1XJ0A

Crystal structure of the gdp-bound form of the rasg60a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
165
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
molecule tags Signaling protein
source organism Homo sapiens
publication title Structure of an intermediate for nucleotide exchange by Ras
rcsb
total genus 60
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xj0A00
3EIHA 4IOLA 1OSNA 1W0KD 1U8ZA 2F43B 1KJZA 3PUYA 3GFTA 2TMKA 4Q18A 3ZVMA 1AZSC 1KI2A 2EWVA 4CDGA 1M1YE 3QUSA 3AF1A 2XB2A 3THXB 4IOKA 3QXSA 1JEDA 3P20A 4DSTA 1FNMA 3R9WA 3ICQB 3VFDA 2IK8A 4HAUA 3IBYA 3A1WA 1CU1A 2I1QA 5GJWC 1HEIA 5CM8B 3T34A 5B64A 4MKGA 3K09A 2OT3B 4Q02A 4C7OB 4IVRA 3AB3A 1N6KA 3U3RA 1VCIA 1M8PA 4PQYA 1ESNA 3NKVA 3M1IA 3B8HA 2IXGA 3DM5A 2YWFA 4D0NA 3KFXA 4IDQA 2P2LA 1KI3A 1N0WA 3AEZA 4Y0AA 5BYKA 1XD9A 4GL2A 5AUPB 4RCYA 2GXQA 2QE7D 2V6IA 1S8FA 3KZ1E 3RRZA 2ODEA 2OO7A 1E2NA 2PH1A 1EX7A 4XSHA 3BRWD 4B76A 3QPVA 1G4AE 3SFVA 2RH5A 1GFIA 2GA8A 1OFIA 4QL3A 2BEJA 4P31A 5A0FA 2BBOA 5JEDA 2PMDA 2O8EB 3EW9A 2C9CA 1LFDB 4GNKA 1RZ3A 4PPQA 2EFHB 1YU9A 3B78A 1NSTA 2HEIA 5TMPA 1OXVA 1YZUA 2FE4A 2ZI5A 5DSZA 1P6XA 4JKYA 3RRYA 3I61A 2GCPA 3PV0A 2BMFA 3EWAA 4URVR 2CK3D 2FSGA 5AJXA 1JR3A 3RC3A 4F4IA 2F9LA 4DBLC 1FL9A 5FR1A 3E1SA 4IDHA 2BKUA 1OH7A 3DM9B 1E6CA 2P6NA 2W2TA 4PO1A 3AGPA 5UKDA 3BOSA 1TQDA 3MJRA 2GBLC 3PJRA 2I3BA 5DI3B 2IYYA 1BO6A 1MV5A 3CX6A 3QF7A 2ODWA 1O3YA 1Z2AA 4IVPA 5IRCD 2VL7A 1XTIA 1Z3IX 4JL5A 5LD2B 1UBFA 1DG3A 2REXB 1Z5ZA 4IDNA 2VH5R 5CITA 1SXJA 3QPUA 2ODNA 2RGNA 4RKFA 3EPHA 3WY9A 5GVSA 1CP2A 4EAQA 2JAQA 3K0CC 3GJ3A 1GL6A 3SBEA 4B3XA 1B23P 4TZ0A 3FKSA 4KCGA 4WZAE 1K5DA 1NLFA 4P33A 1T3HA 5JFGA 3QIAA 2CJWA 1K8RA 3H84A 3QJYA 3AF4A 1ZIPA 4GP6A 2CVHA 1K6MA 1ZAKA 3LDAA 521PA 4POAA 4QNRA 3RYTC 2JLXA 1QHNA 1RRCA 3UXMA 2FWRA 4MKFA 4XD7A 4NYMQ 3W8NA 1OFUX 2ECKA 4PZLA 1OHHA 3FYHA 5K8LA 4UXHA 1U0JA 1VG9B 1P73A 3TGPA 2A7QA 3I32A 3BORA 4LPKA 3EZFA 3LXXA 3LVQE 5IF9A 1Z2CA 2VQSA 4JVLA 2NO1A 4A8JA 1X1SA 4LYJA 1VKJA 5KSZA 2DWPA 3RS2A 1F6BA 2G83A 2QP9X 3CO5A 3ZS8A 4O25A 3U6BA 2XTNA 3B6EA 3E5HA 2J9RA 3GJ7A 1MRNA 2V54A 4YONB 3HYRA 3KXKA 4PZYA 4TYPA 4FXPA 1W49A 4F91B 1IY0A 2RGXA 1EXMA 1AIPA 2AKYA 3R8CA 4B2IA 3N2EA 3KTAB 5IDVA 2WAYA 2ZRGA 1OH5A 1E9RA 5TXGA 3LXRA 5JLJA 3C16C 2C95A 1LF0A 2ZI3A 4V0ME 2IYZA 1SQ5A 3U3MA 1GDDA 2C9OA 3OIYA 4NYIR 3DMDA 1YRAA 3LRPA 1XEXA 3Q3JB 5JRJA 1XTRA 2G77B 2QPAA 1VIAA 1XZQA 4M9QA 1Z6YA 1OYYA 1BS1A 4OJQA 2F43A 3REGA 4W5JA 4CZ2A 1P2SA 3PUXA 4D80A 5G53C 3WP1B 2OCPA 3AKEA 2FSIA 1FX0B 1PUJA 4QHSA 3CRMA 3KQKA 1JPNA 1E9CA 2FFAA 2ZAMA 3KXIA 1G21E 4BFUA 4CYMA 1FUKA 1VG8A 4NCNA 5B58C 3IQXA 2ZSAA 4WVFA 1RJ9A 5DYGA 1NSFA 3AUXA 2KWIA 1JB1A 5LBIA 3L8YA 3ONWA 4KITB 4PAMA 2OLJA 2PL3A 2CBZA 2X77A 3FHOA 2Q9AA 1T91A 3A4NA 3QNUA 4NHOA 2C04A 5DI9A 2IS6A 1NIPA 2OBNA 1AGPA 1H8HA 4J0QA 4UNQA 1HTWA 5BN4A 4URXR 4XVRA 2HF9A 1P2TA 3A1VA 2DR3A 4LWZA 5A4JA 4B75A 1OIXA 3OIWA 2ZAOA 1P62B 3CF6R 1OT3A 3B60A 3B9QA 2V6JA 1W46A 3NHAA 2C98A 1RYFA 4FW9A 4HAZA 5AR1A 1DAEA 3CRVA 5BW8A 2DBYA 4P3YA 3CPHA 2VHTA 5JBQA 1W0KA 1Z0FA 5EUMA 4KO8A 4C7OA 4HUQA 4MA4A 1WP9A 1YZGA 1DAMA 3QF4B 4PPNA 2J0UB 3MGCA 2JJ2A 4RY2A 2X1VA 2DCUA 5SZKB 2CCKA 1Q20A 5HR5A 2UVQA 4M8NE 5BN3A 1DPFA 2ERYA 3EARA 3SNHA 3A6PC 4F7WA 2J46A 2RGGA 2ZRBA 4MQBA 1ZMXA 1BH2A 1DEKA 1HYQA 2RGBA 4RD0A 4UNPA 5EJEA 1Z6GA 1MO3A 3R8FA 4Q00A 1P9NA 4B33A 2DY1A 2GCOA 4K81B 1VYTA 4Q9LA 1KMHA 1QF9A 3KJEA 4FD2A 2VLIA 3RS5A 1Z0KA 3B7GA 4ASUD 2Z5FA 2ZS7A 1M74A 2QROA 3IHLA 4TQUS 1QHGA 2WJHA 5CDFE 4URYR 1KMHB 5KPDA 2ORWA 2R6FA 1EFCA 2NO9A 1G19A 1UDWA 1ZD9A 2FPKA 2BKEA 4NCIA 3WP0A 4LRWA 5HKKA 4LHZA 1XJ0A 2B8TA 3W6OA 3CBQA 4RD4A 3U60B 5TVKA 1OHHD 3MLEA 2OBLA 2C99A 5KSYA 1YZTA 1UBGA 3CR7A 1XXHB 3BGWA 3KJIA 3NDPA 4G3XA 4M9ZA 5DLQC 5JWRA 2LCFA 4UNRA 3THWA 1LTQA 1OV4A 2YOGA 4Q4JA 5D3MB 2F55A 1NG9A 1R4AA 4QGGA 2AFHE 1XD8A 1S4QA 4GOKA 4G5QA 1F2TB 3TR5A 4GOJA 4Q1BA 2BCGY 4LPSA 5LB2A 2D7DA 2FEOA 2B7BA 2HV8A 5C18A 2XXAA 2F1RA 1FP6A 2CE2X 2KBFA 1COWA 5KDDA 2Q6TA 1R5BA 2QAGA 5KPJA 2AK2A 4PZZA 2IYSA 2JLRA 2HCBA 4KFSA 2XNDA 3UWOA 3VR3A 2BIFA 3VR4A 4BGDA 3H86A 1ZNYA 121PA 2FG5A 4IJMA 4JLDA 4LYFA 2X19A 4RFSB 4LUCA 3A4LA 3ZDQA 3T1OA 5JI2E 2XNSA 2D2FA 3PUVA 4ZCIA 5CK4A 1YR7A 2GXUA 1HQCA 4DWJA 4H1UA 3TSOA 1YJ5A 2IWHA 3VAAA 1GUAA 3BE4A 3ECCA 1KO7A 4GMXA 1ONBA 2YHSA 4Q4HB 1C9KA 3FFAA 4I1VA 2O8FB 2D2EA 4AWXA 1ZC4A 2EFCB 5FTJA 1EK0A 3C5CA 4V0KA 1W4AA 3C7KA 4DLYA 4IVQA 3FWYA 1ZNWA 5EQTA 1U0HC 1YR8A 3QVVA 3PXGA 4MGIR 4WIAA 4KLZA 3THYB 5AUQA 3J81k 2J59A 4GZLA 3SYLA 2KE5A 4OKSA 1TL7C 2VRWA 3THWB 2PEZA 1S0UA 1XDBA 4IRUB 2Z0MA 1T9HA 3EZ6A 1AKYA 2QM7A 1D2MA 1XCPA 1XFAA 2ZRMA 4LBWA 1FFHA 4Q1CA 1T3SA 1NIJA 4GBMA 3P1JA 3QKRB 3N5CA 4OHVA 4P4UA 5AUOB 1OYWA 3GLIE 3K8YA 4JVNA 3TH5A 3ZVNA 1XTSA 4D0LB 4TMKA 4EFLA 4L16A 1KY3A 3B5JA 2ZI6A 5K8UA 1NRJB 2G3YA 5KNCA 5DNYB 5EUQB 4JKIA 3V9PA 2C78A 1GM5A 2ZVPX 2ZI9A 3H2YA 1TMKA 2BBSA 5HTKA 4WAUA 3U44B 4D25A 1M6NA 2QT1A 1WDTA 2RMKA 3ADKA 1ZRHA 1SVKA 2NTYC 4Q1FA 5KSOA 5FTNA 1JR6A 1GG2A 3RS7A 3CLVA 3DZ8A 1QHSA 4R9UC 1SVMA 3C4JA 2XSZA 5CYPA 3GLHB 1OFTA 2H1LA 2IYTA 3QE0A 1YE8A 4ZV4A 3BIFA 3LVRE 1KDPA 1N5IA 2WPDA 3BFVA 1V5WA 2PCLA 4KXFB 2Y8EA 1UKEA 1XBTA 4BZPA 4NL4H 4CT4B 1GKIA 2VA8A 2WAXA 2ZRCA 3ZLJA 5JJIA 2J45A 3EG5A 4Q4JB 3X1YA 1AS0A 3T5DA 2HYIC 4NCHA 4DDWA 2W6ID 3AP1A 1XCGB 4HB2A 1AS3A 1AA9A 2YVUA 1TF2A 2VF7A 2R2AA 1E9SA 2ZUDA 3AKYA 2YNMA 4Q48A 1G41A 1SXJB 1ZC3A 4XVQA 3BXZA 4DLXA 4PC3A 1Q1BA 1QDEA 4JLKA 3CR8A 5E7IA 3W3AA 1SVWA 2QN6A 2F9MA 1LNZA 2VYFA 3A37A 3RSOA 4DEYA 4PSAA 1IQPA 1OXTA 1IXSB 4CIDA 4C0JA 3QG5A 2AXPA 2ZTSA 3ZGXA 4KHZA 5H68A 1TEXA 1CJVC 1P5ZB 2HUPA 4US0R 3PR1A 2V9PA 1H8ED 3B82A 4OBEA 3QOFA 2FFQA 5IHPA 1KY2A 721PA 5CB8A 4BQSA 4OYHA 4KV9A 3TJZA 2VP9A 5FR2A 3IIMA 3HPRA 3U7GA 4ZIRA 3T12A 1XTQA 1U99A 1DO2A 5JCZA 3FHTA 4TYYA 4DLRA 4A2WA 4AKHA 1TQ4A 1E0AA 1IAQA 2WKQA 4K8OA 2WWYA 4HYYA 3AQ4A 2AL7A 2ZRLA 1YZNA 3FE2A 1S3GA 3THYA 4ITRC 1UF9A 2JLZA 4QJ3A 3B13B 2GRJA 3GLGE 2FF7A 3OFND 2GDJA 1YZKA 2A78A 2FA9A 4WBSA 3CH5A 2OSBA 2YWEA 5J47A 1V43A 3FHCB 2P6RA 3LWNA 2Z4RA 3B1WA 4OJKA 5FFMA 3OEHD 3ZH9B 4XWKA 1NVXQ 2W0MA 2DFLA 1IONA 1AQUA 1OKKD 2VTKA 5K8IA 3BBPA 1KK1A 5JEEA 3MWJA 5C46F 5IK2D 3IPXA 1FQKA 5FUYA 4KYIB 1MT0A 3VKWA 2C96A 2AFIE 3L43A 3L0IB 1TF7A 4PHHA 5G40A 2PMKA 1CRQA 1HUQA 2Q3HA 3CKLA 3D8BA 1Z6XA 3ND8A 1E9DA 4C0AC 3AVQA 4A36A 1KOFA 2XNDD 2IYLD 3F5FA 2ORVA 5F9FA 2F3RA 2O52A 2XITA 1COWD 2ZR7A 1QBKC 2KBEA 4FN5A 1KDOA 1P2UA 2NOAA 4PPGA 1S1CA 2YOHA 3B9PA 4FMDB 4ZDJA 2BJVA 2OCAA 4LBYA 3T1QA 1W1WA 1UAAA 3QKTA 4YDSA 3U4QA 1DVRA 4BZXA 1YKSA 4AKGA 1SVSA 2WPDD 4M1OA 1R0YA 3BJIC 4XSGA 3RAPR 4W5WA 4B71A 4HAYA 3KDSE 3O8CA 4Q21A 3G5UA 4KJZA 3SR0A 3NBXX 3GJXC 1XMIA 1A7JA 2AXNA 2F1HA 4NKRA 1CEEA 2OHFA 1AS2A 1E99A 4Q7JB 1KNQA 1TADA 2J0UA 5FBLB 1MKYA 2FEMA 1XD2A 3B85A 4DVGA 1E2EA 3UG7A 1OH6A 4UXJA 1ZYUA 2QBYB 3RS0A 2WJIA 3EASA 4JVMA 2YKGA 2GJSA 5LPNA 4IXNA 4MYTA 2G9NA 1N0VC 4DDVA 3LLMA 4A9AA 2JLUA 3VR6A 3H1TA 5FTKA 2GZDA 1JXOA 1JI0A 4M9XA 3TW4A 3PUZA 2IHYA 3KFVA 1ESMA 1VG1A 3TVDA 1YZQA 3NEYA 5H8WA 1FPMA 1CF4A 3BH7A 3L2OB 3AKDA 1ZNXA 3RC8A 3C41J 2ATXA 4NYIQ 3QKUA 3TSZA 2JGNA 1LW7A 4NYJR 2BV3A 1GP2A 1E1QD 4JT4A 2JJ1D 4M1WA 2CLCX 3SQXA 1AJEA 2BJWA 4LHYA 5HZHA 2IUTA 5LB4A 1X8KA 2HT1A 2H5EA 4M2LA 4CVNA 3EPJA 4D4LA 1ZM2A 1E0KA 1Z28A 2AN9A 1TEVA 3A58B 4HDCA 4HLCA 3L8ZA 4JLPA 3CNLA 3K0FB 3HU3A 4V0MA 4CEIA 4A6PA 3OEEA 4BWYA 1IJFA 1IHUA 3NBZC 2D3WA 2PT5A 3QXCA 4N3NA 1R0ZA 4Q1DA 1J2JA 2ZSFA 4FMCF 4DCVA 2JATA 3QI2A 2O5VA 3K0AA 3T61A 1KNXA 2ZITA 3B2EA 3ADBA 4GRAA 1RKBA 3BK7A 3OHMA 4C0KA 2OUKA 4CEHB 1HV8A 1OF1A 4B47A 1X6VA 1RJ9B 2QNRA 1I4LD 3GEIA 1VCMA 4BFYA 1LB1B 1ZU5A 1E2QA 2L0XA 5P21A 3RSLA 1NL3A 4JYBA 1SHKA 4GPTA 1B0UA 3P4YA 4LBZA 3IO3A 5DH9A 1HT2E 5JJLA 4JMPA 1CBUA 2GNOA 2JDID 5G3ZA 2IWRA 2P3SA 1S3SA 3WMFA 3ZIAD 3QSYA 1BOFA 2Q21A 3GEEA 1QHYA 4FINA 1AN0A 1XNJA 3CZQA 4YDHB 3W3ZB 5DISB 1IOZA 4JLOA 4X8LA 4DDUA 1Q22A 3U5ZB 2A5DA 4RZXA 2ONJA 4LJ4A 5GJCA 4YXWD 4EQ6A 3UMFA 2WWGA 4YMSA 4A0HA 3BWDD 4TWZA 2RHDA 1R7RA 3CF0A 3NTUA 1JEEA 4BLTA 2J3EA 5E3HA 1N6HA 4QG7A 1NMZA 1TUEA 1VYUA 1W7AA 4LJ7A 8OHMA 1KI8A 4MITA 1M2OB 2H18A 2X2EA 1E79D 3VX3A 1N6OA 2V1XA 5E95A 4XWAA 2QENA 5DIFA 2WM9B 4ZDWA 5HCNA 4AY2A 4QBGB 2WOOA 2FN4A 4AK9A 4LJ9A 1ANKA 2OAP1 4DT1A 4Q7KA 3TQCA 5HCIA 1WQ1R 2WWWA 5DO9A 1XXHA 2OAQ1 4JLMA 2ZJ2A 2YZ2A 1YR6A 1UEJA 2A5GA 1W36B 2AD5A 1N6PA 1U0LA 4A8JC 1G3UA 4ZCLA 2B8WA 1KI9A 5B2ZA 1Z47A 3V4RA 1N3BA 3MSXA 4TYNA 4XD7D 3RWOA 4LGMA 2QI9C 5IK2A 4B35A 3R9XA 3W6NA 4PX9A 3F0TA 4M4SA 3VKGA 2IYQA 1YR9A 3O8RA 2IS2A 5AWFC 2DB3A 2G1JA 2WSSD 5J4YA 3OEHA 5HPYB 4Q9KA 4US2R 4Q03A 2XZOA 2IS1A 4BFTA 1Q0UA 4QXAA 1T0JB 3KKPA 3GLFB 4HLQB 5KOYA 1GWNA 1T6NA 3CRRA 1KAGA 4C9BA 4EPVA 4ZKDA 1E2GA 2QP4A 5AJWA 3AV0B 4IFEA 4A4DA 2F1IA 3EZ2A 1US8A 2QSZA 5L3RA 1P3JA 2ZJOA 4KBFA 1ELOA 3VNVA 3HDTA 4GI7A 3DKVA 5FTMA 1XXHE 3LW8A 4DCSA 3ICEA 3WRYC 1KSFX 1T8TA 2BBWA 4Q1AA 4UQOA 3I5XA 3AM1A 4TQ9A 2Z83A 4B3FX 4LYHA 3TUJC 3BFKA 3NHBA 4DEXA 1ZIOA 1TQ2A 1KSHA 3P4XA 4HB3A 3ZIAA 4C0SA 4B32A 2UKDA 3KKNA 4C0QC 4X8OA 3G82C 4P4SB 1H8EA 4NDZA 2GJ9A 2QL6A 4ON9A 3ADDA 3ZYCA 5FL7D 2HF8A 1HY3A 4QJ4A 4BRWA 2IYRA 3A1TA 3K70D 1XRJA 3QBVA 1E98A 4Q5IA 4CW7A 1M7GA 2ZRIA 2CHQA 2KB0A 3RS4A 2JLQA 5KDLA 2ZQ5A 2EW1A 4NBSA 3U3JA 2KI5A 1KK0A 2WIAA 1I2DA 4M21A 2ANBA 4P32A 2QP3A 1G3QA 1DTSA 4TMXA 1KI6A 4UJ3A 3GP8A 1CR1A 3FTQA 4GOXA 1KO1A 3PVSA 4FIDA 4OL0A 4WW0A 3FVQA 3OEED 4RJLA 3VR2A 2ZJAA 3TRFA 1CJUC 1G18A 5TB5A 1JPJA 1NN3A 1PLLA 2HXYA 4IDPA 4TN1A 3K0FA 1MR3F 1K5GA 4ZPXA 4TTQA 2JCSA 3KQLA 4MUAA 3GJ8A 4GFDA 2WHXA 4M1KA 2XAUA 2YC2C 4TL7A 5TY0A 4D4JA 4EPTA 1SXJC 3ZD6A 4Q4LA 4US1R 4DRZA 3LBNA 1DG1G 3ASZA 4N0EA 1MO4A 1KTVA 3I73A 3C8UA 3PENA 3RANA 1W2GA 2IEZA 1E1QA 3KL4A 1NVUQ 4KYUA 2NPFA 3RS3A 1T5IA 3OZXA 4DXAA 5K8TA 3CX8A 4ESVA 1NG1A 5FBVB 3I5YA 2FH5B 3NH9A 4R71A 4YLGA 4DUGA 2W2XA 1BYIA 2V4ZA 2OM2A 2J5XA 3GFOA 4MYUA 2GEVA 2VIIA 3WYAA 5EE0A 2CVFA 5BWMA 1LVGA 1KYIA 3WMEA 2FGJA 3QY0A 5EE9A 2Q9BA 4BPBA 2Q0HA 4TT3D 4ZI2A 5JHGB 1AGRA 2W2VA 3PITA 4KVGA 2A5FA 4GMDA 4M22A 1PLKA 1A4RA 2IA5A 1EFRD 3Q9LA 3TIFA 4GDFA 2HDNB 4DKXA 2ZS8A 2J0QA 1G16A 1FQJA 4JSTA 2R44A 4LDJA 4QHTA 1KI4A 2PX0A 4EPRA 2NPIA 4HZIA 4NCKA 4ARZA 4BECA 1UJ2A 1JR3E 3LO5A 5DI3A 2JLVA 1IN5A 2JIZD 1E9FA 2QUZA 4XH9B 3KJHA 2H57A 4JJKA 3TMKA 3WYFA 2QAJA 3TK1A 2BMDA 2IF0A 2ZXUA 3TVTA 3K70B 4U02A 4DLTA 3EA0A 3E2IA 1IM2A 2ORIA 2Z43A 3AVOA 3FGNA 4XTRA 4MDFA 1PLJA 4E07A 4PHGA 1ZU4A 1FMLA 3AKCA 3ADCA 2K5UA 3MUFA 4QRHA 5KSPA 3T35A 1SXJE 4OI1A 3OE7A 2RAPA 1X3SA 4QM7A 1E1RD 4LJYA 4D0GA 4MRPA 1VDZA 1Y63A 2ZIAA 4L9SA 2G6BA 4DZZA 2W00A 2C5LA 3HP1A 4AYXA 4B2PA 1FNNA 1EFUA 1KK3A 4FMBB 3TKLA 1TF5A 2BCJQ 1XEFA 3W5JA 3Q7PA 2OEPA 3TLXA 1XPOA 2V55B 2WTUA 3CIOA 2EFDB 1XPUA 1ETUA 4G5OA 4Q66C 1X86B 3MCAA 2V1UA 1Z8FA 4BRUA 2QPOA 4R2IA 4H9GA 3QKSA 2O8CA 1G4UR 3H4MA 4JT2A 2ZRPA 4KFTA 1GIAA 2R6AA 3RABA 4KBGA 2IXFA 1UBCA 4U5XA 2EYUA 2WBLC 3DMNA 3IUYA 2O8CB 3W34A 2BM0A 4KVAA 2DFTA 2DWOA 5CK5A 1E9EA 1YQTA 1MH1A 3OF5A 4LHVA 2HLDD 5HKKD 5JSZA 3AVPA 3TE6A 1EESA 1D2EA 2IS4A 2EWWA 2OXCA 4V0OA 1G3IA 4MKHA 3KQUA 1OJLA 1L2TA 1E2FA 2GETA 5L3QA 3OIVA 4FMDF 3I1FA 1RIFA 2C9YA 2VBCA 4HLUC 3QPWA 4QBHA 4E09A 1U98A 1WBDA 1SVOA 1QHHA 2IYUA 3B1VA 1VTKA 4YMUA 5LD2C 2QTHA 3JZAA 5L3QB 1ZW6A 1U9IC 2RGDA 4PTLA 5EXXA 4XWOA 5J4HA 2ZI7A 1UKZA 4TMTA 1VHLA 2ZJBA 3SOPA 1E69A 4Q1EA 5IT5A 3NC1C 1FOEB 3FMIA 3O47A 4F92B 4DSOA 4GP7A 4O2LA 4F38A 1J99A 2A30A 3WRXC 1G64A 1CJMA 4HAXA 4E5UA 2JJ8A 2HT6A 4OHXA 2J41A 2WWIA 4RCZA 3WNCA 3DVLA 2RGNC 4RZ3A 1E4YA 2OFWA 3TSWA 1QHXA 1TU3A 5A5GA 4G1UC 4BLPA 1G7TA 4LCBA 4JL8A 1W0JD 4LOAA 4NMMA 4TMVA 4Z8YA 3RRMA 2GKSA 4B3DA 4Z54A 1WF3A 5G3YA 2P5TB 4ARZB 1Z83A 3HU1A 4DSUA 2AX4A 4NCJA 3RNLA 4DLSA 1I4TD 1NVVQ 3P32A 3QVUA 4V0NA 4EQ6B 2REBA 2FNAA 1RRPA 4CT5A 3AVYA 2WJYA 3MMPA 1ZINA 2QAGC 4XTCS 5E7JA 3A36A 2E87A 2GTPA 3NDBB 4PQFA 1ZD1A 4X8MA 1YRBA 2DWQA 3NIBA 1EX6A 2WICA 4PQRA 5EE5B 5C4GB 4BLOA 4DT1B 3WHLA 1P9RA 4B43A 2A5JA 3CW2A 4Z1MA 2YWHA 5JJKA 2CNWD 2ERXA 2NZ8A 3QXHA 1J7KA 3SJZA 4Q4AB 4Z8XA 1JXMA 4FMCB 1Q3HA 4QM6A 2FJUA 1TNDA 3DDCA 1TAGA 3N2IA 3D7MA 1KO5A 4R7ZA 1U8AA 2O8DB 1Z0AA 3KKMA 5J5CA 5B57C 5J4VA 4Q4HA 3QQ5A 2N46A 4KODA 4NP6A 4BEJA 5JWOA 1LV7A 1T8UA 1NMYA 2EU8A 3HPQA 4BFWA 2B7CA 3SHWA 3RLFA 3KJGA 3ZVLA 4II7A 1Q1ZA 2GJKA 4C0HA 3I72A 2FPMA 1VCNA 3QKSB 1RRFA 3VHXA 5EP3A 1KI7A 2KSQA 1PV4A 1DAHA 2G1KA 4PC1A 1IN6A 4Q9IA 1GRNA 1D8TA 4AG5A 4EPXA 1VPLA 1JQJC 1JNYA 1VIYA 4OI2A 3PEVA 3AVTA 1G8FA 3KTAA 1UKVY 4HDOB 1TX4B 4FWTA 1E9BA 3IGFA 1G5RA 3AF0A 1GKYA 2JA1A 3GLIA 1Q21A 2IF2A 2C77A 2QEQA 4KFRA 2P0EA 3T1TA 4D82A 4G01B 1XD2B 1XMSA 3BH0A 2WWXA 4U00A 3ZZ0A 5FOWA 5FPYA 2DFKB 1R6BX 1R5OA 4QHYA 1HURA 2H92A 1L8QA 2GVZC 3BERA 3OAAD 2A5YB 3CPJB 4IDOA 1RYHA 4TLDA 4PC6A 4FCWA 2JLWA 5KO2A 1CR4A 3MFYA 4TLEA 1F2UA 2ZRKA 2PLRA 2FDCA 3VNUA 4D81A 3D6TB 5SZIA 3AP2A 1SHZA 2P6UA 1R8SA 1NN1A 2ODBA 3CNOA 4HZUA 3UIEA 4JBXA 5M04A 1ZJ6A 2QT0A 1E79A 5AJYA 3UATA 2QRZA 4YMVA 1GZSA 2BOVA 3CF2A 5JHHB 3NC0C 3AUYA 4LSGA 4B6EA 2XOKA 4ZI3A 3AVVA 3LBHA 5CYOA 1NBMD 1US8B 2ZANA 3IPYA 1G1MA 1G8PA 5JWHA 2J7PA 4PC2A 5CIQA 3LBIA 1JBKA 1E4VA 2I4IA 1TPZA 4TLAA 1FP7A 4CRWB 3UPUA 2GILA 3WNDA 2C2HA 4MGZR 1IXZA 3B1YA 2AD1A 4YMTA 1ZM7A 3SHFA 3FMFA 1DBSA 3GLFA 5H1YA 2ZUBA 3C5HA 1CRPA 3TW8B 5AJVB 1J90A 2VEDA 5J40A 1QHHB 1D6JA 4I1SA 4BFVA 5CJPA 2ZUCA 4Q9HA 2B92A 4TMZA 2CK3A 4OI0A 1ZP6A 1AQYA 5DN6D 4JYCA 1KAOA 3IBGA 4LYAA 3KKQA 3VR5A 1W4CA 2RGCA 3ZVRA 1XJQA 1EGAA 2ASEA 3X1XA 4UJ5A 5CLLA 2GXAA 2WJGA 3GFPA 4JVSB 1XPRA 2G88A 4B48A 1ZM4A 2W6JD 4HSEA 2H8KA 1CJKC 4Y0VA 4AIIA 3QF4A 2C03A 1E3MA 3WXMA 3BB3A 4L15A 2QRNA 4A1FA 5EXTA 3U6KA 1A1VA 2QU8A 4PSVA 4YC7A 1ZUIA 2ZM5A 4WXRA 1JJVA 2ZU0C 3RHFA 4LY6A 3GLFE 2JDIA 3ASYA 2CNWA 2MMGA 4LC1A 2DFNA 2ZI4A 4Z1MD 1CS4C 1DO0A 1DE0A 3TQFA 1HT1E 3LD9A 4UXIA 5EE3A 2WOJA 4Q7MB 3SU8A 4EDHA 5BXQC 3EIEA 4OI4A 4B2LA 5JI3E 1C1YA 4M1SA 1GNPA 1Z22A 2IXEA 4C2UA 4LJ5A 2BBTA 3I4LA 1IJEA 1UDXA 1NJGA 3EA5A 1D5CA 4AG6A 4RD6A 4FCVA 2VSXA 5E7MA 1OFHA 3CX7A 3IIJA 4CF7A 2J0VA 3OIUA 3RDPA 2EVWX 4B44A 1N6RA 4CGZA 2YV5A 1XJCA 2FSHA 1IN4A 2GBLA 2ZU6A 5C1BA 3VX4A 3S1AB 4ZKEA 1FMJA 1XEWY 2UZ3A 3K09C 4LZZA 3SFZA 4HB4A 4OQFA 4BEBA 1T4GA 2AR7A 2V7QA 2VSOA 4V03A 3BC1A 2ZREA 4OQMA 4RD1A 2JJ1A 4LC0A 5F2EA 2WKRA 3Q5DA 2GEUA 2RGEA 2W6JA 2ZE6A 2JLYA 3GJ4A 2F7SA 4B3BA 1UKYA 4JIMA 2BM1A 4JBWA 4ZCMA 3IQWA 1XTKA 1L7VC 5JRZA 4LBVA 3VKHA 3KX2A 3GLHE 2Q3MA 3NBYC 2RGAA 2MMCA 2ONKA 4RZUA 1II0A 2WMNB 3NH6A 4D6PA 5DN6A 2ZRAA 5L3SB 3W90A 2XXAB 4URWR 4C30A 1U94A 3TUIC 3GJ6A 4YQFA 1T0HB 1PZNA 2WMOB 1GNRA 3D3QA 4EJSB 1E2DA 4OHZA 3SE0A 4AD8A 1S1MA 4V02A 1X1RA 3GMTA 5EXPA 1J8YF 1NF3A 3WMGA 1N2CE 4A0RA 2BEKA 3OESA 4QFMA 2RKOA 4NYMR 1G5PA 3L0SA 2VP5A 4EPWA 4JBYA 1R2QA 1OXUA 4ESHA 2ZSBA 5JSZB 3FDIA 2R6GA 4LHWA 1IY1A 2PX3A 3SYKA 4PSKA 3GLGA 4MRNA 5TDHA 3V4FA 4PANA 4A0FA 1QRAA 2CE7A 2QGZA 621PA 4NYJQ 3JVUA 4BUJA 1WB9A 4B34A 4EKDA 1QZXA 2HJGA 1LF5A 4TTRA 1RPZA 3GLHA 2D62A 4ILEA 2ANCA 1DAKA 3FKSD 5LDDC 2CL6X 1OH8A 3EC1A 3SQWA 4PXAA 4QOSA 2A3RA 5FOXA 5FUWA 4OQXA 2ZE8A 5SZHB 3SZRA 2ZYUX 4AYTA 3EPKA 4XOIA 3QKRA 2OESA 4IXMA 1XP8A 1E2HA 1KK2A 1SXJD 1FW6A 4M0LA 4QNMA 2GF0A 1P9WA 1GNQA 5CJ2A 3L0PA 3OAAA 1Z6TA 3I3SR 3IIKA 1RFLA 3EPLA 4IOMA 1U9IA 4G5SA 4EUNA 1XWIA 3P26A 3U4QB 3LAWA 4DHEA 1II9A 2FZ4A 4M53A 1XMVA 2GESA 2ZRHA 2CL0X 2QY9A 2GVDC 3DOEA 4I81A 1JECA 3CWQA 3CZPA 4BZQA 1G6OA 1KJYA 3W5IA 1A2KC 1KDRA 2GK6A 3LFUA 5KNDA 1G5TA 1XEWX 2UZIR 4P4SA 4QGAA 5L8VA 2GWHA 3GD7A 1GAJA 1W5TA 2JIZA 2GEDA 2OG2A 1G3MA 1GRRA 4NU0A 1JAHA 3I8XA 3VU9A 1U81A 4D2IA 1TQ6A 1VG0B 4H1VA 2QG6A 3FFBA 3GEHA 4B74A 1F5NA 4S2EA 4G5GA 1R10A 1Q57A 3K9HA 5KU1A 3VU9B 3SI7A 2OBMA 2W6IA 4B3GA 5FBWB 4BLQA 3U61B 4R2HA 4TT3A 1MABA 2ZRFA 2CMKA 4BFSA 5FI0B 2PT7A 3SDZA 4ERNA 5JMTA 2QMEA 4EFMA 4X8HA 1M7HA 4NZYA 3B1ZA 4F93B 2N42A 3QEOA 1OIVA 4AYWA 2YJTD 3TAUA 2CEAA 4B3CA 4DCTA 4DSNA 4XJXA 2P65A 3EX7C 4PAOA 2C8VA 2H17A 5D3QA 3L82B 3QXXA 2VP2A 1OE0A 5DHAA 1Q3TA 2G0TA 5FOUA 421PA 4D4MA 4I4LA 4LJAA 3SC3A 1NVWQ 3ZS9A 1BYUA 4OK6A 5EXSA 2QMHA 2GJ8A 4Z51A 1PJRA 4HATA 1KSGA 4QKQA 1W0JA 1DADA 5JS8A 3AF2A 4TSFA 3DOFA 2AK3A 4JLBA 1M7BA 2ZS9A 4LJ8A 4URUR 3RWMB 4EFNA 1EFTA 2LKCA 3EAQA 5HZKA 1P72A 1UBEA 1CJTC 1Z0JA 4TSFD 3VMFA 3O8DA 2XSZD 5EP1A 4HAVA 1CR0A 3FPAA 2EYQA 3SBDA 2VHCA 2VP4A 4BE7B 4DLVA 3ZJYA 4C3ZA 4EPYA 4FWIB 1WA5A 3R7WB 4TYWA 1E2JA 1SKYE 1E96A 1NN0A 4BFXA 3P27A 1F2UB 2QMUA 4Q9JA 1G291 2GXSA 3MG9A 3PQCA 2BHRA 4MRSA 4C4PA 1ZNZA 1GRQA 2WWHA 1R0XA 3W6PA 3R7WA 3K0CA 2GCNA 1OXSC 1VMAA 4RFVA 2ZETA 2OFOA 3AVUA 1NKTA 2XJ4A 1C4OA 1DELA 1IN8A 4BASA 1KGDA 3IKJA 4MUBA 2WV9A 4E03A 2JEOA 1QHIA 4F4JA 5FL7A 2ZR9A 4CEIB 1FTNA 2FSFA 1NNEA 3NBFA 3PEYA 1HA3A 2GK7A 4RSGA 2PZGA 1Z63A 1GKUB 5E4FA 5C2JB 1NKSA 2FGKA 2HLDA 2FMXA 3X2SA 1VYVA 2FOLA 1A2BA 1YZLA 4G5RA 3TNFA 1WCV1 1MO5A 1BIFA 3IDQA 4BLSA 4PAQA 4A0GA 4ZO4A 4LHXA 4FI3C 2Q3FA 1NI3A 3REFA 2O8DA 5F9HA 1SGWA 1E2IA 4KAXA 2XZPA 3K9LA 2NIPA 3EZ9A 4RD3A 4EJSC 2RHMA 5AUNB 4HAWA 4DCUA 1P7CA 2ZRDA 3DL0A 3JZMA 2WSSA 4IW3B 2Z4SA 4M1YA 3FOZA 3LQRA 4LK2A 3LLUA 2D74A 3MWLA 3KQNA 3X1DA 1PVOA 2ZSEA 1G17A 2ZJYA 1ZUNB 1WRBA 3CUEF 3ZQJA 1Q1QA 1T3LA 1KIMA 1OXXK 2P67A 4PO8A 3PFIA 1KO4A 3UMSA 3OE7D 4LV8B 4C0LA 3AVXA 3EWSA 4UKDA 2O0JA 3TR0A 4V0LA 3KQHA 1NMXA 3MJHA 2IUUA 1IN7A 3KXLA 1J70A 3X1WA 3NVAA 1NJFA 5CB6A 4TLCA 5DGXA 2QTFA 1I2MA 2KJQA 3KB1A 1I4DD 3ETLA 1E2KA 1NLYA 3UMRA 1X8LA 4MYCA 1ZVQA 1A5TA 1NP6A 4KI0A 2J1LA 3DPUA 2CJWB 3E70C 4A15A 1Z07A 5JCPA 2CLDX 1UADA 2F6RA 4KU4A 4UNSA 2AKAB 2VHJA 3A8TA 1DAGA 4MGYR 5ELXA 1HQYE 3MWYW 4LX0A 4AI6A 3MWKA 1GOTA 3GLIB 2YYZA 1YVDA 1G8GA 4TL8A 1O87A 3U2QA 2ZR0A 1N5JA 2NZJA 2I1VB 4AURA 1GVNB 2CHGA 4D4KA 1OB2A 5TARA 1II8B 1UPTA 1NY5A 1A82A 1KKMA 2OCBA 3LA6A 5JZVA 2NMVA 5FPHA 1KZ7B 1OPXA 3Q5EA 4LV6A 4PPFA 1KI1A 1E2LA 3DZDA 5FUVA 2HXSA 1ZUHA 5FOSA 1S2MA 2QPTA 1MOZA 3U3KA 3VQTA 5KDOA 2JJ2D 4URZR 5CDFA 5GVRA 5DE3A 4JL6A 4ACAA 3TUZC 2WKPA 3CRW1 5BQ5A 3CONA 3AF3A 2H16A 4TYQA 5FBQB 4A8JB 2GF9A 4M1TA 4XIGS 2WSMA 3BS4A 2REOA 4KLNA 4BLRA 3K0EA 3FKQA 4UNNA 1MABB 5EP2A 1G3RA 3PG5A 4WZBE 3UG6A 5KHOC 2CCJA 2PZEA 1N5KA 1SVIA 3THOA 4TZ6A 1KZGB 1G8YA 4L5BA 4ZDIA 2VO1A 1KHTA 4IHQA 4CEHA 1UEIA 1XU4A 2A2ZA 2OILA 1Z6AA 3Q8XB 2NGRA 1XMJA 3Q72A 2ZJ5A 4EJSA 2QSYA 2EFEB 2LWIA 2V7QD 3ZD7A 2VHUA 3BB4A 4JS0A 1FTSA 3EXAA 1N6LA 1GL9B 3K70C 1W4BA 4DDTA 1QG2A 1BMFA 1YHNA 5J4KA 2IT1A 4N1AA 1P75A 1TTTA 5B30A 2ZYVX 3WBKA 1F2TA 4NH0A 2WIBA 3M4YA 4W7SA 1VHTA 4OQNA 4M1MA 1E2PA 4I1UA 2O8FA 2WWFA 1ZBDA 2XEXA 1F3OA 4ZDKA 1OIWA 5FI1B 1SULA 1XX6A 1NBME 3DKPA 1H8HD 2J0SA 3IHWA 3PCRB 4MYHA 2ZPTX 2QQEA 3BB1A 4N0DA 1VECA 1XEXB 3ZZUA 1GL7A 3VHLB 5BN5A 3AGQA 4DCNA 1N6IA 2W58A 4LJ6A 2FFBA 2NO6A 3MAAC 2IX3A 2CXXA 4DC9A 2ATVA 2CDNA 5DHFA 4OHWA 4TTPA 1M34E 3A1UA 2ZJZA 3Q7QA 4QJ5A 1EFHA 2QMOA 3HU2A 3WYGA 2HCJB 2QTVB 1N0UA 2AWNA 5HE8A 4RZ2A 1FX0A 3HR8A 4PHFA 1Q44A 821PA 3O8BA 4DLZA 4K46A 5GJBA 2FV8A 2WJVA 4GT1A 4JLVA 1NN5A 4ACBA 2QBYA 2MSCB 2P5SA 3GJ5A 5AJZA 2IYWA 4Q19A 1F60A 2VP6A 4MDEA 5FTLA 2D4HA 4PHTA 1P2VA 3F8TA 4NE2A 3M0EA 2ZRNA 1MRSA 4OK3A 2OZEA 3KUDA 3SJAA 2J7PD 3NG1A 4GZMA 1CXZA 4LI0A 1RE0A 4BFZA 3QBTA 4O2RA 3VTKA 1NBMA 2IL1A 3THXA 1EWRA 4O0MA 1OLOA 1CULC 1D2NA 2XOKD 2AHOA 3Q85A 2D7CA 1CR2A 1Q12A 1UFQA 2DPXA 3HWSA 4QC2A 5FOVA 4JLJA 3T1VA 2R6DA 4RD2A 5FH9A 4W9MC 3BH6A 1SKYB 4TMWA 4Q7LA 3ZZTA 4QGHA 4HUQB 3UWKA 2B6HA 3AP3A 4PFSA 1AZTA 4DLWA 4HZUB 4PR0A 1ZCBA 2XTMA 2ZE5A 3S1AA 1WBBA 2OXRA 1S96A 3LW7A 1R0WA 5FPSA 4S35A 4U7DA 2NO0A 2ZVQX 2RB4A 4JJZA 2CHVA 3LX8A 1ZM9A 1JQLB 4HLUA 1W36D 1KDTA 1XB2A 2PLFA 1KJWA 3JVVA 2GHIA 4HEJA 1Z0DA 4P0TA 1FZQA 1P60A 3KKOA 2N1BA 2D06A 1BKDR 3R20A 1G20E 4A2QA 5L3VA 4P4TA 1KSJA 2IYVA 5KYKA 3DHWC 2GZHA 1CLUA 3GPLA 2O8EA 4NONA 1II8A 4WA7A 2VPPA 3K53A 1GTVA 3QENA 4MRVA 4LV5B 2R62A 3A4MA 5FPTA 5JS7A 1IBRA 2ZSDA 1DS6A 2PBRA 1CTQA 5JECA 2FPLA 2X2FA 4HUTA 4A2PA 2E9SA 2QM8A 4DJTA 1D9XA 1JR3D 1G6HA 3R9IA 2J7KA 3I62A 1HH4A 2IW3A 1PUIA 1XF9A 3D31A 4D26A 3G0HA 2IEYA 1TUIA 2OV2A 2V3CC 2YWGA 2OE2A 1P4SA 5TV2A 4DIDA 2B21A 2E1RA 1KKLA 3LY5A 4YXWA 1XTJA 2YINC 5CM9C 5F98A 1DAIA 1U90A 2ZYTX 5J4LA 5EE1A 1JAIA 2ZROA 3FMOB 2F3TA 4RFSA 1SKQA 5EZ5A 2GAOA 3WNBA 2O0KA 2FU5C 3X1ZA 2R8RA 1E9AA 1CIPA 1WMSA 3NWJA 4A92A 5FL3A 3UK6A 4IEIA 3B1XA 3M6AA 2EQBA 1G9XA 1ZD8A 4KSBA 3CH4B 3VR1A 2G0NA 3V00A 4DIEA 3GQBA 5G41A 3MD0A 2QORA 2O8BB 3W9YA 1HE8B 4JLAA 2PJRA 1RC8A 5SZJA 2QGNA 3K9NA 5FBRB 3U7FB 2GZAA 2W0SA 3PEUA 4GSYA 1W5SA 2CL7X 1S9DA 1NLZA 4ZIRB 1AK2A 5H70A 2QA5A 3KUCA 4KSCA 1FUUA 2IBMA 3K0AB 4HI0E 1G7RA 2F1JA 3K9GA 2IC5A 2AWOA 2BMEA 1Q1EA 2PJZA 3FMPB 2QAGB 3NXSA 1L4YA 2QE7A 5C4MA 6Q21A 4DB2A 2NQ2C 2BC9A 2EFGA 2VHQA 4OQLA 3AVWA 1N25A 1E0SA 1H65A 1BMFD 5EP4A 4QBIA 1L4UA 1IY2A 5BYJA 1IXRC 4A6XA 2GAAA 2X8AA 4WXPA 3IO5A 5GJVC 3C14C 3HR7A 2MSEB 4YMWA 1QVAA 4I1OA 3N70A 2FX3A 4NTZA 1DARA 1HE1C 4RVCA 1W4RA 1Z06A 3PUWA 1R8QA 2PCJA 3T5GA 3CRQA 4E22A 4JSYA 3EC2A 5KNBA 1KI6B 4IKEA 2DYKA 4NPHA 1QVRA 2ZRJA 3IILA 1F48A 1DAFA 1E2MA 4HB0A 2OCYC 5ANRB 3WHKA 1G8HA 3SYNA 2XGJA 3CWZA 4HDQB 2H7VA 3RRNA 2CLSA 2ZJ8A 3QEJA 1MO6A 3SN6A 2GCOB 3W8RA 3F3YA 4MH0R 1DOAA 1W44A 2IHBA 3RVBA 4PO9A 3BAFA 5CLQA 1LY1A 1R5NA 4JLNA 3LX5A 1ZCAA 1Z0IA 2JASA 3I8SA 1AKEA 5KTYA 2IUSA 2WZQA 1JJ7A 2ZEJA 3PIRA 4CEJB 2YOFA 4WZ6A 3GJ0A 4AC9A 3I92A 1NY6A 1X8JA 3CB4A 4W5HA 3BD9A 2OLKA 3T06B 2GJAA 4L8GA 5FOTA 4B73A 2ZYWX 4KFUA 1P61B 4Q4AA 1SZPA 3IEUA 1W36C 3UANA 2HJVA 1RW4A 5DYIA 4PC7A 1UM8A 3LQQA 3DEFA 5D3MA 3C15C 5EZ6B 1E0JA 1JALA 3LV8A 2Z6VA 1GSIA 3SS8A 2VP0A 1XZPA 2BVNA 4IOJA 4AKIA 4RKEA 2XTZA 3AH8A 1E94E 3EZ7A 3QG1A 4L9WA 5FPKA 4L4UA 4XVUA 1WE2A 2XZLA 2J87A 1U8YA 2MSDB 1AM4D 1GITA 3CPEA 3SJBA 1LS6A 4CEJA 1OB5A 2BDTA 1ODFA 1Z08A 2NO7A 3EIQA 4Q47A 1W2HA 1XCMA 4WOPA 1OKKA 4EIWA 2XX3A 2RCNA 4O3MA 1N5LA 5HE9A 4DLUA 3TBKA 3DO6A 3ND9A 3H0KA 2R9VA 3NEJA 221PA 2XJ9A 3OFNA 3SEAA 3ZQ6A 2WVJA 4IFBA 3HYTA 4M9SA 4A82A 4C0BA 3CM0A 1Y3AA 3KB2A 2V8OA 1Z29A 2CCGA 3LNCA 1RRGA 3SJCA 4QBFA 2LKDA 5CIWA 1G7SA 1T5LA 1E1RA 4F4CA 2WJJA 2R65A 3MRSA 4ABYA 1W48A 5F3WB 1E32A 2O8BA 3HJNA 2SHKA 2VF8A 2FZLA 3PEWA 1QG4A 4TL6A 5FUXA 2XB4A 4HLDA 3BFXA 4C2TA 1EG7A 4MRRA 2ZE7A 4G0NA 2PEYA 3U7EB 3UKDA 1S9HA 2DHRA 3GCGA 4IEEA 2JLSA 1OW3B 2IYXA 3U7HB 1CKEA 3K1JA 1GILA 1KMQA 3TAHA 4ASUA 2PZFA 1KO8A 4TQAA 1W47A 3CNNA 1RVDA 2A9KA 2HYDA 4OK5A 4Q01A 1VCOA 3LH5A 1TU4A 5KUTA 4DB4A 1WXQA 2R6CA 5AK0A 2O0HA 2QQ0A 5L3SA 2QZ4A 4TLBA 1D9ZA 4DUGD 4JZKA 3WBJA 1G7CA 2NG1A 4B6FA 3GLGB 1U2RA 1J8MF 1NVVR 2Q9CA 3A1SA 3K0SA 3U3OA 3IEVA 5GADl 4R98A 2BWJA 2YC4C 1EWQA 1EFRA 2OFXA 2VSFA 3T15A 2W83A 4FCTA 4MKIA 4QGFA 4AKEA 3U44A 4OHYA 3QXJA 1SVLA 3L0OA 4I99A 1ZM3A 2BMJA 1LS1A 4MGKR 3FB4A 4TL9A 1N6NA 2FFHA
chains in the Genus database with same CATH superfamily
2D1YA 3WMXA 3RODA 1RZVA 1MZPA 3VO2A 1UK8A 2WD8A 2K2QB 2TMKA 3GFTA 4Q18A 1AT1A 2AG0A 4LX8A 4PX5A 4YDRA 3W1VA 1C8LA 4KAAA 5DIZA 1AZSC 1BW9A 1R8JA 4CDGA 4MV3A 3ZU4A 2A7XA 6ADHA 1PWHA 1TO2E 1BCSB 3HVUA 2Q4RA 4NECA 2VHZA 3K0KA 3IPRA 4IG9A 1YA6A 4P5DA 2GD1O 4FBMA 4DSTA 1FNMA 3R9WA 5CLHA 2IK8A 4J1NA 3MOGA 4GECA 4HAUA 4XWWA 5H3HA 2VPQA 1PTJC 3E7WA 1N8KA 1I7NA 1TVEA 2E4YA 3FZNA 3T34A 2NADA 4AF8A 2CT8A 1E5TA 3DP7A 4JBHA 1JQAA 3H9UA 4AMUA 1SUBA 4L6IA 5CVTA 3U3RA 1ORDA 1VCIA 4BCCA 3OZRA 1Z2OX 1ESNA 4JYZA 3NKVA 4X1IA 3CLHA 3M1IA 3EXIA 5KNCD 3U26A 1GAQA 1V11A 2OLEA 4EO4A 3DM5A 3RUFA 1Z0UA 3KEQA 4RTOA 4R1SA 3OZCA 5I9BA 2QD1A 5WRFA 2B36A 2EQ5A 2KQUA 1T6BY 1FLDA 2P2LA 1WXIA 1HLGA 4G1EB 4ZFNA 3GLUA 2DKNA 3RIMA 1F8FA 2C5AA 2XQIA 1GCUA 2V6IA 3L92A 3P71T 5JE8A 5LBTA 1SC3A 2HRRA 1FK8A 1YS1X 2WEKA 1ODCA 4B76A 2M98A 3BRWD 1YS7A 3Q0TA 3ENQA 1B8NA 4BPRA 1XQXA 5LR6A 3T94A 2GA8A 3I0ZA 5ALHA 3LMKA 1YHYA 2DPGA 3ECSA 4DDHA 2VZLA 3OTIA 2UDPA 3KIPA 3R3ZA 3FW1A 3WV5A 2C2YA 5CX1A 1T1SA 1SOMA 1XCOA 4Q15A 4UE2A 1HNNA 1NFFA 1Y3FE 4RKWA 1NSTA 3SDBA 1EX1A 2VAVA 1UC8A 4EF4A 5TMPA 4CKWB 1PS9A 2HBRA 1M5RA 1YZUA 3ER8A 1P6XA 4K5QA 1K8YB 1NXQA 3I61A 4Y9UA 3A32A 3B7WA 4FC7A 4ZMRA 4URVR 3OHSX 4JOQA 2H1CA 5AJXA 4EVIA 1G4HA 3T9BA 1FL9A 5FR1A 3E1SA 4X65B 1YVEI 2ZBVA 3URKA 4C21A 4GRDA 5AVTA 4KR3A 2QGFA 1I24A 5DX0A 4F2PA 4PX3A 1YR1A 1ZJZA 3DM9B 1E6CA 1C9MA 1SKUA 2NO5A 4P58A 1GAEO 1R74A 1WOYA 3CZRA 3N87A 1LA2A 1XN1A 3BUSA 1DOHA 3MJRA 3QTTA 2IYYA 4XLLA 1C7FA 5D84A 5DI3B 3ZKAA 1RMTA 2QTRA 2OV6A 1O3YA 1Z2AA 2VL7A 1XTIA 1RCUA 3LDFA 3N1UA 5CFRA 4UTVA 1IHPA 2FR1A 2HCRA 2X8JA 4IDNA 1E3TA 4UOZA 1HLFA 5CITA 3EJ6A 3GYGA 3BEDA 4M7OA 1GEGA 3GH3A 2HA0A 3S55A 4EITA 3EPHA 2PXXA 3R4CA 2JFVA 4PCAA 2JC3A 3P2MA 4ZXPA 4JNCA 5B12A 3WFIA 3SBEA 4B3XA 5I7RA 1B23P 4YX9A 4TZ0A 1WB4A 4KCGA 4CGYA 1MIHA 4KWTA 1K5DA 3IB6A 1A9QA 3E0XA 3VPHA 4B4DA 4P33A 4ZAFA 1YRLA 2J85A 3IOCA 4L08A 3KB8A 1K8RA 1KMNA 3K3PA 1ORTA 1SBNE 3AF4A 5BOVA 3RYIA 3ZWOA 3LDAA 1ZAKA 2DMRA 3COYA 2I8AA 2F64A 3AHDA 3LWZA 4YIKA 1RT9A 3BT7A 3H5WA 4D8XA 1Z17A 4NYMQ 1HEUA 2PIDA 3HKBB 3QPAA 4RIGA 1XHFA 1GL3A 4UHJA 5FI3A 4QTYA 1WJGA 3NU1A 1V1JA 1VG9B 5LWHA 2FB9A 3TGPA 3DLHA 5AJUA 4BNWA 4YAWA 3QX7A 5AKGA 2VQSA 3ZY2A 2YJGA 2D7JA 3DFKA 4A8JA 1X1SA 1VKJA 1RAIA 2DE0X 1YUMA 2DWPA 3ABOB 3F6BX 1GQYA 4XDHA 5KSZA 3F74A 2M6LA 1V8OA 4W6ZA 2HPAA 1YIDA 3B6EA 3WQSB 1I6WA 2REQB 3AR5A 3GJ7A 1FDRA 4OG2A 5ALDA 5FXMA 5KVQA 5JXHA 2VQEB 4YONB 3ZGLA 4JLWA 4PZYA 3T0GA 3G9XA 3PXBA 4TYPA 3UBTA 3KAKA 3DOOA 3BSSA 3IC5A 5F7JA 3OPNA 3PCXA 3R8CA 3L8CA 1SOVA 3D3NA 3WL7A 3TFOA 1R1DA 3PXAA 1O1YA 4NOJA 1GUFA 3R09A 4Y2YA 4OYYA 5JLJA 3C16C 2X0FA 3V97A 3AI2A 2C95A 4RAOA 2D1QA 4UHFA 3HO8A 1KAEA 4CLEA 2IXAA 2C2ZA 4IF6A 4ZK6A 1IXYA 2UVPB 4QYSA 3ZXSA 3DMDA 1RKVA 1E6UA 1X9HA 3Q3JB 3WLQA 2I6GA 1X94A 4KVFA 3ZHXA 5B7NA 4QTTB 5DHRA 4LAFA 5IN4A 5B3JC 1BS1A 3NEPX 4LOLA 4RH3A 4OJQA 2F43A 3P9NA 4H35A 4MWEA 1Q14A 5DN9A 1LWOA 3V8MA 3BXOA 4D80A 5G53C 1A95A 4D9CA 2NV2B 2OCPA 3AKEA 1G9SA 1PUJA 3PNMA 4QHSA 2VBIA 5EIBC 3WE7A 2CLEB 1E9CA 2FFAA 2JH9A 4GLLA 4XM0A 2G80A 2XUGA 4NCNA 4AJHA 2AR9A 4WERA 5JBNA 4WBNB 1VRCA 1NSFA 2KWIA 3GDWA 1T34A 4YAGA 5AM2A 1JB1A 3G5LA 3IJPA 4W1SA 2I7DA 1EGQA 5LBIA 5BWNA 2XW6A 4QFDA 1H4VB 4BIMA 2AOVA 3G02A 5JVDB 4P7KA 1NIPA 1PEAA 1AGPA 3CRZA 2B99A 4J0QA 4UNQA 4ZOLA 3I01A 3L4EA 4FYHA 1P2TA 1Y7LA 1Z6PA 5KSWB 2DR3A 4LWZA 4C03A 5A4JA 1SXQA 4F3TA 1CUAA 2ZAOA 1W9HA 3BYZA 5E4YA 2J3LA 1OT3A 4F1WA 1VLMA 4LRSB 3QU5A 1KE2A 2V6JA 1JHXA 3NHAA 1RYFA 4FW9A 3GAFA 2DBYA 3CPHA 3ZY5A 3SC2A 1V4VA 1W0KA 1Z0FA 5K4AA 4O29A 1EGVB 1XSEA 2HDHA 4MA4A 1HMPA 1YZGA 5E2AA 2J0UB 4X66B 3E8XA 2AXQA 2CCKA 3BGIA 3FPFA 5HR5A 2UVQA 3G2NA 3AL0C 1DPFA 2ERYA 2FHSA 3EARA 2H7CA 2Y1EA 4JEMA 1O9BA 2J46A 2ZRBA 4MUJA 5JYEA 1T9GR 4XFDA 3ETCA 4ZMSA 1BH2A 1DEKA 4AG3A 4LS3A 5AXCA 1HYQA 2PLWA 4M60A 1OOEA 5LQDA 5JHGB 3D6JA 4D9NA 3MZ0A 2I55A 4PM4A 4GZ3A 1P9NA 2QJTA 1T5TA 2GCOA 1OFUA 4K81B 1VYTA 1RP1A 1KMHA 4EX6A 3KJEA 5CT9A 1EBBA 1N7JA 1T8WA 1Z0KA 4FR0A 4HNHA 4KQXA 5FT9A 4ASUD 4BO9A 2ZS7A 3F3KA 1WP4A 3JSAA 2VDLB 1JEAA 2QJOA 1EJ2A 3A6GA 4CCWA 5CDFE 1X7GA 3KP1A 5KPDA 4IIGA 4XRGA 1QU3A 4S2UA 2ORWA 2AJTA 2NO9A 4NCAA 1G19A 3ROFA 5LLDA 2HSGA 4A16A 1QQAA 3RLIA 1A76A 1ZD9A 1O6ZA 1EP2B 2BKEA 2FPKA 5ILOA 2QG9A 4LHZA 2R4QA 3QNMA 3E5RA 2OA0A 3SJ7A 3OA2A 3TLEA 1J0XO 1QFMA 1OI4A 1S2GA 2CXHA 2PG3A 2PGDA 2TMYA 4FCCA 3U60B 2OBLA 1HRKA 1E6LA 2YIMA 3U49A 4FFDA 3NDPA 5JWRA 1DBIA 2ZQZA 1FSPA 1GG9A 2LCFA 3OQJA 4D9FA 2BRUA 1R4AA 1FB5A 4QGGA 5EC8A 3RROA 4HN9A 5CT4A 2TSYB 4RTMA 5FLYA 3B6JA 4GOJA 4LPSA 2O8NA 4Q1BA 5TC4A 2FEOA 4AX4A 5A2QA 3D43A 2XXAA 4J4BA 2CE2X 3HV2A 4YJ3F 5KDDA 4C87A 4EENA 1VFNA 2VWGA 4J7CA 1CRZA 2YL2A 1JDBB 2PPLA 3MUOA 4PZZA 3HDYA 1P1JA 4BO6A 4BQIA 4KFSA 5EXDA 3G2MA 1ISSA 2YY5A 4MW5A 4NHEA 4EG5A 4IGFA 3U19A 2REQA 3NYRA 1NYLA 2V96A 2FG5A 4RFSB 3QLJA 1TVKA 1JAZA 4CU5A 2XCRB 5JSFA 4MJLA 4ES6A 2KYRA 4TXNA 5IXSA 3ROPA 3KSDO 2MYUA 5A02A 1INLA 1JU9A 2O2YA 3R5TA 3S29A 1DQSA 4PG5A 4WX2B 4ZCIA 3ZV4A 1QRTA 1MB2A 3JQ8A 1AQJA 4DWJA 2ZB4A 3TSOA 2IWHA 1ZLYA 2A3NA 2PAFA 3U3XA 2QW0X 4ENWA 3BE4A 3ECCA 3L8FA 5C81A 1ONBA 3OZDA 4L74A 2GN8A 4YREA 4CN8A 1DX9A 1MC5A 1PQ4A 2BGNA 4GBJA 5FORA 5SYMA 3ORHA 4ZZ3A 1BKSB 5FTJA 4ATNA 5KAPA 3C7KA 4IVQA 1W52X 3IQHX 3VHXB 3QVVA 3HEAA 3O7MA 1TYZA 4RAQA 3NTLA 4WIAA 3THYB 3R23A 3J81k 5A4IS 1OLSB 1ZOIA 4NMWA 4J90A 2J59A 1K8XB 3CCBA 3Q41A 5CGQB 2P4EA 2VXOA 2D59A 1FFCA 2ES4A 2O05A 3RQSA 3C6QA 5B58T 5DB4A 4X7RA 1FYEA 4HG2A 4IINA 2V7UA 2OCKA 4RLSA 4GBMA 4QOEA 3MB5A 1NF8A 4TOIA 1Z7BA 3ZVNA 4BNJA 5CCEA 1RU3A 2PKWA 2H51A 4TMKA 2QF7A 3KYIB 1OI3A 3M4NA 3JSXA 3B5JA 1CNFA 1P19A 1J39A 2VDUE 3W4IA 2C78A 1DC7A 4FHCA 2X76A 3A04A 2ZVPX 4R41A 4LQCA 2OO5A 2FXIA 2I99A 3JWGA 4RWZA 3WRYA 5IPFA 3KT8A 5DNUA 2GNPA 1FYDA 2ZJ3A 3VSCA 1CIJA 1U7WA 3G0DA 5BN1A 1M6NA 4EP1A 4UW9A 3S2GA 1X42A 2Q1WA 1SVKA 1LC0A 1UFKA 4DJEC 4JV5B 1NDQA 3PX3A 4Q1FA 1L7AA 2IIQA 2NXJA 3TLAA 4ZK2A 2ZT8A 4BNDB 2AKEA 2YVLA 1Z4PX 4IIHA 1SVMA 1DSSG 5EHNA 3I09A 2PUAA 1M9NA 3GLHB 2OPBA 5CLJA 4RIEA 4YAOA 1WDMA 3M2TA 3QE0A 1Y3IA 3EGWA 3O1JC 3VO9A 1BEUB 3BIFA 3LVRE 1FDUA 1YRYE 2I2BA 1SIUA 3RTGA 2Y67A 4OBBA 1GNLA 3EDOA 2HOQA 2WPDA 3HRIA 2BAGA 1V5WA 4MEJA 3WLAA 3ZE9A 1UKEA 4KYTA 4O08A 1M5UA 2VA8A 2ZRCA 4K86A 3KD2A 3FRHA 2WC1A 3OIDA 4GX0A 1A88A 1B6SA 1XZFA 2TMGA 4HB2A 1AA9A 2JGRA 3MS7A 4QFBA 1E1MA 1BE8A 4WZBE 5DGTA 1QP8A 3P2YA 4Q48A 4DLXA 2YNMA 2XGSA 3BKWA 4PC3A 2JFOA 3ON5A 5NLLA 1RTTA 1SB8A 4N3GA 1ZIXA 5K0LA 5I45A 2F9MA 2IEGA 2WSIA 4ZZIA 5B4TA 3C8HA 1LJ8A 1CUYA 3E9QA 3AIOA 3ELDA 5GTDA 2COUA 2XUJA 4KUGA 1AMOA 3DLBA 3ANSA 1ZRSA 3R44A 3C6XA 5MDHA 1W76A 2P8SA 3QG5A 4C0JA 4HY3A 3PRHA 1OLXA 2VYND 1M1YA 3CC8A 2HUPA 4FFVA 4PGMA 5KBYA 3U56A 3PR1A 3KZMA 3OMWA 4FYPA 4YFVA 4K6FA 1KY2A 1TA9A 5CB8A 3ABQB 4KV9A 3TOSA 2JW5A 3QMWA 1O95C 2VP9A 5FNZA 5FR2A 1RXIA 1TA4A 3EDRA 3LOQA 3U7GA 2IH2A 4IUCS 4DLLA 3RSGA 1ZK4A 2Z1NA 3R7NA 1KRHA 4YN3A 4XA8A 1YCHA 5FWYB 3PD7A 3ET4A 1H2FA 1ZMOA 1TQ4A 4CMJA 5K20A 1LBEA 3LPDA 2VTEA 5EN4A 2DR0A 3AL2A 3CEPB 5HA5A 2WWYA 1N2HA 1WZUA 3GB9A 1HM5A 4KUHA 1NUTA 2QX4A 3QOWA 4R3WA 1MXFA 1TKAA 1UF9A 2EL7A 2HU5A 2Q4OA 4KK4A 3RSHA 3RJZA 3V4PB 3B13B 2GRJA 4QJ3A 2RHTA 1ARZA 1WUKS 2G04A 1IQUA 4JUCA 4OCZA 3S2YA 3GLGE 5GP1A 1EK1A 1RVV1 3AHEA 5AXAA 1YT5A 4F5DA 3V1YA 5CEEA 5FFMA 4F6RA 2H85A 2QV0A 5JMPA 4EVQA 1EJBA 5DKFA 1J42A 1IONA 4PVDA 1VB3A 1L1RA 4WLEA 1CPYA 2LBPA 2ZJ6A 4KE6A 1L4LA 5H4HA 3W0LB 4CMGA 2PD6A 3MWJA 5IVIA 5IK2D 1LVUA 4MQMA 1MJ5A 3CEMA 3N2KB 2C96A 2DUWA 4N8EA 2OVFA 2I6TA 3L0IB 4PHHA 2CUKA 2Q3HA 3D8BA 4CIYA 4H3SA 3HCDA 4IQ8A 1Z6XA 4PAGA 4CM8B 4GF5A 3BMNB 1BQEA 4MS1B 1J1UA 3SP1A 1QBGA 1Z4LA 3EMVA 3FI9A 4DV0B 5ITVA 1WCWA 1TKCA 4LIPD 2ORVA 4REOA 3TEMA 2J33A 4EW2A 2XITA 5AW8A 2AA3A 1NI4A 3ME5A 3KRTA 1LLCA 4XAQA 5A5FA 1O96A 1P2UA 3DA8A 3OX1A 4O2AF 4AN4A 1KTIA 5CW2A 4FMDB 5LQMA 1BX3A 5ICGA 4LBYA 3Q0IA 3OU2A 4MUEA 2EDCA 5ES3A 1KAMA 2F00A 3A9TA 1VLHA 4UM5A 4P7JA 1XT6A 4WD3A 2EBHX 3DLAA 5F5XA 3OM8A 4KGDA 4ARSA 4TV8B 4M1OA 5AQ1A 4DGSA 2ZZMA 2BKVA 1UPCA 4XSGA 2H2WA 4G0MA 4NZPA 1AUVA 4FFRA 3SR0A 3GA0A 2CB9A 3H0CA 3HCAA 2QRGA 1NA5A 2NYRA 3PE6A 4TVBA 4TRRA 1K7EB 1QV7A 4BKPA 4CFSA 2E5WA 4HH3C 5I7FA 2GN4A 4M0DA 3NHUA 4NKRA 5JSQA 4BMDA 4DG5A 3LY9A 2NW6A 2YZ7A 5F76A 2ZAYA 4ENSA 1J49A 5C5CA 5LZ8A 1HYGA 4MI3A 1WZIA 3ZIDA 5FBLB 1O96B 3VNSA 1YL6A 2QUIA 3T99A 3B85A 4QYIB 1OXBB 3PGKA 2WLSA 2JD2A 4PGAA 1OH6A 1ZYUA 1ZGGA 4X1YB 4KAFA 1E5VA 4LRXA 2VPWA 4J91A 1L4HA 4G97A 2HU7A 1XMOB 3VPDA 4W8OA 1GPAA 1BU5A 4GM0A 3LQYA 4MYTA 2G9NA 4RWEA 3CF4G 5I9IA 1CQZA 4LZPA 5ECWA 2OC9A 3GPIA 2R6JA 1R88A 3G79A 3OQNA 2GZDA 4CKZA 4MNTA 2OYRA 1FDWA 1Z13A 2IHYA 1N7GA 1WU7A 1AXGA 1ZPDA 4LQLA 3RUEA 4E46A 4F7DA 1YZQA 1CUCA 4M8LA 5H8WA 3K0HA 5DW3A 2ONYA 3GRVA 1IHYA 4W7HA 1ZNXA 1LQ2A 3RC8A 2ATXA 1HBJA 2FZGA 1CEQA 5TNXA 4NYJR 5LA6B 1GP2A 2P1RA 2PS1A 3K4PA 4R8SA 2CLCX 4EA6A 2XUHA 1AJEA 1GZ5A 2C4WA 5HZHA 3QLUA 1PL8A 1WL8A 1Z36A 4D3ZA 1A9TA 2AI1A 2KLHA 4KPEC 2HT1A 3D5EA 1P1CA 2H5EA 3SMVA 2XTAA 1B41A 1I5OA 1PK8A 1BFKA 4OJTA 1K4KA 1T1RA 2FDRA 2AN9A 1TEVA 4JLPA 4L9AA 3RFFA 1C14A 3K0FB 3ZWCA 4OHPA 2F4NA 3OEEA 3VHQA 4EHIA 3ESCA 3L05A 3N53A 3KKZA 3NBZC 5JROA 1HDIA 1VM6A 1VJRA 2XYRA 4DNXA 1R0ZA 2O2HA 1CY0A 4RV9A 2HF7A 2OSVA 3TB6A 3WGUA 3ITDA 2JATA 1P8JA 4YBRA 1NBEA 2AOUB 2P1DA 1VE1A 2R11A 3TZEA 1KNXA 3ZY6A 2QOEA 3HCWA 1BVYF 2ZITA 3O9ZA 5E1BA 1P2BA 3JASA 3ORFA 3BK7A 4LQDA 1EFLA 2Z4TA 3Q6IA 4XB6B 2NLOA 4MW1A 2J48A 1LZLA 2AN1A 4HJRA 1C7EA 1I4LD 2QVLA 4XW2A 4BFYA 2P9BA 1E2QA 4G63A 3A3NA 5P21A 3M4JA 4NV0A 3QWFA 4RMGA 2PY6A 4JYBA 4L1KA 5IMBA 4LFCB 2I29A 4YRAA 1B0UA 4HWPA 5LUBA 5LQRA 2IHNA 5LUAA 4B8ZA 3IKLA 4DLPA 2NSHA 3P9CA 1CBUA 2JI4A 1R66A 4G9GA 4GPEA 4JMPA 3WICA 5JQGA 4ZEOA 4C05A 2QT9A 1SXPA 1MJNA 1N2ZA 2JCVA 2JG3A 4GPIB 2Q21A 3I12A 1LXCA 3GEEA 2V0GA 3UTDA 4YDHB 3JQPA 3HCOA 4JLOA 1OZ0A 4NPAA 3T5BA 4K87A 4G8DA 3QVKA 3N0VA 5LZ5A 3BK1A 3PWSA 1NYTA 3UAZA 2R4TA 4LJ4A 5K5EA 3FZYA 2R1UA 1T6ZA 2V7XA 3AC0A 1WMBA 1FEZA 3F9CA 4MYSA 4P6VF 3BWDD 3K5WA 5THQA 1DCTA 2RHDA 1J8FA 1G8MA 5B36A 1MENA 2C94A 3EAFA 2C0PA 2IOFK 2R7NA 1V16A 3FCOA 3KU4A 4RIHA 4Z9YA 4D96A 8OHMA 1KI8A 2PFSA 1JIJA 1M2OB 1QPBA 2R6ZA 4H4CA 1NR7A 1N6OA 4TV9F 1UZUA 3D6AA 4AY2A 1N2BA 5DWVA 5DCUA 5EEHA 4QBGB 5SYAA 3ZU2A 2WOOA 4X63A 3FBGA 2PTGA 4UUPA 4LJ9A 4FT2A 3AEYA 2O2IA 4Q7KA 2WWTA 3TQCA 5DM4A 5DO9A 2FZ5A 1XXHA 2OAQ1 4R0MA 3AINA 1AX9A 4JLMA 4GO1A 3TCKA 3JRXA 3H1PA 3N58A 4KN8A 1W36B 3HFGA 3MMNA 4MTCA 1N6PA 4IHKA 1SQSA 5A9TA 5A3SA 1NW5A 4A8JC 1G3UA 4XD2A 5B2ZA 5BMVA 4UDNA 3OOEA 1N3BA 2G5GX 4RK7A 1GY8A 5EWLB 4XGQA 4MZDA 4B35A 1JHVA 1UJMA 1RXEA 1ZRNA 2XB9A 4YJFB 4B5KA 3R9XA 2CYBA 2E1PA 1TECE 4TKUA 4TWAA 1F0KA 2IYQA 2A14A 2I6UA 3MK31 5BP7A 2XVYA 2QYSA 3K7EA 1H5UA 1COZA 3E3LA 4B6SA 2WSSD 2VWQA 4FMPA 4PG8A 4Q9KA 4PN3A 1T0JB 3NWPA 3UGTA 3E9RA 1D09A 1MU0A 1G5IA 3B9RA 4HLQB 1FXWF 5FFNA 3UJAA 1IZ7A 1JQEA 3EBLA 3E9NA 1MN6A 1T6NA 3CRRA 5CJJA 5CCDA 4YAJA 4I2NA 2C57A 4ZT3A 4C9BA 5AJWA 4NG5A 3FBTA 4RUKA 1NPDA 2ZSUA 3EZ2A 1YVPA 4IHJF 4MX8A 2J3KA 2WYHA 3HDTA 3VNVA 3FVWA 3LZDA 1TC2A 1WSWA 2HQOA 4KN9S 4YP6A 4BP3A 2GSDA 2R87A 1W73A 3TDNA 2HMUA 1YFZA 2X4IA 4UQOA 4CTJA 2CLKB 4J0GA 4A10A 2A9QA 1CRWG 1ZH2A 2NUBA 1PDOA 2VDMB 3K9CA 3TUJC 3H17A 4BGVA 4JQZA 3KOUA 4GHWA 3HA3A 4IDCA 1ZIOA 4B79A 4E15A 1W0CA 4R8MA 1MQ8B 1R4MA 1UPBA 4LJLA 3ZIAA 4JA2A 4X8OA 2WD7A 4NDZA 1RLUA 2GJ9A 3DEAA 2X5XA 3MBOA 4P4GA 1DC4A 3MOIA 2BEUA 3FNRA 8ATCA 1BDIA 1M10A 4BRWA 4ZN6A 4FM9A 2FN9A 2NP7A 2BUBA 3MXOA 5HUQA 3QBVA 4F5EA 1MCZA 1VKOA 1ZVJA 1RI3A 4CW7A 2V5UA 1U2EA 2PXHA 2V6BA 2JLQA 3RS4A 2ZKIA 3DXZA 2EW1A 3RVSA 1O6GA 4QPZA 4QO8A 4HPWA 2YWRA 4F72A 1PIWA 1HNZB 2ANBA 4GPZA 2PO5A 4E5NA 2QP3A 1Z25A 1XLVA 1G3QA 2WTAA 3NPAA 4FSHA 4R0VA 3ZHRA 3CVXA 3VZQA 3FTQA 1IH8A 4GOXA 2IVZA 1T43A 4FIDA 4Y2JA 1PJZA 3O31A 2R47A 4OL0A 1B74A 4P7FA 3OEED 3TRFA 2OHXA 1K68A 1NN3A 4JKOA 2HXYA 2G40A 2WD7B 4R68A 1WSBA 3K0FA 2V7PA 2IU0A 1MQSA 3IQEA 3ZK8A 3COSA 3OQIB 3S4YA 4XIFA 3RYIB 3PKJA 3WGJA 3KQLA 3GJ8A 4GYYA 5JMOA 2WHXA 1GZ6A 1TOAA 4ZANA 5JYCA 1Y1LA 2YC2C 4YRDA 5TY0A 2YV4A 4L5CA 4DDTA 4LFAB 2XE7A 3ASZA 4N0EA 4B17A 3PENA 4U2BA 1W2GA 3M70A 4NICA 1LSJA 4QDUA 5HIMA 3G8AA 1T26A 1KYXA 2CDRA 4YGYA 4DSZA 3HFSA 4HD8A 4ITVA 5GONF 3AWIA 3ZW9A 1T5IA 3OZXA 1CYDA 1E3QA 1A2QA 3IX7A 4KN5A 5AP9A 2W93A 1YFJA 1FC0A 2C5FA 4JB0A 5ARCA 1HK7A 5T4HA 3HQ4O 1BXRA 3NH9A 4UTPA 3GY0A 1ECCA 1G2QA 4DUYB 1RFGE 2E0IA 2W2XA 1VJCA 2R2GA 4GR9A 5IU6A 2QVYX 3C1TA 3RF6A 5AHXA 1YGPA 4GWLA 4WXEA 2NSLA 3EEIA 4ZHQA 4AWBA 2IUFA 1X1BA 5EE0A 3WYAA 1U3UA 4OGLA 4XQ0A 4H3KB 5JZOA 1J9EA 3KWMA 1LVGA 3PVCA 1H2WA 1M2VB 4HXGA 2CV1A 2E82A 2Q3DA 3RUIA 3VR2A 4DJJA 3IXMA 3QY0A 1YR2A 3VYVA 5TGZA 3OEYA 4K9OA 4ZT4A 4H60A 5IAJA 4PEVA 2VQDA 3T5AA 2LVBA 3PITA 4HRXA 3S2EA 4HFRA 2PKQO 2Y6UA 4IDDA 3M81A 1EZZA 1FRQA 1TE2A 3H5RA 2X8WA 2Z2JA 1NXVA 4GDFA 2AW3A 2EJCA 4HTFA 4KO1S 2IZ6A 1Y3DE 3RR2A 2YVAA 1RABA 3RVPA 1KI4A 3QLEA 2RH9B 3ETJA 4JVOA 5JO9A 3U9LA 4CDNA 5JJBA 3KHSA 4HZIA 5CB4B 2WUVA 1XQWA 1O4WA 3FCCA 3EOZA 2RGWA 4CM9D 2FK8A 3LO5A 5DI3A 2JLVA 2UAGA 2JIZD 2NAPA 3VPAA 1E9FA 3PD1A 3GVPA 4NK4A 4YXFA 3N2LA 4YJ2B 1RQ7A 3EGOA 4JJKA 3ZXXA 3JD2A 1HNWB 5FQNA 2I4OA 4QUAA 2Q2NA 2ZXUA 1N2GA 3LCRA 4Q37A 3EISA 4B3IA 3LQ1A 2BTQB 2RHLA 4QZVA 4ARIA 5DGCA 4FZVA 2Q49A 3K70B 4GMGA 1IM2A 3USZA 4EO9A 3TEJA 4XTRA 3WAGA 1EUQA 1SXHA 1PLJA 1Y42X 2FPOA 3TZHA 1ZZEA 1QO9A 3JQ9C 4OGKA 3ZH2A 1ZU4A 1FMLA 2W6MA 3ADCA 2P2CA 4QRHA 2ZTLA 4ANFA 2BGGA 2F8MA 3OE7A 5T3YA 2RAPA 3BPSA 4W7IA 1Z5UA 4F96A 4LJYA 3F78A 3P0IA 4ALIA 2ZIAA 4L9SA 3N6RA 2XRYA 1XK6A 4NBWA 3TDMA 3IQZA 4UMDA 1GCIA 3ZK7A 1MEEA 1JSZA 3C3KA 3HP1A 4KPUA 3L0BA 4B2PA 2XEDA 1FNNA 4J2OA 1EFUA 4FMBB 3DZKA 1U4SA 1MPTA 2C9MA 3OCVA 3NOQA 1KEZA 2GWRA 3CIOA 3ELYA 5AKYA 3UCXA 2WTUA 1CEYA 2N0SA 1S89A 1W6RA 4G5OA 2YW9A 1EDEA 3MCAA 4GS5A 3GDFA 1Z8FA 4AN1A 3RVQA 4KE9A 4R2IA 1E58A 3VYRB 1AG9A 2H1RA 5HQ3A 2VJMB 2WUEA 3GPBA 5HGXA 5AW3A 1V7ZA 1JFVA 1E2UA 3STVA 4BX3A 1RHRA 3CZ5A 4FOPA 3ZGNA 5EKSA 3EYAA 2QMZA 1QRRA 1WXGA 2I0FA 1VXRA 4U8GA 2JS7A 3E4CA 4OM7A 5K0TA 2X2PA 2O8CB 2QL5A 1F6DA 1HFJA 2PVSA 4GMHA 4KVAA 4AROA 3I9FA 4YR7A 5GIPE 3OF5A 5DXJA 5CXQA 2P3QA 2ZYIA 3AVPA 3BG5A 3E22B 4MCHA 2C54A 3RJ5A 3VVMA 1SNYA 2I4NA 3CTPA 2GZ1A 3EXHA 2OXCA 3PGJA 4QDZA 3HB0A 4R7GA 4MXDA 1E2FA 1GHTA 3OIVA 4FMDF 3I1FA 3Q7IA 1RIFA 5KX5B 1FVXA 2VBCA 4HLUC 4ZODA 4BX8A 4GYKA 3QPWA 4G36A 4RXUA 4ZCQA 1HZZC 4HO1X 4DV1B 1QHHA 1NOJA 1UDCA 1Y3BE 2QZSA 3B1VA 3UQYS 4C2AA 3RH0A 2L69A 4CIXA 4XCVA 1H2EA 1W85A 2BCEA 2G67A 4CM9A 4I19A 1K0UA 3W8FA 2CNKA 4TMTA 1VHLA 2ZJBA 4ITUA 4M8SA 3FA2A 4ILKA 3LPNA 3CJQA 4F06A 3FMIA 5IT4A 4YHHB 5JC1A 3KUUA 3DF9A 3KE8A 4O2LA 5HILA 4EG0A 4OIFA 3O2NA 2CVOA 3SG0A 2A30A 2OK8A 3AFOA 2PSDA 3DPSA 5EIFA 1KQNA 1CJMA 3WRXC 4E5UA 2IOQA 4DKJA 2CXOA 2OBBA 2JJ8A 5JDCA 3H8JA 1ACLA 2NNWB 4RCZA 3DVLA 2J30A 2QKYA 2RGNC 2C31A 3GFFA 2OFFA 2WTBA 2IUEA 3ENVA 3IBCA 2Y68A 3W6UA 2JKZA 1D6NA 3L06A 2P9EA 2VKTA 3D1VA 1G7TA 4LCBA 5TS2A 4F11A 5G4KA 2ZSKA 4JL8A 4TMVA 3RRMA 5CBKA 1A0OA 1AUPA 2GKSA 3GG2A 4U7FA 3NRBA 4ARZB 3BE6A 4NCJA 1AKWA 2Z30A 2YS7A 3NETA 1YBHA 1QTNA 4UASA 2H5JA 5AKZA 3H6KA 3DLTA 4WUTA 4Q3AA 1I4TD 2Z58A 1E0DA 1PJQA 1NVVQ 3P32A 4I0WB 4V0NA 3TNYA 4EQ6B 5LU8A 2REBA 4IP0A 3BZBA 8AT1A 3CVYA 1RRPA 4BE4A 4C22A 1X1CA 3AVYA 5KMGB 1T13A 3B51X 3X44A 5A62A 1H69A 5IABA 3A36A 2EL9A 2BE9A 4PICA 3ES9A 3C4QA 1LUAA 1ZD1A 2I34A 3VMMA 1QDLB 3OJCA 3NIBA 4NZZA 4PQRA 4RLFA 5EE5B 5C4GB 4DT1B 3KQOA 3K92A 3TL3A 1C30B 3HP7A 3WHPA 4B43A 4CCYA 3IAEA 1QH1B 3BMCA 1EVIA 1BA2A 4JYAB 5JJKA 1D1TA 1H9AA 4ZCRA 3QXHA 3N59A 4DRYA 1EFKA 3MLBA 4Q4AB 1JXMA 4FLEA 1URPA 2EDAA 3OZTA 2Z56A 3M3PA 5BO5A 1Q3HA 5JS2A 1YK1A 3E61A 3F5QA 3E6AA 4UFNA 1JKJB 3H2JA 3HVHA 5KQSA 3N2IA 4F4UA 1DMSA 1VRWA 3LDUA 4C3UA 3UJ9A 4R7ZA 2RBEA 4AY3A 4DLTA 2O8DB 4P3PA 1PF7E 5B57C 3SR3A 5THXA 5BN5B 1KEVA 2WAMA 3H3XA 3N74A 1ETHA 4KODA 5BN4B 4G0WA 4OKIA 1LV7A 4NV1A 1T8UA 2WAOA 1EM8B 1D1SA 2B7CA 2Y66A 4XB2A 3RLFA 2BE7A 3KJGA 3PQFA 5EKUA 1X7ZA 3O4VA 1SU4A 5GONB 4MI9A 4C0HA 3I72A 2DCMA 1HFEL 3PDUA 5EP3A 4P22A 3L7JA 4R5HA 1DAHA 4Q9IA 4WY8A 4EO7A 1D8TA 1TAQA 4CF5A 4EPXA 1JQJC 4QICA 2GVNA 3PEVA 4D3XA 2RAUA 3KTAA 2IYAA 1Y8ZA 1EUYA 1VYHA 1XDZA 1FDOA 4MHOA 1J0BA 2G7ZA 3EXG1 4E5VA 2CC2A 3ETEA 2IF2A 2C77A 4KFRA 3RUHA 3OF3A 2C5GA 4D82A 2GM5A 3T1TA 1I94B 1XD2B 3QWHA 3QOXA 1V1MA 2R48A 2ZLBA 1RM0A 1C4XA 2XWBF 3CVWA 3DYIA 3DFZA 1TMGE 5M29A 4OXXA 1ZJWA 1SG6A 1CUFA 5HQJA 1V3TA 2Q62A 1HURA 1WDWB 1PSZA 3USCS 3NTOA 3CPJB 3DXXA 2WQ7A 4Y9DA 1D1PA 5BOSB 5I47A 5KNBH 5G2OA 4I2VA 1F2UA 3VNBA 3R75A 3UJCA 4D3SA 1U6JA 1NSYA 2H0QA 3E3NA 4D81A 2FN3A 3D6TB 3R5XA 1OJ7A 3TRDA 4MWCA 2BGKA 5HP4A 1C7IA 3DCYA 2ODBA 1TK3A 3V2GA 4M89A 1ZJ6A 2X2OA 3KZKA 1QOPB 1O0CA 4P5EA 2QRZA 4J1TC 2BOVA 1GZSA 1MOSA 2B5WA 1CC1S 1DV1A 3AUYA 4ZQCB 3UHAA 5BSRA 3HBLA 4U9HS 3OFJA 4HNVA 4OA5A 3EZYA 1VJTA 2XOKA 1REQA 2C07A 3D6UA 1N3LA 1U11A 2A1UA 3QSGA 4EI7A 3AVVA 3H2ZA 3DHYA 3RVNA 4LVCA 2WG2A 1US8B 4HX9A 5F4ZA 1G1MA 5T6MA 4DQVA 1S8OA 4X62B 2J7PA 3WL6A 4BMYA 5CIQA 1ES9A 1E4VA 1P0IA 5MF6A 3CJRA 1FP7A 2GILA 1C8BA 2ATEA 4MGZR 3FNBA 3B1YA 3EZLA 3O94A 4I7EA 5EI5A 5H80A 3SHFA 3FMFA 3M4XA 5H1YA 3AQIA 1C29B 1XLWA 5TPWB 1G5FA 3C5HA 2ILVA 5AVRA 2MSNA 3NLLA 3TW8B 5DOVA 3PGMA 4U7PB 1Y5MA 1XROA 3HWWA 4FJ0A 2R8PA 1QHHB 2P2DA 4PYNA 3SQDA 3F47A 4R7TA 3ETHA 1YQDA 3HZOA 4X91A 2MDTA 1UP7A 1TB4A 4DV3B 1DHRA 2OKCA 3BA6A 1ZP6A 4HWSA 1AQYA 3OTGA 4JYCA 2MIIA 2MR5A 3VR5A 1W4CA 1E89A 2EX1A 4UOQA 2BHTA 3GL9A 3SIRA 1XDGA 3OEWA 5JXIA 3CE6A 4CQMD 4EYKA 3X1XA 1XQVA 4NATA 5CLLA 3HXOA 5A5EA 5B1HA 5CW1A 1CFJA 4HSEA 4WY2A 2H8KA 2HGZA 1K8QA 1M1ZA 2VNHA 4YRFA 3C24A 3JRNA 3DDZX 3COJA 1RHQA 2PZKA 3BB3A 4L15A 5EXTA 1A1VA 2FUKA 3RT1A 4L6AA 1K88A 2EZ8A 3ZU6A 3O91A 4ARUA 4N7JA 1EYZA 3FGZA 3L84A 1GQFA 5B3AA 4PBSA 1JJVA 1MHTA 1XZGA 2PUEA 2C20A 2Y76A 1ORVA 1M34A 4M37A <