1XJ0A

Crystal structure of the gdp-bound form of the rasg60a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structure of an intermediate for nucleotide exchange by Ras
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xj0A00
3WMEA 3ICEA 5FL7D 4I1OA 5BN5A 2WWFA 4A6XA 4F38A 2OBNA 3VKHA 4Q1FA 3EXAA 2CVFA 4EJSC 5CJ2A 4U7DA 4MYCA 4TT3D 4LV6A 3VHLB 1OLOA 3RRNA 4D25A 3SR0A 1PLLA 1E9DA 4TN1A 4D0NA 3E5HA 4JL8A 3IO5A 2DBYA 4GZMA 1MV5A 1KI6A 3GCGA 1D8TA 3A8TA 4A9AA 2ZVPX 2W6ID 2C78A 1F2UA 1MABB 4TYYA 1DAIA 2FEMA 4PSVA 3HPQA 4PHGA 2R6DA 1N0VC 2ZJBA 1G19A 2FPLA 1OIWA 1ZINA 4BLSA 2DWQA 3NG1A 5TV2A 2QGZA 4X8HA 3VR4A 1KTVA 1L4YA 2N46A 5JEEA 4JJKA 2WKQA 3U6BA 2ZQ5A 3J81k 1T5LA 3QG5A 4IEIA 5SZIA 4BE7B 1KK3A 2GCNA 1SVSA 3KKQA 1XTJA 1Y3AA 4AIIA 1XPRA 1S9DA 3K0EA 3W6NA 4KHZA 4P4SA 5FR1A 1N5LA 2DWOA 5HZHA 3ASYA 1T5IA 4J0QA 2IK8A 1GRNA 2WV9A 3HP1A 1B23P 3I92A 5E7IA 5AR1A 2BHRA 4CIDA 2CLDX 3LBHA 2XB2A 3Q85A 2ZROA 4KJZA 4JVSB 1G3IA 1UJ2A 3NBFA 2JEOA 3AVYA 5LBIA 3KUCA 1NMYA 1T6NA 3PEVA 4PZZA 3GLGB 4M1SA 4Q47A 5J47A 4MRNA 4RKFA 1T9HA 3JVVA 4FCWA 3QXXA 1NLFA 1Z06A 2WWYA 1RC8A 3B60A 2B6HA 2DWPA 3V4FA 1E2MA 1TU4A 3B1XA 4HAUA 4FMDF 1HUQA 5KSPA 3A58B 3NH6A 3BB4A 121PA 4DCTA 2GEVA 4W7SA 2HT6A 2BM1A 2ZI6A 3EA5A 4N3NA 1A2BA 1COWA 4MYHA 1OV4A 3BS4A 5FPSA 4ZIRA 1E2PA 3VKWA 2BCGY 3RLFA 5J4HA 3OFND 3B13B 4UKDA 3EG5A 2OCYC 2BBOA 4TYNA 4WXPA 3WBJA 1KK0A 1QRAA 3KQNA 2JCSA 2OCBA 3ND8A 2XXAA 2NZJA 4MGYR 4N0EA 2O8FA 2WWXA 1BMFA 4EFMA 2ANCA 2GJ9A 4LYAA 2QSYA 2ODEA 2IHYA 4JZKA 4P0TA 4PX9A 3V00A 2VPPA 2V4ZA 3PEUA 5E7JA 1ZD1A 1RJ9B 2W2XA 4LBWA 5B57C 1T8TA 1PUIA 1P60A 3PVSA 1YRBA 4NCIA 3R8FA 4V0LA 1OYWA 5HTKA 2J7PA 1N0WA 3H4MA 3K0AB 4MKIA 4PC1A 4EFNA 4LZZA 2KBEA 4L8GA 2H7VA 1TAGA 2JGNA 2HF8A 2ZJ8A 4A0FA 1XNJA 1KGDA 1US8A 1CP2A 2JJ1A 1LVGA 1W0KA 3DZ8A 4HUQB 4IDQA 4N1AA 2QRZA 3LH5A 5EE3A 1Q12A 4C4PA 3FB4A 4Q18A 2A2ZA 4X8LA 1FP6A 2ZE7A 4A8JA 2ZYVX 4I99A 3SU8A 2JIZA 2GCPA 3K0FA 4PQRA 3AQ4A 5KSZA 5DE3A 3I8XA 4ZDWA 1GL7A 2F1IA 3SFZA 1N25A 4AYWA 3DPUA 4G5GA 4PXAA 4C30A 1F60A 1CJUC 2FG5A 3NBXX 2BBSA 5C4MA 2ZSAA 1VYVA 3THWB 3OE7A 4LYHA 3TR5A 1KO7A 4MA4A 4KLNA 4W5JA 2GDJA 3RHFA 2KB0A 1NF3A 2ECKA 1R0ZA 1M1YE 2HLDA 3BB3A 3BOSA 5JZVA 1GRQA 4ASUA 1OKKD 4M2LA 1JQLB 2GWHA 5CLQA 4FMCF 2WJJA 5DHAA 5C2JB 2F43B 3IPXA 5FBRB 3SYNA 2GCOB 3GQBA 1EG7A 1E1QD 3TAHA 1AZSC 4A36A 1NG9A 4Q7MB 4LJ8A 3B85A 5AUPB 3SZRA 2CNWD 5CYPA 2C9YA 3ZVLA 4TL8A 4BFSA 2FFQA 1G5TA 1OXSC 3EZFA 4OK5A 1EESA 2QAGA 1XZPA 1K6MA 1OW3B 4QBFA 1W4RA 1F48A 2QNRA 1SKQA 1X8JA 2VQSA 1HE1C 3QBVA 4Y0VA 1SGWA 5GADl 4KVAA 2ZI7A 1E2KA 4YDSA 1KO8A 2FWRA 3WYGA 1R5BA 5HKKA 4ACAA 4DIEA 1F6BA 3FHCB 3H2YA 4PHFA 1E98A 2A30A 2GVZC 3CRVA 4F93B 1LV7A 3JVUA 1Z0IA 1W36B 4C0QC 2KI5A 2YOGA 1HA3A 1RFLA 3PEWA 1E99A 3KZ1E 2WHXA 1Q0UA 2C96A 1IJFA 1X6VA 2DYKA 2EYQA 2RGDA 4JLPA 4TTPA 2PBRA 4BLQA 3UANA 1LW7A 4DLSA 3QOFA 4YMVA 3FYHA 3OIWA 4UQOA 4XTCS 1N6PA 3CRRA 4RD6A 4E5UA 1GVNB 4Q1EA 4TL6A 3AP3A 3VR3A 2QT1A 1K5DA 4BGDA 4BRUA 3MD0A 4KODA 4WZAE 3CH5A 4IVQA 4C3ZA 1VIAA 4I1VA 1IXZA 4LY6A 3CLVA 3FMIA 4IVRA 5DYGA 2VTKA 4QGAA 1R6BX 1OHHD 2P67A 4JKIA 2FSGA 3EZ7A 3T61A 4HAYA 1IY1A 2B21A 3WNBA 1JB1A 2WJVA 5KTYA 1NY6A 4GOXA 3AUXA 2PMKA 4DDVA 2Q6TA 4IVPA 2QP3A 1SXJD 4AWXA 4B71A 1OE0A 2QGNA 1QVAA 4CEJA 2P5TB 3GFTA 2WIBA 4GNKA 2J1LA 2B92A 2PJRA 4MYUA 2REBA 1QHXA 2BEKA 2AK3A 4URYR 3OEEA 2VP9A 1N6LA 3THXA 1D6JA 1XEFA 2RKOA 4TYWA 4OK3A 1E9BA 5JSZB 1BS1A 4A2PA 1YVDA 1UKYA 3A4LA 1R10A 3CF0A 4AYTA 4NP6A 4QJ3A 1J8MF 3I73A 3SN6A 4B32A 4IHQA 2ZSDA 2O52A 3I1FA 1G4AE 4EJSB 3NC0C 1JEDA 3BH0A 3CB4A 2QY9A 4NH0A 3QPWA 2G88A 2JLVA 1ZNZA 4GT1A 3KFXA 1Q3HA 3RSLA 1DAEA 3EWSA 4LDJA 1AN0A 1Z47A 1ZM7A 1TL7C 1WP9A 1KMHA 2QZ4A 2IA5A 5FPKA 1AK2A 4GRAA 4AK9A 2V1UA 2IUUA 1ZM3A 2GJKA 1Z63A 4UXJA 5ELXA 3BFVA 1EFUA 3SHFA 4KITB 4PQFA 2WWWA 5EE9A 1AS3A 1G4UR 2FA9A 3NDPA 4V0MA 2IEYA 4DVGA 1DO2A 3VQTA 1FL9A 2FH5B 1ZM9A 3T1TA 2QROA 3CNNA 3TKLA 5J5CA 1GUAA 3U2QA 3IILA 2GZAA 3C15C 1DAHA 2ZRFA 4O3MA 3NTUA 1ZVQA 5KOYA 1NSFA 4JS0A 4YMUA 3NBYC 1QZXA 1CU1A 3KX2A 5DYIA 1CS4C 2BOVA 5IF9A 2WJHA 1DELA 2AWNA 1TEXA 5HZKA 1G8YA 3U7GA 4BFVA 2YC4C 2H17A 1Q21A 1ZAKA 4G5QA 1WXQA 1ESMA 5JEDA 1GKUB 2C5LA 2ZJ2A 5HE8A 4Q4AA 4B44A 5J4YA 3UPUA 2AX4A 3B2EA 4YONB 1EFRD 3NBZC 5KUTA 1RRPA 3KTAB 2Y8EA 4HEJA 4PPNA 2X19A 3C14C 4AKEA 4F92B 2JAQA 2HT1A 3L8YA 1CRQA 1W49A 5DI3B 1KDTA 3X1YA 1XB2A 3U7FB 3OFNA 1G18A 3U3JA 2VP6A 2QMEA 1PLKA 1ZU5A 3LY5A 1G3RA 1PUJA 4W5WA 5CITA 4BZQA 2QM8A 1OB2A 1KAOA 2VP4A 5FTLA 4DLWA 2ZR7A 4G5OA 1ZIOA 2B7CA 3KB1A 1W4BA 5AK0A 3JZAA 2OHFA 4P4TA 5AJZA 4A8JC 3EA0A 2O8DA 5JMTA 1GL6A 3FMPB 4TMZA 1NIPA 3GJ7A 2PZFA 3EIQA 4GMDA 3ZS9A 3PJRA 1KZ7B 3FE2A 4EPTA 3BAFA 4DWJA 1XEXB 4PHHA 3BRWD 4HAVA 4CT4B 3GP8A 1OJLA 1IXSB 3WP0A 2ZU0C 4JLMA 2ZSFA 4LRWA 4LV5B 2GKSA 3IUYA 4WBSA 1JJVA 3MGCA 1W5SA 1FMJA 1TPZA 2YHSA 3W5JA 3ZZTA 2V9PA 4ESHA 3UK6A 2XGJA 3C4JA 4Z51A 3H1TA 3LQQA 3BFKA 3TUZC 1G17A 4G01B 3U60B 1HQCA 5H68A 1BO6A 5C1BA 5KNBA 2ZUBA 3REFA 3KXKA 2JJ8A 3WRYC 3T5DA 1XXHA 2MMCA 2G77B 2GAOA 3BXZA 2BCJQ 3MWJA 4IOKA 2QAGC 4RJLA 4GDFA 1DAKA 4ZCLA 5J4VA 5KDDA 3MAAC 1XD9A 2CJWA 3I4LA 4QNMA 1F2TB 3QXSA 3GJ3A 4HLUA 3VU9A 1NP6A 4ZPXA 1E96A 4Q21A 5EP2A 4BRWA 2QQEA 4KBFA 2G0TA 5A0FA 1BIFA 4UJ3A 3TQFA 4Q01A 2PMDA 5HCIA 2O8CB 1Z28A 1LFDB 2VSOA 1XMIA 5DISB 3QI2A 3W6PA 1E1QA 2O8BA 1Z2CA 3GJ8A 5CK5A 3TQCA 4K8OA 2DY1A 2CNWA 1I4LD 3L43A 2ZI9A 1A2KC 1J70A 1W5TA 4Z8YA 3FOZA 2J45A 3UXMA 3B9PA 1P62B 3IEUA 4JLJA 4RZ3A 4C0JA 1WE2A 2GEDA 4RCYA 3KKPA 1GRRA 4TYPA 4B3GA 3IBGA 2XTNA 2LWIA 1FTSA 1HT2E 3QF4A 1XJQA 2QBYB 2V3CC 1QF9A 4PSKA 1G7TA 3GJ0A 3DKPA 2RHMA 4GBMA 5G3ZA 3TW8B 3HPRA 3L0IB 5FBQB 2VHTA 4W5HA 1GL9B 3N2IA 4HUTA 4Q4LA 2FF7A 3BC1A 4JBWA 4UNNA 1VG8A 3EZ2A 3H86A 2GESA 821PA 3TRFA 4BFWA 5EXPA 1CLUA 3N70A 4D6PA 2RGAA 1VECA 4NYMR 2QE7D 3R8CA 4DC9A 1T0JB 1Z6XA 1JR3A 3UMRA 5EP4A 4D0GA 2E1RA 2ZJAA 5JJKA 3KQUA 3HU1A 1P9RA 2BV3A 2AD1A 3LXXA 3N5CA 2O0KA 4YC7A 2VYFA 3X2SA 1COWD 1I2DA 2ATVA 2XTZA 4NMMA 4B2IA 2VL7A 4M1WA 2OFOA 1P6XA 1VG9B 3Q7PA 3CONA 5FBLB 3WBKA 3QEJA 1ZU4A 4JYCA 1SXJA 4EUNA 3I3SR 3SI7A 4R2HA 1E2IA 2ZJOA 4QBHA 2JATA 1YR8A 2PH1A 2F9LA 2ZSBA 1U8ZA 4GSYA 4M22A 1J90A 3EZ6A 3EX7C 4LJ5A 3EARA 2YKGA 4CW7A 3DOFA 3SOPA 4H1VA 3CF2A 1G9XA 1G8GA 2YC2C 2PT5A 4KI0A 4NDZA 3TE6A 4QM7A 1SVKA 1YE8A 3DL0A 3MJRA 2BJVA 2EQBA 1XTQA 2IYRA 2NOAA 1S96A 1XMSA 2IXFA 1GIAA 1KJYA 2OAQ1 2WVJA 4HDQB 4G0NA 4OI4A 5EXSA 4JT4A 4C0LA 1OH5A 1R5OA 4C0AC 2J7PD 5FPYA 5EQTA 3ZYCA 3L0OA 2CCKA 2QAJA 2OBMA 3VR6A 4OHXA 3SJZA 4OYHA 1V5WA 4FIDA 4Z8XA 4PTLA 1KSGA 5JS8A 2SHKA 4GFDA 4AD8A 3SC3A 1GFIA 2V6IA 3GLHB 2EWWA 2HCJB 4BEBA 2XITA 3U61B 2G6BA 4RD1A 3CX7A 2FDCA 4B34A 2BM0A 2BVNA 1LF5A 4P33A 5E95A 4LX0A 1UEJA 3MWLA 4IFBA 2AWOA 2I1QA 1GKYA 4UNSA 3K09A 3FPAA 4IXNA 3AVVA 2P6UA 5D3QA 1NN0A 1YKSA 5G3YA 4UNRA 1IAQA 1V43A 5DN6D 1UPTA 1Q44A 1G3MA 5KYKA 1L2TA 2KSQA 2AN9A 2BBWA 4CT5A 2QEQA 2HJVA 2YJTD 4M1YA 4LSGA 5BYJA 1CIPA 1I4TD 4NU0A 5F2EA 2A9KA 3U5ZB 1RYHA 4TMTA 6Q21A 1GDDA 3FFBA 4OQXA 2XZPA 1AQYA 1FX0B 2UZ3A 4RSGA 5L3SB 3GJXC 4TSFD 1VMAA 3KKOA 3QKRB 3CX6A 4Q66C 5KPJA 5AUNB 5EP1A 2C99A 2DFLA 4LC0A 3VNVA 1YU9A 3NC1C 4IDOA 4M9SA 1MO4A 2OE2A 3K9LA 2IYUA 1U9IA 1TF5A 2UKDA 1EFRA 4HAZA 2GF0A 5CM8B 5D3MA 4ZIRB 4HLQB 3TLXA 3B1VA 4IJMA 1M8PA 1N3BA 3CNLA 1SQ5A 3TVDA 1QHNA 4B3DA 2WWIA 2AKYA 3GJ4A 1N5JA 2J0SA 2XXAB 4XOIA 2J0UA 2X77A 3AF1A 2RGNA 4Q4JA 4D80A 2MSDB 4WVFA 2C9CA 3M1IA 5JBQA 1W2GA 3REGA 4MRRA 2D74A 1JI0A 3ZH9B 2ATXA 4UJ5A 2X1VA 2QQ0A 5JRJA 2J5XA 1KK1A 4ZCIA 1G3UA 2UZIR 2HXYA 3HYTA 3OIVA 1Q20A 4QHYA 3C7KA 2G3YA 3QPUA 3AEZA 3OF5A 1LS1A 1Z83A 1XMVA 3BBPA 4PANA 3G0HA 1HY3A 3NHBA 3P27A 4LJYA 2CL6X 1FTNA 1Z0KA 4NONA 4Q00A 3QKTA 4G5RA 2VO1A 1NRJB 2ZS9A 4PAOA 2CCGA 1J7KA 4OHWA 2J3EA 1FNNA 3Q9LA 1KYIA 1YR9A 2HXSA 3RWMB 3GLIA 2OO7A 3IEVA 4C7OB 1ZUNB 1ANKA 3K0CA 4A8JB 2QP9X 2Z83A 1W48A 2GTPA 1YR7A 2H16A 4TLCA 4CEIB 1T3LA 1IY0A 4GPTA 221PA 2C77A 2YINC 2GZHA 2PEZA 3NKVA 3OEED 2OESA 2VHJA 1E32A 2ZRMA 4DLZA 4LJ7A 4Q9LA 4DT1A 4P3YA 4OK6A 3S1AB 5LD2C 3THYA 2O8EA 4ZI2A 5HPYB 1BH2A 1TQ2A 3HU3A 2F3TA 1KIMA 3QVVA 4B3CA 4D4KA 1Z5ZA 5DLQC 4QGFA 5K8TA 2IF2A 1D2EA 2ZI3A 4MRVA 3EPKA 2E9SA 1RKBA 1KHTA 1TEVA 4ZDKA 1Z6TA 1ZNWA 4FXPA 3DO6A 1UKEA 1KJWA 1KI3A 4ERNA 2GF9A 3ZD6A 1E2FA 5GVSA 2OFXA 4P32A 1II8A 2QPTA 2RMKA 2FX3A 4L9WA 2QAGB 3KUDA 1FP7A 2OG2A 2ZU6A 3TBKA 5J40A 3AV0B 1G5RA 1P9WA 4R7ZA 2IS1A 2BC9A 4WA7A 1IONA 1SVOA 1AS0A 1IN5A 3LW8A 2FPMA 3U3MA 1D5CA 4XTRA 4Q02A 1P3JA 3B1ZA 4Q03A 1RPZA 3UG6A 3BB1A 5EE5B 2IYQA 3GFPA 3RSOA 2BIFA 4HLCA 3RRYA 1T8UA 2O0JA 2CE2X 1SXJC 1HV8A 4D2IA 2MSCB 4RFSB 2GXQA 1UDWA 1Q1ZA 2QORA 5JECA 2QE7A 1DEKA 3QF7A 4OI1A 3T15A 2ZXUA 4HB2A 2TMKA 2QU8A 4RD4A 1S4QA 4QJ5A 2ZI4A 2V8OA 4UXIA 5DIFA 4DCSA 4IDPA 4PSAA 3GLFB 4FWIB 3SFVA 4M9QA 2HYIC 3TUJC 2ZR9A 1TUIA 2QP4A 4O0MA 3WXMA 1G16A 3C16C 3IGFA 5KO2A 4M1KA 5EUMA 2GXAA 1CKEA 3ND9A 2CBZA 1G8FA 3JZMA 4CRWB 4MRPA 4QBGB 4PC2A 1ZMXA 1ZP6A 4C0HA 4YMWA 4TL7A 3Q7QA 1NLZA 3W90A 3HU2A 3EIEA 1DAFA 2R2AA 2NQ2C 4NKRA 3UKDA 1XP8A 2RGXA 3EC1A 1ZC4A 2CXXA 2ONKA 3K70D 3RS7A 1Q1BA 4JLAA 1NVUQ 5GJCA 4IOJA 2F6RA 4Q9KA 3KQHA 1KI7A 3O8CA 4GZLA 3M0EA 3ICQB 1LNZA 3IDQA 3K09C 5K8LA 1T4GA 2A5GA 3U3OA 4AKIA 1G8PA 2VP2A 2DR3A 2OILA 3M4YA 3I62A 1F5NA 1ZW6A 5JFGA 5LB4A 3K8YA 3K9HA 4HYYA 2AD5A 2XX3A 1XU4A 4OKSA 3O47A 4F4IA 4QKQA 5KPDA 1XD2B 2JLUA 1ODFA 2RB4A 2ZRIA 5CM9C 4Q9JA 5EE0A 4FCVA 3KQKA 1XBTA 3L8ZA 3MFYA 3GLGE 2K5UA 4WXRA 4DEXA 4HAXA 2FGJA 3FMFA 2ZE6A 3KJHA 1M34E 1NVVR 1CR2A 1P2UA 1G7SA 4CYMA 4IDHA 3VAAA 4F91B 1W0JD 4CEHA 3ZZ0A 1U9IC 3WYFA 5DN6A 4TTQA 3QNUA 1E69A 2A5YB 3LQRA 3UMSA 3GLFE 5JI2E 3KB2A 1C9KA 1BYIA 2ZANA 1UEIA 2CCJA 3Q5EA 4JMPA 1KSJA 3EPHA 2B8WA 4OBEA 5FTNA 4HZIA 5JCPA 5L3RA 2YWGA 3B9QA 5FPHA 1CJKC 1KNXA 1IBRA 1E9SA 4YDHB 2RGNC 4TSFA 1ZNYA 1XF9A 4FMBB 3RNLA 5KSYA 1JJ7A 3TAUA 2H5EA 2BMDA 2IX3A 4DRZA 1MT0A 2ORVA 3PR1A 3NWJA 1MABA 1XTSA 3D8BA 1XTKA 4AC9A 2QTHA 4KSBA 5DHFA 4IKEA 4Q4HB 4Q1DA 4MDEA 5JHGB 1OIVA 1RYFA 2VRWA 1N0UA 1TADA 1MRNA 4NL4H 5KHOC 1Q3TA 3PUZA 1MOZA 1VCOA 1XD8A 2QG6A 3G5UA 4U5XA 4V03A 3ZZUA 2HUPA 1DO0A 1S1MA 2ZUDA 2DPXA 2F1JA 4RZ2A 4U00A 2VP0A 2GK6A 5FUWA 2WZQA 4DZZA 1NIJA 1Z0FA 5JHHB 3CF6R 1ELOA 2Z4SA 1Z6GA 2O8DB 4NPHA 2OCPA 4LK2A 4N0DA 1JR3D 3KL4A 5FH9A 1EK0A 5LB2A 1AQUA 2Z4RA 4HZUA 3GMTA 1XTIA 3GPLA 2H8KA 4CGZA 3SDZA 4LPKA 1H8HD 4WZBE 5K8IA 3AVWA 1AA9A 3IQXA 4GP7A 3LV8A 1GTVA 1N6OA 2OXCA 3ECCA 3RRZA 5SZKB 1SVIA 3H0KA 5FL3A 1EGAA 4PO9A 1KO5A 1XCMA 4DSNA 5IRCD 3GLGA 3CKLA 1VCIA 3B1WA 5G40A 4DB2A 2PT7A 1G1MA 4X8MA 1M2OB 5KSOA 3P1JA 3R9XA 1NJFA 1GOTA 1OFHA 3IIKA 4QJ4A 5JRZA 3ZLJA 3KXIA 1XEWY 1AGRA 3NEYA 1E2HA 1VKJA 2C9OA 4NCNA 4RZXA 2I1VB 3HR7A 4PZYA 3LX8A 3MMPA 1P72A 1L8QA 2JJ2D 3LLMA 3VR2A 5TMPA 2RAPA 2DFNA 3IQWA 2FZ4A 2NO6A 2R44A 3LX5A 4LCBA 4ZO4A 4ZI3A 2KE5A 4IRUB 5FOVA 3LAWA 3FHTA 1YZNA 2EU8A 2ZYWX 2H18A 3O8DA 2ZE8A 1LTQA 3E1SA 2BMEA 3QY0A 2WJGA 3QENA 4TZ0A 4Q7JB 4B3FX 1P61B 2NPIA 1OH8A 2VH5R 4WIAA 1E9RA 4FD2A 1C4OA 4BLPA 1R0YA 3HJNA 4JLOA 1QHHA 1SVMA 4BFUA 3NXSA 1AM4D 2HEIA 3L82B 4C0SA 3SBDA 5LD2B 3TIFA 4PAQA 1T3SA 4DDTA 3DEFA 2EWVA 1HYQA 1MKYA 1Z2AA 1G41A 2IYVA 4XIGS 3B8HA 2J59A 1ZJ6A 3C5HA 2RGCA 1E0SA 2GHIA 2NO0A 4PPGA 3SJCA 2WKPA 2ZAOA 1J99A 4B6EA 1R5NA 4MGZR 3VFDA 4DXAA 2C98A 2G1JA 2JLQA 4L9SA 3AM1A 1E2DA 4Z1MD 1CTQA 1U98A 4YXWA 3R7WB 4LJ9A 2IS6A 2ZVQX 1Y63A 3CR8A 1QHYA 1YZLA 1G7CA 3W8RA 5TXGA 1NLYA 3T35A 2IEZA 5G41A 2D4HA 3NIBA 1OXTA 3A37A 3LWNA 5EE1A 4URUR 4E09A 3B7GA 3IO3A 1KAGA 5JI3E 1CJTC 1N6NA 2IC5A 2QPOA 2G83A 3LBNA 2ZM5A 2XSZA 3GEHA 1E9CA 2ZRAA 1E3MA 3SJBA 3WHKA 1KI4A 1UDXA 1VPLA 1SXJB 4AG5A 4ZKEA 3SS8A 1OIXA 3CIOA 2WPDA 2ONJA 4KCGA 2F43A 5A5GA 1I4DD 2GCOA 2AL7A 2C8VA 3KDSE 3LNCA 1VHLA 2A3RA 3X1XA 4C9BA 2XZOA 1KY2A 1Z8FA 4LYFA 2IUTA 2PCJA 5J4LA 4OQMA 2W2VA 4BFTA 3T1QA 4D4LA 4HI0E 1H8ED 2W58A 4LJ6A 2D7CA 4RCZA 2IYZA 2ZRJA 3PV0A 2WBLC 1WF3A 3DM5A 2CE7A 4PC7A 5TB5A 2J0VA 2XJ9A 3BORA 2ZSEA 3MLEA 3AH8A 2A7QA 4QFMA 4M1MA 5FTMA 4EPVA 2W2TA 2GEUA 3CRW1 2CMKA 3QKSB 4FW9A 4JVNA 4PHTA 3X1ZA 1IJEA 4IDNA 3V4RA 4US2R 3RRMA 3DOEA 4B75A 1NBME 3RAPR 1ZC3A 4I81A 3RS0A 3SQWA 2XNDA 1WCV1 1M6NA 1QHSA 2GA8A 4PPFA 4BEJA 1C1YA 3U3KA 4DIDA 1HURA 2BMJA 2VHCA 3QQ5A 2YZ2A 3EAQA 2HYDA 5CDFE 1Z6AA 4NYIR 3WYAA 3K1JA 3I61A 1W0JA 2IYWA 3E2IA 3KKNA 3RYTC 4XVRA 3AVXA 2PLRA 3WHLA 4FMCB 2ZYUX 3A36A 4EQ6B 5H8WA 1FPMA 5AJWA 2EFCB 3T5GA 1A4RA 1AKYA 1G8HA 4Q1BA 1R7RA 1IN4A 2EW1A 1W47A 1XCGB 2GXUA 4TLAA 3NEJA 3CWZA 3KJEA 4A4DA 2ZEJA 1XTRA 1TMKA 1ZRHA 1JAHA 3FTQA 3HR8A 2D2FA 3A4NA 5CB6A 2AKAB 2ODWA 1YQTA 3AF3A 3D31A 2BKEA 2IYYA 2XTMA 5E4FA 4DCUA 5JSZA 2ZETA 3QXCA 1F3OA 3LDAA 3CRQA 2W83A 2ANBA 4XJXA 1WDTA 4GI7A 5KNDA 1IN7A 1YZQA 4OQLA 3CR7A 3GEEA 4X8OA 5C4GB 1TTTA 4QBIA 4PAMA 4EPYA 2CK3A 4E07A 2AXPA 4Q1AA 3WNDA 3G82C 1UAAA 2ZI5A 5FUXA 2ZRPA 4US0R 1OB5A 2GJSA 1M7BA 1S8FA 4LHWA 2IF0A 2ZR0A 3PITA 4KFUA 4OJQA 5CK4A 1P2VA 3QEOA 1KZGB 4D82A 1NMXA 4LPSA 1XDBA 2EFEB 4KYIB 1PVOA 1OF1A 3TGPA 4KXFB 1TF2A 2CL7X 4JT2A 1OXVA 1U99A 3P4XA 3PUYA 1EWQA 4A92A 2HF9A 2HJGA 3FWYA 4M1TA 1KO4A 1P5ZB 3U44B 1UBEA 4HLDA 2V7QD 2R6GA 1LS6A 1SKYB 1H8HA 2QN6A 1CF4A 2OM2A 1WBDA 3BH7A 4MKHA 2H57A 1QBKC 2FV8A 1U81A 1NBMA 4G1UC 4DB4A 3QG1A 4M0LA 3FKSA 3PUWA 4MITA 2JA1A 5AJXA 3LFUA 1MO3A 2XNSA 3GLIB 1CXZA 1OH6A 1OFTA 4E22A 1VIYA 1UKZA 3B1YA 3MWYW 1KI1A 4RFVA 4LHVA 1EWRA 2PX3A 1YZKA 1NNEA 1W46A 1DADA 3WMFA 1N6IA 1OT3A 1VG0B 4ABYA 1GG2A 4QL3A 1KI6B 2XJ4A 3CPEA 3D6TB 1NKTA 3U3RA 2A5JA 4DT1B 2JJ2A 1D9ZA 1F2UB 1QDEA 1P2TA 3L0PA 4IXMA 4LYJA 1EX6A 4TQAA 2EVWX 3KTAA 2IS2A 1KO1A 1X86B 3MCAA 4BLRA 3RC8A 1EFCA 1NKSA 4DHEA 4FCTA 5DI3A 2F1HA 2ERXA 4RZUA 3BJIC 3EPJA 2W00A 4A0RA 5FOSA 1BKDR 1J8YF 3CNOA 4JLKA 5J4KA 4B35A 4A82A 1T0HB 4TYQA 4C0BA 2V54A 1KK2A 1II8B 4KFRA 2NMVA 3W34A 3ZDQA 3ZQ6A 1QHGA 3RWOA 3KFVA 4EFLA 1RRCA 2WJIA 5B2ZA 2E87A 1Q57A 1DBSA 4P4SB 1WQ1R 1NN3A 2V1XA 2OXRA 3AKYA 1HT1E 3W3ZB 4A0GA 4D4MA 4EKDA 1OSNA 1DVRA 1XEXA 3TSOA 2XAUA 5DNYB 5GJWC 3D3QA 1SVLA 4NTZA 1SKYE 1S2MA 4RD2A 4WW0A 3PCRB 3RS4A 3GJ6A 4A15A 4L15A 4QOSA 3CZQA 4B74A 1FMLA 2JLYA 3LO5A 2IBMA 1ZM4A 4DLXA 2J41A 1OXUA 4Z1MA 3CUEF 4R71A 1AZTA 1ZCBA 2CHQA 2W0MA 1QG2A 1UM8A 1TNDA 4PC6A 5FI1B 4NYMQ 2X2FA 5P21A 2PJZA 4DSTA 1YZTA 3T1OA 1QHIA 2OCAA 1SVWA 4TQ9A 5A4JA 2ORWA 3K70C 4HB4A 4Q19A 3OIUA 5FTKA 4DKXA 1UBFA 1X1SA 3CH4B 1KDPA 1F2TA 4Q48A 3C41J 2ZRDA 2IWRA 2KJQA 1OFUX 4BZXA 1FZQA 3LVQE 4LUCA 3SQXA 2I3BA 2ZRKA 1VCNA 4R9UC 4G5SA 4RD3A 4XD7A 1Z3IX 2R6AA 1W36C 3GD7A 3R9IA 2PLFA 2ZAMA 3ZQJA 3H84A 5BN3A 2O8FB 3UWKA 4IW3B 3U4QA 4RY2A 1D2NA 4LBVA 3RVBA 1NN1A 2F7SA 4M21A 1YRAA 5HCNA 1HTWA 3EC2A 3GLHE 3K9GA 3X1WA 3BH6A 3L2OB 1D9XA 2QSZA 2RCNA 2ZRNA 4DLUA 5F9HA 2RGEA 1H8EA 1UADA 3R20A 2LKDA 1KY3A 4LC1A 5TDHA 2WSSD 3PQCA 3ZIAD 2O0HA 1VYUA 2ODNA 4D26A 4Q1CA 4U02A 1PZNA 2GK7A 3RANA 4BLOA 4HLUC 3CRMA 2CDNA 1US8B 2BBTA 5BW8A 2H92A 2NO9A 1WMSA 5ANRB 1SHKA 1N6RA 2BEJA 1E79A 1VDZA 3OAAA 2JDID 4HB3A 1GZSA 1XJ0A 3BERA 3M6AA 5FPTA 1NVXQ 1R4AA 1GNQA 1XX6A 5FFMA 3K0FB 3C5CA 1TQ4A 2YNMA 4BLTA 3KQLA 2BMFA 1II9A 1S3GA 1UBGA 1IQPA 5AWFC 1KNQA 3FMOB 5EXTA 4XWAA 2FSFA 1R2QA 2WWHA 3IIMA 1VYTA 1KMQA 2ZE5A 3ZVNA 2BJWA 4Q7KA 1VTKA 2ORIA 1ZM2A 4Q9IA 3EWAA 4KV9A 2ZRGA 1A7JA 5FI0B 2GJ8A 1GNRA 2BKUA 1B0UA 4KO8A 4D4JA 4HATA 4OQFA 3W9YA 5EXXA 1FQJA 4QHTA 2Z0MA 2PX0A 4TMXA 1WA5A 2JLSA 2P2LA 4LBZA 1GAJA 4LJAA 4HAWA 1IOZA 1UF9A 3VX3A 4AG6A 3MUFA 1GNPA 2VHQA 5EZ6B 3ETLA 4PZLA 3VMFA 4ON9A 3PENA 3K0SA 2N42A 2V6JA 4DSOA 4QM6A 3FHOA 1OXXK 1P2SA 4DDUA 2GJAA 4JLBA 1W4CA 4C2TA 4AI6A 3AKEA 2ZITA 3AVPA 5FOUA 3AB3A 3VKGA 4GOJA 3IHLA 3SE0A 5K8UA 1EXMA 3T12A 2JLZA 3C8UA 1T3HA 1P4SA 2W0SA 1QG4A 1RZ3A 3TSWA 1SHZA 3NVAA 1E1RD 1S9HA 3QVUA 3QKUA 2BWJA 2VSFA 2WAXA 1WRBA 1TUEA 3F0TA 5C18A 2F55A 3GLHA 1Z6YA 2QTFA 5L3QA 4MUAA 4YXWD 4Z54A 2C95A 4GP6A 1IHUA 4HZUB 3F3YA 3ADBA 3P26A 4CVNA 2XZLA 1G291 2Q0HA 2FMXA 1VHTA 2V7QA 1Z07A 1TX4B 5AUQA 2DHRA 4JBYA 4YMSA 1XRJA 2ODBA 4TMKA 1ZD8A 1DS6A 2XSZD 3DMDA 1W7AA 2DFTA 2GETA 4MDFA 1G3QA 3GJ5A 4JIMA 3MJHA 1ZNXA 3KXLA 3CBQA 1E2JA 4K46A 4Q7LA 1GITA 1QVRA 3T34A 4AYXA 4CEJB 4ITRC 1E2EA 2WPDD 1FX0A 4P31A 4ARZA 5L3SA 2OLKA 2FGKA 4GL2A 5BYKA 4H9GA 2IT1A 1KI9A 3QKRA 4DSUA 2B8TA 4CF7A 4L16A 3THXB 4V0OA 3QXJA 3TVTA 3OHMA 4URWR 2CLCX 5FBVB 2JLXA 2PCLA 3QE0A 4HDOB 3TH5A 2FNAA 3B5JA 3BIFA 1EX7A 3RS3A 3N2EA 2AFIE 1S3SA 4ZV4A 2AR7A 1O87A 1JALA 2OV2A 2VBCA 3PG5A 4LGMA 5GJVC 2PZEA 4PQYA 4LWZA 4WOPA 2C03A 4TWZA 5CIQA 2NPFA 5HR5A 5JJLA 3CO5A 2ASEA 1Z0AA 4A1FA 3TJZA 4MGIR 3SEAA 1GP2A 4FN5A 2C04A 3THOA 5TVKA 1AJEA 1W36D 4JSYA 1QHHB 1JPJA 1E2QA 3HDTA 1KMHB 3ASZA 3W5IA 2HDNB 2VF8A 1ZUIA 621PA 3UATA 2WAYA 4AKGA 2XNDD 2H1LA 2PL3A 4M9XA 2CLSA 3SYKA 3AKCA 721PA 2PEYA 2Q9CA 3NDBB 4JLDA 4KBGA 4AY2A 2VA8A 1G6OA 5DSZA 2D3WA 2C2HA 2ERYA 1FUKA 3DMNA 4G3XA 1L4UA 4KFSA 4MKGA 5AJYA 3PEYA 4LHYA 4NCHA 4F4JA 3IPYA 1EFTA 5FOXA 4XWOA 2J46A 3QUSA 2J87A 2FFBA 1CR1A 2P5SA 2MMGA 2ZJ5A 4ILEA 2FU5C 5FUYA 4B33A 3KJGA 2QA5A 1Q1QA 4H1UA 4QGGA 2J7KA 3BD9A 2QTVB 4JLNA 2ZIAA 2ZRCA 1FNMA 1MRSA 3QJYA 4GOKA 5UKDA 5E3HA 1NG1A 4C7OA 3DKVA 3FVQA 3DDCA 4WAUA 2OAP1 4D0LB 5JCZA 2VEDA 2WOJA 4IEEA 5IDVA 4CEIA 2CL0X 4IOMA 8OHMA 4EPXA 1Q22A 1DG1G 521PA 3OESA 2ZRBA 2QENA 4Q4AB 5B64A 4BECA 2NZ8A 3ONWA 1M74A 3FGNA 3S1AA 1W2HA 4B43A 4S35A 2YWHA 1TQ6A 1CJVC 2JLRA 3OEHD 2QI9C 1MR3F 2CK3D 3LRPA 4XVQA 3U7HB 4BFYA 4XH9B 1G6HA 1A1VA 4FINA 3AGPA 1E6CA 3ADCA 1VCMA 2G1KA 4MRSA 3I5XA 4KAXA 3MRSA 2IS4A 4BFZA 1AKEA 4RVCA 3K70B 1DG3A 1P73A 4EPWA 2NIPA 3K0CC 2LKCA 1A5TA 3RDPA 2A78A 3A1VA 5KDLA 3BFXA 5DGXA 1E9AA 4LI0A 5DH9A 1P7CA 1NMZA 1G21E 1UFQA 1G64A 4V0ME 1W4AA 2Q9BA 2DFKB 4I4LA 4W9MC 3RC3A 2WSSA 3PUVA 3CPHA 3ZIAA 4TQUS 1NBMD 4YMTA 3A1WA 1XPOA 3A6PC 2Q21A 3FKSD 5CJPA 2RH5A 4HDCA 2KWIA 3VTKA 2I4IA 3ZD7A 3FDIA 4KLZA 3SNHA 4S2EA 1XZQA 4B73A 1HE8B 1UKVY 2NG1A 4JBXA 5IK2A 5IHPA 2O5VA 5JWHA 1KDRA 1II0A 2QMUA 5BWMA 2IWHA 1BYUA 1K8RA 2IL1A 2WM9B 3MG9A 2JDIA 2ZPTX 4M8NE 3LLUA 5TY0A 4RFSA 3SJAA 3X1DA 1NVWQ 2FN4A 1H65A 2HV8A 2J9RA 5GJBA 1KI2A 2AFHE 1FOEB 5SZHB 3WY9A 2X2EA 2NGRA 1M7HA 4ZKDA 1XXHB 1MH1A 1O3YA 4JSTA 3P4YA 4EIWA 1NVVQ 1VG1A 1XWIA 5TARA 3GLFA 1DE0A 2RGBA 4DCNA 1E9EA 2CJWB 2Q9AA 3E70C 4F7WA 4ESVA 5FL7A 2D7DA 3VU9B 4JLVA 4XSHA 2EYUA 1ZUHA 2FOLA 4LJ4A 4O2LA 4PC3A 1Z29A 3IHWA 2D2EA 4BWYA 1GKIA 3AKDA 1Z0DA 3LXRA 1Z22A 4EPRA 1U0LA 5EJEA 4TT3A 5H70A 5C46F 1E94E 2R6CA 5FR2A 1E0AA 3DVLA 4KVGA 3AVTA 2Q3MA 4L5BA 2GVDC 2P6RA 2O8BB 1UBCA 2V55B 5B58C 1M7GA 2OBLA 4A2QA 2P0EA 1I2MA 3MWKA 2W6IA 4A2WA 1DTSA 4GMXA 3AF0A 1PV4A 1E0JA 2N1BA 3WNCA 4M4SA 2DB3A 1DOAA 4ACBA 1RJ9A 3R9WA 1CULC 4JVMA 3PIRA 4UNQA 1XFAA 2R9VA 1ZBDA 3BE4A 3QF4B 4O2RA 3AP2A 5M04A 2QPAA 1NL3A 2ZTSA 3K0AA 4QC2A 3ZGXA 4B2LA 4V0NA 2XOKD 2WWGA 4DJTA 4HB0A 3IBYA 4MYTA 2IYSA 1E1RA 1IY2A 2ZS8A 1N6HA 1E4VA 1KJZA 3UG7A 3VR1A 1XD2A 1GSIA 2REOA 4HUQA 4LHXA 2WIAA 4DEYA 3TUIC 4A6PA 5FBWB 1Z0JA 4F4CA 4C2UA 3ZS8A 1IN6A 4FMDB 5LPNA 1AS2A 1DAGA 2CEAA 2W6JD 2WOOA 4DCVA 3PXGA 4MUBA 3VX4A 2R6FA 1ONBA 2OT3B 2ZRLA 3V9PA 1XEWX 4OHYA 1G7RA 2IUSA 5H1YA 3U6KA 2ZYTX 1XXHE 3QPVA 4BZPA 1X1RA 2VLIA 2ZJYA 3ADKA 3THWA 5G53C 2VHUA 3ADDA 5KU1A 4JYBA 4DBLC 4NYJR 4O25A 1N6KA 3UWOA 2R62A 1XMJA 4XD7D 4ZDJA 1Q1EA 1N2CE 2X8AA 3Q3JB 3NH9A 1S0UA 5BN4A 2Q3FA 4D81A 3CX8A 3PFIA 3KKMA 2VIIA 2WSMA 5HE9A 1E9FA 3F5FA 4DLRA 4TZ6A 5JJIA 4Q9HA 5FOWA 1ZIPA 2NO1A 4DUGD 2WJYA 2KBFA 1E4YA 1X8LA 3Q72A 3GEIA 4KFTA 2IXEA 3LD9A 3LBIA 4FWTA 4Q4HA 1FQKA 3CM0A 1R0WA 4POAA 2FPKA 1RW4A 2RGGA 2AXNA 4V0KA 3VR5A 4ZDIA 1TF7A 5JS7A 2OEPA 3AVOA 1KSFX 3QBTA 4OI0A 5AJVB 4B3BA 3QSYA 2FSIA 4OQNA 3OAAD 1E79D 5JWOA 3I5YA 4JL5A 2L0XA 3VHXA 4ZCMA 3LVRE 1NSTA 1R0XA 4OL0A 3B78A 3SYLA 3AF4A 1XCPA 3QIAA 4OI2A 2LCFA 5FUVA 2GBLA 4E03A 2GRJA 2Z6VA 4XSGA 1JR3E 2WTUA 3EPLA 1S1CA 2IHBA 1U0JA 1KSHA 1OPXA 2QM7A 1PLJA 2D62A 4MKFA 2Z5FA 1ESNA 3F8TA 1KKLA 4NHOA 2F1RA 5FTJA 3O8RA 1IN8A 2J0QA 2WMOB 3IKJA 5L3VA 1CR4A 4M53A 3W3AA 1WB9A 2WKRA 4B6FA 3EASA 1IM2A 4B3XA 4URVR 1YZGA 2VSXA 4C0KA 2Z43A 3NHAA 4DLVA 3HWSA 4OHZA 2G0NA 2XEXA 1SXJE 1TQDA 3OZXA 2B7BA 2D06A 5KDOA 3EW9A 1NY5A 4Q5IA 5EZ5A 5GVRA 4YLGA 1AIPA 1HEIA 2GXSA 2Q3HA 2R8RA 3CW2A 3LW7A 4QRHA 1E2NA 1ZCAA 4LOAA 1NN5A 3WP1B 2FFAA 3RS5A 3RABA 5D3MB 2P3SA 1OFIA 1W1WA 3KJIA 3AGQA 2QMOA 2WMNB 1RRGA 1ETUA 1JQJC 4KU4A 3OEHA 4EJSA 2AHOA 3K9NA 2OFWA 1N5IA 4NYJQ 4KSCA 1OKKA 4I1SA 1HH4A 1OH7A 421PA 1SZPA 2J0UB 2YVUA 3DHWC 4Q4JB 3AVUA 1E0KA 2GILA 3U4QB 5CIWA 4L4UA 3TMKA 4UNPA 1RE0A 4TLDA 1XJCA 3MSXA 1FFHA 2VF7A 3ZVRA 1KKMA 1T91A 3A1UA 2GAAA 4MH0R 4CZ2A 4TMVA 3WRXC 1JNYA 5JWRA 1JBKA 2G9NA 2EFGA 1P9NA 2VP5A 4B48A 4WZ6A 1E2GA 2OLJA 4BPBA 4B2PA 1YZUA 4IFEA 4DLTA 4TL9A 3W6OA 1WBBA 2MSEB 1NJGA 5DI9A 4M1OA 3B82A 3D7MA 2OZEA 1LF0A 1X3SA 4PO8A 5AUOB 3TK1A 3A1TA 5IT5A 3EIHA 3L0SA 1G20E 1KOFA 4QG7A 4CDGA 1RVDA 2ZREA 2YOHA 3O8BA 4JL6A 1E2LA 5EUQB 1W44A 1Z08A 2QMHA 4BFXA 2YYZA 3R7WA 5CDFA 2PZGA 4A0HA 2FEOA 2RHDA 1A82A 3DZDA 4BQSA 2P6NA 4PPQA 1OYYA 4BASA 2EFDB 2QT0A 1OHHA 4NYIQ 4V02A 4EAQA 5F3WB 3THYB 2O8EB 1RRFA 3B6EA 2YWFA 3IIJA 4DLYA 2YWEA 1JPNA 2XB4A 3UIEA 2UVQA 4XWKA 2JASA 2GZDA 4QHSA 4URXR 1JEEA 4P4UA 4R2IA 4UXHA 2NO7A 1AGPA 2ZUCA 5JLJA 3P32A 4EDHA 1P75A 1U8AA 1DAMA 4NCJA 4PO1A 1D2MA 2FFHA 3AP1A 1BMFD 2GNOA 1GM5A 2YV5A 3PUXA 3Q5DA 1KI8A 3TSZA 3I8SA 4LHZA 1IXRC 2IYXA 2F9MA 1BOFA 3A4MA 2JLWA 2FE4A 4KYUA 3SBEA 1YJ5A 3UMFA 2YOFA 3CWQA 2FSHA 3W8NA 4RKEA 1U94A 3A1SA 1MO5A 4MQBA 3WMGA 3QKSA 4PR0A 3TNFA 4B47A 1SULA 2XOKA 1GWNA 2QRNA 5L8VA 2JJ1D 1W0KD 3GFOA 4LV8B 3LA6A 1JECA 2CVHA 5DO9A 2ZRHA 3K53A 5L3QB 4II7A 1LB1B 3ZJYA 1LY1A 3GLIE 1L7VC 4TLBA 4PFSA 4QNRA 1CR0A 3HYRA 2JIZD 3ZVMA 3Q8XB 2W6JA 1JXMA 4JKYA 3U7EB 4B76A 5BXQC 3TR0A 4K81B 5CLLA 4R98A 3OE7D 3BWDD 1G5PA 3VNUA 1K5GA 3DM9B 3T06B 1FUUA 2HLDD 5B30A 2FZLA 4TLEA 3RS2A 3SHWA 4Y0AA 1X8KA 3EZ9A 4NCKA 4EQ6A 1JXOA 3FFAA 4NBSA 2A5FA 2CHGA 4ASUD 1FW6A 2R65A 4ARZB 2DCUA 1HQYE 4QXAA 5SZJA 4DDWA 3QXHA 1YR6A 3AUYA 2O8CA 1CBUA 2A5DA 1TU3A 4HSEA 1R8QA 3AF2A 3P20A 2FJUA 5F9FA 1ZYUA 4DUGA 3CZPA 5LDDC 1DARA 4YQFA 1KDOA 1CRPA 1YHNA 2WICA 5EP3A 2HCBA 1N5KA 3BGWA 4OHVA 2GBLC 3CPJB 5HKKD 1R8SA 2IXGA 4IOLA 1EFHA 2F3RA 1MO6A 2QUZA 4M9ZA 2REXB 1RIFA 2ZS7A 4US1R 2CHVA 2NTYC 1U0HC 2QBYA 2ZJZA 3AVQA 1CJMA 1U2RA 3TW4A 2OUKA 4TTRA 3I72A 1ZD9A 4URZR 4JVLA 4FI3C 2BDTA 5F98A 1U8YA 4TMWA 3T1VA 1DPFA 4LBYA 5IK2D 3BK7A 4QGHA 2OSBA 1CEEA 1NI3A 4I1UA 5BQ5A 4JJZA 4OJKA 4XVUA 2IYLD 4BUJA 1J2JA 4NZYA 2IW3A 3OIYA 4MGKR 2P65A 1XPUA 5CB8A 5E7MA 4AKHA 1U90A 5CYOA 2AK2A 4RD0A 1JAIA 5KNCA 2QL6A 3U44A 4AURA 5FOTA 3FKQA 1GILA 3I32A 2EFHB 4NE2A 1PJRA 2IYTA 1JR6A 4CEHB
chains in the Genus database with same CATH superfamily
2W6CX 3WMEA 4W5TA 1ZGBA 2PXXA 4I1OA 5FL7D 5BN5A 1UJCA 2WWFA 2BGJA 2VK2A 3BMOB 1ABFA 4L0QA 3E9MA 2AVNA 2BGGA 1TTQB 3EXAA 3LDGA 1JG2A 4ES6A 5LCXA 1J0BA 5HFAA 3KQYA 3VHLB 4D25A 4LIPD 5J43A 5JALA 3Q4GA 1E6LA 1JKJA 2BGKA 4YV2A 1PLLA 4CDRA 3E5HA 1N2ZA 5BXYA 1MZVA 3ISTA 4HWKA 4CNBA 4EYOA 4CLXA 1KI6A 3PQDA 3UHJA 1EVJA 3JATB 2PKYX 2W6ID 1F2UA 2EP7A 4MXDA 4NENB 1R0KA 1SIUA 3S44A 5CLFA 5HIJA 2H5LA 2Y27A 1EK6A 5I5GA 1T0BA 2ZYDA 3HPQA 4KDCA 2R6DA 1KQNA 2OKCA 3WK7A 4F7DA 2ZJBA 5LWHA 4X92A 1G19A 3FUCA 2Q1SA 4HDNA 1XKTA 4MI9A 5CBKA 3HJGA 2FSSA 4PG6A 2QGZA 1S6YA 4YALA 1T36A 5F7OA 1L6RA 3WL4A 5JT1A 1XV5A 3FDFA 5JEEA 3O9MA 2GZSA 4JJKA 2WKQA 4MV4A 4R0NA 1CUDA 5D7BA 4ZYYA 1L5KA 1T5LA 2K4MA 3D3JA 2WEKA 3BWEA 5JASA 1ZR2A 3CZ4A 1GQ2A 4EUEA 2W4QA 1N0HA 3I9V6 3QNMA 1Y3AA 3P5BA 3JYQA 3B6IA 1BHQ1 1OU4A 1ZH6A 3GJTA 5BRNA 4BX3A 5LL6P 3K0EA 3W6NA 4JC8A 3GGSA 4P4SA 4I1PA 3KQMA 1RABA 1XL1A 2PKXA 1FYEA 2DWOA 4MR8B 3OSUA 5CX1A 5IT0A 1I7PA 4ZYVA 2YY7A 3ZHRA 1NRXA 3R0QA 4Z4GA 2IK8A 1ESCA 3JD2A 3QMPA 4MMZB 3FDJA 5G02A 1YL7A 4LY3A 1PJBA 2O3TA 2XB2A 3ZZ1A 4KXVA 1UMDA 4JVSB 2W22A 3IUNA 4DNQA 3LWBA 1YAJA 3C1TA 3PT5A 1KMIY 2IZ6A 4IIYA 4MS3B 4X63A 1Y6JA 3UUGA 4ER0A 3T95A 3PHJA 4M1SA 3M2PA 5J47A 3OVMA 4MRNA 5AXBA 3WB0A 3ZE8A 3JVVA 2R60A 1P31A 1Z06A 3HDYA 4I4TB 2WWYA 2LUOA 2B6HA 2O7RA 4DTIA 2Q1YA 1R9NA 1SCBA 3L1JA 3R76A 2LRHA 1TU4A 4LXUA 3GR6A 4XVHA 4YRPA 4BMOB 1PRYA 3WDSA 3IUSA 2AF4C 4HAUA 4L27A 4RNCA 4KQMA 1I4EB 1IEWA 4QO8A 5DM4A 3KPJA 5AJUA 1M2WA 1Q7RA 121PA 3PC4A 3IC5A 3H04A 2FEWB 4ZT4A 3ZJ4A 2N75A 3ZV7A 1I7NA 3FIJA 4MOWA 2WY2D 1U0FA 3DLAA 1ISGA 2PQ6A 4E7OA 1F0NA 1JZTA 4A23A 5LA6F 4ZIRA 1AUPA 5HXAA 4I50A 3SSMA 2BCGY 3U09A 3OFND 1E1CB 1UC9A 3KHTA 5AKLA 2OCYC 2UXDB 1A9RA 2C2KA 3UPDA 2XODA 3BT7A 4L50A 1CUJA 4RA6A 1I3OA 3TZEA 2WQ6A 3QW4B 3KQNA 2NXWA 2OCBA 5AW5A 2IKQA 2IPNA 2XXAA 2SKEA 3IXQA 3T7IA 3ZHUA 3QUBA 1WKCA 1DWQA 4FNAA 2UXBB 2G80A 2F1OA 2QSYA 4F4DA 4JZKA 9ABPA 3RS8A 3I64A 3DHEA 5HEKA 1GGNA 5AM2A 1YB4A 1LRLA 1VPTA 1Y1KE 1ZD1A 1RJ9B 2BF4A 2QR5A 3FUTA 3VV2A 4GG1A 1EGHA 4FGKA 1PNTA 2D8AA 2QF7A 2X76A 4HAIA 4YI5A 2LPMA 5L45A 3FLEA 4V0LA 1OYWA 4RF3A 5HTKA 1Z8HA 1UFRA 4C6TB 4Q3KA 2FJ0A 3ZPXA 2AFRA 2XCUA 1NQOA 1TAGA 3ITDA 1PZFA 2JGNA 3S2EA 3OY7A 4A0FA 2P4HX 2Z6QA 1I0IA 4FOPA 4HUQB 2JJ1A 1W0KA 4N1AA 4B3MB 2WIJA 4IDQA 1KFEB 1Y1RA 4WK4B 5EZYB 3RARA 5EE3A 2JHGA 3IE2A 4C7MA 1ZJYA 2PQ0A 4FUTA 2FMTA 3KPVA 1CEQA 3ROQA 3V4VB 2GPYA 4A8PA 4QPCA 4KC0A 4ZU1X 1FP6A 3IT1A 2DLDA 3K8QA 1L4KA 2ZYVX 3SU8A 1B74A 1XZMA 4OBXA 2YJZA 5K6TA 1P74A 4Q9AA 3EDQA 5E1BA 4Z0NA 4ARVA 3V3KA 5P8WA 4ZDWA 1NJ2A 4ZZ2A 4AYWA 4G5GA 3PCXA 5KREA 3PR3A 4QX6A 5HKLA 1VYVA 3MEQA 3OE7A 2OWEA 4RL4A 3TTUA 4KIFA 1KO7A 4D3XA 4YYZA 1I0LA 4ME6A 2GD2A 1FFXA 3RHFA 4JUAA 4BMPB 1EFDN 1NF3A 4IGKA 1M1YE 1ADYA 4REQA 3VZDA 4A6EA 5JFTA 1TPYA 3FNGA 5LZ5A 5JZVA 2JKVA 1L5MA 1TJ3A 4OYLA 1OKKD 4M2LA 3FVRA 4C7BA 2WD9A 1IY8A 3CO0S 3OQIA 2GWHA 4II3A 5CLQA 5D00A 5DHAA 4AUNA 3IPXA 5FBRB 3SYNA 4B82A 2NADA 5KYWA 1JEJA 1EG7A 3IXMA 4LYYA 1E1QD 4A36A 3GGCA 1NG9A 2QYTA 3B85A 4LJ8A 3E22B 5CIYA 2HPAA 1ZD5A 3SPXA 2QD3A 1H0RA 3EK2A 3HFSA 1I6WA 5JPCA 2AFIA 4TT8A 4D7AA 2QAGA 1K6MA 2IU4A 3F6EX 4QBFA 1F48A 2QNRA 4N54A 1SCNE 4N82A 5F4BA 3S99A 3UAWA 3PTZA 2OZPA 1E2KA 3HCFA 3VH4A 3M1YA 1GN9A 4NFYA 3WI7A 2HMWA 3JTEA 3EXIA 1EINA 3FHCB 3A31A 4U1RA 2WUWE 2A30A 2GVZC 4LDRA 4R1MA 4XDZA 1LV7A 5F2KA 3JVUA 1K4KA 2AC4A 2QTAA 2WTAA 1LDBA 3WRWA 4C0QC 3OUTA 1TZ2A 1E99A 5KQPA 3PEWA 4RAQA 2C96A 2RGDA 3PA6A 3R0IA 5E6UA 3KOZA 5AHKA 4G4SP 2W2NA 1K6EA 4B4OA 5C1PA 3Q8MA 2Z2YA 1LW7A 3QFTA 2O1WA 3JS5A 3QOFA 3EAGA 4E30A 1BX0A 1S7GA 2E37A 4EKYA 3FTPA 4UTOA 4E5UA 1GVNB 1X7ZB 1G55A 2AMJA 1Z5NA 1K7FB 3AP3A 2QT1A 1K5DA 4BGDA 1HO3A 3F4KA 2MYPA 3OTIA 4WZAE 1VRCA 4DMMA 1BVUA 1LZLA 3OZCA 4I1VA 1IXZA 3SF0A 3VYRB 2RH9B 4V2UA 4QGAA 1UZLA 2P67A 5HVNA 4KDFA 3A1NA 1ILEA 3L5OA 2G1AA 1IY1A 3AFMA 4YY3B 2WJVA 5KTYA 1GTRA 1TI7A 4K6OA 4Q3AA 3ZNNA 2PMKA 3QYJA 1T1SA 1TTHA 4IJVA 3ZXXA 1HDCA 4IVPA 1Q0PA 2EFJA 1ZNQO 3SBOA 1OE0A 3IAFA 4YAEA 1XZFA 3WV4A 1G63A 2P5TB 2XYQA 1BMTA 1EJ2A 2H52A 2IKSA 4K87A 5DN9A 2IU0A 3U4AA 3W5BA 2PJRA 2REBA 4EF5A 1Q11A 4HTFA 2C4TA 3BWCA 4QDOA 3VBEA 4E12A 2AK3A 1DAOA 4URYR 1JFTA 1N6LA 1SBIA 1XNQB 3KNZA 2Y67A 5EJ5A 5HRAA 5MN5A 4ZHQF 5MFPA 1E9BA 1RWNA 5HQ3B 1R6VA 1FYWA 2O57A 1WSBA 1NT4A 4KQ2A 2Z1MA 5JDCA 4EUKA 5I4CA 2NSYA 4OHOA 5ED0A 4FB4A 4AYTA 1WLYA 3SN6A 2MYNA 3I1FA 3LC7O 5EJ8A 4LQCA 2A9VA 2G07A 4BE4A 1MC4A 1WVGA 2B5VA 3CB4A 4X54A 4CM4A 4QYIA 1XHLA 2P11A 4B79A 2D3TA 3D0KA 1D7OA 4IIDA 3HV0A 1Q3HA 2EBFX 2XMQA 4YN3A 3RSLA 2BKVA 2P4QA 4RZIA 2J6CA 2OMEA 1WVIA 1JPVA 2C5BA 2DERA 1N92A 3GWZA 4KXUA 4NOKA 4DM3A 1WP9A 4ZYZA 1NU6A 2QTNA 2A9QA 3WK8A 1CY0A 4AK9A 2FOXA 3GT4A 5FRDA 1E7YA 3QITA 1CQJB 4BJ6A 1EFUA 2QRQA 1Y7TA 4N49A 1PQ4A 4LJLA 3T0GA 1MJNA 5KWJA 3H83A 1AHPA 1BEUB 1DKRA 1NJ6A 5GWXA 3VQTA 4CL8A 1INLA 1FL9A 1C7RA 1KH2A 4G1BA 2FH5B 1ZM9A 3ZHXA 1R5JA 3CNNA 2R8OA 1YZYA 3M6UA 1YBAA 4D9EA 2C3UA 2GFHA 2XUJA 3EOBI 5CH5A 2ZRFA 5DVZA 3VUFA 4MR9A 2GD6A 4LXYA 3STVA 4B3JA 1NSFA 4JS0A 1GZUA 3IP9A 5TNXA 3FVTA 4K8RB 1CU1A 2R7NA 4INPA 3KX2A 4OQ4A 2CVZA 5ALRA 2AFHA 4TXMA 3OLVA 5JVDB 2AWNA 3OURA 1TEXA 2CY0A 4N03A 5C1OA 5HZKA 1L9XA 1QHEA 5U9CA 1XNGA 4AKSA 4R3WA 1AQNA 2P8SA 2Q0QA 2ZIUB 3WWDA 4WX2B 3TTYA 2HK9A 1WXQA 1Q6YA 1GKUB 2C5LA 1M2VB 3RC9A 4Q4AA 3UPUA 4GI1A 2AX4A 3I2HA 4M3NA 1Y81A 3NBZC 4KK4A 5FWXB 1NJSA 1CT9A 4PPNA 2X19A 3C14C 3MCUA 4KKXB 2JAQA 4HWSA 1BHSA 2UZ1A 5GM1A 1AKVA 1PVVA 2HT1A 4W8OA 2OV8A 4HV4A 1U7DA 4WBNA 3RYFA 1XB2A 4RFLA 3U7FB 4I08A 4UEWA 4EHAA 4J3NA 1O4VA 1H4TA 1PLKA 1ZU5A 1SURA 1GNLA 3LY5A 4CG2A 5CB4B 1U9JA 1PUJA 3JZIA 4UUNA 5CITA 2HR1A 2AQIA 1HYBA 5FTLA 2YJGA 2XYVA 4PLWA 1ZIOA 2B7CA 5LOVB 1G5IA 1W4BA 5AK0A 2F17A 1U28C 2YFQA 1GL6A 3FMPB 4JR0A 1MH9A 3RT7A 1NIPA 4HOYA 1UH5A 3NV7A 5HA5A 3UFXB 1KZ7B 3WWPA 4NECA 4G84A 3WK4A 4EPTA 5IANA 1KYWA 3IJPA 2VT6A 1XEXB 3FA2A 5E6SA 4QZVA 3BRWD 4MJ3A 1JHQA 1B6SA 1OJLA 1QCDA 3TMYA 4KR6A 5CVDA 1ZH8A 2TS1A 2PS9A 3CRZA 2GBIA 4WESB 2RHCA 2ZSFA 3FYUB 4LV5B 4Q93A 3V34A 4WBSA 1MEOA 2G09A 3UXEA 4FYYA 1YWGO 2I9KA 2E3JA 2ZRQA 4PSCA 2B82A 3E18A 1QIIA 4EF6A 1EP1B 1ZUWA 3RFXA 3F6CA 4IHJA 4Z51A 3H1TA 2XGJA 1BSVA 1N7GA 3BFKA 1X42A 3PXEA 1G17A 3TUZC 4G01B 4RLQA 4OGWA 4XUGB 4WDQA 4HFRA 1CUUA 1HQCA 1P0PA 1X9HA 2ZSJA 1BO6A 5H68A 4MKZA 2ZUBA 5AHXA 1A97A 1W5AA 4M76B 2JJ8A 2MMCA 3C8ZA 1AUOA 3TB4A 2J6HA 2G77B 2W9XA 1ORWA 3FWKA 3MWJA 4IOKA 3LK6A 5EGNA 2DFVA 1U2GA 1DAKA 1ZIYA 2G5PA 2J8ZA 5EG5A 2IODA 1QV9A 2JFHA 4CMGA 1KC1A 2O7SA 4YAKA 2BI7A 1FU7A 3GJ3A 3WIUA 3QMVA 4ONEA 1ZGJA 4ZPXA 1B43A 2B2NA 3L01A 4AN0A 4BRWA 3GD5A 2QQEA 3H9GA 2FLVA 4OEHA 1LLCA 1H22A 1XVTA 1B8UA 4FHEA 4KQHA 3TQFA 4UHKA 3HEMA 2CYCA 4F6RA 4ND1A 4BKOA 1IE3A 5MF6A 3E9YA 5CX4A 3NMUF 2A1IA 2VSOA 3C7CB 3VR4D 3L05A 1XMIA 1MFZA 2C2WA 2L17A 4MS1A 4DLBA 1ZD3A 3QI2A 1X7HA 1M6YA 3B7WA 2J3LA 2I3AA 3KWMA 3BJZA 1I4LD 3L43A 1T0UA 4YP6A 5JBIA 1RC0A 3GGOA 3FOZA 1XELA 2GKGA 4F2DA 4EI7A 1JKIA 3P0RA 1YQDA 3IEUA 3ESAA 2E4XA 3JASA 3KQVA 3AHCA 2JD0A 2P9CA 4EY4A 4K6GA 1NXSA 2QKYA 4RXMA 4DQUA 3BSSA 4JDUA 3MRTA 1ZN2A 1ZY2A 3AFIA 1GRRA 4PTYA 2WTEA 4TYPA 4FYMA 4B3GA 2I67A 1M6VB 2QBYB 5A2GA 1EFVB 4U9HS 1DIGA 1JG6A 1SC3A 2O7NA 3BQ9A 2QLMA 4HN4B 3DKPA 1PWXA 1U3TA 1OTXA 1JP7A 2WJ3A 2ZSUA 3JVIA 3QEKA 2I03A 4GBMA 4IIVA 4R9VA 5FBQB 2Z2ZA 3N2IA 4NQRA 4TWAA 2QY6A 5E3IA 5IG2A 4S1OA 3BC1A 4K9OA 1NVFA 4UNNA 1ZIXA 4LX8A 2GESA 1TKBA 1GEGA 3H1FA 3CC8A 4OD0A 1CLUA 3T4EA 4IMRA 1NXQA 4D6PA 5IXYA 5KSWB 1VECA 4P9NA 3NEPX 3TEMA 4JY7A 4DC9A 4OJTA 3M1LA 1Z6XA 4ISCA 3UMRA 3MYYA 4Y1RA 4IQ4A 3CCFA 2WC1A 1XG5A 2YWCA 5EP4A 3P2KA 3WVNA 3I0ZA 1DCFA 3B1JA 4MIYA 4AS3A 3ED5A 5JJKA 1Y4ZA 3K9FC 2Q2OA 2WSBA 3L6RA 2YHIA 4EI9A 4CI9A 1SG9A 5IM4A 1HNWB 1COWD 1UK9A 1M2GA 1USUA 2JVJA 2VL7A 4NMMA 4QEZA 4B2IA 2OFOA 1VG9B 1BD3A 1MVOA 1GKKA 2I54A 4MJ7A 4ZA2A 4I2NA 2FE1A 2NUTB 3RVPA 3H2IA 3KE8A 2WTBA 5JW6A 1LEHA 4JYCA 4AMYA 1DQZA 4KE9A 5K0FA 4RACA 1QFMA 1ID8A 3LECA 4EH1A 1JDUA 2VXBA 4LZLA 1T4BA 2JGJA 4JBIA 4Y2GA 3NHMA 4QBHA 4X7BA 1PFVA 4I4TF 3UW3A 3JD1A 1C1XB 2ZSBA 3EF0A 1R8XA 2WHPA 2P6OA 3EZ6A 3QYFA 3NT2A 1GZHB 4CW7A 3GUVA 5DF1A 4BMCA 5L40A 1M3SA 1TD9A 1A72A 5AKZA 3U49A 1DOZA 2EZ8A 3EXG1 4QYWA 3BUSA 4M0EA 2IYRA 1QGZA 1XMSA 3BYZA 4P7KA 1C9JA 1GIAA 2WVJA 3SR4A 3KU4A 4HDQB 4OI4A 2AOTB 2X6TA 3DD1A 3G2MA 4Q0MA 3A28A 4QA9A 3Q1KA 4UMEA 1K7CA 1SWWA 5ALWA 1SEVA 2J7PD 4FIZA 5ECYA 4C0AC 5HJ5A 2Y4NA 3ICOA 1SUIA 2HU5A 3GEBA 4KEAA 3VR6A 3WGUA 4GKAA 4YR9A 4KDEA 2OHHA 2CLIB 3L6UA 1PT7A 1V5WA 1NR7A 3I9MA 2NZWA 3L7JA 3QNWA 4OYHA 5JS8A 2SHKA 1Z56C 2UV8A 1HZZC 3K0KA 3SC3A 5AOAA 2EWWA 1UBMS 4Y2UA 1ZHOA 721PA 1JFRA 2ZLBA 1K2VN 3HEBA 3QPDA 4RD1A 1QRUA 2X9GA 3L04A 3P19A 4B34A 3UMJA 4XQ9A 3HG7A 4GGMX 3WLOA 2CNNA 5HJ2A 4CQLB 1ISJA 2GEKA 3MWLA 4NMLA 2AWOA 5LJIA 1DTWB 1XRQA 2Q6VA 2FMKA 3BZUA 3PD7A 4O2AB 3A9SA 5HF9A 1GPBA 3K09A 3L7MA 2X0IA 2P6UA 5D3QA 3ZE0B 4YJGB 3FNHA 3OOWA 3GUUA 1YXMA 2HK6A 3U0BA 1G3MA 2JBAA 1KL7A 2G1PA 1L2TA 3G5MA 2YCBA 4F4UA 3ETGA 4XPIA 5CEJA 1M33A 2GPBA 2AQKA 3GCDA 4PLFA 2YJTD 3COZA 3UHAA 3R4VA 4W8HA 1RM5A 4D9CA 5LZ4A 4HRXA 4R8RA 4TMTA 4FILA 4C04A 3AR2A 3FFBA 2N47A 3G5LA 2CD7A 3MW8A 4ZOLA 2VZ0A 3KZCA 3WLLA 1RD4A 3GJXC 3UJ6A 2EJUA 3TMAA 5FWYA 5D84A 5FO1A 4FR0A 4X20B 1VMAA 3KKOA 2FWJA 2Z08A 3CX6A 1WW3A 2VJLA 4X71A 1TGVA 1KR2A 3MK31 1Q3KA 1CJBA 2C99A 1VYHA 2ZAGA 4LC0A 5C3MA 1BGWA 2QN8A 1NXOA 4HYEA 4QQ8A 4IDOA 4JI5B 4U7TB 2IYUA 2WTMA 1TF5A 2BL4A 3PHLA 4OJNA 2IHTA 3GBPA 5D3MA 3D3KA 3TLXA 2ZPAA 1O95C 3H5LA 3E2PA 2IPAB 4AUKA 2AZXA 1JVBA 4HBZA 4RK1A 5TJHA 1O97D 4B3SB 3L7DA 2X0JA 1MORA 1PR4A 2H63A 1E5XA 4JQOA 4WWHA 1TKRA 2M6KA 3NP9A 4X1YA 3K8OE 3SQMA 3AF1A 4Z49A 1B0ZA 1DBVO 1LVHA 1POWA 1VLHA 2HIGA 2VPXA 4WVFA 5DBIA 1WZIA 2HMTA 3M1IA 3SZUA 2FWBA 4DWOA 1YONA 1BS9A 4RENA 1CZNA 1JI0A 5HDQA 3ZH9B 4BP3A 1YZ3A 5I8PA 5IHXA 3UTDA 3H1PA 2A84A 4MUXA 1EK5A 2QQ0A 4UULA 4CG3A 3GJZA 2WM3A 2PMEA 3VR3D 1G3UA 5AQEA 3NRBA 1PFQA 1GJRA 2XD4A 2YHAA 4KBYA 2G3YA 2R1UA 2VXOA 3H2SA 1Y3FE 5EJMA 4Y9RA 4ETWA 4WPGA 1Z83A 3BBPA 4PANA 4WERA 4DLAA 3G0HA 2JFFA 2PRSA 3PD1A 1E18A 1HY3A 4MV8A 3Q15C 2QX6A 1FTNA 1JYFA 4NONA 2ECPA 3DFMA 4G5RA 1AXEA 1XR3A 2E82A 3MHPA 2WLTA 2QL5A 3N0VA 4BX2A 4F97A 3SMVA 5BWLA 3EA4A 2PO7A 4Y2HA 5JY1A 4Z4FA 3CGWA 3Q9LA 1KYIA 2Z8XA 2HXSA 2X3UA 2EJCA 2HSEA 3GLRA 3AZQA 3CGGA 1WP4A 3ZJVA 2H7XA 4EW1A 4G23A 5EINA 3KQOA 4TLCA 4KMSA 4CEIB 2GBFA 2V7UA 2AEMA 3OEED 4ZRNA 1N75A 4MEAA 2OESA 4PCUA 2OP0A 3ZV3A 2VHJA 1E32A 3G8DA 3OUUA 1GU0A 1FMCA 2XGMA 3RVLA 5GONA 1ZR4A 4WOCA 2SKDA 4HAOA 3WHPA 1KU0A 1WB6A 3GXBA 5U1PA 5AW1A 4M98A 1XZJA 5LD2C 4JWKA 2OECA 1T1RA 3NM5A 1LRKA 1Z0SA 3SIWA 4PN3A 4KQGA 3EVGA 3TIGA 4YPOA 5HPYB 3A9CA 3EBLA 4PX2A 3HU3A 3BD6A 3HXOA 2ROQA 1KIMA 3CEAA 3QVVA 5C8ZA 2WFLB 3JQBC 4D4KA 1Z5ZA 2OMKA 5K6AA 4MRVA 2ZI3A 2DHQA 1PNQA 2E9SA 3NNDA 2PWPA 3DE3X 1TEVA 4MP8A 5KTOA 3RIGA 2P9GA 1EGMB 1EG2A 4FXPA 1FRZA 2JRCA 3DO6A 1U5AA 4G9GA 1ORVA 4IS3A 1KJWA 2DR0A 1H3FA 1KI3A 2GF9A 2IYFA 1GSHA 2GH1A 2RH8A 2UYQA 3BA6A 4KZPA 5CHYA 3S3TA 2GAIA 3ZK7A 5GVSA 3LCMA 2YFKA 3TQQA 4BQQA 2GNAA 2VRBA 1P3Y1 1VL6A 1K75A 2EHDA 3DHVA 4M49A 5DNDA 3NKFA 2VDUE 3GYBA 6REQB 3H9BA 1PSWA 3AV0B 4U2CA 2AG0A 2WYWA 2AN1A 3ID6C 5BRAA 5EKSA 4EYKA 2W2OA 1AS0A 2TYSB 1L5FA 5K0ZA 1QP0A 1C9DB 2FPMA 1S02A 1SPXA 3JWIA 5EXEA 3TIIA 1D5CA 1K92A 3QOYA 2CXHA 4MKRA 2E6UX 3ESYA 3B1ZA 3BD7A 4J29A 4QU5A 3UG6A 5EE5B 1CUXA 3EFHA 3IAS1 2QG9A 3I53A 3R5SA 4CQNA 5C3UA 3OF3A 4X62B 1TK9A 1RBMA 1T8UA 1UZAA 2JFOA 4JJIA 4NG5A 5H83A 5B1IA 3DTVD 2E2WA 3ANXA 3MC1A 1SXJC 4KXMA 3G2NA 3PXXA 4LZJA 4P5PA 3TD9A 4UVGA 3UV6A 3ZZNA 5ALOA 4W63A 2O0LA 4Y6GB 3SZGA 3L4KA 2PUBA 1Q1ZA 3DW3X 2QE7A 4PLGA 5CT9A 3UPTA 2ZXUA 1WKBA 3GAZA 3H9JA 5MGBA 3KZOA 4RD4A 2BFNA 3BJEA 3R6GA 4Y9DA 4QJ5A 4HGPA 2Q46A 1U1CA 3ZOZA 4CUJA 4IILA 5AVTA 1E7MA 3SFVA 4BAZA 3IVMA 4I5DA 4RV4A 5IKMA 5KVVA 3DE5X 1TUIA 2QP4A 3AESA 3EIOA 4O0MA 4GHWA 1RPAA 1GUZA 7ADHA 5AOVA 1U1IA 4YRFA 2GXAA 2C42A 2F8LA 4EB3A 5BV0A 1TMOA 2AGVA 2CBZA 4PG5A 1G8FA 3JZMA 3OLXA 5HMLA 4EHKA 4CRWB 1X7YA 4DYDA 3MJEA 5K3AA 1JN0A 1TK2A 1D0VA 4YMWA 2FQ1A 1CEXA 1IB6A 3AFOA 3KTDA 1NLZA 3W90A 4BNGA 4QQKA 1XTBA 3E9DA 2JCXA 4XX1A 5TQ2A 4DREA 1XI2A 3IH5A 3DT9A 3UKDA 4FPXA 5FF9A 3EC1A 3DBRB 1JH8A 1K98A 1V71A 3IBCA 5HJ7A 2A1UB 2QRPA 3ZGYA 1V37A 3L07A 4HKTA 4B45A 4UUBA 2DRIA 3R3JA 4GR9A 4Q9KA 1L7PA 4GM0A 1FYXA 1NVMB 2AYXA 2NU9B 1LK7A 3HUTA 3IDQA 2XCSB 1YTUA 1C1DA 1T4GA 1Q74A 2A5GA 3C43A 4YP1A 3V6LA 4OUKX 3LUAA 4ZTZB 2ZIGA 2RGUA 2DR3A 3I62A 4N0QA 3CSDA 4N5DA 1NNI1 3I2YX 4AU1A 3ZKWB 2PGAA 3GLTA 5JFGA 4HNQA 5ALIA 1Y4SA 2AD5A 3NHRA 3PUIA 4MYRA 3E3OA 4WOBA 4AS2A 1WXWA 5H0IA 3EDRA 1Z75A 1ODFA 2RB4A 4M55A 4Q9JA 2IV2X 3RB8A 5CB4F 2QM3A 3KQKA 1XBTA 2YBEA 2Y05A 1SC9A 1VBFA 3AEQB 3MFYA 1JKFA 2BZSA 2FEAA 5AI4A 1EFKA 1IDOA 3AERB 4ND2A 4WXRA 2GM4A 1M76A 5DOZA 4TRMA 4DEXA 1AKUA 4E6EA 5KNBD 4HAXA 5LOVF 5F35A 4L4RA 2G5GX 3ABIA 2PRKA 2D5LA 3KJHA 3PWKA 3UUFA 2P3OA 3ER6A 4LDPA 2XE4A 2QQFA 2VH1A 3SGLA 2EGUA 4JJ8A 4MVYA 3GVPA 1UZMA 5AO9A 3ZZ0A 1EDEA 1T9DA 3A32A 3WYFA 5KB3A 5G4LA 3E81A 3RUPA 1P1FA 2E21A 2HGZA 2Q7OE 2M32A 1ACMA 3LQRA 1GYRA 4AZVA 4F9GA 1OLUB 3VYVA 1C9KA 3WGTA 3TECE 2C9MA 3QE9Y 1Q16A 3CG0A 4LHEA 5F5NA 3EPHA 4OBEA 2P9FA 3BX1A 3R0XA 5EIHA 4D9NA 5L3RA 5BVHA 4N7JA 2YWGA 1KNXA 1LLUA 1VJGA 3CT6A 3KXDA 4MQ4A 1PTJA 1EVKA 2O19A 4KLCA 1G5HA 1QO7A 1CK4A 4BNWA 1RCUA 4UCFA 1JJ7A 2C4UA 4D9BA 4Q3DA 1BTOA 1R37A 1FP4B 2XADA 1I01A 2B7LA 1ZK4A 3KSMA 2Y92A 5B2FA 3ESCA 3JX9A 1XTSA 3D8BA 3GYGA 2FP4B 4UAVA 2AZDA 1RRVA 4GDFA 4EMSA 1X87A 3BG5A 3H6KA 3LC1O 4CLEA 4B9EA 5AHRA 2V0CA 4N5LA 4XQCA 1QGUB 1DIAA 3EZGA 3M83A 4HSGA 2NV6A 4LZPA 5JHGB 4D8TA 1JF8A 4HPXB 2JFZA 4Y7DA 3UJ9A 4YP7A 4N6NA 3V55A 1IULA 1MRNA 4MWDA 3DD5A 4N0MA 3MSCA 3PUZA 4YRTA 4QEKA 3U7QA 1XD8A 4I5FA 3VC2A 4ZCTA 3G9ZA 3KBOA 3V4ZA 1G2PA 3FLMA 2GHQA 4TVSA 3STWA 3MT9A 4ZANA 2ZUDA 2F1JA 3HY4A 4NBVA 4U00A 5TRTA 1LLDA 3VU8A 1TJ4A 4RVNA 4UM5A 1AC5A 2W2PA 5FUWA 3DQZA 1KOLA 3VHXB 5JHHB 1Z0FA 3SCZA 2I7CA 2ILTA 4H27A 5A9SA 5ALNA 4JP1A 5E7QA 2O8DB 2PUDA 3KL4A 1GGEA 1AQUA 4TXJA 1KDVA 4ALLA 5EIOA 4BB6A 3NUGA 1UUFA 1XTIA 3UC5A 3GPLA 1W2WB 3OCYA 2AG6A 2PGDA 3OUZA 2FZVA 3MIZA 3SDZA 1KBOA 1PX2A 1VIMA 3O8QA 4N8DA 4O0LA 4CF6A 2IXTA 5JD5A 3PF9A 1AA9A 3IQXA 4GP7A 3HKEB 3R3XA 4HH3C 1N6OA 5DGIA 4DL9A 4MULA 3RKRA 5KYVA 2EDAA 2EZ9A 1X7DA 3IX7A 4NENA 4ZQBA 3LTNC 3GC6A 1KO5A 4B7ZA 4C3VA 5IRCD 4EAAA 3GLGA 5G40A 3A9RA 1PNRA 2PT7A 4JEUA 3PRJA 1G1MA 1QYVA 4F8JA 3P1JA 3WRXA 4D3FA 1GOTA 1DC7A 1UOPA 2PKCA 2HUNA 3EQ9A 4UE3S 3ZLJA 3LLVA 2JF0A 3DB1A 3M6IA 4GMKA 4HTAA 1N5MA 1E2HA 1VKJA 3ZDAA 4NCNA 4RZXA 2I1VB 3HR7A 5BQPA 4OFZA 4CCYA 3UUWA 1FLDA 2JAOA 1L8QA 3DONA 3HGMA 1FFAA 4ERXA 3X1KA 3UMCA 1MVNA 1PJ4A 3EHDA 3IQWA 3LLCA 1HORA 1Y42X 3GRAA 1QYXA 4M37A 1Q7CA 2CLEB 3CS3A 3KJFA 4B3RB 5AI9A 3PQ3A 1VJ5A 2AUMA 5GONF 1RE1A 1TE2A 1AZLA 3V9AA 3LAWA 4EY6A 1YZNA 2EU8A 4LJSA 5F64A 3ZR4B 3FHTA 1OXMA 1DBQA 1JHOA 1K7XB 4DMUB 4RVGA 1NNUA 1SBHA 1KORA 2FZEA 1LX7A 2WJGA 3LKZA 4B3FX 5IBRA 3IOMA 3MT0A 4B87A 3CZCA 5HOQA 1XZBA 2QU7A 2FOIA 3NCTA 2O7VA 1UBTS 1XKQA 3FAZA 2I2WA 3CNQS 3FM9A 2BHTA 4LXQA 1W94A 3OCVA 1Y9AA 1SVMA 3SSAA 3TI9A 2XB6A 1V8OA 2BRUA 1JDBB 1SBCA 2MU1A 3LCVB 4XIIA 1CZLA 1TB4A 4L9WA 4KIGA 2C7OA 1BVYF 4JOBA 2BSAA 4PAQA 3L6OO 1IQ0A 5EKDA 1MKYA 1YK0A 1HOTA 3AIIA 4XIGS 2VJNA 1YS6A 2VHYA 2C7PA 2Q8NA 1ZJ6A 4AMVA 4RU1A 1E0SA 2O3SA 1KJJA 2GHIA 5LDHA 2NO0A 5LQUA 5C5CA 4OXYA 1B3BA 2ZAOA 2PRJA 3PL1A 4MV1A 2BONA 4XYEA 4BJHB 1R5NA 4NEQA 2XUAA 1H6CA 3UVEA 2COUA 4I4CA 1ZVMA 4MCHA 1E2DA 1CTQA 2HJ9A 4V1CA 3MGBA 3D6AA 1FVFA 4YXWA 1PV2A 3WYBA 4NESA 4PAWA 5BSEA 3R7WB 5GZ6A 1VI2A 1QE5A 1C4WA 1YB7A 1VKNA 2VAVA 1Y63A 4AMGA 1RXEA 1ENPA 3D8SA 4DNXA 2ZAYA 4R41A 3L6DA 5I6DA 1JDPA 4JITA 2V9ZA 5EY5B 2YJ4A 5I7HA 3SEQA 1JHMA 1XC7A 2C20A 4H18A 1XDDA 1CDDA 1U1DA 1CJTC 3HYNA 3MXTA 2QPOA 4IBOA 1TVMA 1JIXA 3TTVA 4DIOA 1UPXA 2XSZA 3EFBA 4INJA 4DDHA 2ZM5A 3OPXA 4GBED 5DCWA 1C7JA 2GYUA 3P7MA 1VPLA 2E5WA 3RVJA 2ZJ6A 3Q7EA 4LF5B 2H1CA 4AG5A 1JU4A 5F21A 3C8DA 3CIOA 5F4ZA 5ICSA 4FBMA 2GCOA 3FZEA 5B3KA 1CV2A 5BRJA 2XY4A 1GAQA 2PPVA 3NAQA 1CUVA 4AP6A 1OX4B 2IUTA 2PCJA 5J4LA 1P1CA 3A7DA 4I5GA 4TM7A 1R3DA 1THZA 1QZUA 1K66A 2F3QA 2BKXA 2IY9A 3MLBA 4LJ6A 3ZWDA 3STHA 5AW3A 5EUBA 4RCZA 1N9GB 1KEZA 3OX4A 2C0CA 3C85A 1V47A 3G2KA 4FB5A 4ZICA 1GD1O 5TB5A 1U80A 3AIKA 3BORA 1K8XB 5A04A 3AH8A 3KUKA 1V8PA 1XAIA 4F72A 4EPVA 2VDWA 2GEUA 3QE4A 2CMKA 3MILA 5CFLA 4UATA 2LZ0A 3M6LA 4US2R 1GNVA 1WZEA 3DOEA 4AZ0A 4KPUA 1I0ZA 1QIDA 2HNKA 3BXXA 1UP6A 4ALIA 3PJDA 1F0YA 2EF1A 5EFZA 1U7XA 1M6NA 1QHSA 3JW8A 2QL7A 4FEEA 1QX4A 1LQUA 1HURA 1F20A 1FNBA 2BMJA 2VHCA 3NO4A 3SDBA 4MJXA 2YNMD 1ULSA 3B2NA 3VGPA 4TKLA 1Q0QA 2VBIA 1UMBB 2D59A 1V2HE 3Q2KA 3WYAA 2JLAA 5KSOA 2MINA 3JQ9A 1L7EA 4RK6A 1W0JA 1YDGA 2XV1A 2IYWA 3P9XA 3IKLA 1QYRA 5BP7A 2Z6AA 4RTQA 1S89A 4XVRA 1FIUA 3DPIA 3E0QA 2OY0A 1SUEA 4HFJA 3NP7A 4EHFA 1CDEA 1SU7A 3QWIA 4FMCB 4LRUA 4F0JA 4X7MA 5H8WA 5AJWA 4COKA 2EFCB 1A4RA 1AKYA 1A9OA 1U1EA 1R7RA 3IAHA 1GGJA 4TS9A 1W47A 1XCGB 3II6X 4LOLA 3LDUA 5IVKA 5TMBA 4IDAA 4A4DA 1CNEA 2ZEJA 3E5RA 1ZRHA 4HQKA 1JAHA 4YH1A 3S2SA 4FFSA 1QQTA 2ODWA 3TQRA 3SAJA 3KVRA 5E4FA 2IYYA 2Q6KA 4DCUA 5JSZA 3QXCA 4F4HA 1BJKA 1NVDA 1PR1A 2P68A 5G1PA 4BVLA 3LDAA 3CRQA 1QH8B 1KWGA 3D3EA 4MV3A 1E7QA 4GI7A 1IN7A 1YZQA 2WM2A 3CR7A 3QVGA 1TT7A 2OD7A 3C3BA 3QWBA 4FFLA 4MCJA 4RIIA 5C4GB 4PAMA 2WA2A 4U2GA 4D6XA 2VQ6A 4J7AA 2AXPA 5CMLA 3U9LA 3N2GA 5CBPA 4G0XA 4O4IB 4EZIA 2CV2A 2ZRPA 3ZG6A 2X8LA 1M7BA 1S8FA 2H1HA 4Y9SA 5CA0B 2GZMA 4OJQA 3A7EA 3IAXA 3C6MA 5A7HA 8LDHA 1K3FA 1I2CA 3J80A 1J20A 3U4GA 3VPXA 4P08A 4LPSA 4D82A 5JXWA 4EGAA 3QXGA 1JDTA 1W30A 2A94A 1YDWA 4JT2A 3P4XA 1EWQA 5BMVB 5CDUA 2HF9A 2YIMA 3L1KA 1Z5VA 4KXNA 1CG6A 5E6RB 1I2BA 2QN9A 5HMMA 4C4SA 4HLDA 1Z82A 3TLMA 1Q91A 5MDHA 2EV9A 1SKYB 4DRYA 1SH7A 1QUFA 2OM2A 1WBDA 1EE1A