1Z6ZA

Crystal structure of human sepiapterin reductase in complex with nadp+
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
264
Chain Sequence
LYFQGHMLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Sepiapterin Reductase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 92
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z6zA00
5JDCA 1O89A 1HEUA 1BDBA 2X6TA 2Y0DA 1UXGA 1XQ6A 2I65A 4R41A 2VT3A 1Q2XA 1P1RA 4GX2A 3HDHA 1NAIA 4GLLA 4N5MA 5A5FA 2NSDA 5MGBA 1DAOA 3PK0A 4MVJE 4N5LA 1Y8QA 3GZNB 2QRKA 4RO0A 3L0DA 3PEFA 4XR9A 2JCVA 4AJLA 4G2NA 2RIRA 2JHFA 4E5MA 1HE4A 5H81A 4NDNE 1FDSA 5G4KA 4BB6A 1M75A 4DXHA 4U6SA 4ZVVA 4TQGA 2WWRA 1YH3A 4UUOA 1V6AA 2QRJA 3KSUA 4CM7A 5JYDA 2D2IA 4YBZA 4EDFA 2GN8A 3C7AA 4IDFA 4CPDA 3D3WA 3K30A 3FN4A 4I8XA 1Z7EA 4YEDA 2VHXA 3OBBA 1G0OA 3N74A 5L3ZA 1P31A 3FCOA 3HB5X 2DM6A 2GCGA 2OP1A 3AUSA 4JNKA 4R5MA 3WB9A 4EW6A 5AVOA 1BW9A 4A73A 5LC1A 2E37A 1H6DA 3GRKA 3L6DA 3UXYA 2BI7A 4J49A 5DP2A 1X1TA 1EK5A 3P7MA 2NTJA 1OC2A 2JD0A 1P1IA 4O5OA 1DC4A 5C37A 2EKQA 1HYEA 1LXCA 3WLFA 3AY6A 5C7IO 1P9LA 4IDEA 1LRLA 2PWZA 4BOYA 5G0WA 1NWHA 4C7JA 2G1UA 3VPFA 4EBFA 2EKPA 4CMAA 5CEJA 1X0XA 2VYVA 4BGUA 3H9QA 4WNCA 2IYOA 3AJRA 3KVOA 1ZNQO 1DFIA 1F14A 2I6TA 2D8AA 4O1MA 2RBEA 3FNGA 1E3WA 4R16A 3PGJA 3TF5A 5ICSA 3UVEA 2X0RA 1WMAA 4F46A 1MG5A 1L7DA 1JKFA 3DTTA 2B4QA 1E92A 2ZYAA 3DZHA 3K31A 4LSMA 5B4VA 4AG3A 1GUYA 4RF2A 5TX7A 2P91A 3DTYA 2QYTA 4MVJF 3RQSA 2NWQA 5AXBA 3ZU5A 1ZZEA 1U4OA 5ADHA 4D3FA 2PLAA 3OJ0A 4WUVA 5L51A 2DU8A 3KXDA 3QVXA 4J9UE 1RM0A 4GQAA 4WLNA 1SBYA 4XRRA 3IKTA 3R3SA 3GK3A 2WM3A 1IL0A 4TVBA 3CKYA 3LC7O 2VUUA 2WMDA 4N5NA 3GT0A 3QVSA 4XKJA 1DPGA 3NT5A 3GOHA 3OA0A 2J8ZA 3D5QA 2B4TO 5G0UA 2OO5A 2FRDA 1QORA 3U9LA 1EZ4A 2WJPA 1E5LA 4ZA2A 4ND2A 3UCXA 2YV1A 4RDHA 1LSSA 1YE3A 3M2PA 3RUCA 4FGWA 1NQTA 1F8FA 4DMMA 1QG6A 1EBUA 2J3HA 3HFSA 3F6YA 4NFYA 1I32A 3FF4A 4MVJM 1E3EA 1VJTA 4PZDA 2G5CA 4WCDA 2ZTLA 4QECA 1NXQA 4RORA 4UAGA 4YAEA 4J1TA 1R4NB 5TJHA 2FPIA 5HS6A 4IGFA 3TL3A 5A9SA 3MJTA 2UYYA 3QWIA 3ETDA 3H8VA 3VTFA 5JDIA 2WE8A 4ALJA 4O6VA 3AI3A 4EITA 1RWBA 3S8MA 3DBRB 3ABIA 2O3JA 4JBIA 3QSGA 4TRMA 4BV9A 1P44A 3ZHZA 2GZ2A 1NVMB 1SC6A 3DAFA 3P2YA 1U8XX 1DAPA 2DC1A 4ZJUA 2H9IA 2EJVA 1B8PA 2FR1A 1D7OA 3CE6A 1R0LA 3GRPA 4JROA 5G2OA 4CV2A 1L1FA 4M87A 3KV3O 2WYVA 2QRLA 4FBGA 1VSUA 3B1KA 1TT5A 4BNLA 3OJFA 3AK4A 4B8WA 4NHEA 4LCJA 4NU5A 9LDTA 1IULA 1Q7CA 2RH4A 2P9GA 4LW8A 5IXSA 1ENYA 1YWGO 1GAEO 3Q9UA 4DIBA 1PJLA 2O4CA 1DHTA 3F3SA 2H63A 2E6UX 4TMFA 3NGLA 5DCWA 3FBGA 1CDOA 2GSDA 5GY7A 3RKRA 4F6LA 3DEYX 3ITKA 3OA2A 3B6ZA 3JQGA 5EPOA 3BZUA 2BFOA 2ZCUA 1ADCA 1UZMA 1T25A 3QIVA 2DQ4A 4UUMA 3OJLA 5T64A 3WFJA 1TA4A 2EGHA 2CF6A 1O6ZA 5C5IA 1BGVA 3BMOB 2VNAA 5DBFA 2X58A 5BSHA 4XR4A 3KM0A 1PEDA 2A94A 3WG9A 4WLOA 3RC9A 3QWAA 4XIYA 2XF8A 4QXMA 1YQGA 1UAYA 2QZ9A 3QVTA 4R1SA 4RQUA 4KMSA 3ZNNA 3IKVA 1XYGA 2LDXA 3SXPA 1PL6A 3PXXA 2CVOA 4IJVA 4NQZA 1AUPA 2GRAA 3FR8A 5ITWA 1KS9A 4S1VA 4DIFA 4D41A 4Z3DA 3PYMA 4FGSA 1E0DA 3E9NA 4XDZA 3TNLA 3KTDA 4PLYA 3ONEA 1ENZA 1HTBA 2R00C 2ZTUA 3JD3A 1XSEA 3ANLA 5JE8A 1J4AA 1KVTA 1VC2A 3NTOA 4J16A 4BQPA 3Q9NA 2O3SA 3F9IA 3KHUA 1N9GA 2OUIA 1VRWA 2IE0A 4RLSA 1HDZA 4J91A 4YYZA 4RDIA 3ZWXA 5CFZA 1NPTO 4CL8A 1YJ8A 1B16A 3K6JA 3ENNA 4Z9FA 1ZMOA 3VDQA 1I01A 4MIOA 3V8BA 4Q3CA 1HDCA 2YHIB 5CDSA 2FR8A 3LF1A 4H16A 3PHHA 1B8VA 4IJWA 4Y6PA 3KYBA 4YR9A 3D0OA 5TT1A 3KUXA 2Q1TA 3TZHA 1BWSA 3GDGA 3VPHA 3JSAA 4DC1A 3G17A 3LT1A 1Q7GA 5CEEA 4DLLA 3CIFA 4L76A 1IZ9A 1NNUA 3DBHA 3QWBA 2P4HX 4CLEA 1C1DB 1PJ4A 2AE1A 1UP4A 5DZSA 1GCUA 3H9JA 1E3IA 2WSBA 1LRKA 1RJWA 4QO8A 4IY1A 3U4HA 3L6EA 3VHRA 1NP3A 2HJRA 2FSSA 4TZTA 3BTSA 4CMJA 3GHYA 1IZ0A 5KVSA 4BNHA 3A14A 5JNLA 3O38A 4EJ0A 3DMYA 2SCUA 1YL7A 3CZRA 3QJ5A 4NZ9A 3D4NA 1LLDA 3DQPA 4B4WA 2NNLD 4CUZA 1Y8QB 3GZNA 3K92A 4W99A 2HU2A 2DLDA 4FR5A 3LU1A 4L4RA 4CMEA 1K6XA 4YVFA 2B0JA 3U0BA 7ADHA 1NASA 3GFBA 2ZATA 3K9QO 3KYCB 5CG2A 2FR0A 2EHDA 4JBHA 5DT9A 3RC1A 1DIGA 1PX0A 1H9BA 2O48X 4M1QA 4E3ZA 2EIHA 2BGMA 1KEUA 1B7GO 1GU7A 3IDSA 3R0IA 3PWKA 3GG9A 2GN6A 1YL6A 1GYPA 5KNLA 2QW8A 4GVXA 2GO1A 1NHGA 3F5QA 1Z74A 5DCYA 3NT4A 1R12A 1MC5A 1T4DA 3LC1O 4HFNA 4I08A 5FFFA 4Z6KA 3I6QA 1YBVA 5HBRA 5T5QA 1N92A 4PLGA 2CY0A 2YZ7A 3KSZO 3WIEA 5G4LA 2X0JA 2Z1NA 5JFOA 1A4UA 1GEEA 2GR9A 2VTEA 5FF9A 2FP4A 5J23A 3C1OA 5A1TA 1VLLA 2EKLA 4J7XA 5JO9A 4R9RA 1Y5MA 3LK7A 1R66A 2DT5A 1H93A 3S55A 3Q0EA 1TT5B 2EG9A 1T2AA 3HJAA 1R16A 4KQXA 5CDGA 4IBOA 2D4AA 1BHSA 2PNFA 4PZEA 4B79A 3H9UA 1M67A 1PJTA 2JD2A 3ZWPA 2HCTA 2G17A 2DBVO 5FYDA 3H9GA 3SC6A 5F5LA 3WWYA 4L9RA 1ZVMA 4IIUA 8ADHA 2AG5A 3ZV3A 4XQ9A 5DCUA 1JW9B 3IIEA 3K73O 2EP7A 1QRRA 4L4SA 4OOEA 4WJZA 4UUPA 1EK6A 4GLOA 1ZK3A 4DL9A 4E2ZA 3WWZA 3VPGA 5TLSA 2O3TA 5BT9A 4A2CA 1VL6A 1GDHA 3JYOA 4ZQFA 5T57A 5L40A 4B7UA 5GMOA 1DFGA 3ANMA 3G3EA 4B4OA 1ISIA 3MZ0A 1PWXA 5JAIA 3ROMA 2UUPA 5L4NA 2HAEA 1F0YA 2NACA 3IUPA 2X0NA 1JVBA 4BMNA 3T7EA 1H6CA 3UH1A 3WDSA 4BNTA 4HV4A 5I7EA 3HDQA 1A9ZA 4FOSA 3FTPA 3JCZA 4P4GA 2I5PO 2HO5A 4QO7A 3ZW8A 4CM4A 2HMVA 3N58A 2EJWA 3GAFA 2ZB8A 5CDTA 5A9SB 1ML3A 3BMNA 4HWKA 1MFZA 2ZCVA 1NQOA 3WR5A 5BNFA 3STHA 1EVIA 2ILTA 4D0SA 3I9JA 1G0NA 2YDXA 4KUEA 3TFQA 3I9OA 1GQ2A 6ADHA 1DIRA 3H4VA 1DXYA 4UVIA 3PZBA 1JKJA 2O7SA 4WK6A 1EQUA 3OM9A 3DBLB 5KKAA 4DIOA 3EZYA 4RPLA 3JQ8A 4J0EA 3SEFA 1PS0A 4MO2A 1ZEJA 3TZCA 4GX5A 1J6UA 5T67A 3KEQA 3ZV5A 1M76A 3GN2A 1V0JA 3G1UA 1GUFA 2RAFA 3GUYA 3I9NA 4MDHA 1D4FA 3IJRA 3JYPA 2DFVA 1HYGA 2YUTA 3AM4A 1CF2O 3JQ7B 3CUKA 2Q50A 3OECA 3Q11A 5HA5A 4Y6RA 5K6AA 1DEHA 2C5AA 3FWNA 5B4UA 2ZTVA 3A06A 4A7PA 4W6ZA 1Y9EA 3NX4A 5IN5A 2ZK7A 5JCJA 1U8FO 3NKLA 4R5HA 3GLQA 5HM8A 2JKVA 1AGNA 1YO6A 2HK9A 1N1GA 3H2ZA 4OQZA 4CQMD 4PIVA 3SLKA 4K1LA 3QP9A 3ZWBA 4YQZA 1TEHA 3D4PA 5ILOA 1ADBA 1ULSA 3ONFA 2VOEA 2B36A 3F46A 1KBZA 4QSMA 4TKMA 2VNSA 4OM8A 3QWFA 2H6EA 3C85A 2BD0A 1NFRA 1DHRA 2YDYA 4BO1A 4J7UA 2A4KA 2I67A 3NTRA 4EYEA 2RHCA 4ZRNA 4IIVA 3K2BA 1CJCA 5EQFA 2DFDA 3OICA 4G81A 1SOVA 1JN0A 4ONEA 3DZJA 2HK8A 1BDMA 4XQEA 4NMHA 4ITUA 2WD7A 2PKQO 1QXSA 1E77A 4B3JA 1KY4A 4XB2A 3WBFA 4Q9NA 1AN9A 5BSEA 5U9CA 4NBTA 1IB6A 2G82A 4BB5A 5TGDA 3GVPA 3PJGA 2GN4A 4R1TA 1ZFNA 1YOVB 4YJHA 3A4VA 2J3KA 1AHHA 2DBQA 3Q2KA 3GVXA 3L77A 3GDOA 1U28A 4LSWA 1ARZA 4D44A 1ZJZA 3WYCA 1T2FA 4XZ3A 5DP1A 1V8BA 5H82A 4OHUA 1LDYA 4OSOA 3G79A 4ALNA 4K26A 5TT0A 2X1HA 5JSFA 4K6FA 1ENOA 1VL0A 4YRBA 2B5VA 1DB3A 4LN1A 4F45A 5EMHA 1LJ8A 1U2GA 4HFJA 2NU6A 2YV3A 3AOGA 3JQ9A 4PLFA 5K0ZA 4HFRA 1YQXA 3AOEC 4BMSA 4FJ1A 5TF4A 3PFFA 4S3MA 3JQ7A 5A3VA 1U3UA 3JQDA 2BGLA 1X0VA 3E8XA 4GSLA 1TB4A 4IDCA 3WNVA 1U5AA 2PY6A 3RBVA 4RV9A 4BNGA 3M2TA 3F1LA 3RKUA 2GYYA 4WGGA 2X8LA 2W98A 2NQTA 2VCYA 4B7XA 2DKNA 1O8CA 2O3RA 3OETA 4QX6A 5IZCC 5KWEA 4NBVA 1ZO8A 2CZCA 2CSUA 4OXYA 4BL5A 1ZK0A 3KOUA 4GX0A 3GGOA 1YKFA 3PHIA 3AFNA 4UVEA 4EI2A 2NUAA 5KKCA 4MVJP 5T8KA 4YAIA 2AA3A 5I8WA 2POQX 4ZQGA 3PFWO 3KB6A 3R1IA 3RUHA 3NRCA 1C1XB 2W2KA 1P1FA 4XDYA 4CM4B 2P9EA 3FR7A 4O63O 1MB4A 2C7VA 1R4NA 1WDKA 2RHRA 3GNQA 1E7MA 1F17A 3ZU4A 5BNTA 4WE3A 4KQWA 1LDNA 2CVQA 2ZB3A 1E7QA 1JU9A 2QZZA 3RUAA 4GWGA 4WEOA 1UAGA 3LQFA 1W6UA 2JFGA 4Z0PA 3A1NA 4J3FA 3CPSA 3NEPX 5CPBA 3RAJA 4CMKA 1LC3A 1PJBA 3JQ9C 3JYNA 4Q39A 2O23A 4XYMA 3HWRA 4Z3KA 3DZFA 3HQ4O 4PLHA 4BQRA 4XJSA 4CV3A 3NDIA 3OFSA 5JXWA 4KWHA 4FS3A 5L7YA 3QW2A 1D1TA 4WCFB 4HBGA 4IGEA 4G5HA 2DUWA 5GZ1A 1V9LA 4PRLA 1X15A 4MINA 2IDZA 4AJPA 4E31A 1CRWG 2Q2QA 3QV1A 5HWSA 3UCEA 4MVJH 3QVWA 1P0CA 1GPDG 4OXNA 2NVUB 1CQJA 3AY7A 4XGKA 1ZK2A 2W4QA 4KDEA 4DA9A 2E48A 1I2ZA 4U0KA 4DWVA 2Y66A 5TNXA 3OQ1A 2EV9A 2PGLA 3GFGA 4DTIA 1WPQA 3ZU2A 3DBRA 1X7HA 5LDGA 4IM7A 5JDIC 4WCFA 3FPCA 2BKAA 1XGKA 1IPEA 1LNQA 1N7GA 3OIDA 3DDNA 3EGOA 1EFLA 4H15A 1Q1NA 2B4RO 2NTNA 4JX8A 3UHAA 3IP3A 3MWEB 2NU8A 4XEHA 2NVUA 4B4UA 2VWHA 3EMKA 3LZ6A 4N18A 3UW3A 4XRGA 3HB4X 1KEPA 2VHVA 4B7CA 3AU8A 1K89A 2J3JA 2PZJA 4LVUA 1OMOA 3ZW9A 3DZBA 4BO3A 4RLHA 3NV9A 5EQDA 1LLUA 3KYCA 5U4QA 4ID9A 1KVRA 2HUNA 4E5NA 3O4RA 1N5DA 2Q1UA 3AUTA 2Q46A 1HZJA 3JQ8B 3M1AA 4DQXA 1GZ4A 4XCVA 4E2XA 4OQYA 4LGVA 3SBOA 3L07A 2BFPA 4FFOA 5BR7A 5EESA 1YBMA 1RM4A 5CHEA 1KIFA 3VC7A 2GERA 1DO8A 4J0FA 1PR3A 2EF1A 4YAKA 3H5NA 3H65A 4Z9XA 3RUEA 4R4JA 3QVOA 3BMNB 3TDKA 5JYEA 5JS6A 2D5AA 5LCXA 4ZQHA 3RUDA 4XWYA 1KC1A 3TN7A 3RI3A 1RM3A 2Q2WA 3OEWA 1A5ZA 2BLLA 2O7QA 5F1PA 1AHIA 4R9SA 5KTKA 1GZ6A 2D0IA 4M89A 4I5FA 4ZRMA 3JYLA 1HT0A 1T1RA 4DQVA 2I66A 1EQ2A 3ANNA 2CUKA 4B8ZA 1U4SA 3HN7A 4OKIA 5B1YA 4MIYA 3WGZA 4F3YA 3QA9A 1S6YA 4D42A 1Z7BA 4W4TA 2NU7A 3AWDA 4WASA 4D0RA 1QP8A 3C7CB 3W8DA 1SEPA 1I3NA 5KVCA 4GAEA 3ORFA 4GWKA 2VUTA 2VYVD 2WDZA 4CQMB 4NBUA 4DLAA 5AXCA 4DPKA 5IF3A 3KYDA 1C0LA 1E7SA 2W2KB 4RVUA 3ZGYA 3O8QA 2VQ3A 3TFOA 5L53A 1PZHA 1R37A 1LLCA 4MPDA 2BH9A 4XYGA 1UP6A 3RFVA 1A27A 3TZKA 3DMTC 1M6WA 3ADOA 3GDFA 1HRDA 4CMCA 4RPGA 4IQ0A 4WEQA 3RBXA 1O95A 2NLOA 4GVLA 4JJIA 2AEMA 4J1NA 3BMCB 4ALKA 4AVYA 3NT2A 2VN8A 1YXMA 1EVYA 1KY5A 4CL3A 4IZIA 4YB8A 2IODA 3N7UA 4DYDA 4W9NC 4JJFA 1PJSA 3VH1A 5TJ9A 2GZ3A 2OORA 1FXSA 1EDZA 4NBRA 4PGFA 3S2GA 2XXBA 1F8GA 2Y93A 3ETGA 3GF4A 2C0CA 2ZQYA 4CMHA 4NFSA 5I7SA 5ITVA 3ENKA 3AI2A 3RSHA 1Z75A 1XKQA 3GEMA 1YL5A 3HNPA 3WGIA 3GC6A 3ADPA 3DL2A 2X23A 2FZWA 4CLOA 1KC3A 4CV0A 5G4KB 3WIDA 1BW9B 2ZJ1A 3WQRA 5HS4A 3VTZA 4MIEA 2PKQP 3RVDA 1DIAA 3GAZA 1JWAB 3PWZA 4RVFA 3PHLA 1E6WA 5AXAA 3RBZA 1VJ1A 3INRA 4M8SA 5K9ZA 3OHSX 3HDYA 3TJRA 1EUZA 1E7RA 4L0QA 4CM9A 3B70A 3PLNA 4ND3A 2VRCD 1PR9A 1UDAA 1BXGB 1NVGA 5TS3A 4DREA 2CF5A 1IPFA 3GVHA 1Q0LA 2JAHA 4ZQEA 4BO4A 2AW5A 2DUUA 1D8AA 3GGGA 4NJMB 4AJIA 4QFCA 4KUHA 4BIIA 2ET6A 1Z45A 1BG6A 2R00A 1A7AA 4MP6A 5COBA 2Q4EA 1PGOA 4D43A 3GEDA 4GH5A 3H6KA 3MJEA 4FDAA 1H94A 1PL7A 3I9LA 3EYWA 4OMUA 2W8ZA 4IINA 4YT8A 2C07A 3JD4A 1QLHA 2ZJ0A 3ZV4A 1YGYA 1I5RA 2JL1A 3AY3A 4W7HA 4RF3A 2AHRA 4E5KA 4DPLA 4FB5A 1UH5A 1JDJA 4PLVA 3F4LA 1MX3A 3A28A 1SB8A 1XU7A 5CG1A 3CINA 2WYWA 1LU9A 4J2OA 1PJQA 4XQCA 1VL8A 5DOZA 3MCVA 1OZAA 4I5DA 2A35A 3ASUA 4CLRA 4ZHSA 3UFXA 4M49A 1UUFA 2BGKA 3GUCA 1FK8A 3PZRA 3TPCA 1GQYA 3RJ5A 2YQ4A 1P45A 4BNKA 1M2WA 5ICMA 3LF2A 4QEDA 3JD1A 2PH5A 3BMOA 1J0XO 1DRVA 1O5IA 3DBHB 1GPJA 3JQFC 1N1EA 1EVJA 3MTGA 1XHLA 2VZ8A 1YVEI 2I3GA 4DLBA 1QYCA 2ZYDA 3QHAA 5JPIA 3ZDFA 1T2CA 4DUPA 1WXDA 1HLDA 5ER9A 4Q3NA 3VVBA 4UULA 3VVCA 2GF2A 3GHHA 1A4IA 1BSVA 4TRRA 5A02A 1SEVA 1R0KA 3DB2A 1KVQA 3VZRA 1PGPA 2AE2A 3PJEA 4MVJD 1BXKA 3GR6A 1ZUD1 5IDXA 4CLHA 2AQHA 1GZ3A 3T4XA 1ID1A 4U7WA 3EK2A 2D59A 3RFXA 3TQHA 3JQEA 4GMFA 2IZ1A 2OHXA 5AYVA 3PRJA 1QYWA 4Y67A 3GY0A 4FN4A 1DDOA 3WGOA 3C7DB 1YBAA 3ST7A 4NR0A 2PR2A 4OXKA 1N8KA 1NYTA 4YT2A 1PJ3A 3B1JA 4ZD6A 1P0FA 5ILGA 4HY3A 2C2XA 2CMDA 2FOIA 4LVCA 3JQAA 1LSOA 1WLYA 5KVVA 3WGTA 4EUHA 3CMMA 1P1HA 4RF4A 4BNJA 3LYLA 3ZHYA 3QQPA 4BNZA 4BO8A 4J4HA 2HK7A 1BVUA 3I3OA 5IZ4A 1W4ZA 4GL4A 4HADA 4UVDA 5TRTA 4RPHA 1JLLA 3I52A 1TXGA 1ISJA 2OOSA 4ESOA 4A10A 4BKQA 2PZKA 4IDDA 2E4AA 4DQUA 4WOJA 4CLRB 3FSRA 4RL6A 4BGVA 3WQQA 3FRJA 1T2DA 1SMKA 1MXHA 4NNJA 4RPJA 4E2WA 1QYVA 4AFNA 4G65A 1JWBB 1QV6A 5HTOA 4JP2A 4MJLA 2PA3A 4NG5A 5DBGA 2Q1SA 1E3LA 4MVJI 4WNIA 2OFPA 3E82A 4Y8VA 4BNMA 1MC4A 5B37A 3W6ZA 3DZKA 4DBZA 4E33A 4LRSB 4B4VA 1DC3A 5T8KC 2CVZA 3S2IA 3RUIA 3WNQA 4CMEC 1SNYA 1NQ5A 4R69A 4XIJA 5EERA 2PD6A 4GMGA 4MP8A 4B3IA 4FOOA 1QR6A 1UJMA 4RVGA 4U5QA 5TSDA 1VKOA 1JTVA 3JQFA 2J3IA 3AI1A 2A9FA 2OP0A 1LEHA 3DOJA 1DLIA 3ZI0A 5JC1A 5IJZA 2C82A 1IUKA 2P2SA 5IG2A 3PWSA 2AMFA 5JDCC 4LK3A 3TSCA 1OC4A 5EIOA 2VWQA 3VKUA 1HETA 4XJTA 1EE2A 2Z5LA 5GZ3A 3R3JA 3QWHA 2FY8A 3K96A 4AJ2A 5L4LA 4CLXA 3AFMA 3SC4A 3DHNA 1EDOA 1H2HA 2EP5A 1AE1A 2UDPA 2VZ9A 3WJ7A 4NI5A 3LC2O 3OIGA 1VSVA 5A9RA 5IN4A 1MLDA 3BYZA 5I7FA 2E49A 4R51A 3E1KA 5AXDA 3Q2IA 2PGJA 2ZB7A 1LQUA 3IOYA 2HMTA 3C1TA 1FDVA 1T26A 3BTUA 3IMFA 2JAPA 4UEJA 5BSGA 4JP3A 4BO0A 2Y0EA 3L4BA 2AEJA 5KJEA 1UXJA 3LDHA 2UAGA 2YW9A 3NAQA 4I9NA 1ONNA 5KIAA 2QX7A 4GGOA 1YDEA 2NVBA 2ZTMA 3WYBA 3WQSB 1G6KA 2GUGA 4ZN6A 4QQRA 1U1IA 3H7AA 1EE9A 1VE9A 3KRTA 5JAZA 2Q4BA 4XYEA 2G0TA 3ROPA 2VUSA 4ND5A 4BO5A 1ZBQA 4PLZA 4RJTA 2B35A 2H1SA 3BMQB 3NTQA 1VM6A 1SAYA 1ORRA 3CTMA 5U1PA 4UUNA 1HE5A 2Y1CA 3U5TA 3WMXA 3U4DA 2JCXA 4P4LA 4YRDA 5CEFA 4L75A 2C29D 1VPDA 3ZNOA 4UEKA 5JAMA 5FWNA 4UREA 5KCZA 2P9CA 4W82A 5MDHA 3BHIA 2NTVA 1SCUA 4A03A 2CDCA 4JK3A 2VWPA 3I9MA 4NBWA 4BO6A 1HXHA 1N7HA 3QRWA 1NQAO 1D3AA 1I3KA 1PS8A 4L8VA 2I9PA 3I4CA 2TMDA 1E6UA 3L9XA 4URFA 4P8RA 1NPYA 1Q7BA 3AU9A 3WX0A 2IZZA 4U0JA 5CP8A 4DRYA 5L4SA 1SB9A 1HKUA 2W90A 5JY6A 3G49A 4CUKA 4CR8A 3LT0A 3MTJA 3ZWYA 3DHYA 4AJHA 1GADO 3PIDA 4JBGA 1XELA 4CODB 3EAGA 5JBIA 1LA2A 2HRBA 3V2GA 1Z6ZA 4YDRA 4ZICA 3ROQA 3EHEA 3BAZA 3GQVA 1VKNA 3IL2A 2O2SA 2GNAA 2VYNA 3MJSA 3GPIA 5KJFA 4D79A 4IS3A 3ZHXA 3BMQA 4BNWA 4CM5A 3AM3A 4PVCA 3P2OA 2V6FA 1PQPA 3LLSA 1NWCA 4MKZA 4JXKA 1P74A 4CMBA 2VHYA 3GGPA 3BMCA 3G0OA 4KTVE 3INGA 3ICCA 5A4DA 3MEQA 4XB1A 4E5PA 2VOJA 1Y7TA 3BHMA 3GVIA 4D7AA 1H2BA 3WBBA 4RZHA 3TWOA 1X7GA 3LSYA 1JQBA 2F00A 2ZB4A 4MOWA 3EUWA 3WTBA 4CM8A 4BNNA 4BHTA 1ZCJA 3E48A 2DAPA 3FTNA 4YWJA 2Y68A 1EUDA 1B3RA 5B4TA 4Z9YA 3H2SA 1I2BA 2Y0CA 1DJNA 1VI2A 2PV7A 3PLRA 2JHGA 3F1KA 3LT4A 4Q3EA 2VWGA 1NAHA 3VKVA 4A27A 1NM5A 2AEFA 1AXEA 5CPFA 1RYEA 3P5SA 3L4BC 4YJGA 3NDJA 5A03A 2BFMA 3WYEA 2PZMA 3KSDO 2YFHA 1X1EA 5IZCA 1DIHA 3JQBA 4Q3BA 5HRUA 4HKTA 3WJAA 1K6JA 2PFGA 4JIGA 4OYRA 1PL8A 2QQ5A 1ZEMA 2D3TA 2P5YA 4ALIA 5KJCA 5C3MA 3DAPA 1GV1A 3BTOA 1B0AA 4JCOA 1OBFO 4LCEA 4GGPA 1V35A 4E32A 2NU9A 3CXRA 3QE3A 4PFJA 3NGXA 2X9VA 3FNFA 3LVFO 4TVOA 1CWUA 3OMLA 2C20A 2R2GA 3DR3A 5CAEA 4AJ1A 4I9HA 2Y1EA 3E6AA 4DMLA 5K6AC 3Q3CA 4ZU3A 1KVUA 1U3WA 9LDBA 3ETEA 4JLWA 4E4YA 3KZVA 3B20A 2QIOA 4LISA 3U49A 2W2LD 3HE3A 3WGHA 2BHLA 4J4TA 2NV6A 4DYVA 3VH3A 3KLMX 2AQ8A 2F1KA 3M1LA 3TRIA 3NYWA 4FFPA 3ZCXA 1U7TA 2FN7A 1B8UA 1E1MA 3JD2A 5IAAA 4EEZA 4L73A 3DFUA 2ZKLA 3TOXA 4XD2A 3GMDA 3MOIA 2WD8A 5L9AA 1PTJA 1FF9A 4XX0A 1ADFA 4EUEA 1T4BA 4FIZA 5DBIA 2OZPA 1QYXA 2HMWA 4CM3A 4CR6A 3ROKA 3MWDB 3NDRA 4HXYA 4I5GA 1C0IA 1HWYA 1LSUA 1KETA 1R4MA 3U4IA 4OKNA 1KEWA 2DVMA 1R6DA 4YRAA 4K28A 6LDHA 4RGBA 3PIIA 4U6QA 3GZ4A 5ENDA 4KWIA 1K5HA 3VPXA 1K3TA 1FDTA 4LMRA 2Y67A 1H6BA 1ULUA 2NADA 2G76A 1X13A 4I5EA 3A9WA 3HSKA 3ZV6A 4IMRA 1W0CA 1IE3A 3RD5A 4YPOA 1HDXA 1LI4A 4NK4A 4E21A 1HSZA 2FWMX 1ZKMA 1ZW1A 3KO8A 3OP4A 4DPMA 3LT2A 4FC7A 1P77A 2Y05A 3H9EO 3FNHA 2DTEA 2J5RA 3GVCA 3L9WA 3VAZA 5GZ6A 4D3SA 1EVZA 3W8EA 1QYDA 4H7PA 3PVZA 1MA0A 1MP0A 2X7HA 4ILKA 2HJSA 3EY4A 1QLJA 4YT4A 4YACA 5FI3A 1IYZA 5DOVA 5JCJD 5KJ6A 3PDJA 4KDFA 1ISGA 1BTOA 1LBEA 1MUUA 1WDMA 2C2YA 2O2YA 3DOOA 1UDBA 1UR5A 1GYRA 1XDWA 4P4NA 5FI5A 1AXGA 1HE2A 1U7HA 4J43A 5TC4A 3PHGA 4KP7A 3V1TC 1GV0A 3K5PA 2D5CA 1DC6A 3DWFA 4IJKA 2Z1MA 2X5KO 3X2EA 1NTOA 1HF3A 4E2YA 5DULA 4GI2A 1DOHA 1FMCA 4UVGA 4FCCA 3WFIA 4R54A 3SVTA 3CMCO 5KJ1A 3PGXA 1RKXA 1C3VA 4FJ0A 3WSVA 2Q3EA 3RFTA 3ZZNA 1WZIA 5JO0A 3CSDA 3VZSA 4YA6A 1LDBA 2IXBA 1I10A 4M55A 4OGWA 4CLDA 1YB1A 3EVNA 1SPXA 4OSPA 1K2WA 4INAA 2GDZA 2XOXA 1FDUA 4QUKA 4PRKA 3SLGA 1LDGA 1DRWA 1TI7A 3JV7A 3VH2A 4WLEA 2BELA 3GNTA 4RCVA 2I3AA 4YCAA 5FEUA 5IFLA 2V6MA 2DTDA 5JMPA 4Y98A 4R68A 1XLTA 2WYUA 3AOEA 4DVJA 1ZK1A 5COAA 5I7VA 1J49A 4IXTA 1ONPA 1U9JA 1KERA 1PS9A 1TLTA 3OEYA 3UAGA 5JMWA 5EJ2A 1JAXA 1NPDA 5THKA 2LDBA 1QMGA 2IZ0A 3WS7A 1OAAA 3Q1LA 2V65A 5DN9A 4AJOA 2HRZA 1ISHA 3DZGA 4WPGA 1BXGA 4CQLA 5I8ZA 1GTMA 1NVTA 7MDHA 4A26A 2E82A 3DMTA 2JFFA 2P5UA 3E18A 2B5WA 3F4BA 3WICA 4IZHA 2C59A 2X4GA 3O8QB 3K8ZA 5CDYA 2AXQA 1CEQA 4D3DA 4IS2A 1SZJG 2O50A 4EEXA 3UKOA 4XYBA 4ND1A 3WTCA 5IDWA 4FW8A 4IQGA 1GUZA 1EMDA 2DBZA 2O4UX 1GR0A 4J1QA 4NFHA 1M6HA 2BRUA 3O9ZA 4Y6SA 1ZH8A 4NPCA 1C1DA 4AJNA 4BV8A 3UN1A 5JY1A 3I83A 4KZPA 2V6GA 3ULKA 4Z0HO 4HFMA 3GEGA 1PWZA 3CZMA 1FJHA 3WLEA 3W6UA 4E5YA 1O0SA 1E3SA 1OOEA 3EDMA 3QLJA 1GYQA 4GX1A 3WXBA 2PGDA 4N54A 1ONOA 3PDUA 5IDQA 1U3VA 1M66A 2X5JO 3JD0A 3NJ4A 5JLAA 2V6BA 3DFZA 1R15A 4YTEA 3S1LA 3ZH2A 3E9MA 4CV1A 4BMVA 4PN3A 4AJKA 5IXYA 1NR1A 3RC2A 2Y1DA 3S2FA 1PIWA 4OL9A 2PZLA 4PVDA 3WGYA 3CH6A 1F12A 1DLJA 1XQ1A 1KYQA 4H3VA 4MVJA 1F06A 3S2EA 1ZSYA 4BGEA 2HQ1A 3FHLA 2FPGA 2OMEA 1GFSA 3KYDB 4IMPA 2HMSA 1LDMA 3ON5A 1SO8A 4WKGA 1WWKA 2CFCA 5JCXA 1A72A 3OSUA 2VHWA 3BHJA 5COQA 1A9YA 1PZEA 3I9KA 1H5QA 2OXIA 3DAGA 1I24A 1PGQA 1T24A 1WDLA 2YHUA 4PG4A 1N2SA 2NVWA 4FD3A 3INTA 4BNFA 4Z0TA 3ZWWA 4CM6A 1V3UA 2H5LA 1DJQA 5DF1A 2IXAA 4CMGA 4YAGA 1BRMA 3M6IA 4ROSA 3UUWA 2ZYGA 5B12A 1E1NA 5F1KA 2PD3A 2UVDA 3WOHA 4D46A 2B83A 1RPNA 4CMIB 1HE3A 1XEAA 5BSFA 1PZFA 1H9AA 2GN9A 4NJOA 4OAQA 1PGNA 4E30A 1ENPA 4II3A 4UEOA 4WECA 1GY8A 4N7RA 1LTHR 5G0VA 3JQGB 3B1FA 3V2UA 3I6IA 2YYYA 1CERA 2R6JA 3QY9A 4JGBA 4FFRA 2C54A 2GLXA 3VOSA 3OH8A 4C7KA 3G1TA 4FPXA 1LSJA 4KUGA 2UV8A 1DFHA 1X14A 3PTZA 3PQFA 4BNXA 4AJJA 2AQIA 1EEHA 3GPDG 4FFLA 3IJPA 3I1JA 1YB5A 5A06A 2FZEA 2QG4A 4F6CA 3HFGA 2OGUA 1MGOA 3MJVA 1E7YA 5G0TA 4LRTB 4E0BA 5I9NA 3W1VA 1K0UA 3MJ4A 5BNIA 2J6IA 1U2DA 3VZQA 4PG7A 3BA1A 2AQKA 2YHIA 1LLQA 3HUDA 3TZ6A 4AJEA 5JW6A 4BO7A 1PSDA 4RF5A 3PYLA 4L74A 2HDHA 1E3JA 1CYDA 3OQBA 2GZ1A 2NQ8A 4TSKA 3ZWOA 3DZIA 2J5KA 2PK3A 1C0KA 1UXKA 2WTBA 3LLVA 4RVHA 1MFPA 1B15A 4KTTE 3I4FA 1B14A 1W73A 3D3EA 2JD1A 3RIHA 3EC7A 1JKIA 4Q3DA 4TRJA 2J5QA 2I76A 2EW8A 1UDCA 4R3NA 1O9BA 3CEAA 2VTDA 3U62A 4CQMA 3P19A 3VDRA 5JC8A 2PD4A 4II2A 5L45A 2ZQZA 4FSHA 1KEVA 4XQGA 4GKVA 1DBVO 4UVHA 4FQ8A 5C7LO 3D3WB 4XGIA 4J6FA 3UCFA 4U8GA 4R1NA 1I2CA 1V3VA 3JQBC 3OJOA 2C7GA 1PZGA 5L7WA 1GL3A 4BGIA 1NBOA 3WGQA 5EL0A 2I99A 3IS3A 1YS4A 1RYDA 4J9VA 1SOWA 2V7PA 1VJ0A 4HP8A 4MKXA 1PJ2A 8LDHA 4BKPA 2Y1GA 1FDWA 4XYLA 1CQIA 1S7CA 3X2FA 5KOIA 4XGNA 2HMUA 1ISFA 1NHWA 2FHSA 3PJDA 4K6CA 4DGSA 2GD1O 4J2HA 3DC2A 1NX6A 4E6PA 4I9UA 4ZQBA 4X54A 3OQ6A 1UP7A 4GBJA 1HL3A 2OL4A 2VRCA 1N9GB 3GG2A 1HDOA 3KEOA 5DNAA 1XWFA 1E3WB 4R1UA 1PJCA 3C1AA 2VT2A 2YJZA 4IDGA 3AUUA 3DBLA 4M54A 5F1OA 4BKUA 1Q0QA 3E5RA 1LX6A 5THQA 2VYND 5H83A 5BQFA 4BNUA 2IYPA 5G0SA 2X22A 2RH8A 1ZSNA 3D1LA 1LC0A 1C0PA 3TL2A 3PQDA 1NFFA 4A0SA 2DPHA 4MVJG 1PGJA 1UXHA 1B2LA 3KLPX 2O3UA 4WOKA 3UOGA 4JQCA 5TQVA 4YXFA 5AQ1A 1E1KA 2RCYA 1R0SA 2PTGA 1C1XA 2B69A 4J4BA 4TKLA 4WLFA 3HADA 2Q49A 3E9QA 5ENVA 4D45A 2QYSA 2X9GA 4B3HA 3W4IA 1DIBA 3ZHBA 4ALMA 3H3JA 5ES3A 3V1YA 2BMAA 5L95A 4J1SA 1CETA 1HYHA 3RC7A 1KVSA 2FPPA 4HX5A 4EJ6A 1K6IA 3FD8A 3O26A 4IXWA 4IJUA 4O59O 4BNIA 4O0LA 1WW8A 2CDBA 4P38A 4BNYA 4NH4A 1PQUA 3D64A 3I5MA 1Q0HA 1WAMA 5A9TA 4NIMA 3K2EA 4PLTA 3PQEA 3F47A 4PLCA 4R3WA 3ONDA 4MKRA 1HZZA 2EWMA 3SJUA 2VHZA 1I36A 5F3RA 3DO5A 1JAYA 3EVTA 3JQCA 4BNVA 4J90A 4JN6B 4AL4A 3GH3A 1H6AA 1I0ZA 1ZJYA 2EXXA 1JA9A 2VRBA 4OO3A 4TROA 1HLPA 1QKIA 2DPGA 4I1IA 1HDGO 3E03A 3OF2A 2BFAA 2GASA 2CNBA 4BVAA 1DC5A 1BXZA 3ITDA 3TOZA 4OJNA 4WLVA 1EBFA 3V5NA 3VPSA 2YV2A 1OI7A 2OBNA 2WEKA 2EEZA 2GGSA 4YT5A 5L7TA 1EFKA 1LUAA 3C3XA 2WD7B 4PG6A 1I30A 3SJ7A 1WVGA 1BMDA 3PPIA 4XA8A 1U5CA 3FI9A 3D7LA 1UZNA 2BF7A 1L7EA 3JQAD 1TT7A 2NM0A 3OIFA 4HNGA 1U3TA 1XCBA 4K9DA 4AJ4A 1I8TA 1H0KA 4NU6A 1ISMA 3RWBA 2JJYA 2XAAA 1LDEA 1ZMTA 3AM5A 1TVEA 3ZNPA 1J5PA 4PG5A 4TZKA 1IHXA 1XG5A 3FPLA 4KOAA 5A04A 3DHEA 2HLPA 4NJMA 4PCVA 4HNHA 4EGFA 1IOLA 2EW2A 2CD9A 4ND4A 1V3TA 3HN2A 3NUGA 2DTXA 1I33A 1WMBA 4C4OA 5C7OO 4PZCA 3WGGA 4DBVO 1LRJA 3V1UA 3DBVO 4FFNA 1PU2A 2XPCA 1X7DA 2Q2VA 5DDIP 5JAQA 2EGGA 2JCYA 3IC5A 4MP3A 4ZGWA 3W4KA 1Z73A 4BS9A 4CQLB 2Y1OA 1Y8RB 4YJFA 3JTMA 3ZWVA 1E1LA 1IY8A 5EN4A 3AW9A 1A71A 1IHYA 3ZN2A 3AUAA 4HUJA 1WP4A 2FMUA 2PKRA 5KVQA 1UZLA 1MXFA 4J7CA 3UICA 1RM5A 1GQQA 3VH4A 1LQTA 2BI8A 2P68A 3C8MA 4CR7A 1WZEA 2IRWA 3SX2A 3JQAB 3ZWAA 3DONA 1Y9AA 1E5QA 3MOGA 4TRNA 2GPTA 3H5RA 3BXXA 2JFHA 2X9NA 3O03A 3RCBA 1ZXLA 3T4EA 1P1KA 4OIMA 1XU9A 3EW7A 2HKIA 3ICPA 4BKRA 1YOVA 1I3LA 4QFDA 3GNSA 2VZ0A 3FWZA 3F5SA 1GD1O 3BIOA 2PH3A 1NR7A 4YJDA 2WE7A 4YAJA 2Y99A 3RU9A 2XXJA 5LDHA 4AICA 2FSVA 4CM9D 1C14A 3FBTA 4CM8B 2X86A 5A3JA 1R4MB 4FFMA 3HDJA 2X0IA 1UXIA 2TMGA 3I23A 1P1JA 3U09A 2YFQA 5A05A 4ALLA 3BTVA 3D4OA 3ZU3A 4OH1A 4IQ8A 4NK5A 4RQTA 1ZK4A 3HZZA 1QV7A 4PG8A 3OJEA 4E12A 4QT0A 4WLUA 1Y6JA 1DRUA 3ZWNA 3ASVA 4RVDA 4BKOA 4RZIA 1W8DA 3ZWCA 4Y9DA 2IEBA 4FC6A 2EERA 3IP1A 4CUJA 2AG8A 2O3QA 3PJFA 1BVRA 1DSSG 2W2LA 4GSKA 1Y5RA 3PP8A 2P4QA 1YRLA 1YONA 3ZNQA 4YQYA 3RASA 3ZWMA 4E13A 3PHJA 1T1SA 3D5TA 1GEGA 3U3XA 5A5EA 4RPKA 4OOFA 5AOVA 1QSGA 3IUSA 1G1AA 4CM1A 4CJXA 3KETA 3L4SO 4R01A 3COSA 1HSOA 1YQDA 1EUCA 3HHPA 4IPTA 4P22A 3FNEA 4L4XA 4YJGB 2CDAA 1CIVA 2B37A 2HSDA 3DXFA 2DBRA 5I9MA 5I9LA 1HDRA 2OBYA 4CMIA 1Y1PA 2A92A 3PI7A 1T2EA 2Q45A 1E7WA 3GMSA 3H5AA 4DC0A 3TZQA 1P33A 3JQ6A 1XIVA 1XR3A 2C5EA 1ADGA 3H3FA 3HG7A 2Q1WA 1Y81A 2D1YA 3IQDB 4M86A 3RU7A 4FJ2A 3T7CA 1I3MA 3WSWA 3W4JA 3GA0A 4IUYA 5F21A 5EINA 5TIIA 2YQ5A 3UF0A 4YJHB 3Q6IA 3UGKA 3L6OO 2Y1FA 3W8FA 1O94A 3RUFA 1Z82A 4CLOB 3PYXA 1Y8RA 1YB4A 3KBOA 4YJFB 2Q99A 4BO9A 1ZXBA 1B3BA 5F5NA 1ZIDA 3WMWA 5IDYA 1E6EA 3IAHA 4BO2A 2Z95A 4W9NA 4EJMA 4IDAA 1XA0A 5T6BA 3VZPA 1YDWA 2YY7A 3E5MA 2UUOA 5ER6A 3JYQA 4QTZA 3RROA 1YJQA 3DOCA 4TWRA 1D1SA 1GCOA 2X5OA 1NFQA 4EZBA 2IEDA 4GKBA 1A7KA 3EZLA 4WCFC 4BUCA 3NJ8A 4PLWA 4Q3AA 4RVSA 4IDBA 4LMPA 3MJCA 4W7IA 3U4CA 5CDUA 3GN1A 3V2HA 1OFGA 4EUFA 1HDYA 1KOLA 1B26A 1MV8A 1ZSVA 3RJ9A 1MG0A 4GPD1 3C24A 1PQWA 3R6DA 4JJGA 2QHXA 1JVSA 1WNTA 4PLPA 2ZIZA 4A5OA 1P3DA
chains in the Genus database with same CATH superfamily
1N2CE 1P7WA 2RHOA 3L84A 1C9YA 2FZKA 1RRCA 3O8LA 3U4AA 1L4NA 3QJGA 1NN3A 1QNFA 2I65A 4WI1A 3DL7A 5KYXA 1Q2XA 2ZREA 3NP7A 3O2SB 3R8XA 1BU8A 4BKMA 2BCGY 2DECA 2NSDA 2I6GA 3PK0A 3EPRA 5MGBA 1P2BA 5DGDA 2FPRA 4RO0A 1NONA 2QTZA 2DX7A 4UM5A 5CNKA 4LY3A 1T36B 1XRSB 1KYTA 1QZXA 2VSQA 1U1CA 4KOEC 2RIRA 1Q7TA 3H7IA 1M7HA 1Q1BA 5AK5A 3LW7A 4ZVUA 1FDSA 4HZIA 5G4KA 2PXAA 4MGHA 4O02B 4CU5A 4BB6A 4BFXA 2LXNA 3SNKA 5K0EA 5L3QB 1QIMA 2NNWB 3PQ5A 1T6XA 1NF3A 3B1YA 3AEKB 1IK4A 3SX4A 3LAWA 1YH3A 4IVRA 2HN9A 3L1VA 3KKOA 3ZXUB 2QSYA 3P5BA 5JYDA 2D2IA 1O0CA 4YBZA 3G2JA 1T15A 1YZUA 3C7AA 3OOWA 2PYIA 3D3WA 4DMKA 4I8XA 1KAMA 2VHXA 5HIIA 5J4YA 5L3ZA 3GJTA 1P31A 1V1MA 3HB5X 2PU5A 2DM6A 5J4VA 4OCZA 4V1CB 1ECJA 3GO4A 2O2GA 1BWQA 3AUSA 3WB9A 1T3HA 3VBEA 4G89A 5JJIA 3MWJA 4ESEA 1KK3A 3DKRA 1H6DA 3DV2A 3GRKA 1RC1A 2VNIA 4PR3A 2ZSIA 5JZMA 1TM2A 3CRRA 1X1TA 4O5OA 1W7AA 4OBXA 1IY1A 3KR0A 1XYVA 1Z0JA 4MI6A 1LXCA 3GX1A 3AY6A 5C7IO 2IXDA 2X9LA 4BBAA 2N42A 3C1UA 1XZBA 1ATIA 1HL7A 1GAJA 4JMLA 3MRSA 5G0WA 1M34B 1TQDA 4C7JA 4AKSA 2BVNA 3VPFA 4EBFA 2EKPA 3R76A 5CEJA 5DKFA 5G3ZA 3PNVA 3TJZA 2Z56A 3IURA 4C0HA 4WNCA 4F38A 4A1OA 4F5YA 4M9ZA 2FZLA 4YRZA 2OD7A 3DDOA 3I05A 1I7LA 4IFBA 3FI0A 1KYVA 3OKCA 2OCBA 1KWKA 2P77A 5K8TA 1MPXA 3AHHA 4IJ6A 1CR0A 4EUKA 4C4XA 1G2PA 1MG5A 2HJVA 3IEIA 5K20A 2F90A 1U80A 2A59A 2WG2A 1AU9A 4LSMA 5IAEA 2ZITA 2ACWA 1GUYA 3O8OB 4RF2A 1PT8A 1WKBA 3CF4G 2P91A 1L4GA 2HPVA 4Q4CA 3DTYA 4QUDA 4U2BA 5CH5A 2JFVA 4NHOA 4ASUA 4LDNA 3HUEA 3NCTA 1MEEA 2I7TA 4KKVA 5IAKA 4D3FA 4V1CA 3OJ0A 1Y6GA 3NEAA 3HYSA 5DH9A 3R7BA 4KR6A 3TFWA 2VTBA 1Z0SA 1DEKA 3HYLA 2QTHA 5EZQA 4AB1A 1SBYA 1FP4A 3A3YA 3CZQA 3R3SA 2XUIA 3FVTA 3DKIA 3GK3A 5LA6B 1THMA 5GV8A 1OYWA 2WTMA 1AB6A 4FFBA 2GF0A 4XKJA 4HPJB 3MWDA 1CNEA 3SE0A 3GOHA 2E5LB 2FQQA 3HY6A 3F74A 2VAPA 1UINA 5T3YA 5DK4A 4CHGA 5B7GA 5IABA 3KQLA 2J8ZA 2FB9A 4ZI7B 2RD2A 2Z6QA 3SQDA 3VO2A 4H0NA 4Q1BA 1QU3A 2NSYA 3KFXA 1ZN8A 1EZ4A 4LOLA 2JLRA 1G64A 1AA9A 2NYVA 5H4GA 3UBTA 4MUJA 2JVJA 3CLTC 4RDHA 2G9UA 1W8IA 3TMYA 3OPYB 7YASA 5ICEA 1PHRA 1H22A 1T8RA 1Y98A 2I0FA 2P75A 1K5DA 4QUBA 1H0SA 1W36D 1EXWA 3HM2A 4TX1A 1VSBA 4C30A 4TXMA 2A2ZA 3IEKA 4ZXPA 4C6TA 2Q3MA 4AIIA 1OI3A 4HQLA 5LZ5A 3UQZA 4AMVA 2ASEA 1VJTA 1ICEA 4PZDA 3MJHA 1PHPA 5E6UA 2EFCB 4BATA 4B81A 1WSAA 2QMOA 1EJ2A 4UAGA 5E9AA 4YAEA 4LXIA 4L5YA 1GL9B 3KKQA 1Z34A 2J08A 5MN4A 1R4NB 3U48A 5A9SA 2FZCA 3QJYA 5K99A 1EI9A 3MJTA 3DH0A 1FVOA 3QWIA 4GRDA 2ZDQA 3H2YA 3BJMA 3ETDA 3GLIE 2FFAA 3SI7A 1YRBA 4N0QA 5FAKA 3OPYA 2DPXA 2DUMA 2ZBEA 4RIIA 5ITSA 1V2HE 2ZPTX 4GI3A 2HXSA 2AWNA 2VEOA 3IIJA 4BY9E 5EQTA 4GLFA 3R9KA 4W8GA 3S8MA 1O4WA 3CRMA 3SMVA 3TZBA 4CF5A 1L7MA 1BA2A 1L6IA 1ZNZA 2QDKA 1CUGA 2O3JA 4JKIA 1FQKA 4BV9A 3Q7IA 1TAHA 2I4NA 1SC6A 3K1JA 2E2WA 3DAFA 4XUCA 3P2YA 4ZVRA 2P4EA 1NX9A 1RFGE 1RJ9A 2QF7A 3HJGA 4MW4A 3W79A 5GTDA 5FD8A 5CIWA 2IYXA 4C9BA 5A3RA 4D9CA 2X0EA 1WL8A 1O08A 2VKTA 4XW2A 4ZARA 2FAXA 1UWKA 4CV2A 2QRLA 5EKXA 2IH2A 1GSHA 1V26A 2ZSKA 5ILQA 4MLDA 1E2DA 1KJ9A 2WAMA 9LDTA 3ZDQA 4ARBA 1E1CA 4YX9A 2O05A 2XCLA 4LW8A 1ENYA 1QTQA 2JKYA 3L1KA 2WVAA 2G7ZA 2O4CA 2BLNA 4RD2A 2FF5A 3F3SA 4GQIA 2E6UX 2WSYB 3CGWA 4TMFA 3EGIA 3NGLA 4UE3S 3ZTWA 3W5AA 1H4SA 1CDOA 4UFNA 4OJYA 2QD1A 3ZGZA 5DI9A 3LX6A 4G1BA 3DEYX 3H17A 3OA2A 1M2OB 5DN6A 2D6FA 1EVQA 1J1IA 2ZCUA 3KOZA 1NP7A 2HT1A 3QIVA 2JI8A 2FEXA 5IDVA 4DKXA 4CG1A 2C5BA 2DQ4A 3ZDBA 1P5JA 4J94A 2CV2A 3OJLA 2FYTA 3WOVA 2I87A 4QYTA 3I3SR 2OKGA 2XECA 2G9RA 5KDDA 4CEHA 5DBFA 1OVMA 2X58A 3NTXA 2IF0A 4KSBA 3FKSA 1E6KA 4L3OA 5P21A 3KM0A 4ZT6A 3B3GA 3HXQA 4G6ZA 4QNMA 3RC9A 5FUQA 1QFJA 1RCUA 1VG8A 3CX3A 5L3SB 1YQGA 1VHQA 1XZDA 2FWAA 3BHNA 2RHGB 4UM8B 3Q3JB 4RQUA 4JUBA 3TGWA 1VCOA 2XE8A 1QQAA 3EIOA 1JYSA 3IKVA 4C87A 2M98A 3OEED 4JOQA 4YN3A 1EK0A 3SXPA 3UFXB 2V7EA 1UFQA 4IJVA 5K0CA 3MGGA 3FR8A 5HCUA 1KI2A 1RYHA 4Z3DA 4TKUA 3H84A 3PYMA 4FGSA 1VJ5A 2A5DA 4XDZA 1SUCA 2RIPA 3HI4A 4AY4A 4PLYA 1X1SA 1KI4A 3ONEA 5CD9A 4CQNA 3HZRA 3OUTA 4MUHA 1HTBA 4RTLA 3ZX4A 1R4ZA 2HLDA 3VKHA 1QR2A 1XI2A 3FKSD 3ICWA 3LG2A 5JE8A 1AK9A 1BMFA 1MB2A 2A33A 1HT3A 2PRJA 2VAVA 3OF5A 4BQPA 1LWOA 4MEAA 2NUAB 3P9RA 4DMRA 1B6SA 2J9FA 2JIOA 1IXRC 2YHAA 1N9GA 2OUIA 3N3BC 5FPYA 2WG1A 1IZZA 2IE0A 3TKYA 1HDZA 2WPDA 4KJZA 2R8PA 3IAFA 4BLPA 3WMFA 1H5NA 4MS3B 4LQCA 4UDOA 1KE2A 5CB4F 1J22A 3NUQA 2YC4C 1ECBA 4I4TA 2A5GA 1DUSA 2R44A 3ETNA 4R7TA 3ZE6A 4Q3CA 3H99A 3LF1A 3B38A 2ECQA 4YR9A 1B8VA 4Y6PA 1UPCA 3D0OA 4L2IA 2Y9MB 2QP3A 3GIWA 3L7JA 5E7MA 4C7XA 5IP5A 3B82A 1C41A 2XUKA 3R24A 3G17A 3QW4B 1KO1A 2Z8ZA 2QR3A 3X44A 4DC1A 4IZOA 1JJ7A 3CIFA 1Q3KA 2J45A 1N6KA 1NNUA 3DBHA 1UJNA 3QWBA 5GOTA 3ZG6A 3Q4GA 2AE1A 1KDPA 2WAXA 2CYCA 3A3KA 5DZSA 1NUTA 2NGRA 4BWFB 1E0AA 4QO8A 2NT3A 4F85A 4FNAA 1GZUA 4ETIA 1UDWA 2HJRA 2V58A 1S8OA 3PPVA 2P1ZA 4GKAA 2I2WA 4CMJA 1HNZB 1IZ0A 1BHJA 2H9YA 4NDZA 5KVSA 4A8JA 1YFLA 1ZI9A 2W42A 1WQ3A 4EZIA 2H65A 4FINA 2VJBA 3UJ9A 3T94A 1FFCA 3TTYA 3FPJA 1YL7A 3OZTA 3D4NA 3DQPA 3HA2A 4W99A 4L4RA 4OU5A 4YVFA 7ADHA 1FDOA 1ZGGA 3K9QO 1L5LA 5K09A 2QUIA 1JQEA 1H0RA 3BWEA 3RC1A 1IEQA 3BQ9A 2C5HA 3Q6MA 1ORTA 5BY2A 4MB6A 4BYMA 1TIPA 1VIMA 3A58B 2M6SA 4ZO9A 2Q4TA 4Q4HB 5DTRA 3U61B 1E1QD 3O3CA 1ULBA 3G2LA 3NBZC 3P4XA 3D6AA 5JJ5A 1QAMA 1G8GA 3DJYA 1KEUA 4M0KA 1T4CB 2ODBA 1NMYA 3D7RA 4BFYA 1GU7A 3PWKA 3HA3A 3I0MA 5IKMA 1UMDB 1AQIA 2HHCA 4PSUA 3WO0A 4PEVA 4RTSA 4UATA 2V8OA 5HZGA 3CG4A 5T41A 2GO1A 1NHGA 3F5QA 3GELA 1Z74A 1G5RA 4E5VA 3ESAA 1JQ3A 1BX1A 3HJCA 1XMJA 3LC1O 3OM0A 1WUYA 3DR5A 1S2DA 1WY5A 2XNDD 3I6QA 1QC5A 1EB9A 4I08A 4UCFA 5HBRA 4BNDB 1I4LD 3B85A 1N0HA 4OX9Y 4EQ6B 3FTFA 4MV1A 4ANFA 3BDVA 3D0QA 1OJLA 1CKEA 1A4UA 4D6XA 2PSJA 4IV8A 4PANA 3AV0B 4ND6A 2VTEA 2WUVA 5DN6D 3ZNQA 1VIAA 2FP4A 2R79A 1DQSA 1YMUA 4QAQA 3BBPA 5HMLA 3TIVA 5A1TA 2EKLA 2R1TA 4J7XA 3AEUA 3BE5A 2O1XA 5HKKA 3ILSA 5FA5A 1IQUA 4UM9D 3DJFA 2Y1WA 4MCIA 2G28A 4LOIA 2RBKA 3S55A 1T9GS 1TT5B 1B6TA 1UT5A 3CPHA 1R16A 4GBED 1U63A 2IC5A 3A9TA 3EASA 2DB3A 4C5AA 1M67A 2BISA 2W2PA 4NMMA 1GRRA 1BE1A 1KDVA 5JCZA 2R25B 5LNK6 1MO5A 3T38A 1YU6A 2ATIA 1PNVA 4LXXA 5I45A 2AL7A 2V0GA 6CHYA 3Q3EA 1ZVMA 1NJ5A 3QBDA 4Z9BA 2MSWA 1Z7WA 1SCDA 3BD7A 3FRIA 3LP8A 4XQ9A 3B53X 3BL8A 1NZFA 4Z54A 1MW9X 1QV9A 3ELYA 3CPEA 1JW9B 1Y1TA 2QVBA 4FWTA 1SD2A 2FJPA 2Y2UA 3IIEA 4U7DA 2GH1A 4L4SA 4BTEA 4IO0A 1QIJA 3KLBA 1EK6A 2DWUA 3OMWA 2P8JA 3PD7A 2UZ1A 2J67A 4NOJA 1YVRA 3AETA 5AW9A 1HNNA 1V8FA 1KQ3A 4L2IB 1GPUA 4MK4A 3NATA 2O3TA 2CWDA 2CCJA 4GP9A 2ZIGA 3PC6A 3DZ8A 2PL1A 3LHSA 4PC6A 5EGSA 4KRFA 1SC4A 5GMOA 3ESXA 3MFQA 2PIDA 3RWOA 3G3EA 3U81A 1HNWB 3QSYA 3A1FA 3MZ0A 4EJFA 1NMXA 2P35A 3K6RA 4ZAZA 3V42A 4CNQA 3CFYA 1NU6A 4BNTA 1XRJA 4ENTA 1AKEA 3QU5A 1YR9A 3TSWA 5CXUA 4P4UA 2WYHA 3EIWA 2ID9A 3EVEA 3EDOA 1RABA 3QEJA 4GZ5A 3ZW8A 3U7GA 1VKHA 2EJWA 2DQKA 3L43A 4ENQA 2CL6X 4RK6A 2ZB8A 2CUZA 2ATVA 2JEZA 5CDTA 5T7BA 4BMZA 1FX0B 1MRSA 1XDUA 4HWKA 3IV6A 2GBIA 3U3DA 1T8PA 1LPPA 4JOBA 4UCQA 2ILTA 5LYJA 3STHA 3VI3B 4D0SA 1VG0B 4HWSA 3TFQA 4AN1A 1GQ2A 3AO0B 1W0JD 3UC5A 2Z6AA 2PNJA 4D92A 2Z4TA 4MUYA 1GXSB 3AB3A 2CBGA 1T3GA 3EXHC 3HV0A 4HMPA 2CHQA 5EIXA 1H2RS 3PWTA 1Q0SA 5LP6B 5DRTA 5LD2C 4BEWA 2F3UA 1CJBA 3FZNA 1VXOA 2GCIA 2ZTHA 3D6UA 4J0EA 1U6KA 3ZD9A 2X8JB 1ZEJA 3ND7A 4QT4A 3QVKA 4CCYA 3KEQA 2HW8A 5DU2A 3HUUA 3DTVD 3ND8A 1XTQA 2AG0A 4LZOA 3G1UA 5DNDA 1EUQA 1KDOA 1T2UA 2UYQA 5EJ6A 3PX2A 2RAFA 3I9NA 4REMA 1RBQA 1D4FA 3DT9A 3GLHA 3AG5A 1L9KA 3K32A 3B9RA 2JAWA 4JKOA 2OHFA 3TQOA 3IJ5A 2CJFA 5EP4A 4C3VA 3CEPB 3IJRA 1TJYA 3K1ZA 4EHAA 5IUNC 2YUTA 2G4CA 4KW7A 4ND7A 3KAKA 5DYTA 3OECA 1DJPA 2H4ZA 3V7YA 1DEHA 4QPNA 2BPOA 5B4UA 3WKEA 2K7ZA 1Y9EA 4JP5A 4M8NE 3ZPXA 5AVXA 1NI4A 3U3ZA 5K3BA 3VVMA 5JSUA 4BBJA 2I78A 5AVUA 4R5HA 4MV9A 4DLTA 5HM8A 4TL8A 2R2AA 3U44B 2C7PA 3BH7A 3JYHA 2P1RA 3EWAA 5AW1A 1K75A 4K1LA 4YQZA 1QONA 4EA8A 2PUEA 4MI1A 1CYEA 1ADBA 3ONFA 4V0SA 5FWYB 1CE8A 1KEEB 1L6RA 2JDIA 1KBZA 2XB8A 3F46A 4OLHA 3IAS1 3PDWA 2VNSA 4HNAB 4CIVA 4JXXA 2P3QA 4OM8A 5C5DA 3P26A 1CB7A 3C85A 3HJRA 5K8LA 4GP7A 3ZVMA 2F17A 1LPSA 3N0WA 4EHNA 2AJDA 2J9XB 2YDYA 4P7KA 2WUWE 5SICE 2EX1A 3WRXC 3AYZB 5KDOA 1XMXA 1YFKA 4J7UA 3GPLA 4ZVTA 2PUGA 2EFGA 4TV9F 2I67A 1WB5A 3NTRA 5AOAA 2IXFA 2P40A 4XE5A 2NO6A 2ZJ6A 1MABB 2DQZA 1CJCA 3FX2A 4IOLA 2WF5A 4LXGA 5E6SB 3OICA 4YECA 3ZCRA 3LXMA 4JFAA 1IC6A 2GDJA 2ZBFA 4TUYF 2YBEA 3S5UA 3T4PA 5EY5B 2WD7A 2D62A 1QXSA 1PV1A 1KY4A 2I2FA 1AF7A 1E58A 3WBFA 1NDHA 1THGA 2O20A 4QGSA 5BSEA 2YXDA 3KZ1E 4X45A 4NBTA 3IOMA 1TKAA 3R09A 2OO5C 4Q1VA 5TGDA 2X8WA 4TZ6A 2J3MA 3BGSA 3KJXA 5EP1A 5B3LA 3PJGA 4QOSA 1BXRA 2CZQA 4N9WA 4R1TA 4ZT5A 4LFBB 1ISSA 3A4VA 3CG0A 2EQBA 3WDLA 3SEAA 4DLXA 1AHHA 1GN8A 2Y0PA 3Q2KA 3E84A 3L77A 3STUA 3E0XA 1QRSA 1Y4DE 3GDOA 2V9PA 1L5NA 2PX2A 4LSWA 4XX0B 1Y4SA 4ZJPA 4LZZA 2CBXA 1GGHA 1HMPA 1Z4LA 1ZJZA 4MITA 5C52B 5AKLA 5B1DA 3PF9A 1X70A 2XDQB 5DP1A 1YI1A 5KYWB 5DTEA 5H82A 3GUHA 1K5GA 1M5UA 1LDYA 4OSOA 2NP6A 2ZIEA 4ALNA 2X1HA 1RLOA 3SSNA 2E85A 2Z2ZA 2BMWA 4PZ9A 2MU1A 1Z0DA 3ACBA 4F45A 3KEMA 2DQYA 1LJ8A 1U2GA 3MT9A 3H1FA 2II6A 3B9QA 1GUAA 1CUIA 2G04A 3JQ9A 1DADA 1P72A 2XT6A 3I2GA 1YQXA 1XLTC 4BMSA 4G9EA 4Z1OA 2K2WA 1GNQA 5A3VA 3PL1A 1U3UA 3JQDA 5IVIA 4RWEA 3L6UA 3E9EA 1FQOA 3ZQUA 1TE2A 5EZ6B 3PENA 1K86A 3DYIA 5HE8A 3F78A 3IBCA 2VPWA 4IJMA 2GRJA 3D1VA 1U5AA 3WNVA 5L8VA 1P18A 4BNGA 2QUBA 5KTMA 1EFVA 3M2TA 1W4BA 3F1LA 3IOEA 4Q4AB 3RKUA 2GYYA 4DMFA 3M8KA 2HF7A 4HDCA 2W98A 1I3CA 3UZUA 5LYJF 3EXFA 4EX7A 1W88A 2LV8A 2Z5VA 4O8ZA 2O3RA 4QX6A 3WWCA 3JW8A 3VR3A 1OXKB 1EUDB 4KIJA 3SX0A 5F9FA 1DTWA 5IZCC 5AD1A 5F2NA 4NBVA 4MZDA 1ACJA 2CZCA 1T3ZA 1W0JA 2DHCA 2JH9A 2HIGA 2ZIAA 2FDXA 1VLQA 3OWOA 4FX2A 4G1EB 4HLCA 4EIWA 2GN1A 2ZE8A 3G2MA 3IPAA 4JY7A 4MW9A 4WOPA 5DM1A 3M89A 1YKFA 3PHIA 4PFKA 1NRJB 4KH1A 4ZU1X 5CT4A 1NVVQ 1B00A 4HMOA 5IW8A 4BQEA 3LFTA 5IMBA 2KJQA 2GBPA 2JIQA 3B2EA 5JHGB 3CT6A 3PFWO 1KPIA 3KB6A 5JD4A 4IVNA 4WSOA 3ZDDA 1P1FA 2OCYC 2OXCA 2VS1A 4S35A 1P1BA 4F9TA 4MA4A 1RI2A 3A9CA 3U44A 4NENA 1P6QA 1VGQA 1R4NA 4DIUA 5IHPA 2RHRA 4D9BA 4HL6A 5AK6A 5BNTA 4LJ4A 1SHLA 3AL2A 1K27A 5FTNA 4E22A 7REQA 3CZPA 1JU9A 4QTYA 4YXWD 2CHEA 4WEOA 1V47A 3CN7A 3PB3A 4LTNA 4BFLA 3KAQA 4MUIA 3ND5A 4U2DA 3CPSA 3RAJA 4FYHA 3ZHVA 1DQYA 1W93A 1LC3A 1ZA1A 4CMKA 2R68A 2QZ4A 3IP8A 2XMDA 4GOMD 1AUQA 3C6ZA 1OFVA 4BQRA 4F60A 5JXWA 2PUBA 1A3CA 4OG2A 1K9VF 2CGEA 3SHOA 2K7FA 1D1TA 1QPGA 1ZRMA 1TO1E 4WCFB 4CCYB 3IB6A 3R20A 5GZ1A 1XC7A 3T95A 1AQYA 4F92B 4OLBA 4PRLA 1QIGA 4HSGA 5CIQA 4MINA 3VU0A 4PWYA 1SUWA 3HL4A 1XRRA 1C0EA 1Z4MA 3TOSA 5IX8A 3H2JA 1P0CA 1EWRA 1Z0UA 2VDJA 4FP9A 2NVUB 2UVPB 4DDTA 4ZOAA 1IN1A 3I01M 2JGDA 2B8JA 2W4QA 3B8EA 1V5EA 4BECA 2FSUA 4ARIA 4AXBA 1I2ZA 3RIMA 2F1OA 3C4QA 3OQ1A 4CTNA 2WJGA 3GFGA 4OMDA 5LP6C 4HEQA 3ZU2A 1X7HA 1BHQ1 4Y2PA 3STWA 4Y1GA 1Z5PA 1U3CA 3HVHA 4GYKA 2R96A 3FPCA 2BKAA 1XGKA 5CYPA 1SKUA 1IPEA 4NICA 5FPTA 3I58A 2REXB 5T4BA 1SOAA 3H86A 2PSDA 2Q6OA 3UHAA 4ENPA 3IP3A 1YI8A 3KAPA 4LF6B 3V4PB 1XZKA 3MTBA 2NU8A 1CLEA 4Q0MA 4DWOA 3WLJA 4L08A 4N41A 2GX6A 4N18A 3WC4A 4HNUA 3AGQA 1GG8A 1AUXA 2XIQA 4HUTA 3AU8A 1K89A 5E1BA 2BDTA 1K8YB 1QGUB 1L8AA 3G89A 2XCSB 3ZW9A 3A6LA 1LLUA 2IU0A 4OJKA 3NG1A 2UZIR 3JVIA 4DMCA 4K8RB 4UTRA 1MB3A 2BZ1A 4IRUB 4KN8A 5CGQB 1CZHA 3AUTA 5HIAA 2EW1A 3LECA 4XD7D 4DQXA 3IAUA 1JG2A 4XCVA 2QTGA 3RVQA 2VP4A 4OQYA 4E2XA 5K1ZA 1N6NA 4GUAA 4LGVA 3RRJA 1SWVA 3N76A 4L5JA 4O4HA 5I01A 5GINE 1OASA 4FFOA 2EBUA 5EESA 2HEIA 3WK4A 4H7FA 1RM4A 5AVVA 3ZTYA 5C53B 3ZWXA 3RK0A 5B2ZA 3N2YA 3SJBA 5E95A 4YAKA 2DH6A 4I3GA 2WJIA 2MR5A 1SKYB 1CU1A 1YIAA 4M1WA 2Y1LA 3MPOA 4MR7B 2O0HA 4EFMA 4XSVA 4MYDA 1P39A 4U2FA 5JYEA 2VYQA 5IVHA 4HGOA 1PL0A 4ZQHA 4MS1B 3DTNA 421PA 4AMBA 2OZKA 3OC0A 1KFEB 2J4CA 1QH8A 2Q2WA 3OEWA 1XXHB 2PQ2A 4QQ8A 1KI9A 2OKCA 3K0SA 3GJ5A 4R9SA 1GZ6A 3SF0A 3IO3A 2CXNA 1HT0A 2EGUA 1OHHD 1MEOA 3LIIA 4POAA 4E6EA 4DQVA 1I3OA 5AQEA 4MQMA 5TGZA 2CUKA 2BFNA 2RC6A 5DM4A 2J3EA 4ND8B 3CISA 4D42A 2GETA 2R8XA 3U80A 2PKCA 1GCGA 4LQLA 3TCXB 4C0WA 3ER8A 4YMIA 3AWDA 1A2QA 2JLWA 2LWIA 1AOXA 4D0RA 1QP8A 1S3FA 3C7CB 2E3JA 1JB9A 1N9KA 2Y9PB 3Q7SA 4ZTUB 4JI2B 3ZV7A 4NH0A 2VYVD 4WDQA 4NBUA 3BFKA 4CG2A 1FFWA 5AXCA 1O0BA 9MHTA 3KJNA 3HRIA 3ZGYA 1PYDA 3O8QA 3IJEB 3TFOA 4M7PA 4C29A 1R74A 5L53A 5KOYA 1E59A 2PMEA 2HBQA 2ZAYA 4MPDA 1AVTA 4EGQA 4Q66C 4ZQIA 1XL0A 2XB6A 3SXUB 1UP6A 3CLVA 3RFVA 4K86A 4XWTA 5B1HA 2ZBUA 1OQAA 2D2FA 3DMTC 4Z4GA 3SKYA 5ALRA 4G0ZA 3DS8A 4IHJB 3RBXA 2FZ5A 3UMBA 2VP5A 2A0KA 4ALKA 1Z2PX 1B43A 3AR6A 3RFFA 3A0RB 1B1CA 2AX3A 3UJPA 4D8WA 1YXMA 5DHFA 1KKMA 2HSJA 1GZ7A 1P3JA 3U4QA 1ZM3A 3NO4A 5BUSA 4XFDA 2GXUA 1J25A 1PJSA 2FP4B 1CJVC 5F2KA 1GL7A 5TJ9A 3TTWA 1J8QA 3VH1A 2O59A 1FXSA 2VHJA 4JT2A 3TSYA 3MQ2A 1RRGA 4L1KA 4X1YB 1P2GA 4JYZA 3UFBA 4ZZ3A 5LUAA 4P0QB 1ZGHA 3ETGA 1JLSA 1D03A 2FA9A 2V54A 3B9BA 1LGYA 3OFND 4NFSA 1TCAA 1V95A 1QO0A 1YR8A 2EBWA 4CMHA 3OKAA 5ITVA 4A8JC 2GM3A 1QE3A 3H05A 4X8OA 3VVLA 1QANA 3WL7A 1N78A 2O8BB 5GJVC 1DAFA 3N0VA 5ECDA 3GEMA 1YL5A 3HNPA 2W6OA 1W46A 2X13A 4P84A 3HO1A 4HATA 3WGIA 3AF3A 5LMZA 2CKDA 3OG9A 3BL5A 1B8NA 4JUCA 5IH7A 3DL2A 2ZJ8A 1W96A 2A5FA 3HO8A 4CV0A 4QPPA 1XVTA 2XLBA 4MIEA 5DGHA 5BQOA 1Q91A 2UKDA 5BSMA 1DU4A 3AV3A 2PQ6A 5HZMA 3AESB 4HAXA 3PGLA 3GAZA 3GEHA 3LRPA 3TTSA 3H4TA 1ZN2A 3H0CA 3PHLA 4X62B 1E6WA 4R40A 3O4HA 3BB1A 1L5RA 3GCGA 3QM1A 2YQZA 4D4MA 5FR1A 4Y30A 3RV4A 3SZGA 1K08A 5K9ZA 1N2HA 3HDYA 1U7WA 4L0QA 1NJ6A 5JBNA 4CM9A 1IQRA 3N0RA 5CNMA 5LMCA 2Q3LA 3BXZA 3BB4A 5CYFA 5TS3A 1PR9A 2XD4A 1EFHA 4DREA 3C3EA 3IR5A 3OT4A 1IOZA 3RYHA 3GVHA 2B8EA 2C97A 2EDCA 5DLEA 4H2DA 5HJEA 4DCCA 3OO0A 4JDPA 1ZINA 3GGGA 2RE8A 2IYLD 2BEWB 2R1VB 4QFCA 1A7JA 2XMBA 3LV8A 4AJIA 4BIIA 3G6WA 4Q4JB 5HF8A 2VCEA 1PGOA 1JMKC 3GEDA 1BKSB 3H6KA 4GH5A 3TJMA 5HK9A 4WBNF 1H94A 1PL7A 4FHDA 1RQ2A 2PKEA 4FDLA 4WXHA 4IV0A 1JFFA 4OMUA 2C07A 3IA7A 5IMSA 1QLHA 2WQZA 4RH0A 4FBLA 1NQWA 1YGYA 1I5RA 2PLWA 1EGQA 4L0MA 4PAGA 2X1LA 4L5BA 2AHRA 4E5KA 5LYJB 1YVUA 3LUHA 1UH5A 4PLVA 1DTEA 1KO8A 5EE9A 2R1VA 3BRWA 3R7AA 4JA0A 1NJ2A 1H2AS 1EA7A 3A04A 4Z53A 3I12A 1DTSA 3QBTA 4LVOA 3OQMA 5DOZA 1W36B 3RABA 4HPWA 1ISRA 2A35A 3GDHA 5AHXA 3PJRA 2OV6A 5KZMB 5A71A 1FK8A 1G18A 3ND9A 3EW9A 2YQ4A 1P45A 4GXNA 4BTLA 2QLJA 1DAKA 3L6BA 3RF6A 4QEDA 2N9UA 4RMNA 5IAOA 3BMOA 3OU7A 5FWDA 3TLZA 3IESA 1RLUA 1XHLA 5B55A 3RQIA 2VZ8A 3GUZA 2FUG1 4Y9TA 3QXSA 3RVNA 1KMHA 3X1JA 4BLQA 1P29A 3QHAA 3UJ3X 4ZRDA 1QZTA 1RTTA 4DUPA 1PUXA 1S9DA 4J0IA 1RWQA 4M99A 3HY4A 3QVJA 4LOHA 4Q9IA 3UWMA 1LK7A 2RONA 3VVBA 3EDCA 2XBLA 3CRNA 3UG6A 5B58T 4TRRA 3KDAA 1TUBA 5IYZA 1FZTA 2A9KA 5LB2A 2LRHA 3DB2A 1FCJA 1K97A 1O87A 2Q3DA 4IQFA 1PGPA 2AE2A 4MVJD 3VZRA 2NP7A 1L0BA 3K94A 2HGSA 3GR6A 1E4EB 2QTLA 1EJ6A 3E3MA 3FDZB 1LBTA 2AQHA 4RETA 3TQCA 3V7WA 3KZOA 1BOOA 1ID1A 1L7RA 1FFYA 4EG5A 2J6BA 3FXAA 5CX1B 1YSCA 3TQHA 2QMYA 2X42A 1X1QA 2I33A 3C98A 3COYA 3JQEA 5AYVA 2O8CB 1XNGA 2RGXA 5FBRB 5E3HA 4X1KA 1ZISA 2OC9A 4FN4A 1BE6A 4M1SA 2W6IA 3C7DB 1TYBE 1XYYA 1YBAA 2DY0A 4FDMA 5BUQA 3I30X 1AMOA 2Y2VA 1N57A 1ZOPA 3THYB 1N8KA 3PFNA 1GKYA 3R2JA 5KI6A 2ZWMA 4QG3A 2R1TB 3PNPA 3EX7C 4W9RA 1KSJA 3OZCA 5FNZA 5ILGA 3V8NA 3MWFA 1X1AA 4MWEA 2G63A 3WGTA 4EUHA 4PAWA 2GZSA 3D3KA 3CMMA 4EI8A 4B5LA 4US2R 1TGYA 3R5FA 1SVMA 3EGXB 3SY8A 3KFLA 4J4HA 5DWQA 4D81A 4HI0E 1V7CA 3I3OA 2IXEA 4NZZA 4UHBA 2SKCA 4R05A 5DBHX 3WIUA 3L1IA 2YJNA 2QLBA 1Y5LA 2P69A 2ZUVA 3I52A 8AT1A 4NYIR 5K6TA 3HDVA 5KTPA 3VA7A 3RLFA 2IWHA 3QXHA 2AFHA 3OQIB 2AFRA 4DEVA 3O3OB 3EVBA 1GRCA 2PAAA 3OKFA 2PZKA 5BR1A 4IDDA 2C98A 4CIYA 3KQNA 4GM4A 3TCKA 4K81B 4DQUA 3CKMA 3FSRA 4RL6A 1TIKA 2O0LA 2RAUA 1MXHA 2AG1A 4LV5B 4F91B 4RPJA 3LDUA 4Q3KA 3UWPA 1QYVA 4G65A 4RIHA 1M6VA 2EWWA 1OXSC 1YR6A 3PC4A 5EEGA 3AQIA 2XUFA 4YONB 3VUFA 1UK8A 4XVCA 2Q1SA 4GYYA 1SKQA 1CRPA 4CCWA 1TCUA 3KJEA 1V45E 1ZCAA 2HCJB 4TTQA 3KQTA 4WKOA 3FWPA 4KMMA 5B37A 3W6ZA 4BNMA 4UCWA 1P8JA 4B4VA 2WTUA 5FL7D 3MG9A 1DC3A 5T8KC 5LDDC 1NVXQ 1O9HA 2CVZA 4ITRC 1LB1B 4G67A 1V96A 4MRVA 3HXKA 3H4IA 5EC8A 3S2IA 3L40A 3RVBA 2HRRA 4RELA 3RUIA 4ON9A 4MS4A 1ZJJA 3WNQA 1UMBB 3IDQA 3NH6A 4R69A 4TWAA 4CMEC 3BH0A 4D3ZA 4XIJA 4F84A 2MOKA 4CW7A 1YOBA 1RI1A 4JEHA 3H83A 5EERA 4FYJA 4MP8A 4FOOA 1QR6A 5JVDB 4HS4A 1C9MA 1JU4A 5TSDA 1VA4A 4L85A 4RPCA 4AECA 1OLUA 2A9FA 2QM7A 1T6ZA 2PGNA 3EIXA 1DLIA 3ZI0A 5FBKA 5JC1A 1IQPA 1OIXA 1F6WA 1U8ZA 1IUKA 2C82A 4OHMA 5HPYB 5JDCC 2XE6A 3TG2A 1Q0RA 2IHTA 2VAXA 3PE6A 4CIAA 1OC4A 3U3KA 1HETA 4NPAA 1JZQA 4XJTA 3W2TA 3BWMA 1UDXA 4M7OA 1GRVA 5GZ3A 5JHHB 1ZUWA 1W48A 3HNRA 4ZOBA 5DMXA 3HPRA 4PTZA 1K5PA 1Z2EA 5L4LA 2OBMA 4CLXA 1KAQA 2XNSA 2HQOA 3SC4A 4YJ2A 1EDOA 1X80B 2EP5A 1AE1A 2RJNA 3BCSA 2VZ9A 2WVJA 4GPBA 4OLFA 1W94A 2NX2A 3ZZUA 1O2DA 3OIGA 5BPFA 2ZBRA 1BDIA 1G8FA 1E9DA 3PHBE 5H02A 3N2ZB 3KR2A 1FX0A 1RADA 2ZRJA 2HMAA 3HVUA 5HTKA 3Q2IA 4ES6A 2GJ9A 4KVZA 3OCVA 5ALFA 5JFTA 5F3WB 2V9ZA 4CWAA 3EEIA 3KFVA 2NUTA 2XBUA 1J39A 2A57A 3BZBA 5CVEA 1PNQA 1WHSA 2YJ4A 5D7NA 3UJBA 3ZCVA 3NIDB 1UXJA 2CFIA 4MX8A 2YW9A 1UC9A 1GNPA 4Q4HA 4MWCA 1LPMA 1YDEA 2NVBA 2ZTMA 2ZYWX 4UDNA 2HHJA 2JATA 3DQZA 2R6HA 2W6PA 4IHQA 3O93A 1XNRB 1Y6QA 1DJMA 2GPYA 1FY2A 1X9HA 1XNHA 3AJDA 1VE9A 3BGIA 1SELA 3KRTA 1RQRA 5PGMA 2OHOA 5DHTA 1RWXA 2G0TA 1IQ0A 2FUEA 2VHUA 3GCWA 4ND5A 1TYAE 2ADOA 1MJGM 2FX5A 1JZSA 1ZBQA 4PLZA 2W6JA 3AKYA 3FFTA 3H2GA 4GGMX 1JEOA 1WRBA 2Q6IA 4FQ7A 4M0CA 2BFCB 4XOUA 1KH2A 1ECPA 4BZXA 1WETA 3CTMA 3A1TA 2FEOA 3EF0A 1HE5A 4H0FA 3HTXA 1NL3A 1L3BA 1OA0A 2WIAA 4P4LA 4QTXA 1O95C 3MVEA 1M1UA 2GZMA 4UHKA 4MUEA 4AY2A 3WGKA 4FBMA 1J2UA 5FWNA 5J2TB 1RXWA 2Q8QA 4UREA 1KJNA 1Q14A 3B1XA 3GAAA 4PSAA 3CEMA 2AI2A 1XZFA 1SXPA 2CDCA 3HHEA 3UG7A 4KLZA 3UKDA 4JK3A 1YF3A 2VWPA 3I9MA 1UMCB 2AH5A 1TVCA 1C3JA 1JTFA 1HXHA 1J9GA 1EESA 3CKKA 3PD0A 4TYPA 2GCOA 4L8VA 1US8B 3I4CA 1HT2E 1E6UA 3L9XA 2EQ5A 4N0EA 4N6OA 4YP7A 3N8DA 3HM9A 1UQUA 3S1AA 1N2XA 3SQOA 3AU9A 1O6CA 5CUQA 3WX0A 4KR7A 3O4VA 3R3XA 5L4SA 3FFAA 1A9XA 2VK2A 4P32A 4RMJA 4O3MA 1U3GA 4CUKA 3C5EA 4CR8A 2XXAA 5F9MA 4DCSA 2NXWA 3CQ9A 3IE2A 4W8HA 3SS8A 5HGXA 2KX7A 2DBYA 2HWKA 2GPBA 4TWJA 3KZCA 5JBIA 1R8SA 3PNYA 2HRBA 3KOYA 1Z6ZA 1XK6A 4ZICA 3ROQA 3EHEA 4MB0A 1UBTS 4NDAA 3MTQA 3AZPA 2IF2A 3RU2A 4HB2A 5KJFA 3CLHA 5HFAA 3M4ZA 4INPA 2XRZA 1ODIA 1WF3A 1PWYE 2ZIFA 3MT8A 4IS3A 2R8YA 2GKGA 3V9AA 5CU7A 4HEA6 2PWBA 2V6FA 1NWCA 4GOND 4DJJA 3PQ8A 4MQ5A 2H0QA 4BZQA 4CMBA 2VHYA 1GGFA 3TTTA 1NM5C 4NBNA 3DWEX 3WGUA 1YJCA 3HU2A 4R2WA 4QYIA 1JE0A 3TW8B 4E5PA 2JGAA 1F2UB 3LUJA 3GVIA 3JAKB 1KJJA 3L0ZA 2COUA 4UEWA 5L3SA 1QAQA 4HDSB 4CM8A 3NP9A 4BNNA 2AR0A 5BSWA 4RACA 2E6KA 1MO6A 2FWJA 1JI3A 4ENRA 4DIMA 4UBIA 4BP3A 2Y0CA 3B7PA 1Q57A 2O6LA 1VI2A 3QE0A 2JHGA 3CUYA 3F1KA 3LT4A 2W2XA 2F48A 3DL4A 3E9CA 4L02A 2PO7A 1EAYA 3COWA 3R23A 1NM5A 4HAIA 1NOIA 1AXEA 2NU9B 3P5SA 1R5OA 1YDHA 1OIVA 5KYGA 2VHQA 1QGUA 3AVVA 4FKBA 4F21A 4ZT4A 5IUKC 1JLMA 2PQ0A 2XI4A 2A9JA 3E8SA 2B92A 1OWLA 3KSDO 3MCZA 3WYEA 5BSKA 5IZCA 1DIHA 1G98A 3WL3A 1JIQA 1YDFA 2YICA 2H57A 1FSZA 3OURA 4FYMA 4QVGA 2GI4A 1L2TA 1C3OA 3VOAA 3OOSA 4DCGA 4NZYA 1ZEMA 1JLHA 1FYXA 2M32A 2P5YA 4DOMA 3HCNA 3L0IB 2VDOB 5C3MA 1A8IA 3ET4A 1GV1A 3BTOA 1B0AA 1ORDA 3QMMA 4QPCA 5DTQA 1ODJA 1SCNE 5FPSA 3RS3A 2DERA 4D02A 3DVRX 4GGPA 3M6UA 3WA7A 1Y89A 3QE3A 2CXHA 3CO0S 4LDJA 4PFJA 3P4UA 3GWGA 2X9VA 3LVFO 4TVOA 2BMJA 2C4MA 3OMLA 2R2GA 3BKWA 4AJ1A 1E4YA 3L8MA 3Q3CA 4ZU3A 1KVUA 2UUBB 4PFSA 3D2BA 3LT5A 5DRYA 2W11A 5BXYA 4JLWA 1JDZA 4E