3AHCA

Resting form of phosphoketolase from bifidobacterium breve
Total Genus 323
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
323
sequence length
802
structure length
802
Chain Sequence
b'VIGTPWQKLDRPVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLMKEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFIMGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNPSLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVAGFDNEDHMSIHRRFAELFETIFDEICDIKAAAQTDDMTRPFYPMLIFRTPKGWTCPKFIDGKKTEGSWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVIREDLKLPELDQYEVTGVKEYGHGWGQVEAPRALGAYCRDIIKNNPDSFRIFGPDETASNRLNATYEVTDKQWDNGYLSGLVDEHMAVTGQVTEQLSEHQCEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAKWLEATVREIPWRKPISSVNLLVSSHVWRQDHNGFSHQDPGVTSLLINKTFNNDHVTNIYFATDANMLLAISEKCFKSTNKINAIFAGKQPAPTWVTLDEARAELEAGAAEWKWASNAENNDEVQVVLASAGDVPTQELMAASDALNKMGIKFKVVNVVDLLKLQSRENNDEALTDEEFTELFTADKPVLFAYHSYAQDVRGLIYDRPNHDNFHVVGYKEQGSTTTPFDMVRVNDMDRYALQAAALKLIDADKYADKIDELNAFRKKAFQFAVDNGYDIPEFTDWVYPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylulose 5-phosphate/fructose 6-phosphate phosphoketolase
publication title Crystal Structures of phosphoketolase: thiamine diphosphate-dependent dehydration mechanism
pubmed doi rcsb
source organism Bifidobacterium breve
molecule tags Lyase
total genus 323
structure length 802
sequence length 802
ec nomenclature ec 4.1.2.22: Fructose-6-phosphate phosphoketolase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
A PF09363 XFP_C XFP C-terminal domain
A PF09364 XFP_N XFP N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ahcA01
3AI7A 2FWNA 2X7JA 2PGNA 2YIDA 2AG1A 4RJIA 2BFDA 2O1XA 4QQ8A 4JD5A 1YI0A 1QS0A 2C3OA 3M6LA 3UK1A 3RIMA 3EXG2 4KXVA 3EXHA 5C4IA 2XT9A 2R8PA 1UPCA 3EXFB 2JI6A 4JUAA 4GPEA 3LPLA 4C7XA 2JI9A 2QTAA 3AHEA 1UMDB 1UPBA 1N0HA 2BP7A 3MOSA 1JSCA 3EY9A 1POXA 5EJ9A 4RJJA 2BFBA 5EJ7A 2Q27A 1V1MB 3L84A 5EJ8A 4K9OA 2Q5OA 4MZXA 4WBXC 2BEWB 2Q5JA 1X7ZA 4JUDX 1X7YA 2C42A 3AHCA 2JGDA 3LQ4A 4JUCA 4K9LA 3ZHSA 1YD7A 5HJEA 3M49A 5ERYA 1OLSB 3KOMA 3FLMA 1V16A 2BFFB 3DV0B 4GM0A 3EXEB 3IAEA 1T9DA 1L8AA 4K9NA 2IEAA 2G67A 2JI7A 1V11B 4MPRA 3DVAB 4K9QA 5EJ6A 1ZPDA 2EZ4A 2XT6A 2BEWA 2G28A 1PO7A 5DEIA 1UMCB 5K6RA 2PANA 3AHIA 1R9JA 2JIBA 1AY0A 1QGDA 4QPZA 2O1SA 2QTCA 5K6TA 5ERXA 1PVDA 2UZAA 3AHHA 2VK1A 3AHFA 5K2OA 1OLSA 2VK4A 2JI8A 1MCZA 1DTWB 2WVAA 2VBIA 4K9PA 3OOYA 5EXEA 1V11A 2EZUA 3DVAA 2YICA 3LQ2A 1W85B 2XTAA 1WCIB 2R5NA 5I5EA 2EZ8A 5HGXA 1X7XB 2UZ1B 1UMCA 4K9KA 4JUBA 1T9CA 4JU9A 1B0PA 2C3MA 2G25A 2Y0PA 1IK6A 1U5BB 4MPPA 4KXXA 3AHDA 5ESDA 2W93A 3ZHVA 5EXDA 3F6EX 2EZ9A 2E6KA 1OLXB 1OLUB 2WVHA 2IHTA 3UPTA 4QELA 4K9MA 2BFEB 3EXFA 5I51A 1W85A 1Z8NA 2DJIA 1POWA 1W88B 1UMDA 1X7XA 5AHKA 1OZFA 3EXIB 2JLAA 3F6BX 3ZHTA 4FEEA 1UM9B 1V5FA 2BFDB 5EJAA 1QPBA 1U5BA 1X7WB 3HWWA 1V1MA 4RJKA 4Q9DA 2Q5LA 3D7KA 1OZHA 3M7IA 1ITZA 4MPJA 1TRKA 3EYAA 1RP7A 5HYVA 3M34A 3EXHC 2Q28A 3OE1A 1UPAA 2BFEA 4KXUA 2VK8A 3JU3A 5DGTA 5IMSA 2EZTA 2PDAA 3LQ1A 4C7VA 1YHZA 2BFFA 2BEVB 3DV0A 1BFDA 3EXIA 3EXEA 2BP7B 4COKA 4KXYA 2BFBB 1Q6ZA 1NGSA 1UM9A 1V5EA 2NXWA 1TKBA 1X7WA 2J9FB 2JLCA 5EJ4A 3E9YA 3ZHQA 1YI1A 1X7ZB 2Q29A 2C3UA 1X7YB 2IHUA 2JGDB 4KXWA 2VBFA 2Q5QA 5FEMA 3EA4A 4GG1A 1GPUA 1TKCA 1PI3A 4ZP1A 1V5GA 1V16B 2BEVA 1T9BA 1OVMA 3HYLA 2VJYA 5DGDA 3HWX1 2OZLB 1X80B 2AG0A 1UMBB 1DTWA 1T9AA 2BFCB 2J9FA 1NI4B 1V1RB 2C31A 2R8OA 1WCIA 2BEUB 1YBHA 3DUFB 4JUFA 4KGDA 2IHVA 3ZHRA 1OZGA 2UZ1A 4D5EA 5HHTA 5EJ5A 3FZNA 3AHJA 4GM4A 1Y9DA 2C3PA 5I5GA 4GP9A 3FSJX 2WVGA 4FEGA 3EXG1 4GM1A 5EJMA 2VBGA 4XEUA 1KEKA 1QS0B 5I4IA 2OZLA 3AHGA 4JU8A 1X80A 4D5GA 3IAFA 1UMBA 1YNOA 1OLXA 1OLUA 2PGOA 2V3WA 2BFCA 1PYDA 3EXHB 2C3YA 3ZHUA 1NI4A 1V1RA 2FN3A 1TKAA 1YHYA 5K3SA 2BEUA 3DUFA 1W88A 4MQ5A
chains in the Genus database with same CATH superfamily
3WO0A 3PF9A 2FTKE 2Z2XA 4ZOLB 5K09A 1JGTA 4WOCA 1OPXA 4IWNA 2ZE6A 1IUPA 1MW8X 1JEJA 2OHGA 4YJHA 4XIYA 4IUYA 4JCOA 1YS9A 4B43A 5KYNA 3O82A 4K87A 2WHPA 1WMBA 1FYEA 2PRYA 5A5EA 5JUWA 4NL4H 3VGPA 2NVBA 1RAGA 2VRNA 2XCLA 4GF5A 4IJMA 4X41A 2ZUCA 1F17A 2FSIA 4WKPA 4CETA 1R5NA 1NN3A 3TCKA 1PWZA 1OSNA 5KYTA 3B8HA 2HPVA 3HN6A 1XVUA 4EGCB 4ZMBA 2G7ZA 1U8CB 3MYRA 2FWPA 2FEPA 2XLBA 2OBNA 4GUAA 1W6RA 5JASA 1J2TA 1H2ZA 1M2GA 4YMHA 2YCLA 1NE2A 5CT9A 1YVRA 1FRNA 1UDBA 2QX7A 3IMEA 2ZQYA 1NMZA 4FB4A 1AGYA 4WWHA 1H3FA 4YJKA 3MOGA 3JR3A 3Q2OA 4MKXA 1Y81A 4YRRA 4IKPA 4QFMA 4YP9A 3DTTA 4CEHB 1XK7A 2B69A 4KXVA 1FLDA 5BSEA 1Q83A 1QFSA 5LMZA 3D2LA 3K1TA 2GYVA 3RNOA 4YUZA 3AJAA 4CKEB 4I55B 4MQLA 4YAEA 4Q03A 3GEDA 1IBCA 2JLZA 2DQYA 1ISFA 1WMSA 1Z33A 3QLUC 5TT1A 5LYJF 1FW6A 3IQXA 4QGFA 3A6DA 3OKAA 4N41A 2XOKD 3QFRA 1U2GA 1QMPA 4C7XA 2Y71A 1SC3A 2QJWA 3IIIA 3L6CA 4HFJA 2X19A 1N57A 4MJLA 2ZUTA 5IVPA 1Z68A 2XV1A 1N1MA 3A6JA 1TLLA 4UFOA 2IZ7A 5ALHA 3GCXA 3TLXA 4GRDA 3EY9A 5KDDA 3IOEA 1LBSA 1P17A 4RJJA 4TLMB 3ZZMA 4YP0A 1SKUA 2AZTA 4BEVA 1RBYA 1YDFA 4BEWA 1WDTA 4UE2A 1SKYE 3ZX5A 4W9RA 2VP6A 1KEVA 4FQ8A 4PN3A 4C01A 5LYYA 3TI9A 3A8TA 3C98A 4G5QA 4CIBA 2G0AA 3PVCA 1E2PA 5AJTA 2QKYA 3H2IA 2DAPA 3LCUA 4J0GA 3PU6A 5GGXA 1EK0A 4XUDA 5DCLA 5AR1A 3RTGA 3LYUA 5EOVA 1EEHA 3F8TA 4Y2TA 3CWQA 3FTEA 1CUGA 5T3YA 3I6YA 2ODWA 3VPGA 3EC2A 1MUUA 3F8WA 6REQB 2HSEA 1Y7TA 3BQMB 4HAIA 3CEAA 2OO5A 3MRSA 4MZXA 3B82A 1KMHA 4AMYA 5A02A 3E84A 3UT6A 3C14C 4BC1A 2BEWB 3IBSA 1U5AA 4O8ZA 3EEFA 3TD9A 1IHYA 2OQ2A 3DMNA 5HOEA 4JYBA 1PGJA 1XEAA 5I7SA 4B5KA 3V8VA 1GL3A 4KPUB 4TSRA 4HWSA 3D2BA 4GWLA 4IDDA 3CKMA 4IDBA 5FPPA 4CFZA 4CUKA 4F8YA 3JZDA 3CJQA 1QIHA 3AJEA 3DHNA 2BGGA 3QLVA 2CMGA 5AJZA 4PY2A 1GPNA 1WA5A 3LW7A 4WBSA 3NETA 1SUIA 3ABQB 3BGSA 3G88A 1V16A 1SQFA 4R1QA 1U4NA 1VG0B 3JATA 3PYLA 1CUFA 1FXWF 1WUJS 1XZHA 4EEZA 1U1IA 2FSHA 2WIJA 4Y7CA 3KJGA 1JECA 2XUIA 3PNPA 5BSGA 3IPXA 3JQQA 3TSYA 2HK6A 1T9DA 4D99A 3LA8A 1ECPA 2WW8A 5JG7A 2WLTA 1JSRA 1NZJA 1NVGA 1W9HA 3GDOA 3KSDO 5TXGA 1PFVA 3EARA 2J6IA 1EFRA 5TS2A 3TPZA 3U5ZB 1PEKE 1LK5A 2D59A 5M2QA 1WVIA 3LFHA 1OFHA 1C7EA 2QTTA 1GG9A 1HE1C 2CL6X 4GOJA 3WGQA 6LDHA 1NYQA 1U0SY 5KTOA 2GO1A 1A27A 3CINA 3E4CA 4MUBA 5EKUA 5HG0A 4PCLA 4AYTA 3FFBA 3O8LA 3P27A 4W8OA 1PYOA 4HBZA 2D8MA 4P83A 2XVMA 2BJVA 3OC0A 4MUMA 4KVZA 4I66A 3WBKA 5JPCA 1UJ4A 5FQOA 2JCGA 3C3CA 1E96A 4K03A 4Q02A 5BN4B 3VFDA 4B6SA 3IS3A 1F5SA 3WP1B 3ZW9A 4N4AA 1Y33E 1RQPA 1EHCA 5B58C 1KK0A 1J5PA 4LKOA 1I24A 2IP4A 1N5OX 2J5XA 4J0KA 4N01A 1P91A 1AA6A 1E1CB 3UICA 2H9YA 2PYZA 2YHBA 3GJ0A 3RC3A 2OCBA 4NKRA 4O1IA 3I5MA 1YOVB 3K72B 4ZOCA 2ZRHA 3E3MA 1A9XB 5M3BA 5BWBA 3R76A 3OD5A 4KUGA 4I1UA 1W5FA 5AVWA 1PW5A 1B8VA 1OLSA 3ONFA 4OQQA 1TJ5A 4EKDA 2JI8A 5AJYA 5EJEA 2P91A 1AD2A 1GADO 1RYNA 1TK9A 1NXSA 4BIMA 4EP1A 1N6OA 2GESA 2H7XA 2DSTA 3ILSA 3KZCA 3OLVA 5L3SA 3G7SA 4TWAA 4WK6A 2IUTA 2ZJ1A 3LD9A 1VIAA 1MO4A 4F72A 2FZKA 2ZJ3A 3DT9A 3AVWA 1ESDA 4NOKA 1UIRA 4XZ3A 4H08A 3OOYA 1RS0A 1PK8A 3HB9A 3MMSA 1NVTA 1WZIA 1T26A 4L78A 3P26A 2R25B 4UE3S 3HB5X 4UATA 1RRFA 1SXJE 2O5VA 4LJSA 4MCHA 4RVCA 2FVXA 4CDMA 5LP1A 4K3UA 3RR2A 4GECA 1GQYA 1EWRA 4HLCA 3BJRA 2O4UX 4IIEA 1WB9A 3FHTA 2WIFA 4ZV4A 3O4JA 2HQBA 1W9MA 5K2MA 2PLRA 1ZOIA 3Q7PA 2GZSA 2RGDA 3QPWA 3UMSA 1NR1A 4BLOA 3OZUA 5C1DA 3K4QA 3L8YA 3RRXA 1TCVA 4B3MB 4RFSB 4UDXX 5HM8A 2FOXA 1V71A 4BNKA 4LDZA 3ANSA 4WJZA 4A4DA 1N2JA 3EGVA 3KVYA 3DOOA 1Y6RA 3PR3A 5HR5A 1ZMBA 2QR2A 5BUSA 5TGZA 5D3MA 1FDSA 3DLHA 3RRMA 2X8LA 3TTWA 2GCIA 3ZS9A 1K89A 2QJFA 1D1TA 1Z13A 3D3NA 3LUJA 3GG9A 3PNVA 3QYAA 1YUBA 2CUZA 4X7MA 2XGOA 2XTZA 4A2PA 2XZOA 1K2VN 2BD0A 3FCYA 3JYNA 4EW6A 1MC5A 2BR4A 4CKWA 1JR3D 3EVZA 4RZUA 3CW9A 4B45A 4GKKB 5AJWA 5FBLB 2I2BA 2X40A 4NNJA 1UBNA 2IP1A 4L22A 4Z9YA 3ZHVA 3GO4A 4KQFA 5BW4A 2C95A 2BGKA 4W82A 1NF9A 1PR0A 1E9FA 1T0JB 1VHLA 4RIEA 4V38A 5DNAA 3TFOA 2QQ5A 1W94A 1OLXB 1D6SA 2CNWA 4FWIB 4DF3A 2Q0HA 5CDFE 1Z07A 4JS0A 5JFOA 4YXWA 1ZC3A 2ZK7A 3AEQA 2QP9X 3GAFA 3HDQA 3JRWA 4V0LA 3SG0A 4YQFA 4Q7EA 5CBPA 2BCJQ 2IHTA 3U80A 4G5SA 3FROA 2BYTA 1DI0A 3A4YA 4TYMA 1RM4A 2YINC 4HGYA 1G41A 1XV5A 2CHFA 3CX3A 1PZGA 2X8JB 4HXGA 4D45A 2PL1A 1AOXA 3EDOA 4FFDA 3UW3A 3QKRB 3M4JA 2O6HA 4UHHA 4X1KB 3WY9A 1ADFA 1HL7A 4YUXA 3F1KA 4U4AA 2QVZX 2B61A 2PKWA 5E7QA 1FQWA 1UDXA 4MCIA 5CHYA 2VK2A 5AHKA 4EPYA 2CE2X 2PMBA 5IZ4A 1P2TA 2AVDA 3Q88A 2I54A 2EJTA 5H0IA 2G88A 3T41A 3K1AA 2PT6A 3O4HA 1HURA 5JSKA 1Q1ZA 3RSZA 4X8MA 1QQ6A 1WABA 5DBIA 5G0UA 1H2XA 3NEJA 1WW3A 4B75A 2JCSA 4US2R 3VTKA 1R1DA 1XZMA 4IIBA 4GZLA 1M1YB 1VCHA 4UC0A 4DG8A 3WYBA 4F6CA 2JLSA 4HHEA 2PXHA 3ONEA 2SCUA 1T5LA 1DAFA 1ZXXA 1UK6A 3LCVB 3EMVA 1K92A 1YDWA 5BXQC 3F6RA 4WFQA 1JTEA 1ZY2A 1G8SA 3GPIA 2OHHA 4R31A 2I66A 2WZDA 3A2NA 5EZQA 4S04A 2RE8A 4KE6A 2H0QA 1VBFA 4KQ1A 4EDHA 2PKRA 3QKUA 4EVRA 4PAGA 2X41A 3AIKA 4J0FA 1O6CA 4KN8A 4UTNA 2I4IA 3U0BA 2JZCA 3LP8A 4OQYA 4OATA 2AX4A 1YRWA 4XSGA 2YIMA 4RFLA 3RHSA 2W8ZA 5HYVA 1N6KA 3TW8B 2H54A 3F6CA 2OQRA 3UMBA 1N6NA 3TQRA 3VR1A 1GRRA 1KXJA 5CNKA 4GWGA 5A0TA 4L5AA 2Q41A 3WB2A 2ZU0C 1YS6A 2VK8A 3CEHA 1QHSA 1B6SA 2DETA 1Q1AA 3PBKA 1PFKA 4ZYYA 2O5CA 1F8YA 1A5SB 1OE0A 3F9RA 4HEA6 4LYJA 5KSOA 1K0FA 2MMCA 2OXRA 2QYHA 3FAKA 1CUHA 4IHJA 3V2HA 4F9EA 3EVTA 1CJBA 3IE0A 4ZFNA 1E2IA 2XMDA 2F55A 4RWZA 5ADWA 1KR5A 1OVGA 1WUYA 2BEVB 1S3GA 4TL7A 1G5QA 4NG5A 5AI6A 2REBA 1LXCA 2PX6A 5JCJA 3EA5A 5TRTA 3RSOA 2BP7B 4YJDA 4RDIA 2PO7A 5FOXA 5AO9A 1EUQA 1GTL1 2LR0A 2PKQO 1ZWKA 2QEQA 1NXTA 4M53A 3TDKA 3D7NA 4RZQA 2X5NA 1XTUA 3P2OA 5C8YA 4BMXA 3S3TA 2IXFA 3RBXA 3WADA 4F45A 3D4LA 3LPAA 3X1YA 4EBBA 4D96A 4HQOA 4PZUA 1NJ8A 1YBMA 5CVVA 3SQOA 4ADSG 3OKCA 2LDXA 1N8KA 3BSFA 1DC6A 2Y8EA 5IX8A 4WRRA 4KL8S 3RVLA 3KLPX 3ZY3A 3QXGA 1BHJA 2ZOSA 1SBIA 4R54A 3TSWA 4F4UA 2VNJA 3GAZA 2JLYA 1L4UA 4QPJC 2Y1KA 4RVGA 3R7BA 3GHYA 2H16A 1P1CA 2ONKA 3PYXA 3KB2A 4EW3A 3NVKI 1Y1QA 3EJ6A 4RH1A 4M7WA 3TQQA 4BO1A 3TLBA 3TWOA 1HFJA 4Q6BA 3NFYA 4FD3A 3VHXA 5AQ1A 1YFZA 1R0RE 2R1TA 3I83A 3M6IA 1VRCA 3PQ7A 1VLVA 2IJGX 2PTHA 4OHCA 3SK0A 2WA1A 3ZJTA 5HA5A 4HBGA 2YV3A 3C7KA 4KYTA 2ZAIA 5IJAA 2YVUA 5FEMA 3W05A 2JCXA 4TXLA 1C9JA 1LPMA 2PSEA 2V7EA 2Q2OA 4HAXA 5DHQA 2QUIA 4ZI7A 1XZNA 5E95A 1J7JA 4ENTA 1TLFA 2O23A 4LJAA 2R48A 3AO0B 1QV7A 4FYWA 4K7JA 1I7DA 4M36A 3EVBA 4C22A 4DDWA 2F8MA 1V8PA 2H1WA 1XROA 1IXYA 3KAJA 3HWX1 1MH1A 4JGIA 4KIFA 2XA9A 4PWYA 4CGYA 4DMLA 4OXQA 1EUDA 1Z7EA 4XKJA 5H9WA 4EEXA 1ZFNA 5J9FA 3NUZA 4TQGA 1E3LA 5B2ZA 1PHPA 1OGYA 4QKQA 3DLBA 2JA2A 3NBZC 3FHJA 4GOLD 4C88A 1BKSB 1K75A 1YASA 1IN5A 1YZFA 2ERCA 4TM7A 4AS2A 4D02A 2GLXA 4IJKA 5T4HA 3W2FA 2J5BA 4H3SA 2VKQA 4EY5A 4ZKDA 2C5SA 1GGJA 1DP4A 4M1OA 2O2SA 2HBYA 2PUVA 3ZU5A 1ZOPA 1C0LA 1PSWA 2DBYA 2ET6A 4TKVA 3ZXYA 1FEZA 4XYMA 1VYUA 3W3ZB 1TUGA 1D5WA 1O9BA 5BW8A 1GQFA 3AFMA 3PFNA 1ECJA 4YP5A 2QUHA 1CC1S 1YRYE 3QVGA 5ALMA 4KYUA 3NTUA 3DP7A 3Q1LA 4AJNA 1OZGA 1KC1A 4FS8A 1V3TA 4V03A 4D5EA 1T6BY 4MQFA 4NQZA 4RYDA 3C3BA 4U9IS 1NZDA 5HE8A 3WSWA 3IQFA 3HJAA 5LC1A 1TUEA 4KQIA 4GKJB 1A5AB 3E1KA 3SS9X 2OBMA 3CG0A 3DZKA 3NO4A 1W4RA 2MSKA 4UCQA 5EHNA 1BHO1 1ECGA 1YZ3A 4BTVA 1EVKA 4LX8A 4CM8B 4PWZA 2VJKA 2ZSEA 5AYVA 1DAIA 4GP9A 1LI7A 3TD6A 4Z0HO 3DM5A 2P9FA 3V55A 3PX3A 4R3UC 4NAVA 3HNPA 2A67A 2HFKA 5GV7A 3U5TA 1J5EB 5DYWA 3UWOA 2ZCVA 3B2EA 4WCFB 4B87A 4QTYA 5AUPB 1NF2A 3BF7A 1XJ0A 1Z26A 3FWZA 4H7DA 1PG0A 2OC9A 4TQAA 3TTUA 3UGTA 5KYXB 1AKNA 5EJ2A 2A0XA 1GZ6A 2HDWA 3JQGB 5IVDA 2XQVA 2CJWA 3SX2A 4HGPA 3EAFA 2IUEA 1KZ7B 1ES9A 1VG1A 2GT1A 4BO3A 4BVHA 4ZANA 2GZ1A 1JQKA 2VF2A 3WBJA 1J24A 5IC5A 5A06A 5KVAA 2WQ7A 3ELDA 2QMQA 3LQKA 1V1RA 2FN3A 2XQGA 3Q10A 1NBWB 3MA0A 3KZNA 3TDMA 4S05A 1EUYA 1IIRA 3KEMA 4NBTA 1H3NA 2EWMA 1IY8A 5KNDA 3HKBA 3Q2KA 3EIEA 1E3EA 4N6OA 3WV5A 1YR6A 5HVNA 2A35A 3T3MB 5JALA 5DXJA 3D0RA 2QN9A 5A05A 1M76A 5FP0A 4OKNA 3G8CA 4L7VA 3WLMA 2YY7A 3ZDAA 3F73A 2YBDA 3O4IA 4CLRA 2PGNA 2G5GX 5KJCA 1I1HA 2BWJA 4PC7A 2ZCUA 2IXAA 2VCYA 5IXYA 4TTIA 4FT4A 1Q91A 1S02A 1YL6A 4NF2A 4QJ5A 2R1ZA 1TOAA 1VMAA 2BFDA 5HW0A 3VZRA 2P2DA 4IVNA 4Y0VA 5EKXA 1BDIA 4QASA 1MO3A 4DSZA 4XRRA 1KC3A 4R0VA 1CS0B 3FN4A 5EGSA 5FLXA 4NK5A 3PTLA 3LW8A 4EAQA 1KQFA 4HVAA 1A7JA 3K1ZA 5EWLB 3IKJA 4BQQA 4UVIA 5HKOA 4PHGA 3GGDA 4BX2A 3PPXA 1QJCA 4PHCA 3OHMA 2BCEA 2GEBA 3E3AA 4LZAA 4JSYA 5KOJB 4IWYA 3DTVB 3ANNA 3D8RA 1F2TB 4I36A 2IS4A 2C7RA 1M5UA 3LZ6A 2BTEA 1Z16A 2H2AA 4OMCA 2HLNA 3M6LA 3ZLTA 3KJNA 3QG1A 4BPBA 4FGKA 5CCBA 5J63A 3EXHA 1T4GA 5HBRA 3EDYA 2J6BA 1OFUA 2WJ3A 3NHYA 1B15A 1U3WA 3L8FA 4LNUA 1LVGA 1UPCA 3VI4B 1B6TA 1TEZA 3RF6A 3NHFA 4QE3A 3WQSB 4TV9A 1E8MA 2PQMA 3HEMA 2WVJA 3K5PA 2JFXA 3G8DA 4LG1A 4Y6LA 3LTEA 1SOWA 2CXXA 1P0QA 2AR7A 2YW2A 2C2XA 2P9ZA 2N1MA 5SZKB 3IDOA 1WE2A 1A4IA 4C29A 5KS2A 3TLJA 4CKYA 1U3TA 2P11A 3MELA 5BR7A 2NZWA 4MKZA 1Z6AA 1ZQ9A 5K0GA 3U19A 1QWOA 1ZI8A 4HLUC 3ZE0B 1NVEA 4BP1A 1ULZA 3HFJA 1LB1B 1P0FA 1YK0A 4UNPA 5CB0A 4KDRA 1P5JA 3TLGB 1RE1A 2GXUA 3M9LA 3KT8A 3S27A 1MC8A 3L1IA 3EW7A 2MYNA 3STWA 1FRQA 2VF4X 2BM8A 1G5TA 4RKEA 1J2RA 3CR8A 5HIIA 3HPQA 5TY0A 4BQIA 4QULA 2UUBB 1FJGB 3AJRA 1YB4A 2PJRA 3N0XA 1WD7A 2QGZA 2YIVX 5D5HA 2VPTA 3UQYS 3DFKA 2LXNA 4W6ZA 2CHGA 2PBFA 2GCPA 2ZSIA 1T2FA 1WCV1 3OE4A 1QRAA 2Y99A 5AVOA 5IEJA 1H1DA 1N3LA 1UAYA 1PL6A 4EY7A 1QTNA 1ZNXA 2AJCA 1O03A 4JAVC 3LH5A 5EINA 3S2SA 4WLUA 3OIDA 3CNBA 1OXTA 4TKLA 1UWKA 4ZD6A 3O91A 3SX4A 4JLDA 3HO6A 1MRSA 1NG1A 1UBOS 3SHWA 5C7LO 3I01M 1TIBA 1S9DA 1X7YA 5DSZA 2JLXA 3FI0A 3OD1A 4FGZA 5BYJA 3SZGA 3UA3A 4QJ4A 4BFCA 3AUJB 5EE0A 2BMFA 2PSHA 1KI6B 4FI3F 4OGFA 4BUZA 4CCAA 4UCFA 5ED4A 4MEAA 1J70A 1IHUA 1GG8A 1II8A 1OWOA 2FFAA 3M49A 4OKIA 1SOVA 4OQDA 5ALIA 2ES4A 3TE7A 1J22A 1KYYA 1T5OA 2NU9B 1MNQA 2E18A 2O3UA 2WKQA 1RWOA 3SX0A 2IXTA 5TQ2B 1QBGA 3TBFA 3MMPA 4V3BA 4QFCA 3UJCA 2DWOA 5ALQA 4DV7B 3QI7A 3UAWA 4XARA 1A9TA 4ZVVA 1J23A 3JQ9C 4E7PA 2QORA 3T4PA 1Z6ZA 2ZB7A 3AR7A 3AETB 2RHJA 5E7IA 1LF0A 4YPVA 4Y1GA 3ONNA 2FSSA 1XBTA 3EWSA 4CGZA 2FW0A 1LBQA 1K8XB 1USUA 2BONA 2J7PA 2Z57A 2R6R1 1R8XA 2ZVDA 2ZJ8A 3JSXA 4GPAA 4IXWA 3E5RA 2CBXA 3F9CA 3I9MA 4Q5IA 5HK8A 3W9BA 1Q0TA 1BO6A 4LF7B 3ANMA 3O1IC 1NAHA 2PAFA 3ETEA 2UUCB 1IL0A 2XBMA 2O7SA 4M0EA 4RZXA 3IIEA 2RI0A 2P7IA 2BMJA 3KK0A 3ND7A 4ND8B 1W1WA 4DV3B 4K0RA 3K6SB 2ECQA 3BWMA 3V4ZA 2IPLA 2CHUA 1JH8A 3BMCB 1PJ4A 4EUFA 2EATA 2HU7A 1SOAA 3D6UA 5C31A 3K8OE 4G5YA 1ORWA 1WV1A 4EPVA 1OYVA 1VGRA 4G84A 3ILHA 4CM4B 3AKCA 3AXSA 2CEAA 4OF4A 1BHQ1 2P27A 2QJTA 4RSRA 4UM7A 3AFIA 4PM4A 5ERXA 1DAKA 4A27A 1NC3A 1BMFD 1FF9A 1HSOA 1JQ5A 2J87A 3PB3A 1KJJA 3HNOA 1R88A 3ECAA 4NBRA 1A9RA 4ZO8A 3T1YB 4D4IA 1EVEA 1XA4A 3ETCA 1TA0A 3M6VA 1NBOA 5JWRA 3I1JA 4IDHA 2JA1A 1SCJA 4JI8B 3E9QA 3NGMA 4PRLA 1GNVA 4MV3A 4P7JA 4UAUA 3G0CA 1VBNA 2QD1A 4ZMRA 3ECCA 1AHPA 1LZLA 5HF6A 3VYVA 1HMPA 5D86A 1RAHA 4XGRA 3ZKWA 3MOIA 2ZI9A 3GJQA 3EFOB 4P9NA 4IX9A 4ZAVA 4PIVA 2WVAA 5CVDA 1E1KA 3JQAD 3G2NA 3VSEA 1SXJA 4TPKA 4B3XA 4MB0A 2IKSA 3WRWA 5FPYA 1V11A 1YJXA 1D8TA 1DELA 2YV2A 1Z39A 3MT9A 5E6SA 2X1HA 4G4SP 3SSAA 2QBYB 1FYFA 3PL1A 3V1UA 1KAEA 2FK8A 3IEVA 1EK5A 1GV0A 5LP6F 5EEHA 3TLCA 1S4QA 1HDOA 3HK2A 1VA4A 4LBYA 1IPEA 2HJHA 3A9RA 2ZUEA 4FGSA 3LK7A 5DN9A 2V0NA 1BDHA 3WGUA 3IUJA 1BRTA 1ZVMA 2DVMA 1EXDA 4ZVRA 4UNRA 1J39A 1WP9A 1S7CA 4KE8A 3X3HA 1YKSA 4OLAA 1G5IA 3QELB 2WSMA 3I62A 2WUDA 3D4OA 3IAUA 5L4NA 4DR4B 2DXIA 4M0KA 4ARBA 1WXFA 1J2EA 3DLCA 4OQNA 3REQB 3U7QB 1FFYA 5IKMA 4IV5A 1AIPA 3F9IA 1E0AA 3RYFB 1QHFA 1XDUA 1O0BA 5J58A 5JVDA 3HH8A 3BH7A 4ZVQA 3FLAA 3TFQA 3VKFA 3NR2A 2F1HA 1C50A 3JV7A 3OIWA 3KYIB 4GEGA 2GK4A 5AW2A 4XYEA 5BQPA 1OXBB 4Q39A 4PNEA 2W93A 4AJ4A 4ZXFA 5IM5A 1ORDA 1A97A 1SD5A 3KQWA 4U0KA 5CDFA 3H87A 1ISGA 3PNBA 1QM5A 2GEKA 2RKWA 3OPYA 5EXDA 1W8IA 4R40A 3T5DA 3KUCA 1CUAA 3K53A 3F6EX 1ZIDA 1Z0UA 2EZ9A 2EX1A 1ESMA 4ER5A 4ROSA 1E92A 2J9YB 1E1QD 2C96A 1Z5OA 3FUTA 3R9XB 2X0JA 3BD8A 4MLCA 3PQEA 2JVIA 4MUAA 4DM3A 3SFVA 2CHQA 3IBCA 1XPRA 5WRFA 4DCTA 3ZE2B 4UXHA 5LQCA 1SBTA 4K9MA 2VHVA 3EXFA 5IAOA 2B8TA 3GGOA 2GPJA 3IJRA 4XIIA 1UK7A 1A8SA 3GNSA 2OHXA 4BKQA 4CG3A 1F5NA 3WL8A 5LOVF 3A70A 1E6MA 3PFFA 3RVSA 1P7ZA 2DJIA 3EGWA 1E7SA 1QZ3A 1L6RA 4JJIA 3V2GA 3VKGA 1ZM2A 2L2QA 5CIYA 5FWYB 1W1UA 2QRGA 2ODTX 1DBWA 2G72A 3UO8B 1LRJA 3RC1A 1FTSA 3CZ5A 1VJDA 3SQXA 4KQWA 2O8DA 1IDN1 2A9RA 2I67A 1PT6A 3NT4A 4GZMA 3F6BX 1Y6GA 4N6NA 4LGVA 1C2YA 3EGXA 4FC6A 2OFFA 1N2GA 5FPHA 4EARA 1UM9B 3WK4A 4LY9A 2WAAA 2IXEA 4G97A 4H6WA 3CWCA 5LQKA 1DG3A 2QNBA 4WXRA 1OH5A 5F98A 4IILA 1KJ8A 1LPAB 3DHEA 2HREA 3C6BA 3V7YA 2BGJA 1KDTA 3V4SA 1GPH1 4BGDA 3ZLVA 4M1KA 4U5XA 2VG8A 1K4KA 5B1EA 1U31A 4IZHA 2P2YA 1J8DA 1VMIA 4L16A 1O95A 1VHQA 2XB6A 4E4TA 4W5OA 4PQRA 5BQXA 1URPA 4TTRA 1XELA 1AX9A 4FOSA 3UC5A 3U48A 3ZU3A 1J1UA 5K8VA 1DRWA 1M0EA 3C87A 1PYGA 2D0DA 1LCIA 2VDPB 2ZS8A 1KZYC 4UMFA 3PQCA 2PM8A 3I23A 3NONA 1K63A 3FMPB 1NQAO 3QENA 5K8UA 3L46A 1DINA 3MD9A 4LOJA 2I7VA 1QE5A 1NKVA 2LDBA 5AI8A 5AHXA 3KCQA 4FGWA 4E5UA 1L3CA 1T2EA 4BV8A 4IJQA 1R6UA 1LSJA 1Z45A 3GIWA 3KZKA 1RC0A 1RXCA 4NK4A 2FE1A 1RI2A 4NEHB 4V1CB 3VJKA 1QMGA 1X1DA 2JEYA 1NHWA 4RC9A 2XUJA 2BN4A 2CLIB 2WJPA 3NXKA 4MTLA 3T5CA 2FN4A 4K6MA 4MUFA 1II0A 4LGMA 3I9LA 3RVNA 4ZO9A 3OSZA 3OZFA 2H85A 1P6UA 1J1ZA 2HA3A 4KXYA 2ODQA 1CG6A 2XUKA 4KQEA 2FQ1A 3TSCA 2IPNA 2VRBA 4V2IA 1E2BA 2IUYA 3N1UA 5LQNA 4IQFA 1SH7A 4GDMA 3CLUD 1Y9AA 2J6CA 2VYNA 4P4SB 1JFVA 4X0EA 2FKNA 1TZJA 4NZZA 1M2KA 3I9FA 3GLIB 1W1IA 2QP3A 3DC7A 4I4LA 3ZHQA 2YV4A 4NMXB 2X5XA 4PAQA 3RREA 3LSYA 4QL3A 1TVEA 1JBEA 1NHGA 3FTFA 2FPPB 4EA9A 3VPAA 1VCIA 4CKBB 3NHKA 5JS6A 3TW0A 3VSCA 3WL5A 4DXAA 2W6PA 2VWHA 1MABB 2AE2A 4WCDA 3VU9A 1NW4A 3D7MA 4YDSA 2QV0A 5H1YA 3K31A 2AS0A 5CJJA 5B2EA 1GLVA 3IVXA 1I7SB 1T91A 3W1VA 4KXWA 3ABZA 1G18A 3H99A 4HMOA 4RZSA 2EHDA 4TT3A 3BERA 4LTDA 3W5BA 1TLTA 1P2SA 1Z0AA 2UZ3A 3OZGA 2ZAMA 1Z5PA 4CLHA 4Z6KA 1XZEA 2FMHA 4NMHA 5KVQA 2G06A 4GBED 5JD3A 2MSNA 3KC2A 4YAGA 1MP0A 1IY2A 1TKCA 1PI3A 5TT0A 4KHZA 2C92A 3CRNA 4S2EA 5EEGA 3RBVA 4AW9A 3CLRC 3OLXA 5BN3A 3Q3HA 1E63A 1H8HA 2G08A 2GS9A 1RCUA 2XUAA 4LJ7A 1DQPA 1LBTA 1Y3FE 2J5RA 1WMDA 3ICCA 3Q5GA 5EVCA 3GXBA 3H0CA 4WERA 1HKUA 2QVLA 3NZEA 3ZD9A 1MRNA 1EX7A 3EB9A 3PA6A 5AHOA 4RHFA 2AD5A 1SELA 5ADHA 4BPRA 5EIXA 1ZHOA 1KORA 3KYJB 4RKQA 1HQCA 4KE9A 1X70A 4KKXB 4LN1A 1QRTA 3U26A 2MINA 4F7WA 2A5FA 1VRWA 4J0CA 2PX8A 4RAQA 1M6VB 3VX3A 4CT0A 1TVKB 4YCAA 3L1HA 2L82A 1RAAA 2QTLA 1M8JA 4XSVA 4EG3A 1V8DA 3NT2A 4LJ4A 4MWCA 3UGKA 4LKRA 1G7CA 4YMTA 1BN6A 5EMHA 2KBEA 4XUGB 3F4BA 1G9XA 3PUZA 1Y1RA 4ZI3A 1VIVA 3RVPA 1Z12A 5F9MA 4WUVA 3C45A 3LXMA 1AA9A 2F59A 1WXQA 2X4GA 2ZPUA 2AMFA 2EFDB 3DYVA 2IYQA 3ZJ4A 3U4QB 2JH3A 3QBEA 3EPRA 4MW5A 3Q7RA 4RLQA 4GM4A 4KFTA 3ROMA 4HVLA 1EM8A 2NZUG 4IGFA 2QN6A 3HACA 3BHNA 3FPCA 2CFSA 3EZFA 1OCEA 2AMJA 1M66A 5SV2A 4TV8F 1NKTA 4F4JA 1NWHA 3ZV7A 2JBWA 2I80A 3WNVA 3T1OA 1UXIA 4OOFA 2BBOA 1N5JA 3G0BA 3MERA 3UYLA 4PSAA 1CSEE 2VDKB 3BSSA 1U02A 1MDBA 4JEIA 3RVBA 2Q0SA 4FBGA 4IIYA 2GBLA 2VZ9A 3ENKA 4OP1A 4Q4LA 3RYHB 4D5GA 5IDXA 3E15A 1NU6A 1UMBA 2K87A 5AHWA 1LNQA 1RKUA 2C4MA 3BFPA 1DWPA 1OLUA 4Q4AB 5ESXA 2DPGA 4Q1BA 3F98A 1C8LA 1I4TD 3MRVA 3UJ6A 2C3YA 3HBNA 4XGQA 2R3SA 3DDSA 3L41A 4H16A 3T5BA 3WLNA 5GZ3A 2HB6A 2JDIA 3WK7A 4FE3A 4WZ6A 4XWYA 4YX9A 1EP1B 2P79A 1U9IA 2VHCA 3H8WA 2D13A 3HEAA 2QHXA 3MK31 2BF7A 1N2SA 3PC3A 2CGEA 1EP2B 3PR1A 4ERNA 5EHZA 5EI5A 4MRNA 3SKVA 5FX2A 1TE2A 3CMCO 5AWFC 2QR5A 1XNRB 1ENYA 1QH1A 2I8LA 4N47A 1KK3A 1FVFA 1AQYA 3EFHA 3U7IA 3AL3A 1KFJB 5CW2A 4N8DA 3F78A 2RCNA 3LDHA 4QXMA 3T7SA 4BNUA 3EZ6A 2JBAB 4NJOA 3T54A 2ZYDA 1HNXB 1RNLA 3HVIA 4M9QA 2GFIA 2Z5GA 3FNGA 3OOEA 1Z7WA 1ISIA 1JNYA 1T25A 3FJYA 4JROA 1QFYA 4L9RA 3KQMA 4QPCA 2HA6A 5FB3A 5IASA 4UFNA 1SY7A 2EARA 4QXQA 2RI1A 2IPOA 3C70A 3DB1A 3JQBA 1B74A 2VRCD 2IBMA 3OWXA 5E4FA 3CZRA 4QGHA 3PQ4A 2Y67A 1HO3A 1HTWA 2OT3B 2XEDA 1PQYA 1XE3A 2YBEA 4G0PA 4S12A 5DBFA 1UFRA 3CF2A 4J7XA 1MV5A 1TJNA 2XDAA 2ZIAA 3K0EA 3TX2A 3E1SA 3UJ9A 2CLKB 3JQFC 1BAPA 3FSEA 4Q1AA 3ZR4B 3TR5A 1RDFA 4O4IF 1T2DA 3DMPA 4MRMA 3IT3A 1C2TA 1PZNA 3AWDA 4ZOEA 3JD4A 3RIMA 3JYLA 5EPUA 2I87A 2P6OA 1GHTA 4INPA 4KQCA 2QX9A 3K8ZA 2JJ2D 3DBHA 3T7IA 1IOVA 1W25A 1IHXA 4Y6SA 3TNJA 4KFCA 2J0UB 4L4ZA 4KAFA 1AKMA 1S3IA 4BWYA 4WLFA 3CONA 3T4XA 2A5LA 1J0CA 1T4MA 2Y9MB 3JTMA 3V7NA 1SQ5A 3BICA 1AK9A 4BZWA 4DYDA 3CZ9A 3KKNA 1XCBA 4BX0A 3ICWA 5HQJA 3VU0A 3E9ZA 5BPFA 3E53A 3HL4A 2XXAA 2JGRA 1QJ4A 2WKRA 4L07A 1PK7A 4DADA 4EA8A 2D3TA 5AW6A 5KYWB 4DABA 2QQGA 1KAHA 5JXGA 1O3YA 2Y1OA 2V7TA 3HCPA 5DPMA 3WWDA 1RP1A 4YROA 3C8UA 1A72A 2VOEA 2IC5A 3IBYA 3R7AA 1MQAA 3BAZA 2C9ZA 1GVHA 3RG2A 2IHKA 1H2EA 3AUAA 4WVFA 4BNNA 4TWRA 1DAOA 4JI7B 1JJ7A 1H6BA 1TVCA 4P82A 3VNAA 4P0QB 1NOJA 2JIDA 2BMDA 3L1VA 2VT2A 5TQJA 5F64A 4E31A 2YOGA 1X8XA 2HIHA 3BGVA 2FZGA 1D0VA 1E89A 5EJ8A 1RXSA 2ZYGA 2QMEA 1L2TA 1Q77A 2CK3D 3K0FA 3W2HA 1D04A 3KXIA 1R0KA 3CMMA 2GD2A 3UAXA 3OG9A 4ZT3A 3U7FB 2CNKA 2I55A 3N59A 2VAMA 2WMYA 4L0DA 5FUQA 3C4VA 2J3EA 5FI3A 4UNIA 4UBLA 2I2CA 1H42A 2Z5LA 3CKKA 3FPFA 2R65A 3GUCA 1E6UA 5ALTA 1SQ0A 4Q4CA 1ZCBA 3DO5A 4HJRA 4DLLA 2QENA 3CCBA 4RF2A 1X7ZA 4LOLA 3DDUA 1LSUA 2CMDA 1IN7A 3GU3A 1SXGA 2JGDA 5FWXA 4IDAA 1QLHA 4J90A 4M46A 4LFCB 2C4WA 4QDKA 4JB0A 4X3PA 1OC2A 4BKOA 5K5EA 3MHTA 5TJHA 2G36A 5TPZA 2BFNA 2XE7A 3TXYA 1XCMA 3ODGA 4EY3A 1DV2A 3O3CA 4YIKA 1OBCA 2IIVA 4JLPA 2E4WA 2NYAA 1SD1A 5E6RA 5K8TA 4OQFA 1JQJC 1L5SA 4GIBA 4ZOAA 4BLWA 5JYCA 3LC0A 3GRPA 2JARA 2JJQA 3VZDA 3S2EA 1ZIXA 1WCXA 4PLPA 4YWHA 1H1LB 1EFTA 3HXLA 1LFDB 3KTOA 4IHAA 1N9ZA 4RKWA 3HUEA 3Q3CA 2P90A 3A36A 1OXVA 4ITVA 4K6OA 4LGCA 5FUBA 5GINE 2Y1EA 4MNTA 2DUNA 3BIXA 3GEBA 5DZSA 4YRPA 3MAJA 1JPNA 1L8AA 3QMVA 3WTBA 4O4JB 2V0GA 1V7PC 2G67A 3K15A 2OD9A 1YJ8A 1EYZA 5A3QA 1ADYA 4C6RA 5JJBA 2H9IA 4O2AA 1A2QA 4AMGA 1KZ9A 1T8PA 1U04A 5C9ZA 3N76A 2JPDA 3ESZA 2VBCA 4DMFA 1E4VA 4N5HX 3QF4B 3ZJUA 2O8VA 3K35A 2ZRFA 5KOIA 2XCRB 4EF6A 2YRWA 2O3RA 2ZUVA 4JLAA 3U4AA 3LA6A 2O8CB 3SXJA 3OIVA 4JEHA 4WV3A 3RUDA 1G9TA 5LQSA 3PUJA 5JD6A 1SRQA 3H05A 5I7RA 5IJWA 2P40A 1SR8A 3FX2A 4XX0A 1HT0A 3CSUA 3G5UA 4ZRDA 5EMLA 4PBRA 3L06A 3Q4GA 4B3IA 4U3JA 4X44A 1ULTA 3HXOA 3GY0A 2X0RA 3OEHD 1KI2A 2YS6A 3HSSA 3ZDCA 4QPZA 1D2MA 1VYVA 3QPCA 4TXJA 5BUZA 3OZBA 4MRSA 2E87A 5IANA 1IBKB 1MV8A 1JG7A 4DT1A 2PZKA 4B2YA 4FYXA 1RJ9B 2ILVA 2C5AA 2P5TB 4WFKA 3SPXA 4DWVA 5KCZA 1E5VA 5AVSA 4U2DA 4BO8A 2GYYA 4O3MA 1U8UA 2PZFA 3O47A 4GOMD 3OQ1A 3VH2A 5F73A 5HNKA 2W83A 4NENB 4EHDA 2IW3A 5CEEA 1TEHA 3UH0A 1PWXA 1K06A 1D4ZA 2QG4A 1QP8A 1RD4A 3H16A 4PFQA 4WLOA 3CVUA 5KWIA 3DFIA 1T1RA 4F7DA 2O19A 1FS4A 4YMVA 3FFWA 2I03A 1MCZA 3NCTA 2VYCA 4GI5A 4YP7A 4P5DA 1GGKA 1T9ZA 1JR2A 1QGUA 4MA5A 1GN8A 2F9LA 4HAVA 1YQUA 5MHTA 5L9AA 3NW9A 4UM5A 1OYYA 1Q16A 3NOOA 5J59A 3M6MD 2WSSA 3LDAA 3KFXA 2DR0A 3LFUA 4M8LA 3ZHCA 4CDRA 4DG5A 5JYBA 4ZCQA 3SMQA 4LSZA 4BVFA 1NW7A 2GJ9A 3FYUB 2GZHA 3T3PB 2PUWA 3ROQA 5LXTA 4P7BA 3AJ8A 1SMKA 1ZMTA 2SKDA 5D6NA 1G5PA 2OYSA 2PL5A 4A0GA 3UAOA 5BVGB 4EJMA 2A2ZA 2P4QA 4KLRA 521PA 1SVKA 1RRKA 1F0KA 1LRKA 4RMHA 2ZIUB 2WZCA 3LT5A 4AK9A 3UMMA 1C0KA 4RD2A 1YK1A 4K9KA 4YALA 1RRCA 1KSFX 4I2NA 4QUJA 5EZYB 4KW7A 1YR8A 2ZS9A 3QKWA 4JU9A 1ISPA 2C3MA 1E0JA 1UINA 4JBWA 3THYB 2C0PA 3GHHA 4FQ7A 3WFJA 2FX3A 3NRCA 2OXCA 1W5TA 3KHSA 1PQUA 5DI9A 2HQOA 4HQFA 3AP1A 3B89A 3GRZA 2G5PA 1Z7YA 1B73A 2OK8A 1OI3A 3EVEA 2QAIA 3GJ4A 3LQYA 1W76A 4GZ5A 3OQ6A 4MMYB 5HCIA 3W3AD 1K8RA 4GMXA 3BCHA 2WIAA 2FEOA 5EL0A 5HFNA 3W5AA 1BW9A 1RWNA 3S8YA 3T7EA 1E3QA 1KY5A 2GLUA 3SWWA 4EY8A 2H2IA 4H18A 1VTKA 1O9HA 1Y3IA 1GLNA 2PBRA 5JMPA 3U37A 4AZ3B 1UADA 3AMVA 2EOAA 4FTWA 4UNNA 5CH5A 1RHQA 1SG6A 3UAGA 1QU3A 2YHSA 1V8FA 5TR9A 4KLZA 1NP6A 3JWIA 5AP9A 3A4MA 5KTKA 1RRPA 2P4HX 4JVSB 3RFXA 3ZBUA 3FVWA 1TGYA 2BDEA 3B36A 3EEIA 4KC0A 3P19A 1QGOA 1WOMA 2C2HA 4MULA 3NWPA 3LUCA 2OCLA 2G1AA 2V9PA 3EZ2A 4YEDA 5B7PA 3MMNA 1ZRSA 1UKYA 2HW8A 3G2QA 4BO7A 1BWPA 2IIPA 4MCAA 1E79A 1EAYA 3ZD7A 2XD4A 2KX7A 1R12A 2FEAA 4INZA 3VVBA 4EG4A 1OX4B 2K2QB 2XBUA 4GLBA 5TPWA 2B1IA 3F6PA 3T9BA 2K6GA 2ZXEA 3L7JA 2Y0EA 4NV0A 5ER9A 1UOQA 4XFKA 2QRHA 2P4SA 2IHJA 4HQ6A 4NDNE 4F86A 1U5CA 1ZJ4A 3C8MA 1KMIY 4PW0A 3RQIA 2ZRJA 2XTMA 2J3JA 3OZDA 3QV2A 1SCNE 3NHSA 3V48A 1GFZA 2HRBA 1HDGO 3VR3D 4IS2A 4R01A 1QPBA 3SZOA 4QJ3A 2O8FA 4LVOA 4LCJA 4MR9B 4OLBA 1JVNA 3TOSA 1JEYB 3I9V1 3LPMA 2EERA 2R2AA 4FJ2A 3CUEF 5H7XA 3RSLA 4WJLA 2B92A 3CJTA 2W2LD 3QVOA 1AN0A 4F4HA 4I1VA 1GTSA 4EWLA 2W58A 2W2PA 3DOJA 2Q5LA 3R0XA 5G4LA 5HDBB 3T7TA 5TV2A 2HRCA 4B4DA 2ZUDA 4D6YA 1M73E 1O89A 1YRBA 3EEBA 2DKOA 3MQ4A 1E9DA 1M2VB 3O9ZA 4YONB 2ILTA 2J0QA 4OLHA 1E6CA 1A3CA 4JKIA 5LZ8A 3JVDA 5JISA 2NQTA 5CB6A 1DJOA 1QYIA 3L6OO 1KGSA 1Z63A 3J81k 4J6FA 4QHTA 3GMSA 2OE2A 3PUVA 4HS9A 1CXZA 1UPAA 2MU1A 4TVKA 5THKA 3HMQA 4BMDA 4EELA 4DA4A 2BLNA 2PZEA 4E1VA 2CNBA 5ARCA 3IV6A 3OTWA 4PV7A 3R7WA 4IR7A 2YFKA 2ZRAA 2HYIC 4US0R 3JD3A 3WE7A 4C0LA 4WZAB 3ZJVA 1FMLA 4PZEA 2Z08A 5IUKC 4C7VA 5K1ZA 3OZCA 3TBKA 3DBLB 2XEXA 1UOEA 1F3LA 2BFFA 3H65A 4IQ8A 4TM8A 1YRHA 2C58A 2Q62A 3PPWA 3RIGA 4CUZA 3EXEA 3JQAB 3KUKA 3SC6A 4F9GA 1JFFB 4URVR 4ZEWA 1TJPB 3U61B 1BE1A 4YPFA 3SBOA 4OYLA 1HL3A 3CLTD 1E9AA 3H42B 1XEXB 4FGUA 3K16A 3N8HA 2Z30A 4HX9A 4OMDA 4Y30A 4E46A 2OSVA 4EZBA 4C0BA 4NV1A 2Z1MA 4LYEA 2C04A 4EFKA 3JWGA 2FCRA 2JFPA 1X7WA 1R6XA 4OQPA 3WNBA 1DARA 1FDRA 1PUIA 3BYZA 3NM6B 3NH6A 4NFLA 4JJ8A 3N2GA 13PKA 4RDHA 2NN3C 3L7IA 5CM2Z 2X2OA 3DDHA 2IHYA 2RAUA 2D1FA 1QF7A 2FWAA 1E2KA 5F12A 3A1CA 3DV9A 1R4AA 3VZPA 3R3ZA 3I5UA 1X3SA 2XGMA 5CR9A 1OJLA 4DJ5X 1K5PA 1QHHA 4AZSA 1J99A 3PD7A 2H2FA 4JVNA 2DBVO 4OU4A 4W4TA 3TIGA 4IMIB 1TADA 4TYYA 1L4HA 1A5ZA 3R3YA 3KXLA 3QOFA 4JITA 3RJMA 4BE9A 4YCSA 5KYKA 1EK2A 4Z3DA 3G2JA 2IYOA 2V7VA 1U8XX 3GDHA 4B32A 1FFXB 2GUWA 4ZXPA 5AKJA 2P9QA 1NVVR 2DFKB 3CRZA 2YHAA 1MQ8B 1DQZA 1E3SA 1UJCA 2HJSA 3HSKA 3K96A 1Q7GA 3QX7A 4JX8A 4MDEA 1F3OA 4ZP1A 5JAZA 4EM6A 5AVQA 1LZKA 4NOLA 2HIMA 2CNLA 1SHZA 1KVSA 2D2VA 2DLDA 4H77A 4YWJA 4ZYVA 2Q6LA 3HYLA 2AZDA 1XDGA 2PGXA 2WUGA 3OJOA 3B2NA 4J75A 1CQIA 1VPVA 3GOHA 5JHGB 9GPBA 2CJFA 2VJNA 1HOTA 2YNMC 1SVNA 3WVNA 4C7JA 1WHTB 3FDIA 2Q0QA 1VGQA 2VH2A 5FAKA 5DNYB 4KRXA 5BW6B 4JLMA 3REOA 4AZTA 2J46A 4RVSA 2FMXA 4Q24A 3KYCA 3LI2A 2OEPA 1U1CA 3URKA 3G2LA 1ZJ5A 5LUBA 1ZZGA 4YC7A 4D6XA 1A1VA 1TTTA 3EDCA 3GLVA 2O4CA 1U2RA 3CCFA 1Z2PX 3EVCA 3FYTA 4H6PA 1AMUA 3W2TA 4FR2A 2HT1A 5IUNC 1A4XA 3CE9A 1P4HA 1VKOA 3IMKA 3LT1A 1AXEA 4OGLA 4ESOA 4YJGA 3AOEA 3WR5A 3L4BA 4EGFA 1BFUA 4BNHA 3IT0A 1LJLA 3LC2O 2RGRA 2IIQA 3L7YA 4D0NA 1UZUA 2ZIXA 4G09A 3KU4A 3EOZA 4IINA 5B1HA 2GSDA 5JC1A 2UVPB 1GEGA 3P9NA 1XAHA 1ZH8A 221PA 4IFBA 1H65A 3LXUX 4LNAA 4YT8A 5J2UA 3RODA 4JBHA 1PLKA 2B5OA 3E7PA 4B9EA 4JT2A 1Z08A 3AM3A 4CM9D 1PGQA 1QG4A 2QUZA 3CJRA 3DZGA 4H0FA 5EUCA 2XYRA 2W37A 3AW9A 4GM1A 1IDOA 4L6CA 5EJMA 3RSQA 1VLZA 5GGYA 1GRVA 3PXEA 3VDMA 2AYYA 3GGCA 4LDNA 4N5NA 4O29A 1HKHA 4YJ3A 1AJEA 3BTOA 4QJIA 1IUOA 3CUTA 1P72A 3Q7EA 1AXRA 4H3HB 4P4TA 2Q4TA 5EIHA 2C57A 4PICA 4QTTB 5DHFA 4AUKA 4D98A 4X66B 1X1TA 1SOMA 2C54A 2J4DA 2VP9A 1NJ6A 3DF7A 1BH2A 1KYIA 5IWCA 2Z6VA 3HKCB 4YT4A 4XM2A 3DDOA 3QBDA 1C29B 3RNLA 2QPOA 4ZO7A 5B3JA 1EVLA 9MHTA 1KJ9A 3L1UA 1JHUA 4HTFB 3JQ8A 4WVLA 4G1BA 4XGKA 4QYWA 1SCQA 3A6EA 2K5UA 3HG7A 4DIFA 4L08A 2RHTA 3TW6A 1S2NA 1E2EA 1Y1KE 2CXSA 3OTOB 1NBEA 3IB3A 4Q01A 3OQMA 2OK7A 4IVPA 3ZY4A 5DO9A 4F6RB 3PFWO 1PZMA 4ZHQF 5EWJB 4GSLA 1MGPA 4C9BA 1A8IA 2FLVA 2QAGC 2RGAA 5CFNA 4CQMD 1TT5A 1TUIA 1P80A 3NTRA 1X9HA 1TFUA 1UM8A 3AYZB 4CV0A 3U7RA 2AEJA 3O75A 4MUKA 4GI2A 5IVHA 3AF0A 3BXEA 5JARA 3PGA1 3N9IA 3HXMA 1UBMS 3HU3A 4HRXA 5HGJA 3I30X 3I92A 2B1GA 3ADOA 4P4GA 1CDOA 1ZGJA 2DPYA 4LZLA 3NHBA 4P54A 3FBGA 4YA6A 5FO1A 4AU1A 3RYCB 1E4YA 1UJMA 1XAIA 2DFLA 1GLGA 3M5WA 3UHOA 4Q37A 5LDHA 2WY2D 4G37A 1W30A 3SZUA 3SFZA 3DEZA 3CN7A 4RW0A 1G2QA 3EIUA 3JXEA 3GEGA 3SN6A 4L5CA 1NKSA 4PQFA 3HSYA 4ZCIA 3TIXB 3A31A 2PH1A 3M9WA 5JO0A 4C06A 4OA8A 3F2VA 1U0LA 2C4VA 4B6JA 1SKMA 4JT4A 4RH3A 1OFIA 4NXNB 1XZQA 3D2AA 2Q49A 2OESA 4RENA 4W63A 3ISTA 1SUDA 4FDMA 1DEKA 3F7OA 1Q7CA 1BG6A 3A1DA 2XB8A 4K46A 5JPIA 3DP9A 1JEOA 2PKCA 3TVDA 3KS9A 2O52A 3W0LB 3WDMA 2MJLA 1SCBA 1UBGA 5K45A 1U0NA 3FKSD 2VJLA 3H86A 2CZQA 4IJWA 1H2YA 1ZUD1 1P19A 2FAXA 2YC2C 2MSCB 4JUAA 5P21A 3SQMA 1EQUA 4GPEA 1GYQA 1XVIA 2WM2A 5FBQB 3N6VA 1L3BA 4ENUA 1GT91 4XTCS 4F9TA 4URUR 2P30A 3ROEA 5GONF 1CPYA 2PUEA 2YDYA 3LOQA 1KS9A 4W9MC 2XKKA 1NTOA 2Q6TA 3QG5A 4HDRA 4E22A 3ADDA 2NV2B 1QYXA 4X6LA 2C5EA 1YNSA 3GT3A 2WFLA 3MOSA 1RFLA 1TD1A 3DOIA 3WGIA 1G20A 2CCGA 1A76A 2CC2A 4PINA 4ZZ3A 3CX8A 1E0KA 7MDHA 2L17A 3PNMA 4RIHA 1NF3A 2FPWA 3B12A 4HNAA 2JD0A 3JZIA 4JR1A 1VI5A 4ARIA 3DB2A 4J4HA 3H9UA 1JLSA 2BMAA 4KO3S 3CNEA 4R6WA 5C80A 2RGWA 2HBQA 1BWQA 2FUCA 4EY4A 2EQAA 4BZZA 4PSVA 2ZW9A 3LYAA 1Q7EA 4LK3A 1YR9A 3N53A 4BQEA 1EG7A 2I3ZA 4UHBA 2AZMA 2HU5A 4D8UA 2YY6A 4B1FA 1A4UA 4UVDA 4TTVA 3FZGA 5J4HA 4QPPA 1WXDA 2IEGA 1MXHA 4U00A 2N42A 2G77B 3OP4A 5KNCA 4XB6B 1A96A 5DHAA 3Q41A 1NSYA 2XMRA 4NABA 1L7RA 3RHFA 3DAOA 4MW4A 3D43A 3TUJC 3Q9LA 5JATA 2CMFA 1PLLA 2WWFA 1Y9JA 2GN8A 3LUKA 4Q0MA 3SP1A 2G5TA 4DNXA 1ABBA 1M2JA 3IOBA 4J1TA 5K8JB 3F5DA 5IT9A 4RTPA 3Q6MA 4OREX 5E4YA 3ZYCA 3H1FA 4UEWA 1M1ZA 1P1KA 1R50A 2B99A 2GZDA 3DV0B 3C1TA 5KJEA 3PITA 3QI2A 1XZAA 1ZWLA 4X45A 4B85A 3O26A 5D3KA 4AG6A 3ES9A 2G3YA 1WTAA 4RZHA 4DJTA 4KH0A 1IC6A 4KR6A 1JQBA 5IM4A 2W6JD 3JPYA 3GP5A 1V6CA 1IY1A 4RJ2A 5HXAA 5I4CA 2UYYA 2GEDA 3BXHA 4MUHA 3DE4X 3MXTA 2IH5A 4K9NA 4NHEA 4Q4JB 2HF7A 5HS4A 3I8SA 2DFNA 4YJ2F 2ZRPA 3CA8A 1QP0A 2VKTA 2CJPA 3IRVA 1NFRA 5LSAA 5DGCA 3I58A 4NS1A 2HUPA 2IPAB 1XF1A 3L0BA 4JJGA 4URWR 5IDWA 4CR8A 2A1TR 1WDKA 2ZJFA 5JSQA 3L4KA 4FJ0A 1RZRD 2QDXA 3AKEA 3ADPA 2AI1A 2VPXA 1E7YA 1R15A 2C2WA 2Q1XA 5EUMA 1PZFA 4ZVNA 4N39A 1FNNA 3D1JA 2HIGA 2WF8A 4LEIA 1P3DA 5KAMA 5SZJA 1U2DC 2GHQA 4YRKA 3VDQA 2PXXA 3KVOA 4DDUA 1FZTA 2BRUA 5CB4A 3VI3B 2HJGA 2SICE 4EPRA 1YZNA 2GPBA 4ENVA 1WLSA 2CF6A 1Z6TA 2O7NA 2XD9A 4JMPA 3OT1A 3C3JA 5ILGA 1HZZA 3ZU4A 5DN6D 2JG3A 3O74A 1Y4AE 3ED5A 1S8FA 2DJ5A 3T7DA 1S2IA 1NURA 4BGVA 3QEAZ 5T67A 1WJGA 1N6LA 3OA0A 4RAOA 4Z3KA 4F2HA 5E6UB 4XVUA 3SIWA 3ITDA 4TTTS 4W5TA 1JHZA 5FADA 5A03A 1TDJA 3M6WA 2ODBA 3W4JA 5TNXA 3MC1A 1QR2A 3N2IA 3E7FA 4IIVA 8ATCA 1JAYA 3IO3A 2LUOA 3TRDA 2ZT5A 3KXDA 1Q3TA 4NS4A 3S8MA 4U7TB 1H9BA 4Q4HA 2ZR0A 4R8KA 2TSYB 3MWDA 4INJA 1ESNA 3AR3A 1OXKB 3C3WA 1IWBB 5EIWA 5CEFA 3LK6A 4JEUA 4ZC1A 1M3SA 3QNUA 1EBBA 4H4EA 4IGEA 4GXRA 1A04A 1YA8A 1DCKA 4O3FA 4QOHA 4RF3A 3N8KA 4HNUA 5A5GA 2VH1A 3MFYA 1G21B 5BXYA 2PRKA 4DB4A 4X95A 1RYFA 4B79A 1DL5A 1PFGA 1JHYA 1JKIA 5D7NA 4MV0A 4I4NA 1H9CA 1PV1A 3I6BA 5CB8A 4R68A 3JSAA 4CYMA 3HY4A 1RRGA 4YYEA 1AF7A 2YUTA 3FNQA 3IT1A 1ZJZA 2HK8A 3G2MA 5A6SB 1F0PA 2QSUA 4XGIA 4JI1B 2FZCA 5I01A 1SXIA 2R11A 1JIQA 1Y5NA 1OIXA 2V6FA 1QYDA 4OBXA 2PO5A 5ESWA 4A6DA 3IL2A 2ZDQA 1EFHA 2B4KA 1UKZA 1EHIA 2I4OA 1TKRA 3GELA 4MVWA 1RQ7A 1Y4SA 4Q6WA 3V7WA 3ID6C 1US8A 1XFDA 2X14A 5HMLA 1XG5A 3V7UA 4M6WB 1XQ9A 2AEFA 3DVQX 2WD7B 3CNHA 1Z0IA 3WLTA 1QR6A 3C5HA 2C77A 4BJ5A 1JLLB 2J6HA 3D6AA 2JW5A 2PKXA 3QNWA 5DWDA 3ENVA 5I9SA 5B64A 4XWAA 4KR3A 2Q3EA 4KXXA 1LPNA 2JIOA 1PJLA 1QCCA 2FEMA 2POCA 3TD2A 1OFGA 1Y1TA 4ZVOA 2KQUA 3AUKA 3DMFA 4OD0A 4R1TA 2BY4A 1H1TA 1DRKA 1T4BA 2AFHB 2NUAA 2V74B 3SZ3A 2ZR7A 3K4HA 1OZ0A 5EFZA 2REOA 2XMZA 2DUUA 1O94C 2IQ5A 3ETHA 3F4KA 4K9DA 5CLHA 3QFFA 4BKMA 4BNXA 4E2ZA 2TYSB 2IE8A 5HUHA 2BE9A 5AICA 2IYVA 3TRHA 4JH0A 3D4NA 1P62B 1JKJB 1U0FA 5HZKA 1HETA 4GC5A 3BZUA 1N4AA 4PQEA 1C7JA 1CFJA 3Q2IA 4YLGA 3ZDXB 4KJXA 4EMBA 5JNVA 2CV0A 4NZYA 2CFOA 3A3NA 3S70A 3R23A 5IDVA 3DOCA 1XMOB 1POWA 3KT6A 4A15A 5EP2A 2E85A 4TYQA 1VL8A 2BKXA 3KFVA 2YXBA 3OCZA 4WHMA 4MV8A 1I1NA 1P3Y1 1Q95A 2BBWA 1C8BA 3OZXA 4BDSA 3A4VA 3QZUA 1XCGB 1Y8CA 4OK3A 1L5ZA 4TN5A 1RQXA 1QG0A 1Z56C 2UKDA 2PJDA 2ASVA 2W22A 3IFSA 5ERGB 4MVJH 3ZCUA 2GK3A 2W43A 2R6JA 3D6JA 1MD9A 1RQGA 1TPZA 5P8WA 3TN7A 2PBLA 3B70A 1KYTA 2Z8XA 1IZYA 3CF4A 4FBMA 4QOJA 3KKPA 3N2ZB 2Q2VA 4G1UC 3VOSA 3CISA 3GF4A 3AEKA 4U7DA 4J16C 1SU6A 2AUMA 1XZLA 5DISB 5JR3A 2X8BA 2XE4A 2XUQA 3M5DA 3ONVA 4GX5A 1A2BA 4MICA 4CMIB 1AB6A 1YU9A 3OU2A 2QROA 3P8ZA 2PYDA 5A4IS 4Y6PA 3ILVA 3NTOA 3ORYA 2VUHB 2EX0A 1WXGA 1D9ZA 1Y3HA 3HO1A 2PPVA 1HQDA 4OPMA 5AKIA 2I76A 1THZA 1UH5A 2KLHA 5CT6A 5D1HA 4EBFA 5JECA 3THOA 2XI4A 2JGJA 3WICA 3KUXA 1FP4B 1KPHA 1L7NA 4A8PA 3GZNA 4JJ7A 1C8KA 2QGFA 2QMHA 2JKYA 2ACVA 2ODPA 1XMXA 5C52B 3B1YA 4AQDA 5AUOB 4C04A 2H1FA 4M22A 5H5JA 5HCUA 4R4JA 2Z4SA 2LD4A 4FDLA 1EGHA 2D06A 2X0KA 1JDNA 1I3NA 3L1JA 4ZVKA 4BX9A 4JCCA 3PC2A 4IQ0A 4WD3A 4BNDB 4HPJB 3H5NA 4MUYA 2HEGA 4TTQA 1FTGA 3TJZA 4DW8A 4ER6A 3EFEA 1CNMA 1W34A 2DCMA 2NO9A 1GXSB 3HMKA 4LZZA 4M60A 3N70A 3ZE1B 4CLOB 5KQLA 1FFCA 2OUIA 3WGTA 4LF4B 1JYSA 1YHZA 3SC3A 4NBUA 4JYZA 1JDJA 1LC0A 1X1CA 1V95A 1UEIA 2J4FA 1JZQA 1N8TA 3C7CB 1CY4A 4MKFA 3THRA 2Z09A 2EF0A 3P96A 4DTIA 1PJAA 3RSHA 1CY8A 3H2ZA 3KNZA 1VM6A 1Q6ZA 2VF8A 3HB1A 4BFVA 1Y42X 3AB7A 5LNK6 1WV0A 3IKLA 5COBA 2Q4EA 4B46A 4HAOA 1BYUA 2FVYA 1CT9A 5EJ4A 1ZHFA 3WAJA 1IHOA 4OL0A 2R8ZA 1LPPA 2BBSA 4MDFA 2V8OA 3P0RA 3GRKA 1F20A 1NAIA 1L4MA 4J0EA 4UD6A 2XF2A 5DF1A 1GRNA 3ZV6A 3ZN2A 5BSVA 1R2QA 1S2DA 1TW2A 1I6WA 2AG5A 3UBTA 3VPSA 3JYOA 3IQDB 1AKYA 3M33A 3GLRA 3KQNA 1WB4A 4GX2A 3UZUA 2O0LA 3EXAA 3LCRA 1H66A 1RKVA 1ZNZA 2PVSA 2PFGA 4OFWA 5EKDA 1U3VA 6ADHA 3AL0C 4J2HA 3BE6A 3NM4A 1ISHA 3WRYA 2IHUA 1RBZA 1UC5B 2I65A 3S1AB 3G0IA 2Q5QA 4PYMA 1KWKA 3ECSA 1HDRA 1I0LA 2IQIA 3W34A 2ZBRA 4MYCA 1KY3A 1Q7TA 1QVZA 5DLEA 4Z9BA 5EWMB 3HYCA 1VL1A 1DXYA 2GPWA 3GLFB 3QSGA 2Y1GA 3X2SA 3KHUA 5J5VA 4R41A 4D3SA 3LMKA 2DH6A 4A6PA 2Q50A 4PU0A 3SQLA 1C4WA 3WIUA 3QU5A 4F5WA 3O4GA 1KMCA 1OVMA 1SZJG 3ON5A 4WUTA 4R98A 4FXPA 1SBQA 1B76A 4I1YA 4LV6A 1Z5ZA 2PD6A 1TO2E 5DRTA 1GSHA 3DKPA 3EIQA 3MAAC 4DLPA 5CDUA 2A9OA 1H85A 1E62A 2OFOA 3L02A 1M1NB 3SVZA 3HZRA 4ZODA 2PUBA 3VU1A 2G71A 4KWTA 5CD9A 4MARA 1G3MA 4TGLA 5DT9A 1RLUA 4EUNA 1ZGBA 3FZEA 1XZBA 1BXRB 2WEKA 4LY0A 4ZALA 3EMDA 4MW9A 3M81A 4Y0AA 2IYLD 4AD8A 2HA7A 2FHPA 3BWYA 3B3JA 2NVUA 5EMMA 3P2YA 1WCIA 3RBZA 1EFRD 1SB8A 1WD5A 2E4AA 1PFYA 2WHQA 3R9KA 4N5LA 4UEJA 3DFZA 1LTHR 1E64A 5HKBA 1OXUA 4CCYB 1G2PA 4JYPA 1MB0A 5LU8A 2ZWIA 4I81A 1GILA 4F2DA 1O1YA 3FZNA 3IPLA 3I9JA 1S3FA 5C7IO 1KETA 3WQQA 4U6NA 1ZNWA 1JH9A 2I4NA 4EA6A 3DCJA 2FU5C 3UTDA 1JTVA 3ND5A 3ZGYA 3C41J 1S1MA 3H04A 1L9XA 3F1LA 3ZEIA 1T6NA 1GKYA 2YWBA 1H2FA 4IDEA 2BTOA 3FSJX 3V8QA 1CJTC 3H11B 1P4RA 4QHSA 5CA0B 2VJMB 1Q11A 1ZBDA 4FP9A 2D7DA 1BA2A 1XYGA 1JAIA 3UXYA 5GZ1A 5BV2P 1DXHA 1XVVA 2YN0A 3IAHA 2Q4BA 4DUGA 1Z4PX 2MYUA 1F2VA 1YUMA 3MCTA 4KCGA 3KJZA 5EHXA 5F3DA 1RJWA 3A0RB 3U4IA 1KH2A 2OZLA 4AWAA 3HKEA 2Y6VA 1P9RA 4EAAA 1XCOA 1Q50A 1SZPA 5E3JA 1R5OA 3OCYA 2ZXUA 3GLGB 1E6KA 4ALLA 1HYBA 3O8QA 1N77A 2FRVA 5PGMA 3NOVA 3K9BA 1QIJA 4R1PA 2R7LA 1DGQA 1IM8A 1T29A 4RZ2A 5EZSA 5LBIA 4EB6B 1NQ5A 4LV8B 1SEPA 1X39A 2HMWA 4NG4A 4P34A 3RGGA 4AIIA 4QLBA 4E6EA 3DLAA 5AUQA 5CGZA 1H23A 4WI1A 5F5XA 4I3GA 3DZDA 4P3NA 4JNCA 2Y1CA 4U8HA 1Z2DA 2D5BA 3D0OA 3LLMA 5C5IA 3EBPA 3QLJA 4MROA 2ZTUA 2GA8A 1U90A 4XJSA 4A8JB 3I9NA 5AHRA 5BVHB 3RTAA 1DQSA 1R6DA 4IFTA 3D3WB 4M2LA 4NYIQ 3VUEA 4FNMA 1ILEA 3NJ8A 3A6HA 4QPNA 1EIZA 3FHCB 4J3FA 4UUAA 2WYOA 2FWNA 2G8NA 3LXRA 3RFTA 3NNSA 3OCXA 1O58A 2GBCA 2QAGB 2OMKA 2XF8A 4TSKA 3WZMA 2FLWA 4HCJA 3H4VA 3ZIAD 2WHRA 1J09A 3AUYA 4JQOA 4LIPD 1BD3A 4OJMX 1BKYA 1E3IA 2I1LA 1FY2A 2VTBA 4MHTA 4TLLB 4KX3A 2R6GA 4JI2B 1M33A 3GLHB 3TINA 3AFOA 5DX8A 1B8NA 2VQDA 4NZOA 1OZAA 3BCSA 3JQDA 3O3MB 5ALXA 3W9UA 2XRYA 3V2IA 3IDQA 4DQXA 3PQFA 2XT0A 4KDFA 5JTTA 2VOJA 4EVQA 3PEWA 4IAOA 4L85A 1AMNA 1TTPB 4ZDIA 1LLQA 3L7KA 4OJTA 4RQUA 5AKZA 3H5LA 4DIEA 2XA1A 4M7OA 4P3XA 5B12A 5LQJA 3AF6A 2QUAA 4JZYA 2PIAA 2W6NA 4C1NA 1FJHA 3K09A 4LSWA 3CEJA 4WEOA 3FNEA 5G0VA 4B5LA 4RD0A 2GFHA 1EDBA 3PEVA 5DP1A 1UANA 3EXG2 1U8ZA 3KXKA 2BT4A 3IT2A 2WD8A 3KYBA 3PUIA 5LQRA 2I1WA 1XTTA 4NCHA 4AUEA 2CNWD 1XDBA 2GVNA 1J1IA 2PRIA 2PA3A 1BVUA 4IQ4A 4YXWD 3UGJA 2D2IA 3HV0A 4PZLA 1NRIA 1O5OA 1BCSA 3WZLA 4G8BA 1QDLB 2EU8A 1AS3A 4JLKA 4Y0NA 5AW3A 2ZP1A 2QR3A 4JJKA 3U3MA 3KTDA 4BZQA 5HOQA 1NPTO 3FDZB 1LDNA 3LYLA 1TYEB 3OEYA 3JASB 4C20A 1YZLA 3V6LA 3BD7A 4MUJA 4NU6A 4D4KA 1E5XA 2VDWA 3JARB 2HO5A 5B1DA 3RYIA 1EXVA 3WLAA 2ZTHA 5EJ9A 1DKNA 5ADUS 4FINA 4RXUA 3QJGA 3GAMA 3ML1A 3UQZA 3TEMA 1GTJ1 3V80A 1HY3A 1SBZA 3SF8A 3NTXA 5JV5A 2ANBA 3W4KA 4YMUA 5AQEA 5I48A 2IEIA 2C2ZA 4DCJA 1V1MB 1VE9A 4EJSC 3Q3JB 3H3XA 5BMVF 5J4LA 1TM4E 2FPOA 1MO5A 2G7MC 2H29A 2YOHA 3I6QA 2VDMB 3MBKA 4PZDA 4G0NA 4DC9A 2ZI4A 3O83A 2VJPA 5JAPA 4U2BA 2R47A 1AZSC 2HF9A 2X15A 4BX3A 2QXUA 3YASA 5J2TF 1ZVJA 4D57A 4B35A 5DCWA 4B7XA 4B44A 2VPPA 3EQ9A 3MIZA 2XVYA 1DX6A 3ER8A 1LJ8A 5FXMA 5A9SB 1XOIA 2WT9A 2MWMA 1JIJA 1JP7A 3VPFA 4MH0R 4LBWA 1UK9A 2QMOA 2Y4NA 5BR1A 2QY6A 3I9V6 4N3AA 1YZKA 2NT3A 1JPVA 3UJBA 1EFKA 1G38A 2WLSA 4LPSA 4I5DA 3K20A 3QF7A 3ZNNA 1L7PA 3FNHA 4BNZA 2WU0A 1HYHA 1GSAA 1V8BA 3FRHA 3T9DA 4Y8VA 4RF5A 4AMUA 1REQA 1CR6A 1F8XA 3IMGA 4XWOA 1C4XA 1PJCA 5A3SA 4GX1A 5B30A 3M6AA 3RLFA 5L6LB 3D1VA 2NU6B 1O4VA 1T0BA 4N9QA 3KSAC 3A6PC 1NM5C 4F93B 2V58A 1G291 4L8VA 5JCJD 4KITB 1ZN2A 1ISRA 1PLJA 2WP8J 2XH8A 1FXWA 4FMBB 4GS5A 1UQUA 4MPRA 2NXCA 2QZ4A 4AMZA 4S24A 4DBVO 4ZC8A 4RA9A 5TQVA 2XGGA 2LV8A 2OCXA 3DVAB 3G2HA 2AF4C 4DWJA 4Q7MB 1DC5A 1NW5A 1SEVA 2EFYA 1CFZA 3VH4A 4RSHA 3ZVLA 2BE7A 3QIVA 4B76A 4DRXB 3TGPA 1H3EA 1JT2A 3JWPA 2ZWVA 5BT9A 5KNBA 1L7BA 1GZVA 1QC5A 1M72A 1UT6A 3EFBA 4NCKA 7AT1A 2XPCA 1X8LA 4BRSA 5JW6A 4YP6A 3PVSA 2PD3A 2X4LA 1TAGA 2OB2A 2YVLA 4J94A 4UUMA 2C8KA 2I99A 3HJBA 2WP0A 3PX2A 4KNYA 2R8RA 3RE1A 3SS8A 2KE5A 3MTIA 3PRYA 4XQ9A 2D54A 4X20A 2EFHB 2O1SA 3DSRA 1M74A 4HQRA 2O54A 5ABPA 4XYBA 2C2BA 4I9FA 1L5OA 1WXEA 1Y8QA 1ZN7A 4MAFA 3ADBA 3GFPA 1ZZEA 1HLFA 2HBRA 1O96B 3CM0A 3L40A 3EWAA 4HF7A 5I9TA 3SLKA 3W7AA 4EO9A 2J3IA 5K2OA 2FSGA 2N75A 2B3TA 3N0TA 1C0IA 2OPBA 3ZCRA 1WZ2A 3OPXA 2A88A 1GZSA 2OYRA 3FFAA 1Y9EA 3NI2A 1DTSA 2CJXA 2FN9A 2OV8A 5CH8A 4NE9A 3OCVA 4WXEA 5HKAA 1DIHA 3QQ5A 3LVFO 4GWKA 2W4IA 5KIAA 4NU5A 1DBIA 3GB9A 4EQ6B 1SC4A 2ZRDA 1K8YB 1BEZA 2I3DA 5DBEX 2VHZA 3ICPA 3IV9A 2FLKA 2XNSA 3U3JA 1YZHA 1ZESA 3GEHA 3DEYX 4LJKA 5AOCA 5FUWA 1FUKA 3WLOA 4QOEA 3VUFA 1JDBB 1BX0A 2AZXA 3RFFA 2BJHA 4AKEA 1IZ7A 1E94E 4H59A 1TPYA 4Z9AA 2HY7A 2NQ8A 4XQGA 4M99A 4BKPA 4W1SA 4YHHB 3MIIA 3OM9A 3ITEA 4F9FA 3D5EA 1DIAA 1VLLA 3AR2A 2R66A 3N6XA 2QSZA 1EFVB 1U2QA 1YB1A 2UZ1B 3NIDB 1UMCA 4IIJB 3UWDA 4ZOLA 5E2AA 3U62A 3WIDA 1Q57A 5ALYA 4NMWA 3REFA 3B3QA 2J3QA 3VOBA 4BNFA 3BRCA 1Z5GA 3ZGZA 1O97C 3QMPA 1IK6A 1L5FA 3P4XA 3WGNA 3VNQA 4RBNA 4LHZA 1GNSA 2AUTA 2PKQP 5BN1A 2ACKA 3R7FA 4E5SA 3EN0A 3EF0A 4DZTA 3ESQA 3C3EA 4RL4A 3PE3A 4W5JA 3VDNB 4AY6A 4YI5A 3KVNA 2PFKA 4CF6A 4ZPXA 3ROXA 1RWQA 3DLIA 5B1YA 1QGZA 4YCJA 1M75A 4DXDA 1M2EA 4IMJB 3AEUB 2WV9A 3BMNA 4Y1FA 3AY0A 4ZCPA 1YWGO 3THXB 3FCXA 4RDCA 1N2CB 3WWPA 4I4TF 1U6JA 5A1TA 3RCBA 5KWJA 4RLSA 2LCQA 3ZDQA 4CEHA 2JAOA 3AYXB 4G0MA 4N5DA 5DH9A 2FZVA 4AJLA 5LQAA 3PFBA 1MKYA 1Y8RA 4Q1DA 3UC9A 3HDJA 1T8RA 1VBMA 2DG2A 4BV9A 4ZV9A 4CKEA 4BLTA 1AS0A 4CWAA 2XKAA 2IW1A 3C3KA 4ILKA 3TQCA 2BZ1A 1YKFA 4GVXA 1T0IA 1Z8NA 1RJEA 3HTXA 3Q40A 1D7AA 4EH1A 2JHAA 4MVJI 4CIDA 3HDTA 2GZ2A 3H2BA 4ZAFA 3VVCA 4C3VA 3V97A 2RB5A 3DVLA 1IJFA 4JT8A 5KNDD 1Z4OA 5DGHA 3ANLA 5DTRA 1P61B 5D01A 4CN9A 5FBRB 2UZ4A 1EJ0A 1DFGA 1PK9A 4YCNA 4BZPA 3T5PA 4FEEA 3LOUA 2MIIA 4L75A 3AVVA 1Q74A 3AGPA 4YY3B 1T13A 1NW3A 4IH9A 2JFWA 4UASA 1E1NA 1JB9A 1GR1A 1T36A 1PR5A 4D81A 3DCIA 5J1SB 4HDQB 2IV7A 3D9QX 4LXGA 3IPCA 2EYUA 4CKCB 4BO0A 2V5VA 2GNAA 5AKHA 5C37A 5LIPA 5DIFA 4C4RA 2D0PB 5TF0A 4CQLB 2BGLA 3WISA 3ZJYA 4EMTA 3WAKA 2V6GA 5JYEA 4G0UA 4MKHA 3CNLA 4P93A 3E03A 5DYTA 3M2PA 1O2DA 4BBZA 4M4SA 1HLDA 3U31A 2QE6A 4I4CA 2VP0A 2FG7C 1H6DA 3PDUA 1T8UA 3CNOA 3OPQA 3U60B 3WJ2A 5JWHA 5CX1B 1VSVA 2FETA 1Z0SA 2R8YA 1CZUA 3MGGA 4ZT5A 5JDIC 5E3HA 5AK3A 5FUVA 1MO2A 2YS7A 1YTLA 4KPUA 3L0IB 4X9XA 3OE1A 3V4FA 1SBCA 1VLQA 4A0SA 1KH3A 2AD1A 3M1AA 3O8OB 4JBXA 4PNPA 3M6FA 3GPLA 2WTUA 3BRQA 5JCOA 2QYOA 1TQHA 1H0RA 3TFWA 2NSJA 2EAUA 1JG6A 1C1XA 1OIWA 4IBOA 4DCPA 2PDAA 3OX4A 2FPIA 1JFTA 2FDCA 3EPHA 5AKEA 1ZI6A 2AEEA 3FWHA 2YH2A 3WGLA 1ZUIA 5IAGA 5CYGA 4GBMA 4MPDA 4PO3X 3BFJA 4HDMA 2XMPA 1Z0JA 2XVAA 4YCBA 5JFTA 3PPIA 3SHTA 1RE0A 2ORVA 2YQ4A 1SPXA 2ZBUA 1U8EA 3QE0A 1KHTA 4UBIA 3ZVKA 4QLAA 3ZI0A 1AF4A 2KBFA 1EFDN 1PR3A 3W77A 3EZXA 3NGLA 1MVOA 2VTVA 5A2QA 1BA3A 2O3TA 3MHPA 4X63A 2QX6A 4E13A 2GXSA 2VAWA 4R69A 3AI2A 1CUYA 1P31A 1PG5A 1T6ZA 2G9VA 3E9YA 3IQIX 2PX4A 1OH8A 4CJXA 1S7GA 3BB1A 3PEYA 4QVIA 3W5UA 2FMUA 3SSMA 1WF3A 4BBAA 1VHJA 1C3LA 4XCVA 4HUQB 2LWIA 2G63A 3B48A 3KPYA 2R6FA 4K6CA 5JMTA 3TG2A 2QTGA 5DU2A 2BLLA 2IZ1A 5F33A 3R7LA 4BGUA 4HQLA 4GPD1 4A1OA 4HDSA 1QSGA 3ANXA 3RUPA 3PNKA 3T38A 3D81A 2YZGA 4PLYA 1YOVA 3IOCA 1V7ZA 3B52X 3EOBI 3WHIA 4M1SA 3H17A 3TL2A 1G4AE 3DR5A 4GG1A 1D2EA 1VXRA 1Y6ZA 3TJRA 1X7DA 4BWVA 1DUIA 2XQJA 3SEQA 1CYDA 2ZYUX 4BNVA 2W2NA 4H7JA 4HDAA 3QVLA 2OTCA 2RAPA 2Y9PB 3H5IA 1QYWA 3DZHA 1EVYA 4D4GA 5I8WA 1KFBB 1O6BA 2CNNA 2ZIWB 1IRXA 5CCDA 3B53X 1Z8FA 1A88A 3F6YA 4P2BA 2IEDA 3ZCXA 5KREA 2ONCA 3C3AA 1Z5NA 4EY6A 1KP2A 2VZEA 4TL9A 4HYEA 1QIGA 2IYUA 3LQQA 2VATA 1QANA 1ZMRA 1NI4B 1RYEA 1SUFA 1T2NA 2GBIA 2HPZA 3O38A 2PR2A 3AY6A 4ARZA 4EHJA 4LECA 4WGGA 4QG3A 4ND6A 5REQB 2Y3IA 4C6TB 9ABPA 4Q16A 3HLYA 2OGZA 2J7PD 3KYDB 4IDOA 4XUCA 4M9UA 1GAWA 2QIPA 1U11A 1K88A 2PD4A 2DB3A 1EM6A 2O7QA 2G76A 3R6WA 2OV1A 4RA6A 2RCYA 4ZRMA 5EJ5A 4H15A 4K6HA 4HXFB 4JGGA 1CRZA 1ETUA 1TYZA 2V4ZA 3AHJA 4S1OA 4DUPA 5KO2A 1H4VB 2W2KB 3QUTA 4OGWA 3UGQA 4AP5A 1NMXA 2CXUA 1KOJA 1VECA 1RZUA 4BUCA 2HSWA 1OILA 2WHPB 4P92A 1OASA 5KKCA 3PGMA 2BFMA 3I9OA 4PGGA 2XYQA 2WVGA 2HFJA 2WJAA 1HFKA 1GKUB 4Z0TA 5IBCA 2X3FA 3RARA 4MS3A 1NVBA 1JJFA 1LK7A 1UZAA 3T9CA 4ZCTA 1UXJA 1MPTA 2YN2A 3TQIA 4W1PA 1EX9A 1CVLA 1G19A 3JQPA 4WESA 4D74A 2AOWA 2JGIA 2JVJA 4KO1S 1K4YA 4ATNA 4CE6A 1V25A 4D41A 1T1SA 2PQ6A 2R6DA 4OFBA 1DZIA 3AM1A 4NMLA 2R79A 1OLXA 2G1UA 4PBTA 4BHTA 2Y66A 2P0AA 4AXXA 2G04A 2VHQA 4QICA 1QIIA 1XRJA 2C2KA 1BMQA 2NTVA 3VDRA 8AT1A 3NYQA 4G8DA 3DAHA 3EDRA 1FMCA 2I33A 3DMTA 4HDOB 1HORA 3RFCA 1U9ZA 2UU9B 2FRXA 3DXZA 2ZE5A 1X7HA 1SXJD 4K8RB 3UANA 3RK1A 3UMGA 1RLJA