1XJ0A

Crystal structure of the gdp-bound form of the rasg60a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structure of an intermediate for nucleotide exchange by Ras
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xj0A00
3K09C 4ITRC 1E2DA 1E94E 4IDHA 4FMCB 1HV8A 4TTRA 2BBWA 4LRWA 2OBMA 1JR3A 2N42A 1II9A 3FMIA 4QXAA 3VTKA 2VO1A 1JJ7A 3TRFA 1JR6A 3C5HA 4Q48A 2FZLA 2PZFA 3AF1A 3T06B 3U4QB 2ZI6A 3ZJYA 3BRWD 4TTPA 1AQYA 3HPRA 4LOAA 1DAHA 3Q85A 1GRRA 4NONA 3LO5A 2DFLA 5J4YA 2WKPA 1VCIA 3DZ8A 3GJ4A 5KSOA 3R20A 2ZREA 1Z0AA 3GJ3A 3NDPA 3SYLA 1MH1A 3SYKA 4AKGA 5DYGA 1NLZA 1R6BX 3VR2A 4ZDJA 1NKTA 1LFDB 2WJVA 4FCVA 1I4TD 1LVGA 1NIPA 3A1UA 3KQLA 4RZ3A 3EWAA 3TQCA 4P33A 3TSZA 3ZD6A 3X1ZA 2JLQA 4TN1A 1U8AA 2HDNB 2O5VA 3SS8A 3X1XA 2ANBA 2Q3HA 1EG7A 2FPKA 4EPRA 4L8GA 3EWSA 4A15A 2OEPA 3B1ZA 4D4KA 5JSZB 1QHGA 4OYHA 1W2HA 4O2RA 2HF9A 4MGKR 1ESNA 1SVOA 3QBTA 3T1TA 3HR7A 3QKSB 4G1UC 5EP2A 1XMVA 5SZKB 3UMSA 2Q3MA 3AP3A 1LTQA 2J0VA 1COWD 3AB3A 4PPGA 3SBEA 4D80A 4HAZA 3LA6A 4EJSA 3QG5A 1X1RA 3AGQA 2AD1A 2ZS7A 3BGWA 1CJUC 3VKHA 2E9SA 2AWNA 1N6IA 2F1JA 1V5WA 3EPKA 4ZI2A 4K8OA 1YVDA 1E0AA 4PPNA 1W1WA 5DNYB 1AS0A 1TU4A 3RRMA 1M2OB 1II8A 2JA1A 4F92B 2O0KA 2IA5A 2F1IA 1G291 2DR3A 1KDRA 1XTRA 1JB1A 2ZJOA 1XP8A 5AJVB 5EXPA 4D26A 1BIFA 2QMOA 5FBRB 1X3SA 1CJTC 2ZUBA 3IDQA 4XTCS 5C4MA 3HU1A 3K9HA 4GZMA 3B13B 3PENA 1LW7A 3THXB 2KE5A 3PFIA 1RW4A 1XRJA 2QNRA 1AS3A 2FH5B 4F4IA 2GEVA 2G0NA 5LBIA 4G5RA 5D3MB 3QKSA 1Z0IA 3GLGA 4DCVA 3B2EA 2ORIA 3RNLA 3QXJA 2REXB 1MRSA 2ZRGA 1NMYA 1ZM3A 3OIVA 1AZSC 2QGNA 3E5HA 2UZ3A 4JYCA 2WPDA 4OHWA 1KTVA 2QAGB 1C4OA 2YNMA 2QM7A 1ZCAA 2WJYA 5JZVA 3T5DA 3BB1A 3T1VA 4DSUA 2ZI5A 5FPHA 1KO5A 1E1RA 2ZJ8A 4R7ZA 3T61A 4DCNA 2J0UB 1BO6A 1P75A 3Q5DA 4JVLA 2FV8A 1Z83A 4YDSA 2C8VA 2RHMA 4WA7A 5JHHB 2RH5A 1U9IA 1XCPA 2QL6A 2W6JD 2AKYA 4PO8A 4GOXA 3GLIE 1XCGB 3BORA 4EPVA 1A2BA 2D62A 2PMKA 2H7VA 4PZZA 3L0PA 1MABB 4PHHA 2KI5A 4D4LA 2F6RA 5HKKA 1XD2A 2VSXA 4TQAA 3N5CA 4O3MA 2FWRA 3HJNA 3QVVA 4RD3A 1G17A 3KUCA 5AUPB 3JVVA 3LDAA 5D3MA 4RD1A 5E4FA 1XDBA 4JT2A 4LGMA 4RZUA 3AVOA 5GJWC 3K53A 1ZAKA 2C96A 4MKFA 3GLFA 3GEIA 1E1QD 4HB3A 5SZIA 1AS2A 1DARA 3RABA 2XOKA 3IIJA 1N5IA 1E9FA 2C78A 3A6PC 1QBKC 4IVQA 2QAGA 1SXJA 1A5TA 4PR0A 1XNJA 3ICEA 121PA 5A4JA 1DTSA 1E99A 1WE2A 1U2RA 3FE2A 1XTQA 1D2MA 3HDTA 2BKEA 1UF9A 3K0AA 2ZROA 4B33A 2YC2C 1G1MA 1U94A 1AZTA 1P2UA 1IOZA 2FJUA 3DOFA 4EPTA 4QC2A 2IUUA 3VR4A 2Z6VA 821PA 2J0UA 4I1VA 4B73A 1LF5A 3IPXA 2VQSA 3EX7C 3REFA 1XTKA 3ZVMA 4OI1A 3JZMA 5TV2A 5EE5B 2ZM5A 1QHIA 2IYZA 4HLQB 2X2EA 2JJ2D 4DLVA 4IOMA 4QNMA 4A8JC 4TQ9A 3K0EA 4BUJA 1WB9A 5CK4A 4POAA 4OHXA 1MABA 1XJ0A 4TYYA 3WP0A 2MSDB 2CVHA 2JGNA 2BOVA 2GJ9A 2FE4A 3KKMA 3KL4A 2WJHA 4LJ5A 3CX8A 1CJKC 2VP9A 3NWJA 2OLJA 2ZRMA 4ON9A 5KNDA 3SQWA 1LV7A 2IXEA 3WNBA 4KBGA 4DSTA 3F5FA 2FDCA 1VCNA 3QBVA 2V3CC 5DHAA 3FPAA 2DWOA 2VHCA 3B9QA 2IYXA 1I4DD 1E0SA 1R8QA 3U61B 3WMFA 3LQRA 4NBSA 3NBYC 1FTSA 1QG2A 1XD9A 4NCJA 2QEQA 5IF9A 2QGZA 1KKMA 3PEYA 4IOJA 2GWHA 3BWDD 4P32A 4DSOA 1TMKA 2WMNB 2VYFA 3ZGXA 3OE7D 2CMKA 4S35A 2ZS8A 1JQLB 2H92A 1I2DA 4U00A 4PQFA 1O87A 3BB4A 3SYNA 3QQ5A 2IUSA 3OFND 1W4BA 4MH0R 4PPQA 3ADDA 3LY5A 1G9XA 4BECA 2H57A 1NJFA 3SFVA 4NZYA 4YDHB 1U9IC 2EFEB 2QRZA 4MRSA 3SC3A 4JJKA 3CPJB 1FTNA 2GZDA 2GJ8A 3TVTA 4I1UA 1ZINA 3AH8A 1FQJA 1Z3IX 2O52A 5CYPA 5FR2A 3THYA 4TMVA 3T12A 1W0KD 1VYTA 2ZR0A 2CCKA 1GDDA 3N2EA 1RVDA 2AX4A 1CXZA 4F4JA 2MSEB 5F2EA 5CB8A 2YWGA 1YR9A 2FNAA 4V0OA 3ZIAA 1KAGA 2FFQA 3C15C 1E4YA 4D6PA 4GFDA 1R0WA 4URYR 1XEWX 4F38A 3I8XA 4TWZA 1TTTA 4A9AA 4YMTA 5AUOB 4B3GA 3IIKA 3IO3A 2AK2A 2P6NA 2V8OA 1G7CA 1TAGA 1VCMA 1DAGA 4XD7A 4G5OA 1UAAA 3LH5A 4EAQA 2B6HA 5E3HA 3TK1A 4QJ3A 1EX6A 1A1VA 2RGCA 4D2IA 1Q22A 5JI2E 1TNDA 1RPZA 1GL6A 2KJQA 1MV5A 1P61B 5CYOA 3GEEA 4ARZB 5TARA 1GL7A 1UKYA 1CIPA 2D74A 2P5SA 2OAQ1 4E03A 1BKDR 3TE6A 1G7RA 1E79A 1CLUA 4URWR 1E0JA 3HPQA 1VKJA 1KI6B 3FHCB 5ELXA 4QBIA 1XXHE 1WXQA 4L16A 2W6ID 3WRXC 3QXSA 1TEXA 1TUEA 4PX9A 5KTYA 4M21A 3G0HA 3EZFA 3WYFA 4W5HA 1T5IA 5HTKA 1AA9A 3SNHA 1JI0A 1ZM2A 2F43B 4TMKA 3TAHA 4BLSA 4ZKEA 2WSSD 1CU1A 4BFWA 8OHMA 5KYKA 4OK3A 5FOSA 2J7PA 1Z6XA 1TPZA 3DMDA 2VF7A 1XPOA 4NYIR 1GKYA 1S0UA 3DEFA 4M1MA 1EFRA 4DZZA 3T5GA 2XB4A 1T3SA 4DT1B 4Q7JB 2C9CA 4LJAA 1RRPA 4GL2A 3GCGA 2AK3A 3FFAA 1IXZA 3DZDA 4PHGA 4JLDA 4Q02A 3MSXA 1OJLA 2J0QA 1K5GA 1OHHA 4BWYA 2ZU6A 4UNRA 2AWOA 1UFQA 2X77A 2NO9A 1GILA 4WOPA 1E2IA 3VR6A 5BN5A 5JS8A 2QG6A 4CEJA 1NSFA 1V43A 4LHXA 4LJ6A 2GAAA 2HEIA 3C14C 3U3MA 3R9IA 3ZQJA 4MKGA 1GG2A 4M22A 1TQ2A 1PUJA 2D3WA 1OYYA 4US0R 1U8ZA 1RE0A 2QZ4A 2JJ1A 5EUQB 2P0EA 3KDSE 1YQTA 5KPDA 2QRNA 3L43A 4LBZA 3QPUA 1KKLA 4TMZA 4TL9A 3BFKA 5KU1A 3SE0A 2IT1A 3U5ZB 1AIPA 1UEIA 3Q3JB 1OIVA 2NQ2C 1UBGA 4A92A 1EK0A 2XSZD 1F2UB 2FFHA 4DDTA 2MSCB 1P7CA 3OESA 3LV8A 3QF4B 4A6XA 4U5XA 3J81k 4JT4A 2JLRA 4Q21A 4NKRA 5KDDA 5IK2A 4JS0A 4DT1A 5DH9A 4BLOA 1UKVY 4Q9KA 4ESHA 1PLKA 1G5PA 1OYWA 2IUTA 1G4UR 1IN5A 1YR8A 2C2HA 3NIBA 4FIDA 4DLZA 1CR2A 4KFTA 2QT0A 3SJAA 2WWHA 2R6CA 3VR1A 4FXPA 4UXJA 4Z1MA 3W8NA 1XJCA 4UJ5A 4XSHA 1EFCA 1KY2A 4Z8XA 3H0KA 4G5GA 4H1VA 2KBFA 4KFRA 2AXNA 4NCIA 1BMFA 3W34A 2WV9A 1YRAA 2ZANA 3IBYA 3RSLA 1ZJ6A 3WBJA 3KTAA 1NIJA 1R5NA 4DLWA 4DUGD 1G8HA 1G20E 4OI2A 5FI0B 4MYUA 1X8JA 4EKDA 5J4KA 2Q9AA 4Q4AB 3M4YA 1OIXA 3I5XA 5L3SB 4Z54A 2CK3D 2WJJA 3SI7A 1OF1A 3PUXA 1N6NA 1GNQA 4OQFA 2QSYA 2OFOA 3L2OB 5J4LA 1F2UA 1YZQA 3RWMB 3QF4A 2JDID 4LPKA 4YMSA 3NBFA 3TR0A 3W8RA 4PQYA 3EAQA 3GLIB 3A1SA 2EWVA 1KSHA 4C0BA 2Z4RA 5FOVA 4HDCA 3LQQA 4ZCIA 2RGNC 3RVBA 3LLMA 4URXR 1IN6A 2RMKA 3PEUA 4HB2A 2ONJA 4DBLC 1HEIA 2ODWA 4MUAA 4I1OA 4LCBA 1W36C 3BIFA 1QRAA 4FMBB 2XX3A 5DGXA 3L8ZA 4D25A 5DISB 3TKLA 4FCWA 4OHVA 1T5LA 3LD9A 3AVXA 1CS4C 1E9SA 2MMGA 1CRQA 3O8RA 3RS3A 2OM2A 3BFXA 1ZU5A 2CLCX 5LD2B 3K9NA 3OF5A 1E2NA 4ASUA 5H8WA 5CDFE 1AJEA 1N0WA 1XWIA 5L3SA 3TSOA 4R9UC 1Q44A 2OFWA 4XTRA 1N0VC 3EXAA 4D81A 4DDVA 3U7HB 2YWHA 1JEEA 3RDPA 4PZLA 2OFXA 4Q1DA 2GDJA 2HYIC 4DLRA 3PEWA 4TZ0A 1KJWA 5KO2A 1UDWA 4FINA 4A4DA 3ADCA 4IXNA 4LV5B 1J2JA 5BYJA 2OCYC 4DDWA 3GLIA 3B9PA 4QGGA 3A1WA 2WMOB 2DYKA 1KO8A 1C9KA 3A4LA 5G40A 2VIIA 2BEJA 2WVJA 3O8BA 1T4GA 3K70D 3C4JA 2X2FA 2CHGA 4BASA 1DO2A 5KUTA 1XMIA 2WWWA 4MYCA 4ZCLA 2G83A 2QE7D 2N46A 3U3OA 3X1YA 4P4UA 4Q9JA 4OI0A 2NZJA 2H1LA 2RGGA 4AK9A 1KO1A 1SZPA 2DBYA 3KJHA 1KAOA 1NN0A 1Q1QA 4PSAA 3WHKA 4AC9A 1GNRA 1QDEA 4MITA 5K8UA 4ZV4A 2HJVA 4ACBA 2O8DB 4OQNA 4DIEA 2EYUA 1N25A 2VTKA 2ZYWX 3CF6R 4GZLA 4RCYA 4Q00A 3AM1A 3WBKA 4GRAA 1LB1B 2OBNA 4K46A 1NN5A 2FEMA 5F98A 4P4SB 1OH8A 5GJBA 5GJCA 3NC0C 2QAJA 4BLQA 4G0NA 3BS4A 3U7FB 3LVRE 5FL7D 4LPSA 4UXIA 2IWRA 3SR0A 5C1BA 2NIPA 1T0HB 3LBNA 3QXXA 1T9HA 2WWGA 2BWJA 2P3SA 3OIYA 1G8PA 3ZH9B 1D8TA 3CRRA 1YZGA 1CKEA 3ZLJA 4QOSA 3O8CA 1KDOA 4GDFA 3MWYW 2DPXA 4CEHA 2C9YA 3PG5A 3B1WA 2RGDA 1ESMA 1Z6TA 2OHFA 1SQ5A 3DKVA 2DFNA 4LY6A 3VNVA 2GVDC 3SEAA 1GTVA 3E70C 2R6GA 1MO5A 4DRZA 2O8DA 2C98A 3VKGA 1E4VA 3F0TA 4LYHA 4IW3B 5EP4A 4DVGA 1R0XA 2FFAA 1OFTA 4M1KA 1Q3TA 5D3QA 1KMQA 2X1VA 1VHLA 3FOZA 1F2TB 4P4SA 4FMCF 1TEVA 1IN7A 4HUQB 3U2QA 4YXWD 1Q0UA 3LRPA 4NPHA 2IYVA 1ZVQA 2IHBA 1I2MA 4QBFA 5FOXA 3D3QA 3F8TA 1NMXA 4MGIR 3BH7A 2ZR9A 3OIUA 4Q7LA 4WBSA 3D6TB 2FX3A 3AGPA 3HWSA 2VP0A 3FMOB 4FWTA 1Z5ZA 1XU4A 3IEUA 3NEYA 4PSVA 4DEXA 1KHTA 3BK7A 2ZRNA 2WICA 2XJ9A 421PA 4HLUC 1XTJA 3OAAD 2C9OA 4IFEA 1XXHB 2CLSA 2OO7A 3GLHE 4Q18A 2NOAA 4ZKDA 2G3YA 4J0QA 1G3MA 4NTZA 4B35A 4RD4A 3B60A 3R9XA 1XMSA 1NP6A 1E2QA 2G1JA 4N1AA 4TYQA 2PCLA 2ZI9A 1X8LA 1MO3A 2GK7A 3RHFA 1ELOA 1XEWY 2V55B 1QVAA 2JLSA 4YMWA 5FR1A 3MG9A 2HJGA 2WZQA 3TH5A 4WIAA 3U3JA 1XD8A 2IBMA 3Q8XB 1F2TA 1L8QA 1X8KA 2ZETA 1KZ7B 5KSZA 1T91A 3FVQA 3TSWA 1GIAA 2BKUA 4A36A 4LSGA 2GCOB 1JR3D 1GAJA 4PXAA 4OBEA 4TZ6A 3H1TA 2ZVQX 2ZJBA 4L4UA 4X8OA 4B2IA 2QM8A 2O8EB 1TF5A 2PT7A 2I1QA 3VX3A 5KDLA 3I1FA 3B85A 1ZUHA 1HTWA 3KJGA 4LK2A 4Q1AA 2IW3A 4BEBA 3ZQ6A 1KK2A 1J99A 2P65A 1LNZA 4ERNA 1N6OA 3QKTA 4TLAA 1SGWA 4DXAA 1EESA 2ZJZA 4DDUA 1XXHA 2GZAA 1CP2A 4KLNA 1COWA 1DAMA 4Z8YA 4LHZA 5SZHB 4QRHA 3U4QA 4EPXA 2GVZC 4TL8A 3ZVLA 3OEHA 4B6FA 3KUDA 2D06A 1GM5A 2YWFA 3RS0A 1AQUA 2Q9BA 1VYUA 3JVUA 5CLLA 3W9YA 2VHUA 3ZVNA 2XB2A 4JSYA 4BZPA 1N5LA 4B34A 2PJRA 2WAXA 1E2EA 4HAXA 2YYZA 3AKYA 2ERYA 4WXPA 4HI0E 2GJKA 2QU8A 1NG9A 1HY3A 1NLYA 3CB4A 2PT5A 2ORVA 3CIOA 4B75A 4Q7MB 3WHLA 4QKQA 2BM0A 4YMVA 4DCSA 3U6KA 4O0MA 1N3BA 5AJXA 3VMFA 4LV6A 3A37A 3D8BA 4FWIB 4UJ3A 3B82A 1IONA 3I73A 4DC9A 3RLFA 1TL7C 3IHWA 4RD6A 4MDEA 2FGJA 3QEOA 4NYMQ 3O8DA 1YZNA 2O0JA 5FBWB 5JSZA 3L0SA 3V4FA 1EGAA 1YZUA 2C95A 2ZJ5A 5AK0A 4BPBA 2GTPA 3BFVA 4EFLA 2XJ4A 3H4MA 4Q9IA 1G3UA 1FMJA 1XTSA 1SHKA 4US2R 1E2PA 2RCNA 1II0A 3GJXC 2FMXA 3W6PA 1VPLA 4C2TA 2EVWX 4M1TA 1DO0A 2QI9C 3U44B 4BEJA 2D2EA 4U7DA 2D4HA 4QNRA 2GZHA 2J5XA 1Z0DA 2N1BA 1GOTA 2B8WA 4TMXA 1M7BA 2XXAB 3QKRB 4RFVA 5E7IA 1IY0A 3TQFA 1UKZA 5B64A 2YV5A 2W2XA 4MA4A 4O25A 2XTMA 2W6JA 3SJCA 4MGYR 4BFUA 1G3QA 4QG7A 4AD8A 4QFMA 5K8IA 2ZRHA 5TB5A 2ZR7A 1OKKD 1ZC3A 1N0UA 4D0GA 5JLJA 1UM8A 2V6IA 2WKQA 4ZIRB 1WMSA 1S9HA 2B7BA 1QHNA 2HV8A 4Q1CA 5FUVA 3AVTA 3THXA 2EFHB 4B71A 2QPAA 4R71A 3CWQA 4Q4HB 2PZGA 1FQKA 1E1QA 3EA5A 5EXSA 3QXCA 4NE2A 3HYRA 5JBQA 3C41J 4Q19A 3AVYA 5CIWA 1E9CA 2OE2A 4LHYA 2NZ8A 4JBXA 4IEIA 1NVUQ 3CF0A 4LX0A 1KMHB 1FX0B 3NBZC 4BFSA 1XF9A 4H9GA 3V4RA 3SFZA 4Z51A 2QMEA 4C0AC 2XNDD 2ERXA 1GSIA 3CUEF 2ZRDA 1AN0A 3CF2A 5E7MA 4D0NA 3NH6A 2JLXA 1UADA 3TR5A 2HCJB 1MRNA 5EXTA 1IY2A 4EJSC 3RRYA 4WAUA 4NP6A 3EPLA 1PVOA 3DHWC 2I3BA 5L3RA 4R2IA 2JJ2A 4A2WA 4CDGA 3WP1B 2H17A 1OXXK 4EFNA 1HE8B 2KWIA 1DG1G 3GD7A 1Q1BA 3AVPA 1F60A 4E5UA 4IDQA 1W5SA 3RSOA 3HYTA 4OHZA 4IJMA 3I32A 2XOKD 4XVUA 4ZIRA 5HPYB 4MYHA 1CF4A 4B3CA 1FPMA 2B92A 2GXSA 2UZIR 3CO5A 3VAAA 1OH5A 2F3RA 1R5OA 1IJFA 2P5TB 3LVQE 4EQ6B 5KPJA 3P4XA 2ZSBA 5FPSA 4FW9A 2ZJYA 2K5UA 4NYMR 1AKEA 1P3JA 1SVMA 2D7CA 3QI2A 2RGEA 1YR6A 3Q72A 5EXXA 3PVSA 5CDFA 3A8TA 5EJEA 2ZSDA 2GCPA 4Q66C 2FOLA 1L4YA 1JNYA 3I72A 5LB4A 2OV2A 4RKEA 4B48A 1NVXQ 2J87A 4UNNA 1KDTA 521PA 1IHUA 4PAQA 2IYWA 2QUZA 2OT3B 4A6PA 2VH5R 5JCPA 2YHSA 2CE2X 2YOGA 4LI0A 4IVPA 4TT3D 1TU3A 3OE7A 5AR1A 3QNUA 3RRNA 3CNOA 3EZ2A 5C2JB 1ZUIA 3BB3A 2EW1A 4RD0A 4D0LB 2BC9A 2GNOA 2IYTA 3UG6A 2GBLA 3OFNA 2VRWA 2C03A 3I4LA 4AKEA 1UPTA 1H8HD 3KKNA 2W2TA 4AKHA 3U3KA 1P2SA 4DLUA 3HU2A 1IAQA 2R6DA 3QEJA 1W2GA 2J3EA 3UMFA 1KO7A 3PQCA 3P1JA 1A82A 4M9QA 1DG3A 2F7SA 4MKIA 4PQRA 2NO0A 4EQ6A 5DI3B 5HZKA 2QENA 3SOPA 4NCHA 5G53C 2V6JA 4MRNA 3WMEA 2FEOA 3B1XA 3MWLA 1U8YA 1ZMXA 5FTNA 3ASZA 1ZCBA 3PEVA 2FSFA 4XH9B 1GKIA 2ZRKA 1HE1C 3L8YA 1H8EA 4KHZA 1E9DA 1VYVA 2XITA 5GADl 1R7RA 4BFVA 3MD0A 1NJGA 2QSZA 4OJQA 5JHGB 4RJLA 2JLUA 1TADA 3VU9B 4EIWA 3I5YA 3QY0A 5BN3A 4M1YA 2WIAA 2JIZD 2QAGC 1SXJC 4V0MA 1JR3E 2R8RA 4EUNA 4Q4JB 2OSBA 2BBOA 3UK6A 3T35A 2X8AA 4B3DA 5FPKA 5FBVB 1XPRA 1XPUA 4TYWA 1DBSA 1QG4A 4FI3C 3I62A 1S3GA 1CRPA 3CPHA 1FUKA 3VFDA 4AY2A 3GLHB 4KO8A 4HLDA 1RRCA 4LJ8A 4DLTA 1QZXA 2VL7A 4WXRA 1RJ9B 4DKXA 5DHFA 6Q21A 4CT5A 3Q9LA 5FL3A 1G5TA 2FPMA 2DHRA 4AIIA 5DI3A 1XMJA 2Z5FA 1DADA 2UVQA 2W6IA 1OFIA 2WTUA 1T3HA 4B76A 3KKOA 3WXMA 3TMKA 2JLWA 2H16A 1U0JA 4HAYA 2VF8A 1CBUA 3SHWA 1OH6A 2XNSA 4OQXA 3FGNA 1KY3A 4HLCA 3W5JA 1S2MA 2FG5A 1R0ZA 2QPTA 1N6PA 3IBGA 1NBMA 2IEYA 3QUSA 2CVFA 5IHPA 1T6NA 4HZIA 2TMKA 2ODBA 4LJ9A 4L9SA 4L9WA 1DE0A 2ZSAA 1G3RA 4TYPA 621PA 4RZXA 2J59A 5HCNA 3ETLA 2JCSA 3BD9A 3TBKA 2FFBA 4GMDA 3BERA 1JBKA 1WQ1R 2Q3FA 1E79D 4PHFA 3R8FA 1JPJA 3Q7QA 4OQMA 3FB4A 2WKRA 1W7AA 1MO4A 2R62A 4BLRA 3BOSA 2F9LA 1OLOA 2EFCB 3GLHA 2Q0HA 3BE4A 4PC2A 4DHEA 3QOFA 1WA5A 4PC6A 4RY2A 4ARZA 3DDCA 4OL0A 2QY9A 2IS1A 2QTHA 5JWOA 2IS2A 5IDVA 4HAUA 4KITB 1B0UA 1L7VC 2GAOA 1KI6A 2B8TA 1NKSA 2CXXA 4DJTA 1W36D 1GWNA 1RIFA 2FPLA 2Z83A 4C0JA 4DWJA 3VKWA 1AK2A 1DVRA 2DCUA 1VDZA 1RZ3A 1F48A 2F43A 2XSZA 3IHLA 4PAOA 2IHYA 5CLQA 5C18A 4ZPXA 4V0LA 3U3RA 1OHHD 3K9LA 1FP6A 4QJ5A 2RHDA 2J41A 3IUYA 4LC0A 5SZJA 3GQBA 1J8YF 3M0EA 4Q03A 3W3ZB 3KQUA 1RYHA 3W5IA 2PZEA 3EARA 2J7KA 2ODEA 1ZUNB 5M04A 2BMEA 2GILA 3AV0B 4CRWB 1M6NA 5K8LA 4W9MC 4LBVA 2A5GA 4DB4A 3GLGE 4JKYA 2CCGA 1KO4A 2V4ZA 4D4MA 3NBXX 3RWOA 3EPHA 4RVCA 1TX4B 2HT1A 1EWQA 2VHJA 3GJ0A 4FD2A 3KZ1E 3IO5A 4JLNA 4TQUS 3EPJA 1NVWQ 4Q7KA 1AGPA 3CRMA 2QT1A 4PO9A 4Q9HA 3RS4A 3V9PA 3PV0A 1NY6A 2ZE8A 4OI4A 1Z29A 3KXKA 2BMFA 4DUGA 1JQJC 3NG1A 5EE0A 4ZDWA 4CIDA 2RGXA 3TLXA 4W7SA 3NDBB 4BLTA 2FF7A 1EFHA 3Q7PA 4X8HA 3R7WB 1CR1A 2X19A 2CK3A 3E2IA 4Q1BA 3ZZ0A 1CEEA 2YOFA 1D5CA 2IS6A 2ZITA 5DIFA 3AVUA 4BRWA 1NY5A 2F3TA 5JWHA 4II7A 4JL5A 3UIEA 4BZXA 1MO6A 3AVVA 2JDIA 5EP3A 2E87A 4QBGB 1EX7A 1E96A 1E2KA 2ODNA 2V7QA 3D31A 4UNQA 1Z8FA 2CNWD 2FGKA 3KJEA 4Z1MD 3BH6A 2REBA 4EDHA 2BJWA 3N70A 2IYUA 2AFIE 1DOAA 2ZUDA 3K70B 3IQWA 2QP4A 4R98A 2BCGY 5HE9A 3MJRA 1NNEA 2HXYA 2IYSA 2QMUA 2WJIA 5AJWA 4C0LA 2ASEA 3DM5A 3GLFE 1OFHA 2A5FA 1U0HC 4LYFA 1ANKA 1ZIPA 4QGHA 2BBSA 4PANA 3DVLA 2AN9A 2GEUA 4BFYA 1NVVQ 5J4VA 4KSBA 3KQKA 5CJPA 4DB2A 3FKSA 3ZVRA 2ZEJA 1NL3A 2P2LA 5FI1B 4MUBA 1CTQA 1OV4A 5JWRA 1OXTA 4GMXA 1Q1ZA 1KJYA 2ZSFA 3LBIA 3TAUA 1FZQA 3GJ7A 3UMRA 2GETA 1W49A 5FOWA 3R7WA 4YMUA 4DLYA 5GVRA 1EFTA 4IHQA 4X8MA 4FMDF 2IWHA 1KI9A 3TUJC 4Q4AA 4DCTA 1QHHB 3R8CA 1JECA 1GNPA 4LBYA 4DLXA 2HLDD 4AG6A 4D4JA 4HYYA 1KNXA 4MRVA 1VHTA 2FZ4A 2VP2A 2CL0X 1CULC 2O0HA 3SJBA 3QSYA 2NGRA 2OCPA 4B43A 4CW7A 2A5JA 2F1HA 2ZTSA 5EP1A 3I8SA 1E2LA 4FMDB 1P9WA 3G82C 4TLDA 4C3ZA 2BBTA 2JEOA 5B58C 1U90A 2P67A 1P2VA 4JKIA 2GK6A 2QE7A 3NKVA 3B6EA 3LWNA 3H86A 4KODA 4JLMA 3K0CA 2I4IA 1YZLA 5CM8B 1KK3A 1G7SA 3UWOA 1PJRA 2PMDA 3MWKA 4TSFD 2VA8A 2A5YB 2OZEA 2ZUCA 2R65A 1TUIA 1NLFA 3K09A 4HATA 3IPYA 2W0MA 1J90A 3QXHA 1UBCA 5GVSA 3CPEA 5IRCD 2ZU0C 3OEEA 2PH1A 4IEEA 1QHHA 1S8FA 2ZE5A 1LY1A 1DAIA 3NEJA 4DCUA 3CRW1 3LFUA 5JEDA 3U60B 1W47A 5FL7A 4S2EA 1LF0A 1NN3A 3NVAA 4HB4A 1E69A 1OXUA 1XJQA 1CJVC 4HEJA 5C4GB 1MKYA 3MUFA 1KOFA 5EZ5A 4LYJA 2CEAA 4MRRA 4QL3A 2ZAMA 1P73A 2HT6A 1KGDA 4KI0A 2XAUA 3EG5A 4NL4H 3CBQA 4GI7A 4IFBA 1GKUB 3KFVA 3QJYA 4F4CA 1K6MA 3PJRA 2A2ZA 4TL6A 4GBMA 4OHYA 4LV8B 4HDQB 4AYWA 4F93B 3CZPA 4URUR 4UNPA 1Z07A 2QROA 1NN1A 3DL0A 3LNCA 1Z08A 2GKSA 3P20A 1YRBA 2VSOA 2OLKA 5ANRB 2VHQA 1DELA 3ZD7A 1OPXA 4AYTA 4V03A 4KVAA 1T0JB 4XSGA 3DOEA 3FWYA 3TIFA 1UBFA 1PZNA 2L0XA 1KNQA 3CH5A 3QF7A 1OXVA 3SJZA 2BVNA 1G6OA 3MWJA 3RS7A 1U99A 221PA 2HCBA 4TTQA 2KBEA 4BFZA 4HAWA 1M74A 5CJ2A 2B21A 1N6HA 3EW9A 3IILA 3TVDA 4URZR 3VX4A 1G19A 4N0EA 3KXLA 1UBEA 3AKCA 4B6EA 4KCGA 1S1MA 2NMVA 3KB1A 4P4TA 1AM4D 3NTUA 1DAEA 5HR5A 3RS5A 4U02A 2ZRIA 1WP9A 5DE3A 4GP6A 4E09A 3AEZA 1WF3A 2OILA 3CNLA 3GEHA 4CF7A 3H2YA 1SKYE 5HCIA 4A0FA 3EIQA 3QKUA 4GOKA 1HUQA 4N3NA 1IY1A 4DIDA 5G3YA 1YU9A 1M34E 2WAYA 2ZAOA 1KJZA 1Z6GA 2EFDB 1MOZA 3HU3A 3CH4B 1WCV1 5KNBA 2FU5C 2GXQA 3RANA 2BHRA 2PBRA 4KYIB 5DO9A 5DN6D 5J4HA 4M4SA 1K8RA 3AF4A 1HT1E 3PXGA 4I99A 4TLEA 5BQ5A 3X1DA 3GPLA 1IXSB 4JL8A 3B5JA 2XTNA 1E32A 1LS1A 3A4MA 4ZDKA 3K0SA 2BJVA 4X8LA 3GJ8A 3SZRA 4HB0A 1W0JD 3ADBA 1YKSA 2DY1A 1JAHA 3AF0A 3DPUA 1N5JA 4NCNA 1AKYA 3VHLB 3WNDA 4B2PA 3KQHA 1E3MA 2CDNA 3MJHA 1RRGA 1YJ5A 5J47A 5LD2C 1D9ZA 1P62B 1KI2A 4EPYA 1SULA 2P6UA 1YE8A 2ZS9A 4HUQA 4TYNA 1OT3A 3KX2A 5JCZA 1R4AA 1RRFA 4CEIB 4YLGA 1E2GA 1ZM4A 3BJIC 3WRYC 3P27A 3EZ9A 2J46A 5KDOA 2G77B 2W00A 2F9MA 4EJSB 3T1OA 1XEFA 2OXCA 2GXAA 2G6BA 5G41A 4AURA 3GJ6A 5B57C 3W90A 3TUIC 1E0KA 5HE8A 3AKEA 1FFHA 4IOLA 1K5DA 5IT5A 3A1VA 5EE3A 5JJKA 3C16C 4A8JB 2IYYA 4LZZA 1P9NA 2SHKA 2ZI7A 3IQXA 1E9RA 4O2LA 2J0SA 2ZJAA 3Q5EA 3AF2A 1NF3A 4G5QA 4YONB 5LDDC 1II8B 2EWWA 3JZAA 4G5SA 2JJ8A 4NH0A 2ONKA 2WOJA 5JFGA 4XIGS 3KB2A 1A7JA 1ZNWA 4TMWA 5E7JA 3FYHA 1R0YA 4G01B 1R8SA 3UPUA 2ATVA 4XOIA 4C0SA 1WBDA 4IDPA 3LW7A 3SU8A 5TY0A 2XEXA 3EC2A 4DEYA 1XZPA 1YZTA 4C0HA 1VMAA 2CL7X 4BFXA 3GLGB 2YOHA 1VIAA 1ZNZA 2GF0A 2GCOA 1A2KC 2WBLC 4BZQA 4CEIA 3X1WA 2NTYC 2VP6A 2IXFA 3AP1A 4PAMA 3TUZC 1OFUX 2OXRA 1MR3F 1E98A 2GA8A 4KU4A 4BGDA 3DO6A 1XBTA 1UJ2A 3CM0A 2IC5A 2QQ0A 3OEHD 4Q1FA 4M1WA 4Y0VA 2G88A 2O8EA 1XX6A 4OKSA 4KAXA 2VLIA 4M8NE 1HA3A 4Q4LA 1FMLA 3AP2A 1O3YA 1P72A 3W3AA 4JVMA 4OQLA 5AJYA 3A58B 2O8CB 4JVNA 4GP7A 4HAVA 4HUTA 3FHTA 4AI6A 4PC3A 1ZM9A 4A8JA 1P9RA 4AYXA 4LHWA 1P5ZB 2Q9CA 3DKPA 2Y8EA 1HH4A 1OXSC 3BBPA 3S1AB 3GFPA 2IYRA 5CITA 2YKGA 2ZYTX 3D7MA 2O8FB 5AUNB 2Q6TA 2NO6A 2LKDA 3B1YA 4CVNA 2A30A 3ND8A 4UNSA 1XD2B 1HQCA 5AUQA 3G5UA 5CB6A 1SKQA 3EIHA 2GCNA 4NU0A 4W5JA 1JJVA 2PL3A 4ILEA 1M7HA 2GF9A 3GLFB 4CYMA 1OKKA 2CBZA 4Q01A 5H68A 4A2QA 3MRSA 3TGPA 4M1OA 4PSKA 1JXMA 2YJTD 1G4AE 1SXJB 3AUYA 3PIRA 4MRPA 2HYDA 1IQPA 2WPDD 2BV3A 3I61A 3LBHA 3K0AB 2O8CA 3C8UA 2AR7A 4RD2A 1N6KA 4M9SA 2ZYVX 2CHQA 3FTQA 5DYIA 4MGZR 1DPFA 1GRNA 4PHTA 2AD5A 3S1AA 1FL9A 2XNDA 5JRJA 1E1RD 1ETUA 1SVIA 5FBQB 5F3WB 1NMZA 4DSNA 1TF7A 3ADKA 1N6RA 2ZE7A 3U44A 2O8FA 3WNCA 1UKEA 3BC1A 4M9XA 2NG1A 1E9AA 3LX8A 5EUMA 2A78A 3V00A 3EZ6A 3KQNA 4RZ2A 1W5TA 1KDPA 4MKHA 3PUWA 3P4YA 4JLKA 4JL6A 2XXAA 3QKRA 4PO1A 4HZUB 3A1TA 5EE1A 2ECKA 4I4LA 4JLOA 5JEEA 5HKKD 3GJ5A 3M6AA 1KK0A 4AKIA 2KSQA 4IKEA 1P2TA 2QP3A 2D2FA 3ZS9A 1E2HA 4H1UA 1Q1EA 2IL1A 3AF3A 1Q20A 1G8YA 4KJZA 4JIMA 5CM9C 4ACAA 3BH0A 3KXIA 1VG1A 3RC3A 2FSHA 2DB3A 2LKCA 1KIMA 2ZPTX 4KVGA 1ONBA 3TNFA 1GFIA 2R6FA 5BW8A 1X86B 4OK6A 2WWXA 1NI3A 1TQ4A 2WWFA 2F1RA 1U81A 4Q4HA 1SXJD 1NRJB 1Z28A 5FBLB 3QVUA 4C7OB 3K0FB 4A0RA 2ZQ5A 4PTLA 1KSJA 1M7GA 2J9RA 4N0DA 2WWYA 1Y3AA 3CNNA 4Q1EA 1N5KA 4A0HA 1KZGB 3MLEA 4CGZA 1DAKA 2YVUA 1ZYUA 1UEJA 1EFUA 4F91B 1KMHA 1BYIA 1FX0A 1QF9A 3AVWA 4KXFB 1D6JA 4K81B 2VHTA 5G3ZA 1P60A 4EPWA 5BYKA 1QHSA 4TT3A 2R6AA 4V0KA 2OAP1 3CX6A 4M53A 2J1LA 1EXMA 2GJSA 2J45A 4PFSA 2G0TA 4A0GA 3KJIA 2WM9B 4W5WA 1KSGA 4HZUA 1Z6YA 3HR8A 1E6CA 2V54A 1VIYA 4P0TA 3DM9B 3KFXA 4GSYA 4XJXA 4ZCMA 4KSCA 2CJWB 1H8HA 5TDHA 5FUYA 5FPYA 5KHOC 5JJIA 4G3XA 3BAFA 3MMPA 2ZI4A 3THYB 1MT0A 1VTKA 4GNKA 3PUZA 5FOUA 2FSIA 1OB2A 2ZRLA 3ICQB 3GFTA 3LXRA 2CHVA 2JAQA 4NYIQ 2C5LA 4XVQA 3GP8A 4QGAA 3PUVA 4IDOA 4TMTA 2XTZA 3SHFA 3NH9A 4C7OA 5H70A 3K0FA 3VR3A 2AFHE 4XWOA 1G16A 1F3OA 1W0KA 3GFOA 1ZNYA 1FNMA 3T34A 4Q9LA 2RB4A 3ECCA 2REOA 1GUAA 4IRUB 5F9FA 3CZQA 2H5EA 4DLSA 2AHOA 1RKBA 1S9DA 1Z0KA 2V1XA 2ZYUX 5DLQC 4M0LA 5LB2A 3X2SA 1L2TA 4KYUA 1G41A 1FUUA 2JIZA 1IM2A 1HQYE 3EC1A 2FA9A 2NO7A 2ORWA 4KLZA 4TLCA 2CCJA 4RSGA 5FUWA 4AG5A 5JRZA 2ATXA 4XVRA 1RYFA 1G6HA 2PLFA 2CJWA 4NYJQ 1EWRA 1C1YA 1N6LA 2QTFA 1ZD8A 1YR7A 5DI9A 721PA 2ZXUA 3IKJA 3FFBA 1SKYB 2WHXA 3FKQA 3QENA 4LWZA 1XCMA 1BS1A 2RGAA 4B3BA 4JLJA 1ZP6A 2BMJA 2Q21A 2VP5A 2W58A 3UWKA 1WDTA 2PLRA 1Q57A 1JEDA 5K8TA 1D2EA 2FN4A 2QPOA 1ZC4A 4A2PA 4JBWA 1UDXA 3U7GA 1FNNA 1H8ED 5FTMA 1ZBDA 4MDFA 2BDTA 4C4PA 3NHAA 5BXQC 1BH2A 1W36B 2YC4C 3ZIAD 1T8TA 2R44A 4C0KA 2ZVPX 1QHXA 2ANCA 2XZPA 3QIAA 4I1SA 3NC1C 3T1QA 4E22A 1KI3A 2ZE6A 3MFYA 2H18A 3EASA 2BEKA 3ZS8A 1G8FA 2WSSA 2QBYB 3SDZA 4XD7D 4I81A 2LWIA 2VP4A 1RFLA 2A7QA 1QVRA 4F7WA 2P6RA 2BIFA 4WW0A 3A36A 4NCKA 5KOYA 4AWXA 4CEJB 4GPTA 4YC7A 1FP7A 2YINC 4JMPA 3VU9A 3R9WA 4ESVA 4MYTA 1YHNA 3UKDA 4Q4JA 1U98A 3PITA 3E1SA 5EE9A 1DEKA 3MCAA 3P26A 2QN6A 1B23P 5FTJA 4LYAA 3CONA 2QORA 1P4SA 1R5BA 4A1FA 1Z06A 1R2QA 2YZ2A 1J70A 1XTIA 4URVR 4ABYA 2GBLC 5LPNA 1RJ9A 2RGNA 1NBMD 1FW6A 4BQSA 1A4RA 4C9BA 2NPIA 4QBHA 1BOFA 4QHYA 4WVFA 3TW4A 2C04A 3REGA 4WZBE 5FPTA 1Z0FA 5FOTA 1G64A 3C7KA 3UANA 5JMTA 1Z63A 5JS7A 1VCOA 1US8B 2PX3A 2GRJA 5A5GA 1GRQA 2QP9X 4JZKA 2J7PD 2EFGA 2JASA 1E2JA 2NO1A 4PC7A 4ZDIA 5FTLA 3B78A 1G8GA 1S4QA 1EFRD 1IN4A 1XEXB 2QBYA 3RC8A 5BN4A 2W2VA 2R9VA 2QQEA 4FCTA 3K1JA 5CIQA 1JALA 1ZU4A 1GP2A 3PUYA 2HXSA 2CLDX 4QHSA 5CK5A 2BM1A 1T3LA 2HUPA 3FMFA 3OHMA 5HZHA 1QHYA 4LBWA 3B7GA 1VG8A 1KYIA 1KI8A 2GESA 5L3QB 5TVKA 2RGBA 2Z4SA 5JI3E 2JLYA 5EZ6B 4IDNA 3W6NA 1TQDA 3KTAB 1GZSA 1D9XA 3NHBA 1VG9B 5TMPA 2IF0A 1X1SA 2DFTA 2DFKB 4NYJR 4ZI3A 5KSPA 1GL9B 2OBLA 3QPVA 4BE7B 3L0IB 2JJ1D 2YWEA 1E9EA 1PLLA 1N2CE 1H65A 1KI4A 2C77A 4FN5A 2WJGA 2MMCA 3UG7A 2PJZA 1SHZA 4NMMA 2O8BB 1KSFX 1Q3HA 2KB0A 1DS6A 3I3SR 5FTKA 4GT1A 3T15A 3U7EB 3MGCA 3TW8B 1HT2E 1SVKA 2ZRFA 1US8A 4E07A 4IOKA 2ZRJA 4B74A 1IN8A 2PEZA 3K8YA 2LCFA 1G21E 2PX0A 4C0QC 1M8PA 5IK2D 1XEXA 2EYQA 3CKLA 2F55A 3A4NA 3UATA 2CNWA 4QM7A 2E1RA 3THOA 2EQBA 4QGFA 1W44A 3KKPA 2I1VB 4IVRA 3EA0A 4LJYA 4V02A 5FFMA 3L82B 5H1YA 3U6BA 5L3QA 3P32A 2XZLA 1PLJA 3SQXA 3PR1A 4PZYA 5B2ZA 1D2NA 1M1YE 1T8UA 4TLBA 1ZW6A 1BMFD 5JJLA 3F3YA 2HF8A 3RAPR 4UKDA 1DAFA 1VECA 2IK8A 2ZRPA 4B3FX 3B1VA 3LW8A 2ZI3A 4US1R 4CZ2A 1FOEB 3AQ4A 3CRQA 1VG0B 4XWKA 2OCAA 4LJ4A 3SBDA 4RFSB 2VSFA 4GOJA 5E95A 3IEVA 3WYAA 3FMPB 5TXGA 1P6XA 2O8BA 3WMGA 1SXJE 2Z0MA 4UXHA 2CE7A 1SVLA 3KKQA 3LX5A 4B32A 2WWIA 1W48A 2V7QD 1ZD1A 4M2LA 5F9HA 1OIWA 2ZIAA 4L15A 4C2UA 2A5DA 4YQFA 1G5RA 1NG1A 2V9PA 2IX3A 1Z2CA 2IYQA 5L3VA 4M9ZA 3TJZA 2DWPA 4JLVA 2JATA 1J7KA 3DMNA 2HLDA 2RKOA 3CLVA 3OZXA 2XZOA 2EU8A 1KK1A 1IJEA 1SVSA 2WIBA 3N2IA 1TF2A 3CWZA 4LC1A 1F5NA 2C99A 4JVSB 2IXGA 3RS2A 3CW2A 3WY9A 4JLPA 3LXXA 1ZRHA 1E2MA 1W4AA 2GJAA 1G3IA 2WSMA 3ASYA 3AUXA 3L0OA 3M1IA 4JSTA 4KFUA 1IBRA 3C5CA 3FKSD 4IXMA 5BWMA 3K9GA 2G1KA 2OESA 2GEDA 2AKAB 1PUIA 1LS6A 1XZQA 4D82A 5KNCA 4RFSA 1BYUA 2GXUA 4WZ6A 4QJ4A 4ASUD 2W0SA 4TSFA 1U0LA 4Q47A 1GVNB 1Z2AA 2OG2A 2XGJA 1WBBA 4LHVA 4B3XA 2VPPA 5KSYA 4Q5IA 3WYGA 5J40A 4QM6A 2WOOA 2QMHA 4RKFA 3EZ7A 3H84A 4HLUA 4LJ7A 4RCZA 3RYTC 1J8MF 4KV9A 4P3YA 2FSGA 4OJKA 3PCRB 2JLZA 5EQTA 1E2FA 3FHOA 3W6OA 3I92A 3SN6A 3ND9A 3BXZA 1OE0A 2ZRCA 4CEHB 4A82A 1PV4A 1G7TA 1W4CA 2H8KA 4NHOA 4Y0AA 5A0FA 1W4RA 5B30A 3CR8A 2IF2A 3ZZTA 1ZNXA 3RRZA 4V0NA 1HURA 2JLVA 2BMDA 1HYQA 4KBFA 1CR0A 4JJZA 2PCJA 3UXMA 5JECA 1CJMA 2IYLD 1JPNA 1AGRA 4JLAA 1F6BA 1ODFA 5FUXA 2ZRBA 3AVQA 1S96A 1Z0JA 1Z47A 2PEYA 2QA5A 3LLUA 3OEED 4C30A 1OH7A 2V1UA 3O47A 4NDZA 4BLPA 1S1CA 1OW3B 3AKDA 3HP1A 1NSTA 4PPFA 1GITA 3VQTA 3VR5A 3NXSA 1I4LD 1NVVR 1WRBA 1Y63A 2W83A 4BRUA 1ZIOA 3CX7A 1OSNA 4BFTA 2A9KA 2QTVB 2IS4A 1CR4A 4HDOB 3GMTA 2A3RA 2R2AA 4KFSA 4HSEA 1IXRC 2G9NA 3VHXA 1E9BA 4MQBA 1YZKA 2CL6X 3ZYCA 3THWB 1R10A 4V0ME 4WZAE 2D7DA 1ZD9A 4B2LA 1JAIA 4JLBA 2OUKA 4EFMA 1ZM7A 4YXWA 4TL7A 1Q12A 4B44A 5AJZA 3ONWA 3QG1A 4JYBA 4ZO4A 1Q21A 1SVWA 4R2HA 4UQOA 2OCBA 1G18A 4M1SA 5FH9A 2ZJ2A 4PC1A 5J5CA 3QPWA 2DWQA 3EIEA 4P31A 1TQ6A 2BCJQ 2VEDA 1Z22A 3CRVA 1L4UA 2Z43A 4B47A 1KI1A 3IIMA 5GJVC 1KI7A 3MAAC 1Z6AA 3OAAA 4LUCA 1S3SA 3CR7A 5P21A 3IGFA 3LAWA 4CT4B 2AXPA 2NPFA 3K70C 5L8VA 4LDJA 1JXOA 5DN6A 2RAPA 1NBME 4OK5A 3ZZUA 2GHIA 5UKDA 1OB5A 1RC8A 4QHTA 2UKDA 1XFAA 5DSZA 1X6VA 3VNUA 2ZRAA 2B7CA 2ZSEA 3QE0A 5AWFC 3K0CC 1W0JA 4XWAA 2AL7A 1W46A 3OIWA 4JBYA 2IEZA 1XB2A 3ZDQA 3THWA 4L5BA 2VBCA 5C46F 3FDIA 3B8HA
chains in the Genus database with same CATH superfamily
2YW9A 2GA9A 3WK5A 2IIQA 4FMCB 1W94A 4AZ0B 1QSGA 1XC7A 2WRZA 2BBWA 2YJGA 4CUKA 1U8CB 1ZCJA 4RZSA 1JJ7A 2JHGA 2HSDA 2VAVA 3C5HA 3QFCA 4E3ZA 2PZFA 3NHZA 2FPPB 1I2ZA 1Y7PA 4DNPA 1F38A 3CVWA 1H6AA 1ZGCA 1D5WA 1JHOA 1TIBA 4CKEB 3AL0C 2FN3A 3AEQB 1ZMTA 1AQYA 3KUUA 4UMVA 1NV8A 2VH2A 4LOAA 5CEFA 1DAHA 1NXOA 2FMKA 3NV9A 2BH9A 1BH6A 4UCWA 3RBXA 1SWWA 4NONA 3B48A 3WLJA 3KSMA 4KWTA 1DRUA 2WKPA 4L0MA 3BWMA 3EIOA 4I5EA 1O54A 1TCUA 2OCLA 3AHJA 3GJ3A 3M3DA 1UMBA 3SYLA 2QUBA 5DU2A 5JSHA 5DYGA 5AIAA 4RSRA 1Z45A 3U0VA 3H11A 3PA8A 3VBEA 2W6NA 4BB5A 1R4MB 2CVZA 5DNWA 2AF4C 3VR2A 4ZDJA 4TS9A 2AX3A 2IEGA 1I8TA 3QVOA 4I4CA 4RZ3A 3WR5A 2BFOA 2QD4A 4P33A 3T4EA 3ICVA 3TSZA 3UC5A 2CNNA 3V1UA 3A6ZA 4QSMA 4QWMA 2JLQA 4YJ2A 1ATZA 1DWQA 3HZHA 3PNOA 3X1XA 1RBYA 2Q3HA 1PAUA 1SRQA 1S8OA 4R8VA 3GLRA 5EJ2A 5KQPA 2JAOA 1R9JA 4HGRA 4ZVOA 3E7FA 5EWLB 4CTOA 4AZ0A 2OEPA 3JR3A 4KDFA 4RK6A 5JSZB 4BQQA 4OYHA 2AN3A 3HWX1 3QBTA 5H7XA 2PSFA 2FPPA 2XT6A 2E82A 2XRYA 3PUJA 3E58A 1W29A 1E77A 3AP3A 4AJJA 1HDXA 4UEWA 1LTQA 4C4AA 3B6JA 5EJMA 3NHPA 4QYMA 4WKGA 3UBMA 2GB4A 2X2PA 4HAZA 3LA6A 5L40A 1UBNA 4OAQA 4YRMA 3QLEA 3DD1A 1C0KA 1QDUA 3L1KA 2CLMB 1H6DA 1H3NA 1BXGA 4ND5A 3DQPA 3EPKA 3TYXA 4ZI2A 2C83A 3TEMA 1VLQA 2PHZA 4BVKA 3OC6A 1NBHA 1R4MA 3E3MA 4QTUB 1P19A 5AKYA 4GMGA 1TU4A 3W6ZA 2I8AA 4EYQA 4H7IA 4F92B 3H5OA 4Z0TA 2IA5A 2O0KA 5AJXA 4D26A 2ZJOA 1KDRA 1XTRA 1HTTA 1DCKA 4LG1A 2X76A 3G2LA 5FBRB 4WV3A 1CJTC 1ZJWA 5JMOA 1QNLA 4A6EA 1OZHA 3B13B 4ZU6X 1LW7A 3THXB 5EWLA 2FH5B 3RVRA 1KJ9A 3HJUA 2G9RA 4LXHA 4F4IA 4CF5A 2G0NA 5HJ7A 5IH3A 1JQ5A 2RK3A 4V1CA 2REXB 5FBHA 2BHLA 4JB3A 3WSWA 4KAAA 1E18A 1MRSA 3DG9A 3DR5A 4P5DA 1AZSC 2XB9A 3TOCA 2QGNA 1E3QA 3E5HA 1XVTA 3FYUA 4JYCA 2Q3CA 4NI5A 1A4IA 2R2GA 2I2FA 1P2GA 3NGMA 3OQIB 2R00C 3WMRA 1XDGA 1P5FA 2YNMA 1W30A 2P77A 2WJYA 3HI4A 2YVLA 5B7GA 2CV1A 2O59A 5C35A 4JMLA 4HS9A 3T5DA 3BB1A 3T1VA 1PQWA 3ZW7A 1LRKA 1H2RS 5ESRA 8ADHA 2W42A 3IMGA 5FPHA 3DXFA 4G1EB 3ZE6A 2ZYGA 1H4QA 1OZAA 4R7ZA 1WXXA 4DCNA 1BAPA 2YX1A 4Y2YA 3PIIA 3CZ5A 3LCUA 3Q5DA 2Q2QA 2IDMA 4I9GA 4JVLA 4MAMA 4NSNA 2RHMA 5EUBA 5GZ6A 3T3PB 5ESDA 2RH5A 2FN7A 1L7MA 1XCPA 3KOWA 4WOCA 4YJKA 2AKYA 4PO8A 1CW2B 5E8RA 1K4KA 2W8BB 4TTJA 1XCGB 3F8SA 2WHEA 4X45A 4CM8B 1XP5A 2PQ0A 3D54D 3JQEA 3L0PA 2KI5A 2F6RA 5HKKA 1JHZA 5HEKA 2VSXA 4M0FA 3PNYA 3HJNA 1AKWA 4RHFA 1ZD2P 3SEFA 2QXTA 5AUPB 4RX1A 5BWOA 2ZYAA 3SZGA 4Z4GA 5E4FA 1E1NA 4PE5B 4YAEA 3LPCA 3G8CA 1ISHA 3WHIA 1QGZA 1ZAKA 2ECFA 3K53A 5TGDA 3SLKA 1OGJA 4AKTA 1E1QD 4HB3A 2PBLA 3RABA 3CUSA 1U3GA 1QLHA 1KBZA 3LUDA 1NRWA 2XOKA 3UMMA 2P9QA 2C78A 3NYQA 4QXRA 1QBKC 4DM3A 1L8XA 2X0KA 3KM0A 4JOCA 3OQIA 3RV3A 2GN4A 1JVBA 1UDCA 2ID7A 2OV6A 1C3JA 5A4JA 4BTEA 1QP0A 4RHEA 1XTQA 2WD9A 1D2MA 1MRZA 2Q7XA 2CV2A 3D0QA 1A8QA 3TQTA 1VYHA 2Q1UA 1P2UA 3DOFA 4NQZA 1SOUA 3OECA 2P35A 4QO8A 3VR4A 1MQSA 5KYYA 2YY5A 5JYCA 2PR2A 2VQSA 3OU2A 1OX6A 1XTKA 3ZVMA 2HK9A 5B4UA 3LUAA 5TV2A 5EE5B 3RPEA 2X2EA 2JJ2D 2LUOA 4IHJB 3SK0A 4IOMA 3KJNA 4P3XA 4A8JC 4BUJA 4E4RA 1Z4PX 5LXTF 1UIRA 2V7EA 2W8BA 3TL6A 2AT1A 3CSSA 3O2SB 4CM8A 3ILYA 1Z56C 3L93A 3T1NA 2D1YA 5H3HA 4MB2A 1OVGA 5ECYA 2CVHA 2JGNA 1TO6A 2QNBA 3GVCA 1MAUA 3ZG6A 4RQBA 3LHSA 2UXDB 2PKQP 2GSWA 1T34A 4YAUA 1FXWA 1BE6A 2WJHA 1CJKC 2VP9A 3JV7A 3TTUA 4ON9A 4E4YA 4D79A 3QLUA 1ZXXA 3F46A 4GR4A 4JI8B 3UJPA 1FTWA 1OFVA 3CTPA 3ISJA 1TC2A 3UCFA 2XYQA 1M6YA 5I9MA 1QBGA 1PX0A 3K1AB 3MA0A 2C5BA 4DFDA 3R6WA 1TEZA 1YE3A 4Y2XA 3VNRA 5EJ8A 1E0SA 2V5UA 2OAGA 1R8QA 2XT0A 5DTRA 1FLNA 4ZGWA 2HWYA 3ESZA 3TKAA 1YAHA 4LJKA 3LTEA 4CCWA 5JV5A 2AZ4A 2NYAA 2BP7B 3WB0A 2Z5LA 4NZ9A 3PEYA 1RACA 1BWSA 1QZZA 2FUKA 1KKMA 1UK9A 2OV8A 3Q98A 4E0BA 2HMUA 3LCJA 5AKKA 1HZZC 1Q84A 4P32A 5KOIA 1IEWA 2VYFA 2Z3VA 9ATCA 3ZDCA 2ERCA 1C8VB 1DJMA 1VJ5A 3VKFA 3F5MA 5JZ9A 1R1DA 3A2LA 4EB0A 3EB9A 4IHJA 1E3JA 3OFND 3QIVA 5LLTA 2I80A 1PO7A 3MELA 4G4SO 2N75A 3OCUA 4PPQA 4Y2TA 3LY5A 4HN4B 3DOHA 3OOWA 4YJ3B 3WNVA 3SFVA 2IDKA 4CHTA 2PUCA 3GEGA 1BWQA 4EZEA 2EX4A 3BMXA 1ZIDA 4MRSA 3W05A 4JJKA 3CPJB 4AMYA 1WPRA 3PC8C 3PZBA 4GGMX 4I1UA 5HKLA 3AH8A 4IL5A 3WJ7A 1Z3IX 3VR3D 5CYPA 4LFCB 4ARAA 3THYA 2A9QA 1I2CA 1PYGA 4MNTA 4QDJA 2XCLA 4TMVA 1GUZA 5KAPA 4ZJPA 4KLRA 2BR4A 3N2EA 4DCCA 4K9SA 3D7KA 2ZT5A 3EDCA 1JJAA 2B9EA 1UJ5A 1WR8A 1GPJA 1VE5A 4HNSA 4D41A 2I99A 3VO8A 1KAGA 1RI4A 2G9ZA 2BP7A 1E4YA 4GFDA 3I8XA 4TWZA 1WSWA 3AR8A 4A9AA 3VOSA 4B3GA 3LDGA 2V8OA 3Q3CA 3WWPA 4MV1A 1VI6A 3EUWA 4XD7A 1NFQA 2B6HA 3B89A 3C6BA 4Y67A 5E3HA 3WAJA 2J4FA 4W5TA 1EX6A 5KAMA 2EJWA 1U5CA 2ID9A 2RGCA 3GT0A 4FHGA 4MQMA 3VC3A 4D2IA 2VR1A 3S29A 5CYOA 4W6QA 3GEEA 5DKFA 2JB9A 4ARZB 3KOUA 1CX9B 3R3YA 3CN9A 4IINA 1GL7A 4ER7A 1RTTA 3SZOA 1SUAA 4B6QA 4YASA 1PJCA 1R6TA 1CUZA 1E0JA 3DHVA 3HPQA 2P2DA 1JIUA 4U2GA 3FHCB 3OUUA 1JFSA 3BJZA 1XXHE 1WXQA 3AK4A 5AK3A 5HIIA 1PQYA 1ZHOA 1TUEA 2XNCA 4LXTA 4M21A 4RIHA 1B1CA 1BFUA 5HTKA 1XRSB 2B8NA 3GT4A 3ETJA 2VQ6A 4BQPA 2G5TA 5LBTA 4XUDA 1GD1O 1G60A 1OLUB 4ZKEA 1JZQA 1NNI1 1J1IA 3TG8A 1WSAA 4BO8A 3DAFA 3H2JA 3I30X 6AT1A 3DP9A 8OHMA 1AD2A 4OK3A 3VNAA 1I33A 1Z6XA 3DMDA 3E81A 2V7XA 1S0UA 3DEFA 1EFRA 3GFRA 1XZIA 5TE9A 3WGGA 4R2XA 3IBCA 4HNHA 3N7TA 4HFNA 4OO3A 1E92A 1NTRA 3LM8A 4PHGA 2XCOA 1EG2A 3AM3A 4Q02A 2FAXA 4OFZA 1X77A 1HBJA 1Q7TA 4HTAA 4AJ9A 3DE6X 2J0QA 1GNSA 3LY7A 3EAGA 3QOYA 4UNRA 4O2AF 5AKIA 4B82A 1F5SA 3DJYA 1LPPA 1WX1A 4RDHA 3TIVA 1NHGA 1YL7A 2QW1A 4WOPA 3VR6A 3ULKA 3K4QA 4CEJA 1V43A 2BFBB 1WABA 2H54A 4R1OA 2X5KO 2GAAA 3MCVA 1SIBE 1VPDA 5BWLA 3C14C 3NCHA 3FGOA 3R9IA 3RFFA 1PJ2A 2WIFA 1K1EA 4I55B 3LHKA 1DBRA 1X2EA 3L1JA 3TLZA 1VE3A 2A0YA 1OYYA 1FTGA 4US0R 3W2GA 5CVJA 2P0EA 2LPMA 4URHA 1YQTA 3ZDRA 4KH1A 4I66A 2O0LA 4M8IA 1KKLA 5E9AA 4TMZA 1R9GA 3BFKA 1Q7EA 3M33A 3PQ3A 4PLHA 2X8JB 4L27A 3SE0A 2UUCB 3OE1A 1F9EA 1UEIA 1Y5IA 5BUZA 1SK8A 4ZYZA 1REQB 4WGFA 3KSAC 5I8WA 3M1LA 1EK0A 3ELUA 2FFHA 1A2OA 1PJQA 1J0AA 2DH5A 4HYQA 4DDTA 2GPNA 3OESA 5JCXA 4YQZA 1T9GS 2Q0QA 4P0QB 1MTOA 3OZUA 4TMFA 2IE8A 2ZTUA 4NKRA 5KDDA 5IK2A 2WEKA 4BBAA 2PWBA 3OJ0A 5DH9A 3R7AA 1U0TA 2SKCA 1FU8A 3DLCA 2WG2A 3I6IA 2YRWA 2YW2A 3NIBA 2IIPA 3PFHA 4FFLA 2C2HA 1Z12A 1P3DA 2H4XA 5B1EA 2QT0A 1HK7A 2WWHA 3FVTA 3WAGA 1P4AA 1SXQA 4XSHA 3AOEA 3R4VA 5ALTA 2KBFA 5DTEA 3S40A 1XO1A 4BNUA 2BFBA 2AXNA 2INGX 4WVLA 4BO5A 1W87A 1J7JA 2HIMA 2ECQA 2WV9A 2VXOA 3ND5A 3W34A 4OMFG 3TLMA 3I04A 4I55A 4Z3KA 4Z7NB 3F98A 4IZIA 4E32A 4R7TA 4EM6A 3E9MA 4PLGA 4UHCA 1NIJA 1R5NA 3C98A 1F0YA 3C24A 3KAJA 1G20E 3OLWA 2QTBA 1T29A 4BJ3A 2Q8NA 3AC0A 2Q9AA 3L1VA 4J2HA 1XQVA 1QP8A 1T5BA 3QMPA 2WJJA 4A0QA 1ECPA 2BHTA 3PUXA 3R6DA 1REQA 4GL4A 4EITA 1AHIA 1RQGA 1GZDA 2C2WA 2R6JA 2ZTLA 3FTPA 1FSZA 5JNVA 5BVHA 2CB9A 1N32B 3BJMA 3EISA 4FEYA 1ZQ9A 3RSFA 1EWVA 1VJ1A 4LPKA 4YMSA 3X2FA 4HAOA 5IM4F 4JJEA 4EGJA 1CVIA 2PFKA 2BTEA 5BV7A 3EAQA 4I3GA 4X84A 3SZLA 4AF6A 3GLIB 3K96A 1SHJA 1KSHA 2ZUWA 5FOVA 1TYCA 3D3WA 3GA7A 2ZBUA 1DIOB 1VM6A 3HJFA 4J43A 4I1OA 1W36C 1ARZA 1CEXA 2GI4A 5KQMA 5LM3A 2J3MA 3OZIA 1RXEA 1QRAA 4FMBB 4XYMA 4RHUA 1P0PA 4EGAA 1SIWA 3L8ZA 1JWLA 3RU3A 3DE0X 4K26A 5AOCA 2NNLD 3FNBA 4AZVA 2R3SA 4XDGA 1D1SA 5KU7A 2POCA 1KEPA 4LISA 2HMWA 3AVXA 3AINA 1SC1A 3JTEA 2WQZA 3NGLA 3P96A 3BFXA 1U8FO 2O07A 2CLCX 3PGLA 4YCLA 1XVVA 2B0JA 1C5KA 1J39A 4ENUA 3ETDA 1E2NA 1DG9A 4PZ0A 4D6YA 1GLNA 5ELLA 3SD7A 1Z3CA 5LZ9A 5KINB 3LVFO 3HLYA 2F4NA 4LZNA 3R24A 4DQXA 1ID8A 3WDKA 5CA0B 5DW3A 1KRXA 4ZZ0A 3DB2A 1NW9B 1YB1A 1JEEA 2ZBEA 2J31A 4IH1A 3OQPA 4JA2A 4R4JA 4PZLA 5AT1A 3WJAA 1FMFA 3LBFA 5AW9A 4DR3B 1Y8AA 3DO5A 3PF8A 3SHOA 1UDWA 2P62A 2VDPB 3AIKA 1KL7A 3GLIA 3FZQA 3MWEA 3W5DA 1TTHA 1EB8A 1JJFA 1LDBA 1DQZA 2QMYA 1KO8A 2ZJFA 2D1FA 3A4LA 2VF4X 4RY0A 4UBKA 2AXQA 2WVJA 4BNZA 5C34B 2ZVJA 1CQIB 2CHGA 4F3YA 3T1HB 3V4ZA 1YHYA 4O08A 2QK4A 2JW5A 2WWWA 1HDOA 1TCBA 2WYWA 4M0CA 4ZCLA 3A11A 3RGWS 2DETA 4P4UA 3B1FA 3JZDA 4KFCA 1BE1A 3H99A 3C43A 3MNFA 1KO1A 1SZPA 4H6WA 1J5PA 4ZEVA 2HA2A 1NN0A 4EYGA 4PSAA 2R1VA 4AC9A 4GXTA 5I9LA 3NM4A 5K8UA 2OM6A 3R3HA 4OQNA 2O8DB 3EOBI 2OYRA 5DTIA 4AL4A 4DIEA 4IQ8A 4KXVA 1T0BA 1WVIA 4MDHA 5DP1A 3M5PA 1IC6A 2JA2A 4GZLA 2OYCA 1SVUA 1O08A 3VU3A 4RDXA 3AM1A 3WBKA 1KS9A 1X9HA 2OBNA 2DTXA 1B43A 1UBSB 5CA0A 4BWGA 2YCBA 2FEMA 2YMLA 5K3AA 1BX0A 3BMNA 1GSHA 5GJCA 3NC0C 4N47A 4JLSA 2FR8C 3R3SA 2ZAIA 2E85A 4HRXA 4G0NA 2O05A 1WL8A 4KQ9A 2QG4A 4IM7A 2I4OA 4MQFB 2OHHA 4MP6A 3ZHBA 5KMGA 4OYRA 2ZUVA 4GUDA 2IWRA 2HFJA 2IXAA 3Q0TA 5ESXA 3SR0A 3UPDA 3ZE2B 4PTYA 1OROA 4ZQBA 3KK0A 4X6UA 3CHYA 1EBFA 1T9HA 1HDRA 1KJNA 2IVZA 2H0AA 1DOHA 4P7JA 3CVYA 2Q4RA 1B1AA 2I6TA 1CQIA 1KZYC 3LBAA 1UM9A 1CKEA 4Y6PA 1NJ1A 1GQQA 3ZHCA 2XMDA 2D4AA 3HXLA 5B4TA 3STVA 2HCFA 3F1KA 2RGDA 3JSXA 1JTFA 2CVQA 5B3AA 1ML4A 3CU5A 4P98A 5D5QA 3DTYA 1SB9A 1GVHA 4QTTB 5C8DA 2XF8A 2DFNA 2HMTA 3DKVA 5REQB 2GVDC 3SEAA 1GTVA 1BQ3A 1RXIA 5I7RA 1MO5A 5AK5A 3AL3A 2O8DA 4JWKA 5CVUA 3F0TA 3GW8A 3ODGA 1Q83A 1R0XA 1ESCA 1ZUWA 3BMCA 5K05A 4JP1A 4K9RA 4MIKA 1FJGB 4G65A 3MT0A 3LUPA 5JD3A 4TS1A 2REQB 5D3QA 4EHIA 1KMQA 4RM2A 3DZIA 4PVCA 3EJWA 3FOZA 3TRHA 1FDUA 2P9HA 5SY9A 2VA9A 3MJEA 3ZWAA 2XD4A 4HP8A 3OLCX 4FKZA 4WIAA 3U2QA 1VHQA 1R50A 1Q0UA 3LRPA 4LZJA 3EC7A 1ZVQA 1UBMS 1NNLA 4EL0A 4UVEA 4D9HA 1OASA 2PUVA 3ME5A 4EATA 3D3QA 3BBLA 4TUYB 4MGIR 5HK9A 5A04A 5KHLB 4L85A 3O8OB 1ZK2A 3V6LA 4RTOA 3HWSA 5E2AA 3FPHA 4FWTA 2RGWA 2JANA 1JMYA 3S8EA 2XBLA 4F2PA 5GZ1A 3BMOB 3OPYI 1GCAA 2K7ZA 5AW5A 2FETA 3DBIA 1PZMA 1RWVA 4HLUC 1EQAA 1PYOA 2R1UA 3GG2A 3Q8LA 1ULAA 1V5FA 1U7ZA 3JPYA 3JQAD 3I2KA 3KHTA 2C9OA 3H6GA 3D2AA 2G3YA 5JYEA 4MIYA 3I2GA 4IIBA 3WL3A 2R1ZA 5REQA 5IABA 5ICMA 2F8LA 1QYIA 2F59A 1E2QA 4N1AA 5KNBD 5KQGA 2ZBRA 2ZI9A 4EOGA 2F8MA 1J97A 1SD2A 3HB4X 3I05A 5EQJB 3ESXA 3RHFA 1XEWY 4CJXA 3I28A 4OQ4A 3LQ2A 2JLSA 3JWHA 3ZTTA 5K09A 2EERA 1I24A 3TH5A 3OMLA 1AQNA 1IQUA 3II6X 1XU9A 5IN4A 3MQ2A 1W6UA 1KFKB 3L7LA 4WASA 3TMAA 1X8KA 3TI9A 1X3LA 3QUCA 1KZ7B 1PZHA 4HH0A 4QPNA 5BNFA 5KSZA 5J1SB 4M83A 3TSWA 4AW9A 1Y34E 5T41A 3RBVA 1NGSA 4G9GA 4K6HA 1OMOA 1JR3D 2I3DA 3ZIDA 1ATIA 1GAJA 3ZW9A 5KOHB 3PEEA 4X94A 2WAAA 3MJFA 4OBEA 3HCBA 1B8NA 2X0FA 3H1TA 4TUYA 2ZVQX 1C8BA 3O26A 3ZD9A 3GYBA 5JLAA 2VJNA 3O8OA 2EFYA 2I1QA 1EX1A 2C7VA 5DGDA 5KDLA 1SN7A 3B85A 3MJTA 3E23A 1ZGBA 3NKFA 4LK2A 3I9V6 3Q88A 3BMOA 4M55A 2JI6A 3TLBA 1KK2A 2P65A 4KIFA 1G9SA 4LNUB 4WLVA 4DIBA 3Q2IA 4BTLA 1G98A 2H4JA 3NFYA 4KLNA 3DEYX 1COWA 4Z8YA 3ZOZA 5A62A 1FFDA 4QRHA 1RHQA 5JSFA 2C8JA 2FQYA 4V38A 5A7HA 4NBUA 3KZNA 2Z95A 1E5XA 4GM0A 5HM6A 2SICE 4NZNA 3W5BA 2DQZA 5J2TF 5GONB 3MLBA 3RS0A 1X74A 3QNWA 1F2DA 2VHUA 3UAWA 3QFRA 4BZPA 4QA9A 1R8XA 2WAXA 1Z6PA 4WZBA 4J4TA 2YYZA 5IJ9B 1GT91 1FRZA 2ERYA 3TGLA 4YLYA 3ON5A 1R6XA 4OHPA 1QO0A 1CJSA 2NX2A 4YJHB 2PKRA 3QUTA 1VMEA 2GAIA 4OLBA 4DUPA 1OXMA 3SQMA 3T4PA 3DCIA 3TLGA 5KOHA 2ORVA 1PEYA 3QVLA 1CVLA 3Q1KA 1NBEA 1HT3A 3KE9A 3AEUB 4PZAA 4OJYA 3CH6A 3QA9A 1N3BA 1PDVA 3EGXB 3A37A 1TYDE 3I73A 4MEJA 3THRA 2C8KA 3GDGA 4MDEA 2B34A 2YHUA 4NYMQ 3GX1A 3GYGA 4LNUA 1YKFA 1YZNA 4NENB 5FBWB 2H5IA 3LZDA 1X94A 2JJMA 1EGAA 2ZJ5A 4G41A 3C7DB 2IV2X 3SCZA 2GTPA 4CLHA 3GLUA 3I01M 4PYIA 4DLKA 4Z4FA 1G3UA 2N47A 3LSYA 5D5HA 7REQB 2ISQA 3W8DA 2H7CA 3HKEA 3R6LA 4IUYA 4F9EA 1II0A 1EVYA 3COYA 4JB2A 3I0NA 1VPLA 3ZX4A 4BKRA 2FWNA 4EI9A 4M1TA 3V2GA 4N0QA 1NXVA 5FPQA 4G0WA 4RJ2A 3TOVA 2ZCUA 4BLVA 2LCIA 5BMVF 1QFJA 4W8HA 3T4UA 9LDBA 2D2EA 2Z08A 10MHA 1E2BA 4D45A 1KF0A 4WOJA 1UH5A 3FWPA 2B8WA 5C3MA 3UHAA 5T5QA 2XXAB 4GKJB 1BN7A 5EERA 3E3LA 4DJ5X 4UE3S 2Z2ZA 3CH7A 5E7IA 5CLJA 3RUPA 2PWYA 3Q6IA 2YV5A 1NFFA 2C1XA 3OSUA 4ZVTA 2XTMA 4H7HA 5JY6A 2V7PA 3I9LA 3BQ9A 3AEUA 4U7PB 2DBZA 3SJCA 4MGYR 1RHMA 4O4IF 1O5OA 1JLMA 4AD8A 5NULA 3EGXA 1L5NA 3V8VA 5ITSA 1E6UA 5J63A 5TB5A 1OKKD 3KRTA 1N0UA 1JIIA 1USUA 4MXDA 2LCQA 2HA0A 4ZIRB 4Q1CA 1QHNA 1O0SA 1K6JA 2EFHB 4O63O 5I5GA 4C6HA 4NENA 3OM1A 5IT9A 3BZBA 4Q4HB 1GTRA 3ER8A 1CZNA 5TS2A 3RKSA 2VJYA 2Z9CA 5EXSA 4EVIA 3WB1A 4NE2A 3HYRA 1NYTA 1GGEA 2P7IA 4Y0NA 4BKOA 3C41J 3AVYA 1XHLA 2IPLA 1NR7A 2B1IA 5CIWA 2B20A 4JUBA 2JGKA 1YQ9A 4IRXA 3V7WA 2DBQA 2FSSA 1FEZA 3H9BA 2CUKA 1XRPA 3QV1A 4HWGA 4GPD1 3CF0A 4IEIA 1L9KA 3NBZC 2YJ3A 4P9NA 4Q9DA 3O6VA 4FGUA 4HMQA 4H9GA 1LRJA 4KACA 3SFZA 4BU1A 4CDMA 4BX3A 1FY2A 4EX7A 4YT8A 3AKZA 4ROTA 2FTKE 2ZRDA 5F1KA 4J0EA 5E7MA 4D0NA 1A7AA 4JCOA 5FUQA 3DWIA 4ENWA 3TR5A 4F9GA 2H8GA 1AUVA 4MWTA 4ZT3A 5JR3A 1E4EB 5JRDS 1OT5A 3EW7A 1EVEA 3ONFA 3RRYA 3C8DA 4NP6A 7YASA 3NMUF 1E6KA 3F97A 5KNLA 3T7DA 4R2IA 3K0KA 1OLXB 4CDGA 5CVDA 3Q3EA 3GD7A 4IS2A 4FFWA 3AVPA 1F60A 2VC2B 4BNDA 1W5SA 1Q19A 2PVPA 3BCUA 4LYYA 3RSOA 5C7LO 1PGJA 3WKBA 1T9BA 2F48A 5BUSA 4ZIRA 4PQGA 4B6JA 4B3CA 4B09A 3ZZNA 3PX7A 2JGDB 4IX1A 3PUKA 3V1YA 1R5OA 1HTBA 2P2GA 3LVQE 2WA2A 1WZEA 4KN9S 4NYMR 2IHTA 3I4CA 3O1JC 3P2KA 2VAMA 2WFLB 1R9NA 3A8TA 3CNBA 2GCPA 2DGDA 2PD6A 2FOLA 1UJCA 1JNYA 1ADFA 2DQYA 1FBTA 4HGYA 1U2GC 1VLVA 5LB4A 5K8CA 2VYVD 3ILHA 2A1TR 2WWRA 1CRLA 4RIFA 1FFXB 3G0BA 4B48A 3QYPA 2BGKA 3RADC 3RHSA 3VYUB 1TZMA 3SDSA 1G2IA 1KDTA 3MGGA 1IHUA 1YS7A 4G1BA 2UV8A 1JHAA 5JCPA 2VH5R 4OA5A 2CE2X 2YOGA 4LI0A 3ZWVA 2MYTA 4Z4QA 2ZFUA 2XHEA 5AR1A 2IEAA 4RHYA 4G8CA 2BGJA 2FK8A 2HCRA 5AI8A 3RRNA 1FJHA 1ZUIA 5E9WA 3P9CA 4RE5A 2EW1A 1OLXA 2IKSA 3MS7A 4EG7A 2GBLA 1J06A 4Y1RB 5FLYA 1L5GB 5IVIA 3VVLA 1PJ3A 1ZVMA 4XSVA 1L5KA 1U7XA 2AG1A 4KL8S 1H8HD 2DWUA 4ALLA 3AEXA 1J5EB 4XQ0A 2C0PA 2W2TA 2P9EA 3U3KA 1P2SA 2XLCA 1MENA 3MW8A 3P9ZA 4GBGA 1KEKA 3PHHA 1W2GA 3R0IA 4P6VF 3RVJA 4NOLA 1A82A 4LZAA 2JGDA 4TKUB 4HNVA 3WL5A 2MYPA 3WLSA 1ZGHA 2OO5C 5HOQA 1TLLA 4HNAB 1O95A 2VPYA 4IX9A 3WB2A 1T13A 4GYKA 1O2DA 1J9GA 5EPEA 3SOPA 4D42A 1JGTA 2V6JA 5AVRA 1TMOA 3RG8A 2QLJA 1ZI9A 1ECJA 1ZMXA 1U8YA 1MH9A 1R9MA 1RRKA 1VJGA 1XG5A 1FFXA 2P0YA 3PEVA 1LU9A 2ZYDA 1MN6A 3SX2A 4DE5A 4IIGA 1N5MA 1F2VA 1H8EA 2Q2WA 2FZ5A 1FK8A 1YVEI 4ZXFA 3G1WA 3MD0A 5HJ5A 4R31A 1LPAB 2BKVA 3OCZA 4OHOA 3NHLA 4OJQA 3GOHA 5JHGB 1HE4A 2H1FA 3FWZA 2JLUA 4Q1VA 4PLVA 1XKTA 2VQDA 4PF1A 4BV3A 1NOIA 2QR3A 3I5YA 4PIMA 3UAGA 2FR1A 2DWCA 2QAGC 1E0DA 1JR3E 1OI4A 2R8RA 4I2NA 4EUNA 1OV6A 3UK6A 4GXNA 2X8AA 4Y1RA 5EA2A 5FBVB 1XPUA 3Q2KA 6LDHA 5EN4A 4ZZ2A 1MD9A 3NTOA 4LDPA 5KJEA 3U26A 1S3GA 3D8UA 1L4BA 4HOYA 4LSZA 2QN1A 4KO8A 5KTRA 4HLDA 1NI5A 2CJFA 2V7WA 4TKMA 2E21A 2DOKA 3SM9A 3MGAA 4GX1A 4TKUA 1UBUS 2R751 2ZSHA 1A9PA 3ROZA 4CT5A 5FL3A 4YUVA 3SG0A 4HNAA 4L8YA 3TAXA 4YUZA 4GICA 2NSDA 2W43A 2YXNA 3OPXA 5FWDA 1GO2A 2VOEA 4I50B 2NU7A 4L22A 1EFAA 1E89A 1SIUA 3CLRC 1G1AA 1U0JA 1T4DA 2NO4A 4PIPA 4ZAVA 1OH6A 3QX3A 2ID8A 2XNSA 2QUKA 3NO4A 3LL7A 4H77A 3CFYA 4OQXA 3VPGA 4AZTA 1S2MA 1YDWA 1NLMA 1NBMA 2OY0A 2SCUA 9LDTA 1HI9A 1M54A 3R41A 4QEZA 4H08A 4FFSA 1T6NA 3ZH2A 4E11A 4YRRA 4LJ9A 5TRTA 1LLQA 2JGAA 1MB0A 2KLBA 3HC7A 3VTFA 4EKIA 5BSGA 1I6LA 1TK3A 1CQJB 1YIDA 1SQGA 2DQSA 3NM5A 3PJGA 4ZRMA 1JRLA 3MMXA 2J59A 5HCNA 3C70A 5DM60 5FYQA 2GM4A 4YR9A 1ADJA 3BD9A 1NW3A 4OGWA 5C8YF 4I1RA 1WDLA 1XA0A 2PY6A 4GMDA 5KYUB 4NFYA 4PIVA 3OCVA 1QUFA 5AJUA 3RVSA 2J5QA 1HPLA 2G07A 2DPGA 2V97A 3BOSA 2ZGVA 5I8PA 3BT7A 3IBSA 4A8PA 3L1UA 1GARA 3GA0A 5IJWA 1M5RA 4F2DA 1KBQA 3BE4A 4K9LA 2EG5A 4G09A 2E55A 1P6QA 4PC6A 5CX1B 5GP1A 3S7ZA 1M2VB 4MCAA 2O2DA 1DSSG 3F6PA 3CISA 3KOZA 4OLHA 2IS2A 5IDVA 5LL6P 2QR5A 4FFBA 4P3OA 2NXNA 4KQ2A 3GRPA 2LVBA 3CT4A 5ICSA 4D02A 1KI6A 2GX6A 2JVKA 4DJTA 1GWNA 2GT1A 2QL9A 4TV8A 3TZEA 1RIFA 2FPLA 1SCIA 4C0JA 1CDZA 3ROMA 2BGIA 4I0WB 1MEJA 3PLNA 1Q50A 2WHQA 1QQ5A 1VIDA 4ID9A 4U9HS 4WFKA 1O96B 4X7MA 4IH9A 5EPUA 1N36B 4V0LA 1ECCA 1OHHD 1UFRA 2P2YA 4LRQA 4ZI7B 1R3DA 2W98A 4QJ5A 5SZJA 3ER9A 3GQBA 1J8YF 3TKYA 1CQJA 3W3ZB 5KYGA 4F97A 1TJ3A 1NQTA 1UJ6A 2VT7A 3IQDB 4XIIA 5KNDH 3FHJA 5EHQA 4BIIA 4W4TA 1OX4A 1M6NA 2WD8A 4PZ9A 5IAKA 5K8LA 2BISA 4U2FA 3GLGE 4JKYA 2JD1A 1MIHA 2V4ZA 1YRYE 2V0CA 2YR0A 3S2IA 4LKOA 3TRKA 1X1CA 3IA7A 1V16A 3WLHA 3SF8A 4M89A 4OYLA 1H9AA 2WSLA 2GZ3A 3QWHA 1AKVA 5CFQA 3GJ0A 3GIDA 4FD2A 4MWGA 1CNFA 1N7IA 2H4ZA 2WTUA 5YASA 1DKNA 5CX1A 5LZ2A 5CVVA 4Y2RA 2GD6A 5CFZA 4BXOB 1M2VA 2Q5OA 3DLAA 5G0UA 2ZE8A 3KVOA 1Y0BA 1CE8A 4DIKA 5LYJA 3ZY6A 3H2IA 4HQLA 1OXKB 4CG3A 3DOJA 3QPBA 4M49A 2A84A 2AOTA 3L8MA 4WCDA 2BM9A 2VHYA 3X1MA 4BLTA 1K6EA 4RABA 3O8LA 3UAXA 4BN4A 2Z6UA 1ODJA 1VIVA 2YOFA 3H4IA 3TQQA 1UXIA 4IDCA 5LQAA 3Q11A 1S5PA 2JBAA 2ZITA 3GMSA 5DIFA 4TXJA 4H7JA 5BV0A 3AVUA 1A50B 1H6CA 3R44A 3V32A 1Y1TA 2M98A 2JDIA 2ZB7A 4F5EA 4F85A 3V8PA 5BW5A 2C7RA 2E87A 1E96A 2RJ3A 3EEYA 4II3A 4ZI7A 1ZWKA 4HYTA 4PGGA 1QX4A 1W9MA 2FGKA 3KJEA 4ZVUA 4MS1B 5KYWB 1GGMA 2BONA 3IMEA 4RYDA 3X1KA 2WVAA 1POWA 1WLYA 1XNGA 1FFCA 4WKCA 2IODA 2IYFA 4G36A 1G8SA 2Y4OA 4FGJA 1O6ZA 4NDNE 3K70B 3F67A 1I6WA 1PT7A 1VSVA 2QP4A 3FNHA 4KTTE 1CUEA 3OFVA 1NNEA 2IYSA 2ASEA 3FZNA 1GYRA 3KR0A 1W85B 3QI7A 3GLFE 1TO2E 3K20A 1ANKA 1YS9A 4YO7A 2FF5A 3OZTA 3LGSA 3DVLA 4RJTA 3L01A 2AN9A 1WW2A 1GZ7A 2BGUA 2HO5A 1ZRMA 2IP2A 2Y1OA 3E9YA 3G3EA 3HEMA 4LZOA 1TPYA 4KK3A 4MUYA 4BXOA 1PEKE 4GPEA 3I53A 1NL3A 3JZFA 5FI1B 5J59A 3RRJA 3FTFA 4AO8A 1NP3A 1YJCA 1ZNQO 5CG2A 2ZSFA 4HWPA 3IAEA 4YAIA 4F21A 4NMLA 3RFUA 3F6RA 4RFLA 1WHSB 4UBOA 2Q6VA 1EFTA 2GS9A 1RS0A 4FMDF 4XEUA 2JIOA 1XAJA 1OREA 4KAFA 4QU5A 3KQMA 1SO8A 3TUJC 1GAXA 4Q4AA 2D2XA 5DXAA 4DCTA 3KV3O 1JECA 4GBJA 4KQCA 2GM9A 3ROPA 5JANA 4LBYA 3G1UA 4OSOA 1TA9A 3G2IA 3JWGA 2IV3A 4D3SA 1Z62A 1YS2X 1XTUA 3FIUA 4MS1A 5KYWA 2Q2OA 1FBNA 1VHTA 2FZ4A 5F52A 4E1BA 2I2AA 4AVYA 1QK3A 3ONEA 4B43A 1QLJA 2BZSA 5LJLA 5J23A 1JJIA 1J25A 2BR5A 2ZTSA 5EP1A 3LUBA 1V3VA 1SC4A 3LT5A 2BBTA 1U11A 2JEOA 4HRAA 5B58C 1IUKA 5IXJA 5MFPA 2B4QA 2BFAA 3TBFA 1NM5A 1Z88A 2PGAA 1XMXA 3K0CA 3C6XA 2HL6A 2I4IA 1I3LA 3HCNA 4UUBA 1G7SA 5D51S 1QWOA 4EDFA 1P74A 2PMDA 3C6ZA 2G08A 5ALFA 4UNIA 3FOAA 4P38A 4TSFD 1T0IA 4HATA 3PHJA 1NLFA 4X3CA 3F7MA 4LE1A 4ETMA 1LZKA 3VDXA 3OJEA 1UBCA 2CHEA 1A7UA 1WHSA 2FJ0A 3WKAA 1JKJB 1BHO1 3OEEA 3AR4A 2C1EA 4DMHA 5AW2A 1V8OA 1YDGA 5E0OA 1GYQA 3PNVA 1LY1A 3V6MA 1D4FA 1XQWA 2O1SA 3NEJA 3SZMA 3QMWA 3W6UA 3LFUA 1W59A 1WB5A 4E15A 3U60B