI4A 1UC8A 1T34A 3IT0A 3HCNA 3OF3A 3ZHTA 3GGSA 2VRWA 5BOSB 5KNLA 4FSHA 4MIKA 5M2QA 3CH6A 5DN6D 1UMCA 4JB2A 4RE5A 4MKIA 2DTEA 4X7PA 4L5CA 2Z6AA 4Z49A 4Y3UA 1VMEA 4QPZA 4GSLA 3IB6A 3JQBC 1UR5A 3JQCA 4RSRA 2C4UA 3LBYA 4UARA 5CH8A 1NWHA 1QC5A 5GP1A 2P1RA 3Q8XB 3REFA 1GSHA 4F2PA 3RJ9A 4ZCIA 5IHPA 2AQKA 4DMHA 1SJ9A 2R87A 5JMOA 2F3QA 1VZ3A 1YC2A 3GFPA 4OJTA 1PFKA 3KBOA 4GZ5A 5FPPA 2IBMA 1JR6A 1GQYA 1NPYA 4XVHA 1P5JA 1WNTA 2J0UB 2N46A 4RVFA 1SK9A 1LDYA 5T67A 1QOPB 3WMWA 3FOEC 2IYQA 2NWQA 5AKZA 5JW6A 3OOWA 4DVGA 1J0DA 1XEXB 1ORIA 2QLTA 3QEOA 5TPWB 3QUTA 1DKUA 1VHJA 4HLQB 2W4MA 2B1RA 4HWOA 4F1JA 1Q0RA 1ZFNA 3F6CA 3KKEA 3OCXA 4J94A 4Z7QB 3HWWA 2QX8A 2FEOA 4TL8A 2FEPA 4IXMA 4DG8A 4BECA 1C1XA 1KPHA 1D6NA 5B4TA 3R0XA 4HAUA 4B47A 2JLAA 2OTCA 1KI2A 1V2HE 3GF4A 2NU6A 3GLTA 3IBFA 5EZ5A 3ECAA 1PRYA 1V1RA 3LYUA 1JHDA 3TI9A 1Z07A 3KDPA 3LTEA 2J0SA 1OXVA 5TARA 1NW7A 3B1JA 3ZHBA 1AIPA 2ERXA 2JJ2A 3ORSA 4AJNA 3GPBA 5HJ2A 3U40A 1X2EA 3IUYA 2HQSA 1D1SA 3PPIA 1TAGA 1XTJA 4JEHA 4B46A 4BV3A 1E89A 4MUBA 1W88B 5LZ5A 4F56A 3WDMA 1UMKA 1A2QA 2ADOA 2K87A 3B3JA 4MRPA 5BV7A 1T6XA 2ZWVA 1BJKA 2PLAA 3K1JA 3L7NA 3QOXA 5DEIA 4JI7B 4MKXA 1SQ5A 1FRNA 2C04A 3QLUC 2GTIA 3KQHA 5LA6B 3ESQA 5CX4A 1LPAB 2YXLA 1Q6YA 2DTXA 2QUZA 4GBGA 4HWGA 4UMFA 4A0SA 2OBYA 3H9JA 3L4KA 2IY9A 5H70A 1I4DD 3UKJA 3MLBA 4NK5A 4D9JA 4MI1A 1GNPA 4PWYA 2HQ1A 4G5RA 4UHKA 4DILA 3MC1A 1RADA 1HO3A 3KT8A 5HK8A 2DFPA 3BMOA 1SCNE 2WE8A 1GGJA 4HZUA 3PYXA 2O8NA 3FYUA 1MJGA 4KHPB 5A2GA 5IWCA 2ZTVA 3O75A 4A1OA 4AB1A 1R74A 1FFHA 3HWRA 5IUJC 4FQ8A 4C7BA 3NTUA 3A1NA 2I6QA 2VNIA 3GDGA 4ZCRA 1YBAA 1RHKA 4GDMA 1GRQA 1OXMA 1NKTA 1PFQA 4JL5A 1IVSA 3VV3A 1VSVA 2ZRBA 3T4UA 4OLHA 3COSA 4RJKA 4B73A 3PQDA 1SY7A 4HO1X 2E48A 3IPLA 4KAAA 4L9RA 1V4NA 4YRFA 5DULA 5KHAA 4F6RA 5J23A 2WBLC 2BOVA 3IQFA 1H6AA 4B6RA 3K9CA 4MV4A 4MTCA 4RIHA 4A92A 4Q00A 2B5OA 5TIIA 1L3CA 2ZI9A 2O8BB 4KXYA 2Y05A 5EJ6A 3AI7A 1DWQA 3BQNB 3OY7A 3V3KA 2IHKA 4DTCA 1X15A 2VF7A 1IQPA 1L8QA 2YKGA 5K0EA 2FN7A 3NWOA 1J1ZA 1G8AA 4LISA 4C0WA 1H23A 2GZDA 2Q07A 3UY4A 4RDXA 1DBPA 1NATA 3VKFA 3J81A 4PHGA 4LJ4A 3GLGB 2P77A 4EB0A 4AY2A 3CZAA 1J2EA 1RBYA 5DGXA 4NARA 1C30A 3AR2A 2Q5QA 4TLDA 5DPMA 4D4JA 3VKVA 4LJRA 1MVOA 4JB0A 3TJRA 4FLMA 3GAZA 1TGVA 3OLCX 1ECGA 4BO2A 2Y6UA 1JSZA 2FMIA 2QG6A 3EN0A 5M7EA 4GLLA 2G1AA 2ZBPA 2C2WA 3DVQX 5B6IA 1TAHA 2D1FA 1NW9B 1Z5GA 4PQGA 5DW3A 3RVLA 4TYQA 4DCVA 3TIIA 2QI9C 2F3TA 2XTNA 4ND8B 2H4WA 3TIVA 4J0HA 2PUFA 1DBVO 3LLUA 3P9YA 4UUQA 4PXAA 5IBQA 3WMGA 1K2WA 2O0KA 3VDQA 1NAIA 1U6IA 3ACBA 5JECA 1NUUA 3MCZA 2G9VA 5IVPA 4GZ3A 5C1IA 2W9XA 1UH5A 2FYTA 4FW8A 3I9JA 1E0AA 3HTXA 2NUAA 2CB9A 3JQGB 1US8B 1NJ6A 5FNVA 1W93A 2GHRA 4NV3A 4XGNA 1LLDA 1OSNA 1KVQA 3G0GA 3ITNA 1C0PA 1BVUA 1TYEB 2Z04A 4ZO7A 1ONBA 4AMYA 3H2ZA 5IVDA 4MQFA 5ITZA 4XM2A 1CNMA 2FR8C 2ETVA 1F8GA 1XRSB 3UW1A 4EHFA 2A7XA 3KR2A 4RLQA 1UJBA 1JJ7A 2JNWA 2C57A 4D0GA 2CK3A 1YS1X 2P9YA 2VJKA 2XT6A 4FFRA 4NJEB 4RO0A 4XYLA 4Q7JB 2IXFA 2RGCA 3V9AA 3BSWA 3NRJA 4CETA 3WGIA 1WBJB 2PMKA 4FCWA 4P4SA 3LDFA 1S3FA 5EWLB 1Z8NA 4BGVA 3C1OA 3JAMA 4L6CA 4CNBA 5B37A 3QEJA 4GWGA 5CYFA 3ZWWA 3H17A 4K40A 2KS6A 4N18A 2JIQA 3SR4A 2EJTA 4F3YA 5HQ3A 4P0PB 1H0RA 4AKIA 1KKUA 2DBYA 3UMRA 4ZVMA 1S7GA 2CXUA 2CW5A 2D2VA 2J5XA 2VWGA 1R0RE 5CX1A 4E2XA 4EJSA 1M1XB 4XGRA 1Q1NA 3HB4X 4TLLB 3NKFA 3HYTA 3TNDA 3UO8B 1NJ1A 3SEAA 3HKCA 2ZB2A 3UAXA 2OXCA 3E9MA 5K2MA 5HMLA 1XWIA 3PQFA 1XVUA 4GLJA 1A8HA 4R1PA 3WK5A 1BA3A 1DXHA 4AYTA 4Q6WA 2HADA 4LOIA 3VC3A 2A3RA 4B3MB 3UMBA 5K9ZA 1U0TA 3A28A 4IIBA 4CR7A 1I2CA 5T41A 1ZA2A 4WCVA 5F5XA 1PI3A 3R8CA 1XCJA 2HLHA 5LXTB 3R7AA 3GRPA 1PR2A 5KYXA 5JZMA 4YECA 4I50F 5IJ0B 2IUEA 4BKRA 4G85A 4AP6A 3R9WA 4XIGS 1KZ1A 4XD7A 2Z3WA 3FHLA 4PLZA 4YMSA 1Y98A 1GUBA 1NT4A 4MV7A 1DTEA 4OQQA 3LI2A 4IVQA 4B71A 3D64A 2F7SA 4MJ3A 2XIQA 2W2KB 2HZBA 2VAWA 2Z2IA 1I0IA 4K7JA 3A6EA 3T1QA 3G2JA 1TF5A 1N78A 4Q7KA 1DV2A 2H4FA 3K3PA 4G1CA 2HEGA 4G9GA 4JUFA 2XUIA 2PX8A 3REGA 2Q3JA 2QN1A 1C1DA 4R2LA 1N34B 4JBIA 1F8FA 2D2IA 2H8GA 2IP4A 4GHWA 5LU9A 2E3JA 2WJGA 1OGJA 3F4BA 3MJTA 4PFSA 5B3JA 3J80A 1B74A 1Z0AA 2G3YA 3TDKA 2GEVA 3QVJA 1GGVA 1QZTA 2O1XA 1R18A 5B58C 2G9QA 2NO7A 1ZNYA 3M5CA 4X1IB 1HTBA 2P9JA 3FD8A 3SC4A 4YUYA 3D7RA 4ZHQB 2V8BA 4C6TB 3K6JA 3JWPA 2V6FA 4JJ6A 3QEMA 3AR4A 1A8IA 4EJFA 3KQNA 2BSAA 3R5SA 2YHIB 5JD5A 2Z2XA 5SYAA 4Q24A 3AKEA 2APJA 3MD0A 3FXAA 4GXNA 6ADHA 2IXAA 3MVEA 4XPIA 4TRNA 2C58A 3I8OA 4XDGA 4D8YA 4DEYA 3B12A 4DQVA 3CCCA 5IZCC 1N6OA 3A9SA 4G65A 1JR4A 1UAYA 1HYBA 3OCJA 4L8VA 4EG4A 3DA8A 3IGFA 1RHUA 4UC0A 1PZGA 5AYVA 2NSHA 1BS9A 5EUBA 1E3QA 3PXCX 4ZI3A 1ORTA 1YZKA 4TS9A 1E9AA 2WWXA 1C7ZA 4H0CA 4HGYA 4II3A 2UZ4A 5GPBA 3K70B 3MG9A 3A32A 1Y81A 3RU3A 3EXFB 5IH7A 1N7GA 1E5TA 1RJWA 2FDXA 2XQKA 3B5JA 4EB8A 4ABTA 2ZB4A 3NIGB 1CCWA 4IJWA 4E07A 1S8AA 1W85A 2PT6A 4GZLA 1QTNA 4QQFA 3VNUA 1MJHA 2HSEA 2X1HA 1KF0A 2ZB7A 4HYEA 4N8DA 4Y0VA 4RV4A 2RHOA 5FPQA 2OK8A 4KYIB 4S2UA 5AKYA 1SG0A 1HMYA 3TZKA 5I9SA 5AHOA 3VPHA 2C4VA 4Z53A 1Y3AA 2YL2A 4LJYA 3WA7A 2VRCD 1TIKA 1I32A 2XITA 1JKJA 2QXTA 2WJZB 3DPUA 3MTIA 4L76A 4E32A 4AO8A 3CRNA 1H3NA 1BS1A 2ABWA 3NTRA 3WE7A 2C9BA 2DFKB 1ZN2A 3EEYA 4X66B 4AN4A 1EBFA 2BBOA 2HBYA 2QRMA 5EI5A 1CUGA 4YGYA 3THWA 3IKJA 4JBGA 3S1AA 4JN6B 1RQNA 1QRUA 4ISCA 4XSVA 3FNRA 1NE7A 3D2BA 3ETGA 2XWPA 1U0EA 1IEQA 4ZJPA 3GUUA 2GZAA 3GHYA 3T7JA 2BJHA 4ZGWA 2Z1NA 3ROGA 4OX9Y 1MN6A 3FB1A 1Z0SA 2PT7A 1TA9A 5AKEA 1K7CA 4KLNA 4BMZA 3MXOA 4RENA 3HGMA 1L1FA 5CDTA 1ADCA 3R3WA 4E11A 1DXYA 2W6JA 2EOAA 3M5PA 4YP6A 1AGXA 3OX2A 1FNBA 3EVTA 3L9WA 1K6EA 2QRVA 3JQFA 2R8PA 2VZEA 4FZRA 3LDHA 3P9SA 4XH9B 3SSNA 3BERA 1Y5LA 4IWXA 3UAGA 3D6TB 3JRXA 4UMVA 1AA6A 2RAVA 4LNUA 1EQ2A 2QZSA 5ERGB 1E77A 3UTDA 2G9ZA 2A92A 4HQ0A 1S2LA 4WNCA 3L84A 5KJEA 3MIIA 4TSFD 2JASA 5LL6P 2XCRB 1MZVA 2JVKA 4RKQA 3LCJA 5JBNA 2Z2ZA 1TJYA 4OSPA 1SBIA 2V7EA 1LX7A 2O05A 2C2YA 1P9OA 3SSAA 1OASA 3BCSA 4JNCA 4E0BA 1FQKA 1P80A 1MB2A 2CT8A 1LRJA 4Y6PA 2W6CX 1SB9A 2G8LA 1AZLA 1CZOA 3CWZA 3H5TA 1P7VA 4Y9TA 4X6YA 4QPNA 1HFKA 2A58A 2R5WA 2QLMA 2WA1A 1BX1A 3R5FA 1QJCA 5HJ7A 1Q84A 2JKZA 4V1CA 1FLVA 1TNDA 2GJKA 5ECDA 3FGZA 1ZH8A 2ZSEA 1Q1GA 3L8MA 5BSMA 5IKXA 2O20A 2MTBA 1T2NA 3KTAB 4OXIA 3QWAA 5B1IA 4QUDA 5ALLA 1UDBA 1T8RA 5ETJA 1E1KA 1HYEA 1JKIA 1SM4A 1YH3A 3QMVA 4OF4A 1VECA 3K9LA 2RGNA 2X5XA 3PQ8A 2V03A 4YRPA 4F9FA 2P90A 3I5AA 5CM2Z 3V1TC 5BQ3A 1QF9A 4GM1A 4M49A 3G3EA 4TL9A 2ADMA 3R8XA 2Z4TA 4DLNA 2CMHA 2R8YA 1Q7TA 1PLLA 1SQFA 3SX4A 3V33A 1MXHA 2J07A 2W58A 3WGQA 4B32A 5BT8A 1GTSA 3H4IA 4WBNA 1XJ5A 1SKYB 1YONA 4HH0A 1EI9A 5IS2A 1D4FA 1WULS 2RSLA 3O1HB 1T3GA 3LYHA 4NCKA 1U2DA 4G5HA 4HNGA 4C0XA 2D5LA 4WOJA 5BMOA 4LQ4A 1XVIA 2ZW9A 4N5IX 4TTAA 4UAJA 1P29A 2IA5A 1B3BA 1Z8HA 2I6SA 4JLMA 1GHTA 2PYIA 1FX1A 2BLLA 2X2OA 4H4CA 1YB5A 3UPUA 2CLLB 4US2R 3V8QA 1PYDA 1VB3A 4HNQA 4Z3DA 1XZIA 2I29A 2I34A 4DAOA 1HZZC 1KI6B 3VU1A 2VHZA 4N5NA 3AF0A 2ZAYA 3IS3A 4HQNA 1R64A 2HRDA 4Q15A 4XOIA 5IYZA 3ZDYB 1ZJZA 3OMXA 3AM5A 4P7JA 3OU2A 4KREA 1Z0UA 1ZM3A 2VRNA 1MCZA 3QOYA 3BF8A 2FU5C 4GLFA 5B1HA 5KYTA 5TJHA 4G24A 1OAOC 5K8CA 5SZKB 2J3DA 2EFHB 3JALA 1FK8A 1STOA 4IQGA 2UUCB 1D2NA 2FRVA 2NXEA 3BTOA 3E03A 3KJZA 2RB5A 5CT4A 2PUDA 3LE8A 1AO0A 4HMOA 1VPWA 3ANTA 5A9SB 1QIEA 4NL4H 4Q1EA 1Z4MA 1N5DA 3QYJA 4C1NA 1WSBA 5K6RA 1E2NA 3NDIA 1NBMA 4U0JA 5TEVA 1DIBA 1E2QA 2DFVA 2VDUE 3W5AA 1H1LA 1P8AA 5KX5F 4CR6A 3O8QA 4AQ7A 3DAFA 3I6ZA 5KKNB 4PZLA 2ACVA 4TMVA 2ZWPA 5ESWA 2VXOA 4ZI5A 3WFJA 1NN5A 3DLPX 3SQNA 1CF9A 3D3KA 3KPJA 3D4LA 4I55B 2YW2A 1Z5WA 3DEIA 1IUOA 5DHFA 3RJTA 1D07A 5FO1A 4IJ5A 2PSJA 3D31A 1R6TA 3HCRA 1LS6A 2QZPA 1GEGA 4EA6A 1P18A 2R6AA 4LOAA 1EAMA 2JLRA 2XNHA 2X3FA 1TI7A 2QL5A 4HWSA 4RS3A 4XW2A 1KWKA 2ZI4A 5LR6A 4RHEA 1YFJA 5KI6A 3ZLJA 4TKZA 5CDFE 2H2IA 4A0HA 1EZZA 1Y82A 3UA3A 2OCIA 1B76A 4ISBA 5HTKA 1Z7EA 2WAMA 3ZQ4A 3MK31 2IE8A 3WGGA 1CUVA 3BSSA 4M8KA 2WWHA 2GF2A 2C94A 2LP4Y 3P4XA 2HBRA 2QAGB 5LBTA 4P7GA 3SC6A 3V2GA 1Z2EA 1JW9B 1V1JA 1YCFA 2I1LA 4DV5B 1EINA 4BVBA 4C5BA 1CUAA 4IEEA 5EIAA 4XX0B 1JV2B 5JPCA 4UCWA 1XR3A 4CMAA 4PBSA 3NTVA 3D6FA 4TN5A 1DJOA 4B35A 2EBFX 4RH1A 4BJ6A 1O97D 3FSRA 4B4UA 1DTWB 4O4JB 3K0SA 1GZHB 3C7DB 4EAQA 3VPSA 3LUHA 1W5SA 3Q7IA 2E82A 2Z5LA 3FFAA 3TL2A 1GDDA 3D6MA 1QRDA 2V5VA 3HNRA 4F3CA 2J0VA 3PE3A 5B7QA 5HPYB 1XPJA 5SZIA 3WLSA 3GUYA 2PMDA 1A97A 3R77A 4KDEA 5ED4A 3GMSA 4J7AA 1G5TA 2WUVA 3E1KA 3IR7A 4HUQB 1O0CA 1M7GA 3B1KA 2TMDA 3IV7A 3VFDA 3TRDA 3A4IA 3RYIB 3C7CB 4BUZA 1UBOS 3ZK8A 1NP6A 2D62A 1IULA 3DZBA 2QRQA 4GOOD 2X1LA 1IMJA 4FFOA 2NNWB 2GSWA 1U80A 3I76A 3EFBA 3SHVA 3SZRA 2B0CA 4IV5A 3MFQA 1CJVC 4Q1AA 1JI3A 2B92A 2C9OA 3MCVA 5DGHA 5AOBA 3ZCTA 4I9NA 3PQ6A 4HDKB 3ZNPA 3P20A 3IAXA 2IEIA 1BA2A 2PJDA 4E2YA 2JHGA 3FHOA 1MZPA 5DLQC 5A3RA 4DMFA 3LHIA 2VJPA 5F3WB 4URYR 3S2YA 5DTRA 1PZNA 1TYDE 4QRHA 2F8MA 4CCYA 3LZDA 1DQRA 1UPAA 4GPZA 3P2OA 5IAJA 1GUDA 2VUSA 5ALZA 5E6UB 4BMSA 3HZRA 1PL8A 3DV2A 4CM8A 2FF7A 2WPNA 1TM7E 1ZCJA 3B7WA 3MTAA 7REQA 1IATA 2LZ0A 3AW9A 3T3MB 2D1TA 2NZJA 2FK7A 3FIJA 3HEBA 3FTCA 4ZFNA 5BMVF 1P7WA 1ZP6A 2FPGB 5I7WA 3CINA 1EFDN 4I81A 4CKWB 2YVQA 5THQA 3C3WA 3FX2A 4LFCB 1L4NA 5A2QA 2HA3A 2SKDA 1HI9A 1ATZA 5FOWA 4F2DA 2ILVA 2NGRA 1Y5MA 4G89A 3PYMA 2CXNA 1YZ3A 4PPNA 2C4TA 2CDAA 1ECLA 1CZUA 5JDCC 4CWAA 1LD3A 2FOIA 3BZBA 5CT8A 5AJZA 3HUUA 2AJLI 1EFAA 3KB2A 1MT3A 4FKMA 4KXUA 4TPKA 1KFJB 2C3YA 3OZSA 4WZZA 4NYJR 4REMA 5HE9A 1KDTA 1YS2X 2QL9A 3W4JA 3UJ6A 1EUYA 3MZ0A 5I8PA 1YS4A 3ZE9A 1SQ0A 2QT1A 5AVQA 2IDKA 2RK4A 3JTMA 5K8TA 4MVJM 1XMSA 1VGQA 3RGWS 1I94B 4PZUA 5L4NA 1EESA 3VR1A 3FYHA 1NVFA 2Z9BA 1DBWA 4EHIA 3CLTD 5A6SA 3HXMA 1YB1A 5TY0A 2CKDA 1QK3A 5JD3A 3MS2A 4BZPA 5J5AA 1NZDA 1C9NA 3H2KA 3T5BA 1EXDA 2D1SA 1YRBA 3C7KA 4OPMA 5DTIA 3H5NA 1U65A 3GPCA 2M9MA 4RTNA 3A4MA 4AFNA 2R8EA 1U7WA 3IO5A 1FBNA 4KR7A 3COWA 4IG9A 5LZ8A 5DIFA 3COVA 4PCVA 5ALVA 2P2GA 4NLLA 5KOJB 1TUIA 1RJ9B 5EZYF 3S2EA 3W3AD 1YDMA 1C1HA 1PWZA 3DMRA 3PWZA 3E84A 5IK2A 4V39A 3E22B 1Z7WA 3QU4A 4M55A 1QNLA 1E7YA 3DOJA 4PNEA 1M0EA 1LGYA 2O6HA 3HUDA 2QQEA 3IBTA 2ROQA 1TA0A 3I9NA 3SN6A 5KDOA 5ITVA 5K4GA 3EEFA 1NWCA 4TT8A 4UM9D 2ESRA 3UWPA 3IJEB 2I67A 5KMGB 1WXFA 1Y80A 4ME6A 4CXMA 4UDNA 4KN8A 3E3OA 4WOPA 1O95C 3VMMA 1O6ZA 3FZQA 1EEHA 3KTDA 3WXBA 1J21A 1PT5A 4QJ4A 1MIOA 2XEXA 3RS2A 1I8TA 1BO6A 3LHKA 4WN9A 4OHWA 2BGTA 3JQ7A 1J09A 4MVJI 2FSGA 3H86A 3SQXA 1KH3A 1T8SA 1QGZA 1TK9A 2W00A 2RBEA 2GBLA 1FDVA 3AU9A 1ECBA 3LXMA 3IDZA 4WLOA 3NHPA 3D8TA 1GR0A 4PCAA 2ODNA 5F23A 4I46A 5FV7A 3CE6A 4AL4A 5HE8A 3HUFA 1B41A 2VYVD 4Q9HA 3WYAA 1Y7IA 1N5MA 3P5BA 2WYHA 4DDHA 3ZVMA 2ECQA 4GQAA 1HBJA 4J4HA 4LRSB 2W98A 1GPWB 5CEFA 2PWYA 3DDUA 3K2QA 3KT6A 3NCTA 4KV9A 4QLBA 3RYCA 1DBIA 4HX5A 3UXHA 1PO7A 2HZ7A 2GM4A 2B2XA 2QW0X 3OFJA 3SQMA 4DA4A 1J8YF 5LP6B 5I8ZA 5E8JA 2WV9A 4NF2A 4Y2XA 1R5BA 1QV9A 2XCUA 3TQIA 1TLFA 3GRRA 1Z2DA 4JBLA 3SICE 3AFHA 3B6ZA 3KXPA 1ADGA 1YVRA 3KT3A 3ICQB 1XNGA 1M1NA 2REBA 2DFLA 2EG5A 3F6EX 1GNTA 3EVZA 2HMAA 4G1BA 1Q2XA 5EKUA 4EHAA 4YCMA 2OC4A 2NSDA 5FUBA 3R76A 2ZSJA 4EY3A 3N6VA 3E3MA 4TVOA 3KKLA 1TU3A 2MOKA 3EZLA 3FDZA 1PGOA 1EVJA 1SPXA 1JA9A 2VEDA 3GW8A 3KG2A 3TJZA 4G0XA 1KI8A 4MW7A 1E32A 1U5BB 4TX1A 5H3CA 4AZVA 1Z6XA 1YQQA 4GO1A 3S7TA 3JTEA 1QHNA 4C4PA 2VYND 2YHSA 1MUUA 1XDZA 4PAWA 4AU1A 4LF7B 1QCCA 5EWMB 3QKSB 1PEAA 2J6IA 1ZH4A 4RQBA 3KSRA 1C8LA 2QRGA 4YPVA 4JGIA 4ENRA 4MEBA 4G1MB 3G9QA 3UAZA 4AN1A 3FLAA 1FZTA 3OIVA 3UMVA 2PMFA 3ASYA 3Q3VA 1RIFA 1L4UA 1M1YA 3DTVB 2OHVA 4TQUS 4X3OA 1R8SA 5FXMA 5I7EA 1KYQA 1RVV1 2C7VA 3G0OA 5EUMA 5M3BA 2FFBA 1I24A 1ZGHA 3M6AA 3MJCA 4G84A 4QRIA 5E6RA 1N3IA 2BJVA 4CKBB 3IAM6 2CLHB 3GDOA 1J22A 2VLIA 2WJPA 3KCNA 4D8TA 5IT9A 2WU4A 1A82A 5ES3A 1E7MA 3NXKA 2KLHA 2R79A 3Q85A 2FN4A 2GR9A 4ZAWA 2EF0A 1P9RA 1Q7BA 4JMPA 4FGUA 1PJBA 1YJ5A 2E18A 1LRLA 1F7VA 1AKYA 3NLLA 4I3HA 3AUTA 1V8OA 2CVZA 4Y2SA 4COOA 3NBQA 4EKDA 1P39A 1LDEA 1QV6A 2VHWA 1D2GA 1EVQA 3FUXA 3GELA 5ADVA 3VA7A 1T2UA 4LYAA 2IK8A 1FXSA 2HB6A 3NT5A 4FD2A 4IIFA 3LMKA 5EP2A 1H2XA 5TVKA 1JXOA 2XX3A 4NCAA 1BC5A 1L7EA 3N74A 2AI1A 3RF6A 2ZYTX 4EI8A 2PD6A 1AKTA 2Z4RA 3NYQA 4UJ5A 1Q19A 5D00A 3PWKA 3S3TA 1RCTE 4D9CA 4BASA 5KTNA 5MFPA 1ID1A 2E85A 2JIRA 3R5TA 4MPTA 3H19A 4KIUA 2CJYA 2R8ZA 3C4QA 1KU6A 3M4YA 4F9TA 3DEHA 3WLAA 2Y2VA 1V35A 3GB9A 3F2IA 3VPXA 2RI0A 4EW6A 1LSOA 2CHGA 3DFMA 1U98A 1HFWA 1FU4A 1UPUA 3QI7A 4QTTB 5GOZA 3TQSA 2FN9A 2XYGA 2BPOA 5EHXA 1NVAA 2PRKA 3FF1A 2PKRA 4IMJB 3LSYA 4PCUA 5G40A 4H7FA 4BBJA 3LU1A 3IIJA 1QO9A 3HUTA 5T6MA 4DDKA 3I5XA 2ZBUA 2FW6A 3V4PB 4AJKA 2RK3A 1MOZA 4REOA 2C88A 2XCLA 1V45E 3B1VA 4ZANA 2XWBF 1PYGA 1QG6A 1CRWG 1DEHA 3PBKA 1DRVA 3EIXA 3BZUA 4YDRA 2RIRA 4KACA 1GCIA 1L5VA 1NUSA 4MO9A 4TTJA 4E3ZA 5BQFA 4U2GA 4BZWA 8MHTA 1HNXB 1NUHA 1J6UA 2V6GA 3AJ8A 3TR0A 2V0CA 3PXXA 1IQRA 4KLZA 5J2UA 2JDID 3ABQB 3GG2A 2GCIA 1UMBA 4H0NA 2O7NA 3QPBA 4YRNA 3OCVA 1WMAA 1U4SA 1ZEMA 1MO5A 1U4NA 3A4YA 4GSYA 5I7SA 2FPRA 3LK6A 5CHYA 4HX2A 1FA9A 3E5NA 1NQVA 1RXEA 4PANA 4LCBA 1HORA 1XZNA 5ECYA 5LDGA 3RVNA 4DYVA 5I01A 1N2SA 1BJRE 2EYQA 3L4JA 3IUBA 4XA8A 3UFXA 3AR3A 4MIEA 4C0KA 4U9UA 3ZWVA 2QJTA 2HD4A 5EYPB 1I2ZA 2JI4A 3JD2A 4J7XA 1NY6A 1JFLA 4UD6A 5F2EA 3GT3A 1YUNA 1I4WA 2BP7B 2YRFA 3UCFA 3I1FA 3OU7A 4LXYA 3DBHB 4KK3A 1CR1A 3TD6A 3O92A 4C4YA 2IOYA 2ZCUA 1O5TA 4UQLA 1JFSA 3JZDA 5E0KB 5KVVA 3K6RA 2M2IA 1MIHA 3MRSA 1MABA 3KB1A 4QEZA 4WSOA 4YUVA 3U1TA 1KJ8A 3A6FA 4J2TA 1V5FA 1KNXA 3G9XA 5EE5B 4Z5XA 3U5ZB 4B2YA 2M6LA 5ER9A 2PAAA 1DEKA 1VRWA 4H4DA 3RAGA 2JGRA 3OZIA 4DG9A 3G5LA 3HB0A 4R4JA 5H4GA 2DCMA 2JJ1A 1V8PA 3KUXA 3PDIB 4YHBA 2HMUA 5GGXA 2IX9A 1NVMB 1KORA 4KE7A 3C5WP 1DC8A 2ZVJA 2FE1A 4V0SA 1UANA 3QBDA 4QICA 2VZ9A 5C4IA 3E9ZA 2H00A 3FPBA 1DG1G 2JRLA 1IZYA 4KPUB 4P92A 3TIGA 3WRWA 4KFCA 1GDTA 2JJ8A 4FNOA 5KAPA 4M99A 3INYA 2ZIXB 3FOWA 2JGFA 2AFHB 5L3ZA 4MW0A 4F2WA 5HUHA 2J0UA 3L6OO 4IS3A 2ZROA 4J49A 3TW8B 2WP0A 1UODA 1A8PA 5EJAA 3EZ7A 4D0LB 1UM8A 1Z8DA 4PLHA 2DETA 4GNKA 3U9TA 1P2VA 1R0YA 5K3FA 3LX6A 1AF4A 4BHTA 3MHTA 1K2VN 3F97A 1AUQA 5HSGA 3Q3GE 4MUYA 1WD5A 2NP7A 4KR0A 5HA5A 1OC2A 2FUKA 3OQIB 4MUXA 2OEPA 5D3MB 2PUTA 3K15A 4ZEOA 4OYLA 5K8IA 2HTFA 4Q34A 4PSUA 3RVPA 2NAFA 3EMDA 2HK6A 3KETA 2DEUA 4J3FA 2VSNA 4LE2A 1YBMA 3EOBI 1RM0A 4B34A 4LF5B 1JMVA 2H5IA 5MN5A 4L5YA 2GYVA 3EGEA 4HB0A 2BRUC 3TO5A 5K6AA 4RABA 1YE8A 1O57A 2WJ4A 3MWJA 1O2DA 2UV8A 4UXJA 3V7YA 3AB7A 4NYMQ 4F5WA 1QGUB 1UBUS 2Q8PA 4TKLA 4DZRA 2B7CA 2PJUA 1BWQA 4E2ZA 1E2FA 4G41A 1Y89A 3UAYA 2XKJE 1FP6A 3HRIA 1D4AA 1YDEA 1VSTA 4GL2A 2WTNA 3P2YA 3H16A 5LA6F 1A50B 4W5JA 1P5HA 2W4IA 3STVA 3DLBA 3PA8A 4XEHA 3UWKA 3ZQKA 4AAYA 5AUNB 2C9CA 1QVAA 5K8JB 1DNPA 4JQOA 2TMGA 5L3QB 1WP4A 1ZD8A 3LL4A 4TKMA 3Q8KA 2ZAMA 1CR0A 1MJGM 3WX0A 1C41A 1BE8A 7GPBA 5TMPA 4I2VA 3IP7A 2CXSA 2XJ4A 3K70D 1XQWA 1G6OA 2J3LA 1D03A 4IGAA 4QO8A 3ENQA 3BWVA 4FJ2A 2QG9A 4S1OA 3WZ2A 1RZRD 1PJZA 1G18A 1UP6A 2EZ8A 2I2XB 1GKIA 2QX4A 3UMGA 4RZSA 5JDIA 2Q3FA 4K86A 4UBJA 4QDTA 3IPCA 2GPBA 2OBBA 2F59A 5EGNA 1TVKB 2H2HA 3AL3A 2XJ9A 4WEQA 2H2GA 5L3VA 4KODA 3AILA 4PRKA 4G5SA 3MM4A 4Z3OA 5FTKA 1GKKA 2GAFA 4EO4A 1OU4A 2Q8QA 3TLYA 1I36A 3NZEA 2YDXA 3I4LA 1JRLA 3MQ2A 4HVAA 3O3MB 2DC1A 1KDRA 2JF0A 4C1BA 4Q4CA 2F3SA 2V7UA 4U7JA 4N47A 3ZU4A 1U0FA 5FAXA 1EIWA 3I83A 5FOTA 4YV7A 5JALA 1P19A 3OIDA 4G23A 4EGFA 1PN3A 5F1PA 1JFFA 1U2SA 2XSZA 3JQQA 4DBZA 4C3OB 1UJ5A 3OZAA 4BLVA 5B5SA 5DNUA 4N3CA 1KC1A 4PO1A 3OT4A 1Z82A 2ET6A 4G5OA 4QAQA 3KE9A 3ROTA 2V6JA 2IS1A 4UAUA 5LCXA 3PFFA 3KSBC 1AU9A 1CWUA 1J9EA 4PS0A 4HYQA 1QP7A 2AOUA 3IO3A 2SNIE 4MR8B 5JLJA 4QA9A 4RSMA 2YIDA 1H9CA 1R3UA 1YE5A 2J4CA 4OXRA 4ZTZB 3D7SA 1W0KA 1RWOA 4QBTA 2Z57A 4OKSA 3ZLUA 1A2BA 3AGQA 1V9SA 1RR6A 1MF7A 4NR0A 2FQYA 4ROTA 5LC1A 3ZHSA 5JAPA 3MERA 5AI8A 5T4EA 2AI3A 3DO8A 3F90A 2XCSB 4G9EA 3BMNB 3PVCA 1BRTA 3O7MA 3WJAA 1IN7A 2EJUA 3I2YX 4O2AB 1S5PA 4ND8A 4ZOLA 5ENVA 4A7PA 1O6CA 2GERA 5BWMA 4B76A 1WV1A 4O8ZA 5EE1A 1L3IA 4XCXA 3MHPA 4N3NA 1ZHHA 2GD1O 2DHRA 1XQ6A 2QXUA 4K26A 4XYEA 1BE1A 1LY1A 1V43A 2ZU0C 1B6SA 4K6HA 1XU7A 3GEHA 3RC7A 4GVXA 4J1TC 1VKJA 4G0PA 3PQCA 4ANFA 4QBFA 4UDOA 5AM4A 1DWPA 3OEHA 2ZATA 5BSWA 1ENZA 1E3SA 3DDOA 1UFVA 3M70A 5LP6A 1TW2A 4EY8A 2Z8XA 2CLOB 2X8AA 2W2VA 4L0DA 1IN1A 1SVUA 2BZSA 3HY3A 5DKFA 1I2DA 2Q4OA 1M67A 4NK4A 1AHHA 2HHCA 4RD4A 3G0BA 9LDTA 3B70A 1CDOA 1M8GA 4PLYA 4UPVA 4L4ZA 4QFBA 2ZUTA 2R6ZA 4YUZA 1OBHA 3MRTA 5HOEA 4W5TA 3MTEA 1S2OA 1IBMB 1E3DA 3KE8A 5FYQA 1YOBA 3OQ1A 3CLSC 2WSSD 4BJ3A 1ZCAA 5EHQA 3CVUA 1RQGA 2DF8A 3MBIA 1ZXXA 2QL7A 2FW1A 1AXRA 2OBMA 2BFMA 2QRUA 1R4MB 1Q91A 1T9ZA 2X15A 1CV2A 1GOTA 3MT9A 2HSWA 4I4TB 3WNVA 2C5GA 5CFNA 1PSWA 4QYMA 4E6PA 2V59A 4ZYTA 5IG2A 2WSYB 1YZHA 1DOAA 2O7SA 2PXAA 4AJ2A 1U8TA 1V7QA 1EFUA 4I4CA 2XUAA 1DO0A 3RS7A 3IVMA 3EUWA 3LO5A 3ZY6A 4GNRA 3KS9A 1LPNA 4JQZA 4RZ3A 4PN3A 1UBFA 3C2QA 1L5SA 1LFAA 3TRKA 4WKBA 3FCOA 4DUGD 4HR7A 2ZBQA 1OROA 2G04A 4AZ0B 3LOPA 5AOAA 1RP7A 2VP0A 3TL3A 3IFSA 2W2MA 4C20A 4WKOA 3K20A 4F96A 3WHLA 3W6PA 5IZ4A 1Z3CA 1L6RA 5FBLB 1TO2E 3G7NA 3U39A 1Q50A 3LYAA 5J4LA 3SF0A 3HXTA 2JFXA 4PRZA 5HIMA 4DQUA 2PK3A 5KWVA 1YHZA 3O8NA 4ESEA 1JEJA 2Q7DA 5P21A 2RHJA 2QDKA 2Y2UA 2IHBA 2R9VA 5K20A 1U9IC 4A2CA 4Y2VA 1R8XA 4E5DA 4JGGA 3STYA 2VP5A 3QKIA 4BFUA 1WMBA 3BTSA 4MINA 1KP9A 4E22A 4XFDA 4D98A 5KTYA 2ZBDA 1WVMA 3B60A 2BWJA 1LV7A 2F43A 2UXCB 4PPGA 2OSBA 1PSDA 2C96A 2D2EA 2JHCA 1DQPA 2QKYA 3ICWA 2ZZMA 4LZPA 3T5MA 3PP8A 4GMHA 2PZJA 3PGLA 4DT1B 8ABPA 1OFIA 1J06A 2FN3A 3RYHA 3QE4A 5B2EA 3OZWA 4DUYB 2VDWB 4KNVA 4A8HA 3DFZA 1UFRA 1KDZA 4BPRA 4TYYA 1L7BA 4IOLA 1PQPA 2RGYA 1USIA 1P4HA 4DABA 4GYKA 4R8SA 4DYDA 4AUKA 2C8KA 2FPLA 2G71A 4L75A 3AEKA 3FTNA 5FO0A 3UYLA 4ZALA 5KCMA 4ETWA 1KP3A 1CB7A 1J7JA 1WPGA 4P22A 4QBKA 1EUCB 2BISA 4N03A 4YJHB 1JH8A 5JS7A 1FU7A 1IBSA 3A05A 4V24A 4ZHQF 4B3GA 2FW0A 4ZREA 1EEXB 4YEDA 3LNTA 2UZAA 4BP1A 3JX9A 4C6TA 2CF6A 1GPJA 2Z8ZA 1JR3D 4NBTA 1W5BA 2QQGA 2ENWA 2MHCA 5L53A 1ACMA 2IT1A 1P2TA 1VYUA 4A3SA 1XD2A 3GH3A 3KP1A 4RIGA 4HKTA 4LE1A 5INTA 3AUXA 2IHVA 2FMKA 4JC5A 3KLNA 1PGQA 4I1VA 1G8SA 3DNPA 3GLHA 5H5JA 3U4HA 3UMFA 3ZNNA 2CJFA 3PEEA 1L4HA 2Q41A 1WDLA 5HVNA 5E9WA 2RGBA 3W6OA 4FMPA 1PT8A 4AMVA 5HRUA 3FLMA 4YMGA 3NOXA 4HBGA 1J8MF 2X4DA 4HQOA 4Y6QA 3JYNA 3TUIC 2JGMA 1RU3A 4BO5A 2RC6A 3R44A 3AWIA 3UC5A 1LZLA 4G63A 2OHFA 1N2EA 4G37A 4L16A 2ECKA 4GMKA 2CJXA 1YOVA 3CWQA 3HFRA 5IM4A 1NF8A 1QWSA 3NASA 4L0QA 1ESZA 2J09A 1PR0A 4URFA 3E5MA 4A6EA 3EDOA 1OPXA 3NBAA 3HDVA 3EOAI 3HMQA 2Z3ZA 3AY6A 4L08A 3SS9X 3Q3CA 4NYIR 4EF4A 3QE3A 2QMUA 1PS0A 3FMGA 4OHZA 3L6EA 1OF1A 3KSUA 3V4FA 2AW3A 5FA8A 5BXQC 1LB1B 4KXNA 4D8VA 3GMIA 1T8TA 1ZMTA 3NWJA 1EE9A 2HRBA 3LWBA 5JVDB 3ZPXA 5C5EA 2ZYHA 1XDUA 1NLZA 1RLUA 2PSHA 2XNDD 3LBIA 3QTBA 4ND4A 3UK1A 1FPMA 1YB6A 1AURA 4B84A 3TQCA 4BVJA 5F2NA 1CP3A 1JSRA 1QHYA 1SUWA 1U1CA 4TUYB 1O08A 3TZCA 4CM9A 3KSZO 2BKXA 2WYIA 1Q44A 5B36A 4FCTA 4RPJA 1H8ED 3WFIA 5KKAA 2X6RA 4L15A 2DTDA 1USVA 3HR4A 3NDPA 4I1RA 1BDMA 1Z75A 1H85A 4A73A 2O48X 1YU6A 3PCRB 2IUYA 3VPDA 5K3EA 3GRCA 2IF2A 2JGNA 3BD8A 1PK7A 2WFAA 5B1DA 5TS3A 4F93B 1M2JA 1J23A 1OFGA 3JAKA 2P9ZA 1A5ZA 3TR5A 3VJLA 1G4AE 2NU7A 3ZW8A 4DMRA 2QU8A 2WM3A 4PZYA 2I0FA 1QH9A 5AI5A 5DT2A 4MHOA 5A62A 1KHHA 2XUOA 4H3VA 5GM1A 3N2GB 3MOIA 4KVAA 2QJFA 3VUFA 2EJCA 3N3BC 4M0MA 3WLOA 5D01A 1QOZA 4LDJA 3KXDA 1MH9A 3LPNA 3P9NA 4FZJA 1BXGB 1QO0A 5DXFA 4Y6GB 1N3BA 3BXHA 1YDGA 4HQRA 3L82B 4PYKA 3EPJA 1X0XA 2HAEA 3G8DA 3KZMA 2X0DA 5UKDA 1PGPA 4TMWA 3AG5A 5LNK1 1MNQA 3QVVA 1WIWA 1WR8A 4BC0A 1NR5A 5CXUA 4DWOA 5K09A 1LUAA 2AZXA 1WCYA 4BQPA 5HCNA 1JPUA 3EVGA 1BMQA 4AVYA 2PS0A 1DAHA 1IFXA 2JVJA 3LKDA 4EJ2A 3U60B 1DOHA 2A5GA 4MJ7A 3TUZC 2PT9A 3ZTWA 4P9NA 3OO0A 5DYWA 2NTEA 3M8KA 4DSNA 3AFMA 2GEJA 4CG2A 3WGKA 1RWVA 4NCJA 4OJMX 3HR7A 1LC0A 1NVVQ 2YVKA 3NALA 3QXGA 5FOUA 4CT4B 1GGMA 3P1JA 4OGLA 1XZBA 3Q3IA 4JUCA 4P84A 1IIRA 1YCHA 2PO5A 3W79A 3WLLA 2GN4A 2P3SA 1L5GB 4JYZA 4NCXA 3FPLA 5TXGA 1DE0A 2JIOA 1XJCA 3DCJA 3KTAA 1L4LA 4TXNA 5FWYA 6PFKA 1MV5A 4A8PA 5IFLA 5EWJB 2C8JA 3SF8A 3ZCQA 1CYDA 5BURA 1OZFA 2QRLA 5ISMA 4FUTA 4QDKA 4UNPA 4Y7DA 3DOUA 5JQGA 2PUWA 2PX4A 3HB5X 3LIPA 5IT0A 1E5DA 2IHJA 2YNMC 3OO1A 3QVSA 4W1RA 3DF9A 1PUXA 2AMJA 4G5YA 1M2NA 3UT5A 1RKQA 1LBTA 4FK8A 4NONA 4BFXA 1JLMA 2BFEB 2GPWA 1U2GA 1ZOLA 3BF7A 5JU6A 3DB2A 4H7JA 3RKUA 1FQWA 4ZT5A 2J3IA 2EEPA 2E1PA 3MMXA 4AWXA 2ZSKA 1JP7A 5FJIA 4I99A 1YXMA 5KWIA 1N0VC 4GDFA 2BM0A 3QBTA 1LPMA 4ND6A 3KV1A 4IO0A 4AJEA 3OF2A 5EIXA 2ZYVX 2EXXA 4LC0A 3C1TA 4CJXA 1KEUA 1TYAE 3FTFA 1U7UA 4IQ0A 5KHOC 3GRVA 2GBFA 4MGIR 4GX1A 3RFCA 2Z0MA 1KI6A 5CVUA 3A4TA 1XO1A 3SHTA 1OA1A 2QENA 1HPLA 1HM5A 4KSBA 3PQ2A 1U99A 1B6RA 1ISRA 2Z08A 2Z58A 2EDCA 3OJFA 4PZ0A 4DLTA 4F04A 1W7AA 1NBHA 1NUPA 2O2HA 2YQ4A 4RD6A 4U4AA 4V1CI 1T0HB 1G8HA 1JAIA 5GIPE 4PXSA 1Y4AE 2D7JA 2UKDA 4QVGA 2X3YA 3JPWA 1A9XB 4L1KA 4B6PA 4EOGA 4UVIA 3ZUPA 1XX6A 3EIEA 2CZGA 4BVEA 4Y2HA 4EFLA 1RIIA 3IP1A 4GRIA 5P8WA 1RHMA 2PN1A 1GZ5A 5HF6A 3TUJC 2IQIA 1UADA 1GPNA 4XJSA 1CDDA 4LW8A 5BRNA 1PGNA 1SXJA 2C31A 3BIOA 3C3JA 1UK9A 2DFDA 2P9TA 2WYUA 2QTZA 1W52X 2Z2KA 2AWOA 3H97A 3R0JA 2SECE 1UXOA 4GP9A 4H1WA 5AUPB 5TDHA 4UBLA 1I3KA 2XMQA 2GUWA 1QFJA 2HRZA 1NF3A 2N1MA 4I55F 1QTRA 1ZQ1A 2C2KA 3R3VA 1S02A 3ZX5A 4WOCA 5AJUA 3WHIA 5KWJA 5EFOA 5HOQA 3DE4X 1DJQA 1NHWA 3HB7A 2JPDA 3IUEA 5JJLA 1R0KA 1QHHA 2ZXFA 5FPYA 4EKEA 1A7JA 5H83A 4M7WA 6LDHA 3D6VA 1OZAA 5H1YA 5EZQA 2GKSA 1YASA 3DVAA 3GRUA 4M9QA 2OXTA 3RHSA 4EMUA 4IMIB 1EH5A 4FEGA 2P69A 5AJYA 1EJ2A 3K2EA 4B8YA 4KRFA 2BFCA 2PFKA 3C4VA 2XOXA 1EA7A 3OHPA 1JAHA 2AJCA 5EJEA 1CQJA 4TVKA 1NVKA 4WNIA 3VHLB 2X4GA 3CY6A 1B8PA 3U4GA 3MJEA 5AVTA 2X4LA 1M34A 1P17A 1YJCA 1RYYA 2XMBA 4G56A 4YFVA 1X70A 2RHMA 3TBHA 1K8ZB 1P9WA 2CKMA 4CLEA 3FWZA 5EXDA 1JXAA 3JYOA 3R0VA 4M9XA 4O3FA 3T6KA 3W5UA 5H68A 1LPPA 2G07A 1OX4B 2HIGA 3DV0B 3I0ZA 4ND1A 3STWA 3KLBA 4XX0A 1KAEA 3UGKA 5CTAA 1TT7A 3HXOA 2P41A 4B6FA 1L7NA 4MR7B 3T9BA 2A0KA 1EFVB 1LVGA 4D0RA 4O4JF 2XUJA 4Q05A 4X8OA 2BSQA 4IS2A 3L7CA 5AD1A 1YR2A 4LSMA 1X7ZB 1O94C 4H7DA 2GEDA 2JFPA 4WLUA 4B40A 2ZDQA 1NV8A 4NWIA 4Q19A 1VCNA 1LK7A 1GGHA 2BZ1A 4IFTA 3IMFA 1P3JA 3QA3E 4QYWA 2BGUA 4YBRA 4C5AA 2VTEA 3BB1A 3FH0A 3ZWXA 1Y8QB 3DUFB 4UXHA 1ZKMA 4X00A 1J0AA 3FM9A 1JLRA 3OKCA 5JRDS 1OLXA 3VU9B 3E8SA 1V6AA 1M2WA 2O0JA 5H82A 2J87A 3EEQA 2CDRA 3HZOA 4LF8B 1FXWF 3F6YA 3H11B 3R9IA 3IIKA 4Q3BA 4PZPA 1BDIA 1U3FA 2ZRMA 4IO1A 5REQB 1Z0IA 3A1SA 3DEKA 3H0CA 5U9CA 3ZI4A 2DR3A 2TYSB 2HXGA 1EJ6A 3EZXA 1QQAA 4HDKA 3BE4A 3LP6A 1E9FA 5CBKA 3ER9A 1AB6A 1ZJ5A 1WD7A 5AVOA 5KU7A 5I7VA 5JMWA 2FPXA 3EZFA 4MW6A 4F86A 1Q95A 4OA5A 4PC3A 1RM3A 2C54A 4JLNA 1J7KA 1GP2A 1GGFA 5AK6A 4TYPA 1MNAA 3V42A 5KSOA 1Z4KA 2PL3A 1JQDA 1ZNXA 1C4OA 1WUTA 1SHLA 3OZXA 4I5IA 4XGIA 5LFAA 4TKUA 1XZQA 4AW9A 3V8RA 3EVBA 4KE8A 2C2HA 4C0BA 4I2NA 4X90A 3OG9A 3S7ZA 1OW3B 3QY0A 3SP1A 3RIMA 4A5SA 1DAFA 1QU2A 2XMDA 2X0FA 1RJEA 1I5RA 1BDBA 1SCIA 1OBVA 3OQ6A 3G9UA 2OC9A 3OZFA 4NX2A 4U3JA 1KEWA 2LDXA 3BFPA 1H2ZA 5KNBA 3LX8A 3TSZA 1G6HA 3TZEA 1C8BA 4DSOA 1C2TA 1XZCA 5HKBA 1SXGA 3LQQA 3EQ6A 2EAUA 1YQEA 3IHWA 4GG1A 4HH1A 1OR8A 4RZXA 1UT5A 1Z16A 4BFTA 2XTZA 3UICA 1D7AA 1ESDA 4I9FA 4U8HA 2AN1A 1DBQA 5U4XA 3ZVKA 4UQOA 4I5FA 4UVDA 4F3TA 2AEEA 1UDCA 1MXFA 1TM2A 2HCTA 1KS9A 1LBIA 1UP7A 3O1JC 1HRKA 1NMSA 4I0WB 3SYTA 3UWSA 5DW0A 4ZD6A 2W6ID 1FUIA 4IXTA 3QLJA 1DKNA 1EWTA 2CE2X 4Y6LA 2P9FA 5F4ZA 2VT7A 4C7KA 4RV9A 3CPHA 1LQUA 2PGXA 2MJLA 2CMDA 4Q9NA 5JI3E 3RAEC 4XEUA 4JLOA 3TCKA 10MHA 4QUKA 1GNSA 1V5GA 2E0IA 4LUCA 4WKCA 4ZJYA 4HAIA 2Z6VA 5ICEA 1RCFA 3CVOA 1U8UA 1XGKA 4M54A 2V45A 1RJ9A 4N82A 5ADWA 3RSSA 3R8FA 1ACLA 2OHGA 2TS1A 1KQFA 3O9VA 1Z3IX 1HF3A 1QM5A 4KB5A 4EUEA 5KTTA 2W2XA 5CM8B 4OD0A 2V7QA 3SWWA 5AVRA 3FOBA 1HQDA 4F4HA 1NMQA 1FYWA 4Q16A 4KAFA 1H0KA 4II2A 2HRCA 1FLAA 4YT2A 3I9LA 5EJ9A 3KVYA 5DGTA 5HFAA 1A04A 3KQYA 2BW0A 3VVCA 1PTJA 1KK1A 4R8KA 4OSOA 5KMGA 3ECSA 3CRMA 4PY2A 4CLXA 4IDPA 3GBSA 3OICA 3ORYA 4IKPA 1M5RA 1PU2A 3LO8A 1R6XA 2GILA 2D0DA 2Q3CA 4EY6A 3RS3A 1BSVA 1XQ9A 4F3NA 2Y27A 4RF2A 1E99A 4HEA6 1FYVA 3OZTA 1N2HA 5TNXA 3X44A 3D5QA 5F73A 3PEUA 2WWGA 3FW1A 5FQOA 1KKLA 2B8NA 4L4RA 3SZUA 4EHNA 4DA8A 1Y1LA 4URXR 2ZSBA 3CN9A 5DNCA 4MB2A 3ZGYA 1FMTA 4M1QA 3I0MA 2WF9A 3QZUA 4IOJA 4E88A 3IP5A 2G28A 3KLMX 1ARZA 1HEUA 2CJWB 2DKOA 5DHSA 4TMZA 2H4XA 1VBFA 2OGWA 3HJHA 1BOFA 2GJ4A 2O3RA 2ZU6A 3I8SA 1ESCA 3TVYA 5CCEA 1NMYA 3HCDA 4BU0A 2OPBA 5FTJA 5C9ZA 1XEWY 4MDHA 4LJ6A 3LL7A 3LUGA 3E9QA 3PPYA 3THXB 4OX9B 1N33B 5IC4A 2ZWAA 1LJLA 1U8EA 3ANYB 4IMPA 1R0BA 4MLDA 3W6NA 4DKJA 2XKKA 3O0DA 3KT0A 3USZA 1RLJA 3LX5A 4OHBA 3V1MA 1K5PA 3Q9SA 1QCZA 2I7TA 3OVMA 4O2BF 4RPGA 4YP9A 3KJXA 1XL1A 1U28C 1T35A 3GVHA 1V8BA 4FP9A 1G8KA 2CHQA 3GUCA 1A1VA 3ENKA 3EISA 3V6LA 4IR7A 1L5YA 3ZNOA 2GN1A 3OQBA 5L8VA 2OFOA 2PA3A 6REQA 5DH9A 1JB9A 2JLXA 1ZD9A 2CC2A 2J5KA 1ZOOA 4DNFA 3U62A 4EG1A 1D7OA 3HXPA 4K9LA 4RYDA 3DE6X 4GI5A 4D3FA 2ZJ8A 2W0SA 3NO4A 4BZZA 3TMKA 4CN9A 4IUBS 3D4IA 3GGDA 4EJ6A 4ZC1A 3OJOA 3DZIA 5L4SA 3ADKA 1IK6A 3MWEA 4MPPA 1XZMA 4M9RA 3RK4A 3L7KA 1HNZB 3ZUGA 4RKYA 2I91A 3BZWA 5BSKA 2FKAA 4RVUA 4LHVA 4D0NA 5JH7A 2GPTA 2BFDA 3IPRA 1E1YA 3S1SA 1XU4A 3AC0A 1CUBA 3OJ0A 2ZJZA 1F06A 5AIBA 1T3HA 2XVMA 4DRXB 3AJ9A 4P7FA 4WCFA 4LTMA 1J42A 1KYIA 1NXTA 1UJ4A 3LW8A 1A2OA 5AT1A 3WSTA 1RPNA 4YP0A 2H2DA 1UWCA 3ELYA 4PAMA 1WZIA 5LMCA 5AJHA 3T9FA 5FNZA 3I2KA 4FB5A 2RGGA 1ISGA 1BWRA 3AFGA 3BAZA 3MWDA 3OFND 5HF8A 4Z9BA 1KO1A 2XNCA 3AF5A 4ZT7A 4Y0AA 3W2HA 5I7OA 2ATCA 3DPIA 3SIRA 4KR9A 2NOAA 3FNQA 4JI8B 2C0PA 4Q37A 4BVAA 1GXSB 4EYOA 4I08A 2OORA 3JQEA 3ZH2A 2EW1A 2I7CA 2VH5R 4FBMA 3PVSA 4F5ZA 2C42A 2IDMA 2OO5C 3DHEA 4AMUA 5GJBA 3NGMA 1HL7A 4I36A 4PEVA 5L40A 4LVCA 3NDJA 2FOXA 4O5OA 2NADA 1YBFA 3QHPA 2B4KA 4J16C 4PSDA 3L1UA 2H31A 3W7VA 1KQOA 1R4NA 1MB4A 2H9YA 3SJZA 4CMEC 4O0LA 2CLEB 4IIXA 3RSGA 2ZPUA 5A7FA 4ENSA 2P3LA 3PJGA 3GLFA 1WUKS 1ZISA 2A7QA 4KR3A 1ECFA 1K3UB 1O4WA 1MX5A 4M0DA 3SR0A 1WY7A 2JCVA 1UZMA 1XK6A 1XHEA 2XVAA 2IELA 3HNOA 2CXTA 2PX2A 4Q0MA 4D97A 3SHQA 1D2EA 3TLZA 1O9HA 3KELA 1QYRA 4I1SA 4ILEA 4X1YA 4K9RA 3VKHA 4G81A 1IUKA 3ICPA 3X1DA 4C7MA 1P7ZA 2W83A 4FFSA 2E7ZA 4KIGA 5JCPA 5J5CA 3PQ3A 2WMNB 2WU0A 1QXSA 4TZ6A 4G86A 3FZEA 1XLTA 2P0AA 5WRFA 2ASEA 3RRFA 2ZR8A 3N9IA 3CUKA 4G0ZA 1V37A 2J5RA 4M89A 4WWHA 4WX2B 3ZKWB 2AEFA 1DJPA 4D45A 2F9FA 4O6VA 3DNFA 3WL8A 3IOEA 4FYIA 2HF8A 1X1CA 2PBLA 1L5RA 1P5RA 5FWNA 4UTXA 3GARA 2DBZA 3ETHA 1HLGA 4R81A 3VZRA 1R8JA 4OQPA 4AQDA 4YN3A 5CPFA 3VH4A 2AG1A 4B3TB 1BCRB 2ORVA 4NG5A 4A6PA 4HBZA 3G23A 4XSGA 3D3WB 3MJRA 2WHPB 2AFRA 1VXRA 4H16A 5KX5B 1TIBA 2HJHA 2R97A 3FPSA 1NY5A 3R75A 3QITA 3VDRA 2QZ4A 3LQKA 2BM1A 4DADA 4ZAZA 2CJPA 4MWBA 3RVJA 2WD7B 1FUUA 1VMKA 2BEJA 3HZHA 1PJQA 4BNGA 3AR6A 4EGAA 2H6EA 4C89A 4EG0A 3LXRA 4LPKA 2GASA 3HP1A 3E1SA 1TVEA 4F72A 5BW4A 1Y1KE 2HCFA 1X7WB 3C74A 1RWPA 3CX7A 3LRTA 4V0RA 2ZI3A 5BQPA 2QGZA 2QVYX 1UWVA 4R31A 5LP1A 4CEIB 1YZTA 1BXKA 3QPUA 1L4MA 4WKNA 1B1CA 5JEDA 3PR3A 1N2BA 1TIPA 2H8KA 5JC8A 4CCAA 3IR5A 3BHMA 4R8LA 1Y5NA 3ZDBA 1A5AB 2OAP1 1W2WB 3JATA 2IOFK 2ZITA 2VZ8A 1X86B 3ICCA 1I7PA 4JSRA 1JLLB 3BH6A 4LECA 2PRIA 4X8LA 3OF5A 3JWJA 1NGSA 3PDIA 2C7QA 3FCUB 5H81A 2FEXA 3LLMA 5HWSA 5DNEA 5GONA 3W4KA 2FX5A 4KEAA 2HLNA 4QYTA 4XARA 3MEQA 4QOIA 5C8YA 1M6YA 1NVGA 1ZM4A 4HTFB 3O03A 5GADl 3JD1A 4KJXA 3E5RA 2GPAA 1OVGA 2Q2QA 3IEKA 2EWWA 2FPKA 1H66A 4MXDA 2JK0A 5AHRA 4YXWA 3JR7A 2HJWA 3F8SA 1N5OX 4ENVA 3ZBTA 3BC1A 1XDBA 1PWXA 3NAGA 3PI7A 1RKVA 3DLAA 2J6CA 1IQ0A 1BWPA 3HE3A 1OFHA 1XZDA 2I2AA 3PNOA 5AWFC 3OSUA 1OB5A 1N3LA 5E7JA 1GL9B 1KR5A 2O9JA 4OYYA 1GZ6A 3MJSA 1NNEA 4YR9A 3NKLA 2IIPA 4LY0A 3PT5A 1U11A 3O4VA 2X5NA 4ZCTA 4N5DA 4Z4FA 4JC8A 5FIUA 3HFGA 3OURA 2I1WA 1E6CA 1I6KA 4RZHA 3UB3A 3VTKA 4AT1A 1II9A 3Q15C 2WTBA 4H1HA 1V5EA 1NA5A 4E12A 1WZNA 2Q5IA 1GQRA 1O4VA 3IX7A 2I3GA 3L05A 1L5OA 3ONEA 4PCLA 4RDHA 2YXNA 4QXMA 4QUBA 4YJ2F 3SI7A 1D4ZA 3QLEA 4ALIA 2VYFA 2WILA 2ZRAA 3AEUA 2IZ1A 2VDQB 4DLPA 1YS6A 3H3XA 4PX2A 1QGUA 4MS3B 3UWDA 2ZRHA 2GZMA 5J2TB 3C8HA 3WGYA 4FN5A 4IGKA 2C0QA 3B7GA 2JFFA 3L1VA 4FMCB 4GOMD 4M88A 1Q16A 5JADA 3C6KA 2XGMA 1WBDA 4AZWA 4M53A 1YE3A 3DJFA 1XTKA 2HOQA 2G4CA 2VJLA 1IM2A 2RHBA 1LK0A 1NXWA 2ZREA 3FHCB 3O4RA 2ZT5A 4LV5B 4O2LA 1QS0B 2OV4A 2R1ZA 3ISTA 3Q3HA 1ONOA 1FJHA 2H63A 2R96A 3DV9A 2PGIA 2YJ4A 3FRJA 3UM9A 1K4YA 4KCGA 3B51X 5FB3A 3VZCA 3ZZNA 1KZYC 3EDMA 3PPVA 5MGNA 4LOHA 4AQYB 5C37A 4UFOA 2X8WA 3E9CA 2UDPA 2WVAA 2L82A 1VKRA 4OK3A 5IBCA 2NYRA 3BN3A 3E3AA 3CUSA 3OTIA 3P2KA 4KX3A 3CU5A 5EAIA 3D6AA 5BWOA 2YXEA 4MRAA 2AEMA 2NUPB 2VRCA 4WQMA 2BTOA 1PVVA 1NRWA 4O4IA 2ZAOA 4PS1A 3N2ZB 3QFSA 4ZVTA 3D4OA 4P5DA 3SE0A 2CFCA 1IN6A 1IOWA 4JB8A 1UIRA 5EOVA 3RU9A 2GM9A 1N75A 2R4UA 2VCYA 3SEQA 5ICSA 2O59A 3LLCA 1M1ZA 5K0BA 1OLUB 1TC2A 2GNPA 2ZIVB 4F1WA 3UOAB 1T2AA 2CY0A 1MO4A 3Q8WA 4UUOA 1JU3A 3WI7A 4DXDA 1P9LA 1XRLA 1ZJYA 2VPTA 3QU9A 2TSYB 3DPSA 4MX8A 2ZS9A 3RSLA 3CKKA 1JQJC 3I6IA 3CF0A 1Z28A 2HA5A 3LC0A 4B7AA 4CMIB 3QA9A 4CN8A 5JFGA 2FWBA 4OOFA 3DC2A 2QPOA 4M1OA 1XLVA 2XDQB 4IOMA 4X84A 3RT9A 2E87A 3ZY3A 2VAMA 2ZOSA 3L8FA 4WMLA 3GP8A 5AI4A 2LW7A 4C7XA 4QHTA 3NKVA 3PIRA 4URUR 1PJ2A 3PF9A 2O1WA 4XLZA 4X6XA 5F21A 2XF2A 3NAZA 2WAOA 2VTBB 1Y0BA 2NW6A 2B2CA 1Y33E 4G5QA 4B43A 5A6VA 3OCYA 4QGGA 2A86A 2KBFA 3GRKA 3IEIA 3EAGA 3FGOA 3KTOA 1ML3A 1X87A 2GAAA 1KYWA 1YRAA 2I4OA 3CQ9A 2P2YA 4MR8A 5E2IA 4Z4CA 1KWGA 3G9ZA 2OCBA 3T52A 4F4DA 5AHXA 3CRW1 8AT1A 3BICA 2GA8A 1S2DA 3EASA 1TCAA 4WASA 3WL7A 1DV1A 1EA5A 4N8EA 1IK4A 4O2AF 1WEHA 3N8DA 1J9ZA 1ISJA 1G8JA 3WADA 2WFLB 4NNOA 2DB3A 1ECJA 4LBVA 3ZKAA 5KWEA 5CVEA 5JAUA 2YC4C 1ZK0A 2UAGA 5A4AA 2Z6UA 3AIOA 2AFIA 1NC3A 3HU3A 3IQEA 1DXOA 1APBA 2XQGA 3HABA 5F33A 5TS2A 1UK7A 4LBZA 4UCFA 1RAHA 1D4OA 3H1GA 3O84A 4MKFA 3UAWA 3EXHB 2XXBA 4MQEA 3TSCA 4D7AA 5JXWA 3CLSD 1C7EA 1CUHA 3FBGA 4NENB 3SS8A 3ZE0B 4F4JA 1N6LA 2P6UA 4NZPA 4KXQA 2GXUA 2HLPA 4LEIA 5I4BA 4XJTA 4R05A 2WJYA 3ZV6A 4L28A 4YMVA 4IILA 1Z4NA 4I1UA 3OKAA 4PZEA 2VBGA 1D0IA 3RRNA 2PA0A 1LS1A 1V5WA 4KNWA 1CB0A 1NHGA 1KARA 4M22A 3HY4A 4O02B 5SV2A 3QMPA 2A5FA 3HM2A 3T4EA 4WGGA 3JQ8B 3QU7A 1NXSA 4EQ6B 1JIQA 1KMHA 1JIXA 5FUWA 5DRYA 2D06A 4K9NA 4I4TF 3V55A 1H94A 1NYRA 5EC8A 1M72A 1AXGA 3L7IA 4C4XA 2PO7A 3C5CA 2F67A 3M4ZA 4Z8YA 3TNJA 5JASA 3KYBA 2NTYC 3AESB 5DLEA 2I99A 4R54A 2JEYA 2DT5A 3N1UA 2CDBA 2WHRA 4RFVA 1I4OA 1OBFO 1UBRS 2OXEA 2B21A 4Q82A 1JZTA 5DN9A 3AK4A 3BFJA 4UU1A 2O0MA 4G5GA 3PC8C 4OQXA 2GYUA 4DR5B 1SQSA 4H1VA 1DAEA 4X85A 2JC3A 3KOZA 4NAUA 1OLOA 4G25A 3WBBA 2OA0A 5F7XA 1SULA 3IUQA 3S81A 1JWAB 2QSYA 4DSTA 1EP3B 4MVWA 1VL0A 1E5QA 4TLBA 4LQDA 4J7CA 3TDNA 1EX9A 2VQDA 3B1WA 3FUVA 1RQPA 1HT3A 4XM1A 2BGLA 1LSUA 4KNYA 2P79A 1DB3A 3KYDA 4UD2A 1UFQA 3EA5A 4R2MA 2OV1A 4RPLA 1Q1QA 2JGAA 2Z5GA 4FFBB 4B5KA 4D6YA 1YRYE 3OTHA 5THXA 1UPTA 1XTRA 1RTKA 2WJIA 1Z38A 3BK2A 2HMSA 5T3YA 4RH0A 2F9LA 4CDGA 2XECA 2ZKLA 3MNFA 4O4HB 3N2IA 3RBXA 2AN5A 3HL0A 3IIIA 2J4FA 3PC2A 3ZX4A 5DI3A 4B48A 2AKEA 3ANMA 4QT0A 3B48A 4AO6A 4ZV9A 4H1TA 5HG0A 3ND5A 3H1PA 2R8RA 3N7AA 1KEZA 3CX4A 5CK4A 3TM4A 4TQ9A 1WF6A 2ID4A 1AXEA 2RGUA 4MGZR 3ROFA 1NBME 4IQFA 2FP3A 4U00A 1K68A 1P4SA 4NMWA 1WQ3A 3DQQA 1XAIA 1I3NA 3NONA 4U2EA 5DHUA 3NHJA 4EA7A 1K6XA 4N0EA 3PGMA 4P5EA 2J8ZA 4JNKA 1Y6GA 3OECA 3ONWA 2WVJA 1A1SA 1JKXA 1LSJA 3G82C 4E1BA 3O82A 2FSUA 1PHRA 3ILSA 4KO1S 4BO8A 2HY7A 2QBYA 1JMYA 3AZPA 4A0FA 1ZAYA 4QM6A 3EG9A 4D3DA 3DLTA 3OT1A 4EYEA 3HCBA 1Y1RA 4OH1A 3EIOA 4DR6B 3PRKE 1XEWX 2BFBA 4LZZA 4GPBA 1JG6A 1QKIA 3V4VB 1B23P 3EDYA 3CO0S 4UTVA 2C7GA 2J3KA 4OFZA 1NQOA 1JEQA 1O54A 1SVKA 3EF0A 2B4TO 3M34A 4FR2A 1KQ3A 3OQOA 2AJ8A 5JBIA 1FCJA 3VKGA 2XZDA 5AW2A 3ORHA 1HFJA 3DULA 1GT6A 1L4BA 1SZCA 2GS9A 3H05A 3JVDA 2FOLA 4WL0A 5EJ8A 2PMWB 2BIFA 2SICE 4QRDA 1H5UA 1QQ5A 1Z8FA 3JQAA 4QEKA 5EIBC 3HBFA 3RLIA 3M33A 1SURA 2A0FA 2EFYA 3IKVA 1R27A 2DFNA 3LBHA 3N2KB 1SXIA 3VHRA 2E4VA 1E9CA 1E7SA 1EMDA 1KJZA 4LXHA 2HDWA 3RIEA 3BXEA 3P9QA