1HGXA

Hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprtase)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
173
structure length
164
Chain Sequence
b'MDDLERVLYNQDDIQKRIRELAAELTEFYEDKNPVMICVLTGAVFFYTDLLKHLDFQLEPDYIICSSLTISKDLKTNIEGRHVLVVEDIIDTGLTMYQLLNNLQMRKPASLKVCTLCDKDIGKKAYDVPIDYCGFVVENRYIIGYGFDFHNKYRNLPVIGILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE-XANTHINE PHOSPHORIBOSYLTRANSFERASE
molecule tags Transferase (glycosyltransferase)
source organism Tritrichomonas foetus
publication title Crystal structure of the hypoxanthine-guanine-xanthine phosphoribosyltransferase from the protozoan parasite Tritrichomonas foetus.
pubmed doi rcsb
total genus 54
structure length 164
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hgxA00
1DQPA 4JLSA 1D6NA 3KB8A 4RHUA 1P19A 1ECBA 1WD5A 3EFHA 3MJDA 4KN6A 3HVUA 5EUCA 4M0UA 1HGXA 2WNSA 1V9SA 4P3KA 4WN3A 4P84A 4M0PA 1MZVA 4RHXA 1U9ZA 1BZYA 3ACDA 1FSGA 2AEEA 4RQBA 1Y0BA 1DKRA 1I5EA 1DBRA 1A97A 4RV4A 5ESXA 3QW4B 1JLRA 1U9YA 1CJBA 1UPUA 1XTVA 2E55A 1ECJA 1P4AA 3MBIA 1QK5A 1L1RA 4PFQA 4Z1OA 1QB8A 3LPNA 5JSQA 1TC1A 1BD4A 1J7JA 1DQNA 1I14A 4IJQA 1LH0A 3NAGA 1BD3A 1I13A 4RACA 1GPH1 1QK3A 2PS1A 3GEPA 3OZFA 1A4XA 4RQAA 5KAMA 4OHCA 1TC2A 1NULA 1IBSA 2IGBA 3DAHA 5BSKA 1Z7GA 2H08A 5ESWA 1W30A 2JI4A 3N2LA 1OREA 3M3HA 4LYYA 5HKLA 4P81A 1G9SA 1O5OA 3OHPA 4JITA 1ZN7A 3O7MA 4RABA 1QCDA 1L1QA 1P17A 1A95A 4LZNA 3DEZA 2JBHA 1O57A 2XBUA 4RANA 3DMPA 4P82A 4RAOA 5IAOA 5E38A 4RADA 2DY0A 1VDMA 2PRZA 1G9TA 4ZFNA 2PRYA 4RAQA 1G2PA 4M0KA 4FYMA 5IPFA 3OZGA 1UFRA 3GGJA 1PZMA 2H06A 1ZN9A 3ACBA 4X45A 1OROA 5HIAA 5BRNA 4P80A 2JKZA 1A98A 1GRVA 1STOA 4QYIA 5KAPA 1DKUA 2P1ZA 2HCRA 1ECCA 3S5JA 1XZ8A 2H07A 1QCCA 1I0LA 4F8EA 1QK4A 3G6WA 3LRTA 1ECGA 4LZAA 1QB7A 2C4KA 4TWBA 1VCHA 4X44A 4PAWA 4P86A 1OPRA 2FXVA 5BQPA 1JLSA 4WMLA 1I0IA 3ACCA 5K51A 1NONA 4MB6A 1XZNA 2VFAA 1P18A 1XTUA 4RHTA 1ZN8A 1ECFA 1XTTA 4QRIA 4QYIB 1VSTA 1A3CA 5JV5A 1UPFA 3H83A 1A96A 4LYGA 4S2UA 4RHYA 4LZOA 4P83A 1G2QA 1HMPA 2YZKA 3GGCA 1R3UA 2GEBA 1AO0A 1YFZA 2EHJA 5BQOA 2JKYA
chains in the Genus database with same CATH superfamily
4ZI7A 5LDGA 4NFLA 2O2HA 3AUXA 1AIPA 4X93A 3UQYS 1PHPA 1ZOIA 1FX1A 5GONF 4HDNB 3RVKA 5K8VA 1NE2A 3Q7RA 2PLFA 5FLKA 2W0MA 4ZAZA 4URZR 1ZNWA 1F4PA 4MRPA 3A14A 2TYSB 1S2LA 2JAUA 3F5MA 1Z5WA 1U80A 1O5IA 2MYTA 3KQYA 3MCAA 3HN6A 4LNHA 4RXUA 4WKCA 3VH4A 4C3UA 3H5TA 2A3NA 4RZHA 3BPSA 3MD9A 1Z68A 2G88A 2IEZA 2IXEA 2JH3A 4ND3A 4P92A 2IT1A 1TW3A 2PVPA 5ALEA 1AKRA 4ZV4A 4V0OA 3IHWA 1X80B 1SUIA 1KFCB 1US8B 5GM2A 2A9KA 1Y0BA 2IIVA 1NVXQ 3GEGA 4BAZA 1O9HA 4E31A 3H1BA 4EW6A 2PH1A 3I23A 3KKMA 3MS4A 4QFCA 4AJOA 5EMMA 2ZCJA 2KLBA 1J42A 4L16A 4YRQA 2AJCA 4R8LA 4DF3A 4EZIA 1XMQB 1OGYA 4FK8A 1Y3AA 4II2A 4ARUA 1QLJA 1JHZA 3DHNA 1XCOA 2Q50A 1DT5A 1TO6A 2YRFA 5KQGA 2CUTA 3AG5A 2W2KB 3FNHA 4OGLA 4OI1A 4EGSA 1JAYA 1DRVA 2I2WA 4LRTB 2WF9A 4DIOA 4WESA 4QWWA 3RARA 2RK6A 4OMCA 5K03A 4WZ6A 3PQEA 3EQZA 4U7GA 3IMCA 1X19A 1XXHE 4HQNA 4GM4A 1E3LA 4D80A 3UPUA 4EI8A 1G5RA 3PD7A 2JCVA 4DQUA 4YRJA 5AUQA 2Z2KA 3ZU5A 1E2IA 3OM0A 2ZUWA 4YAWA 3HGQA 1I9GA 2JZOA 3ICVA 2HCJB 4FINA 1DXQA 3TJRA 2EKDA 1GLNA 2ILTA 1F06A 5K1ZA 5LN1A 1H93A 1VSVA 5ADVA 4BNLA 4J3FA 3ZZ1A 3QJYA 4MKHA 4G5XA 4BVKA 2KQUA 2FFHA 2O8VA 2RBGA 1Y4AE 2XCLA 5F3DA 5CHEA 1GTJ1 1DIRA 5CDHA 5IWAB 5A3VA 1Z6YA 2NZUG 2Q1TA 3L6BA 3LM8A 3QUTA 3WYBA 3HLKA 4PZPA 5CAEB 1FXSA 3NG1A 4B47A 1O94A 2R8OA 4RVHA 1UZNA 1ESNA 3DEKA 1SC3A 4HY3A 4K8RB 2RAPA 4OVKA 3UB4A 4EB8A 2Q4OA 1CUBA 3MQFA 4EM6A 1KO4A 2BFEB 4I8XA 2FF5A 4LXTA 2G1JA 3NP9A 4MVYA 2A0WA 2A5LA 2COKA 1FUYB 3NBKA 4WVLA 1BWRA 5G4KA 1G42A 2V3VA 3NTLA 3FVTA 4HNTA 3F6PA 4YJHA 4R0MA 1M3SA 3I61A 1AZSC 1B1CA 2IHJA 3OURA 4R6WA 1R0BA 3RD5A 1ZW1A 4FFSA 1U28C 2RH8A 2IJGX 3OOEA 2WJWA 1NW9B 4YMSA 5ALGA 4JROA 3OZ7A 5JR3A 3U09A 5BQPA 2VL7A 5GIOE 1TKBA 1HMYA 3QY0A 3ND7A 4IV8A 4RH3A 1Q16A 3RFXA 4FONA 4EECA 4ZALA 3FOBA 3QHQA 1JE1A 3UJHA 2I91A 1N7HA 1NMXA 3KQVA 1RLOA 3RYFA 4GPAA 3H2YA 5FQNA 3CEHA 3IB3A 4DIDA 3BRCA 2JATA 5C1OA 2ZRCA 3PNSA 5EMKA 5EESA 5KNBH 1COWA 5HKAA 5EZYF 4LYGA 5AHOA 2AH5A 1G41A 3V55A 1J8YF 2VWHA 3PEEA 4CKXA 3I2JA 2R751 4TUYA 1K0UA 1ODSA 2GZSA 2YJ5A 1Z0JA 3U4IA 3Q1KA 4DC1A 1YJXA 2P9BA 1BJKA 1AN0A 2AT1A 2E3JA 4F92B 1X8LA 3N87A 1HF3A 1QKIA 3LS2A 5IDVA 4BNWA 3DWEX 5EPUA 4RTRA 2G63A 4TMVA 1MB2A 4XWAA 1GFSA 1ZNXA 4OXNA 5TF0A 5KJ6A 2QUBA 1ISHA 4EA6A 1FCJA 2ZB7A 2PRSA 4UDYX 4YUYA 5COQA 1P9LA 4FMDB 1TXGA 5E8RA 2XUZA 2BGUA 4Q9IA 3N3BC 5K3CA 4IQGA 3G2IA 1A7AA 3TTWA 4RDHA 3PD1A 1VDZA 4UCWA 4GUDA 5KQSA 2QMUA 4H1HA 5FPHA 5JLAA 3LDUA 3GRZA 3ANTA 1TJNA 1L5LA 3Q7QA 1S3GA 3UMJA 1XJ0A 5LBIA 3KUDA 4UCXA 5SYAA 2OC4A 4CCSA 1Z0KA 2PSSA 2CFIA 5CLGA 4LDJA 1O97D 2O2YA 1JXQA 2HLHA 3IDAA 1MC4A 1XXLA 1W9MA 3UT5B 3GT3A 1DIGA 3ZZ0A 5KTKA 1X1DA 1TJ3A 1L5FA 1N2SA 1B73A 1V2GA 2OBFA 3FYUB 4HYEA 1G8AA 2H2HA 1ZUHA 2NVOA 3GGOA 4TTQA 3CYFA 1N2CB 1OT3A 1H1LB 5ALKA 1W30A 3L8CA 4KIGA 2VYND 2R48A 4OQNA 2F55A 1SB9A 3HWWA 3WRXC 2ZYVX 1F1JA 1TPYA 3FIJA 4FYVA 5DBHX 1DTWA 1L0BA 2B4RO 4ZEOA 3R7NA 2FZCA 5DW0A 2NYRA 1N4AA 2NXCA 2MSDB 2QXYA 4F96A 4XIFA 2QL5A 4LCJA 4ATNA 2PZ8A 3T9DA 3WKEA 1KZ1A 2B20A 5DNWA 3H1GA 3EDCA 3VPDA 4CUKA 4JI4B 4IILA 3AM4A 3UIEA 2H7XA 2EF0A 1MNQA 2UZ1B 4UM9D 4UNSA 1UJNA 3J81k 1J99A 1N1GA 3EGCA 1MJGA 2GPJA 2OUKA 1DFIA 1V3VA 3QFCA 4NJMB 4CG0A 2XUIA 4X65B 1KFBB 1O0SA 4E70A 1D1TA 1JDBB 4I9UA 4KI0A 1MQSA 1STOA 2A9FA 3CX7A 2I8AA 4LKRA 3T7CA 2Q3JA 6REQB 1C0EA 1SNYA 1TA0A 1VJRA 1XRJA 2ACEA 4ZT3A 2IH2A 3D7LA 5E9WA 1JLHA 3U4DA 4EYEA 3I28A 1CR4A 1ZCAA 4OJKA 2GD2A 4ZODA 3WFZA 4E5KA 1MJHA 1NRXA 4D0NA 1PYDA 3KKLA 3QV2A 4IH9A 1AUXA 2HF2A 2BH9A 3R7WB 3U81A 1UK9A 4CLHA 3ZEIA 4EHDA 4YMUA 5EJ4A 1Z47A 5A1JA 2CLKB 1TZJA 2HQRA 5DNDA 4EL0A 1ID8A 2X8BA 2DTEA 3AFNA 4US2R 3L1UA 2BUCA 1JLMA 1MO5A 3T9BA 1V1MB 2F64A 3K31A 4WDQA 3TE6A 2CJXA 5ALFA 1ZUNB 3DZHA 2ZRMA 4QYXA 4CHTA 1UBHS 3WIEA 2HMVA 4FFBB 4KE8A 3SXUA 3JQ9A 1HO3A 2QRNA 1LPMA 3A1CA 5TS2A 3LWDA 3ZGVA 1LPAB 1JA0A 2UDPA 2OILA 3IILA 2HAEA 4H7FA 1JLLA 1Y6JA 3HJAA 4N6GA 2V0CA 2ZPTX 4R9SA 2P8JA 4BE4A 2C00A 3B7GA 5CVTA 2DFKB 3SJUA 1G5HA 2AB0A 4MTLA 5JAZA 1AMOA 3ED1A 3GAFA 3OTQA 1U7WA 3UJ6A 5JJ5A 4BBZA 1TB4A 5B2FA 1D6NA 2EFDB 1AUVA 2Q2VA 1B0UA 2CXHA 3WBKA 5FTLA 3OTOB 4MVJE 1JALA 2WHPB 1RXEA 1D0SA 4U6QA 3SNKA 3WTCA 3U6BA 2HO4A 1UZUA 2AD1A 4NU0A 5AI0A 5KSPA 1H6CA 4Y1FA 1TEZA 1U8UA 1O95C 3PC4A 3VO1A 4FXOA 2CXTA 4IDEA 3RVBA 1X0XA 2WMDA 2ZJOA 2ASEA 1V35A 3V1KA 4DCMA 2UYYA 4E5MA 1IM5A 1H6BA 3IXMA 1URPA 3ADBA 1MO3A 5EUMA 3ISVA 3ZJUA 1WB6A 5LP6F 1RYNA 4F8JA 3A2MA 4B4KA 1A9RA 4EZEA 2I2XB 1U90A 5DP2A 4HZUA 1NNLA 5AR1A 1KAOA 3MD0A 4LJ5A 2PGDA 5KX5F 2DKNA 2LVBA 4FZRA 2FEMA 2IOYA 3RBAA 3LQYA 1EE9A 3NC1C 3FWKA 2R44A 1K5GA 1ZUNA 4NABA 3TRFA 4CG3A 4ML3A 3ZW8A 2GEUA 5CPBA 721PA 4YWHA 1KY5A 3QWHA 1U8AA 4LHVA 1QGAA 4WUTA 1UJ2A 1UQRA 1T13A 2B36A 5D01A 2AQKA 2AUNA 3JQFA 4EMSA 5IT5A 1KL7A 1XMOB 4MP3A 1PG5A 2QLBA 3AY3A 4FQ7A 4YGYA 1U8XX 1W4AA 4Y6PA 2VBIA 4BVFA 1I4EB 5LJIA 4H0CA 3IVCA 1E1MA 3GYBA 4KVZA 5AKYA 2H4WA 3E53A 2FOXA 2JJYA 5AD1A 1K7YA 4IUDS 4ZT7A 3VPBA 2AKEA 1VPEA 1CRLA 5E0OA 3PEYA 4FCCA 1L1QA 3IPAA 3ILSA 2E82A 5D3MB 1MQ9A 3K72B 2P9YA 5BN3A 1CW2B 4C0AC 1P9NA 1EFDN 2Z9BA 2ERXA 4KNWA 1EXDA 1YZQA 3S1AA 2D7JA 2NUTA 3ABQB 1GUFA 5EJIA 4CV2A 2OBNA 1P0CA 5E8JA 3QLUA 1PR9A 5T57A 5HM8A 1N7GA 1MAHA 1NI3A 4GPEA 4RIHA 1BDJA 4X45A 1XV5A 3RABA 3T99A 1P2UA 4QPPA 4GOKA 3KPUA 1N7IA 1U7ZA 4RZUA 2Y0BA 3AF4A 2QW1A 4MUXA 1KK0A 3UXHA 1ICIA 2H9IA 3B36A 1G6HA 2HCBA 1PLLA 3AU9A 1EFCA 1H42A 3ZG6A 5BR1A 1XDSA 4EGFA 4ODIA 3CVVA 1XTRA 2A9RA 1XZGA 2QVYX 5DLQC 5ALVA 5T7BA 1N3LA 2F3TA 1MFPA 1NNUA 1PZXA 2VAPA 3IQEA 4D99A 4ZU1X 5EKTA 1CUVA 1H2EA 4CV3A 2QHXA 4MUIA 1SVUA 2W6ZA 3ZYZA 4XDGA 5WRFA 2WIBA 2NUAA 4R1QA 3QK7A 1GNSA 1EX7A 1E6CA 2JIQA 2XTNA 4ER6A 4LQ4A 1JAIA 1FXUA 1SUCA 1WW2A 2A5FA 3B1XA 5IJ0B 5GONA 2VT6A 1Y48E 2RGXA 3AP3A 1WB9A 1R5JA 1I7DA 1GZ7A 3MB5A 4Q3EA 1WDTA 4M1MA 4HX5A 4UBOA 3H5LA 3TLYA 1SPBS 1U2QA 1E3SA 1TU4A 2OHHA 1FLVA 1HMPA 3MJ4A 5ALNA 3UW1A 5THKA 1J70A 4POAA 1PBTA 1D5WA 3B1FA 4NRDA 3WB2A 1OYYA 3U4GA 5LB4A 2O8BB 4XWOA 4U0JA 1A5BB 3SE7A 3KAPA 2NPIA 1FF9A 2VJBA 3LHSA 4H4EA 3TZHA 2EWMA 4TLDA 3OZWA 1P19A 2Q9BA 3UK6A 5ADUS 3WQSB 3T35A 2W4IA 3AJRA 1J2EA 3VR1A 3SSNA 4RJKA 1HOXA 1RHRA 3CLSC 1B4DA 2BFBA 5TMEA 3FLAA 4OGWA 4UKDA 5ELLA 4MWDA 3TRHA 1R9JA 2QGNA 4FYIA 2P6NA 2RGWA 3LX4A 1LDMA 4JT9A 4PFKA 4ENPA 5HKBA 1U0JA 4BUZA 2WVHA 1WQ4A 4RGYA 1T2DA 2ZG6A 2FRVA 4QHTA 1TU3A 2O1WA 4QOGA 2J0UA 2HA6A 5TIIA 3BGIA 4ZC1A 2C04A 3ETEA 2M98A 5CURA 1BA2A 2AUTA 1J25A 2BFFA 1A82A 2B37A 3HCOA 3PBKA 4LRWA 5K20A 4L5AA 2C4MA 2HTEA 3FTPA 3SS9X 1KOGA 5CD1A 4B17A 4ALMA 3TTUA 1P1BA 4TTRA 1JDUA 3U17A 3ZKWA 1PJBA 1Z3CA 1YTUA 5CH8A 3UWKA 2C9OA 5K7SA 4E1VA 3OZUA 4PS0A 1T9HA 4PR3A 1NVMB 5I9TA 1U6KA 3C7TA 3WWCA 3FWYA 1TA4A 3WRXA 1YOVB 5EYPA 2R6HA 5A9RA 2IUFA 3IC5A 3ZHXA 3AVXA 5BSKA 1RNLA 3KSZO 3Q5EA 5GJWC 2D2FA 2QQ0A 3C1UA 3GH1A 1XAJA 1IBCA 2BSQA 3I72A 4WZAA 4QE3A 4PYQA 4U5XA 4CIYA 3TXYA 4M9CA 3QVJA 4AXXA 2VJDA 4AY5A 4INAA 4UFOA 1Q12A 2JK1A 3DR3A 3LQKA 1RAAA 2VOEA 1FPQA 1G16A 5REQB 4FEAA 1LPNA 2MSNA 3QVXA 1TZKA 1FVOA 3A32A 3A3KA 3JR7A 4KOEC 1JNXX 4ITVA 4QXRA 2NP7A 1YS1X 2VWPA 1FDRA 1YAHA 2HIMA 3EDMA 1DAMA 1VSUA 3FNFA 3AEQA 5F2EA 5EXDA 2PX0A 4DMGA 2ZBPA 3FYHA 1Z07A 2ONZA 4G63A 5I7VA 2VT7A 4QJ4A 1I3LA 3NDPA 4G1UC 3UOWA 1JS1X 2PE5A 2BHLA 1IM8A 2NGRA 2XUJA 1PJ8A 4QUKA 3SK0A 3LKVA 4NLLA 1YL7A 3K9WA 4OHXA 4B44A 4BLQA 5A5VA 3HSKA 1E1KA 3IDQA 2B5OA 4IJMA 3TG8A 3GN1A 4JI5B 5ILOA 4A92A 2MYPA 2ZUDA 3UPTA 2CV2A 2O2DA 4OLBA 2PY6A 4ZMRA 3IS3A 2F8TA 3UT6A 5DEIA 4DQLA 3OF5A 4ENRA 3GFPA 5EZ6B 5HZHA 3PNQA 1L5YA 4TWIA 4YUAA 2NOAA 1X1BA 2P9JA 3IUPA 4OXIA 3WLQA 3ZCVA 2RJ3A 4BX0A 3Q6MA 2HNAA 5AM3A 5AM4A 5KINB 2XLCA 1KEEA 4AZTA 3DWFA 1CUYA 1E3DA 5A7HA 5AXCA 2CLOB 1D4FA 1MRZA 2XA1A 2YJ3A 3FPEA 3LT4A 3SICE 1O77A 1NVKA 4MJ3A 1V6SA 1PR3A 1T9CA 2AFIA 3NOXA 4DWWA 4EP1A 4EPYA 2FWNA 3AR9A 5E2AA 2UYHA 1NFQA 5H4HA 7ADHA 1I6KA 1GKKA 3CRVA 4QJIA 3N2GB 1OAKA 1RFLA 1U5BA 1YR3A 1E61A 1EXNA 3HUDA 3KQSA 1RTKA 1YUNA 2FUKA 4GHWA 4J16A 3KQLA 3O21A 2OESA 5DE3A 4F3NA 4JCCA 3IOYA 4F4HA 3RAFC 4F2DA 4N76A 3EIWA 1ZOSA 3EY9A 3IV7A 4FDVA 5G4KB 1P2SA 4DV2B 3RIXA 1XL0A 4EG3A 3UUFA 3T4EA 5EUCA 2P5UA 3QU2A 2LRHA 3I01A 3AEXA 3V8NA 5CYFA 1WZCA 3ZCUA 2A59A 1J7KA 2ATVA 1E1RA 3WL8A 3QLTA 4J91A 1O5TA 5LPNA 3VO2A 5I47A 4R2XA 4QNNA 2W6NA 1JWBB 3NHFA 3CX3A 3BMXA 3KAKA 2VDNB 3F3YA 3HNRA 3NORA 2JZNA 4Q4AA 3TOVA 4M8NE 3D8BA 4M21A 4OFXA 2HF9A 2J6HA 1ZUWA 4B74A 1LQ2A 5CLHA 2BFDB 1UOPA 4YRTA 5FBVB 1SXQA 2CFCA 1W47A 2UUBB 1W36B 2A0YA 4D8VA 3S40A 4MO2A 1I10A 2I4RA 3I5YA 4OI2A 1AKYA 4CCAA 4AZ3B 2YS7A 1DJNA 1W0JD 1IBSA 3KJHA 4WDRA 4U3JA 1C81A 2JFBA 2O2CA 5A03A 2NU9A 3TS1A 3WKBA 2EZUA 4HMPA 4LVCA 4MS1B 1TYBE 1MF7A 1D5CA 5TQ0B 1CQPA 3T3IA 2FETA 3KVRA 4BLTA 1RQ7A 1SOWA 1MLDA 4XGQA 2QTCA 2GDJA 5KX5B 1Z22A 3WAJA 4LK3A 2VDPB 2OBBA 3CCFA 1WW8A 3PLAE 1HE8B 2CFSA 1LF5A 3MINA 4TQAA 1QVZA 2ZWVA 5LYJA 1J39A 2BTQB 3DCYA 1DKLA 1NXXA 3T5BA 3FX2A 1XTIA 2D4AA 5C2JB 2EQ5A 4QYMA 3VX3A 1PW5A 1CV2A 2O2GA 4TQUS 3KSAC 4NFHA 5FH9A 2VBFA 1NXSA 3HDJA 5G0WA 5KVAA 1XQYA 4BNTA 4LDRA 2HA3A 2FEKA 1S2GA 3ESCA 5B7NA 1H2HA 2BCJQ 3TZKA 4EFMA 5J43A 3HCBA 2ODEA 1K08A 2V6GA 5ECDA 1OW3B 1RLTA 1XZ8A 2H07A 2XMZA 1V11B 3C5WP 1TAQA 2DSTA 2Q9UA 2ZRKA 4NV3A 1CK4A 5T3UA 2JEYA 2X0KA 3P0FA 2YY6A 4HAOA 2PVSA 3ROGA 3UMGA 2Z04A 2ZR7A 1VCHA 4Y6GB 3PFKA 4X90A 1L5NA 3SHQA 1C4OA 3FD8A 1S2IA 2TS1A 4D8YA 5JUWA 2R1TB 3QVOA 1EJBA 3NS7A 4CHGA 1CJMA 1PR6A 1CR1A 4JXXA 2GI4A 1VKZA 2VHJA 2A78A 2A5GA 1S2DA 3VBEA 4N8SA 5ILGA 3W0LB 3WFIA 4C4RA 2JVKA 4OJTA 1TT5A 5KYKA 5LZ9A 1E9BA 5D00A 1XXHA 1SXPA 1MDBA 2QMOA 2XA2A 4PC6A 5HJEA 4CLRA 2OLEA 3OVMA 2YYAA 2RB5A 4G0XA 5DYTA 2CLMB 4ZTZB 4FYKA 2O50A 1C2TA 1NDQA 1YQTA 3RVSA 1NYTA 1IIBA 4DM3A 3DDOA 2ZUVA 3FPSA 4DMKA 2IH5A 2HJ9A 2DBYA 4ZYUA 1OIXA 3KQQA 4AKGA 3KQHA 3FLBA 1N5DA 2LR0A 1GV1A 2VA8A 1WMEA 3CT6A 4HUJA 4W6ZA 5LKRA 2OOSA 3W7VA 1HC7A 5B3LA 2ZROA 4OGGA 2BFCB 3AKCA 5EN4A 1JKIA 1IY0A 3UMSA 1SBNE 3PSAA 4US0R 3ROEA 5KPDA 1NXTA 2IA5A 1K3FA 2ZIEA 5IU6A 3ZXXA 3IAFA 1PZHA 3DMNA 2R1UA 1NRWA 4WCFA 1ZM4A 1XQWA 2QX8A 3FUXA 3U0VA 4YJ2F 2DFTA 3BQMB 1RQPA 3GVHA 3PP8A 4RVNA 1WEHA 4I14A 4BQEA 3VNQA 4D9CA 5CEEA 5DXFA 2C2YA 2BP7B 2RC5A 2XRFA 1KTIA 2CYAA 3GJ8A 3BZWA 4WAUA 1I5EA 5JVDB 3K2IA 3RTGA 4KN8A 4NAHA 2QE6A 3LLMA 3NOOA 4TRJA 1GUYA 4D9BA 1YE5A 4QBGB 4K87A 1C30A 3DLAA 3PXCX 1H2ZA 3EGEA 4BAUA 2ANBA 1S3FA 1TF7A 4C1NA 3Q8KA 4KFUA 1MEOA 4ZOEA 2WWGA 4I1OA 4IIGA 4DUGD 2SECE 3C3DA 5JMTA 1UIMA 4RW0A 1PS0A 2JD0A 1BE1A 4BLOA 3P2YA 3JAWA 2QMQA 4N0QA 3ABRB 1OREA 3WIDA 4R40A 3TW6A 1E1CB 1ABEA 2GK3A 2AN1A 1MU0A 1YSCA 3D3NA 4PHCA 4ZVMA 4P36A 2PX8A 2ZIXA 4C07A 3GLGA 1Z73A 2UVDA 3MA0A 4BJ5A 2B6HA 1UKYA 1SHJA 3HV0A 3WOHA 2J3DA 1JG3A 2XBUA 3IEIA 3KYDB 3T0FA 3BBPA 4MI1A 1PWZA 1TX4B 1O95D 3CWCA 3GV0A 3S2SA 5JNVA 2DPHA 2ZJYA 3PJRA 2D13A 5I7RA 2W98A 3PWKA 3MWKA 1IJEA 1DC3A 3WHLA 1KQFA 5KUTA 2IX3A 4IJ5A 3SX0A 1DBWA 2P7IA 2G9NA 1F51E 2VP3A 5B2ZA 3N6XA 2ZEJA 4MV0A 5CA0B 1CUHA 5EKSA 3AJDA 1EWKA 2PX2A 5BW5A 2J9YB 1GQRA 1K2VN 1W5FA 2CUKA 3RFCA 4DJ5X 5E7QA 4LVUA 4RKEA 3UG6A 3ZIDA 4LJLA 2R8EA 4BVGA 1G55A 4CMGA 4BNIA 1BTOA 3DZFA 2X9NA 1ZL0A 4K6OA 1P3JA 1OLXA 2NNWB 4ISBA 4MZXA 5J5AA 4LV8B 2D5CA 3JX9A 2VYVA 4FZ3A 2IEYA 2GBLA 1PO7A 3H9QA 3M4YA 4FMDF 5CYOA 2BR4A 1M2EA 4BZXA 5F77A 4K9QA 5HA5A 2QORA 4EKYA 1SB8A 2OCXA 2G1UA 4L27A 3BMCB 1C0PA 3IAS1 1EFVA 3PGVA 3R9IA 4YTEA 3A10A 5CR9A 3RWBA 3O8LA 4WXPA 5L7WA 2DCUA 4EARA 1P31A 4HT3B 1OXVA 4QRIA 3BF8A 3L8ZA 2CMHA 2LBPA 1V2HE 3VC2A 2IIQA 1Z75A 4MJ7A 3OTHA 1TI7A 1TMKA 3LVRE 4EQZA 2NTVA 4QGBA 1O1YA 3LQ4A 5DLEA 2Q7XA 2HLNA 2J3LA 3A1EA 5SZHB 2RAVA 2HQBA 3H5OA 3SHWA 2Z43A 5JBNA 3DMDA 3U3OA 2QZZA 5D3KA 3F3KA 4WADA 5LDHA 3KUKA 4MITA 1KH2A 3IJ5A 4UM9B 4HDKB 1UKVY 2VPPA 1Z2DA 4HBZA 5JOQA 2FW0A 3CUUA 4UTPA 3IP9A 4BBJA 1F2VA 4GXQA 3P9ZA 5EHZA 2HUNA 3EIEA 3OLWA 2GVDC 4LYJA 4QOSA 3PK0A 1KYIA 1HE2A 2JIBA 3G82C 4KMSA 1S4MA 4G24A 5EY5B 4CF3A 5C8DA 1I2BA 2FRDC 4ZA2A 1ENPA 5GV8A 4JLDA 1YRHA 4MP6A 5CH3A 4DILA 2OXCA 1PQYA 3AERB 1KERA 1OTYA 4OJYA 5DNAA 4BRZA 3F8SA 4ZEVA 1WL8A 3TBKA 4DMHA 2PD3A 1X1AA 4UHDA 3RC7A 1AY0A 4HS4A 2OCYC 1XCPA 1SQGA 1NVFA 1YBMA 3IPRA 1Y7IA 1E6WA 3A9TA 4NOLA 1C14A 1C3LA 4TQ9A 4FOTA 2RBEA 3AEUA 2RGEA 4LEIA 2KI5A 1Z34A 1O08A 3PHGA 1CUWA 1QH9A 3USCS 2W6OA 5K01A 2CL7X 3TMKA 4RTMA 1YKSA 1P4RA 5EFZA 3W5DA 4JBYA 2NMVA 1MW9X 4MUGA 2A67A 1PJCA 3SVZA 1Q1EA 5DGHA 2VT3A 2VK8A 1N25A 1KMHB 3T41A 2XE6A 1CY7A 1G8PA 3MCVA 4NYJQ 5JALA 2EFGA 3NEJA 1ZO8A 5HZMA 4HAZA 2ZIAA 1BOOA 4AWBA 3AHHA 4EY8A 2WJHA 1ZHHA 2B9EA 4RAOA 1YCHA 1Z62A 3QLVA 3GBVA 3KVNA 4JC5A 8AT1A 2W2PA 2V6BA 4HQLA 4BIIA 2YXPX 5FOUA 4ZYYA 1Y3BE 2NYVA 2Z6VA 2W6QA 3CBQA 4YK7A 1T4BA 5FOWA 1G9XA 3WLLA 1ESDA 3UV7A 3IE0A 3JQEA 2JFUA 1F14A 4I55A 1CRQA 2QPTA 4G5FA 4P34A 2M2IA 4RULA 3LCJA 3NNNA 1FTQA 5C5CA 4FR0A 2C5EA 2F6RA 1J0DA 2NO5A 3RAEC 2BZ1A 3EISA 4IIXA 4L6AA 1C4KA 4B5LA 5L6LB 3SR0A 2XNCA 1GSHA 5DMXA 5EQFA 4U6NA 1L4GA 4EHIA 1DQYA 5EFOA 3VQTA 4TKZA 3A6HA 3K16A 3MHPA 2VUSA 5ITVA 1P7ZA 1V8PA 1QYIA 4HQFA 3IKVA 3KT0A 3ZWWA 4DCVA 3A2LA 1T3LA 3ORQA 4JKYA 2E89A 2CE2X 2W4QA 1PFYA 1Q3KA 1T5HX 3BDVA 4O4LB 4PO1A 4ZKDA 3DOOA 1E5XA 4IM7A 2IELA 5HILA 2ZE6A 1Y1SA 3E5RA 3MJVA 2Q3CA 3DDHA 4P3OA 1PS9A 2I6TA 2Q62A 3L93A 3PCTA 4LXYA 4OYYA 1UEIA 1V1RA 1VI6A 1WP9A 4G1EB 1XZFA 1OXUA 2FMFA 3CLSD 2PJUA 2GPBA 1L5KA 5SY4A 2M1ZA 3TXXA 4QFMA 3BREA 3N74A 4IDHA 2ZYUX 4RVUA 4ZVUA 3T94A 2CNOA 3G0IA 3V1NA 1T8WA 2BMEA 4QFBA 4X1OA 5IVHA 3B9RA 4MQ5A 4FT2A 4WJKB 4YREA 3CMMA 3D59A 1G6KA 1TVEA 4LMBA 4IMPA 4D6YA 3WK8A 4EG8A 2UYGA 3RRBA 3UT5A 1HTBA 1VMDA 3CRMA 4JB2A 4GMKA 1AV7A 2D2VA 2SICE 2W8BA 3AI3A 2ODAA 1P44A 3TJZA 4J7AA 3EIQA 1RRGA 1MHTA 5MHTA 3R0JA 1E8DA 1DC5A 2Q49A 3DSRA 2RH4A 3AUTA 3ESYA 2X0EA 5JS1A 5IKXA 4N41A 2PUAA 2QL9A 2GZMA 1YQQA 2LUOA 1GNLA 5HJ2A 5B37A 4Z7OB 3TZEA 3RWOA 3UCFA 3ZY4A 2EERA 2XVYA 1E2NA 3EXIA 1ZOLA 3A4TA 3A4YA 3G23A 5G53C 1N4DA 1J8MF 3FG9A 3HH8A 3ZU3A 1XTVA 5CFNA 4IDCA 4CEJB 4OJNA 2VTVA 3DM5A 3MTBA 3O4VA 2A35A 1HLFA 4LWOA 1JTFA 2X0FA 2O2ZA 1TC1A 4FWTA 1M5RA 1USGA 1N6KA 3MGAA 4JR1A 2GYYA 3L8GA 4LA4A 4CETA 1KMCA 1O6GA 3BEOA 4UVIA 1KR2A 1G7SA 5DRYA 2IPMA 2Q9AA 3NTRA 1J0BA 1LB1B 2NSDA 2V4MA 3HY6A 2V4UA 1AXEA 3I1IA 3L1IA 5KNCA 3NMUF 1KYZA 2IRWA 4MHTA 4X66B 4F7WA 1L5VA 4PLWA 1R6BX 1KP3A 3L43A 5DOZA 2FSIA 2RONA 3SKVA 1QP4A 2PUEA 3FHTA 3DZDA 2AR0A 1E99A 1HYQA 1TLTA 3O26A 3DAPA 1KP2A 1O57A 3SJAA 5EJ6A 1PQWA 3EFEA 4PBRA 1HSOA 2XCRB 1Y6ZA 5CVUA 2R6GA 3H9UA 1G9TA 3UXEA 3ZTTA 1FP7A 3JRWA 4GNKA 5E6SB 4A6DA 2MMGA 3DEHA 4ZHQB 1GFZA 3BAFA 1ZRMA 4JS0A 3MJEA 2HCTA 2QB5A 3I12A 4TSRA 3ZVKA 3L7AA 4WCDA 3ROTA 2WBLC 1WVMA 3TFQA 2FDCA 1CZNA 1M2GA 2BWJA 4LJSA 4Q05A 3QF4B 3TOXA 4L51A 4EL5A 4IH1A 2P62A 2PV7A 5L6MB 3ERCA 4MVJF 2FMXA 4AECA 2YVAA 1HOTA 1QB7A 3HC7A 4UFNA 4YHBA 4WOCA 2JAHA 3ZWXA 5BR7A 5LMNB 1ULAA 1OLXB 3REQA 4E14A 2VPXA 5CEJA 4BC0A 4JGBA 5ES3A 1U0TA 1FMFA 4ZOLB 3TGPA 1T5BA 2GLUA 1EYZA 1XLTA 1NXWA 1CHDA 1U0FA 4UASA 3ADCA 1FJHA 1KKMA 4YRIA 3EE6A 5B6IA 5AOAA 3G7NA 3G8DA 1A8UA 1H22A 2GD1O 2RGUA 3F2IA 3L06A 3Q8WA 4OJMX 4RKYA 4PLZA 2ZZMA 2BGRA 3RYFB 5A3QA 4DANA 4ZIRA 5A1TA 2PWBA 3X1DA 3DEIA 3FPKA 5HBGA 1N36B 1U1DA 3GJ7A 5J4YA 1QH0A 1JNYA 4GI3A 5CLJA 4IHJF 3R6TA 1G3UA 1L7OA 3L1VA 2IKSA 4E5SA 1PTKA 3L4JA 2W6ID 4G1CA 1DBIA 1YBHA 2REQA 2PVCA 4KNVA 4ZHQF 3KYDA 4OQLA 4YLYA 1E0SA 4LY6A 1SHTX 4QAJA 1D04A 4U7HA 3V1TC 1E6LA 3FVRA 2R00A 4N0PA 1ULHA 2QQ5A 3OIUA 3NU1A 1A1SA 1UBEA 2KWIA 2YWEA 4DVGA 2IY7A 3HCCA 1CS4C 1TZCA 3JASA 3EIOA 4U0KA 5DLPA 3U7QA 1TF5A 1WKBA 4M8LA 4P3NA 3ZDZB 4R7ZA 2BFEA 2HSGA 2J59A 2YMPA 4RORA 3CW2A 5IDYA 1HTTA 5JO0A 4Y2UA 4PEVA 1FUIA 5LQDA 3U62A 3H4IA 4DLBA 1N5LA 1ZEJA 3ZCQA 3AO0B 2RARA 1Z45A 1O6ZA 1UINA 2VHTA 1XPJA 3GA0A 4RK1A 4MMXB 5DN9A 2AE2A 4O2RA 3AVUA 1GZHB 1MENA 2O19A 3HVIA 2OV4A 4RCZA 3VYRB 1TZ2A 4ZI7F 4DMLA 4EHAA 5C4MA 4B87A 2R68A 1K6EA 4YRMA 3ZVMA 4G97A 1ZI8A 4AZWA 1K4KA 4PINA 3ZQUA 4JYBA 1ZX1A 2HK7A 4JD5A 4GSLA 4LNUA 4LWQA 3GGDA 5ETJA 1FMJA 2WA1A 3FBGA 3OU7A 4D79A 1FTNA 3H1EA 1H5QA 5K0LA 4KQWA 1TK3A 2GM5A 3E5MA 1Z4PX 4UQOA 5K3DA 3KX2A 2JRCA 3S68A 4DPKA 2APJA 2PSHA 3IEVA 1USWA 4M0CA 1NJGA 2GNOA 3NT4A 1E2JA 3G8YA 1K06A 4W5OA 1XPUA 3LDFA 3P9XA 1X39A 5EXPA 3AVWA 3AEZA 3QWFA 4RYLA 4WA7A 1WNTA 4KYVA 5DHQA 3GBPA 2CHVA 3DZJA 3F6BX 2F17A 4PLVA 4PV7A 3WIOA 3HDGA 4KRGA 4J16C 4L4ZA 2RHWA 3Q7IA 3IEXA 3O5AA 4GI2A 1RCUA 3EGDA 4L15A 3GLIE 2GCOA 1KXZA 3PC3A 4ROSA 4CGYA 1I9CA 1WNFA 4R2LA 4OLAA 4HLQB 3BSYA 4EATA 1KZYC 5HE8A 5JEDA 1Y8RA 1M2JA 2VK4A 3NCTA 1JR3D 3BWXA 5E3IA 4AKSA 5CX1A 1X7WB 1F1BA 1YACA 3EC1A 1M1UA 3FTQA 2ID7A 3Q7SA 2MCFA 1BW9B 1L9KA 1P61B 3LKBA 4RFVA 1DJPA 1U0NA 4NPHA 5GIPE 5J4LA 2V9ZA 4BVJA 4MVJI 2ROQA 5C4IA 5CA0F 1FJXA 2B25A 1DP4A 3A11A 4X1YA 3GGGA 1DZIA 2BMVA 3TTVA 3N5CA 3UKDA 1TRKA 5LMCA 1NFRA 1IONA 1IDN1 1JQ3A 4C05A 1GSAA 3HNOA 2C4KA 3LC7O 4R5MA 1Z3IX 3RDPA 4EGQA 2R5NA 5K99A 2YFQA 2Q45A 2IWRA 1SCDA 2PH5A 4NJEB 1JF8A 2ET6A 5G40A 5BW6B 1BCRA 1YU9A 1ZIXA 2OBLA 2YICA 3A9WA 3AUUA 3B38A 2VJAA 3BDAA 3DDZX 4H1VA 5D5HA 5AVUA 3EULA 1TTQB 2MSLA 3LP6A 5C1DA 1WM1A 1ZK1A 4O63O 3WGMA 1GHTA 1MJ5A 1TDJA 1BHQ1 3TFOA 3X1YA 2RAUA 3R0IA 4Q0MA 3TQFA 2KB0A 3KQOA 1A4RA 1W52X 2PN1A 3KKNA 4M7PA 1LI7A 1IHPA 4BN4A 1NUAA 2IW1A 5AW0A 3LRPA 3FGNA 2YMQA 4OUDA 2IWHA 1K8RA 2AF4C 4LC0A 3G2KA 4MVCA 1GTRA 4J0FA 5JT1A 2LPMA 4HB0A 3U3DA 3JYHA 1BQ3A 2DECA 2JIZA 4RK5A 2VYVD 3VSDA 5H9WA 1X86B 1RJDA 3R1IA 2XHZA 3IP6A 1Q1GA 3KD3A 1ABFA 1UXHA 4WZBA 3MAJA 4ITRC 1V9SA 1G20A 1RRFA 4QHSA 5FBKA 4NVRA 3V4LA 3LT2A 2FP4A 2V98A 1UMKA 1NVVQ 3HB7A 2VPTA 1H0HA 2DQSA 2PL1A 4MICA 1OLSA 2SCUB 4V02A 1QHSA 3ANNA 2G4VA 4W1SA 5T5QA 4EKEA 3GRFA 3TF5A 1FRVA 5DSXA 4QAQA 3E82A 3FNEA 3IUNA 4LF8B 4QELA 1OHHA 1IEVA 5KOIA 4BEWA 4MAMA 1T6YA 2D2IA 2PRKA 4Z1OA 3WGUA 1FFXB 1DQNA 1QNLA 4DL9A 4K46A 1F6DA 2O5RA 1R9NA 1ZD3A 3EOAI 2OPHA 3WTBA 4BVEA 1OH8A 2IEBA 4D02A 3UUEA 4ZI2A 1ZGGA 1F8XA 2FSHA 1Z7GA 1KU0A 1Q7CA 1KRXA 4DJTA 5J23A 3FZNA 4BWYA 4BASA 1NQTA 5FO1A 1PT6A 2YZ2A 5AHRA 3FNBA 5HF9A 4ARBA 1M0SA 1MOSA 3H1PA 2WUFA 2XCUA 2Q6VA 1T8SA 1GUAA 2AN9A 5FBZA 5JMPA 3CR7A 2P3OA 4DNQA 5CXSA 4WFKA 4DCGA 5I7SA 4G8JA 5KI6A 1T10A 2AG5A 3TW8A 4YFVA 4KAXA 4ZHQA 5HFNA 2DWCA 5EMNA 2G6TA 2JFWA 2ATIA 4O8ZA 1A0OA 2UV8A 1ISSA 4D9JA 3AHGA 5HK9A 3BMOA 1JSZA 3GLKA 1ST2A 3AEYA 4Z4GA 4JBGA 2P69A 3T15A 1TKRA 1GPLA 3JAKA 1QVWA 1WCWA 4LHWA 1RKUA 2ZR0A 3PKIA 2H2FA 4HPWA 4I5IA 2O2IA 5DISB 1A7UA 3KLMX 2XVAA 3EAFA 3S2GA 3U7FB 2HNBA 4OHUA 1X94A 4FYYA 1X1EA 7GPBA 1MTOA 2Q2WA 4B6EA 2QQFA 3AKYA 3LOQA 3M5DA 4JP2A 4MO9A 4O4IB 1Y81A 3EXFA 2IUSA 3BM5A 2QYSA 4YDSA 1A50B 3WHKA 4JC0A 1WPRA 5EZYA 2G1KA 3CSDA 2PUWA 3SY8A 1H2YA 4XWKA 2XR1A 1XNQB 3UKJA 4PVCA 1S4QA 1H3EA 4MUKA 4AAYA 4PZDA 1QH1B 4DXAA 4IDNA 1BS1A 3AQIA 2XGGA 3GIWA 4FFLA 3DEYX 1AF7A 3I2YX 4Q47A 3ZDAA 4FI3C 4NICA 2YOFA 4EUEA 1TEHA 3ONWA 5EQJB 1KZGB 3AY7A 2PH7A 4B9AA 9ATCA 4HBGA 1RQGA 3M6WA 1OCEA 4TS4A 1JG6A 1JFVA 3I5UA 1K9VF 4F3YA 1N6OA 4MKXA 1I2ZA 1ITZA 1KF0A 2B21A 3QSGA 2J3KA 5EMLA 1G2IA 3FYSA 2X7HA 1F6BA 5H16A 3CNEA 4B4UA 3RCBA 4WN9A 3S0JA 2JFQA 1GDTA 2FPSA 1TA9A 5IJ0A 4ZAYA 1OHHD 2BE9A 3H2JA 1H0RA 1N1EA 1RADA 2R4UA 4O1MA 4U9IS 2PGNA 1TUIA 4IFEA 2ENUA 1AKUA 4MR7B 1DINA 3INNA 4B3DA 5EWLB 2ADOA 1HTWA 3WWDA 4XX1A 2J0VA 3BH7A 3L41A 1B6RA 1VMAA 2C92A 5DN6A 3TCKA 2HM7A 5C0OE 1PL8A 1MG0A 5DW3A 5EP3A 1JVSA 2ZBUA 3GLQA 3W1EA 1S1CA 621PA 3Q7TA 1CDOA 3T5PA 5CTAA 5ED0A 1V1RB 2G6BA 1JTVA 2O2XA 4MYCA 1IVYA 4BFZA 2CL5A 3VM6A 2BISA 3K8OE 1II8B 2C4TA 1Y8AA 1YK0A 2O7SA 1QFXA 4QULA 4NDAA 5KJ1A 4KMRA 4D9EA 1I36A 1LH0A 2O2SA 1YJ5A 2ETVA 7AT1A 4IOMA 5H4GA 2VSXA 3CUEF 3EDYA 3IODA 4R3NA 5IYZF 1DPGA 1EM8A 3GBSA 3KKOA 2E18A 2ID9A 2AG1A 2VVTA 2GM9A 4IMRA 1XVVA 5ECGC 3V4FA 5EE3A 4DIEA 2XQIA 3UUWA 3AHIA 4WPGA 1BS2A 1MJFA 1W88B 2YC2C 3LWZA 3SF8B 2H00A 2H9AA 3MW8A 1DEXA 1L5WA 2W8BB 4LTNA 2AOXA 4R0VA 5A5EA 1MX5A 3TOCA 5CT4A 3H9JA 1R0XA 1ODTC 1OUMA 3DZBA 4QXPA 1H9AA 4QO7A 1RE1A 1K68A 2DQZA 4RE5A 1U2ZA 3IRUA 1WXEA 1W87A 4UQLA 2PKQO 4RZQA 5KKCA 4IMIB 4BP9A 2PKYX 4OAPA 4QFDA 1CPYA 4DBLC 3ICQB 1E5QA 3EXG1 4LV6A 5F33A 2ZUFA 1NM5A 2JLCA 4JU8A 4K6HA 2G67A 2VXYA 4M76B 3KDAA 3HUEA 1S96A 2QT9A 4DMRA 2X2FA 4RETA 3V1UA 1TJPB 4XIYA 3SXUB 5KAPA 4D9FA 4BNNA 5JWOA 3G13A 2P79A 2O0JA 2ZBVA 1C8BA 1N1DA 1II0A 3IO3A 3PUYA 3WKCA 3RJMA 1FJ2A 5A4JA 1C9NA 3SCZA 2IS2A 4CM3A 3PXBA 1QYVA 3HKEB 4L08A 1O96A 4IYJA 5DLYA 1KDYA 5A9SA 4MAAA 1NJ1A 1GPWB 3MWEA 4G4IA 1K63A 3T9FA 1OYOA 2XQVA 4R1UA 1M2FA 3DQQA 3GLGE 2W6PA 2H9YA 4BO4A 4JU9A 1SQ0A 3W3AA 4PGHA 1UJ6A 3PLRA 1IZ8A 1MC5A 1MRNA 1ULBA 1BDMA 3DGFC 2VXCA 1ORHA 1KVSA 2NM0A 4PR0A 5HEKA 2O07A 5FBQB 1IB6A 1KDOA 3V7FA 2GZ2A 3K2EA 4QYIB 1V8BA 2PPLA 2QL6A 4W9NA 4TYYA 4LDAA 4U6SA 1PRYA 5I4BA 4AG3A 1JEDA 1P5HA 1Z39A 4M98A 4EUKA 4WNIA 3GOQA 3TTTA 1R4MB 4CTKA 2A3RA 1VM6A 2Q1YA 2V45A 3QXJA 1G19A 4QSHA 1WWKA 2PPVA 3V9PA 2QVLA 5IF3A 4FKMA 1L8XA 1L2TA 2QQEA 4ZOQI 3E4CA 2LDXA 3EIXA 1U0SY 5CD9A 3SM9A 4P4SA 1XZHA 1PJLA 3KVYA 2PX4A 3LX6A 1V41E 2X2PA 1G20B 2E4UA 2IUTA 3CLUD 3K9BA 4QGHA 4NESA 3GFGA 3OIDA 4CL8A 2Z56A 4CMIA 5ICGA 3UK7A 4EOGA 3PNVA 2COUA 1NJ5A 4ETIA 3H16A 4GEGA 1KA9H 2ETXA 3L7DA 4EFKA 5AW8A 2YWFA 3CF2A 3B9BA 3HYLA 3HABA 4OKNA 3DAFA 3REFA 3T3HA 2J3EA 1YCDA 1WB4A 1EK6A 4Z86A 2WFAA 5DTJA 4M54A 4MR9A 3TR0A 4TTTS 4JXKA 4B9EA 3KCNA 2TMKA 1PR1A 3RV4A 3LVBA 3KHUA 2OZKA 4BFUA 4CF7A 2WSSA 2B4AA 1ORIA 5CXUA 3AOGA 3U4MA 2WDPA 4BQIA 4RD6A 1CUEA 4KR3A 4TKVA 3MVEA 3T1TA 1UBMS 1JEJA 1Z0IA 3IIKA 2DFLA 2QX7A 3EEFA 3H8SA 2OFXA 2Z2IA 3HA2A 4OB8A 4OQ4A 1HDEA 3U3XA 1PNRA 2QT1A 1Q0TA 1Y1TA 3BDIA 2NTYC 3NAGA 3F9CA 1I13A 4MGZR 3ZBTA 5F35A 2WP8J 4XFKA 2OVFA 2HYIC 1ZGZA 4RVGA 4RY9A 2JASA 1ZCZA 4FD2A 3VUFA 3Q5DA 3QE2A 1GG2A 2QOEA 4GPIB 3FB4A 3PJDA 4MQEB 2QRKA 5BNWA 2C77A 3UMVA 5JSFA 2Q3MA 1O87A 3FPHA 3PX3A 1AOXA 4H9GA 4B33A 2HR1A 3SAJA 2OV1A 4YP7A 1GAWA 5FLEX 4X1YB 2FN4A 2IHTA 4QGAA 1FNNA 4YJKA 3A1VA 4D9IA 2GPYA 1NA5A 3V2IA 2GN4A 2ZB2A 2ENWA 4NCIA 2FZLA 4UFPA 2PZGA 3EA5A 4GXNA 3T7RA 1T25A 3HB0A 5CITA 4L4YA 3B7PA 5DZSA 2H06A 4NYIQ 4CTJA 4JR2A 3B8HA 5FUBA 3RK1A 3R3JA 3DKRA 4W5QA 1NUTA 1EVEA 2VZ9A 4F1JA 1NF8A 2E21A 3DTVB 4G56A 3VR0A 3WL4A 2FF7A 1PT8A 3BMNB 3ZE8A 2EQBA 1LJUA 3G2NA 2WU0A 2CK3D 3QNUA 4ZARA 4AU1A 3JD0A 1VIYA 1QK4A 1TYCA 3OA0A 2ZRPA 4MLPA 4D3FA 4XQ0A 2YOGA 3TTSA 2HGZA 4L5IA 1T9GR 1NAIA 1YKFA 2G1AA 5JYEA 1WW3A 3ZNQA 3THYB 3K9CA 4MPRA 3O74A 2XKBA 3F78A 4P4NA 4ZVVA 5C7IO 4PYOA 4TROA 1VJ5A 5K51A 3STTA 4NZPA 5K8UA 3FR8A 1U6JA 4JI6B 1YB2A 2LV8A 4G23A 4ZIRB 2SBTA 4X20A 1BCSA 3T54A 3H75A 1NP6A 4L73A 4QA9A 2BKVA 4CT0A 4Q4JA 4G5YA 5U1PA 5L53A 1N33B 1WUHS 1H4TA 2IDZA 4BQNA 2JLAA 2VP9A 1NN3A 5AM1A 4A26A 5H83A 3KV3O 2X86A 4S1TA 1A9ZA 1CF2O 2SCUA 1ND5A 5AJYA 8ATCA 2K7FA 3LQQA 1M8KA 2B9VA 2Q2OA 2JAWA 2ZT6A 4FPXA 4DRXA 3MTQA 5I7EA 2E5WA 4KFRA 1KI3A 3LY7A 3MWLA 5FWDA 4BEJA 2X5KO 2QT0A 4F2WA 1HX7A 2OM6A 4IICA 4LF5B 1JKXA 1VL2A 1JKJB 3ND5A 4H4DA 3KQKA 1Z4JA 2GASA 4FDUA 1W36C 3RM3A 3GL9A 5EIEA 2ZSUA 4WESB 3F4LA 4ZAWA 1JE0A 1NIPA 2D4HA 4YAJA 4TLAA 1DXOA 2WMOB 4ER0A 1F7UA 2HYDA 3B2EA 2PSJA 2G07A 4FNMA 1SUPA 1WXQA 1KO5A 4PZUA 1JDPA 1WSDA 4PGGA 3LBYA 3CVXA 1NVWQ 1ISRA 2I6UA 2P27A 4Q3OA 2KBFA 3RKSA 3VOBA 1U9ZA 4GZ6A 3IOCA 2Q8QA 4C0SA 1U2GC 1WJGA 2FOLA 4OXXA 3LWNA 2AI1A 1Z7WA 4L4XA 2WILA 2EJWA 5DNUA 4EJFA 2P30A 1FNSA 4KXWA 5TQJA 3BL8A 3B60A 3VH3A 3PEUA 2WJPA 1G98A 2WQ7A 3BKWA 1T2VA 2EP7A 1AVTA 3ORHA 2BBOA 2E5FA 2X8LA 1QF7A 1ZYUA 1L5QA 3E22B 2WIDA 3M1IA 3N2NA 1KKLA 4LHXA 4RC9A 4YJFB 1BD4A 4BFWA 2J41A 2XDYA 5KNBD 1I4LD 1VG0B 3FFWA 3K5WA 3O4RA 4XUDA 5E7JA 3ZDCA 1JIUA 1XJWA 4JLOA 3RYCA 1PTJA 5ISMA 1GPMA 1T1IA 1X7XA 3D3EA 3A36A 4L9SA 1E18A 2XW6A 1AKQA 3WJ7A 3KXKA 4QXAA 1R15A 2IYFA 3TLZA 4BMYA 2F8MA 1WDKA 4G85A 1X1QA 2D06A 1EG7A 3GZJA 3AI7A 5CJPA 3VA7A 5C8YA 1P45A 2YWJA 4JITA 3TQQA 2ZBGA 3E81A 5I9MA 1JMKC 3BUSA 4E11A 3ZS9A 2P67A 1E2PA 3PCRB 1JSRA 3HZZA 4CG2A 4DOMA 3T7TA 3RWMB 1D0VA 3JTEA 1ZJYA 3MWFA 5CT5A 1N3BA 4ZQGA 5IC6A 3RUIA 5EZQA 3H3JA 5I5GA 4LDQA 4C7JA 5HQJA 1H2BA 3C1AA 5TSDA 1ZNZA 3COSA 3EG9B 4C76A 2PRYA 1B8OA 3PNPA 3EN0A 1SQ5A 1ISFA 4IGAA 3EVBA 3JATB 4QBIA 1PZMA 3T4UA 1TIKA 2YJTD 1MUUA 4BN0A 1U99A 2ZRJA 1L7XA 1O58A 3H1TA 5F3RA 4NHOA 3DV9A 4KYTA 2X1HA 4P80A 3T3EA 3E35A 2D54A 3IV6A 3WK6A 1TT5B 2C2BA 3WMWA 4GI1A 4WKPA 2X13A 4K40A 1X7ZA 4TS3A 4AY4A 5FD8A 1P1KA 1JW9B 1L5GB 1TQ2A 4IIBA 3OPVA 3A6GA 3P26A 4MCHA 2BSAA 5K3FA 3GU3A 1JQAA 2R8BA 1FX0B 4S0XA 5IHXA 1V5FA 5EIOA 1JKJA 4I3GA 4Q01A 1ZHOA 4WERA 2XXAA 1G8KA 4LXHA 4BP8A 1X77A 1Y33E 3I2HA 4FOPA 2Q5OA 4P4SB 2XF8A 4WVFA 1XMPA 3CLHA 4WEOA 1B6GA 3VYVA 2ZU6A 4P9NA 3U1TA 2V3WA 4DA8A 3W5BA 2R5WA 2AC2A 4RVCA 2J85A 5MN5A 1MOQA 1CU1A 3SF0A 5BR4A 1VYUA 4G5RA 1DRKA 4P08A 4QBKA 3CNOA 2H11A 3RRFA 2H2DA 2VPZA 3H1AA 1H0SA 1KHHA 3HYSA 4LZZA 1VSTA 3LU1A 1D2NA 2FY8A 3AFOA 4ZU3A 4ZEWA 3DGEC 1UBCA 3A3PA 2VQSA 1GNTA 3C4VA 1REQB 2RH5A 5GOZA 3PJGA 1OBVA 2OCAA 2LNDA 4M1QA 1X87A 1I4TD 2O8DA 1MW8X 1NSYA 3KOOA 4ZANA 2L17A 3GLIA 4IZ6A 2QA5A 1JJ7A 3R3SA 3CKMA 3HCNA 3AT1A 4D82A 1DDIA 2VDVE 4BFXA 1XD2A 4WXEA 1BGXT 5AUOB 3HJHA 1ESCA 2XYRA 2F1JA 1DNPA 3L0ZA 2YVUA 4LZLA 4ROTA 5IVKA 4P7BA 1YK1A 3VDQA 2B78A 1CVLA 3HU2A 1KMNA 4M46A 1YZFA 4NG5A 4GKJB 3MSCA 4YROA 5DYGA 1H3NA 1MGPA 1N6RA 4Q4DA 1Q19A 2O5VA 3PHCA 2CDRA 2JFVA 3OQIA 3QQ5A 1GXSA 4IDOA 4M37A 1A97A 3SSMA 3U0BA 2VUIB 2C9MA 2JGRA 2Y1DA 3AUAA 3KTAA 4UXHA 2JGMA 5EGNA 4ZWNA 1ADFA 4BDSA 4UOZA 3VPSA 2FPOA 3BC1A 1GPUA 1ONBA 2VRWA 2PKXA 4QXOA 4QX6A 4TV9B 1PJZA 2P4HX 3PXGA 2VIIA 5JXIA 3U49A 2AKAB 4KXMA 8ABPA 4PC2A 4QNMA 3M6LA 3H8JA 4QU0A 5JNSA 2HADA 1ZRSA 1J7JA 2OR3A 2COEA 2RJNA 2H2WA 4Z8XA 5FI1B 3MJSA 3MUOA 3RF7A 1QK3A 1JPUA 3R5HA 2JG3A 4K0KB 4ESOA 1D2CA 1USUA 2DWOA 4OTZA 2HSDA 1KAHA 4REOA 2QAGC 3BWEA 2NV0A 3OFVA 4CM4B 2BLLA 3KVOA 3OP4A 4CXMA 1R9MA 2NYUA 2QX4A 3Q11A 3ZIAD 8OHMA 3OZAA 3FCXA 3X1MA 1DDOA 3KOZA 3KSDO 4KK4A 2F90A 5K2OA 4BLSA 5B1SA 1NW4A 4YFYA 3Q5GA 4I99A 4Q1AA 4DDMA 3LF1A 3JVEA 1AQLA 2P7HA 2YXEA 4NYJR 4FC7A 1G6Q1 3K30A 1E96A 4ZAGA 4B3JA 1F60A 1YFJA 5E4FA 3O0DA 1FU8A 4ERNA 1Z8DA 2IE8A 1L1EA 1TLFA 1QO0D 1VIAA 2AMYA 1EGAA 1Q7RA 3N9IA 4GR4A 4LGMA 1X1RA 5LZ4A 3GJQA 2C8LA 4MA4A 1GZSA 4TKLA 3TG2A 5EHNA 3U9SA 2C99A 4JNCA 3TUZC 2CBZA 4CIVA 1FTSA 4U7WA 1ONNA 2J08A 4ID9A 3GWGA 3NXSA 4PICA 4RA6B 5DHPA 5AW1A 3U9LA 2YCLA 5K8TA 2IYEA 5AVXA 4MYHA 1ZOOA 3NUZA 1ZBDA 3DXZA 4IH4A 5FWNA 1SC9A 1Z4NA 4O0LA 1W7AA 4GLJA 5JFOA 2Z6UA 2PA0A 4DLKA 1S02A 1DIBA 2X5JO 3TIXB 1JB1A 2JLRA 3BL5A 4HP8A 4K6FA 4MYSA 4NEQA 3HLTA 4B7ZA 4OKIA 3NOQA 4P0QB 1M6EX 4JHXA 1S01A 4WNCA 4Y1EA 5HTOA 3IPYA 4UMVA 1CJUC 3PCXA 1OFUX 2FW9A 4NOKA 2AMJA 4JLBA 4IIYA 3ETCA 4ZYLA 1P18A 1Y8QA 1M2KA 3KLNA 1ZK0A 3EQ2A 3X44A 3N2IA 4I08A 3ZXIA 4D4HA 2QRPA 6CHYA 1CX9B 4WLFA 3F5DA 4YALA 2DFDA 2H1OA 2HHJA 4QOIA 1PNVA 4BAGA 5T4EA 4X1KA 1PL0A 5JSZA 1A96A 4D9MA 1FP1D 2F48A 2WF7A 4P83A 3EYAA 5JNUA 1A76A 3AERA 3BJZA 3P97A 4MX8A 4D6XA 4RNDB 5G2OA 3T3OA 2BMDA 2RGAA 3CUKA 3JAMA 1UT5A 5LR6A 4IDAA 4BMOB 2IV7A 3FYTA 2CJWB 1Y6QA 4K3VA 1M2WA 3OT4A 4AMBA 3I9OA 1B74A 3IQGX 4A16A 4AD8A 4YIHA 5AVZA 4GX5A 1GTMA 1WCIA 1WUIS 5BSWA 1L5ZA 3AXTA 3PFHA 5HRCA 3U16A 3A26A 1R16A 3EVFA 3ZXSA 2RFLA 1GA1A 3RJTA 1N2GA 4ZZIA 2PJRA 1BU5A 4GEKA 1R4NA 3K1ZA 2M1XA 3NWOA 1Z17A 4EH1A 2FMIA 3PFWO 4P0TA 2Y1WA 2C2ZA 3S27A 4AJKA 2XB2A 1XDDA 3P9IA 3V8VA 3N8HA 5F9HA 3NP7A 1SIBE 4BTVA 5BWLA 2ZAGA 3UY4A 4C4XA 3JQDA 4NZ9A 1D7OA 2Q1XA 1K6IA 2XE4A 3ESZA 5GONB 4CDRA 3U60B 1T5IA 3HI6A 4WT7A 4M1KA 4BFLA 1XJQA 4Q3DA 1J5XA 3SVLA 3W6OA 3F3SA 3FZGA 3OEHD 2Q5HA 3DE6X 1F17A 2EKZA 3U7EB 4LVNA 4C9BA 5KTYA 2B7CA 2OLKA 3LI2A 1RMYA 3AUYA 3GLTA 3Q8MA 2EW8A 2WJZB 3GH3A 2REXB 3D9QX 3EZLA 2PLNA 3D8SA 1M8PA 4Q93A 4BUCA 4DR7B 4KV9A 1GN9A 4TSKA 3BXPA 1SRRA 1CJKC 3PUKA 1BG6A 1CYDA 1NU8A 1HDGO 1XMIA 1MIOB 1HL7A 2C3MA 4HFMA 2VPIA 3KLOA 2IZZA 1JFFB 3I0NA 4YAOA 2WG0A 1C3OB 1SBHA 1EVQA 1Y80A 3DEZA 2WJVA 3HUFA 4ND8A 1LWNA 5EOVA 4UTVA 4ZVNA 2G8NA 4XEHA 1A8PA 1BH2A 2V0NA 1T2NA 2AIRA 4J1NA 4JQOA 2ZYSA 3I53A 3UAXA 1BFKA 2R47A 3JY6A 1TM7E 3DV0A 3UK0A 3B78A 2Q41A 3M33A 3LUJA 1DJLA 3KUXA 3T9EA 4JKIA 4EYOA 4Z9AA 1VA4A 2NAPA 4ECAA 1WF6A 5LLDA 1JSCA 2HA5A 3NO4A 4PPQA 1PVOA 3LLVA 3ZJVA 1P75A 2RHJA 5HF5A 1TM2A 3GLVA 2XXAB 3KB6A 1TD1A 1XNHA 1ZCBA 4GRIA 4XYLA 3UAOA 2FWMX 5IEJA 3W8RA 3DEJA 3R3YA 1SG0A 3F97A 3GLRA 4DJDC 1VRCA 4J3JA 3NETA 3ZQ6A 4ZCRA 1RRMA 1P2DA 3UGKA 5ELXA 3HB9A 4A82A 5HOEA 1XQ6A 2OYSA 1E5TA 1F0KA 3ICPA 3NBQA 4P33A 3CNQS 1M8GA 1R8QA 3R7WA 2CFTA 4FNGA 5AJHA 3WB1A 3O8QB 1WCIB 3WA7A 4YPFA 3HZRA 3OEEA 5K2MA 2R2GA 1R5NA 5SV2A 1XFDA 2A8YA 3ACCA 4S0ZA 4KVFA 3UHPA 3VR6A 2V9CA 2RIPA 2WM3A 2Y1OA 1CUCA 3QVWA 1GQOA 1UBGA 3MGGA 5E95A 3GFOA 3I3OA 2XQGA 1T0HB 3QF7A 1RWOA 3PC2A 4ASUA 2HXYA 3BL6A 4EKIA 4XXHA 4RJTA 3MJFA 4PSAA 5AW6A 4TTPA 4RIFA 4YRBA 1GGMA 3W05A 2XGOA 1FNBA 2V5VA 3RVOA 2C82A 2HBRA 2QN8A 1J09A 3N8IA 1NUHA 4WXYB 2BHNA 1ENYA 3VTKA 1V25A 4KZPA 3D7KA 3IUYA 5HS6A 3RIYA 1PJ4A 3C3PA 1YDWA 3H13A 5IVIA 2C9YA 3ZCSA 1A9XB 3GVIA 3R5XA 2PBRA 5JASA 3R6DA 4AT1A 2PZAA 3EPPA 4CT5A 4E2XA 5AP9A 2ZQ5A 3OUUA 2JA1A 3DXXA 2JVJA 4PSCA 3T61A 3IP7A 3UFBA 1FVHA 4FYHA 4GFDA 2Z2JA 3N8NA 2A7XA 4AP6A 1EEHA 1SEVA 2POQX 3IKLA 1SG6A 4RHXA 3DT9A 5B4UA 3PS9A 3ACDA 1FSGA 1LJLA 4KI7A 5BP7A 2Z8YA 1RRKA 1JLRA 3A6DA 3BEDA 4UCQA 4V0MA 4KO1S 1IWBB 3I1YA 4KUGA 3SU8A 4BGDA 3EGDB 2HK9A 3FVQA 4R1LA 3WIUA 1VHTA 1FRFS 1O94C 2ZIFA 2ZRLA 3CXUA 1NI4B 4ZXFA 1I1NA 1N34B 4CUZA 3FI9A 4YACA 1WU7A 4QPZA 1V47A 5GY7A 4KLNA 3HM2A 4L9RA 3RYHA 5LP6A 3IYLW 3WQQA 4D44A 3GEPA 4B3XA 3TAUA 2HLDA 3ROXA 3VVLA 4CF5A 4JDUA 2O05A 2FWIA 1P1CA 1WP4A 5ALXA 5TARA 4ID3A 4NNJA 4JP5A 3AFMA 4JSRA 3SKYA 2KM1A 1P7PA 1ACJA 1ZD8A 2I71A 3TEFA 1R6DA 3PUWA 3V3KA 1NMEA 4RTNA 1NHGA 4F38A 4UEJA 3CF0A 3U3ZA 1E9SA 2QVGA 1S8NA 2PKEA 4Q7EA 4TLBA 1UFKA 2YYSA 4HXYA 2JFNA 5E38A 5ERXA 4BVHA 1G3IA 4O5AA 1GTSA 2RGBA 2J45A 2V6JA 2C5BA 3STYA 4O59O 2K5UA 4BNMA 4BO5A 3DFFA 3DTTA 2PDAA 2AMLA 3CHYA 4UVDA 3HV2A 3UWSA 3QKRA 8GPBA 2GWRA 4JI0B 3HFRA 2QNBA 1DRUA 1VGVA 4V38A 3DVRX 3VJKA 4BKUA 1BS9A 1SUDA 4URUR 4AN4A 5AQ1A 5P8WA 4J49A 5A5GA 3ZVNA 5BSFA 3OQIB 5H1YA 2KJQA 2J9ZB 2HJGA 4CR8A 3ITNA 2LCQA 1DSSG 1P2VA 1PD1A 4DDVA 1E58A 1BX3A 3QWAA 5HUHA 2NSYA 3NBYC 1N2CA 1ISJA 1ZHFA 2GCGA 4PFSA 2E1RA 2IHYA 4RIGA 1XQ1A 5F7ZA 4JZKA 4C0LA 4IWNA 5CFPA 5K4GA 4PAWA 1HRDA 3A4IA 2Z2XA 3DZIA 3IXQA 4M1EA 2X9QA 3TZBA 2XOKA 3A1DA 4AF6A 1DCFA 1X14A 1FXWA 1ADBA 3DM9B 2QMYA 3VNVA 1XD2B 1CS0B 1Z6ZA 3FWNA 2FX3A 4PZZA 5A6VA 1Q2XA 3HXLA 2AN3A 4KTTE 2GEDA 1C3XA 2R6R1 3P94A 4KLAA 4DSTA 4AWAA 5IT9A 1JKFA 4AYWA 5BN3B 3SZOA 3OY2A 3FMIA 2WA2A 4KR9A 1MN6A 2XUQA 1Y5LA 5HGXA 1GTL1 1LNQA 4YGXB 3CZ5A 3B6ZA 3FSRA 3B3AA 1A9PA 1V5WA 2WFMA 2PX5A 3DB1A 1AF4A 4QODA 3RTBA 2I8LA 1MDFA 1ZJ4A 4Z3KA 1M8FA 2O9JA 1RAFA 3RQIA 3SP1A 5DHFA 1EUDA 2OZLA 4Q3BA 1EFHA 2HLPA 4MS3A 4XDZA 2VZ0A 2DWUA 3ZBPA 3OQJA 4QEZA 4EPRA 1EPUA 2FEXA 2G04A 3OJ0A 4W63A 1V7QA 4BVBA 1F4LA 2PU5A 5JS7A 2HL6A 2O23A 2XUHA 3I05A 4NJEA 4V0LA 2ZM6B 1SMKA 2YV2A 3TQHA 5FJIA 1N6LA 3DULA 1DTEA 1E2KA 1JHRA 1U04A 4NMXB 2P77A 3HCFA 3OEYA 1SWWA 4HFRA 5D3QA 2I8CA 2X4GA 3RYCB 4LJRA 2L19A 2R7MA 1Q1BA 3JW8A 1P1RA 4UU7A 3HN7A 5FWYA 2PUTA 4TLEA 3K70B 1EIWA 3RUAA 2I3GA 4I5EA 1HDXA 4XKJA 3ROQA 1YOBA 3E22A 2CB0A 2BTQA 4MOWA 1C9DB 4OHWA 4KO3S 1PN3A 4IJ6A 3N39C 1WTCA 3B3JA 2PMWB 4MIKA 3F6CA 5HIJA 4RFLA 1HETA 1MCZA 3KEMA 4D7AA 4OHVA 4BXOB 2H31A 3PQ3A 5KYUA 3SJCA 3SR4A 4F04A 1YS2X 2WLTA 1U0RA 1D1SA 4EA7A 4QVKA 1BH6A 2GBGA 1Y8RB 1UEXC 5FWYB 3SC2A 3JWHA 1JHQA 2NNLD 4L5BA 3T3MB 4DCOA 3O2QB 4DXDA 4FOOA 2CMFA 4LXUA 5DDIP 4U3JB 3JZIA 1GG5A 5IAOA 4LN1A 4HNGA 1KYQA 4PC1A 5EJAA 3R7DA 1FMTA 3D4BA 4CM7A 4TMKA 2XV1A 4MP8A 1OIWA 3JRXA 4LIPD 4DGSA 4C2UA 3OPYB 4R1TA 4RS3A 3AIOA 1XKXA 1PZNA 2VH2A 1ZONA 3GZTB 3TKAA 4ESHA 4V1CI 3KR0A 4PO8A 2CVPA 4CI9A 1M75A 4OAQA 1F20A 4INOA 4TV9F 2IBSA 3F7TA 1JN0A 2JJ1D 4DLUA 2P8SA 4RADA 1PUJA 2J6CA 3EZ7A 1DADA 4MCAA 4BNXA 1E0DA 3GRRA 2VYNA 4Y6LA 4QU9A 5C3UA 2Q4BA 1P7WA 1LQUA 2WLSA 2ID4A 4BQFA 1EGMB 1GZVA 4JLUA 2ZAMA 1XD8A 5FEMA 1XMSA 4J4TA 3VI4B 1XK7A 1KGDA 2Y6VA 2OCDA 2HRDA 3OM9A 4W6QA 4H16A 1N2HA 3NGLA 1EG2A 5IAAA 2XZOA 5C5IA 2EATA 2B7BA 1QSGA 5IM4F 4BZPA 3P9PA 1T8UA 5HDBB 1Z8NA 4B85A 2WZQA 3D1LA 2VJPA 4ABTA 1TMYA 5K4AA 4YXWA 5E9QA 3I9MA 1RXIA 1GQYA 3CKKA 1J8VA 3V34A 4FTWA 3W77A 3TLKA 1P2GA 2EG5A 4J2TA 4PX9A 1RMTA 2QD3A 4MV5A 2VSOA 2I4LA 4MRRA 5C1IA 1KOLA 5HVNA 3LF2A 4QTXA 4XTCS 4J03A 1C1YA 1VJDA 3B3QA 1T6XA 4UVGA 2P2SA 4OI4A 4MWBA 2D2XA 1YRYE 1KWKA 4NF2A 2QRZA 5KHAA 1EDDA 1JVNA 1YFKA 3JQGB 1QHEA 4NDZA 4Y9TA 5F76A 1ODCA 2N46A 4COKA 1WUKS 4HUTA 1UZLA 3DKVA 1OI4A 3LHIA 2J48A 2C9CA 2J30A 4NZOA 1AO0A 4LFBB 5FRDA 1KZ4A 4J94A 1V4BA 2PLAA 4PW0A 2ZSKA 1PSZA 4H1UA 1F5NA 1TOAA 1N57A 4QJ5A 1CQXA 4WTOA 4RHUA 2AFHB 1JZQA 1C8KA 1DC8A 2M6RA 1NMSA 4P5EA 3WGLA 4B46A 4NXNB 2QK4A 3WKDA 3QBDA 4EY7A 4ZMBA 4B79A 1K3UB 3DS8A 4PQFA 4IGIA 3CZRA 2LE0A 3N3AC 3HHEA 4NYMR 2L69A 5TLSA 1EQ2A 2CHFA 1NG1A 3V2HA 2CXSA 1NKTA 1SA0B 1NLYA 3L1KA 3OF2A 4B3CA 4D6PA 2WNIA 3EZYA 4BVAA 1AGNA 4XSVA 2XNDA 1F2TA 5KKNB 4N3BA 1ZI6A 1EESA 3RVMA 3QM1A 4DR5B 5GGYA 4F4FA 2C2OA 1BWQA 3WZMA 1YH3A 2PCLA 2FLVA 4ENVA 3WLKX 2PK3A 2H52A 1BJTA 4KHZA 3QLUC 2HHCA 2FE4A 2G40A 4TS1A 1BMFD 2I7TA 1F12A 4GZLA 3M3PA 4N7RA 5K3BA 4OBWA 2FFAA 4QXMA 1J9EA 1H8HD 1M76A 1QFJA 4D96A 1AZWA 1I80A 1SVLA 5K0JA 1ZLYA 2J09A 1YQGA 3QE0A 4FDMA 3V8EA 3CVWA 2XGJA 3HWRA 3ZTYA 2TSYB 1CQZA 3ZWOA 3I6MA 2DPLA 2G9ZA 1AT1A 5BSMA 3P4XA 1W5BA 4RPIA 4UCFA 4A27A 1YDEA 1TCCA 4O4JB 2BEUA 1AG9A 3QTTA 3C41J 4M1TA 2ID8A 1WU8A 1BDIA 1WG8A 3HEMA 2QJTA 3JU3A 3ZHVA 3K9LA 3ELDA 1SJ9A 3KHKA 1CP2A 1Z18A 2FR8A 1Q20A 1B7GO 2X14A 3HS3A 4G0OA 1HDRA 2XAUA 3DAYA 4XOUA 2H18A 5F4ZA 3ZCPA 5DULA 3A4MA 1V4VA 1I6MA 1UFRA 3AH8A 1Z6PA 2I62A 3GGJA 1YMUA 2RE8A 5ALUA 1HT1E 4NP6A 4AL4A 2ZIZA 1Z0UA 1CT9A 2PT6A 4JJKA 4TN5A 3UANA 1CFJA 2IYUA 4YMVA 1PUXA 1NASA 1WVGA 2AWOA 3CGWA 2P4SA 1CHNA 3K53A 3PD0A 5TQVA 1NU6A 3UMFA 4ZVLA 4Z3OA 1VRWA 5DHRA 4L5JA 2BBSA 3WGJA 4Z2AA 1NBAA 2G9UA 2KE5A 3R4VA 1SD1A 1PAUA 4HEA6 1R0SA 1QDUA 4LC1A 3BCRA 1V3TA 3S2FA 1ESMA 5DH9A 3E1SA 1Y4ZA 5AKXA 4E13A 1ONPA 3IVMA 4OHOA 3HYNA 5SYMA 2GAAA 4WEQA 3WX0A 4QDOA 1FFAA 3FVVA 3CEMA 4R2MA 3LD9A 4CKZA 4CKEB 2V55B 1XNGA 2AE1A 4W5NA 3JPWA 3HK2A 1DUVG 3K5IA 1TTHA 3QEKA 5B7PA 4MW5A 4QT4A 4UARA 4K2AA 1TGVA 5BW8A 4HRVA 2EFHB 1LY1A 2HO5A 4W9NC 1A2QA 5IMBA 2B8WA 2QRVB 1QKKA 1VLZA 2ISQA 2MDTA 1IC6A 3D6HA 3MRXA 3TEJA 3T5AA 2OO7A 3LZCA 4F9GA 3RVLA 3KZNA 4I50F 3L0PA 821PA 4QYTA 1HURA 1DKPA 1OWOA 3FCAA 1K6MA 1BA3A 3FTNA 5DCYA 4ENUA 2PJDA 3OH8A 2YV4A 5HFJA 4WGFA 3NAZA 3P2IA 2PEZA 4ZVOA 3L1JA 1ZNYA 3RW9A 2FWJA 1AU9A 1QQ6A 2MWMA 1CJVC 5BRAA 1XT6A 5HKKA 2E7ZA 5MGNA 5TEVA 1GUZA 2KMLA 3HE3A 2WICA 3G0HA 2Z09A 2YW2A 2J31A 3SJZA 5A0FA 4GWKA 5GINE 4D9HA 1N9ZA 1DDGA 5J2UF 3G2QA 1YNSA 4XQGA 5LBUA 4MQEA 4NE2A 4B6SA 2FP3A 1RXVA 4TYWA 4M0PA 1IOLA 5BV7A 4JOBA 3RIGA 4NJMA 3SQXA 1D03A 1MB3A 1WHSB 4FR5A 3SXPA 1C1XA 1Y3HA 2G83A 3SQOA 5L3QB 2XDQB 3GB9A 3LCUA 1L4BA 2BEVB 1USKA 1L8AA 2CXNA 3CG4A 2VPQA 3D6JA 4O6VA 4ZQBA 3T5GA 2VF4X 3KWFA 4DQKA 1VL0A 3OP1A 3R20A 4KSYA 4QKQA 3WE7A 5F3WB 3UAVA 1N8KA 1UT8A 4HDSA 4MKRA 4ZK2A 3P0HA 2BGMA 3MTGA 4OUKX 1Y1KE 4FFBA 4QEDA 1U63A 1EFAA 2DETA 2QDKA 3A3OA 3NRCA 3RSGA 1JFLA 4OAOA 4PYLA 5AJXA 4BB5A 3KKZA 1K8QA 4BO2A 3QH4A 5FAKA 1JEQB 5H68A 4JJEA 3LGXA 2B1RA 4TL8A 1UXOA 3WADA 3V4VB 1AUOA 4A73A 2W71A 2N47A 4UUQA 1U7XA 1EP3B 3IBGA 4URHA 2W70A 4IZHA 2I2FA 5LQSA 1MOPA 5H59A 4JX9A 3FGZA 1KEPA 3E3LA 1BVHA 3LK6A 1QFSA 1RWPA 1ND6A 4JHLA 3C15C 4ZDKA 4YRNA 3OF3A 3U5ZB 4DSZA 5FOTA 2DH6A 5E0KB 4YP9A 4MVJD 4UAGA 3E70C 2AD5A 3PWSA 1J0EA 4Z8YA 4X6LA 2ZE8A 5ENZA 1M83A 4GRAA 4HTFB 3H0EA 4ZVSA 4J8PA 1I4DD 5ULLA 2NT4A 3PUXA 1H4QA 2BGWA 1XCBA 1EP1B 1NTRA 1UQTA 5DCWA 4CM6A 4QJBA 1GRCA 1T2EA 3I2GA 1DEOA 1ORDA 1YO6A 1U9IC 2J7PD 4HEJA 3UWDA 4D3ZA 1N3YA 2QRMA 3OEHA 1TM4E 1JDBC 1R37A 3KEOA 3WRYA 4BDTA 5F7OA 1VJ1A 1YVEI 1N78A 1EDBA 1E7RA 1PE0A 1W4LA 3P2EA 1DTWB 1TJ4A 2XITA 4UBJA 1OX5A 3Q3EA 1CEQA 4ZKEA 3VPAA 3SFZA 1K5DA 1GT6A 4NEHB 3WISA 3WRYC 1P2TA 5I9IA 2VF8A 5BPHA 2DG2A 2ZB3A 3BIXA 4BCBA 1J07A 4LXXA 1QIKA 5FXMA 4IKEA 4RK7A 2PT7A 3VDRA 1CJCA 1HQCA 3FFTA 4N01A 1TJYA 1DIAA 4MVJM 3AEKB 4XWWA 1QH8B 1QFZA 2AFHE 1A8QA 1YRBA 4E07A 3ZTWA 2VP2A 4PRLA 2NLOA 4GGOA 4OIFA 4KUEA 1ZN8A 3IALA 5DTRA 4BZQA 4LW8A 3JWPA 1K66A 2AKYA 4KN5A 3GT0A 4YP6A 5FO0A 2CV0A 2OSBA 1LVHA 4QWMA 2WB4A 4C4OA 5LKAA 2JKVA 1UPFA 5K0FA 1A71A 3HUUA 4QUDA 3BSWA 3PQ5A 3R44A 1E77A 3VNSA 3NI2A 3H2BA 3KJIA 1J56A 3BTUA 1Q17A 1ZVKA 2I4TA 5KCZA 4HB3A 2YQ4A 4CDMA 1Y8CA 1XO1A 3WLSA 3OZDA 5HGJA 4EPXA 3L4SO 4FOLA 3MPUA 3S2EA 1XX6A 2HDHA 2CWWA 3WWEA 3HA3A 3AB8A 1JEAA 2VJMB 2F8SA 4MR8B 2I55A 3M4XA 5EIWA 3M6UA 5HMMA 4R1SA 3GXBA 4ENTA 4KQMA 4KU4A 1VE7A 4LNAA 3FHLA 3HXPA 2XVXA 3VR6D 3JZMA 2C2GA 4TRRA 1MQAA 4NI5A 1XZCA 4F06A 5CAEA 5EWMA 4YRKA 4E7OA 4LF7B 1Y1QA 1G21B 3DVQX 3A1SA 4ZD6A 3FB1A 3P20A 1HEYA 1I1QB 4K1LA 2WIKA 4KH0A 3WR5A 3CM0A 1M2VB 1KDZA 5BN1A 1HNZB 2Y4OA 3GNTA 3IT3A 4TV9A 4J43A 1EB8A 4GBMA 4AW9A 3TAHA 1AXGA 1SRQA 1L1RA 2WIJA 1DO0A 3LO8A 4CODB 1ZJZA 2N1MA 2BLNA 3CBGA 4UM5A 5G02A 3MTDA 2NVBA 1NXPA 1RJ9A 3M82A 2Q6LA 3L8HA 2OKGA 1SU6A 3K70D 1NDHA 1I5OA 4X8MA 1R50A 2WEKA 2Z3WA 2V7QA 4RKWA 4M9UA 4HNAA 2JLSA 5J2TF 4AF7A 2ZK7A 1H9BA 3IAS6 2Q2NA 5T4BA 4RTLA 4DY6A 3AHCA 3X43A 1EXVA 3VU9B 2C7QA 2O0KA 5ITZB 2FRXA 2A0XA 3V4PB 2MHCA 1E4YA 4IFBA 2QWXA 4BPRA 3HO6A 1FYEA 1YT5A 3IMKA 4KKVA 1W76A 1NL3A 5JATA 4DMUB 3OBBA 1NE7A 5HMLA 1AK9A 2WIFA 1A8IA 3RYIB 1R8SA 1ZKDA 4OUDB 3F74A 5DMHA 1Z74A 4YPOA 2WYHA 1YVUA 2MSWA 3KPJA 1BMTA 3OESA 4BFCA 1VHLA 2R4QA 4FNOA 2QRJA 4C4PA 3VHXB 1NOIA 2X5NA 5CNJA 5BSVA 5DHAA 3GNQA 2WJIA 5B3JC 4FWBA 3D3WA 3OJFA 2H1HA 1MT0A 2G28A 1JU4A 2JGLA 3TQRA 3GVXA 3I3SR 5J4HA 5H70A 1FP4B 1MH9A 4P22A 5INTA 3V4ZA 3Q88A 2P2CA 2RHRA 2XDWA 4GL4A 2HLDD 1M67A 3PNMA 5JVDA 1HE5A 3HRKA 5SYNA 3QG5A 5BWCA 1DBQA 1KEZA 3H0KA 4HL6A 4LBYA 1O7JA 2AEFA 3Q1LA 5H82A 5F78A 3RJ5A 4DBZA 1C80A 4YV7A 5EJ5A 2ZE7A 1HZZA 3QITA 2RIRA 3L6UA 4TVSA 2NW6A 2Q7DA 5J3JA 1WKVA 5E4YA 2JJ2D 4FN4A 3ZZTA 1G3MA 2IZ1A 2P2DA 3D3QA 2FXVA 1NXQA 4I1YA 4N3AA 1CQJA 4JJGA 4WMLA 3TTYA 4F3RA 5FFFA 1I0IA 2FZ4A 4PSVA 1AX9A 1KJZA 1M1YA 1XK6A 2H4HA 2I78A 4KQJA 1GGFA 1JBKA 2VFAA 3RVQA 4ZHSA 1AKTA 1MJGM 2AI2A 1XJ5A 3A9UA 3KE9A 3I04M 4EG5A 1DBSA 4OHKA 3IRVA 3LHFA 1UBTS 2L2QA 4LJ4A 1SCUA 3CY6A 4K26A 1P81A 4NBUA 4TMXA 3ZCTA 4DARA 1CS0A 2P0AA 2C4HA 2ZCVA 1Z2CA 2DQKA 4ZAFA 4BATA 2XUKA 4Q00A 4OBBA 2HRZA 4HLCA 2BC9A 5KWIA 3LUCA 4DV5B 4LBZA 1AO3A 2FTKE 4LQCA 2QAGA 3VVBA 5K0GA 1X7GA 3ASYA 2QM8A 2B5WA 4GOLD 4II3A 5I9SA 2AZXA 3HKBA 4CMJA 4UM8B 2CGEA 4Y2VA 2NUPA 4IIJA 3WDSA 1RYEA 3WP1B 2ATEA 2H59A 1UUFA 3FBTA 1FP4A 3C98A 3I9LA 3KYCA 3LOPA 3DQZA 2XA9A 5F1PA 1YRQA 3O4IA 4LK2A 1Z2OX 3V7NA 2JHPA 1NOJA 2QNIA 4C0QC 4H08A 2YN2A 4RSGA 1DKRA 3V3TA 3K0AA 5JSYA 4ZVTA 3ZLBA 3ENNA 3DMHA 3HEAA 2VCHA 3S3TA 1FSPA 3RYIA 4C01A 5ALJA 1Y7HA 1I7NA 2ZJBA 3FMPB 3KYCB 3GCZA 2QYHA 4GSYA 5HF8A 3IO5A 4I3FA 2OGZA 4F72A