1Z6ZA

Crystal structure of human sepiapterin reductase in complex with nadp+
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
264
Chain Sequence
LYFQGHMLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Sepiapterin Reductase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 92
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z6zA00
3VPGA 2RIRA 1HYGA 2BD0A 4BNYA 3NAQA 1IULA 5FI5A 2B0JA 3INTA 2FWMX 2UUPA 2YV1A 4Y6PA 2TMDA 3H5NA 3GNTA 4L9RA 4RVFA 4Z0PA 3FWZA 3OIFA 3ZDFA 4Q3AA 1JTVA 1MXFA 3ETDA 4FR5A 1GV0A 2OZPA 3CXRA 3A06A 3OBBA 1G1AA 1WLYA 2WTBA 3DFZA 4J9VA 4JGBA 3QWFA 4IXTA 5I9MA 2OL4A 5JC1A 4JJIA 5KTKA 2IEBA 2W90A 4PFJA 4AJ4A 3VAZA 2C0CA 5HWSA 2YYYA 4E2ZA 1ZMOA 3OECA 1Y7TA 4J4HA 2VHWA 1UP7A 2ZQZA 2CF5A 2FY8A 1ARZA 5U9CA 3R3JA 1Q0HA 2X8LA 1TA4A 3QVSA 2GRAA 4UEOA 3L4BA 3ULKA 3WJAA 3RAJA 1XEAA 4NFYA 3WR5A 1NHWA 2YY7A 3V5NA 4E6PA 3LC2O 3DEYX 4FFMA 2EGGA 3ZWMA 4OOEA 1T4DA 3ETEA 5IAAA 1GTMA 3I9NA 4DA9A 4CMEA 1YO6A 2X0RA 4RPHA 1ISJA 1LUAA 3JD2A 2O3UA 2RCYA 1EVIA 1G0OA 4B3IA 4XIYA 1YDWA 4DC1A 4B7CA 2CZCA 3TFOA 4PZCA 1XELA 3ZU4A 2I5PO 4CLHA 1I5RA 4F6LA 2OP1A 4NJOA 2A35A 1W0CA 1KC1A 1YDEA 3PJFA 4GVLA 4R69A 4I5DA 4F45A 2NQ8A 5JW6A 2NVBA 2WDZA 1ZBQA 4CLOA 2QG4A 1B8UA 1OC2A 5CP8A 1X0VA 3ZZNA 5TT0A 3OFSA 4XGKA 1YGYA 4MIOA 3GEGA 5B4TA 2W98A 5JY6A 3P2YA 3HN2A 2CDCA 4GLLA 3X2FA 4TRMA 2VZ9A 3S8MA 1CYDA 4J4TA 3BA1A 5CEFA 1E3JA 3NTRA 4OJNA 1ADFA 1HE5A 3IUSA 3WB9A 1MX3A 3AFMA 3PLNA 1E5LA 3GC6A 1PGOA 3DHYA 1JW9B 4MVJH 3RUEA 3DAFA 1DFGA 1M2WA 3GPIA 3KO8A 4CV2A 4M86A 2NVUA 5JYDA 3VDQA 3UXYA 1MV8A 4GSKA 4CMCA 2F1KA 2X5KO 2A94A 4EYEA 4ZICA 5BSHA 1E0DA 4NBUA 4CPDA 1R0SA 1ZNQO 2Q1UA 4PLYA 1ZMTA 5JDCC 3JQBA 1YB1A 1FXSA 4E0BA 3HWRA 3DMTA 1IE3A 2G17A 1B8PA 1Y8QB 4DWVA 5T64A 5CFZA 1MB4A 4EGFA 2IXBA 1M66A 1NPDA 1NTOA 4UREA 3RJ9A 4MVJI 2D0IA 4W4TA 4AJPA 3JQ7A 3K9QO 4F6CA 4D43A 4XGNA 4EJMA 1A7AA 1ONNA 1LDGA 1DIGA 3CZRA 4XKJA 4GPD1 3TJRA 2WJPA 4X54A 2CDBA 4BGVA 3N58A 4CM7A 2V6MA 2VZ0A 3JTMA 2XOXA 4ALIA 3T7EA 3WBFA 2PFGA 1LDBA 4MVJP 3RQSA 4EEXA 4BNLA 5TIIA 3PHIA 4BO0A 1KYQA 3ZHXA 1ENOA 3PGJA 1KOLA 4YRAA 4CLRB 4I08A 1VKNA 3E6AA 1K6XA 4AL4A 3GR6A 3UICA 3LC1O 2VWQA 3NKLA 2XPCA 3OJOA 1DAOA 4ND5A 2EWMA 3ADPA 1UXKA 1X15A 4FJ2A 3ZWNA 3GDFA 4NJMA 2HRZA 4RPLA 1PL8A 3RASA 1GZ6A 2RH8A 1JWAB 4I9UA 5DT9A 3WOHA 4GAEA 4R5MA 1U7TA 4Z0HO 3K92A 4P4LA 4CMHA 1A9ZA 3WX0A 1V3UA 3IP1A 5JE8A 3RUDA 1JAXA 3WWYA 1KS9A 2B4RO 5B37A 3E82A 4Y67A 1WMBA 1NQAO 4NQZA 5BSEA 1LX6A 1YH3A 4JJFA 1Z6ZA 1DIRA 3VH4A 1DHRA 4QQRA 3KBOA 4CUKA 2P91A 3WSWA 1SC6A 1E5QA 3GA0A 1X1EA 1SBYA 2EERA 3IJRA 1YL5A 4ZJUA 2HDHA 4PLVA 3JYNA 4Q3EA 3S2IA 1S6YA 1T25A 4JROA 3HHPA 3NV9A 3GF4A 4UUOA 4ZA2A 5I7FA 1NVTA 2X22A 1SMKA 3KRTA 3PHGA 4WEQA 5DCUA 5DN9A 4O1MA 3ENKA 2ZATA 3ZNNA 1FK8A 4KZPA 4YJFB 5TT1A 3W4IA 2EF1A 3CTMA 5B1YA 1FDTA 3D4OA 4GKBA 3ZU3A 4BGUA 5CEJA 4OXNA 1MP0A 2H6EA 2BI8A 3K5PA 3GUYA 3VH2A 1PIWA 1GQYA 1V8BA 4D3SA 3Q3CA 4RPKA 5JCXA 3Q0EA 1ZK4A 4PIVA 3AI3A 2WYUA 4YAEA 4ALMA 1EFLA 1Y81A 1VLLA 3QJ5A 3QQPA 1E1LA 3KOUA 3NJ4A 3O9ZA 4PLGA 3AM3A 4Y8VA 2OXIA 2VUUA 4CQLB 5KOIA 1FDSA 2VRBA 4U6SA 3DOCA 5DP1A 3GFGA 4XYGA 3RCBA 4RF4A 2JFFA 2UV8A 1PGPA 5MDHA 1PQWA 1YB5A 2PGDA 2V6BA 2W4QA 3DWFA 2VT3A 3I9OA 3PVZA 2FSVA 4CMEC 2PGJA 2X4GA 3WNVA 1P1KA 1ZK1A 4YYZA 4RF2A 3DBLB 1P1FA 2ZYDA 3O8QA 4J0FA 3DMYA 3ZHZA 4BHTA 4FFOA 1KVSA 2HMTA 1LTHR 5FFFA 1YKFA 4N5MA 2YHUA 4MO2A 3GVXA 4DLLA 2XAAA 2EP5A 9LDBA 1Z45A 3PDUA 1JKFA 4NBWA 4PLZA 1SEVA 1MUUA 3K2EA 3RJ5A 4FC6A 4MOWA 2UVDA 4YQZA 3BMCB 2H63A 1LDMA 1I36A 2GD1O 1B15A 4BMNA 3PPIA 3KEQA 5L7YA 5BNIA 2YFHA 4B79A 1LDNA 5HS4A 2O7SA 3PHHA 2FPGA 5G0UA 4JBIA 1B3BA 1U2DA 1ONOA 4MVJF 5G4KA 4GH5A 4RLSA 4P4GA 1YQGA 2ZKLA 2OHXA 3TFQA 1ZUD1 1T26A 4RDIA 5BT9A 3R3SA 3MEQA 5TLSA 3JQBC 1F0YA 1LQTA 3AUAA 4UVHA 1HETA 5ENDA 3FI9A 2X23A 2O4CA 2NNLD 1GQQA 3I9MA 3ROQA 5AOVA 4O0LA 3V1UA 1LU9A 1ORRA 1Q0QA 5CPFA 4J4BA 4XB1A 1F17A 1XQ6A 1R6DA 3JCZA 4FD3A 3RKUA 5TF4A 3BZUA 4N5LA 5I8ZA 4DC0A 3W8EA 4AJJA 3WSVA 3RBZA 2HJRA 4KOAA 4A0SA 5I9LA 5JDCA 1RM4A 4PCVA 5HBRA 3EHEA 4FJ1A 4ZQFA 3DMTC 3HFSA 4ROSA 1LDYA 3ZWBA 4BB5A 2X7HA 1CETA 1H0KA 1DO8A 3JQCA 3WIDA 1UP6A 5JSFA 1UP4A 1AN9A 2DBZA 4R9RA 5JMWA 1DPGA 1HL3A 1NVGA 3DZIA 4MJLA 3ZNOA 5ITWA 4NG5A 4K6CA 3AJRA 2FN7A 4YAIA 1Q1NA 2CD9A 2WMDA 1Y6JA 5KCZA 4JIGA 4Q3DA 3Q9NA 2P68A 3N7UA 3S2FA 1OOEA 1B7GO 1O95A 2AW5A 4GL4A 1ZEJA 2RH4A 1O0SA 2BFMA 2JCYA 1WXDA 5K6AA 3R1IA 3ENNA 4A03A 2P4HX 3FR7A 3H9QA 1E1NA 1QMGA 4YRBA 1SB8A 1E7SA 2QRJA 4E2WA 1FDUA 2F00A 4TKLA 3W8DA 3ZGYA 4XYLA 1ULSA 1UXIA 2DKNA 2H1SA 3U4HA 4NJMB 3JQ9A 4BNNA 3LU1A 3V2GA 4OSPA 1GCOA 1I3LA 1ZSNA 2B4QA 3JD1A 1AUPA 2UDPA 4RQUA 3IC5A 4BO5A 5A5FA 4U0JA 3KYBA 1K0UA 1VJTA 2B5VA 2BMAA 2BRUA 3GH3A 9LDTA 4YJDA 4OQZA 1FF9A 4R9SA 5KJFA 3R6DA 4R41A 5JS6A 1WPQA 1TLTA 3KYDB 3DAGA 4J0EA 5JO0A 4WJZA 1DEHA 1NR7A 3TWOA 3C85A 5T57A 2JJYA 1IY8A 4ZU3A 1E3LA 4XR9A 3BHMA 2VRCD 5FF9A 3SBOA 1H93A 3EZYA 3MCVA 1LJ8A 4CR7A 2P2SA 3RFXA 2O4UX 5EIOA 2V7PA 1ISMA 4EBFA 4UVIA 2ZTMA 4UVEA 1LLUA 1R15A 2G82A 1R4NB 2P5YA 4K6FA 4DGSA 1EBUA 1YOVA 3D3EA 4LRSB 3VH1A 5DOVA 4KWIA 2FR1A 1ZH8A 3R0IA 1ENZA 1M6WA 3VTZA 6LDHA 3P19A 3G79A 2WWRA 3QWAA 3BMNA 5EQDA 1BSVA 5DBFA 1XR3A 2IXAA 5AQ1A 2HK8A 1H2HA 2HUNA 2W2LA 4B8ZA 4E5NA 2OBYA 3E9MA 2Q1TA 4HKTA 1NWHA 1WDKA 4JCOA 3WICA 4DVJA 3FWNA 3OH8A 3JQ8B 3AFNA 1NQTA 2JKVA 3F9IA 1WWKA 2Z5LA 3QWIA 4XQ9A 4G65A 5C7LO 2Q4BA 3G1TA 4RO0A 2DLDA 4KMSA 1Y8RB 5F21A 3FNEA 2JD0A 1ZJYA 1H2BA 1TEHA 2JD1A 4ESOA 1GYPA 3AUTA 2B36A 3GOHA 4E2XA 1ADGA 1L7DA 3ORFA 3GVHA 2O2SA 2EW2A 3RI3A 3FTNA 1U8XX 2NTVA 3GG2A 4CM6A 4OQYA 4GX2A 2VUSA 1BMDA 1U2GA 1BDMA 2QZ9A 4CR6A 2DPGA 4CM9D 4DLAA 3G49A 3LT1A 3H3FA 2J6IA 1CF2O 1F8FA 2IZ1A 4TKMA 2GCGA 4GX1A 2FZEA 1DDOA 4WLNA 1ZSVA 2ZJ0A 4J1NA 2VTEA 4TVBA 2WM3A 2A92A 1JKIA 4Q3NA 3IUPA 4KDEA 3MWDB 3RSHA 5COAA 4GWGA 1DC5A 4FSHA 2CMDA 2B37A 3F6YA 3HJAA 2EG9A 2X5OA 1LSJA 4Z9FA 5CDYA 7MDHA 1HRDA 3PWSA 4IS3A 3W6UA 3LZ6A 3PFWO 3PP8A 5ICMA 4FFLA 2DM6A 2BGLA 4QTZA 1B0AA 4W7IA 3IIEA 1B14A 2Y05A 1PSDA 3HDQA 1UAYA 4ND3A 2XF8A 4DLBA 5CEEA 2JD2A 2CY0A 1N2SA 5HS6A 1Z7BA 2B35A 3WGTA 1PJBA 3HG7A 1TT5B 4FFNA 4XEHA 4BNKA 3VC7A 5U1PA 3FBTA 3ICPA 4BKUA 3JQ7B 1ZXLA 4MP8A 2E37A 5ER9A 2JHFA 4J7CA 3PYLA 2NV6A 5K6AC 5F1PA 1YOVB 4R1SA 4YJGB 5L4LA 3DXFA 4OXKA 1PR3A 3FCOA 1VM6A 3DBRA 3GNSA 4P4NA 4E31A 1SCUA 4WOJA 4CR8A 1C0PA 3GDOA 2QRKA 5KJ1A 4FFRA 2C20A 5JAMA 1RKXA 2XXBA 3OEWA 1XLTA 4WCFA 4HV4A 1VC2A 4XX0A 5LDHA 3O03A 2NTJA 3TF5A 3G3EA 3JYQA 3EZLA 4FW8A 4R1UA 3JQ8A 1DLIA 3EW7A 3IP3A 2GGSA 3CH6A 4FOSA 1E92A 4MIEA 4R4JA 1E1MA 1GUYA 2HMUA 4XYBA 2JFHA 1LA2A 4UULA 4R54A 2HAEA 3NT5A 5JNLA 1HDRA 4B3JA 1T2AA 2O7QA 2CF6A 3FF4A 3H65A 2FOIA 5IDXA 4Y98A 2PZKA 4URFA 2GZ2A 1TVEA 4GX5A 3D4PA 1HDOA 3I23A 1P77A 3NJ8A 3PQFA 5BNTA 3GZNA 1RM3A 3RC7A 4YRDA 3MJCA 2BHLA 2OBNA 4LK3A 1EDZA 4CMGA 4FBGA 4RV9A 3GGGA 1GEEA 4ZQGA 3AY3A 3UOGA 4XWYA 4CM4A 4MKXA 2P4QA 2J5RA 4CLEA 4XZ3A 3D5QA 3LT4A 3QIVA 2QQ5A 1YL7A 2C5AA 1I3KA 2EEZA 2PA3A 4S3MA 1IOLA 2NVUB 1KVRA 1OI7A 2CVQA 3IQDB 2J5QA 3WGQA 1XIVA 1GQ2A 1RYEA 3QW2A 3UHAA 5FYDA 4PZEA 2GPTA 2IRWA 2ZB4A 3WBBA 4AJLA 4CM8B 1FDVA 3NTQA 4IIUA 5ILGA 5TX7A 4BNWA 1C1XB 1M75A 4PZDA 3D0OA 3QRWA 5EN4A 4WE3A 1EMDA 2Q2VA 3A9WA 3HN7A 3L07A 1A9YA 2NACA 1SEPA 3BXXA 4RF3A 5TGDA 3QA9A 1J4AA 2HMVA 3ZV3A 5BSGA 4BV8A 2BF7A 4CLOB 1IZ9A 1PJ3A 1T4BA 1H6DA 1LLCA 3C7AA 1RM0A 1CQIA 2J3JA 3DOJA 5BQFA 3JQFC 1MFPA 2Q4EA 4DYDA 5CG1A 2C7VA 3C1AA 3U0BA 3PK0A 1BRMA 2Q99A 5GY7A 4IUYA 3L6EA 3AUSA 1L7EA 3HADA 1ZK3A 5H82A 4E2YA 4DQXA 4J49A 5ITVA 3L6OO 4XB2A 2DBRA 1L1FA 1VL0A 4MVJD 3RU9A 1C0LA 5C37A 1BG6A 3S55A 4NK5A 3TRIA 4GQAA 3KB6A 4CODB 2I66A 2ZB3A 4GVXA 1AHIA 4HWKA 4GMGA 3GGPA 3H9EO 1YWGO 4I1IA 4RPJA 4QFDA 3TZ6A 1H5QA 3BTOA 4RORA 4TSKA 4E5PA 3QVXA 5T6BA 3WYCA 1GPDG 2Q2WA 4BV9A 4RVGA 2VYVD 2HKIA 3IOYA 4LMRA 1QP8A 5T8KC 4BGIA 3VPHA 3Q11A 4ALNA 1YBVA 1ZVMA 4ID9A 5CG2A 3SX2A 4AJ2A 1SZJG 3RFTA 4AVYA 1PS8A 5G0WA 2GN4A 1NFQA 1HLPA 4PGFA 2FPIA 4QO8A 1NP3A 5DBIA 5JY1A 4PG7A 3GPDG 1XDWA 4C4OA 3H4VA 5EJ2A 3INGA 4FPXA 1QORA 4OO3A 4LSWA 1IUKA 1ISHA 4WCDA 1U3WA 5LC1A 1K5HA 3I6IA 3KZVA 1D4FA 5HRUA 3P2OA 2H5LA 1NVMB 2ZB7A 3TPCA 3PHJA 1PJTA 2C2YA 2GZ3A 1C0KA 4J2HA 1GAEO 2FP4A 2FPPA 1EVZA 3JQGA 3MZ0A 3JQ9C 1HDGO 3EVNA 3T4XA 4BKPA 5L7TA 2EKPA 3FNFA 3GMSA 2ILTA 2CVOA 4RCVA 5JXWA 5CPBA 5B4UA 1NQOA 2Y1GA 3PDJA 3O8QB 1I32A 2LDBA 1V6AA 2EXXA 5G0VA 5JDIC 1LDEA 5L45A 1PJSA 1XYGA 2IDZA 3B20A 5L3ZA 3S1LA 3TZHA 5F1OA 1UZMA 4I5GA 1W6UA 4YCAA 4R51A 5F5NA 5THKA 1E3WA 1EVJA 1TI7A 4A7PA 5AYVA 3WGGA 4I5FA 1NPTO 4MP3A 5EESA 1IB6A 3WFIA 2ZYGA 3ST7A 5GZ3A 5KJ6A 2E82A 2YJZA 4M8SA 3OA2A 1ENYA 1O5IA 4IDGA 4CLDA 1ZZEA 1RJWA 4NU6A 2PZLA 1NYTA 1U3UA 5K9ZA 3K96A 2W8ZA 3GEMA 3VPXA 4J7XA 4FC7A 3U4IA 4GGPA 4CUJA 3MOIA 4FGSA 4EUHA 2Q1WA 3N74A 3ZV4A 1N9GB 4J16A 1QXSA 4IDFA 4MINA 3OF2A 2GLXA 2AEMA 3SC4A 1FMCA 2X9VA 4IJWA 5JAQA 3BMCA 1NASA 2VRCA 4D7AA 3I52A 5A9SA 1GYRA 1ZCJA 2E4AA 4WNCA 3HNPA 5DP2A 1XA0A 1ZO8A 5EQFA 2VWHA 1DC4A 3FD8A 4WUVA 1AGNA 3PYMA 3AUUA 2RBEA 3AK4A 4QSMA 5AXCA 4CMBA 1ISIA 1J0XO 4BO8A 1IPEA 3VVCA 2VHZA 1JN0A 3WYBA 1QLJA 2X0NA 4CMAA 1YQXA 2EKQA 1BTOA 3JQEA 5KVQA 2OUIA 3KYCB 4Q39A 3QVOA 4B4VA 4E33A 2A4KA 1I2ZA 1P1IA 5TRTA 2GASA 2D8AA 1NFFA 4RVDA 3WTCA 1MG5A 2PKQO 2Y68A 1H9AA 5AXDA 3WJ7A 1LSOA 2NLOA 4IXWA 1N7GA 5ILOA 1JVSA 3W4KA 5JCJA 2I3AA 2PD6A 1ZK0A 5JLAA 1DXYA 1DC6A 3ZI0A 4CM8A 2P5UA 1GL3A 4JX8A 4HUJA 1HWYA 3RD5A 1P1HA 4UVDA 4E13A 4KUGA 3PWZA 3DB2A 3ZCXA 4B4OA 3GK3A 4JQCA 1PJQA 4UUNA 4UUPA 4MKZA 4HXYA 1VSUA 1GDHA 3SLGA 5F5LA 3H9JA 4E5YA 2HMSA 4RVHA 3WNQA 3L4BC 5B4VA 2V6FA 4CJXA 4R1NA 1BGVA 1ADCA 1LSUA 1QYXA 3WQQA 5LDGA 4DMMA 3KLMX 3L6DA 4LN1A 2Q46A 4S1VA 3T7CA 4WNIA 4EW6A 4RZIA 3RBXA 1HF3A 4YXFA 1YB4A 2G0TA 1GR0A 3SVTA 4HFJA 2ZJ1A 3UFXA 3H5RA 4DPKA 3NYWA 3DOOA 3TZQA 4BO9A 5I8WA 1QLHA 1E7MA 3MOGA 4OAQA 4J91A 2NU7A 1MFZA 2R00A 2UAGA 1E6UA 3WGOA 2VHVA 3GAZA 2I65A 1PWZA 2WYVA 3NDIA 3V1YA 4EJ0A 3P5SA 4ILKA 1HDCA 3QV1A 5TQVA 1VL6A 2OGUA 4WECA 3T4EA 4A5OA 4PG8A 3AM4A 4GI2A 5KIAA 4R5HA 4UVGA 4CL3A 1Q7BA 4A73A 5I9NA 2VHYA 3PZBA 3E9NA 1I3MA 3LVFO 4BB6A 1QV6A 3I4CA 3LT0A 4J3FA 5JCJD 1TXGA 5TC4A 4IPTA 2ZIZA 3H6KA 3PLRA 1KBZA 4O63O 4YB8A 5ICSA 1LI4A 4FFPA 5C7OO 3UCEA 4WOKA 3ROMA 4CM1A 3H9GA 5A3JA 1GYQA 1MA0A 2JFGA 1P33A 1NNUA 4J9UE 4BO7A 3ZWCA 1XCBA 3WLEA 2I67A 4J6FA 5A5EA 1YONA 2HCTA 4LSMA 1PZGA 4BNTA 3JQAB 2WD8A 5DULA 4K9DA 2P9EA 2WSBA 3CSDA 1X7DA 3D5TA 2J3KA 3AY7A 6ADHA 1ONPA 3ASUA 1N92A 1BXGB 4ZD6A 1UZLA 5KNLA 1EE2A 4PLPA 3TSCA 4ZRMA 1A4IA 5TSDA 4YT4A 4WEOA 4AJEA 4IJVA 2C7GA 2EJWA 4DPLA 2PH3A 4I5EA 2VWPA 3BYZA 2DFVA 3D64A 2AA3A 2DBQA 1F8GA 3OJEA 4NH4A 1GU7A 4BS9A 1CEQA 5THQA 2O3TA 2VHXA 4LW8A 4N18A 4JBHA 1B26A 2ZCVA 1NFRA 2NUAA 2YV3A 3O4RA 3TL3A 4D3FA 5DBGA 3GZNB 4M89A 3TN7A 5IF3A 5KJCA 2DC1A 3FR8A 4BO4A 1KETA 1TB4A 3ZU2A 3HE3A 1PJLA 1PL7A 5K0ZA 3EUWA 1EVYA 3TZKA 3VKUA 3UF0A 3CINA 2P9GA 2OFPA 4OYRA 4NIMA 5JBIA 3WFJA 3KETA 1YRLA 4OH1A 4ZN6A 3HZZA 1F06A 1PEDA 3K2BA 3UCXA 3VDRA 1U8FO 4D45A 4AJNA 1I30A 1JWBB 1KEWA 2Z1MA 4IY1A 4L0QA 4PN3A 2Q3EA 4GWKA 4D0SA 4NBRA 2W2KB 2GZ1A 3FPLA 3VPSA 2O50A 4XR4A 3WG9A 1AHHA 3CIFA 1DIAA 3CKYA 3LF2A 1NR1A 1H6BA 3F1KA 3C7DB 3LQFA 3D3WA 4CLXA 3RU7A 2IODA 3ASVA 3D4NA 1HDYA 1BXGA 1DIBA 1ZXBA 1Y9EA 2WD7B 2NU9A 2PZJA 1PU2A 3KUXA 3ZNQA 1GUFA 2E48A 2RAFA 4EDFA 3A1NA 3JV7A 3WXBA 1KC3A 4FDAA 3QP9A 4HFNA 2B69A 1EUZA 3U3XA 3TOXA 1GZ3A 2PD3A 3GY0A 4FS3A 5IXYA 1X0XA 1FDWA 4E5KA 3DFUA 3NUGA 3Q9UA 1WDLA 3KXDA 3WGIA 1IYZA 1JQBA 4KQXA 4W7HA 1UDCA 4XRRA 4TRNA 1EBFA 4WLFA 2BGMA 2QHXA 1JVBA 3WS7A 3IKTA 2DFDA 3NRCA 5IDWA 3HB5X 3OEYA 1N8KA 3LK7A 1QYWA 3ANNA 4NMHA 3UKOA 2R00C 1GPJA 3IDSA 4PLTA 3DZHA 2Y1EA 1Q7CA 5L95A 2NU8A 3AY6A 1Z82A 1QRRA 1I3NA 2JAHA 4BVAA 3W1VA 1EFKA 1LXCA 3GZ4A 2BI7A 2NU6A 2BLLA 4P38A 2VOEA 1JLLA 4H7PA 4O5OA 4GKVA 4AJIA 1OFGA 4PVCA 4YT5A 4YACA 1Z74A 2PLAA 5GZ1A 1DBVO 5C5IA 4KTTE 1Z7EA 2AG8A 4FIZA 5COBA 1N9GA 3RC2A 1SOVA 1R0KA 3QWBA 2X9GA 1B16A 1VJ0A 4BNUA 1K3TA 1UZNA 3F4LA 4EITA 2ET6A 3TL2A 5DCYA 1KEUA 1MGOA 2Y93A 3DL2A 3JYOA 1ISGA 4CM5A 4R1TA 4YJGA 4BUCA 4QFCA 3JD4A 2CFCA 1DAPA 2DTXA 4NR0A 3MTGA 2VQ3A 3B70A 3V2UA 1ZJZA 3JQAA 2Y0EA 5IXSA 4BNVA 1UJMA 4ONEA 1XKQA 1R0LA 5ADHA 1PX0A 1Y5RA 5U4QA 3DTYA 1O94A 1NWCA 2JAPA 4R01A 3BTUA 1SNYA 3ONFA 3ZU5A 4XRGA 2C5EA 2JHGA 1E3IA 3DTTA 2G5CA 4BKOA 3FN4A 1BVRA 4MIYA 2GN9A 2OORA 3L77A 2D5AA 4BNIA 4BKQA 3ICCA 4R3WA 2W2LD 2YQ4A 1NQ5A 3HDYA 4BNXA 2AG5A 4BMVA 3K73O 1HKUA 3PRJA 4CQLA 3RWBA 3RC1A 2Y99A 3E9QA 3JQFA 4CMKA 2DUUA 1P31A 3ETGA 2DTDA 4NZ9A 3SJUA 4K1LA 4IDAA 3BIOA 3W6ZA 1JU9A 1PJ2A 3PWKA 4YPOA 5ENVA 1BW9B 4PLFA 2NADA 4XQGA 3I6QA 5EL0A 4C7JA 5DDIP 4GBJA 1EDOA 4L4RA 1RWBA 3DHEA 1P74A 1EZ4A 4UEJA 1ZEMA 1LSSA 4DQVA 2RHCA 1GD1O 3DR3A 4MVJA 4YTEA 3L4SO 3KYDA 5COQA 3M1LA 4Z9YA 4W82A 4H16A 1O9BA 2Q2QA 3I9JA 2X86A 4N7RA 3BAZA 4ND4A 2Y67A 2VN8A 4D44A 4YQYA 3RUFA 2I6TA 2Y66A 4ZHSA 1S7CA 1HZJA 4DIOA 1D1TA 1A5ZA 2YQ5A 5IZCA 1PZFA 4NDNE 3QLJA 3F3SA 2HJSA 4L73A 2GNAA 1MXHA 4CMJA 1VSVA 4JP3A 3G0OA 4I9NA 4Y6SA 1GV1A 1HSOA 3COSA 4A10A 4N54A 3QHAA 4OIMA 1Q0LA 2O3RA 1DIHA 2VYNA 3PJEA 1R37A 1T2DA 2Q1SA 4FJ0A 3WMWA 4XDZA 3VTFA 5JYEA 4J1SA 5C3MA 1LLQA 1VRWA 3DC2A 4KP7A 1QYVA 4TROA 1W4ZA 4ITUA 4M49A 3U9LA 4Z9XA 3LSYA 3ANMA 1ZKMA 3CMMA 4GGOA 2NM0A 3WGYA 4I9HA 4NHEA 1XU7A 4ND1A 4EI2A 5CDSA 2VOJA 1X14A 3LYLA 3BHIA 3NGXA 2VWGA 2HLPA 3AW9A 2YFQA 4NFHA 2D4AA 4MVJG 3SC6A 1HLDA 1GFSA 3UGKA 1DFIA 1YJQA 1G0NA 5IN4A 2D1YA 3GEDA 1PGQA 5CHEA 3RBVA 5GMOA 1PGJA 1I2BA 2ZK7A 5KWEA 1KEVA 5IN5A 4E5MA 1NHGA 5G4KB 5HTOA 4QT0A 2ZTVA 1D7OA 2C07A 4LMPA 4M1QA 4PLCA 2HK9A 1DLJA 3JYPA 1P0CA 4WLUA 1QYDA 4YEDA 5A02A 3I3OA 1CIVA 2VTDA 4NU5A 1NAIA 1Z73A 4IDDA 4OOFA 4DRYA 2I99A 3VZRA 4G2NA 2DT5A 1KY4A 1R66A 2HQ1A 4L8VA 4BQPA 3UVEA 2O3QA 3CMCO 3E18A 3FBGA 4BL5A 1E6EA 1DRUA 2C54A 3GRPA 1R12A 5AXBA 4F46A 4ZVVA 5TJHA 2YHIB 2DU8A 3KV3O 1HSZA 1HYHA 3ZHBA 3DZKA 1IZ0A 5JDIA 3AOEA 1I0ZA 3ITDA 2G76A 4IQ0A 4WK6A 4EJ6A 3OQBA 3Q2KA 4MDHA 2RHRA 1LRKA 2ZB8A 4BMSA 1WMAA 4DQUA 4G5HA 4Z0TA 1E77A 4AG3A 1SO8A 3B1JA 4IQ8A 3ZWWA 3AOEC 4KTVE 4BKRA 4CQMA 2YW9A 1FJHA 3BMQB 1XSEA 4CQMD 1VKOA 4PLHA 1X7GA 1Y1PA 4YA6A 2PKQP 2AQ8A 3EVTA 3JYLA 5FI3A 1D8AA 5T8KA 3STHA 3DO5A 2IEDA 4O59O 4CQMB 1V35A 4AFNA 3ROPA 4HY3A 1VE9A 1UH5A 2JL1A 4OKIA 2HRBA 3HQ4O 5L40A 4UUMA 4RDHA 1B8VA 3H8VA 3H7AA 5KKCA 4CLRA 2FSSA 3NT4A 3OQ1A 1QG6A 2J5KA 3F47A 3FTPA 1DOHA 4ZRNA 4U0KA 3I5MA 4BNMA 4PVDA 4MPDA 5JC8A 5KVSA 3L0DA 1WNTA 1ZFNA 5G0TA 1A72A 2DVMA 3C24A 3O38A 5EPOA 3GLQA 2WYWA 3GFBA 3ZH2A 4M55A 3CUKA 2D59A 5G4LA 4LVCA 2HO5A 3ZN2A 3LLVA 4MVJE 3WQSB 1AXEA 4YR9A 3JD3A 3NGLA 3RKRA 3ONEA 5H81A 3RUCA 4OKNA 1A27A 3WGZA 3RUIA 2WD7A 5CDTA 3K8ZA 4AICA 4NI5A 4XYEA 1CERA 2X58A 3CE6A 3NDJA 1K2WA 1LC3A 3KSUA 4QECA 1NBOA 1LLDA 4PG5A 3E5MA 1I24A 3ABIA 2DTEA 4QX6A 1ID1A 3WYEA 5B12A 3KEOA 2PH5A 2PZMA 2GN6A 4ZGWA 4WLEA 2B5WA 3KYCA 8LDHA 2CVZA 3OHSX 3EC7A 3KVOA 2YUTA 3H9UA 1E1KA 2GYYA 3EDMA 3PJDA 4R16A 4DMLA 3EAGA 4PG6A 1HE4A 1BHSA 2TMGA 4R68A 1ULUA 3M1AA 4IINA 2ZTUA 2GERA 2BH9A 1BWSA 4P8RA 3M2TA 3U4DA 1K6IA 3AU9A 4IIVA 1PGNA 2J8ZA 3QVTA 2PD4A 3KHUA 4D46A 3ZHYA 4EUFA 2FMUA 1KVQA 1H6CA 4L75A 3KSZO 3K6JA 4A26A 3AM5A 2EGHA 1O89A 4NPCA 1R4MA 1Q7GA 4W99A 3RUHA 1E6WA 3DBHA 4PG4A 3NT2A 1PZHA 3I4FA 4GMFA 2YZ7A 4LVUA 1MLDA 1U5CA 2YDXA 4WCFC 2YV2A 3X2EA 3JD0A 3LLSA 4QUKA 1NPYA 3EMKA 1U5AA 3M6IA 3E03A 4MKRA 2OOSA 4B7UA 3ONDA 4U7WA 3ZNPA 2QX7A 3H2ZA 5DOZA 1D3AA 3MJ4A 4LISA 1BVUA 3ZWVA 1T24A 1V3VA 3DBRB 4IS2A 4IGEA 5T67A 1Y8QA 2NWQA 2HU2A 3PXXA 3UAGA 3OJFA 3I9KA 1NX6A 1HEUA 1I01A 2Y1OA 4FN4A 1LQUA 2A9FA 1ENPA 2AEFA 1F14A 2W2KA 3FRJA 4ALLA 3PJGA 1P3DA 3WWZA 4J2OA 4CM4B 1C1DA 4LCJA 3OP4A 3C7CB 3A14A 3MWEB 3GDGA 4WLOA 4INAA 3GT0A 4IDEA 1YBMA 1HZZA 4U8GA 3SJ7A 1YQDA 3INRA 1DHTA 1U28A 3GN2A 5IDYA 4IM7A 4K28A 1A7KA 4YAJA 3GVPA 1XQ1A 3OQ6A 1T2CA 4J1TA 4L4SA 3C1OA 1P44A 3V8BA 1G6KA 4E3ZA 3A28A 5JMPA 4TWRA 2PV7A 4E21A 4HFMA 3P7MA 2FR8A 3U62A 4UAGA 1HYEA 3ITKA 1T1RA 4BNHA 2LDXA 4KQWA 3RC9A 2V65A 2CNBA 1GEGA 4M87A 1V0JA 1BW9A 1E3EA 4XCVA 3QWHA 2Y0DA 1JKJA 4OMUA 1JDJA 3UW3A 4NNJA 2AQHA 2VNAA 3JQDA 5F3RA 2VYVA 4IMPA 1WZEA 1WZIA 3QY9A 4DUPA 2D3TA 3VOSA 3WIEA 1YVEI 2PY6A 3UUWA 2C29D 3B6ZA 1F12A 1RYDA 2D2IA 3GG9A 1Y9AA 1YBAA 4XIJA 2EJVA 1M76A 5G0SA 3RIHA 5A9TA 1SAYA 3WLFA 1W8DA 3GAFA 3GUCA 5IZ4A 5A4DA 2J3IA 4RVSA 1K6JA 4TZKA 2Q45A 1T2EA 3UCFA 3ON5A 3KSDO 4HX5A 3HUDA 1HDXA 4B7XA 3BMOA 4OXYA 2D5CA 2GR9A 4W9NC 3B1FA 3DZJA 2Y1CA 4XJSA 5A1TA 4IQGA 2OMEA 4Z3KA 2IYPA 3OETA 1J49A 1P1RA 4B3HA 2DPHA 4BOYA 4E4YA 2AE2A 5MGBA 2B4TO 2GSDA 2I3GA 3E1KA 2C82A 2POQX 3WGHA 3DZGA 4YAKA 4KUHA 3UN1A 2G1UA 3C1TA 4NK4A 1T1SA 3RROA 1EEHA 5BSFA 4ZQEA 1IHYA 1TT7A 2QYSA 4E32A 4BNFA 4XA8A 2PTGA 1A71A 1GZ4A 4N5NA 4OSOA 3GVIA 3SXPA 5DNAA 2Z95A 4IDCA 3MJVA 1N7HA 2GN8A 4CMIB 4J7UA 1J6UA 4Q3CA 3D3WB 3OJ0A 2X1HA 3NDRA 4PRLA 5J23A 4E30A 5JO9A 5L4NA 3OIGA 1UDAA 2WE7A 5L51A 2Y0CA 4CL8A 3KTDA 2QW8A 3F5SA 3TNLA 1RM5A 4JK3A 2GDZA 1U4SA 1IPFA 1Y5MA 3JSAA 3U5TA 5L53A 4UEKA 4YDRA 4RPGA 5CDUA 1BXZA 1R16A 5HA5A 1ML3A 4TRRA 4FQ8A 5KVCA 1Y8RA 4ALJA 4NBTA 5LCXA 5JAIA 1DRVA 4BQRA 3U49A 1KVTA 4ALKA 4RF5A 5TNXA 2V6GA 2VZ8A 3W4JA 1AE1A 3CZMA 4EUEA 5DF1A 4XD2A 1H94A 2B83A 3OICA 1EK6A 3FNHA 4HNGA 4BO2A 1NAHA 1LEHA 1OBFO 1EUCA 1OAAA 4AJOA 4CM9A 3D7LA 1N5DA 4GSLA 4HNHA 3HDHA 4W6ZA 3D1LA 1PS9A 3WMXA 1YXMA 3GGOA 3MJTA 3U09A 4EZBA 2JCVA 1O6ZA 5AVOA 1E3SA 1ZSYA 5BR7A 3MJSA 2AQIA 3HB4X 5G2OA 1J5PA 4FB5A 3G17A 1SB9A 1D1SA 2Y1FA 4JNKA 3TDKA 2EV9A 2C59A 4XQCA 1LRJA 1R4NA 2GUGA 3FHLA 2X6TA 4HFRA 4YJHB 2XXJA 1UDBA 3JQGB 4WASA 3DDNA 2EKLA 3EY4A 1U1IA 4YAGA 1XU9A 4DPMA 1KIFA 3K30A 4KDFA 1KEPA 3ZW9A 2CDAA 3PGXA 3PHLA 3ZW8A 5A03A 3SEFA 4BO6A 1OC4A 2EHDA 2DQ4A 2SCUA 3HDJA 4TMFA 4OGWA 4GLOA 4MP6A 3DQPA 2AHRA 2PR2A 4YJFA 3DBLA 4AJHA 5CDGA 2BFOA 3B1KA 4IZHA 3CEAA 3E8XA 4CV3A 1R4MB 2R2GA 3RFVA 4F3YA 3OIDA 3BTVA 4Z6KA 3JQ6A 4YVFA 2IZZA 3C8MA 1HE2A 5I7SA 2DUWA 1HDZA 3BMNB 1LBEA 5FEUA 4CMIA 1X7HA 4WKGA 1XWFA 3ZWOA 3F5QA 4MVJM 3E48A 4WLVA 3PI7A 4RVUA 5TS3A 1UR5A 3FSRA 4BNZA 1U3TA 3WTBA 1VI2A 3PFFA 4G81A 1WAMA 1MC5A 3HFGA 1MG0A 5EERA 2AE1A 2Z1NA 3Q1LA 5KKAA 4YT2A 1QYCA 1TT5A 5FWNA 3DZBA 4Q9NA 3W8FA 2Q50A 5F1KA 3KM0A 2DAPA 3DBVO 3I83A 2EIHA 1T2FA 4QXMA 2NSDA 4RQTA 1GCUA 4GX0A 2WE8A 2X9NA 4BIIA 4DXHA 2O2YA 3GQVA 5DZSA 3ANLA 1UXJA 3A4VA 3MTJA 4LGVA 5H83A 3ZV5A 3ADOA 3ZWXA 1M6HA 2X0JA 1WP4A 4BGEA 1P9LA 3Q2IA 3GN1A 1M67A 4CV0A 4IBOA 3PTZA 2X0IA 3QE3A 1KVUA 1E3WB 4RL6A 1I8TA 2PK3A 2I9PA 2CUKA 2GF2A 3DAPA 1DJNA 1P1JA 1E7RA 3EGOA 3F4BA 4IGFA 1CJCA 1E7YA 4JN6B 1XHLA 4II3A 5ES3A 4JLWA 5EINA 2VUTA 2HK7A 4DYVA 1EQUA 1N1GA 1PQPA 2FR0A 1EUDA 5EMHA 3OM9A 1UXHA 5JFOA 1LC0A 2UUOA 3RUAA 1U4OA 3PIIA 4ZQBA 2EW8A 4IZIA 3LDHA 4OL9A 4WGGA 5IFLA 1PR9A 5AXAA 4A2CA 3IMFA 4B8WA 1C1XA 1LRLA 1RPNA 3F46A 3ZWAA 1UXGA 5L4SA 3IAHA 1JA9A 3VZQA 1HE3A 5TJ9A 2E6UX 2PKRA 4J1QA 1YJ8A 2OO5A 3EYWA 4W9NA 4DBVO 4U5QA 3LF1A 2R6JA 4FGWA 3OA0A 3IS3A 4HADA 1IL0A 4PLWA 3PEFA 3S2EA 3E5RA 1ISFA 3AOGA 3TOZA 5HM8A 3O26A 1KY5A 3GMDA 2H9IA 3PQDA 3BHJA 1OZAA 4XGIA 1H9BA 5I7VA 2FRDA 3M2PA 3WDSA 2PWZA 3OJLA 3AI2A 1E7WA 2OP0A 2C2XA 3KLPX 5L7WA 5CAEA 2VNSA 3OMLA 4II2A 1OMOA 2NTNA 4RGBA 3UH1A 1EQ2A 2YHIA 1QR6A 4I8XA 4U6QA 3SLKA 4QO7A 1C3VA 4K26A 2ZQYA 4FOOA 4JP2A 1A4UA 1YS4A 3QSGA 2HMWA 1B3RA 1MC4A 1Z75A 2ZCUA 4L4XA 2X5JO 4D0RA 1KERA 3Q6IA 4NFSA 3VPFA 1GY8A 2JCXA 2WEKA 3BMQA 4TZTA 4Q3BA 4Z3DA 2BGKA 3VZSA 1BXKA 4JXKA 2P9CA 1HTBA 3AU8A 1UAGA 5BNFA 1DC3A 1UUFA 3WQRA 3DONA 3EK2A 1WW8A 2ZTLA 4TQGA 4EEZA 1I33A 4NBVA 3BTSA 1P0FA 4J43A 4AJ1A 4FCCA 3VVBA 4CM3A 5I7EA 4ZQHA 1QKIA 4HP8A 2QRLA 4M54A 2PNFA 3ZWYA 1C0IA 1DSSG 1EK5A 2QZZA 1P45A 1DB3A 4WPGA 3VKVA 1ZIDA 2VYND 4J90A 3NEPX 2VCYA 3H2SA 4IMRA 4JBGA 4RLHA 1PS0A 3AI1A 1CDOA 4RJTA 1WDMA 3PZRA 3VH3A 3VHRA 3IKVA 3JQAD 1VPDA 2AXQA 4XQEA 5DCWA 5JAZA 4QEDA 3VZPA 2O3SA 1C14A 4BNGA 4RZHA 4R3NA 3CPSA 2AEJA 1CQJA 1I10A 1NM5A 3IJPA 1SOWA 5KJEA 4D3DA 4KWHA 1U9JA 4OHUA 4Y6RA 4DBZA 1ZK2A 2VT2A 3GHHA 4CV1A 5IJZA 4KUEA 3L9WA 5A9SB 4O6VA 4LCEA 5C7IO 4YJHA 1PZEA 2DBVO 3OSUA 2EP7A 5T5QA 5A3VA 4TVOA 3AWDA 5A9RA 3I1JA 2CSUA 2O48X 1X13A 1PL6A 2Q49A 3K31A 2IYOA 3PIDA 1PJCA 4DIFA 4YWJA 1WVGA 8ADHA 3I9LA 4YBZA 2NVWA 4HBGA 1CWUA 3NTOA 5A05A 1VL8A 5KVVA 3GRKA 1GADO 4OM8A 5L9AA 3G1UA 3TZCA 3LC7O 4LRTB 1W73A 4JJGA 1BDBA 1QV7A 1PQUA 3MJEA 3BMOB 1JAYA 3NX4A 1QSGA 1LNQA 1N1EA 3U4CA 4D79A 2FHSA 5IG2A 3HSKA 4H3VA 1K89A 2AMFA 3DZFA 3C3XA 7ADHA 1IHXA 1YL6A 1U3VA 5JPIA 2O23A 4YT8A 1VJ1A 3RVDA 1PWXA 3H5AA 1U7HA 1I2CA 2O3JA 2QIOA 4PRKA 1PTJA 2PGLA 3TQHA 1B2LA 1HT0A 1PJ4A 4B4UA 2IE0A 4D41A 1XGKA 4C7KA 4DREA 3FPCA 2FZWA 1AXGA 4DTIA 3ROKA 5IZCC 1DFHA 4XJTA 4XDYA 4L74A 1NXQA 3QVWA 2BKAA 3ZV6A 2I76A 4H15A 5A04A 4BO3A 1CRWG 1YE3A 4L76A 3S2GA 1ZW1A 5A06A 2BFAA 4AJKA 1HXHA 4P22A 2E49A 4IJUA 2YDYA 1Q2XA 2QYTA 4DL9A 4XYMA 2HSDA 3FNGA 3GHYA 4A27A 2J3HA 2ZYAA 3GVCA 3F1LA 1H6AA 1XG5A 3H3JA 1DRWA 4CUZA 1V3TA 1O8CA 4TRJA 4E12A 5GZ6A 1EE9A 4ND2A 4BNJA 2NQTA 2IZ0A 4Y9DA 3DBHB 1DJQA 2BELA 2BFPA 1V9LA 2AQKA 1E7QA 1ADBA 1X1TA 3GNQA 3IL2A 3LT2A 4IDBA 1GUZA 1C1DB 2UYYA 3DHNA 3PYXA 1SPXA 4IJKA 4DIBA 2GO1A 2Y1DA 4WCFB 3L9XA 3V1TC 5IDQA 3V2HA 4B4WA 4BO1A 4D42A 3PQEA 3ZWPA 5ER6A
chains in the Genus database with same CATH superfamily
3DDCA 5H80A 3VPGA 2VVTA 3UYLA 3FCAA 3MFQA 1T6BY 4QFBA 5BY2A 3PFBA 1P2GA 3W3ZB 3B1VA 4CDGA 5KC9A 4BNYA 3NAQA 5KQMA 3B9QA 2IK8A 2CE7A 2R1TB 4R2MA 5AW2A 5FI5A 1Y34E 5HPYB 3INTA 2VSFA 2FWMX 5DO9A 5DB4A 2Z2ZA 3H5NA 4DLTA 5HKOA 3MBKA 4L9RA 3ZZ0A 2FZCA 1NDUA 1CPYA 1BHJA 1DZ3A 1RBYA 4CTMA 4XCQA 5T41A 3DLTA 1P0QA 1M2OB 2NU7B 3RTCA 4BEJA 2BSXA 3IV6A 3ETDA 2OZPA 4L16A 4IDQA 2QGNA 5HE9A 5JD4A 3AKEA 4LHZA 4RTPA 2AIRA 5CIQA 4Q03A 2V4ZA 2WTBA 4HNRA 4UQOA 3WAKA 3PS9A 4K6OA 4OG2A 4RKFA 1JHQA 2OYCA 1PAUA 3B9PA 1IMOA 3RVBA 5ERXA 1UKAA 2NO1A 2C0CA 2PSEA 3QNWA 1MO3A 5FPSA 5E4YA 1PUJA 2KYRA 2XD9A 3MLAA 4JBNA 5DX1A 5EWJB 4J4HA 1SOAA 3MSXA 4J76A 4TMZA 3HJFA 2FPUA 4QVIA 1V7ZA 3BORA 1UP7A 3I1IA 2R8ZA 3G0IA 2WUEA 4C4TA 1Q0HA 1TA4A 1WQ1R 1BMQA 3HP1A 1ZH6A 1X7XA 1B8NA 1WA5A 5G41A 3WJAA 3VR2A 3Q72A 4PFQA 1XEAA 4JBWA 4NFYA 5FCDA 1NHWA 2ADOA 2QTAA 3BVPA 3V5NA 1MO4A 2XNDD 1Z33A 3G5UA 4OOEA 4JR2A 1F9EA 1GTMA 1OI3A 4DA9A 4KE8A 4P3OA 5D8DA 2BBSA 3F6CA 3OX2A 5DX0A 1MJ5A 1VCMA 3IVCA 2IP2A 3KAKA 3NV7A 1Y4ZA 4QNMA 4UJ3A 4CMEA 5K0GA 1LUAA 1SC1A 2B5OA 3GLFB 4F1WA 4D5EA 1ZC4A 4NP6A 3KQKA 4B8YA 1EVIA 5JV5A 5LA6F 5HUJA 1G0OA 4B3IA 4C43A 3JATB 3ORQA 2D1TA 4XIYA 4B7CA 2CZCA 5ED0A 2QM3A 2XTMA 2W2QA 4PZCA 2BZSA 3GLFA 1WUHS 3ZU4A 2XCSB 3U7FB 4I6GA 3DLHA 1PKXA 2AK3A 5B53A 3I76A 4RZSA 1T3SA 2OK7A 2ARKA 1YQQA 2EFHB 2H4ZA 1K8YB 2V9CA 3CURA 4F45A 1A1VA 2WDZA 5DMXA 3MXTA 1CDEA 3RK1A 4CLOA 5FUMA 2O8DA 3CO5A 4G07A 5C5CA 1THZA 2CWWA 1GA6A 2V7EA 3SKXA 4PE5B 1YGYA 4MIOA 3VZCA 1FC0A 2VNJA 4P92A 1ZY2A 4C04A 1CEXA 3CLRC 3GEGA 1BN7A 1STOA 5LQCA 2OE2A 3LY8A 1FW6A 3RHFA 3HN2A 4Y2SA 2F3PA 3C6BA 2ZYHA 1OZFA 3X2FA 4KO3S 3A26A 5FLYA 2WJZB 3S8MA 2JFXA 1CYDA 5EWJA 1E3JA 2C8VA 3BK7A 4KFUA 5TS2A 4KQMA 2DT8A 2QI9C 4OJNA 3SR0A 5F2NA 1QRSA 2YVKA 2XYHA 3WB9A 3AFMA 3DULA 5LU9A 1Z0DA 3VU1A 3DHYA 2GKOA 5FI0B 3DAFA 3P2KA 1DFGA 3LDAA 2YZGA 4WBNB 1YFZA 2DKOA 2UVPB 4O4IA 2DSNA 3HBNA 3K0BA 3RR2A 3UXYA 3VDQA 3TIXB 5KYYB 2XCRB 1QQ6A 1QGUB 4EYEA 2HWKA 5BSHA 5JTTA 2DG2A 1TA0A 2VQFB 1BX3A 3DDHA 2RB4A 4BWGA 4DBLE 1ZNQO 2Q1UA 4UFPA 5CLLA 2RGCA 4NCIA 5ALSA 3X1XA 5T4HA 2WPNA 3SNKA 2E6KA 1FXSA 2ZJ2A 3JZIA 4WKCA 2PSJA 4PYJA 1JGTA 1L4HA 1R6AA 1MABA 3ICWA 4J94A 5DSTA 5GJVC 5KYVA 2FA9A 3G85A 5T64A 3T41A 1N6NA 3OP1A 2H00A 3PC4A 2VDUE 1OF1A 4MVJI 1X9GA 1L4FA 2P4UA 3GFOA 2BCJQ 2J4CA 4IZ6A 1VPEA 2XECA 5HZGA 1ZM3A 3BRSA 5C31A 1DEAA 1ID8A 4D43A 1O0CA 3OCXA 3N76A 4RQBA 4XGNA 3SD7A 1RP1A 1FFCA 2ZSJA 3CZRA 4HDKA 5WRFA 2WYHA 2JLYA 3KLOA 4KU4A 4GPEA 1F8XA 3BWYA 1LTQA 1XA3A 4UPVA 1A4XA 2J0EA 2YTZA 3TQFA 1ESEA 5BUSA 2EZ8A 1KOJA 1QH1B 1KR2A 2XOXA 4HQ0A 1EB9A 1Q1BA 4JUAA 4DSNA 3T7EA 1QH0A 1RC0A 1E9SA 1LDBA 1H1TA 2FWIA 1DCMA 4WN9A 5AJUA 3RQSA 3NNNA 2IHNA 3HJNA 4GFDA 4UXHA 1E99A 1G5TA 1Z36A 3OCWA 3QLVA 2LNDA 4MGIR 4IVRA 4RELA 4AMVA 5AW4A 2DFLA 1VKNA 4KR0A 4HDRA 1XK6A 4B3BA 2VAVA 2WOJA 3HBAA 4F04A 4I9GA 1UXKA 1JV2B 2PGXA 1MX1A 1UM9B 5ES4B 5DM60 1JXMA 3SE7A 3T9CA 4B46A 3HZRA 4D5GA 4RPLA 2ECOA 3T1VA 2AFHB 3QUSA 1PG2A 3L8MA 3OLWA 1GZ6A 1YR6A 1YQWA 1YT5A 2RH8A 3R5SA 4FYYA 4I9UA 5DT9A 4S1NA 5K1ZA 3UK6A 4JSTA 1U7TA 3BBLA 2ZANA 5AHKA 4FI3C 3LOPA 4PINA 1ZESA 2NZ2A 2QTNA 1H42A 2VDWA 3RU2A 1V3UA 4BE7B 1D2RA 3H18A 3IP1A 2ZPUA 3MCZA 4IV8A 1A5TA 1JAXA 2PJDA 4PZ9A 5JXGA 1BC5A 3M6XA 1DBRA 5DM0A 1EGHA 3E82A 1NQAO 3EXFB 4KN5A 5BSEA 1LX6A 1YH3A 5CH3A 1YQ9A 1Z6ZA 3TVDA 3SFZA 4D9MA 2PH7A 2R11A 4HTFB 3C8UA 3IUQA 2BPOA 1VYVA 4F1JA 4OI0A 1CY2A 2PN1A 2N42A 1MT3A 3GA0A 4CIDA 3IBCA 5KPJA 1PL0A 2HDHA 3JYNA 5KKNB 5LQRA 3NATA 4QPCA 1T25A 4B6EA 2FQXA 3NS7A 5A0FA 1CUBA 4JUBA 3HHPA 3GF4A 1Z18A 4UUOA 4IFIA 4ZA2A 4DR6B 1P7WA 5C9ZA 2XODA 1KAMA 2ZBQA 4PQRA 3CF6R 4X1OA 2J3LA 2QGFA 3H11A 3QJYA 4M1OA 4N5IX 4MYHA 2IYEA 4BX9A 2N3ZA 4UMFA 1M34B 3EVBA 4YJFB 3WLAA 3O1LA 2OGZA 1GG2A 3CTMA 4TV8F 4WFKA 3D4OA 3ZU3A 4X3PA 5CEJA 4LX8A 4EPYA 3WIBA 5M5BA 1YR2A 4YMLA 1J2UA 4UM9D 3N9IA 4HGYA 1PV2A 4PHGA 1VMIA 4DLXA 5C35A 2R97A 2YHAA 1PIWA 4FGJA 3FRIA 3TR6A 2NZXA 2NUPA 1SWWA 3Q3CA 1ZK4A 5JCXA 5LQKA 4YRGA 3HM9A 1F1BA 2WYUA 4YAEA 3RB8A 1QO9A 5LQJA 1Y81A 5JCOA 2HF8A 1VLLA 1AK2A 2ROQA 4KX3A 3KOUA 4MQMA 4OB8A 5DSXA 3AM3A 4DR3B 2NP7A 5KOIA 1ESNA 4LV6A 2DY1A 2VRBA 4CEIB 3LQQA 4MKFA 3RCBA 3GFGA 2IV3A 2OZLB 1Q0UA 2QQ0A 4MR9A 2JFFA 2IW1A 2JIPA 2YCBA 5JR3A 4RTSA 3RH0A 4Q4LA 5MDHA 1PQWA 1W2HA 1YB5A 2H7VA 2W4QA 3DWFA 3A3YA 2P67A 1P72A 4WJKB 4QUBA 4CMEC 1TQ2A 1XFDA 2C9BA 1OZGA 4YYZA 4TKUB 1CR2A 4PHCA 2HX1A 3QJGA 4MARA 3W2HA 5CVVA 3C7KA 3HB0A 4K3VA 2K87A 1QONA 2J07A 3O8QA 2ZBVA 2ZYDA 4UNIA 5TMEA 3V4PB 3VPAA 2FEKA 4DUYB 1WCV1 1R8XA 4FFOA 3F97A 2HMTA 5D84A 2YHUA 1JMKC 2XVZA 3GP5A 3GVXA 3G2LA 4G5YA 5EE5B 3TW6A 3VHLB 1WBBA 3A4MA 4HB4A 1UXOA 3ACDA 4NYJQ 1W9HA 3TLYA 3UJ9A 4B9AA 2C4NA 2HSWA 1IDOA 3HM2A 3V33A 1HT1E 2QTTA 2WUFA 3K2EA 1CQXA 2W93A 4E5UA 4YQZA 1JMYA 2JATA 1JLSA 1OY1A 1UJ4A 1LDMA 1B15A 1N2CB 2IXTA 2QRZA 3FA2A 4HNAB 4D56A 5L7YA 4A8JC 2YFHA 3PHHA 3K6SB 4KX5A 1L9XA 1RYMA 2YVLA 1ONOA 4MVJF 4DR1B 4GH5A 2BRUC 2CUTA 5K05A 2JLCA 1BVHA 3HGMA 1YQGA 4Z54A 5THXA 3MJRA 1ZUD1 4NG4A 1WLSA 1M8JA 2BYTA 3R3SA 1QANA 4MB2A 3QG5A 4XWKA 5TLSA 4Z3OA 3F8TA 1LQTA 3AUAA 3L18A 4MRAA 2D1RA 2J7KA 3USZA 2WKSA 4NBSA 2YVQA 1HETA 3IJEB 3WFZA 2YBDA 3C41J 2OECA 3K09C 1VZ2A 4DV6B 3ROQA 1W87A 4I4IA 4NOKA 4Y9UA 1AD2A 3Q15C 1Q0QA 3ZZUA 4AKEA 5KDOA 1NXVA 4J4BA 3EDRA 4YDSA 3U9TA 5B3JC 5EJEA 1F17A 5FORA 4A10A 3HJGA 4FD3A 1M74A 2VI5A 2WZBA 3CUEF 3HLKA 4PIMA 3RKUA 1IOZA 1MX9A 3GCGA 1U99A 1FL9A 3O2QB 3RBZA 2HJRA 5I9LA 4B3DA 1JI3A 1QMPA 3WKCA 1WV0A 4BZZA 2E55A 4E07A 3DMTC 5CTJA 2VDVE 3B5EA 2B7CA 4HMOA 3ZWBA 2X7HA 1IY0A 2I4NA 2JJ2A 1DO8A 2PLNA 3AXTA 1UP6A 3BL5A 3KHKA 4GR4A 5FTNA 3RARA 5C18A 4YCNA 1DPGA 1NVGA 3DZIA 3NC0C 2GXSA 4QATA 2FZ5A 3CH4B 4NPHA 3ZNOA 2R6R1 3L43A 1D2EA 4LQLA 4K6CA 2V4UA 1MO6A 2FN7A 3AJRA 2IHJA 3KQOA 5IBCA 2BFFB 1TO6A 1YZUA 3O5AA 1PI3A 3O91A 3VSCA 5KNBA 2RAVA 1C9DB 2DWQA 2PLWA 1OOEA 4FYPA 4F86A 2OHVA 4FDVA 4LJ6A 1O0SA 1Q20A 2BFMA 4COOA 4IWNA 4BIMA 4TPKA 4URXR 3GPBA 4B6SA 4A03A 4M1ZA 4EVSA 3H8SA 4L4YA 2E5FA 2PUBA 1SB8A 1E7SA 2HIMA 4O29A 4EJSB 1VIDA 1FDUA 1EXVA 2QMZA 4TKLA 3CKLA 4IAOA 2R1VB 2CVFA 1D6MA 1Z34A 4M9RA 4NJMB 3U4HA 3J7TA 2P1RA 4D6PA 4OSPA 4RADA 3VU9B 5JS1A 1MC8A 3JD1A 3EQ2A 1AUPA 4RTRA 2P9YA 3HMKA 3R6TA 3NCHA 4U0JA 1K0UA 3N1UA 3GH3A 4FLMA 4ENPA 9LDTA 3TRJA 1TD1A 3U61B 3MGCA 1FNMA 5EYPB 5KJFA 1U2GC 1V1RB 1W581 4J0DA 5CW1A 2ZZMA 1ZU5A 3TAUA 4EY8A 4MWZA 2DHCA 1XZNA 4GOOD 4KIFA 4GS5A 3KYDB 2IS6A 1G5FA 4UCFA 5HWSA 2UYHA 1ST3A 1Z2CA 2AFIB 3PXBA 1NR7A 4AMBA 3C85A 3GWGA 1XCMA 2JJYA 2F8TA 1ESZA 1WEHA 1ZKDA 2CFSA 3GP3A 4H6XA 3EXG1 3TL6A 2GBIA 4EHKA 5A6SA 4LJRA 5K8CA 5G02A 2VRCD 3UOWA 4KDCA 8MHTA 1H93A 5SYAA 3TYXA 2G67A 2GS9A 3JZDA 2V7PA 4ND6A 1H1LB 4EY4A 2QWXA 1GHTA 3COZA 4YFVA 4NEQA 4PHFA 1LLUA 1SVLA 3JASB 5FR1A 1O94C 2CXRA 3RJZA 5LOVA 2B3DA 2G82A 1R4NB 1Z3CA 2VPXA 1TZBA 3ZE9A 2E85A 4L9AA 4TWJA 1OXXK 4F5DA 1TU0A 2IU4A 1G8FA 4YUXA 4L9SA 1QIMA 3OIYA 2FR1A 2V9ZA 4DWVA 4P0PB 2BGJA 4AS3A 3L1KA 4AKGA 3G79A 4J1TC 2WWRA 1XKLA 4HH4A 4L1KA 3BMNA 4TQUS 4C0LA 4CG2A 1BSVA 2QI9F 4J03A 1UPAA 1XR3A 4TWAA 5DBFA 4EHJA 2HK8A 5ERYA 1IBRA 5GQSA 1H2HA 1E0AA 1KHTA 2PT7A 2W2LA 4B8ZA 5K3FB 2OBYA 3BE8A 3KWJA 1T1IA 4HKTA 4HSEA 4H0CA 1OW3B 4FGKA 2AN3A 4NARA 1LQ2A 1R6XA 3TDNA 3OH8A 2BZ1A 3PDIB 1WWKA 1UC4B 2Z5LA 3VUEA 2X4IA 4EHDA 4EJFA 5A1JA 1QHHB 3P9YA 4EW2A 3P8ZA 4JYBA 5C7LO 1AH2A 4FLFA 1FMTA 1HYQA 3C3KA 1Y8RB 5F21A 3PT9A 3RJMA 5FO0A 1ZJYA 2OKCA 1WY5A 4PYOA 2HI0A 1SIUA 5BXQC 2XWQA 3GOHA 4JA2A 3C3PA 3FKQA 4UNSA 3V8VA 4E2XA 4A15A 2O2SA 4R9VA 4DV3B 5DWDA 2EYUA 3OZTA 3QYFA 1U8XX 5A2QA 3GG2A 3K4PA 2JHAA 3QTLA 1XMJA 1FX0A 2VUSA 4HGRA 1U2GA 3F5DA 4OQYA 2BGIA 3WRVA 3DLBA 3K5HA 5EUCA 3GLSA 5PGMA 3G49A 1VZ3A 2H16A 1ZWLA 5LP6A 4ZAFA 2CBGA 4GEKA 1FU7A 1QZZA 4LEIA 4DMLA 3KPWA 2ZAGA 4WGFA 1RRFA 1Z0ZA 1Y6ZA 3ISJA 3KIPA 1W5EA 4EBFA 3T7RA 4Z51A 1B6GA 1GAJA 4IEFB 4YRCA 4D4LA 4FYMA 3BD7A 2JCBA 3IUPA 4IOKA 4KDEA 2UYQA 4Q4JB 3KCNA 4YAWA 2VAXA 3SX4A 4F4HA 1MZVA 1CFJA 3EVGA 3L6RA 3D31A 4GWGA 4OHCA 1FYXA 3KJGA 2QMUA 4FSHA 3SS8A 3EQZA 2EG9A 2ZRFA 1MHPA 1N2BA 5CDYA 7MDHA 2P2NA 1G20B 4Q6BA 2GBFA 3KYIB 3OOJA 3R3UA 1KQOA 1W4LA 2RHLA 3PP8A 4NL4H 4A8JB 5F23A 1QO7A 1WXGA 4GE0A 2BGLA 2QP3A 4FDMA 1TK3A 3BWVA 1Z4LA 1Z7WA 1B14A 4M9CA 2QRMA 3B60A 2IOQA 4ND3A 1UAYA 1MRSA 4QOHA 4JKOA 3NZEA 4ON9A 4PCAA 3QE9Y 4ZV7A 2BGWA 2Z43A 5MN4A 1R3UA 2E7ZA 1J5EB 2FV8A 2WSSD 3D6HA 4FFNA 4DE5A 4QTUB 1OE0A 3FBTA 3ICPA 3SEQA 1VB3A 2FPXA 4K5QA 4POAA 2AOWA 2F3SA 4MCAA 4GOND 4WBNF 3RS3A 5F1PA 5K6AC 5ALRA 4KJXA 5FBRB 5L4LA 3JU3A 3KB1A 3HU3A 3OF5A 1WE2A 3FCOA 1VM6A 2PMBA 4RY8A 5TVGA 1NF2A 1P2DA 4MJ3A 1H1DA 4Q7MB 1E9FA 4WOJA 3RE1A 3THRA 1C0PA 2ID9A 3EIQA 1C0EA 1AS0A 2FR8C 1EFUA 2C20A 2PT6A 1BIFA 1PZXA 3FSGD 4UAJA 1E9EA 4G01B 4NRDA 5CLGA 5BVGB 2ZEJA 1U02A 3TRKA 1TIPA 2H85A 4FGUA 2J08A 4JLMA 2C8LA 5LDHA 3O03A 4RZXA 2DYKA 4WN9B 2C7QA 3EQ9A 3DEJA 2EWWA 3F3MA 4MMYB 2XE4A 4YDHB 1RMQA 2HLHA 3EW7A 2GGSA 1I80A 2I22A 3CH6A 3CF2A 3EY9A 3HC7A 1ZM4A 3MWEA 1GUDA 3RV4A 4LGCA 3VNBA 1E1MA 5DSZA 1B41A 4N82A 4XYBA 4KDRA 3HJTA 4TLMB 1GRQA 2HAEA 4G5RA 1U2RA 3S29A 3F5MA 4DABA 1HDRA 4UTXA 3DVQX 1TUBB 3A1SA 1XZDA 5DU2A 3QV2A 4GNRA 3N8GA 5AVZA 2OO5C 2ONJA 2VNHA 3N0WA 4UE6A 4Y98A 2PZKA 3OD5A 4G8BA 4URFA 3SQOA 2GZ2A 3UY4A 1T3ZA 4OUKX 5FPQA 3I23A 5BNTA 3PQFA 3P1JA 2VC2B 4M1EA 4LK3A 1SZPA 3DPSA 1MGPA 421PA 4C4PA 3U3DA 4CMGA 2UUCB 2W11A 2P65A 2OQIA 2QUHA 4RV9A 5FPKA 4GI7A 5AHOA 2HRQA 4BMYA 3BXPA 5AM0A 1L1RA 3RSLA 1CNFA 4MQFA 2RDMA 4G67A 4HZUB 4S35A 3VXKA 1VCIA 4Z1OA 3QIVA 1DUVG 2GJAA 2QQ5A 1VL2A 2WYOA 4JSYA 3J80A 1EX1A 3EPKA 3RFUA 4DJ5X 4BVHA 5CT6A 4BV2A 5TPZA 3LQKA 3H42B 3IQDB 2CVQA 4KV9A 1KI7A 1MEJA 1PDVA 3HJCA 4LOIA 1GQ2A 1RYEA 1XRQA 3SDSA 5EJ4A 5I9IA 4TL6A 1CUWA 2YMPA 5KTTA 2A9VA 4H35A 1LI5A 4RZQA 2IRWA 4CM8B 5BYKA 1YJCA 2VP9A 1ZIYA 3FMVA 4BNWA 1QDLB 4HZIA 1C1XB 1G60A 2IF2A 3LUKA 4M36A 3QRWA 1KF0A 2WWFA 4UXJA 4AZ3A 3THWA 2Q4RA 1L5RA 4OHMA 3WL4A 4BCCA 1R4AA 1ZPDA 3RNOA 4D4IA 2Q2VA 2HPVA 3HN7A 4Y18A 4YP1A 1A9YA 2TYSB 3KEFA 13PKA 2FSGA 5EC8A 4GPZA 1N32B 2NACA 2CL7X 3N28A 3NHMA 3K0KA 1IHOA 3NHPA 1XDDA 1FYEA 3QA9A 2UUBB 3G8YA 2HMVA 3HEBA 3K6RA 6YASA 2GBCA 2HW8A 2O7NA 1TLLA 1U1GA 1HBJA 2ZGVA 4MRPA 4A9AA 4CLOB 1ZJJA 1BDHA 2VDQB 1W36D 4OQFA 1PJ3A 2JIZD 2X6RA 1LLCA 4JLJA 2AUNA 5IH3A 3URKA 2MIIA 2GCEA 2Y2VA 3TKYA 4DYDA 2HNBA 1K9VF 3HA3A 2BEUA 2Y0PA 4OJMX 5CG1A 1EWTA 1Z9BA 2GEDA 4JBXA 2YMMA 4NULA 4YY3B 4LRQA 2IPLA 2Q99A 4KXXA 1YJBA 4IUYA 2P2CA 3L6EA 4MUBA 3TEJA 3ADBA 4BVBA 1N2CE 2N75A 4KLNA 1ZK3A 3G5MA 3VU9A 3TW4A 4F9GA 2IDKA 3GFFA 1JQEA 4MV9A 4CG3A 3BKXA 3LW8A 1QZTA 4OQNA 5K03A 3M6LA 1I7DA 3L7DA 3T7JA 3TQRA 5ITVA 3L6OO 1RXVA 5CURA 1Y8ZA 2XE6A 2VDLB 1Q83A 1R3DA 1X8KA 1DT3A 1NN0A 1C0LA 1YFJA 1PKEA 5C37A 4UE2A 1KJ8A 3BIFA 1ZUHA 3TRIA 1UWKA 2ODQA 3CLSC 3KB6A 4HWGA 3AUFA 3RS7A 5J58A 2ESRA 2I66A 4OMFG 5LM3A 1Y7IA 4MR7A 1TPYA 4Z99A 1Y42X 3BJMA 2Q5IA 3M6FA 2PLFA 4D4GA 4QGFA 1RHMA 1JJ7A 1C8LA 1N5JA 1X3SA 4RORA 4G86A 4TSKA 4E5PA 2FZKA 3CRQA 4LBVA 4UNPA 3DOUA 3OWXA 5T6BA 2BKXA 4ID3A 4WZAE 1XQ9A 4D9CA 1UKZA 5FX2A 4BV9A 4RD4A 1H66A 4LGYA 5DGIA 1C7ZA 1DAEA 1W0JA 1XF1A 1AY0A 2VYVD 4J0JA 2HKIA 3IOYA 1ORVA 1RKVA 1EM8B 1RE0A 3H5LA 4LMRA 5DW3A 1QQ7A 4LF4B 1IN1A 2VJMA 2VKTA 3MTBA 4ID9A 3G2NA 4Q3LA 1CRLA 1EAMA 1COWA 3AZQA 3CPHA 3LWNA 2YN2A 3RFTA 3MUFA 1JEEA 2W37A 3RK4A 3TECE 1JDUA 1T9GS 4QO8A 4AWAA 1NP3A 5BV7A 1CJMA 3SYKA 1KYVA 3V3TA 5BUZA 1WHSA 4KXYA 2EDAA 3IT2A 3B2NA 3WYFA 4NMLA 3D0QA 3FAZA 1RAFA 4IUDS 4M37A 3GXOA 3OJXA 4LSWA 4BPRA 4BATA 5IVPA 1U3WA 2FX2A 4JDUA 4JS0A 3LWZA 4C88A 1P61B 3OMXA 1RXIA 1IJFA 2J31A 4CF3A 2NSLA 3FPJA 3OHPA 3P2OA 4L07A 4CL0A 4WRRA 3K0AA 1MJNA 1TECE 1XTUA 1YQTA 3TPCA 4A6DA 3PGMA 4HBZA 5A7HA 3BL6A 3NNSA 4LFBB 2C2YA 1E9RA 5F35A 3NORA 2AFHA 2JEZA 2GJ4A 1D09A 1P0IA 2QRGA 3JQGA 1UBSB 3MZ0A 2VBGA 4B81A 2D06A 3ZVMA 4H59A 3JQ9C 1HDGO 4P93A 1XLUA 2CBZA 4XFDA 3J7AC 3FNFA 2CVOA 3FROA 4DEVA 4J75A 2LCFA 3O4JA 4YECA 1V6AA 3LPDA 5G0VA 1J8VA 4BTVA 5JDIC 4Z8YA 5EUBA 4OV6B 5JNRA 1ZD5A 1LDEA 1ABFA 1XYGA 2IDZA 2X9QA 3CN9A 3G2IA 4MRMA 5L3ZA 3FNBA 4ER6A 3HJRA 3O92A 5DFAA 1Z2PX 2J9ZB 3WK9A 4I4LA 4AY6A 1W6UA 4NENA 1GKYA 5FLXA 1E8DA 3KQVA 5ETJA 1DTEA 1Z4NA 2RHDA 3WGGA 1Q3HA 5LMNB 4MR9B 5HF5A 1NPTO 3PKIA 2TSYB 1ZZGA 3AFHA 1IB6A 3QOFA 3WFIA 5HZMA 2ZYGA 2JIOA 3NAGA 3OZRA 4HGOA 3FUTA 4XIGS 3AYZB 3JVDA 4OQEA 1PLJA 2DWOA 3TB4A 2AWNA 4EPTA 4M8SA 3OA2A 4UD6A 2PL3A 1O5IA 4IDGA 3B36A 1TF7A 1U9IC 4OHPA 3TXYA 4C29A 4XM1A 4J6EA 4Z53A 1ZZEA 1IEWA 4LHYA 4PQYA 4G24A 2ZOSA 1RJWA 3PSHA 3MD0A 3UMBA 3O21A 1XX6A 3CS3A 1U3UA 4FHZA 3OC0A 4Z7NB 3K96A 3AILA 1PJ8A 2P7IA 1NL3A 3GEMA 1HQDA 4TV9A 5T4FA 4Z4GA 2C1XA 3D8RA 3GU3A 1JI0A 3V42A 2ZI6A 2PWBA 4CU5A 4UOZA 1J0DA 3IAFA 4EUHA 1BDIA 4BEBA 4ENRA 3ZKAA 3SHQA 4IDFA 3VGJA 3OF2A 3ZCRA 1BWPA 1FMCA 1T8PA 4IJWA 5KSOA 5LU8A 4PSCA 5H3HA 2UZ3A 1BAPA 1AO0A 5CLQA 1RHKA 2AJLI 3V7WA 1KNQA 2E4AA 1RHRA 3RS2A 3EH2A 1EHIA 1LPNA 1XA0A 5EQFA 5KWSA 1B4DA 2VWHA 1H4QA 5HBGA 1DC4A 2ZRKA 4Q1AA 4WUVA 4FIDA 2WLSA 3QTBA 3RODA 4TS1A 4PAQA 16PKA 4CMBA 1KMQA 4ETMA 1ISIA 2ZRGA 1MEOA 1EJBA 2MMGA 4BO8A 1WTCA 4O33A 4YUAA 3HBLA 5I7UA 1JIUA 4KAJA 5KNDD 1MOZA 1YQXA 2QM0A 1CUSA 3R75A 1BTOA 3H11B 2COKA 3JQEA 4CNBA 1J1ZA 4Q5IA 2J7PD 4CZ2A 1AHPA 1RJ9B 5CVEA 1QVZA 1U8TA 2YBEA 4LJSA 2A4KA 1P1IA 2Q0HA 2GASA 4ZAZA 5AKHA 1MG5A 1R0XA 5SYNA 4ZK2A 1H9AA 3A9VA 2IYVA 4IXWA 5JCOC 4ZYYA 2CLCX 3EZGA 1YC5A 2WKQA 1QP0A 1NJFA 1JXAA 2QRPA 2I3AA 1ZK0A 2IQIA 4CIXA 4DLYA 4X62B 4I50A 3DPUA 1Q1AA 1AUXA 4R2JA 1SQFA 4LUCA 1R6UA 5CFQA 4GYJA 3H19A 4ZYXA 9ATCA 2R68A 2V59A 1P5FA 4F7WA 3RD5A 2OWDA 5FOTA 2GPSA 4UVDA 3WLSA 2WJWA 3BH7A 3DOEA 1X7YB 3GK3A 3I2FA 3TEFA 1XJCA 3KR9A 1C4KA 3E7XA 3QMPA 1L5LA 3UWMA 2OFOA 5IS2A 3M82A 2YC2C 2YXEA 3T3OA 4LXGA 4BRWA 1WBJB 4HXYA 4DR5B 3R23A 4PO1A 3KTFA 4EFLA 3CLUC 4QGAA 3IP6A 4WA8A 1AIPA 5CFMA 1FVXA 2SKDA 3KKMA 3RRMA 1T9AA 4ZWNA 1H4VB 4CJXA 5JROA 1C7RA 2M6RA 2VK8A 4JVMA 2C00A 1IK4A 2MSKA 2WG1A 5LDGA 1NNI1 3SHWA 5LD2C 2DB3A 1QNFA 2ZVJA 4TWIA 3T95A 2OVFA 1KO7A 2Y3IA 5CGQB 1YDGA 3I34X 2IEIA 3JAWB 4IXMA 2QTFA 4YXFA 4HAXA 2WIJA 2Q4DA 1VJGA 1T36B 3DOOA 1QLHA 1E7MA 3B3QA 3K4HA 1Z37A 1KI8A 4F2GA 3CVUA 1GDTA 3GBSA 5KOHA 5DYNA 5LQNA 3ND6A 4RTLA 1PP4A 3UWSA 4F3KA 5T3UA 1LPPA 1XTBA 4LCBA 2VHVA 1EA7A 3GAZA 4FYJA 1VYHA 3AIKA 1ODLA 1ZOIA 3PB3A 2LV8A 4AZ3B 1I7LA 3E70C 3VHXB 5TQVA 3T4EA 4A5OA 1VL6A 4LVOA 4WECA 4Q9IA 2OHOA 3HWX1 1EJ0A 3Q40A 4E4RA 4C89A 3WZMA 4JOBA 2B4AA 3AM4A 1Q21A 1NW9B 1SC4A 4GI2A 4GKAA 4ZAXA 3KT3A 5KIAA 4UVGA 4MAFA 4CL3A 2FCAA 5CNMA 4IGKA 2M1ZA 1TJ4A 3PZBA 4EFMA 3EOAI 3FWHA 1QV6A 2FSPA 2P7HA 4PONA 4J3FA 4BMDA 1TXGA 1UBCA 5TC4A 4IPTA 1KP2A 2BEWB 4IR7A 3IBSA 2V96A 4G9EA 4AG6A 5ICSA 4XE5A 1PV4A 1UEXC 1NJGA 2O7VA 4U4AA 4ZJYA 5C7OO 2GF9A 1Y3IA 3UCEA 1BXRB 3H9GA 5A3JA 2GJ8A 4C08A 4X7BA 3W1WA 2FQWA 2W22A 4RM2A 1EXNA 4HDSB 3AEKB 4J6FA 3LPAA 1Q22A 3TJZA 1HNNA 4KHZA 5AW8A 4HN4B 1J8FA 2WD8A 1SKBA 4K9DA 2WSBA 1X7DA 5DGDA 1SA0B 4M38A 1U63A 4ZC8A 2QX4A 3DLAA 4Z1MD 1SVWA 1UZLA 3O2JA 4X6UA 5E1BA 1UWVA 3TOVA 1EE2A 3V8QA 3VNSA 3HN6A 1AN0A 3QLEA 4ZRMA 3WDMA 4E1AA 4AO6A 2QXUA 9ABPA 2B1IA 3OQHA 4ARIA 5ERGB 2YVUA 2C4WA 2EJWA 1FY2A 4I5EA 3KP1A 3A37A 4QT4A 1S0UA 1U2PA 2CLKB 2F59A 4QJ3A 1GGNA 2ZP1A 2HWXA 4AN4A 1T0BA 4NH4A 4GT1A 1P6XA 4NESA 4BS9A 1CEQA 5HKLA 5IT9A 3JAMA 1UQRA 4LW8A 5AVTA 3QKSA 5LMCA 4BV3A 2JPDA 5B1DA 1BROA 1BH2A 5KJCA 2WVHA 4LWZA 5FPTA 2DC1A 2XIJA 1ABEA 1OGJA 3U40A 3IELA 4ENSA 4B76A 1PJLA 1PL7A 2AGVA 5CVJA 3FSJX 1EVYA 4EX7A 4CF6A 4NDZA 1EB8A 1F8UA 4M9ZA 1GRCA 2Z9CA 3PGLA 3QGMA 3P9QA 1I4OA 5ALWA 2WI8A 5H02A 3HCDA 4JBLA 3KETA 5HKKA 2YWJA 1WETA 5A5DA 4OH1A 4QBFA 1XL0A 4ZN6A 3PL1A 1IQPA 4NHOA 4IIXA 1AV7A 2R6CA 3EZ6A 1PEDA 3A70A 1GVHA 3VDRA 1PR2A 1ZAKA 3KZKA 4AJNA 1KEWA 2Z1MA 2XOEA 4EHNA 4EO9A 3L49A 3H7IA 2XUHA 2HL6A 1RI5A 2IIBA 2VEOA 5BN3B 3FYSA 3OJWA 1OIVA 2FCRA 3R3WA 4ZO4A 2GZ1A 5UKDA 4IKPA 5FV4A 4XR4A 2ORYA 3UAOA 1I2MA 2GEJA 3CIFA 4G5OA 1DIAA 1PHRA 5CFPA 1ZCZA 2H1VA 3F1KA 3HP7A 3ZE7A 1RNLA 2RARA 4CLXA 4H6VA 3EPJA 3WMRA 3UJHA 3ASVA 4XUEA 1GPAA 5B58T 3UT0A 1CJVC 3E9CA 1HLFA 3MGKA 1U1FA 1C41A 1ZGCA 4C3ZA 5K09A 3AB8A 2I6QA 3ZNQA 2BEKA 3SZGA 3HXQA 5DXJA 3C3WA 2H3EA 3Q7RA 3WXBA 3I6BA 5BMVF 2BFCB 3DV0B 4NONA 3P5BA 2XMCA 4ZAGA 3PLAE 1MOQA 4EM6A 2OD9A 1UC5B 1KC3A 4PCLA 3ZJ5A 4LTMA 1O1YA 1QIIA 3U3XA 2GA8A 2JCGA 3TOXA 1BE1A 2ANBA 2FEPA 3DBIA 4X6YA 2EKBA 4MV3A 1WXFA 1WDLA 1KDVA 2C42A 5L3SB 4GYYA 3BSFA 4JB3A 5LYJF 2P3SA 2XCLA 1UDCA 1CV2A 4WLFA 3Q1KA 3EOBI 2B30A 3DDOA 4UM8B 5GONA 4ZMBA 3CX3A 3N87A 3QZUA 4AULA 2DFDA 1G3MA 3ZEAA 1V5WA 4U2EA 2RJOA 1SXJD 1A8QA 2AR9A 4D9IA 5EHQA 1QYWA 1N8TA 3ZK8A 3H0CA 3ANNA 2ZSIA 3C97A 5KYWA 3ME5A 3H2BA 1GPJA 2B9VA 2DFKB 4PLTA 1NI3A 3H5OA 1Y4UA 4RVNA 2Y1EA 3I9V6 2VHTA 3ABOB 1IEQA 2DE0X 2VUHB 3N86A 2HV9A 2XLBA 4MV1A 1Z82A 4ZYVA 5HKAA 5JZSA 1I3NA 5HHTA 1U7UA 3I8OA 2IT1A 5I4IA 2QLMA 1G21B 3GZ4A 4BRZA 4DV1B 5ELXA 1K5GA 2VOEA 4IJ6A 4WL0A 4JLOA 3DMDA 3SYLA 1S02A 3S68A 4PVCA 4YI5A 4YT5A 4YACA 1M1YB 4P81A 3UMCA 3IMEA 2VH1A 1EFCA 2OT3B 1JUDA 2Z8YM 3CBQA 4FIZA 4JT2A 5TPZD 3NETA 3WYGA 1R0KA 2DQZA 2X9GA 4M8IA 4HH1A 4QQKA 3UXMA 4B40A 3O2NA 4R8LA 1TE2A 3E61A 3F4LA 3GLRA 4WK2B 2NVOA 4X41A 5DCYA 5EG5A 1KEUA 2IUSA 2Y93A 3I2HA 1I51A 4LFAB 3AERB 1O03A 2G8NA 4LXIA 121PA 1M2FA 3RRJA 1W5SA 2FLWA 3ADKA 2FDRA 3ZQUA 4QLOA 1PBNA 4ARBA 3PHCA 4C5AA 7GPBA 1W4RA 1VLJA 3OZAA 5KOYA 4HC4A 1K1EA 1QM5A 3QVKA 5DM2A 4QDJA 2FPLA 3P26A 3B70A 5J1TB 3VJKA 1JEAA 3JQAA 3HKCA 1OROA 2Y0EA 3BULA 5KYUA 3RC8A 4WV3A 1QCZA 1QIFA 1W7AA 1U94A 1XKQA 5LWQA 1KI1A 1NC1A 5B6IA 3MTDA 3OE1A 4X1IA 3DTYA 1Q1ZA 4CKWA 3KALA 1JECA 2HF9A 3HR7A 1MCZA 1OFUA 1P7ZA 3EA4A 1CUJA 3BTUA 3ONFA 4FSXA 3Q8KA 3WA6A 5KTSA 2D62A 4RNCA 4YROA 2G5CA 3CKMA 3PI6A 4YPVA 4PIPA 4ZVTA 1EXDA 1GZUA 2OORA 4OLFA 3A6ZA 1GVNB 3ICCA 4C4RA 1A9SA 4K7JA 3AEQA 3NIDB 5F1YA 2QE6A 1M1ZA 1HOTA 1KYWA 2FJ0A 1U0OC 3A9RA 1UJ6A 3N2IA 1L7OA 2MINB 5DEIA 2O8FA 2AG5A 3NHZA 5LQUA 3PRJA 4KE9A 3PKZA 3RWBA 2RJNA 3KPUA 1FDOA 3DB1A 3VC2A 5JJLA 3JQFA 4DLWA 1NYLA 2RE8A 1V45E 2F43A 2Y71A 1GSOA 2QG9A 2PA0A 1JFLA 1EDDA 2PS0A 1EFHA 3SJUA 4IDAA 3VO8A 5BR1A 1JU9A 1PJ2A 1X7WA 1FSZA 3PWKA 4L85A 4MW5A 3CVWA 3GARA 1GWNA 1X87A 4KRXA 1SQ6A 4GM4A 4TUYA 1L5QA 3COPA 2NADA 3N2EA 4WBXC 3F74A 4RYDA 2OHIA 2ZSFA 3I6QA 4WFQA 1ZGHA 1RD4A 2G09A 2HQBA 4X6XA 4L4RA 4D9FA 1FFYA 1ZEMA 2JFZA 3PFGA 4Q4DA 4DY6A 3U60B 4WIAA 1TD9A 1TQ8A 3HV0A 3ORSA 2O1WA 1T8YA 1V8DA 4UU7A 3VR6A 4EL0A 2AFHE 4TTAA 4BRSA 5BWOA 3F6PA 4RA9B 4YCLA 2XMRA 3DCIA 1RWKA 1ESCA 2COUA 3EFHA 4W82A 5GV7A 5TPWB 3R5FA 3VSEA 4TMKA 2C5HA 2BGNA 2ZSKA 4K2AA 4N7RA 2Y67A 2I6TA 3CZ4A 1TEZA 2G4CA 2Y66A 4ZHSA 3NC4A 4R98A 1A5ZA 4GXNA 1I7NA 2E18A 2YQ5A 4P34A 4LDNA 4NDNE 2C7PA 1PUXA 3QLJA 3LBIA 4L73A 3SP1A 3QKSB 4LKRA 4JI2B 1TYZA 1UKCA 4JYZA 3EEOA 1SUWA 1MDBA 1YRAA 1PG0A 3HRKA 5EXEA 2XGSA 1R37A 2CT8A 3WRWA 1DGQA 3VTFA 5EWLB 1H3EA 1L0BA 4HMQA 2W8BB 4QUDA 1XJWA 1L4YA 2R87A 5DM4A 1UADA 5BQOA 1M2HA 2BHSA 1ZONA 5CITA 1E9CA 1W4ZA 2A1UA 4ITUA 3U9LA 3W0LB 3LY5A 1Y6RA 5AUOB 1AB5A 1JA1A 1OFIA 1YCHA 2NM0A 4NHEA 3WGYA 1XXHE 1WJGA 3L02A 3MAAC 4IVQA 4AX4A 4NXNB 3AVTA 3K7EA 5K0CA 3BHIA 4JENA 4A2PA 2XD4A 4DOMA 4MLCA 1K5DA 3IR5A 4GP7A 1F2TB 2OD7A 2F8MA 3L6CA 1K0FA 4U7HA 3SC6A 3UGKA 3PD7A 1I4EB 1LH0A 3TMKA 1WZCA 4RIEA 5LYJB 1AM4D 2E4YA 5IN4A 2ISCA 1KEEB 4LI0A 1W