1QKJA

T4 phage b-glucosyltransferase, substrate binding and proposed catalytic mechanism
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (glucosyltransferase)
molecule keywords BETA-GLUCOSYLTRANSFERASE
publication title T4 Phage Beta-Glucosyltransferase: Substrate Binding and Proposed Catalytic Mechanism
pubmed doi rcsb
source organism Bacteriophage t4
total genus 131
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA02
4BQIA 5GPBA 1NZDA 2SKCA 1HLFA 3OY2A 4W6QA 1P4GA 3BD7A 3H4TA 2F3UA 3COPA 1NOKA 3HBNA 2FF5A 3E3LA 1UQTA 1P4JA 4MICA 4MRAA 3T3DA 1XOIA 1RZVA 2IEIA 2VCEA 2R4UA 3CX4A 4KQ2A 4X7RA 2R60A 4HLNA 4YI5A 2ACWA 3L7CA 3CEHA 2X0FA 1PNVA 3TAXA 2Q6VA 2GM9A 3C48A 1VGVA 1XC7A 3BD8A 3GUHA 3G2NA 3RHZA 3OTIA 3OKPA 2GEJA 1RZUA 4N3AA 2ECPA 2XCIA 7GPBA 1M5RA 3TOVA 4CTNA 1AHPA 3FROA 3IA7A 4MI9A 4F9FA 2ACVA 5HXAA 2GPBA 1Z62A 1SXQA 3VUFA 2OFFA 2X0EA 1FU7A 1UZUA 1PYGA 3BCSA 2C4MA 1RRVA 4HWGA 2XCUA 3QKWA 2G9RA 1JG6A 4GYWA 2YJNA 1KTIA 3HBJA 3MS7A 3OY7A 4GZ3A 3MT7A 3TSAA 3MS4A 2P6PA 4G2TA 3WC4A 1PN3A 4N39A 4CDRA 5BNWA 4WHMA 2G9UA 2JZCA 2QRQA 2AV6A 3HBMA 4QLBA 4M7PA 1GZ5A 1O6CA 2PRIA 1L6IA 3BD6A 2BGTA 1EXVA 4N3BA 5DU2A 1IIRA 2IUYA 4FKZA 3OTHA 1PSWA 4F96A 4GZ5A 2ZB2A 1C50A 3AMVA 1FU4A 3ZCTA 1Y6FA 4YI3A 2XGSA 4NC9A 3Q3EA 1JIVA 1P2GA 4EKYA 2IYFA 3MRTA 2QLMA 2PRJA 2QNBA 3C4VA 2C9ZA 3Q3IA 4MHOA 3C4QA 4EKEA 2QN1A 3ZCUA 4RIFA 1L5WA 3NP7A 2C1XA 3D1JA 1LWOA 3NCHA 2XGMA 1XL1A 3UYLA 2FFRA 3BCRA 3VDMA 3CUWA 4N9WA 3OT5A 4MHSA 3IAAA 3NB0A 3OTGA 2VSYA 5IKOA 3L79A 4BQEA 1K06A 2PQ6A 6GPBA 1AXRA 2XA9A 2JJMA 1K08A 2GEKA 1F6DA 4REMA 4M83A 1FTWA 1FS4A 4AMGA 2AW3A 5ENZA 1FA9A 3CUYA 8GPBA 3GPBA 4XIFA 1JIXA 2BISA 3RT1A 1Z8DA 4RIEA 9GPBA 2ATIA 2XGOA 4MI3A 2X6RA 2XA2A 2QRMA 4MI6A 2R66A 3G2KA 1L5RA 4CTOA 1GPYA 1H5UA 4X7PA 2BGUA 3BEOA 3BDAA 3Q3HA 4RIHA 3HBFA 1C8LA 1L5QA 1P4HA 2X6QA 2QLLA 1ABBA 1IXYA 1EM6A 5DXFA 4X7MA 2QN2A 1WUYA 2QZSA 3NAZA 2IV7A 3T5TA 2SKDA 3MT9A 3G2LA 1L5VA 2IV3A 3G2HA 1L5SA 1L7XA 3ZCPA 4CTMA 1WV0A 3DD1A 5TMEA 3MSCA 2X0DA 1NZFA 3EBOA 2H1HA 2G9VA 3UYKA 2FETA 3CEJA 1SXPA 1NOJA 1GFZA 2QN9A 4AMBA 1Z6PA 1P2DA 2F3PA 2H1FA 5DLDA 3D0QA 4XI9A 2BFWA 3CUTA 1NLMA 2F3SA 2GPNA 3O3CA 1JEJA 4N3CA 3WADA 3S28A 2AZDA 2JLBA 1BX3A 4WACA 5IKPA 3S29A 3T3IA 3BCUA 4EL0A 4EL5A 4AN4A 2KS6A 1XL0A 2IEGA 3CUUA 2QRGA 3T3GA 3NP9A 3MQFA 3ZCSA 3ZCQA 2XA1A 2C1ZA 3OKAA 3L7AA 3MTAA 5JTTA 1NOIA 2O6LA 1GG8A 1GPAA 1P2BA 4KQ1A 4PQGA 2GJ4A 3CEMA 4X6LA 3RSZA 3PE4A 2AMVA 2R68A 4WADA 2QN8A 3ZCVA 3G2JA 4L22A 1B4DA 3SYMA 3S27A 1V4VA 1NVKA 3T3EA 2GPAA 4RIGA 4GPBA 1WV1A 4RIIA 2IYAA 1E4OA 2WTXA 3CUVA 3MRVA 1FU8A 3DZCA 5JTUA 3D0RA 1FTYA 2VCHA 3E3OA 4LEIA 4KQMA 4GZ6A 5C1DA 5D00A 5D01A 4Z5XA 1FC0A 3G2IA 2G9QA 1Z6QA 3MTDA 3S2UA 3T3HA 3CV3A 4RBNA 4EJ2A 2QRHA 4LDPA 4FZRA 3L7BA 3MS2A 3MT8A 1LWNA 1C8KA 1YGPA 1QKJA 3T7DA 3EBPA 3OKCA 1WW3A 2SKEA 2F9FA 3VDNB 1GGNA 5TVGA 1F0KA 1WUTA 1UQUA 1J39A 4GYYA 2QN3A 1WW2A 3DDWA 1JIUA 3RSCA 1P29A 1FTQA 3QHPA 4BFCA 1Y8ZA 3WAGA 5LQDA 1QM5A 3MTBA 2IW1A 4AY5A 2QN7A 2QRPA 3H4IA 5TMDA 4BQFA 3VUEA 1Y6GA 3MBOA 3MRXA 2PYDA 2VG8A 3E3NA 2QLNA 3SYRA 3S0JA 4F97A 1E1YA 2R4TA 1XKXA 2PYIA 2HY7A 1A8IA 3L7DA 3NC4A 4NEQA 2F3QA 3NPAA 2GT1A 2VSNA 5TMBA 4M60A 3PE3A 1GPBA 4RENA 3ZCRA 5I45A 3L01A 4AY6A 1JG7A 2XMPA 1C3JA 4RELA 4YUAA 4NESA 3DDSA 1YA6A 2ASVA 1XV5A
chains in the Genus database with same CATH superfamily
1PQYA 1K89A 1QTQA 3RARA 5CPBA 5BRJA 1UT5A 3IQWA 3ABQB 1SD1A 3JQCA 2GAOA 2YWGA 3M82A 3MUOA 3PYXA 3V48A 2BCJQ 3C5CA 2Y4OA 2JBWA 1NZDA 2NTYC 2QW1A 1CDOA 1DKOA 1TJYA 1WOYA 3NRCA 2G5TA 1RC1A 1P4GA 2NV0A 2BFDA 2W4MA 3ADPA 4IGAA 2DQZA 4S1VA 5A6SB 1UBHS 4PZUA 4BO3A 4RTNA 2FV8A 1KQ3A 5JMOA 5A3RA 3H75A 3E0XA 4D74A 3VH1A 4ZOLF 4MV9A 4FTWA 2GCPA 1USIA 1T9GS 4WINA 3U4DA 4IP0A 2OOSA 5IJ0B 2PAAA 1QHHA 2ZSKA 1NDQA 1P4JA 4U7WA 4DR4B 5K0BA 1XNJA 1SWWA 1Y4ZA 1EK1A 2PH3A 4F5WA 2G0AA 3DKIA 4D8TA 2ZDQA 2WPDD 1W4BA 3H8VA 1JSRA 3D3WB 2VRCD 2IY9A 3ESQA 5EXDA 3AHEA 5IANA 1Y7IA 2RD2A 1SKUA 5FLKA 4GC5A 4ALIA 1GL3A 4X6YA 3BZBA 4X7RA 1P5FA 4I4CA 4LOJA 3VI4B 2BI8A 4JLAA 2YHUA 2ID9A 2XVAA 4QXRA 2XE4A 3LC7O 3ZBUA 3EPLA 4B3MB 3DOEA 4JK3A 4J2OA 4DIOA 3U44A 1SHKA 3M2PA 3B9PA 1MVNA 2A1UA 2BFNA 2QE7D 4J0IA 1OJ7A 4I5IA 3EW9A 1ARZA 3AFHA 4IVQA 4DR6B 4TLDA 4B48A 2X40A 3O9ZA 2X58A 3ZDEA 1LX7A 1N5DA 1DX4A 2XWQA 3ABZA 3IS3A 4HDNA 5K3DA 3DL4A 4LXUA 2RBGA 5T57A 3H17A 3A2NA 1XD9A 4OUDB 3ZXXA 4G65A 5K3AA 1D09A 1SCBA 4MQEA 3KLNA 2C95A 3EMKA 4EUHA 4H7FA 5EEHA 1EJ0A 2H9IA 4TWAA 3H1BA 4WLVA 3IXLA 5A4IS 3FROA 3HWX1 5E7QA 1PR9A 4OLBA 5FD8A 1E99A 1QQAA 1AZTA 1N6IA 1EVJA 3A1VA 3M4NA 3LDHA 4KG7A 2VHJA 3TCXB 2VRNA 1VKRA 3A6KA 4OF4A 1NPTO 3JATA 1YE5A 2GD1O 4I8DA 3V4OA 3ZU6A 4EI7A 5BNIA 2Q3HA 2AVDA 1OGIA 1EDEA 1I5OA 4TV9F 1FZQA 2R5NA 2JNWA 1IUPA 2ZRKA 1RKUA 4KN5A 1K9SA 2VDQB 2QSYA 4JASB 2EP7A 2I2FA 1G6KA 4WA7A 2GD2A 1GU1A 3AXSA 3AIMA 1O77A 2CCGA 3FCEA 3H1TA 3D4LA 3MN1A 1TCBA 4NZZA 5IPFA 1IBSA 4JLKA 3ZGOA 4KREA 4ZO9A 1ZQ9A 4DMFA 1NYRA 5KWVA 3RG8A 3ITNA 2AX3A 1ODCA 4K6GA 8AT1A 2FZKA 1KJNA 3B1ZA 3EYWA 3SC2B 3BBLA 3W2EA 2AVNA 3ORSA 2X8AA 1KBQA 9ATCA 2R25B 3ZZMA 1UOPA 4MSUA 1KZHA 3DDNA 4TLLB 2OQRA 1Q84A 4HAUA 1UFKA 5CFNA 3RS2A 4D5EA 3TUZC 4RE6A 4LDAA 4RM3A 5EJ4A 1CK4A 1JSXA 5DTEA 2NZYA 5KVQA 3UJPA 1Y63A 2C4KA 2EW8A 3NRJA 3HN7A 1LRLA 5AM3A 1E3MA 3NXSA 1OBOA 2ZT5A 4FWIB 4N18A 5B2EA 3OM8A 4OMFG 1CSEE 4A8PA 1P2SA 4EHIA 1DEOA 1R0BA 3IEXA 3NBXX 1B16A 2O0MA 1QHXA 2QUKA 1DJOA 1VL5A 2H29A 3FDZA 3JY6A 3NVDA 4JB3A 5BR8B 4KMOA 1KARA 4NY1A 5TPWB 3QPDA 3VZQA 2J5RA 2HZBA 2VAVA 1QONA 4N5NA 4ENWA 2FW1A 3GQBA 4I1OA 3V42A 3IXQA 3VJMA 2DFPA 4K9PA 2W70A 2CLEB 1P61B 2AFRA 4F0JA 1CUJA 5E7MA 1YWGO 2Z2XA 1C50A 5K0JA 2XUAA 5KNCD 1CUUA 4R5HA 3JWJA 1X8XA 1X7WA 3C6QA 1SNYA 3L0YA 5KYKA 3L43A 3JAWA 3GNSA 4Q19A 4EG7A 1JX6A 3VXKA 4CIWA 3RC8A 1FPQA 2DVMA 3QEMA 4CMIA 2VFAA 3KLPX 5F9FA 2FP4A 3O74A 1PE0A 4O8CA 4KVAA 2ZS7A 4C3OB 1FNSA 1IBRA 1E6MA 1XN1A 1R6UA 1AKNA 1NUHA 2QZ4A 2DHCA 2CLOB 4HNUA 1Z6ZA 3N05A 4DIEA 1EFPA 5I4CA 5EP3A 3PIIA 5A02A 4EFDA 3ORRA 1NF8A 1QRDA 4PPYA 2IF2A 5DI3B 1WCIA 3QK7A 4FSDA 3RGWS 5JJIA 3RVDA 3CLUC 1C80A 1FMLA 2C9ZA 3LAWA 3M5CA 4PTYA 1G3QA 4PIVA 3C7KA 1C3XA 1XEAA 2RJOA 2O06A 1Z45A 4ILKA 4MS3B 5GMOA 1QRTA 3HPQA 4REQA 4TZTA 3DVRX 2FSHA 2BR3A 2ZJFA 1U99A 2AQIA 2IYQA 3RHFA 3UZUA 4B7CA 3TVTA 4JXZA 5LXTF 4DCVA 4F4CA 3HDJA 2WQZA 1A9RA 1QYRA 2YRFA 2PKEA 2QIPA 3L7JA 3EDOA 2VHYA 5IP5A 2R84A 5LNK1 1LI7A 4CF7A 2QTNA 2WJ4A 2Q4TA 4D4JA 4H60A 1XDGA 1R27A 4NAHA 2FFRA 1G8KA 3W3AH 2QRVA 4DKJA 1AN0A 4GLJA 3G68A 1RVV1 3ECAA 1T8SA 3JR7A 1GZ6A 2QL6A 3MAGA 4MHSA 5C8YB 5KWIA 4ARCA 1OSNA 2GEDA 1ZMBA 4ADSG 4B5LA 2P79A 3AEKB 4AP9A 5FYQA 4BQEA 5GZ1A 3DYBA 3HA7A 3HCWA 3UA4A 4JV5B 1K8ZB 4H3KB 3UJHA 1IPHA 4HN4B 1T91A 4I46A 2HK9A 3IBGA 1EGAA 3OIDA 3QVLA 4OSPA 5BN4B 2ZBUA 3TOSA 3OQBA 3OZ7A 3VFDA 2C9BA 1DCKA 3D6VA 4JX9A 4Z4IA 1SC1A 2CXSA 2VVTA 1JIXA 1GGHA 1T1RA 1ZJ6A 3V8PA 3RKRA 1XNQB 5JW6A 5KU1A 4MUNA 4RACA 1FSGA 3AJ8A 1TX4B 2HEIA 2OO5C 2RHOA 3E1KA 3GHYA 1IATA 3L1JA 4LDNA 4WV3A 4OYLA 1BEEA 3WGTA 2XEDA 3FWNA 4Y2TA 2Y0CA 2XJ4A 1K8QA 1M0WA 1KERA 1WMSA 1HYQA 4OFXA 3BJEA 4RCYA 1JEAA 3OFJA 1GAQA 3VPGA 1DC4A 1Q50A 2GRUA 3ZNOA 5IJWA 4NYJQ 5F98A 1FYEA 4EPYA 3OCWA 4YYZA 2BOVA 3JPWA 2G82A 2XDQA 3QXXA 3RFTA 1DV1A 2Q5OA 4H6XA 4J29A 4BLSA 1H65A 4FIZA 1PL0A 1N3BA 2HXSA 3BEOA 3OC0A 4WKOA 2IOYA 3GEIA 1KDYA 4BMYA 4EK9A 4YJ3B 1W35A 3EDCA 4MWCA 4XLTA 4D4LA 4NH4A 3L7NA 1D1SA 2VBGA 3CW2A 1V8DA 1O94A 4IHJF 4UC0A 3TL6A 2DPMA 5B57C 1RBYA 2AOUA 1V26A 1YHZA 2HLDD 2YDYA 3W3AD 4IDGA 2F1OA 2HRRA 3JZMA 4G0UA 1KJQA 3E8MA 2PZMA 3T54A 3VZBA 4BNUA 2QZSA 1Z8NA 3W34A 1QB8A 1JHDA 2B8WA 3CPSA 5F3WB 1YUBA 1OQAA 4BJ3A 3HCDA 3L8HA 3K7EA 1XF9A 1YR8A 4OL0A 2SICE 2IEBA 3HEMA 1L5SA 1SRQA 5CUQA 4DLRA 4F92B 1WV0A 4S1TA 3H4VA 3PNMA 4J2TA 4Q3LA 5KOHB 2Y66A 2MINA 2J30A 4RF3A 4RKQA 5BW4A 2OOKA 3A9VA 3ER8A 5I4IA 3FYUA 2CWWA 4RQUA 4DJJA 1YU9A 4ENVA 1X15A 4NULA 2GZ1A 4LXQA 5KSWB 4QOFA 4V38A 1YRWA 4ZN6A 1Z6PA 2Q50A 4AG3A 3U13A 1NNSA 2CVQA 1QU3A 2WD8A 1KYZA 3ICPA 1E3IA 4GRAA 4BEBA 1HK7A 2HCTA 4W5WA 3V6LA 4F7DA 4PYJA 4D26A 1HLPA 3K1ZA 2HADA 2F8MA 3H5OA 4JOBA 3UV7A 3ZLVA 4MKFA 1XRLA 3O8RA 4TQAA 1XXHB 2XQKA 1XMSA 2NVUB 3ZU3A 2MSCB 1DIAA 4EF6A 3MK31 1YQ9A 4NZOA 3QIAA 4FFMA 3ZJTA 2PLFA 2PGOA 2QQFA 1WXDA 3ZD8A 5EZSA 5KCZA 3EEBA 2AD5A 3TJZA 2P3QA 1OKKD 3IP9A 2JW5A 3STUA 1IN4A 1G21E 1I7NA 1RADA 1R66A 3P9KA 4EL0A 4M99A 4U7GA 4DDWA 1ES9A 1LS6A 2P3OA 3E7XA 4JJKA 1L5GB 1AGXA 5GQSA 2FEPA 3H3JA 2OFPA 3D8TA 4MR7A 1T1GA 3NP9A 2WF7A 1GQQA 2XUGA 5AW7A 1PT9A 3N0TA 2XT6A 4ER0A 3W05A 2C1ZA 2O2GA 4KYUA 3W5CA 4YRQA 5DOZA 5DTJA 1Z68A 1W6UA 4MGIR 3KCQA 1GG8A 2OGSA 2V45A 3BIWA 4MS1B 2JLAA 4HX9A 4LE0A 1PWZA 3N2NA 5H16A 5G0TA 1BE1A 1RQ7A 2RAPA 2XRMA 4CM6A 4NFLA 2GJ4A 4IM7A 2W6IA 4FE7A 3MT0A 4MP8A 5A03A 3IQGX 3JZFA 4JHLA 5TPZA 3VJKA 3T9FA 3Q3VA 2AE1A 3GJ5A 1GRCA 5FAKA 5LQCA 1XMQB 3ZY3A 1GQYA 1TW2A 1V2GA 3MSXA 5JQGB 4N41A 1T4CB 3W5IA 3I37X 1J0XO 3NDJA 4MCIA 1WB9A 3HN6A 2FJUA 3HB0A 3HVUA 2I33A 3L93A 4J2HA 2JI9A 1GDDA 1C1DB 1P4SA 2A92A 5IJ9B 4DLBA 2NUAB 2CSUA 1NQTA 1W4CA 4OMDA 4Z7OB 4JIMA 4D4GA 4IGKA 2AXNA 3F9CA 4XD2A 4TTQA 4X7BA 2NU9B 4E51A 4H7KA 4H77A 3VPHA 3TUIC 1CEEA 4N6OA 2LNDA 3JV7A 3KV3O 4XM1A 4RKWA 1N75A 3MJTA 3IP7A 4PCUA 3NHPA 4JUIA 4CLRA 1KAOA 2EKPA 2A1TR 1OZHA 1C3OB 2AJCA 4OBXA 2RC6A 4HDMB 4KR0A 4ON9A 5DMHA 1CUYA 4AKSA 1JXOA 1IM8A 4IJMA 1XMIA 4C0QC 1ZD1A 1C9NA 3EIOA 4GZ6A 4KQMA 4G01B 2IBTA 4ARIA 2YWBA 1Q0UA 3RHSA 4US1R 2FE4A 1ST2A 2DPYA 1D4ZA 4BO6A 4R8VA 2HFJA 5D00A 4E08A 4DSZA 2CZGA 2OCKA 4EX7A 3FPCA 3KQLA 1JAHA 1QHFA 1XYVA 5DBHX 4RSRA 3QGMA 3RFXA 2FOIA 1P2UA 5EHXA 3G9UA 3EQ9A 3ZDQA 4BKMA 2RK6A 2F9LA 4ATNA 3GDFA 4HDQB 3INYA 2OYRA 1QQBA 1NATA 1YS1X 4XYGA 5AW2A 1FYVA 1OASA 2YKGA 2ZRBA 4R01A 3P20A 2Z58A 3A9CA 4X9XA 3IA2A 4F93B 5JDCC 5FV7A 8ATCA 2AUTA 2R7LA 2QQGA 3IOYA 1ZQ1A 2L42A 4FQ7A 3G9XA 2P9FA 3AC0A 4ZHSA 4H4DA 1FMTA 2AI3A 2CNWA 2WINI 3GEEA 3L4BC 4FDVA 5B2ZA 5HSGA 2ZKLA 3DE1X 2VNHA 3B1XA 4WOPA 3KYCB 2HA6A 4P93A 5LD2B 1CJBA 1NMZA 2FN8A 3HY3A 3HJAA 1GNLA 1B00A 4G1BA 5K45A 5CIYA 4PFSA 4ID9A 5JH7A 2FUNB 1P29A 2ISCA 3STYA 5IEBA 3MCZA 3S3TA 2GN8A 4TTVA 2ZRGA 3WMGA 3X1MA 4E4RA 3GLTA 4IOJA 4CZ2A 1CZRA 2GDJA 2Q6OA 4HYEA 1JHOA 2KLBA 4BZWA 3I64A 4EGJA 3DO5A 4TYMA 1EVKA 1QYVA 3EXG1 2WR8A 3H2YA 4FFDA 3D0OA 1E7SA 2RGGA 2OB1A 5EYPA 4QDUA 4OTZA 1IIBA 1Z16A 3A9TA 4K6FA 4F60A 1XK6A 2H63A 4HZIA 4IXDA 3L46A 2BMAA 3E27A 4QDZA 3D6JA 5A0FA 3RVMA 1NXQA 1NGSA 1GILA 1U0FA 3CRW1 5KNLA 1ORIA 3L8MA 4MVJP 1M2NA 1BVRA 4O4HB 4QGBA 1Y8AA 5K6AC 1H9CA 4YALA 1IDOA 1EB8A 1AD2A 2PYIA 3PE6A 3O1HB 1S7CA 1QO0A 2TECE 3NJ8A 2HYIC 4FDMA 1P91A 5BSWA 3K0AA 2PR7A 1L7MA 3TN7A 1QFSA 3UM9A 2C7PA 2C84A 4FBGA 2HREA 1RTTA 1NY5A 3A3YA 4KPFC 5TIIA 2E85A 3FIJA 2XCOA 4HZGA 2L0XA 3D3QA 4TTIA 2GJ9A 1ZITA 2IDZA 3GMIA 4KVZA 2YASA 1N2OA 4MB6A 3ZHTA 4P0QB 3RVSA 1R8YA 1RKQA 4WBNF 4Q34A 4Q05A 1N1MA 1P9WA 3E48A 4PXAA 4RDXA 2AXEA 3V1KA 4DUGA 2NT4A 3T9DA 4ZI7F 3DKRA 5CA0F 4G09A 5INTA 1DX6A 2H65A 4I4IA 1CRQA 4BMPB 5ARDA 3GLGE 4H6WA 1JFTA 4R2LA 2UVQA 2YHIA 2QM7A 1U8EA 2VQ6A 5K0CA 2PUCA 4WD3A 1YT5A 2I3BA 1NXXA 3PUVA 3C7CB 4W9NA 2IGBA 1KYTA 1BFDA 1A4IA 4KFRA 3TZKA 2DFTA 1UEJA 1UJBA 4W6QA 4YA6A 4BVJA 4CDGA 5E1MA 4PBTA 2JLCA 3FIUA 5E8JA 2ROQA 1O6BA 2FMFA 3EJWA 3HE3A 1E4VA 2BEUA 3COPA 3L7IA 3QXHA 2EC5A 4M8NE 2PLNA 1TPYA 5FOWA 1HKUA 3ZCXA 4YV0A 4FX5A 1SCDA 2IYYA 3IV6A 3KJFA 3OZWA 3C6MA 2VLBA 1A3CA 1SBQA 3IEPA 3OEYA 4OXQA 2C2YA 3CLSC 3ZLUA 4F3RA 4YAUA 2X9NA 1LZLA 1YI1A 5I5GA 4PXSA 4OBBA 2HNBA 3TQQA 2K5UA 1T5DX 3OFSA 1J07A 3PBKA 4B4UA 1B3BA 2XMCA 3M6XA 3QTLA 3AI7A 4HEA1 1GKIA 3R74A 1MA0A 2E82A 3HU1A 4YAIA 5JNTA 3Q1LA 3FMGA 4BNHA 5HIKA 2ZAOA 1JH8A 3OCJA 1RQNA 2C96A 3RBVA 1HKHA 5FBVB 4B71A 4EQZA 4KQWA 1ZI6A 4YRSA 1JIJA 1HBJA 1MC5A 3DEZA 2J7PD 3NX4A 1CQXA 2WJAA 4UTXA 3FPHA 5CLGA 4TKVB 5CVTA 2CY0A 2AFHA 3HRIA 5F64A 4RU1A 1B42A 1CCWA 1N0WA 3BFKA 1NW3A 3LVBA 2C97A 2ZT8A 3CEAA 4FP9A 5LLTA 3RU2A 3ZDBA 4N03A 1GUZA 2R65A 3UVEA 2NU7B 3KXPA 5AESA 3TOVA 1XSEA 4RXTA 2A5FA 2QTHA 4XSHA 2ZUEA 5DLYA 1PUXA 4EY6A 1NBIA 3LT0A 2JEYA 4Q16A 4K9DA 1VJDA 3SXUB 3X43A 4TTTS 1TD1A 3FRHA 3GGSA 1EXMA 1F8FA 5EP2A 3JWHA 3TRDA 3LQQA 1LW6E 1TQ8A 3BFVA 4IIDA 4HSEA 3VUFA 1NN1A 5BNFA 3SXJA 2MT9A 4TLCA 3L7KA 1PTJC 1UKAA 1GZVA 1WR8A 1YMUA 2C4MA 2WAAA 1EJ6A 3IT3A 5HQJA 3ZIUA 4D9KA 3ROPA 4BEWA 1LNZA 4X94A 1KWKA 1JHMA 2Z1NA 4XX0A 1JRLA 3VTAA 4JVLA 3AUSA 2DFKB 4WL0A 4Q02A 1FCJA 1NJ6A 1RJGA 3SJAA 5AW0A 2VF5X 4GPIB 4NYJR 1AS0A 5LDGA 4IQ0A 5TY0A 1O03A 4NZNA 1CG6A 2O9JA 4P58A 3LDAA 4ND3A 4ARAA 5H81A 1UXGA 3ETEA 3KFVA 4OY3A 4ECAA 4XJTA 1E9AA 2NW6A 4G2NA 2G9UA 1MAAA 1VE3A 1R6AA 3JYNA 1N0IA 2C7OA 1WHTB 2AV6A 4U7JA 5A9SA 4MVJI 3V32A 4OB7A 4HJXA 3PGMA 1KI2A 4TWIA 1EFKA 1KPIA 3FBTA 1DAMA 1N6NA 5GZ6A 4B6GA 3K6RA 1O6CA 3GAMA 4WA8A 5B2FA 4OQDA 3O0DA 3U26A 4FHFA 3ZR4B 1LU9A 4R2KA 2JHFA 4PONA 3OJWA 3BEDA 3QA3E 1GHTA 1RPNA 4RZQA 5G2OA 1NE2A 5BR1A 4CLXA 4C7KA 2FZVA 3FNEA 1FBTA 4L2IA 4F96A 4FN5A 2A67A 2B8TA 3FSGA 2CDRA 3SP1A 4RNDB 3EVEA 4LPSA 2C78A 4RHXA 5DM4A 4YBRA 10MHA 3KYDA 4U7FA 1TTQB 2YQ4A 1J8MF 1U7PA 3QXGA 4IKPA 4KXXA 4DJAA 3FPFA 1QE0A 1NX9A 1Z6AA 3D8NA 3HKEA 1XP5A 4U02A 2D62A 3KKKA 4U7HA 5FWDA 3KKLA 4TMTA 3WGYA 5BMVF 3WK9A 3AVYA 3EFBA 3UGQA 3R24A 2UUCB 4TUYA 4HXGA 2WKSA 3KR2A 1FP6A 4GPZA 2C2OA 1LPSA 4B9AA 2JGMA 5KYWB 1CX9B 3U4MA 4HNHA 3DCYA 4M0EA 5LSAA 3JQFC 2ANBA 4HDRA 4CCYB 1SHTX 3C4VA 4HB4A 1CY8A 4ZMSA 2XRZA 2EFYA 1VE1A 3ENZA 4DQ0A 3PVCA 5CAEB 4NOLA 2YL2A 4YMTA 4EKEA 5KNBD 1NC3A 2Y2UA 5F78A 2FMIA 1CF2O 1K68A 1RNLA 4NBVA 4PO9A 1NXPA 2VSOA 2C1EA 1CUAA 3NYWA 1RHRA 4MW6A 3BS4A 4GMGA 1EFLA 5KYXA 2HWWA 4RHYA 3NCHA 1MH1A 3HDYA 3QPWA 3J81k 1Q21A 2A84A 4I55B 2Q9CA 5PGMA 4Z4QA 4BMSA 2WT4A 4FX2A 4HAIA 1LI4A 2VPQA 4MPJA 3DF7A 5FWAA 5EZYB 3JYPA 4PAOA 4MUYA 2EWMA 3IAAA 5JCOA 3ZKWB 2E5FA 3FPJA 1UEIA 1AA9A 1K7XB 1K06A 1UP7A 2LV8A 5LA6A 3SZOA 2OCYC 2R8OA 4H15A 3VC2A 2Y1DA 5ITZB 1M74A 2X1LA 3EY4A 3QEAZ 1WO8A 3OQHA 2HF8A 5AJZA 4RK6A 4QICA 2EP8A 1RXIA 1G1AA 2PH7A 1AKQA 2AW3A 2FNAA 1BCSA 2A0FA 1FA9A 2RIRA 3SFTA 3LGAA 5CA1A 5AOVA 3DWEX 1HDGO 3OA2A 1DJLA 3ZUPA 4AI6A 1WMDA 1H8HA 3RT1A 4L76A 1PNQA 1XRSB 1E0SA 3WSTA 3OQPA 4ZRNA 3HNRA 3CGGA 2BEVB 3TDKA 4ALJA 5K2OA 4DUYB 3QVGA 1L7VC 1NQWA 1R4NB 2AC4A 1TC2A 1V7ZA 2X6RA 2CJWB 5H02A 2VHVA 2Z8ZA 4N7BA 1PKEA 1MT0A 2W6JD 1KZ4A 4MI6A 5CLLA 5REQA 4ZCIA 3T5DA 3WLHA 5B4UA 3BWDD 221PA 1MRZA 1V25A 3EIWA 1GOTA 3KP1A 3G7UA 4PWYA 1B23P 2CDNA 2G7MC 4UNNA 4TLAA 5B1HA 2CVOA 2YJ6A 1UZAA 2G70A 4F91B 2JLYA 1AQJA 3MIZA 4ZZ2A 5ELLA 4E3WA 1CUXA 3PPXA 1ILEA 3DHVA 4LF7B 3K8QA 5BSKA 3HXKA 3IIEA 3MJHA 1BYIA 1DOHA 2WY2D 3TJRA 1Z4NA 3EXAA 4Q3EA 1KHTA 3JWEA 2BDEA 4WY5A 1SPBS 1PL6A 2QRNA 3JRXA 1NN0A 3UWMA 4HNAA 3N6RA 4M1QA 1P1JA 4RTOA 2C0CA 4ZVKA 3SSMA 2GR9A 4BTEA 2BM9A 2FZCA 3BWVA 1EP9A 1BO6A 3IVCA 4DC0A 1NF3A 3NAZA 2HUPA 3FOFC 4LXHA 3F74A 4FNAA 3L1UA 1O1YA 2F48A 1TKBA 1VE9A 4B84A 3FRIA 1L5VA 2FX3A 3I6BA 5FBRB 5IAJA 5CITA 2OFWA 1YU6A 3PWKA 4UAJA 4BNGA 3HLTA 4EEZA 5JZBA 1BQ3A 2GSWA 3NT5A 3TNLA 3HUUA 1Z2EA 3FCYA 4P4UA 2H51A 3D4BA 2G9VA 1V8BA 3UC5A 4ZAYA 5H7XA 1T6XA 3UOAB 3VZSA 1JVBA 3QLEA 2X2OA 2ZAMA 3SJUA 5JNRA 4J1TC 2CV2A 5DBEX 1A9OA 2IYNA 3FDXA 2AK3A 2H1FA 3I2GA 2O0LA 3H2ZA 3RIXA 4AYWA 4RMNA 4POAA 2VQEB 2HF2A 3D0QA 1IUKA 3D3NA 3FBGA 4HQ0A 4OQQA 3DOFA 2H00A 4OYHA 5D5QA 4L4UA 4RV4A 4BRWA 1MGPA 1YASA 4HPXB 3I1IA 1HE5A 4QJIA 4UZSA 1P1CA 4AMVA 1UWKA 4U7DA 4CKCA 2VWHA 4GPTA 3OZIA 1BGVA 3K1YA 4C0XA 1N6HA 1TM7E 3MPOA 3AHGA 3SQMA 4JCOA 1SUFA 4ZPXA 1X19A 1K6JA 1YZYA 4HX5A 1I4EB 3D6UA 4RQTA 1L7DA 1QK5A 5CHYA 1IPFA 4E07A 1XZMA 2Z2YA 3A4IA 3KVRA 4AU1A 5MDHA 3BULA 3LVFO 3T99A 5IKPA 3KDPA 1DAGA 1HURA 3DEIA 2BMWA 1DWOA 2NXCA 4IOLA 5K3BA 4YRNA 5BVGA 1LF0A 4YPVA 2FUCA 4RSGA 2IPXA 1UFOA 1SC4A 2FSVC 5FTJA 1X1RA 4AJHA 5DTMA 2DUNA 1P39A 1MAUA 1N2CA 2JATA 2J08A 2P62A 1T3SA 4KLNA 4R0NA 3USCS 4NKRA 5KIAA 3QFRA 4JR0A 1RC8A 4LFCB 3V3TA 4IQGA 1M2OA 4UTRA 1YBMA 4JEMA 1MO6A 2PUJA 5ALWA 5AVTA 1RLIA 1X7YB 2OB2A 1OXBB 2I0FA 3FOCA 4GWKA 5IS2A 4MJ7A 1E6CA 3LYHA 1ONBA 1I7PA 4AULA 3VU1A 3R8FA 4CQNA 3E5NA 1E96A 3RADC 1AHIA 1B6TA 4HX2A 4W63A 1H66A 1G5RA 5JRDS 3ESXA 3D6FA 2A0XA 3NAGA 4LE2A 2IU4A 2SCUA 1XRJA 2AFVA 4A6DA 2OWDA 3VAAA 1IOVA 1REQA 2GLUA 4EH1A 2V0CA 3PUJA 1RRPA 3WB0A 3FPSA 4PSCA 4ARVA 2B0JA 4CE6A 1RHJA 2FVXA 2RG1A 4L22A 4ZFNA 4I3FA 1MC1A 3AILA 1N6LA 3SYMA 4D8YA 5E38A 3S1SA 4UM5A 4MYSA 3UW3A 1Q0TA 1MO5A 3EWAA 3UB3A 1GG5A 2WHXA 1PT7A 3AQIA 3LPCA 3MWEB 4OYRA 4TWZA 3RIGA 4QUHA 3OPQA 4CL2A 4RIGA 4G85A 2O07A 5K3FB 2W43A 4XFDA 3STHA 1WV1A 2JPDA 2PK3A 1JHXA 1XLWA 3LFTA 3ME5A 3OLCX 1SOAA 3BD9A 3NEJA 4IO0A 5JAHA 1B73A 1TIKA 3FSJX 3SVTA 5AVKA 4CMGA 4WLFA 3Q7EA 4I8XA 2AT1A 2CV1A 3C5EA 2C58A 2OHGA 3QJYA 5CBPA 1P7CA 3SF8B 3WYDA 2B37A 1I4LD 4BGEA 5JC8A 3KQSA 1O5IA 1P0IA 4KVFA 2JCGA 3OHPA 4AWXA 3C74A 2DHQA 2Z8XA 5TQ2A 4D96A 2BELA 4MCHA 2PLRA 5K6TA 5ALUA 1N5RA 4YT8A 4D0RA 1SEVA 3DA8A 3WOVA 1NVFA 1M1YE 2NTNA 4JQSA 1I7DA 1UANA 5JLJA 3ND9A 4JP5A 4W1RA 3KKNA 2VK4A 3D9QX 3FPAA 2ILTA 5LYJB 2GPYA 3DYIA 4I9NA 5FL7A 1J0BA 3LQYA 3NWOA 1XAHA 3A70A 3OWXA 3RO7A 1WBBA 4RS4A 3F4LA 2WK1A 1U3FA 5L3SA 2AG0A 2B30A 4L3OA 4XUGB 2VDLB 3CV3A 4YCDA 4YAFA 3K2IA 5KNBH 2CXTA 2N75A 2WBLC 4YMIA 3DMNA 3R3ZA 3ZQKA 1K7CA 4A0HA 4GHWA 4M1SA 1K8XB 3PX3A 3L7BA 3AB3A 4K3VA 4QPPA 4ZV7A 3RJMA 2QS9A 2V8BA 4AY2A 1D6NA 1BCRA 2P2ZA 1UH5A 3C98A 1QK4A 4Q01A 1EAMA 1R88A 4YCMA 1YFJA 3EISA 1SCIA 2H1CA 3VA7A 1O9GA 2K7ZA 4B9EA 2UYCA 1U28A 3Q6IA 3GIWA 1L8LA 3VDNB 2ZYTX 3KVOA 1OTYA 3A8TA 3GUYA 3VKVA 6REQB 2VEOA 4UZFA 3PGVA 3A3PA 1EUZA 1AZSC 4DLWA 1PR2A 4YP9A 3KZ1E 2QN3A 1WW2A 2I4RA 1J9GA 3VKGA 1VKJA 2DKOA 3A04A 3PC6A 4UEOA 4M49A 2O05A 3RVKA 2JK1A 2O14A 4BFCA 1SPXA 5E9JA 1E9DA 1H6AA 1J0AA 1UBOS 1J2RA 5GM2A 4ITVA 1UK6A 1FPMA 2RAUA 1JQDA 3A6EA 1Z0DA 4UUOA 5HUQA 3D6HA 3EPRA 1IAQA 3NHWA 4JYPA 4YAJA 5F2NA 1KU6A 1Z4KA 1U1FA 2WILA 4A7PA 2CL6X 5GJVC 1ECBA 3CE6A 4DC1A 2CT8A 4Z4GA 2QLNA 2NSDA 3TFWA 1YR1A 4N6GA 4TKUB 2W9XA 1IHPA 1RAEA 1XKXA 3JQ7A 4DSAA 4LTDA 4AX8A 1G8YA 2HY7A 2VAWA 3FKSD 2XE8A 3SYNA 5KTNA 1JT2A 4REOA 3PSAA 1U1GA 4M37A 4TSKA 4A1FA 1KYYA 1L5HB 3GRZA 4PPNA 3RRNA 3WL4A 4EO4A 5BWNA 5CW2A 4DVJA 5C1IA 1VP9A 1EUDB 4M60A 4BVBA 2W42A 1G2PA 3H9EO 1UFQA 2WICA 1SBNE 4RD6A 4U2GA 3UJBA 1W1WA 2W2KB 4TM7A 2OHVA 3KWJA 1IMJA 4WVFA 1R10A 3EDMA 3AERA 3C6ZA 1T6NA 3KT3A 1GRVA 2DLDA 2YN4A 4FGKA 4O4JB 5TX7A 3BWXA 4ZQHA 4MV6A 3C2QA 3IFSA 4MHTA 1K5GA 4JQYA 4Q9LA 3RYCA 3U61B 3RANA 1JSCA 1WUIS 4CLOB 3CBGA 1KK3A 1L4FA 1N5LA 1P62B 4YQYA 4HEHA 4JMPA 1QHNA 5LP6A 2WJWA 3CZMA 3KAPA 1X87A 3WL6A 3VU9B 3ZS9A 3O91A 5CVUA 4B0OA 1G5FA 2NQ2C 4PNPA 4BYGA 2YHAA 3JWGA 2REQB 5CNMA 1ZCZA 5ERGB 3JQRA 3W6NA 2EZUA 1F3LA 1KI4A 2G77B 4HB0A 5C1OA 3OBIA 3L6CA 4Y0NA 4MV3A 1ND5A 1WVMA 2AYYA 1YB4A 4JA2A 2BHLA 1OYYA 5FUWA 3NMUF 2YS7A 3R9XA 3EIUA 4YDHB 4CEHA 3BKWA 2ZGVA 3P71T 3BMCA 2WYIA 3AONB 1NM5C 1H4QA 1V11A 3PWZA 1TL7C 3ITDA 2KLHA 2O2SA 2M6SA 4HWKA 1KEZA 3DG9A 5I7UA 3VR0A 3KYBA 2RCNA 2I8LA 2IEIA 2OCLA 3DLCA 3EHEA 3HCPA 2RBKA 3HCNA 2FPKA 3LYUA 3U37A 1TU4A 3UK1A 3MXTA 4GR9A 4RZ2A 2J9ZB 4Q3OA 2D13A 3B3QA 1VM6A 1PJBA 3DFIA 1WEKA 5KYGA 1Z4QA 2G1JA 4WESA 4IPTA 1K7FB 1N2GA 3L7LA 3UMMA 3Q6MA 5EE1A 4DV0B 4LF6B 1KNQA 1RWKA 1US8A 1FEZA 2J3MA 3RFCA 4BZPA 1FYWA 4HNTA 2X22A 2D1SA 5JNWA 8ABPA 4ZQIA 1Z0AA 3QUCA 1Z6XA 4AAYA 1KY2A 2XYRA 2MTBA 2HBQA 1JZSA 2OGUA 3CM0A 1M2FA 1JVSA 2ERXA 3KB8A 4P4SA 4V0SA 5AH0A 3VC1A 5JY6A 3HUFA 2IELA 1EAYA 2RGAA 2NXJA 3GUHA 4IICA 4RK7A 2BFFA 4YLGA 5FYDA 1C7QA 3F1KA 5AJWA 1GZ4A 4V0NA 4YCLA 4C4OA 3AV3A 1WZ2A 2BRUA 1V2HE 4P0PB 1ULUA 3TLJA 4DADA 2DT8A 3V4PB 1RWBA 4K87A 4DIMA 7GPBA 1DQPA 4L07A 2V1UA 5JPIA 4A3SA 3CB4A 3WGVA 3VR5D 1MJFA 1XZJA 1YA8A 2IYEA 3W0LB 3IA7A 1K75A 3NFRA 4IOMA 1RPJA 3HEAA 4HDKB 4E46A 2JKZA 3AHCA 2LVBA 4MQFA 4E3ZA 2XCTB 1HDZA 3DOCA 3RF6A 3BIFA 2GPBA 1X7GA 2JI7A 2NSLA 1DSSG 1PQWA 1ZKMA 3AW9A 2PMWB 2JCSA 4MUMA 4LXGA 3ZHYA 4D4IA 3EFOA 1RAGA 2KWIA 2IQ5A 2X0EA 5LU9A 2I4IA 1W0KD 3R3VA 4RFLA 1ZS9A 3I5YA 4HTAA 3WWOA 2OENG 3HO6A 3QFHA 4FPXA 1EYZA 4A8JB 4C9BA 3ICQB 2XGJA 2CUKA 3CEPB 3QI2A 5IDYA 1H94A 1TKRA 1JG6A 3H5LA 3G2OA 4NSNA 5EGSA 4WDRA 2C9MA 3KOOA 1K1EA 4H1UA 5AWFC 5GONF 1FXUA 2VA8A 1H2YA 3ZGLA 4MA5A 3BDIA 3MT7A 2DQKA 3KVVA 3LQRA 1U1CA 3GGGA 5HHTA 1UKEA 3S8EA 4NDNE 3SX2A 4H1HA 4CIYA 1BN7A 2A33A 3HP7A 3PS9A 4R81A 2QB5A 3UFXA 5FWXB 2V59A 5H3LA 2GAIA 1TUBB 3BT7A 3H1GA 1E58A 3KLBA 3GRRA 4KIWA 2WJYA 2JGFA 2PLWA 3TLEA 4YRTA 4QLBA 4BBAA 1FE8A 3SM3A 4R41A 5EKUA 3RQSA 1OH5A 3I8OA 3W79A 3P2YA 1WKBA 4NJMA 1RXEA 4YCCA 3AZOA 4LCEA 2XHEA 3CSSA 3TPZA 4B3DA 2HMYB 2Y77A 4AZ3B 1YI0A 4A0RA 1YI8A 1ODIA 3RCBA 2Y6UA 4EB8A 2PO5A 2W2LA 2ZWPA 2F8LA 1PGQA 2H7XA 3AFIA 4M0FA 4IV0A 1MHPA 2CV0A 3VKHA 4IIJF 1GNVA 1CY1A 1N8NA 1MG0A 1SUWA 3BCHA 4ML3A 2JIBA 5JAOA 4LF5B 1ADGA 2ZJ6A 2ZPAA 1J70A 3GNQA 3OD5A 4ROSA 4UU8A 2C4HA 2GCOB 4Y9DA 1XZCA 4MLDA 4I4LA 4IO1A 1CRWG 5DLEA 1Y3BE 1C4KA 3W1VA 1ILWA 1LY1A 1JXAA 4D9EA 3FYUC 1T36B 5F7JA 1E5TA 2CLIB 3QWFA 2FY8A 2OK7A 1G21A 1ZGZA 5C37A 4XQCA 4D80A 5D3QA 5KMGB 3ANMA 3G8CA 1U3VA 4IDQA 4L0MA 5CM9C 1J5XA 3QI7A 3O75A 1E98A 5KKCA 2L18A 2ZSIA 3EZ6A 2PANA 4LA4A 1VLLA 4N49A 1HX7A 4RD0A 1CQIB 5CFPA 3WBJA 1HORA 1BHSA 1SQFA 1Q6YA 2VXCA 3LBHA 4N8SA 4CMBA 3G82C 2A9OA 2JI8A 1SK8A 2VHZA 2Q2QA 1KY3A 2AXPA 2JFXA 3FB4A 5CJ2A 3CF6R 1ZI9A 4WQMA 4IV8A 3I34X 5IBCA 4HDAA 5H1YA 3CZCA 1OXXK 3LCUA 1KPGA 2VWPA 3TZCA 5M04A 2AR0A 4EI2A 1WETA 3JQAA 3OLXA 4RIFA 5CR9A 5EZYF 1GDHA 4ZKEA 1U4NA 4DDTA 1FFXA 3X1YA 5B58T 4ZC1A 2C1XA 1N9GA 1LWOA 1XCJA 3K53A 5ICMA 3DE2X 1PFUA 3LUHA 5C0OE 3QUSA 3WJ2A 2B0CA 1GP2A 1SG0A 4BWYA 5HQ3B 1SEPA 3SWWA 3PDJA 4LYJA 3EHDA 3VV3A 3K6SA 2C54A 2NTEA 2EWVA 2FVYA 5EPUA 2AB0A 3OT5A 2GDZA 3RYFB 3TK1A 5DM70 3LLMA 4ABYA 5MN6A 4NYMQ 5ENVA 3F9IA 2JH8A 5HE9A 1BXKA 4IYRA 2HXGA 5C51B 1RJEA 3VPAA 3CZ9A 3IQHX 4BMXA 4XB2A 1BW9A 3TE6A 1GG9A 3K92A 4YR9A 1FIUA 2RHGB 1DTWB 3OIUA 1R0RE 4U5QA 3IAFA 4DY6A 4RVFA 2VHWA 4LZOA 2O5CA 4W8GA 3R3UA 4LYHA 1KDRA 2JARA 2GCEA 3LVRE 3DEFA 4NENA 5EL0A 1L5NA 8GPBA 3INGA 1V1RB 1FF9A 2BISA 2IZ6A 2CYBA 3KX2A 4LWZA 2R8YA 3PUKA 1GV1A 1XTZA 2W6PA 1RDFA 2JAUA 3KV1A 1IEXA 3ZOKA 4E5DA 2IVZA 1YBVA 1UDWA 3DVAB 3ZHZA 4OQMA 2XA2A 1S8OA 2MYTA 2WKWA 4NWIA 1V5GA 2IOFK 4PZYA 3R7WB 4QGSA 4Z3KA 5JYCA 4R6WA 1ZNYA 1U81A 2FPXA 3F96A 2C2XA 2I2CA 4OHCA 1GSAA 1Z26A 2ZUWA 3U60B 2D5IA 2AH5A 4AJ1A 4GOXA 4AJPA 3EDQA 2WSYB 4ZARA 1VCHA 5CB4A 4QJ5A 4D8UA 1I1HA 4HGNA 3LUKA 5KNDH 3MFQA 3KJQA 4PAWA 4BB9A 3TW8A 3L0CA 1CW2B 1KKMA 2HSDA 1R0YA 3IQXA 4I1UA 4Z7JA 1P74A 5JLAA 2QLLA 1COWA 1H8ED 1P3Y1 2WHPB 3I2HA 3VDRA 1WIWA 4GE3A 4X7MA 4HQNA 5KSZA 1ADBA 3TEMA 4PZEA 3ZWKA 1Y5MA 2NO9A 1UBSB 4I19A 1S2LA 2VHCA 4KLRA 2OZPA 4QHSA 5LZ9A 5IKXA 3IHWA 1WY7A 2B7LA 3CT4A 2V7BA 3NU1A 4XTCS 5CM2Z 3WYFA 5BUQA 1YE3A 3HJCA 2OCPA 2WVHA 2NPOA 4GI3A 4EHDA 2Q2WA 2P1ZA 4QG7A 1ZVKA 1FDUA 1U80A 4PBRA 5AJHA 2VBIA 3O3MB 5B53A 4ZCRA 4RA9B 1VSVA 1LC3A 2UDPA 3CEJA 1K3FA 4FW8A 4XYMA 5LDDC 1NOJA 5HZKA 4I0WB 3THWB 2GHQA 4I6JA 3ZW9A 4ZANA 3SE7A 4HKTA 1G2OA 2BHTA 1E3JA 1P2DA 1UMCA 3WLMA 4UDYX 2DPGA 1UBFA 4DQUA 4DYHA 1YA4A 5TXGA 5IXYA 1YCGA 1GNPA 1DIOB 3KIPA 3TZQA 3LDGA 3DXZA 4KAFA 2Z0MA 3QOWA 2VP3A 2NP6A 1AU9A 3VNRA 2C88A 2ZBFA 1GXSB 4RVDA 5IJXA 4RTSA 1TGYA 4LV5B 4ZJPA 5HKKA 2V7XA 4NU8X 2Q0QA 1QH1B 1XO1A 4BVFA 3J81A 3UATA 4TROA 1DB3A 1T3TA 2FEAA 3DTVA 1EEXB 4D02A 3BE8A 3EJ6A 4X97A 4E12A 1ZNWA 3P5SA 2YIMA 3ROQA 2HNKA 1I3NA 3A9SA 4XOIA 3A4LA 1OV6A 1W75A 3GYBA 4ZCTA 1ZH2A 4G9EA 1NMXA 4PS1A 2IODA 4RD2A 2GK7A 1MOQA 1XHEA 1VECA 3D2LA 3NHUA 3QHQA 3IILA 3R09A 3V8QA 3UQYS 1Z28A 4EF5A 3ZK7A 2NAFA 1HETA 1R0ZA 5FOSA 4G4SO 2CHEA 2X5KO 5A0VA 2AUNA 3W2FA 3GLGA 1EFVA 5CM8B 4ZEWA 3WB9A 3D7SA 3ZCQA 3OKAA 3GW8A 1SOVA 5A9TA 1KS2A 2P9BA 1BIFA 1C9DB 1XWIA 3LUPA 3I28A 3RTCA 5GWXA 4GI1A 1IQUA 2XD9A 1P33A 1Y7PA 4KR9A 5BNTA 4DCPA 5FPYA 1UMDA 3KXDA 5GAJA 1IJEA 1JEYA 1OH8A 4FI3F 3W6OA 3JTMA 1NBMD 1QDUA 3FYCA 4GI5A 3KQNA 3FNHA 2E4YA 2ALJA 2DWUA 2KB0A 4MW0A 2E4XA 5DASA 1V8ZA 3QY0A 4FGJA 1A50B 4PAGA 3HCEA 4YREA 5DZSA 2ZOSA 3R9IA 2VSQA 1QXSA 2FN4A 1H0SA 2Q0HA 4Q4AB 1HTBA 1WPRA 4AF6A 1JV2B 1XVIA 4Z1MA 4BFUA 1EHCA 3B1YA 3QYFA 1MRSA 3P94A 2X7HA 2O2HA 2DOKA 3RWOA 1W88B 2VF2A 3HWWA 4FYIA 4DIBA 3R6LA 4LJYA 3AIKA 1CETA 1POWA 3OUTA 1XEXA 1UBRS 2GF0A 3L1KA 5E95A 2OO3A 4JBNA 4ED9A 2Q2NA 5EE5B 4W5QA 4W9NC 2I1QA 4B3JA 1ZH6A 3QOFA 1G59A 4Z4HA 4YRBA 3VVMA 3AI3A 4ZVQA 1XD2B 3P27A 2H7CA 4LPKA 3VNUA 4XTRA 3EUFA 4LMBA 2F3TA 4JEHA 2P2DA 3RUPA 4JJZA 3QNMA 3A26A 5DJ5A 5LYJF 1IHYA 2CXPA 2PMBA 4KPUB 4IF6A 4CCWA 4EY3A 5JTUA 1IJBA 1KGSA 4MGYR 2B2CA 4WXHA 5IXJA 1HQKA 3WI7A 3T1VA 1CB7A 5AUOB 1VHQA 2ID8A 3RRFA 4K0KB 1CS4C 1UDBA 4Z9XA 1JTEA 2DX7A 1W4LA 1XMPA 2QUBA 2VYCA 3BMOA 3FW1A 3L7MA 5I9LA 4ZTZB 1ZGHA 2EEPA 1PK8A 3TIFA 3WRXA 1P0QA 2XRYA 1I1OA 1BKDR 1QP7A 1HRDA 1BDBA 3KOWA 4S05A 2ZYUX 1RYDA 3HMQA 4RV5A 1EZZA 5COBA 4GX5A 2CK3A 3GLIB 1QYCA 5J1TB 2IHTA 1L7AA 1VXRA 3IQFA 3EWIA 3RUEA 2PCLA 3E7PA 3PPYA 2FXIA 3HKBB 3HUTA 2O3JA 3H5VA 4DNXA 4E32A 3DZHA 3L2OB 5I5EA 2GUWA 1XZ8A 4P6VF 1AQYA 1P5HA 2VDJA 5T4BA 1LQ2A 2A0KA 2PEZA 3DZJA 4GLFA 1V3TA 1B0AA 1QVRA 4RKEA 2YJZA 4LBZA 4P3KA 1E5QA 3VOBA 3CR3C 3RAEC 1T3GA 1E79A 3BC1A 5IAEA 2R1VB 1SOWA 1KBOA 5ULLA 1SVNA 3FNBA 4IH1A 1GU7A 2AJBA 2F1RA 2OCDA 2OR3A 2V74B 3P1JA 3Q9LA 2TMYA 2EQ5A 3NGLA 3R2JA 5KTYA 2H4XA 1IVYA 3RJ5A 1KPHA 1Y5RA 3UICA 5KDDA 4PC2A 3V8RA 3GLFE 3V00A 1JIUA 1FYXA 1X2BA 3UH1A 2PBRA 1Y98A 3PJDA 3UJ8A 5CGQB 5DK4A 1YRBA 4Y2PA 2PZBA 3FTNA 4L4ZA 3C45A 5J59A 2F1HA 3LG2A 1WCWA 1SQ5A 1U7TA 2LE0A 3OT4A 3SS7X 1H2XA 1Y8RB 4LY6A 2FQ1A 2GF2A 3UOGA 2QRPA 2OBMA 2YMLA 4GFDA 4ZVPA 2WT9A 4ZT3A 1QS0B 1DC8A 1RQGA 2F43B 3IDFA 2Q4DA 1RSZA 3KR1A 4LOKA 4Z8YA 1NVEA 4MITA 4OHZA 5AW3A 2VG8A 4PHCA 1IHDA 1T3ZA 4EDHA 2GYVA 2Q3JA 3S6JA 1VJGA 1DRWA 1HQYE 5HRUA 2PH5A 4MGEA 2O8CA 1LBIA 1MLDA 3X1XA 4PFJA 5EOVA 1HT0A 1T2NA 2QORA 1TECE 2H5EA 3L7DA 4NYIR 4C2TA 1EVEA 1Z18A 2ZQZA 2QOEA 4KRGA 1RMTA 4HMOA 2K7FA 2GT1A 1NBAA 2I9KA 1QG2A 5FUXA 1NP7A 2ZI3A 1ONOA 1EM8A 5IAKA 3DKVA 4FYPA 4JYZA 2PAFA 3PFBA 1CFZA 4RY2A 1LDEA 3U3DA 1XN4A 3BYZA 5AVJA 1UPFA 1TZ2A 1EKXA 3HJNA 2ZEJA 1GTZA 1WCXA 4ESOA 4MO2A 2CFSA 2HRCA 3R3SA 4E2WA 4U0JA 1A7JA 1KEKA 4LDRA 3WOHA 2FPMA 4WCFC 3L6RA 4BNZA 2H8GA 1ACLA 3ZV7A 4MS4A 2CUZA 4H16A 4BL5A 2IUUA 1JEQB 3B20A 1RKVA 3MWDB 4IINA 4IIEA 5EINA 5B6PA 3FLEA 2I2DA 2OHJA 4AN0A 2O59A 1PR4A 3KOMA 2H1WA 2F3RA 3S5JA 1GRQA 1P1HA 1RWXA 4M8KA 3U1BA 3IAUA 3E7FA 2PMFA 2Y0BA 5F52A 2X1MA 1NAIA 4P34A 4WZAE 3GFVA 4OA5A 5LB2A 3EQ2A 1RI3A 2BC9A 1TZBA 2X5OA 4D1YA 3V4RA 1TVMA 2IJGX 2ONYA 3NT4A 2HGSA 2VA9A 3D1LA 4BQNA 2XVYA 3BH6A 2BUBA 2YXDA 5FI0B 3ZE7A 1GARA 3DOUA 2O3UA 5ALZA 3EQZA 1W1IA 1U3WA 2PMCA 4MRAA 4OI1A 1WKCA 2KBFA 1FMJA 2Z3VA 2J0QA 4W8HA 2HZ7A 1VHJA 1UFRA 1XWWA 3EEOA 4C7OA 3R5SA 1RXVA 3BA1A 4JQOA 2HQRA 3TECE 4BYMA 1EFDN 2ZZMA 4MVJH 4LJLA 4YR7A 4UAVA 4QM6A 3PXGA 2HPZA 3ZI0A 1P0CA 4H3SA 2BKUA 3E0QA 2MDTA 3T7EA 4F3TA 2JFVA 4H1WA 1L4YA 3HZOA 3L0PA 5KX5F 4MUIA 4AXBA 1LVGA 4IUCS 1TDJA 4P7BA 4LDZA 5KREA 1L3CA 1XC7A 1MA3A 1W6RA 1N33B 3V2UA 5FLXA 4RVGA 4M1KA 3UT6A 4QUKA 3M6UA 2QV0A 4WSOA 4ZT7A 3RHZA 1EGQA 2IYWA 1JR4A 4AFNA 5IZCA 5E6UA 1PBNA 5EESA 1E7QA 5DBGA 1NNEA 4B35A 4M1YA 4LTNA 2VI5A 4Q0MA 3V55A 3NNSA 2FUKA 1U1DA 4K6KA 4MWZA 4X0EA 4YAGA 3I2FA 3Q0EA 5HJ5A 1RZRD 1DJPA 2VYVD 3MTJA 4Y2HA 3G8BA 2IPAB 1Z2OX 1K4KA 1BYUA 1K63A 4G97A 4BKOA 4DT1A 4E5PA 1E9RA 2K87A 4RVUA 4C1BA 4PZLA 5JCOC 1LLQA 1JIIA 1MJGA 1W49A 4UMEA 4XARA 2ZIEA 1Z35A 1UC4B 3DLBA 1I51A 5K6RA 1O9BA 1M2VB 4US2R 4CGZA 4MMZB 1YB5A 3SICE 3KO8A 5TLSA 1JR6A 3O2NA 3CKYA 1CS0A 3T7IA 1QGUB 1LRJA 2VNAA 3HFRA 1GIAA 2CJFA 3MOGA 2OV8A 3LQ4A 1MV5A 4TV9A 5DN6D 2XNKA 4PO8A 2JL1A 1VBNA 1YDWA 4Q4HB 5TT0A 5KYUB 2EARA 2JH9A 4U3JA 2G9RA 1YONA 2G1AA 3NHBA 4ISBA 3HZRA 5DGCA 2BGRA 4R9RA 4EJSA 3I2IA 4GZ3A 4YJHA 1OX4B 4UJ5A 5AKEA 5HKOA 4XUDA 3DV0B 2E37A 2CXOA 5DW3A 3IOMA 3O0TA 5FHRA 3UHOA 2GZ3A 1VHDA 3HLYA 2FWNA 1HLGA 1P8JA 3MS4A 1DI0A 2FWIA 4LYYA 3X1DA 5BR4A 4TTRA 1I6LA 1MF7A 5DSTA 2VPTA 1PTKA 4PZ9A 2OESA 2QRQA 3LKDA 5JNUA 1TEXA 3RFVA 2A2ZA 3EMVA 1WF6A 5K8UA 1TQDA 2ZRDA 1ZMTA 3BWCA 3TXYA 2VOJA 1BOFA 4DCOA 1EGMB 2PZKA 3CVJA 1WBDA 2N1MA 1PZEA 4GGPA 1S9HA 1VG0B 2GJ8A 4PQYA 1JLKA 3HVJA 3G5LA 1ORRA 3OEHD 5D87A 2H31A 4MRSA 3I45A 1S3IA 2ERCA 3WRVA 5D86A 1ZD5A 3TTVA 3V2IA 2NV6A 4FKZA 4RZUA 2VWQA 3HYCA 1YJAA 3VBEA 4XWKA 2JJ1A 4D3XA 4DCMA 2GM4A 4WKBA 3N3AC 1FDTA 4DMKA 4PAMA 3GWZA 4DDMA 2V6IA 3B8EA 3F6PA 2OTCA 2ZIUB 1U6IA 4WZBB 1KP3A 3JRWA 3KSZO 2B9VA 2P5SA 4QO7A 3IVXA 2VNIA 4ZT4A 1K6IA 4RHFA 3F90A 4OK6A 1MB9A 1F2UB 4KIJA 4F3NA 2P40A 1E1MA 1XA3A 4NDAA 2EG9A 1JQBA 4LJ6A 3LW8A 4D3SA 4KE6A 4C6HA 2HCFA 4IILA 4YUWA 3WLQA 2AG1A 1G3MA 3GO4A 1GA1A 4N3GA 2H5JA 4QUIA 4KJXA 1HA3A 3RIHA 1U8CB 1AUPA 5KJ1A 3RS3A 4PYRA 3MD0A 2PJUA 1NDHA 2EL9A 4R1NA 821PA 3O4RA 4TT8A 4F9GA 4PQEA 5IU6A 3BXEA 4MWBA 3WYBA 3KRTA 5EY5B 1T1SA 4YRAA 3EK2A 3HNPA 2IWRA 3IR5A 3GJ7A 2V6GA 2GM3A 3HVHA 1H1DA 1M66A 1UBNA 2HB6A 1QGED 3W2GA 2C82A 2ADMA 2C7GA 3R77A 1I2CA 3RG2A 3SZ3A 3AL2A 3ERCA 3KQHA 2IH2A 1CFJA 4YJ2A 2BZ1A 4OI4A 3KS9A 3D31A 3K8YA 3ZIAD 1W7AA 2NIPA 3BTSA 2XH8A 3IMCA 4NE2A 1YDMA 3UYLA 1M0SA 3G9TA 2A3RA 1NL3A 1JJAA 2R751 3FLBA 1S02A 4O4IB 4C43A 3IB3A 1M2HA 3ENKA 3HB1A 3F5DA 1ZNQO 2GPTA 2CC2A 1Q0QA 2VK2A 1JG1A 1WRBA 1SRRA 4I6GA 5G3ZA 4CKEA 3GT3A 2AZMA 2WHRA 2XOEA 4C4ZA 2GZSA 2EHDA 2H48A 2WPDA 4NECA 5KVAA 3CLRC 4MLZA 1RWQA 4EPTA 1YSCA 4XPIB 3G0CA 5LZ4A 2PKYX 1ZUD1 2VJQA 2V9ZA 2BBSA 3RVPA 4M83A 5JRJA 3BIJA 1P4AA 3KEFA 3OM9A 4Q7MB 1Q7EA 2JFHA 5I7SA 3BGSA 5LKAA 4N8EA 5CFMA 5JYBA 3WV5A 2K2WA 5DVZA 1NFQA 5I48A 1IULA 5HFNA 1EVLA 2GRAA 1OIVA 1L5OA 1Q7TA 2ZSBA 3ETGA 4UBOA 1ZVJA 3U4HA 3U3MA 4IH4A 4TTJA 4M54A 1J56A 2QE7A 1T3HA 4HNGA 3EPJA 4JWKA 1M1YA 1SXGA 4BBJA 3A1WA 1X7HA 3GGDA 4LSMA 5CFZA 3AKCA 4YTEA 1PR1A 2WNSA 1ICIA 2V1XA 1MXFA 4RTQA 4L7VA 1U0RA 1Y3AA 1EEHA 3G2KA 3RD5A 2FW6A 3RKSA 3C3AA 2GFQA 4FLMA 1M6YA 1Z2CA 1I1QB 2PZAA 3R40A 5L3ZA 1I9GA 1GPYA 1V1MA 2K2QB 2RGXA 2ZB3A 4I5EA 1PGNA 4XDHA 3WNCA 2FRDC 2OAEA 2I2AA 2EFDB 3DUWA 1MTOA 1YRYE 2AJDA 4FOPA 4WN9B 4FXPA 1RCUA 1SCKA 5J4VA 4ZO6A 1DXQA 3L8ZA 1HPLA 4M9QA 2GO7A 2EKBA 1KNXA 1D6SA 1YAJA 2ZYRA 1YR7A 1D1TA 2P6NA 1QFXA 3EQ6A 2G6TA 4F56A 2HTFA 1TQ4A 1NONA 2XTNA 3ZW8A 3UT0A 1DUVG 3LFUA 4PZDA 2EIXA 2WV7A 3QEJA 1D5WA 3VTFA 2IP2A 4IQ8A 2X8JA 3G2HA 4O4LB 1Y82A 2JBAA 1W9HA 3PXUA 3W7BA 3ZCPA 5KOIA 4K81B 4MI1A 3CRQA 2M1XA 3DZKA 5DP2A 5TMEA 3Q8WA 3TZ6A 1AKMA 3EXEB 4EVRA 3G0DA 3I4LA 1ISFA 1Z3CA 1XDDA 3OHSX 3Q7RA 3RV4A 4GOLD 4LZNA 3HM9A 1F0YA 1VLZA 3EXIB 3JALA 5IC6A 1QUEA 4OXXA 5IH7A 1OI2A 4XGKA 4Y8VA 5MN5A 3GEPA 2GZMA 1BRTA 4L85A 3D8HA 2ZM5A 1Q0LA 5J2TF 2EGUA 1P18A 3A25A 3LKBA 4LGCA 3A6GA 4Y9UA 5EHNA 1MMFB 1NV9A 1NLMA 3KDSE 4H4EA 4B5KA 5DYNA 4YUVA 3DE0X 1F8XA 1E59A 1G5QA 2FFQA 2KBEA 2RKWA 4NV3A 5TF4A 1NVGA 3PDUA 3U31A 4DS3A 3QXJA 1FFDA 1OX5A 4UTPA 1PV4A 1H6DA 1I4WA 2WA1A 1XEFA 3O3CA 3U7QB 1NNLA 2GLXA 5DTRA 4ETWA 2F90A 4J16A 3C8ZA 1XZAA 3WADA 4URZR 1TT5A 2J33A 1PJ3A 2WFLB 5DI9A 1LEHA 1WZIA 1B43A 2VZEA 2WC1A 4Z4EA 5IT9A 1QBGA 1IE3A 2FSFA 2JFQA 3FMIA 4B79A 1X39A 2QZPA 4RH1A 1CDDA 3IPRA 2VK8A 3AG6A 4URVR 4JT9A 1WCYA 1RPAA 1BS2A 2VH2A 5LDHA 3N39C 1GY8A 3R7SA 4FOTA 3DLHA 2QRGA 3FDFA 1QAQA 3P4YA 4FLFA 3L6BA 2GMWA 4PC1A 2Q5QA 5EMNA 1U0GA 2PQ2A 4DMCA 5LOVB 5B12A 3FM9A 4ZVOA 1UP4A 4GM4A 4CM4B 2FHPA 1LLCA 3ADBA 3WKDA 1NJ1A 1U1IA 2WV9A 2JFOA 1KSJA 4ZQGA 4FFLA 2ZQ5A 3GHHA 4K9KA 3V7YA 2BKLA 4DCCA 2OV2A 2R1ZA 1QCYA 5LJIA 2ZUVA 5KYVA 2O0HA 5HOEA 3PNBA 3FTEA 4AZ0A 3M9LA 3MEQA 1PX0A 5FULA 4YH1A 4ILEA 1FXWA 4KKVA 4PRYA 1MQ8B 3U09A 3ICEA 4CU5A 3DKPA 5G41A 4HB3A 4DQXA 4JGGA 1L4LA 1FVXA 2F59A 3KQOA 5IBRA 3CRZA 1MIOB 2PTHA 1OBCA 4RD4A 1CF9A 3CG0A 4EEKA 1B76A 1M6EX 3OU6A 2O2XA 1JKJB 1PHRA 5K01A 4II2A 1QE3A 5IDWA 5LP6C 2B6NA 3CF4G 3JD2A 4J4BA 4JGBA 1J2YA 1RYFA 2R7AA 3HFSA 2PIAA 2R44A 3K0HA 3TWOA 3OBBA 2B7CA 2LUOA 3Q41A 3BK7A 5GV8A 5C5CA 4XRGA 2VYQA 2E49A 1N8KA 2ODWA 4QXPA 3AK4A 3FVQA 3FX2A 1KBZA 3ANLA 4UHEA 3SU8A 2QA5A 3EXFA 2CLFB 3JAKA 2EX0A 2PPLA 3V1UA 2YVAA 1A9XB 4O0MA 4C7XA 2DZDA 4LGVA 4O29A 5ALFA 5BVHB 3T3NA 4TXNA 3NIWA 2VDUE 2C8LA 5AVZA 2H2AA 4QKQA 1DFHA 1U4SA 3AI1A 4BGUA 3A6DA 3NHZA 1EX7A 1FFEA 4NBUA 2UYQA 5E6RB 5FNVB 1SIWA 3WBBA 2QM8A 2L17A 1LH0A 2D2XA 3FNGA 3UCEA 1R9GA 4M88A 3ETNA 2G9QA 5EUBA 3QWHA 4QXMA 1EPUA 2VT7A 3ASVA 4I9FA 3UV3A 1JTVA 4WI1A 2P4EA 4QRHA 1G42A 5IG2A 2UZIR 2OZVA 2PUVA 3OTOB 5EG5A 5LZ5A 1GPLA 5EWMA 4JL6A 2A3NA 1JHPA 1RQ2A 4L7QA 4PLCA 2C2MA 4LDPA 1GCUA 4M22A 3EPHA 2GWRA 2ECFA 4GH5A 1OXUA 2C9DA 2X86A 1R8XA 1ZX1A 3DL7A 1UJCA 4MUEA 4XFKA 5EE9A 5GIPE 1LWNA 4BNDB 3NHMA 3GJQA 4DA0A 5FDFA 4CQLB 4QUEA 4PYIA 3OPYB 2C3PA 3K73O 4BUJA 4X3OA 3QBEA 1B2LA 3V97A 1KJ8A 1FSZA 1RJWA 2NVBA 2BRUC 4L4XA 4U9UA 4UZEA 5CX1B 1E6UA 1NQ5A 2HR1A 3FBWA 1PJSA 3W06A 4JR1A 5DNWA 4ZICA 2J3HA 3PRHA 4F45A 2WW8A 3W3AA 5CXQA 1MDBA 3F7TA 1XQ9A 1FY2A 2ZROA 3I0MA 2Y0PA 3NHLA 2BT4A 3AHHA 3OFND 1P9OA 2O3QA 1BMTA 3TIXB 1XTUA 3LWBA 4N5MA 1JNXX 3RBXA 1AKRA 3WAGA 4JCCA 3TE7A 1BMFD 2HRBA 3WXMA 4EJ6A 3UT5A 4QOIA 4AK9A 2C4NA 2BGKA 3VUEA 1Y6GA 1DKMA 4IVNA 3MBOA 4H17A 2IZ5A 3IEVA 4C6SA 3O7MA 4FBLA 3DV9A 5F23A 5HKLA 3E3NA 3IE1A 2YYAA 4F6RA 2IKQA 2P68A 1DGQA 2ZVJA 1NKTA 3ZJYA 3A1DA 1ISPA 3BMNB 1PJLA 4IYJA 3TLGA 1HDXA 5YASA 3KUXA 3DBRA 3CW8X 4Z0NA 4LWOA 3WMXA 2IS2A 1T1EA 5DBOA 3SSNA 3TLCA 4WCFB 4ITUA 1ZZGA 2AMLA 1PZGA 3FZNA 4B0PA 4Q9DA 2IE8A 3IUJA 3CTMA 3KJEA 2OUIA 5T6MA 3Q7SA 1TZJA 4ZHQB 4B34A 2KHZA 2P6OA 2R6ZA 3O31A 4Z0PA 5ELXA 1SCJA 2P69A 3LM8A 1G41A 2HFKA 5DHFA 3ZCRA 2H4JA 2P9ZA 1KJ9A 2R2AA 4F1WA 5TT1A 1EB9A 2PKQP 4TQ9A 2YXPX 1NXOA 2QPTA 3AY0A 3M6LA 1WBJB 3LQ2A 3BTUA 1IWBB 4B3FX 3AF3A 3HA2A 1ISRA 4G84A 1JQAA 5JSUA 4D9NA 4HVCA 4A8TA 3K4QA 4JKYA 4BE7B 1SHZA 3AYZB 3ZE0B 3UJ7A 1QIIA 4O5AA 1XG5A 4IMIB 2DQSA 1YUNA 3LRPA 3IT0A 2BJWA 2JEOA 4MV7A 5G1OA 5JJBA 3E2MA 5C52B 4KK3A 1GNTA 3TTYA 4NMHA 4BQIA 4YMUA 5A6SA 2WIBA 3EOAI 1KRXA 4BPBA 1HLFA 1E0KA 1PRYA 3HCRA 1NVTA 2BI7A 2I4NA 2O8EA 5IJ0A 3TG8A 3MTGA 1DKQA 2VEDA 3G79A 3ZWOA 1LRKA 3TB6A 4JLNA 1NOKA 1I2DA 4B6OA 3N74A 1C41A 1IZ9A 3EGEA 5CGZA 3T5AA 2VJLA 1HFJA 3D3WA 4RTPA 4WW0A 4TWBA 1R5OA 2OZEA 1EE2A 3BFJA 5J5AA 5I8WA 2FYTA 1KRHA 3H2HA 2QN6A 1K3UB 4NZMA 3O8NA 2MSEB 4EKNB 2KYRA 4Z0TA 2DPHA 3ABRB 3I01M 3WGJA 3CLTD 3H5IA 2DUJA 2IY7A 1QIEA 1XTSA 2QMQA 5HZMA 3C7AA 2QVYX 2C5GA 2ZP1A 3MB8A 4RQAA 4DDUA 3FTDA 3DJYA 1O97C 2QAGB 3AUTA 1EGHA 5DNEA 5G3YA 5ALMA 1FLVA 1YIOA 2JAXA 2X0NA 3MJ4A 4NIMA 2NU6A 2IPOA 4UU1A 3ZHCA 1KJJA 1WJGA 1T4MA 3H1FA 1AO3A 2JLZA 5SY4A 4R0MA 3OZEA 3DWFA 3L8YA 5DB4A 1QVAA 1VGVA 2JIZD 3CA8A 4IKEA 1DO2A 1R3DA 1T25A 2HLHA 1IC6A 2HCRA 3SX0A 4OUDA 4QLAA 4ZVLA 1Z63A 4WDQA 1X8KA 1DQNA 2GEJA 2ORVA 2EERA 5JVDF 1CYEA 5ILQA 1QJ4A 3TTXA 5A1JA 4OLAA 4CU2A 3KJXA 2FEMA 4EMSA 4RANA 2HSJA 3COSA 4YUXA 3K9LA 4OGFA 2B20A 1FP4A 1XDBA 3QVJA 1G64A 3W6ZA 4RKFA 4URWR 4INOA 3BRSA 4NOMA 3TZEA 1GAXA 4F9FA 1C8VB 3SEZA 1UBUS 4BKPA 3HI6A 4DNFA 4WBXC 1LPNA 3JRNA 4LX0A 3D2BA 2ACVA 2NO4A 1PJTA 2ACEA 4Q00A 4HO1X 4X62B 2PRSA 1U65A 2NU8B 3N9IA 1AZWA 2ZJ2A 4G4JA 4HS9A 3IPCA 4B47A 4XGNA 5G40A 1GA4A 3AG5A 4MIOA 3ZIDA 2YN2A 1G18A 3BJRA 4NZ9A 3FOEC 3RTDA 1JF8A 3ND7A 2XCUA 1D04A 4TV8F 3VTZA 2WUEA 5KI6A 3SC2A 1QHIA 3U3JA 3WXBA 1ISIA 2ISSD 2IOFA 2EHJA 3KD2A 3ZDRA 1AKYA 2IU3A 5E1OA 3H5RA 2FCAA 3C6XA 3N7UA 4Z99A 3B5JA 3WIOA 4A82A 1N3LA 4ZTBA 2Z2JA 1RXUA 4M0CA 3ZJ5A 2PX5A 3U2QA 2B69A 2CBXA 1QOPB 3CJRA 4P5PA 5EHGA 3ZGVA 2JZCA 5DYYA 1WZEA 4NBKA 2PUBA 4E5YA 3SMQA 3UXHA 1Q1BA 2D0IA 1KFCB 1GTRA 2XT0A 1LSSA 3KQVA 4WIAA 4QBFA 3H8SA 1B8OA 5TPWA 1S9DA 2ZAYA 4C7MA 4O2AB 3OZAA 3LT5A 3HGTA 2BGTA 1Q17A 1F8GA 2HRZA 2QG6A 2Y2VA 5F3RA 1GAJA 3L05A 3GMDA 2EEZA 5H0IA 2UUPA 2WZDA 1SUDA 3O92A 3OE1A 4AUEA 5T6BA 2FEXA 3V3KA 7REQB 1UXOA 2JFBA 5THQA 4BMNA 3T0FA 3MFYA 2HEGA 1DXHA 2JLRA 3RWBA 2G76A 3FI0A 4XQGA 1Y3CE 1SU8A 1RI5A 3BHMA 2NQ8A 4Z9AA 5IEJA 2NYRA 3RS8A 2OSBA 4MB0A 2I87A 2Y0EA 4KAJA 4CUZA 2QE6A 1D7OA 1OIXA 2ZIXB 2OCIA 5HIAA 1KZYC 5BO5A 5M7EA 4YRMA 1U2DC 2W2OA 2WTMA 1M73E 1GL9B 3PK0A 4QPJC 1IQRA 3H86A 3JQEA 3PQ4A 3UAYA 1LDNA 3R3YA 4N54A 5DI3A 1CZNA 2V7VA 1E1LA 3FUWA 2QSZA 3QU7A 4R69A 1UBJS 2AEJA 2VTDA 1OIWA 4MS3A 1JYSA 4LQCA 5AP9A 2A78A 3HP1A 1OFUA 2CMKA 4DEXA 4WLOA 4HNRA 3N6XA 4G5XA 4EUEA 5EQFA 1L7QA 5JCXA 1CP3A 3LCCA 1IUNA 3DMRA 4TVKA 4MHOA 4QZVA 1Y3FE 3OE7D 4P08A 2H0RA 1KIFA 1AK2A 2QXUA 2FFJA 1KO7A 2HCBA 2VDWB 5KTSA 4O4IF 1ZMXA 3HKDB 3L07A 3TZLA 1ML4A 5IC4A 4UEKA 4ZV4A 1L5WA 2H3EA 4RAOA 1E2NA 1YFKA 4DMUB 3GLHB 2PZFA 4V2UA 1AN9A 1GFWA 2OORC 5J5CA 2IIPA 1POXA 4WY8A 5C8DA 2HTEA 4E30A 1DG1G 1DQYA 3RJZA 1YACA 4BVHA 1NW5A 3S2YA 2XOKD 1RYNA 2FMKA 2VPZA 2J6IA 2W2PA 3CKMA 1O89A 5H3CA 5C8YA 4KRYA 5EA2A 4QFCA 2QTWB 1T5LA 3AEKA 3B9RA 4WOCA 3UFBA 4B3BA 4FEGA 4Q93A 1MHTA 4R83A 4V3BA 1L3IA 4BECA 1CUWA 2X0JA 4PSDA 3RBZA 4DLLA 6GPBA 5JAMA 1H4VB 1AV6A 1M8JA 2EF1A 1PV2A 3TQSA 5BN4A 2XA9A 4BXOB 3AJRA 1ADCA 3F3SA 3UBTA 1TF7A 3DE5X 4XVCA 2C29D 2FZWA 3KKZA 4IX1A 4JSYA 4KIUA 1IXRC 3HGQA 4L9SA 4YWHA 5FOTA 1AG9A 4Y2GA 4D9CA 3PVZA 4PSAA 2ZDGA 2YNMD 3AVOA 4AYXA 2XD4A 4UHFA 1PG5A 3PPWA 4YX9A 5FPQA 4AYTA 1S2GA 2FR8A 2JFNA 2RFLA 2D59A 3DZDA 3FCAA 3NHJA 5D3MB 3ORHA 3UWDA 3M6WA 1HH4A 1AS2A 4PHFA 3KJNA 2BDUA 4TYQA 1ECLA 4TYYA 2QENA 1LQUA 1FZTA 1OLUB 2FZLA 4PIMA 4OP3A 4PR3A 1T0UA 2XMBA 1CYDA 1VIDA 4RWEA 3UKJA 5AKGA 5JV5A 2QYSA 4P0TA 4EO9A 5KOJB 5CURA 2NZWA 1IWPB 1Q0PA 1BVHA 1QHGA 4XWWA 1L5RA 4H31A 1AB6A 4TN5A 4YJ3A 5TQ0A 1DMRA 3GFBA 3N2IA 5ESXA 2UXBB 2I67A 1PGPA 3DB1A 4S2EA 1IY8A 1C8LA 3I6QA 3OAAA 5KHLB 2YWRA 4EB0A 4KIFA 4H1TA 4OGLA 5BUSA 3CR8A 4BVEA 1ZA1A 4AUMA 4R7ZA 1EGVB 1IJFA 1OCEA 5DXFA 1GDTA 2WUFA 5CYOA 2OHFA 1E2PA 3TRFA 3FUVA 3UHPA 1MNQA 2PEYA 1KI3A 3HXPA 1TO6A 4JLJA 3T5TA 4FMCB 5IT5A 5JEDA 1DQSA 2XEXA 3TAHA 5KOHA 1HFEL 1XU9A 3H5WA 3O21A 4KTTE 3WRXC 5ICCA 3M4JA 3W1WA 4K2HA 3E53A 5DYWA 1IMOA 1XZQA 4X90A 3E7WA 1XZFA 2WJ6A 2XT9A 1FP7A 1XZGA 1A7AA 3DM5A 2G17A 5KPJA 2WOJA 3R0QA 3V1NA 4BMZA 1IM5A 2REBA 2CXRA 1A9TA 2QL5A 3DWGA 4EHJA 3RSHA 3UHFA 5HG0A 1MXHA 1I3OA 4X5OA 1N9ZA 1ZJ5A 3CLKA 1QIDA 3AKEA 1Q3KA 3ONDA 5ER9A 4FWTA 2CUTA 3THOA 3PFHA 2GFHA 5E4FA 2J45A 3PXCX 2Y99A 3AF5A 1X7ZB 2NVUA 3BJMA 4LOAA 5HRCA 1GAEO 3GVIA 1J42A 5AI5A 3JXEA 4MH0R 4MIEA 3TBHA 3IJEB 4WNAB 4CEIB 4A2QA 5IASA 3O83A 2Y76A 1TIBA 3RF7A 1ZUHA 3H42B 3R5TA 4R2WA 3F8SA 1YMQA 1IYZA 1Y3IA 1V41E 3I2JA 1KDOA 2Z1MA 3I76A 3QVXA 4RK1A 4C5BA 1ZR2A 1Q44A 1XEWY 1JFLA 3DB2A 1GPJA 3LRTA 5JI2E 3HO8A 2WU4A 4JSRA 4Q4LA 4QOGA 4QTYA 4G0QA 3MWJA 1D4OA 1UJ2A 3OJEA 2ZYHA 4UTZA 5EPOA 1K9VF 3IJRA 4WJKB 1XL0A 4W1PA 4ZAGA 4M8SA 1GUBA 1SD2A 2X7JA 1ONPA 4ND4A 4YWJA 3ZCSA 4RW0A 2OCAA 3U4AA 4MS1A 4M9CA 4KWHA 1U6JA 5BW8A 1D2AA 4UREA 1QC5B 2AC2A 3P7MA 3NUQA 4YDRA 3L77A 4YJKA 2IE0A 5FBZA 3TPCA 5I4BA 4N1AA 2E5LB 4MRVA 3MMZA 2ZBPA 3CTPA 1A1SA 3QWBA 4WVLA 5KTKA 1ZCFA 2C99A 3QVWA 3ETCA 1PYOA 5FPPA 3G9QA 4PRZA 4JLBA 1GVNB 3S1AB 5JMWA 4MR9B 5T64A 2VH5R 3C6BA 1QPGA 4CQMB 1O2DA 4IHKA 5JQGA 4BV8A 1T4CA 2QLBA 2ZE5A 4FGWA 1OGJA 4AJIA 1N0UA 5KNBA 3I39X 5ILGA 3UAVA 5B64A 1WDWB 2QUHA 3REFA 1C1DA 4Y2UA 3A6JA 4G5HA 4HG2A 2NUAA 2VJOA 1FFCA 1JPJA 1T5SA 5DEIA 4BN5A 1JR3D 3JQ6A 4GXNA 3L7YA 4ND7A 1ATIA 1MZPA 4JZYA 4D99A 4P9NA 2NU9A 1WTAA 3A36A 2YOHA 1WHSB 3E8XA 4E1VA 3SVZA 1J0CA 2XIQA 1WY5A 1CNEA 4FKBA 4AS2A 1NQXA 4BO5A 5AW8A 1OREA 4RMIA 1C3OA 4PTLA 1SVIA 4HDMA 4RCZA 1A88A 2JA2A 4DTCA 5BSVA 4YBZA 1ID1A 2NO1A 2OXRA 3EY9A 4ZQBA 2C9CA 1K6MA 4LOIA 1EESA 5EMLA 2XQGA 3GGJA 3WR5A 3A2MA 2D4HA 3QY9A 2EYQA 3TFQA 4LSGA 4TWRA 1E3LA 3P2OA 2DBQA 2PSEA 2H4YA 3N3BC 4TT3D 3VPFA 3EUAA 2Q28A 3ESAA 4X1YA 4YXWD 4C89A 4AF8A 4XCVA 3HXMA 1V9SA 3QYPA 4JITA 4R7TA 4CVNA 2M98A 2NQTA 1JPVA 1QZXA 2FUEA 3R6WA 2HBRA 3G02A 3NHSA 4CKXA 3K5PA 3D3EA 1T0PA 5AKHA 6PFKA 2GBLA 1WDLA 3KE9A 1ZESA 2UAGA 4M7OA 2XVXA 2FG5A 2J0VA 1M6WA 5DT9A 2W6JA 2R7NA 3TTWA 1RI2A 5A4JA 1CUVA 3RR2A 3TF5A 1N9KA 4QYIB 3GH1A 4YV7A 4OXNA 1UT8A 2ZYAA 2MSKA 4OREX 2PZJA 3OLVA 3BXXA 3RVBA 4HLDA 4PG7A 3EBPA 1QK3A 4M9ZA 3OKCA 4HFRA 5IZCC 1G5PA 3L9XA 4GI2A 3B2QA 3KYCA 4I9UA 4RJIA 2JIPA 3VAYA 1LDMA 1WD7A 1M6NA 3SOZA 1OAAA 1M1NB 2A5LA 2JJ8A 4XYEA 4RVOA 5JARA 4E1BA 4LVOA 3IPLA 3V6MA 1JU3A 4BRUA 1PKXA 4ARUA 4FJ1A 4CM9D 4I7EA 3QLVC 2VYFA 3WIVA 5LQUA 4KL8S 3B3AA 2HJRA 2HK8A 5BPFA 3GUZA 5E3HA 2HMWA 3UEOA 2ZWVA 1SIOA 2ZVPX 4ER5A 2EWWA 3I9FA 3GVPA 3FNQA 4NBLA 1WQ3A 3HR8A 5DE3A 7YASA 1IB0A 3HU5A 2C9OA 3FCSB 2Z4TA 4MVJM 4AKTA 1JXQA 4F11A 1YOVB 2EKLA 2H7VA 1NFFA 1NNI1 3KFXA 4NCKA 1O57A 1DFIA 4O4HA 1U8AA 3VTKA 5JFTA 4C78A 2DR2A 4N47A 1RRKA 3O90A 1DBPA 1JYEA 3F5FA 3SYRA 4ENPA 3H6KA 3IEUA 2D7JA 3NC1C 2CVHA 4K6OA 3UXEA 3HDHA 3KQMA 5BRNA 4QPCA 4JIGA 5KAMA 5CCEA 4YT5A 3GOQA 4HGPA 1WP9A 5TEVA 2ECOA 1SO8A 3GGCA 4TRNA 1H1LB 2CCKA