1QKJA

T4 phage b-glucosyltransferase, substrate binding and proposed catalytic mechanism
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSYLTRANSFERASE
publication title T4 Phage Beta-Glucosyltransferase: Substrate Binding and Proposed Catalytic Mechanism
pubmed doi rcsb
source organism Bacteriophage t4
molecule tags Transferase (glucosyltransferase)
total genus 131
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA02
3L79A 2X6RA 1RZVA 3S29A 8GPBA 2F9FA 1LWNA 1GPBA 5IKPA 1NVKA 3NP7A 1L5QA 3E3LA 3PE3A 2XGOA 2GPBA 3L7BA 4F96A 4LDPA 1Y8ZA 5TVGA 3MRTA 3OKAA 3NCHA 1L5WA 3OTHA 3DDSA 4L22A 3ZCTA 2GPNA 3DDWA 2F3SA 1EXVA 2XA1A 1P4JA 4RBNA 3BEOA 3OKCA 2XA2A 1V4VA 4CTMA 1PYGA 4GYWA 1WUYA 1GFZA 4FKZA 4X7PA 3S0JA 2VSNA 3CEHA 2IW1A 4X7RA 1K06A 3ZCVA 1FTYA 4RIFA 4MI9A 4BQFA 3MT9A 5TMBA 2PQ6A 3ZCSA 1ABBA 1XOIA 2ACVA 1AHPA 1KTIA 2QLNA 5TMDA 4FZRA 1C8LA 2R4TA 1Y6GA 2QRHA 2IV7A 2XCUA 3VDMA 2FFRA 4MI3A 1JEJA 1WV0A 4BQIA 2C4MA 1SXQA 1Z8DA 1WV1A 2PYIA 4YUAA 3OKPA 4F9FA 3MT8A 2BISA 1GPYA 3BCSA 1FU4A 1P2GA 3G2HA 3TAXA 4GZ3A 3MRVA 3PE4A 3NC4A 4NEQA 3MT7A 4KQMA 1XC7A 3OY7A 3G2IA 1Z62A 4Z5XA 4N9WA 2SKDA 2O6LA 1UQUA 1GG8A 3ZCQA 2SKEA 3HBMA 3NB0A 1L5SA 3OY2A 3H4IA 1XL0A 3ZCPA 2QNBA 4G2TA 2QRPA 3OT5A 1QM5A 3WC4A 3BD6A 1JIUA 3TOVA 5TMEA 3NP9A 2WTXA 4MRAA 3S2UA 4RIIA 1C50A 4WADA 1FA9A 4MI6A 3ZCRA 1P4HA 3CUVA 4WHMA 1LWOA 2C9ZA 3BCRA 3G2NA 2QN1A 2XGMA 2F3QA 5HXAA 3HBFA 1PNVA 3CEJA 4N3BA 4M7PA 3O3CA 3Q3EA 2QN7A 4EL5A 2QLLA 1P2DA 2ECPA 1FTQA 2ZB2A 3GUHA 2X0FA 2QRGA 4NESA 3MQFA 4RELA 3C4QA 1Y6FA 3QKWA 1Z6PA 3CUTA 3E3OA 5D00A 4GZ6A 1EM6A 4N3CA 1YA6A 2VSYA 2GEJA 2ATIA 3GPBA 1JG6A 4RIHA 3BD8A 1XV5A 2VG8A 1AXRA 1WUTA 2IV3A 1XL1A 1B4DA 4YI3A 1NLMA 2QLMA 1GPAA 1PSWA 4N3AA 4EKYA 3BDAA 3RSZA 5DU2A 1Z6QA 3L01A 3CV3A 4WACA 4AY6A 1FS4A 3H4TA 2ASVA 3UYKA 2GEKA 2XGSA 3T3EA 4QLBA 9GPBA 3QHPA 4M60A 1YGPA 2X0DA 2AMVA 2P6PA 3D0RA 4BFCA 2H1HA 2AV6A 4GYYA 1P4GA 2GPAA 3MTDA 1NOIA 3D1JA 3MS2A 4X7MA 2IYAA 4EKEA 2QRQA 4AMGA 1L5VA 2BGTA 1NZDA 2F3UA 2G9UA 2F3PA 2H1FA 3NAZA 2HY7A 3D0QA 1P2BA 2PRIA 1FC0A 2XCIA 2Q6VA 2XA9A 1GGNA 2BGUA 2JZCA 4CTNA 3G2JA 2C1XA 3RSCA 4CDRA 3DD1A 2KS6A 2YJNA 3L7CA 3SYMA 6GPBA 2PYDA 3T3GA 3HBNA 4RENA 4XI9A 1JIVA 1H5UA 4EJ2A 1E4OA 2ACWA 1WW2A 1IIRA 1HLFA 1L7XA 4AMBA 1NZFA 3CUWA 4NC9A 2AZDA 4AY5A 3MTAA 3HBJA 4LEIA 3MRXA 4W6QA 3MBOA 4REMA 1P29A 1F0KA 3RT1A 7GPBA 3WAGA 1BX3A 5I45A 3CUUA 1QKJA 2C1ZA 2PRJA 3ZCUA 5JTTA 4GPBA 1NOKA 3E3NA 3L7DA 2GJ4A 5IKOA 5C1DA 1C3JA 3TSAA 1A8IA 3MTBA 5LQDA 3IA7A 1IXYA 2G9QA 2IYFA 4F97A 4HWGA 2R66A 2R60A 2FETA 3EBOA 3CX4A 2IEIA 4N39A 1VGVA 3C48A 3Q3IA 3T7DA 3COPA 3VUEA 3T3DA 4GZ5A 3MS7A 1PN3A 1GZ5A 5BNWA 3C4VA 2GM9A 3BD7A 4BQEA 3NPAA 3S27A 1K08A 1F6DA 1UQTA 2R68A 2QRMA 1JG7A 2XMPA 4RIGA 2VCEA 2QZSA 4RIEA 5JTUA 2BFWA 3RHZA 3MSCA 1O6CA 4YI5A 5ENZA 3OTGA 3T3IA 1E1YA 4XIFA 5D01A 2QN8A 2SKCA 1J39A 5DLDA 2G9VA 1SXPA 1L6IA 1UZUA 3G2KA 1RRVA 3IAAA 1FU7A 3FROA 1FTWA 1WW3A 3SYRA 4MICA 1JIXA 5DXFA 3VUFA 3G2LA 2AW3A 3S28A 4M83A 2JJMA 3BCUA 2X0EA 3T5TA 3AMVA 5GPBA 4EL0A 2G9RA 3CEMA 2QN2A 2IUYA 2JLBA 2VCHA 1M5RA 1NOJA 3UYLA 4PQGA 4AN4A 2QN9A 1FU8A 3T3HA 2X6QA 1RZUA 4KQ1A 3DZCA 4X6LA 1XKXA 3WADA 2QN3A 3MS4A 3Q3HA 2R4UA 3CUYA 4HLNA 3L7AA 3VDNB 2OFFA 4KQ2A 4MHOA 3EBPA 4CTOA 2IEGA 2GT1A 1C8KA 3OTIA 4MHSA 2FF5A 1L5RA
chains in the Genus database with same CATH superfamily
4URUR 3CKLA 1QHHB 1RZVA 1VM6A 2IDZA 2R00A 3H2ZA 3N0TA 3R0IA 2FEXA 3C8UA 3L92A 4F5EA 4MV8A 1WCYA 1POWA 5G41A 2L82A 4TKUA 2F9FA 4KBGA 2ZCJA 3O4GA 4AZ0B 1ZBQA 2CE7A 3VI4B 2J5RA 4OB6A 4IFIA 2XT0A 4OHPA 4BMYA 3IE2A 1O58A 2OD9A 4N7RA 3ZKWA 4J7UA 1FX0B 4CUKA 4OL0A 5J4VA 1OW3B 1W5SA 1NBIA 1AK9A 2VZ0A 3B6EA 2O20A 1QFZA 2Z95A 4YUXA 1DNPA 4ZVQA 2FUEA 3CQ9A 3X43A 3QFFA 4M1ZA 1WU7A 3KVVA 1MIOB 3FAZA 3M5PA 3L6BA 4IM7A 3TIFA 2JJ1D 1NMSA 1UZLA 4BNHA 2VYQA 4DG9A 3H7IA 2JJ8A 1BU8A 1IHXA 3STWA 3EF3A 3LBHA 4F71A 2GM5A 1UKYA 1A5BB 3V4SA 2JAPA 5C51B 2VHEA 5IDWA 3V2IA 4ZRDA 4QQFA 4HXYA 4E4RA 3MOGA 1EMDA 4AP9A 4G65A 2ZS7A 5SZHB 1JLHA 2GXQA 2Q49A 1JLLB 4MCAA 3ZV4A 3JRXA 2R8PA 3LNTA 1CUXA 1BW9B 3BEOA 4RBNA 1E0AA 1PJTA 2ZDGA 3OD1A 4IJQA 5ITSA 3WGOA 4L85A 4XOUA 4X44A 2GXUA 1YUBA 3UUEA 4HN4B 2P77A 5KPDA 1R66A 2ZITA 2NU6B 1J8YF 1T8SA 3I5YA 2WJYA 3TTTA 1UT6A 1LBHA 3WFJA 1GZDA 4URZR 3BZUA 3W1VA 1YCHA 4IINA 2R8BA 4JB3A 4U6NA 4AIRA 4NV1A 2QTVB 3FPCA 3SM3A 4NJEB 1DAIA 1P39A 2AG6A 2EHJA 3ND7A 1Y37A 1ZX1A 3H1BA 3WLRA 1QRAA 2HA6A 5LOVB 3N2EA 5A7FA 1JQJC 2OHIA 2PQ6A 3K1AA 1Z6YA 2AI2A 4YX9A 4OHCA 4F4IA 1N9GB 1USKA 2KLBA 3FRHA 1LDEA 3KPJA 4OHFA 1SZPA 3EGCA 2GDZA 1C8BA 1N8NA 5ITVA 3PXGA 1V1RB 3EOAI 2G09A 3OE4A 3LPNA 4MV9A 4EB0A 4L72A 3L40A 2IWRA 2IV7A 5GVSA 4U2EA 3HRKA 3WYBA 1IN7A 1S8OA 4JGGA 4WPGA 1HDZA 3UHJA 4EI2A 4WASA 1E9DA 2PR2A 5L4LA 3HHPA 3KVOA 4NBUA 4GECA 2C4MA 1P19A 2ODQA 3NR2A 5AM4A 3RUCA 3SS9X 1W36D 2AK3A 3L8DA 4NICA 4NP6A 2PRSA 2PWBA 5CM9C 1N2BA 1XRMA 4R1LA 3FJOA 5TJ9A 1JFSA 2ZYAA 4C4RA 4R6XA 4UMDA 3W77A 1VG9B 5DP2A 2VXOA 1QXSA 1G3MA 5CLHA 3IULA 1YUNA 3OZTA 1ATZA 4QBIA 3SX4A 4UKDA 2JGIA 4MMXB 4R81A 5KYTA 2P4QA 2R8ZA 1L7PA 3H04A 2AOWA 4RX1A 5CT8A 3WGLA 2VHZA 3OCZA 1FRZA 3EGEA 3L3BA 4FLMA 5AVZA 1E2KA 1FP4B 1GPYA 3FOZA 2NVUB 1Q6ZA 1AGXA 4P3PA 1ZVVA 5KJFA 3SX0A 2B25A 5KYWA 1G4AE 4GZ3A 2R7MA 4OB7A 5DKFA 5LP6A 5HKOA 1FFBA 1XC7A 1GYRA 5MF6A 3GRZA 4YRPA 4KDFA 1Q3HA 1JHZA 1Z4IA 1Y48E 2HJWA 4QUAA 4M1EA 4Z5XA 1I6LA 1GPH1 3VU1A 4A73A 4DVJA 3L6EA 5JROA 5EZQA 5L53A 2RHTA 1GG8A 1CHDA 3TW4A 3EUWA 5BWLA 3A4LA 5HKKA 3AESB 3CTMA 4J0QA 2P6MA 5K6AC 1JDTA 3QU7A 2BMAA 1QZXA 5FL7D 5DASA 1MRSA 4AZ3B 2C4WA 3GRVA 4YACA 1W25A 1R9JA 2VNHA 1XL0A 4TTVA 1E8DA 1ZVKA 4RD1A 3ZY4A 4ABTA 3OHSX 3OJCA 5ED0A 1C2YA 1V43A 1OT3A 1PHPA 4RPCA 1Q0RA 5CHYA 3VKFA 3ZBTA 3LY7A 1KO5A 2ENWA 3I0MA 1YNOA 2IW3A 2CXNA 3IVXA 1GCIA 3ILVA 3PD7A 4QDUA 1IXKA 4WKGA 4O4JB 3CLKA 4BQNA 4CL8A 4WH0A 3VZRA 2QUZA 1JF8A 3MAJA 4UCFA 4J3JA 6LDHA 1YS9A 4POAA 4MVWA 4K5QA 5KJEA 1L5HA 4DBLE 3MBIA 3ADPA 4CMIA 4EABA 1VCNA 2RAVA 1POXA 2HEGA 3FSEA 3O4JA 4ZYZA 4RD3A 4IIEA 4NOLA 4C7XA 16PKA 1N5OX 4G0ZA 4RA6A 1Z38A 3RC7A 1GZ7A 4CKCA 3CRNA 5BOSA 5KJ1A 4HC4A 3WJAA 3PFFA 1L8AA 4BWYA 4YC7A 4KIFA 4TX1A 3EC1A 1JLKA 1YJ5A 3ZWBA 5KNDA 4RGBA 3A4VA 4CEHA 1ZXLA 4JOSA 2X0FA 4ACAA 2XKKA 5H4GA 3VTKA 5TGDA 3CFYA 3G9QA 1EESA 3MWYW 3EIUA 3ECAA 1Y6FA 5CU7A 4RJ2A 2BZ1A 4FZVA 3EEFA 1P2TA 3UJ7A 4PLCA 5JZ9A 5KTPA 3F5MA 4JYBA 3CNNA 2RARA 4KI0A 5ICFA 2EJTA 4IDBA 4Y6PA 4WA8A 3RIMA 2YS7A 4K6GA 1A98A 2I34A 2C4VA 3A25A 5CK4A 3FVQA 1K7YA 1XDDA 4GG1A 3ONWA 1Q84A 3NM6B 2VP4A 4KPFC 5MDHA 2R8RA 2AQ8A 2WVAA 2HIHA 4ILEA 2ATCA 4G09A 3M82A 1KP3A 4Q4CA 4F7DA 1J2UA 2G63A 2NQTA 5K1ZA 1J07A 1AA6A 4QLOA 5H0IA 2G0AA 2NSJA 2V45A 4FN5A 1TT7A 1M0WA 3C6ZA 4EG3A 4QYTA 1QNLA 3AI7A 2QTBA 3TF5A 1I5EA 4OGGA 4GMHA 5SY9A 1JMVA 1VE1A 3EIOA 5BRAA 1ZXXA 4MZDA 2G4VA 2WMYA 1MT3A 3G02A 3OPXA 4P36A 4UHKA 4N3AA 3M1IA 2ZE6A 5LJLA 3RNLA 1X7XA 2EAUA 5L6LB 1Q14A 2VF5X 3WV5A 3B53X 3AR2A 3U5TA 3G2QA 2IYRA 2VP5A 2BSXA 4LYGA 1MRZA 4FFOA 2ZM6B 4YJ2A 1BEUB 3I37X 3OO0A 2X9VA 2Q7DA 1WY5A 4LVCA 5KOIA 3INRA 4IDPA 2ZZNA 4OJTA 1AA9A 4JROA 4Z0HO 2YFHA 5GAJA 3O8QA 3BN3A 3OUUA 2QTTA 4P58A 4RK4A 1C3OA 1A71A 4QGHA 4TRMA 1Z2NX 3ZXXA 4RVCA 2WZDA 3ND5A 5FJIA 3OZ7A 3NASA 2HA4A 4P7FA 1QHIA 5LA6B 1WXHA 2HBZA 1EFLA 2HLNA 4YONB 3TVTA 1SVOA 2Z0MA 3UATA 3AXSA 3MPOA 1WS6A 2FSIA 4XJVA 2QRZA 1OILA 3MZ0A 2PGLA 5DGXA 4F3TA 1R4MB 3GGPA 4CF4A 5B7GA 4CI9A 1EFPB 2X7HA 5CM2Z 1DXYA 1NUHA 4BFCA 4EHLA 4OAOA 1FX1A 2DWUA 4NK4A 1WE2A 2FG7C 5BSHA 1HE2A 3ZWVA 3TTWA 1NOIA 3PDUA 2IUEA 1CQJA 2V6FA 3Q41A 5JNTA 1NN0A 4JP1A 4HMPA 4AC9A 3DBRA 4RGVA 5EIFA 1UT8A 1RCUA 4YO8A 2CE2X 3D6JA 3NUQA 3PHBE 3G9TA 4U8HA 4UBJA 4R05A 2UUOA 3N7UA 4M0DA 4ZT4A 3RYFA 3GLIE 5AKEA 3LLSA 3BXPA 3DZKA 3FPSA 3FDZB 4L76A 1JEOA 1Y3AA 5CNKA 1M6WA 4GX2A 5CB0A 5F4ZA 5K0CA 5EWJA 4BC1A 2RKOA 3N8NA 2GO1A 2WUGA 4UDXX 3WO1A 3MHTA 3BTOA 3ZWKA 5KUTA 2H1FA 2W58A 1DKUA 2Z5GA 4GPAA 2GZRA 3GLFA 4Y2TA 3MM4A 3FTEA 5ALVA 1ECCA 5HM6A 3K0FB 5K8LA 3E27A 5A9SB 4YLEA 3RKSA 5EGNA 3TRDA 3VU8A 2AMYA 1RJDA 1KI7A 1J7KA 2BDUA 3WDSA 3JQGB 1B3RA 4YECA 2IBMA 4I9NA 3HDHA 5DH9A 3QI2A 3W04A 1YI0A 3NJRA 5JYEA 1RJFA 4FCWA 3OLQA 1GTRA 1D4AA 3UMVA 4RTPA 1I14A 2W0MA 3RAPR 1E3EA 1QFJA 1A27A 1IN6A 1DI0A 1ZGCA 2A5JA 4EJ2A 1GTSA 3FSJX 1BFDA 1S8AA 4AX4A 2ZIXB 2NVWA 1LUAA 5AUQA 1A8QA 3OX3A 4WKNA 1MB3A 3B13B 3KTAB 3A8TA 4Y9RA 4WZBB 2C2MA 1T36A 1EAYA 1RXCA 3THYB 5E4JA 2WLSA 4LGYA 4LWQA 3OP1A 4Q7EA 3DTVA 2NV6A 5CNIA 1G16A 2CNLA 2O0KA 1YOVB 3UVEA 2C00A 2BJVA 4EHAA 5TE9A 1SKAA 2FQ1A 2FPIB 4ER3A 3MRXA 1TJ4A 1UZAA 3Q3CA 4RH1A 4EKIA 4REMA 5B7NA 2VYFA 3RK0A 3MTEA 2XQFA 4KG7A 1F0KA 4WZAE 4JA0A 7GPBA 2X7XA 1CS0B 3A4NA 3GGSA 5F1OA 1YZKA 1PLLA 1ZRMA 1NT4A 2C3UA 4DUPA 4C7MA 5DNWA 3A9CA 1A8UA 4IIJB 3P2EA 1PTKA 4DPMA 5EZYF 1MA0A 1YC5A 1W88A 4FPXA 4KMMA 4RANA 2NG1A 5JEEA 1EUCA 3W1EA 2VJPA 2M6KA 4R3NA 1CZKA 5AVXA 4RKFA 4ZOLF 3ZWQA 3KOWA 4K3UA 3LFUA 4QEDA 2I8CA 3FAKA 2JI4A 1WMEA 2Z57A 3G59A 1H3NA 1L7OA 5J4HA 1R5JA 3VI3B 2VK1A 1XNJA 4P5DA 1OZFA 2HNKA 2HU8A 2QRLA 5KYUA 1P18A 4GI2A 2ONJA 3QVLA 2FLKA 3WSWA 5E6UA 4DQ0A 1C9KA 2Y4OA 1YU9A 3ZQKA 3CLSD 5COBA 1YZUA 1V25A 1LBIA 2Y1OA 2Z8YM 3HPQA 3IDFA 3T3DA 5CFZA 1BA2A 1TUBA 3EXEB 1T0IA 1DEAA 5LQAA 1SCKA 2X5NA 1Y7HA 1L1QA 2BKUA 4Q02A 1R9NA 4Y8VA 2J09A 4KYIB 1CY1A 2VNSA 3BZBA 2OGSA 2A1UB 3EGXA 1SC9A 1VLJA 4II2A 1SELA 3Q0IA 4UC0A 4BE7B 4KE6A 1QX4A 3GB9A 4TV8F 5HBGA 4X9XA 3UAGA 1FFEA 1Q7CA 2YYSA 3K2QA 4MPJA 1VE9A 4PSCA 1F60A 3ZUGA 3WB9A 1CG6A 4YCSA 3WB2A 4IIXA 2ZSEA 3RFXA 2EKDA 1EBUA 3R0VA 4FKMA 4C05A 1J2TA 1WCV1 4M9RA 3KX2A 4G41A 5DX1A 1DKPA 1SK8A 1X15A 2JFPA 2OENG 4U2GA 5LR6A 2TMGA 1FLNA 1QVWA 4KQJA 3A6HA 3PFHA 2AMLA 3IDSA 2WD9A 1RZRD 3CF6R 1X77A 4DV3B 2WG1A 2YWGA 4I4TF 4YAOA 1X94A 3UJHA 3VR5D 2Y99A 2I7DA 2FMHA 2IT1A 3GQBA 4QU9A 1CJTC 2R6CA 3T3IA 3C98A 4CKBB 3B36A 1XYGA 2FSVA 2KJQA 3QENA 3RC9A 3O4VA 3ZV7A 4ZEWA 3W78A 1M83A 2Z9DA 1IZ8A 4FR0A 4F6RA 4X64B 2NSHA 2QLJA 1EWVA 1PE0A 1UZUA 3IUJA 3RTBA 3C3BA 4BRUA 13PKA 4IEEA 1WKBA 4Y1RA 2ABWA 1HMYA 4QOSA 3T7SA 1JKJB 4WLNA 5DLEA 1Z17A 3AIIA 4G81A 1GU7A 4OU4A 3UPDA 2CJXA 3IC5A 3X1YA 5CW1A 3V7YA 3C6YA 5JJCA 5KQLA 3ML1A 3TQTA 2V0GA 2BLNA 2QTFA 2GJKA 1RI5A 1J8QA 3D2BA 2Q1XA 4QASA 4Y1EA 3TQRA 4NU8X 3QY9A 2J9FB 2R48A 2Y8EA 5BQ3A 1CJUC 1RYNA 2QVLA 3BFKA 4D7AA 1SCQA 1YE3A 2P2GA 2C31A 5FEUA 4DSAA 2DBQA 3AF0A 2R751 4WGFA 3WGZA 3ZDQA 1WRBA 4AQDA 3N5KA 2VNKA 2HWKA 2IITA 3UICA 1I5OA 3ND9A 4DZZA 4EL0A 3HWRA 3ZPXA 1VL0A 3ETGA 3PG5A 2A88A 1NT2A 5F64A 1U4NA 2OAP1 3L0DA 1BCSB 3PUXA 3WKCA 4MRRA 4WVLA 2H4XA 1SBQA 1AN9A 2F43B 3CZQA 1XCGB 2VP6A 4A6XA 3RJMA 4Q9JA 1YO6A 5FWXA 4Y2SA 2LUOA 4QWWA 3PFWO 3KEOA 3DMTC 1P77A 2WVGA 4ZU1X 2ZRLA 2YJ4A 1DAPA 2XUIA 1NW4A 2PRZA 1GIAA 4E5KA 1NC1A 1Z3IX 3VMMA 3MS4A 4DA4A 1KK2A 2BF4A 4WKPA 4Y98A 2I6QA 1QGUA 4XEUA 2J07A 2PLFA 3ZGXA 2DR3A 2QGZA 3AZQA 4ESEA 1OZGA 4QNMA 3WWCA 3P2YA 3ZHOA 1ODFA 2TMYA 4ZGWA 2AFIB 4YMGA 3R75A 4PX9A 3R8XA 1FSFA 4C0AC 3DJYA 4MHOA 5CYPA 3RSQA 4D74A 2IEGA 5IU6A 1ZC4A 2BUCA 1DX9A 1M0TA 4WWHA 2BHLA 2DGDA 4X8LA 2Q5FA 5EHNA 1M0EA 1A8HA 1Q20A 1QMGA 4L8YA 4HATA 1W4AA 4OMDA 4RY9A 4NYIQ 4DV2B 1QGDA 2HLDD 4F60A 3I01A 3JZAA 2BGNA 4WCVA 3S29A 3WIBA 3UFBA 1QU3A 4O08A 1MQSA 1H23A 3ZIUA 4PYRA 5ESXA 5JAOA 5IJ0A 1GT6A 1E2UA 3HEBA 1G1MA 2JIRA 1ZD9A 2ILTA 2WWFA 4WMLA 2OCXA 2YFQA 5TVKA 4YRSA 4HB2A 1PEDA 2FMXA 3EVEA 3KWJA 2HBQA 1XMQB 5BSVA 4TYQA 1KAQA 1FVOA 3ZHYA 2CFIA 2W7TA 3WHIA 4GLBA 2QVYX 1RWBA 1RJWA 1T5OA 4CKWA 2R0QC 1P1HA 1PZGA 3KZOA 3M2PA 3QYAA 1HV8A 4OQXA 4PZPA 3OTOB 1BDHA 2R1TA 3DFUA 4RXTA 3R44A 3SP1A 5C32A 3V1NA 1HE1C 5JADA 1E63A 1H66A 4NYIR 3DC7A 5DMXA 4QHYA 5L3VA 5LM3A 1A95A 5K3SA 2CYAA 2M1ZA 2ZQYA 2W6IA 4TTAA 1K75A 2IGTA 3BDVA 2F3SA 2YY7A 3MGCA 4LHZA 4M3NA 1EQUA 3GA7A 1IHDA 1R0KA 2XUZA 3BRCA 5IBPA 2WU4A 3L07A 3SNHA 3VZPA 3WI7A 4ERXA 4UNQA 3V6MA 4RVHA 2XUQA 4Z4IA 3G0HA 2IL1A 3A7DA 5CJJA 4H3VA 5F5XA 5KB3A 4G84A 4TVBA 2I78A 3TBKA 4Q9KA 4QREA 1M2GA 1TZ2A 4IIGA 2GH1A 3M4NA 5FA8A 1R12A 1KKLA 2B83A 1EDBA 1OGYA 2I3GA 2OFOA 4MVJP 1EX7A 3I72A 3A6GA 5EL0A 1Z4PX 5EIOA 4R84A 4F06A 4IWNA 4DDUA 2JHAA 3RHSA 3ITEA 1XCJA 1PG5A 1ISIA 1RM0A 3Q3GE 2OQIA 4Y1GA 4DVGA 1MHPA 5J59A 1SQFA 4KYUA 4KSYA 2WICA 4NAVA 1BFKA 1OAKA 1ABBA 5FA6A 1ZP6A 5J2TF 4G07A 4LSWA 4NJMB 3SZUA 1QV7A 3T0GA 5AJVB 2H0AA 4MW5A 4B6GA 1AHPA 3IEVA 5EMMA 1AM4D 3UUWA 3VOAA 4F5ZA 4BN4A 2QRHA 5DI3B 3PPIA 4LDNA 5JSFA 4V1CA 2VH2A 1CQIB 2J5XA 3SN6A 1JQDA 2VZ8A 4ND8A 2PZEA 3HXMA 3MCVA 3OJXA 4R8MA 2GNOA 4MGHA 5G0WA 4AO7A 3PEYA 2PLNA 3BDIA 5HMMA 3Q5DA 3COWA 3G1WA 3FVRA 1MAVA 1Z8DA 4Q4AA 2Q5CA 1RWMA 3G6KA 4LDJA 5AIAA 2B92A 2XXJA 4PGGA 5HBRA 4YAFA 3UPUA 3ILYA 3ZDEA 2BFOA 2ZVJA 2BEUB 3T1TA 3VPXA 4MKHA 2I76A 1X7HA 3K0EA 4RJIA 5ICCA 3U6KA 2CFTA 2WSSD 1MB2A 5EESA 1FNDA 1ZSVA 5HIJA 1WG8A 2ZT8A 1Z28A 4KN9S 5EQDA 1RQRA 4OK5A 3E58A 4EPXA 1X8KA 2WWWA 3FYCA 1MW9X 1ZESA 2BBTA 3Q3JB 4QGGA 1TQ6A 3P20A 4XUEA 4RTNA 1GGEA 1TYBE 3L5OA 4PNHA 4B4WA 5C5DA 1ZOSA 4B2LA 3W7AA 1MNAA 3GNLA 2X7JA 2G82A 5DCUA 2G5GX 1L4BA 2GK4A 2C29D 5DM4A 4B46A 2Q3EA 2HGZA 2D5IA 4C78A 3JQ9C 1JFFB 2FMFA 5JQGA 3ZLJA 1J5PA 1WY7A 1DV2A 1GDHA 4DJJA 2A1IA 2W98A 2OCBA 1UKVY 3WS7A 1OJ7A 2WF7A 1QPZA 4XIJA 3E82A 5AR1A 3O94A 4C4XA 1XKLA 1MT0A 2CHUA 1MJHA 1HC7A 2GVZC 2OHHA 3A1WA 2X9LA 3AHCA 6Q21A 3JQFA 4UXJA 3BMCB 5U9CA 4DQUA 5TT0A 4KGDA 2YIDA 1PGPA 2FDXA 5D3QA 1MQ9A 3RS0A 4CM1A 1ZOPA 4FIZA 4MRAA 3PTLA 1A9TA 5FOWA 5KTMA 3QE3A 4ISBA 1C50A 4AUKA 3RADC 1W35A 3VKUA 3CN9A 2ZJZA 1P1BA 1ZH4A 3PEUA 4P86A 3HSYA 3LQKA 4JJAA 2A86A 1HI9A 3REGA 3ZCRA 4YCLA 1EG2A 1W581 2QMZA 5D86A 5ICEA 1RAAA 2CHGA 2PRKA 1T0JB 4B73A 3IR7A 4QDKA 5ALNA 3MWEA 1ZGAA 4JK3A 4XX0A 1FFAA 1V4NA 1FMTA 3JQ7B 4WK6A 3TGWA 3VSDA 4Q0MA 1VE6A 1IB6A 2W0SA 3CZCA 2I4RA 2B1JA 3R0ZA 4G01B 1XMPA 3STUA 1DIOB 5HCNA 2VTEA 2O3QA 2ZE8A 5BSTA 1X7YB 5LIRA 1AMOA 4H7EA 3GLGB 2YW9A 3OU6A 1JEYA 4N5NA 4X20A 4CDMA 4OXIA 1Q1GA 4J0CA 3UC5A 1VHTA 2Z4SA 2GSDA 4K6KA 1ZVQA 4TMXA 1QH8B 1NBMA 4KE9A 1H2XA 4KOAA 5SY6A 3Q72A 2REQB 4YJHB 3KJQA 3ENKA 5D6NA 3GXBA 3LPMA 3PQDA 3T7KA 4D9KA 4FILA 4U3JA 1V39A 4HS4A 1EM6A 1NE7A 4YCJA 1E0JA 3LIIA 4LOJA 1JS1X 1DC4A 4X1IB 3W2EA 4F12A 4F4HA 5TPWB 2Y27A 1JTEA 1M2EA 4UUOA 4JI8B 1OHHA 5HTKA 2GSWA 4AJOA 4OH7A 3CW8X 4WBNB 3V8VA 4J9UE 1MO6A 3IUPA 1OWOA 2P1RA 2J3LA 5KHOC 1HQKA 1AJEA 2Y0EA 1FZQA 2A8YA 4C7JA 3L0IB 4RZSA 1LV8A 1E9CA 1RXUA 2QE7D 2P3QA 4NEHB 4YI3A 4R2MA 3WLSA 4NFLA 1WEKA 4FHEA 4ROTA 1N5RA 2GKGA 3EYAA 2BCEA 3R3YA 4IHQA 4JBLA 4JL8A 4G25A 3P9IA 4K9MA 5C1IA 2AEFA 2H2DA 4ZOAA 4IDEA 4GOXA 1FUIA 4HLDA 3WWOA 5KTSA 5JZOA 3LPLA 4WX2B 4MVJI 1NMYA 5KKAA 2ZAIA 3JWHA 5AK3A 1G98A 1LEHA 4F6CA 1S7CA 3VPCA 5D3MA 1KEUA 3I52A 4AF7A 2ECQA 2ZRGA 3HZZA 1ZM7A 4KLNA 5JCPA 2ADMA 1D04A 1OBHA 1RI1A 3H13A 5JU6A 4FHFA 4ENWA 2G36A 3PEEA 3UCEA 3PR3A 2G17A 3U1VA 2BCJQ 1CX9B 4RKWA 2GEKA 1MR3F 2QXUA 1GL9B 2RC6A 3F6EX 1IONA 2H11A 1MX1A 5DX8A 4QLBA 4MUBA 4JBGA 3UNXA 3HJFA 5C1BA 1K0UA 1NQAO 3D7LA 1IK6A 2P6PA 4MQUA 4NPHA 1WMFA 4YBZA 1VJRA 3SE7A 2O59A 2CXHA 3P9RA 1XZQA 3H5NA 2BTQA 3QELB 3EVGA 2AV6A 4FOOA 4INZA 2IFTA 5HK8A 4ZCRA 2JLCA 5HKKD 4TLCA 1NL3A 3K32A 4TRNA 2ZFUA 3DULA 3RLIA 4Z3KA 2CNKA 3V1KA 4C4SA 3V4ZA 3LBNA 1TUGA 2V5VA 3HVKA 1TVMA 4OPMA 4QTYA 1U5AA 5IXJA 5JNRA 2B69A 1XVTA 2P69A 1QP7A 1OMOA 1QIJA 1UDRA 3RAFC 4AMGA 1TO1E 2BFPA 2F6RA 1XDZA 4N6NA 3OZSA 1HZJA 4TQAA 4LZLA 2GAAA 2CL0X 3ZLVA 2RGYA 4BKOA 4OJYA 3GWGA 3DVRX 3K94A 3DR5A 4Q6BA 5B53A 1W6RA 1TUIA 4Q34A 3AR6A 3R8FA 3FFAA 4ECEA 4X84A 3D0QA 2ONZA 3GHHA 4U2BA 3NRCA 4QQRA 1G3QA 2WFLA 3I42A 3LQ1A 1P7WA 3WZ2A 2QJTA 5HOQA 5KWSA 3CF4A 2BGUA 5LLDA 1Y8QA 1OI4A 2HUPA 2Y1WA 3QOYA 3LRTA 4ENVA 2ZYRA 3OESA 1H2RS 4XGNA 1LH0A 4EMBA 2J9GA 1T13A 2Q8NA 3H8WA 2BFBA 2PQ0A 3SYMA 5K0ZA 5FUYA 3CIOA 4A2CA 4XWAA 3NWOA 1EHIA 4OM8A 3HBNA 3HDGA 5B2ZA 5TQ2A 3NHJA 1IY8A 3W79A 2WBLC 4BJ1A 5T6MA 5CK5A 4DA8A 1O6GA 5A9RA 4UAVA 2EWWA 3AW9A 2HO5A 1HLFA 4FD2A 5IT5A 1FUYB 1GCGA 1OCEA 2JFYA 4OQDA 5D3ZA 3KZ1E 5KNDD 4S2UA 2E9SA 3V4VB 4J1SA 3BSSA 4KI7A 3QEAZ 4XUCA 1PT6A 3D4NA 3JQ8B 1LXCA 1ZJ4A 3NVMB 3OBBA 2COUA 2JGDA 4UE3S 3WHLA 1RBMA 3GUVA 4K86A 1JVBA 4M9QA 4N48A 2GVDC 5L7YA 3GROA 2V54A 3NWJA 3R8CA 5HE9A 4BNKA 2IH4A 3JALA 3TMKA 1UEIA 5SYNA 1L8LA 2C5BA 2CLSA 2PFGA 3DE7X 1RM5A 1ZOIA 2YL2A 3ZOKA 3D4PA 4MULA 1FYVA 1KMMA 3FIUA 4UPDA 4ZCQA 2HRBA 4C6TA 1AV7A 1O94C 2PRJA 2XZPA 2XUKA 3ZCUA 1FE8A 2HRQA 2KYRA 3QKRB 2HD4A 3AVOA 3PNMA 1SWVA 4LHVA 4ZEXA 3TCXB 4PHCA 4F1JA 3OQOA 2B6HA 2PLRA 5JJIA 1NVDA 5FF9A 2CMHA 1PEAA 1JSCA 3AW8A 2O2ZA 1LTQA 2YOFA 4RD0A 5FR1A 1ETUA 2EDAA 5B57C 3D5EA 4LFAB 2ZXEA 1I3CA 4G5GA 2ZT5A 1IN5A 4Y7DA 5ALRA 3W3AH 1P7YA 3HK2A 4BVKA 3LLVA 5BO5A 1XIVA 3NGMA 1MVLA 1EWTA 2Y67A 3AFHA 3A2MA 4JB0A 3DE3X 4K6CA 4QRIA 4EELA 5EHQA 1RWOA 1DZ3A 3DNMA 3Q7RA 3QQPA 3BSYA 1TQDA 3COPA 2ODWA 4NS1A 1BXRA 1UPBA 2QL7A 2TSYB 1EUDB 4GM1A 4EZEA 3R24A 1VMEA 4MQLA 2HL6A 4DDKA 4CLXA 1AX9A 3H0KA 4M46A 1H6DA 3HN6A 4K9SA 5AKHA 5CVEA 5BWMA 1PNRA 2WSMA 3VYWA 5A4AA 3M6XA 5HJEA 3AVQA 1GILA 1T5IA 2GJAA 1Q7TA 2HF9A 2QY9A 4AK9A 1NR1A 3EEYA 4W8HA 3ROXA 1ZISA 4EJ6A 4DLZA 1I32A 1C81A 1RYEA 1D2AA 3PGMA 1JKIA 1I36A 1ST2A 3W6PA 4FEAA 4EA9A 2Z6AA 1AKQA 3O4FA 4PYQA 3V97A 4O33A 5DN6A 1UBEA 5EMNA 1C4OA 5K3BA 3TN7A 3AVPA 3SMVA 2EZ9A 2JA1A 3V7FA 2CJWB 4DUGA 4TN5A 1QHXA 3EXIA 5KKCA 3GCXA 1ZIDA 5ILGA 4WY2A 1OFUA 1G7RA 1L3CA 4O5OA 4FNAA 4QA9A 3GFFA 3PFBA 1V9LA 4MPRA 1HORA 2A3NA 2G9VA 1RYBA 3NHKA 1FP2A 3VR4H 4GM0A 4PG6A 2ZR9A 4ZVLA 3OX1A 1TC1A 2XMGA 1LNZA 421PA 4TKLA 1V2HE 4MDHA 2BFDA 2DPMA 2GM3A 3FI9A 4UFOA 1PFKA 2PS0A 3RLFA 1CUFA 3HY3A 4ZZ0A 2Y05A 3BH7A 3H2HA 2E37A 4Q9LA 4L08A 3O3MB 3QBVA 2Z1MA 1SC6A 3TGPA 5D8DA 1RXWA 2AXEA 5J2TB 1WUKS 4O2BF 4J1TC 3PNOA 2I6GA 3RE1A 1Z4KA 5HRUA 5JSUA 1T26A 3LA8A 4X0EA 4BFVA 1QOQB 3ZK8A 1KA9H 3G8DA 4P7BA 1FRNA 5IC5A 4ND7A 5JR3A 4UUMA 5DBFA 4HAOA 1N1MA 3BCUA 2X0KA 4YRDA 3FMIA 2LCQA 4IICA 1DWOA 4EGCB 3CNBA 3H87A 2EFJA 4QSMA 3RCBA 4NDZA 3HO1A 4CMCA 1U7XA 1B00A 1PR6A 4JYPA 4EX6A 1GR1A 2VCHA 2PK3A 2ACKA 2AKYA 3JQQA 4MRVA 1QH0A 3CLTC 4DN6A 1Q16A 4BXOB 2Z1DA 2BGWA 1OZ0A 4RADA 1WOYA 1RIIA 4E32A 3DTVD 2QN9A 3RU3A 3LE8A 3K6SA 1QS0B 4GMKA 4UW9A 4EVSA 2D0IA 4C88A 2D1YA 1F6WA 5FPTA 1N6KA 4O4HF 3IA2A 5A6SB 3BICA 4B8YA 2ZJ4A 3AF5A 4HB3A 4ZHQF 2IY7A 5J23A 2PUEA 3R5HA 3ZDAA 2CLCX 3D6HA 4PNPA 1NXSA 5JARA 4GT1A 3GGGA 3GP3A 4TPKA 1HLPA 3G7NA 2MYPA 4FD3A 2JVIA 2OXFA 1B6TA 3AERA 4YJ3A 2XCQA 1QCCA 1G5PA 1DAOA 2EVWX 2FF5A 1OX4A 3OJOA 4G86A 1PJBA 4MS3A 4RYDA 3L79A 4MQMA 1GUFA 4BLUA 2RIRA 2QDKA 3ZU3A 1SVUA 1ZGJA 1ZK0A 3FSRA 1MGOA 4LXUA 5HRCA 4GXNA 1QG2A 3EDCA 8GPBA 4C6RA 2D1SA 3P8ZA 1H0RA 3H2JA 1GPBA 3MMXA 5GVRA 3C0KA 1BQ4A 4ZAZA 1L5QA 1K4MA 2NTVA 3LH5A 3LO5A 1P1JA 3S2EA 1QK5A 3DQPA 2EFHB 5F3DA 3L7BA 1E6CA 1ZD3A 4RQBA 4CNBA 3CKKA 1X1TA 1NRWA 1Z56C 2QYHA 4MR8B 1KDZA 1LF0A 1OI2A 4PZDA 1TZCA 4EA8A 1U2SA 1X0XA 3LYLA 1QQ5A 4GAEA 5JALA 1YH3A 3PLNA 3R74A 5C5IA 5CMLA 3T5CA 1TFRA 1L5WA 1R27A 1A8PA 3BTUA 4WJZA 2YYZA 3WLKX 3VHLB 2FKAA 3HVJA 5AXDA 4Z1OA 4KFCA 1BS1A 1S96A 2WIGA 2GPNA 4DLLA 1O8CA 1F2TA 1QV6A 4Z8XA 4DKXA 1HDYA 2W2VA 3HN2A 1ENOA 1AVTA 4EMSA 1EEXB 3RR2A 4JJEA 2Q9AA 5A62A 1QYCA 3OHMA 4RSMA 3T34A 4PTLA 5L4SA 1AKMA 2X2FA 3PGXA 4EFKA 1AH2A 2B9EA 3ELDA 1JL3A 1V1MA 2J5BA 3OCWA 4GL4A 5E6RA 3FHJA 3L8HA 5H7XA 4DJFC 5H9WA 2H0RA 3BWVA 3WA7A 2C9DA 1VJ0A 3DWEX 3ILSA 4NSNA 2GNAA 3CEHA 3QYFA 3BJZA 5T4BA 3HVRA 2EJUA 2XAUA 2VUTA 3HKDB 3C5WP 3OT1B 2G8NA 4FFDA 3RS4A 1K06A 3B78A 4EGSA 2OYRA 1G7TA 5DM60 2LCFA 4GKJB 5HQ3B 1KMQA 1N2JA 1F2UB 3ZXIA 5AJXA 3ZZUA 4TS4A 3AVVA 1OBFO 1CVIA 4BFSA 2OGTA 1ODLA 2NGRA 2DBYA 5JC8A 1C0LA 2HYIC 3A28A 5I3ZA 3UXMA 5C5EA 5KTKA 4L9SA 5NLLA 3QFTA 4JBHA 3BFVA 3JAWB 2BFEB 3TLKA 2ZIWB 5SICE 3VDRA 2IWHA 3WLMA 2DWQA 5EFZA 5JS6A 1Y9DA 3H8VA 2Q7XA 2ZOSA 3PD1A 5IN5A 1OV6A 1YA8A 3SHVA 2PUWA 2PH3A 1T2NA 4B87A 4AKIA 2VK2A 3QU5A 4N7MA 1A76A 4ZQCB 2C7QA 4R83A 4RHUA 5C53B 3TVDA 2ZUEA 1ZOOA 3PX3A 4BWFB 1BMDA 3H2KA 5DHFA 4BRZA 2AX3A 5A9TA 1S3GA 3G89A 4IAOA 2WYOA 2LXNA 1R00A 1TB4A 2YS6A 1W47A 1JAZA 3D43A 4LBVA 4PIMA 3FRIA 1JDNA 1MCZA 2VUIB 4YUAA 3R41A 3HP1A 3DZGA 4KQXA 3UH0A 3RUHA 4A23A 1NVAA 4DCNA 3DEZA 3I9V1 4LJ5A 3VR0A 1D3AA 4IL5A 1BG6A 2REBA 1S2IA 3FKQA 4LX8A 4QZVA 2X41A 1RKXA 2NO6A 4RK1A 3T4XA 1PX0A 2R85A 5I7WA 3WGGA 1INLA 3G2HA 3OEYA 5BYAA 8AT1A 2CXUA 1GG2A 1MDBA 3AY6A 1JHAA 2FB9A 3QKTA 2QX4A 4GW3A 4UBKA 5AW0A 1XCMA 3NHBA 4GPZA 3EJWA 1D1PA 3IUMA 5C37A 5EIHA 3DEAA 3THOA 1RWQA 4EK9A 3MJHA 2QTMA 3QG5A 2BI8A 1K98A 1ZGZA 2H07A 3GZNA 4B6SA 3NTRA 1VSTA 2YXBA 1T9DA 4LY9A 1FYDA 2C78A 4XIYA 3OZRA 3DSRA 2I7XA 5FI3A 3DBIA 3RUPA 3R5XA 4Q1BA 1GTZA 2W6PA 3ZW8A 2H7XA 4B0PA 1YJAA 3HBMA 2WC1A 3PKJA 1T1RA 4F2HA 3U56A 4P0PB 1CRPA 4NCBA 1SBYA 1ULAA 4C0BA 3K96A 2WQ7A 5LKRA 1KPHA 1U28C 3IV9A 3QVJA 4LE1A 3V4OA 4HX2A 4OXKA 1EGVB 3W06A 4HJXA 4FU0A 5DGHA 4JQSA 4FX5A 2WSYB 2EFGA 1N9ZA 2XNDD 3S5JA 1RNLA 1QM5A 3WC4A 1SQGA 4LOAA 2WTBA 4AROA 4E6EA 2VQ6A 1WXWA 1GPMA 4FFBB 1X1EA 2GS9A 1QCDA 2CDAA 2PDAA 1KVTA 3OUZA 1EFRA 1S2DA 2HADA 3EW7A 1G60A 3I4CA 1VQ1A 1VSUA 2VN8A 2BBSA 3SC6A 2VJDA 1I30A 1IRIA 1WHSB 3LM8A 4BTLA 1XU4A 4X66B 3LXXA 4MB2A 1P6QA 3H5TA 1T9CA 1UC5B 2LR0A 2P27A 4FQ7A 3PHCA 4IS2A 5AI6A 2ZANA 4ZJUA 5KS2A 3VYUB 4URHA 2ZSDA 4X61A 1VG8A 2GAJA 1UBTS 4NONA 2AH5A 4AZVA 2NPOA 2PX8A 2W6ID 4IDHA 1Y5NA 4HZGA 4G3XA 4PLZA 1QK3A 4GU5A 1SVMA 4HV4A 3CISA 1XZFA 2WG2A 1NATA 5AH0A 2YV4A 4M7PA 5DK4A 3DWFA 5LLSA 4DQXA 1M8PA 1SULA 1K9SA 2PG3A 1XDUA 2OORA 2FEKA 2ODAA 3RWMB 3T3MB 3U4AA 1B16A 2ECPA 4D99A 1R8SA 3INYA 5BVGA 3AIOA 3GUHA 4FHCA 2UZAA 3MJRA 2ZBUA 3IOMA 4PNEA 3GLSA 5FXMA 2DTXA 5AFSA 2WZQA 1XNRB 3LUHA 3KS9A 1UF9A 3IKMB 3SZGA 2IDMA 1KH3A 1Z8NA 2QB5A 1P17A 1YB2A 2CFRA 4RETA 4JJ4A 4TWJA 3RQSA 3U1BA 1ID8A 2Q2WA 3CJTA 1HZZC 1RRPA 2ZI6A 4Y6SA 4CV0A 2A84A 2EERA 4AMZA 3L1VA 5IK2A 4RTMA 1GG5A 3ROZA 2W2NA 2GM4A 3ED5A 1KMHA 2ZXUA 1IK4A 2PD4A 5EMLA 5AVJA 3SI7A 1D0SA 3W2GA 2WYWA 2O8VA 2YJ5A 3A1TA 1WHTB 2B6NA 3GJ4A 3IVMA 3MPUA 4BNMA 4QTTB 4RNCA 3K8YA 5KREA 4EW1A 4U1RA 4WW0A 1Z83A 1UJBA 3SQLA 5G53C 3EOBI 4B6FA 1N4DA 1GRRA 1WOMA 5E1MA 4C89A 4LV5B 1M6VA 3JQEA 1R10A 3QLTA 2HPAA 3ZWAA 1GRCA 4MR9A 3QE4A 1MH9A 1HNNA 4UMEA 4CKEA 2LKCA 1CYEA 5HUHA 2IXDA 3GEPA 3JWGA 4MIOA 4PLYA 5LZ7A 2JFGA 3EVNA 4RCVA 2HZBA 4TROA 4A7PA 3TUZC 2FZLA 3V4FA 1PL0A 3IUYA 4BNJA 4XSHA 3X2SA 1KR2A 2VHVA 3AKZA 2MHCA 2JCXA 3H5AA 3I3OA 1XK6A 2O06A 4LSZA 4QTZA 3V8PA 4XKJA 4OATA 3D8HA 2X13A 1AHNA 2IYYA 2Q27A 3BHJA 3ONEA 3TDMA 4Y30A 1UPXA 4Z8YA 2QAIA 5IFLA 1AXGA 3WOHA 1HOTA 2Z43A 2YWEA 4D9NA 1SCJA 3RS9A 5ALGA 3OX2A 4X63A 2DJIA 3FWKA 2YN4A 5JXWA 1YSCA 2OMEA 1OZAA 1RP7A 3CVOA 4DB4A 4DLUA 4ZZ3A 4BY9E 1QHGA 4MUHA 5ELMA 3BK7A 3W5AA 3HB0A 5HKLA 2OV8A 4QNRA 4RLQA 1T0HB 3OEWA 4DBZA 1MO3A 1UZNA 3CVVA 3EWIA 4MVCA 4FGLA 4BKQA 3V00A 1RC8A 2IH5A 5IARA 5KOHB 4IMPA 5CA0B 5LQMA 1F2VA 4EDFA 1GU0A 5ALQA 2C3PA 3ZWWA 2Y1DA 3E3MA 4IO0A 1F1BA 3O26A 4PLPA 4NXMB 4LISA 3TR6A 1FYEA 3A7EA 3L7LA 1VHWA 1EX9A 2X8BA 2Y1LA 5LQNA 4DKJA 3CF0A 2AMJA 3C5VA 4AKEA 1JFTA 5EQJB 5LPNA 5A0FA 3W5CA 1R6DA 3D2LA 3KXDA 1M2NA 4LXGA 1OREA 4HLUA 4K03A 2Q6VA 2IYXA 1N0WA 5TF4A 4KX3A 4LJAA 1DBWA 1S3IA 3QPCA 2JZCA 4U5QA 9ABPA 1J25A 1DXOA 2RI0A 2VSOA 4HRVA 5GIPE 3P94A 3BTVA 1U2GC 1ESZA 1JLMA 1ZNYA 1HTWA 3B3GA 4AAYA 1XZLA 5K3FA 3NNSA 2GJ8A 2J5QA 4XJTA 5IDQA 1E5TA 1JIVA 2XTMA 3DUWA 1U2ZA 1V16A 4PX2A 5BXQC 1WW2A 2IPMA 3AOGA 1MO2A 1CRWG 1QYDA 4F2PA 4ZVSA 5CITA 1EEHA 3LV8A 5I7RA 1RHQA 2O0MA 3TLMA 3LLMA 2YJ3A 2CCGA 4TYNA 4H31A 3MTAA 1XR3A 1IBLB 4G2NA 5KVVA 1PDWA 1N7JA 1SU4A 2AK2A 3G5UA 4I9GA 3ZZ0A 5DXAA 2SCUB 1NBMD 4O4HB 4DLYA 1Z2PX 1XTJA 1QOPB 4ZHQB 5H80A 1TEZA 3F4KA 3RT1A 3RV4A 1T8TA 3ZD8A 2KBEA 4R7ZA 5I45A 2X14A 2XIQA 2OHFA 2VZ9A 1XWFA 4KXFB 4TM8A 3ZZTA 4EAQA 2FOLA 5CIQA 1Q1AA 3B70A 4L0QA 4LAFA 4RORA 3VC7A 3G0CA 2Z9CA 5GZ6A 1OHHD 1C3JA 1S89A 1A8IA 5EP2A 3N2KB 3FZYA 3ZU5A 2XRFA 4DQDA 4I46A 3O6VA 3EVAA 1GPUA 2PUHA 1OE0A 2RB4A 4FHGA 4ZOCA 3S99A 1GCOA 2JGNA 1GAWA 2P4HX 4B45A 1W75A 2VXCA 4FFSA 3V1UA 2XY4A 2F9LA 2H63A 3IOEA 2ZJ8A 3RBZA 1KJZA 1ZNZA 2JEZA 4YLYA 1CE8B 4OXYA 2VTBA 3TH5A 2QPLA 4TKVB 3AZPA 2Q5HA 2G0NA 2I2CA 1VKHA 4RPJA 3THRA 4DC1A 1ECPA 1IZ0A 4XX1A 3B7GA 4OK6A 5H1YA 3P9SA 3GRYA 4ZO9A 2YHIA 3PT9A 3BD7A 2NV0A 3TTVA 1T9ZA 4C4ZA 4C08A 5DLPA 2PAAA 1YQXA 3IT2A 1WVMA 2GBIA 3N07A 1WQ4A 1R2QA 2PMCA 3K9NA 3RYCB 3H0EA 2CNBA 5DRTA 4PFJA 4CUJA 1V8FA 4LFCB 3N0WA 3VV2A 3TKLA 1QGYA 1Y6RA 1E62A 1QO7A 1ZNXA 2FR1A 5AK4A 3IEXA 2WWIA 3RVNA 1JDSA 1NI5A 2PSSA 3LX5A 4MSUA 3T5DA 3HPRA 2BKAA 3TTUA 2C3OA 3FYUB 4TV9F 2I6UA 4O4LB 4OI0A 4P08A 1V8DA 2G25A 1OLSB 2Q9UA 3G17A 3IPYA 3KE9A 2Q3HA 2ZQ5A 1JG3A 5KX5A 1G6Q1 1TK2A 3VJLA 1GUZA 1MAUA 3PUYA 2C04A 4JJIA 3CWCA 4JGBA 2HCTA 3NTQA 3BHNA 2CVHA 1YQUA 1TTQB 3F74A 5FCDA 4DPLA 3CZ5A 1IDN1 2CN1A 1NW9B 4KK4A 1B23P 1PJLA 1RTTA 2HB6A 2VRWA 3FCOA 3HKEA 2PWPA 3DEFA 2B94A 1VLVA 3ACCA 5TIIA 2JZNA 5B36A 3LX8A 4NJOA 1BMQA 1J0DA 1YIDA 4FJ0A 4IIFA 4RPLA 2CNWA 5EWMA 4DQVA 5JJBA 4RTRA 4JXZA 2GWRA 4AVYA 5KOJA 2EFDB 3BUSA 4BUCA 1AQ6A 4YRNA 3GW8A 2OA0A 4J94A 3IEIA 4RWZA 1IEWA 3SYRA 5DEOA 4A0HA 4CQLA 1UM9B 1NAHA 2YWCA 5AHKA 1S2LA 4ZD6A 4K3VA 3LSYA 4I1OA 4NWIA 3HR8A 2Q2NA 4CIDA 2XUHA 4WNAA 3VPSA 2AOTB 4U2FA 4NZOA 3WIOA 4Z4HA 4JVMA 2IA5A 5JVDB 4BP3A 1ABFA 1AS3A 1G5IA 1UDXA 3A4TA 3HB5X 1CV2A 5D6OA 2X0EA 3ROPA 4EF5A 5KYYB 2HDWA 3TOZA 3H2YA 2X2PA 2IYVA 4EG6A 3T1OA 4GBED 4MJ3A 1TD1A 3KSMA 5CG2A 2FF7A 3QKSB 1P81A 4TYMA 3A1EA 4ZI5A 2MYUA 1TAUA 1USGA 4CEIB 3GJ5A 5FBQB 4RTKA 1IXRC 1Y8AA 1RRCA 3AGPA 1TI7A 2COKA 3NOOA 3OUTA 4BUJA 2I67A 2FEOA 5KYVA 1GQRA 1TA9A 4WCFB 2BMJA 3LT2A 2RHLA 4GOKA 4HAXA 5GONA 2HN9A 5LBUA 3KLMX 4RWEA 5JCJA 2JJ2A 5KMGA 4XB2A 1SEVA 1DO8A 3THSA 3F5FA 3DTNA 3L7AA 2FDCA 1Y3CE 2QF7A 1DL5A 2RI6A 4YR7A 4BAUA 3K9WA 3R7LA 2YXNA 3TQFA 5TMPA 5CFQA 4GXRA 1CIPA 3HUDA 1U63A 1RCFA 2GZ1A 1E58A 1T34A 1UBJS 4DMHA 2VWHA 2J3QA 4P35A 5A3SA 2A9JA 4V02A 5CB4F 5LYJA 2LRHA 3K5HA 1QNFA 1VOTA 4LCEA 1PAUA 1Y89A 4FT2A 2XPCA 4KQ9A 1DZIA 1UMDB 3PCTA 4JODA 4MQ4A 5IKEA 1V7PC 4XZ3A 3KYIB 1YZNA 4Z9FA 4P4TA 2Q6OA 5K51A 4XEHA 3I5MA 5BR7A 3X1MA 4UOZA 4UXHA 2WVJA 4EM6A 4C5BA 1U31A 3K31A 3U61B 4LUCA 1W44A 3E3LA 3P32A 2QQ5A 1G8FA 1SIBE 2XGOA 1XU9A 4REQB 5IYZF 4CIXA 1F7VA 1ATIA 1OFHA 2BP7B 3QWHA 4BV9A 3KCNA 1HTTA 1Y8ZA 4B4KA 3SSOA 5DWVA 4GUDA 4R7TA 3P96A 1ZYUA 2ZRCA 2FR8C 4X92A 3AB3A 1XA0A 2ZJAA 1ZM9A 3Q5GA 4WXRA 4F3CA 2FP4A 2QW0X 1I4WA 1Q91A 4YQEA 2GQ0A 2PV0A 1U9IA 3DDSA 5EXSA 1ZD8A 1PNOA 3V34A 1AQIA 3NHWA 4R1SA 1AUVA 4KDEA 2IEZA 4Y2RA 4A1OA 5I9LA 3UV6A 5DN6D 3DDWA 4G4JA 5K6AA 3E9RA 4IW3B 3TLZA 4NZMA 4PR3A 4QTUB 1LNSA 4B82A 4DUGD 4ZQBA 4N6GA 1L5OA 3LXUX 4UHHA 3ZVRA 2OB1A 2VAPA 5BMOA 2PKWA 2QY6A 4GYWA 4UAGA 4CM4A 2FN4A 3BSFA 2OCPA 3B3JA 2PMKA 3E5HA 2BEVA 3UAWA 4D4LA 4TT8A 5HW0A 2WMNB 3GFRA 2O1WA 1NPYA 4GMGA 4Z86A 4K05A 3FWNA 4RSRA 2GMWA 1BDBA 5E4YA 3JQPA 5JASA 2XXAB 4HPJB 3H5LA 4RIFA 4MI9A 2O6HA 4CYMA 3UB2A 4YALA 3UXEA 4B3RB 1ZD2P 3FKSA 1S1CA 2I3AA 4B3BA 2JFZA 1K8XB 2FWAA 1BYUA 4FMCF 2X22A 4RS3A 5DM1A 5C7YA 5AVWA 3ODGA 2FZGA 1XFDA 2X0JA 3I83A 1M2VB 2ZRPA 5FTNA 1BOOA 5HILA 1ODJA 3HG7A 3I61A 3FBGA 5K8TA 3OETA 4RJJA 1FFYA 2G7ZA 1XTRA 2WYHA 1Y6GA 4CZ2A 5DIZA 3TW6A 2XCUA 3OPMA 2BLLA 3DBHB 4O3FA 2FYTA 1RRGA 3L8FA 5TXGA 2Q7OE 3X2FA 4ZFNA 3A6KA 1EDZA 3ANMA 2ZBDA 3EB9A 5HK9A 1M3SA 3EZNA 3MSXA 2FK8A 4KAJA 3RF6A 3UGQA 3TW0A 4QARA 3DHWC 1ISSA 4ESVA 3M3HA 3FB1A 4TXJA 2C2YA 3HUUA 2F3TA 1E3QA 4I36A 1H2BA 1DELA 2E21A 2FPXA 5AKXA 2E5WA 2AEMA 5AVOA 3W6UA 5FPKA 4EKNB 5I7UA 3VZQA 2XD4A 2A94A 2OCYC 4QDOA 2VZLA 2QRVB 3JD0A 2PVPA 2FZ4A 1DKLA 2OO7A 3PXAA 1IIBA 5G3ZA 4K9NA 5JJ5A 3L8EA 4FFNA 5FQOA 3P4XA 4H4DA 3F5QA 3WAJA 3UMCA 4JU9A 4Z9XA 3BCSA 1BE0A 2FPUA 2VPPA 1J1UA 2NUPA 4Q9DA 5BR1A 3F6BX 3NC4A 3EGOA 4JLOA 3FNBA 1U7TA 4UCWA 4AYXA 2FN3A 4W7SA 1U2QA 4H35A 1H3FA 2WK1A 2AN9A 3KTDA 4U2CA 1NP6A 3LA6A 1W5EA 1XMVA 3X1WA 2WVHA 5ADHA 2XZOA 2RFLA 1GTG1 2VJMB 3WDMA 4IJ5A 2IVZA 4OHXA 3VO2A 2RGUA 5AOCA 5FX2A 5ALEA 2ZPTX 3T3OA 3SG0A 1P72A 2XYGA 2VHTA 1KRWA 2JL1A 2OT3B 1MBZA 2D54A 2O3JA 2YQ5A 5JMOA 2JASA 4IMIB 4KQGA 1SK9A 3JQAB 3L4SO 1N7IA 1Q1ZA 2PGOA 3LC0A 3B9BA 1SQ5A 2DUMA 1ESMA 2N75A 4IF6A 3ZHTA 3JASB 2CZGA 2CF6A 3HFGA 2Q3JA 2R7NA 3IHWA 4HDRB 4WV3A 1ADYA 5AIBA 3ZY6A 2A35A 3DAHA 1ADGA 2GLUA 5ICMA 4H7PA 4ZCLA 3DFIA 5A1TA 3OQBA 5H81A 3V1MA 1T9AA 3OLCX 1ISMA 2JCSA 4MZXA 1TJYA 5FOUA 2M32A 2ZTHA 4K6FA 2IOFK 4YV2A 3KB1A 4FNOA 4MUMA 2H4ZA 4NLLA 3V8NA 4FFLA 2IIQA 1QHEA 2CMGA 1TUEA 1LWOA 2OC9A 2C9ZA 3LZCA 5B4UA 4YAWA 3PWTA 4QYIA 3VKWA 4LF8B 4IIBA 1J5XA 4DWVA 2HU7A 3NRBA 1H4SA 3R9XA 2ZRJA 2OOSA 1GD1O 2ISQA 3MMPA 4YUZA 1L1EA 3D9QX 1GNLA 4TRRA 3E9ZA 1BC5A 1EVJA 1KZ6A 3IUEA 4LECA 4ENQA 5C4MA 3EIWA 1E9BA 1SIOA 1KXJA 2FWIA 1H2YA 1V0JA 2OHVA 3C15C 3C4QA 3MQFA 4M9UA 5CDYA 5K8JB 4LY0A 5JNWA 2HPZA 3ZWNA 5LWQA 3IMEA 4ZRMA 1WQ1R 4IZIA 2Q3LA 2NU9A 3DE6X 2Z30A 3E4DA 1JVSA 4F4JA 1GL6A 2AHRA 3NZEA 3Q6IA 2MT9A 1NR7A 3FNIA 3ZV5A 1EZ4A 1Y42X 4QPDA 5E3HA 3L2OB 4CDGA 1T10A 3DO6A 4MCHA 1M1YE 1KOJA 2HSGA 3OIWA 4LF4B 2WDPA 5KNLA 2XADA 3VDQA 1CZRA 4DCVA 5F23A 1NSYA 2ATIA 1MOPA 2CMKA 4Q7QA 1SZDA 3GLHA 2WI8A 3NVKI 3O8RA 2F59A 3DWIA 1BH2A 1XTUA 3EZXA 1SD1A 2CBXA 3RDPA 4F1KA 4K6OA 3HZOA 1XTQA 2P9QA 5GJWC 1CR0A 2D8MA 1IMOA 2OM6A 2XTAA 1PSDA 1RBYA 3A36A 1SU7A 3TR5A 2GHIA 3HC7A 1DG3A 2H1WA 4CG2A 3KXPA 4OMFG 1X42A 4B8WA 1Y98A 5AJTA 2DBVO 4RHEA 4URWR 1GFIA 4I3FA 3SS8A 4DDMA 2NYUA 4LVOA 5PGMA 1D2CA 3B82A 4P4GA 5KQMA 3I4FA 4H7JA 4UZFA 1DOHA 1MOQA 4JLAA 3UWDA 2I5PO 3NT4A 3UT0A 4G26A 4TZ6A 4I1IA 4Q21A 7MDHA 2YDYA 4EYEA 4RPGA 1E92A 3FHOA 1JR3A 2VJQA 4FFMA 2P6RA 3NHSA 1J20A 1BD4A 1FY2A 1JXAA 1GUYA 2PBZA 2Y0BA 3KU4A 4G85A 1LB1B 3DT8A 4B83A 3B9RA 3MCWA 2M6RA 3WK5A 4QO8A 3NBKA 1LSSA 1AF4A 1E2EA 3PFGA 5DTRA 3SF8A 1IEXA 1ZSNA 1IOZA 2XB8A 2YWXA 2NPFA 4E5SA 4HNVA 2XD9A 3DLTA 4KPUB 4GKVA 3RW9A 3NM5A 3M6WA 3AU9A 1YE8A 4RPIA 4QBKA 1TVCA 3TOXA 2AW5A 2OO3A 3LFTA 1QKKA 5A3RA 1M34B 2XE4A 4EEZA 3LD9A 4KDRA 1WCWA 2Q9CA 1UQRA 3KQTA 1WETA 5FOXA 2HIGA 3HACA 4NMMA 1LFDB 3EPKA 1IUPA 1OBOA 2PVCA 3C6QA 1BVUA 4G5YA 1TIPA 1UK8A 3O91A 4P5PA 4R41A 4WXEA 2ORWA 5ERYA 1P5FA 4BNDA 1GTL1 1H3EA 1AZWA 2WA2A 4R40A 5L3SB 2IP4A 3FNHA 3OCCA 3A0RB 4E0BA 2ZWVA 1C7RA 1KSGA 3GDFA 1PEYA 1TAGA 1UJ4A 4A2QA 1ONNA 1YQWA 2KBFA 4I1YA 3KU1A 1C4KA 1EFRD 4WESB 1P2BA 3HXTA 3HYLA 1NLZA 2XCIA 1X6VA 2EFCB 5FLKA 3PITA 3RQIA 1AXEA 2VHWA 1WBDA 4LRYA 4DDWA 3ENWA 4RCZA 1YFJA 3WL8A 1DC6A 1KYTA 1RLTA 1VDMA 2A0FA 3KLPX 5HF5A 4BFTA 2IU4A 4CDRA 5AW8A 5JS2A 4X65B 1OTYA 1VKJA 3L7CA 4V0ME 1BWRA 3LQ2A 4DAEA 1NUTA 3QXGA 2F1OA 2W93A 2NO4A 4I8DA 5JD5A 1U8EA 3ZE1B 4Q16A 3CA8A 1QKIA 4O2LA 2C4KA 1HXHA 4D97A 2EFEB 4QBTA 4G0XA 2QVGA 2LD4A 3A31A 3CNLA 1KPIA 5HF6A 5DBIA 4Y2PA 5T5QA 1F1JA 1IYZA 2UYOA 1AB5A 4M1MA 3C7CB 4IX9A 4R9NA 5IAKA 4BU0A 1J0CA 1GSIA 1RLIA 3MWDB 1V37A 4R98A 1EK1A 1HR0B 4NL4H 3R9WA 3OPYA 3VR3A 4F8EA 4BZQA 2C2WA 1JVNA 2VK4A 1Z37A 4LZZA 2PGAA 4MVJG 2DERA 4TTRA 2VPXA 1LX6A 1I13A 5CM8B 2YXPX 1V1JA 3CRW1 1E2BA 3ZD9A 2ZK7A 2JIMA 2HLPA 3T1QA 1WF6A 8ABPA 4JXXA 1PZEA 1I80A 5IK2D 1O2DA 5GOTA 2ZW9A 5LZ5A 5AYVA 4F5WA 4QFMA 5F3RA 2JGEA 4RGQA 1X1SA 1U1DA 2BKXA 4D9IA 1RXSA 4C0WA 1NKTA 1TJ5A 1NOKA 4RD6A 1DTSA 3UMBA 2X58A 5C1DA 2XYPA 4OA8A 4PLHA 3RREA 4WZBE 1DX6A 1TT5A 3GLQA 4MS1A 1ZIXA 5KWVA 1LLFA 3QVKA 3VC2A 1H94A 4M8IA 4CJXA 1T6NA 1TMKA 3KTFA 1WDLA 1VJ1A 3U0VA 2WAAA 4YO7A 4RE6A 4QU5A 5AJUA 3W5DA 2BM9A 2VKTA 1WM1A 4M0MA 3HBAA 3IMCA 5E1BA 1H2ZA 1VKOA 2VVTA 2XMRA 3ESCA 3V1LA 3SWWA 5G0SA 4EUFA 1XHLA 4QVKA 4TS3A 3CEPB 3KBOA 3UUGA 2OK7A 1V5WA 2O57A 2C2GA 3NH9A 1Y63A 2X2EA 4GZ5A 2ZSKA 4MS4A 1FJ2A 3VZSA 5IYZB 3BX1A 4OP1A 5FOTA 5JECA 4X3PA 3W9SA 2XQGA 3NPAA 3NKLA 3M9WA 3S27A 4R8SA 1U5BA 1Z2OX 1XXLA 2Y76A 3O1JC 3TTXA 4EX7A 1EHCA 4WK0B 3TNJA 2JPDA 3H17A 4BO5A 3ROMA 4EYOA 3U4IA 4EPTA 4F3RA 2IHYA 2AJCA 1VTKA 2XMPA 3ANTA 2I80A 5JD4A 3L18A 4MUNA 3RHTA 1UFRA 3AGQA 4HAVA 1GG9A 2FUCA 3TG8A 1IQUA 1R0RE 3AFOA 3K0CC 4LNUA 5FNVF 1QH1B 3R7WB 3RBXA 1VP3A 4GE3A 2CNNA 3WNVA 2NU7B 1TM1E 1CB0A 2BSAA 3U4DA 1Z5PA 2PGDA 1SZCA 5EXDA 2Y2UA 4FC7A 4P0QB 1XZBA 1E4EB 2OGUA 3EWNA 3GT7A 5ECYA 2WQZA 3K1TA 4NQZA 3N0RA 1TJNA 3PJDA 3WK4A 1KKUA 1G8MA 2CWDA 4HQRA 1RYZA 2C7BA 2J0UA 2OAGA 2DQ4A 4MYCA 4RHCA 4F4CA 4AJPA 1N78A 5HCUA 1F51E 2CEKA 2G67A 2ALJA 4XASA 5REQA 1V11B 2E4UA 2H0QA 5DLDA 4F9EA 2EEPA 1XZMA 1M5TA 4HNHA 5GZ1A 1PYOA 2Q5OA 4WY5A 2NUAB 1H9BA 3PQEA 2JGMA 4HL6A 1VSVA 1DCFA 2AG1A 4E11A 5FKJA 3STXA 2JCVA 4KXNA 4G5FA 2GDJA 4DMGA 3LC7O 1OH6A 1QVRA 2ZCVA 5EMJA 3MA0A 3JARB 4FOPA 1P60A 3NUGA 4H4CA 4M6WA 2JIQA 4OV6B 4F46A 1Y9AA 2VOEA 4YMHA 1RADA 1COWA 1Y5LA 4ALJA 4BNZA 5IMSA 2EZTA 4MQEB 4UU8A 1T3GA 1OBCA 3F7NA 2IYZA 1XZDA 2B36A 5HKAA 3H9QA 1O0SA 1OLXA 3LECA 4FW8A 5FNZA 1BIFA 1EUYA 4KR7A 1OROA 3RVDA 1MV5A 1K5DA 1KI1A 5AQEA 4Z53A 4TMFA 1B14A 4LGCA 1XT6A 2X42A 4H1UA 3AMVA 4HXFB 2Y1FA 2GNPA 2YMLA 3DBVO 1DQSA 2QD4A 3PPYA 4NABA 4KC0A 2QN2A 3HJTA 2ID7A 3GT4A 4LYJA 4CNQA 2O8NA 3EODA 4BFYA 4QXQA 2HQRA 4BCCA 5K5EA 5IZCA 2XH8A 3RVBA 3PVCA 1QFYA 3QU4A 1N32B 3PHHA 1DE0A 3W5BA 1KYZA 1VJ5A 2X4IA 1PG2A 2FW0A 2OLKA 5EUQB 4KHPB 3GELA 3M6MD 1QG0A 2LCIA 3PB3A 4PNZA 5DHTA 2HKIA 1X7WA 2R1UA 1LSOA 4KGVA 4DC0A 2J8ZA 2VEOA 2WHYA 3QH4A 3P0JA 1M67A 1NVEA 2HQBA 2CFOA 1FXWF 3ORFA 4IVPA 4L9RA 3W5JA 3WADA 3GFVA 3T0FA 3L1JA 4N7JA 3I04M 1MU0A 2HFJA 4HLNA 1HSOA 4LF9B 3NDRA 1CR6A 2CVPA 1XJQA 3DE0X 3GAMA 3UIEA 3W8RA 2FXIA 4GQIA 3T3NA 4JY7A 2JBAB 2GN8A 3S2FA 3OZWA 1PO7A 5D3KA 3NDBB 2GHRA 4TS9A 2YDXA 1P9OA 4WNYA 3G0OA 4I5FA 1KBQA 4XIIA 5K0BA 3L8GA 5KNCA 5BUQA 3ANXA 4JLDA 3F9IA 3NKFA 1Z4MA 4M54A 1KEPA 3D7MA 2CLHB 3TOCA 1WVIA 3WLAA 3U3DA 2QRKA 3OQNA 3QMMA 1KGSA 1X70A 1CU1A 2CY0A 4JB8A 3ROEA 4CMGA 4BEBA 5IH7A 1EAMA 1A82A 2Q6LA 1SOMA 2OKGA 4UUQA 3S1AB 1NVKA 2VL7A 3KHSA 4M86A 1DTWA 2J6HA 4YRTA 1PLKA 1CR1A 3E9EA 3ONVA 4M0PA 1S9DA 4UJ3A 4ZAGA 2C98A 2FHSA 3H42B 3TL6A 5BSFA 1WCIB 2N3ZA 1FLAA 4AP5A 1KR5A 3CURA 2WT4A 4DTCA 2JDIA 3PDIB 1JDUA 3NIDB 3GNSA 2OD7A 3QG1A 3QUCA 4AURA 4AKGA 1ICEA 3HUTA 3NEAA 4IMJB 4RMNA 4L6IA 3ZE6A 2O8FB 3FYUC 1O97C 4I55F 3OKAA 2UZ1B 2X8AA 1GL7A 2HEIA 2ZG6A 3EDQA 3F8WA 4JP5A 3IDZA 3WDKA 1PHRA 5SZJA 4UVIA 3CRRA 1A7KA 3JR7A 3LUCA 3EWAA 1V35A 1IHYA 1WZNA 1K6EA 3JQ9A 3UWKA 5F51A 4AZ0A 1M2FA 4RTOA 4C4TA 1FW6A 4HB4A 4V2UA 2JS7A 2HJSA 1AQYA 5BSGA 3A1SA 5K20A 5EQTA 3DKIA 1FX0A 1RKBA 4G6ZA 3VTFA 1T9BA 1E9FA 1DQNA 3N2YA 4DR4B 2B98A 3ENQA 3LCMA 3ZXYA 1ZH6A 5CPFA 3NC1C 1WUYA 3T9DA 1HT3A 1T2EA 5DTIA 2LE0A 4FFPA 4FM9A 4ARUA 5BWCA 1T6ZA 3FSGA 4F3YA 1CPYA 2I1VB 2MSEB 2IU3A 4CM5A 2IW1A 4KYTA 4Y1FA 4A4DA 5JSZB 1PQWA 2DR2A 3BD9A 1O0CA 3HVUA 3HDQA 1Z39A 1Z5VA 3MERA 4IDAA 4L4ZA 4RKEA 1TYDE 2W71A 3LY9A 1JLLA 2ZWPA 1WJGA 2IV2X 2XIJA 3IESA 1T35A 3K3PA 2BRUA 1G18A 4E07A 2DXIA 1JR4A 2IKQA 5DNEA 2GBCA 1YK1A 3ZZNA 3TQCA 3MWKA 4GR5A 1P6UA 4GMDA 1KZ9A 1IOLA 1ODCA 4LV8B 4R8VA 4PF1A 3OZAA 1SHKA 1QF6A 5CXSA 1JA0A 1NWCA 5KDLA 2WHEA 1A9XA 1R4NB 4GNRA 1W36B 2VRNA 4GOLD 3WY9A 3OIUA 2GZAA 3DDZX 4ALMA 4F85A 4Z2YA 4QBHA 1PQ4A 1PKEA 3R77A 3F3SA 4DMUB 2OILA 2VAXA 3KDSE 5IM4A 2QTVA 1DXHA 3C74A 3GLIB 1K5PA 5IW8A 4O2AA 4CPDA 5LOVA 3C70A 4NE9A 4WCFC 1IQ0A 4ID3A 1UBKS 2BZGA 1PJ2A 1XEAA 4KPEC 1QGAA 2AZ4A 1UMBB 2G1JA 2P5YA 1KAEA 2FZ5A 4F9FA 3T54A 2PJDA 4YMVA 5HS4A 3SZLA 1N9GA 3GH1A 3PGKA 1XZAA 2ARKA 2XJ4A 3K20A 2GD6A 2A1TR 1C9NA 3L6UA 4XVQA 2W2MA 4NEGA 4UJ5A 5JCJD 2R5FA 2W2LA 3HV0A 1ISPA 4LBYA 4PC7A 1GPDG 4IIVA 2CSUA 3NBAA 1N2CE 1QQAA 1PFQA 4ZANA 4TMTA 4RACA 4A82A 2IXFA 3DXXA 3MVEA 2WJWA 4ZALA 3O90A 4ILKA 1DBSA 1MQ8B 4PGMA 1O5OA 4LK2A 1UEJA 2QQFA 3Q15C 4XD7A 2BWJA 1EQ2A 1PYDA 3A1CA 1VGQA 3R7AA 2PKCA 3V8RA 4MA0A 3VFDA 4EGFA 2A67A 5KNBA 3T9EA 2ZWIA 3RSOA 3AUJB 4MW2A 2C8VA 1FUEA 4FYJA 4D9MA 5E3JA 3EW9A 3I8SA 6REQB 4HYQA 1MTOA 2HZ7A 4KNWA 2GK7A 3BRWA 4R2LA 4P34A 4ZCSA 4DYHA 5G1PA 1QX3A 3EQ9A 3PC8C 5CG1A 2IYPA 4IDGA 1FP4A 1Z34A 2NVUA 1NBOA 1ST3A 4V39A 3LUFA 3TRHA 4BJ5A 2CVFA 1QGOA 1ML4A 1P6XA 4OLHA 3TPCA 2D00A 3MQ2A 3N70A 4RFVA 1L4GA 2A6PA 4ME6A 4X71A 2IHVA 1YS1X 2EP8A 4WZAB 3KAJA 1XWIA 3MWGA 3TOVA 4BBAA 2LPMA 3N39C 4BV3A 3BXFA 3MEQA 2YICA 3QVOA 4IX1A 2VJOA 1S2GA 1HLGA 4JLSA 4NATA 1XTZA 2A59A 2OV4A 4WCDA 1N6IA 1QBGA 5M5BA 4IDOA 1RAGA 4AZ3A 3A6FA 2GILA 4QYXA 3W2HA 4YIHA 2F3QA 1RJ9B 2GBGA 1E5QA 2OVBA 3NOVA 1DDIA 3O93A 5T4EA 5KTYA 4U2KA 3FB4A 3SPXA 4BZWA 4TUYA 4BV2A 2Y1XA 3EXG1 2IXEA 5KCMA 1ZIYA 5B1SA 1FFXB 4UCXA 2AB0A 2IXBA 2QUHA 3KQVA 3A3OA 3FMGA 4FT4A 1ZVJA 2LIPA 2QRGA 2PWZA 3FVWA 3LYHA 1SOAA 4GGPA 2XSZA 1YZYA 3IHKA 1NUAA 4U8GA 1NE2A 5AJHA 4R1NA 3EK2A 3SXUB 2WD7A 2Z2ZA 1MX5A 3C85A 4DUZB 3QKIA 5FFMA 1H1DA 2FCRA 2XLBA 2V4UA 3LJKA 4UHFA 4DV4B 4PG7A 2O0JA 1ETHA 3FKSD 3VR6A 3OJWA 4LS3A 1WBBA 3EXFB 5G0UA 4BLPA 3SLKA 2ESRA 1TCVA 2CMDA 2AE2A 3FFWA 4GRIA 4HSGA 5LDDC 4NNPA 1P3JA 3HNPA 3GPBA 1XEXA 3R6LA 2OBBA 2F64A 3TSZA 2AI1A 3H9JA 4LI0A 3O8OA 4Q1EA 3IUSA 1IPFA 4DWOA 4E22A 2XMBA 4EG5A 3DEJA 1AUPA 4NV3A 3T4EA 3GLGE 4PLVA 2QSJA 1ZPDA 3HCDA 4FDUA 4MJ7A 2UVPB 4BMSA 1YVUA 1Y3BE 4DIDA 2VA8A 4AF8A 1JJBA 4CG1A 2WTEA 4RVFA 4B43A 2D59A 3K6RA 3M6AA 3LW8A 2DFPA 2VHQA 2WKWA 3FPJA 3OE7A 3DVAA 2R5NA 3CKYA 4PINA 1TL7C 2PM8A 2GBLC 3I53A 2IF2A 4JZKA 4JC4A 1OGJA 4ENTA 3EFHA 3NTLA 3WWDA 1VIVA 2WR8A 5BMVA 3S8EA 2LDXA 4KV9A 1O94A 1XJWA 5LXTF 1E0SA 2IZ5A 5B6PA 1GRVA 3IILA 1JMYA 5GM2A 1T25A 1GFSA 5CVTA 1F14A 4XCVA 5AKGA 2ASVA 2J9ZB 4BL5A 4C0HA 4CGZA 1H6CA 1EFAA 4H9GA 1Y9EA 5B1EA 3WYEA 5JNVA 4FVTA 4GC5A 1VSQA 1QE5A 5FNVB 4ZXFA 3UZUA 1SKMA 1SPBS 1J70A 1G7SA 1SCAA 2GAOA 3QHPA 3SKVA 4KIWA 3VU3A 5AW2A 4RL6A 5JO9A 5TV2A 5BV0A 5C8YB 2ICAA 2FPLA 5IKXA 2FRXA 1RYYA 4YN3A 2ZZKA 4HTFB 5JWHA 2FMUA 1F4PA 2ZUBA 3AIKA 4DV0B 1QTRA 3ZVMA 3FBTA 4EQ6A 3NBUA 2DBZA 5TPZA 1E1DA 1EVIA 3UM9A 5AKJA 1LI5A 3D1JA 1KORA 3LQQA 3SC2B 2PD3A 4BO7A 2WJ6A 1LZKA 1CJVC 2JFHA 2NUBA 4N8EA 1RWXA 2V7TA 2VDWA 3UG7A 1I1HA 3NPMA 5MN4A 1HY3A 1OI7A 2O8EB 3OJEA 3L4KA 4FN4A 3EZ2A 3SCZA 1XZIA 1CFZA 2PMBA 3MINB 5CA1B 1C2TA 5LA6A 4PZCA 3F1KA 2FW6A 5DF1A 5E95A 4ZVKA 4FMDB 4DW8A 2IY8A 2OY0A 4IPTA 4LOHA 2BYTA 2PRIA 1ZK1A 3OLYA 1IZYA 1H2EA 1IULA 2QUIA 3B1KA 3R0QA 4G67A 2D2VA 4HFNA 1GKLA 1NGSA 4RH3A 3VNAA 2NT4A 4IDDA 721PA 3OZCA 2GGSA 4ZQEA 5K3EA 1RXVA 3EEBA 3EGVA 1F5SA 3THXB 3K7EA 3B20A 3G5LA 1QV9A 3NI2A 1J22A 1P4RA 4YCDA 3FBWA 3SDBA 4L3OA 3HXQA 3F4LA 3VR1A 4AZTA 1M1NB 3TVYA 4ZDJA 4R9SA 4ZV4A 4GLFA 3L0PA 4NPCA 4UBNA 1OXVA 3SE0A 1MJGM 3E0XA 3GJ7A 2C9OA 5E7IA 3IP5A 5ESRA 1H5NA 4M7WA 3P9KA 1LPNA 2G76A 3H3FA 2J41A 4CR6A 3I3SR 5DNYB 1B0ZA 1E3LA 1RHUA 3K0FA 3GLRA 3ZWOA 1LY1A 3RUEA 5A9SA 2E4XA 3RD5A 1D0IA 1V96A 1ZBDA 3IPCA 1C1YA 1IOVA 2OV3A 3H65A 3I9LA 2QVBA 2GXAA 3D5TA 3SF0A 4B3GA 3CX3A 4J1TA 2AFRA 3PUWA 5C8DA 3A26A 2WTNA 3K8QA 1E59A 1JQAA 1BX3A 4CIAA 2H1RA 2IEYA 1N8TA 2GO7A 4PSUA 1EDEA 2OC4A 1NU8A 3TD9A 2M6SA 2Q46A 2ZIXA 5CVVA 2QTAA 1GM5A 4CCYB 2IS1A 5TQ0A 1SC4A 3KTAA 2Z5FA 4HXGA 3T5AA 3GJYA 1G8HA 5J43A 3H9CA 3RRNA 4ZV9A 4LRWA 4IQFA 1W85A 1Y1SA 3O47A 4B35A 3QU2A 2CKDA 2ECFA 2O5EA 4EB3A 5DT9A 5KNBH 5IT4A 1YOVA 2C7PA 4CT0A 3KDPA 2ZYIA 2ATEA 4YCBA 2ZSIA 3TE6A 3EXG2 2O1XA 2FPIA 4N39A 2XYHA 1OR8A 2B1RA 2DAPA 4TMWA 1YF3A 5CD1A 3OX4A 4Z4GA 4ZZ1A 1L7NA 2O52A 1GQOA 3W5IA 4NOMA 4C3ZA 2ZU0C 3MTIA 4W7IA 4BWVA 3B7WA 3A6EA 1NNUA 3D3EA 4DC9A 3OZXA 2BDEA 5D00A 3RF7A 3MGBA 3WMEA 3WIEA 4LHYA 2GPJA 4HMQA 4QJIA 3K0HA 2UZ4A 1XLTC 4MKZA 4I9HA 4YAIA 4YYEA 5C80A 1ESCA 4OQZA 3GDOA 5A4JA 4Q12A 4MGZR 1TD9A 2H29A 1Z0AA 3GMSA 3NVAA 1G1AA 1J8MF 3MMZA 1H4VB 1TGYA 2GB4A 5ARCA 1WMAA 5T4FA 4BQEA 3RHZA 4CM9A 1Z7EA 2BOVA 3AUFA 5JOQA 1CNFA 2C4NA 1WQ3A 4FSXA 1NJ5A 2IPLA 2O5VA 4TLLB 5JSHA 2L0XA 3OZBA 1SKBA 1IRXA 2BM0A 3KYCB 5D1NA 1YTLA 3VPFA 3VV3A 1M1UA 1P9RA 1YDWA 5E0KB 2NU8B 4DRZA 5EJ5A 1K6JA 2GD1O 1SO8A 3M4ZA 2PZLA 3SX2A 3ROTA 3UB3A 4NH0A 3WLIA 3R23A 5LLTA 2A9QA 1NTRA 3S44A 1LA2A 2X15A 3HGTA 4D0GA 4Q93A 1PS8A 3DQZA 1EGMB 3ASVA 3ZJTA 1NHGA 2O1SA 1Z68A 3KG2A 1JPVA 4BE9A 3QWFA 5H4HA 2CL6X 3OOSA 3PNPA 5LU9A 5KSOA 1DMSA 4LYHA 2C2OA 3OSZA 5DM0A 4QVGA 1N2EA 2CVQA 1P1IA 3CO5A 3PENA 5BN4B 1KEKA 2VQSA 4WL0A 1N7HA 1I3KA 1QPBA 2GN4A 1CY0A 3IP8A 4G0YA 4UREA 4XA8A 2PWYA 2FV8A 3MFQA 3CPSA 2H2FA 4B7XA 3NEJA 3HEAA 4XSGA 2BJHA 3WNQA 1FPMA 5LDHA 1N5LA 1E1CA 2HWWA 3HSSA 1DS6A 2KE5A 3KUKA 4H59A 1GPKA 3K72B 4BMVA 1OBVA 4YFVA 4I7EA 2FSGA 4KR6A 1C30B 3U3RA 3ABOB 2QMQA 2VUUA 4CMAA 2HDNB 2X40A 5DYWA 2QTGA 4RPHA 4OKSA 4TQUS 1XRSB 3F7OA 5CT5A 3U3JA 4QUIA 3ORSA 4AF6A 2DPLA 3DL4A 2QOEA 4OBEA 4EPWA 1M10A 2ZBFA 4URYR 5EG5A 3SR3A 1ZHOA 2IOHA 3GGOA 3K8OE 3VR3D 1GTJ1 1GY8A 1TKCA 5CVUA 3T3HA 1QFMA 3TMYA 1XJCA 1VJTA 5E6SA 2FN9A 2P5TB 5D87A 3IAEA 1BROA 3C16C 1AIPA 2J9FA 3OQIB 3V2GA 1SA0B 2VEDA 2QN3A 1O89A 2F2TA 3Q3HA 3GD5A 2VKQA 2Z2XA 4IDFA 4N54A 3P52A 4QJBA 2ENUA 1HYQA 1UC9A 3C3WA 1E6EA 1OXKB 4FYXA 4JC0A 5E4TA 1PFUA 3VDNB 2WYVA 1BCSA 7AT1A 1HBJA 1YBVA 2ONCA 3LMKA