1Z6ZA

Crystal structure of human sepiapterin reductase in complex with nadp+
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
264
Chain Sequence
b'LYFQGHMLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sepiapterin reductase
publication title Crystal Structure of Human Sepiapterin Reductase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z6zA00
2EGGA 5CG2A 1NQAO 1QV6A 5F1PA 2WYUA 1KC3A 1BGVA 1LDYA 4MKXA 1P77A 3L9WA 1CQJA 4RVSA 4BO2A 1B14A 2XAAA 2GNAA 3INTA 5L7TA 1N1EA 4N18A 1LSUA 1ZJYA 3DMTA 1C1DA 1HDOA 3DHYA 1IB6A 4MVJG 3RKRA 1NPTO 3L0DA 3T4XA 7ADHA 1BVUA 4LVUA 3ZHZA 4KTVE 4RJTA 1JW9B 1ZEJA 1R0LA 2NTVA 3RC2A 3KVOA 4ZQGA 4FPXA 4CR7A 5HS6A 3V2UA 5A9SA 3MEQA 3AFNA 2BFOA 2P2SA 3IS3A 3WQQA 4GX5A 1DIRA 3OETA 4NJMA 1K6JA 3ETEA 3ZWWA 3PQEA 1ADBA 4LN1A 3RBVA 4FB5A 4I9NA 1UUFA 3B1FA 3ROQA 4OL9A 4CUKA 1GU7A 3PFWO 1E1MA 3TZ6A 3LC1O 3L9XA 4WECA 5ER9A 4CM6A 5EL0A 1R0SA 1ZXBA 2ZYDA 4P22A 1ZK3A 1SCUA 4UAGA 1H6BA 1XSEA 4CM8B 3HADA 2RH8A 1CERA 3E03A 5C7OO 4R9SA 1BMDA 5K6AA 1PL6A 1E1KA 1U5CA 4YVFA 1NWCA 4QSMA 1A7AA 1BRMA 1HSZA 1PJ3A 4YAEA 3WR5A 4MOWA 2O2SA 4L4SA 3JQ9A 4BO5A 2PH5A 3PJGA 5T64A 4P4LA 2ZB4A 3L6EA 1DLIA 1Y1PA 1GUZA 1WZEA 3UAGA 1LDMA 3DZGA 1DC4A 3PHIA 1ADFA 3FWZA 1ISIA 1PR9A 5EESA 3VZQA 1Y5MA 4GH5A 2DPHA 1T2CA 3EZLA 1VC2A 1UP6A 4QO7A 3WOHA 1N92A 1XLTA 3VVCA 2J8ZA 1BVRA 1G0OA 5FI3A 2G17A 3VVBA 2JFFA 3PJFA 1T2EA 3QW2A 4BNKA 2B4TO 3H5RA 3V2HA 1BDBA 4IDGA 3CZMA 4ZU3A 4DPMA 1VM6A 4RVHA 2YQ4A 4FFRA 5JY1A 4BQPA 3WTCA 4Q39A 1O9BA 1Q7CA 5C5IA 1TB4A 4RZHA 3TQHA 5BSFA 3H5AA 3JCZA 3WLFA 5CDGA 3CZRA 3ZGYA 3E6AA 1Q1NA 3JQFC 4FJ1A 5JDIC 1PJTA 1ZZEA 2EWMA 4PRKA 4R01A 3AU9A 2FZWA 3I9LA 3MCVA 4R3NA 5KKCA 2VNSA 5EMHA 5F1OA 1GQQA 3WMWA 3CSDA 3SC4A 3WJAA 1YXMA 1UZLA 2BD0A 2GUGA 1QLHA 3PP8A 3R6DA 4RVGA 1CRWG 4OIMA 1AN9A 1A5ZA 3JSAA 1JKJA 2O3RA 3ONFA 3ASVA 4Y6SA 4DTIA 1UAGA 2ZB3A 2C54A 1A9YA 1ZKMA 2HAEA 3AUSA 4RCVA 1H6DA 4E0BA 2NQTA 5JNLA 4E5NA 3S8MA 2J6IA 2X23A 3OJOA 2H5LA 4DYDA 5B12A 2JD0A 5BNFA 3GGOA 3D3WB 1BW9B 1YQGA 4OO3A 2YZ7A 1F14A 5A3JA 3JQ8B 4J43A 5F1KA 2WMDA 1HETA 1ONOA 1V35A 1BXGA 3PIIA 4JX8A 1C1XB 1QKIA 3JYLA 2I76A 3E8XA 1DFGA 3V1TC 2AHRA 3VZSA 4XIJA 2HUNA 2YQ5A 1YQXA 3KEQA 3MZ0A 1AGNA 1TLTA 4B79A 2B35A 1XDWA 3PZRA 3RFVA 4A26A 3ULKA 4BOYA 1SMKA 3H4VA 2DBQA 4CQLA 3RQSA 3TPCA 4Z0HO 3AWDA 1HF3A 2QRLA 4YEDA 4DMLA 3JD1A 1KERA 3H8VA 1JN0A 3MJCA 2WYWA 4YT4A 4UVGA 1M6WA 1RYEA 4DPKA 3HDHA 3RKUA 3GFBA 4Y9DA 3RVDA 4D41A 2BRUA 4J7CA 1LJ8A 5A9RA 3W6UA 2PWZA 3RASA 3RIHA 4IQ0A 1ADGA 3LK7A 2OBYA 2RAFA 3KETA 1ZXLA 3F4BA 5HS4A 2DC1A 1K2WA 4TKLA 4IIVA 4RGBA 4W7HA 4QUKA 1G6KA 3NKLA 3VAZA 1Z7BA 1K5HA 1GCUA 1T2AA 4BIIA 2G5CA 5JMPA 4FFOA 3GDOA 3EZYA 2JFHA 4RF3A 4CMAA 1P1IA 3G17A 2V7PA 2W4QA 3PEFA 4OXYA 2DFDA 2XPCA 2Q1TA 4A10A 4BNJA 2Y0CA 1C1XA 2GZ1A 4DVJA 3VH1A 1ZK4A 1B8PA 2HU2A 3HE3A 1LLCA 1NFRA 3ETGA 3NDJA 1GYPA 2I67A 4CPDA 3JYPA 2I66A 2Y68A 2OMEA 3BIOA 1A9ZA 3PWSA 4WLUA 3U9LA 3EHEA 2HMVA 3AK4A 1E1NA 2ILTA 3G1UA 3OJLA 1D8AA 1XELA 4J3FA 4Z9YA 3MTGA 2CVQA 1SEPA 4WE3A 1SNYA 4DIFA 2VWHA 4PLYA 4AVYA 2GN6A 5LC1A 4C7JA 1P44A 4YCAA 4CM4A 3NJ4A 4S1VA 8ADHA 3WNVA 2WD8A 5IXSA 3WIEA 4YTEA 2Q50A 4ND2A 3GN2A 3IDSA 3IQDB 5A05A 3PHLA 2X0JA 4QT0A 4EYEA 2X0IA 1DRUA 1AXGA 1B3BA 3FI9A 3RUDA 3GNSA 1Q2XA 5FF9A 3OIDA 4FCCA 1EVIA 4CQMA 3BMCA 1A72A 1IY8A 4JN6B 5I7SA 1MG0A 1O94A 2B36A 2Y0EA 3T7CA 2Q2QA 4BGVA 3IUSA 4P4NA 5BNIA 3JYQA 4FFNA 5G0WA 2BGLA 3TNLA 1N8KA 4DGSA 4DXHA 4YT2A 1XU9A 1DXYA 1PS0A 5JMWA 3I9MA 1YVEI 3GF4A 3GOHA 3A14A 3GH3A 4CM3A 2EKLA 3HB4X 2J3KA 3ZW8A 5A04A 5I7EA 2G82A 3FR7A 2ZATA 4ZVVA 4CJXA 1I2ZA 3KUXA 4AFNA 1M2WA 2HRBA 2WWRA 2PKQP 4NR0A 4HWKA 4CMIB 1WZIA 2NNLD 4FJ0A 1BXKA 3QV1A 3I9OA 4HFNA 1B8UA 3UGKA 1K89A 5JYEA 1VSVA 3ITDA 4JGBA 5GZ6A 4OSOA 3ZWNA 3W4KA 1F17A 4BGUA 1ZVMA 1R4MA 3SC6A 4J1SA 1HXHA 4E2ZA 1M76A 1UZMA 5KJ6A 2GRAA 2NVBA 2BI8A 3QVXA 1MB4A 5CDSA 4PG7A 3PVZA 1I3KA 1YL7A 2EIHA 1ZCJA 1GL3A 3LLVA 2CDCA 3B6ZA 3AJRA 4IM7A 3H9EO 4U0JA 4PZCA 1U2GA 4WCFB 2AG5A 4BB6A 2BLLA 5CEEA 1RM5A 3QHAA 5T6BA 3GZNA 5DDIP 3QRWA 4JNKA 4IIUA 2NSDA 4OOFA 5B37A 1E6WA 4B3HA 4TVBA 4Z0PA 5L7WA 4BUCA 4B3IA 1E3LA 2GZ2A 4ZGWA 3WJ7A 2VOEA 4IPTA 1YE3A 3K31A 3VPHA 3ZU2A 2AE1A 3G79A 3W4IA 4J1NA 3TZHA 3NV9A 1E77A 3TFOA 2AQIA 4E2XA 3NT2A 3N7UA 3PI7A 4CV3A 4QXMA 1XA0A 3B1KA 2Q99A 1O0SA 3ZDFA 3MJTA 3KO8A 1Q0QA 2EJVA 3GHHA 4F6CA 3FN4A 1YOVA 5CP8A 1XIVA 2NV6A 1KEVA 1UXHA 3AM5A 1U3VA 1KEWA 4WEQA 2YV2A 2GDZA 2PD4A 2WJPA 1CIVA 3GLQA 4FSHA 3U4DA 2Q49A 3L6OO 3R3JA 3FTNA 4MVJE 5BSEA 4PVDA 1X13A 4IJVA 5L4LA 1KOLA 3DZFA 1I33A 2A9FA 3PHHA 1YDWA 4Q9NA 2NU8A 1GQ2A 4BV9A 4FJ2A 2CD9A 1WWKA 5FYDA 3UCXA 2B5VA 5HRUA 5L7YA 3FNFA 5ILGA 4B3JA 3HDQA 5JYDA 2OP0A 2VWGA 1GCOA 3K6JA 4XX0A 3X2FA 4MP8A 1EK6A 3W8DA 5I8ZA 2NTNA 4NH4A 4E12A 1IE3A 1C0LA 3JQBA 3FNHA 2P5YA 3GG2A 3ZNQA 4Z3KA 3EVNA 3UCEA 1MFZA 2QRKA 5DBFA 4ZQHA 1EBUA 1QMGA 4QO8A 2QZ9A 2JL1A 3V1UA 4B7UA 2J5RA 1NXQA 3INRA 4MP3A 2DBVO 4H7PA 1D3AA 1W73A 4BNNA 4WUVA 3I83A 2C5AA 3C1OA 4P38A 5G0TA 2PD6A 1DFHA 2PV7A 2VRBA 1O5IA 3UHAA 3O26A 4Z9FA 3GHYA 1QORA 1PZHA 5A3VA 2O3JA 1DIGA 3M1LA 1VKOA 2UUPA 3AOGA 3KRTA 3PXXA 2Y67A 3PZBA 3JV7A 3WGGA 1X7DA 1H9BA 3GVIA 1NQTA 3QIVA 4U6QA 3ROKA 4BO6A 1PGJA 1LSJA 3NJ8A 4UUMA 4WLVA 4D43A 2AEFA 2FY8A 3JQGA 1F8FA 2PZLA 1LC0A 2B37A 2VZ8A 4YJGA 3DBHB 2WYVA 2I3GA 1KIFA 4GGPA 4YJFA 3QVWA 3WYEA 4HUJA 4R1SA 2F1KA 2P91A 3ANMA 1LNQA 2QX7A 1UDCA 3ORFA 3VDRA 4CR6A 3V5NA 4G65A 5TC4A 3EW7A 5JO0A 2PR2A 3DZIA 4R41A 4W82A 4E21A 4E4YA 1K3TA 1UAYA 2VHVA 4QFDA 4GL4A 1T2FA 3RFTA 3NTQA 2PZJA 5EIOA 3L4BC 1Y8RA 4Y8VA 3WB9A 2O4UX 1LLQA 1J5PA 4L4RA 2IZZA 2DBRA 4O5OA 4WASA 3ZNNA 4YYZA 3CXRA 1SEVA 1V3UA 1JWAB 2D5CA 3K73O 4J6FA 1DHTA 4XKJA 1K6XA 4F45A 3VC7A 3VKUA 2W90A 4LSWA 4GPD1 4MVJD 4ALKA 4FDAA 2FR0A 1KYQA 1NM5A 2DLDA 4LCEA 3CMMA 3S2EA 3OF2A 4W7IA 1ZJZA 3ADPA 3FPCA 2NTJA 1BTOA 5KVQA 2CDBA 4GI2A 4IINA 4OKNA 5TGDA 5DBGA 3ASUA 4HX5A 1B26A 3WGOA 3ZN2A 4BO3A 1EUCA 4B8ZA 2QQ5A 2P68A 4MPDA 3OSUA 1T1SA 5TT1A 5KOIA 4LMPA 2W8ZA 3DO5A 3H3JA 3DBHA 5AYVA 4CMJA 4IDFA 3U0BA 4IDBA 3DWFA 1F0YA 2HDHA 3QWAA 3UKOA 1J4AA 1DC3A 1P1FA 3H3FA 2V6MA 5TRTA 2O3SA 4XGKA 3WQRA 1H93A 1MFPA 4J90A 2HCTA 2G0TA 4ZQFA 1Q7GA 3ZW9A 2Z5LA 2EERA 4DLAA 5TIIA 1U5AA 2Y93A 3H9UA 4HADA 4KOAA 4NZ9A 5AXAA 5L9AA 3AW9A 4L74A 2Q46A 5DN9A 2R00C 2NU9A 1PGQA 4XJSA 2JHGA 3K92A 4HXYA 1E6EA 3JYNA 4QEDA 2GCGA 4J7XA 1NPYA 4CLRA 3JD4A 4I5DA 4OXKA 1HZJA 3DFUA 4CMEC 4GSLA 5F5LA 1I01A 1ZIDA 2D1YA 2GERA 4R1UA 2DTDA 2HKIA 1Y9EA 1EMDA 5L4SA 4ESOA 3BHIA 1YDEA 4RV9A 5DF1A 4M1QA 4PG8A 1LRJA 4D3DA 3SJ7A 4OXNA 3AFMA 4IDAA 4IDEA 4O59O 1PGPA 4R51A 4YJHA 5JAIA 3TJRA 3ZU5A 3D7LA 4PG5A 4XR4A 4YAIA 3Q9UA 2Y05A 1U8XX 1FMCA 1GUFA 3RJ5A 1NAHA 3PQFA 2X1HA 1CDOA 3QY9A 1C0PA 4EI2A 5ILOA 4CMBA 4DC1A 2I5PO 1ID1A 2D0IA 3BHJA 6LDHA 2Q4EA 1NX6A 4DLBA 3D5QA 3SXPA 5F5NA 1C1DB 2HMUA 1UDBA 2PNFA 5TLSA 2X5OA 3HN2A 5TT0A 3IMFA 4BVAA 2RBEA 3ZWAA 4BGEA 2B5WA 4Z9XA 2Q45A 1HYHA 3GQVA 4JCOA 5LCXA 2GD1O 3I3OA 5A9SB 4NDNE 1LLUA 4HFJA 4U6SA 3MWDB 2H63A 4B4OA 4CLHA 1P31A 4NJMB 3I23A 2WTBA 2ZQYA 3GG9A 4GLLA 3GEDA 5JFOA 4BO0A 2PKQO 3I1JA 4LK3A 3OM9A 1WW8A 3MTJA 1XR3A 4ND3A 3RFXA 1HDYA 1ZK1A 1A7KA 1Z75A 4E13A 1NAIA 2B69A 1NNUA 3GNTA 2QRJA 1GPDG 1HDCA 1Y9AA 1P0CA 4R16A 3KYCA 4OOEA 4BNLA 3ZCXA 3UFXA 2VT3A 3HJAA 1UZNA 3DONA 3SJUA 4J1QA 2X0NA 4ROSA 5I8WA 4L9RA 4ILKA 4UVDA 1PEDA 2GF2A 5L45A 3VPFA 3FD8A 3QLJA 1U7HA 2R2GA 5L51A 3DOCA 4N5LA 1HDZA 3D64A 3C1TA 1U28A 1CJCA 4OSPA 2DKNA 2PZKA 3RSHA 4BGIA 3P2OA 4D45A 2AXQA 2GR9A 1IPFA 3E82A 1DRWA 4G81A 1IZ0A 5J23A 3E9MA 3JQAD 1QYWA 1YWGO 1DHRA 5I9MA 4UEKA 3TZQA 4CM9D 1V0JA 5BSHA 1X0VA 5L3ZA 1DIHA 5JW6A 3CTMA 1E7SA 3PPIA 3OQBA 4TZTA 2A4KA 1DC5A 1SC6A 2JCYA 2ZYGA 1GPJA 3WS7A 3PDUA 1AHHA 1UDAA 4JXKA 5G0VA 2O2YA 1JU9A 2E49A 1N9GA 2TMGA 2VUTA 4AJJA 3U4HA 4OQYA 1R37A 2EW2A 2ZTMA 5A02A 4ZRNA 5CHEA 5ADHA 2Y1GA 3TWOA 5BT9A 1PWZA 1EDZA 2POQX 2UUOA 4KUEA 5I9LA 3CH6A 4OAQA 2IRWA 3DDNA 5KWEA 4AJIA 1LI4A 4ZICA 2X9GA 1DLJA 2GGSA 3DL2A 4J4HA 4ITUA 4IS3A 4RF2A 4PGFA 4RPGA 4NIMA 4I5FA 2YHUA 4IMRA 3F1KA 4MIEA 1NR7A 4IGEA 3WFIA 3S2IA 1N1GA 1HYGA 2NVUA 5DNAA 3UH1A 1B15A 3S1LA 3HN7A 5TSDA 4JJGA 3ANLA 2AEMA 4TRRA 5L4NA 1IUKA 3NEPX 1HE3A 5JPIA 2QHXA 4OM8A 3TL3A 5IF3A 2IXAA 1R66A 1ZMOA 4CLEA 3GVCA 4MDHA 2D3TA 4XB1A 5BNTA 1WDLA 4D79A 4AJNA 1BXGB 1PZGA 1PL7A 3HFGA 2DTXA 4Q3DA 3VKVA 2Y1CA 1HE5A 3WG9A 2EF1A 2FWMX 3JQFA 1SOWA 2UYYA 5JLAA 4BQRA 2ZTVA 3UN1A 3KZVA 2OL4A 3SLGA 4EEXA 3DOOA 3IP1A 3TN7A 3HG7A 4TWRA 4XRGA 4CQLB 4J0EA 2FOIA 3N58A 2O3UA 1PWXA 1P33A 1PQWA 2Q2VA 3WBFA 4KDEA 3LC7O 4ID9A 4J2HA 4AICA 2LDXA 1A27A 3OQ1A 5GZ3A 2GYYA 4R5HA 1KETA 5T5QA 1DJNA 3E1KA 3RUAA 2OFPA 1NQ5A 3P7MA 1RKXA 3FBTA 4XGNA 4ZQBA 2OZPA 4JJIA 1D4FA 2VTDA 3E48A 4OJNA 5AXBA 4R1NA 4URFA 2VHWA 3UVEA 1B16A 4XYMA 3Q2KA 1GFSA 1VSUA 4EJMA 2Y1EA 5TF4A 4YJDA 2IDZA 1I0ZA 5HTOA 3TZKA 1X15A 3EYWA 3ZWOA 4P4GA 1PGNA 4Q3BA 3KHUA 5A5EA 1U8FO 4HNGA 2J5QA 4BO1A 1IULA 2PY6A 2B0JA 3GEGA 1EQ2A 4ZA2A 1QR6A 3JYOA 4BO8A 4BO9A 4WLEA 1GADO 8LDHA 1GZ3A 3I9JA 3DHEA 4XA8A 4H16A 1NHGA 1M67A 1N5DA 3E9QA 3PLNA 4N7RA 1FDWA 2GN8A 3C24A 1ZK2A 4OH1A 4BO7A 4AJEA 3GVXA 2W2LD 3BTOA 4LISA 3W8EA 3ZV5A 1EZ4A 1DIBA 4HNHA 3KTDA 4WLFA 4YR9A 2PGLA 2FN7A 3AOEC 3DAPA 5U4QA 2P5UA 4RZIA 3LT2A 2X9VA 1EBFA 3GAZA 3RU7A 4D44A 5IJZA 1HEUA 1R4NA 5G2OA 1FJHA 1AE1A 1TT7A 4TQGA 5KNLA 2UAGA 4CM4B 2J3HA 2GPTA 2B83A 1YKFA 3WSWA 2NU7A 4BNXA 1EFLA 3RC7A 1ULUA 2C2XA 2HMSA 2PZMA 2Q1UA 4PLFA 1K0UA 1EDOA 2VUUA 5CEFA 4OYRA 3D4OA 3WGTA 2BGMA 2IYPA 3WFJA 4BNMA 1KC1A 4IQ8A 1NP3A 4EW6A 1GV1A 3AI1A 4GSKA 4YXFA 3ZWXA 3DBLA 5JCJD 2FSSA 3E5RA 2EGHA 3RUFA 3ST7A 3H5NA 4CQMB 1KVUA 3BMCB 4K6CA 2DUUA 1MP0A 2CF5A 1GR0A 4WOKA 1A4UA 1ENPA 3A28A 4K6FA 3ZWCA 4J2OA 1MG5A 4NI5A 1TA4A 4BNVA 2X6TA 3GC6A 2PFGA 3QVOA 4JBHA 4CMGA 3RJ9A 3JD2A 1HE4A 2EV9A 2HK8A 3BMOA 3AU8A 4XWYA 1WLYA 1GAEO 4RDHA 2Q2WA 2Z95A 3GGPA 1ZUD1 3GEMA 1LDNA 3ONEA 4LMRA 4FOSA 3ENNA 3NRCA 4IXTA 5JC8A 4ND1A 3ZNPA 1OC4A 4E30A 4DLLA 1F12A 5ES3A 2FRDA 4U5QA 4XYEA 2JAPA 3VTFA 4Y6RA 4N54A 3DOJA 3GRPA 3ZI0A 3F3SA 4XQEA 1Y8QA 4GVXA 1NR1A 3WGHA 3PWKA 3P2YA 1R4MB 4DBZA 2LDBA 4FIZA 3ZNOA 5CDUA 3U62A 1C3VA 5IDXA 3RC1A 1PJQA 4GX1A 3UXYA 4RPKA 3KXDA 1JVSA 4BNYA 3GPDG 4TRMA 2DPGA 2GZ3A 4GGOA 4BB5A 1IYZA 1ISFA 4XZ3A 1X1TA 1KVTA 1AXEA 3GUCA 1UXKA 4R5MA 3WLEA 3PK0A 1P3DA 3Q6IA 3OA2A 4NFHA 2Q4BA 1YBMA 1TEHA 3QP9A 4WEOA 3GZNB 1YBVA 3IIEA 3MOIA 4PG4A 4BNUA 1ZO8A 3DFZA 2NU6A 1BG6A 3ONDA 2XF8A 1ZMTA 3B70A 3H9JA 4FFMA 2BFAA 3CKYA 2QZZA 1P0FA 3EGOA 1PJBA 4LSMA 1MUUA 1X7HA 4W99A 5DOVA 2JD1A 4BKPA 3WGYA 1YH3A 4DA9A 1I3NA 1UP7A 4F3YA 4OMUA 1BHSA 3NGXA 1OI7A 4BKOA 3PRJA 1I2BA 1YL5A 4BKRA 2RHCA 1J49A 1V3VA 1YOVB 1L1FA 2EXXA 5DT9A 1YJQA 2XXJA 4M54A 5LDGA 2OBNA 3F9IA 3KEOA 3OQ6A 4MVJA 4UUNA 4L75A 5KTKA 4E5MA 1LDEA 1VJTA 2QG4A 3VDQA 3WGZA 1E7QA 3DAFA 3E5MA 4NQZA 2JFGA 1DIAA 4YRDA 3WSVA 2DU8A 5AQ1A 4GX0A 3RBXA 1ZBQA 3KOUA 4EBFA 1R15A 4L4XA 2ZTLA 2AQKA 3Q0EA 2B4RO 3KLPX 3GDGA 1I3LA 4WNCA 3WX0A 4KP7A 1WNTA 1DPGA 5DOZA 3S2FA 4LRSB 4UVHA 1NFQA 3ZU4A 1H6AA 1X14A 2OHXA 3BAZA 1E6UA 1E7YA 4CV1A 5B4UA 1GYQA 1O95A 1BSVA 5JAZA 1H9AA 5COQA 3I4CA 1SPXA 1M6HA 2BF7A 3M6IA 4A03A 1U1IA 4KTTE 2BH9A 3LT4A 1DBVO 4D3SA 1KVQA 2J5KA 2IXBA 2VCYA 2VRCD 2O50A 3O8QB 1CF2O 1NYTA 1RM4A 4TMFA 3S55A 4OKIA 4XD2A 5JDCA 2WSBA 4B4VA 3JTMA 3KYBA 4M49A 1Y81A 4PLVA 2WD7A 4IUYA 3H2ZA 1XCBA 4PLZA 2NM0A 2O7SA 2V6BA 4NBRA 5IZCA 1WDMA 4ALIA 3TFQA 3DZBA 1H5QA 3JQGB 4A2CA 3HQ4O 4QQRA 4N5NA 4F6LA 3LZ6A 1YJ8A 1NASA 1X1EA 4XEHA 1OBFO 4YJGB 5IAAA 4FR5A 2DTEA 1W6UA 1U3WA 1LRKA 2BGKA 1B3RA 1T25A 2VYND 2Y99A 4K28A 4RPLA 4EZBA 4YT5A 2CVZA 4YJFB 2PGJA 3VH4A 4RVFA 2HLPA 4ONEA 1ISJA 4KDFA 3DTTA 3I6QA 4E2YA 3EAGA 1PS8A 2SCUA 1NVMB 3EUWA 4XYBA 3LF2A 3U4CA 3WGQA 4BHTA 3WDSA 4E33A 5C3MA 5JBIA 4PLGA 3O9ZA 4O6VA 3TRIA 4DL9A 2VNAA 3QQPA 4J1TA 4Y67A 1FDSA 3W8FA 1PZEA 1HKUA 4ALLA 3B1JA 1Y8RB 2VZ0A 1PIWA 2HRZA 2ZCUA 4DQXA 4BMVA 5KJEA 4DRYA 2VHYA 3O8QA 3MJEA 3QSGA 4R69A 4J49A 4ZRMA 1DO8A 3NT4A 3GK3A 4WCFC 4S3MA 3F5SA 4J4BA 3F6YA 4XDZA 2WE7A 2EP5A 2JCVA 4YWJA 1GTMA 1RWBA 1EK5A 1N7GA 2ZQZA 3ZU3A 1KVSA 1XQ1A 1B0AA 1PQPA 2FR1A 3FWNA 4M87A 3IKTA 2BFMA 1W0CA 1SZJG 3DC2A 2C07A 3ROMA 4YDRA 1YB1A 2YV3A 4UVIA 4GLOA 1E3EA 1CETA 1ZSVA 5EERA 2X5KO 1QLJA 4E5PA 4NFYA 1SB8A 2EKPA 3LSYA 3AY3A 4D7AA 5IDWA 2X8LA 2B4QA 4KUGA 4B4UA 5L53A 3D5TA 5KIAA 3GR6A 3K96A 4KQWA 3VOSA 3IJRA 4RL6A 3JQEA 3PHJA 1VJ1A 3L4BA 1QV7A 3CPSA 1I2CA 3RU9A 1V6AA 3FF4A 2CDAA 5MGBA 2V6GA 1O8CA 1HL3A 3HSKA 2WDZA 3NDIA 3I9KA 5KJCA 1E3IA 2JAHA 1I3MA 4CM1A 4WKGA 1BXZA 3JQDA 3TL2A 3C3XA 1QYCA 4E2WA 1Z74A 1U7TA 3JQAA 1U4SA 3K5PA 4CM5A 4KMSA 4D42A 4CM9A 1E7MA 4RPHA 4CLXA 5KKAA 4CLRB 3ETDA 2IE0A 4IGFA 3Q1LA 5C7LO 1JQBA 4U8GA 5EPOA 3I9NA 3BYZA 2Z1NA 5G4KA 4GX2A 4ZD6A 2P9GA 2G1UA 2A92A 5A1TA 1JVBA 3GZ4A 4BV8A 5IXYA 1GEEA 1OC2A 4KWIA 3BTSA 3KSZO 1D1SA 1CYDA 2YFQA 1AHIA 1NVTA 1C0KA 1LEHA 1LC3A 2EG9A 4Q3AA 4YJHB 5U9CA 2NLOA 1QRRA 4J16A 1Z73A 3WGIA 1ADCA 4GVLA 4TSKA 5CFZA 2O48X 3EMKA 2GASA 3ADOA 3E9NA 3LF1A 1IHYA 2R00A 1EFKA 1UH5A 2X22A 2D5AA 4MVJF 4PFJA 4XGIA 4ALNA 4AJHA 5IN4A 2C20A 4QX6A 2CFCA 1P45A 3AM3A 4YAKA 3RBZA 4I8XA 4W4TA 1OAAA 4PZEA 4CMEA 5IG2A 3WWZA 4AJLA 1VE9A 1UP4A 1PX0A 3ZV6A 3SLKA 4TRJA 4II3A 4JK3A 3U49A 5HWSA 5EJ2A 3A4VA 3FTPA 4NG5A 3DXFA 3IKVA 2JCXA 4NFSA 4PZDA 5JAQA 3TDKA 4WJZA 1K6IA 3RCBA 3MWEB 4DIBA 1MC5A 2C0CA 3FRJA 3JQ7B 3PYLA 4NPCA 5JO9A 4Z0TA 3ZWPA 3QA9A 2VN8A 3QWBA 3DMYA 3OECA 2TMDA 3MJVA 4YQYA 2AA3A 2EP7A 3PQDA 2V6FA 4JJFA 2CF6A 3WNQA 4WLOA 2C7VA 1UXJA 3KYCB 5AXCA 1HLDA 1Y5RA 3FNEA 4W9NC 4CMHA 3CMCO 5DCYA 1GD1O 1PL8A 3EK2A 3RUIA 2GN4A 3A1NA 1EVJA 2AW5A 4GMFA 1IOLA 1FDVA 5JXWA 3FSRA 1OZAA 2X58A 4M89A 3RUHA 3G1TA 4FQ8A 2VYVD 3H2SA 4B7XA 4CODB 2A94A 4I5GA 5T8KC 1I36A 3M1AA 4NNJA 4TKMA 2HJSA 1GQYA 1JKFA 5U1PA 2DT5A 4NK5A 2PA3A 2YYYA 4HFMA 2ZB7A 1Y6JA 2HJRA 2ZJ1A 2BMAA 2Q1WA 4ZN6A 4XCVA 1SB9A 5EQDA 5F21A 3JQ7A 3U4IA 1MGOA 1V8BA 1PQUA 1HE2A 4RVDA 2QYTA 5CAEA 3OEWA 4OHUA 4CLOA 3I5MA 3I6IA 1SO8A 4FC6A 3ZWMA 5I9NA 1ZK0A 1HRDA 4PLHA 3IC5A 3DBVO 3OJ0A 5ENVA 1L7EA 3K9QO 1N9GB 4LGVA 2W2LA 3D3EA 2IZ1A 4OGWA 5T57A 1TT5A 2O3QA 2YFHA 1RPNA 3PWZA 3UUWA 1NBOA 3QWIA 3H9QA 5JC1A 2UVDA 2O3TA 4KQXA 2NUAA 1R16A 3Q9NA 4PLPA 4BNIA 1PJCA 2AEJA 4IDDA 4LRTB 2D2IA 2DM6A 3RUEA 1EE9A 1O6ZA 1B2LA 4YACA 1E1LA 2NVUB 1E3JA 3M2TA 4QTZA 4XR9A 1I10A 4LW8A 1T4DA 3C7AA 2P4HX 4BS9A 2YW9A 1M66A 3TOZA 4CR8A 2BKAA 1T2DA 4YB8A 2EEZA 5JCJA 1NVGA 3PYMA 2RH4A 3W4JA 3WYCA 4G5HA 3IP3A 3EDMA 2CY0A 4RLSA 1ML3A 1IHXA 2YHIA 5ICSA 3G3EA 1B7GO 5AOVA 3EC7A 4FGSA 1NFFA 2DFVA 1Q0HA 2PK3A 5GZ1A 3LDHA 3BXXA 1XKQA 2O7QA 2Y1DA 3RROA 1ZFNA 4WLNA 1BDMA 1E3WB 4DUPA 4BNHA 4MP6A 4AG3A 4A5OA 4Y98A 4E32A 3DMTC 1ONPA 2DVMA 3ZWVA 3GDFA 2D8AA 1VL8A 4IQGA 1P74A 3U3XA 4U0KA 2VOJA 3D1LA 1I5RA 1QG6A 1I8TA 4DPLA 2H9IA 3BMQA 2CVOA 3AY7A 3TZCA 1JLLA 3WMXA 4IJKA 2PKRA 1LSOA 3HFSA 4CM7A 1WPQA 1E7RA 5BR7A 1IZ9A 3OJEA 2RHRA 1DB3A 4YBZA 4D0SA 3UF0A 4EUEA 1HLPA 2V65A 1HDGO 1CWUA 2ZIZA 1PJLA 1DDOA 4J7UA 4K26A 2C59A 2JJYA 5GMOA 1GUYA 3GRKA 3IUPA 3U09A 1VLLA 1WAMA 3T4EA 2I3AA 1HDRA 5KCZA 4RF5A 4UVEA 1SBYA 2OOSA 1A4IA 1ORRA 1Q7BA 5H82A 4JROA 2C5EA 1ISHA 3G0OA 5ENDA 1ISMA 4FGWA 1ZNQO 4XQCA 1UXGA 5K6AC 3L77A 3QVSA 1ENZA 5L95A 1LDBA 2OORA 9LDBA 5JDIA 4RF4A 5LDHA 3ZZNA 1HT0A 1PJSA 3VPGA 1XQ6A 4NBVA 3NTRA 4XYGA 3JQ9C 1E3WA 1MLDA 3F4LA 2AE2A 2ZJ0A 3JD0A 5TJ9A 1FXSA 1H94A 1U3UA 1E7WA 4TRNA 5MDHA 2Y0DA 1LQTA 1R4NB 1ENYA 3DZKA 4HBGA 2ZTUA 4CUZA 3IAHA 3O38A 5A9TA 1R6DA 4R4JA 4DIOA 4E5KA 5B4VA 4AJ1A 3ENKA 4ALJA 2ZB8A 4NU5A 2VT2A 2FPIA 1OMOA 1KY5A 1RM0A 2RIRA 1XU7A 1GDHA 3GAFA 4IDCA 3VH3A 1DFIA 4BNTA 4YA6A 4RDIA 4JBGA 1WDKA 4Q3EA 2DUWA 1DAPA 1Y7TA 2PTGA 3FCOA 4FC7A 3WQSB 5H81A 4MIYA 3DBLB 1P1KA 4CM8A 2FP4A 5A5FA 5JCXA 2FHSA 2GLXA 1ISGA 1R12A 3C8MA 1UJMA 4L0QA 3ON5A 3UOGA 1E92A 3COSA 1EQUA 3DEYX 4EEZA 5HM8A 1W8DA 5L40A 1N7HA 2VWQA 4NK4A 4PG6A 5EQFA 3H9GA 3K2BA 5I7FA 3KM0A 3LC2O 2WM3A 3BMOB 2ZCVA 3AOEA 1ENOA 4I1IA 3D0OA 1QYVA 3L4SO 2AG8A 2UDPA 3OBBA 4HV4A 1XYGA 5H83A 3NAQA 1QYXA 5THKA 3OIFA 5ITVA 3SBOA 3KB6A 3MJ4A 3F1LA 3HB5X 1PGOA 4ZHSA 3IL2A 4CMKA 3IOYA 1S6YA 3Q3CA 3BZUA 4WCDA 4KUHA 2W2KB 4CV2A 5AXDA 2BFPA 4DQVA 2VRCA 3AUTA 1YGYA 4WOJA 2P4QA 1ZEMA 4NU6A 1HZZA 1Y8QB 2VQ3A 4EGFA 3R1IA 5TJHA 1YS4A 3C85A 3RC9A 4QECA 1JAYA 1PTJA 3A9WA 3GPIA 4J91A 5KVSA 3CE6A 1DC6A 4X54A 4FFPA 5A06A 1FK8A 1UR5A 4PN3A 2E37A 5FFFA 3LVFO 1QSGA 2EKQA 2IODA 3KSUA 4I5EA 5ER6A 3WXBA 4XQ9A 5K9ZA 2NADA 1GZ6A 4XQGA 5JE8A 4BMNA 2ET6A 1I24A 3OEYA 1LRLA 3EVTA 4I9HA 4MIOA 4B4WA 3GMSA 3SVTA 4UEOA 1D1TA 4BKQA 4DMMA 1NTOA 1WP4A 3WIDA 2GN9A 2VYNA 3AUUA 2PH3A 1TI7A 3TF5A 4F46A 2R6JA 4ND4A 3UICA 1VRWA 3BHMA 1MXHA 1PR3A 2D59A 3MOGA 4PLCA 3D3WA 1BW9A 1L7DA 4DYVA 5IFLA 4B8WA 4NMHA 1XWFA 4IMPA 1D7OA 2OUIA 1KEPA 5CDYA 1G0NA 3JQ8A 4U7WA 1QP8A 1NHWA 1U3TA 3UW3A 5T67A 2Q1SA 3INGA 3NTOA 4MJLA 3AI3A 3RD5A 2FR8A 2PGDA 3BMNB 1P1HA 2W2KA 3FR8A 2RCYA 5ICMA 1E5QA 3D4PA 1SAYA 4NHEA 4L76A 2PD3A 2YY7A 1FDUA 3OHSX 4M55A 4RQUA 1WMBA 2XXBA 4R3WA 4M86A 1WXDA 3LT1A 4XB2A 3F47A 1HWYA 2UV8A 9LDTA 4MVJM 3AM4A 1OOEA 2HSDA 1V9LA 4UUPA 1EE2A 1KVRA 1DRVA 4PLTA 4M8SA 4O1MA 1LU9A 2E6UX 3W6ZA 2NWQA 3BTUA 2GO1A 1UXIA 3TOXA 1GY8A 2AQ8A 4FBGA 4YAGA 4JBIA 3B20A 2VUSA 3ICPA 4Q3CA 4GWGA 2I65A 4H3VA 1GV0A 3PYXA 4GBJA 4BNZA 1MXFA 1E3SA 3BTVA 4NJOA 3OMLA 2J3JA 3F5QA 3GY0A 4JQCA 1VJ0A 4GQAA 4ALMA 2P9CA 2DBZA 3PTZA 5DP2A 1U4OA 1YBAA 2X86A 1R0KA 1XEAA 1FDTA 2CUKA 3IJPA 1HSOA 4RQTA 1KEUA 2X7HA 5C7IO 5CEJA 1E0DA 5DULA 4CLDA 3BMNA 5TNXA 3O4RA 2PLAA 2IEBA 4IXWA 2ZYAA 4WK6A 1AUPA 1EUDA 1VI2A 4XIYA 3PLRA 2FMUA 1M75A 1Q0LA 3KV3O 4BKUA 1PJ4A 1QXSA 2IYOA 2BELA 2BI7A 4D46A 1IL0A 4Z3DA 1JDJA 4YQZA 4G2NA 2VZ9A 2WD7B 3UCFA 4E5YA 2VHXA 1Z6ZA 2NACA 1OFGA 2DQ4A 3X2EA 2BHLA 3H7AA 3P19A 4J4TA 1GYRA 2JHFA 2C29D 2J3IA 4JIGA 1TXGA 3KLMX 3PJEA 4KWHA 4HY3A 4IY1A 1HYEA 3KBOA 1WVGA 3GVPA 1E5LA 3GNQA 2A35A 3VPXA 4H15A 5A03A 5CG1A 2Z1MA 3LT0A 2XOXA 3K8ZA 3GA0A 4R54A 3C1AA 2YDYA 1H2HA 1DSSG 2OO5A 3O03A 3OA0A 4N5MA 4Q3NA 5FI5A 3T7EA 1KS9A 4INAA 4JP2A 4PIVA 1RJWA 3HHPA 5FWNA 5CPFA 4CMCA 3HZZA 3GGGA 1YRLA 4EDFA 4RLHA 2YV1A 4XJTA 6ADHA 5HA5A 3DB2A 3FPLA 4MO2A 2DAPA 3NT5A 2JD2A 4TVOA 3OIGA 3EY4A 2VHZA 4NBUA 4MKRA 3V1YA 1YO6A 1ULSA 1DEHA 3QJ5A 3ICCA 4DBVO 1B8VA 1DJQA 3V2GA 1JKIA 2Y66A 2YUTA 3A06A 1G1AA 3DBRB 2CSUA 3NUGA 1EVZA 1LX6A 3WTBA 4D3FA 4XYLA 3QWHA 4O0LA 1Z45A 4C4OA 1GZ4A 3VTZA 4GKBA 4CMIA 1NPDA 3JD3A 1N2SA 4W6ZA 3OJFA 5KVCA 2JKVA 1MX3A 1YB5A 3GUYA 1SOVA 1JTVA 3JQCA 4A27A 2EHDA 4IBOA 4ZJUA 1XGKA 3NGLA 4UUOA 3ZHYA 1KBZA 4L8VA 3K2EA 3P5SA 5G0UA 3VZRA 1I32A 1KY4A 5DZSA 3PJDA 3ZHXA 1HDXA 3MJSA 3N74A 3ANNA 2HQ1A 2P9EA 4K9DA 4AJ2A 3CIFA 3LLSA 2EJWA 4E3ZA 5JDCC 2VYVA 4AJKA 4JLWA 1RYDA 5COAA 1XHLA 5TS3A 4FW8A 1U2DA 4WCFA 2FPGA 4WNIA 3NDRA 5G4LA 5THQA 3ZH2A 5JY6A 4DC0A 4PCVA 4A73A 2OP1A 5B1YA 2IEDA 3JQAB 5IZCC 2HO5A 2AQHA 3RWBA 4BL5A 4EUHA 3ITKA 1P1RA 4I9UA 1NQOA 1VL6A 3ZWYA 1LTHR 3PIDA 5CPBA 3DBRA 2YDXA 3ZWBA 3Q11A 1F06A 4HKTA 4FN4A 5ITWA 1HTBA 4JP3A 3VH2A 4CL3A 1PZFA 4K1LA 4CL8A 2E4AA 5G4KB 5DBIA 1J0XO 3JQBC 1ZW1A 1MA0A 1FF9A 5TQVA 4MVJI 3HUDA 3SEFA 4GMGA 4MINA 2HMTA 2HK7A 3OFSA 3R0IA 1A71A 1Z7EA 3G49A 4AJ4A 5C37A 3NYWA 5DCWA 3DZJA 3GT0A 1YQDA 4TZKA 4GAEA 4GWKA 3L6DA 4CQMD 4RO0A 5JS6A 1C14A 5DP1A 1T4BA 2W98A 1H2BA 4UREA 2CZCA 3M2PA 1ARZA 5EN4A 7MDHA 4WPGA 4NBWA 2ZK7A 1LXCA 3RI3A 4P8RA 2VTEA 4YRAA 4IZIA 3GFGA 1YONA 1I30A 1U9JA 2H6EA 1LLDA 4DQUA 3HDJA 3DZHA 1P9LA 3LU1A 1LBEA 4IJUA 4LCJA 3TSCA 2GSDA 3AUAA 1BWSA 3HWRA 3GMDA 2HMWA 4RORA 4ZQEA 3VZPA 1X0XA 2D4AA 3OP4A 5F3RA 5JSFA 5K0ZA 5KJ1A 2QYSA 4YRBA 4L73A 1VKNA 5EINA 5AVOA 1ZSYA 4GKVA 3CUKA 3WWYA 5IZ4A 3R3SA 4MVJH 3PFFA 4XRRA 1MC4A 3DAGA 3Q2IA 4YPOA 3GN1A 4EUFA 2FSVA 4A7PA 1F8GA 1V3TA 3LYLA 3AY6A 4IS2A 3DTYA 2X9NA 1PS9A 1IPEA 4QFCA 4EJ0A 2C7GA 1H6CA 2E48A 4DREA 4IZHA 3KSDO 5CDTA 1CQIA 4J9UE 5KVVA 4MKZA 1EUZA 1PJ2A 3VHRA 5DCUA 5GY7A 4EJ6A 1YL6A 4MVJP 1H0KA 2X5JO 3DR3A 1ONNA 2AMFA 2FPPA 4IJWA 3ABIA 1DAOA 3E18A 4D0RA 1PSDA 2H1SA 2Q3EA 4BNFA 3QE3A 3AI2A 1W4ZA 4LVCA 4RPJA 4A0SA 1T24A 2WEKA 1J6UA 4HP8A 3CINA 2ZKLA 3ZV4A 4AL4A 4CLOB 3FBGA 2HK9A 4W9NA 5TX7A 1T1RA 2F00A 5JAMA 3C7DB 4YT8A 3KYDB 4Y6PA 3S2GA 1X7GA 4RVUA 3D4NA 1JWBB 3DQPA 3WYBA 2G76A 1TT5B 3PGXA 4BMSA 4CUJA 1LSSA 3WICA 3QVTA 5BQFA 2IZ0A 5IDYA 4J9VA 1JAXA 2O23A 5T8KA 4B7CA 1VL0A 4NBTA 2VWPA 5IDQA 3ROPA 1XG5A 3HDYA 2QW8A 2Y1OA 2NQ8A 1GEGA 1T26A 4Z6KA 4BO4A 3NX4A 4AJOA 1LA2A 3H65A 5IN5A 3OICA 1PU2A 2OXIA 4HFRA 3RAJA 3VPSA 1EVYA 1P1JA 1DOHA 3F46A 4FS3A 4KZPA 2WE8A 3I52A 3DHNA 5B4TA 2E82A 1LUAA 1QYDA 1TVEA 3QWFA 3L07A 5KJFA 4FOOA 1ZH8A 3SX2A 2CNBA 3C7CB 3LQFA 3U5TA 1Z82A 2YHIB 1WMAA 1C0IA 5I7VA 3PHGA 3K30A 1VPDA 4XDYA 4J0FA 4O63O 4I08A 4II2A 4OQZA 3WBBA 4BNWA 3RUCA 3ZHBA 2X0RA 1LQUA 2YJZA 1JA9A 1S7CA 3PGJA 2C2YA 3W1VA 3JQ6A 3KYDA 4ND5A 1CEQA 1O89A 3I4FA 5COBA 4YAJA 4PLWA 3BA1A 3ZV3A 5FEUA 2CMDA 2I9PA 3CEAA 1EEHA 1LDGA 3FHLA 2O4CA 1NWHA 3BMQB 2QIOA 1ZSNA 5HBRA 4C7KA 1YB4A 4AJPA 4PRLA 4PVCA 2I6TA 4EITA 3STHA 2OGUA 4R68A 4R9RA 3FNGA 3GVHA 3OH8A 4E31A 4E6PA 2I99A 4FFLA 4UEJA 4UULA 5BSGA 2C82A 2EW8A 2Y1FA 4R1TA 5G0SA 4CV0A 3HNPA 5A4DA 4TROA 1MV8A 3H6KA 3V8BA 4DWVA 3PDJA 4BNGA 1RM3A 2FZEA 4FD3A 2X4GA 2NVWA 4WGGA
chains in the Genus database with same CATH superfamily
2EGGA 4EG3A 4PW0A 4NNOA 1QV6A 4HWPA 1J23A 3D02A 1A9XA 1TECE 2WYUA 4MR9A 5LYJF 4TYPA 3LHFA 1BGVA 1LDYA 4UZSA 5IEJA 1KWGA 1F5NA 1FSPA 1ZRMA 1CQJA 4JI6B 1T0IA 4R6WA 4WZAA 1Q92A 4XWKA 2WQ6A 3P96A 3INTA 5L7TA 4B6EA 1W4LA 3RKRA 2QL7A 3H83A 3MJFA 2FG6C 5BN4A 1T5BA 5AW8A 4H1UA 1IUPA 4JC8A 3HXTA 1BVUA 3T4XA 2Y1WA 4L02A 3K32A 1F4VA 1JW9B 3KFLA 5AHRA 1R0LA 1E9VA 1OASA 1OI3A 3QFCA 3M6VA 5JS7A 1P81A 1ZI6A 3TB6A 3MWDA 5IARA 2P2SA 2A1UA 1TKBA 2ECKA 4GX5A 1IXKA 4MV1A 4NJMA 3WDLA 4Z4GA 2JK0A 2QMZA 4O4HF 3BE8A 1CUGA 1YB6A 3NYIA 2AUTA 3ZWWA 2PUTA 1ADBA 5DX0A 5EJEA 1MAHA 1U0SY 1UM9A 4FB5A 2G9UA 1GNPA 5JAHA 5K8IA 2F62A 5IKOA 3B1FA 4URXR 3PFWO 2YR0A 1P1BA 3T1VA 4M8IA 4OI0A 3GCWA 4TOIA 3G8DA 3IP8A 3L9XA 2G4LA 3FMGA 4L8GA 5ER9A 3PDCA 4RABA 2AVNA 4P22A 2Q4TA 4OMCA 1C1HA 4Q01A 4ATNA 1FX0A 1KKLA 1AGRA 5EKSA 1Z3CA 1Z0IA 3GJXC 3STXA 3OUUA 3AHIA 1XSEA 2O2XA 3PGLA 2ZS9A 4LQCA 3CX8A 3DO6A 1QOQB 2CE7A 2RH8A 2J4FA 5C7OO 1RI2A 3HEMA 1K68A 3UJ8A 1PL6A 1P91A 5F9MA 2C95A 4X93A 1AQYA 2UZAA 1VHWA 2A2ZA 1A7AA 1BRMA 3PV0A 5CFOA 4CIYA 4OQLA 1AM4D 4R1OA 1PG0A 3OX1A 2YX1A 3KIPA 1XKTA 3SS8A 2HQOA 3IAS1 4O4LF 1CW2B 2QRPA 4M0KA 5ELMA 1ZICA 2AJCA 4R6XA 4IZOA 1Y1PA 1SHZA 3CNOA 3FHCB 2ZSDA 3BRCA 3IAUA 4MGIR 5EMLA 3T9EA 3UAGA 5A4AA 1C7ZA 3F5DA 3PHIA 4LMAA 1ISIA 3GRZA 1AKVA 4MNTA 3VZQA 4ZYUA 2C9CA 1VC2A 2CJWB 4A82A 1PJAA 1QGAA 1XLTA 4F92B 2CLKB 2C4NA 4AN4A 1FTWA 2OHVA 1I7QB 5FI3A 2G17A 2LNDA 3HUEA 5ALLA 3TL6A 1L3CA 1R0WA 4U9IS 1FSZA 2W6ID 4TLCA 3Q8MA 3WLMA 1DDIA 3D1JA 3A2NA 1H2FA 3UH0A 3BJIC 3SZ3A 3O0TA 3OESA 3A2LA 2IY8A 4N65A 4F21A 3V34A 4IH4A 4LY9A 1GZUA 1TIBA 2G4CA 2QU8A 4HDAA 1O9BA 5HEKA 3O7WA 4D6PA 4RZHA 3DMHA 3TQHA 1W6RA 5C5IA 5IVKA 4G09A 3BF8A 2WIJA 1ZR2A 2WWIA 1D1QA 4FUQA 4FJ1A 4RTNA 1PJTA 2EWMA 1N8NA 3LVBA 4R01A 2J9YB 2PHZA 2VNHA 1Y82A 2IY9A 2WVAA 3AU9A 3DKKA 1M1NB 3MCVA 1W5EA 2ZZKA 3MJHA 5EMHA 4R1MA 3WMWA 4KNVA 3BHNA 2GVZC 4KKVA 5JXGA 4B43A 4NS4A 3MTDA 3RJZA 3WJAA 4EY8A 4R0MA 4ODIA 4PZZA 3LZDA 2Z56A 2RC5A 4KW7A 4G5QA 2V5VA 1Y34E 4COOA 4NHOA 5CH5A 5HUHA 4LYAA 4RD3A 1AN9A 3FNQA 2CE2X 1JKJA 3ONFA 2A67A 3ABZA 3PEUA 1TTPB 2HU8A 5E7JA 4DTIA 5BW6B 2ZB3A 2PZEA 5BUZA 1ZKMA 3HCBA 3S81A 4GPEA 1H6DA 4QDTA 2TS1A 2IYLD 5JNLA 2OCXA 1LBQA 3DUWA 2ZU6A 2PUWA 3M7IA 3OTOB 5B12A 1DRKA 2G0NA 2MYUA 3MTBA 4BNUA 3PJRA 1G4AE 5JQGA 1GRCA 1TMYA 1ZNYA 1UWCA 1BW9B 4JUIA 1CR2A 3BZBA 4HHEA 3U7EB 1QK4A 3JQ8B 5FWYA 3IV9A 5F1KA 2XYRA 3F2IA 3W2FA 2QWXA 1QKIA 4WN3A 4M76B 2OCKA 2HD4A 1J25A 4Q4LA 3RRMA 1SD1A 1QCYA 5F7XA 3F0TA 3M83A 3HVUA 4HGRA 3W79A 3EXG1 1DX6A 5LA6A 1XDWA 1JR3D 5B2EA 5LP1A 3I42A 4HNUA 2F8MA 2JFNA 2DBQA 2JFXA 2PWAA 2Z04A 3RQSA 3TPCA 4EW3A 3LRPA 3KKPA 3PDIA 3AWDA 4GGMX 4I46A 4E5SA 1HF3A 2JBAB 5EKTA 4DMLA 4A6EA 3QTLA 4IIEA 5ED4A 2DY0A 4IGKA 4EVIA 1UBHS 2XB6A 5LMUB 1RP1A 1C30A 3HDHA 1E1RA 5CB4B 1U9CA 1V1MB 3EDCA 2IHJA 1IY2A 5SZIA 3RVDA 3ESBA 4CIXA 5KTPA 2OD2A 3SWWA 3UOAB 2HWUA 3OLZA 4YP9A 3ORSA 3KPVA 3ZH9B 4B83A 3L46A 5K0SA 5LWQA 1LJ8A 4TWAA 1UOQA 4RH3A 1B42A 3W6UA 4ZCRA 3F97A 3PU6A 1GP2A 5A9RA 4KITB 1Q11A 4TSFD 2PWZA 3RASA 3VV3A 2E4ZA 3OEEA 1H8EA 1Q15A 3NOVA 4C20A 5MN6A 3Q0IA 1Q19A 3L8CA 4AX8A 3KETA 4HX2A 1XEWY 2XMSA 3LPNA 4TKLA 4W7HA 2GD2A 3VAZA 1HZZC 1GCUA 3FUXA 4BIIA 3ZY5A 2G5CA 1TEZA 2HL6A 4FFOA 3GDOA 3QF7A 4E4RA 3SXJA 1UEJA 3ZCUA 1G38A 2FX5A 2VA8A 2WAYA 1GA4A 4RF3A 1P1IA 3WFZA 4CMAA 3WA7A 1PUXA 3AF4A 2IQ5A 4N3AA 3C6YA 5D1NA 3SBEA 1YSCA 2Q1TA 2HU7A 3N2LA 4QRHA 5FP0A 3VZCA 1C1XA 2GZ1A 3CM0A 3HKCB 3VH1A 2PQ0A 4AMGA 2FMHA 4LHZA 1DAEA 1E9CA 2PJUA 1AQUA 1XZAA 1NFRA 3P26A 2HM7A 3NDJA 3R0ZA 1NW6A 1QVAA 5FAXA 3VUFA 4BMOB 4ARVA 4OJYA 2I7TA 4HVLA 1NIJA 4B40A 2XODA 1UJ6A 2GJ9A 3PWSA 5ALXA 3LWNA 2VSNA 2Y6UA 3TQFA 3EHEA 3GGJA 2HMVA 5BXYA 1WOMA 5IANA 4MLCA 1ZVKA 5JJCA 5ABPA 2PBLA 3R5SA 4J76A 3EEBA 1H1LA 2A0FA 3UWMA 2DHEA 3AHDA 4NMLA 3QF4A 2OHHA 5LC1A 4MGZR 3T5CA 2OKCA 2ZWMA 4D6YA 3MCZA 5CYOA 2V55B 4DMGA 5FUWA 5FOVA 2M6LA 3F4KA 4NY1A 3ZQJA 1QGUB 5IT0A 1IHDA 1S2MA 5DIFA 5FUYA 2IHYA 4PGAA 4HZGA 2FRDC 3IDSA 2GI4A 4B3DA 1EM8A 4ND6A 1FP4A 1E6CA 2QQGA 5LOVB 1DRUA 1TW3A 3DGFC 1B3BA 4Q6BA 3K1JA 4W5TA 1QANA 1YU9A 1JQ3A 1T3GA 1UFOA 2XTNA 1ABBA 3W2GA 3ZDXB 4C0KA 3BWXA 3DVAA 4BEWA 5LL6P 3R74A 4Z4CA 4MHSA 1KO1A 2RHGB 1O94A 2B36A 1UBNA 4BGVA 5LJLA 3ZDBA 1CUXA 3IUSA 4FX5A 2VJNA 2XKAA 4H7HA 4K6HA 4DA0A 3JYQA 3DHWC 4Q02A 2D06A 3TQCA 1CNEA 1T4GA 3ORQA 1NQXA 2XNDD 1WMSA 3RVPA 3H84A 1DXYA 4ZVNA 5HIAA 1I7SB 1F6WA 3GF4A 3I9MA 3IURA 3A14A 4CM3A 3ERCA 3ZW8A 1JNXX 2J3KA 4KGVA 4L5CA 5KNCH 4CTKA 4JT8A 1F6DA 4B35A 4G5FA 3STVA 2O19A 1UJ4A 4UOQA 2B21A 4ZVVA 2B4AA 3R77A 2ZSIA 4UTXA 1T6YA 5IJ9A 2QR3A 3KUXA 4AFNA 4ZJZA 1M2WA 2WWRA 4LZZA 4NR0A 1X6VA 4TZ6A 4HWKA 1QIDA 1M74A 3G8CA 1YR8A 3ICOA 4I4NA 3T5BA 3QV1A 4BECA 4PX9A 3SS9X 3N1UA 1MAAA 5CA0A 3KAQA 2NZUG 1B8UA 4QELA 4E11A 3H2HA 3BGIA 2ZUTA 1HEYA 5B3JC 2YY6A 3L5KA 4HAWA 2XBUA 1DU4A 2XEDA 1Y1TA 2YTZA 1BGXT 1EP9A 1VSVA 2R5NA 3ITDA 3NBMA 5EPUA 4HNTA 5JYEA 1VKHA 3AFOA 4BGUA 2J1LA 1PV1A 1YZ3A 1DE0A 3EXHC 2ETVA 2GOYA 1E66A 3SZGA 3AF2A 1XD2A 1RQRA 4C5BA 4DR3B 3QVXA 5JZSA 3CX6A 1WX1A 1KPIA 1QC5B 2IPOA 4G0MA 2VAMA 4C06A 2J4CA 3VA7A 1ZCJA 4MWTA 3BXFA 1TAUA 3LLVA 2OFWA 4Y2YA 1G3RA 2CDCA 3B6ZA 3AJRA 2CXUA 5K3CA 5JI3E 1W48A 1WSAA 4WCFB 1GG8A 2FPGB 2ZTHA 4A6PA 1KZ6A 1A8HA 3R3VA 5CEEA 4FXPA 1ZIPA 5DHQA 3WK9A 2Z6AA 1YJ5A 4QXQA 5DDIP 3ZYCA 1G8YA 2YRWA 2VBGA 3RVNA 2CLSA 3UENA 4A0HA 4NC9A 1HNZB 3BREA 5DCLA 2XGJA 2XZPA 2YC2C 2ZIGA 5H3CA 3PQ2A 2AOUA 4R8RA 4TVBA 4Z0PA 4HDSA 4BUCA 3NCHA 1E3LA 1SC9A 2GZ2A 3OIVA 3OM1A 1JDNA 4R71A 1Z26A 2OO5C 2WFLB 4Q1VA 2W00A 4ZGWA 1SCQA 3K31A 2QRZA 5CK5A 2RI1A 2AE1A 3G79A 5D8DA 3VPHA 3ZU2A 5EHZA 5JQGF 1YRAA 1I5EA 3TFOA 3JPYA 3HJNA 3N7UA 3G2JA 1E64A 3WX0A 3QKTA 1HPLA 3TBHA 2EJVA 2Q3HA 4F6CA 3FN4A 3LL4A 1GLVA 3F7NA 2I6UA 3QXXA 4ZC1A 1UXHA 3A7EA 5A0TA 1K7EB 2VSOA 4WEQA 1EA5A 3HA2A 2PD4A 3GLQA 4U3JB 5I5GA 3U4DA 4BASA 1YOBA 2XQVA 4HDOB 2J6HA 3L6OO 1Z06A 3E3AA 3FTNA 3KDSE 2WJ3A 4MVJE 2HT1A 5LA6F 2E2WA 4KV9A 1LBHA 3DZDA 4S1OA 1Q0ZA 3WIVA 3ZI7A 4C7OA 2PGIA 3WLPA 2A9FA 2VF2A 3PR2B 3ANTA 4P3YA 2IYQA 5IK2D 1BVHA 2NT3A 3RSSA 3C6MA 3K9CA 4QLBA 1RFLA 3CVVA 4YLYA 3BH0A 1WWKA 3UCXA 1ECCA 2B5VA 5HRUA 4NCBA 3FNFA 3DE0X 3SY8A 1EE1A 4IF4A 4NXNB 1H4TA 5EQTA 5JYDA 1TLLA 1YB7A 1GCOA 2YWBA 3AVVA 2CNWA 2WFAA 1H0RA 2HIHA 4E12A 2VAPA 1C0LA 1PR5A 1SQGA 2A5FA 3FNHA 4HLDA 2XIJA 2WB4A 3GG2A 3V8RA 4Z3KA 5TF0A 3UCEA 1PT6A 3B2QA 4BRWA 4HNAA 4Z0NA 2B1IA 5K8VA 3W6PA 3WL8A 1JHQA 1N3IA 3COVA 4DT1A 1T6ZA 4MV7A 2I87A 2FLKA 3AM1A 4NNPA 4UHBA 3ADBA 1GTVA 4UATA 2PZFA 3V1UA 3PPXA 2OILA 1NXQA 3INRA 4Y7DA 2C2WA 2VHEA 2HHCA 3UT6A 3I4LA 1D3AA 1P8AA 5EIBC 5AESA 5AHKA 2R7KA 1RXUA 5B1EA 3EISA 3N2ZB 2C5AA 4P38A 5ALMA 4B44A 4J1TC 2FF7A 3IP5A 2JJ2D 5FLEX 3SSAA 2VRBA 4KN6A 3S0JA 1O5IA 3ODGA 1NI4B 4Z9FA 4YMHA 2ZRIA 1QORA 2PBRA 1M72A 1KFEB 1W96A 1NVAA 3C3AA 4M38A 3KQUA 2VJAA 4U00A 1AG9A 3PXXA 1V96A 1MIHA 2Y67A 1N2GA 3JV7A 2XCIA 1Q74A 3B89A 3RS3A 2AIRA 1NQTA 3GVIA 4IIDA 4R9VA 4TUYA 4NYJQ 4U6QA 1ORIA 4DWWA 2BR3A 5CXSA 5K2OA 2HXSA 3OAAD 5F12A 2W2OA 5C3UA 2AR7A 1E3TA 2Q2OA 3NHPA 4ROTA 4MW2A 1SD2A 3FMVA 3ROGA 4HN2A 3ESCA 4YJGA 5AI0A 1MO5A 4DOMA 1BHQ1 2W2PA 2OHFA 2FPPB 5AUNB 2I3GA 1TM1E 4QGBA 3JVDA 4FFVA 1XFDA 5G1OA 1KIFA 2C97A 4N8SA 5FPQA 3IPRA 4P7JA 1A95A 3RS4A 4B2IA 4WWHA 5I48A 1HDEA 1Z5WA 4OPMA 4O3MA 2P91A 1RWVA 1LNQA 1DCFA 1WCV1 2SBTA 3ORFA 4S0ZA 5EE9A 3DB1A 3VDRA 1NN1A 4G65A 5TC4A 3EW7A 4R41A 3NHYA 1K3TA 1UAYA 5A3QA 3L7OA 1T2FA 1A4RA 4RD1A 1Z15A 2PZJA 3TIFA 3WB9A 4B6SA 3BRQA 4WASA 1G18A 4DJFC 4OHFA 2FG5A 4YYZA 2G5PA 2JLRA 3N3BC 3C5WP 3L4KA 2D5CA 1JWAB 4J6FA 4KN9S 1GFZA 4XKJA 5LFAA 1VB3A 3O94A 3X1YA 3W2TA 2XV1A 1K06A 2HW8A 2WILA 5EXSA 1AZSC 4LSWA 1LX7A 4GPD1 1UBFA 4ALKA 2I4LA 1WQ4A 5GV7A 5HF5A 3RSGA 2PQ6A 4CNBA 2BTEA 4OU4A 3W5SA 1YVUA 1SK9A 1NVDA 5A7GA 4A2WA 2CVPA 4D1YA 4GI2A 4DMUB 5DBGA 3BXPA 2AFIA 1N5KA 3ZN2A 2G4VA 2XBLA 4U9HS 2J0EA 4UMDA 4XJXA 1JH9A 1EUCA 1M6VA 3MS7A 2BONA 2QQ5A 1RI5A 3NKFA 3H8JA 2R751 3OSUA 1M1YE 2W8ZA 5E2IA 1HYBA 3HVIA 3CR8A 4JC5A 4RKRA 5CA0F 3IEVA 3GRVA 1FCJA 3FIUA 3DWFA 5C32A 2QP9X 1XMVA 1XUOA 1L7NA 4JVSB 4QDXA 5EZYB 1DC3A 4IOLA 4BNDA 1P1FA 2V6MA 2ZJ5A 3OX3A 5TRTA 4XGKA 3ZOZA 1XEXB 5K6TA 4R8SA 1AHPA 2HCTA 4ISCA 5K8UA 1M5RA 1BWQA 4B6QA 2EERA 1RADA 1X7WA 2IFTA 1XC7A 2Y93A 2LIPA 3HU2A 4JKOA 4KBYA 4KOAA 4KU4A 4LSZA 4NZ9A 5AW6A 5EIXA 3IAXA 2HOQA 3LXMA 2EJBA 4U7FA 1POXA 4ER5A 2GHTA 1RJFA 4Z49A 3ZJUA 221PA 2AEEA 4HXYA 4AECA 5JJ5A 1E6EA 3GJ3A 1MIOA 1Z0JA 2GCGA 3FVRA 1OFUX 4AU1A 4UPDA 4ITVA 5ALRA 4QBHA 4OXKA 1HZJA 1JRLA 4PIPA 5F5LA 1I01A 1LBSA 5GOZA 1WXXA 3ZDAA 5JARA 3N7AA 4G8JA 2QLNA 1I9GA 2ADFA 3TKAA 5L4SA 2JHCA 4Y1FA 3DSRA 1FTYA 2RJ3A 1YDEA 3BWBA 3L7AA 4PHTA 4RV9A 5KX5B 1DDGA 3KV1A 1BE0A 4M1QA 5K3OA 3A1VA 3KQSA 1ZIOA 1R6BX 2ZIXB 3KCNA 1Y1LA 5E0OA 4P80A 1JG6A 1NRJB 4IDAA 4O59O 2IXEA 4WXPA 2WABA 1KAGA 2WM8A 3OZVA 4E15A 1J2RA 2ZYIA 1RLOA 4KYTA 5KB3A 4MQ4A 4HWGA 3TJRA 3ZU5A 1SFRA 5J4VA 1EQAA 3I04M 3MTIA 4RNDB 2REXB 2Z4TA 3DKRA 3GLSA 3MGAA 1AGYA 2KE5A 4QG7A 4WKPA 2IV2X 4AN1A 4LDNA 3KNZA 1JHVA 4N3GA 2BFNA 1KNQA 2BGIA 5E4TA 4AZ3B 1OY1A 5IHXA 1OX4A 3RODA 1DKUA 1OLUB 3DG9A 4DC1A 2OCDA 2Q4DA 2D0IA 5EIBD 2PSSA 1HT3A 4M9RA 3EZXA 6LDHA 4W5OA 1NX6A 1P5ZB 3SR3A 5CU7A 1UEIA 5F5NA 2WG1A 1C1DB 5TLSA 2PNFA 1OX5A 4EARA 5HRAA 2AOWA 1Z6YA 2V3CC 3MFQA 5JTUA 1HYHA 4GKKB 5HJ2A 1Z8DA 1Q91A 5A9SB 1X8JA 3I62A 2C2KA 4NDNE 1JEQA 1LLUA 2BN4A 2OHJA 4HFJA 2NYUA 4MV6A 3C16C 4U6SA 4ETMA 1FFBA 3TAHA 4Q7MB 2IELA 3I23A 4WCVA 4L22A 5CM8B 3GEDA 3BCSA 2ZYVX 3WLQA 4HMPA 3CNLA 2ZWPA 4OY3A 3MC1A 3QV2A 1V41E 3ED1A 5EJGA 4E22A 1M10A 5KVAA 1J0DA 4EUHA 2I0FA 4ZC8A 3FTFA 3RYIA 3STTA 3RFXA 3HJHA 3ZJVA 3H5VA 2C4HA 2ONCA 1NAIA 1I80A 2OCLA 2PXXA 1V45E 2BKLA 3F6CA 1P0CA 1I4LD 4BNLA 1XZBA 4DA7A 4EUSA 5JZOA 4UTPA 4DR6B 2R2AA 3B9RA 1RHRA 3FYUA 1Q3KA 4MH0R 4RX1A 5K09A 2A0YA 1PDWA 1P1CA 1EG7A 2X0NA 1L0BA 3OPXA 4KXXA 2O8FA 4WNAB 10MHA 3FX2A 4J0QA 4LFAB 4L9RA 3M5WA 4ILKA 4ZAVA 1L1RA 5TQ0A 5AH0A 4DG9A 3IEPA 4OK3A 3QK7A 3QOXA 2HA5A 5EHGA 1VSBA 1SBZA 1HGXA 3KLBA 4WQMA 5CCBA 1DAGA 4UM7A 1K63A 1W29A 3D64A 2IHUA 1U28A 1CJCA 3RSHA 5BXQC 2FF5A 1G9SA 1M7HA 4HT3B 4ZYVA 3MCTA 1O0CA 3M3HA 1TO1E 3OTIA 3DAYA 1IPFA 3E82A 1ZUWA 4DCTA 1IZ0A 2QN2A 4F96A 3HGMA 3IOCA 1PR4A 5D84A 2WJWA 1NDQA 3K70B 4IDNA 1S2OA 1G19A 5CVTA 2OCAA 4FDUA 4CM9D 1V0JA 3HRHA 5L3ZA 5JW6A 1JBQA 1QMPA 4AF7A 1U8AA 2O1WA 3S5JA 1K7SN 3GFOA 2Z9BA 1WXWA 4O8CA 4RVOA 1VIYA 3OQBA 2PIDA 3JASB 5JI2E 1HLGA 1DC5A 2A4KA 2DY1A 2FPUA 3OWXA 4QNMA 1KR5A 4YRKA 4MRRA 4XTRA 5JD4A 2HHJA 3PDUA 4RA6B 3UOWA 2IXGA 3J7TA 2O2YA 1IHOA 2Q9CA 1HLFA 3DUFA 4AN0A 4D3YA 4WFIA 1EDEA 4X90A 1N5MA 2LGJA 2TMGA 3U3KA 2P3OA 1QM5A 2C2OA 3GFTA 1XDUA 4YJ3B 1R37A 4HUQB 1LK0A 1FNBA 1MD9A 4JZKA 3VR6A 4DQLA 2OQRA 3K1ZA 3NORA 4G67A 3TWOA 1L4UA 1PWZA 2H2FA 1EDZA 1V6CA 2GK3A 2NAFA 5DHFA 4KNYA 1QF6A 2WJHA 3CH6A 3GLRA 2IYAA 1D04A 3IJ5A 3EX7C 4UHJA 4BKMA 3LTNC 1VJRA 4ZICA 2X9GA 2Z3WA 4UEQA 2X8JA 2YOFA 4ITUA 3TVYA 4PGFA 5AUPB 3TCXB 4NIMA 1W9MA 3F1KA 4MIEA 4RK1A 2H3HA 3WFIA 1N1GA 2CV2A 3LJKA 2RHLA 5AW5A 4HGYA 3GLIE 1CZKA 3RR2A 5BR8B 5TSDA 3ANLA 2PKCA 4S24A 3VUEA 1D6MA 3ZS8A 4TRRA 2V7QA 3EIWA 2BBWA 3UV7A 5L4NA 3O47A 4B7ZA 4D8YA 5T41A 2IXAA 2CUTA 2EX0A 2R6CA 3NC0C 2V03A 5BNTA 3U3ZA 3ZIAA 3TDMA 1JQDA 4AWBA 2OCYC 1XJCA 4OFBA 13PKA 2G72A 1BXGB 4Q5IA 4X95A 5CX4A 2VC2B 4ED9A 3BQNB 4RMJA 1PL7A 4C01A 4DLUA 1HE5A 1KI9A 2VHQA 2DPMA 3THRA 2FWMX 4JD5A 2ZTVA 4CKYA 1RHMA 3UN1A 3SLGA 1OVMA 2GM3A 3QXSA 4WKOA 3KDPA 1R74A 4TWRA 5EUCA 4CQLB 4J0EA 5DNCA 5KNCA 4MUIA 1PWXA 1ITZA 2OORC 3K5HA 3KX2A 2J30A 4IVRA 2ZWIA 4KDEA 3WBFA 5C53B 1FS6A 4CN8A 1QGZA 3HSSA 2JJ1D 1Z2EA 5ESXA 1EWVA 3JWHA 3ROTA 3U1TA 4OP1A 1A27A 4YUYA 3GZTB 5DKFA 4XE5A 4BLOA 4X44A 5T5QA 4F72A 1XZDA 2VT7A 1NLYA 4IMJB 3PEWA 5CLGA 1NQ5A 2HWKA 4Y2SA 3ZHOA 1UT5A 4ZYTA 5A62A 3ICQB 2YRXA 2OZKA 3MYRA 4G56A 4TLLB 1JX6A 1D4FA 1DUVG 2VTDA 5H70A 4BFXA 1N8SA 3V7FA 5DNDA 1OKKA 1LPNA 4QLAA 1A8PA 1PP4A 3BM5A 3EA4A 3Q2KA 1VSUA 2H00A 4XVHA 3V7YA 3WK8A 4YJDA 1OH8A 3GP8A 1SQ0A 2ZDGA 3TZKA 2XUZA 1X15A 3K6SB 2BEUA 1FFXA 1DINA 4P4GA 3ZWOA 3A3OA 3KJIA 3KHUA 2XGGA 1KHTA 4PYKA 1U8FO 1FRFS 4BO1A 5EPEA 1UKCA 1TYBE 3NTXA 3HJGA 1SBTA 2QRNA 2WSLA 1W49A 1Z4PX 4V1CA 2Q6TA 4C0HA 5CFQA 3BEDA 1WUTA 5B3KA 2IH4A 3LCUA 4YRFA 3N87A 3HL4A 2FSFA 3CH5A 4AW9A 1DG1G 1IN7A 1SU4A 6REQB 3LP6A 4XA8A 4ETIA 3A2KA 3R75A 4F8JA 1WO8A 3OTGA 3E9QA 3IT2A 5JJBA 5AKIA 1SUBA 3ZZUA 4DIUA 2HV9A 4TX1A 3HDVA 3GVXA 4EQZA 2VDWB 2W83A 1H3NA 3DQQA 1XFAA 1EZ4A 4LYFA 3U26A 3W8EA 3ZV5A 3E58A 3KTDA 3LPCA 2PGLA 1JSRA 3V4VB 4B6FA 4RZIA 3LT2A 2JASA 1AQJA 1L7QA 2Z2IA 4MMXB 2F90A 3H8SA 3AVOA 5KREA 2WUDA 1T35A 2UAGA 1CFZA 2R6FA 2WTEA 4CM4B 2B83A 2FFHA 1Y9JA 2K2QB 4I55B 5DJ5A 1G8KA 1Y4DE 1EFLA 4BJHB 4E46A 4I1SA 2C2XA 5IYZA 3S8YA 4YONB 3M6XA 1K0UA 1XVIA 5DNEA 1Z6TA 4JP5A 2VJBA 3WGTA 2IYPA 4G0WA 5ECYA 4JHLA 4P7BA 2ERXA 3TW0A 1T6NA 2B20A 2X2FA 2F1IA 3ZHCA 3FGOA 1G3IA 4R2KA 3IUNA 2MYTA 3UEOA 4QTTB 1B6SA 2I4OA 3PS9A 1NJ8A 2HPHA 3H5NA 4KQCA 4K6CA 4MTCA 1IATA 1NG1A 2DUUA 4OQQA 4IXNA 3EXAA 1PTJC 5CITA 2BTQB 3OO0A 3A28A 4BFSA 1EP3B 1MAUA 4IIFA 4Q1FA 3ABOB 3B1XA 1CVLA 5D3MA 5DTIA 2X6TA 2GBIA 5J1TB 3GC6A 2E7ZA 1T10A 4UW9A 3H3XA 3R8XA 2EV9A 1GN9A 4BU1A 4XUCA 1H23A 1WLYA 3KP1A 4DCMA 1U0TA 3AUXA 7REQB 2PUVA 1P2UA 1ZUD1 3EODA 3IAFA 5BOSA 4K9MA 1XNJA 1OA0A 3OCYA 5HDQA 1RRVA 1RCTE 1TF2A 1XF9A 5JC8A 3E70C 3FG9A 3KYJB 3F6SA 3WHIA 2DCMA 16PKA 4ZZ3A 4E30A 4DLLA 4POAA 4LF7B 4MWEA 3QVJA 4GXTA 4N6GA 4DLSA 2ZVDA 2XMQA 5GADl 4AMZA 4XYEA 3FYTA 3MLAA 2Q9BA 4DZZA 3ZE2B 4X66B 3ENQA 4N54A 4K8OA 4JODA 4NDZA 4PBTA 5TB5A 2VR1A 3F3SA 4G5RA 4XQEA 3WHPA 1SCNE 4PICA 3ZI0A 4DNOA 4Z7JA 3U44B 1FYXA 4Y2GA 1F2TB 2W6JA 4GD3Q 3VR1A 5JISA 1YTUA 3TOCA 3LPMA 1NR1A 2H4FA 2N42A 5AO9A 4A1FA 3QFTA 1UBSB 4BFYA 4DBZA 2H4WA 2YN4A 1Z6PA 2KPOA 4PAOA 1DJPA 3ZNOA 3A1UA 5CDUA 2ZAMA 2NAPA 4JKIA 3EIQA 3Q98A 3RC1A 1PJQA 4V0SA 4GX1A 3UJCA 2CNOA 1KQ3A 1QX3A 1X1RA 2HA2A 4MEBA 4RPKA 2DPGA 1N6PA 2SKDA 4EL0A 4BZXA 3WQHA 1T8SA 4BB5A 4JQZA 1IYZA 1EZ1A 4HQ0A 4L28A 1W5SA 1M34E 1IWOA 1ISFA 1DO0A 1KVTA 1AXEA 1QAMA 1T43A 2QJOA 4C2AA 4PS0A 3EPJA 2NO6A 3AY0A 1I7LA 4FYJA 3OA2A 1QK3A 1QRAA 3UK0A 1YBMA 2WVHA 3TG8A 1M8GA 4PAMA 4KQ6A 4ZI3A 3JTEA 1EGQA 2RIPA 3OKFA 4NJEA 3ZHQA 4M0FA 1JP7A 4JX9A 3DFZA 1BG6A 1E9SA 2A6PA 2PFKA 4IOKA 3ONDA 4YRMA 3TNFA 2V97A 3M1YA 3CWQA 4HX9A 2BFAA 1UWLA 3W1EA 3EGOA 4ZFNA 4LSMA 1AIPA 3EA5A 4RYLA 4BVBA 1X7HA 1A2QA 2ADMA 3Q7EA 5LQCA 2JD1A 4EKGA 4B75A 3VR5H 1B1AA 3RT7A 1I3NA 1KEEA 4KHPB 4MWOA 4OMUA 3SJCA 3RJMA 3SAJA 1IBLB 1BHSA 3U3MA 4FEYA 4MV9A 4AKEA 1OI7A 1S3IA 4AZ0A 2Q6VA 4PPFA 4TXMA 2OPHA 4HO1X 1USGA 3EVCA 3MUEA 3IO5A 3HPQA 2JVKA 4ARSA 5BQXA 3I5XA 3TSZA 1KYZA 5JSUA 3NB0A 2FEPA 3K0KA 4Z2AA 5K20A 1OKKD 1V3VA 1YOVB 4BQQA 1EFRD 1UMDB 2FZVA 2R7LA 5DT9A 5P8WA 4Q7QA 1YJQA 2D2FA 3EWAA 3KEOA 4MVJA 4LOIA 5KTKA 4JJ7A 4TMWA 2QE7A 5ED0A 1FUKA 1VJTA 4V38A 4E5MA 3BFJA 3T34A 2ZM6B 2HREA 5CJ2A 1KKMA 1E7QA 1IN5A 2XIQA 2JLQA 3GP5A 1G8GA 2QT1A 4NQZA 4PC6A 4WK4B 5E4YA 1E2DA 3SC3A 4HB4A 4MWZA 2H7XA 3AXTA 4Y6GB 4IW3B 3P2IA 1JJ7A 3V7UA 1E9RA 2O0MA 3TQTA 3ZK7A 5JYCA 1WHTB 3LE8A 3IT0A 1I4EB 3X1DA 2A86A 4EBFA 4L4XA 3EZ2A 3IP7A 3VJRA 2AQKA 5EYPA 4DLNA 1BE1A 4ZT7A 5TIIA 3QX9A 5H9VA 2DR2A 3SZUA 2Y0BA 4XX0B 8ABPA 2FZLA 3KQLA 1DCMA 2AN3A 4FYHA 4DWOA 1PSZA 5HNKA 4LRSB 1AHNA 3ZU4A 1Q14A 1X14A 2OHXA 2UUAB 2XWSA 3VSCA 4RK4A 1GGHA 4D3XA 2JI6A 2ZR0A 1F1JA 4UNNA 5LIPA 5ERYA 1RWKA 1BSVA 4EYOA 1RCUA 4AZVA 2IX9A 3KWJA 2QMQA 3DV9A 3NV7A 2UXCB 2KBFA 4CIVA 1ODCA 3NLLA 1ZCFA 2QZJA 4EI8A 4B0PA 3H0CA 3IEXA 4LTDA 4Z53A 1U1IA 5F1YA 5AW2A 3ADKA 5ARCA 5HMLA 1X7ZA 1OPXA 4QQKA 3U7HB 4RZUA 3O8QB 2EFGA 1U2RA 1Z2NX 1Y6RA 3A6LA 4P81A 4LHVA 4OKIA 5KHAA 3RHFA 5ELXA 4AM8A 1GAXA 2OENG 3KYBA 1CEEA 1BXRB 2FCAA 3IO3A 3BXZA 2OC4A 4IUYA 5ALEA 1K9SA 3W7AA 5KYWB 5H80A 2NM0A 1X86B 2OLEA 1SXJD 3FH0A 3PFHA 4NBRA 1N7IA 1Q7EA 2HHAA 2ORIA 1C9EA 3VC1A 4ALIA 4F3CA 2VDQB 3DZBA 3L7YA 4D4IA 3K1AA 1PR0A 3L93A 3RRBA 5K01A 3M4NA 1POWA 1A7JA 1QHHB 4QATA 3QU2A 1IQRA 1AKTA 2UZ1B 2HCBA 2ZAGA 5DX8A 5FD8A 1I4OA 4Z7OB 5IAAA 3RVLA 3EVDA 3SVLA 2XJ4A 1OREA 2BGKA 1PF7E 4XASA 1NATA 3BX1A 1G20B 2VPXA 4UHCA 4L57A 5IYZF 4RVFA 4KDFA 1EG2A 3DTTA 3I6QA 2ONYA 4QXOA 4BHTA 1UKBA 2SCUA 4E33A 3W5BA 1QH1A 1DRJA 2ECPA 5BORA 5JBIA 3T1YB 2YVQA 3O9ZA 3I01M 4DL9A 2VNAA 3QHQA 4Y67A 1FDSA 3GA7A 4EK9A 5C1DA 1T5OA 5UKDA 2Q3MA 2H1VA 2P2ZA 1J8DA 3CUYA 2IGTA 4HRVA 1QWSA 2ZCUA 4DQXA 1P0PA 3ZX4A 2CL6X 4CKBA 3PXUA 3MPOA 4R69A 2W6JD 4J49A 5EP3A 1Y89A 5J4LA 4ZRMA 3NT4A 1DQRA 3ESDA 3GK3A 4WCFC 1Z08A 3UC9A 1PYGA 2E0IA 3F6YA 4JYBA 2X8AA 2NVOA 4G1UC 5D7BA 2C92A 4TV8B 3TIVA 4DKJA 1KFBB 1SRQA 3H97A 3PX7A 1OWNA 2QQFA 1EK5A 4QJIA 2ZQZA 4M1WA 1REQB 3ZU3A 1NSTA 1B0AA 1AQIA 2FR1A 3M9XA 4R81A 1TZMA 2GQ0A 2PM8A 3AEQB 3DCIA 6AT1A 4HWOA 3DC2A 4MAFA 1OYYA 2AMJA 2FW6A 2X42A 4FFSA 4G5YA 4YDRA 4CE6A 1RRGA 3KHTA 2VAXA 2OWDA 1O4WA 1XVVA 3UJ6A 1YZYA 4AMVA 1TUBA 1M1YA 1KGSA 3HCPA 1K7CA 3EB9A 4BB0A 3AY3A 4L15A 4UHDA 1J00A 3DKVA 5B5SA 4X20A 1W46A 3D5TA 2C3YA 3GJ5A 3O2JA 4QOHA 3LQ1A 5KIAA 2VF5X 5KHLB 3LY8A 1R0CA 2WQ7A 1JI3A 1FB5A 1QE5A 4RL6A 2R6GA 1GSIA 3PHJA 4ZMRA 1LWNA 2AJDA 1G21E 3HR8A 1QV7A 5DYTA 2AMVA 4E1VA 1TKRA 3BL6A 2AX4A 4DE5A 3BFKA 3OQMA 2OUKA 2XR1A 3ER6A 4M1SA 3WP0A 2ZRLA 1ZMRA 1DBQA 5MGBA 1UOEA 1A04A 3BOSA 3QLTA 1UKVY 4ZQCB 1NJSA 3HSKA 3UB3A 5KJCA 4RZSA 3AV0B 4CM1A 4C5AA 4C3UA 1BXZA 2LZ0A 3JQDA 3DV2A 1BEZA 1Y3AA 4XQ0A 3TPFA 1Z74A 2XB9A 3JQAA 4EGJA 1KAOA 1SOAA 5M04A 5LU9A 4D42A 2XWPA 4CLXA 1QHIA 2HXGA 4KODA 4CLRB 4B3BA 3JAKA 1P7YA 3OFJA 3U3RA 1M0TA 1EAMA 4FINA 1FRQA 1WUKS 3ROZA 4U8GA 4MI6A 1FBNA 1W52X 4ZALA 2Z1NA 2BEKA 2YYSA 3OCUA 5G4KA 3VPDA 1PN3A 2P9GA 1YA4A 4Z5XA 3O8CA 3F67A 3OG9A 1AB5A 5IXYA 3R7DA 1GEEA 1EYZA 3ID6C 4KWIA 4Q12A 3TBKA 3T4UA 1D1SA 1QDEA 2CFOA 4JENA 1TYCA 1AHIA 2EP8A 3LHIA 5D7NA 5HDBB 2OR3A 1SU8A 4KR7A 3TLJA 1LEHA 3IMGA 1RBYA 1S2LA 2HCFA 2O59A 2NLOA 2HJVA 2P2DA 2Y71A 3OT1B 5E1DA 4CT4B 4UBOA 1B6RA 1DELA 3E7XA 3L0YA 3OMXA 3ZVKA 4NMWA 4D9BA 5K0BA 4RTOA 4E88A 1JUDA 1O97D 1IU9A 2BW0A 2PGXA 1KSGA 1KTIA 4HH3C 2GASA 3ADOA 5LBUA 4G85A 3RVMA 2JGDB 2R00A 1SK8A 2KB0A 4D9IA 1WSDA 2CT8A 1UANA 1OTXA 4MVJF 4GZ5A 4K9NA 2ES4A 3T38A 4M88A 4PFJA 4XGIA 4B34A 2JGRA 4MCIA 4QX6A 1GAWA 1JQEA 3ZCSA 3G9TA 4YAKA 4N76A 3UGTA 1I51A 4CMEA 2W6NA 4XPZA 5G02A 1PK7A 1WPRA 3NNNA 3RVJA 5L6LB 4QD3A 2PS3A 4O02B 4A0GA 2PSEA 1F2UA 4JK3A 3DXFA 3G2NA 1SUCA 3D8NA 4C6RA 3U2QA 5IWAB 1Y5LA 3AJ8A 1K6IA 4UEWA 4WMLA 1QBKC 3PUVA 5TMEA 4PYOA 3TDKA 1ZIYA 3PYLA 4NPCA 5JO9A 2WV9A 2WTXA 3D6AA 2X7JA 2WU0A 1YNSA 3A1DA 1Z18A 4IHQA 4RFVA 4BWFB 3QWBA 4AO8A 4XVCA 2H52A 5CB6A 4RKWA 2IU4A 3QEKA 3PQDA 2NMVA 4JJFA 1NBMD 3OJWA 2PSFA 1ZISA 4OUDB 4QPZA 3L7CA 3F3MA 3ZGNA 1O9HA 1Y6FA 1HLDA 1PD0A 2N46A 4W9NC 3UFXB 1TZCA 3LI2A 2GAJA 1XDGA 3FOEC 3EK2A 4JUCA 5E8RA 2GHRA 2WUVA 3RUIA 2Q0XA 2BV3A 1ZC3A 1IOLA 2G1KA 1FDVA 2J32A 4DQ0A 1A98A 1O96A 1OZAA 1T2VA 2AOXA 2QAGA 1VPTA 2X58A 3BH6A 3NRJA 4H0CA 4M89A 2Q8NA 3RUHA 2IHNA 3H2SA 5HF6A 1LTKA 3IUQA 5ALQA 2W6OA 4YASA 1U99A 2QSJA 3G85A 3E7PA 5JNVA 4X1IA 4G84A 1XOIA 4EF6A 1DEKA 4J07A 4NNJA 4TTVA 4X00A 4X97A 2HJSA 3A32A 1ZOOA 2I2CA 2FMTA 3IOEA 1VBKA 2EBHX 3CISA 3O8LA 4LY6A 4NK5A 3FZEA 3GYBA 3PF9A 4HFMA 4PRYA 5IJWA 1U1GA 4ZWNA 1M5UA 1Y6JA 2HJRA 2BY4A 2ZJ1A 3BWDD 4PZ9A 5HOQA 3GLKA 5C31A