1XJ0A

Crystal structure of the gdp-bound form of the rasg60a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
165
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-Ras-1
publication title Structure of an intermediate for nucleotide exchange by Ras
rcsb
source organism Homo sapiens
total genus 60
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2004-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xj0A00
2DFNA 4DDWA 2IYWA 4WA7A 2F43B 1GRNA 2R6GA 1T91A 4B33A 5KNBA 2OM2A 3QNUA 4QGHA 3GLHB 4UNNA 3SU8A 1NMXA 2PCJA 1KI4A 3MSXA 2FOLA 1BIFA 3FVQA 2P6NA 2XTNA 2JA1A 3ECCA 4Q01A 5HZKA 2YKGA 2OFWA 4QJ4A 4TTPA 1KJZA 2NIPA 4V0NA 2D74A 4PZZA 4HDOB 3VU9A 4YMVA 4LYAA 4HI0E 1ZM2A 1A82A 2F3RA 2ODBA 4OHYA 3A37A 2IYYA 4KO8A 3BFVA 3V4RA 2BEJA 2BEKA 5IDVA 4H9GA 1WQ1R 4DUGD 4UXIA 5JMTA 1LTQA 3RAPR 1GDDA 2X1VA 1I2DA 4AYTA 4PSVA 4GNKA 4Z8XA 2WPDD 1SVWA 2ZE6A 3MJHA 1UAAA 2F7SA 3GJ4A 3ZS8A 1J70A 4TMWA 1SULA 1E79A 1CJVC 5AK0A 4ZKDA 3D8BA 4PFSA 2B6HA 3OFNA 1U90A 3QBTA 4DLTA 2NMVA 2PLRA 4HAUA 1NN3A 4BFUA 3HPRA 2BBOA 4GPTA 1DTSA 1G16A 1US8B 5KSZA 2KJQA 3EPJA 2VP2A 2F3TA 3VNVA 4U02A 4KI0A 3IHLA 4IDPA 3BIFA 5D3QA 1E9CA 5LBIA 3B60A 4AIIA 2HT6A 3SYKA 3VKWA 1EXMA 1TF5A 1E2QA 3HJNA 4KBGA 2KI5A 5EXPA 5DNYB 2CXXA 2O5VA 2FGJA 1DVRA 4UJ3A 2ZI9A 4YDSA 3PFIA 4RZXA 1TADA 4Z51A 1NSFA 4OHZA 1NMYA 2PEYA 4RD2A 4BEBA 2FPKA 3K70B 1D2NA 2BM1A 1CIPA 5A5GA 3GLHE 2ZRBA 2LKDA 3RC3A 3PITA 1GOTA 2DPXA 4GFDA 5L3SB 3K70D 1RPZA 2ANCA 4OK3A 4DDVA 4ON9A 1YQTA 2AKYA 2FWRA 2A9KA 2R2AA 4ACAA 4HB2A 4M1KA 4CEIB 4A0HA 2OEPA 1G3RA 1NP6A 5JWOA 3FMIA 4NE2A 2CE2X 5KOYA 2ZE8A 3FTQA 3N5CA 5DYGA 3LDAA 1XFAA 1FMJA 4MH0R 1NKSA 4LYFA 4MQBA 4C7OB 2W6JD 1XXHB 5JSZB 3KL4A 1W36D 1TUIA 4QJ3A 3A1WA 2CCGA 1D9ZA 3NXSA 1T4GA 2W58A 4MRRA 1T0HB 2VP9A 1KY3A 4AURA 4CEJB 1FZQA 4N3NA 3V4FA 2J41A 3LW8A 2CCKA 4TTQA 1XCMA 1YHNA 2QPAA 3SBDA 2OFOA 4ZCMA 4C0AC 1GM5A 1LY1A 4JT4A 3W90A 3QPWA 2ZJZA 4GI7A 3C5HA 1FX0B 1OXTA 2W00A 3SQWA 2EQBA 2JLQA 5TDHA 1RFLA 2QT1A 3UATA 1PUIA 2WKPA 5DYIA 3OESA 2WMOB 1XX6A 3NBFA 4RJLA 4ZIRB 3AUYA 1ETUA 1W1WA 2QBYB 1BYUA 3AP3A 4WZAE 4GOJA 3REGA 4NHOA 3U7EB 2QENA 2WM9B 1S3GA 2BHRA 4BUJA 4TZ6A 4UQOA 4S35A 1H65A 2ZQ5A 3ZIAA 3CH5A 1GUAA 3NC1C 2WICA 3U7GA 1OV4A 1N2CE 3P1JA 3WYGA 1TUEA 1BKDR 2Q6TA 2RGXA 1Z28A 4NCKA 3DEFA 4FCVA 5GJVC 2GBLC 1SVIA 4R2HA 4TL6A 3AVWA 3CM0A 1GRQA 3TUJC 5KUTA 1JECA 1W7AA 1DELA 3SFZA 3LVRE 2WTUA 2R9VA 1QBKC 4JLAA 2N46A 3FB4A 4I1OA 4M2LA 2O8CA 2VP5A 3MWKA 3O8BA 3GMTA 1XXHE 4NTZA 1VCMA 1DEKA 1VDZA 3IQWA 3EC1A 1G3QA 1XTJA 2XSZD 3R20A 3LXRA 1YVDA 4TT3D 4RCYA 4A6PA 2YOFA 5GVSA 5AWFC 2Z4RA 3QKSB 1W36C 4XSHA 2AXNA 1E2DA 1IXRC 4K46A 2HF9A 1UKVY 2Q9BA 1KHTA 2CLCX 1GNRA 3FMOB 2YINC 4DLXA 2WHXA 5HTKA 2GXQA 3U3KA 4DJTA 2C04A 5JCZA 4HAXA 2XB4A 1ZC3A 5LPNA 3BERA 3REFA 2OXRA 2PH1A 4CEHB 1Q1BA 2F43A 3GFPA 2IL1A 1CJMA 5H68A 5C4MA 3EPKA 4Z54A 3QXSA 2ZAMA 1NIJA 1YRAA 1VCIA 4LV5B 3NDBB 3Q5EA 3GLHA 3I62A 1KK1A 2RKOA 2JIZD 3E5HA 3K9HA 2QI9C 4RZUA 3SBEA 4V0ME 3TVTA 3VTKA 2A2ZA 4Q19A 5FL3A 4AKEA 1W2HA 2ONJA 2AWNA 1QHSA 721PA 1OHHD 2LCFA 4A82A 1X1SA 5G53C 2GCOB 4HAYA 2PL3A 2UVQA 3THYB 3T5DA 5L3QA 1DAKA 4QXAA 2XNDD 5FOSA 4KFTA 1NNEA 3UWOA 4LWZA 3W3AA 1E0JA 2J1LA 3QEJA 4ZI3A 5FBQB 2ZETA 4ZKEA 2E9SA 2R8RA 3X2SA 1SXJB 1W4RA 5G3YA 2J0UB 3C7KA 1T6NA 4C0QC 3UG6A 1E0KA 2VP4A 1XZQA 5EQTA 1SXJD 2CEAA 3K9LA 2P6RA 3AVUA 2V9PA 1XU4A 4Q9HA 2IK8A 3A1SA 2HF8A 2QN6A 3LX8A 1R6BX 2DY1A 1PLKA 1RJ9B 1M1YE 1US8A 4PHGA 5JECA 1ELOA 1ZIOA 4MITA 2VH5R 4JSTA 1ZD9A 5F2EA 1K8RA 1ZNYA 2BJWA 2YWHA 4TTRA 2J3EA 1LS1A 4M21A 4A15A 5DH9A 3OIWA 4WZBE 3AVOA 1YZQA 3W6OA 1NF3A 3U6KA 3SDZA 4D80A 2FDCA 1U0LA 2IT1A 3QG5A 2GXAA 3EZ6A 3KUDA 4XD7A 5AJZA 4B47A 2EU8A 4WOPA 4C4PA 1P4SA 1R2QA 4IVQA 1BOFA 4MYTA 2GCPA 5EXXA 4F38A 4NU0A 1AS0A 5L3SA 4YQFA 3R7WB 1WA5A 1J2JA 2VQSA 4JBXA 4EPYA 5FTMA 5EP4A 3T15A 3L0OA 4KFUA 2NO9A 2W0SA 3U7FB 1XJQA 3QKRB 4CEIA 4KYUA 3C41J 1G291 1XEFA 2ZROA 3BS4A 4MDFA 4OHWA 5CB6A 4DLWA 4UXJA 1RC8A 2R6DA 3AGPA 1N5IA 4M0LA 4UNSA 4BEJA 1FFHA 1NJGA 5HZHA 3B1VA 1EFRA 1XXHA 4C7OA 4GOKA 1EWRA 1NRJB 5AUPB 5JSZA 2REOA 5FL7D 1AGRA 2J0QA 3TIFA 1O3YA 4P4SA 4LV6A 1D8TA 4M1TA 5DHAA 3CX8A 1SXJE 4ZI2A 2Z43A 1NSTA 4IOJA 2H8KA 4CEJA 1JJ7A 3BWDD 1E3MA 1RYFA 1X8JA 1D9XA 3P27A 2GJ9A 2MSDB 4Q4HB 4TMVA 2QTVB 5KU1A 3QSYA 3ZQ6A 2AK3A 1QHYA 4JJKA 3NDPA 4WXRA 1FX0A 2O0JA 4NL4H 3SOPA 3I92A 3HR8A 2GJAA 3CNNA 2ODWA 4GP6A 3D7MA 2NO1A 1QF9A 4ZIRA 1Q1EA 2RGDA 5AJXA 4EFNA 5ELXA 1EFUA 2R6CA 2QBYA 3HPQA 2H5EA 2ASEA 4V0MA 1BYIA 3U44B 2IYUA 4B3GA 4M4SA 4IEIA 3DMNA 4QHYA 1ZC4A 1GVNB 5JI3E 2H1LA 1XP8A 4M1SA 4EUNA 2EYUA 2YC2C 2GNOA 3FHTA 3CRVA 1F60A 4B3XA 3P26A 4YXWA 4MYCA 2IEYA 2Q9AA 2DWPA 5EZ6B 4E03A 4HAZA 2FFAA 2WKRA 1KOFA 4G3XA 3EA0A 5FPHA 3AVVA 2C9YA 2ZRAA 2WWYA 2J0SA 3KB2A 4C0LA 4C0HA 2RHDA 2JLRA 3CX7A 3I4LA 4KCGA 1S4QA 4JLNA 1IBRA 4LY6A 4AK9A 5HR5A 2KBFA 2QU8A 3KKQA 2V6IA 2XSZA 1AQUA 2C96A 2GF0A 1QG4A 3AF2A 4TT3A 5G41A 5GADl 1TEXA 2DFTA 2VHJA 5FR2A 3UK6A 1G7SA 3AKCA 3CRW1 3CBQA 3F3YA 4MRPA 2YWGA 1FNNA 3NBYC 5KYKA 1AJEA 2VSXA 3F0TA 3EWSA 4KODA 5DN6D 4HB4A 1T5IA 1COWD 4TQAA 3QKSA 3AM1A 5IK2A 3EIEA 4ARZB 2HLDD 3K09A 4LHZA 2A30A 3WP0A 4HLUC 5IRCD 3QF7A 5SZHB 1M8PA 1U8AA 1E2NA 1CULC 5FUXA 1KO4A 1MT0A 4CEHA 3CIOA 3RHFA 1YZGA 1N5JA 1ZNXA 2JIZA 5B64A 1RE0A 1T8TA 4DBLC 5F9HA 4LDJA 3FDIA 1Z22A 4HSEA 5AUNB 1SVMA 1E2EA 1OHHA 1YR6A 2WIBA 1F6BA 4ZDJA 4RKFA 2ORWA 2CHGA 3I1FA 1HURA 1G5PA 3CB4A 3RS2A 3W8RA 2REBA 2ZR7A 2GCOA 4EFMA 1DAMA 2NO0A 2ZE5A 1E9EA 3B5JA 3TR0A 1BMFD 1EX6A 421PA 4E5UA 2C77A 3THYA 3QPUA 3CONA 2CL0X 3PEVA 5GJBA 4EQ6B 2L0XA 4IDNA 1O87A 1Z3IX 2CMKA 4MYHA 2MMCA 1Z47A 5AR1A 5FPYA 2OG2A 3RRNA 1SXJA 4JS0A 2J0UA 1UBCA 4M8NE 4DVGA 5TVKA 3UG7A 1WF3A 2ZRIA 2PMKA 2ZYVX 5HE8A 5KSOA 4PC2A 1OXXK 1DOAA 4P32A 3IIMA 4Q18A 2B92A 4MYUA 4QHSA 5H8WA 3LBIA 1D2EA 4LPSA 1RIFA 5G40A 1Z2CA 1L4YA 1NKTA 2WOOA 4JIMA 4X8OA 4ILEA 1RJ9A 2GDJA 1N5LA 4DEXA 2ZRKA 1E1QA 1VG9B 3UMSA 3AP1A 3BC1A 2ZSAA 2GXSA 3PV0A 2C99A 1KZ7B 4O3MA 4EAQA 4BLRA 5J40A 2DR3A 1Z6AA 3SYNA 3W8NA 3IO5A 5JRZA 5AUOB 4GP7A 1Q12A 4TLCA 1ZIPA 4KVGA 4CYMA 2D4HA 1KK2A 1II8B 2YZ2A 4A2QA 4NDZA 5K8UA 4V02A 2ZI3A 4QRHA 2P0EA 2IYVA 4HLDA 1XMVA 4I81A 1MKYA 4LHWA 4V0KA 4GRAA 3JZAA 2OE2A 1E6CA 1VIYA 3RS3A 2J0VA 4URZR 1T3LA 2QT0A 2D2EA 2NO7A 2ORVA 3CWZA 5CYOA 3R7WA 1VMAA 4DSUA 3QBVA 1J99A 4IVPA 3VHLB 1II0A 3QKRA 1IQPA 4QGGA 4CIDA 4DEYA 4OL0A 3MRSA 3GEEA 1UM8A 3A4LA 4Q5IA 5D3MB 1W36B 5FL7A 1ZM3A 4A8JC 1E0AA 1KI1A 1XMJA 3UWKA 2P3SA 2ODEA 4E07A 5EZ5A 2X19A 1VCNA 2ZRCA 3A4NA 5FBVB 3BBPA 5AJVB 3NWJA 1EFCA 1G8YA 4LJ7A 1ZRHA 3U3MA 2OAP1 4IXMA 2CCJA 3B1YA 2ZYTX 4M9ZA 1P6XA 3NBXX 4XTCS 2A3RA 3AB3A 1AK2A 1AS3A 1KI3A 1P72A 1JNYA 3EIHA 1VECA 5JJLA 1TQDA 4HYYA 2ZRNA 3PG5A 4PXAA 1MO6A 1DAEA 3PUVA 4URWR 4D4KA 2PMDA 3B8HA 3KTAB 1CEEA 2GRJA 3NIBA 4Q4HA 5B30A 3AF4A 4MKFA 5HKKD 4Q1DA 3RC8A 2F1RA 4P4TA 3LVQE 2GEUA 2VSOA 3PUXA 2V4ZA 2OCBA 2C95A 3RVBA 2QL6A 1SGWA 1VCOA 1ESMA 4YMUA 4KHZA 4LGMA 3U44A 3QEOA 3EIQA 3LXXA 3PUWA 5TV2A 2EVWX 4OI1A 3UPUA 2A5YB 3EZ7A 1DARA 2DBYA 3I32A 4HAWA 1E2FA 4IDHA 1HE1C 5SZJA 1OT3A 4XVRA 3GJ0A 3VNUA 3IBGA 1M2OB 2J59A 5EP2A 3OIVA 4Q1FA 4Q9JA 3E2IA 2ZJ8A 1KO5A 4BFVA 2D06A 2JLVA 2FFBA 4FXPA 4YONB 1UBGA 1IJFA 2J46A 3LH5A 2G6BA 4K81B 3RRYA 2B7BA 3IUYA 1Q20A 1N6NA 4OQLA 5FTLA 2WWHA 1ZUHA 4NYMQ 3U3OA 1HQCA 2VIIA 3SC3A 1G3MA 1YZUA 4KSBA 3D3QA 3MJRA 2F6RA 4RFVA 4B44A 1N6KA 5DN6A 4AYWA 3AVYA 1COWA 4EFLA 1MO5A 2RAPA 3I73A 4P4UA 4WIAA 2ZSFA 2B7CA 2HLDA 621PA 5CB8A 4RZ3A 3QG1A 3FOZA 1KMQA 1UKZA 3K0CC 2KBEA 1KYIA 5EE5B 4ARZA 3A1VA 1IAQA 3QXJA 5M04A 3O8RA 5FOWA 2ZRMA 1XEWY 1Q3HA 1EGAA 1GFIA 1E2JA 1XTQA 4NONA 3O47A 1XEXB 1EWQA 2DHRA 1AM4D 2OO7A 5FBWB 2RGNC 4AY2A 2H7VA 5KSPA 1ESNA 2JDID 4D4MA 4XOIA 3CF2A 5AUQA 2TMKA 2J9RA 4BFYA 4OQMA 5DGXA 4QNMA 2XJ4A 3Q9LA 4HUTA 1KGDA 3BH0A 4PX9A 1BMFA 3DHWC 1V43A 2QA5A 3FKSA 1XF9A 3Q7PA 1G6HA 2NPIA 3B9QA 3CH4B 3CR7A 5BWMA 2FA9A 5EE3A 2VBCA 2ZXUA 2ECKA 1G17A 5FTJA 2D2FA 2W83A 3SFVA 4FCTA 1P9RA 5J47A 3GLFB 4EQ6A 1TQ6A 4LJ6A 1XB2A 3B78A 4P3YA 3HYRA 1YRBA 3GLFE 1G41A 3KKOA 3X1WA 1I4LD 4PPQA 1AN0A 5BYJA 2QEQA 1ZM7A 2WAXA 1J8YF 2ZRDA 4NCNA 5FUVA 2NZ8A 3QI2A 4W7SA 1N0UA 4QNRA 4NH0A 5GJWC 3U7HB 2Z5FA 3B1ZA 2Q0HA 1OIWA 1SHKA 3QQ5A 2PCLA 4LBZA 2ZRFA 1GWNA 1KSJA 4D4JA 2WJIA 3SN6A 3PJRA 1RRCA 2GEVA 1KO1A 2DFLA 2JJ1A 2ODNA 2NPFA 1XRJA 1NG1A 2ZTSA 2ZREA 3KJHA 1AQYA 3CZPA 3THOA 1UBEA 2I1VB 2FZ4A 1E2GA 2V54A 2Q3FA 4FD2A 4A4DA 3QKUA 4BZPA 2GBLA 2JLXA 5JLJA 4IOKA 5EXSA 2KWIA 1II8A 2GZAA 2OLJA 1A1VA 3M4YA 4PHFA 4A36A 4Z8YA 5JEEA 1WRBA 3EW9A 4UNPA 4XSGA 1DG3A 2F1IA 3R9WA 4RVCA 3K9NA 3KKNA 4KLZA 4DRZA 5B57C 2ZRHA 2Z0MA 2IUSA 2P2LA 2YOGA 1KDOA 2BOVA 2PT7A 3LRPA 2VPPA 521PA 2QGNA 4IFBA 1RRPA 3ZLJA 4TN1A 2GJKA 3ND8A 5DLQC 821PA 1E1RA 5CM9C 2Z4SA 1XBTA 5D3MA 3AKYA 3EA5A 1Z0KA 3CPHA 3GJ7A 3NH6A 1ZCAA 3RS0A 5JJKA 4RD3A 4ASUA 2V7QD 4QC2A 3ZZUA 1DO0A 4HLCA 4LRWA 1II9A 2D7CA 2HYDA 3PCRB 2OCYC 3QJYA 3TR5A 1CKEA 3WBKA 3WYFA 1TX4B 3OE7D 1VG8A 3U2QA 1CF4A 2D7DA 5IF9A 5EE0A 4LPKA 4LHYA 3D31A 5TXGA 4Q47A 4Q1EA 1G8FA 2VHCA 5JWHA 3DOFA 1G19A 3P32A 4V0OA 2QP4A 3KTAA 1G1MA 2QUZA 3WY9A 1XD9A 1W4BA 1XDBA 5KNDA 1D6JA 2E1RA 2RH5A 1YZNA 1MO3A 3TE6A 1D2MA 2ZI7A 1PLJA 3CNOA 1Y63A 3CPJB 2ORIA 3X1DA 1U81A 3W34A 3IO3A 1G7RA 2WMNB 1G3UA 4OJKA 1G7CA 4KLNA 4W5WA 4II7A 1NLZA 3BRWD 3RLFA 4YMWA 4DCNA 2R62A 3BORA 3KFVA 3HDTA 4B2IA 1NN1A 2WWIA 2WWGA 1S1CA 3QF4B 1Z06A 2XZOA 1XCGB 4U00A 5JFGA 3HU2A 3HYTA 2VHTA 4B74A 3FPAA 2PZFA 5AJYA 3GJ8A 4DLSA 1XCPA 3TAHA 4IVRA 3EPLA 3FHCB 4GL2A 1NLFA 4C30A 1SVOA 3BOSA 4R7ZA 3DKVA 4B2PA 3TUIC 3ADDA 2YWFA 4TWZA 3GLFA 1Y3AA 1NBMD 3FE2A 5KDLA 3ZVMA 4G1UC 1ZUNB 4LJ9A 1G3IA 4BLQA 3D6TB 4A0FA 3TSWA 3A58B 3RS4A 4P33A 1P2VA 3T12A 1TAGA 1HT1E 3IGFA 1YZLA 2OBLA 1G4UR 3KX2A 1KJWA 1CU1A 3EZ2A 5DI3B 1FQKA 1Z6YA 4I4LA 4D26A 2AR7A 1TF2A 3M1IA 4OHVA 2QORA 2QSZA 2PZGA 4RSGA 1Q22A 1ZJ6A 4PO9A 1OFIA 4PC7A 1I2MA 3I5YA 1RRFA 4BE7B 1Q57A 2IS2A 5BW8A 1XTKA 2BMDA 5CK5A 4OQFA 1N0WA 2FZLA 3SJBA 2BMFA 2CK3D 3GLGB 3U3RA 1XEXA 1ZP6A 5GJCA 1U0HC 2FEOA 2JDIA 1CJKC 4F92B 1LNZA 1KDTA 3G5UA 2OLKA 2F55A 3NHAA 3EG5A 4WVFA 1E69A 4A8JB 3RSOA 5BQ5A 4JBYA 2OSBA 4C0SA 1U0JA 2QG6A 4US1R 4IXNA 4V03A 1F2TB 1CR0A 2WJJA 5FOTA 3K9GA 3B1WA 1G8PA 3T1QA 4PAMA 2AD1A 2ZS9A 1IXZA 5BN4A 5TB5A 3CKLA 2O8EB 1K5GA 3LWNA 5LB2A 2WJGA 3OEED 2QM7A 3ADKA 1P73A 4Y0AA 1NBME 4EJSC 4V0LA 5K8TA 1WMSA 2I1QA 2R6FA 1T3HA 1GNPA 3L82B 2WVJA 4O2RA 4Q1AA 3MWYW 4Q9IA 4TMZA 1UEIA 3UMFA 3HU1A 4OQXA 2WAYA 5FUYA 2H92A 2NQ2C 3DMDA 4JLMA 4ERNA 3O8DA 2PX0A 5JBQA 3RDPA 2N42A 3EZ9A 1G8GA 3FMPB 3ETLA 4DUGA 1HEIA 1E94E 5J4LA 5HPYB 4L15A 1IN4A 4JSYA 2WPDA 1JQLB 2XAUA 1XD8A 3HU3A 3SEAA 1EX7A 3SNHA 1CR4A 2GVZC 2ZYUX 4NYMR 2XITA 3LNCA 3PVSA 1QVRA 2NG1A 2G83A 1FP7A 2ZJ2A 3WMEA 4B2LA 1OH6A 1FQJA 3T35A 5BXQC 5FPKA 3J81k 3LFUA 1WP9A 4OBEA 3H0KA 1N5KA 3MD0A 4G5OA 3GLGE 4PPNA 2G77B 1AZTA 2CVHA 4MDEA 2OAQ1 4ZDKA 4LI0A 2BV3A 2B8TA 4BFTA 1XPOA 1RRGA 2GETA 4BLPA 2Z83A 4D81A 1XNJA 4WXPA 2BCGY 3VR5A 4OHXA 2RMKA 2ZRLA 1R0ZA 4GSYA 3TRFA 3B2EA 3DKPA 2GHIA 3G82C 2C8VA 1E9DA 2CJWB 1JQJC 5B2ZA 3VX4A 3WP1B 1E2LA 2IXEA 4KV9A 1TPZA 5E7JA 2H17A 1X3SA 4IOMA 1JJVA 1W0KD 3LO5A 4HDCA 1NY6A 3L2OB 2Q9CA 3OE7A 4L5BA 5DSZA 3TQFA 3NC0C 3VX3A 3THXB 1G8HA 1G20E 4HLUA 3ZYCA 4ZCLA 2RGBA 4LJAA 1R5BA 4AWXA 5FH9A 4X8HA 3KXLA 2VHQA 1R7RA 1DAHA 3CNLA 1UJ2A 3LA6A 3N2IA 1HY3A 3OHMA 5CM8B 3V00A 1UEJA 1W5TA 4LC0A 4B3DA 2W6JA 1N25A 1TMKA 3W6PA 3TUZC 2IS1A 1G18A 4OK5A 6Q21A 3GFOA 2EFGA 3Q7QA 2X2EA 4EIWA 4ZCIA 1JB1A 2WV9A 3LLUA 3O8CA 4Q66C 2F1JA 3EZFA 2EW1A 4LBYA 2OCAA 3NBZC 3OIUA 3AP2A 5CYPA 2JLUA 2WJVA 2QGZA 2W2VA 3L43A 1W46A 5TY0A 1G5RA 1P9WA 4LCBA 3QENA 4MKHA 3QF4A 4L4UA 1J7KA 3VQTA 1JAIA 3UMRA 4GMXA 4R98A 2XB2A 2WKQA 3ZVRA 5KPJA 4ABYA 4Q03A 4HZUB 4QBHA 3VR3A 1NBMA 5F3WB 1LW7A 1ZMXA 3RWOA 5K8IA 1GKUB 5DI9A 1K5DA 1W48A 1SVKA 1ZYUA 1OJLA 1FTNA 1F2UB 1YZTA 1Z83A 3Q3JB 1SVLA 4OK6A 2GTPA 1XJ0A 3W6NA 4JLJA 4AKHA 3NG1A 2ZSBA 2PJZA 2Q3HA 4Q7LA 2EFDB 4JLOA 4PHTA 3H84A 3L8ZA 3P4YA 1RVDA 1X1RA 2GCNA 4PC6A 5JS8A 4HUQB 5C2JB 4B35A 2F9LA 3JVVA 4PAOA 1A7JA 5DI3A 3IQXA 5F98A 4GDFA 5C1BA 2GAAA 2IEZA 2W0MA 1J8MF 1PLLA 4F4JA 2QY9A 1R10A 3NHBA 3NKVA 1PVOA 2C5LA 3F5FA 2V1UA 4Q1CA 4YDHB 2VF7A 3R9XA 4F4CA 1CBUA 4QG7A 4TQ9A 3LQRA 4POAA 1E2MA 2O0HA 3E1SA 4TYQA 4US0R 4RFSB 2XGJA 4EPWA 3B82A 2IS4A 2XZLA 5J4VA 2IYXA 4LV8B 4D0NA 1YR7A 3AH8A 5LB4A 4KXFB 2ANBA 1E2PA 1G9XA 5FTKA 3H4MA 3GLGA 4DCSA 1E9RA 3RABA 3A8TA 1W5SA 1KAGA 3B1XA 4BZQA 2EWVA 1X86B 3GCGA 3HR7A 3RNLA 2EFHB 3KZ1E 1QHGA 2GWHA 3DDCA 4GBMA 3WBJA 1OKKD 4A8JA 1G4AE 4BRUA 3BXZA 3LD9A 2HT1A 5JJIA 2GVDC 1F2TA 3QPVA 3FFBA 3FFAA 2GILA 2BMJA 3OEEA 3WHLA 1Z6TA 1W47A 4JLPA 2O8EA 3DZDA 2BKUA 4PPGA 1KDRA 3VHXA 4MGZR 1EFTA 4NYIR 4DLZA 1NY5A 2V6JA 2V8OA 4FWIB 1CXZA 1YJ5A 4EDHA 5CJ2A 1M7HA 1KK3A 2G1JA 1IONA 1E0SA 4M53A 1H8ED 4EPRA 2IWHA 3WMGA 2XNDA 2OHFA 4BQSA 1S96A 4MUBA 1T5LA 3I72A 2IYSA 4BLTA 1W0JD 4L9SA 2IYZA 5E7MA 4W5HA 3LY5A 1U2RA 2IWRA 1BS1A 2IYTA 2VP0A 4GZMA 4L16A 1GILA 1SHZA 2ZR0A 4UNRA 2G0NA 2AX4A 4A0RA 2AKAB 2KSQA 1JPJA 3IIJA 5E95A 2ZJYA 1RZ3A 1XJCA 4ZO4A 4XH9B 1Z07A 1QHIA 4Q02A 3TK1A 2JASA 3TW4A 3X1ZA 1I4DD 2IXFA 3LBNA 4TYYA 5FBRB 4CDGA 1TQ4A 1NJFA 2ZJBA 4IOLA 1AS2A 1GZSA 1QRAA 3I3SR 1L7VC 3AEZA 5CJPA 5DHFA 4XIGS 1P3JA 3TW8B 2JJ2D 1OIXA 1KK0A 4YC7A 1I4TD 3CPEA 2ZI4A 1OFTA 5C4GB 3G0HA 2V55B 4M9QA 4QBIA 2FG5A 3U5ZB 4TMTA 4J0QA 4KITB 2IUTA 1HUQA 3DZ8A 4PZLA 4NCJA 2XZPA 4HB3A 2CJWA 1IY1A 1JR6A 4JYBA 4O2LA 1UDXA 3UKDA 1TF7A 1R0WA 4QOSA 1G64A 4ESHA 3K0CA 4CRWB 2QAGC 1NVVQ 4M22A 1A2BA 5H70A 4XVQA 3NEJA 4Q00A 3THXA 4OI0A 4CW7A 2IYRA 3UIEA 1GSIA 1OXUA 4AYXA 1VG1A 2VSFA 1CJUC 4OJQA 5EE9A 3BB1A 3KXIA 3R9IA 2A5JA 2XNSA 2DWOA 4QGFA 2RGNA 2P65A 3H1TA 3L0PA 4OI4A 2QRZA 4DDTA 4PSKA 3RWMB 3HP1A 2QQEA 3NH9A 1RKBA 2WSSD 2HUPA 4B6FA 1IHUA 2XEXA 4DHEA 4PANA 4C2UA 1VYUA 1Z6XA 2DWQA 4JVMA 2QTHA 4Q7JB 1M7GA 2VEDA 3OFND 4D25A 1DAFA 1R5OA 2ERXA 4O0MA 4TL7A 2IBMA 1GKYA 2G1KA 4PC1A 1P75A 2AXPA 3CF0A 1KI7A 3AVTA 2QPTA 4GT1A 4EJSB 3CWQA 1HT2E 3PEUA 4TYPA 1ZM4A 1JR3D 2ZANA 2ZU0C 3TBKA 3WNDA 4F93B 1VYVA 1YR8A 1Z8FA 1E2IA 2IF0A 2ZU6A 3GFTA 2BVNA 4UNQA 2IHBA 5JCPA 3CX6A 4R9UC 4N0EA 2I3BA 4HEJA 4GMDA 4AC9A 2V3CC 1HE8B 4NYJR 1OF1A 1YR9A 5DO9A 3ZZ0A 4BZXA 4HZUA 3GLIB 4ZDWA 1UFQA 1ZUIA 3H2YA 4PO1A 1JALA 2ZYWX 4HAVA 4DSTA 1ZU5A 4TL8A 1R8QA 1F2UA 1P61B 2WZQA 2VF8A 4MA4A 3TSOA 1KI6B 3TH5A 4B34A 5KHOC 2C9CA 1KO7A 3VR6A 1ONBA 4A9AA 4GOXA 2P67A 4A2PA 2PEZA 1OXVA 2ZIAA 1MH1A 4HUQA 4OI2A 3U6BA 1DS6A 1OE0A 4P0TA 2BWJA 3EPHA 1Q1QA 1TU4A 2XJ9A 4PHHA 2ZPTX 4MKGA 2FNAA 1AKYA 2E87A 3B6EA 4JLVA 4B73A 4CT4B 3AKDA 1GP2A 4HATA 4FCWA 1VG0B 4PR0A 1ZNZA 2ZI5A 1WCV1 4C0JA 2ZI6A 4IHQA 4RFSA 1A5TA 2JCSA 1C1YA 2MSEB 5C18A 1FUUA 2FFQA 5J4HA 3RSLA 1PJRA 1Z2AA 4TYWA 1E32A 1X8LA 2NGRA 1ZNWA 1U98A 1ZVQA 4M9XA 1L8QA 2FJUA 4G5QA 4LHXA 2ZUCA 1OKKA 3PIRA 3DM9B 4LK2A 1ZW6A 4Q9KA 4XWKA 3MGCA 2OZEA 1SKYE 3C5CA 3QXHA 5TARA 4AD8A 2ZJAA 4Z1MD 2CNWD 3C8UA 1JR3E 1JPNA 2IA5A 1ZAKA 1OFHA 1NVWQ 1FMLA 2RHMA 4KU4A 4A1FA 3LX5A 1SQ5A 3AUXA 1XTSA 1ZCBA 4FMBB 3SZRA 5JHGB 3UXMA 3MAAC 2A7QA 4F4IA 1FPMA 3EX7C 2FFHA 3U3JA 2FSGA 3GLIE 5JWRA 3T06B 5B58C 2HV8A 2WOJA 1E9BA 4BECA 1OH5A 1U8ZA 4O25A 2IF2A 3KDSE 2XTMA 1GKIA 3M6AA 1H8EA 1MRSA 5JS7A 2LKCA 2FX3A 1R5NA 1W0JA 3WYAA 3SJZA 1KO8A 1ZU4A 4BRWA 2BKEA 2DYKA 2JLZA 3S1AB 2G88A 3AV0B 2JLYA 4TLAA 4LJ4A 1HA3A 5AJWA 1DBSA 1KAOA 5KDOA 2OV2A 4MGYR 4AG6A 3RS5A 1IY0A 4YMSA 2VLIA 1Z5ZA 1F5NA 2F1HA 3VMFA 2XXAB 1XD2B 4JKIA 3SE0A 1UPTA 5EJEA 2VP6A 3PEYA 4DLYA 3QY0A 2QSYA 3T5GA 5CLQA 5E3HA 1KJYA 1OXSC 4Y0VA 2BBSA 3BJIC 4MGIR 2JJ2A 1E4VA 3I5XA 2GZDA 3VAAA 4N0DA 3EXAA 4TQUS 1IOZA 3RRZA 1IN8A 2ZEJA 3KFXA 1ZM9A 2AN9A 4FW9A 2ZE7A 1CRPA 4QM7A 2D62A 4PO8A 2PT5A 2QMUA 1F48A 1R8SA 4BASA 3Q5DA 3GJ5A 4HB0A 2IX3A 4TSFD 2FMXA 4QBGB 1MOZA 4ESVA 2ATVA 1X8KA 2OT3B 2DB3A 2ONKA 1M6NA 3CRQA 4R2IA 1LFDB 3A4MA 4PQFA 1WBBA 3ZVLA 5L3QB 4W5JA 2CE7A 2YHSA 4QKQA 3CLVA 1B0UA 3C4JA 3I8SA 3U61B 5GVRA 4BFZA 4U7DA 3IPYA 3VKHA 2A5DA 4AG5A 1OB5A 2QTFA 1T0JB 4R71A 2VL7A 4YMTA 2CHVA 3CUEF 2ZS8A 2AFHE 2XTZA 5TMPA 2WSSA 3MUFA 3AGQA 3IPXA 3PQCA 2VRWA 1OFUX 2GJ8A 1RYHA 1P7CA 4LOAA 4NBSA 3U60B 1X6VA 4RD1A 3GQBA 2AK2A 5DE3A 1C9KA 4XWAA 1OIVA 2EFCB 3QVVA 3SJAA 3K0SA 2JLSA 3LW7A 2QZ4A 3VKGA 4TZ0A 2JAQA 4TMKA 4I1UA 1T9HA 5BYKA 1U9IC 4JBWA 1CR1A 3VFDA 3WMFA 4BFSA 1JR3A 1QVAA 3KQHA 4RY2A 1Q44A 1KMHB 4DLRA 1C4OA 3CW2A 4EJSA 5HKKA 4WBSA 4URYR 3K1JA 4QHTA 4A0GA 4FI3C 4RKEA 4A2WA 3B85A 1R0YA 2CVFA 4LC1A 2FGKA 3QUSA 4QL3A 3TGPA 3GLIA 1T3SA 4U5XA 2WBLC 1GL9B 3H86A 1XPUA 3MG9A 3SHFA 4G5SA 2N1BA 4DLUA 4LJ5A 4XD7D 3LQQA 1HV8A 4NYIQ 4C0KA 5H1YA 2QMHA 3EC2A 2ZUBA 1KI6A 3L0IB 4B75A 1B23P 4DLVA 4NCIA 4B6EA 3DVLA 4M1WA 2JATA 3A1UA 2C03A 2NTYC 5DISB 2O8DB 4KSCA 2VYFA 4H1VA 4IDQA 2UKDA 3P20A 1S3SA 4KFSA 1KI9A 1VPLA 4NZYA 5EUMA 3FKQA 3TKLA 5KSYA 2FE4A 1KDPA 2EWWA 1DAGA 1CTQA 2FN4A 4ZV4A 5FOVA 3ASYA 1LF0A 1XTIA 4P4SB 2ZVPX 4DB4A 4PQYA 1EFRD 3RRMA 1J90A 1Z0JA 1BO6A 1NVXQ 3CRMA 4Q4JB 4CZ2A 1DAIA 5FR1A 4DSOA 5KPDA 3ZVNA 3NEYA 1ZD1A 2IYQA 2MMGA 2WWWA 3FYHA 4FMDB 2RGAA 2JLWA 2LWIA 1TEVA 3WNCA 1Q3TA 1NVVR 3M0EA 4A92A 2B8WA 4RD6A 1OH8A 2GAOA 2QP3A 5JZVA 5EUQB 2PBRA 2W2XA 5EP1A 4Z1MA 2CNWA 1GNQA 5FFMA 2O8BB 4KFRA 3MLEA 3AF3A 2GJSA 2JGNA 2KB0A 3K0FB 3WXMA 4B3CA 4CGZA 4XTRA 2EFEB 2QAGB 1XWIA 2VTKA 1JXMA 3EWAA 3ICQB 2P6UA 3GJ6A 1NN0A 1S2MA 2IW3A 3SQXA 4URXR 3MMPA 1XTRA 4Q4AB 4DT1B 3L8YA 1Z0AA 4B43A 4EKDA 1E99A 1LVGA 5KDDA 2GF9A 4DB2A 5F9FA 3B9PA 2GESA 2O8FB 1E9SA 3ONWA 3BD9A 4FMDF 1OYYA 4YXWD 1P2TA 3QE0A 3SHWA 2H57A 2CL6X 3GD7A 3Q8XB 3GP8A 5KNCA 3OAAD 4KAXA 1QDEA 2H16A 2ZJ5A 1KY2A 3OIYA 1AA9A 4FN5A 2B21A 4QGAA 4LHVA 4DIDA 2G9NA 4TLDA 2FF7A 1QG2A 4BFWA 2AHOA 4I99A 5HE9A 3S1AA 4GZLA 5FI1B 1K6MA 3ICEA 2QE7D 1DADA 1CR2A 3IEUA 4CF7A 2XXAA 5A4JA 1XD2A 3GJXC 4NCHA 1Z0FA 1E9AA 4NMMA 4WAUA 3C14C 2SHKA 2HCJB 2ZSEA 2FV8A 4LBVA 3UANA 4ZDIA 1GG2A 5CIWA 3QXXA 1IY2A 4US2R 5IK2D 3VR2A 1M34E 2A5FA 2G0TA 3SYLA 3IBYA 4C9BA 2QM8A 3Q72A 2PX3A 2OCPA 4B48A 1TU3A 3NTUA 2PJRA 4PTLA 1T8UA 1UF9A 4JT2A 4C2TA 2W2TA 4KJZA 1VKJA 4NYJQ 1KI2A 2W6ID 4TSFA 5J5CA 3WHKA 4XWOA 2BC9A 1A4RA 1L2TA 2Y8EA 3KXKA 4HDQB 4URUR 3I61A 4D6PA 4B3BA 1N6RA 5EE1A 4BGDA 1OH7A 2ZSDA 2J7PD 3LLMA 1E9FA 1HQYE 3DOEA 2VA8A 2ZS7A 3ZS9A 5CDFE 1KKLA 1N0VC 4LUCA 2V1XA 3CF6R 3OEHD 1KI8A 1NVUQ 5JEDA 3V9PA 3ZD6A 3QXCA 1VTKA 4PAQA 1IN6A 2GK6A 5L3VA 1LB1B 1UDWA 1AKEA 2CDNA 2VHUA 1IN5A 2ZITA 4DCUA 2BCJQ 1WB9A 4EPTA 1G6OA 3Q85A 3KQNA 3U4QB 5IT5A 2KE5A 4IEEA 4M1YA 2ZUDA 3T34A 1EESA 1JXOA 3PXGA 2FSFA 1QHNA 4I1VA 2V7QA 2X8AA 3TVDA 2UZIR 1XMIA 1WXQA 2GEDA 2RGEA 5IHPA 2YNMA 2XOKD 2DFKB 5SZIA 5JRJA 4QFMA 3W9YA 4DIEA 1Q1ZA 3E70C 2PLFA 3R8FA 3WRXC 1W2GA 3THWB 1GAJA 4B76A 4L9WA 2WWFA 1U99A 1E1QD 1EG7A 1W4CA 1HH4A 4K8OA 4E09A 4N1AA 5LD2B 2A5GA 1P5ZB 1KMHA 4JL8A 2IUUA 4BWYA 3DO6A 3GEIA 5JI2E 1AIPA 2CHQA 3KQUA 2RB4A 1E2HA 2FSIA 1PZNA 1MO4A 2FEMA 1N6LA 3AQ4A 4LYJA 1DPFA 4C0BA 4ACBA 1Z0DA 3WRYC 3PENA 5J4KA 1F3OA 5P21A 2F9MA 4JJZA 1L4UA 1EK0A 3K8YA 2AD5A 1HYQA 2ATXA 1DO2A 4URVR 1GIAA 2O8DA 4E22A 5BN3A 3N70A 2QAJA 1CJTC 2HEIA 5DIFA 2GZHA 2HXYA 3ASZA 3LBHA 3DL0A 2H18A 3QOFA 4IRUB 3LAWA 4DSNA 1KZGB 2CL7X 5JHHB 1MR3F 5L8VA 2CBZA 1ODFA 2VO1A 5E4FA 3X1XA 5UKDA 4PQRA 2IC5A 4P31A 4LYHA 2MSCB 4Q4JA 5FOUA 4B32A 1KSFX 3CRRA 3ZGXA 8OHMA 3RYTC 2A78A 2GK7A 2FPMA 1N6OA 1LS6A 4MRVA 2IYLD 4FIDA 4BPBA 2IS6A 1CRQA 2DCUA 1XZPA 2EYQA 1GRRA 1SZPA 4JVLA 3BAFA 4DKXA 1LV7A 1S1MA 3KJGA 1OPXA 1QZXA 4LBWA 2O8BA 3AF0A 2GXUA 4MRNA 3RANA 2YJTD 3A36A 3K0FA 4BLSA 1G7TA 1XMSA 2HCBA 1CS4C 2I4IA 3K0AB 2QAGA 4IW3B 1ZBDA 2R6AA 3TNFA 1UBFA 1FTSA 2CK3A 2O52A 2YOHA 4G01B 4OQNA 5SZKB 3TLXA 3ADBA 1FW6A 3GEHA 2BIFA 4Q4AA 4AKGA 4DT1A 5FBLB 2C78A 3IDQA 2HXSA 3B13B 4FINA 4KBFA 3W5JA 4Q7MB 4UJ5A 1U8YA 5CDFA 3P4XA 3FWYA 3SI7A 1A2KC 4DXAA 2GKSA 2REXB 4JLDA 2O8FA 3ADCA 1W44A 3EARA 2P5TB 1P2UA 1GL6A 1UKYA 221PA 3FGNA 3OAAA 4F91B 2HJVA 2R44A 5ANRB 2BJVA 1S9DA 3KJIA 3L0SA 2HJGA 4LJ8A 1FP6A 4JYCA 2NOAA 3BH6A 4UXHA 1OYWA 1N6HA 3BFXA 5HCNA 2BMEA 1MABB 3RS7A 4MKIA 2FU5C 2QE7A 5FPTA 4LX0A 1W4AA 3T1VA 1JBKA 3ZZTA 1DG1G 3CZQA 2P5SA 4JKYA 1ZD8A 3OF5A 1Z63A 1SKQA 121PA 2WJHA 1OB2A 1WBDA 2OXCA 2J7KA 2NO6A 2XX3A 3HWSA 4MUAA 4DC9A 2WWXA 1VYTA 3K70C 1CLUA 2ZRGA 1M74A 4KVAA 4B3FX 4BFXA 5K8LA 2J5XA 3IILA 2HDNB 2YYZA 2G3YA 3F8TA 1QHHB 1WDTA 2IXGA 2NZJA 2BBWA 1YKSA 2FPLA 1IJEA 1FUKA 2YWEA 2W6IA 4D0GA 3VR4A 3CR8A 3K0EA 1E96A 1FOEB 4TLBA 1VIAA 1WE2A 2C9OA 3IKJA 1PUJA 1ANKA 1KIMA 1FL9A 2J7PA 2QNRA 1TL7C 3EAQA 1Z0IA 4JLBA 4NP6A 3W3ZB 4EPXA 4AI6A 2ZRJA 2OUKA 2RGCA 4Q21A 4LSGA 4DCVA 1QHXA 1Z29A 3OEHA 4W9MC 4JL6A 3W5IA 1JAHA 1H8HD 1OLOA 2PZEA 4RD4A 2QMOA 3FKSD 3AVQA 4JZKA 1M7BA 2HYIC 2GA8A 2IHYA 4X8MA 1SVSA 3IHWA 3MWLA 4JVNA 1KTVA 3KJEA 4NKRA 2ERYA 4WW0A 1NIPA 3B7GA 2RCNA 2QMEA 3OZXA 4M1MA 2YVUA 5FI0B 3T1TA 3U4QA 2WJYA 3KKMA 2J45A 1G5TA 2XOKA 4MRSA 1W0KA 4DWJA 5KO2A 3ZDQA 5BN5A 1Q0UA 3VU9B 3BK7A 2JEOA 3PEWA 2ZR9A 3ZD7A 4AKIA 2Z6VA 2AL7A 3ND9A 3DM5A 4PSAA 3BH7A 4LJYA 4QM6A 1D5CA 1V5WA 2YC4C 3KQLA 2X77A 4RD0A 3THWA 1TTTA 2O0KA 1GL7A 2OESA 1IXSB 1E4YA 4XJXA 3KUCA 3C16C 2JJ1D 4Q48A 4B71A 2CLDX 3IEVA 1NG9A 4KYIB 1KNXA 1EFHA 1S8FA 5J4YA 4A6XA 5G3ZA 1UADA 4D4LA 1P2SA 1P62B 4Q1BA 4UKDA 1GITA 1S9HA 1FNMA 1JEDA 3R8CA 1E79D 2Q3MA 3QIAA 4M9SA 3TJZA 2RGGA 1R4AA 3K53A 2YV5A 4RCZA 1SKYB 2OBNA 1YU9A 3BB3A 2QPOA 3SR0A 1IM2A 1E98A 1G21E 1N6IA 1UKEA 3AVPA 1LF5A 1AGPA 3ZJYA 3VR1A 1N6PA 4QJ5A 5CLLA 4FMCB 5FOXA 4IDOA 5CITA 1E1RD 4TL9A 1JI0A 3BB4A 4JVSB 5CK4A 2ZM5A 4TLEA 3K09C 4TMXA 4IFEA 1NMZA 2BM0A 4G0NA 4ASUD 1TQ2A 1AZSC 2UZ3A 3EASA 3KKPA 3BFKA 1HTWA 3I8XA 3GPLA 1PV4A 3WNBA 4DZZA 3ZQJA 3FHOA 4I1SA 3T1OA 3KQKA 4HLQB 3TQCA 4HZIA 4FWTA 2CLSA 1E2KA 2WSMA 3TSZA 4MGKR 4ZPXA 1ZINA 4D2IA 4OKSA 2C2HA 3AF1A 4PPFA 4NPHA 2R65A 4S2EA 5E7IA 4EPVA 3NVAA 4L8GA 5FTNA 1Z08A 4C3ZA 4RZ2A 2K5UA 2QROA 3GJ3A 4BLOA 4QBFA 1XPRA 4FMCF 2FSHA 2ZRPA 3MWJA 3SS8A 2QRNA 3IIKA 1DE0A 3K0AA 5A0FA 3QKTA 3X1YA 2Q21A 3A1TA 1CP2A 4IKEA 2OBMA 4DCTA 1VHTA 1SXJC 1Q21A 2ZAOA 2JJ8A 3ZH9B 4JMPA 1MRNA 3C15C 2OFXA 1MV5A 1YZKA 4JL5A 2WIAA 5CIQA 4YLGA 1N3BA 3SJCA 5HCIA 3JZMA 4WZ6A 1R0XA 1TNDA 2QQ0A 4OYHA 4DDUA 3BGWA 4Q4LA 2BDTA 2D3WA 4Q9LA 4D82A 1U9IA 3PUZA 4XVUA 3AVXA 3N2EA 4ITRC 3MCAA 1MABA 2AWOA 3ZIAD 5LD2C 4PZYA 2J87A 4Q7KA 3TAUA 3T61A 4H1UA 1P60A 2C98A 3JVUA 5EP3A 4TYNA 1S0UA 2FH5B 4G5RA 3FMFA 1W49A 1P9NA 1GTVA 1NL3A 4G5GA 5FPSA 4IJMA 1NI3A 3PR1A 2X2FA 2ZVQX 2O8CB 1JEEA 1VHLA 4LZZA 5EXTA 1QHHA 1OSNA 5FUWA 1IN7A 3DPUA 3TMKA 3LV8A 4D0LB 5C46F 2BBTA 1OW3B 4F7WA 1NN5A 1KKMA 3KB1A 2ZJOA 3PUYA 3MFYA 3QVUA 4CVNA 1BH2A 3CO5A 5KTYA 1KSHA 4X8LA 1KSGA 2AFIE 4JLKA 5L3RA 3BE4A 1KNQA 4CT5A 1NLYA 1XEWX 1H8HA 1U94A 5LDDC 2OILA 3A6PC 1YE8A 1RW4A 4M1OA 4PC3A 1Z6GA 3AKEA 2QP9X
chains in the Genus database with same CATH superfamily
2DC1A 3BAZA 3KT3A 4HVAA 4YUZA 1CUUA 3OT1A 4QDKA 4WA7A 4F4HA 1JTVA 1GRNA 2CB0A 2F43B 2NQTA 2ZT7A 3FAZA 1T91A 2DJIA 4IGKA 4OHCA 5IAAA 1VKNA 5KNBA 4E4RA 1I30A 1HDXA 5JD5A 1T8WA 3C4VA 1JBEA 4I5FA 4KQXA 4M8LA 1SCDA 4K6CA 4N76A 2IKQA 3MPUA 2FOLA 4CXMA 3CO0S 1QKKA 2XVAA 1E7MA 1T5SA 5JMWA 3ZN2A 1ZLXA 3UAVA 4WXMA 5IZCA 2FPPA 4KGVA 4QAJA 3F5SA 3DEIA 1BXZA 2K6GA 1TM7E 3GAFA 4HDOB 3U4GA 2X2OA 1DTWB 4HI0E 1IYZA 2QTCA 3DMRA 2ODBA 4AJ9A 1MQ9A 2W8BB 5DXAA 3OWXA 4KO8A 1M8GA 4EX6A 4G09A 2GCGA 4H9GA 3EQZA 5A05A 1Z8DA 4UXIA 1PJCA 5I7OA 3RYCA 4LQ4A 1FRNA 1H69A 1HOTA 1NRIA 3JQ6A 1I2DA 4K26A 5LLDA 1SZJG 4GNKA 1SVWA 2A9JA 3Q3IA 3QYAA 2C82A 3K05A 2F7SA 1R4ZA 1J70A 3B6KA 4X24A 5HJ2A 2AYYA 3KEOA 1ENYA 4TMWA 3R7FA 1SULA 5D86A 5SICE 1P9OA 1CUZA 1TAQA 4N7RA 1PJZA 4JA0A 1VJ5A 4D3XA 4DLTA 5FHQA 1UT8A 3WAJA 3PD1A 4JC5A 1EEHA 2R5WA 1DTSA 2FPIA 2Q29A 5LKAA 1KKUA 3ED5A 4BMSA 1WZIA 2VDKB 4MB2A 4AAYA 1C3LA 2KJQA 3LX4A 5JPCA 1PWEA 2F3TA 2GHQA 3Q0EA 2VNJA 3WGNA 1P19A 3PP8A 3JAWB 4PN3A 1VGQA 3BIFA 2ZWMA 1T2AA 1CS0B 5LBIA 3AETB 1P7ZA 3HJNA 1E2QA 3ZOKA 2KI5A 3MUEA 3DMTA 1VJTA 3A11A 1E5XA 1H4VB 3VR5D 2EDCA 1A8UA 4UJ3A 1HFKA 4YDSA 3W05A 2PN1A 3PFIA 4FNAA 3TLMA 4GOMD 2QVBA 3OE1A 1ISIA 1NSFA 4JU9A 2PEYA 4HQLA 1HOXA 4OHZA 3TZEA 4BEBA 1ABEA 4ZK6A 2ST1A 5LQAA 1NBIA 4DVJA 1C8VB 4J43A 1E8DA 1GLGA 1GOTA 1ZCJA 3AR5A 3CLUC 3DJFA 3JQCA 1NLUA 4GFDA 1UDRA 3FOWA 3IR6A 5FBZA 3UQYS 3M4NA 1HDYA 2Y4NA 4H4EA 4TZTA 4DDVA 1YQTA 2AKYA 2FWRA 2R2AA 3CSDA 3MT7A 1OLUB 3V8QA 3QKIA 1E2UA 4HB2A 5DNAA 5HRAA 4O2BB 3P2MA 2OEPA 3C3CA 1NP6A 3BWCA 2XWBF 1B2LA 4YAWA 1VHJA 3UK7A 3FRIA 3MMXA 4EA8A 1NPTO 1XFAA 3T94A 4DCJA 1FMJA 4YRZA 3P0RA 4MH0R 3E8XA 5C5IA 1RAEA 5WRFA 4TWRA 2W6JD 1XXHB 1LJ8A 3CVOA 1VFPA 2RGWA 3WQHA 1U02A 2F9FA 2A58A 2PJUA 4PXSA 4MAMA 1XA0A 2GYVA 3LM8A 4PYLA 4F3CA 2AFIA 2W58A 3KT6A 1A7AA 1YRQA 3IIIA 5A2GA 4IY1A 1PR6A 4YR9A 1FFWA 5CLFA 2CCKA 4JEHA 4N7BA 4P53A 1YHNA 2QPAA 3BICA 3SBDA 5CYGA 2W6PA 1M83A 4C0AC 2KX7A 1L1QA 3NHPA 2WD8A 3QPWA 5KQPA 4AX4A 4GI7A 1OXTA 2AKEA 2OCLA 3SQWA 2XCRB 5TDHA 2GPAA 4MUNA 3GEGA 4UHFA 5K4AA 3TQRA 3UATA 2WUGA 4EO9A 2XQIA 1TC1A 2WMOB 4GNRA 1TJYA 4MGHA 5EIWA 5SV2A 4BMPB 1RWPA 3CTPA 3Q6NA 3LUAA 3I6MA 4QQRA 1ETUA 1R0CA 3DV0A 4WZAE 4GOJA 4BB5A 2R4QA 3DWEX 5IAOA 3TGLA 3N0WA 4NHOA 1JEQA 2QENA 2WM9B 4BUJA 1R0SA 4TUYB 4ZAGA 2B8JA 4QELA 3E9RA 3L7NA 4NZNA 3GPBA 1GUAA 5EG5A 1Q84A 3R7AA 3K73O 1TYZA 1BKDR 3N87A 3QOWA 2I2WA 4NI5A 4GW3A 3E4CA 2YFKA 1I1HA 2UVDA 1YQ9A 3PPVA 2XW6A 1RJEA 3ZCXA 3AVWA 1RSZA 2D2IA 1DKLA 2QSUA 3ZE6A 2PWBA 2FRVA 5KUTA 3R9XB 1JG2A 3H3FA 4OU4A 4PYIA 2VJOA 2HJ9A 1G2PA 1DELA 2HD4A 2YXPX 1KH2A 4CU2A 4F60A 1VSTA 1Y7LA 3J7TA 4NV3A 5K51A 3SFZA 3TGWA 1QBKC 4JLAA 1XNHA 2AFHA 5LR6A 3FB4A 3AY3A 4I1OA 4M2LA 3Q7SA 4L6AA 3SSMA 1JL3A 2QVCA 4UCXA 1F1JA 3K2QA 3OPNA 4TN5A 3ZWOA 2II6A 4AUNA 1XXHE 1L5SA 2XUPA 3AJRA 3ZDCA 2YIDA 1VDZA 3IQWA 2C2KA 2X8LA 3PC8A 2CF6A 4IS2A 4V3BA 4TT3D 3U4AA 3H97A 4FGLA 4UMVA 2IE0A 3HQ4O 2ZTVA 1JJFA 3BX1A 3TCXB 4K9DA 1SUBA 1K92A 4K46A 3WK7A 5KBYA 3HL0A 4M60A 3A3PA 2RK4A 4IIXA 1M76A 1QWOA 2D5BA 1G2QA 3FNBA 5DNCA 2C04A 5KI6A 5JCZA 4HAXA 1UMCB 1B76A 1ZC3A 2CXQA 3H9UA 5LZ7A 3AKZA 2FP4B 4MVJE 3PQ2A 2OXRA 2PH1A 3IOMA 5FCDA 3TD6A 2JFOA 1E6EA 3IEPA 1T10A 3EPKA 2R86A 3B2QA 4Z54A 3GZNA 3NDBB 1ZESA 4GLFA 3GLHA 4UCWA 4XGQA 2CJXA 4YV0A 9GPBA 2GZMA 1WZ2A 2ISQA 2JIZD 2VHVA 4NBTA 2GO1A 4DLLA 3VTKA 1R4MB 1AGXA 2QJFA 2PBZA 2J4FA 2LGJA 2H4JA 2OMEA 5LZ2A 1CDOA 5J2TF 2PL3A 4RXMA 2DG2A 3OFSA 4FHFA 5CTAA 3G3EA 3WYNA 3QHQA 3WGIA 1G6Q1 1ISHA 3KOMA 1NNEA 2AVNA 2C00A 3GXOA 1O95D 4ZU1X 3Q41A 3PQFA 1C3OB 2C7GA 2WAOA 3QEJA 3KZOA 2G08A 1WMBA 1Y98A 4ZI3A 5KMGA 4ZKEA 1JG7A 1QO0A 3X2SA 1W4RA 4ZQEA 1C0LA 4DYHA 3EXG2 2EF0A 3SBXA 2CHUA 1YF3A 1GAWA 1XZQA 3SKYA 4EZIA 1SXJD 2CEAA 4UMEA 3K9LA 2AGVA 3QVLA 4NZPA 3GIDA 1Z4QA 1J22A 2P6RA 3EGCA 3P0JA 4WBNB 1GZVA 2V97A 1NRWA 4GC5A 1PTJA 3OQNA 1X0XA 1DDGA 2W2MA 2ZYAA 3C3MA 3JQFA 5BP7A 2PGNA 4GGOA 3LX8A 4WN3A 5HF5A 2DY1A 1R27A 5EQFA 1OXMA 2NAFA 3UUEA 1QBGA 4EMTA 3Q3GE 2INGX 3FIJA 3LOUA 5ALVA 4IZIA 1US8A 1GTRA 2I2DA 2ZIXA 2VWGA 1ZIOA 1WSAA 3DVQX 1A04A 4NE9A 2YFYA 5JADA 4DG8A 5KKCA 2JIDA 2UXCB 2C42A 1SG9A 3PLNA 4JSTA 5EJ8A 2ZZMA 3X2EA 1FMFA 5F2EA 3H7AA 2YIJA 4EHIA 4A15A 1LS1A 4KJXA 3EG9A 1XDZA 4XYBA 4JODA 2RD2A 1DNPA 3HVIA 4WZBE 1X7YB 4D6XA 5HVNA 1YZQA 2NU7B 1HE3A 2FQ1A 2H2DA 3GEBA 2Q1WA 1FNDA 4OHUA 4RVFA 1N2OA 1XZBA 4OQ4A 1DQYA 4XD7A 1IG3A 2IXBA 4HGYA 5JYCA 1OWLA 1C3JA 1P4SA 4IQGA 4NBWA 4MYTA 4IFIA 5EXXA 3FCYA 1MNAA 3O31A 3VRHA 2EG9A 5CLIA 3R7WB 2ZFUA 1J2JA 1D6NA 2WFLA 5IKPA 3L0OA 2NYAA 3ZDXB 4CEIA 1VKOA 1X39A 1XZAA 3V97A 4KYUA 3EF0A 1PEYA 1XEFA 2CDBA 2ZROA 4GM4A 2XDYA 4EAAA 3VDRA 1ZH8A 5CB6A 4YBZA 5EVCA 4UXJA 3V8MA 3UBTA 3AGPA 3AT1A 4ALLA 4MJ3A 4M0LA 5IJ0A 1WEHA 3ME5A 3WYEA 3P2EA 1EFRA 3DBLA 3MS2A 4EKGA 1L3CA 4WJZA 5A3RA 3V2HA 1NLMA 3U48A 2J0QA 3I4CA 4OQEA 2H2FA 3C6QA 3P96A 3Q2IA 5DHAA 1MAVA 3CX8A 4R0VA 3ZCQA 2C7RA 1Z5WA 3MF4A 3HFJA 3HRHA 4Z6KA 3SMVA 1SIBE 2N3ZA 4CEJA 4K86A 1E3MA 1X8JA 1TCUA 2GVNA 1D9XA 5DHUA 5DLEA 3U13A 2QJRA 2TS1A 4FE7A 2NWQA 1LRKA 3BZWA 4NVRA 3ZU2A 5I9BA 4BNDB 2QTVB 4R01A 2AK3A 1PKXA 4KC0A 4WKPA 3RADC 4OGKA 1MH9A 4HC4A 5K3FB 3B89A 2O0JA 3SOPA 1X1DA 2ET6A 2X9NA 1DIHA 3K96A 2GJAA 1RZRD 3CNNA 2ODWA 5BRAA 3JATA 2WABA 3FWPA 5AJXA 5ELXA 2RI1A 2R6CA 3K5PA 3NC4A 1GN8A 4UASA 2XVZA 4KR0A 5I9NA 1BDMA 3MRXA 3ENZA 1UPXA 3FZGA 5M7EA 1AHPA 3U44B 3TD2A 3W04A 2IYUA 1JHXA 4JHLA 4B3GA 2XCTB 1ZC4A 5EEHA 4EUNA 3VR6D 2PSDA 3RSZA 3TDMA 1UBTS 2HHLA 4M98A 3G7NA 3B2NA 2F4VB 1G9SA 1IY8A 1E8NA 2GSDA 4UC0A 3W78A 3WLAA 3ZLBA 4B3XA 3F4KA 1IQRA 4ZJYA 1H6CA 3JQQA 3QV2A 1ZXBA 3UH1A 4K9OA 3NW9A 1GTMA 4HBGA 2WKRA 4M0KA 1YDEA 3AVVA 3HG7A 1JTEA 2ZRAA 1ZGAA 4O1IA 4RJIA 5JAIA 2B83A 4C0LA 1RI4A 2JB9A 1WOYA 1ZVJA 2JLRA 3G17A 1QE0A 3TTYA 2O57A 1MIOB 4ZO8A 2HLPA 3JR7A 3WFJA 4GICA 4LY6A 3Q0IA 4Z49A 5HR5A 3Q88A 4D57A 2QU8A 4IEFB 4FDUA 4MVXA 3MCZA 4KG7A 3UJHA 4R1MA 1TJ4A 5GADl 3R4CA 1KFEB 4UCFA 3UK6A 1NASA 1G7SA 5IC4A 3AKCA 4AKHA 1CDZA 4M7PA 2OYCA 1FNNA 1TKRA 3DXYA 4R0MA 5J2TA 3COJA 2VSXA 2P5UA 4U9HS 3OCJA 1D4AA 3C45A 3B3FA 3EWSA 4KODA 4TQAA 1T5IA 1COWD 4UAVA 4AMGA 4QUDA 4CQMB 5DN6D 1NYRA 1N34B 5A0TA 5B1YA 1JS1X 1Q77A 5KTTA 4YRMA 1KMNA 2HLDD 5IAEA 1CUAA 4L8FA 2H2GA 4LHZA 5H16A 4BUCA 7MHTA 4HLUC 3ILXA 3LA8A 3QF7A 2H31A 5EESA 5CVUA 4WNYA 3PHCA 4IR7A 4AKTA 2X0JA 1E2NA 3KD2A 1SCUB 4IG9A 5U4QA 4MS1B 1YMUA 3CIOA 4KEAA 3RHFA 1ZNXA 5TQVA 1P33A 3HRIA 4CM4B 5B64A 5A5VA 2W4MA 4EGQA 3FDIA 5ALLA 4HSEA 1MQ8B 4CM8A 1PL0A 2O1XA 3AEQA 3MN1A 3NBKA 4MWBA 1SVMA 3UWDA 4BVLA 1JI3A 2ZYSA 1NQXA 3G5TA 4KQGA 2L42A 4ZDJA 3L3BA 4RKFA 4O8CA 1XJWA 5EKSA 1HURA 1BCRA 1DWPA 1N2GA 3RS2A 1PJLA 1L5LA 3AL2A 1LBSA 1L5YA 3AUTA 3FDZA 4HH3C 1IHYA 1KVQA 4FSXA 4KRXA 5THXA 3TR0A 3SZGA 4DM3A 1BMFD 1L1FA 3SF8A 421PA 2C77A 4BQEA 4MO9A 2VT3A 3HXKA 1ZA2A 2QNBA 3ZDFA 3ENWA 4FBMA 1T3GA 2CL0X 3PEVA 3JQAD 4KACA 4WPGA 4IDNA 1ECCA 1Z3IX 5F1PA 2ZTHA 4QOHA 1NOKA 1YCHA 1Z47A 2MMCA 1CNFA 1VOTA 5AR1A 3HDVA 3RTAA 4CV0A 4KXLA 1GT91 2F3UA 2VZ0A 4KXYA 1C9DB 2ZRIA 3KV1A 4H7KA 2PMKA 2X9LA 3UG7A 5JNVA 2CXRA 3DV2A 5EJGA 2YIMA 4PC2A 3NV7A 2OLEA 5HE8A 1OXXK 5A06A 6REQB 1DOAA 3L6BA 2CNLA 3WGHA 1SHUX 3IULA 4FTWA 1IFXA 3THRA 2M6SA 4NHEA 1PNOA 2NVUA 3IRUA 1D2EA 1P5RA 5B4VA 3LUHA 5G40A 1OXBB 4PIVA 1Z2CA 1L4YA 1VP9A 2WOOA 1JH8A 1Q0QA 1XP5A 2ZT6A 3DFIA 1N5LA 4DEXA 4D9FA 4UTVA 3ASUA 5BUZA 1VG9B 1GPWB 4C03A 1KZ6A 3S2IA 1BFDA 5DTEA 2GXSA 3N2GB 3NHLA 4NMLA 2X58A 3B20A 3NYRA 1KZ7B 3E6AA 1SUIA 1UINA 2Y9MB 4HWSA 2DR3A 4WK4B 5JRZA 3IO5A 4GP7A 1W6RA 4PGAA 4Q39A 5JPIA 5B3JA 4KVGA 2PUGA 4OXRA 1P1JA 2D4HA 1KK2A 2YZ2A 2PXCA 1GU0A 1GZ6A 2D1YA 3OLCX 5CRIA 3F90A 4CODB 5CFZA 4Z4GA 1IB0A 2L2QA 5JASA 1JFLA 3P8ZA 2QLFA 3PFKA 4D3YA 1VIYA 1LX7A 3OECA 1H0KA 1YASA 3OC6A 3CWZA 4DUZB 5E2BA 2HMTA 5T6MA 1WX1A 2WTNA 5EHNA 3FETA 2C4UA 4H7FA 3GVIA 4P54A 4P35A 1U3TA 4ND8A 3MRSA 4Q5IA 2HN9A 1HDCA 4YAKA 1W36B 1QZUA 5LUAA 2AA3A 3AHFA 4FGKA 4JSRA 1PT7A 1ZM3A 4WNIA 1XMJA 1YL7A 3UWKA 2ODEA 5EHZA 5EZ5A 1RWMA 3MGBA 3N2ZB 2HO4A 2VLBA 3QJ5A 3BBPA 3NWJA 4CTNA 4L74A 1ZRHA 1Q2UA 3TCNA 1RKUA 2HO5A 2OAP1 4IXMA 5GZ6A 2Q27A 2ZYTX 1PG2A 3VTZA 3NBXX 3K71B 3UCEA 1Q7BA 3AB3A 3OX1A 4IUYA 3RC7A 3FH0A 1JNYA 4RVDA 5DNUA 4HYYA 1UCFA 3HBAA 1A4UA 1MO6A 1T2EA 3PL1A 4LCJA 4CL8A 3IQGX 3OZSA 2FLKA 4CCWA 1NVEA 1QRRA 5F3RA 5ALMA 4MKFA 4I8XA 1Z36A 4K88A 5B7PA 2ZYRA 5HKKD 1NXWA 5DP2A 5E4TA 2ZUFA 4P4TA 1SQ6A 2GEUA 3WB2A 3E1GA 2I6SA 4UM7A 4EJ6A 3N76A 4RSHA 1VL0A 5KNDD 2QRKA 4JI0B 4FQ5A 1J2EA 4NEGA 4RE5A 4YRAA 2PMFA 4BGIA 4XDHA 3KQWA 4BCBA 5HRCA 2QL6A 1O95C 3Q7EA 3O3NB 5CVCA 4FFLA 2W2NA 4DC1A 3HJTA 4YMUA 1SMKA 2K2WA 3QXGA 1Y7HA 2G7MC 4Q15A 4A6DA 5KJ6A 1XHFA 4OI1A 5G0SA 4IDHA 1G0OA 1W0CA 2A86A 3UB2A 3GFGA 5DLDA 1CB7A 3I9LA 3A6KA 2NP7A 4CMEC 2I2BA 3NHYA 4I0WB 1F8XA 2GZ1A 4RQAA 2NZYA 2Z2YA 2QGFA 3N28A 1AUQA 5EP2A 3OIVA 4N3GA 3WGVA 4Q9JA 3GN1A 2ZJ8A 5BW4A 1BX1A 2D06A 3KEMA 4N18A 4YONB 1U7ZA 2J46A 3MTIA 3RRYA 3L4BC 4K81B 4RGYA 3IUYA 1PL8A 5E1MA 4L85A 4KAJA 3V5NA 3CLKA 2FSSA 3X2FA 5ALZA 1IOVA 1Y9JA 3U3OA 3TX6A 4C88A 2OG1A 3DE5X 3CY6A 3GHYA 2RIPA 4IIYA 2XF2A 4U8HA 2XMGA 3L0ZA 2XGGA 5LJLA 2I03A 3RJTA 2PL1A 3I05A 1YD7A 4LISA 2GBFA 1A5BB 1FYVA 2I99A 4HCJA 1EFPA 2GQ0A 4ML3A 3RJ5A 3TD9A 1N6KA 3KP1A 4AYWA 1T2DA 3R0ZA 3RUEA 1GGNA 2EEPA 4Q05A 1UH5A 4QO7A 3UMBA 2YN0A 4KV7A 5FWYB 1E62A 2B7CA 2AV6A 2H1VA 1RQ2A 4FS3A 2QSJA 2HQRA 4L9RA 4S1PA 621PA 1U3CA 2X5JO 1OZHA 3FOZA 1KMQA 1UKZA 3K0CC 2KBEA 1MB2A 5EE5B 4RTMA 3EFBA 4X84A 3UOGA 4DV1B 2VN8A 2NV2B 4PYNA 3I28A 4IHJF 2AQIA 4MR8B 1XTQA 4X93A 3AR6A 4NBNA 2O2YA 2E4YA 2OQIA 2DHRA 1NUHA 3LXUX 4OVKA 5KSPA 3A32A 3H1BA 5AKHA 4WZZA 4EHNA 1UIMA 3MCUA 2JDID 1F0YA 4I08A 3TL6A 2CV2A 1MJGM 1V4VA 3CF2A 4FP9A 1C3XA 1XZHA 4QNMA 3PKJA 1P91A 1VL2A 3Q9LA 4N5IX 4V0SA 3W2GA 1KGDA 4XLZA 1DKOA 3RM3A 4F3RA 5JOQA 2FN3A 2AI3A 3FPFA 5ALQA 1B8UA 3D6JA 3CH4B 5BWNA 1QLHA 1O54A 1XRNA 3H99A 1JT2A 2V7VA 4UUBA 5ALFA 4BV9A 3BQ9A 3KQYA 5HJ5A 3PDIA 3L1HA 5J47A 1GGHA 1VI6A 2Q28A 4F6CA 1R6AA 4EQ6A 3W6ZA 1DMRA 1TQ6A 5IJ9A 4YJHA 4IDBA 3P9RA 3OLXA 3RUCA 1UC8A 4M9CA 5LUBA 3C87A 1G41A 3KKOA 1YOVB 3L8GA 2ZBRA 4WN9A 1KY4A 3NNSA 3X1WA 1M6WA 4D1YA 5IDQA 4JR0A 1AN0A 5F35A 2QEQA 2WAXA 2ZRDA 4K1LA 3QI2A 3IPRA 2J9GA 2Y77A 4MEAA 4PM4A 2W2QA 2B3TA 3D3EA 1B16A 4RVNA 4UU8A 2O3SA 2YBEA 5GJWC 5IXYA 2Z5FA 5CR9A 2PCLA 1HTTA 4LBZA 4JI6B 2BZ1A 4RQBA 4D4JA 4UBOA 4MWTA 3SN6A 2YQZA 2M1ZA 4ZEMA 3HBLA 3UEOA 1VSQA 3WX0A 1Z18A 1KO1A 5DNVA 2D00A 4DV5B 2DFLA 3NWBA 1IG0A 2ODNA 2P9FA 2RBKA 2RGRA 1FYEA 3VHQA 1UP7A 2ZTSA 3JCZA 1I36A 3K16A 3KJHA 4CNBA 1AQYA 3THOA 4IV0A 1UBEA 1L7RA 5JR3A 1L7QA 1E2GA 1YR3A 4FD2A 1GPBA 3QELA 3M2PA 4A4DA 3PIIA 3Q3EA 3C7TA 2FJ0A 2VDOB 4IOKA 5EXSA 2KWIA 1II8A 3F46A 4GQBA 2OLJA 4ZQGA 5EIBD 3M4YA 5AKYA 2GEJA 3T9FA 3V4OA 1A1VA 1UFRA 4KQFA 5DBEX 3DXXA 2IYOA 4JP1A 4OMDA 4YP6A 2B1RA 2ZRHA 2RHJA 3C3XA 3SD7A 4P34A 4RZSA 5AW9A 2P2LA 2RFLA 4AJLA 2HDWA 2G9ZA 5HQ3B 4CTMA 2CZCA 4FE4A 3CN7A 521PA 4IFBA 1Y1QA 2RHWA 3DYBA 3IAHA 4IDGA 4TN1A 2HU5A 1A27A 3ND8A 1Q50A 2IDJA 3ZI0A 1V1RB 1UBNA 3HBNA 5YASA 4GI1A 3JWJA 3MXTA 5LA6A 1YH3A 1XYYA 4LE2A 4FYYA 4JI1B 4C08A 2X2PA 1HBJA 4DE5A 1Z0KA 1MVLA 3G1UA 3F6PA 2CXUA 3OOYA 5LYYA 3RUAA 1N2CB 5TQ2A 1NVTA 3DZFA 1DO0A 2X0KA 4YRPA 2HA6A 1II9A 3R5FA 4CE6A 2XI4A 4JB8A 3QJYA 5JXJA 2BHTA 2W6OA 5LQUA 2HDHA 3WYFA 2VJDA 3PR3A 2RHGB 3WI7A 3U2QA 5KWIA 2C8LA 2XODA 4ZJZA 1TEZA 1N9ZA 1PVDA 1O03A 1PZXA 2FW8A 3DJYA 1ONSA 2O06A 4Q1EA 5C5CA 3MGAA 1HMPA 1FFAA 3P32A 2QXUA 3D0RA 1G1MA 1Y9ZA 3DFKA 1W4BA 2VPYA 4AQDA 5CPBA 2RH5A 3DCIA 1YZNA 4ZGWA 5BYAA 1OU0A 4IICA 5C4IA 1KWGA 1PLJA 2ORIA 3X1DA 1F38A 1N7JA 1AF7A 4L4SA 4YHHB 3IO3A 1LPNA 1V16A 1VDMA 3FM9A 2WJ6A 4ZOLF 3GGGA 3KKKA 4AFNA 2GKGA 1IQ0A 1NLZA 3CZ9A 4E21A 4DV7B 4OEHA 2A67A 1OV6A 3RLFA 1MMFB 4EM6A 3TSAA 5LOVF 3TLJA 3OKAA 4RVOA 2J3LA 4YRKA 2WWGA 1S1CA 3SWWA 1T2NA 1WMEA 2ZUTA 2XZOA 1EXDA 3C98A 5FLXA 2F1OA 5CAEA 1V2HE 1CRZA 3ZR4B 2GD6A 1I2AA 3FPAA 3T41A 4DMMA 3BKWA 1GJRA 1XCPA 3I9MA 1PBTA 3CZRA 4JQCA 1NLFA 2ARKA 2H6EA 2PYZA 4TS3A 4BV8A 4CHTA 2F00A 1HLGA 1D0SA 4JU8A 1EGMB 4IHJA 3AO0B 5ALSA 2ZIWB 3LKVA 4IGFA 5ALXA 3ADDA 4TWZA 3GLFA 1CY0A 3OCYA 4YLEA 1JFRA 3C7DB 4G1UC 1CDEA 4JUFA 1BG6A 4D8TA 2BHNA 2QYOA 4WA8A 4A0FA 3TSWA 1TUBA 4K03A 4FXOA 4CIAA 4P33A 4C3OB 1TAGA 1U0FA 3KG2A 3GNQA 3IR5A 4BVFA 1BWQA 4WERA 1YKFA 3WRWA 5EWJB 5CT5A 3ZX5A 4I4LA 3WGYA 1QP4A 4D26A 1YQQA 2AR7A 3TLCA 1T24A 3M1IA 4OHVA 2G82A 1QYCA 3OZFA 4QREA 1R8JA 2QSZA 2PZGA 4NSNA 3ZWNA 1DXHA 5KAMA 4FGWA 1VRVA 4ZU3A 1LK0A 9ATCA 3EFOA 2BEUB 2M6KA 3ZHBA 1JKIA 1CUCA 2V5AA 3F5MA 3UENA 1DEXA 4LECA 1ADCA 1JHYA 3DMGA 1LK5A 3MTDA 1GQFA 3G88A 3VSCA 3O2JA 5CK5A 5BW8A 5AM3A 1U04A 5AM2A 2UYOA 2BSAA 3HMQA 3NDRA 1R50A 4IYRA 3RU7A 3ZU5A 2CK3D 1WDKA 2IDKA 1NBHA 2AC4A 1KEUA 2O0MA 3FNGA 5IVPA 1PYOA 3UTCA 5AQ1A 1M1YB 5K3BA 2Z6AA 2OLKA 5AOCA 3IQZA 4D5GA 4WVFA 4TTIA 1Z0UA 2CLEB 1YVUA 3G0GA 1KGSA 4YECA 3K1AB 4CMJA 3Q3CA 3OY7A 4US1R 4TLLB 2AEJA 1ISMA 1F2TB 1J06A 1CVIA 4QBTA 3K9GA 4AMBA 1URPA 3L6CA 2ADOA 1VPEA 3D4OA 4PAMA 2NT3A 2VYQA 4AW9A 2BFOA 3QX3A 3D8UA 1AH2A 1PW5A 4WXHA 4QUEA 3TOSA 3PJGA 4IIJA 5LB2A 1YTUA 4I1YA 4MV8A 2VATA 3P19A 2C29D 5IKXA 5LQSA 1RTKA 4N0QA 3CV3A 4EJSC 3TB6A 2P78A 2P6MA 5K8TA 4RGQA 1LQTA 1OMOA 2I1QA 4BN0A 1TYEB 4R54A 4PGGA 2CZQA 4HTFB 3UW1A 3HACA 4WJLA 1NF2A 3GFBA 4H7DA 4Q1AA 1SU7A 1IXKA 4NATA 4TMZA 4CMHA 1JKJA 1A0OA 1QH1B 3MS4A 3TDKA 1KARA 1AQLA 3CLSD 2WAYA 5JBQA 3EWNA 3DMDA 5THQA 4MMYB 5BV0A 5KOHB 2VTEA 3CVJA 2QL9A 5K3OA 2HNKA 3IIEA 3QRWA 1HEIA 4BNJA 3DT9A 5DULA 3WOVA 2O4UX 4QRIA 5JSYA 2HUNA 1IN4A 1QCZA 4JDUA 5KTKA 4W5NA 5EMJA 1PD1A 5IVDA 4KNWA 3SEAA 1VGRA 3SNHA 1ULUA 4NIMA 1CR4A 2C8JA 4QSMA 2H4HA 3ZWDA 1V3QE 4MJXA 3OQIA 5T3UA 4AXBA 4J91A 3QLUC 2ZJ2A 1DRKA 2WLTA 1ICIA 4GH5A 5HCUA 3IE1A 1MENA 1OH6A 1FQJA 1C7EA 3RU9A 4OBEA 1KVRA 1KFKB 5C52B 1GUDA 4MCJA 1PYGA 4PPNA 2G77B 4MDEA 3E9EA 3PGMA 2FEPA 1B1AA 3DWGA 1YE3A 3EEFA 1X9GA 3T8YA 3ZU6A 4ZDKA 4PBTA 3ANMA 3BXGA 1XPOA 4YRBA 5BSRA 1G5QA 2QHXA 3VXKA 1U5BB 4X71A 1UM9B 2AQKA 2Z83A 3QEKA 5D85A 3R09A 4Y2TA 5FNVB 1Z2PX 4MQ6A 1PL6A 3VR5A 3TOCA 3QP9A 2RMKA 3QEMA 2FPGA 1N0HA 2C0QA 4IMPA 2JGDB 3G82C 4TWIA 3WP1B 5JJKA 1MTOA 4ZOLA 1FDWA 4KV9A 1TPZA 5E7JA 2ZUVA 2BD0A 2XNHA 2DR2A 1Y42X 5L6MB 3HJRA 5LOVA 3JVDA 3B9RA 3EGXA 4HDCA 2Q9CA 3OE7A 1UJMA 1EP2B 3HSKA 4KQMA 5DXJA 3VX3A 1DLIA 2Q0XA 3PQ8A 2UYCA 1G20E 1NNI1 4HLUA 4CG1A 4XRGA 4TZ6A 5H5JA 1NDQA 1VE7A 1BU8A 4LJAA 1MOQA 3H75A 1SBHA 2PHZA 4PQGA 4TT8A 5FH9A 5JVDA 2VTBB 2HRDA 2UYQA 3KXLA 1JZQA 1KP3A 2ZBQA 5HGXA 3HEMA 4AP5A 1E1DA 1KJIA 3IJEB 4CKBA 4DR5B 1DAHA 3CNLA 2PZLA 2UYYA 3LA6A 4TSKA 1HY3A 1Y3IA 3ITNA 3PXXA 3QVMA 5BQ3A 3WHPA 4QT0A 1OGYA 2IBSA 5AW1A 2BYTA 2W6JA 5KHAA 5TR9A 2Q5HA 1N25A 1TMKA 3QUTA 3V33A 4TWBA 3QPAA 1Y5MA 3MJFA 1DC6A 1SD5A 4YRNA 3T0FA 2FCRA 1HLDA 4RJ2A 4MI1A 2HWYA 4HYTA 5ES4B 2VHEA 2CJYA 1PR5A 2AOUB 3L04A 3TI7A 3BRWA 1PFGA 3OQPA 4ZCIA 1JB1A 3LLUA 2YHIA 3NS7A 4Q66C 2A5LA 4DUPA 2WKSA 2OCAA 3SHTA 2C7BA 2J3HA 2KHZA 4I55B 4KI7A 2G80A 2KMLA 2QGZA 3ZYCA 4KUGA 2IITA 4NESA 1G5RA 2MCFA 2Z2KA 2I6GA 2W71A 3QF4A 5ILOA 3T3DA 1M2NA 2WYIA 5I4CA 4B8WA 2WKQA 1WMAA 4TROA 3ZVRA 1HEUA 5CCDA 1NW4A 4RULA 1CEYA 2H65A 1LUAA 1NBMA 2NUPB 1LW7A 3UNXA 4Z3KA 1E3WA 3CJTA 1TJ3A 2NNWB 5DI9A 1K5DA 3GGPA 1ZYUA 5EJMA 5B1DA 5EIHA 3F7TA 2NQ8A 1Z4OA 4OK6A 2PH3A 3L9WA 4JQYA 4ZARA 4JLJA 4DJFC 1SB9A 4YCSA 1S2DA 2PJZA 3GOQA 4Z4CA 4YBRA 4JLOA 1U7DA 1MJHA 4OQQA 1P4GA 4PHTA 3L8ZA 1PAUA 2PZMA 3GRKA 3W9SA 1I13A 3P4YA 3GA5A 1T36A 1UC5B 1RVDA 5D5PA 2GCNA 3QY9A 2AIRA 3S2SA 3GRAA 2E18A 1P45A 2HSGA 4FDTA 3SKVA 2Z8YA 1OLXB 2IYFA 3F96A 4MLDA 5C2JB 3KJZA 1A7JA 3KOOA 5DI3A 1SK8A 3U0VA 5HKBA 4GDFA 2GPSA 2GAAA 2IEZA 2N1MA 1R88A 2XUIA 3EVDA 4LTDA 4F4JA 1WQ4A 3TVYA 5ECYA 1R10A 1MF7A 3NKVA 2LE0A 4I1IA 1MAAA 5DWVA 3F5FA 4EA9A 3AIKA 3JAKB 4YDHB 1FFCA 4F5WA 4F4CA 1CBUA 4LRSB 3TECE 3EFEA 3LQRA 4TYQA 4ESEA 4IMIB 3P45A 1R0BA 1WUYA 4XIIA 2XGJA 3IKMB 1OD6A 4HGPA 2XZLA 5J4VA 3T7TA 4LV8B 4D0NA 4HX2A 1YR7A 1JG6A 1CT9A 2DJ5A 1P7VA 2JGEA 4OREX 4A5SA 1TCVA 3GUCA 3KSBC 3IESA 4DXHA 4DCSA 4KPUA 3GLGA 2O05A 3FPHA 5G4KA 4R7TA 3RSCA 2UUBB 2L17A 1KAGA 3HNRA 4O4JB 3GCGA 3QVJA 3RNLA 2GUGA 3DDCA 2EV9A 2AZTA 1OKKD 3ZHRA 5DNWA 2Q3DA 4BRUA 2WQZA 3HVKA 4O59O 3LD9A 1FJGB 2HT1A 3VNRA 2GVDC 5FXMA 5LL6P 1PF7E 1RT9A 3FFBA 3F5DA 4FFBB 5AKIA 3FFAA 3E61A 2BMJA 3GO4A 3OEEA 3OU7A 5CH5A 3R3HA 1AXGA 4I50F 3VYTB 4JLPA 2O8EA 2ECOA 2JK0A 2X15A 3V4ZA 2ORYA 1KDRA 4NQRA 1V8OA 3CNBA 4OQDA 4ZTUB 1EFTA 2OCIA 3T7EA 1KAQA 3HL4A 4TWJA 5DP1A 5EJ5A 2V8OA 5A3SA 4BCDA 1EAYA 1TGVA 1CR6A 3P7MA 4J0IA 5TPWA 1HO3A 4DDMA 2PQ2A 5IAJA 4E15A 5DW0A 3KNZA 2PZKA 3CF4G 1QIEA 1RU3A 3LCMA 1ULZA 1T9KA 3LQ2A 4ZFNA 1C3VA 2IVFA 4RKYA 4EPRA 3T5TA 3WNQA 5K0GA 1O95A 3I72A 1HWYA 4G0UA 1KAEA 1Q16A 5E7MA 3T5CA 2W6ZA 3K6RA 1SG6A 3JD2A 3LY5A 4G85A 4PTYA 4OHRA 1BS1A 5D2CA 2VP0A 4IZOA 5HQTA 5HXAA 3QVOA 4HO1X 5K3CA 1PSWA 3JV7A 5HWSA 3PC7A 4DARA 1KRWA 2FUG6 3QH4A 3L0YA 2MSKA 1W581 2W43A 4IIEA 5M2QA 2ZJYA 3IALA 1XJCA 4WK2B 3QA3E 2WNIA 4CMEA 4FZVA 1KYZA 1FA9A 1WHTA 4Q02A 4ZXFA 2JASA 1CWUA 2IXFA 3X1ZA 1VRCA 4EGSA 5CLJA 1NJ2A 4AJ2A 4DY4A 1MJFA 4TYYA 1LSJA 4CDGA 4LF9B 1NJFA 3AUFA 4YQEA 3R7BA 3FVWA 1AS2A 1NUSA 1R15A 3KBOA 3L4BA 5HKOA 4RTNA 4S1OA 5CJPA 3PQ3A 4RPJA 4XIGS 3TW8B 5KC9A 1SCJA 1UZMA 4CG2A 1JHVA 4CIYA 3ZNPA 1OIXA 4LDZA 5FLKA 4HH1A 2PRZA 3ESYA 3PFNA 4XARA 3CPEA 1PT6A 3NIDB 3NI2A 1OFTA 3AUUA 3G0HA 2V55B 3BL6A 5TGDA 3SZLA 2ZIVB 3NX4A 1AY0A 2FG5A 5I7AA 3V1KA 5AHKA 5EMNA 1UWVA 1YBHA 4KITB 2IUTA 1V8FA 2VF2A 3WL4A 4FMPA 4NCJA 1ESDA 1YS4A 2CJWA 1W85A 1GPNA 1IATA 2X3YA 3GRUA 2XMDA 3GRYA 2FW6A 4LS3A 1NW5A 1UDXA 1YFLA 2LCQA 1G64A 3ZD8A 3K0CA 1UJ6A 1NVVQ 4M22A 1A2BA 1IZ8A 2AE1A 2Y92A 2ZWPA 4U7FA 4XVQA 4Z0NA 3THXA 4L8WB 5LP6C 1A1SA 1GG5A 1GZ4A 2VSFA 2ILVA 5FAXA 1UEXC 4C43A 4YAGA 4ENWA 4U2FA 3R9IA 4LOKA 1LCIA 2A5JA 2X7XA 2DWOA