1XJ0A

Crystal structure of the gdp-bound form of the rasg60a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an intermediate for nucleotide exchange by Ras
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-Ras-1
total genus 60
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xj0A00
4CEJB 4Y0AA 1NN0A 3LWNA 3UPUA 1WF3A 1G4AE 1XJCA 2WWWA 1SKYB 1X86B 1N25A 4US1R 1N6OA 1N0WA 1Q3HA 1D2MA 1TF7A 1TEXA 3IIKA 4JYCA 2G6BA 4E09A 2ZSFA 4P4SB 1N5JA 5FTJA 2E87A 1E2MA 4Q00A 4MGYR 4C4PA 3PITA 2V6IA 1SGWA 2EFGA 1A5TA 3BAFA 2QMUA 3B82A 4FXPA 4KFTA 4EQ6A 1AS3A 2A3RA 4NCNA 4IDQA 4D26A 6Q21A 3T61A 1W46A 5EXXA 4BE7B 1OXXK 3TQCA 5L3SA 2DWPA 3A1UA 1ZM7A 3KQUA 2R6FA 1W5TA 2PJRA 3OFNA 4IDPA 1N6RA 4GMXA 5DO9A 2BHRA 2QY9A 3CB4A 1SULA 4FCTA 3QE0A 1E4VA 2F9LA 1G4UR 3U6KA 1E2PA 1P2SA 2PMDA 5FPTA 1E9SA 4LC0A 3GJ6A 3GLHB 1Q12A 4A6PA 1OIVA 2SHKA 4GT1A 2MSEB 3AKDA 3FDIA 3WMEA 4DCNA 4JBXA 1OB2A 2YZ2A 1AKYA 2R65A 3T5DA 4NYIR 5F9FA 3TW4A 3IUYA 4KO8A 1E2IA 1W48A 2PT7A 1FUKA 4O3MA 4YMUA 4Q9IA 4US2R 2FFHA 1EX7A 5GADl 3SNHA 2DWOA 2JLYA 3WYAA 2AWOA 2IYYA 4P0TA 2GJ8A 2OBMA 2GJKA 1GWNA 1P73A 2H1LA 2IF2A 3QEJA 4BZQA 1KO5A 4IOMA 3PEWA 4BLPA 2GXAA 3B2EA 2IT1A 2PEYA 4UNSA 4BRUA 2KSQA 4LBWA 2C9YA 2PX0A 2IC5A 4RSGA 5CDFE 1BOFA 1EESA 2FA9A 1XCGB 4E5UA 1YVDA 5EE0A 2C9OA 3BIFA 2EVWX 1XMSA 5L3SB 2ERXA 2GTPA 1GIAA 3LBHA 1GZSA 2J41A 3CRW1 4R2HA 2C2HA 2V8OA 1NJGA 3SOPA 2DYKA 3QXXA 1E2NA 1IJEA 3ASYA 3TAHA 1IN4A 1J90A 1GRRA 1EFCA 4LC1A 4RD6A 1NIJA 2EWVA 3DKPA 5DI9A 5CB6A 1Z0DA 4KITB 4IOKA 2C96A 3DVLA 2BMDA 4AKIA 3NWJA 5KNBA 2A5DA 1AGPA 2IYQA 4P4UA 3CRMA 2FNAA 2OO7A 1YE8A 4ILEA 2BMEA 4C0KA 3BS4A 3ADKA 1I4LD 4NH0A 2G0NA 1P5ZB 2IS4A 1CRPA 5IRCD 121PA 1DAMA 5C1BA 1XXHA 2ZUBA 1S3SA 1P6XA 4PQFA 2CLCX 4S2EA 3O8DA 5EE3A 5FTLA 3O47A 1NVUQ 1VG8A 3HDTA 3C4JA 3EA0A 3EG5A 3K0FA 3BWDD 5HCNA 4BFXA 2X2EA 5JCZA 1CIPA 4OI1A 2DWQA 1E79D 2R6DA 3W90A 4F7WA 1D9ZA 3GFPA 5B64A 2IBMA 3K09C 1B0UA 3TNFA 2ZRDA 1COWD 1DAFA 1WA5A 4B6EA 4HATA 1EX6A 1SQ5A 5IHPA 3L8YA 1P3JA 3VAAA 3ETLA 4C0QC 4HAUA 3QG1A 1P2VA 4BFVA 2OBLA 3BK7A 4DCUA 3OIUA 4QJ4A 4QBIA 1HEIA 4DLSA 5JHHB 2GRJA 1OH6A 3VR5A 2OFXA 4RJLA 2GCOB 4DEXA 2O8BB 1QHNA 1SVKA 2BWJA 3BERA 3NBYC 3QI2A 2ZJBA 1MABB 2ZEJA 4S35A 3BJIC 1XEWY 3LNCA 1YR7A 1P2TA 1K8RA 1JEDA 3IILA 1W49A 2O0JA 3RRNA 4NYJQ 3VR2A 3NBXX 3X2SA 2ZRJA 1X3SA 5F98A 4LJ4A 4ZDJA 3EAQA 2OESA 2AK3A 4RZUA 5FBQB 3T15A 4XWOA 2XJ9A 1L8QA 4B3BA 3Q8XB 4PC1A 2VP2A 1ZIPA 2FZLA 5DLQC 4A92A 3AVPA 3NBFA 3PUYA 2QSZA 4BECA 1XEWX 1ZBDA 4TQUS 4PAOA 1R0ZA 2HT1A 3IQWA 1KO4A 5AJVB 4Z8YA 3PFIA 2WPDA 3HWSA 1IM2A 1PVOA 1QHXA 3TAUA 3WXMA 4LY6A 4AKGA 4UNNA 2V6JA 5FPYA 1HE1C 2BCJQ 4XVQA 1MOZA 3IBGA 1NLYA 4XSGA 2F55A 2B7BA 3SDZA 1L2TA 1DS6A 1TQDA 2PMKA 1P7CA 2JDIA 3B6EA 3GCGA 2ZS7A 3I72A 1VYUA 4WA7A 1JR3D 3AGPA 2PEZA 4MYUA 4CZ2A 5J4LA 4XVUA 1CULC 4B6FA 2AKYA 2BEKA 2CLSA 4G01B 3VFDA 1ZW6A 4L4UA 2WMNB 2W6IA 4DDTA 2VF7A 5JSZA 2ZRNA 2PZEA 5CK5A 3QG5A 4H9GA 4U7DA 2R6GA 4PZZA 3B9QA 1G8FA 4ZIRB 3KFVA 5F2EA 4GL2A 3T12A 4M9QA 3CX7A 2BJWA 2B92A 4HLUA 1Z0JA 2NZ8A 5FUYA 4C2TA 2IXGA 2QNRA 3PUXA 1RW4A 5AUQA 1N6KA 2IYWA 4TL9A 4DT1A 4GOJA 4A2QA 2V55B 2NQ2C 4TSFA 3TSZA 3MMPA 3G0HA 1S96A 1G8YA 1ZNXA 2WOJA 5AK0A 1G64A 1G3QA 1JPJA 1ZU4A 4HYYA 2RGXA 1KMHA 2ZPTX 3SBDA 1DG3A 2ZR0A 4NONA 2L0XA 1KYIA 3AF4A 1PV4A 3CX8A 1M74A 4OK6A 2Z43A 1WMSA 3W3AA 1YZUA 3CH4B 3J81k 1HQYE 1NKTA 3GJ5A 5JI3E 3EWSA 3T1OA 2NPFA 1TU3A 4PTLA 3RNLA 3EIHA 4Q21A 1ZM3A 1CJMA 3ZS8A 4GRAA 3V4FA 3OE7A 4C30A 2IYVA 2ANCA 4F38A 1LB1B 4GFDA 5TY0A 2ODBA 3A1VA 1DAKA 2GJAA 3A1TA 5FBWB 5FPKA 3UMFA 4MRRA 1D2EA 5GJWC 2WIAA 2XTNA 1QHSA 2Q21A 1X1RA 1E69A 3GEEA 3LO5A 3C41J 4RCYA 1VG1A 1J8MF 4YDHB 2C95A 1CF4A 2CHVA 1MABA 1NP6A 1NVXQ 2BKUA 1OH8A 3DPUA 4DLUA 1Y63A 3I62A 4WXPA 2OLJA 1AGRA 3E5HA 3SJZA 3K0CC 1XRJA 1SHZA 1VIYA 4UXHA 2HLDA 3LV8A 1E2LA 5A4JA 4DSUA 3EXAA 4IDHA 3ZZTA 3U60B 3ZD6A 4Q4JB 2K5UA 2WVJA 4LX0A 3PUWA 2DPXA 1J70A 2AFHE 2GBLA 3QPUA 3K0AA 2GEDA 2QAGC 1FNMA 1XD2A 4Q01A 2JJ1A 2CHQA 1ANKA 4DRZA 3QENA 1S3GA 3X1WA 4XJXA 4ZKDA 2PH1A 2XAUA 2IS6A 3CUEF 2ZYWX 1PJRA 3LLMA 2V3CC 2ZROA 2IHBA 3BC1A 3NC1C 3Q85A 2JLZA 1E2KA 4JKIA 3ZZ0A 3FMOB 4TLDA 1RFLA 3PUZA 1KSFX 1ZUIA 4IDOA 3DZ8A 4YXWD 3HR7A 2YWHA 1T91A 1U2RA 2HXYA 3Q7PA 5EP1A 5FR1A 3GJ7A 1H65A 3QBVA 3L43A 1Q44A 1YQTA 1BMFD 3C5HA 1O87A 4PPGA 3SQWA 4A0HA 3FMFA 2XNDD 1IJFA 1DELA 2Z4SA 3B1WA 3MG9A 2F3RA 1VCIA 4DDUA 4OL0A 1CLUA 3CBQA 2HLDD 1U94A 1WRBA 1KTVA 2FU5C 3CF6R 4LBZA 3BORA 2O8FA 3WYFA 1XZQA 1QG2A 5LPNA 4XSHA 2H57A 2CBZA 1VG9B 3MAAC 4QOSA 3SHWA 4DBLC 2J46A 1KSHA 1UKZA 1AS0A 1RRGA 3FHTA 4K46A 1XMIA 1IXZA 2NTYC 3QSYA 1CKEA 2FSGA 3UG6A 4E07A 3AVYA 4N3NA 2VHUA 4C0JA 3VKWA 3ONWA 3THXA 3KB1A 2O8EA 1ONBA 4P33A 4DUGA 3MLEA 2YWEA 2NOAA 4G5GA 2ZJ2A 3I5YA 1OXVA 1ZCAA 2IUSA 3PENA 4M1TA 2FDCA 1GNPA 5AJWA 1JXMA 1TMKA 1TPZA 1Q3TA 2C5LA 2GEVA 3FB4A 4IFEA 5BYJA 3RSLA 3WNCA 5EXPA 4AKEA 1RE0A 1DAHA 4O2RA 2FFQA 3O8BA 4LHYA 3LBNA 1FX0A 2OUKA 1OKKA 4JLNA 1Z6GA 1F2UB 3CF0A 4DJTA 5LB2A 4TSFD 1E2HA 3SS8A 2ZUDA 3CONA 3KKOA 4I81A 1WXQA 3I8XA 4JBYA 5GJCA 3E70C 2XB4A 2C9CA 3HPQA 2VHJA 2B8TA 3AP3A 4AG6A 2CDNA 4UJ5A 1ZJ6A 4NCJA 3LAWA 3CPJB 1II8A 5AJYA 1SXJD 4NYJR 1KK1A 2GZHA 1JR3A 1G8HA 4Q7LA 2N42A 2FSIA 1NRJB 3WYGA 4D4MA 1SKQA 2A2ZA 1KO1A 2ZU0C 3VQTA 4AYTA 1DADA 2QQ0A 2KE5A 2ZRKA 2ZSDA 1M7BA 3AVQA 3IHLA 4TMVA 2GXUA 3UMRA 3CZPA 1H8HD 3I1FA 3ND9A 1GNQA 2PX3A 2IS2A 4V0NA 4M1SA 2VYFA 2V7QA 4DLWA 1OFTA 4HLCA 1E98A 2EWWA 4RFSB 1GNRA 1NBMD 2ZI7A 3KJHA 4KYUA 5ANRB 4A8JC 4EPXA 3ZVLA 1U98A 1G21E 2EQBA 3A36A 3EIQA 4IVQA 1WE2A 3SR0A 1S2MA 3BH7A 4AK9A 2ZI4A 2IYSA 3SYNA 2OM2A 3MUFA 1G17A 3PR1A 5BN5A 2RCNA 3HU1A 2VP5A 4PC2A 5CDFA 1ETUA 4M9ZA 5FUVA 1LF0A 4EJSC 3LXXA 1Z08A 4LOAA 1JB1A 2O52A 4X8LA 4TL6A 2CVFA 3K53A 1F3OA 1QBKC 3THYA 5KPJA 1X8JA 2FGKA 3KFXA 2FGJA 2G3YA 3M4YA 4K8OA 2CE7A 3WMFA 2Q3MA 4MITA 5DN6D 2QAGB 3LXRA 2NIPA 5FTMA 4Q02A 1RKBA 3BOSA 2Z0MA 2GK6A 1Q22A 1VIAA 2J0SA 1AK2A 3OFND 1NN5A 1E9EA 5EZ5A 1TQ2A 3K0SA 5DGXA 1KY2A 3SC3A 1A7JA 4WOPA 2JLVA 2QP4A 4HDQB 1MO5A 1N6HA 1IBRA 1XJ0A 3W9YA 2GVZC 1A2KC 1OJLA 2QTFA 2ZAOA 2BBSA 3VKHA 2VF8A 1X6VA 3RS5A 2PZFA 4P3YA 1GL9B 1OSNA 1IAQA 3BFXA 3VU9B 4ZDIA 1S9DA 3B1YA 3ZJYA 1IY1A 4MYCA 1Z07A 1R6BX 1Z0KA 3ZZUA 1W2HA 1IY2A 3AF3A 1YKSA 3AV0B 4ZI3A 5J4KA 3KJGA 2Z6VA 5L8VA 2F1RA 1E9DA 1VHTA 1XTQA 4QM7A 1RIFA 3K09A 1BS1A 4MGZR 3PV0A 221PA 2GXSA 2WM9B 1XBTA 2B7CA 5FOWA 3HYRA 4HB3A 4V0LA 2W6ID 4NCIA 4IVPA 1D6JA 2ZYTX 3OZXA 4OK5A 3DM5A 1LTQA 4BLOA 3QXHA 1MRSA 1MO3A 2BIFA 2ORIA 4DUGD 2C99A 4C3ZA 1UFQA 1VHLA 4FI3C 4A9AA 2AX4A 4GZMA 4JLVA 1ZD8A 2W0SA 4B75A 1O3YA 3D3QA 3MJHA 2QSYA 2OAP1 4HI0E 5KTYA 4KVAA 3EIEA 5EP4A 1T5LA 1MO6A 3D6TB 2XITA 5JLJA 4OHWA 1T3SA 3VR6A 4ESVA 4G5RA 5F9HA 2D7DA 3LW8A 2WWFA 4HAVA 3KQHA 2W6JD 3K8YA 2BBWA 2BCGY 2IYRA 4OHVA 1WCV1 3QKUA 3RWMB 1FPMA 1V43A 4UJ3A 1OKKD 4LJ5A 3EPJA 2HT6A 1PLLA 2GZAA 5HZKA 2HF9A 3GMTA 1G5TA 3CRRA 2W2XA 4PHTA 1FOEB 4A0GA 2XXAB 2VEDA 1CJTC 1ZVQA 4LJYA 4IFBA 3UKDA 3TK1A 1M6NA 2IXEA 2QORA 5EUQB 2D7CA 4LCBA 2I1VB 2G0TA 5FOUA 5CM9C 1R4AA 1GITA 4LDJA 1F60A 4NU0A 4OQLA 4OJKA 3KKMA 1W0KA 3THWB 3LFUA 3A37A 3FKQA 1OYYA 1PUJA 1BIFA 5DHAA 1T3HA 5HKKD 1SVLA 4BFYA 2RKOA 1YHNA 1G7CA 3VR1A 4A2PA 4LYJA 3NEYA 2YKGA 3S1AB 3U7HB 1AS2A 4DDVA 3PCRB 2HYIC 1HQCA 3EZFA 1XZPA 1UEIA 5DSZA 4D4JA 1L4YA 2FEMA 4ACAA 3ZVMA 3R20A 4C0SA 1SKYE 1UF9A 4ASUA 3BFKA 2EYUA 3GLFE 2F1HA 3KTAB 5EXSA 1N6PA 4LPKA 5JECA 4QBGB 1Q20A 4URZR 3SJBA 4LHZA 4LYHA 5KDDA 4RVCA 4AIIA 3R9WA 1U0HC 1N3BA 5G40A 2NGRA 2ZIAA 3B5JA 4CW7A 1XXHB 1KNXA 1VYVA 2ZRAA 4TMWA 3IHWA 1Q1ZA 1FTSA 1QHYA 2WTUA 4CEIB 2O8FB 1LW7A 2OSBA 1F2TA 2GAAA 4MH0R 4CT4B 2H5EA 2FG5A 2KB0A 4L16A 4JVNA 1KOFA 4B3DA 2A9KA 621PA 1ZC3A 4BFSA 1W5SA 1G3UA 2QMHA 2WMOB 4OHXA 5FOSA 4JLOA 5SZHB 3WRXC 4BZPA 1W36B 1YU9A 2LWIA 2GVDC 2WWHA 4DCVA 1EG7A 3CR8A 4OYHA 4BFTA 3S1AA 1N0UA 5K8LA 1CTQA 4FWIB 4Q47A 1JEEA 3DL0A 1U0JA 1N2CE 2FOLA 1W36D 2ZVQX 2GWHA 3EX7C 1A2BA 1W47A 2JJ2A 5J5CA 4X8MA 1UBCA 1G18A 2RGEA 3GJ0A 4OQXA 4YMTA 2A7QA 3LW7A 4YONB 1E0SA 5AUNB 4PPQA 4XIGS 2ZRIA 3UWOA 1EFRA 1UDWA 2GXQA 1K6MA 3AH8A 4JSYA 1QHHB 2ONJA 1I2DA 4U00A 1IN5A 1SVIA 2ZJAA 1X8LA 3PEYA 4ASUD 3SEAA 5LBIA 5CLQA 2W2TA 2OFOA 5AWFC 2R9VA 2GETA 2IYLD 1UKYA 3GEIA 4JLPA 1JR3E 4MYHA 4UQOA 5FTNA 4Q9KA 3MWLA 3B1VA 5FOTA 4ESHA 1G6HA 2CL7X 1Q1EA 4PAMA 3T5GA 3PXGA 2MSDB 2P5SA 3K0AB 4PSVA 1S1CA 1VPLA 1U9IA 3FVQA 3JZAA 4PZLA 3QKRB 4ERNA 1GKIA 1GRQA 1ZUNB 1Z47A 5HTKA 3UMSA 2ZI5A 4YQFA 1E1QD 3N5CA 1IHUA 1P9WA 2NPIA 5JRZA 3NHAA 1GILA 1WP9A 2WPDD 2OCPA 5E95A 4EAQA 1CJUC 3GJ4A 1OF1A 2HEIA 4A36A 1PUIA 3U4QB 1G3MA 4XH9B 3VNVA 1TEVA 1FUUA 2YV5A 4DXAA 1KI2A 2RHMA 1ODFA 2QENA 4BFZA 1S9HA 3LRPA 4Y0VA 2XNDA 2JIZD 3W6NA 1HH4A 3QPVA 3SHFA 2N46A 2IEYA 4WZBE 1Z22A 4G5OA 5J47A 3QPWA 1CEEA 3QIAA 2Z5FA 1OLOA 1JAHA 1YRBA 3HU2A 3JZMA 1KI3A 4LBYA 4D81A 1U8AA 4CGZA 4LJ9A 3U7EB 2KBFA 1VTKA 1GL7A 2QBYA 2RGCA 1DO0A 3TR5A 4PQYA 4IVRA 4ZO4A 3P1JA 5E7IA 3WBJA 2OV2A 1OT3A 1YZTA 1T9HA 2RGAA 3QKSB 4QM6A 2IXFA 4LUCA 3A4NA 4PHFA 3FKSA 2WV9A 1XDBA 1GTVA 4Q1EA 4R2IA 1PZNA 5GJVC 3WHKA 4GBMA 3SFZA 1MO4A 1OFUX 2XJ4A 2OLKA 2VHTA 1EWRA 2FJUA 4AWXA 3BXZA 1VCMA 3KKNA 1G6OA 1E3MA 3QY0A 1FQJA 4PPNA 1NN1A 1SXJE 5JRJA 2J7PD 5EP2A 1XEXB 2WJHA 4TYWA 4M0LA 4DC9A 4Q7KA 1XP8A 5B2ZA 2ZRPA 4BLTA 5JS8A 4XD7D 3L0SA 2JA1A 2F1IA 4ZIRA 4BLSA 1NVVQ 1M1YE 1SXJC 4QGGA 4CF7A 4IRUB 2OILA 3MRSA 4V0OA 4AD8A 1T8UA 2PJZA 3QKRA 1AQYA 1F48A 1ZD9A 4OHZA 3KUCA 3THOA 2AD5A 2YC2C 5HPYB 4Q18A 3FPAA 1HV8A 2ZJZA 1FZQA 1W44A 4B3FX 1HA3A 1NI3A 1TL7C 2ZYVX 3FYHA 1BO6A 2OG2A 1U0LA 3AKYA 3AKEA 3HR8A 1W1WA 2OEPA 4RFVA 3MWJA 1YRAA 3PEVA 1RYFA 3CR7A 2IL1A 2NO1A 3DO6A 5TDHA 4ACBA 1XEXA 2OFWA 5LB4A 2ZREA 3OF5A 3GLIA 4JVMA 3UATA 1IQPA 1GSIA 1KMQA 2QGNA 3GJ3A 3E1SA 1NIPA 4Q1BA 2BOVA 1B23P 1G41A 2XZOA 4IKEA 2DFKB 4YMVA 4PPFA 2ZTSA 2QT1A 4QBFA 1Z2CA 1ZNZA 5EQTA 3P27A 2OXCA 4JL6A 4KSBA 4LHWA 3K9GA 1YZQA 2QN6A 3VU9A 1TQ6A 1YZKA 3NC0C 3QVVA 2RMKA 1E9CA 1TNDA 1DPFA 4HLUC 3MD0A 3PUVA 3DZDA 4FW9A 4UNQA 1KI4A 4LBVA 1II8B 2XOKD 1F2TB 4NE2A 2H92A 2A5GA 1G9XA 4CEHB 3REFA 4KBGA 3PJRA 4MRSA 4M1OA 4JVSB 5HCIA 1KDRA 4DCTA 4KI0A 3C7KA 1GL6A 4NHOA 1G8GA 4B33A 4JLJA 3K9HA 4Q1CA 4B35A 1OH5A 2J7PA 3ND8A 3EPKA 1XPOA 3L8ZA 4HUTA 2RGNC 4TT3A 5AUOB 1DVRA 2BV3A 1FX0B 1NG9A 1D9XA 2KI5A 3RABA 1GOTA 1G19A 2FSHA 2ZE8A 2P3SA 3L2OB 3OIWA 3QEOA 4GOKA 1GM5A 3NXSA 2VL7A 3V4RA 1VDZA 3BGWA 2Z4RA 2ZXUA 4F4CA 2OXRA 4EUNA 1A1VA 2GZDA 1IOZA 1AZSC 2DY1A 3H1TA 2EFEB 2RH5A 3TUZC 3EWAA 1EK0A 1TQ4A 4NZYA 1JXOA 2WKRA 3B85A 3GFOA 4URUR 5E4FA 5KDOA 4CDGA 1UKVY 4JL5A 4QFMA 3GP8A 1NLFA 1QHHA 2I1QA 4NCKA 4Q9HA 4PC3A 1OPXA 4WIAA 2OCBA 2ZM5A 3WRYC 4I1OA 4KXFB 3FHOA 1G1MA 3MWKA 3T06B 4LJ6A 4LPSA 3SE0A 4F4IA 1YZLA 3SU8A 3ZLJA 3ZDQA 4LV6A 3CKLA 3IQXA 4DLRA 4P4TA 4CRWB 1OE0A 1KY3A 3SJCA 4DZZA 1NF3A 2P6UA 4L5BA 4NTZA 3B7GA 2IX3A 2D06A 3DOEA 3LBIA 3LX5A 3TBKA 3H2YA 2CCKA 4DLVA 2CVHA 4EPYA 5EE9A 2IWRA 4GP6A 1LS1A 1XNJA 4O0MA 3SYLA 3VHXA 1CS4C 2QTHA 5GJBA 3M1IA 5FL3A 1JALA 2GJ9A 2H8KA 2NZJA 2ZI9A 2A30A 4B76A 3UIEA 1F2UA 3K1JA 1I4DD 4XVRA 3EPHA 3OE7D 2HF8A 4BGDA 1LY1A 2EU8A 5E7MA 3TUJC 2RGNA 2NO7A 1P60A 3K9NA 2QTVB 3P20A 2D74A 1E79A 4I1VA 8OHMA 2XSZA 3C5CA 2ZYUX 1YZGA 1LNZA 3ICQB 3AQ4A 4KLZA 1SVOA 1T6NA 1FL9A 4QXAA 4DLTA 4DEYA 3THXB 3AVXA 2PLRA 4C0HA 5KSOA 1SXJA 1XXHE 3RSOA 3SYKA 4B44A 5FTKA 3TQFA 1E2EA 4TLBA 2ZJYA 4H1UA 3VMFA 3F8TA 4KJZA 5H70A 1KKMA 1RZ3A 2G88A 1WBBA 3PIRA 2O8DA 1GFIA 1GAJA 3GLHA 4GDFA 3W6PA 4TYNA 2ZE5A 2NO9A 1M2OB 2QMOA 2ZRLA 1KK3A 1UBEA 2DBYA 1I2MA 4OQMA 2VSOA 4RKFA 4G3XA 4PO1A 3KX2A 2ZETA 3CNOA 5IDVA 2QQEA 1J99A 1ESNA 1W4BA 3RLFA 1TUIA 1VCOA 3FFBA 4QBHA 3SBEA 3WHLA 5FUXA 2QE7D 4L9SA 4L15A 3NH9A 4RD3A 3T35A 4F91B 2E9SA 1ZNWA 4KFSA 4DB4A 4KCGA 2AWNA 5J40A 3CLVA 2O8DB 4PANA 2ZJ8A 2ONKA 4P4SA 4JKYA 1R7RA 1DBSA 2YJTD 4QRHA 4KLNA 1ZM2A 3EW9A 1T0JB 3WP1B 3LH5A 1KO7A 1XF9A 3UWKA 3VR4A 5JWRA 3CM0A 2QG6A 5UKDA 3C8UA 4Q48A 1KMHB 1UJ2A 5H1YA 1Z0FA 1N6NA 3RS4A 2QT0A 3A4MA 4PSKA 4M1KA 3BB4A 3B1ZA 1AM4D 1TX4B 3OEHA 5DYGA 3OIYA 3BFVA 4W5HA 1MR3F 3ADCA 1ZRHA 1ZU5A 3B78A 2WJGA 2QP3A 2HYDA 1DE0A 2J5XA 4A8JB 1V5WA 4EPVA 4B2LA 1XWIA 4D6PA 4MKHA 3A8TA 2WKPA 4II7A 1NKSA 1TF2A 1EWQA 4Q66C 4LV5B 3AF2A 4JLKA 2QROA 2ZVPX 3U3KA 5JWHA 2OZEA 4E03A 3GFTA 4POAA 3MSXA 4GZLA 5BN3A 2HDNB 5EXTA 5KPDA 2VBCA 4NKRA 4PXAA 2PCLA 1NY6A 3MJRA 4QHSA 1GUAA 2A78A 3WNDA 3AUXA 4D82A 3OIVA 5L3VA 2A5FA 3I8SA 2J7KA 1G7TA 1JQLB 5FH9A 2XTMA 5KDLA 1NMYA 5JMTA 5CM8B 4QG7A 4IEIA 3NDPA 4DVGA 5KNCA 3TMKA 4W5WA 3IDQA 2ZRBA 5GVSA 2ZR9A 3D31A 1HT2E 1P61B 2DR3A 1MKYA 1P9NA 4FINA 3BB1A 3WBKA 3PQCA 5C18A 2G9NA 3LDAA 2G77B 1BKDR 4URYR 4MDEA 4JT2A 1E1RD 2YWFA 5JEDA 3W8NA 1ZMXA 1RRFA 1Z29A 4KYIB 1T8TA 4IHQA 2IA5A 4JYBA 4TZ0A 1ZUHA 2GBLC 1R10A 2JDID 4AG5A 2ZR7A 1E2GA 2GNOA 5C46F 1W0JA 3ZIAA 4M9SA 3C14C 2ZSAA 2JJ8A 4YLGA 1GKUB 2ZRHA 2DFNA 2AFIE 3Q7QA 3TW8B 2XXAA 2PL3A 4G5QA 4FMCF 4LJ8A 5DH9A 1LF5A 1UDXA 1CXZA 1XCPA 1OIWA 3KUDA 3EZ7A 3K70D 1E0AA 1CJVC 4TZ6A 4B71A 3FGNA 4Q03A 4UXIA 3AKCA 3KL4A 4PC6A 4BFWA 5SZJA 2H18A 3G5UA 3LVQE 3U3RA 4A8JA 1X1SA 3CW2A 3F0TA 4P32A 4MRPA 2V1XA 4TYPA 1E32A 4WZ6A 4CEHA 3IPYA 1XTKA 2JLUA 1KJYA 5TB5A 3IIJA 1GP2A 2RAPA 2P67A 5JS7A 2NMVA 2J87A 2QEQA 4BFUA 1WDTA 1ELOA 2PBRA 4Q4HA 4U5XA 2WJYA 5K8IA 2J0UA 4A4DA 1US8B 4X8OA 3EC1A 4LGMA 1II0A 2A5JA 2O0HA 4MA4A 4BRWA 1FFHA 1KO8A 2AKAB 4OI2A 2X77A 1RJ9A 5FR2A 1NSFA 2BBOA 2CNWA 2HCJB 2FSFA 2H7VA 3RANA 1N6IA 4F93B 4UXJA 5AJXA 4BQSA 3B8HA 5BXQC 5LD2B 1AJEA 4GI7A 1VYTA 1KKLA 1CR1A 1Z06A 2HCBA 3EC2A 1KAGA 3JVVA 3CNNA 2JLRA 5TARA 4MKGA 1II9A 2YOFA 3T1VA 1R8QA 3TR0A 3U3JA 1BMFA 2ODEA 5BWMA 1KNQA 1EXMA 4HZUB 4LHXA 1E1RA 5CB8A 2CJWA 2YOHA 3GLIB 4JT4A 2P5TB 1L7VC 2QA5A 4V0KA 5BW8A 3R9XA 4EPRA 5SZIA 5SZKB 2GCOA 2BEJA 1RJ9B 3NEJA 4PHHA 3R7WA 1CJKC 4NPHA 4Q4LA 3E2IA 2GAOA 1DAIA 4TTQA 3AVUA 5KSPA 4XTRA 2VHCA 4ZPXA 4AKHA 5IF9A 4C7OA 3WY9A 1W0KD 4M4SA 1P2UA 2WSSD 4FD2A 4B3CA 4F92B 4AI6A 1NBMA 1E2QA 3KXIA 4UKDA 3TRFA 4L9WA 3H86A 1IN8A 1F5NA 3IKJA 4W7SA 4U02A 2CL6X 1SXJB 3IBYA 3N70A 2V7QD 3RHFA 1JQJC 2FMXA 4G5SA 4Q4AB 2G1JA 1BYUA 1D8TA 2PZGA 1G16A 4R71A 1CR2A 3IO3A 2FF7A 3F3YA 3U3OA 1FP6A 5G41A 4GNKA 4OQNA 1G8PA 4OKSA 4NYMQ 2OBNA 3I4LA 4I99A 5EJEA 3L0PA 4XWAA 2PCJA 4O25A 3CNLA 1IN6A 3AUYA 3Q3JB 1M34E 1QZXA 4D80A 4TLAA 3F5FA 4A6XA 5DYIA 4Z1MA 1OFIA 2DB3A 2FFAA 1E4YA 3I73A 1R0XA 2BM1A 2JEOA 3FFAA 4D2IA 3QKSA 2O5VA 4JVLA 4A0RA 4AURA 4PAQA 3KQLA 1QRAA 3ADDA 3MWYW 4ZCIA 1XFAA 4NP6A 4L8GA 1NNEA 5JBQA 4M22A 1W4AA 3AP1A 1W2GA 2CCGA 1KI7A 2HUPA 2CXXA 4W5JA 1E6CA 5A5GA 2NG1A 2ECKA 1GKYA 2W83A 1E94E 2MMGA 5CJ2A 2XSZD 4EPTA 2D2EA 5DHFA 4NCHA 3CRQA 3P26A 2QM8A 1M8PA 3GLFA 3GPLA 1T5IA 3ZVRA 1DOAA 2DCUA 4OI4A 4DDWA 1NG1A 3QJYA 5J4YA 5CITA 3KJEA 1KI6B 2VP9A 2D2FA 3OAAD 3B9PA 4RY2A 2YNMA 1R5OA 1XPUA 1CU1A 2C98A 2FPLA 2JJ2D 1WBDA 3H4MA 4EFMA 3IEVA 2VIIA 3R9IA 4AYXA 1U81A 5JJIA 5TV2A 1QHIA 4M53A 2VTKA 4IEEA 1FMJA 1GG2A 4V02A 3K9LA 1ZM9A 1UKEA 3GLIE 2XGJA 3ZD7A 2WJIA 2VO1A 2W0MA 4NDZA 2Q9CA 1MT0A 3AVOA 5JCPA 2CE2X 2O0KA 2N1BA 2ERYA 1NVWQ 3QBTA 2FWRA 4E22A 1NY5A 2FX3A 1ZNYA 1A82A 1DAEA 3MGCA 4Z1MD 4MQBA 2C8VA 1TTTA 3W5IA 1W4CA 2YOGA 2H17A 3EZ9A 2ZJOA 4HAZA 1NVVR 2W6JA 3VX3A 4A0FA 1QF9A 5L3QB 4YXWA 4BLRA 3RRYA 1DTSA 2V54A 2AN9A 2QE7A 4TL7A 3PEUA 3KDSE 2YINC 3QQ5A 1RRCA 3RAPR 2YYZA 2QU8A 1KSJA 3CX6A 3R8CA 2J59A 4H1VA 1ZD1A 2WHXA 4QGFA 4WXRA 4DLXA 1SVMA 3RVBA 2Q6TA 2QP9X 5LD2C 1H8HA 3DKVA 1G291 4JIMA 4WVFA 5FFMA 1JJ7A 2AK2A 5CIQA 5JHGB 1XEFA 4XD7A 1UBFA 3OAAA 3KXLA 1Q1QA 4D4KA 4UNPA 2P6NA 1VCNA 2VHQA 4HLQB 1Z63A 4OBEA 1C1YA 4TQ9A 3QF4B 5JI2E 3CRVA 3U3MA 1YJ5A 4ZDKA 1US8A 1ZYUA 5FPSA 2IYUA 2QAJA 4JMPA 3X1YA 3OEEA 4JLBA 5KSZA 5K8TA 2R44A 3QOFA 4RD0A 4TQAA 3CWQA 4G0NA 4HDCA 1NBME 4DLYA 3HPRA 4TYYA 2WWIA 3OEED 5D3QA 4C0LA 3SZRA 4CIDA 5ELXA 5DISB 4Z54A 3RC3A 1KDTA 3W34A 3U61B 4A82A 3W3ZB 3FHCB 4JZKA 5JSZB 1E2JA 4HB2A 2ODWA 3MCAA 3SI7A 4ZI2A 5M04A 721PA 5IK2D 3RS3A 5HE8A 1Z6YA 1LFDB 1XX6A 1U9IC 2ANBA 1E96A 4JS0A 2V1UA 4C7OB 3JVUA 1AQUA 1QVRA 1CP2A 4I1UA 1AKEA 4M9XA 4CVNA 2QRZA 1UADA 4RFSA 5F3WB 5CK4A 2YVUA 1KI9A 4QKQA 3IPXA 3U5ZB 4Q9LA 2J45A 4KV9A 1R5NA 4FMDB 3DHWC 3TJZA 4EFLA 4V0ME 3DMNA 2GESA 5JFGA 2A5YB 4PSAA 2FZ4A 2IYZA 4N0DA 2F9MA 3TH5A 3SQXA 1C9KA 1KIMA 4PQRA 5C4GB 2GF9A 4LV8B 2ZE6A 3I92A 1DG1G 1HTWA 4RZ2A 5HR5A 1E0KA 3P32A 4FMCB 1HE8B 1ZCBA 4N0EA 4XTCS 5DI3A 4NMMA 3TGPA 3X1DA 3FMPB 2ZRCA 2MMCA 1E2FA 1XTRA 2QPTA 3EZ2A 1W4RA 5KOYA 4M1YA 4ARZB 1Z0IA 2Z83A 4X8HA 3WNBA 3VNUA 2F43A 4IW3B 5KYKA 4Q9JA 4ABYA 1D5CA 1OXUA 2UZIR 2ZUCA 1JPNA 3ADBA 3QXSA 1COWA 2ZU6A 4KU4A 3TSOA 1Z83A 2WICA 1G20E 2MSCB 4DSOA 3EZ6A 4RZ3A 1E0JA 2GCNA 1TF5A 1J7KA 1HY3A 1MH1A 2HJGA 2J0VA 2WBLC 4NBSA 3M0EA 2P6RA 2WAYA 4HSEA 3X1ZA 3EASA 5KSYA 2JAQA 2ZQ5A 5JZVA 2EYQA 2JJ1D 4Q4JA 1SVSA 4R98A 3ICEA 1R2QA 4A15A 1JBKA 2GJSA 5KU1A 1I4TD 2RHDA 2GDJA 3DMDA 2BKEA 5IK2A 1NN3A 3K0FB 2RGDA 2GF0A 3U44A 1KJZA 4JJKA 2ORWA 2WWXA 3VR3A 3ZH9B 5B58C 1G5RA 4GP7A 3VX4A 1JJVA 3SFVA 2RGBA 3GLFB 4US0R 3A58B 2W58A 3BB3A 3OHMA 2VH5R 4BWYA 1ZC4A 3AP2A 1DO2A 1E99A 2V9PA 1FQKA 2X19A 4M8NE 2EW1A 3EA5A 1OHHD 1CRQA 2EFDB 3AVTA 4C2UA 3V9PA 4I4LA 4HZIA 1JNYA 3LVRE 1Q1BA 4Q1DA 1TUEA 2VSFA 3BH6A 1EFUA 1JI0A 1NLZA 4Q7MB 4QJ5A 1W0JD 2P0EA 4HB0A 3ZIAD 1KZGB 2NO6A 1XD9A 2JLWA 3ZYCA 3K70C 3ECCA 1NSTA 2JATA 5H68A 2ORVA 2DFLA 4JL8A 5CIWA 1T0HB 4Q4HB 4R7ZA 1NMZA 4PHGA 1P62B 1G7RA 4JLMA 1ZM4A 2XOKA 4B43A 5IT5A 2WSSA 3W8RA 4Z51A 2B21A 3A6PC 1OYWA 1N5KA 3WMGA 3BH0A 3NIBA 3VKGA 2WOOA 4K81B 4Q1AA 4DWJA 2VSXA 3T1QA 2F1JA 4BUJA 1XB2A 2JLSA 5AUPB 2KWIA 2Q3HA 3FWYA 1R8SA 5B30A 3GJ8A 1ZAKA 2VP0A 2LCFA 4EJSB 4KSCA 2C78A 3QNUA 2O8CA 1C4OA 1XCMA 3FKSD 1L4UA 1W7AA 4DLZA 2QRNA 2CNWD 1W36C 4YMSA 2ZI6A 2ZI3A 3NBZC 1FMLA 2H16A 3GEHA 3NH6A 4EKDA 2Q0HA 4B3XA 2IF0A 3FE2A 4PR0A 3QUSA 2D62A 1GRNA 4TN1A 2BJVA 5E7JA 1OW3B 1E9RA 1Q21A 4LK2A 4QNRA 4BEJA 3A4LA 4AYWA 3VHLB 5EZ6B 3FTQA 3IO5A 4D0LB 2ZS9A 3TVTA 1SVWA 1G7SA 1KI8A 4BASA 1BYIA 2F43B 3QXJA 2HXSA 5KNDA 4MDFA 4OI0A 4QC2A 2BMFA 2KBEA 3N2IA 4BZXA 2WJJA 2GHIA 2WIBA 2G83A 3I3SR 2WKQA 5CJPA 1EFTA 1UAAA 1OHHA 2BBTA 5TMPA 1KDPA 1QVAA 4D0NA 1S0UA 3L82B 3LA6A 421PA 3H84A 3KB2A 4FCVA 3CO5A 1CBUA 5FI1B 2FPMA 1G3IA 3R8FA 4QL3A 3IIMA 4RD2A 3EPLA 1EFRD 4GPTA 2OT3B 2PLFA 2O8BA 1Z6TA 4IOJA 5EE1A 3DDCA 2X8AA 4W9MC 5EE5B 3BE4A 1YR9A 3AF1A 4DCSA 4B47A 3AEZA 1F6BA 4DSNA 4MUAA 3B13B 1N5IA 1OV4A 5L3QA 1P75A 1AZTA 1GVNB 1RC8A 2QAGA 2C04A 2ZAMA 2ZE7A 4XOIA 2R6AA 1QG4A 2ASEA 3A1WA 1J8YF 2ZRFA 1OFHA 4MRNA 1JR6A 4CEIA 3H0KA 5C2JB 5BQ5A 2UVQA 4URVR 1IONA 4URXR 2Y8EA 5DNYB 2IW3A 3IGFA 3LD9A 1R0WA 4Q19A 4IDNA 4IXNA 3WP0A 4ON9A 3U4QA 2W2VA 1E1QA 2Q9AA 2J1LA 5KUTA 2IWHA 1T3LA 2XZLA 2VLIA 3RDPA 1KAOA 1K5DA 2CK3A 2F3TA 2VQSA 3KTAA 5CYOA 5FOXA 1M7HA 2CEAA 5B57C 3Q72A 2GCPA 1U90A 4TYQA 3DEFA 5AR1A 1WB9A 3AGQA 3GQBA 2BDTA 3DOFA 1H8EA 2C77A 3KZ1E 2XB2A 4PFSA 4YC7A 3PVSA 2X2FA 3CPHA 1KSGA 1AA9A 1YZNA 4RD1A 2REXB 2CHGA 3SN6A 5G3YA 4EFNA 4ZV4A 1ESMA 2IHYA 4PC7A 5J4VA 3HP1A 3Q9LA 1HYQA 2CMKA 1DEKA 2D3WA 4FWTA 3RS7A 2IUUA 4BLQA 2QGZA 3IEUA 3TIFA 3CWZA 3FOZA 1MRNA 1HURA 2W00A 4RKEA 4B32A 4Q5IA 1RPZA 3B1XA 4MGIR 2ZJ5A 2OHFA 5HKKA 4Z8XA 2HV8A 1XD8A 2NO0A 1XJQA 2GILA 2WWYA 4LJAA 1XMJA 3RRZA 3QF7A 2YHSA 4LJ7A 2DFTA 4B74A 4TLCA 4C0BA 1K5GA 521PA 2GKSA 5EP3A 3UXMA 3W6OA 4FIDA 3T34A 3V00A 4A1FA 3ZGXA 1Z0AA 1CR0A 4LYFA 4GSYA 1UEJA 3DM9B 1FP7A 4HUQB 5P21A 4B34A 4GMDA 2LKDA 2E1RA 3UANA 2FEOA 1OIXA 1S4QA 4TWZA 5C4MA 5J4HA 4BPBA 3I5XA 3TVDA 2J0UB 4CYMA 2ZITA 4D4LA 2G1KA 2CCJA 4KBFA 3LLUA 1QHGA 4QJ3A 2ATXA 2FFBA 3ZVNA 4BEBA 2BVNA 3BD9A 1U8YA 2J3EA 4DKXA 2FE4A 5FBRB 1Q57A 3P4YA 5KHOC 1TU4A 4C9BA 1CR4A 2QZ4A 2FV8A 2R6CA 4FCWA 4WAUA 4LSGA 1TAGA 3CIOA 1IY0A 3CZQA 3NVAA 2BMJA 1Q0UA 1R0YA 2B8WA 2IUTA 3ASZA 3CH5A 4KAXA 2JLQA 2B6HA 3CF2A 2J0QA 2QBYB 4HAWA 4WZAE 3TE6A 2QPOA 1Z6AA 4TMXA 3ZQ6A 3KQKA 3GLGB 4TMKA 2VPPA 4JLAA 2I3BA 2XTZA 2AL7A 2YC4C 3NTUA 2PT5A 3RS0A 1E9AA 3U6BA 4LHVA 5HE9A 5JWOA 4MYTA 4KHZA 2XNSA 4I1SA 4QHYA 2WWGA 2OAQ1 5BYKA 4OHYA 4MRVA 4OQFA 1NJFA 1UPTA 3TUIC 2V4ZA 4G1UC 1MV5A 1KDOA 1J2JA 3GLGE 1YR8A 5DN6A 1DAGA 2IEZA 2QUZA 3AM1A 1KI1A 5AJZA 1XTSA 2JLXA 2GEUA 2OCYC 3GLHE 3X1XA 5FL7A 4O2LA 1XU4A 4QGAA 4TMTA 1OB5A 3I32A 4B2PA 2VP6A 3HYTA 1Z6XA 1E9FA 4HDOB 3ZS9A 2I4IA 4P31A 1ZINA 1VKJA 1XD2B 3Q5DA 1NMXA 2XEXA 3QVUA 3O8CA 4PO8A 4RD4A 4Q1FA 2UZ3A 4LWZA 4DT1B 5A0FA 1HT1E 2REOA 2O8CB 4YMWA 2FN4A 3I61A 2O8EB 1XPRA 2ATVA 1RVDA 4V0MA 4HUQA 1KGDA 1VG0B 2P65A 2OE2A 2ZANA 3RS2A 3U7GA 1Z3IX 4DB2A 4QNMA 4RZXA 821PA 3OESA 4JLDA 5FOVA 4FMBB 4ARZA 1A4RA 1RYHA 4DIDA 2JIZA 5FBLB 4AY2A 2OCAA 1G5PA 4IXMA 4LYAA 5DIFA 2F7SA 4QHTA 5E3HA 2AXNA 2ODNA 2QL6A 2QI9C 2ZSEA 3LY5A 4J0QA 2AXPA 5JJLA 3O8RA 1NL3A 2ZSBA 4YDSA 5L3RA 3P4XA 2CL0X 3KJIA 2D4HA 2EFCB 3C15C 3UK6A 4ZDWA 2ZRMA 4EDHA 4D25A 3M6AA 3MFYA 1XMVA 2EFHB 5CLLA 1OXSC 1M7GA 4DHEA 4EQ6B 1PLJA 2VRWA 4KVGA 5FI0B 4PZYA 5DI3B 3B60A 4MKIA 2CLDX 4EPWA 4ITRC 1S8FA 3T1TA 1Z28A 2DHRA 1Z2AA 3KKPA 4TTPA 4IOLA 3ZQJA 2WJVA 3RC8A 3KKQA 2R2AA 1IN7A 1P72A 1YR6A 2GK7A 4NYMR 3THWA 4KFRA 4Q7JB 4TL8A 4LZZA 1R5BA 3AF0A 1KK2A 1FW6A 3D7MA 1XTJA 2RGGA 5EUMA 1IXRC 3UG7A 2JGNA 5BN4A 3RWOA 4D0GA 4DSTA 2REBA 1G3RA 3QKTA 3L0IB 4A2WA 1X8KA 4B73A 3Q5EA 4ZCMA 3D8BA 1DARA 3HU3A 1E9BA 1JECA 3FMIA 4HAYA 4V03A 3W5JA 3BBPA 4N1AA 4Q4AA 1GDDA 3NDBB 4KFUA 4LI0A 1XTIA 4ZCLA 3AB3A 1EFHA 2WSMA 2BC9A 3THYB 2AD1A 4MKFA 2FH5B 4RCZA 1JAIA 4HLDA 4M1WA 3K0EA 1HUQA 4ZKEA 2IYXA 1OH7A 2VP4A 4NL4H 4QGHA 1KI6A 5DE3A 3NKVA 3NHBA 4M21A 4OK3A 1N6LA 3BRWD 4UNRA 3SJAA 1LVGA 2UKDA 3TLXA 1AIPA 3TSWA 5HZHA 4AC9A 2P2LA 3N2EA 3L0OA 2XX3A 3REGA 2QPAA 3AVWA 1FTNA 5JEEA 4HB4A 1S1MA 5G3ZA 3AVVA 2R62A 2BM0A 1P4SA 3GD7A 2YWGA 5G53C 3PG5A 4FN5A 1SZPA 4F4JA 4HZUA 2CJWB 4C0AC 1UM8A 1KK0A 4HAXA 3CPEA 1KZ7B 4IJMA 4PO9A 2IK8A 3QF4A 3R7WB 4JJZA 1WQ1R 3LQRA 1UBGA 5D3MA 2KJQA 2QM7A 4TLEA 4FMDF 4URWR 2AHOA 1ZIOA 1VECA 3GJXC 4PX9A 3VTKA 2F6RA 4KODA 1U99A 4NYIQ 5FL7D 2VA8A 3LQQA 1VMAA 1RRPA 3K70B 1AN0A 4M1MA 5TVKA 4DIEA 2QMEA 5H8WA 2IS1A 5K8UA 5FBVB 2JASA 1N0VC 3NG1A 4LRWA 2GA8A 4TT3D 4JBWA 3RRMA 1D2NA 2FPKA 4B2IA 1Y3AA 4B48A 2J9RA 2CK3D 2TMKA 4JSTA 3RYTC 1QDEA 5KO2A 1OXTA 4OJQA 5CYPA 2JCSA 3KQNA 5TXGA 1N5LA 5D3MB 3GLGA 1Z8FA 4MGKR 1Z5ZA 3KXKA 5GVRA 4TTRA 4M2LA 1H8ED 1SHKA 2X1VA 4EIWA 2WAXA 4EJSA 5LDDC 4CEJA 1PLKA 1IXSB 2ZRGA 5FPHA 4CT5A 4XWKA 1KJWA 3HJNA 3LX8A 3EARA 2LKCA 3U44B 1LS6A 1U8ZA 3A1SA 3TKLA 4HEJA 3U2QA 2HJVA 2C03A 2AR7A 3OEHD 2RB4A 1P9RA 4TMZA 3QXCA 4MUBA 2Q3FA 2R8RA 3U7FB 3K0CA 1KHTA 2ZS8A 2XZPA 3G82C 4WBSA 5JJKA 5FUWA 4R9UC 1LV7A 1E2DA 1BH2A 4WW0A 4B3GA 1FNNA 2IYTA 3C16C 2WZQA 2Q9BA 1T4GA 1TADA 4GOXA 1ZP6A 1EGAA
chains in the Genus database with same CATH superfamily
3QVLA 3UPUA 1GPDG 4LF9B 1RIIA 1X86B 1IAVA 3B8EA 1OX5A 3BIJA 1WKBA 3KVOA 1TF7A 1OXBB 2QD4A 2LE0A 1MEEA 3DJYA 3EQ6A 2RAUA 4JYCA 4E09A 5JNUA 3LC7O 1N5JA 1O77A 3PFCA 4HQOA 4HRYA 2NV2B 1Z7EA 2VR1A 2BZGA 4Q00A 3ORHA 2PWPA 2QXTA 2V6IA 3FGOA 2VOJA 3Q15C 4RQBA 5A62A 3FFWA 5CVDA 4YUXA 3KSUA 4MGEA 2QZ9A 3CY6A 3QV2A 4Z9FA 2GPTA 4C3OB 3RAEC 4EMUA 2VJYA 5BRJA 4KFTA 3JXEA 2A3RA 1UK9A 1SXHA 1OBOA 4YLYA 1ZA2A 4EW6A 1SD1A 1QX4A 1W46A 3SX2A 3NONA 1UBKS 1OXXK 3WRWA 5EIEA 2ZCVA 3VZRA 1ZLXA 16PKA 3KR9A 4PW0A 5CIYA 3HJCA 4KW7A 2BR3A 4FYJA 2BM8A 4OVKA 1U7ZA 1XTPA 2GBIA 4GMXA 2R97A 4IDPA 4YH1A 5IMSA 1OYVA 1SULA 3QE0A 4R1PA 1E4VA 3BZBA 4HQNA 4N39A 2GBFA 1P2SA 3U6KA 5FPTA 4KX3A 1JG2A 1DINA 4NNOA 1JYSA 3VDRA 5JV5A 1O03A 5AIBA 3CXRA 3LFHA 2MSEB 2G9QA 1CE8A 3BWCA 1XZJA 5EMKA 4YHBA 4CLXA 4JBXA 2A1IA 1RU3A 2YZ2A 1IVYA 4OXXA 2C4KA 1G20B 3VC1A 4IUCS 5HMMA 4C7JA 5AUNB 1JF8A 3AUAA 1N5MA 2WG0A 1NVTA 4N4AA 3ZI4A 4LJKA 1WVGA 2ZOSA 1E2IA 3D81A 4X1IB 5H82A 4CXMA 1FUKA 4J0KA 3IRUA 3R0IA 1KVTA 1EX7A 4R0VA 2JVIA 3LYLA 3V8VA 3TEFA 2WFAA 1J06A 3N86A 4M0UA 3A70A 4IIFA 1GWNA 3ZTWA 1F8XA 3A3KA 5SYNA 3A4TA 3QEJA 4ZJYA 1KO5A 4B45A 4FJ2A 4ITVA 3E2MA 2EKLA 2WHEA 4U2GA 2IT1A 2KSQA 1NW7A 2PX0A 2IC5A 3FOBA 4RSGA 3ZV7A 1NI4A 2P3LA 4ZT4A 3VPSA 4BRSA 3C3AA 1ZXXA 3HY4A 2OV3A 2PSJA 1XI2A 4IJ5A 1A8QA 1S4MA 2V7WA 5JDIA 1JVBA 1GZUA 2FUCA 5FF9A 4AG3A 3GLUA 2V8OA 1NJGA 5K20A 5KX5F 1QQTA 1W88A 4LG1A 4G67A 4PSDA 2FUNB 1E2NA 1YFKA 1KETA 1J90A 2EZ4A 5CW1A 4JDUA 4E32A 3KR1A 1JEYA 4YROA 5DI9A 4FZ3A 3VR2D 2CNNA 3L8DA 4KITB 1FFGA 2WU1A 5EHXA 3V7FA 4TN5A 1YK0A 4JQYA 3DNFA 1LPAB 4AKIA 3NWJA 1KYYA 1QZUA 2IYAA 4K03A 1CY4A 4JFRA 3SIPA 2XMRA 5KNBA 2IGTA 2GMWA 5E9JA 1QFZA 4CLRB 2QN1A 2FNAA 1EUCB 2Z98A 3ZEAA 4NK4A 2AI3A 1NXPA 1PT7A 1YO6A 2OO7A 3G2NA 3IT1A 4ILEA 3T3DA 2HN9A 2V74B 1ZGZA 2Q2QA 1PTKA 1MNAA 4C4XA 3VKFA 5IRCD 3O1HB 2BF7A 4PRYA 2C0CA 4U6QA 121PA 1ENOA 1SWVA 1HTTA 1ZKDA 3O82A 4D3FA 2ZUBA 1NYTA 4PQFA 2PFGA 1JKMA 2CLCX 4RF5A 2R8PA 1CRWG 1QK3A 3KDAA 4OXRA 4S2EA 5LBUA 3T0IA 5FTLA 2O06A 2EBWA 1YIAA 3HDTA 5DNUA 3EA0A 1EYZA 2RHCA 3BF7A 3T7SA 1CIPA 2WTAA 4OI1A 4YASA 3R7LA 3UOWA 3M6UA 4BDTA 2RHJA 1D9ZA 2WLSA 3GFPA 4H08A 4XW2A 3IR6A 5ABPA 1X7XB 1B0UA 2VT6A 4UD2A 5B2FA 2BP7A 2RHOA 3T6KA 3H9QA 5J2UA 1W19A 2OCLA 4ZVSA 1COWD 1DAFA 4B6EA 3TCXB 5AQ1A 4CJXA 1LBQA 2LBPA 5J2TA 2CV2A 1P3JA 3VAAA 3ETLA 2BFBB 1C7EA 1EQ2A 1FFAA 2CEKA 2R5NA 3I39X 3QG1A 3PQ8A 4F4DA 2OBLA 3PRYA 2QDKA 2NV6A 1W2WB 4DLSA 1WMBA 1WY7A 2GRJA 3GN1A 3HJUA 3K8QA 2OFXA 3RW9A 3EZXA 3VR5A 2GCOB 4P83A 1T2NA 3CEJA 4V0RA 1BMDA 2PYDA 4JBGA 4RA6B 3PX7A 3TIGA 1YQEA 3DVAA 1SVKA 3BERA 4TWRA 3WZ2A 1TCAA 3OOWA 4V1CI 4J7CA 1U2DC 1MABB 1X7WA 2GASA 2ZEJA 4RV4A 3BJIC 4S35A 2Q7OE 5A4IS 1XEWY 4G4SP 1IEXA 3LNCA 2VQFB 1YR7A 4GR9A 1P2TA 3L46A 4UCXA 1JEDA 4BXOB 5D51S 1W49A 5F98A 3VR2A 4UPDA 3X2SA 2ZRJA 3H9UA 2BEUB 2JRCA 4QQNA 4ZDJA 2X23A 3K71B 1XQ1A 2OHHA 4XWOA 1VE5A 2XJ9A 2G63A 3NNSA 4EVQA 2R7MA 3EUAA 5EHGA 3PUKA 3RREA 1F8UA 3N7UA 1YDWA 4KN9S 5DLQC 5IHPA 2FW9A 5KYWB 3JVIA 1ONPA 2HWWA 1CUCA 2QSZA 2Y1XA 3A3YA 3NWBA 4P3KA 1MAAA 5DWQA 4BECA 4ZZ1A 2XF2A 3BVPA 5AJVB 4Z2YA 4Z8YA 3S8EA 2AV6A 2WPDA 1P1CA 4NV3A 5DNCA 3FCSB 4X6LA 1Y5LA 4QUAA 4UEJA 3UJ7A 1IB6A 1XRRA 1ODSA 2M98A 2ONYA 2AFHB 1T4DA 2EHJA 4LY6A 2H1WA 3KUKA 1L3BA 3M6XA 3OPYB 4OG2A 2WEKA 1UZNA 3I1IA 3IBGA 3RJ5A 1P4GA 3GLRA 2WLTA 3CMCO 1NLYA 3NFRA 3ZW7A 4ANFA 1ULUA 3SDZA 4FVTA 1L2TA 1JLKA 2PMKA 1ZRMA 3H87A 3B6EA 3OFSA 2ZS7A 2EG9A 5DF1A 4F2HA 2X0JA 4MUEA 1AF4A 4MV0A 5HIMA 4K6HA 3UJ9A 3AKZA 2A0FA 1ZZGA 2H5LA 4PZ9A 3DVSX 3AM3A 3KZXA 2QQFA 3CF4A 3G13A 4ETMA 2BEKA 2QD2A 2WG2A 1NBEA 3GRRA 1XQYA 4IIJB 4RA6A 4NNPA 3LF1A 2PS3A 1QZTA 5SY6A 3TZBA 1RJEA 1CY8A 3EAGA 5IXYA 3QG5A 1AGXA 4H9GA 3SYRA 4DHWA 3IUPA 1ZHOA 2ST1A 3B9QA 1X92A 2PRKA 3MD9A 3R75A 4K0KB 4M9QA 4TPKA 5EVJA 3K72B 1H3FA 3PDHA 3GNTA 3VPDA 3Q0TA 3NETA 2PL9A 4TL9A 1HETA 2V55B 2WHQA 3ANYB 5FLYA 2EW2A 1JB9A 2RAVA 1Y34E 2NNLD 2NQ2C 1TT5A 2XMPA 3NWPA 1PSWA 2QUHA 1U7XA 3L1KA 1ZONA 1G8YA 5DFAA 1B0PA 2PD3A 3DEAA 2WOJA 1OZ0A 1G3QA 1ZU4A 4HYYA 4NV1A 2RGXA 3PU6A 2Q6OA 2AG1A 3N05A 5F5NA 5GQSA 3RIGA 2W6OA 3G1UA 4NAVA 3BHJA 3PVZA 4OK6A 2PU5A 3C6XA 5KTPA 1K1EA 1WMSA 3QKWA 5HDQA 1F1BA 4JNCA 1R88A 4EVIA 2Y66A 3J81k 3GGPA 3GJ5A 3EWSA 2NPFA 3PKJA 1I7QB 4WKCA 3VVBA 4IX1A 2HA3A 1TTPB 2OZKA 4PHCA 2QX8A 5THXA 1IIRA 4C06A 4RTPA 2VQEB 4MV9A 2X0RA 1ZM3A 1CJMA 3EYAA 4HP8A 1PF7E 4FFWA 2X86A 2Q4EA 5EA2A 2ANCA 4RF3A 1GZHB 1Y6JA 2RJNA 4KE6A 3DCIA 3ZTYA 1DAKA 3ABSB 1C3JA 4IILA 1U3UA 5C7IO 1K86A 4RVFA 5ENZA 1D2EA 4FTWA 3GLTA 2IV7A 2XTNA 3L7KA 2Q21A 5HCUA 1L5ZA 3C41J 2PNJA 1XP5A 1YR1A 2VUTA 1B4DA 2JEZA 4MJ3A 3H17A 5HIAA 4N5HX 4DLUA 3S2IA 2AIRA 3M1AA 4FGUA 2K7FA 3WS7A 2XYHA 2OLJA 1QYIA 3QPBA 3S6JA 4LRTB 2QRUA 5KTRA 4AU1A 1XRJA 4J29A 4UXHA 1FZTA 1RPJA 2CSUA 3BYZA 3WWZA 1Y9JA 1ZH6A 4CQMA 3WC4A 4DSUA 1V48A 3HJAA 3ZD6A 4KXMA 2IH5A 2K5UA 1CZLA 3LUHA 5I7FA 3BTUA 1TIBA 3ELUA 2Q1XA 4OU4A 2B30A 4EGFA 5CBKA 4O4IB 1T5TA 1L4EA 2DUNA 3RBXA 3NALA 1NLMA 4KK4A 3QENA 4CR6A 2ZIFA 4K28A 1HXHA 1B14A 2FWIA 4LS3A 1W76A 4E7OA 2CXHA 3R6DA 4HR7A 4D8TA 2DBZA 1KAQA 1USKA 4KK3A 4ZTBA 4DR3B 1MG5A 2OAGA 1FF9A 3TTYA 1VHWA 4ZEVA 1P6UA 2G0AA 3ZHUA 2EX4A 3LLMA 4YN3A 3O90A 3BC1A 3I6ZA 3NC1C 3Q85A 1Q15A 1U0EA 2NZXA 3I12A 5CFQA 3ZZ0A 3L8MA 1RFLA 3MZ0A 1KSFX 1C9NA 1ZUIA 3IT2A 3PUZA 4Y0NA 5LYJA 1QZZA 1PQUA 2R4UA 4YXWD 2NYVA 3HR7A 1T91A 3NGXA 4S24A 1D4OA 3EEBA 3O2NA 4FBMA 4H1TA 3D8UA 2H11A 2JBAB 2VCYA 4JYMA 5BP7A 1LFAA 3GG2A 4NICA 1YQTA 5K51A 4S1OA 1TJPB 1USIA 2A59A 3C5HA 5EKUA 4HWTA 3VC7A 1U3DA 7AT1A 3FMFA 4CMGA 1E58A 3MG9A 2F3RA 1VCIA 4JJ8A 4OL0A 2OYSA 2GTIA 4HFRA 5ALTA 1E18A 1T8PA 2HNAA 3PF8A 3T3EA 2C2WA 2HLDD 1KTVA 1IUNA 2MTBA 1B7GO 2QU7A 2R8EA 3CF6R 4LBZA 3TOXA 3OX3A 4RANA 1QG2A 3V7NA 2OGTA 2H57A 2SCUA 4QOSA 3WJ2A 3GEBA 2PFSA 3U7JA 1XG5A 3N53A 1RRGA 3KT8A 2GNPA 3HDQA 4RK5A 4KI7A 3H75A 2Y05A 5EKXA 4NAHA 3W5AA 4AS3A 3AVYA 3OWHA 1AHHA 4MJXA 1XZFA 4MW6A 2IHTA 3VKWA 4CLHA 4RVGA 3THXA 2EBHX 4PICA 2C4NA 1V8PA 1LQTA 3FPFA 5JNSA 2ZJ2A 3AF6A 3CT4A 3I5YA 2KM1A 1LXCA 2IUSA 4M1TA 3IAHA 3VTAA 1H9AA 1UPCA 4ZO8A 4EO7A 2I4MA 1SEPA 3RK4A 1GLVA 1RE0A 2YASA 1SC1A 3K15A 2EG5A 3A3PA 2FFQA 3LDFA 3ODPA 4JJFA 4L1KA 2W6CX 4LHYA 4IIUA 4MS1B 4P3OA 1FX0A 4E15A 4NCAA 2B2XA 1SC4A 1Z6GA 3ZGYA 4EYGA 1F2UB 4OU5A 4RY0A 5I3ZA 3DBRA 3ZG6A 4EF5A 3I83A 3QIVA 4F3YA 2ATIA 5AXBA 1NT2A 2GPBA 4IDGA 4RQUA 1PVDA 4XAQA 1WXQA 1FDOA 2CZQA 5KWEA 1KYWA 1W85A 3EGVA 3FUXA 4I55B 3E70C 3M6LA 1V8BA 5GJCA 4BX9A 2BKXA 5CB4F 2C9CA 3K5HA 3R5SA 4RKWA 4BVGA 9MHTA 1G60A 1JJAA 1FRQA 1M1NB 1A9SA 4EKNB 2CDNA 4DIUA 4UJ5A 4NCJA 2IPOA 2G5GX 5E4JA 4RIEA 4DRXB 4FEYA 1ZK3A 1XVTA 5AJYA 1SXJD 1M2NA 4C4YA 2B4QA 5CA1A 1C1XA 1JKIA 2P77A 1G8HA 5CYGA 3ZNPA 1UUFA 1WEKA 4BV9A 1SKQA 3R4VA 4EYEA 3D1LA 3EIOA 4E4RA 3NUGA 4IS2A 4UQLA 2ZSDA 4M0DA 2X5XA 2A86A 5A6SA 3I1FA 3A2MA 5I9NA 2PX3A 5FXMA 4RK0A 3GVPA 2P79A 1E1NA 5BSGA 1KXJA 1XN4A 3CB2A 1H42A 3H2ZA 4WASA 1IHPA 2E4WA 3ZVKA 2G8NA 4E5PA 3DXFA 4A8JC 5ANRB 1DRKA 1HFWA 4RADA 4F9FA 4QFDA 2QZJA 4BB0A 1CY7A 2R79A 1AK1A 3RU7A 1S2MA 3BH7A 4RMGA 5CNIA 2OM2A 1G17A 1L5MA 1NHWA 1V7ZA 2RCNA 1WKVA 3T4PA 3ZQ4A 2I4NA 2NUAA 3HDVA 4KOAA 4MRMB 4FOOA 3PP8A 2Z2IA 3FGZA 5I47A 2IH4A 5DWDA 4AIRA 4OAQA 1EKXA 5DMHA 6PFKA 1XA4A 2BEWB 3L8GA 3ASVA 3H4TA 4TL6A 1JHAA 1LC0A 1B2LA 1E3QA 2X58A 1QBKC 3LYHA 1F4LA 3K8ZA 3THYA 1GUDA 3BXEA 2FEPA 3UAOA 2CE7A 4O1IA 1GPYA 2MSKA 1TO1E 2P9EA 4CMCA 1LBTA 2GWRA 1D03A 4Q02A 1GGVA 3BOSA 2GK6A 1UPFA 1Q22A 4WN9A 1IQRA 2J0SA 4MUNA 1RRMA 3K0SA 2IHVA 1ULZA 3DDOA 4RE6A 4CKCB 1KY2A 1YONA 4G63A 1A7JA 3GT7A 2M1ZA 4WOPA 1U1DA 1CP3A 4UAVA 1ZR2A 2JLVA 1YJBA 4CNQA 1MO5A 4EARA 1OJLA 3AHGA 4MS4A 3VJRA 4KDRA 2CUTA 3JR7A 1ORTA 1G2PA 4IXTA 3ZJ4A 3HCNA 3FGPA 4R51A 1ZOOA 1FFEA 2PZFA 1BS9A 1IAQA 3BFXA 4PCUA 3VU9B 3GGOA 1NVFA 1K6EA 3B1YA 3COWA 3WGLA 2R8YA 4ILKA 4RH3A 5BWNA 1XTBA 5I01A 1QIFA 3JQAA 1I6LA 3LP5A 3PC6A 3UTCA 5BUQA 4FZ5A 5DTIA 4ZI3A 2Z6VA 1E9DA 1Q74A 4D8XA 3AB8A 3PV0A 221PA 3AFMA 1QO0D 1Q0LA 2V3WA 1XBTA 3HY3A 2GZMA 1T9KA 2XUIA 3LKDA 5FOWA 4TWJA 3JATB 4HB3A 4MARA 4QDUA 2W6ID 3M6MD 4TXLA 3BMXA 1QFYA 4IVPA 3ZBQA 4RULA 4JT9A 3G5MA 3H0CA 3GGGA 4OMUA 4CBVA 2XRYA 3FR8A 2XQFA 4FHDA 1VHLA 4KG7A 4A9AA 5ALZA 3WRVA 2P6OA 4AUEA 3JZFA 4JLVA 2W0SA 1T8YA 4EO4A 4C87A 4Z7NB 2VSNA 2QSYA 2OAP1 4RACA 3HRHA 5ALKA 1QYXA 3EEFA 4Y2PA 4FYYA 1JEJA 1QIEA 2XITA 3D3WB 3I6BA 4OHWA 4YAJA 5A02A 4CN8A 1VBFA 3ZDBA 2LV8A 2WWFA 1UBRS 1NFFA 5TPZD 4EDFA 3K8YA 1VLQA 2Y99A 3QKUA 3ZKWB 5BMVA 4HDSB 2BFEA 3GDWA 3EPJA 2WYHA 4AO8A 3LJKA 5HZKA 4RTSA 5KYYA 3HCPA 3Q3IA 2DF8A 2EP5A 6ADHA 3V1UA 2ES4A 1FOEB 1Z12A 4MCJA 3URKA 4C07A 4GMGA 4A0GA 5JD6A 2VS1A 4UVGA 1ZVQA 1EFPB 3QBDA 4IFBA 9LDTA 2DE0X 1QFJA 3ZGZA 5EUQB 1H2BA 4R1QA 2ZYGA 3ROPA 2D7CA 5EIOA 1W4LA 1ZFNA 4HDMA 2XQIA 2H52A 3EN0A 4QU5A 3EAFA 2G1AA 5KJCA 3PQEA 4N5MA 3MQ2A 1KYTA 2CJPA 4LKOA 4LDJA 4G0XA 1YS6A 1NZJA 4OJKA 1W0KA 3WQHA 3A26A 5IVDA 1A8IA 2OZVA 1NRXA 1YMUA 3FKQA 1OX4A 4O33A 4CKBB 2ZXFA 4I3HA 1M6YA 2V0GA 1CDOA 4FOTA 1JU9A 1SD5A 4ZVPA 1RI5A 5AHWA 1G7CA 1P19A 2AQKA 2FRXA 5DBIA 4A2PA 1ESDA 4Y2XA 4A73A 2X3FA 1UPUA 3S1AB 2I2XB 4NESA 4XDHA 4CT0A 1ZUWA 4NATA 1QH0A 3FPCA 4MPDA 2WYOA 2HYIC 1VOTA 2D0OB 1XLWA 3ESRA 4WOKA 3DVQX 3PL1A 2JI4A 3LPNA 2DM6A 2ISQA 1XZPA 2V9ZA 3RH0A 1KH2A 4D4JA 1E1MA 3AY0A 1MC4A 3IUQA 3R20A 1UJ4A 3UOGA 1P9LA 3KTAB 2HX1A 3I2HA 1L4FA 1SQSA 3U4HA 4I4TA 4URZR 3HDGA 2HEGA 2V6BA 4FYWA 3OZUA 2RDMA 4LYHA 5A9TA 1SBTA 4MW5A 3FB1A 2ZUUA 4F4HA 1NUTA 1T4CB 2AA3A 3L5KA 1YDMA 3HL0A 5CNMA 2PUEA 3TPFA 2NGRA 2ZIAA 3H3FA 5F7XA 1DQYA 3IESA 2P91A 4CW7A 5GINE 1EUQA 1UT8A 3IHWA 1Q1ZA 4LE0A 1QHYA 3PC8C 3PXXA 2WTUA 4ZZIA 1LW7A 2OSBA 5JXHA 2QOEA 4C78A 2BEWA 2QTNA 1F2TA 1V7CA 4PM4A 2AF4C 4XIFA 1IH8A 3TLJA 2FX2A 2H5EA 4IHJF 3TIVA 4B84A 1F2DA 3VVMA 9LDBA 1E3LA 3HNPA 3BTOA 4KJXA 1RKUA 2FG7C 3N6XA 4BFSA 2IX9A 4OHXA 3BT7A 4JLOA 4RELA 1EXVA 2XKJE 3ZK8A 1GPUA 1YU9A 2LWIA 4QXRA 5AO9A 3SJ7A 1WZUA 2GVDC 5FUMA 1ZWKA 3M6IA 3SQDA 2B7LA 4LF4B 3VXKA 3NANA 5ALYA 5AVJA 4RPCA 4GKJB 4E5MA 1A27A 4QICA 1N2CE 2FOLA 2YTZA 5EIAA 1T1IA 1H0SA 1A2BA 3DJFA 1W47A 4QXPA 2NU9A 4J49A 2L18A 2R84A 1A4XA 1UBCA 4BO1A 1MB4A 1KERA 2PZKA 4YMTA 1VL0A 4UAGA 2A7QA 4W1QA 3T1YB 1GT91 4KUHA 2HHCA 5BUCA 4DR5B 1XJ5A 1U0FA 2LGJA 1CEXA 3GHYA 4X85A 1UDWA 2GXQA 2XHZA 4MQ4A 1K6MA 2NU6B 4UMEA 4B4KA 4X1OA 1RYDA 4ZQHA 3F4KA 3NPMA 5A05A 1SVIA 5EN4A 1V71A 2OBXA 4IYRA 3DZKA 1BN7A 5L40A 2OZLB 2ZBQA 4TROA 2PXCA 5F4BA 5JJ5A 1RKVA 3QWAA 3TW6A 5B2EA 3C3DA 1RZRA 1KMNA 1QM5A 4KLRA 2GETA 3HBAA 4HNRA 2IYLD 3TM5A 3SYTA 2GN2A 1E3SA 1JR3E 5CT9A 1EJ0A 4UQOA 2PZBA 2QQGA 3WB1A 4ESHA 1SCUB 1UIRA 3R0QA 1G6HA 2PH5A 4N7RA 4R2WA 5D1HA 5J5VA 4C03A 2P5SA 5J2UB 2YN4A 4R31A 1KOLA 4WCVA 3QKRB 1PTJC 1SK8A 1H2EA 2XE4A 1Z47A 2ZI5A 4CM9D 4YUAA 1N5OX 3EC7A 4DNQA 1E1QD 3OWXA 1IHUA 1P9WA 3PHJA 4LDZA 2FRVA 1GILA 4EAQA 2CXSA 3I37X 1CJUC 1QMGA 1EUDB 1OF1A 1P5FA 4KPUB 3BIOA 3A4IA 4C20A 4UOZA 2WDPA 1TEVA 1QCZA 2Y1EA 1KI2A 4G1CA 2GT1A 3K16A 1ODFA 2Q4TA 3OQ6A 2Q2OA 4BFZA 4Y0VA 1L1FA 4H31A 3W6NA 5GONB 1RYNA 1HH4A 2N46A 3G9TA 3WDKA 3B9RA 4UARA 3RVRA 3G9UA 2VT2A 5AOCA 3GT4A 2NV0A 4C6TA 4EZIA 3Q7EA 5JH7A 1CQXA 1Z22A 2ZT6A 5J47A 3T3OA 1JAHA 2Q49A 3LNTA 2XCSB 1JFFB 1KYZA 3AF5A 4LBYA 4ZQFA 3QV1A 5HX7A 4NV0A 5IZCC 1MORA 4CGZA 5ES4B 1IQ0A 1ORRA 1QHFA 1A9YA 2KBFA 1VTKA 4ZAZA 4ND8A 4YCLA 4O08A 4FNAA 1QO9A 4NOJA 1GQQA 1Z39A 1DO0A 4C1NA 4PQYA 5IWCA 2QBYA 4IVRA 1M5RA 5EMJA 1RWVA 3E7DA 3PNKA 4R9NA 2DKOA 1N8SA 1OT3A 1YZTA 2IXFA 1O4VA 3FUVA 1E77A 3FKSA 3C5EA 4JWKA 4QYIB 1XDBA 3GG9A 3CG0A 3VO2A 3N8KA 4MEAA 3WHKA 5GJVC 4GBMA 4P5EA 2XJ4A 3TOZA 2ZYAA 1CZUA 1C3OA 4LF6B 4KPEC 3KEQA 5CH8A 3RTCA 4EG8A 3TI9A 4IGEA 5ILOA 1G6OA 4ZT7A 1LI4A 5AYVA 3DAYA 1NN1A 3JWEA 5JRJA 1JDSA 3UT5A 3PDUA 1SUDA 1XROA 3UT6A 4QX6A 5EP2A 3X44A 4ARIA 4MVCA 1YZVA 2WJHA 1YK1A 2D1SA 1JFVA 5HF9A 2XY4A 2WRZA 5T57A 3D6HA 2QM3A 2D0PB 5B2ZA 3WI7A 3WYDA 3IUMA 3I58A 4DG5A 3W7VA 4BLSA 4QGGA 5JZ9A 4YJFA 1MF7A 2OILA 4AD8A 3IDOA 3QKRA 1AQYA 1TYDE 2LRHA 4OHMA 4OHZA 1J22A 5JS2A 3KUCA 3THOA 2YC2C 3H4IA 2JGIA 1NSYA 5CA1F 1QIKA 1G1AA 3FPAA 2VOEA 1HV8A 3G8AA 2YWCA 1W44A 2ZWOA 1T1RA 3Q10A 1NI3A 3W8DA 3FYHA 3TQTA 1EK5A 4JC8A 1R16A 1Y48E 2JD1A 4XEUA 1PFGA 3AB7A 3U7RA 1BN6A 4RJTA 2DHEA 4XIJA 1TK9A 2NO1A 3CR7A 1PR3A 1BTOA 2H7YA 4ZAWA 5C8VA 3OF5A 1NJSA 1R12A 3RJMA 1KMQA 1CLEA 3GJ3A 2OXTA 2CWDA 2XZOA 1B23P 3HJGA 2P9QA 3UH1A 2DFKB 4EABA 1L5KA 4XX0B 5CLGA 4PCLA 3CA8A 1AG9A 1Z2CA 1ZNZA 4WKPA 3P27A 4JL6A 1MRZA 4KSBA 4LHWA 1EWYA 3KQQA 5REQA 3RKRA 4AN0A 1YZQA 2XE8A 2QN6A 2FZWA 3QVVA 1S3FA 1A71A 1Q2XA 3JD4A 3QVXA 1ZI9A 3PUVA 5FORA 1C30B 4FW9A 1APBA 1N3YA 4PF1A 1Q83A 1Y3DE 1YQQA 5AKGA 1POWA 3E15A 3QYFA 4G0MA 5T41A 4CEHB 3D4PA 3NTQA 5TQVA 3NEAA 3UKOA 5IKPA 4CR8A 3ONVA 1FRZA 1A8UA 4JR0A 1PEAA 4Z4QA 3P96A 3N28A 1M75A 1H2RS 3IMKA 4DYHA 1MXFA 1JSXA 2YW9A 4JFAA 4RXUA 3WLAA 2DH6A 3DLHA 1B0AA 4IDEA 4QGBA 3WJAA 1QCYA 1M83A 4DWOA 3VPAA 4UTNA 1JDBB 4L4ZA 2FWNA 5AUOB 4KQ9A 4CQMB 1T1SA 2ZB2A 1YQ9A 4ZO6A 4GOKA 4X3PA 4EJ0A 3NHWA 1W93A 4QUEA 2AFIB 1EHCA 1P7YA 4QRIA 4ZMBA 2ZP1A 3BGWA 2X0NA 1HF3A 3ETJA 4BNTA 4CM9A 4F4CA 2OXRA 3LT1A 2Q1UA 2DCMA 2DY1A 3H1TA 4C21A 2A9OA 3WLJA 4CV3A 4DFDA 3KQSA 3DEJA 1I2AA 4GLOA 3EWAA 3ITNA 4FFRA 4XPIB 3FH0A 1DRJA 1QGED 2WJ4A 4LRQA 3HLYA 4NZYA 2RGYA 1LK0A 1EQUA 1Y98A 4LX0A 4YAOA 3DULA 2OZLA 3DWEX 4IL5A 2HI0A 2X3YA 1LLUA 3DDZX 4E14A 1NLFA 4FYKA 5FEMA 3ZCPA 1MX5A 1DLJA 5GM1A 3GZNA 4PC3A 4F2WA 2OCBA 5KWSA 3KZMA 1V9SA 4NLLA 3WRYC 4F85A 3EPPA 5CXUA 3FHOA 3DTVB 1DIRA 4GM4A 3IAM6 4LPSA 3JQAB 3SE0A 3G6KA 5I5EA 2JHPA 4FONA 4HDKA 4MS3A 4BN4A 4LF5B 2QN2A 3LCCA 4HNAA 1CYEA 1YNSA 1O7JA 5E1BA 3C24A 4IWYA 1TCUA 2CWWA 3DGEC 2FWJA 4P4TA 3V48A 4DLRA 2YFHA 4FOPA 5HNKA 1S02A 2LVBA 3CO0S 3AX6A 5J1SB 1KY3A 2GK4A 2O48X 3H6HA 3OFJA 4J2HA 4R3WA 4UVEA 3HSSA 1NF3A 2P6UA 3LQ1A 4NTZA 5FA5A 3B7GA 1C0KA 1M5TA 1SUEA 3GO4A 5HGJA 3BXFA 4EI2A 2B5VA 4DMRA 3DL4A 3IKMB 1RQLA 3QFFA 2CCKA 1H0HA 2Y76A 2UAGA 2VYVA 1AQJA 4E08A 1DV2A 2PX2A 5SYAA 1NAHA 3VR6D 3DC2A 2P2NA 2XTAA 5ILGA 3PPYA 4GSKA 1CZOA 4IUDS 3A9VA 2NTEA 5E2AA 2AZMA 1K9SA 1MAUA 1KS9A 2VSYA 5E6SB 2NZJA 2ZI9A 2ZR8A 2A30A 2YIJA 3HMKA 5EJAA 5LZ8A 4E1VA 1S7CA 3OQVA 1A4UA 1F2UA 1QH1B 1RKXA 1SPXA 2X7XA 2ZBGA 2C5AA 3DUFB 4WY5A 4XVRA 5G0VA 2QKYA 2HF8A 3G7UA 2G9VA 3VKVA 1TB4A 3RYCB 4RHEA 5BUSA 5DYNA 2GPJA 1NQAO 3C98A 1P60A 4TUYA 5IKXA 1B93A 2QTVB 2D74A 4U3JB 1EU1A 8OHMA 1Y3IA 2NZ2A 2XSZA 3K6KA 3QYJA 2QAIA 3TZ6A 3REQA 5IX8A 1J1ZA 4L5AA 4RPJA 4BUCA 1RXIA 2BR5A 1NMEA 4KXVA 5DK4A 4I50B 1SVOA 4DREA 1C8LA 4QXAA 1N1MA 5IARA 3OPNA 4GYKA 4DLTA 4YV1A 3FZNA 4OREX 5KSOA 1EE2A 1U1IA 4MYDA 1XXHE 1VBNA 3AUJB 4H6PA 4B44A 3QW2A 5F77A 1E2EA 5C31A 2QR3A 3F8TA 4KJZA 5H70A 4FILA 2BGTA 1RBMA 4ZA2A 2F3PA 1V3TA 1MVLA 2PUHA 3IJ5A 1H6DA 1V4NA 2XDYA 1ZN9A 1D6SA 3OT5A 3SKXA 3FKJA 1SQ0A 2FYTA 3GLHA 3W6PA 4OXKA 4TYNA 1W1IA 1I32A 2I3DA 1UBEA 3NX4A 4F6RA 3L8FA 2WV7A 1A9QA 4OQMA 1J21A 2VDMB 2WSLA 3KX2A 3DF9A 3B6MA 1N5DA 1J99A 1ESNA 1OZHA 5COBA 3OOYA 2VHVA 3INGA 3FFBA 4P0PB 4WK4B 2JAPA 4HMPA 4KQCA 2EFJA 4OHUA 2ZIVB 4HNAB 4GMHA 5EZYA 1BNCA 3PT9A 1M10A 3K9CA 5IKOA 4NZ9A 2RKBA 2C54A 3PNOA 1IM5A 1SC6A 2MSLA 4KGDA 3TQRA 2HOQA 3WSTA 1FC0A 5I5GA 3I2YX 4KCGA 1O9GA 5J40A 3WL7A 5LOVA 2A35A 2ALJA 1DX4A 2BFMA 4CCAA 1O89A 2FMKA 2QS9A 4JKYA 5B1IA 5AVRA 4BGUA 1SH7A 4RPKA 1AHPA 1T0JB 3WP1B 3HFSA 2ZW9A 4O0LA 1LEHA 3CM0A 4HRAA 4BO5A 2QG6A 1AK9A 2W8BA 4JJ4A 1IEWA 3FYSA 1WETA 1KU0A 2EC5A 3B51X 4G81A 4RQAA 5H1YA 2PS1A 3TTTA 1BRMA 2BSAA 4UEQA 3HSKA 3RS4A 2JS7A 5IPFA 2RGRA 3A4MA 4M1KA 3BX1A 2UYQA 3IDFA 4IH4A 4BFLA 1TX4B 1WUIS 3EQZA 3WK4A 3U56A 3TD9A 3E7WA 2Y0DA 3BFVA 3GVHA 4W5HA 3TXXA 4QTUB 1NC3A 3ENVA 4MVJA 2QP3A 1LSJA 4Z99A 4EVSA 4ENRA 1GV1A 2HPHA 2HGSA 3OM0A 4A8JB 4ALNA 1V5WA 1AURA 1W96A 2H29A 3K4HA 3B5IA 3C1TA 2VH2A 4JEHA 2WKPA 4II7A 1TF2A 2QGFA 1EWQA 2ZZNA 1KRXA 4NPCA 3K2EA 4KO1S 4Q66C 2OENG 5TF0A 2VZ9A 3NAGA 4JLKA 1GQYA 4E03A 1HO3A 4JITA 4L5YA 3GFTA 4POAA 3V1TC 3VH3A 1WMFA 2E49A 2HDNB 5KPDA 3L18A 4NKRA 4Q3DA 2HQRA 2EOAA 3VGJA 2EKPA 2VCEA 4RBNA 4RYDA 4EG4A 4MUYA 2AZ4A 4UHJA 1B2RA 1GUAA 2H2IA 4Y8VA 4DJAA 4W5TA 1GZ5A 2ZJ6A 4D82A 5L3VA 4LDNA 3ONEA 1X7ZB 3JASA 3WAGA 1NRIA 3U5TA 1PHPA 1PX0A 3ESZA 5KDLA 1ZH8A 3L40A 1TUGA 3BRSA 5JMTA 4BBZA 2O2SA 1JG3A 3BHIA 3NDPA 5CLIA 3TMKA 4W5WA 2R48A 4NF2A 1HT2E 1P61B 2QUKA 4HAOA 2Q5CA 1MKYA 4X0EA 1X9GA 1EDOA 1TXGA 2H06A 3CRNA 1TD9A 2XNKA 3BB1A 4FINA 2PS9A 3E22A 4OB7A 4P7KA 3WBKA 1Z5WA 3DGFC 1TC2A 2G9NA 4TWAA 1USWA 1WKCA 2H0QA 4H77A 3WGIA 4URYR 3CEMA 4WFQA 3TINA 5AI9A 3U48A 5BSWA 4L0MA 4RZHA 5JEDA 2WW8A 4G5XA 5LQNA 1RRFA 4UATA 4GOLD 2JI9A 3GT0A 1OI7A 4PLTA 1T8TA 2VTBB 3BULA 3H0EA 1K2WA 3SC2B 1ZUHA 3BEOA 4P3PA 1ZN7A 1CUFA 1W0JA 3ZIAA 1K6XA 2Q28A 2JJ8A 2J4CA 2ZRHA 1M54A 2AFIE 5CRIA 5IT4A 1MZVA 2PL3A 4YP5A 2YXBA 2NT3A 4MTCA 4OV6B 2YH2A 3DG9A 3I52A 4DEVA 3N2KA 1O94D 1J0AA 1OIWA 3KUDA 1GGHA 2AOTB 5DGCA 3QITA 4D56A 2WK1A 3FUUA 4L78A 5ITWA 3W5BA 1P7VA 3F9RA 4B71A 2QD5A 2FHPA 2QTWB 2X13A 3AKCA 2GFIA 1T3GA 3A1CA 4Q03A 1NUAA 2QLBA 4UXIA 4BAGA 4OQEA 2Y9MB 2H18A 3U3RA 1ISSA 3IULA 3VC2A 4TV8B 4RETA 1MOSA 3AERA 5K3EA 4H4DA 3CS3A 3HVHA 1B00A 2DH5A 1P5HA 2V1XA 3QK7A 1V7PC 1MIOA 4CEHA 1J0DA 3IPYA 4S12A 2CD7A 2JLUA 4B4UA 1EVJA 1I6WA 3IIJA 4INOA 1GP2A 3LX6A 1UBNA 2JFNA 4BFUA 1U8EA 4ZYVA 3OLXA 1M2VB 4RGQA 3A27A 3WLQA 1US8B 3EYWA 2JVKA 1P0FA 3EQ7A 2Q5FA 1OX6A 3GLQA 3P9IA 3ZDZB 2PGOA 2X5JO 3BA1A 5F9MA 5F7ZA 5BV7A 5JBNA 4LGMA 2V7TA 5H5JA 3IVXA 2X77A 5BNIA 1CNMA 1TEZA 1Z4KA 1J5XA 3OD5A 5ITZA 3D8SA 3PFNA 2CNWA 3S70A 4ZK6A 1RXWA 2FSFA 1FJXA 4LZOA 3WK6A 4UXJA 2JFQA 4Z4CA 4J43A 2DPHA 1K6IA 1ENPA 5FULA 2VJCA 1JG6A 3JQ7A 3AHEA 5DW0A 1KKLA 1TJ3A 1Z06A 1RM4A 2AUMA 1LRKA 1SO8A 4OO3A 2HCBA 4P92A 3EC2A 1WMDA 5JCXA 2J4FA 3LWZA 3CNNA 4Q4CA 5JSUA 2WF6A 4LNUA 4MKGA 5FD8A 3SJUA 3WA6A 1R8QA 1Z9BA 3TR0A 1IXKA 3U3JA 5B7NA 5BWMA 4W8GA