2FQWA

Pnra from treponema pallidum as purified from e. coli (bound to inosine)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAEYVPSLSAFADENMGLVVACGSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAGKSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKRADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSKEIVVPVRSARMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Membrane lipoprotein tmpC
publication title The PnrA (Tp0319; TmpC) lipoprotein represents a new family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC)-like operon in Treponema pallidum
pubmed doi rcsb
source organism Treponema pallidum
total genus 121
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqwA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqwA02
1RZRA 4LX8A 5TQ2B 2VUHB 2WJWA 1C0EA 1XWWA 3HZHA 1VLZA 3OQNA 1H9CA 1DCKA 3GT7A 3L49A 4L85A 4KVFA 4TLMB 3SM9A 4GPAA 2B1JA 5ABPA 1A0OA 4MS4B 1ZVVA 4F8JA 4KNYA 3EODA 3MMNA 1JFTA 4Z99A 2IPMA 1F51E 3IPCA 5JNVA 2KYRA 3JVIA 4RY9A 1JYEA 1ISSA 1KRWA 3H6GA 1USGA 1AB6A 1L5YA 2FTKE 2JVIA 3SG0A 2JRLA 5JNSA 1NXWA 1GUDA 4ML3A 2E4WA 4NICA 2WWVD 1F4VA 3F6CA 5JNWA 2NT3A 3DLBA 4D6YA 3T38A 4P98A 3G1WA 3O2QB 4IMIB 2JK1A 4XLTA 1Z12A 1CYEA 2PL9A 5TPZA 1JH9A 4G86A 4LDZA 1PHRA 3GBPA 4S05A 1U2PA 1Z2DA 1LJUA 2WRZA 4QYWA 1Z16A 4OLAA 3I45A 3QK7A 4WT7A 1PNTA 2JBAA 1P6UA 1W25A 4W5QA 1DRJA 1RXIA 4Z9AA 1J56A 1SXGA 4EYQA 3RVNA 4RK7A 1W9HA 3Q7RA 1BDJA 1TVMA 1USKA 2X7XA 4LE2A 4N03A 2PAFA 3GWGA 1M2EA 4F06A 4D6XA 1MVOA 2FKAA 3UUGA 3QLUA 2ID7A 3EGCA 2AYXA 1E6MA 4RXMA 3CZ5A 2W42A 2PKXA 1LJLA 4KK3A 2QV0A 4QYMA 3RVKA 5JS1A 4RU1A 4JB0A 5JS2A 4W5RA 1MB0A 4NV3A 4MS1A 3HJFA 1GLGA 3F7NA 4N76A 1YK1A 3HUTA 4D74A 3OLWA 1U04A 3CNBA 5FWYA 2QZJA 3DGEC 5DKFA 3ROFA 4MRMA 2PUBA 1SXHA 3N0XA 1KMIY 3QX8A 4MQFA 4OTZA 1ZHHA 3HSYA 3N75A 3KHTA 3TMYA 5FWXA 4MS3A 3N0WA 2LUOA 2VYCA 3N53A 1YS7A 4YRZA 1YMUA 4EYGA 2OENG 5KQPA 3CHYA 1A2OA 2FMIA 3BRQA 3GV0A 4PEVA 2A9PA 2GBPA 3CG4A 3MIZA 1ISRA 3TO5A 2FN9A 4JOQA 3JPYA 2MSKA 1OXKB 1Z15A 4G0XA 5CHYA 5HQJA 3TB6A 3T95A 4YV7A 4MYRA 3QLVA 1YIOA 1BAPA 1ZH4A 2JVKA 3NHZA 3KCNA 4G0PA 4HYEA 1GCGA 3DGFC 1GUBA 3SNKA 4Z4CA 3RVLA 1VRVA 1ZN2A 3OMWA 4UHKA 3RVOA 3NHMA 4IGAA 1VPWA 2FXIA 3CU5A 4Q7EA 2PMCA 1YTUA 1UDRA 3QELA 3KYJB 1ZESA 2FSPA 5CNMA 3F6PA 2Q5CA 2IPLA 3OO1A 5EWLA 5KQLA 3DBIA 3H1FA 1ABFA 1APBA 2PUCA 2JBAB 4KPYA 1XHEA 3LOPA 5GQSA 3RVJA 5IBQA 3QEMA 3ILYA 1FSPA 1JLKA 4PYRA 3D8UA 3EULA 3TX6A 1Z17A 1TLFA 1CEYA 2V0NA 3FFXA 1SXIA 2IYNA 4IMJB 3HV2A 1QQAA 1DBPA 2CHEA 1JDNA 4RY8A 4KQCA 4JP1A 3H1EA 3OLYA 4Z9BA 1EWKA 1Y1LA 1USIA 2HSGA 3KS9A 3H5LA 1D1QA 2CD7A 4MS1B 1PEYA 5E3JA 2L19A 4RWEA 5TQ0B 4RZSA 3HXMA 1Z2EA 3UK0A 2E4VA 5IEJA 3IP7A 4E7OA 3C97A 4O5AA 5FWYB 1M5TA 1FFGA 3LKVA 3NNNA 4MRMB 5BRAA 2E4ZA 4NCBA 4H60A 4MQFB 4YP9A 8ABPA 2JVJA 4WXMA 4WUTA 2A9OA 5HM6A 2L17A 2PUEA 3FFWA 2H0AA 1HEYA 1ZH2A 1ZITA 1URPA 1U8TA 3LUDA 2M1ZA 4HNSA 4G0ZA 5IUNC 1D5WA 2F8SA 4ETNA 5C5EA 1JYFA 4OLBA 1DC8A 4MR8B 4W5TA 2WB4A 2GX6A 4F11A 3FMVA 3T6KA 4TN5A 2CWDA 2TMYA 3T8YA 4WXEA 3NBMA 1Z25A 4F12A 2E4XA 3KKEA 4PZ0A 2R48A 1KGSA 4RY0A 2FMKA 2NT4A 4ZMSA 3JS5A 2QR3A 3QELB 3D02A 1EWVA 2FQWA 3DLHA 3CKMA 3E3MA 4WZZA 2IDMA 5EWLB 4EGSA 4NCAA 4Q6BA 3HUUA 3RH0A 3EAFA 3SY8A 5C5CA 1DRKA 4MR9B 1GCAA 1DC7A 1RPJA 5JNUA 1RNLA 4MQEA 1NXXA 4YR7A 2XDYA 2QVGA 3CS3A 4MR7A 1A04A 2DRIA 4XFKA 3OQOA 5TE9A 4ZYLA 5JNTA 3H75A 4XAQA 1PEAA 2GWRA 2PUFA 3A0RB 2FVYA 3CG0A 3N0RA 5HSGA 2HQBA 3H5TA 1E6KA 3L6UA 5EWMB 4EVRA 2IPNA 5T7BA 4ETMA 3I09A 5IC5A 5EWJA 3B2NA 3I42A 3JTEA 1P2FA 3IP6A 5BR1A 1D4ZA 4M88A 2NZVG 4Z0NA 2E4YA 2PUAA 2LBPA 1LBHA 2MSLA 1NXVA 3IPAA 3MYYA 4QICA 5I4CA 2FEPA 4UHJA 3Q7TA 4HNRA 2O20A 1ZDMA 3W9SA 3F73A 3NNSA 3EDCA 3JY6A 3VNBA 3DZDA 3LUGA 1EHCA 4RKRA 5TQ2A 2VK2A 2FQYA 1YS6A 1QP0A 1DBWA 3KG2A 4QPJC 3H5IA 5BRJA 4FE4A 3LKBA 3RQIA 4FB4A 3O75A 4EYKA 1NATA 2PL1A 2AYZA 5T3YA 2YHAA 2R25B 2NZUG 5JNRA 4Z4IA 2LPMA 2RJNA 1BA2A 4RSMA 4YWHA 1AB5A 3O1HB 3K4HA 7ABPA 3CLKA 1TMYA 4H3KB 4EYOA 2QXYA 4LE1A 5KQGA 3H5WA 2FEKA 4PE5B 3LFTA 4RS3A 4Y9TA 2L2QA 2VUIB 1DCMA 2FLWA 5CNKA 4O1HA 5KQMA 2PUGA 5TPZD 1M5UA 3LUFA 5TPWA 2BGGA 3FDFA 3Q41A 5BQ3A 2A9QA 5ED4A 4MQEB 4KREA 4N0PA 1U2QA 4YCSA 3R0JA 4H3HB 2QU7A 3M9XA 3CRNA 3O2SB 3QEKA 1S8NA 2FMFA 4G0OA 2N9UA 3O1JC 2IPAB 4PICA 5B3JA 4F3TA 5KI6A 1TJYA 2PJUA 1QKKA 4Z4EA 3GRCA 3Q9SA 1DP4A 4MAAA 1U0SY 3GBVA 3IDOA 1E2BA 4MLDA 3HDGA 3NNDA 3ROTA 3OLVA 4G0YA 5CNJA 4ZJPA 2QSJA 5EWJB 1QNLA 4RK5A 3C3KA 3HCWA 1D2AA 3LMKA 3LUAA 3MM4A 4YLEA 3S99A 1P8AA 3MF4A 1Z13A 3CTPA 4LE0A 5KWSA 3CZCA 2RDMA 3FFTA 3HDVA 3IP9A 4JASB 4RDCA 1KRXA 4DQDA 2R4QA 4S04A 3EJWA 1JF8A 2JB9A 4MS3B 4RK4A 5FWXB 3N8IA 1E6LA 2L18A 4W5NA 2WJAA 1M2FA 4N0QA 4JA2A 3KJXA 3LUKA 4RK6A 5TQJA 5IEBA 4EY3A 4IILA 3LUCA 3K9CA 4MLCA 3A3KA 2RJOA 2CHFA 2WY2D 2FQXA 4Q6WA 1EWTA 1NTRA 3BBLA 3HEBA 3P9YA 2IOYA 5IULC 3CFYA 3C6QA 1SRRA 1PUXA 5PNTA 3KLNA 5KC9A 4LDAA 4RXTA 3OM0A 5FBKA 1TM2A 5DCLA 1CHNA 5IUJC 3QX9A 2HPHA 4KK4A 5GOTA 1BDIA 1ZGGA 3BRSA 3O21A 4LZLA 2F8TA 2MYTA 1JFSA 4MPTA 4XASA 1JWLA 1IIBA 3RVRA 2JCGA 9ABPA 1MIHA 3HO1A 1OXBB 3QEMB 5TPWB 2GKGA 3QLUC 1DBQA 2HJ9A 4G0MA 4IF4A 3RVSA 1B00A 3M9WA 4ETIA 3H5VA 2OQRA 3ILHA 1JDPA 3OLZA 4KQ9A 4FE7A 2YHBA 1YVUA 2QVCA 4ZPJA 2P9HA 4LRQA 1BDHA 4KFCA 2LP4Y 1WETA 1NY5A 6CHYA 4IRXA 3M6MD 4GNRA 1BVHA 3N6VA 1DG9A 4EUKA 4DN6A 3JPWA 3SAJA 4B09A 1JBEA 2I6FA 1LBIA 4ZMRA 1ZGZA 2QW1A 1NXPA 3GL9A 3H1GA 2J48A 1DCFA 1QO0D 3KYIB 2FLKA 3KLOA 1QP4A 4CBVA 4OATA 4JB2A 1JHZA 3VNAA 4L4UA 1JX6A 2PUDA 1RZRD 2A9RA 2E4UA 1Z26A 3A0UA 3QLVC 3OM1A 1NXOA 2MYNA 4OBBA 4Z4GA 4MS4A 3RVQA 4O1IA 4KRFA 4JAVC 5DGCA 3EQZA 2ID9A 4KV7A 5F64A 4MGEA 4YO7A 2H3HA 1MB3A 4DADA 3BREA 5TQ0A 2FMHA 1FQWA 1L5ZA 4XARA 3HS3A 4E7PA 1D1PA 3C3WA 3I5AA 3G85A 2R47A 5HKOA 5KC8A 2MYPA 3O2JA 3E61A 4KMRA 4XXHA 1T34A 2M98A 3GA5A 1C4WA 5IUKC 1K68A 3H5OA 1LK0A 1R8JA 1JL3A 4HNQA 3IP5A 1RXEA 3KSMA 4YS6A 5FBHA 1I3CA 3EQ2A 3RVMA 3TD9A 1NXTA 2ZAYA 4MR8A 3SQNA 4WWHA 2MYUA 3KTOA 1FFWA 1EAYA 5DLEA 1VKRA 3LUHA 1NXSA 4G0QA 4OG2A 4RK0A 4EVQA 5B3JC 3HM9A 3RVPA 1QQBA 1P6QA 3JVDA 4RXUA 3QLTA 1PNRA 1YK0A 1ZAYA 3C3MA 2PLNA 3BILA 4MR7B 1FFSA 1SD5A 4RK1A 4KZKA 2HQRA 3LTEA 1Z18A 5DTEA 3HVRA 4N41A 1XHFA 3H6HA 4EVSA 5D2CA 2ZWMA 5IX8A 1ZY2A 3MQ4A 2PE5A 3URMA 4MR9A 2B4AA 2HQOA 4YGXB 4Z4FA 3OQMA 3O1IC 3O74A 4G97A 1JFVA 2FN8A 4N47A 2GI4A 1ABEA 1QMPA 3FGZA 4NQRA 3HK2A 1YMVA 2MSWA 3LUJA 6ABPA 2P4UA 2FEWB 3A10A 3OO0A 1DJMA 2LIVA 3OLXA 2FW0A 3Q15C 3UKJA 1DZ3A 1MAVA 5CNIA 1QPZA 4TMYA 4RV5A 1K66A 1QO0A 4P1ZA 5EWMA 2RGYA 1EFAA 1QP7A 4TLLB 3Q7SA 4RKQA 4Z4HA 4W5OA 2WMYA 2IKSA 3OMXA 2NUBA 3GYBA 3MA0A
chains in the Genus database with same CATH superfamily
3IXQA 1JHUA 1K7XB 2QG4A 4RTKA 3GT7A 1GDHA 3KC2A 4UM9D 5E2IA 3LQ4A 3I9KA 1ZCAA 3V1YA 1EVKA 1LDGA 3IBYA 5BMVB 2IL1A 3DTVB 3IA2A 1WR8A 1AKYA 1MRNA 1U1GA 4AJ9A 5HUQA 3ZDRA 4RPCA 2X6TA 3KKMA 3D0KA 1KXJA 3IYLW 1HYGA 3DFFA 5CB4F 5DP1A 2IEAA 1CXZA 3DMPA 3TL6A 4CDMA 1JR4A 1TFUA 3F6RA 3B6ZA 4ZYWA 5L3ZA 5IXSA 4GYJA 5A7FA 2PV0A 3GP5A 3QF7A 2AKEA 3L1HA 5T4HA 5BSFA 1MC8A 4IWXA 3AR5A 2XQVA 5F9MA 3PE4A 1QPBA 3LT0A 4FFMA 3WJAA 5A06A 1DEAA 2ODNA 3ETDA 4IJMA 4WN3A 2COEA 4GH5A 1Z12A 3EXHC 4NBUA 2X3YA 5CB4B 4G86A 2WT4A 3AUJB 4MW4A 4LI0A 3T9AA 2M32A 4BZZA 2Z6VA 1L7NA 3T1OA 1I1NA 1NI4B 4EI7A 3OCWA 3OEED 4JBXA 4X1IB 5JDCA 1IN6A 1RWWA 5TIIA 3ICQB 1OZAA 1YRQA 3EGXB 1ULHA 2FHPA 3D1LA 3M6WA 3WGKA 1P75A 1QU3A 3HYRA 1HWYA 3NOVA 1W581 1W25A 5BSVA 3E8SA 1Z4PX 2OB2A 1GTG1 1TRKA 3CJTA 2QRQA 5D3ZA 4EABA 2GAAA 4JT4A 4Y6PA 3NV9A 2YZNA 2KLBA 4PC7A 3GMTA 2W2NA 4HDRB 4XEUA 3T7CA 1MOPA 5F5NA 1M2JA 3JQCA 1SO8A 3BN3A 4A92A 1JRLA 2FZ4A 2PAFA 3HYCA 4R2XA 4TT3A 3HKBB 5HCIA 1IAQA 2O2ZA 3TNFA 3TUJC 4CZ2A 2OCBA 2P4SA 1TUIA 2VIIA 4CG2A 3EGCA 4AY3A 2C97A 2C5HA 4EO7A 3JYNA 4A8PA 5CT8A 1A4RA 1RPZA 3ABIA 2XBMA 4GPIB 4YCBA 1QHFA 4XM2A 3GN1A 4E4TA 4MV0A 4Q7KA 3Q88A 3HJFA 4YC7A 1T2DA 3FN4A 4QXOA 1PNRA 2VBGA 3Q87B 2JCXA 1FLDA 3GH3A 4M87A 1RQLA 3C1TA 3T1NA 1MMFB 4OXNA 2H5LA 3BL6A 2ADOA 3KLPX 4HZIA 4MNTA 5C81A 3U9TA 4BKRA 1WPRA 5H16A 3EVNA 3STXA 4RD0A 2H57A 3JRXA 1W96A 4P9NA 1XZKA 2V7QA 3WA6A 3EF3A 2YZ2A 1YMUA 3COWA 3P0EA 4UD2A 5EUBA 5F2KA 1PQPA 4GPZA 1D07A 2A9PA 4PEVA 4QPZA 2XNCA 1X13A 4IJWA 3CW9A 4ZVSA 4B4WA 2UUBB 1TTPB 1JR3E 1R88A 1Z56C 3IQZA 4KPUA 2GGSA 1XQWA 4G5OA 1U8ZA 1ZH4A 1LBTA 2RGBA 1XALA 3KCNA 3ZYZA 2FNAA 5E9AA 3DGFC 4BTVA 1IOZA 5HZHA 1OILA 1ZI9A 2FN3A 3BJEA 2DH5A 2YL2A 2P77A 3FVTA 1JHOA 3RHTA 3K9LA 2WM2A 3NHMA 1XIVA 1RXSA 2IWHA 3SC3A 2CFIA 4YJGA 2XOKD 1G2PA 1WCV1 1OH6A 1O57A 1Y8QB 2AZTA 2ODBA 2Q5CA 1C1DB 1SC9A 2ZS7A 4GZ6A 5HK8A 3V1NA 2HDHA 2VA8A 3Q3JB 4TVKA 2H11A 4FUTA 1RRVA 2PUCA 2JBAB 4B2LA 3HZRA 2HLHA 4AMGA 3RC8A 3BA1A 2XGJA 4LDPA 1DKMA 1A7AA 4Q9NA 5J40A 3IKTA 4BO1A 1F06A 2V65A 2F3SA 4HH4A 3FFXA 3KQSA 4TM8A 4D9IA 4XRGA 1ULAA 4D99A 4MWEA 4WRRA 1E9SA 5D5PA 2XMBA 1JXMA 1TXGA 5GP1A 1M66A 3QG1A 4UCWA 5DEOA 4KI0A 4ZT4A 1F1JA 1DBPA 1YONA 1ZISA 1KARA 2QSYA 4TV8F 4EZBA 5K09A 4ARVA 5CLIA 2P3QA 5E7QA 1T10A 3AZQA 3JWPA 1S2LA 2JZCA 1Y7HA 2KQUA 4E3WA 4U7PB 4JXJA 4BATA 2NNLD 3H5LA 3LBYA 3B1WA 4OHUA 1OCEA 4QEZA 3SR3A 1LPAB 3B9BA 5AKJA 1T1EA 5CM9C 4ZO4A 5IWCA 2I8AA 4NF2A 2G83A 1WXGA 3SIWA 4NV0A 4TV8B 3FOCA 4MRMB 2PMBA 4WERA 5JEEA 2BSXA 2D0PB 3IMFA 1CK4A 3TH5A 3R7SA 3IQFA 4RIFA 3ZY6A 5HNKA 1EX7A 3JQAD 4YJ3A 8ABPA 3DR3A 4FFWA 1E8DA 1OWPA 3DFZA 5JWRA 1KMHB 1L9KA 4LF5B 1ZITA 3A1DA 5SZJA 2XVZA 3AL2A 5AW4A 3V4SA 1WHTA 2IZ7A 4WFQA 4CTMA 2G8NA 1KKUA 1SM4A 2AXEA 3HXQA 3OFSA 2G6BA 4M98A 2IUUA 1YVDA 4PXAA 1EVYA 4ZDIA 3L8HA 4BJ3A 2JLYA 1DMRA 3LX6A 3DV0A 4KG7A 1X1AA 2OKCA 4MR8B 3WK8A 1S3IA 2AOVA 2HYIC 1P1CA 1XD2A 3MTEA 1Z62A 4ZDKA 5FR2A 3FWZA 4NR0A 4UUOA 1BCRA 3VH2A 1A27A 3K53A 1ML4A 5FUXA 3BWYA 4Y6SA 2RKWA 4FYPA 5ARDA 5REQB 5AM2A 2OT3B 3ESCA 1GSIA 2O7NA 2R6R1 4YMIA 1XTJA 4JNKA 5P21A 1VLHA 2PZKA 4BV9A 4K9LA 2B99A 4ND7A 2FG5A 3VNRA 3L8FA 4KIFA 1ETUA 1QYDA 4WCFB 3G6WA 4DARA 1RJDA 4PHTA 3BGIA 4QXRA 4X6UA 5I3CA 2E2WA 4J1TA 3F5DA 5BXQC 2H0QA 1U4NA 3C4QA 1V11A 3CT6A 5A3RA 3ADPA 4WNIA 4ZQFA 3ZNOA 4DAEA 1R0RE 1ZH8A 2G72A 3FJYA 4UJ3A 2O2SA 1R9JA 4QDTA 1ZNQO 1AZSC 1XJCA 2R9VA 4LCJA 4YXFA 3ND6A 1XYVA 4YV0A 4DPKA 4EA8A 4L8YA 1A04A 2ZTUA 4F71A 1ISMA 1SBQA 1TQ2A 1PS9A 4A82A 3WC4A 1KTIA 1F48A 2ZYGA 1A71A 5E8RA 1RXWA 3TQFA 1NV9A 3F2VA 3QJGA 5IH7A 1UM8A 1HFEL 2OCKA 2ZE5A 4OGLA 4I1RA 3K0CC 3PFNA 4D1YA 1GUAA 5C7IO 1L7RA 4R54A 4IQ4A 3VPDA 4F04A 3LYUA 5DCYA 2Z4SA 1Q1AA 2AG8A 4GDFA 1P2UA 3QTTA 2XTNA 1J1ZA 1YZUA 1QZTA 3ETLA 4N0MA 3QE4A 4QGBA 2QPAA 1W35A 1QYXA 1TUBB 2Q8PA 1K6MA 3AESA 3ZPXA 4D3SA 2O2HA 3MLBA 2EXXA 1BW9B 1YGPA 2D2EA 4RMIA 4ZI3A 3BK1A 5IJ0A 2X4DA 2Q6LA 4UHJA 4IRMA 3OJEA 1W30A 3EZLA 1X7XA 4HATA 2PIDA 2JJMA 4WEQA 5JCOC 2BEWB 1OZGA 4RKRA 1RM5A 4IS2A 4RADA 3ZU6A 5K4GA 2Z2JA 4OFZA 3H65A 3CV3A 5BRJA 4MVJE 1FTGA 1I9CA 1MC1A 3CLTD 4HGNA 1H5UA 2ZRFA 2YHAA 2XF2A 2P1ZA 2OILA 3GC6A 4M60A 4YJHA 3TLZA 4BNDA 1OLSB 2EYUA 3K4HA 3TW8B 5BYAA 5L4LA 1QBKC 3L7IA 1WO8A 1T4GA 3WGGA 5KWIA 3VNSA 3TPCA 3PJRA 3N9IA 3VR5D 4DY4A 3WLJA 1COWD 1UBJS 4I46A 2HCJB 5GADl 2DP4E 2V6GA 2HLDA 2NV6A 2IU4A 3B6KA 3MD0A 2BP7A 2Y1LA 4F1JA 1TJ3A 1Z0AA 3AV0B 4NNOA 3ZHBA 1R5NA 4W9RA 3VRHA 3TOZA 2YFYA 2H2AA 3QYJA 1U2GA 5KVAA 3MHTA 3H97A 3HU5A 4ABTA 1OMOA 3SM3A 2ZUDA 5ANRB 1E2QA 1VCMA 4KIWA 2GAJA 3P1JA 3PDCA 3Q41A 2VP6A 3OX4A 3RTAA 2IQIA 3QVOA 3UAVA 2Q1TA 2HK9A 2OO5C 2FMFA 3I1JA 1PX0A 4CMEA 1GRVA 2WNHA 1Q0SA 1NVFA 2G08A 4ME6A 3AG5A 4TTPA 3U40A 4AY4A 2NSDA 4KO2S 4W5JA 4C4OA 3GA0A 1Z63A 2XGMA 4W1PA 3N2ZB 2Z1NA 2DFPA 1CQIA 4LMRA 2VA9A 1N33B 4BWVA 3BKWA 1GRRA 5EIWA 2OD2A 3OLVA 4X63A 2C58A 1JAXA 1O6GA 4IIXA 1LZKA 4TTAA 2RONA 3W0LB 2K2WA 1AXRA 5EJEA 3ITNA 3ASUA 4M0CA 2CL5A 2VDPB 1W36D 4JASB 3IKVA 2MT9A 3I9V6 2EJUA 3TLMA 1NR7A 4TVBA 4AJJA 3NDJA 2GO7A 4NE9A 1PZHA 2IEGA 3EVDA 3O9MA 4ZTBA 3F71A 1DAMA 1B8UA 2QOEA 3EVEA 3NALA 3PUHA 4W1RA 1LF0A 1O5OA 4ASUA 4D56A 4TUYF 4EPVA 1HSZA 4JEHA 1YTLA 1KH2A 4P83A 3RSCA 5C8YA 3GCWA 1US8A 1PL8A 2JGLA 1MG0A 2ZIAA 4KH1A 4LJYA 4EOGA 1C8BA 5DE3A 2HXYA 2EFDB 1IQUA 3QXHA 5HIMA 2HW8A 4AJ1A 4M1SA 5IABA 4WLNA 1ZN9A 4NNJA 4CLOB 3K7EA 3GPCA 3SVZA 4JEUA 1N4DA 1NQVA 3PD7A 5CYPA 5JTUA 1R64A 1GHTA 2DY1A 4M76B 1L4FA 1E4EA 4UEKA 3H19A 2JJ1D 2A67A 3D7MA 2HQSA 3VYUB 5A4MS 3GEMA 4ZAGA 1CY6A 4RJJA 3S68A 3M6UA 1RM0A 2ZG6A 1VPVA 1CHNA 5ETJA 2BUCA 2ZGVA 3CONA 2Q1WA 3Q72A 4HLQB 2PZBA 3CNEA 2YC4C 3GIDA 2HTEA 3IQEA 1W0JD 3F7TA 5DB4A 1JFSA 2H5IA 1Y1KE 2C7VA 2JAXA 1F7UA 9ABPA 3HO1A 4WJLA 1P3JA 2X3FA 3IIJA 3TCXB 3DC7A 2HJ9A 4ETIA 1CUYA 2C5AA 1ZMTA 2GFQA 3OCCA 2YY5A 5I9NA 3WYCA 4UTVA 3PC3A 4I4IA 3UH0A 4UBNA 4ZDWA 1CNMA 2BF4A 3RFUA 1CJMA 3KXPA 1YKSA 2ZQYA 1UK8A 2ZI3A 4H7KA 4ZPJA 4D3YA 4EI8A 3HNPA 2YVAA 3LHSA 1AQ6A 1SBHA 4CUZA 5FUMA 2XD9A 4J1NA 4LNHA 4LY6A 3EGDA 4EG8A 3LT5A 1DU4A 3AUTA 3EOBI 1FRQA 1LTHR 1WG8A 2RH4A 4HDMA 3LPCA 4JR1A 1LBIA 5BMOA 2ZJFA 1AKWA 4RDHA 1G98A 1QK4A 2ZYRA 1RE0A 4EHBA 2QM7A 3IP3A 4YRTA 2ZUTA 4GKKB 2X0FA 2VJPA 1RP1A 1BZYA 1X0XA 2XE8A 1R6VA 3A6ZA 1IEVA 1GQSA 1QOZA 1Z6YA 2PT6A 2ATIA 3NASA 5C8DA 5EQTA 4BX2A 4B3FX 3KOYA 4NL4H 1IZZA 1GU1A 2UUAB 5D5HA 1C1XA 1VGQA 2XH8A 4Z4GA 1SC1A 1XZHA 3SZUA 1TCBA 1SK8A 4V0KA 2IYTA 2YKGA 3RSGA 4GYWA 2RK3A 1MPTA 3OG9A 4QE3A 4Q9AA 1IY0A 4DADA 5FI5A 4EARA 3HB5X 3KT8A 4IZHA 2AJ8A 4UUPA 2F1IA 4QQFA 5DIZA 2X15A 1FY2A 1OREA 1I36A 2XQJA 4IIJF 1M34B 3I5AA 4HI0E 5C1PA 2J6BA 2CLSA 2I1WA 1UKZA 1SUBA 4N65A 1HM5A 1DOHA 2BD0A 4U2KA 1OXUA 2ZI7A 3A36A 5EHZA 4AXBA 5TNXA 2Y1XA 1PEDA 3KRTA 4MUYA 3HFRA 3EW9A 5JZVA 2PQ2A 4Z4QA 5JH7A 1KOFA 4JL6A 4M22A 2JFFA 2WU1A 2ZJ2A 5LB4A 3DOCA 4YMUA 2V9CA 3IP5A 2VOEA 1K8YB 4U1RA 2V9PA 4IIJB 3UOAB 1N7HA 4FE3A 4BLUA 4MUEA 1UZNA 2ZAYA 1PKXA 2CDNA 4Q16A 3K1AB 4HX5A 1PRYA 1C0KA 3DOEA 2P6MA 2VVTA 5T4EA 1H94A 2FF7A 4DEVA 3MELA 3AP2A 2G06A 1FX0B 3B5JA 3JVDA 1KA9H 4BNVA 3RW9A 1LDBA 4RVSA 1Z28A 1NJ1A 2H9AA 3HVRA 4B76A 3BE8A 4TKUB 2VXOA 1FYDA 1EUYA 4HQKA 2HLPA 5KTPA 1GR0A 1NJSA 4DMKA 2B35A 2FN4A 3GLHB 4RFSB 3TWOA 2FMXA 2IEBA 2JIDA 3ASVA 3BXXA 1AHHA 1RQGA 2FPPB 4PBRA 4RCVA 3VTAA 1JDUA 4JELA 4DLVA 1AV7A 2A35A 2BM9A 1NVMB 3O74A 3R3SA 3AKYA 4AMBA 3FKQA 1J2RA 1SCDA 1LW6E 3ESAA 2C57A 2PUJA 4MOWA 3UOGA 2A3NA 3CEAA 4LEIA 1U0HC 3IP1A 2OMEA 2JFGA 5KOIA 3PE3A 1O95D 1FRNA 1TGYA 4H2DA 2OOSA 4CXMA 3Q8KA 3IESA 5AJVB 2WZCA 5EEHA 5FLEX 2NM0A 3SIRA 1HQYE 2WSYB 2BHNA 4LX0A 4MS4B 4R69A 4EITA 3KQHA 2BIFA 4KXMA 3RSLA 2WJWA 1UOOA 2QUAA 3GAMA 4QREA 4BEJA 4P54A 4M1QA 5F33A 5JI3E 4ZAZA 3FZGA 1SVUA 5CLFA 3R6GA 1A0OA 3UJ7A 4CLXA 1HOTA 1VYTA 2BKVA 2CXRA 3UG7A 2R6AA 1RBMA 3KELA 421PA 5KVQA 2YXEA 1GTMA 2KYRA 1IDN1 1SUFA 1MNAA 4CF3A 3EFOA 4TS4A 1UBGA 4MSUA 3SS9X 4J4TA 3VR2D 2FF5A 2AW5A 1KDVA 4A0RA 3BMCA 2J0UB 4C2BA 1ZA1A 1ZSYA 2EJTA 1P33A 1NL3A 1V8OA 4LYFA 1JAIA 1FP4B 4MMYB 4OJMX 1NUPA 3SS7X 1XXHB 4QRDA 5TEWA 4B80A 5AJTA 4F84A 1NFQA 2B82A 4NICA 5DNWA 3IEVA 1T0IA 1P81A 3LY8A 5LA6F 4B7XA 1B93A 3PIDA 4M0UA 2WE8A 3PVCA 5COBA 1IJKA 3OT5A 4L15A 3PA8A 4IICA 3V4ZA 2Q3EA 2I1QA 3TQHA 4L0MA 3EQ8A 2I4OA 4BYGA 7YASA 1CYEA 5AQ1A 1P1RA 4TWZA 4FZ5A 3B36A 1ZWKA 1UR5A 1YBAA 2QVZX 3HVKA 3EIQA 4IJQA 1FBNA 2IQ5A 4HK4A 2YVQA 5A3JA 1UJ4A 5JFGA 1Q3TA 3R5KA 2R1VB 4BP8A 4TYWA 2IUFA 3SX2A 3BGOS 2PX5A 4R31A 5LA6B 3L8YA 4FXPA 4QOGA 4I5FA 4YPOA 4JP5A 4G5XA 1ZHOA 5KNBA 5LP6A 2ZRQA 5G40A 1XAHA 4AD8A 4R98A 3ZDCA 3GLGA 4B73A 3ZY2A 1PJZA 1FX1A 3G8BA 2FJUA 5LQKA 2A4MA 2ORYA 1J56A 1KU6A 1JVNA 2C20A 4GXRA 4WH0A 3AVXA 4ZOLA 1G9TA 1U1EA 3KR0A 3F9IA 3V8RA 4DLUA 2W2TA 2KSQA 2VKQA 1KZ9A 1T6ZA 1UXOA 4N03A 2XB6A 3PFKA 5F52A 1RCTE 2OWEA 2CKDA 3M6VA 3Q6NA 5K0JA 2ONKA 3NLLA 5L3VA 1VCHA 2AYXA 5AVXA 1RAAA 1FE8A 3BMXA 3AVPA 3W8DA 2D3TA 5JXGA 5E38A 4ZOEA 2WWTA 3M33A 4JB0A 5FJJA 1OH5A 3QHQA 3PA6A 1HG0A 4JYPA 4GXQA 3ZGNA 2WICA 3L1IA 1ZIXA 4BQPA 1EESA 1G8YA 3LLVA 2H1LA 4GZLA 2P9FA 1C9MA 1ZC3A 1E9RA 2WYIA 3DGEC 4KV9A 5I5GA 2PR7A 2BFDA 2XKBA 5CP8A 3V2IA 1OB2A 2VSXA 2Q5OA 4GP9A 5A5DA 4EFMA 5C4MA 4MQFA 3NJ4A 1PQYA 2X22A 3DAHA 1CRQA 3JQRA 3GRKA 1BXGB 3QYFA 4QJBA 2QR2A 5FWXA 4MS3A 4X20A 3RTEA 5JDIC 2LDXA 4UXHA 1M1YB 1YS7A 1S4QA 1B41A 1BG6A 1P4JA 4LDRA 3O4FA 1YQUA 3EIWA 5IJ9B 4GLBA 2H4FA 1YQ9A 2Z4RA 3OTGA 1YKGA 3PIRA 2MSKA 2YWCA 3VFDA 1B14A 3V7NA 3W7AA 1F5SA 5JASA 2YOGA 2FR0A 4MW0A 5K0FA 2GD0A 4YECA 3RJMA 2CLCX 4PAQA 4WZBA 2C96A 5AJYA 1WF3A 5TJ9A 2DEUA 1GCGA 1QBGA 4R9NA 4HGOA 1VRVA 1FS6A 2CSUA 3MPUA 1U3VA 2QJFA 4KP7A 3T9CA 4GR5A 4I9HA 1BD4A 1AGRA 4NU5A 5A03A 5ILGA 5I7VA 1IY8A 2JFWA 4DQ0A 1A88A 1NVXQ 4XLLA 4FZ3A 4J43A 3PHLA 5K3AA 2VF4X 4KOEC 4NYMR 3UWMA 1F2UB 3CO5A 3WRVA 4OUDA 2I4NA 4K6HA 1UWLA 2W4QA 3LBFA 2K7FA 1PSWA 3JQPA 2OUIA 1PFQA 1PLLA 2VAVA 3DOHA 1B8NA 4KZPA 1SBNE 5FOSA 5B64A 4I1SA 1KO4A 1VQ1A 4AZ3B 2ZE8A 2SKEA 3WTBA 3EULA 1ZMBA 4MRVA 4NMXB 2WIBA 1C50A 3ROGA 4XWOA 2V3CC 1HURA 3WHKA 4PTYA 4F9EA 3HV2A 1MZVA 2VTKA 3OIVA 2VWHA 5BOSB 4KYIB 3E2IA 4JBGA 5FBRB 5DO9A 4LCEA 1FDUA 3CN7A 4J6EA 3AR4A 3ND7A 3ZWVA 3PQ3A 4N48A 2YINC 1WA5A 1YOBA 1XCBA 3G23A 1FNDA 5CEJA 2Z6AA 5DP2A 1E79D 3AJDA 5EHXA 1QHNA 2UYGA 2WKSA 4AP5A 1UJMA 1SG6A 1XJ5A 2G25A 1VG0B 4HAXA 4UNIA 2WV7A 4KGVA 1NC3A 2F1JA 1JALA 4YP9A 1BHJA 4BVBA 3REQB 3GGDA 1F14A 3OQIA 4ZVTA 4CGZA 3L1VA 3KJHA 3QKRB 4G5FA 5BXYA 3KTAA 4GOND 5J63A 5IKEA 1URPA 3DZFA 2BJWA 3OZ7A 2CJXA 1ULZA 4KQJA 1WMSA 2BFEA 3HBAA 5DWDA 4M9UA 3MILA 3TE6A 4EB8A 5IUNC 3ZCUA 4OQMA 2DR0A 4H77A 2EGUA 2MINB 1THTA 3HN7A 3L8ZA 2WIAA 4IWYA 1DC8A 1Q7TA 2ERCA 4HAWA 1Z47A 1C5KA 4JGGA 4IZ6A 4L3VA 4L7VA 3RYIA 1X1QA 6AT1A 2ZRGA 1YFKA 2VHZA 5E6UB 4FOOA 5IDVA 3ZE7A 4BO0A 5LPNA 5HKKD 4RIIA 2WJHA 3RUEA 5J9FA 5KBYA 1IN1A 2VG8A 1KY5A 5H0IA 1X7ZB 3TNDA 4DG8A 2AJTA 4GG1A 3BF7A 4XVCA 3BWBA 4YQFA 2XB9A 5BN1A 1VJ5A 2W2LD 1ZW6A 3EIXA 4F93B 3LBHA 3EXIB 5JYDA 1NDQA 1P0QA 1Z6XA 4RVGA 1KFJB 2WJZB 5C5CA 1E3WB 1O58A 1Z6ZA 2A7QA 4BNZA 4PHGA 3DAYA 2CE2X 3OURA 4B7CA 5JO9A 2SCUB 1KZ6A 2ZE7A 3RYFB 2GEVA 3T3NA 1IOWA 2KI5A 1M7HA 1L7OA 4N6OA 3PXXA 1AA9A 3KUUA 3V32A 1FF9A 1Q1ZA 1JA1A 2YXBA 3ZN2A 4DLNA 1PFKA 1FRFS 2VP2A 1LPBB 1J00A 3IBFA 5JNTA 3HJTA 2NW6A 2NO4A 2FVYA 4GQBA 3WK7A 5HSGA 3OF2A 1R0BA 1E6KA 3IKMB 3PCXA 4GL2A 1UMDA 4AW9A 4ZTZB 3ZQKA 1SRQA 5FFMA 3ZTWA 4BCCA 1QP8A 1KAMA 5JRDS 1UOQA 4K2HA 3I61A 3QSGA 2DFTA 5ALEA 5KDDA 2C07A 1L4KA 1WDWB 13PKA 1CP2A 1Y5LA 2H2HA 4ANFA 4EW2A 2YV5A 3QHAA 2A14A 2LBPA 3E27A 1AUPA 2ZE6A 4QICA 4LJ8A 4M99A 2EWWA 2DR2A 4LTNA 2BEJA 4LJKA 2O20A 2W6ID 3HCRA 2VYFA 3F73A 3NANA 3AUSA 4E21A 2CUNA 3U31A 1RW4A 2WG0A 2C5SA 2F4VB 2JD1A 2Z2YA 2PL5A 1NW5A 1MJHA 4O1MA 3OZDA 2FPMA 3X2EA 3RQIA 1YDEA 1K92A 2Q1YA 2FR8C 3AH8A 3DMDA 4ATNA 4JBHA 2WUWE 4OP1A 3GDGA 3UY4A 5A1JA 3LHFA 5LNK1 1U28C 4Z4IA 3I8SA 1LQ2A 4DABA 4GWGA 4V1CA 4QLOA 2N75A 3BTUA 4FLEA 1YRBA 2IXGA 3I2IA 3W5SA 4MV7A 3ZIAD 2X8AA 1RFLA 1ZXLA 4Z1MD 4S0XA 4AX4A 5B7GA 4XGRA 2GXAA 1BGXT 1GIAA 3EC1A 3YASA 2PVSA 4RMJA 4EDHA 3HR8A 3LFTA 4IVPA 1ZC4A 1SCUB 5CT4A 1FTNA 4JLJA 1U31A 1I0IA 2BONA 3QYPA 4WL0A 5ECGC 3RCBA 2ZYVX 3ZW8A 3WGLA 3FXAA 2Q3DA 3G2LA 5A0FA 4C87A 1HMPA 1XZEA 3ZEAA 1EWRA 1GKUB 2JNWA 4WDQA 1KZGB 2D4HA 3L9WA 5IG2A 1YBMA 3FHCB 3G2KA 5FD8A 4KREA 4JOBA 3UT5A 4B87A 4ZEMA 2GKOA 3OPYA 1ZWLA 2VNKA 3NUQA 4WKOA 3DV9A 2OFPA 4K9MA 4OHVA 3A14A 3ZHZA 4QZVA 1G21A 4ZCSA 4YRGA 3QFHA 4P5PA 5ENZA 1XRLA 2QX9A 5HOQA 3UW3A 1QYRA 5H59A 3HMKA 4B7ZA 3ANTA 2XUOA 3LQQA 4FNAA 2FPWA 4RF2A 1ZPDA 3HFGA 1LTKA 5E3IA 4I4CA 2OV8A 1EZZA 5KMGA 5AVYA 4W8HA 3VX4A 1IWPB 1B0AA 3CLVA 4L8GA 1SXJB 1M2OA 5DMXA 3FKJA 4J2OA 4DJTA 5LL6P 1UJNA 4PLYA 2LCFA 2PZLA 3RBZA 1C7FA 3JD0A 1DFHA 4G9BA 3R5XA 3EJWA 4G89A 1LC3A 4LZJA 1RWKA 1D09A 1OOEA 1F8GA 4ES6A 3IBTA 3OJOA 5ALMA 5GY7A 4B6RA 5LU8A 4AECA 3ZWQA 5ADVA 4DSAA 5DX8A 4P0QB 5BUSA 3OEHD 4X7BA 4JJFA 3CURA 5JWHA 1VM6A 5IVKA 4EY3A 2CJFA 2ENWA 4UD6A 1KEUA 2VUUA 4YRAA 4ZV7A 3CPHA 4DXAA 4X62B 3DF9A 4IQ8A 2HHHB 2DU8A 3ITEA 2RJOA 4PYLA 4ZRMA 1UQRA 1JG6A 2V7PA 1R6TA 2F48A 1EFPB 3G0IA 2Y92A 3C3EA 5IW8A 2C2BA 4BO3A 3C7TA 4YJ2F 3TTVA 4URUR 5KC9A 4U3JA 4OX9Y 4LDAA 3ON5A 3ZDYB 4YMGA 3OLQA 5L9AA 2FG6C 2EGHA 2X0RA 3HVIA 4GR4A 4M0FA 2C59A 2GN0A 5I7AA 3X3HA 4DCSA 4NYJQ 3UMGA 4CG1A 2RJ3A 1BDIA 3M1LA 2YVKA 3BRSA 2FEMA 3TVDA 3SC2B 1EBBA 1N2IA 3LQFA 5HF6A 2P78A 1IIBA 4YCDA 2R97A 3LBNA 3NQ41 3ZG6A 1WLYA 2O8EA 4FD3A 4YJ2B 1FVOA 2VXBA 2EHJA 1XUOA 2VSNA 2NVOA 2XLCA 3K1TA 3KPVA 1XVUA 3DQPA 4UE2A 2EJWA 1Z2CA 2O1WA 4TLDA 1BFDA 3OQPA 4ZDJA 1XPRA 1Y9EA 3A26A 3O8CA 4FNGA 3X2SA 4A27A 4AS2A 1YZGA 5CDTA 3GLFA 2Z83A 3ZHUA 2VJKA 4EB3A 1AQJA 4IO0A 4QU0A 3EXHA 3WL3A 1KK1A 4JNCA 3MT8A 1VIYA 1BE8A 2HMWA 3M6MD 4BO7A 1XZFA 5CFPA 1ANKA 1V5FA 5C7OO 5JE8A 4PYOA 2B21A 3CUVA 4D9EA 3NAGA 1ZMOA 5DNUA 1NQXA 2P9JA 1KO7A 1ZGZA 3IT0A 1CIJA 4FHZA 4NDZA 4A8TA 2R11A 3FPKA 3O4IA 5GZ1A 4UNRA 1MCZA 3WJ1A 2W58A 4DJDC 4JJ8A 1FSGA 1DG3A 2VHEA 1T36A 2D59A 3CRMA 4MVJM 4FGZA 3QMPA 1Q1NA 2REQB 4FWIB 1EBUA 2VTVA 4H7FA 4QDOA 4UNNA 5F21A 3VTFA 1WBDA 1HLDA 1Z9BA 1CETA 3AQIA 3C7CB 3R5HA 1PJ4A 3EZNA 3WWOA 2IW3A 1IMOA 3L0OA 1K9SA 3HVJA 2QAGC 2VAMA 1SKQA 4HEA6 1ZOPA 2R00A 3PT5A 4RL6A 4BX3A 2QTHA 4D0LB 3L7JA 3BXGA 5IDXA 2TECE 1L5ZA 5DFAA 1Z07A 2XTJA 1ONBA 4WJZA 3MAGA 2GTIA 3FCSB 3D8BA 4OMCA 2C9MA 4IYJA 4E7PA 4J3JA 1NMYA 3VR1A 1PW5A 2VNAA 4HQFA 1C2TA 4V03A 3GMIA 5KU7A 1TEHA 2QY6A 4DQKA 3DPIA 4AO8A 2ZWIA 3U4CA 1WUTA 1SHUX 5KYKA 2J9YB 4JZKA 1RKXA 4TKVA 5T4FA 5LWQA 3NDIA 4M9XA 1XVLA 4GMDA 2BPOA 2FA9A 2HY7A 3KSMA 3K70D 3ICPA 3MJCA 1XOIA 2WF9A 1P5HA 4B1FA 3KKZA 1CY2A 3HSSA 1H42A 2Z8ZA 4J07A 4M1KA 5A7GA 3SQNA 2UZ1B 3LOUA 4D0NA 3HEAA 2V6BA 1PDVA 4R8LA 2PX6A 3JD4A 5GJWC 4F5DA 4HB2A 1HNXB 1UPAA 1YQEA 1TM7E 3G5AA 4ICIA 4NE2A 4H0CA 3O3MB 5ERYA 5A9TA 2PLNA 3GPLA 2B30A 2WT8A 4JDUA 3SC4A 2AOXA 3NETA 2ZUEA 2AH5A 3W3AH 2IKQA 1MP0A 5H81A 3RVDA 2BSAA 1NMQA 4ZGWA 4GU5A 4P84A 2IY7A 3IL2A 5C7LO 3PEFA 2K87A 4OA5A 1NLFA 4MYDA 5KQRA 4OI0A 2GA9A 4OP2A 2HK6A 2J6IA 3P71T 3RR2A 4XX0B 4G97A 1U3CA 4UTNA 1CFJA 1ABEA 1P6XA 4H1TA 1N0WA 3LUJA 3GGPA 3GNSA 1NQTA 4HVCA 3HK2A 3KZVA 3EDQA 1VHJA 3UKJA 4NMMA 1XPJA 1Y8RB 4L8VA 1ORTA 4D02A 2YFKA 3WLMA 2Z9BA 1YHZA 4JLVA 4TWRA 4JJZA 1QH8B 3DYIA 5JCPA 5K3SA 1D2RA 3NBFA 5K3FB 1QP7A 1EUCB 3BGDA 3E7WA 2ZRNA 3KSBC 2WMYA 3ETEA 2LTAA 5ALUA 3WYDA 2HIGA 4QJIA 4FJ0A 3GJ3A 1SA0A 4HCJA 3SLRA 4MKXA 4HBGA 4KVFA 3JQ6A 3KUCA 1EJ0A 2Q2WA 3SM9A 1PF7E 1FQKA 2HQ1A 4FCWA 2D1QA 2PRJA 4JLDA 3OETA 4JJEA 1SHZA 2O1SA 4Z8XA 4EZEA 1K3UB 2VXCA 3DBLA 4YRCA 2VK4A 3GGJA 5DTIA 4K3UA 2P2YA 4F0JA 4Z5XA 3I6QA 4PYKA 1N6PA 1T8YA 5LDDC 5G1OA 3ZIDA 2VP0A 4PHHA 1CRWG 1GAEO 2JFPA 4NV1A 4QQKA 3AUYA 4ZJUA 4DR6B 1YZVA 3FCYA 3DP7A 3PNKA 4QVIA 4RZQA 4YIKA 3L40A 2QLMA 3FGOA 3DB1A 4E5MA 3IBSA 5BNWA 3F3SA 5FB3A 3D0RA 4BCDA 1JLHA 1N7JA 1Y42X 4WHMA 1UBCA 2PL9A 3AR9A 1XD9A 4IQFA 1M2KA 2PIAA 2ZJ4A 2J08A 1SJ9A 4X3OA 2OCIA 2GJSA 4HMOA 3UXHA 5AW2A 4KFUA 3V46A 2QMUA 3QF4B 3QUSA 4ID3A 1BNCA 4K6CA 1A5BB 5C4GB 5K2MA 4BU0A 3SKYA 3PPVA 2ZBEA 5AM4A 4MA4A 1JFFA 1P6UA 1DIGA 3QLJA 1N34B 4W5QA 2W2OA 4R2WA 4HAVA 4Z9AA 1FFEA 3QPWA 4YXWA 1PTKA 3I28A 4NK4A 4D4MA 1KWGA 1USKA 2X7XA 3RKSA 1W5EA 1PO7A 3U48A 3HR4A 4PCLA 1P9NA 3FHTA 3JQ9A 4DAOA 1PE0A 5DM0A 2O19A 3KE9A 5AKZA 3T06B 3RC3A 1SULA 3GRPA 4REOA 3TCNA 5FQNA 3U7RA 1NKTA 2WIGA 3AF2A 4MB0A 4YGYA 1Y3HA 2VYND 1V4VA 5C52B 5CLQA 1DQNA 4Z54A 3R41A 3FTEA 5KUTA 4QKQA 1ZGJA 4GZ3A 4DYDA 4HDAA 4FN4A 4WBSA 3ZWNA 1UWCA 3P8ZA 4PGFA 4F2GA 1JU9A 2ZBDA 2DQZA 4X60A 3OLWA 1Q22A 4KDEA 3SIXA 5DYWA 1U04A 1FNNA 2QMEA 2VF5X 3KTDA 1DWOA 2PEYA 3IPRA 2IHJA 3K0CA 3RNLA 4Z7OB 1MHPA 1SXHA 5L4SA 1QLWA 4MKHA 4MUXA 3PDIA 4AB1A 1G5TA 1QHYA 4TL6A 4ZZ0A 4LOIA 1L4YA 1J8DA 1CYDA 1XYYA 3HSYA 4EEKA 1N2GA 2IDZA 1L5GB 5HJEA 1E2JA 2WYWA 4HLNA 3JYHA 5KNDH 5A1TA 1LS1A 1XCGB 2GK7A 1CERA 1S0UA 2WFLB 3ADKA 5H3LA 1E1KA 4LRTB 5JSZB 3IXMA 3G2QA 3P9ZA 4INPA 1NP6A 3GNLA 4P4NA 3HWX1 4FU0A 5CX1A 4KBFA 5DTJA 1GKIA 3OX2A 1KMCA 5AW0A 3M3HA 3WVNA 1UBFA 2C5GA 5CGQB 3A31A 4AYXA 4TZ0A 1MIOA 3D31A 3AM1A 4ZI2A 3LLUA 1OI2A 1ISGA 3IVAA 5BWNA 1M34E 1OI4A 1RFGE 1D0IA 1H2YA 3F6PA 2IPLA 2H65A 3Q5EA 5JO0A 2E5WA 4FMPA 4Q7JB 1FRVA 5EWLA 5C8VA 1F6WA 2GN4A 1TVEA 1OYVA 2ORWA 4HOYA 4RD1A 4XCVA 4DBLE 5ELLA 3VYSB 4R2MA 5IDYA 4DM7A 3LOPA 4Q9LA 5EIOA 2PBLA 3BFPA 3TCKA 2YYAA 1IY1A 4LZPA 2WJ4A 3NJRA 5G0SA 4ND1A 4YAKA 1RQRA 2WP8J 3GDWA 4XJVA 1Q1GA 1GTZA 5JMTA 1DKOA 1QE3A 4PZYA 3O90A 5AW5A 3D8TA 3E18A 3Q1LA 1ZBDA 2A57A 1N2HA 1UWKA 4LRSB 3UHOA 4DFDA 3U5ZB 2GXUA 2B3DA 3PSAA 4IJ5A 4IZIA 4L6CA 4IMJB 1AQIA 1FIUA 4O6VA 5F4ZA 3TRFA 4CF4A 4C7BA 4YCAA 1LPPA 3DONA 3UYKA 1U9JA 1W9MA 2I4TA 4JP1A 1BE1A 2PKQP 3NWPA 4KQCA 3ETHA 4YHBA 1VPEA 3U7GA 3TUIC 1ATIA 3F9RA 4LTDA 1MHTA 4C1NA 3AIKA 3SJZA 3RODA 2R6DA 4CKEB 3EE6A 3ONWA 5CW1A 4AVYA 3C5CA 3K16A 3DMHA 4N3CA 1LDNA 3QVTA 4MIKA 3ESZA 4N3AA 3R74A 3U62A 4JKYA 3UTCA 4U7GA 1PGNA 1YI0A 3NNNA 5AVVA 2OCXA 5KCZA 1CRZA 1FYVA 3WSWA 1BU5A 5ECDA 4EA6A 1PKEA 4YEDA 2W6NA 2ZSEA 3BCUA 3IAM1 2XYRA 1JR3A 4A03A 3BYZA 5K0NA 1LNQA 2XWQA 3KKKA 1JDSA 4QD3A 1XDZA 1XVIA 2C29D 2R8XA 4LECA 3SEAA 4HYYA 2H2GA 4DR7B 3DMNA 1U6KA 4KW7A 1QYCA 3DFKA 1EVEA 3F9CA 2I6UA 3LHDA 4RY2A 5DDIP 1GN8A 2QI9F 1L5HA 4J03A 3KPUA 4BDTA 4BP9A 1J39A 2EDAA 2WPDD 3T6KA 2C0PA 1RYYA 2C8KA 2WWXA 3VM6A 4L02A 4GMFA 4L4RA 1Q7EA 4ZCIA 3AINA 1FL9A 3NBZC 5A5GA 4LPSA 4NH0A 4R9UC 1KEWA 1O97C 5AHXA 4D9FA 5K6TA 3T5AA 1NZFA 2VXYA 3EARA 2X0EA 2WSMA 4NI5A 5BNTA 4QFDA 4RF5A 3VZQA 1ZGCA 2D74A 4J49A 2RFLA 1GXSA 1NYTA 1C7JA 2MSNA 1VJCA 1WCYA 2AOTA 2WE7A 2B0JA 2XVAA 4UFPA 4RTLA 5JZOA 1CS4C 2VBCA 3PCRB 3KFXA 1J1IA 4Y1RA 1ZK0A 2J3EA 3PQ6A 3HB9A 1RNLA 4R3UC 4BX0A 2HCFA 4QUJA 1WQ1R 5FL7D 5LU9A 1P7VA 2ZDHA 1BKYA 1NOJA 3IE2A 3UMJA 3VR0A 3I5UA 3CS3A 3P0HA 1ZUWA 2VSQA 3S8YA 1AQYA 3G0DA 1YA8A 2CL6X 5BN5B 5AVQA 2DGDA 4HPJB 3G5MA 4E1VA 1RRKA 1TT5B 2QLJA 2QV7A 4FNOA 5C8ZA 4E5UA 4DLTA 3B3AA 4IGFA 2D1SA 1J8QA 3HBLA 4J3NA 3IODA 4ZQEA 5ICGA 3RAPR 3T7AA 1T1GA 4ETMA 3VHXA 5KTYA 1EUQA 1W4RA 1JEEA 5FL3A 5A6SB 1T15A 4NJOA 5B7PA 4NBSA 4MW2A 4PQYA 2GEUA 2FP4B 2JGIA 1E9BA 5ALKA 3CZMA 1JIUA 1P2SA 3JASA 1DO2A 2WTNA 3HFJA 4KC0A 2PSEA 2H4HA 3IQDB 5EQJB 4Q4AB 2CNKA 1J8MF 1WVIA 2BEVB 3MZ0A 1OW3B 4PLHA 4DSTA 2J41A 3IRUA 4JVOA 4KN9S 3WK6A 1CPYA 2XE7A 4YAUA 2EKPA 1G38A 3AEKB 4PFKA 2XE4A 5AXDA 3ZY5A 4BMZA 1C1YA 5EXSA 1CY4A 1MR3F 3BMQB 3MT0A 3M6XA 4YCMA 4V0NA 5FOUA 4GVXA 4NPCA 4YJFA 2GD2A 4TVOA 2NV2B 2OOKA 1VKOA 3G7SA 4NBLA 4K6FA 4OYLA 4QBKA 4CQLB 4DJAA 5FV7A 3RASA 2AEMA 1ZHFA 4CQNA 3U09A 1KY4A 1ZD4A 3Q11A 3EZ9A 3NOXA 5ECYA 3EIHA 3MWFA 4FI3F 4ZU1X 1EEHA 4BMCA 1SGWA 1P31A 4MVJH 4EYOA 2WP0A 3W1VA 2C9OA 1K6IA 1SOUA 2B4RO 2G0AA 3H5WA 2AFHE 3UUFA 3GFTA 1L1QA 2Q4EA 2JZOA 1WLSA 2YYSA 3ONNA 3WAJA 3PNPA 2GN2A 4JQYA 1HYBA 1ORIA 2PRIA 3ANSA 2AUMA 2YS7A 4LQDA 3S44A 1FU7A 4UTRA 1HT0A 2YHUA 2PZFA 4PNZA 2IX9A 1QAMA 5LQUA 4MI3A 5ALSA 5ARBA 3D4BA 4ROSA 3E15A 1N1MA 1ESZA 3NAQA 2PV7A 1QNFA 5CU7A 1XP8A 3B82A 4NCKA 4NDNE 4AF8A 3QEKA 4Y6QA 2X7JA 3I62A 3KAJA 1RAHA 2IPAB 4IJKA 2P9YA 3JVVA 5EC8A 4BEVA 5KI6A 4HYTA 2PO7A 1TJYA 2H51A 3CLSC 2PXCA 4GOMD 4Q3NA 4AZ0A 4DM4A 2ADFA 2YHSA 3K9BA 4QGHA 5FIUA 3ZIUA 5IKPA 4BXOB 1VZ2A 2X41A 4NBNA 3IDOA 2QJTA 1DCTA 2WD9A 4NCJA 5KSYA 2C9BA 1GQOA 2IH5A 4PCVA 2QSJA 3UMBA 2I3GA 1XTKA 3KKNA 4NZNA 3WSVA 3CTPA 4MWSA 4PXSA 4X8MA 3FBGA 4YYEA 1GSOA 3RRNA 3IERA 3R5SA 3SR4A 3IGFA 4DQDA 1U11A 3KXKA 5FUQA 1DUIA 2QYOA 2V03A 2NO5A 4KDRA 1BEEA 1T5LA 4MVJA 4DHWA 3PEYA 2VT2A 1LGYA 1XCPA 3FCCA 3N8IA 4PAOA 4PRZA 3ZZUA 2WNIA 1DHTA 4NZOA 4PU0A 2G71A 4FYIA 3R8CA 4J91A 2I6SA 2GQ0A 1ACLA 2AN1A 3A9RA 3BHMA 4DBLC 2ZT7A 4OMUA 4XM0A 1IVSA 1R5OA 3NBAA 5FWAA 1V45E 1AX9A 2RKBA 3K4QA 3BMOA 4CKWB 3KL4A 1ENYA 2CYAA 3IMEA 4YUVA 3M81A 3OQHA 1L7MA 1O6BA 3JZFA 3A2NA 5C4IA 2W2KA 2BFFA 3BXFA 5JJ5A 3OWHA 2OTCA 2X5XA 4E94A 1R7RA 2RHMA 1JXOA 3BRWA 2C92A 2WAMA 3MWLA 3O4VA 4K9QA 4ZKEA 4B33A 4COOA 1CRLA 2WIJA 3MAJA 4EI9A 4OK6A 1C3JA 2P9ZA 6YASA 2MSCB 1BN7A 1ZLXA 4Y2UA 4RNDB 1YJXA 1MIHA 5IK2D 5JYEA 1KY3A 5TPWB 5EXEA 1ND6A 3EUEA 2GXSA 2Q27A 2CB9A 3VVLA 4NZYA 2VDRB 3OFKA 3HJGA 4GMXA 3ZS9A 2ATEA 4HAZA 2XGOA 4MW6A 3S2SA 4PN7A 3TLKA 1EUDA 4LVNA 1SOVA 2RGNC 4MJLA 5KYXA 3PEVA 3UV7A 2EF1A 4PSDA 5F5LA 3T3IA 1II0A 2Z58A 2XUFA 3NHJA 2BHTA 4R7ZA 4N5NA 4B43A 2Q2VA 4BNIA 2YJ6A 4EUKA 2W42A 2JFHA 3OU2A 4JOSA 5LCXA 1KFCB 1JIJA 3R8FA 1KDTA 2XJ4A 2J3MA 2QP3A 2ZTLA 4NPAA 3FNFA 2VQEB 4LV6A 5HF5A 4X91A 3DEZA 3WDKA 1Q2UA 3QVSA 3EH1A 3AI1A 4FGUA 3KDSE 2ASEA 4QULA 1MAHA 4CBVA 1M0SA 3B20A 2ODWA 5LQNA 3P2KA 5KOJA 1P91A 1SVKA 3ZJ5A 1LC0A 1G20B 2IEDA 4A6PA 3CBQA 3KYDA 3KZOA 5G02A 4V2UA 3IR7A 2ZXUA 4G9EA 4FP9A 2F1KA 3DULA 3NHPA 1A76A 3RC9A 3FNGA 4IBOA 4J16C 4BBPA 1U8CB 1Q1BA 4UFOA 5NULA 1AO0A 2UU9B 4I1YA 3LL4A 4PO8A 1U8FO 3RC7A 3W5VA 1CE8B 1Z8NA 1O96B 2AV6A 4X9XA 8LDHA 3GO4A 5AOCA 4TL8A 2YMLA 4GVLA 1OFTA 4ZC1A 1XTUA 2Z2ZA 2UYCA 5TGZA 3R9XB 1JDZA 4C5BA 4BLWA 2A30A 3ISVA 5GJVC 2HJVA 4OI2A 2HL6A 1YE8A 1IHYA 5IUKC 1EVLA 2UZ0A 1Q0PA 3TGPA 2A86A 1J0AA 1JJ7A 2HXSA 5F3DA 1JFRA 1R8JA 4HNQA 3SEZA 5FBHA 1OXXK 2BMJA 5L3SB 3CQ9A 2ZT6A 2X1HA 2EARA 5FBWB 1K2VN 5EQFA 3F5FA 1IVNA 2MYUA 1B3RA 3WKDA 1G291 4PFSA 5JPIA 1FFWA 1NMEA 5EAIA 2O8CA 2ZJ8A 1X8LA 2PJZA 1F8UA 3DZBA 2P7IA 1MO3A 3HCEA 3PXGA 3RWOA 4PLGA 3PEEA 1NVGA 4PLCA 1GRQA 3UJ3X 4LXTA 3RT1A 3IO5A 5LQRA 3W9BA 3ASZA 3OE7D 5AW1A 1J2UA 1EK1A 3LV8A 3HI6A 4QBIA 3AL0C 3H4IA 1H1LB 1P2VA 3LK6A 1X1DA 1PBNA 2C42A 4EVSA 1G4AE 2XTAA 4H3VA 5K45A 5IX8A 1ZY2A 1X38A 4WZAB 3ZD6A 1UZLA 1AQLA 2EBWA 1TFRA 1MO2A 2OZLA 3R6TA 3HFSA 3UGKA 2WF6A 5CDFE 4N9QA 5LLSA 3OQMA 1SURA 2PS3A 3AM4A 5UKDA 3F4BA 4UU1A 3CVJA 2JI8A 5DYIA 4CN8A 3BHIA 1QMPA 4U9HS 5AR1A 3K0AA 2FPGA 4YB8A 2MSWA 3F6SA 3VTKA 1HFKA 4B6QA 3I6BA 1M67A 1WW2A 1FVXA 3QM1A 2D54A 3OLXA 5EFZA 4BO5A 4IHKA 1JSXA 1P8JA 3D7RA 3IEPA 1DEXA 2QEQA 1NN5A 5I9LA 2QROA 5AVKA 2DPHA 4PRLA 2QLTA 3SF8B 5E3HA 5HRCA 2B6HA 2Y0EA 4NMHA 4E5DA 1DWQA 3WQBA 3EF1A 4Q37A 1YDFA 3OCZA 3VJKA 1D7AA 3V7YA 1RZRA 1LNZA 4EG5A 2QTVA 2VZEA 1PSZA 5L7WA 1PJBA 3AKEA 4LC0A 3WP0A 1IBKB 2ZJOA 4OXIA 4FFVA 3VSCA 2IU6A 4J0DA 3MB5A 1JIXA 2V0CA 2QF7A 3MTAA 4ENUA 4JIMA 1LLFA 4A10A 4AKTA 1UDBA 1LWNA 4BRUA 2A9KA 2VJNA 4FNMA 5A0VA 3BXOA 5CCBA 3H1TA 4Q4HA 3IH5A 4FCTA 4DMLA 3AVOA 4G37A 1II9A 1NRWA 2YYYA 3QNWA 6PFKA 2D5CA 3IE0A 2HPAA 2X5NA 4QXQA 1T5BA 1LBQA 4LF6B 3ORHA 4INOA 3QTLA 2WWVD 4OFWA 1KQOA 1P2BA 3AHHA 3EG9A 3KV1A 4XR9A 1WZNA 5B37A 3WIOA 3V33A 2EHDA 4E08A 4E31A 2GN6A 1QRTA 3UC5A 1IAVA 3B8EA 4P98A 5AKXA 3NHUA 2F8MA 3MMXA 4H6VA 1MX5A 2C31A 2DVMA 2VUSA 3DCIA 3V4PB 3VR6D 1ULUA 1TAHA 4S35A 4QARA 4PRYA 1PHRA 1OBOA 3NKVA 4EIWA 4Y2SA 1Z2DA 4F8EA 2WRZA 4PR3A 4ER3A 1EP2B 2NUAA 4IPTA 5AO9A 3CUTA 5BORA 4OLAA 3SJBA 2P3OA 2EL9A 3QWAA 1CEXA 4OM7A 4ZT5A 4ZODA 1DE0A 2EVWX 3D5QA 4H4CA 1LX6A 4NOLA 1O7JA 4B81A 4EENA 5EL0A 3IAEA 8ADHA 1GKKA 1R4MA 2NQ8A 3AW8A 2GSWA 2GZHA 3G17A 4RVFA 3NM4A 3FCAA 3RVNA 3BSFA 1R16A 1RMTA 4B4KA 2UYHA 1EJBA 1Y6JA 1G8SA 3HB4X 3IB3A 1Z5GA 3KXLA 1V95A 4AUMA 4LGVA 1LDYA 2FJ0A 3EVTA 4ZVMA 5KJ1A 3QLUA 2DY0A 1G2OA 5IAOA 1L4EA 3K0KA 4RXMA 3ZDZB 4CUKA 4DV6B 4ARSA 3TB4A 4BO8A 2OFWA 1MJNA 4KH0A 5EIFA 2TMGA 3F6YA 3FZYA 1NP3A 4F4HA 5IDWA 4EHIA 3IUNA 4EHKA 2WAXA 3FRJA 1CC1S 2AR0A 1K63A 1QTNA 2OZKA 2W37A 3BTSA 3F7NA 3OAAA 7GPBA 2DG2A 4H6WA 4RD4A 3AJRA 2GHTA 3WYBA 4CIVA 5FWYA 4D4LA 2H06A 4XX1A 1RPNA 2PWBA 2EWVA 3FPSA 4YMTA 1GLVA 2RARA 2VZ9A 3CMMA 2UZ3A 2ZZKA 5D8DA 2DUWA 2GM9A 2XMGA 2P9CA 5FXMA 5DX1A 1I9GA 3WIUA 3MC1A 4C4AA 1ADJA 1J0BA 2AMYA 2PGJA 1E96A 1MT3A 1QM5A 2CHQA 1RLOA 4CIBA 2RHGB 2H4JA 1HLPA 4XSGA 2XRZA 2C0CA 2QE6A 3D59A 3U7QB 3G2NA 5AM3A 2ODAA 1GITA 2VT3A 3EAQA 5CH5A 1JR6A 1ISRA 1DQZA 3ONDA 4UXIA 2QN2A 3H2SA 3NAZA 2VRBA 1C0IA 3G1TA 5CAEA 1Q15A 1NG9A 5AK4A 4KO1S 5DHAA 1N32B 4GMGA 2D8MA 1W48A 4JQZA 5FA8A 3SX4A 4DUGA 3OJ0A 4DR5B 2NU7A 1PSDA 3RVLA 2P1DA 2I22A 2VWQA 4N40A 2C9ZA 3KXIA 3LWDA 5KHAA 1L7PA 3JYOA 3B52X 2QTFA 2VHJA 3TR5A 5JTTA 2FR8A 4B17A 1GTRA 3X1DA 1WPGA 1I3LA 1M8FA 3EXG1 4G56A 1EVQA 3P32A 4H3SA 2WR8A 2AXQA 5SY9A 5BUCA 4CODB 1FK8A 1D8AA 2GEBA 4J0KA 2D1YA 1CUXA 2QY9A 2DULA 2QRHA 2XZTA 3C1OA 3OIFA 3NP9A 4H1UA 4ENRA 2P6PA 2ACKA 2FAXA 2QGZA 1DS6A 3QEMA 5B3AA 4B74A 3GVIA 1RDFA 4YT4A 1SBIA 2RGWA 4Q9JA 4MICA 2Q6KA 1OQAA 3CSDA 1PT7A 2OCAA 1M6VA 3KQUA 1QVWA 3EPPA 5FOQA 2O2GA 2ZYTX 3CYFA 3GGGA 3UT0A 1V39A 2X0DA 3RAGA 5JADA 1WV0A 2JASA 4BZPA 2Y77A 1E8NA 4YRMA 4JC0A 1K7CA 4UEOA 3AKCA 2Z3VA 3S2YA 1VI2A 1T35A 4PHCA 5A3QA 1CY0A 1S2OA 3KOMA 5DNCA 5DF1A 4ZVUA 1NAHA 1YRHA 3FAZA 2GZDA 1XRJA 2WABA 3GMDA 3I9NA 1TEXA 3EMKA 3GUZA 3JXEA 5E3JA 1RJGA 2B8NA 2L19A 1CUFA 1CZOA 2YQZA 2X77A 1Z2EA 5DK4A 2IOHA 1E58A 2REOA 3QHPA 3TTXA 1E1DA 3FR7A 5TV2A 4LGYA 2QM3A 1DTSA 2EBUA 2YHIA 4NMLA 4RZHA 1XMVA 4M0KA 2C98A 3C3PA 1MVLA 5KWJA 2C4VA 2W6CX 5AMXA 3QWHA 3ECAA 2I76A 5E1DA 5KWVA 3UIEA 3NOQA 3A2MA 4FGWA 1L5WA 5FTNA 4OLBA 2AMLA 1S5PA 1NN1A 2BY4A 1L7EA 2WB4A 1DKUA 4M1EA 2UVPA 4Z3KA 3RU9A 3BJIC 4WLOA 4B0PA 3KQQA 4HQ0A 1DUVG 4UCQA 3NBMA 1F8YA 2H1RA 5IARA 2HLDD 4TN1A 3OCUA 1P1JA 1BWPA 2DTEA 4HWRA 4YJGB 4LWZA 1Y5RA 3NBKA 3DDCA 4PTLA 5E7JA 3TTTA 3NI2A 3VVMA 3QX7A 1ZA2A 3AY6A 1F6BA 3CGGA 4DC9A 2R4UA 4KJZA 3M4YA 3VDQA 4G23A 2XT0A 4MR9B 2I7XA 3VH4A 4JP3A 3AVQA 3ESBA 5JNUA 5HDBB 1LLCA 4WKCA 2WHPA 5JPDA 1RAIA 1M6HA 1MAUA 1KAGA 1RZUA 3FLAA 1M6WA 2PKYX 4TV9F 1PGOA 3F2IA 3ZZ0A 4JVNA 5E9WA 2Q07A 1HEUA 1LQUA 2WYOA 2GKSA 2LCQA 3U26A 1N1EA 1W4AA 3A0RB 1QFZA 3AHCA 1AGPA 3HP7A 3KJNA 1T4BA 4XGNA 5ES4B 5SY6A 1Q44A 3L6CA 2ZB4A 2IOFA 2JKZA 4KQGA 4EEZA 5AT1A 4AG3A 5IC5A 2YASA 2QX8A 4WVLA 1NNEA 4RPJA 1QGUB 1RJ9A 4G41A 4QU5A 4TV9B 5TS2A 2IV7A 3U3OA 4ARZA 4CWAA 2HSZA 3RIHA 1N6LA 2KLHA 1C80A 1N5IA 2WUGA 2X58A 1IBCA 3B1JA 1EHYA 3EDYA 4PS1A 4Z0NA 5CCDA 3UG6A 1S8AA 5JOQA 2RD2A 5HHTA 1K0UA 1TPZA 1JSRA 3OTOB 1PGJA 4NYMQ 5AVJA 4ASUD 1NV8A 1R12A 2IELA 2BN4A 5LSAA 2Y93A 4J1QA 3TGLA 1V5EA 1MNQA 4L5YA 3UMRA 5DVZA 1OF1A 1YS2X 1U3GA 3ID6C 4XZ3A 2JIZA 1U8UA 1T0PA 3CVOA 1QP0A 2R8EA 1LSSA 2ZW9A 4B46A 4RPLA 3PFWO 3IX7A 3QA3E 4KTVE 3T12A 4EG7A 2PL1A 1PVVA 3HA3A 5T3YA 4LJ9A 3DV0B 1HDGO 1E77A 2LPMA 1IXYA 7ABPA 1EWQA 1SKYB 1XD2B 2DE0X 2ZIGA 3CLKA 2CXPA 5BSMA 1N9GA 3C15C 2FRXA 1ZIDA 1DPGA 3EEOA 4TWJA 3K1ZA 3QU7A 4KPFC 3NOOA 2B20A 3NR2A 2FEKA 3NM5A 2ZUFA 4EGQA 4ITUA 4EVIA 1W85A 2VDQB 1QIDA 2H2WA 3W9YA 1DCMA 3GRZA 5AKGA 3TOXA 2ZR0A 5L6MB 4ZCPA 1JXAA 1M5UA 3V48A 2ERXA 3PLNA 2VZLA 1VCNA 5CB4A 1F38A 4I8IA 4CJXA 5BN4A 1ZM7A 4E33A 4MPJA 3L41A 4H3HB 1Y33E 2QU7A 2OK7A 3JQFC 4PAMA 4X1IA 1V2HE 2NU6A 4HEJA 4F7WA 4XM1A 2IS2A 4LXIA 4FR2A 1DELA 1AMUA 4HX2A 2FW7A 3SSMA 1PG0A 3S8EA 1YE5A 1QKKA 4IV8A 4CI0B 2EBFX 4RTJA 2ZZNA 3DAPA 3DT8A 2OGSA 2A78A 3EMDA 3LD9A 3UJ9A 1ESMA 1R6DA 4JVSB 2SBTA 1W2GA 4HDRA 2XB8A 1TTTA 1W1IA 5FOXA 4CKCA 2ZVQX 4BMYA 3E0XA 3OZSA 4TOIA 3MT7A 4EO9A 4DBZA 3FZEA 2JAUA 3HKBA 3FKSA 1HYHA 1V8DA 5FI0B 4BB9A 5HTOA 2B1IA 2AI3A 1B0ZA 3AESB 3H17A 3MOIA 3VU8A 2Z5FA 3KYBA 3HCCA 1KRXA 3VC7A 2IEZA 2NZWA 2R4QA 5EMMA 4RZIA 4X97A 1IUNA 5J59A 1TA4A 5IN4A 4D5EA 5IJ0B 4N6GA 3WXMA 3FDIA 1ULTA 2FZKA 4PZCA 2L82A 1X7XB 1ZM2A 2W48A 4FFBA 4K86A 4NULA 5HZGA 1PWZA 1NW4A 4KMMA 3E23A 1S9DA 2VPTA 4M8NE 3KOZA 2YIJA 4BVJA 2BWJA 4JDPA 1RKVA 1YT5A 1TCUA 2FQXA 2V7XA 2Q3LA 3BIOA 1JNYA 1FFHA 2P2ZA 1EWTA 4G1MB 3ZVRA 5MDHA 4I3GA 3GXBA 2NTEA 3CFYA 4YCNA 1PUXA 4KYUA 4YJHB 3CLUC 4BNDB 4YP5A 1Y5MA 3LPMA 2VH5R 3CUEF 3G9TA 2Q7XA 4IKPA 4G4IA 3FCXA 3EVBA 4G07A 5MGBA 2QVXX 4LOAA 5DPMA 1J8YF 4RYLA 5AI5A 5LWHA 2Z1DA 3DXZA 4MUMA 2Z3ZA 4XD7A 5J23A 4PWYA 1Z3CA 2Q49A 3HG7A 2CK3A 2BP7B 3DO6A 1LI7A 4B3HA 2QLFA 3EEFA 3N28A 1CR2A 5D1NA 3I83A 2R85A 3B1FA 4K46A 3PR3A 4OQQA 1GAXA 2BDEA 1GNRA 5GIOE 3TF5A 4CCSA 4IF4A 2GBGA 4RGYA 4U7FA 3OOWA 1CBUA 2J45A 5B6IA 5J5AA 4BEBA 3Q4GA 5EHQA 2EAUA 1LFAA 3FMPB 3PDUA 4L0QA 3LPDA 3SLKA 4A36A 1C1DA 5B58T 5HFNA 4A5OA 3RAEC 1ELOA 5IAKA 4P0TA 1CWUA 3MIIA 5DNEA 4D46A 2W6PA 2H18A 1Z6AA 4RACA 1E1QA 1U94A 5AP9A 4OY3A 2G40A 4X92A 3T3EA 1ORVA 4K26A 1PR0A 2I0FA 4JUCA 4NBVA 4R81A 3UYLA 3MMSA 1CQIB 1W34A 2AKYA 4O2BA 4D45A 4F85A 4HZUA 1OB5A 3F1LA 4JJAA 2JLSA 3K9QO 3ZU4A 4KXLA 4PC6A 2I99A 4MEAA 3WJ2A 4CI9A 3L82B 1TJPB 1GSAA 1DKPA 3SHTA 3SQMA 2G4VA 2ZLBA 4L9WA 5C8YF 1QP4A 4Q9KA 1DLIA 3BUSA 3LU1A 1VRCA 1GTVA 4EJ0A 1V5IA 3ZKWB 3EA5A 4RIHA 5JROA 2VUTA 4WKBA 4Q12A 5A7HA 4HQ6A 1ISJA 1Z75A 4M7WA 2B1QA 3EC2A 1ZH6A 4EY6A 1XZMA 3PR1A 1WE2A 5GZ6A 5F64A 5C8YB 2D5IA 1VE1A 2V96A 3HBFA 1QK3A 3FOWA 1F12A 2NTVA 1WPXA 1ZK4A 1M73E 3D8NA 3VVBA 3TECE 1H0KA 5EKUA 4TV8A 1T0JB 2R8PA 1U4OA 3TSYA 2P5YA 4GX5A 2C2MA 3LG2A 3E5MA 4M49A 2XDWA 4Q24A 1TM3E 5BW6B 3CNNA 3V8PA 4IJUA 3OOJA 3PUZA 4HUQA 4DWVA 2XODA 1UPBA 4RCZA 5K6AC 3ML1A 4GYYA 1VMAA 5JC8A 2W5UA 3ZC3A 1PT6A 5D7NA 5AKIA 2WWHA 2VCHA 5M29A 2WUFA 1HE2A 3MJ4A 4MR8A 4P2BA 1KJWA 3LW7A 1VXOA 4PGMA 4C6TA 2IIPA 1TVCA 3DYBA 3V1MA 4CMIB 2J67A 4C0BA 1RLJA 4IHJB 3S5JA 1NXSA 2QRPA 2AS0A 1P0PA 5REQA 3HM9A 1HE4A 5I8ZA 1LS6A 1RKUA 3T94A 4CL8A 3ZX4A 2EP5A 1U7ZA 3EEBA 3VKUA 1QIHA 2CC2A 2YWBA 2ZAMA 3IUPA 4N82A 4YAWA 3RRFA 3N59A 2RAFA 3SQWA 3ZGYA 1SZCA 1G0OA 4FEYA 1R0WA 4OYHA 1XHFA 4BDSA 4C0KA 3NKFA 3AKZA 2ZWMA 2NIPA 3H9UA 3FI0A 2H7XA 3G1UA 2BUBA 3TSWA 2CFSA 2IUYA 2OPBA 1NASA 4KRYA 4EX6A 4NZZA 1EXWA 2PQMA 3D2AA 1ACJA 3ZWOA 1VHLA 2B61A 2PUHA 3JQEA 3KKQA 4G8DA 3HCNA 4ND4A 4X66B 3CR8A 4LFBB 2P4UA 2OM2A 1IUPA 2FEWB 2HKIA 1LSJA 3A10A 3OMLA 1DJMA 1DJOA 1KZ1A 5ALLA 5EJ6A 3IT3A 2ECOA 1NF9A 5JY1A 1SUWA 4NAHA 5CNIA 3I9JA 1HYQA 1O94A 3PJFA 1E5DA 2WKQA 1AUXA 3VDNB 2Z09A 3DKIA 2ILTA 3TSOA 1C1XB 2IKSA 1IXZA 4FB5A 4EKYA 1KDZA 4Z9FA 1SUDA 3DOUA 2OESA 4LNAA 4NFLA 1TD1A 3HC7A 5BY2A 2PGNA 3CH4B 4L85A 4QPDA 4RFLA 1THZA 1YAHA 5JH7F 5JYBA 1TUBA 3PQDA 3QA9A 4WCVA 4BYMA 4L6AA 5EINA 4YMSA 5LNK6 3FNHA 1BW9A 2BKXA 4XVRA 1K4MA 3SVTA 5LC1A 2V7VA 1FTSA 1QIEA 3GJYA 1FDVA 5I01A 4D25A 2I87A 5C34B 2V7TA 1GD1O 3C6MA 4DCVA 2QN9A 2HF8A 3UAZA 3KSAC 1BX3A 1PW7A 3G7NA 4Y0NA 4Q02A 4MIOA 4FDVA 5JH7B 3HJRA 1RQNA 3QEJA 3HYTA 3N1UA 1K7YA 2CEKA 1QIKA 4C20A 3DVSX 1YHNA 1MFPA 4A6DA 3GN2A 2B4KA 3T3OA 1CZLA 2P3SA 4D6YA 3W79A 1JXQA 1MJGM 2EJCA 2VATA 3CNHA 4R2JA 2FWJA 3DB2A 2H00A 3QWIA 3TW8A 3WNZA 1UC5B 1G6KA 4MIYA 3ZCTA 5A5VA 5K0SA 3CIOA 4YLGA 1XRQA 3HCPA 1V4NA 3BJMA 5KNLA 3G6KA 2FUCA 1ODKA 3AUFA 1THMA 5DXJA 2HMSA 2I8CA 2HZBA 4GLLA 3I45A 4K81B 1JQKA 5DLPA 5FJIA 3Q9NA 3IAHA 1JKJA 4M6WA 4MIEA 1JU4A 2P2NA 4Q00A 1VKZA 2OHVA 1O4WA 1I2MA 5FNVA 3KWFA 1F3OA 4PY2A 1NRJB 2X2PA 1HDOA 4C4SA 2X14A 2J30A 5JHHB 3H11A 1L4NA 2DSTA 2WQ6A 2REBA 1MH9A 1TVMA 1PJRA 2WYVA 4PQEA 3L4SO 3ZGOA 3HQ4O 3K9NA 5A6VA 3L93A 3ETNA 4LHSA 3UWDA 2EKZA 4W99A 3MOSA 4D6XA 1A9RA 2V0GA 1AXGA 2EEZA 4AZVA 5TLSA 3PHJA 3W6OA 2W0SA 5EN4A 2HXGA 2RBEA 3DV2A 3L7CA 3MLEA 4OOFA 4TMVA 5TMDA 1IRXA 1LKZA 2DCUA 1I24A 4WA7A 3BGWA 4KK3A 4WY2A 1P9OA 2VHUA 4QYMA 4EI2A 1ZJYA 5FAKA 4W5RA 3KSDO 1P18A 1GYRA 1XFDA 3HUTA 1G3QA 3P0IA 1YRWA 4JBYA 4DPMA 2V3WA 2E9SA 3C24A 7MHTA 3BWCA 5EXPA 5DKFA 3HCOA 2NXEA 1Z08A 2OHGA 1KBOA 4TMXA 2HFKA 4PIPA 3NEPX 3QX8A 1A3CA 1GV1A 1QIGA 5BYJA 3ZH2A 2V4MA 2I7VA 2D2VA 4B3JA 2DSNA 2A58A 1LEHA 3P2EA 3R0VA 1A5AB 4WNYA 5F2OA 1FMFA 2LUOA 4NG4A 2R6GA 4JFRA 3D0OA 1E3EA 3GV0A 3WYAA 2R96A 1LZLA 1W75A 2H9YA 3L06A 2V5AA 3P45A 2DF8A 1OI7A 3E8XA 4P34A 4U2CA 3UJNA 4NEQA 1X86B 4GYKA 3S6JA 4YV7A 4HGPA 1K6EA 2GZSA 4CLOA 3NJ8A 1MD9A 3D3KA 1W8DA 3W4IA 3SNKA 3S27A 1M6NA 2F62A 2OFOA 3MCVA 3ULKA 2DT8A 2JZNA 4PGGA 8GPBA 1M2HA 3QQ5A 3GCGA 1IUKA 2NOAA 3KPJA 2O7RA 5F1KA 5FHRA 1H66A 4G5GA 3S0JA 1JKXA 4EFKA 1H1DA 2YZ7A 1Z7YA 4TYMA 3HE3A 4EMUA 4IXTA 2XUJA 2OAGA 3A6KA 3PXCX 1TA9A 1KJ8A 4ZOLF 4RZ2A 1N8KA 5D85A 2FETA 1KKLA 2R1UA 2WSSA 1F60A 2QRJA 1IJFA 4KE8A 2CXOA 1YCHA 1T6BY 1MC5A 1QG4A 4H4EA 4I7EA 1ONOA 3AUAA 4MLPA 4BC1A 2V55B 3WRXC 4EKEA 3GLGB 2CHVA 3IJ5A 4YTEA 1FSPA 1SG9A 4YO8A 1EP1B 3AVYA 4LNUA 3G9UA 4IXMA 4OL0A 3N86A 4ZOLB 1QVAA 2QL9A 3Q5DA 2Z4TA 1AUQA 1ZO8A 3O92A 4LFCB 3V4RA 1OVMA 2DAPA 4D4JA 2ACEA 3KLMX 4MQ5A 1SUPA 2BMDA 3BORA 5EE0A 3WQHA 4B8ZA 1PZNA 1SQSA 3JRWA 1QZZA 1PR2A 3DKPA 5HBGA 3WMRA 4E2FA 1GY8A 4Z9BA 4UCXA 1V3QE 2WJPA 2J9RA 1O5TA 2GERA 3K0HA 2PH3A 4LY9A 4JMPA 2Q5EA 4RWEA 4WZAE 5ULLA 2K7ZA 5ALYA 3D9QX 1RBQA 4LWOA 1E5VA 4N6NA 2ODQA 5AUPB 2H1HA 1GPH1 4ZZ2A 2DR3A 3IBCA 2I5PO 3LL7A 3WBJA 1PX2A 4C4ZA 4DMGA 3R24A 2CUZA 2A92A 2VAXA 4MQFB 1TQ6A 2E82A 3OLCX 5TX7A 5ALVA 4FT4A 1Z8FA 4NP6A 2C2XA 3VR2A 4IH1A 2XUIA 2GWHA 4X20B 4P08A 3VC3A 3LVFO 4LJ7A 1JT9A 1I13A 1WHSA 2N42A 2PYDA 5FUVA 4HJXA 4A2QA 5LYJA 4DLYA 4M0PA 4OKNA 3CWZA 3A1FA 3M4JA 4OEHA 3MWJA 5AK0A 1JYFA 1G8HA 5KX5F 5KOYA 1WSAA 3L7LA 4W5TA 1M34A 1FNBA 1XTTA 1J99A 4C0JA 4LJ4A 4YAOA 3UEOA 2YZMA 3T3GA 1KPHA 5EIBC 5GWXA 3KZKA 5A2QA 2FWNA 3D6AA 2NZYA 3DD1A 2NT4A 1YS9A 1G5FA 2RE8A 2QN3A 1U1CA 5LIPA 4YRJA 3K1YA 5FUWA 2FP3A 1G2IA 1S6YA 1UP7A 2IA5A 5KX5B 1EWVA 2FQWA 4UTOA 1OLUB 2GEDA 5DLYA 3VR5H 4OUDB 1Z4KA 5KYGA 4JH0A 3E1GA 3K1AA 5ALTA 1E0DA 4OA8A 3UKDA 4MQEA 1IUOA 3MS2A 5HYVA 1CUVA 1W6UA 4AS1A 3BFJA 3QBDA 4G09A 3FNRA 5C31A 3AGQA 1NJ2A 2O0JA 3DM9B 3HB1A 1S2IA 5LVAA 5TE9A 3TLBA 1R3DA 1RLTA 3PL1A 3TEJA 1ZSNA 3ORFA 1LLQA 2HRQA 1T2NA 2OSVA 2ZR7A 2HQBA 5BP7A 1BH6A 2BEUA 3KHUA 1D03A 2D6FA 1CF4A 4HN2A 1QX3A 1O0CA 2FPPA 4DC0A 4KHPB 4FDUA 3H83A 4FZJA 4A8HA 5EWJA 3B2NA 3FUXA 1S7GA 2RGNA 1B1AA 3QKIA 1P4AA 1ZI8A 4R3NA 2G0NA 4HF7A 1ORDA 1L8XA 5IBRA 4BMDA 2JFOA 2J6HA 3C6YA 2FR1A 2YWGA 4LKRA 5DBOA 4OHYA