1QKJA

T4 phage b-glucosyltransferase, substrate binding and proposed catalytic mechanism
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
351
structure length
351
Chain Sequence
b'MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSYLTRANSFERASE
molecule tags Transferase (glucosyltransferase)
source organism Bacteriophage t4
publication title T4 Phage Beta-Glucosyltransferase: Substrate Binding and Proposed Catalytic Mechanism
pubmed doi rcsb
total genus 131
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1qkjA02
4X7PA 1XV5A 3MRTA 2F3SA 6GPBA 4N3AA 1K06A 4GYYA 2R60A 2X0FA 3T5TA 2F3QA 2R4TA 2XA1A 4GPBA 1WW2A 1YGPA 2O6LA 3L01A 8GPBA 4HWGA 4AMGA 3S27A 2PYDA 5TMEA 2P6PA 2X6QA 1SXPA 2H1FA 2IUYA 3EBPA 3NP7A 2ATIA 3H4TA 4WHMA 3OY2A 3MT8A 3MS7A 3OTIA 2C1XA 1C8KA 2GPAA 2XGMA 1P4GA 4RIGA 2QN3A 2G9QA 2SKCA 1NOKA 1Z6QA 7GPBA 3OTHA 1XKXA 4AMBA 3S0JA 3COPA 1E4OA 4RIFA 1QKJA 5TVGA 3BEOA 3G2NA 5DU2A 3L7DA 3QHPA 1UQTA 3VUEA 3CEMA 3OY7A 4RIEA 2XMPA 2GPNA 1C50A 5IKOA 4BQEA 3G2JA 4CDRA 2IV7A 4CTMA 1NZFA 2AZDA 4FKZA 3BD8A 4BQIA 3OKAA 3L79A 3OKCA 5DLDA 1XL1A 1XOIA 3E3NA 3ZCPA 4BQFA 3WC4A 2XA2A 3T7DA 1IIRA 1FA9A 2XCUA 3S2UA 2R68A 4LDPA 2F3UA 3PE4A 4MI9A 2VG8A 1WV0A 3C4VA 4EL5A 3C4QA 3HBNA 3VDNB 3RSZA 2QLLA 1L5SA 3DZCA 2ACWA 1P2BA 3E3OA 4KQ1A 2XGOA 5D01A 3ZCSA 2PYIA 1FU7A 2H1HA 4NEQA 4MHOA 2VSNA 1QM5A 4NESA 4WACA 3L7CA 2C4MA 3MTAA 3D0QA 2IV3A 4HLNA 1L7XA 1GGNA 3TSAA 1WUTA 5HXAA 4RIIA 1PSWA 4GZ3A 4RBNA 1RZVA 2GEJA 1Y8ZA 4X6LA 4M60A 3GPBA 2FFRA 1K08A 3D0RA 1FS4A 4BFCA 2GM9A 2YJNA 2Q6VA 3MRXA 1P2GA 1XL0A 2FF5A 2XGSA 4X7MA 2ECPA 1E1YA 3CUUA 3MT7A 3NCHA 3CUVA 3NB0A 2AMVA 1P4HA 1FTQA 3MS2A 2QRGA 1V4VA 3G2LA 3CEJA 1P4JA 4G2TA 3VUFA 1JIXA 2WTXA 3PE3A 3G2HA 1JIUA 1B4DA 4N39A 2QRMA 3BD7A 5JTUA 4MHSA 4PQGA 1WUYA 4AY5A 3G2KA 2BGTA 3VDMA 3T3EA 3MS4A 3MBOA 3CUTA 3L7AA 1WV1A 2X0DA 3SYMA 4QLBA 3HBFA 1YA6A 1P29A 2VSYA 3BCRA 2FETA 1LWNA 3OTGA 5GPBA 5ENZA 3MTBA 3EBOA 4GYWA 3TAXA 3ZCRA 3NP9A 2QZSA 3CUWA 1GPYA 2QN2A 2VCEA 1L5QA 1Z6PA 3Q3EA 1L5WA 5D00A 3ZCVA 2SKEA 3MQFA 1GFZA 2C1ZA 2QNBA 2R66A 3RT1A 3IA7A 1PN3A 3RSCA 3WAGA 3BCUA 4X7RA 2JZCA 2IYAA 2HY7A 2VCHA 1A8IA 2ACVA 4MICA 3WADA 3GUHA 3QKWA 5BNWA 1FTYA 3BCSA 1NLMA 2GPBA 4YI3A 4REMA 1L5VA 3S29A 3NAZA 3MT9A 1FTWA 2QN8A 1F0KA 2PRJA 1NZDA 5IKPA 4FZRA 4LEIA 3T3GA 3CV3A 1AXRA 4W6QA 4L22A 1PYGA 4EKEA 1NVKA 1Z62A 1Y6FA 1RZUA 1GPBA 4N3BA 1IXYA 4F9FA 1NOIA 2PQ6A 2G9VA 5TMBA 2QN1A 3UYKA 1KTIA 4CTOA 3HBMA 4Z5XA 1P2DA 1JG7A 3T3HA 3MTDA 1Y6GA 3UYLA 2GT1A 2F9FA 2AW3A 1NOJA 4EKYA 4NC9A 1ABBA 3MRVA 4XI9A 2XA9A 4MRAA 2BFWA 2R4UA 2JJMA 4AY6A 2QLNA 1VGVA 9GPBA 3DDWA 4YI5A 4MI3A 1BX3A 3T3IA 2F3PA 4GZ6A 2QN9A 4RELA 1C8LA 3NC4A 4M83A 4N9WA 4YUAA 3ZCUA 4KQMA 3ZCQA 3AMVA 5JTTA 1F6DA 2OFFA 3NPAA 4M7PA 3CUYA 1UQUA 2JLBA 2X0EA 1EM6A 3O3CA 1O6CA 2ZB2A 3D1JA 3T3DA 1FU8A 3IAAA 1M5RA 1PNVA 2C9ZA 1XC7A 4RIHA 1FC0A 1SXQA 3OT5A 2ASVA 2GJ4A 2SKDA 1JG6A 3HBJA 4KQ2A 3Q3HA 3FROA 5I45A 3E3LA 1WW3A 2G9UA 4F96A 2X6RA 1GG8A 2QRHA 2QRQA 1GPAA 1JIVA 5TMDA 3C48A 3S28A 3TOVA 1J39A 1GZ5A 2BISA 2IEGA 4GZ5A 2IEIA 2GEKA 2XCIA 3BDAA 2QN7A 1RRVA 3L7BA 5DXFA 3CEHA 1HLFA 2AV6A 4CTNA 3DDSA 4EL0A 3Q3IA 1H5UA 1L6IA 4MI6A 1Z8DA 1C3JA 4EJ2A 3BD6A 5C1DA 5LQDA 1FU4A 1EXVA 2QLMA 1L5RA 4AN4A 3G2IA 4WADA 2KS6A 2G9RA 1AHPA 2IYFA 2IW1A 2PRIA 2BGUA 4N3CA 3ZCTA 3H4IA 4XIFA 3SYRA 3DD1A 4RENA 3OKPA 3RHZA 1LWOA 1UZUA 1JEJA 2QRPA 3MSCA 3CX4A 4F97A
chains in the Genus database with same CATH superfamily
3R4VA 4L3OA 5DW0A 5E6RB 1O9GA 4N8EA 3P1JA 2FN7A 5JBIA 3PG5A 5K6AC 3FNHA 5LWQA 1YF3A 4TXJA 5E38A 4TSFA 4EQ6B 4LMRA 3SHOA 3NO4A 3BJZA 3RSFA 3VO8A 2ZAYA 1GPJA 1JKXA 3IH5A 2ZB8A 4H6WA 4XTCS 2QUIA 1WZ2A 1JTEA 3L8YA 1W0KD 2C5SA 4HXFB 3HYTA 1T2DA 4FXOA 1W85B 1V26A 2QXTA 2G3YA 1JDTA 1QYCA 2F1RA 4GBMA 5CH5A 5ALUA 4C1NA 1YO6A 4M0FA 1VCIA 5HFJA 1E69A 4M3NA 3B3GA 1JB9A 3TCNA 2EKQA 4E46A 4ZHSA 3P19A 3ZXSA 1S7CA 4G56A 1X15A 1YVUA 1CY0A 1XJ0A 3B3FA 2QL9A 3IIIA 3THYB 2PKRA 1NW3A 3INRA 5BWNA 1OZFA 2INGX 2P6PA 1EFHA 1WWKA 1V16B 2YMLA 3NVAA 4MJXA 3ZHBA 2L19A 3FCAA 4RTNA 2VH2A 5AI0A 4BNHA 3A11A 1W29A 2F8LA 3LRXA 4KXYA 1L5MA 3OHMA 4Q34A 1RXSA 4O3FA 3IXMA 2QYHA 4EJFA 1OKKA 5FOSA 3SZGA 1QRAA 2CDBA 4JGGA 4L3VA 1AO0A 4D3SA 2DR2A 2CJFA 3QWIA 2H18A 1RYHA 5FADA 1WZIA 3K32A 4G5HA 5ESWA 4BGVA 5FUMA 4QU0A 4HNAA 2PBRA 8ABPA 4AKEA 2YWFA 2F64A 2ENWA 1Y1LA 4ZOLA 1MHTA 5BQFA 2O07A 2Z6AA 3M2TA 3S1AA 4BO9A 3F3SA 3FDJA 3KL2A 3QEJA 1GARA 1UMCA 4KIFA 2DKNA 3K94A 2FI1A 2ZTMA 3COPA 3WP0A 1SQ6A 2O3UA 2GS9A 2ZVPX 4BZXA 2YCBA 3VR4A 3BEOA 1CRQA 3PE6A 4R2JA 1CLUA 5C7YA 5IKMA 3RS3A 4W7IA 4WVLA 1ZONA 3I6ZA 1WMEA 4ZMRA 1EP1B 1N0UA 2E37A 4KODA 4XFJA 5K0BA 1IY1A 5G0UA 3R3XA 1PDOA 1XK7A 3BB3A 3M6FA 1NBIA 3VR5D 1VXRA 4DFDA 1ONPA 1WXDA 3ZK9A 4YX9A 4OKSA 2WFZA 3PI6A 3OP1A 1SG6A 3H18A 3L6OO 2JI4A 2V7QA 4G0PA 2WWVD 5M29A 3TX6A 4LYFA 4N7JA 3HL4A 3UVEA 2GCOB 3LCUA 3OMXA 2FLKA 4BUZA 3NEYA 4JQYA 1XU9A 4HWOA 5AW5A 2UVPA 3TXYA 821PA 2RE8A 1AKRA 2IGBA 5T67A 5LBIA 1R7RA 2HHAA 3CNNA 3A4LA 4XJVA 4EABA 3G7SA 2MMGA 4OQ4A 4LFAB 1YJAA 3C8ZA 3A3NA 1DT5A 4TKVB 3L4EA 2W71A 3NR2A 3FOZA 4P93A 4LDPA 1DC4A 2WM2A 4B6FA 1ZGZA 1OLOA 1R0XA 1U0SY 2DFTA 4R2LA 4RH0A 4IG9A 2GBIA 1PZEA 3IC5A 5KBYA 2CDNA 5JUWA 4B3GA 4LVUA 3DCIA 3OJLA 3QNUA 5COQA 1Q0UA 3EC2A 5KQGA 2XSZA 1GAWA 5TJ9A 3W6NA 3X0DA 4AS2A 4LRSB 4N3NA 3JQ8B 1Z4PX 5DBEX 3BC1A 1EINA 3Q7RA 5LLSA 1UBJS 4DV0B 3G6WA 1VTKA 2BUCA 3MXTA 4QA9A 3GRPA 4DA7A 1NE2A 5LQJA 1NF3A 5ENDA 1S2IA 3A2KA 4JMLA 4BKPA 3VR5H 1M2KA 3SC2A 5KKCA 1VLMA 2OZEA 1KVRA 1S8AA 2XDWA 3O7MA 1JGTA 2FV8A 4LYJA 5BT8A 1RYNA 2NO6A 5SYAA 2ORVA 3NTOA 5C4IA 5BSFA 2IV3A 5C52B 1I5EA 3FNIA 3QBJA 3PZRA 4QTTB 3INGA 3M6AA 4DLNA 2XE4A 1GCAA 4MKXA 4NMWA 2VF5X 4L0MA 3MLAA 1P7ZA 4LZPA 4YIHA 2AFHB 2JEOA 2SECE 1QU3A 3RNOA 4ZDKA 1VHDA 4B32A 2QOEA 3HI4A 4H6XA 2OCIA 5F21A 4GLOA 1CNEA 2QR3A 2PWZA 3CB2A 4QLAA 3N75A 3W8RA 1J8QA 3LUGA 3UKOA 4JZKA 4JJEA 1IE3A 1MHPA 4J7XA 3S8EA 3BFPA 3EUFA 5E9WA 5J4KA 3R8FA 1ND6A 1CUFA 1NMYA 2C9CA 6REQA 3AETB 3M83A 4XJSA 1OOEA 3ZX5A 4ADSG 3H2YA 1HOXA 2GM9A 3GT7A 4PLGA 5EUQB 3URKA 1C9MA 3QEMA 3RQSA 3TCKA 2XQFA 5BMVA 2A35A 3PEWA 2XGSA 2WPDD 4LS3A 4IJMA 3RARA 4QOHA 3QVXA 5CM8B 3QFSA 2EFDB 4YN3A 1XZIA 1SQGA 1B8VA 3H5LA 4R2HA 5T8KC 1YZYA 1HQDA 1VL1A 5A3VA 1Z15A 4E5DA 4YQFA 4BCCA 1A5BB 3BVPA 4UTXA 1IUPA 2BCGY 2CHGA 3CEJA 4W8HA 2HA7A 2E4WA 4YRDA 3SE7A 4LN1A 2GUGA 2WTXA 4QQNA 1Y3HA 1DIBA 3PUWA 4OQPA 2Z57A 4RX1A 3WLTA 1CEEA 3DYIA 2WF7A 4KN8A 5A4KA 3QVLA 4MW4A 4FOOA 1E3DA 1QGYA 2E4UA 4Q4JA 4U3JB 1NSFA 1S0UA 2J7PA 3GNTA 4OM8A 5L3RA 2EYUA 4DYDA 1GTMA 1NN5A 1IQ0A 4XUCA 1VC2A 3HV2A 4ZJUA 1H23A 3G2KA 4G0NA 4WLFA 1BGXT 2BFDB 4WK6A 2H4ZA 4AG5A 2Y1EA 4NENA 5B30A 1SFRA 2IEBA 4Y6PA 1U3WA 3AF6A 1QNFA 2HRDA 1DC8A 1GTJ1 3HCBA 4FFBB 5CURA 4ZTBA 1O89A 2C3YA 2ZE7A 3LBNA 3ND8A 2BBWA 2OK7A 3CKLA 4B81A 5EJ6A 1U4OA 1PEAA 3DAGA 3KPYA 2G76A 5H7XA 1KQFA 3U1TA 1JFSA 1ZOPA 1V48A 3K05A 1Z5VA 4MLZA 4NS4A 1P29A 2QMEA 2XY4A 4R9RA 2WU4A 4TQGA 2EIHA 4M6WB 2X9VA 2ZIGA 5JMTA 2JJ1A 4UAUA 1HG1A 3L0CA 4CIDA 2ZKLA 2JIPA 3NANA 4FCWA 5ENZA 4CU2A 3I04A 3O1IC 1GLGA 5TQ2B 3JZMA 1OH6A 2DT8A 4HZGA 4RXMA 4V2UA 4LF8B 3IESA 1ZBQA 1J4AA 1N92A 2CFOA 221PA 3QKTA 3OCCA 3LOQA 4CKEB 1PYOA 3NBKA 4Z1MD 2PH1A 3N2KB 4Y6QA 3USCS 4BN5A 4BNGA 5DLQC 3AWDA 3ILVA 2OV4A 4MLDA 3SS7X 3KJEA 5B5SA 3KKPA 1AQUA 4EHDA 2C2GA 4O63O 4P2BA 4QPDA 4C5BA 3WJAA 5CFZA 4DMRA 2OESA 3TBHA 3U61B 3IB6A 3OETA 2W6ID 3D3WB 4HF7A 5H59A 3EC1A 4JP1A 1X0XA 4DQUA 3O8CA 1EBBA 1KYXA 1Q7TA 1TO1E 4P8RA 2WNSA 1BWPA 2PO7A 2QNBA 3EVBA 4BLQA 4F3NA 3AZQA 2HU8A 4KK3A 3KHTA 4G1BA 3V4VB 3KVYA 4LSMA 2FJPA 2V6BA 4H7PA 4PC6A 1Z0IA 4D8YA 4DWJA 4KQCA 4C7OB 1CUXA 3EGXA 3FOBA 3K1YA 3N1UA 4JAVC 2CCJA 3O03A 3PRKE 4PLTA 5JWHA 4UEKA 4CMHA 2PZGA 3SVTA 3O5AA 4NV3A 4HNAB 4YJ3A 3EWNA 4KLRA 1E3IA 5TE9A 2BLNA 4B5KA 3WICA 1N77A 4YJKA 1G6HA 4HUQA 4TM7A 5JHGB 1RWOA 2OHOA 5IM4A 3D0KA 1EX1A 4QUGA 4EEKA 4PBTA 1X7YA 3I1FA 4JC4A 4KMRA 2R7MA 4U8HA 5IKEA 2J3HA 1CZHA 1NVUQ 1CR0A 4C4ZA 1DJNA 5DTIA 2GJAA 1D6JA 4URZR 4DV2B 1SKBA 2UDPA 3KSBC 1MQ8B 2P62A 3G5LA 5MN5A 3TL3A 1GQYA 5FAXA 5HRCA 4PCVA 1BFUA 4XIGS 1C1DA 3KT8A 4QO7A 1YFLA 4IGKA 3RYTC 2X76A 4K9RA 1NVMB 2WFAA 2XDAA 1XQ1A 3JCZA 2RAFA 3OEED 1P4SA 2ZB4A 3T1YB 1W8IA 3THWA 1UMBA 1Q22A 3L9WA 1WL8A 4IFTA 1P9WA 4KX5A 3WFJA 1M1YE 5AW0A 4U9UA 2WY2D 4GPZA 1EAYA 1IVNA 4K0KB 5BW5A 4BO2A 1XZQA 3BIOA 4JUFA 5KYWA 4KC0A 4E6EA 3W77A 3O8RA 2X3YA 4TKZA 1V8PA 4D80A 1Z5OA 4HDNA 4YT8A 2Z98A 4MMZB 5A9SA 4GPEA 2V3WA 3UYLA 2Y1GA 3OQHA 5B53A 3WHIA 2VQEB 1R9MA 4J29A 4N5MA 3VO9A 1CEYA 4QFMA 4BNZA 4I99A 4MUAA 3O74A 3FCCA 3N2EA 2VDQB 3MJTA 3VJLA 3V4FA 1ZK4A 4LYEA 4MUKA 3TF5A 1WF3A 2GX6A 2MSCB 2Q45A 3AC0A 3H2GA 4BKMA 4IIJB 4Q3AA 2NO1A 1BE8A 1I2BA 2KW5A 3VR3D 2C7VA 3FHJA 2BFWA 2R4UA 4F46A 2P0AA 3PS9A 5CU7A 2DSNA 2YFQA 4NU8X 4EFMA 3EVZA 5ARBA 3GG2A 3QE0A 4CQJA 2ACKA 3QVKA 2HDNB 5AK0A 1PFVA 3CISA 5H4GA 2OUIA 2Z2YA 5DHRA 2Y0BA 5CVCA 3LIIA 4OGFA 4AXXA 2FRDC 1YNOA 4HDSB 1QK3A 4M83A 3UW3A 4IXMA 5AJZA 1G7RA 4JN6B 2WYIA 1Y6QA 4LCEA 4QRDA 2B21A 3C7DB 3ZV7A 2WAAA 3GLHE 4HDRA 2P1DA 1E18A 1RCTE 1AUVA 1V7PC 4X1OA 1K6XA 1EFRD 3GX1A 1UJMA 3KT3A 1YRBA 3GG9A 5E6UB 1TO2E 3LY9A 3TB6A 4GL4A 4NPCA 2R7KA 2BC9A 4WKBA 3GVPA 1RXUA 2WNHA 4WZ6A 4DIUA 1RVDA 3K53A 1Q3TA 2QJWA 3I01A 1N8KA 3KU1A 2G09A 1Z2PX 1BE1A 3EGOA 2CL7X 3ETLA 4YUVA 4BLTA 1Y5LA 2HK7A 3JYQA 3H3XA 2HF9A 3K30A 1N2CB 1GN8A 4PN3A 3IJ5A 1EMDA 4GKBA 4AZ3B 4DUGA 2VDWB 1P74A 4TKMA 3PI7A 1EBUA 1M1NB 3ZU2A 5L7TA 3IODA 1V1RB 1XDSA 3EZGA 1BKYA 3IDOA 3QGMA 4IRUB 3NNSA 2GHIA 1L4KA 4Q05A 1C9DB 5CJ2A 4B8ZA 2H63A 1P6XA 4IZHA 2BEVA 1KJYA 3UA3A 3IKMB 2RH4A 4TKUB 3U13A 3NAQA 4QQKA 1BE6A 1FUIA 4IMJB 1XPOA 4MW1A 4NAHA 4F3TA 1FRZA 4Y0AA 3GCXA 4EH1A 5CNJA 1U31A 1CB7A 1J39A 2ZQZA 2NT3A 3GVXA 5IK2A 1OHHD 2HX1A 5KU1A 2YX1A 3ONNA 2IEIA 3A4VA 5BN3A 2JW5A 1J8FA 4C4XA 2HFKA 2ZSIA 1BSVA 4WNCA 1QF6A 1TD1A 3E1GA 4L4XA 1ZL2A 3FIJA 4BTVA 1FY2A 1IN8A 1JHRA 3HCEA 4E5YA 2I8CA 3EDMA 3T06B 1MT0A 2B92A 5AICA 4OQNA 2JFPA 2X3UA 3V7UA 2Q1UA 1GTG1 1CHDA 1E7MA 1NC3A 3WGQA 1Q0QA 1N5MA 1RT9A 1I3MA 2ONZA 5ALPA 1P5ZB 3DZKA 1V6SA 3G8YA 4KQGA 5E1BA 3JAWB 1JE0A 4JR0A 1Z38A 1Z6AA 1TA0A 3T1QA 1JVBA 1KU0A 2O8DA 4HWRA 3BD6A 4M38A 4E08A 5YASA 1JHUA 5J1SB 3AFGA 4V0MA 1IB0A 4OM7A 2XMSA 1V8OA 1EXVA 3HFJA 5JMWA 2HJHA 3FRHA 5KC9A 1UT5A 5E2AA 3E1KA 2C8VA 3Q3CA 4QJBA 3NYRA 1U0BB 2O0LA 2Q3LA 1DO8A 1U0FA 4KGXA 2ZS8A 5CLQA 3HCDA 1CVRA 4B17A 5KNCA 5AW8A 1VMEA 3LO8A 3CCBA 1M6EX 4G1EB 3ZUPA 3M5CA 1IPFA 1E7SA 1KJWA 3A70A 1N8SA 3KFXA 4RY9A 2GMWA 2JKZA 4ZN6A 2C07A 3P9ZA 1N6HA 1FTNA 4XWGA 4KE8A 4NZNA 2FW6A 2BMFA 1TYDE 4BECA 3EGCA 2QD3A 2ZWIA 5JS7A 4PYOA 4O2BA 1U1DA 3PHBE 1R0SA 2JFZA 4OXXA 1P9RA 1KK0A 1P8JA 3WYNA 5L4NA 1M9NA 1NI4B 2FY8A 2R44A 3OZFA 1OXXK 1UADA 3IAUA 3EAQA 1E79A 4YA6A 4JITA 4K5QA 4DDVA 2SCUB 3EIWA 3S44A 4B85A 3RBAA 1H8HA 1QMPA 3V7NA 3ICWA 2D5BA 1J1ZA 2B98A 4ZO9A 4LJRA 4GG1A 3VV3A 5CNIA 5FBVB 2PZFA 1QORA 4HHEA 2YZ2A 3ZBTA 4CMBA 5EQDA 3GLIE 3SSMA 5F98A 3CZAA 4GI5A 4IJWA 2BDTA 1LSSA 1OZHA 4Z4HA 1AJEA 3A6KA 2XUIA 3D8HA 4MIEA 3KZNA 4CKYA 3PUVA 1QCYA 4HUQB 3T4UA 3ZWVA 3A6DA 4AKHA 2CXXA 2O6LA 1D0SA 4HWGA 4BNUA 3PWKA 2BI8A 3D3NA 1GRVA 5J43A 4YFVA 3E9DA 3TQHA 3VX4A 1N6KA 1ML3A 3AYZB 1BQEA 2B34A 3E6AA 4WKNA 4EKDA 3X1MA 3FHTA 1EWYA 4B82A 3BHMA 2BLLA 3NP7A 4IOMA 5F3DA 5T64A 3OFNA 2FPLA 3TOXA 4EFDA 1W0CA 1BWRA 4IIGA 1G2OA 1CR1A 1MC8A 3I6BA 3ORQA 1IUNA 1GUFA 2FPIA 3NEJA 3P45A 2J31A 2FA9A 2GBPA 2Y67A 4ZKEA 4DY6A 2A59A 4YPVA 4GKJB 2P6NA 4LX0A 1KC3A 1PTJC 4R68A 3DOUA 3BE4A 2DFLA 1MB9A 4ETIA 2JIZD 2O5EA 3TI9A 4FYPA 1PR3A 2BFEA 2C2XA 2X9QA 4KGVA 4NG4A 4TMVA 4WZBA 4XLZA 3CKMA 2PUBA 4ZOEA 1CR4A 3H9UA 3IMKA 3LIPA 3P9YA 7GPBA 5EQTA 2BBTA 5EJAA 1DAFA 1XKQA 1XKXA 1P91A 1ZCAA 4PLPA 1BJKA 2HWYA 4JWTA 1LSJA 4YECA 5C4MA 5MFPA 3N86A 3QIVA 3R7WB 1XHLA 1QTIA 1VECA 1RMTA 5GM1A 2DHEA 4R1OA 5JECA 3NTVA 2AB0A 4L9WA 1JP7A 2VA8A 1YQ9A 3VNVA 3RTCA 3SDSA 1VHWA 2PXHA 5E0OA 3TTXA 4D9FA 2EGHA 4QDTA 3UHJA 4IVQA 1MFZA 3GJ7A 3OJEA 3SZMA 3G2JA 3JQGB 2XTNA 3ZX4A 3MTIA 3NCTA 4U02A 1Q2XA 2QSYA 3JAKA 3RUEA 2W98A 2UV8A 4B1FA 4F4CA 3MTGA 2HCJB 4MZDA 1JR4A 3VOAA 4BQIA 4LUCA 2H59A 1WCWA 5J40A 2AG5A 1KFCB 4I1SA 3GUVA 2GZRA 3GAFA 3NH6A 2VJOA 4IH1A 4UMEA 1B74A 1YH3A 1W30A 3GELA 4IQ4A 3OZGA 3UCEA 1SBNE 1VMIA 5AKKA 1U1GA 3IVXA 1CDDA 1GU1A 2ZE8A 2L18A 4QU5A 3GIWA 4TUYB 5F4ZA 1TAQA 2HB6A 4CXMA 5CDGA 4BO4A 2VNKA 2YZGA 1QLWA 5FFNA 3ML1A 3E3MA 1Z4OA 4IFBA 5IKXA 5IC6A 3LV8A 3QX9A 5KOJA 1BN6A 1ZD2P 2J7KA 1WSBA 2WU3A 2ZSAA 3EMVA 4CNQA 4CLOA 4PF1A 3B6MA 3MWLA 1NSYA 1UZNA 3TLKA 2AOUB 5CB0A 3KHKA 1AGRA 2C5GA 4FGZA 2H1VA 2IXAA 3AEQA 3FFTA 3V34A 4MUJA 2RH9B 3GFVA 1SA0A 1VFPA 3ZWDA 1UK6A 1OH8A 1U9IC 1XU7A 5JNUA 1HR0B 1L4BA 1P7YA 2B2CA 1I36A 2ACWA 2RAVA 4K81B 1IM8A 3L05A 4OQEA 3ZHQA 1K92A 1TAGA 2ECOA 4MR9B 1WVMA 1QG2A 3EXG2 1TKCA 5K3SA 1FU7A 2P6UA 5G0VA 3QXSA 5DCWA 4NXMB 3MWGA 4ZI2A 4RJJA 4MGZR 3SJCA 2E6KA 1UPFA 4IIYA 1P2VA 4EI7A 1I4WA 3FBTA 4WLNA 3W2TA 3AKDA 4DLRA 4EAAA 5BV1A 4G5GA 3UY4A 2XUFA 1JAIA 1OTHA 2ERCA 3U80A 1DTWB 2PUAA 2AYZA 4XIJA 4JI1B 3UICA 1PL7A 3HB7A 4RGQA 4HAVA 1P61B 3RIMA 4QULA 1HT0A 3K1AA 5T5QA 4BPBA 2PT5A 4JELA 4A5OA 1FDVA 4YRFA 2WK1A 1NT2A 1ZVJA 3M0EA 1PUIA 3HDQA 4AJIA 1RQNA 1H3FA 2JVJA 4TTIA 5DMHA 3DEFA 1LLDA 1PJ3A 3LYUA 2ZCUA 4RKQA 5CG1A 3KSRA 3QEMB 4W5JA 3T9CA 1NG1A 1URPA 1X7ZA 3LCVB 4XGIA 2WB2A 1EX7A 4YMIA 1RIFA 3PC4A 4MCHA 1BHQ1 2IYZA 3QQ5A 1HV8A 1O95C 4OI4A 5TT1A 3QLJA 4I1OA 4R3UC 3DUFA 5ADVA 1X87A 3ANLA 2BBSA 3AY3A 2FVYA 4JSRA 1EK1A 3OBIA 4WLEA 2Q21A 4FJ0A 4DVJA 3MHTA 1CTQA 1MRSA 2Q6VA 2FN4A 1O95A 3LUCA 3PBKA 2XIJA 2NW6A 1V9CA 3BRCA 3F90A 3C7TA 4JDUA 3UHOA 3VPFA 3R9IA 1E2BA 2ECPA 1E1YA 2DBZA 2A3RA 1RYDA 3TWOA 1OGIA 2ZEJA 5G3ZA 4HQ0A 2C7PA 1EVEA 4DXAA 2Z8YA 1NZJA 3ZKWA 1EUZA 4GMKA 1ECGA 3MS2A 4UFNA 4UU7A 4EY8A 4UFPA 1G6KA 5AKHA 3ZK7A 4E5UA 4XYGA 1G59A 2D6FA 3WQSB 2JH8A 1G21E 1Z2DA 4QFBA 2C57A 5IBCA 5HMLA 5G1NA 4PC7A 4Z4FA 2BFAA 3PXAA 3SFTA 1MO6A 4F3RA 2H57A 3TVDA 5DNCA 5DYGA 3L7JA 4INOA 5DOVA 5HFNA 1GEGA 3KZKA 3TD2A 3KZXA 1PTKA 2YICA 4JYPA 4MV7A 1C9NA 5FOUA 3ADBA 1YRAA 5IVKA 5E1DA 2JLXA 4UAVA 3DMTC 2ZBFA 3CVVA 2E6UX 2ZRBA 3BMQB 3W6PA 3R9XB 2ZIUB 1WTCA 1C80A 3MBOA 1YI0A 1NATA 3JATB 3JYLA 5DZSA 3KAQA 3ZE0B 3GCGA 1N8NA 1Q21A 1IZ7A 4ZZ3A 1HPLA 1D5WA 1T36A 3DMTA 1WOYA 4PTZA 4PZDA 2DLCX 5HJ5A 2VRCA 8LDHA 3SEQA 5K8IA 5KYYA 4OL0A 1V5IA 3QYPA 1N6PA 1ZW6A 1USGA 1TQ4A 2KX7A 1PDWA 3AFHA 1P9OA 2NU9A 3BF8A 3FHOA 3ASZA 3MTBA 4MMYB 5A06A 1F3OA 1ORDA 3LXXA 4RVUA 3Q8LA 1AS2A 2I7XA 1VE3A 3CNHA 1IZ8A 3WLOA 3T5PA 4RDHA 5F3WB 2QE7A 1PGJA 2I3ZA 1XMPA 1XNGA 1K63A 4EB6B 3KKKA 5F4BA 1N4AA 2IY8A 1V9SA 1XQWA 2DAPA 4F45A 1GDTA 3RV4A 1ELOA 1MT3A 3C14C 4F1WA 3QFTA 5FI0B 1S3SA 1SEVA 2XUHA 3QQPA 3LP6A 4EGQA 2BP7A 1JIIA 1P0CA 3Q3EA 3ZCVA 1GU7A 1YL7A 1ZYUA 3AJEA 1PV2A 4E94A 2BGNA 4ZI7A 3BH0A 3VYRB 1ONNA 4O59O 2FUG1 2KMLA 2XHEA 3EMKA 1BQ4A 3GUUA 3HZRA 4FYWA 1VL0A 5AUNB 1LX7A 2F55A 1XCMA 1BO6A 2HRCA 5T4FA 3PJEA 3ZZ1A 4CM8A 3STYA 3EOBI 3KD2A 3OFJA 5IZ4A 2GH1A 2ZTLA 1KE1A 2QVCA 4JD5A 4GE0A 1G41A 3LT0A 8ADHA 1SKMA 1WB5A 1GLNA 4LBWA 1CS4C 1P72A 1XZDA 2RGEA 1YHZA 3EAGA 3UGQA 2DP4E 4ARSA 1L4NA 3GUCA 1SUEA 2FZ4A 2NXWA 2FDCA 2C29D 3C3EA 3AIIA 4FT4A 3KQWA 3N2LA 5EERA 3WYFA 4MYHA 1QB7A 1X77A 3DBRA 3TZLA 4UTVA 5JOQA 4FB5A 3GOHA 3QI2A 1GTVA 3U4MA 4FOPA 3PL1A 4M1EA 4D9CA 3P2MA 5A4FS 3T3MB 4B09A 1YWGO 4E15A 1GKUB 3M3DA 1SGWA 1B42A 2DTDA 3OEHA 3LP8A 1WQ4A 1I1HA 2RHCA 2FR8C 3VR2D 1HDRA 3GXOA 3KWFA 4DR7B 1ZKMA 4QXOA 4KR0A 2J1LA 5FFMA 2WAMA 3WLIA 4AUMA 1LTQA 3NWOA 5HK9A 3HJNA 4BJ5A 1R27A 4L22A 1DC5A 3DFUA 2OSBA 5HIIA 3AOEA 3O9MA 1GUYA 1TIKA 2R6FA 1YS1X 5GJVC 4H1WA 3A05A 2EVWX 1YUMA 2O4CA 2XXBA 3GNSA 4EHIA 1HZZA 1KMHB 2PQ6A 2G82A 3IPLA 5AJVB 2HO5A 2OXTA 1DBWA 3K9HA 3U40A 3UT5B 4XWYA 1BDMA 4D3ZA 4MUMA 2BH9A 5AJWA 1VMAA 2XAAA 5KSPA 4WE3A 5JYCA 1MKYA 2FZLA 1WULS 3ST7A 4AZSA 2I66A 2XE7A 3HVUA 3QH4A 3OAAA 1KWKA 3TMYA 1P2DA 1QP7A 5GV7A 3MTDA 3BWDD 2ARKA 1DV2A 1U6JA 2HK6A 1I5RA 1L7DA 1UDCA 3ENNA 2Y4OA 3RFCA 2DWOA 3LC7O 5ALRA 1N36B 2I2FA 3QEOA 4L6CA 2FRDA 4IDCA 3VR6A 1IULA 1RWQA 2OFOA 3SZ3A 1Q1BA 1J2JA 3BIJA 3ZDAA 2LPMA 3ISTA 4TZ0A 3OQIA 3I9LA 2JCXA 2R6HA 3H42B 1IN5A 3B51X 4Q7QA 4EPRA 5CJPA 3ELYA 3V4OA 1VG0B 2IWRA 4GBJA 3ITKA 2JGKA 4RYLA 1F1JA 5F78A 1T3TA 3F0TA 1NNEA 3PIIA 2JJMA 4J49A 4GI3A 4O4LA 5FIUA 1GTSA 5EIHA 1KFJB 2C94A 1BMTA 4WERA 4HFJA 4AZ0A 3SIRA 5EXEA 4DNOA 2C7OA 2Q62A 3H7AA 4E2WA 1AD2A 3BHNA 3PFNA 16PKA 3OM1A 1L8XA 2G63A 4MDYA 5E6UA 2DWUA 3C8MA 4BVKA 1UKVY 2FE1A 3OC6A 4CKEA 5ARDA 1UUFA 1IH8A 3PHLA 1PDVA 3KLPX 4L07A 2AFIE 2FOIA 3AR6A 4RO0A 3IP9A 2PT9A 2HLDD 4OL9A 3K72B 4MVJD 2W83A 4X90A 2CUKA 1ISFA 5B4TA 3U31A 5E7QA 1AX9A 3C1OA 1PZGA 3ORSA 4LY6A 5FBLB 3DKKA 3VXKA 3FXAA 2D5IA 2HA2A 2O50A 3CLUD 1ZZEA 1AHNA 4G84A 1N4DA 5J23A 2FGJA 4I4NA 1W87A 2NWQA 2WU8A 4JLKA 4ID3A 5AP9A 5EHQA 5B4VA 1XZNA 2W2KB 2WICA 1UC8A 2ZIEA 2ZIXA 1MEJA 3WAJA 5FBWB 2DEUA 1FFXB 2PKQP 2ATXA 1H5QA 2EKLA 4HATA 4UNNA 3AM4A 4UBLA 2KQUA 3X2EA 1QIDA 5FULA 5IG2A 1XVTA 1QX4A 1AKWA 3GN2A 3KV1A 4JBIA 2NN3C 4Q16A 4GOOD 4CDGA 1SZPA 1L1RA 1P0PA 1PQ4A 1YBVA 4ND8A 3B89A 3GJ6A 4OOEA 4S1TA 4XFKA 3RHSA 3ESBA 4NJEA 5HFAA 5IAAA 2DWPA 1K0UA 4NJOA 4Q4HA 4V0OA 1J97A 1E92A 4A6PA 2GVNA 4TTAA 4XA8A 3ICQB 1OBFO 2EKDA 5DHAA 3S7ZA 4O29A 1KTVA 1E9VA 4AECA 3WV4A 2RGWA 3FZYA 2C97A 3U44A 2R84A 1RU3A 3QUTA 4NPHA 4DNXA 2UUBB 1RPZA 3WLQA 3CCCA 2JATA 4DPMA 3C5EA 2ZQYA 5C3UA 1JIVA 2B25A 3PQ8A 3BJMA 2X1LA 4I4TB 4WLUA 4E7OA 4ZOBA 1THZA 5KTYA 4UAJA 4B7CA 1QSGA 3K9WA 1GNPA 4HS4A 4QDXA 4CKWB 4HDKA 2HQ1A 3IPRA 3V33A 1ORTA 4X8LA 3ZHZA 4DDMA 1RSZA 4Y1GA 5JBNA 2OENG 2EDCA 4OX9Y 4M87A 3WKCA 2OV8A 1XTPA 4KWHA 1AXEA 1P1BA 4WZAE 5BVGB 1RM3A 4BLWA 4QUKA 4J9UE 4Y30A 4Y2PA 1MAUA 2JASA 3LPMA 3ORFA 3OOSA 4U6SA 4UBIA 2CBXA 3O73A 3SK0A 3FDZA 3DLPX 4D5GA 5ICCA 1KEKA 1UPXA 2C4VA 2Q3HA 4MI6A 4DLWA 5JEEA 4YAUA 4B3FX 1FUEA 3MLEA 2VKTA 3TG2A 5C1DA 2V5VA 3KCQA 3NKFA 2YNMA 3DWIA 4AWBA 2EFEB 5DULA 5IZCA 2XXJA 1R0WA 2HJGA 3PF9A 4OHOA 1A4XA 5HKBA 1YMQA 2B8EA 4CQLB 1F8XA 3AL2A 1COWD 3UCFA 2X6TA 1ZNZA 4UULA 3PUZA 3TR0A 3MCAA 1YJQA 4ND1A 2QVLA 4REOA 2C5LA 2GKGA 2G67A 4YQZA 3A6FA 4ZVQA 3ROMA 1CQXA 1DLIA 5ABPA 4L5BA 1NMZA 1LF5A 4FDLA 4FSHA 5LZ4A 1GG2A 4XIFA 4TKUA 3D6VA 4UMVA 2ATEA 1E3MA 2B7LA 1ESNA 3GYGA 1OB5A 1RWWA 4G09A 4L57A 4ENUA 5JS6A 4XRRA 5EFOA 2QAJA 1ZUHA 1OVGA 1POXA 2WYWA 1LS1A 3X1DA 4EQZA 3W2IA 3GLGA 3EWSA 3UJ6A 2AC4A 2YY7A 7MHTA 2BEJA 3RT9A 1YUBA 2ZKIA 1YQXA 1MH1A 3QHAA 2D74A 4FX5A 1RZ3A 2OV6A 1I3NA 1AZSC 4AWXA 4BMXA 5BNIA 1JMYA 1CUCA 1VFNA 4BMOB 3W1WA 3OVMA 2A4MA 2DR0A 1Q7RA 2BM8A 1L7RA 2P69A 3F6YA 4WY2A 3UWDA 1XTKA 5I4BA 1U5BA 3O4JA 4KXQA 2F3SA 1ENOA 1K68A 1NI4A 3BHJA 4FYKA 6GPBA 5AVQA 1Z0SA 2PXCA 1H8ED 1RRGA 1VHQA 2GPJA 4TTJA 3NHZA 4GPBA 4KWEA 4E2ZA 4M49A 4TN5A 1G20A 1YZHA 2YXPX 4P4NA 4P7FA 4M0DA 5IAOA 3GHYA 3GGPA 4Q9AA 3F9CA 3WB0A 4AY4A 3IQHX 2X42A 1U04A 1GUZA 3PHIA 1YZNA 3QF4A 5C81A 3BFXA 3EXHB 2P4SA 1ODKA 2QQGA 2IF0A 1KPIA 2WT9A 2F62A 2BHLA 2XB4A 3A14A 3MPOA 3OJFA 1SK8A 3W34A 4B9AA 1JHDA 1OZAA 4BPRA 4EG6A 5FWNA 4GOXA 1SHZA 2Y1XA 3TLBA 4WHMA 3JRXA 5IX8A 2PS1A 1N5OX 2H1LA 1I7NA 1Q5PA 5D5HA 1O5TA 4A5SA 3O9VA 4XTRA 3KTFA 5BQ5A 2C1XA 4ND2A 5JSHA 2H4JA 4HQ6A 4IDGA 3HKBB 1CDZA 4DDHA 5A1TA 5A9SB 2VDWA 1QDUA 4IXWA 4ZQBA 4PU0A 3KQUA 2G5GX 1XAJA 1CERA 4N5HX 1B0AA 1KSFX 5EE3A 1J33A 1BXKA 2CJPA 3HRHA 1UJ4A 2QV7A 4A92A 3STVA 1P1KA 4AMBA 5DN6D 2YWCA 3FR8A 4WH0A 2R1TB 3JAKB 3EYWA 3N3AC 1TK3A 4J16A 4RD1A 3ZXXA 4Q21A 4PQYA 4Q00A 2XOEA 5BRNA 4YAIA 3L7DA 2YW9A 3K7EA 3FF4A 4HNSA 4QTZA 3W4JA 4LZAA 2Q4BA 4RIEA 1C7EA 4Y9RA 2PH7A 2CV1A 3QYJA 2O8DB 1A9OA 2IYWA 2FH5B 4KDEA 4TZTA 5A62A 3GLFA 3H84A 4QU9A 3DLBA 3AR4A 3KC2A 5FFFA 4G8BA 2CWDA 2DH6A 1NVTA 2VO1A 3AERA 1GPUA 3EDOA 4YQYA 3OE5A 4E12A 4ZZ0A 3QEBZ 4X1IB 1SG0A 2NO5A 2ANCA 2XODA 1I2DA 3ZGNA 2AZDA 3SP1A 1NW6A 2LBPA 2GO1A 1T35A 1TVKB 1X8LA 3HYLA 3L79A 4C0AC 3ZY6A 2RHRA 5DLDA 3PD7A 2AZXA 2FG7C 3ZWOA 1II8B 3T5BA 5U1PA 2WSSD 4Z2AA 3ZCPA 3DB2A 1MC5A 1VKJA 4ARIA 1M75A 2A9FA 5LA6F 3VU0A 3MYYA 3IV9A 2BFOA 4LE2A 1OXVA 1LXCA 2O20A 1ZFNA 1IIRA 2Z5FA 2IYNA 2JH3A 4NYMQ 4AMUA 5I47A 2M6KA 2W48A 3DG9A 1UH5A 3JQ6A 1DUSA 1K9SA 2C4UA 2A92A 2XMRA 2DULA 4LWQA 5KREA 1YHNA 2VG8A 2ZR8A 2E0IA 3LG2A 3X1XA 1N25A 3RROA 1P17A 1F4PA 4OVKA 4YGXB 4XE5A 3WV5A 1V11A 1T8SA 2JEZA 5FR1A 2J5QA 3JQGA 1FXSA 4OXYA 4MP3A 4NXNB 1PG2A 2RC6A 3ZOZA 4DSNA 1J22A 1UPAA 4FZJA 2H4HA 1F3LA 3D6NB 3UAGA 5JI3E 4F6CA 3U6KA 4WX2B 5DTQA 1JPNA 2WT8A 3K5IA 1GUBA 5E7IA 5B3JC 2FPWA 4MHOA 3M9XA 2HW8A 2YFKA 2ZZMA 1U65A 3DV2A 1YB4A 5JD3A 4A8JA 3SQMA 3TJZA 1GSAA 3B20A 5J1TB 4IV5A 3INYA 1CEQA 4J91A 3NFYA 1AV6A 3SQWA 3IHLA 3W5SA 5EKUA 2WHXA 5TS3A 3HEMA 3ME5A 1M2VB 2XTZA 5GV8A 2AOTA 2YBDA 3PCXA 5LR6A 3AEUA 1L7XA 2FF7A 1AGNA 1SD5A 4YLEA 4Q9JA 4Z99A 2ICAA 4DCMA 4GKVA 4CM4B 3PNLA 2G8LA 1UK9A 4CF7A 1L5ZA 1DO0A 4RF3A 3W7BA 1JDSA 5JC1A 4L74A 2D1SA 2QWXA 2OBYA 5G2OA 1SZJG 2IY9A 4TTTS 5LDDC 1PKEA 1G18A 1XSEA 4XD7D 4D0LB 4P3NA 3VHXA 4HRYA 3AHCA 2AVNA 3TUJC 1V4NA 2VP0A 3FAZA 3HMKA 4X1YA 3EHEA 2OYCA 2Z08A 3QF4B 1A2OA 3A4IA 4AC9A 1HEIA 2ZYGA 3WGTA 4GMXA 1TUGA 3D4NA 1FOEB 2VUIB 2Y8EA 3NHAA 5HM6A 5FTNA 5D8DA 1RR6A 3I42A 3NORA 3FTFA 1E94E 2V4MA 4AI6A 1K6EA 2J5XA 2GBLA 2C4HA 2Q07A 2JGNA 4X7MA 3JWJA 1ZJYA 1KE2A 4Z3OA 4HEA1 2OZVA 2Y1LA 5E9AA 3E7DA 3FKSD 2ZWOA 3D7LA 3IVRA 3IYLW 3UUFA 2ERXA 4LDZA 3G9TA 1UJ2A 3DNPA 1XTQA 4MYDA 4P84A 2OCGA 4X71A 1M6VB 3HJFA 2QX7A 2FUNB 1DE0A 4K6OA 1YIAA 4L7QA 4A0QA 2XR1A 4Z86A 1TM1E 4Y2YA 3TTSA 5HTOA 4ZA2A 4HQNA 3DGFC 4ND7A 5KOJB 4QVKA 4GR9A 1IN1A 2GZHA 5JJBA 4BWVA 3MNFA 2WJ3A 3QU9A 4KI0A 1T6BY 1IHPA 4JYMA 4F06A 3AESA 4R3NA 1XMJA 3ITEA 2XTMA 3PDIA 4S12A 1P3JA 4Y2HA 3H1BA 4FZVA 4LC1A 4RCZA 3TIFA 3TLJA 3C5VA 5KIAA 4RLQA 4X1KB 4KQJA 4JCCA 4MPTA 5JS8A 3L4KA 4H7FA 4H3SA 3NTQA 3DVLA 2B5VA 1TM2A 2OWDA 4M37A 3RUCA 3FWKA 3AF4A 4X95A 1TT5A 4LRUA 1DUVG 3DA8A 2VPWA 3IV7A 2VF7A 2ZBQA 5JU6A 4MDHA 3FCOA 4MUGA 3W04A 5LZ2A 5PNTA 3BJRA 2B61A 2ZRMA 2PT7A 2X2FA 4NJMB 5LYJF 3BT7A 1PW5A 1V5GA 1M1ZA 2A2ZA 2JIMA 2VNHA 1AO3A 3F7TA 3QIAA 4G5RA 5I7VA 2CVQA 3EUWA 3GLVA 3OM0A 2BTEA 1WZEA 2ZSBA 2PV7A 3OZWA 2V74B 4YMUA 3M70A 2ZJBA 1PGPA 5KSOA 2QAIA 2WWGA 4IIDA 1TZJA 3K0SA 3GK3A 4EFNA 4Z9YA 2IIVA 3ZVNA 1UXGA 1JS1X 3N2IA 1SZDA 4Z0NA 2RGRA 3SR0A 3GJRA 3R4CA 2MINB 3TKAA 3RAFC 4AIRA 2AR7A 2AI2A 3LVBA 4WL0A 5KUTA 1W7AA 1GSIA 1G8YA 2QQFA 1BDHA 3DBIA 1ZK1A 1KBQA 2FHSA 1X8KA 2W90A 3NVMB 2JCBA 3CWQA 5K3EA 4R1LA 2WOJA 3L7OA 2VT7A 3RAEC 2RG1A 2B0CA 1OIVA 2QJFA 1K6MA 3LL4A 1Q1ZA 3NNDA 3R8XA 1EGQA 2O7VA 3EEQA 1ZY2A 4G25A 2Q5QA 1Y7HA 1Y6ZA 2BY4A 5FOVA 3HXQA 3ENZA 4NBNA 4DQXA 1OR8A 4A15A 1R6TA 3OLYA 4D57A 1SCIA 2BP7B 4ZVMA 3ROQA 4TZKA 4EHKA 4MHTA 3VI3B 3PQ5A 3KT6A 4IFEA 2CVHA 2BAGA 2IHTA 2HK9A 1K8QA 2NV0A 2ZFUA 3KEMA 1I1QB 4TTPA 4E4TA 5CHYA 1TQHA 4LHEA 1DIHA 1FB5A 2QMHA 2W6JA 2DBYA 3USES 3O6VA 5BNWA 1N1GA 2WKQA 3T7JA 1G19A 5IJZA 5ILOA 3NXKA 2AKAB 2Y76A 3BCSA 4JP8A 4LQDA 3TSZA 4KRXA 2GPBA 4OG2A 1Q0HA 5BRJA 1KIMA 1EGAA 1JSXA 2AQKA 2J8ZA 1H6CA 3WGOA 2C99A 4ZEOA 4S2EA 2VYVA 5KCZA 1MC4A 3UGTA 2ZR0A 1LLCA 3MMXA 2A1UB 1Z28A 4L08A 4BMNA 2FSVA 4AKGA 4TT3A 1CZLA 1PTJA 2C92A 1T3LA 2IYYA 3PGA1 2OZLB 3NHMA 2C00A 1NQVA 2CFIA 4FZRA 4TV8A 2RGBA 4A0RA 5FBKA 2CVFA 1XRMA 3GDFA 3M3HA 1QIEA 4OX9B 2OXRA 3LVQE 4KQWA 4FBMA 2NVBA 2D0DA 1PFKA 1NVKA 2NNLD 1XIVA 2Y0EA 3CC8A 3FGPA 4Y9UA 3WGIA 1NPDA 4BNNA 1PFUA 3EN0A 3BWXA 3IOYA 4OMDA 2PX3A 1GYPA 5AT1A 3VTAA 4D0RA 1E99A 1JQ3A 4S0ZA 5FQOA 1GA4A 1PFQA 4RHFA 1S2LA 5EHXA 2QUHA 1P60A 2J6HA 2XUZA 4JR1A 1TK2A 1C3OB 1PD1A 1EPUA 3G23A 4EZBA 2YV3A 2ZYAA 2Q8PA 3O84A 4M2LA 1GRQA 3T9BA 1O3YA 1B3BA 3LZDA 4GYJA 5CVDA 1Y0BA 3ZHCA 4L5AA 4Z0HO 2OBLA 1U2SA 2F7SA 3DHWC 1SUAA 4PANA 4B43A 2TMKA 2IHVA 1M67A 4EUSA 3P96A 4UQLA 1QGAA 3L8GA 3T7TA 3I32A 1LD3A 3KOMA 3RM3A 4YDHB 5KOIA 2WJ4A 4MI1A 5AJTA 5LM3A 1OLXB 1YSCA 2ZTVA 1GGHA 1PFWA 3N05A 3WL7A 4ATNA 3HXMA 3A6EA 1NVBA 1W0KA 4ILKA 1XU4A 4AZ0B 4BFZA 4QEDA 2OFXA 1I0LA 1MX5A 1VE6A 2AMYA 3HV0A 3OOEA 4OGLA 4JVSB 3FOEC 4CTJA 5IXJA 2VDUE 4F4HA 4J4HA 2I2BA 2X8JB 4FSXA 4G0XA 5F5XA 4NBSA 1FF9A 4CZ2A 4CMGA 5K20A 3KQLA 3CNLA 5IHPA 3BXGA 1YGYA 1W35A 1R88A 4Q12A 4BVJA 1NTRA 1XK6A 2FWBA 3IR7A 9GPBA 1O96B 1SCQA 3H1PA 3RQIA 4D1YA 2V6GA 4FFSA 4MYSA 2JIOA 1TLFA 4HS9A 5I7OA 4PQFA 4G2NA 5CPBA 3E0XA 1MN6A 1XKLA 2B0JA 5I7WA 1C8LA 4Z2YA 4RKWA 2ZE5A 1J70A 4N9WA 3IEVA 4E3WA 3AVVA 3ZCQA 1I24A 4MV9A 2WF6A 4QG3A 1RPAA 3IJPA 4DM3A 4IR7A 5HJEA 3DTVD 3G85A 1NIJA 4OEHA 5MN4A 4BJ3A 5ECGC 3WG9A 4R8SA 3LGAA 1YR1A 1LJ8A 4WCDA 3QLUC 4EBFA 5KTSA 5IS2A 4EB3A 2ORED 3QOFA 5CDFA 1CCWA 2I1WA 3AF2A 3CO0S 3HKDA 3MWEA 1CUUA 1II0A 2GBCA 2LTAA 1G21B 2FQ1A 3I04M 1JHMA 3K09A 4MR8B 4XXHA 3SZRA 4NBKA 1ZM9A 4I9NA 1R6DA 4GXQA 3DBVO 1RMQA 1R0BA 2IUTA 1BH6A 1XN1A 3OM8A 2WWHA 4MV3A 4CKZA 3TMKA 1FU8A 4Q47A 5FORA 3ODGA 1T2UA 4QBIA 5JJKA 5CGQB 5FUYA 1DEXA 4A2CA 3AETA 1XEFA 3VGPA 4ZV4A 2IP4A 1O4WA 1FC0A 1Z6ZA 2GD2A 2A9PA 4O8ZA 4F2HA 2CUNA 4RFVA 4X8HA 5LJLA 2SKDA 2VDJA 3NV7A 5EJ7A 3N8HA 2UXBB 4OHWA 4NNOA 5HE8A 1JG6A 5GJCA 2YWHA 1O9HA 4RQAA 1RWVA 1DDGA 2ZUCA 3FROA 3JVIA 4OQXA 5IN5A 4E5KA 5JEDA 1EWTA 2I7TA 1CIVA 3E3LA 4Y2UA 4ZZIA 3R3YA 4IIXA 1WW3A 1EXDA 1L3BA 2I9KA 2AD5A 3JY6A 1W88A 4F96A 3E5MA 3M4NA 3NBMA 3WLNA 2NP7A 2Q6IA 3SKVA 2YNMC 1XZMA 2EHDA 4A1OA 1YR3A 2ADFA 2NAFA 1XUOA 1FSZA 4L51A 4NOLA 1YQUA 5JAQA 3FAKA 2L0XA 4UAGA 2ZBDA 3LRTA 2XCIA 3LSTA 1Y98A 4PYNA 5DIZA 5I4KA 1SCBA 3KKMA 3LCRA 3T7SA 1HT1E 2J9FA 3A1CA 1R8XA 2Z5LA 3OWOA 3AK4A 1HLFA 2Q2NA 1CC1S 3A9UA 3CR3C 3Q7QA 5EHGA 3KALA 1A8QA 1DBPA 3AW9A 4HSGA 4AROA 4C89A 4R01A 2NPOA 4JVOA 2G1UA 4EL0A 4EEXA 4HAYA 5TPZA 4DV3B 1Y3AA 3FPBA 3PUYA 3UV3A 1T6XA 3D7KA 1E32A 4UBKA 2CMKA 3O4FA 3DDZX 4Q4DA 1PJZA 4DJAA 2WUFA 3FPGA 4KNVA 3M82A 1C3JA 1U4SA 3CZMA 4IO0A 3CN9A 2O8CB 4N9QA 3UPDA 1WLYA 2V58A 3A4MA 4U00A 1OTXA 4IDDA 1YDMA 4ZAXA 2XB6A 4TQAA 1YCDA 1O94D 1JIKA 2ZB7A 3GVHA 4FJ2A 4FM9A 4RPHA 2D06A 4NRDA 3OQIB 2HYIC 4RF5A 5M04A 4WADA 4YAEA 3BGOS 5FT9A 3QLVA 1B93A 1K2VN 1QFSA 1XQ6A 2PRIA 1R16A 2WSMA 2YJGA 2PPVA 4KE6A 1NWHA 4KVGA 4QBTA 1VB3A 3RANA 1GY8A 1TUEA 3RSQA 1DKOA 2PSSA 2ZREA 1K4YA 2QX8A 5KYUA 5SY4A 3UK0A 4NONA 2NQ2C 3LSYA 3NRBA 4RHUA 4PNPA 3H83A 4EJ0A 4MVJE 1HDXA 1QFMA 4IOKA 2CEAA 4I4CA 3R7SA 5I9LA 1DX9A 5HGXA 3R7LA 1XCOA 4Q3DA 1U5BB 3L0OA 1JEJA 2Q3EA 2Q29A 3BF7A 4O4HB 4QWMA 5EWJB 3UAZA 3VBEA 4Q4JB 4MQFB 1JTFA 4F97A 2F1KA 3FI0A 4CMKA 3DPSA 1Z06A 2R48A 2VFAA 5SYMA 5FL7D 1ZWLA 4Z8XA 1A4IA 3ZQJA 1GNQA 4CG1A 4K9OA 1JPUA 4DE5A 1XYYA 2QVYX 2VUUA 4UXHA 5I7RA 3ZEIA 4C0LA 4FYHA 4D9KA 4ZT2A 1ZD5A 2A1TS 2YTZA 2QAGA 1GDDA 2QPTA 3GEEA 4IKPA 1EK0A 2R86A 4MW6A 2Z9DA 2OCDA 5L3QB 4P86A 4Z8YA 1IQRA 1QIMA 3AX6A 5D2CA 1AHIA 2FOLA 4ECEA 5JQWA 2XADA 4KRFA 1KP2A 4NBUA 3L1IA 3Q0EA 2VTEA 4MVJG 3AKZA 4L4ZA 4B3TB 3SF8A 5H68A 3WSTA 1T1IA 3IBYA 1TDJA 1MAVA 4QJ5A 1T24A 4NTZA 2ILVA 1R5NA 2FUCA 1TCBA 1MD9A 1U9CA 2I99A 2IYXA 3FWYA 1NC1A 1QYVA 1FSGA 4FC6A 4GECA 4LFBB 1T25A 1V5EA 4K3UA 2IS2A 1W4ZA 3S27A 2JFNA 3WNQA 5HIJA 1Y33E 2R8XA 5TMEA 4IXTA 3PQ3A 4UREA 1EEHA 1C81A 5JG7A 2G8NA 2J3JA 5LC1A 2IWHA 1U11A 2O2DA 4IKEA 1YJCA 4F9GA 2R65A 4F8EA 3ESDA 2GA9A 4BMZA 1CWUA 1VA5A 3LOUA 1NE7A 4MUXA 1AQ6A 5FNZA 1SVUA 1K5PA 5D3MB 4AF7A 4CR7A 2CD7A 1OX4B 5KVSA 4RK5A 4ZO6A 2ORWA 2POCA 5FV7A 4H35A 4RFLA 3KPVA 3RIXA 6LDHA 5ICMA 3ACDA 1NYQA 5EUCA 1AZTA 2A94A 1HEYA 4YDRA 4EG4A 4JBHA 1LKZA 2AH5A 4C0JA 2R8PA 2OV1A 5A02A 1IZZA 4MDEA 1KEVA 5C8YF 4LDRA 4QIHA 2FW0A 2IE0A 2O8EB 3C24A 4B84A 3R44A 3GBPA 1OA0A 2C7RA 3U5ZB 2BKXA 1BX0A 5DHPA 2VTVA 4KR3A 2MYUA 4R0MA 3PFGA 4OUKX 4FW9A 4ZTUB 1TUIA 5HKOA 2H16A 5TC4A 3ETEA 3QG5A 1G20B 1U0TA 3L8FA 4OF4A 2OOSA 1UM9B 3F6EX 2WV7A 3GLUA 5G4KA 4BMDA 1JEOA 4M9RA 1Z5GA 2LGJA 4HNRA 2REXB 1ISRA 4PGMA 3WQRA 4CMIB 1W75A 4KIJA 4DLXA 4HMOA 1SVWA 2CXQA 3MB8A 5BSHA 3O91A 1UINA 1Q83A 3O8NA 3HRKA 4EF5A 1K8YB 4L3WA 4NHOA 4UBNA 5K3DA 2YXNA 2CHQA 2QTLA 1PZMA 3QWBA 4YY3B 5L7WA 1YS6A 5AK3A 3VU9B 4IHKA 2WQ6A 3AY6A 3C3MA 3R3HA 3B1FA 1ZSNA 1JSZA 4GMFA 3OKAA 1OF1A 3JQDA 4R31A 4K9DA 3WBBA 1RXYA 3U26A 2I55A 3N7TA 3LFUA 4QGBA 2YOFA 1H2ZA 7AT1A 3U4HA 3ZD7A 4R1UA 4A7PA 1XL1A 5EJIA 4I6GA 4KR7A 4TSRA 5KB3A 2ZRPA 4NCJA 1S01A 1SXJA 2IXDA 4P4GA 1MPTA 2D1YA 2OE2A 2RGCA 4MARA 1DKUA 2P90A 4R1TA 1DBIA 1HRDA 1X9IA 1H9CA 1YQWA 2XCUA 3C0KA 2C8KA 2ZIXB 5L4LA 2CLDX 4J75A 3Q41A 3B6ZA 5H02A 2ZWAA 4EPVA 2I80A 1Q0PA 1XZKA 2WP8J 4MI9A 1XJ5A 3RSGA 3W9BA 4BX9A 1IN7A 1JHVA 1ADGA 1K2WA 3FFWA 3IXLA 4JJGA 1JA9A 3BDVA 4M6WA 1QGOA 4DGQA 2QLLA 1NQUA 5CA1F 2Y77A 3KSZO 2XLBA 3HYCA 4K8OA 3KUKA 1ECJA 3D3WA 4S1NA 2I8AA 1FP4A 2ABWA 4KQ1A 4L5CA 4LZWA 5CGZA 1M0WA 3QVWA 1RAGA 1WEHA 2VATA 4OB6A 1EP2B 4R3WA 4ZAGA 4HDNB 1XMIA 4DIMA 3K71B 5A5FA 1LLQA 1BOOA 1H4TA 1U8EA 1HYQA 2HXGA 3DJFA 1GFWA 2D8AA 2Q41A 2FWRA 4JYAB 4V0QA 1BXGB 3GLTA 1RHJA 3SR4A 1QZZA 2Y6UA 1VKZA 2WA2A 2YJ3A 4DMMA 1L5HA 1MJNA 3HA2A 4WZAB 2HA0A 3BXEA 2CVPA 3NBFA 4CM6A 4DBZA 2O9JA 2H0RA 4FEAA 3SSAA 5ALJA 3LUJA 5KNCD 1JLMA 2O0HA 5BMVF 1ATIA 1V7CA 5EMKA 4A8HA 2H2DA 2UYYA 5A04A 5T7BA 1I4LD 1K6IA 4PC2A 3A1VA 4M46A 3PJGA 3SJUA 1QP0A 5KMGA 5D3ZA 4KP7A 1L7AA 4D99A 1Z82A 3HKBA 1MB3A 4TWBA 4MTLA 2QRNA 4BE4A 5MFZA 1FFBA 5E3HA 3ULKA 2GXAA 4AP9A 4DKXA 4ZV9A 2PUGA 1RQGA 1DT3A 1I7LA 4I3FA 1NN1A 4TXNA 4ZVOA 4Z4CA 4Q1EA 4J76A 2A7QA 1NN0A 4AYTA 5JDCA 1P5RA 1GL3A 3LLVA 2WMYA 1WETA 4ZYYA 4PS1A 3UJAA 5JSKA 1VOTA 1XL0A 2EKZA 3LT2A 4WFQA 1EVZA 1X1AA 3AUKA 1EK2A 1SVSA 3JRNA 1IMJA 1N2XA 2JS7A 3CUVA 1JSLA 3H9QA 3NCHA 4JJ4A 4L73A 3LHKA 2DSTA 1S2DA 1M2VA 1SPBS 1F9EA 3QSGA 4RMHA 4TMTA 3BSYA 4NQZA 1DX6A 1I9CA 3O3NB 2OHIA 3U9LA 4PLHA 3VUFA 3JYHA 3VX3A 4CG2A 4D8UA 3PNKA 4ZGBA 2KE5A 3T3OA 1Q77A 1US8A 1WZCA 5IDXA 4BNDB 2YVUA 3IVMA 5JSZB 3HXOA 1O0BA 5FAKA 4B40A 1KYQA 2P2GA 4ED9A 4PPQA 1KJIA 1RDFA 1Z47A 4MEBA 1T3GA 1T4CB 5JTUA 3V9AA 3WA6A 5IMSA 3SLRA 1SBQA 2VJQA 4NJMA 1Q1NA 1LI7A 1ZMTA 1A7AA 2CLSA 1NVEA 2ZJAA 3CW9A 1KO5A 3M6XA 3MC1A 4J3JA 4KSCA 3ONEA 1CY1A 4HPJB 4KX3A 3NOQA 3VDMA 3HUUA 3DBOB 1JQLB 4AO7A 2IZ6A 3PX7A 4P4LA 4U7DA 2D4AA 2H1IA 1V2HE 2XOXA 3K6JA 4KSBA 4RVGA 3SXUA 4EY7A 2Q46A 2LWIA 2PH3A 2V03A 4AKSA 3AL0C 4KV7A 2NSJA 1R0CA 2WTMA 4G67A 1W5SA 2EU8A 4CQMB 1MRNA 3I1JA 2JFHA 4HB3A 2E3JA 1FSFA 3P9QA 4AX8A 4H1TA 2GF2A 1ISHA 3ELBA 3GARA 4RE5A 3N0TA 3CLTD 2FQYA 3CPEA 3I2YX 3O0TA 5B37A 2O2EA 1IBRA 4HK4A 4L4UA 5F52A 1WU8A 3CXRA 3TAXA 4LX8A 3KBOA 1E9FA 3GD5A 4JU8A 3ZCRA 4BFVA 4DCOA 1LBSA 2P4HX 1ZVVA 1BX1A 3L4BA 3LY7A 1BQ3A 3H11B 2F1OA 4KAFA 4OB7A 2X58A 1N78A 2X8BA 3H65A 4JP5A 3HJUA 4BMVA 1QLJA 4A8JB 2JC3A 4HD8A 1VE9A 3ETCA 3LFHA 2H92A 3RFFA 3V97A 3ZVLA 2XBUA 1L5WA 1KEWA 1HNNA 3KR0A 4JVLA 5EXXA 2ZRLA 5BR1A 3D4OA 3QE9Y 2KPOA 3AHIA 4CF6A 2GZSA 2RIRA 2PCLA 1IM2A 1OYOA 4JX8A 4U6QA 2O3SA 5AJHA 4Z4IA 1RYEA 1VIVA 3IMEA 5ALWA 5EA2A 2VAXA 5B1DA 5B36A 4TUYF 3BWVA 3KRTA 5D6NA 1BEUB 1FFDA 1NXQA 1VYUA 4OQYA 1GGMA 2X0JA 3ZVKA 3TIGA 2SBTA 4RACA 1BD4A 4IJKA 2JB9A 3L6BA 4JYZA 3O8DA 1BE0A 5FP0A 3T4EA 1Z22A 2OXEA 5CT6A 2E1PA 5ALIA 1AZWA 3HDHA 1I30A 3PYLA 5FI5A 2HBRA 1SU8A 5GMOA 4GSYA 1NLMA 3NJ8A 3VA7A 5C0OE 2D1TA 2IPMA 3DKPA 4W1RA 3H1GA 4XGNA 3R8CA 1Y9DA 3LNTA 1I1NA 4K9SA 1ZNWA 3HSKA 3K3PA 3D4BA 5DYTA 3JPWA 2GERA 2PBFA 4B6OA 1SY7A 2XHZA 5NLLA 1O97C 4KUGA 2HLHA 4OGWA 1YR8A 4DSOA 2XOKA 1Q19A 3GJZA 3DMDA 4D4HA 4DTCA 4F91B 5KS2A 1SPXA 2J9YB 4FFNA 3PWZA 1ISSA 1JEDA 3GA0A 3KZCA 1S2GA 3GFTA 3C7KA 1QHNA 3ZVRA 1AXRA 1GAQA 2LXNA 1UBMS 3Q7TA 3T7AA 3ZV5A 4A82A 5CVTA 5JD5A 4ND5A 1MQAA 1XDUA 3PSAA 2Z9BA 4TOIA 1YOBA 2R11A 1F4VA 2I6SA 3JWPA 4F2GA 3W1VA 5KVCA 1G1AA 2EG9A 4YT4A 1YCHA 4X20B 1B26A 4PBSA 1NVWQ 3C6XA 5DOZA 1JVNA 1RWPA 2BEWB 2GN8A 4B6EA 4BJ6A 1C4OA 3HO1A 1PS8A 1QV7A 1M5TA 5LJIA 1DWUA 2Q28A 3EXFB 3RC8A 2VYNA 1Z68A 3VH1A 4QTXA 2XNDD 3W4KA 4RNCA 2ZVJA 3BE6A 1GQ2A 3KLMX 2DFDA 5LU8A 4ZQEA 1NR1A 1F1BA 3N2YA 5C2JB 1VPWA 2EW2A 4YRAA 2F9FA 4FB4A 2AW3A 3OIDA 3E1SA 1YS2X 3I8OA 1SC9A 1S1CA 1SUFA 2XWSA 3KQSA 1N5JA 3T6KA 2ZM5A 2XB8A 4M1MA 2IS1A 4H7EA 4EX6A 4H2DA 4DAEA 2F9MA 1UBFA 4NULA 1SXJE 2PRKA 4X92A 2Y99A 3EEOA 3A6HA 4GFDA 4M0KA 5G40A 2IHNA 1R5OA 4U4AA 1Y89A 3OIYA 1MAWA 2GBFA 2QLBA 4DWVA 1Z6XA 3GRUA 4KPUB 1LFDB 3ZXUB 1JAXA 4NEGA 4OBXA 5LMCA 1E2DA 3HKDB 2XLCA 4RELA 1PJ4A 1W4CA 3AVUA 1Z4MA 2QS9A 3CPHA 5TJHA 3ZCUA 3HVRA 4HWPA 2ZSEA 1QFZA 3JX9A 4YO8A 4EUNA 1QRDA 1RWBA 4ER5A 4LJLA 5KX5F 3N2KA 4L78A 2O5CA 2P91A 2WWRA 2EKPA 4JUCA 4NICA 3TDNA 3IT0A 3KKQA 5KYKA 4QPCA 3EG9B 1R5JA 3MSXA 3RVJA 4CL2A 3AR7A 1WF6A 4I9UA 2WHQA 1U0RA 2FW1A 4OIFA 5EZYA 4BEJA 2Q2VA 1E6EA 3V1YA 3RD5A 1EJ6A 3LHIA 2QL7A 1NY6A 3AHJA 4DDTA 1QHSA 2PX2A 5CFNA 1IL0A 4KG7A 4C7JA 2HU7A 1JU9A 3L0IB 3UB3A 1M73E 4CI0B 1OHHA 1UXOA 1TT7A 1VMKA 4LF6B 3AFNA 4G0MA 3RVQA 1HDGO 3TOZA 4HT3B 3T41A 1CF2O 2AOWA 1SCJA 4MWBA 1W88B 2XZTA 2ZPUA 4LJSA 1ETHA 4PFSA 5DWVA 2JK1A 2B1GA 3UK2A 2FFAA 2FQXA 2HKIA 3KJGA 4ACBA 3FCYA 2FFQA 4URWR 4XQGA 2FP4B 4E2YA 4LJKA 3F5SA 2ZROA 1I51A 3C1TA 1DEHA 2E85A 3BKXA 4JL8A 4MV5A 4P92A 3TW8B 3WLAA 4AJOA 2FR0A 4J1NA 5C1BA 2ORIA 3BXOA 3K4HA 2QW1A 4LYGA 1VLLA 1DQSA 4OAOA 3ZIAD 1JKJB 4WGFA 2A1TR 1LEHA 3S28A 2YQZA 4YMTA 4IVPA 2B2NA 1XR3A 1T9KA 2VQ3A 3FNEA 1JQ5A 1RQLA 2OGSA 2ZYRA 1DRWA 2H0AA 3DYVA 5C1PA 2TMYA 1U7TA 2PH5A 3PNPA 3HDGA 4M8LA 1DXHA 4UXIA 5ALTA 3LD9A 3M7IA 1AMUA 3TVTA 5KDDA 1WSAA 5HQTA 3ZU6A 1XA3A 3EDRA 5EJ5A 1VLHA 4NE2A 2IFTA 5DGIA 5K0TA 4QUEA 4XQEA 1FFYA 1UOQA 1IOLA 2AOXA 2OVBA 4G65A 3WTBA 3OZAA 1WUHS 1LRLA 1UDRA 3S1LA 3ESQA 3CLSD 4GUAA 1XFAA 4G0UA 2Z8XA 2XECA 1R0LA 2POQX 4DB4A 4XAQA 3OHPA 1H4VB 2N1MA 3EPRA 1KY3A 1WUJS 2CZCA 3G5MA 3Q87B 3OUUA 4HB2A 4LSZA 4MW7A 1XNHA 4YP6A 1RPNA 1KBZA 2IYSA 4LC9A 2AJCA 1Y4UA 2PL9A 2VHJA 3IVGA 4QODA 3V3KA 2P6RA 2V3VA 2GK7A 3JS5A 1DJLA 1WCV1 2AI3A 2WKSA 2XYRA 4WOCA 4LTDA 5PGMA 2QE6A 1OFTA 4H3HB 2R2AA 3K70B 5FUWA 3RSOA 4F60A 721PA 2RCNA 1FYVA 4KKVA 3ZR4B 1MOSA 4UTNA 2R1ZA 3DPIA 3EXIB 3H4IA 3HXLA 3LOPA 5GONA 3LLSA 2O23A 1ICEA 4QARA 1YFKA 2C9MA 2I87A 4UARA 3FETA 4ENPA 4HAOA 2EQAA 5AWFC 4BMSA 3T52A 2A1IA 3BWMA 4DS3A 1B41A 1EM8B 1DX4A 4DLUA 3SVZA 4K88A 2WE8A 4IQ0A 5JWOA 1E62A 1ADCA 1VL8A 3EW9A 3FTDA 3DXFA 4C6RA 1FNNA 2KWIA 4H0NA 3AJ9A 4LJ6A 5M5BA 4PAGA 5KTRA 4BQQA 1RM5A 4KBGA 4NMXB 3SBDA 3BZUA 4O4IF 4P7GA 1JPVA 4TS3A 2WOOA 3I0NA 1XV5A 5JY1A 4FONA 2Q3BA 1YT5A 1ZGAA 2X23A 2XWQA 3IMFA 3OFND 4D3XA 4XYBA 4ZC8A 3DULA 2O1SA 2O2GA 2VPXA 1DTWA 3C6QA 3RC3A 3U56A 4XDZA 4YJFA 4DPLA 5IANA 4QEZA 1XTIA 1TLLA 2IPAB 3RYIB 1JHPA 1VJ0A 1Z16A 3QITA 3ON5A 3TZQA 3HJBA 1GXSB 2ZJOA 2ZULA 4BP9A 1CUGA 1B43A 1UBUS 3K0BA 1NQOA 3GGSA 2QTAA 3FM9A 4ZOLF 3AVYA 3LUFA 3A31A 5SZJA 1J7JA 2O2ZA 1DEOA 8GPBA 5AXDA 2E21A 2CV0A 4YRCA 3UGKA 2BBOA 3G9QA 4Z51A 4UQOA 4W9RA 5D5QA 2YXDA 3HHPA 4QUBA 4RHEA 3CE9A 3I0ZA 2IDMA 1H4SA 1T4DA 2QGNA 1KFKB 3BMOA 4TXMA 2XQKA 5TEVA 5AIAA 2RARA 1L1EA 2ATIA 3PC3A 5I9BA 4PZYA 3L92A 1ZGJA 5TY0A 4D2IA 4BRWA 1CRPA 4FEGA 2X2OA 1Y5RA 5FYDA 4TWAA 3BAFA 4JQCA 4E22A 1Y34E 1BYUA 2Y05A 4XFDA 1WUKS 3UB4A 1NJ8A 3H7IA 2UUAB 1S8OA 3W05A 2DFVA 2QK4A 2QN3A 3STTA 3ZHUA 2XD4A 4C29A 3ZYZA 1IUKA 1IN6A 1E1RA 4LPKA 3SD7A 2WTUA 4N5DA 2FEAA 2H1OA 3KWMA 3S2ZA 1J1UA 2IE8A 2R8EA 5EC8A 1FK8A 4YMWA 4JXJA 2YC2C 5FPSA 3TLZA 4F5YA 3HC7A 2H51A 3PGKA 4YVFA 1W9HA 4A6EA 2JGIA 3D59A 1KFEB 1G5PA 1USWA 3W5CA 4MB2A 4KQEA 4TLEA 3K9FC 3ZJ5A 3MG9A 4TLBA 3QHPA 3OJCA 4WKPA 5BNFA 3KLBA 3WLLA 4EVIA 1GZDA 3HEBA 4MRPA 2V6MA 2P5SA 3ZBQA 5IF9A 1JDJA 4HMPA 4JBNA 4RXUA 3PXGA 4RAQA 3H16A 1YZTA 3VPGA 3V00A 2HJSA 2WG1A 1QDLB 2ANBA 5F5NA 4CDRA 1VYVA 1QOPB 4FI3C 1UJ5A 2RIPA 2AWNA 2HIAA 2DE0X 4FUQA 4OSPA 3ABSB 2E5WA 2ZIAA 4HDCA 1NXOA 3BA1A 3Q3VA 3DC7A 2XB9A 3EZLA 3SNKA 1FDWA 1I33A 1M8GA 1MABB 1TCUA 2R8OA 4BTLA 5BW8A 3FYCA 5KYUB 2BZ0A 3Q6NA 4YT5A 4BIMA 4HBGA 3U4QB 3V8NA 4KO4S 1RQ2A 3BDIA 1PP4A 1KNXA 2ZVQX 4U39A 2XA2A 1IATA 1XRNA 3BXHA 9ABPA 2WSBA 3QPVA 3RRZA 3R7AA 3WBKA 4JH0A 1HXHA 4D8VA 4XVHA 5BURA 5IBQA 3KUXA 4MRNA 4LF9B 4TMFA 1NNUA 1SWWA 1N2HA 4CFSA 3ZTTA 2LNDA 1K7XB 1SHTX 2C2YA 2YFHA 3IFSA 3SU8A 3ND9A 4ETWA 4YWJA 2IHJA 3HBNA 4HAWA 3ZIAA 1R9JA 2PJDA 1QV9A 3QZUA 1GHTA 2YUTA 4PO8A 4AJKA 1YMUA 3JD3A 3Q9NA 2X5KO 2GEVA 3KNZA 3LUHA 2IDJA 3BK2A 5DYYA 5B3LA 3DXXA 2HLPA 4FDUA 2BUBA 2JARA 3LUBA 4DIOA 1A9XA 5D01A 1Y7PA 1OYYA 5AM4A 5CH3A 2WTBA 1BRTA 3PFBA 1NM5A 4BAUA 5IBPA 2I3GA 2X1VA 1WNTA 3U4DA 3QU4A 2CNNA 4DW8A 1WMDA 3KOUA 4CL8A 3N07A 3FUVA 3I9NA 2F8MA 3MRSA 5CEEA 1QS0B 4G4JA 3EYAA 4N0DA 4DJJA 4E88A 3F49S 3PU6A 2OC4A 1NJFA 4MIOA 4ZOAA 5FBZA 1MIOB 1NGSA 3ORRA 1E8NA 1Y82A 3KYIB 2D0IA 4G8CA 4ES6A 1NVVR 4ZK6A 5DTEA 4PLCA 3ENVA 4Y3UA 1Y7LA 3QA9A 4JLSA 1O6ZA 4DNPA 5LBTA 2HREA 2V7VA 4RBNA 4G9BA 3SKXA 4RORA 3H5RA 5HZHA 3DLTA 4R1QA 2VAMA 2GHRA 4RY0A 3EIEA 2WYOA 1NVXQ 5LXTB 1P7PA 1NJ6A 1EVJA 2D1RA 3FYSA 4V1CI 3GRFA 3K73O 4TL7A 2CXSA 3NONA 2LRHA 2YWXA 3LX8A 2YS7A 4HH3C 1MNQA 5AKLA 3U3OA 2YV4A 3R3VA 5FI1B 2CKDA 5HF9A 1TZBA 2L17A 5CAEB 4BAZA 3IQXA 1LW6E 3H87A 1HF3A 2QQEA 4LRWA 4FC7A 3VAZA 2O5RA 1N2CA 4P7JA 3EK2A 3NC0C 3BBPA 3JATA 2NU7B 1N3YA 3RTBA 2QPOA 1A71A 4N6NA 3Q85A 4TVBA 2O6HA 4UVGA 3OIFA 1PGNA 3ODPA 1H0KA 4URUR 3QOXA 3AVWA 4IM7A 4R16A 5CG2A 3B6IA 1YDWA 3JYNA 3D2CA 1KYVA 2JHGA 1XD2A 1VLZA 3CLHA 2JVKA 3QHQA 3R6TA 1WKBA 3LC2O 2KI5A 3OZXA 4IHJA 4LQCA 1P4JA 2UYQA 4OHCA 4WD3A 2VRCD 3IR5A 2JK0A 3IVAA 1F0PA 2V6JA 3T95A 1A9YA 3G2HA 5G4KB 4O4HA 4N39A 5FNVB 2IXEA 2CLEB 1U3CA 1T1RA 4UJ3A 4JMPA 1J09A 1I4OA 2WWFA 4K0RA 2D2EA 4S0XA 5TQ0A 2N47A 2R25B 5TGTA 1FSSA 2PX4A 2NUBA 4LYHA 2V7TA 4MHSA 4XCQA 2EF1A 3SEFA 1QQAA 4UTZA 3SG0A 1QBGA 4IQGA 1CJBA 5TARA 5I9SA 2AXEA 4DBLE 1W36B 2XKKA 4LHWA 3BXPA 1OCEA 3ACCA 2YN0A 1US8B 2X3FA 4JROA 3ZQ4A 1NA5A 2YYAA 1ILEA 3TUZC 1WX1A 4PSUA 3V8RA 4RV9A 3ZDEA 3QYFA 3V8EA 4OI0A 2P7HA 5KKAA 4D0SA 2JCVA 1QZUA 2RGUA 2NU6A 3NDJA 1WV1A 5B1HA 4CW7A 4DCTA 1XRRA 1KHHA 1KMIY 1KVSA 1QUFA 1XGKA 4ZI5A 5F7XA 1B6SA 4OJTA 1DJPA 2JCYA 2VSYA 1BW9A 3PT9A 4OMCA 2OAQ1 1EFUA 1TAHA 3HR4A 4GI2A 5IJ9A 1YMVA 5KNBD 2D13A 3KPJA 1M8FA 1JQJC 4NYIQ 3SJAA 4ZRMA 1WMBA 2JBWA 4HGOA 1NI3A 3KKNA 1F5SA 2HLNA 3G2PA 1B6GA 1V0JA 1W34A 4LWOA 5AD1A 8AT1A 1TF2A 4QQRA 2DLNA 3RVPA 1CIJA 4KPEC 1TKAA 1YJBA 2A0XA 5IJXA 4DM4A 4F5EA 5AIBA 1EVLA 5KJCA 4CNBA 1SURA 4N18A 3SQNA 4YRKA 3LK7A 3ER8A 3CUEF 1TE2A 4L8YA 5BSUA 3SYTA 3TQIA 5L3SB 2QI9C 1EUQA 1P31A 4CUJA 3ZDZB 2H7CA 4RYDA 3T34A 3REGA 4QFCA 5CD9A 3K5HA 4V0RA 4OYYA 2R6AA 4OGGA 2XWBF 3F3MA 3UJ8A 3E18A 4LSWA 1GPDG 1XB2A 2SCUA 1JSCA 3IOEA 5EGNA 1NBMD 4BYMA 3PEEA 3K0FB 1Q15A 4ICIA 1M83A 1XZEA 4JGIA 1UWCA 2I6XA 3P0EA 2FLVA 4ZO8A 4P0TA 2IH5A 1CJVC 2AEEA 4PRKA 3DHVA 5EZQA 2P9CA 3MJDA 4E03A 5HF6A 2X40A 2GQ0A 5ALNA 4MV0A 5EMHA 1LI4A 1E5LA 1ULBA 1Z2OX 2EJUA 2OP0A 4TSFD 4CE6A 1ZD3A 2IU4A 2R96A 4L4SA 4F4UA 4UHDA 2FEPA 2J3LA 3HDJA 4IWNA 2X9LA 1KC1A 4I9HA 5KAPA 3C43A 1JLLB 3QY0A 1TJ4A 2GSWA 1AGYA 1TI7A 3H6KA 4N3GA 3GRVA 4MQMA 3WDLA 1J06A 1E6KA 2QN8A 2ZIVB 4ZCSA 3OTQA 4UU8A 2W6IA 4EX7A 3GA7A 5KVQA 4MYCA 1FP2A 5FPYA 1QYRA 2HFJA 3BG5A 4X65B 3K9BA 3CV3A 4MEAA 4Q1AA 3RS7A 3QBVA 4BGIA 5IAJA 4UU0A 3ETGA 3BORA 3C8DA 4ZANA 4IIFA 3ZHVA 5JYDA 4G89A 4X97A 1RE1A 1GN9A 1L4LA 1FQOA 2P9EA 1WPRA 5KTTA 3D4LA 2QZJA 1OAAA 2XUDA 3NBYC 4C7VA 2G0AA 1OKKD 4UTRA 4JLOA 1VRCA 2WFLA 4HNVA 4XPZA 4YRBA 3PD1A 2GPYA 2YXLA 4HH1A 4IPTA 2QN1A 2RB5A 3QMMA 3W2HA 1MG0A 2UZ0A 4D45A 4ZCIA 1ZRSA 5DNUA 4G0VA 4KR2A 3VAAA 3C3KA 3IAS6 4C76A 2NZVG 2IZ7A 3E5HA 1RAIA 5TDHA 5BVHA 3RTEA 3QPDA 2GZ1A 2I2XB 1I6LA 4PFKA 2YYZA 5TEWA 3MGCA 4MLPA 1NMSA 2P4EA 2V8OA 3BYZA 2LCQA 3U3MA 4EA8A 2BE7A 1NOJA 4EYGA 3UMVA 4YAJA 2F4NA 3E9YA 3ELDA 4KWTA 3BGWA 3UXYA 1EWKA 1Y6JA 1RADA 4LBVA 4G37A 5INTA 1S4MA 2FEWB 3WKAA 2R4QA 4MKFA 4PXSA 3WKDA 1E1QD 6Q21A 3KQOA 3OBBA 2Z6QA 3V5NA 1NW9B 4RV4A 2O48X 1A88A 4XASA 1W46A 3EDQA 2OCKA 1UQRA 1Z7WA 3CU5A 5KX5A 1HX7A 3DLHA 3GVCA 1JAYA 1E7YA 2EP7A 2VWPA 4FGUA 1G8KA 1V39A 5C5EA 2BR4A 2JIRA 3K6KA 3L0PA 2ZB3A 4QOJA 3VZPA 3WYBA 4D8TA 5A3QA 5DP2A 1E9AA 3LQKA 3BN3A 5P21A 3U4GA 3PIRA 3V8QA 4MIKA 2D5LA 2IOHA 4BQOA 3JASA 1B73A 3ZY4A 3OZIA 2Q1SA 5DH9A 5DM4A 3R5TA 2JJ2A 5H5JA 3KV3O 4PIVA 1R8SA 4BGUA 2KJQA 3E4DA 1FZQA 3ERCA 6ADHA 1TUBB 3UFBA 3GH1A 3IKJA 1NP6A 1ZD8A 3LT1A 1ZUNB 4LYYA 4QUIA 3K4PA 2ZRFA 3VYUB 1CQJA 3P0IA 5EIWA 5C7IO 3G2OA 2XZOA 3A1WA 3KQTA 4PZ9A 5JALA 3RE1A 4OU4A 2ZRKA 3K6SB 1KAMA 1TTHA 1HGXA 2BV3A 2X0NA 3FOWA 3M4JA 3T5AA 3QX8A 4O2LA 2NSLA 5HM8A 5KTNA 4IRMA 1FLVA 4P53A 3DCNA 4FMDF 4DDWA 2GN6A 3ABOB 3JALA 4W1PA 3OIVA 1DAGA 4BN0A 1POWA 3OMLA 3AHGA 4ON9A 1HOTA 1PQUA 1DRUA 5F51A 3G1TA 1XP5A 1ANKA 4NFHA 4QELA 4OHBA 5AM2A 1IWBB 1JG3A 4NLLA 3T9DA 5AVRA 1QZ3A 2AEMA 2ZS9A 3DVAB 4KQ6A 4ALLA 3H17A 2VZ0A 1ORVA 4KBYA 3UG6A 5I45A 2IH2A 4JLPA 2OD7A 4HGNA 4L9AA 1XTZA 1TVCA 3VNQA 2GETA 3VHRA 1AU9A 5F9HA 4DNQA 5KTKA 1D2RA 1X1BA 4G5XA 1K0FA 4H3KB 4PRYA 3UO8B 4ROTA 4BY9E 1N2CE 1SBZA 3N8NA 4G5QA 4Y2XA 1T2FA 5DRTA 4WTOA 2FSGA 3S2SA 3TOVA 4QTYA 4I81A 4LA4A 4EENA 2GEKA 3AUFA 2FMXA 5AKJA 5EMLA 1IOWA