2FQWA

Pnra from treponema pallidum as purified from e. coli (bound to inosine)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAEYVPSLSAFADENMGLVVACGSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAGKSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDSGVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKRADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSKEIVVPVRSARMMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PnrA (Tp0319; TmpC) lipoprotein represents a new family of bacterial purine nucleoside receptor encoded within an ATP-binding cassette (ABC)-like operon in Treponema pallidum
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Transport protein
molecule keywords Membrane lipoprotein tmpC
total genus 121
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02608 Bmp ABC transporter substrate-binding protein PnrA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqwA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fqwA02
1ZDMA 1SD5A 1P6QA 1U2PA 1U2QA 5EWJA 2LP4Y 4Z9AA 4RS3A 2CHFA 1J56A 5F64A 4LE2A 5TQ2A 3I42A 2M98A 3FFTA 1C0EA 2FMFA 3H5TA 3LUHA 3RVNA 3K9CA 4EYQA 2VUHB 5IC5A 2JVIA 3QEMB 4EVRA 2FEWB 1GUDA 4MS1B 2E4YA 1JH9A 1NATA 2VUIB 5IUNC 2PL1A 1ZY2A 3M9XA 1YVUA 7ABPA 5IUJC 1ZN2A 3KCNA 4D6YA 2KYRA 3SAJA 4Z9BA 5KWSA 1QP7A 3KSMA 1EWKA 4LE1A 3D02A 4PICA 3KTOA 3D8UA 3GT7A 3OLYA 3CHYA 2A9OA 2PUCA 4WWHA 3MA0A 3F6CA 3T38A 3KYIB 1JL3A 1DG9A 1LK0A 4HYEA 4MLCA 4O1IA 3QLUC 4IRXA 4TLLB 4NV3A 5T7BA 4WXMA 4S05A 3H5LA 2QZJA 1BA2A 5IEBA 3SM9A 1TJYA 3HS3A 5EWMA 3LTEA 3DBIA 4W5TA 1RZRA 4RY9A 4QYMA 1VPWA 1JF8A 4OATA 2IPMA 4RK5A 3LUAA 3CZ5A 9ABPA 1JHZA 4MRMB 1M5UA 1NXSA 2P9HA 1USGA 4G0YA 2ZAYA 1Z12A 1D5WA 3MM4A 1YK0A 4XXHA 4DQDA 2PUDA 4MAAA 2FLKA 2V0NA 1KRXA 3KHTA 4DN6A 4Z4FA 3GL9A 3OM0A 2NUBA 1ZAYA 3H5VA 1Z13A 1DRJA 3CKMA 3JVDA 4LDZA 6ABPA 4RDCA 5CNKA 1DCMA 1K66A 1ISRA 4RXTA 1PNTA 3IP5A 3H5OA 4EUKA 5KC8A 3N0WA 2WJWA 3CU5A 1Z15A 2GKGA 3DGEC 3EDCA 1MAVA 4OLAA 1M5TA 3URMA 3HV2A 1DCKA 1DBQA 4OTZA 3LUGA 1XWWA 1ISSA 2O20A 1FSPA 3TX6A 3R0JA 4B09A 3LUCA 3DLBA 2F8SA 2MYPA 1VKRA 4Y9TA 4N03A 3IP6A 2PKXA 2IOYA 4NICA 3GBVA 3NBMA 2FQXA 2FEPA 5DLEA 3BRSA 5IBQA 2PE5A 1NXXA 3G85A 3Q41A 1EAYA 1JBEA 3QLTA 1PUXA 1FFGA 3EGCA 3LOPA 4KZKA 4YP9A 4P1ZA 1Z26A 2CWDA 4GPAA 3N0RA 2ZWMA 3DZDA 3H1FA 1I3CA 3SY8A 3NNDA 4RKRA 1U04A 4IMJB 3LFTA 1D4ZA 4MYRA 4DADA 3C3MA 4HNSA 3A3KA 1JDPA 3H6HA 2MYUA 1ZGZA 4H60A 4JB2A 2FTKE 1F51E 3HDGA 3JVIA 4KV7A 3H1EA 3I5AA 2QVCA 4EVSA 2JBAA 1ABFA 3OQMA 2QVGA 2H0AA 3ILYA 3O2QB 4LE0A 5GQSA 1NXOA 5DTEA 2YHBA 3LUJA 4NCBA 3DGFC 3RVLA 1Z18A 3CS3A 2JVJA 1U0SY 2PUEA 2MYNA 4D74A 3KKEA 2RGYA 1JDNA 3N53A 1H9CA 1B00A 4UHKA 4YRZA 1BAPA 2JRLA 2LPMA 2B1JA 3FFXA 3P9YA 5BRAA 4LZLA 3QLVA 3HVRA 2WWVD 3LKBA 1YTUA 4H3HB 1T34A 2E4ZA 5C5EA 1GCGA 4MR9B 2RJOA 3LUFA 4IMIB 3QLUA 4ZMSA 1DP4A 1A2OA 3LUKA 3MYYA 4O1HA 2NZVG 4XFKA 1EWVA 4RSMA 4Z4GA 2HQOA 3NHMA 1JYFA 2QW1A 5KQLA 3KG2A 3ILHA 3HO1A 3IP7A 1TVMA 4W5RA 4F8JA 1Z16A 3JPWA 4YV7A 2ID9A 3G1WA 4LRQA 1BVHA 4MS3A 1QPZA 4RK6A 1GLGA 2M1ZA 4EGSA 3QK7A 2PMCA 3CFYA 3FGZA 4IILA 4G0ZA 1RXIA 2PL9A 3OQNA 5JS2A 1S8NA 1U8TA 2J48A 2CHEA 1DZ3A 2E4XA 3L49A 2JVKA 2E4VA 1ZVVA 1QO0D 2IKSA 1VLZA 1YIOA 2NT3A 4XASA 4IGAA 5KI6A 2FSPA 3T6KA 3QEMA 3EULA 4JASB 3HEBA 1R8JA 2N9UA 3HXMA 4ETMA 3RH0A 2HQBA 3F73A 4JOQA 5JNWA 3N0XA 3RVKA 2TMYA 1OXKB 3M9WA 5TQ0A 3RVMA 2QU7A 4ETNA 1KMIY 4ZPJA 2FQYA 5JS1A 4RZSA 4KQ9A 4ML3A 4MR9A 3BRQA 1QP4A 3LUDA 1PHRA 2PUGA 3E3MA 4N41A 4RV5A 4W5OA 1AB6A 3E61A 1NXVA 2L17A 2Q5CA 5JNRA 4MR7A 1YS6A 2X7XA 4Q7EA 5C5CA 2LBPA 3QELA 3H75A 1WETA 2IYNA 5TPZD 5KQGA 1APBA 2VK2A 3O1JC 4WXEA 4ZJPA 3CLKA 4WZZA 5DKFA 1BDHA 1SXHA 3O75A 1P2FA 3CRNA 2MSWA 1RPJA 4MQFB 3SG0A 3RVJA 5HSGA 3A0RB 1USIA 3DLHA 2QXYA 1E2BA 1DRKA 3QELB 2LIVA 3KS9A 2FMHA 3HM9A 3EJWA 2AYZA 3TB6A 1NTRA 8ABPA 1DCFA 3TMYA 4GNRA 4RY8A 2FEKA 3M6MD 3OMXA 3A0UA 4RK4A 4MR8B 2FN9A 4HNQA 4Z4EA 3BREA 3MF4A 1JFTA 4FE7A 4YLEA 2PAFA 1RXEA 1DBPA 1D1PA 3IPCA 3RVPA 5CNJA 2FMIA 4QICA 1L5ZA 3C3WA 3KYJB 3CZCA 1BDIA 2F8TA 4EYKA 4N0QA 3SQNA 3C97A 2P4UA 1ABEA 4JB0A 5FWYA 5TPZA 4MS1A 5JNTA 1MVOA 2PUAA 3NNNA 4YWHA 1LBHA 2B4AA 4N0PA 2QSJA 5IUKC 5BQ3A 1D1QA 2L18A 2MYTA 1ZGGA 4KMRA 4F11A 2IDMA 5PNTA 2HSGA 2ID7A 2L2QA 5KC9A 3F6PA 4MQEA 3HSYA 3KLNA 4FB4A 1JFSA 2R4QA 4CBVA 4G97A 2RJNA 3A10A 3H5WA 4RWEA 3OM1A 5KQPA 5B3JC 2HQRA 1JX6A 2WY2D 1SRRA 1QNLA 1TM2A 4RY0A 2PLNA 1NXPA 4O5AA 4Q6BA 3GWGA 4Z4HA 3JS5A 4MGEA 3TD9A 4MLDA 3GV0A 3CNBA 3EQ2A 3OO0A 4NCAA 2FQWA 4RK7A 4Z4IA 2E4WA 3N75A 1ZESA 4MS4B 2FLWA 3F7NA 1YK1A 3QX9A 1KGSA 1Y1LA 3Q9SA 5B3JA 1USKA 3O1IC 5BR1A 5ED4A 3I45A 3FMVA 4EYOA 4L4UA 4S04A 3IP9A 4OG2A 1DC7A 4KVFA 2QR3A 1P6UA 4TLMB 1GUBA 5T3YA 5IX8A 1MB0A 2PUBA 4KNYA 1NXTA 1JLKA 3O21A 4RK1A 5TPWB 3S99A 3HUTA 2FVYA 2MSLA 3EQZA 3OLXA 5FBHA 4KPYA 1JWLA 1PNRA 1M2EA 2A9QA 3T95A 5HKOA 1UDRA 4MPTA 2NZUG 4ZYLA 1XHEA 3RVOA 1FQWA 2PJUA 1LJUA 1FFSA 4RKQA 4MS3B 1P8AA 4KK4A 4MQEB 1YS7A 3MMNA 1E6KA 4QYWA 4RU1A 3RQIA 2A9PA 5FBKA 1PEYA 3QX8A 2JBAB 5IEJA 2PUFA 1XHFA 3HK2A 5JNSA 3IPAA 3HJFA 3RVQA 5I4CA 5CNIA 1EFAA 4WT7A 3C6QA 5D2CA 4UHJA 5TE9A 1KRWA 3OMWA 3C3KA 3T8YA 1M2FA 5FWYB 1Z2DA 3H5IA 4H3KB 1Z17A 2FW0A 3EODA 5HM6A 3H1GA 3HUUA 3L6UA 1E6MA 3BBLA 5CHYA 2JB9A 2I6FA 4PYRA 2OENG 3B2NA 1EWTA 3Q7TA 3ROTA 2GWRA 1ZH2A 3JPYA 1TLFA 2MSKA 1W25A 4Z4CA 3GA5A 2LUOA 3SNKA 2W42A 3O74A 3CG4A 2WMYA 1D2AA 3IDOA 3UK0A 1URPA 4RXUA 3RVSA 4G0MA 2JCGA 2GBPA 2R48A 4N47A 3UKJA 3K4HA 3LKVA 4YR7A 3N6VA 4KRFA 4Z0NA 1QP0A 5FWXB 4Z99A 4YGXB 1A0OA 3N8IA 4F12A 5JNUA 1NXWA 4JA2A 4Q6WA 3OQOA 2A9RA 4G0OA 1DBWA 3O1HB 5TPWA 3FDFA 4F06A 4E7OA 1LBIA 3NHZA 1OXBB 2RDMA 3FFWA 4TN5A 1K68A 1CEYA 4KQCA 4NQRA 5HQJA 1VRVA 2VYCA 3GRCA 3BILA 4G0QA 2FXIA 3OLVA 5ABPA 4YO7A 5TQJA 5EWMB 4PZ0A 4P98A 4MS4A 4G86A 4YCSA 1YMVA 2E4UA 4M88A 2R47A 4OLBA 5TQ2B 3QLVC 1IIBA 4RK0A 2WRZA 3JTEA 4MR8A 4EYGA 4W5NA 3KLOA 3VNAA 1LJLA 2OQRA 3OLWA 5EWLB 4PE5B 4KK3A 3MQ4A 3HDVA 3OO1A 3GBPA 4RXMA 2WB4A 1PEAA 3ROFA 2FN8A 1FFWA 2IPLA 1NY5A 3O2JA 4KFCA 1MIHA 5E3JA 4EY3A 5GOTA 4OBBA 3O2SB 2GX6A 2AYXA 3HCWA 3NNSA 3GYBA 3Q15C 2L19A 5CNMA 1A04A 1SXIA 3RVRA 3Q7SA 3W9SA 4F3TA 2IPNA 2QV0A 2HPHA 4LX8A 1C4WA 3H6GA 2GI4A 4IF4A 4XARA 3I09A 1E6LA 4JP1A 1EHCA 3VNBA 3QEKA 4WUTA 4N76A 4MR7B 1ZH4A 4TMYA 5DGCA 1QQAA 4KREA 1L5YA 1BDJA 5DCLA 5IULC 1HEYA 1DC8A 3KJXA 1ZHHA 4EVQA 2R25B 4W5QA 4MRMA 4D6XA 1SXGA 2DRIA 1TMYA 2FMKA 2JK1A 3JY6A 4XAQA 1YMUA 2FKAA 3UUGA 2BGGA 1QO0A 1RNLA 3TO5A 3EAFA 4G0PA 4HNRA 4PEVA 4YS6A 4E7PA 4MQFA 4FE4A 3Q7RA 1ZITA 3CTPA 3OLZA 3LMKA 2H3HA 1CYEA 5KQMA 1Z25A 1Z2EA 2WJAA 3MIZA 5EWJB 1QMPA 4LDAA 1QQBA 4JAVC 2HJ9A 2CD7A 6CHYA 4QPJC 4G0XA 5BRJA 1GCAA 1QKKA 5JNVA 1RZRD 3CG0A 4L85A 1F4VA 2XDYA 1DJMA 1CHNA 1W9HA 2IPAB 4ZMRA 1AB5A 1JFVA 2NT4A 1MB3A 2YHAA 3HZHA 4XLTA 1JYEA 5TQ0B 5FWXA 4ETIA 5EWLA
chains in the Genus database with same CATH superfamily
2NV0A 3MJDA 2FUG1 3H9QA 4OA5A 1P6QA 1U2PA 4C0SA 4ABTA 1ETHA 1OAOA 2P75A 2WV9A 1X0XA 4H1WA 1HQKA 4NONA 4N6NA 2B5OA 1V16A 1AQUA 2GOYA 2BCGY 1H0HA 1RWXA 1UJCA 1Z35A 3LUHA 2VP9A 3PX3A 4N49A 5ESDA 2IWRA 5A5VA 2Y0PA 1PW7A 6REQA 3TIIA 3AW8A 1N5RA 5HCIA 4NHEA 3GGSA 4JBWA 4LDJA 4LWZA 4D6PA 3OEEA 5A1TA 5BSUA 5IABA 3O8DA 1U7UA 2IVZA 3AI2A 3NVAA 1P7VA 2CXHA 3I0NA 4WE3A 2P6OA 1XD2B 1K8YB 2QA5A 2YY5A 4WNIA 3RRZA 3UV7A 5KWSA 4RFLA 4HQ0A 2BMEA 3PUIA 2G06A 1IIRA 1PGOA 3KKZA 3U17A 1UPUA 3M83A 2LXNA 1IHDA 1QFZA 2Z08A 3FTQA 2HWYA 3ZVKA 1O9BA 4FDTA 5K3EA 3B85A 4BO1A 1WUYA 5ILOA 5AHKA 2ZZMA 4R31A 1F5SA 2CZGA 4WCVA 1FXWA 4HDRA 3GRAA 3LHDA 4YDSA 3W4IA 3M4YA 1MPTA 1S2NA 1NASA 1X80A 1W0KA 4H7DA 2ACKA 4KE9A 4LRSB 2HB6A 2IPOA 4EGCB 2D59A 1W35A 3NDJA 3AHFA 5JMWA 3K0FA 4KBFA 5K05A 2EL7A 3W79A 3E5RA 2Y1FA 3CZ5A 4NMHA 2J33A 2Q3CA 4URHA 5TEVA 4YUXA 1MW9X 1C7QA 3GD5A 3GVXA 2DY0A 2G1UA 2OKGA 4M7OA 4BIIA 4JY7A 1KOLA 1O94C 1G3RA 1OVMA 2JLZA 3AM4A 1JILA 2AOWA 4H6XA 4IOJA 1GITA 4MW9A 4EW1A 3DOEA 2WTMA 2I7CA 1S8FA 4ND2A 3VHXA 3V1NA 3WLPA 4CKBA 5CXXA 4EY7A 1V2HE 4TUYA 3E8MA 4L4YA 1ZUNB 2WHEA 3SR4A 3IQDB 3KOUA 3UCEA 2A9VA 4KGDA 2BGRA 4BZZA 1Q0TA 3EEYA 3DGEC 3WLEA 4C20A 1QU2A 3RWBA 4Q9KA 2DFVA 4IIJA 4KCGA 1JLSA 4HVLA 5MFPA 1NXQA 1QKJA 1ISIA 5HVNA 3GG2A 1YR2A 2IHVA 3PQCA 4S1TA 1BOFA 2ZUUA 3O82A 1P5ZB 3I37X 3TX6A 4MVJI 1U4SA 4HAYA 1KYQA 2I1LA 2QE7A 2YHIA 3HB9A 2F8SA 2WHQA 4H4EA 3WICA 3PHCA 4S0ZA 4P3YA 4UFOA 2BMWA 5REQB 2EP5A 2O3UA 4MJLA 1A4XA 1R4NB 2RI0A 3NI2A 1TXGA 4TROA 5DGTA 3T12A 1E1CB 4TTPA 1W59A 2EWMA 1EGMB 2FHSA 4K9QA 4PQEA 5J47A 1REQA 2VAMA 2QUIA 4ESEA 5HRUA 2BISA 1GNVA 5D3ZA 5TS3A 4DLRA 2EBWA 2VDRB 2H48A 5LMNB 1BEZA 1NM5C 3A9SA 2UXBB 3RIMA 3ZBUA 4EA6A 3IQXA 4TMZA 3DG9A 2REOA 4Q3NA 1ZR2A 2BFOA 1NNSA 1KKMA 1G8GA 2EP7A 2P27A 5FUYA 1Q2UA 4JEIA 5F4ZA 4NCHA 4UHHA 3VR5A 1BGXT 2WUEA 1I2MA 4YRQA 4CQLB 3IJ5A 2CN1A 1XEFA 3HYNA 4XR9A 3BA1A 4Q18A 4CMBA 3KVVA 4HFRA 4Q02A 9GPBA 1QG0A 5JEEA 4J1QA 2JGFA 3DKKA 2WM3A 2FLVA 3MTAA 5IC6A 2JBAA 3CYFA 4BY9E 2FZ5A 4YXFA 1SA0B 4AYWA 1R6DA 1XXHB 2Q9UA 4FBLA 4KMOA 2NO1A 3O2QB 7ADHA 4F4CA 1NXOA 3TD2A 2RI1A 2Z95A 3AL3A 1ACJA 1Z18A 3L46A 3MCAA 2PUEA 4A4DA 1H42A 3NPAA 2FW8A 2ZR8A 1NJ1A 2HTEA 2VOEA 3NX4A 3FY4A 4R0NA 3U0BA 1Z8DA 3GQVA 4YRZA 1BAPA 3IJRA 5KQRA 2C8JA 1CHDA 3H5NA 3L5KA 2FW1A 1YBAA 3O8BA 4P4SB 3KYBA 4ZCSA 5JC8A 1Z34A 5MFZA 1NLMA 4RUKA 1T6XA 2ZRNA 4CTJA 1BYIA 4MR9B 2Y1DA 3LUFA 4DIKA 3FCUB 4IQ8A 3BGIA 2ZQZA 1AURA 1A2OA 1OT3A 1MQAA 4TLDA 5I7OA 2V96A 5AXAA 5K01A 4I1RA 4RKEA 3WLNA 4HX9A 5IT5A 5CD1A 5IXYA 1J90A 1HG0A 4FGJA 2X41A 3AJDA 4JT9A 4GR9A 5BOSB 4W7HA 1HURA 1SBTA 2OE2A 1TVMA 2W2NA 4F8JA 2QGNA 4H0CA 2ID9A 2HRCA 3K71B 5CK4A 3EZXA 3GRYA 2QTCA 3KSRA 3GJQA 5JT1A 3I62A 4GOND 4GPIB 3CFYA 4KSCA 4R1UA 1Q7TA 3CVJA 3K0FB 4NSNA 4RVFA 3UOAB 1QF7A 3M4ZA 5IDWA 3WMWA 4QDZA 1HLDA 1ONSA 1ZNQO 2R8ZA 3GHHA 3LC7O 4JLVA 3ICCA 2BL4A 3VNUA 3C3JA 4O4IA 3F3SA 4TYQA 4XOUA 1I7DA 1K08A 3NJ8A 1CZHA 4LOKA 2UYCA 5I8ZA 1QOQB 3KQMA 3RASA 3ZC3A 1S96A 3SICE 1J0EA 5BSWA 2P1DA 4R05A 2P8SA 1EE2A 2HCTA 1WWKA 2AI2A 5JIBA 1B2RA 2FAXA 1U8EA 1I7SB 3U60B 1H1TA 2VPWA 2VI5A 3R5XA 2WLSA 2Z5FA 3ETDA 1JA9A 2OK8A 2ZYRA 5K0CA 2OP0A 2RK6A 1K4KA 4X6YA 1G6OA 5CRIA 2OG2A 3QELA 4AD8A 2IYNA 3DXFA 3ISVA 4MEAA 5F21A 5C8VA 3C5VA 4LGYA 1E3WA 3FOEC 1DQZA 1FNSA 3E9QA 4HNGA 1UXOA 3L06A 4BASA 3HFGA 1JHRA 4EBFA 1KARA 2MSWA 2PL3A 4G4SO 5E8JA 2EWWA 3QG1A 5CA0B 1A4UA 3C6XA 3FRJA 3SF8B 3L8CA 5EC8A 2YN4A 4BLTA 1NZJA 3LM8A 2H08A 5T6MA 3U4QB 1RKBA 4R9SA 4FC7A 3DLIA 4YMWA 1YULA 2XMCA 3R20A 4JJFA 4HWPA 3NKVA 4YJ2F 1TVEA 3ZY3A 3DSRA 3G8CA 4QOJA 1M6YA 2Z2KA 3TMKA 5LJLA 2XCSB 3KOWA 1VSQA 2FEKA 3D4NA 3PF9A 5T41A 1GXSB 2HOQA 4LVCA 1TD9A 4IDGA 1O96B 1O3YA 4YBRA 3RU9A 1C4XA 1MN6A 4MO2A 1SCUB 1S2MA 3FZYA 1G5PA 2VRCD 4WFKA 3WFJA 5IPFA 1SGWA 2WIFA 3AWDA 4HAZA 1OB2A 4J94A 1NVDA 1RXEA 4ZZ2A 1K6IA 3RVPA 1AGXA 3MWEA 3RB8A 3NALA 1DNPA 1J97A 3U6KA 4LZPA 1IUNA 1L5ZA 2XRZA 3TQIA 2B82A 5LZ7A 4ZI7F 5J23A 1BDIA 2HU7A 2CYAA 4JI5B 2F8TA 1CY4A 4N0QA 4PLPA 1ZM2A 4W1PA 3QTLA 2NPIA 3HN6A 1FVFA 4LJKA 2JZNA 1OKKD 1CB7A 1BVRA 1C3XA 3ROQA 3ZHSA 2IUSA 2O1XA 2P9EA 1LBHA 3DR5A 3N0TA 4YWHA 1ZX1A 2QSJA 5BQ3A 1TVCA 1XZJA 3ZCSA 4FOPA 3OESA 2XXAA 1I13A 1UBJS 3E9DA 2SECE 4X66B 1BE0A 2CBXA 4FZ5A 2BH9A 1DV1A 2P9JA 3E27A 3QPDA 4JD5A 4LJ6A 4PC2A 4BNMA 4X3PA 5EIFA 1JAIA 1NVMB 2X9GA 3QVOA 3ZDDA 3ZCVA 5L51A 2AVNA 4LHEA 4ES6A 2ZLBA 4XEUA 3GDHA 2RHBA 2QEQA 4KUEA 2R7NA 1CFZA 3MJHA 5DU2A 3I39X 4RIHA 4X65B 5H68A 5CYPA 3U9SA 5HR5A 1JHMA 3U49A 1SRRA 5CVCA 3DTYA 3WGIA 3NETA 4KFSA 3A32A 1Z22A 3OE1A 4P35A 5EXEA 1C50A 2PLNA 3G1UA 4A15A 4XUCA 4HATA 1AS3A 1U3FA 1P61B 2PWPA 3WP0A 4A2PA 1Y48E 2ZB3A 3L4JA 4O33A 3R5HA 4G25A 4RZHA 4WOPA 4FXOA 1SKAA 1R88A 1XPUA 4KE8A 5AKXA 4L74A 1GO2A 2C1ZA 3S1AB 1M34A 3PCXA 1NHGA 4IMRA 3PQ7A 1UXJA 3VSAA 1V8FA 2GVNA 1D6SA 3O1IC 4M36A 4LF8B 2ZIWB 4L95C 1P17A 4URYR 1X92A 3G9TA 3L8EA 2QJWA 4Y7DA 4EY8A 4ZI3A 1GZ7A 5J2TA 1LGYA 1U1DA 5T3YA 3GFVA 2E18A 3PPYA 1OIVA 3R0VA 4RY2A 3ESXA 1JZTA 4EQ6B 3KR1A 1NSYA 3O03A 4OQMA 1EGQA 1AXGA 4RLHA 4UULA 4N3CA 2QRMA 4FGWA 3VO8A 1EUYA 3G2JA 1W0KD 1IDN1 2J45A 3KE8A 4JI1B 1JWLA 4MPTA 1ZMOA 3WMRA 5EMNA 5IAEA 2NZ2A 3DNPA 3MTEA 1W7AA 4DNQA 1CS0A 4QYWA 3GLUA 4KYVA 3AL0C 3FCCA 1JG7A 3A05A 4PLHA 1ZUNA 4KIFA 1KYXA 1YIDA 3HJFA 4I6EA 1QRUA 2BN4A 2V3VA 1EFAA 2IUEA 1JDJA 1F4PA 1M1NB 1YDEA 1AH2A 3ZWYA 4ASUD 1EFUA 2R1VB 2ZJ5A 3BHIA 4H1TA 4MUMA 4AULA 4CLOA 3A26A 1J1UA 1XMXA 1E4OA 1SVKA 5DTIA 2QUZA 3ROTA 2GWRA 3BJZA 1RHQA 4MO9A 2ECFA 4IIJB 2XUGA 3AB7A 1BX1A 2PMDA 5EZYB 2WMYA 2XD4A 2ADMA 3UTDA 1MRZA 2AN3A 3N9IA 3UYLA 5F9MA 1BMFA 2NG1A 3WLIA 5JSZA 4GI5A 5CT8A 4L6IA 4KRFA 2WC1A 1XQVA 1ZQ9A 1BD3A 3QE2A 3PPXA 2WJZB 1YFZA 3A37A 1EDEA 1C1XB 1W5EA 3WVNA 1C4KA 4DT1A 2OCGA 1C7JA 2P7IA 3CRMA 5KPJA 1AGNA 2CVPA 4RKYA 4QEZA 4Q01A 1U28C 2QRZA 1VCNA 3FPFA 4IH4A 4M8NE 1OXBB 4RDIA 3CUTA 5FPQA 2DUMA 3QMPA 4MV8A 3GX1A 3TPFA 1AQNA 4DV6B 1XNGA 1HPLA 3ABZA 4J8PA 4PAMA 2HL6A 3GF4A 1P4JA 4GWKA 4RA9B 5HQJA 3U3OA 1XD8A 1KVTA 2J3JA 3BILA 4Q66C 1T5SA 3WB9A 1GGNA 3FTFA 2GZ3A 1XXHA 2IIBA 1NRXA 2ZVPX 3KPUA 1FNMA 1TMKA 1XE3A 1Z0SA 2GMWA 1LDNA 3H1BA 2AGVA 3VA7A 5IAJA 3TLMA 2GFHA 4LV6A 2CDCA 5AKHA 2AE1A 2X1HA 1SELA 1VE5A 3QLVC 3ZEAA 2Q3EA 4MUHA 2ERXA 3DE2X 5D5PA 1FP7A 4UBMA 2WRZA 5AJWA 3CB2A 1TDJA 1EDZA 4FGSA 3CEHA 4LXYA 1LSUA 5F2OA 3RCBA 1T0IA 5KTKA 3BC1A 4UMEA 3K70D 5J2UB 2NPFA 1T5DX 2AQHA 1V3UA 1TA0A 3OO1A 1ISGA 2YZGA 3PL5A 1PEAA 1S0UA 1Z47A 3QVKA 3SSAA 1NHWA 2DEUA 1ZD1A 4CODB 2YVLA 3OUUA 3O3NB 5FL7D 2FW6A 3RRNA 4F91B 5KNCH 4LBWA 4JLPA 3TVTA 4I8DA 3NOQA 5HWSA 3U61B 1TD1A 3LKZA 4MRVA 4DPMA 3SQLA 3OUTA 3EXIA 5CNMA 3LNCA 1PYGA 3PGLA 4EUEA 3AO0B 5A5GA 5GM1A 2QV0A 1EVLA 1SRQA 3FFAA 2GI4A 4IF4A 4LX8A 3IEUA 4A0RA 3I09A 2WQ7A 1FSGA 4GM1A 5I47A 3ZEIA 1ID8A 2C2GA 3NHUA 4PRKA 2RHJA 3DZBA 4E2YA 3IOEA 4K86A 1J7KA 1Z7GA 5CEEA 1E2LA 3DD5A 3EWAA 1JI3A 4GGMX 4KAJA 3G0DA 3ZV4A 2H6EA 2W00A 3P9ZA 4BMNA 5FPYA 3ZGYA 3LY8A 3KZXA 4GH5A 1HEYA 3GFTA 4CEIA 1CV2A 2VUUA 3A3OA 1TMYA 1LLQA 3H2BA 4XAQA 1QAQA 5A2QA 4GICA 3UUGA 4CIXA 2H7CA 4ZT6A 1RXYA 1QCYA 1KYIA 2ON6A 4B0OA 3LPNA 1HDIA 2JEOA 4IZ6A 4R7ZA 3W6UA 2QUKA 2YS7A 4GS5A 2IELA 3WB0A 4PCVA 1OHHD 2NSJA 2YMMA 1RWBA 3AFIA 1GD1O 3KOMA 2VZ9A 4TQGA 2GAOA 2WM9B 1DIGA 2Q45A 1JXQA 1SC6A 3UHJA 4CM6A 2CXPA 1M2VB 2IYFA 1DJQA 5FH9A 3I9OA 1YKSA 2YV2A 4LHWA 4CWAA 4JHXA 2H59A 3FOCA 3M49A 2ODBA 1GN8A 1U3WA 5A3SA 3TKAA 1SD5A 1VBKA 2ZRPA 1UJNA 1TJ5A 4KQ6A 4GGPA 5LJIA 2BDTA 3CE9A 1X1RA 4V0SA 4RS3A 2VTBB 5G53C 1Z73A 2HDWA 3PEFA 4BP8A 4KR9A 3GLGB 3DCJA 3M6AA 4UBKA 1NQXA 2R8RA 2VXYA 4B17A 3BORA 3OEWA 5ALDA 4KQXA 2F1RA 1CF2O 1U7ZA 2FQ1A 1N3LA 5HHTA 1TZKA 3PDIA 1ZNYA 3P9SA 4BJ3A 2XCRB 4PSVA 2B8NA 4NDNE 2HY7A 2YHUA 4DM4A 5CFQA 2BFEA 2XADA 3CWCA 4ZC8A 3NB0A 4G23A 4LMPA 5KOIA 4ZN6A 2W6CX 4R1SA 1GA6A 4EI8A 4HAOA 2G70A 3EFBA 3P0IA 2X8BA 1U0BB 1FP4B 3KTOA 3LU1A 1YVEI 2HRDA 3C8ZA 3MCUA 4QVGA 2ZI4A 4AT1A 2FSHA 3D5TA 5L9AA 2PUCA 1EQUA 1M74A 4AN1A 3U37A 4DYVA 1ADJA 1OV6A 1EKXA 5ISMA 4PLCA 3K6RA 1CUBA 3FZQA 4O1IA 4IRXA 2OXFA 1X0VA 1XTSA 1DI0A 3O8NA 4IH9A 3QXXA 1SXJD 2OAEA 1GIAA 3QUSA 3S40A 3VDXA 4YDQA 2P6RA 2NTYC 4TT3D 3M1YA 5FX2A 1L4FA 2PAAA 4O4JB 3UXYA 4WY5A 4B75A 3VPAA 3SC2B 4TV8F 1TT5A 2B98A 2XZDA 3CUKA 1NXSA 3EZ9A 3F4KA 4EHAA 1G38A 3TF5A 1L5MA 3VKHA 2J9GA 2C2BA 1QWOA 4DV5B 3ED5A 3ZYCA 4RAQA 4B76A 4H17A 4GPZA 3U56A 2NUBA 4BN4A 3BH7A 4DMRA 4Z0PA 1TGVA 4CKZA 1LV8A 5J2TF 3FMFA 3QPCA 4XJXA 1VMKA 1BDMA 1TUEA 1DAHA 4GBMA 4DNFA 5KO2A 4CT5A 4YRMA 1ZR4A 2ZREA 3JZMA 4HQKA 3BSYA 4L9AA 1ZCJA 4QGBA 3R6LA 4MKIA 4D5EA 5LA6F 3S81A 2WDZA 3B20A 2FMXA 1I10A 3D5QA 8ATCA 3QV1A 1TIBA 1IHPA 2M6RA 2W6IA 2DCMA 5DOVA 3ZWWA 4MWZA 2H7VA 1E79A 1BA3A 5FOTA 3X1JA 5DX8A 4C7VA 2X4IA 3E05A 4HAVA 4IOLA 4URVR 3B82A 3DKIA 3FTDA 3EMDA 3GC6A 3TJMA 1N33B 4JYMA 1UPBA 1H8EA 3AT1A 3HO8A 1ZXXA 1AD2A 2XZTA 4GEGA 2QTNA 2NMVA 2DE0X 1YJBA 4P0PB 2OFOA 3J80A 5EJ6A 3ZVRA 2POCA 4LJLA 3INTA 1VCIA 2ZQ5A 1ZK4A 1LPAB 5KSPA 5K6RA 3DCNA 2DPXA 2WPDA 4JLAA 4XIIA 4JUFA 1D0SA 3I1IA 2WWWA 1Z6QA 4JI3B 3DYVA 4AZVA 3RIGA 1FNBA 1K97A 4R6WA 1GP2A 4DMUB 1UZUA 3UJNA 1J49A 3BIFA 2RGRA 2VP4A 3GPLA 4OF4A 2IU3A 3C8HA 2VYNA 3NEYA 4LAFA 4BXOB 3A9VA 3NG1A 1LZKA 1O57A 3W2HA 1VMAA 1GWNA 4X1OA 3B53X 1XL1A 4BFCA 3GLKA 5KIAA 1P91A 2H9AA 2WYIA 3CVXA 3H1EA 3FNRA 2WJYA 2GT1A 1MDBA 1DTEA 1YI0A 1BW9B 4Q7MB 1XRNA 1HDCA 4W8GA 4ZVPA 3KUXA 1E0JA 1GR0A 1QHHB 2I78A 4R7GA 2JLUA 4NCBA 2BFMA 3X1KA 1MKYA 3D2AA 1PL7A 1DRUA 4JQSA 1XQ6A 5E2IA 1GYPA 2HKIA 3ZHYA 4ILEA 4FHGA 4BN0A 4M99A 3U4HA 1P72A 4B3CA 4PX9A 3KTAA 1CIJA 1KI6A 3NGMA 2GTIA 1UANA 1HUQA 1YB2A 3EC1A 4MYCA 5K0FA 1A7JA 3LKBA 4J0KA 2AXPA 3OZ7A 3ADBA 2DYKA 4IOMA 3REQA 1TCUA 3MGGA 2R86A 1OAKA 1X13A 3GNLA 4Q7JB 1CBUA 1UBHS 4BV3A 3K5HA 2Q99A 3IRUA 5KNLA 2AMVA 2H5LA 4RSMA 5HZMA 1QJ4A 3N8HA 4LHZA 1NV9A 2PSSA 3BSWA 4OK6A 3JRXA 1NGSA 1YH3A 4P80A 3NWOA 4R54A 3ZXSA 1GPBA 3QXHA 3VH3A 5B6JA 1S3IA 1DOHA 1SN7A 2P9FA 3FNHA 3KKKA 4X8OA 4B82A 2BWJA 5JG7A 1N1GA 1QONA 2R6FA 3TAXA 3LPCA 1A82A 5F5LA 2CE7A 1PAUA 2OAQ1 4BO7A 5JH7F 5DLPA 4CM9A 1GLGA 4I5IA 2GRAA 3A06A 4MVJH 1P62B 3L7CA 4O4HF 4COKA 5AVRA 3DEFA 5JSUA 1EJ6A 1PR6A 2H4FA 4IILA 2C78A 1TUBB 2QJRA 3QX7A 2XDQA 4G0ZA 3CO0S 4DBVO 1OZHA 4KR3A 1YR9A 7MHTA 3DZKA 1UFKA 3L49A 4NJMB 3L2OB 1I51A 2EV9A 2QF7A 3UAXA 5T4EA 1G7SA 2OO7A 1ZIPA 2PO5A 2WVAA 4XASA 1LS1A 1JJFA 3MD9A 1XELA 4C0WA 2VXOA 4R2XA 5I7SA 2Z2JA 3QEMA 5BT9A 2BV3A 5LYJF 4DVJA 4OD0A 2B1QA 4CHTA 4I4TB 4X7PA 1T5IA 5J3JA 2AS0A 3DYIA 4CV2A 1GAJA 1CTQA 1SQFA 3UPDA 4MICA 3CKYA 4BVEA 4OP1A 4R3WA 1C3VA 1EB9A 1HDXA 4PCLA 4RZSA 4M1WA 4EW6A 3WLQA 3ZK9A 1ZJZA 3D8RA 4GYJA 2D1TA 4YJFA 4HMOA 1WA5A 2Y66A 4Q7EA 3M7IA 1JR3A 3H75A 1WU8A 4QQNA 5KQGA 3T5MA 2DQ4A 5IG2A 2G77B 3O1JC 1JAXA 3HTXA 4IDPA 2OV2A 4OI2A 1FFHA 1PDOA 2C0CA 2C9MA 3ANLA 3F7MA 4H35A 5EEHA 1WE2A 1Y42X 1RPJA 2CNWA 1P5RA 3R3VA 4OXYA 3D1VA 4IVNA 1XYGA 3TFQA 1USIA 5AJVB 3V46A 1G5FA 3QBTA 2FP3A 1DRKA 5JW6A 4V0NA 4O63O 3HM9A 3HCCA 1OWOA 4GUAA 4CV1A 1A1VA 2FVXA 2UKDA 5IANA 1YKGA 2ZVJA 5DGDA 3DEIA 4BLRA 3NATA 4WK4B 1KMQA 1RU3A 2FSVC 3MUFA 1M2OA 4X8LA 3MBKA 4HNQA 2Q2NA 2O19A 2FN3A 3KOZA 3CZMA 2GDZA 1E64A 2GYVA 2QM7A 2X4DA 1NJ6A 4QE3A 2YV1A 3Q8WA 1CEEA 2PAFA 3K09A 3ZZTA 3B3GA 1PJSA 3ZOZA 3JAKB 5KNCD 1KSJA 1JHXA 1YHYA 2JHAA 5THXA 3WMGA 5JYDA 4LWQA 3U0VA 3JZDA 1KR5A 2P2DA 4M76B 1B74A 3AF3A 5KVQA 4PWZA 5FUXA 3ZDFA 1TYDE 1PGJA 3IBCA 4QELA 1CWUA 2F1OA 2H2IA 2H2WA 4M3NA 4NS1A 4UKDA 3CGWA 2MTBA 2AG5A 3FGOA 1GM5A 3JQAA 5J9FA 1T3GA 3RIHA 3VYUB 5KNBH 3CLSC 1Z08A 4OI1A 4JOBA 1H3NA 3H97A 2D2IA 3JVUA 3NT4A 5CLIA 2DTDA 4QTYA 4G0UA 3PJRA 2VRWA 3KL4A 1SVUA 3JYLA 3FUCA 2AOUB 5HF6A 2PH7A 3C0KA 1G98A 1RWNA 2QXTA 2VJMA 4CMCA 3OM1A 3NYQA 2IEBA 3P45A 4RAOA 1ZN8A 2HJHA 3NRCA 2JLQA 4WERA 3RC3A 2ST1A 1QNLA 2JGAA 4CLRA 3X3HA 3CPEA 3VO2A 1L4BA 2CUZA 2MMCA 3GRKA 4JB8A 4JDUA 4QA9A 1LLFA 5AT1A 3GGCA 3RT9A 2C4TA 3UGQA 4F3NA 1E3QA 4J4TA 2DFDA 3F9CA 4HSGA 5CAEB 4DL9A 3OO0A 2XRYA 2AWNA 2RIPA 2FI1A 5F1OA 4AL4A 3SIXA 5JJBA 4D26A 1ZESA 4PLYA 3NAQA 2PTGA 4CG3A 1Z4NA 1YRHA 3ZZNA 4OJYA 1S4MA 1O4WA 1ZIOA 3F3YA 4G4GA 2BTQA 1B6GA 2ENWA 2QN8A 3UK1A 4EYOA 1M8JA 5EZYA 2VPPA 3INRA 4ZAZA 1EFCA 1JEQA 2I4OA 2NTEA 4JBNA 4BOYA 4IEIA 1GUBA 4PWYA 2QAIA 1XLWA 5JYCA 1DWUA 1EFDN 2ANCA 4HQFA 4MB2A 2HA7A 3TW6A 3WGLA 4F9EA 3VTZA 1RRVA 5BN5A 3FKSD 3T4XA 2FE1A 1TT7A 4QPZA 5FBHA 1KQOA 2A0UA 5A1JA 2PNJA 4TMVA 5TNXA 3T95A 4MV0A 1OMOA 4H16A 3UJ9A 2OHXA 3ETEA 3GZTB 2E85A 3DEJA 3SLRA 3NWBA 1P8AA 1YR3A 2VJBA 4RU1A 3TH5A 1E6KA 1Z83A 3UK7A 2WR8A 2LVBA 1GU1A 2RHCA 3LWBA 1P9WA 3WHKA 1XHFA 4U9UA 4LF7B 1JHVA 3PC8A 3HK2A 1Z5UA 1V1RA 2EKPA 2IDKA 2OHVA 1CQJB 3KDSE 2PUWA 5KU1A 5L3SB 2HLHA 1G8KA 2JI6A 4GYWA 4LVOA 4ZQEA 4LWPA 3SSMA 3T8YA 3RC8A 3QVTA 4NI5A 3O9VA 2JGIA 1PT6A 1JHDA 4HNAB 4Z86A 3PEYA 4L5BA 4BMXA 4QSMA 1CDEA 2UUAB 3KSDO 4J1TC 3Q7TA 3RS5A 1WZIA 3D6HA 3OICA 2DPYA 3TM4A 2VBIA 3ISJA 4C01A 3ANTA 5ER9A 5I6DA 1YOBA 3VH1A 1HK7A 1J42A 4UTZA 4HRAA 3K9FC 3EIEA 1URPA 3QU9A 4TPKA 4URFA 4U2EA 4I46A 3UKJA 3EGWA 3TXAA 3K32A 4QRDA 1H05A 2NTNA 1ZK2A 1GL6A 3N6VA 3OA0A 2I76A 4U1RA 1XMJA 2XUZA 2VCHA 2QG6A 1THGA 3FTNA 1YZFA 4P3OA 5DK4A 3OJFA 1KPIA 4FCVA 2E21A 4OUDB 4Q0MA 5E7MA 4ZI5A 1GL9B 4IUYA 4PYIA 1XA3A 4QQ8A 4I55A 4WOCA 3H2YA 4DDMA 1UZAA 2IHJA 4BXOA 1E94E 1VGRA 3KDAA 1JNXX 4FFOA 4KX3A 4OLFA 1X7WB 2ZPAA 1DINA 3BXXA 3SHVA 5LP6A 2JJYA 3F47A 2C3YA 4NZOA 3RSFA 1KMMA 3JQFA 5CDFE 2NU8A 1AU9A 1WZUA 3LC2O 2FXIA 1ND5A 3EZGA 2UZ1A 5H70A 3OZCA 2FR0A 1K5PA 1N5KA 1KVUA 4L9WA 4X60A 1P9OA 4PG7A 2IUUA 3WV5A 5B58C 2JFBA 3JSAA 1AJEA 4NBWA 1D9ZA 3KZNA 2I7TA 1QLHA 1QVWA 1M0TA 4WHMA 3PD7A 3ASVA 3MW8A 2H3EA 4N6OA 4E12A 3KLOA 1JIKA 2GPSA 2HRBA 2VNAA 4ZQHA 5GZ1A 4ZHQB 5ESRA 4KDEA 1XR3A 4KQWA 5JAIA 1N3IA 4PE5B 4LQ4A 1CF9A 3TPCA 1FW6A 3BD7A 5LYJA 1NRJB 1TAGA 3NTQA 1NY5A 1UKEA 2O0KA 3V8PA 4B47A 5E3JA 2V1XA 2JKZA 2VWPA 3CURA 4C89A 1T4DA 1J09A 1UF9A 2FZEA 2VQEB 1V5IA 1JALA 1HI9A 2CHGA 2IHNA 2X0IA 3ZGLA 2B9EA 2XA2A 3HCWA 5M3BA 4BKUA 5B7QA 1RZUA 2DTXA 2G0AA 2RKBA 3GXOA 3Q7SA 3W8EA 3S27A 3GEDA 1NV8A 3AQIA 5K3AA 1TYEB 1CFJA 1VTKA 1ZD3A 3IXLA 4FUQA 4IAOA 8ADHA 1M34B 3F8TA 1UPTA 2IBMA 1HF3A 3PQ4A 3RTBA 2QRKA 2X40A 3U39A 4IGEA 1SO8A 3QEKA 4KVZA 1MJFA 4MIYA 2VJKA 4KREA 2P35A 3KQVA 5LD2C 1UZMA 4OQFA 3OEYA 5EGSA 4ENVA 2PIDA 3NVKI 1N5MA 1GG9A 1T9GR 2C9BA 2IZ0A 2R6JA 1V8DA 5C1IA 4PC1A 5KWEA 1IY2A 3RYIB 2X15A 1B8OA 2WINI 3I04A 5HQ3A 3AIOA 1VCHA 3COZA 4FE4A 4MQFA 5I9NA 1J06A 2FZLA 3HCNA 4GLFA 4HDKB 2ZBUA 5CLGA 1T9BA 1BE8A 4IDQA 3FR7A 3USZA 1FPMA 4DPKA 2LE0A 3DMNA 2EEZA 3EVDA 1ZI8A 1E9VA 5JWHA 4FLMA 2BR4A 4O8CA 2V9ZA 1F4VA 1EFTA 3FVVA 4J0GA 1N57A 3QOWA 4M37A 3J81A 2QORA 2OC4A 4L7QA 1IOLA 1CE8B 4YJFB 2CFRA 4WY2A 5FWXA 1N2BA 4ZD6A 5DNYB 3GOQA 5AM2A 5HRCA 4C0JA 4EJ6A 3GDWA 1T3TA 4S12A 1XZPA 4E30A 3CIFA 2VJOA 1J20A 3IUMA 1FDRA 3R74A 3U4IA 4ME6A 3COPA 1SA0A 1XTBA 3LF2A 1QFYA 3AILA 3R09A 1BHQ1 2FMFA 2YJGA 2XQGA 2HV9A 3NANA 1KJNA 3A7DA 1M66A 4NECA 3RVNA 3L77A 4IGIA 1ONPA 4O4LB 3ZDQA 1K9VF 3TQCA 1FMJA 2BFFB 1O77A 3RHSA 4MWBA 2FPLA 4XLLA 2XQKA 3AMVA 3T7CA 3UMRA 4RMHA 4DJFC 4C2AA 4QUIA 5EINA 1K63A 4M4SA 4MGYR 1ZLXA 5BSFA 2ZS7A 1NW8A 4GMKA 2F9LA 3KCNA 3Q3CA 4FMCF 2X1LA 4KAAA 4XB1A 4O0MA 5EIOA 3V7YA 2J30A 4G4SP 4Y9UA 1XVAA 4CFSA 1C0IA 4PICA 3RS0A 3OLYA 3ODPA 5JROA 3GLTA 2GAAA 5AVWA 4E6PA 4RGYA 5EFOA 1LK0A 1YXMA 4O59O 4RPLA 3DH0A 5DM2A 3S44A 4TLLB 1Q0RA 1WIWA 4NV3A 4ENUA 4G0NA 4BVKA 3K6KA 1KZYC 4S05A 1RI5A 2QZJA 4J29A 2Z04A 1WY7A 1RI4A 4L3OA 1M8FA 1LBSA 4FMDB 2VQFB 1RZRA 2DERA 1ULSA 1P6XA 4MGHA 4OK5A 1GTL1 1X3LA 2NZWA 3K16A 1DC5A 2RH5A 2UAGA 3M4NA 3LH5A 4FC6A 4MRMB 4V0KA 4ZO6A 5TF0A 3ROGA 3UWPA 2CF5A 2J9FB 3JD0A 1P8JA 3SYKA 4DYHA 5AW3A 1TKRA 3W8RA 2R79A 3NFYA 4BLUA 3OFJA 3VGPA 4GI1A 3GRVA 1Q1ZA 2NVWA 3K70B 4LZOA 3FJ1A 4FFSA 4D8YA 4ZDKA 1GN9A 1UEXC 1V3VA 2C98A 3G0BA 1YCGA 3D4BA 3R24A 5FRDA 4IG4A 2JHFA 2Z3VA 3CKMA 3SVTA 5D6OA 3AUTA 4UTNA 3GLIE 1K8RA 1H5UA 3HJHA 4RPGA 1K0FA 4E13A 4RXTA 4BO6A 2H7YA 3OG9A 2CV1A 2NXEA 1U2GC 2QTBA 2W6ID 4X6UA 5HG0A 4Q3CA 4ENSA 1HEIA 1I32A 1PVDA 1XDWA 1WMDA 3AINA 3MWJA 4QO8A 3UA4A 3VR0A 3K9WA 3GDOA 3AHJA 4I19A 2ZRBA 1JHYA 2J7PA 5EQTA 3DMHA 4IX9A 1BROA 1EE9A 1VA5A 1GRVA 1Y4DE 2VJMB 3KQQA 4HFJA 4OP3A 3SX4A 2A78A 5H59A 2CLSA 2OT3B 3MAGA 1KI1A 4IIBA 1PU2A 3Q1KA 4Q7LA 2NVBA 1M8PA 1ZC3A 3AJAA 5EJMA 3K8ZA 2R44A 3E2PA 3IOBA 1H2AS 3AUKA 3BWBA 3RS8A 1ATZA 2P6NA 4RNDB 1BG6A 5EVJA 2QTFA 5H80A 4IJMA 5LXTF 1Z3IX 4Y9SA 2W2KA 3LOPA 1ZM9A 2PBZA 3DJFA 4JL5A 1Z26A 4P1ZA 4P9NA 1TJNA 2TMDA 3GEIA 4RX1A 4WK6A 5BN5B 4OHOA 4ALKA 5JFGA 2ZSKA 1EXMA 1GTMA 1RS0A 1TKCA 3BEDA 3QYFA 2YVAA 1YBMA 4WBNB 4B6GA 1IHUA 4ARAA 2JGNA 4IZHA 3ZWVA 5HBGA 4O4IF 4QU9A 4DCJA 4W9NA 1YZLA 1YDHA 4FI3F 4POAA 1H2XA 2I9KA 1G6KA 1SHUX 1Q16A 1P3JA 2VNIA 3L01A 3PQFA 4R9NA 1YRYE 1IQUA 2X76A 3FYUA 4BO0A 5IARA 4BQQA 5A0FA 2I2WA 2VAPA 3QBJA 3S2YA 5MGNA 3GLHB 3F49S 3R3UA 2HHJA 3DULA 2VHWA 1KZ6A 1U7DA 3B6KA 1P60A 3DYBA 1OH7A 3F8WA 1UXKA 3EARA 4ALNA 1OD6A 3P9YA 1NUTA 1WMEA 3EXEB 4L8WB 4QBFA 1KU0A 4UNPA 5TLSA 3AVUA 4IQ4A 4BB9A 2Q1WA 3O8LA 5SYMA 3K0BA 5ALGA 1T34A 4DV4B 2G04A 1NVEA 3AETA 4LXXA 3S2UA 3CVOA 2Z3WA 1KEEB 2ODPA 3H83A 5C2JB 3BB1A 3H1TA 2XE8A 4RPKA 3WO1A 4Q47A 1DSSG 4ZZ3A 2A59A 1GZHB 1L8AA 1SY7A 3DNMA 1GILA 2FWIA 1N2CA 4BMDA 1LTKA 4F85A 2AUNA 3UK6A 1WHSA 3H9BA 3FYSA 3IP7A 3NTOA 1XEWY 3Q1LA 1VB5A 3FDZB 3MT8A 4MK4A 2BM8A 1IN5A 1WXDA 1HH4A 2WHPB 4R5MA 4WLOA 4OYHA 2FFBA 2ZIAA 1YTUA 2GK6A 1KH3A 4HI0E 1D6MA 1OI3A 3C1OA 1W76A 1IC6A 4MUYA 1XAIA 2M2IA 2ONJA 3NTLA 5HK8A 3FUXA 3V7WA 5BPFA 4NJEB 5JCOC 5KKCA 1AHIA 1T26A 2V9CA 3DVAA 3E9CA 3ELUA 4GZ6A 5C81A 2ANBA 3NTVA 3SQOA 4CF4A 4YUYA 1SCQA 5C4IA 2CNKA 2NT3A 2YMLA 5ENZA 4JDPA 3T7JA 3O5AA 3BDAA 3M6VA 2VN8A 4QG7A 5CPBA 1EP1B 4OH1A 1FQOA 2GK4A 5FTKA 5H8WA 4ENTA 4LCEA 4NZNA 1Q1AA 1RRPA 4TMFA 1LNSA 1XKTA 2PQ0A 5JO0A 1U8CB 1YTLA 1HDYA 2QQ5A 4C0QC 2ZIFA 2BHLA 1A77A 2GJSA 4X61A 3LPMA 5EJAA 5J5AA 5K8IA 1H4VB 2LCFA 3HWWA 2B3TA 4F4JA 1FJXA 3MT7A 4NE7A 5D51S 1E2UA 2BUAA 4BBPA 4IQGA 3QKTA 4LI3X 3DLTA 4H7PA 3BL8A 2ZJZA 4UDOA 1OA0A 3MGBA 3UFXA 4DA7A 2OZEA 3N8GA 2J0EA 2LV8A 4KQ1A 3RREA 4WNYA 5KQSA 4A6EA 1F17A 4HGYA 4ZQBA 5JSFA 2XTZA 4MTCA 1UBOS 4PINA 2G72A 3LGAA 3OWHA 3LF1A 1F60A 5I7VA 1NT2A 3TFWA 2EKDA 1HNNA 1A3CA 4WZBE 2VR1A 3HR8A 4KGZA 4DQLA 1PBTA 2W98A 2H1SA 3G8AA 1HL7A 1T2CA 4QJIA 1JR6A 1YCHA 3SNHA 1CJUC 2R751 2VYVD 4XW2A 4W6QA 3OZTA 3TSYA 3DXYA 2H1HA 5IW8A 3QELB 4OL9A 2LIVA 2PJDA 1JXMA 3LZCA 3T5BA 3TIVA 5HKKD 3M5CA 5LZ8A 2HA4A 4AJKA 4BDTA 1ZL0A 1K98A 4RL6A 4TRJA 2VNKA 1NWHA 1N2OA 4LQDA 4TTIA 4C6HA 4ZGBA 1FE8A 4IJKA 2CMGA 3IVRA 4RFSB 5ALEA 3ZW8A 3S2EA 4RYDA 3RSHA 2G7MC 4EGJA 1OWMA 1DIBA 4UD6A 2OM2A 3SZMA 2AMYA 2VAXA 3VSBA 1OY1A 1XVUA 1ZJJA 4ZREA 1EU1A 3O4JA 5LBUA 4JYPA 4NZMA 4F4IA 1V2GA 1QIGA 4Y6PA 5GGXA 3ZXIA 4QM7A 3U44A 3A04A 1ORVA 4MCHA 4IVQA 3R7SA 3GLFB 3ADOA 4L7VA 2FMIA 3Q40A 3GHYA 3ICQB 1PUJA 1Z8NA 3QXSA 4LXIA 4YJHB 1M6EX 3OFVA 2M6KA 3RHZA 3LLVA 3KYJB 5TSDA 3CZCA 5FBVB 1YACA 3GJ4A 3ND7A 5FOSA 3KZMA 3SE0A 3DKRA 2D7JA 4EYKA 3KXIA 2I6SA 3UMYA 3A3NA 2A57A 4HDQB 1B3RA 3V7UA 1K1EA 3LBHA 1CCWA 3P96A 1IOVA 1OX4A 2GPAA 3WK4A 2JCYA 1TAUA 2PFKA 3DWFA 2DUUA 2AJBA 3QVMA 4DCOA 1KORA 3I61A 3UJAA 3FBWA 1MW8X 1A50B 3JV7A 4HXEB 5CH3A 3SQXA 3LL4A 2Q5QA 2DULA 1DTWA 1I9CA 4UVHA 2XEDA 4PTZA 2WYHA 1TQ4A 1ZGBA 2CZCA 1DFGA 2W2QA 4BQIA 2C3OA 4OGGA 3SWWA 1DE0A 1Y9EA 4BAGA 1LPMA 2IV7A 4R1LA 5B3JC 4A2CA 3A4YA 1UEJA 4UBLA 1UMCB 2VLBA 2B8EA 2AC2A 2XDAA 4G8JA 4RZIA 2FOXA 2K7ZA 3IMKA 4HH3C 4O5AA 2SKEA 3MGCA 4XGIA 4DBZA 4E08A 4Z51A 5CDGA 4YCNA 2XUHA 3KSAC 5FWAA 1DJNA 4EB8A 1VG8A 3JS5A 4YJ2B 1W4ZA 4RJLA 2VG8A 4QIHA 2ZJ1A 4MYSA 4OHWA 3EQ2A 4FFLA 2VS1A 1YVDA 1AKTA 1BXRB 3A6LA 5LLSA 1N77A 4JI4B 2VF2A 4TS3A 3TK1A 1SXQA 2RAFA 1VLMA 4OBEA 1K06A 1PR5A 4CL2A 4HL6A 4XUEA 3BPSA 4R3UC 1L7MA 3QPVA 4YHBA 5JNLA 3STWA 1YKFA 3NOXA 4HDRB 4CMKA 5B30A 4P3PA 5AO9A 2V7QD 4KN5A 2HGSA 4P53A 4Y2PA 1BJKA 4FONA 2W70A 2PT6A 2IH4A 2DBZA 3MLAA 1W93A 1YJQA 4M1QA 3WK8A 4UJ5A 3V4SA 4H0FA 2VHTA 3BICA 3H4MA 3RE1A 3NBUA 3UJBA 1WZNA 3GEBA 1ZA1A 2V7PA 1JI0A 2FU5C 1AZTA 2FPIA 4EX6A 3W0LB 4DUYB 3CRW1 3RVOA 3KB6A 2CLEB 2QL6A 2PJUA 5ECWA 1ODSA 4ZFNA 2OUIA 2YV3A 1NI4A 3OIDA 3BKXA 1VMIA 2DQKA 4M87A 2WPNA 4HNVA 5FBKA 1HFKA 4ALIA 2Q6LA 1EXWA 3R5JA 1KYYA 1MVLA 1OBVA 2BGMA 4M54A 5KAMA 3TKLA 4NV1A 1P75A 1TADA 3DMDA 3ET4A 3LWZA 2Y92A 2H5JA 3FVQA 4I50B 2VBFA 1M2FA 5AOAA 1U7TA 1N5DA 3U16A 5KMGA 4W63A 3BRCA 3N2GB 3QOYA 3UKDA 3ZY4A 1E6MA 5ELXA 4Y2YA 1D8AA 1QOPB 4ARZA 1XU4A 1IJFA 4UARA 3EGIA 1EWTA 3WBKA 3DAGA 2AB0A 1J99A 3HPRA 5CDYA 2C77A 4ZRNA 3AEKA 2P2YA 4CCSA 1NNI1 2RC5A 1KK3A 3PXAA 3ZTYA 2UUCB 4QVKA 1FLNA 1W6RA 3OAAD 5BSGA 4RXUA 1IEXA 4RGQA 3LBFA 3KD3A 2B92A 4JP2A 1D9XA 4GC9A 4JLJA 1P0CA 5EESA 4IHKA 4RGBA 1QCZA 4JVOA 1J39A 3OQIA 1H0KA 1THZA 2NX2A 5JXJA 3R5SA 1XZFA 3RROA 3T4UA 3EQ8A 1ORWA 3W90A 1CQWA 2I2BA 4HDNB 3P9RA 1O7JA 2X0FA 4MQLA 5FD8A 3QUBA 2A5LA 3CIOA 3BMXA 3KV1A 4OQXA 3SZ3A 3BXZA 2PYIA 1LBIA 4MHTA 2PRKA 2XUJA 5DFAA 4HBZA 1P7YA 4XQGA 2MIIA 4UQPA 1Q7RA 3DFKA 4CZ2A 3TIXB 3WS7A 2BEUA 4QREA 2W2KB 5BQPA 3O3MB 3UB3A 4CTKA 4MITA 1SBYA 1QHXA 1W2WB 3RTGA 4QVIA 3HGMA 2QVYX 2LCQA 1LBTA 4KWEA 4MS4A 3DV2A 1JLRA 1E2JA 1ZNZA 2WP8J 3DE3X 3CLRC 3P2KA 2PX6A 3L41A 5BQXA 2C3UA 4P86A 1KHHA 2Z5GA 3QSGA 2C03A 4MPRA 4ZYTA 4OK3A 4FI3C 2Y1LA 4HTFA 3ZJUA 3HDHA 4DIBA 2BONA 1PQYA 1ZIDA 3JQ6A 2OM6A 2QG4A 1XZNA 2I9PA 4DARA 5F35A 1GR1A 3KT8A 4Q4HA 1U6JA 2YDXA 4H9GA 1P0MA 3M6IA 4OQPA 1FJHA 2QMZA 5FOXA 3GFSA 5GP1A 2YX1A 1NSFA 1CIPA 1CNMA 4M60A 2GBFA 1EFVA 3GAFA 1L5VA 3CXUA 1FTYA 4MYUA 5DBOA 1MA3A 1SVIA 2ECPA 2GRJA 1NQ5A 3KHKA 3WQQA 1IMJA 2AYXA 1XXLA 5FTJA 3VYWA 4I3FA 3WOVA 2H07A 1UAAA 3KJGA 3DF9A 3HWSA 2DPLA 2PVCA 1DKRA 2MR5A 2AK2A 2HHAA 4MUGA 4XARA 3ENNA 2OZKA 5B1IA 4AJOA 1EHCA 1E77A 2EXXA 3ZWBA 3IERA 4J2HA 3EFOA 5AWFC 1KAMA 2D5CA 1LC0A 3O4VA 2ZYDA 4IVPA 3PGA1 3W5HA 3IXMA 2AVDA 1X94A 5DGCA 1NIJA 1WKVA 4JVNA 5KTYA 5LVAA 1DEKA 2ZT5A 3DF7A 4R68A 3JQ9A 3PD0A 4KO8A 2Q1SA 2J09A 4ZAGA 1YMQA 3D2BA 3BMOB 1WOYA 4FQ8A 3WV4A 1EUZA 1B76A 1BN6A 1DAEA 2J0VA 3JY6A 4D6XA 5JD5A 2UYHA 4FBMA 3WMEA 3ITDA 3PYXA 5JQGB 2Q29A 4EGQA 1U0NA 3EAFA 2ZRQA 4XEHA 3U1BA 5CDSA 2WTNA 4AROA 3HB4X 1XZQA 2D5IA 4OX9B 3TNLA 3OEED 3Q9NA 4BVBA 3O91A 4EJFA 3TWOA 4WJZA 1WUKS 1S3GA 4MDYA 1SPXA 4QPJC 3QKRB 1YCDA 5HUQA 3SOPA 4B80A 3IBTA 1MDFA 2YXLA 3V34A 2QZZA 5K09A 3MUNA 3L40A 4WINA 3I76A 1Q1EA 3L5OA 3PUKA 3RKSA 4DXAA 4X1KA 5D7NA 4OFBA 4Q4AB 1RC8A 3CN9A 3W9UA 4U7JA 4ETIA 2CLLB 2I8LA 1WXFA 4RDHA 1JYEA 4R8RA 3X2FA 4G1UC 2I2CA 5KYNA 5KMGB 3WRWA 4IINA 5ER6A 3VU0A 4RIEA 4YRPA 3NEJA 3TSZA 4ZTZB 5I9IA 1OFTA 1BCRA 1JRLA 5CM9C 1RHUA 2ATIA 4D0NA 5CBPA 1QPBA 1BW9A 2FUG6 2QPTA 3I5UA 1ES9A 5KNDD 2M98A 3CZRA 1J2YA 2VQ6A 2YC4C 4KFRA 3LQ4A 1P1BA 1I1QB 1IBCA 1X2BA 1I4EB 2VHCA 2QKYA 2XWQA 4KU4A 4BWVA 2YJ6A 3RD5A 3ORSA 4HS9A 4MS1B 3R0XA 2K4MA 3BERA 4AG5A 1Z9BA 1CZKA 4J4BA 2R2GA 1KK2A 2BFBA 1P1FA 2F43A 2F48A 2IYSA 4OHBA 4KYIB 4H7FA 1SOWA 3A4VA 1RE0A 3H9JA 3L7OA 3EX7C 4C4XA 4X00A 1QP7A 2B78A 4FGKA 4JHLA 1BX3A 2H31A 2NZJA 2XBLA 4OUDA 1HKUA 2JIRA 3I92A 2QP3A 1GDHA 3E03A 1T6YA 1Z75A 2QLLA 2W90A 2Z4RA 4ENQA 3ZVNA 5I7HA 5AXCA 5EJFA 3IQFA 4TXHA 1JEQB 1T5LA 2XUFA 1JXOA 4KVAA 4WOBA 3O8OA 3FNEA 2IU0A 2JH8A 4RHFA 3IVAA 1QWSA 1IONA 1XMVA 1Z6GA 4UU8A 3HS3A 4KJZA 2NU8B 1FK8A 3BGSA 4L27A 4N7JA 2GJ8A 2PWAA 3W78A 3EIWA 4XVUA 3C4VA 4QYMA 3IAM6 5ELMA 3QBEA 3N7UA 1ESZA 4E5UA 3EDRA 4DCUA 1TEXA 4RNCA 4A8JC 1E1LA 1A88A 4O4HB 4QRIA 5B1DA 1FZQA 1CUVA 3AUFA 3LS2A 3NM5A 3O84A 4XIGS 5H9VA 1Z8HA 1AO0A 4LBVA 1YK0A 1LPOA 1DMSA 1W48A 1C9MA 2H4ZA 2O0JA 3INNA 4L57A 4LJSA 3FZNA 3R3JA 2CUNA 4KDFA 5DGXA 5C52B 3CMCO 4F3CA 1ZAYA 2AFRA 1OFUX 2VPZA 2PMFA 2FF5A 4V3CA 1KE2A 3VHLB 4C88A 4OGLA 5BXYA 5EPEA 1O2DA 2DX7A 4QPDA 3H8JA 4CNBA 2I1QA 1RWMA 2Z9DA 4MZDA 2HN9A 3ZU2A 4K9DA 3PNLA 1KP3A 1F6DA 2H11A 4BNGA 1OA1A 1UXIA 1R6XA 2P5SA 1P7ZA 4WDQA 3S3TA 1KNQA 3G88A 2GGSA 2R7KA 1NP6A 1UL1X 1TUIA 2DLNA 2PRIA 3GUUA 2ZE5A 4DWWA 1DGQA 2V45A 3LUGA 5AHWA 1CZOA 1Z3CA 3PUHA 4I81A 1W88B 5H3HA 4LF6B 2V6FA 4J0CA 3EGDA 1A97A 3KOOA 2XA1A 2YIVX 1WPRA 1M1YB 1AGYA 4BO8A 2Z6UA 3TBHA 3WJAA 3ZVLA 2AMJA 1RKXA 1XNHA 2Y1GA 4Y9TA 1G4AE 1QZ3A 2Q5IA 2X2OA 3BS4A 3IP6A 2PKXA 4YJ3F 3WGTA 4FFVA 4R8KA 4P5DA 5BMVF 4NBVA 1FS6A 3IAAA 3GBVA 4G1BA 3UENA 3KQUA 3AVTA 3HJCA 2VT2A 1BFUA 3KC2A 3PUYA 5CT6A 1N6LA 5LP1A 4BQOA 4Q9IA 3FR8A 3HI6A 2ASEA 5KYXA 3G85A 2FPPA 2IOQA 4MNTA 1FRQA 1H3FA 5JMTA 4YP5A 1PUXA 3B5EA 3EGCA 3QW4B 3IE1A 4MUEA 1CF4A 1Z5PA 3NORA 3QMWA 1GZVA 1I0ZA 4Z0HO 4DBLE 1R9MA 3KAKA 5IM4A 3H1FA 4AP9A 2B34A 4JBIA 4XB2A 3OT1A 4RKRA 2DUJA 2VJAA 4JSTA 3R7AA 1V5WA 1BX0A 5I7UA 1IY8A 2MU1A 4IIDA 1GZ4A 4X1KB 1IL0A 4GZLA 1F2TB 1SR8A 1RQNA 3A3KA 1GPKA 5BR7A 2IYZA 3NONA 3HYLA 2B61A 2PN1A 4LZJA 2AIRA 1FC0A 4PHFA 1HQDA 4XGKA 2PGIA 2QIPA 3VZCA 5KC8A 3IDFA 1YS1X 3VPFA 4TZ6A 1XBTA 2EF1A 3LUJA 2WD9A 3HYRA 4JKOA 2FEXA 4M9XA 4D3YA 2I4NA 2ISQA 3CS3A 4K8RB 5DBGA 2FPIB 5GJCA 2MYNA 4D74A 2O8DB 1IH8A 3PLAE 1ZGAA 3ZU4A 4R9RA 4BTEA 3ESRA 4E5PA 4YLYA 3JQEA 4U5XA 3MOGA 3TTVA 3DBLA 1F38A 4F2PA 3JYQA 1P2VA 1YC5A 4NEGA 3FPJA 5FPHA 2HYIC 5C5EA 1V7ZA 2ZSAA 5AM4A 5LYYA 4MKGA 4B4OA 3U5ZB 2G28A 3G5AA 3QLUA 3DDZX 5LNK6 4TYNA 2K87A 4GVLA 5TT1A 1OYWA 1EWVA 2P8JA 1IATA 1EMDA 4XB6B 1UINA 3COWA 1TIKA 3E7DA 3JZAA 3OOSA 3P0RA 4LZAA 3TM5A 2ZAIA 4TXNA 3W6ZA 3UPTA 2Z6AA 2AOUA 4D3ZA 1OXSC 4IIUA 5J59A 4LHSA 4AU1A 4KWIA 2I87A 1Z16A 4F60A 1GKIA 1T36B 3FWPA 5ENVA 1TMGE 2QTMA 1X7GA 2BDUA 2ZIXB 4UNQA 1PVVA 4A5OA 4PBTA 3VC2A 3WJ7A 4UUAA 5C5DA 1E32A 1H5QA 3L79A 3QK7A 1VDZA 4XM0A 1GGHA 3I6ZA 5LU8A 2QJOA 4W8HA 1NWCA 2EBHX 4A3SA 2J48A 3HCBA 4DC0A 5I3ZA 1DZ3A 2WIAA 1OZFA 2ZIZA 3BCRA 3QKUA 1MJGA 2WHYA 1UP4A 3FRHA 3A6ZA 4MV6A 1CX9B 1QO0D 3NIWA 3F5FA 3UKOA 4RJTA 3GLVA 2CXNA 3DTVA 3U9TA 5D85A 4EAQA 2JI8A 1CLUA 1GYRA 5ICMA 2AXQA 2EEPA 2PX5A 4Y6LA 5I7EA 3MWEB 1FFAA 1I5EA 1PG5A 3VISA 4F96A 3MINA 1FMCA 2HA6A 3L0CA 1Q1NA 1ZCBA 1X2EA 4ISCA 1GXSA 1RDFA 4WN9B 4JOQA 3H5AA 4L4SA 2OQ2A 5FOQA 1XKLA 2C2WA 3VKWA 3WNBA 2VA9A 2NAPA 3MXTA 1R7RA 1RJ9B 1EUCB 3GLIB 3JQBA 3JWEA 4KNVA 1O95C 4JU9A 1T43A 3L7KA 4W5OA 1P2SA 4F8YA 3A4NA 1JKIA 1R9JA 2X8LA 2Q5CA 1XPJA 2QU8A 1OU0A 2XE7A 2Y67A 2LBPA 2I6XA 3OJ0A 1GNLA 2OWEA 2UZ3A 4C43A 4FFWA 1APBA 3RUDA 2ZULA 3U4CA 3VX4A 4Y6QA 3ACBA 2H2FA 5F1YA 1GQ2A 3AY6A 5JSYA 4D43A 3EZNA 1KJIA 2XSZD 4U2CA 3NIFB 4BO9A 4QOSA 5CIQA 3EXIB 1G0NA 1QTIA 3HDYA 1UJ4A 4I99A 4YQZA 2WKSA 1NJ8A 1Z45A 4FZVA 3WGKA 1W0CA 3I9NA 4FYMA 2J07A 4K3VA 1ZU5A 4A1OA 4LSMA 1T5HX 2P69A 2SKCA 1PR0A 4UCXA 3KSZO 5A62A 5K4HA 3SFVA 2YJTD 4GXRA 4YRLA 1R64A 2YVQA 2D8MA 5IZCC 3TW8A 3BGVA 2OCYC 3KZCA 4NBLA 1ONBA 5E38A 5G4KB 3TQHA 1SG9A 1W87A 4YPOA 3EF3A 2ZXUA 1N2IA 2A0FA 4BNHA 4AJ4A 1KI9A 4MR8B 4CU2A 4BAUA 3K9QO 5JJIA 3EFOB 2XCTB 5ICFA 3OBBA 5HA5A 2QT0A 2C7GA 1UOEA 5A3JA 3Q2IA 5G0TA 3DM9B 4L0DA 4ZCPA 3V8NA 2IDZA 5F9HA 1C9KA 4WXYB 3WTBA 2QQEA 4G2NA 1XN1A 3AEQA 3NR2A 1H9AA 4N9QA 1NW6A 1HOXA 1OWNA 3C6BA 5DHPA 5HDQA 3G9QA 3M6WA 3EXHC 3HG7A 3PQ3A 1E2GA 3RYHB 2HA0A 1KL7A 2ZI3A 2ZUCA 3CF2A 3IEPA 3WYCA 3V1TC 3SYLA 5H4HA 4QASA 3SN6A 3VU3A 1JTFA 1YR6A 1M6VB 4TQUS 3WKAA 1T5BA 4CG2A 4YAGA 4AKSA 1FBNA 4EB6B 2FZ4A 2WB2A 3QFRA 2IHKA 1Z5WA 1U8ZA 3K1JA 4N0PA 3F3KA 4MDHA 3TPZA 3ZI0A 4LMBA 1GPH1 4IIEA 3MUEA 1MJGM 4HRVA 3TSAA 2BEVA 2HZBA 2Q6KA 3LY9A 4XLZA 4KMRA 1TF2A 1WMAA 4A8PA 1H9BA 3AF2A 2UV8A 2HSEA 2QW8A 4U7GA 1E7MA 1W1IA 5FWDA 4JOCA 2AEMA 1B8NA 4HGPA 2AV6A 1RWKA 3WYAA 3K0KA 5JU6A 3CNLA 1CUEA 4G8CA 4JNKA 1GKUB 4RWEA 2E87A 1DCTA 4ZVVA 2WIKA 1IXRC 1U2ZA 2CJWB 2ZYVX 4YXWA 2YTZA 1JG6A 1GPJA 1TM2A 1N2ZA 1MV8A 1TCBA 1YNOA 2DT8A 2IKQA 2QUJA 2I99A 4W7SA 4ZCMA 4JI6B 1BXKA 2HDNB 3T7AA 4JC4A 3OSUA 3V7NA 3WBFA 3L8FA 2C9DA 2V4UA 4NYIQ 2WMOB 4MLZA 4RIFA 4DEYA 5CH5A 2C4VA 4A8JB 4ETWA 3ESQA 2YNMD 5EHQA 2QPAA 4JSYA 1R15A 1R5JA 3URKA 4ZCTA 4LW8A 1Y1LA 3DL2A 3AEKB 3HNRA 2GPYA 3HGTA 3N2ZB 4WKGA 3WIVA 1RPNA 2HQSA 2OV4A 1NBWB 1T6ZA 1OUMA 1WF3A 2RAUA 2W43A 5FAXA 3ZOKA 4R8VA 3FVRA 4DY6A 4WV3A 3RYCA 2O4UX 2IGBA 1GNQA 3PA6A 5AKJA 1VHWA 2VHXA 4NARA 3WWOA 4ND4A 4QWWA 2VRBA 2WZCA 3ZHRA 3ROZA 3I52A 4NEHB 1AO3A 2NWQA 4A2WA 1Z5VA 4KPYA 1P1HA 1MAWA 2GEDA 2XUQA 3KYCB 4U7FA 3ZE6A 4K6KA 4FYHA 1YB5A 2XHEA 4B2PA 2GBGA 4MS3B 1MAAA 5L4LA 2GASA 4UUOA 2EFCB 1S2IA 1UK7A 1MG5A 2CNBA 5TGTA 3RQIA 4D3FA 4CKEB 1T0UA 2ILTA 1FF9A 4NR0A 3K7EA 2HFKA 2UYGA 3QEJA 5EQJB 1ACMA 1CIVA 2WFZA 1T1IA 4E5DA 3I9JA 5T3UA 3USCS 1T8SA 3B51X 3P9QA 4FW8A 3RPEA 4KDRA 4ZCLA 4DY4A 3L7MA 4P0QB 3T1QA 1BU8A 3KB1A 3NHSA 1WNTA 3IUEA 1YR1A 1TQ6A 1Z7BA 2G25A 2CWWA 2DFKB 3G3EA 3W2FA 3LQFA 2B3DA 4OLJA 3WZMA 2PUVA 4FZRA 4HWKA 2OHOA 4INZA 1EP9A 5AOBA 3A1NA 2ETXA 4TTSA 3K92A 2C9CA 5CT4A 4YPVA 3UQZA 3SYMA 1G9TA 2YY6A 4MP3A 1RYHA 3LX5A 1AUQA 3RVSA 1SQGA 5DBEX 2ZBDA 3DBOB 4IIGA 1PZEA 1ADFA 4Z3DA 2X9QA 3LKVA 2XHZA 2RHLA 3HNPA 4UUBA 1P73A 1TQDA 2HBRA 2V8OA 4D41A 3ZJTA 4MHSA 4MCJA 5JNUA 2J3QA 2B37A 3HB0A 2VWHA 1AQYA 1X9HA 2CVFA 3QE3A 3VO1A 1XTQA 1IRXA 4FMCB 4F06A 2HNBA 4G63A 1B0AA 1J2EA 1DLIA 1XGKA 2CD9A 2PCJA 2ZE8A 5BXQC 1XCPA 1A71A 1TU0A 1GCIA 2C4MA 3GH1A 1NOIA 3TSCA 4ALLA 4IW3B 2GK3A 4L8LA 5GINE 2D74A 3R9IA 1F2VA 3L8MA 3QA9A 5IF3A 4HN2A 5LUAA 4N5IX 3P9KA 3E82A 3MCWA 5EIBD 2I6TA 5JQGA 3WFZA 3C1AA 4D3DA 2Q1YA 2PVSA 5I4KA 4OLBA 1AZLA 4BMZA 4IJUA 2ZRIA 5CB4B 4ZYVA 1OH5A 3ESAA 4NYJR 5DNUA 2DQZA 4W5NA 1CR6A 2R6GA 1H22A 5C7LO 3TIFA 3TUZC 2OBNA 1FLVA 1Y4UA 2OOSA 3HKBA 1YCFA 4V0OA 4EFLA 2IV2X 3GLRA 2IPLA 2IUTA 2HFJA 3KPJA 1W4AA 1CQIA 3N07A 1IU9A 2R6HA 3OLQA 4I14A 2CXUA 1IEVA 3MMPA 4EY3A 2GZMA 5BYKA 1O8BA 4LMRA 3WLKX 4MWSA 3FPEA 2QSZA 1AUVA 1KC3A 4DUGD 4M7WA 1ECPA 3VC7A 5B3LA 3V3TA 3TLYA 1G7RA 2A2ZA 3KLMX 4OB6A 4URXR 1DFIA 3F9RA 3VM6A 1RI3A 3FYUC 5BV7A 3DC7A 2VBGA 5EZ6B 5IHXA 2VTBA 2NYRA 3SYTA 4GI3A 3VSDA 4P58A 2V5UA 2G1PA 1Q2XA 5BR4A 4MR7B 4XRGA 3NXKA 2IF0A 2HJVA 2ABWA 1SHTX 4TL9A 1AKVA 1WW2A 3RYCB 1ENOA 2P9ZA 4W5QA 1NVWQ 1HWYA 1SXGA 2GR9A 4RA6B 3FMIA 4YEDA 2PZEA 4ZOLB 1J8QA 1CJSA 2B9VA 2FKAA 3A36A 3VBEA 1OZ0A 4ZOQI 5ADHA 1M3SA 2WFLB 3NXSA 2YFKA 3Q8KA 4C7OA 1LX7A 4JLSA 2XTAA 3CTPA 2WYVA 3D64A 3V3KA 1TNDA 3E2MA 5IRCD 4I2NA 2JFNA 4JMLA 4GDFA 1EX9A 4HADA 1D2CA 5JD4A 5BW5A 1OFUA 3F4LA 1QH0A 1WEHA 3MN1A 5AW8A 1CLEA 2HO4A 4NU0A 3KBOA 4L85A 3QUTA 3PRKE 2FN4A 1QGDA 1RHMA 2WD8A 2XKAA 4BDSA 5EHXA 4JELA 3H6KA 3WKDA 2ZZKA 1DS6A 2WY2D 2YXDA 3WGQA 1E2NA 2BY4A 1Q50A 4E94A 1E7WA 1NE7A 2H29A 2CXQA 2RH8A 4HG2A 3B7WA 2OD2A 3NOVA 4FT2A 4WN9A 5EWJA 2CXRA 3RBZA 3G6WA 3WKCA 3ZLUA 2CGEA 4M0FA 3WDKA 3WLHA 2CHFA 2W71A 1AN0A 4KZPA 3U4QA 3FFTA 3NWPA 2IW3A 2V59A 4M46A 3H2SA 5CJ2A 4KWHA 5LWHA 4E0BA 5B5SA 1EJ2A 1N8TA 2FEWB 2O5EA 3DEKA 2QPLA 1WDKA 2QN3A 2OG1A 3L7JA 4JC0A 4BO3A 2E4YA 4F6LA 4CQMD 4WSOA 4O2AB 4N12A 1UIRA 3ITEA 1KEWA 2C5LA 3SIWA 5L3VA 1XOIA 2HF2A 3A1WA 4H6VA 3SS8A 2H2DA 2VPQA 4BFVA 2BRUC 1JPJA 1EWKA 2YZ7A 1GGMA 2I2AA 2O9JA 5FF9A 1YHNA 1E98A 2A1UA 2OO5C 3D8UA 3GT7A 3EXFA 3TSOA 3ZCUA 5E9JA 2OOKA 1KNXA 1U0HC 3AIMA 2Q49A 3MWFA 5LB2A 4EMBA 4DLBA 1IXZA 5I7AA 2MINA 2WTAA 3MSXA 2GCOA 3CONA 3TN7A 3H5LA 5JTTA 2W6JA 3H2HA 2Q8PA 1VI5A 3G59A 3QJYA 4J16C 3CX8A 1PWHA 4RHTA 2VSFA 1KEPA 4LOIA 1EHYA 4PHTA 3H13A 4XWGA 1VDMA 1VSBA 2ACVA 4Y0NA 5AM5A 3SHTA 1GU0A 3V55A 4AXXA 5IJ0A 1LPNA 4GVPA 3CRZA 1ZBQA 121PA 4YA6A 1IY9A 4GD3Q 2P67A 3GU3A 1B26A 1L3BA 2PEZA 4WBNF 1ZCFA 3S8MA 5DTQA 3DTNA 4DN6A 4YPFA 4FEEA 4FCTA 5CFRA 4DB2A 5K9ZA 1RBQA 1GEEA 2PXAA 2Q46A 1NPYA 2F3TA 1QHHA 1XCOA 4E14A 2VZEA 4EHKA 1P18A 1A7KA 3PHIA 4YAOA 5EP1A 2AD5A 3K73O 2XCOA 5A05A 5CB8A 5TARA 5LM3A 1XD9A 2CUKA 1ODFA 4M0KA 4BO4A 1L7OA 2C04A 1S9HA 1NX6A 1YB6A 2OZLB 2VDMB 2P9QA 2XR1A 1TIPA 3MRXA 4RHCA 4CKCA 3GGGA 1KBZA 3UJ7A 4D9HA 1ZJ6A 3DVLA 3W9BA 1OLSB 1V7PC 4OXQA 4D0GA 5CTJA 1WP4A 3VPGA 1AKRA 2AI3A 4D8TA 2OCDA 4L4ZA 1ISSA 1XZBA 4PXAA 4WXPA 4YACA 1BU5A 1OGJA 2FSGA 3UJHA 1VG0B 2P2SA 1ZD9A 4GWGA 4KQGA 1KFBB 2C2OA 2MSNA 3H9CA 3IIKA 4P2BA 1QX4A 5FR2A 1MOQA 3UC5A 3N6XA 4BJ5A 3QP9A 4RMJA 5AW5A 5DTRA 3F1LA 2ADFA 1LRKA 3O38A 3T15A 4B4WA 3E3AA 4A5SA 4U2FA 3BMNB 1R0KA 1SC3A 3OU2A 4XX1A 2GJ9A 1G16A 3KU1A 5EXSA 2FEPA 5K2MA 3CH4B 1F8GA 3F8SA 4NYMR 3RBVA 3WJ1A 4LNHA 1EH5A 1QO7A 5LDGA 1TK2A 1TPYA 2ASVA 3AVQA 3EPRA 3IDAA 4KKXB 3SHFA 3WL7A 1XTPA 1WB6A 4I1UA 1UBRS 4KZKA 2H18A 5LZ4A 1VJ5A 1X7XA 2OGSA 3JR7A 4XUGB 3S2ZA 3GLQA 1XKXA 2W2OA 4N4AA 1XCJA 5U4XA 4P4LA 1XCLA 1NMEA 1RLOA 1A69A 3D0KA 3SC6A 3TOSA 4UXJA 2C00A 5FNZA 1WCIB 1FNNA 4U9IS 2E82A 3GIDA 3IIEA 3NLLA 3QITA 3ORYA 2VC2B 3P2OA 2IYEA 3BG5A 1C2TA 1SHJA 2D8AA 3JVIA 4QYIB 3I5AA 2GXQA 2F3PA 3KXKA 1GFIA 3IAS1 3QEOA 4PO9A 5DXFA 5TV2A 2H85A 2CFCA 2QVGA 4AJ1A 3ZZUA 5F1PA 4BEBA 2JFHA 1V26A 1JAZA 2JEYA 1XKQA 2QTVA 3DGFC 4FPXA 4AKTA 3QI2A 1QGED 3RNLA 1ZIXA 5K8LA 4M0DA 4R2LA 1A7AA 3V4RA 3I01M 1KS2A 4ZZ0A 2QBYA 3BQNB 4KXLA 3AGQA 2G40A 3N53A 3CMMA 2G83A 3JAMA 3VQTA 3D4LA 5DX0A 5AKIA 1U2DC 3NGXA 4CGZA 4X7RA 4ESHA 3AGPA 1JJIA 2WBLC 1WBBA 4ZICA 1ONNA 2P65A 3QRWA 3ZCRA 1RQRA 5E7QA 1EUCA 1FCJA 3GLIA 3IEVA 1FZTA 3MSCA 2ZT6A 5DRYA 5IH3A 4CL0A 4QDKA 4FOTA 1E7SA 3NMUF 3PVZA 1E2FA 1HDOA 1NQWA 3PC6A 4DA6A 3D5EA 1XA0A 2O2JA 1XPOA 1CUDA 3FE2A 3ILHA 4OM8A 4OIFA 2AN1A 4NH4A 2CNNA 2WJIA 3HB1A 3D8NA 2EJTA 4RORA 3CW8X 2CXTA 1WY5A 2IS2A 4UE6A 4GOXA 4EKGA 1MB2A 4RK6A 4UD2A 3ZGOA 5TXGA 2PFGA 2X19A 1USUA 2V97A 2X6RA 4FVTA 5AUPB 4DR3B 1V5FA 4FOSA 4RCYA 5DLYA 1FP6A 4JT4A 4KLNA 1HLPA 3R5TA 4CMEA 3DJYA 3DDSA 2QB5A 2E6UX 2C2KA 4ERXA 2JLYA 2QYTA 4LYHA 1XHLA 4FXPA 3BZBA 3G2NA 4V2UA 2JAPA 2BMVA 1IMOA 4YMTA 2I1VB 4LY3A 4W8OA 1UK8A 3QKRA 4DIMA 4LGMA 1SURA 2IE0A 5LZ2A 3IP1A 3Q8XB 4MQUA 4OMUA 3RR2A 3HEBA 1PLKA 2FYTA 3ICOA 4MUIA 4BCDA 4L75A 5C46F 3I4CA 2XVZA 2WMDA 1LPBB 5HIKA 4A26A 1AY0A 5ETJA 3KD2A 2Q5LA 1V1JA 3N0XA 5IMSA 1IUOA 1OXKB 3U7IA 4FYXA 3L6DA 4IDOA 3IHTA 3ER6A 4OAPA 4OHVA 1CE8A 5E3IA 5JS1A 4UVGA 2A5GA 1MH1A 4UREA 4EEZA 5I9TA 4O2BF 1AG9A 2HWUA 5F3DA 2XBUA 5G2OA 3IS3A 1PHRA 1U9CA 3B1FA 3E3MA 2OYCA 3H0CA 1JSLA 2L17A 3TEFA 2DU8A 3HWX1 3SGLA 2P40A 3T7RA 3ZDRA 4ESVA 1GQQA 4WXEA 1XU7A 5F7ZA 2ZZNA 4NWIA 4E1AA 3TD6A 3DLCA 3ZWKA 3GGOA 1KOJA 3M70A 4LX0A 2CEAA 4NK4A 4X3OA 2JFZA 3GJ0A 1A76A 2V6JA 1IQ0A 1RYNA 4TUYF 3AOEC 2C5BA 4EA9A 3K09C 5CH8A 2P77A 4EJSB 2HPAA 5KHAA 2DC1A 1YL6A 3CWQA 3D59A 4RKWA 3RV3A 3KQTA 5JASA 2A14A 5K03A 1P9NA 5KWJA 5HOEA 1ENPA 1L1FA 1A5SB 4G1FA 3WLJA 3OPYA 2O2ZA 3MWKA 4L0CA 4GNRA 3WI7A 4U8GA 1U9IA 4TSFA 3AFNA 4KN9S 3TIG