1Z6ZA

Crystal structure of human sepiapterin reductase in complex with nadp+
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
264
Chain Sequence
LYFQGHMLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sepiapterin reductase
publication title Crystal Structure of Human Sepiapterin Reductase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z6zA00
5DNAA 2VRCD 4HKTA 5FI3A 2HMUA 3KV3O 5CEJA 3D3WB 1C14A 2WE7A 2NVBA 1IUKA 2UDPA 3CZRA 3ZNOA 4CMGA 2EJWA 2W2LD 4XD2A 3JD1A 4DMLA 2R2GA 2GD1O 2ZCVA 2HAEA 2VZ8A 3JQ7A 4TMFA 3IL2A 2NWQA 5AXCA 3RD5A 2DTXA 3KYBA 3E8XA 4JJGA 4XYLA 5ADHA 2P4HX 1TI7A 3UUWA 4M89A 4BKQA 3PP8A 4NU5A 3S2IA 2Q1SA 4BKUA 1GZ3A 2Q46A 1ARZA 2YZ7A 1E6WA 3OIGA 1AHIA 4XJSA 3S55A 5L4SA 3DMTA 3F1KA 3G79A 1AE1A 1EDZA 1WZIA 4GX2A 1OZAA 1DLIA 4J1TA 3DONA 3GK3A 3DMTC 2NU7A 2R6JA 3K2BA 4MP8A 4CLDA 1L7DA 4R1UA 1YO6A 2VZ0A 2IRWA 4XX0A 4WCFA 3ROPA 3H3JA 4ID9A 3PGJA 3X2EA 2X5KO 4HFJA 4QEDA 4WCFC 4E30A 4RJTA 1S7CA 4I9UA 2O4UX 4LRTB 3DZJA 5JXWA 1Q1NA 4HWKA 2NVWA 2DKNA 2H6EA 1MG5A 5KKCA 2AEFA 3QWBA 2PH3A 1RM0A 2BKAA 4BNNA 3F9IA 3PHGA 2JD1A 1EVIA 5L4LA 4BKRA 2VQ3A 3QWAA 4RVGA 3BYZA 2D5AA 3K30A 1IB6A 3DZFA 3E5MA 4EEZA 4I08A 1TLTA 3I9LA 3WICA 3ZNNA 2H5LA 1PJ2A 2Y1CA 4P4LA 1NVMB 5EQDA 1T4BA 2CVZA 2O3TA 4ZGWA 5T57A 5I7FA 5BNIA 4BO1A 3ZWCA 4DA9A 1EDOA 2PLAA 4OYRA 2G5CA 1G0OA 1PJLA 2GLXA 5A9SA 4ZQFA 4PLTA 1H0KA 5THKA 2Y1GA 3SX2A 4CLXA 4F45A 4NQZA 4AJNA 2DQ4A 3D3WA 4DIOA 3P2YA 4Z0PA 5BSGA 3JQGB 4DPMA 2RHRA 2C54A 1NTOA 3AM3A 1MC5A 1SOVA 2B35A 1E3IA 3NDJA 4A73A 4CLOB 2CDCA 4AICA 3F3SA 4AL4A 1XEAA 1LDEA 3AFNA 1ADGA 3ZV4A 4U6QA 4GGOA 2Q2QA 1HE2A 3H7AA 1QLJA 1PZEA 1LLCA 5EERA 1DC6A 3MWDB 4JXKA 1IPFA 4D3SA 2R00A 3B1FA 4GAEA 2JD2A 2R00C 3Q9NA 4B4VA 1ZK0A 4E33A 1AN9A 3MJTA 1ADCA 3ZV5A 4YRDA 4WLEA 3FWNA 3F47A 3JYPA 4YAJA 3LT4A 1YJQA 2GO1A 1HDOA 3JV7A 3D5TA 3ZDFA 2F00A 4BNYA 1ZNQO 2TMGA 4PCVA 3BIOA 1ZUD1 3WWYA 4J43A 3ENNA 2HO5A 3JQ8B 3ZWOA 4G2NA 2Y0CA 3LC7O 1NM5A 5BQFA 1B8PA 1RWBA 1A7KA 3OETA 3JD0A 4IDDA 2O23A 4OM8A 5DOVA 4PG5A 4IQGA 4ALJA 3KSUA 3IQDB 5G4KA 3ZV6A 4FDAA 2A92A 4BUCA 3KUXA 3AY7A 4R69A 2G76A 4CLRB 4E13A 3ZNQA 3ZWAA 4UREA 1ZSNA 4WUVA 4OO3A 3AW9A 4GMFA 3WNQA 3VDQA 3ZU2A 4BNFA 3C7DB 1QG6A 3ZWBA 1KERA 1U8FO 3L6OO 4HADA 1MV8A 1ZO8A 4M54A 1PGJA 4D7AA 4PLVA 3C1TA 2IDZA 4MVJI 3U09A 4XDZA 3GMDA 4WCDA 3U62A 4J7CA 2CVOA 4L74A 5THQA 2QYTA 3NRCA 3L4SO 1KC1A 4WNIA 3WNVA 2G0TA 3SLGA 3JSAA 1Z45A 4QX6A 3U5TA 3R0IA 1SNYA 2EERA 3I23A 3IAHA 3RUIA 4RQTA 3INRA 1NHWA 3WWZA 4RDHA 3WGGA 3HDYA 3FBGA 4CLOA 1ISFA 3BZUA 4R1SA 2Q2VA 1JDJA 1WMAA 3V5NA 5GY7A 3VH3A 4DIFA 4EBFA 3UCEA 3ZHZA 2GDZA 3QWHA 3HN2A 1V3VA 3SC4A 1BXGB 3MCVA 4OKNA 3RUAA 1PGNA 1M6HA 1VJTA 2IEBA 4WECA 1H6CA 5JAIA 1LRLA 1K0UA 1G1AA 4XA8A 4Z9FA 4R01A 4Y8VA 3I9NA 4ZQBA 3GGPA 1QYDA 3GMSA 4MVJH 3UICA 3EY4A 1U3VA 3JQFA 2UAGA 2EG9A 1UAGA 2GZ2A 2WD7A 3AJRA 2AE2A 4XB2A 1IHYA 1VM6A 5IDQA 1E7WA 2QHXA 4B8ZA 1T2FA 2J3HA 1A5ZA 3JQFC 1E3JA 4NFSA 4FQ8A 1R37A 2O50A 2YDXA 4HV4A 3JQ8A 1NHGA 5DULA 1MC4A 4LSWA 4E5KA 3PHJA 3W8FA 4OOEA 1X13A 5DT9A 3E9NA 5GMOA 1ORRA 3OBBA 4XR4A 3LZ6A 3R1IA 1AXGA 4PLYA 4J91A 3GG2A 1YQDA 4R4JA 4FJ1A 5EQFA 4IJUA 2DTDA 3WMWA 1PZHA 1ZK4A 1BDBA 4XIJA 2QQ5A 1I3MA 1UP6A 2ZJ0A 4QFCA 3ZH2A 4EDFA 2ZB8A 4MVJF 2Y68A 4WOJA 4KTVE 4KDFA 2Y67A 4UVGA 3TL3A 3ICCA 3R6DA 3JD4A 1NFFA 4AJIA 1EZ4A 1UXGA 4RF2A 5TSDA 1I10A 4CLHA 3EUWA 2X86A 5A5FA 4YCAA 1PZGA 3DZIA 3GAFA 4Y6RA 4RCVA 5I7SA 3WGYA 1A72A 3DO5A 1GDHA 4M1QA 4IJKA 2JFHA 2GYYA 4BNVA 3PWZA 1Z6ZA 1GR0A 3HJAA 3IDSA 4UUPA 4NNJA 2BI8A 5ENVA 3H2SA 3LLVA 4J4TA 4N18A 1P1KA 3AM4A 1HTBA 4K1LA 3PDUA 3G17A 5CDUA 4IMPA 2EEZA 1JKJA 4B4OA 2OGUA 4JGBA 1ZVMA 4K28A 4J90A 2RIRA 3HHPA 4L8VA 5JCJA 2YV1A 3PJFA 4IY1A 4RF4A 4W7IA 4IQ8A 4IXWA 5G0TA 3PLNA 2EWMA 3LSYA 4BO6A 1Q0HA 3GHHA 2EXXA 1UDAA 4GQAA 3TDKA 4H16A 1B3BA 3OJOA 3VPXA 4FOOA 2O7SA 1R0KA 1CIVA 4TRNA 3HE3A 4RVDA 5DBGA 3C7AA 5CDYA 1C1XA 1X7GA 5L51A 4YWJA 1YKFA 5A3JA 2VOEA 1LDYA 1D1SA 3AI3A 3N58A 2HCTA 3I4FA 1I33A 1TEHA 2WM3A 3MZ0A 5JBIA 2E82A 2BMAA 3L4BC 3RAJA 3HUDA 1N1EA 1QYVA 3GPDG 3G1UA 4CUZA 1KEUA 4CPDA 2HRBA 4F46A 3CZMA 1UZNA 2G17A 2FSVA 1QV7A 1SEVA 2Y1EA 5JMPA 3ZU3A 3DZKA 1HZJA 4FC7A 5COBA 4DUPA 3A14A 4FFNA 1WXDA 5AYVA 1H6BA 9LDBA 3GH3A 2P4QA 4ALMA 4CMCA 1JW9B 1OC4A 1XG5A 4DWVA 1SEPA 1R4NA 3G3EA 2VWQA 2Y66A 1ISJA 1VKNA 5JW6A 1V35A 4JNKA 3S2FA 2LDBA 4IDBA 4LSMA 3EDMA 2C7GA 3UCFA 4F6CA 1NQTA 1M6WA 2VRCA 3SEFA 2C59A 3NJ8A 2FMUA 3VAZA 3FWZA 1LC0A 4WE3A 2GRAA 4PG6A 4HP8A 1O94A 3DEYX 4TZKA 2IYPA 1PR3A 1VSVA 3BMQB 2F1KA 2CD9A 3DB2A 4IIUA 5TS3A 4R5HA 4BMSA 4CR8A 1NX6A 1T2AA 1VC2A 4Y98A 1TB4A 5HA5A 2JL1A 1NFRA 3H9JA 4GWGA 5EN4A 3E18A 5KOIA 4Y9DA 1P33A 4BNZA 2QIOA 4Q9NA 5F5LA 1VJ0A 4GSKA 2CF5A 2C5AA 2Q45A 3BAZA 1U3UA 4R41A 3VOSA 5COAA 3JQCA 2DUWA 2B4RO 3M6IA 4YA6A 2OFPA 4OHUA 3DTYA 4CM7A 2AEJA 3PIIA 4J7UA 4L4RA 4LISA 2DBZA 2X5OA 4YAKA 5CDTA 1DO8A 4LRSB 4WLOA 1U8XX 3DQPA 4J49A 2Z95A 4E31A 4XB1A 2JKVA 2OUIA 4U0JA 3VPSA 4TWRA 4KQWA 2Q50A 1X1EA 4FB5A 1PSDA 4YAEA 1ZBQA 1TXGA 1DFHA 1WMBA 5ER6A 3UKOA 4D43A 1LDBA 2ZATA 4BKOA 4BNHA 3ZWXA 1K5HA 1T2CA 2J3JA 3VTZA 5JE8A 1NQ5A 4CMIA 2OBYA 5DP1A 1L1FA 1EFKA 2VUTA 4PLCA 1RM5A 3WIEA 2I9PA 3OMLA 1N7GA 5ICSA 5EINA 1KVSA 6ADHA 3DTTA 4BNUA 4ND2A 5T6BA 5TX7A 1X15A 3OH8A 1DPGA 1BRMA 2YY7A 5FFFA 3ROMA 5T67A 5G0UA 3NUGA 4FC6A 2PR2A 3HG7A 1DIHA 3IIEA 4L73A 5IN5A 5AXDA 1X0XA 1MLDA 4LN1A 2JCVA 3STHA 1H9BA 4EUHA 1B26A 3BTOA 3AI2A 3AWDA 3DC2A 1QR6A 4ALIA 1E5LA 1NXQA 4RVSA 4M49A 3PYMA 3GFGA 4Q3CA 4TQGA 1DIRA 3CH6A 3OP4A 4Z9XA 1ID1A 1OAAA 3OJ0A 1J4AA 4E5MA 4CMJA 4ZVVA 1YQXA 4DQVA 3DFZA 1EVJA 1LDNA 1VPDA 2PZKA 7MDHA 4GKVA 1LLUA 1F17A 5A02A 1FF9A 2Q2WA 4NIMA 1BXZA 4MVJG 4PIVA 3RQSA 3GC6A 1D7OA 3RFTA 2FY8A 1DAPA 4CQMA 2B4TO 1ENZA 3B1JA 4CMHA 3D7LA 3ZHBA 1SMKA 5JSFA 3H3FA 3JYNA 3ORFA 1U7TA 1EQ2A 2HRZA 3TQHA 4ITUA 3UH1A 1NVTA 2VWGA 3MJCA 2Z1MA 4DQXA 4R3WA 1ONPA 2VHZA 1LSSA 2EP7A 3WGIA 3O4RA 5L40A 3GEMA 1B3RA 2C82A 1DLJA 1K6JA 4UUMA 4F3YA 1UP4A 4DC0A 4CUKA 5EESA 1UDBA 2OL4A 4AVYA 4S3MA 3ROKA 2DPHA 1ZXLA 1WDMA 3EGOA 3KRTA 3BTSA 4NZ9A 2Q4BA 2I3AA 4GPD1 4JROA 5LCXA 3GR6A 5ENDA 1U4OA 3KVOA 5CEEA 1KEPA 4R1NA 3GG9A 3KLMX 3H5RA 4B3IA 3F4BA 1E3LA 1FDWA 4J1QA 1JWAB 3UHAA 2VYVA 1LC3A 1V3TA 1NWHA 1GCOA 1NP3A 5KVQA 3IKTA 1XA0A 1GV1A 3QV1A 1IZ0A 4JP2A 1BWSA 4WLNA 1ML3A 3BMCA 3ONDA 1B2LA 3JQ7B 1JVBA 4X54A 3JQAD 5JYEA 2X0NA 3JD3A 5JCJD 3BXXA 3W6UA 3BTVA 1Z75A 1P1JA 3FN4A 3BA1A 4CL3A 3I9MA 1E6EA 4UUNA 4BNMA 1PU2A 1JTVA 2O7QA 5MDHA 3FBTA 4YACA 3K31A 5IN4A 3EC7A 2UV8A 4PLHA 4PRLA 3RFXA 4BO9A 3JYQA 1P1IA 3ZW9A 3PQFA 2E37A 3I5MA 1JWBB 2X0RA 4P4GA 1MX3A 4XKJA 3PGXA 5B4VA 2DM6A 3I9JA 3JQ9A 4D41A 3GVHA 5KJFA 4EGFA 4R54A 4XIYA 4RZHA 4FOSA 3JQ9C 4XQGA 5FYDA 3DAPA 4MP3A 1U2DA 4BV8A 2GN4A 5CP8A 5JDIA 3JQ6A 3CPSA 3OA2A 4CM4B 3N7UA 4FGSA 4DTIA 4YDRA 5JDIC 1HLPA 4NBRA 5CDSA 2H1SA 1DHTA 4DC1A 4E5YA 4OAQA 1DSSG 3RROA 5BSHA 3Q3CA 1WNTA 1GZ4A 3PJEA 2VT2A 3ZNPA 2BFOA 8ADHA 3EK2A 3BHJA 4F6LA 2X9NA 3X2FA 4EJ6A 3PRJA 3QW2A 4B7XA 3ITDA 4PVCA 1MP0A 3KYCA 4D46A 1UJMA 2BF7A 3E5RA 4O5OA 3UXYA 4HFNA 2W4QA 3TSCA 4OIMA 4OXKA 3ETEA 4O0LA 1F8GA 3K2EA 3VZRA 4LVCA 1KVTA 4B7CA 3MTJA 4MOWA 1GYQA 3D1LA 1D8AA 2OMEA 2WEKA 5K6AA 3H8VA 2YHIA 1M76A 3GFBA 4EITA 4FGWA 5K6AC 1C0IA 4C7KA 3JYOA 5A9SB 2X58A 2YW9A 1B0AA 1WVGA 4HFMA 4BNGA 4BGUA 1N9GB 4RQUA 1XKQA 5TRTA 2XXBA 3TWOA 2HKIA 2Q99A 4ZJUA 3K8ZA 1LEHA 1LU9A 4YRAA 5GZ1A 1CEQA 1T1RA 2D0IA 3LT2A 1BHSA 1I24A 1HKUA 4K26A 4GGPA 1UAYA 1DRVA 3GGGA 5EL0A 1WLYA 1E1MA 3WOHA 1YL6A 3W6ZA 4BGIA 3WYEA 3OQ1A 2WMDA 4J1SA 4BO7A 3GLQA 2EIHA 4FSHA 3KEOA 1T2DA 2X23A 4YAIA 1QV6A 5U9CA 3K6JA 4PG7A 1NR7A 2OO5A 1KBZA 1GZ6A 2DPGA 4PLGA 1EUDA 5A1TA 1YJ8A 4IZHA 3QY9A 2C2YA 1SZJG 1E1KA 4TRMA 3UVEA 4R1TA 1P9LA 4ND3A 2PD3A 2ET6A 4NG5A 2BI7A 4OL9A 4DVJA 1LRJA 5DP2A 3WYBA 1MFZA 3OM9A 2BELA 2P9EA 2P9GA 4CM4A 5A9RA 3VZPA 5TIIA 2A9FA 3DBLB 2NTJA 2XAAA 5G4KB 1YB4A 1W6UA 3RKRA 3GPIA 3RUHA 3KZVA 3ZZNA 3U4DA 1LLQA 2IE0A 4W99A 3ANLA 2EGHA 3CUKA 3GAZA 3RI3A 3PFFA 4WNCA 4M86A 1EBFA 4GX5A 5L95A 2O2YA 4WJZA 3L6DA 2PGLA 2A35A 4WEOA 3L77A 3F5SA 4LVUA 5KIAA 3TFQA 4RVHA 1BVRA 5C5IA 3P5SA 2I5PO 4TKLA 2W98A 3B1KA 1BTOA 4N7RA 3U49A 1HYHA 1J5PA 4INAA 1L7EA 2VUUA 3C85A 4AJKA 4NDNE 3GVIA 3PPIA 4UEKA 3GVPA 1A9ZA 4LMPA 1LJ8A 3NKLA 3IUSA 4A7PA 1N9GA 4BNKA 3HB5X 4B4UA 3WTBA 3RASA 3WLEA 1P77A 1KVUA 3PHLA 5A04A 1DC5A 2IXBA 1FK8A 2Q1WA 4BVAA 4NJMA 1I3NA 4W6ZA 3MEQA 4CLEA 3E48A 1LA2A 3KLPX 3NJ4A 4CQMD 1YOVB 4MJLA 3ROQA 4XYEA 5IG2A 1E7SA 1M66A 3QE3A 1Q0QA 3H9UA 1U1IA 1JAXA 5KTKA 4K9DA 1EE9A 5EIOA 4MVJE 4BB5A 5LDGA 4N5LA 2WD7B 1XIVA 2X1HA 1ZKMA 2IXAA 4CODB 3OJEA 1X14A 1GYPA 1YB1A 4RLSA 4IIVA 4RL6A 5G2OA 2AXQA 5BNFA 3H4VA 1I8TA 3WX0A 3JQBA 3P7MA 1SBYA 4FPXA 4KWIA 3ADPA 3DBLA 4AJ2A 3T4XA 1E6UA 1HSOA 3JQBC 1P31A 5FEUA 4DBZA 1ISIA 1GUZA 1IOLA 3AUAA 3GVCA 5C7IO 2D3TA 3EVTA 3RBZA 4FJ0A 3A4VA 2UUPA 5I7VA 1CRWG 3GDOA 3QSGA 2BFMA 3BMOA 3GNQA 1O8CA 1E1NA 2AHRA 2VYVD 4QQRA 1SAYA 4Y67A 5HS6A 5TJ9A 3OEWA 4JLWA 2ZYGA 4Z0HO 4I1IA 4U8GA 1J0XO 3QVWA 3TNLA 1I3LA 2ZQZA 3PJDA 3DZGA 3L07A 1PJSA 3V1TC 3TZ6A 1T24A 5ICMA 3BTUA 2NM0A 3K9QO 1AUPA 1GUYA 3TZQA 4H7PA 1HDRA 1IULA 1PZFA 4WOKA 2VT3A 3ZN2A 1ISMA 3GUCA 3QIVA 1LX6A 3A9WA 1ADBA 1BSVA 3QP9A 1O0SA 1ZH8A 2FZWA 4Y6SA 3UFXA 1A7AA 3D4OA 3GEDA 4CR6A 2OZPA 3QRWA 4BQPA 3AU9A 3NT2A 4DIBA 1PQPA 3JQAB 3WFIA 4NBVA 4GVLA 3ZV3A 4OSOA 5B12A 4BGEA 2J5QA 3DHEA 1IL0A 1JAYA 4GWKA 1ZK3A 2ZCUA 3QWFA 4QFDA 1YOVA 1ENYA 1GTMA 1CQIA 1VE9A 5A9TA 2O3QA 4ND4A 3FHLA 4CL8A 1KIFA 4IDCA 5JAMA 1UP7A 3WFJA 1C1XB 5L4NA 1OI7A 4D44A 3JQEA 4YT5A 2CFCA 3OJLA 4RPKA 2AW5A 1F8FA 4XGKA 3LVFO 1PTJA 2GCGA 2CY0A 1RPNA 1KOLA 1A27A 3O9ZA 4QTZA 3RKUA 1NVGA 2CZCA 1ULSA 1EEHA 3HNPA 3F46A 3V2HA 2HJRA 4TROA 3F5QA 1QMGA 4FS3A 4JCOA 1HT0A 1HZZA 4QT0A 1E7YA 5TLSA 1HE3A 4PRKA 3CSDA 3A1NA 2O2SA 3B20A 4GLLA 4IM7A 2RAFA 1T26A 3FNHA 1R6DA 2GN8A 4P4NA 5IDXA 2AEMA 3HB4X 1BGVA 2EHDA 1ONOA 3H2ZA 2NADA 3RVDA 5ILOA 3ON5A 1A71A 5JCXA 3HWRA 5K9ZA 3LT0A 4ND5A 2P2SA 1GAEO 4DGSA 3U4HA 3MJEA 3OICA 3RUCA 2YUTA 1R4NB 4II3A 4ZU3A 1MUUA 1KC3A 4E2WA 4NBWA 4BNWA 4CQLB 3MJ4A 2J6IA 4DQUA 1UXKA 4JJIA 3IKVA 3V1YA 5L9AA 2Z1NA 2BD0A 4J0FA 5JLAA 3H9GA 5ITWA 2X22A 2VHYA 1TT5A 3UF0A 3M1LA 3VC7A 4PLWA 5DCYA 1BW9A 2BGMA 4R9SA 3KSDO 4KUGA 4A26A 2XOXA 2FOIA 2BRUA 4CM3A 4CM8A 3CXRA 2VNAA 1FDTA 3OQ6A 3NGLA 2HUNA 2VCYA 5DCWA 4CM6A 1GQQA 5H81A 3QVSA 3DZHA 3JQAA 3WQRA 5CAEA 3SJ7A 2JCYA 1B8VA 2I66A 2HQ1A 3KHUA 3S8MA 3IS3A 4NR0A 1AXEA 1AGNA 2GERA 4ZA2A 1GUFA 1K6IA 2DT5A 4YJDA 3E6AA 1E5QA 3FR7A 2RCYA 1LQUA 1F14A 3BMNB 1ZSVA 3AUUA 3NGXA 1KVRA 4JJFA 2CF6A 3VVBA 5CFZA 2WDZA 1E7QA 2PY6A 1XLTA 4GKBA 4KQXA 2POQX 2O4CA 3AY6A 3SXPA 1RYDA 3WGHA 1YWGO 1ZW1A 1IPEA 3NDRA 3PYXA 1HDCA 1E92A 4G81A 4NBTA 1I32A 4UVIA 4E2ZA 1ZK1A 3L4BA 4I8XA 3SC6A 1KY4A 1N2SA 1W0CA 3EMKA 1F12A 4N5NA 5COQA 1XWFA 1X7DA 4Z6KA 3FR8A 4MKZA 5ES3A 2V6GA 1SC6A 3DMYA 4DLAA 1VJ1A 4OQZA 1YBMA 4CMBA 3LC1O 3LT1A 4TVBA 2NUAA 2P5YA 5KWEA 4QO7A 1DBVO 1J49A 4I9HA 3VH2A 4BNXA 4CMIB 5A03A 1EVYA 3PXXA 2VN8A 2O3JA 1Z74A 2ZIZA 1QP8A 3WTCA 1XR3A 1Q2XA 4IDGA 2W8ZA 3I6IA 4I5GA 2D1YA 4WGGA 2DC1A 1DOHA 5B1YA 4IQ0A 2PH5A 1XHLA 4XZ3A 5DN9A 2SCUA 2IODA 4AJJA 1GEEA 4E4YA 4FFPA 2PZMA 3GVXA 3NTOA 4IZIA 4UUOA 4CQLA 1XCBA 2B37A 4J4HA 1GL3A 3U0BA 2NV6A 1PL8A 1BMDA 1E3EA 3HDQA 3L9WA 5F1OA 4JX8A 3WQSB 5K0ZA 1CF2O 2DLDA 2VRBA 3ANMA 4Q3AA 1PWZA 5JY6A 1UZLA 3ONFA 1LDGA 3PIDA 1B15A 3WBBA 1DIGA 4A03A 1FJHA 3O03A 3PK0A 4XGNA 4CM1A 1RKXA 4OH1A 1LNQA 3PHIA 4JQCA 2O3SA 3D64A 3ETDA 1XDWA 3LF1A 3G0OA 4E32A 1JVSA 4YJHB 4CQMB 1W73A 3V1UA 1ZK2A 4YVFA 2AA3A 4K6CA 3FPCA 4RVUA 3CINA 3VKUA 3TN7A 3RBXA 4EYEA 2HSDA 3DDNA 3DXFA 1LLDA 2BLLA 3BMNA 3INGA 3H65A 3JCZA 2PTGA 4S1VA 5G0SA 3V2GA 4YTEA 5TT1A 2OP1A 3Q11A 4R16A 2PK3A 1KVQA 2GPTA 3S1LA 1HRDA 4PGFA 4FFOA 4NHEA 5LDHA 3C7CB 3C8MA 5ILGA 1YH3A 1GD1O 4KTTE 1JA9A 1LQTA 1R0SA 1E7MA 1V9LA 5L53A 2Y99A 2ZTMA 5A3VA 1HWYA 4LW8A 5C7LO 3ZWYA 1Y81A 1LI4A 5JDCA 4HUJA 3RC7A 3RUDA 4GLOA 3WSVA 2NVUA 5LC1A 5JDCC 3WB9A 4UVHA 1PJCA 3QVOA 4K6FA 1JKIA 4NJOA 1SB8A 1HYGA 2JAPA 4YAGA 1CYDA 1LSOA 1U2GA 2W90A 5C37A 3PZBA 4L9RA 3RU9A 1NAHA 2PKRA 2DVMA 3DHYA 3G49A 2NACA 3Q0EA 5T64A 1GY8A 1PQWA 5C3MA 1ZMOA 1WP4A 4QECA 1FDUA 4WASA 1U3WA 5DOZA 1H94A 4I5DA 5T5QA 1U9JA 4FW8A 3BMCB 3PQDA 4DPKA 4ND1A 1EUZA 5AVOA 4MKXA 2EW2A 1YXMA 2LDXA 2NU6A 3IJPA 3QVTA 4O1MA 2HMTA 4RVFA 3U9LA 3FNGA 5IFLA 1XYGA 1N1GA 2P68A 4B3HA 2X6TA 2DUUA 5AXAA 1RJWA 2YJZA 4Q3NA 3DOJA 4U0KA 2X4GA 4UEOA 4RPJA 5HTOA 1QYXA 4RORA 3ZHXA 3L0DA 2HJSA 4L4XA 4YT8A 4E0BA 1EK5A 2YQ4A 2WSBA 2RH8A 2OP0A 2H9IA 4ZICA 1YL7A 3H6KA 4WLVA 3R3SA 3VDRA 4GH5A 3SVTA 3QA9A 5KJCA 1P1HA 4L75A 2PZJA 4LCJA 3T7CA 4N54A 1P1RA 3UN1A 1CDOA 1MGOA 2HK9A 4CMEC 1HL3A 2Y05A 3GY0A 1BXKA 4BV9A 4FJ2A 3WR5A 3I6QA 2VTDA 4YJHA 3F1LA 4E21A 1ZZEA 4IS3A 5EJ2A 2UUOA 3NT5A 3DZBA 5IAAA 1X0VA 2BH9A 5KNLA 5L3ZA 2AG8A 1OBFO 1CQJA 3ZHYA 1Y5RA 2HMWA 1XQ1A 2NU8A 4CM9A 4LMRA 2DAPA 4GX0A 1HDXA 1XU9A 4BO8A 3KYCB 2NTVA 5TQVA 4M55A 3I1JA 5KJ1A 3AOEA 3GEGA 4HY3A 4MVJA 1NNUA 1H6AA 4D0RA 3AOEC 4XRGA 5CEFA 5JO0A 2J3IA 1GFSA 4DRYA 2FPPA 2JJYA 2YHIB 2NTNA 1NASA 2UYYA 3EW7A 3D5QA 2NNLD 3KEQA 3UGKA 1A4UA 2ZB7A 4P38A 4RPHA 4J3FA 4OJNA 1U7HA 4J16A 3ZWNA 3CIFA 4FFMA 4MO2A 3KOUA 2YFHA 4GX1A 5IJZA 1WW8A 1N7HA 2Q1UA 2XXJA 4M8SA 1DC4A 3ZW8A 4MIYA 5DF1A 4E5PA 3PLRA 3KBOA 3R3JA 4YRBA 4YXFA 1A9YA 1FXSA 2D4AA 4HNGA 4YPOA 4IJVA 1OC2A 2HU2A 2BFAA 3RBVA 1ADFA 1FDVA 4MP6A 4YEDA 4UEJA 4B8WA 3VHRA 3NX4A 3QWIA 2Y1FA 4FFRA 3ST7A 5I8WA 4U7WA 1M67A 3QJ5A 1ZFNA 1KYQA 1QXSA 3UW3A 1E1LA 5KJEA 2ZYAA 4BHTA 5JPIA 5BSEA 5HWSA 5L7TA 3W4KA 3ASVA 4JK3A 5C7OO 1EMDA 4J2HA 4BNJA 3HDJA 3UAGA 3W8EA 5L7YA 4IGFA 1DFIA 2UVDA 5JC1A 2VYNA 4W82A 5GZ3A 5I8ZA 4MVJM 5KVSA 3AUTA 4FIZA 4QUKA 3IJRA 2IZZA 3G1TA 1NR1A 2E6UX 5JNLA 5G0VA 4B3JA 1JKFA 1V6AA 2HMVA 1YBAA 4TRRA 2B5VA 2Q49A 1IYZA 2X9VA 4TVOA 4L76A 1PJQA 5DBIA 3WYCA 3CEAA 2VUSA 4XYGA 2WWRA 1GPJA 5DZSA 1ZCJA 3PEFA 2CDAA 3PYLA 1PIWA 3F4LA 2VWHA 5KVCA 5ITVA 2FN7A 4EW6A 1ZSYA 4FCCA 2A4KA 4AJHA 2DFDA 4EI2A 2C0CA 1NFQA 1XSEA 4BO0A 3S2EA 1R0LA 1H93A 3HADA 1OOEA 4DL9A 5T8KC 4Q3DA 1O89A 4EUEA 3VKVA 4GI2A 1CJCA 3KTDA 2Y0DA 1PS8A 1JQBA 4GL4A 3GGOA 4XYMA 1H6DA 1GPDG 3GF4A 3HSKA 2HMSA 2JHGA 1E0DA 4OOFA 4WPGA 3TJRA 1T1SA 4CV2A 4DMMA 3PFWO 3NT4A 4W7HA 4BIIA 4C4OA 4ZHSA 1O5IA 1DIBA 2ZQYA 4NJMB 1I01A 1VL8A 4RF3A 1HYEA 4XYBA 1M2WA 2C07A 1Y7TA 5HS4A 3WS7A 1X1TA 2J5RA 4BB6A 5U4QA 3V2UA 4U5QA 4AG3A 1C1DB 1YQGA 4I5FA 1HDYA 4E6PA 1V0JA 4P8RA 3TOZA 3FPLA 4QXMA 2Y1OA 5TF4A 4WLUA 1D1TA 2O3UA 4QSMA 1GYRA 4D45A 2O3RA 1C3VA 2AMFA 3U3XA 4ROSA 1EFLA 1MXFA 1T2EA 1VRWA 2EV9A 4BO5A 4D79A 5CPBA 1Y8QA 4DLLA 3AUSA 1KEVA 1YB5A 3TFOA 2PV7A 4DYDA 2JCXA 4KMSA 4L4SA 3T7EA 4BOYA 2J5KA 1NPTO 2QRJA 5GZ6A 5H82A 2NSDA 4IUYA 1GQYA 1CERA 1P45A 5KKAA 5CDGA 3EVNA 5JAZA 1PL6A 5L7WA 2EKLA 3IP3A 4MINA 1HDGO 2HDHA 4J2OA 3WQQA 1UUFA 3WSWA 1UXIA 2OOSA 3I52A 3BMOB 2WYUA 3LLSA 2ZB4A 5B37A 4CM5A 2AQHA 2GZ3A 3IP1A 1E3WB 3KYDA 6LDHA 3DR3A 4OXYA 3L9XA 4CV1A 2VHWA 2G1UA 1DHRA 1TT7A 3CMCO 3OIFA 4NU6A 4B79A 3Q1LA 2GN9A 2QZ9A 4KOAA 3TPCA 3ZU5A 1ISGA 1HF3A 1HLDA 3KSZO 5IDWA 3U4CA 1UDCA 2GGSA 1VLLA 3GA0A 3Q9UA 2PNFA 3IOYA 1BVUA 2FPGA 4NMHA 1DJQA 5CPFA 1G6KA 3MWEB 4JIGA 3GN2A 4OXNA 1F0YA 3WG9A 1LXCA 4NK4A 2IZ0A 4BO2A 2EJVA 4J4BA 1NPYA 1Q7BA 3E1KA 5EPOA 3PZRA 3WBFA 4AJPA 3B70A 4ZRNA 2EKPA 3C1AA 1WWKA 1EVZA 2GUGA 3AOGA 1NPDA 5JFOA 3LYLA 3BHIA 4Q3BA 3RWBA 3WDSA 3RFVA 2I3GA 1E3SA 3LU1A 3U4IA 4R5MA 3JD2A 4RDIA 4BNIA 5IF3A 3OIDA 2WYWA 5B4TA 2FR1A 5F3RA 4MPDA 1BG6A 1C1DA 4D3FA 5KCZA 4DREA 4ESOA 3WGQA 1XGKA 2D5CA 1VL0A 2W2KB 3W1VA 4BKPA 2ZTLA 4G65A 1B14A 1E77A 3MJVA 4PLZA 5JO9A 4J6FA 4AJOA 4CM9D 2X0IA 1YE3A 4IBOA 3JTMA 4L0QA 2HK7A 4UAGA 4UVDA 4ALKA 1S6YA 2Z5LA 2VWPA 2WE8A 2BGLA 4MVJD 1PJTA 1OMOA 1PR9A 1Z73A 1QORA 2HK8A 4CR7A 3C3XA 2FPIA 3IUPA 2GASA 4A0SA 1D3AA 3ASUA 1BDMA 3VVCA 2IEDA 4IPTA 5F21A 2ZK7A 1X7HA 4YJFB 1YDEA 1NQOA 1RYEA 2Y93A 4CMKA 4Y6PA 2V7PA 3GOHA 4RF5A 4EEXA 1A4IA 5I7EA 3HDHA 4C7JA 1TVEA 3RSHA 1MA0A 1HE4A 1NAIA 1T25A 1E3WA 4IDEA 2EGGA 4RPGA 4YQZA 3WXBA 4ZQGA 1U4SA 3TZKA 1EE2A 1ZEJA 3PDJA 1O95A 4NK5A 2GSDA 2JAHA 1RM4A 2AQ8A 2OXIA 4URFA 3W4JA 1XU7A 5AOVA 1TT5B 3VPFA 4Q3EA 1BW9B 2I65A 3E03A 4KWHA 5AQ1A 3DL2A 3WGOA 3GDFA 1FDSA 4KDEA 1IHXA 3DOOA 1P74A 2FZEA 3GDGA 4KZPA 4JP3A 2JHFA 4CM8B 3I3OA 3SLKA 2AE1A 4PZCA 2VYND 3FNFA 3OECA 3GQVA 4GBJA 5ER9A 2PKQO 4UULA 3RC1A 1T4DA 4EJ0A 1D4FA 2B36A 3CMMA 5KJ6A 3RUFA 4RLHA 5HBRA 1J6UA 4N5MA 4UVEA 3OSUA 2YFQA 1PX0A 4PG8A 3JQGA 3S2GA 3ULKA 1QSGA 3VH4A 2DBVO 4HFRA 5TC4A 2W2KA 3ONEA 3JYLA 4MDHA 4MKRA 3D4NA 3KO8A 1N8KA 1RM3A 4J7XA 3GRPA 1KY5A 2VHVA 4ZQHA 3DBHB 2CVQA 5AXBA 2C2XA 2NLOA 2WTBA 1PQUA 3ZWVA 1DFGA 1DDOA 3PWSA 3GUYA 2H63A 3KXDA 3UCXA 4CV3A 4ZD6A 5JY1A 2OHXA 2VNSA 2XPCA 4BMVA 3AU8A 4WLFA 1YS4A 3NTQA 5A5EA 4JBGA 4Z0TA 3O8QB 1I30A 4WKGA 5IZCA 4YJFA 2X9GA 4PG4A 3FI9A 3FTNA 4OQYA 5H83A 1YDWA 2ZYDA 4D0SA 5IZCC 1PS0A 1WZEA 3TF5A 3ITKA 1YONA 2P5UA 1U3TA 3D0OA 1ZMTA 3QVXA 5U1PA 1PGQA 5TJHA 2ZTUA 2TMDA 1LDMA 1PGOA 3I9KA 4IINA 4BGVA 2YV3A 4ILKA 4OKIA 4Q39A 4XR9A 5CHEA 3P19A 3AK4A 4II2A 3K5PA 1XQ6A 3RIHA 2E48A 2I99A 4CLRA 2WYVA 1WDLA 3FNEA 3GT0A 4FR5A 4PZEA 1WAMA 3Q6IA 2C29D 2B5WA 3OA0A 4WK6A 3PQEA 3ANNA 3DBVO 2P91A 3FD8A 3JQDA 5FF9A 2DU8A 4ONEA 3PWKA 4AJ1A 4B7UA 3AM5A 3LDHA 1DRUA 2PD6A 3MOIA 2I67A 1E7RA 1JN0A 4DYVA 4KUHA 5HM8A 1CETA 4HXYA 4IXTA 5TT0A 5BR7A 2QX7A 3VPGA 1NQAO 3K96A 3WGTA 4O59O 2V6FA 1HXHA 1C0KA 2HLPA 1QKIA 1Y1PA 3FTPA 4PLPA 4ALLA 2NQ8A 2OBNA 4A27A 4EZBA 1N5DA 1R66A 4AJEA 1C0PA 3OJFA 1U5CA 4PLFA 3M2PA 4WEQA 4A2CA 5JYDA 3I4CA 2WJPA 3FCOA 4E2YA 3VPHA 3WIDA 3DBHA 4J1NA 1H2BA 4BO3A 1Y9AA 3DOCA 4KP7A 3VH1A 1I2BA 1YBVA 1XELA 3RC9A 1I5RA 1O9BA 1BXGA 2X0JA 3VZSA 3EZYA 4XWYA 3AY3A 1P44A 4TRJA 2PA3A 2NVUB 3OHSX 4AFNA 1ISHA 3FRJA 3RJ9A 1P1FA 1UH5A 1TA4A 4DXHA 1GQ2A 1R12A 1UXHA 3O8QA 4BQRA 3PVZA 3TL2A 4HNHA 5L45A 2VZ9A 3TZCA 1WPQA 2ZTVA 1EK6A 2QRLA 4YR9A 1IZ9A 5BT9A 2O48X 5I9NA 3I9OA 4NI5A 2J8ZA 4M87A 3C24A 3ZWWA 1EUCA 1Y9EA 2FP4A 9LDTA 3BHMA 1DRWA 2V65A 4FD3A 1PGPA 5IDYA 4EJMA 1U5AA 3MJSA 2GR9A 3ADOA 2FR0A 4TZTA 1GADO 4IS2A 2I76A 3NAQA 4BL5A 3HN7A 2DBRA 2GZ1A 1Z7BA 2FWMX 2AQKA 3TOXA 4AJLA 1JLLA 3RC2A 1GV0A 2VOJA 2YV2A 3COSA 3W8DA 2PZLA 1SO8A 5I9LA 4ZN6A 3OFSA 2V6MA 3ZGYA 1LTHR 3QLJA 4YT4A 3VZQA 4XRRA 3CE6A 1YRLA 4U6SA 3CKYA 3L6EA 4YJGB 3V8BA 1HE5A 1H5QA 1H2HA 1LRKA 1JU9A 4XQEA 4BMNA 1R16A 5FWNA 3GNSA 4XQCA 3PHHA 8LDHA 2YQ5A 2G82A 3Q2KA 2W2LA 5DCUA 1DEHA 2RH4A 3EAGA 3WJAA 4A5OA 5FI5A 2QYSA 3DBRB 3O38A 3NYWA 4AJ4A 3LF2A 4ALNA 2YYYA 4H15A 3H9QA 1SB9A 2Q4EA 2AG5A 3ZI0A 3HQ4O 2EF1A 4O63O 4E2XA 2ZB3A 4RGBA 4TKMA 3ABIA 5G0WA 3Q2IA 2V6BA 1UXJA 2X5JO 3UOGA 4RV9A 4XQ9A 1Y6JA 1PS9A 4IMRA 4DPLA 5A4DA 1Z82A 1GEGA 1WDKA 1ZIDA 1H9AA 2PD4A 1P0CA 2PGJA 2Y1DA 3AI1A 5I9MA 3PI7A 4GSLA 1QYCA 5DDIP 1Y8RB 1SCUA 1LSJA 3RJ5A 3ZWPA 3K92A 2A94A 3M1AA 1K3TA 3EHEA 1I3KA 4E5NA 1ZJZA 1VKOA 4GMGA 5F5NA 3FSRA 2DBQA 4LK3A 2FR8A 2PWZA 2ZJ1A 4YT2A 2BGKA 5IXSA 1NWCA 1EQUA 4YBZA 5B4UA 2WD8A 1V3UA 2XF8A 3WGZA 4D42A 5IZ4A 3KETA 4OSPA 3WMXA 4J0EA 2X7HA 1QLHA 1ULUA 1LSUA 2YHUA 4MIOA 1IY8A 2PGDA 1GCUA 4HX5A 3INTA 3OQBA 2CDBA 1B16A 1OFGA 4OMUA 2ZKLA 4R9RA 4XGIA 4QO8A 3TRIA 3TZHA 3EYWA 4NFYA 2B83A 1QYWA 2JD0A 3GZNB 1I2ZA 2B0JA 2DFVA 5KVVA 1GU7A 3ETGA 3DFUA 4CMEA 1UZMA 4NFHA 3DWFA 4JBIA 4YJGA 2PFGA 2EKQA 2OORA 4LGVA 4PN3A 1P0FA 1Z7EA 1DJNA 4CJXA 1ZEMA 3D3EA 4KUEA 1PWXA 4FN4A 5G4LA 2EW8A 3H5NA 2X8LA 2Q1TA 2EP5A 3DAFA 3WLFA 2ILTA 2GF2A 1MXHA 3AFMA 1AHHA 3BMQA 3GRKA 1EBUA 4YYZA 3DBRA 4IGEA 1VL6A 2P9CA 1K6XA 3SBOA 4R51A 4XDYA 4IDFA 1YL5A 1HDZA 5F1PA 1K89A 2D2IA 3WJ7A 4R3NA 2NU9A 4YB8A 2E49A 4PFJA 1K2WA 1N92A 3PJGA 3RUEA 5BSFA 3I83A 3ICPA 2D8AA 2NQTA 4BNLA 4FBGA 4R68A 4YQYA 5F1KA 3ZU4A 2B69A 4Z9YA 1DC3A 1Y8RA 4Z3DA 3M2TA 1IE3A 5TGDA 2BHLA 4I5EA 4MIEA 3K73O 5JAQA 3IMFA 2VTEA 2AQIA 1P3DA 2C5EA 2JFGA 5JS6A 1DB3A 1ENPA 3SJUA 4J9VA 2JFFA 4E12A 4Z3KA 4W9NA 1R4MB 2FRDA 3E9MA 3MOGA 4G5HA 3C1OA 1W4ZA 2D59A 4W9NC 5CG1A 2CMDA 3NEPX 4P22A 2GNAA 4TSKA 4H3VA 2IYOA 3HFGA 2RBEA 1ONNA 1HETA 3RU7A 1Q7GA 1PJ4A 1MG0A 4JN6B 1ZJYA 2QW8A 4W4TA 1DXYA 1ENOA 4NBUA 2CNBA 4MVJP 1UR5A 1C0LA 2YDYA 3ZCXA 4A10A 1G0NA 3W4IA 1KS9A 4I9NA 2BFPA 1B8UA 4B4WA 3B6ZA 3NTRA 4HBGA 1Q0LA 4EUFA 2QG4A 3RCBA 2C7VA 1KEWA 1O6ZA 3GZNA 1PJ3A 1Y8QB 4ZQEA 4FFLA 4RO0A 3QHAA 1M75A 3IC5A 4RZIA 1Y5MA 3D4PA 5A05A 3DAGA 4IDAA 1VI2A 1KETA 1U28A 3VTFA 1SPXA 5IXYA 1I36A 4XJTA 2I6TA 1HEUA 1W8DA 4BNTA 4OGWA 4IJWA 5HRUA 5TNXA 1LBEA 1MFPA 4D3DA 3OEYA 1I2CA 2DTEA 3DHNA 4RPLA 1V8BA 3T4EA 2Q3EA 2IZ1A 3EZLA 3GNTA 3NV9A 3QQPA 2C20A 1ZXBA 5JMWA 2QRKA 4NH4A 3MTGA 3KYDB 1CWUA 3A28A 1HSZA 4WCFB 2QZZA 3NDIA 4DBVO 1I0ZA 2CUKA 1SOWA 1DAOA 1FMCA 2B4QA 1YVEI 4CUJA 5DBFA 1NYTA 3H5AA 1MB4A 3LK7A 1DIAA 5T8KA 4ZRMA 3F6YA 3GZ4A 3KM0A 3OF2A 4PVDA 7ADHA 3KB6A 4XEHA 5BNTA 3E82A 3ENKA 3P2OA 4CMAA 3LQFA 5J23A 4JBHA 4BS9A 4NPCA 3O26A 3GN1A 2PKQP 3ZWMA 3CTMA 3E9QA 3PTZA 1VSUA 2RHCA 3FF4A 3H9EO 1PJBA 4J9UE 5MGBA 1PL7A 2Y0EA 1PEDA 2GN6A 3GHYA 5JC8A 1LUAA 3A06A 2FSSA 3HFSA 2VHXA 2J3KA 1B7GO 1F06A 1R4MA 4GVXA 4PZDA 4BO4A 2CSUA 1YGYA 4E3ZA 4XCVA 5EMHA 3LC2O 5CG2A 4DLBA 1NBOA 1Q7CA 3HZZA 4CV0A 4LCEA 1R15A 3N74A 2FHSA 4O6VA 2E4AA 1QRRA 5A06A
chains in the Genus database with same CATH superfamily
4MRMA 1OXKB 3AEKA 4ML3A 2GESA 1DG1G 4HKTA 3SS9X 3C3AA 3WY9A 1C14A 3FCSB 2HU7A 2PWPA 2WE7A 1E2PA 1Y8AA 5HCNA 3CZRA 2WAMA 4JELA 5K3FA 3KJHA 2A33A 5BO5A 4XD2A 5TQ0B 1OR8A 4MICA 3TYXA 4X1YB 1IATA 3JD1A 3RV4A 3U3OA 1KKUA 3MTBA 3VA7A 2R2GA 3SQLA 1YF3A 3A05A 4ZCIA 1QQ6A 2R6CA 3JQ7A 3P9CA 3N70A 2VLIA 3PC4A 4RJJA 1OXSC 3KLNA 3EZ7A 1EWTA 2G5PA 4ZVPA 3DH0A 1LBQA 4NARA 3V8EA 4XYLA 4JJGA 3N2IA 2Y1LA 5BV1A 1W2WB 2GNPA 3P0JA 1TI7A 4C0BA 2VDJA 2VAVA 4W5NA 3WK8A 3UUWA 4R7ZA 1XZJA 4ARAA 6REQA 3W7AA 1H9CA 1JI3A 1F51E 2GAAA 2WF5A 1P1CA 2XV1A 1RFLA 2J59A 2YL2A 3BE4A 2JRCA 1DOAA 4W8GA 1ARZA 3OIGA 4UM5A 3S55A 1AHIA 3O93A 4XJSA 1NVVR 3OIUA 3IMGA 4TX1A 1MCZA 1U0GA 1ZM4A 4KE9A 2GTIA 4BLVA 2NIPA 2UZAA 2ZDGA 4GX2A 3S81A 3JZAA 4J1TC 4R1UA 2VZ0A 2IVFA 2ZZKA 2VQDA 2HHAA 4DSUA 1J1UA 4E6EA 1KSFX 4XX0A 4US2R 4HQNA 2KWIA 4ID9A 2J0UA 2FJUA 3X2EA 3M6AA 3SG0A 2QP3A 3Q5GA 3T99A 1W35A 2C88A 3PR1A 5JCOA 5C8VA 2HFJA 2JLSA 3B7GA 1ZC3A 4HYYA 1LWNA 4J0KA 2KMLA 4YJ3A 4DQ0A 1TYAE 4KIGA 3OM0A 2O4UX 2B0CA 4KW7A 1I7QB 2Q3MA 3BK7A 3T7KA 2H6EA 5MN4A 3HBJA 4D4IA 3BWBA 3GD7A 3I45A 4H0FA 4BNNA 3F9IA 5ARCA 2BW0A 3ERCA 1KYWA 2JD1A 2RAVA 1OLUB 1SXPA 2CWWA 3QWAA 1GL7A 1RI4A 1JHOA 1DDIA 1JKMA 3OZTA 4WZAA 3WICA 4KXVA 2H5LA 2H1OA 1PJ2A 1R0XA 1CUCA 2Y1CA 3F2VA 5EQDA 1MOSA 3VX4A 3N86A 4EB0A 3UT5B 4BNDA 3WNBA 1Q15A 4HEA6 2A0XA 2VPZA 4CRWB 2ZI7A 4O4HB 4OYRA 2Q5EA 1SRQA 2GLXA 2PBZA 5IKPA 3IQZA 5LMCA 1FQJA 2YXBA 1GRNA 3LA6A 2AI3A 3MS2A 4MLPA 5THKA 4CLXA 3D3WA 3GIWA 4XWGA 2ODBA 5LZ8A 3OQIA 3O92A 2ZWVA 3R74A 4ZAVA 3RRJA 4GZ6A 3UG7A 3CVXA 1DCTA 2XDQB 3U7IA 2UYCA 3PNMA 2C54A 3NTVA 4HNAB 4A73A 4WQMA 1LF5A 2DLNA 3C41J 3UFBA 4NTZA 4AICA 1R5JA 1SXJA 1XEAA 3R7AA 1QV9A 3FVQA 4GYKA 1JLSA 1SVIA 1EESA 4KXYA 4M9ZA 5PGMA 3BMXA 5EERA 2J3EA 3MWDB 5K3DA 3ZIDA 1AH2A 3ZQ6A 2TYSB 3B1FA 3B5IA 3KV1A 3RRXA 1U0SY 1XDUA 1RJEA 1JQLB 2SICE 1KAQA 4DA6A 3Q9NA 3OPMA 1IH8A 1NG1A 2PRSA 2KW5A 4HJXA 4E33A 3MJTA 1OLSA 1JJ7A 4NSNA 4WLEA 4UOEA 4HEQA 1CUSA 4AZ3B 4P0TA 3IP6A 5I7RA 2C7RA 1YJQA 4OYHA 2O8CB 1HDOA 3RJMA 1JZTA 1CUYA 2F00A 4DLSA 3TIFA 1XVTA 4AT1A 1WIWA 1ZJ6A 3D5EA 1I0IA 4QDZA 4ZMBA 4QOJA 4TXMA 3GP3A 1VG1A 2TMGA 3BIOA 4BDTA 1GZUA 2ORIA 3H5TA 2RFLA 4J43A 3UOAB 4C0LA 2HO5A 3JQ8B 1OHHA 4IX1A 2A1TS 1U2SA 3ZWOA 1FSSA 4KFTA 2G1PA 2ZBFA 2GAOA 3DM5A 1AV7A 3OETA 4OM8A 2YNMC 1SD1A 5DOVA 1HYQA 4NZYA 1NM5C 2HJWA 4IQGA 3EPJA 2XWSA 4KIUA 3C7TA 5SV2A 4V1CB 1KMIY 3JWHA 2W9XA 1GTZA 4O3MA 4S1PA 3TSAA 2JCBA 4C0WA 4DJTA 1TZ2A 5AVWA 3R6GA 4DN6A 1ZN7A 2G76A 3DTNA 1H4QA 2ZI3A 1UDRA 4UREA 2IFTA 3A2NA 1ZSNA 3B2QA 2CE2X 4GUDA 4NVRA 3GLHA 4WUVA 2M6LA 5IWAB 1EWYA 4J0JA 2WFLB 3WMEA 2VDVE 3N75A 3HXLA 3N2KA 2QJWA 3KQWA 3CFYA 4EOGA 1EWVA 3AR7A 3C1TA 4DLKA 3OQPA 3OWHA 1DQZA 2IDZA 4XDZA 3GMDA 2EBWA 4XFJA 1GGHA 4BFLA 1QO9A 4J7CA 3G5MA 3JTEA 1I3OA 2GVDC 3CPHA 1RD4A 4L74A 5THQA 2OFWA 4OUKX 5LWQA 3AF2A 2ATIA 1G66A 1KO4A 3WNVA 3R4CA 2UVPA 1RHKA 3TIGA 1O9GA 1RXCA 5HF5A 5GOZA 3SLGA 4AURA 4D4LA 4RZSA 4LRUA 4AKSA 1US8A 1SNYA 5JYBA 2XT0A 1KJWA 2YVUA 1G55A 5EXXA 1KMMA 3I23A 3IAHA 3IA2A 3IMKA 2VK1A 3MVEA 1IEVA 1S2DA 1U8ZA 4HLNA 1QIDA 3LXRA 5HW0A 2VUHB 3RANA 1F7UA 4DLXA 1LJUA 3FBGA 4BQQA 4AWBA 4EI8A 4IIJB 4CLOA 3V6LA 1YR1A 2GZAA 1JKJB 5BSKA 2YXDA 1N0VC 3UPDA 3VH3A 4DIFA 4Q48A 2H2WA 2YIJA 1RPJA 4M0MA 4NWIA 3UCEA 3ZHZA 3QWHA 1CZHA 5CM9C 4F0JA 5LD2C 4AI6A 2R0QC 2Z57A 4PYKA 2CL6X 1BXGB 3FUCA 3MCVA 4JEIA 3C2QA 5EVJA 1PGNA 4JJ6A 1M6HA 3JVIA 3EIFA 1BHO1 2F64A 2IUTA 4A0GA 2RARA 2F62A 2ANCA 3LKBA 4JASB 2AN1A 4RTRA 3I9NA 3M6XA 3V00A 2K4MA 3GGPA 1QYDA 3GMSA 3MQ2A 4IZOA 4AXXA 1YZFA 3EY4A 5DYTA 3ZE9A 1ODSA 3IPLA 3ESAA 3LUAA 4XB2A 1KA9H 4WZBE 3M49A 2QMHA 3A4NA 3AHDA 3HB0A 3MRVA 2Z1DA 1E3JA 1ODTC 2J48A 2OG1A 3DCIA 4LNAA 4NFSA 4ZAGA 2FMFA 2R11A 4REQA 1EUCB 5DULA 1A9RA 2FP4B 3PHJA 3R5XA 3W8FA 1BE8A 1NW4A 1ZDMA 1C9YA 1CUEA 1ORRA 2C4VA 2OC9A 3AP1A 3E9NA 3OBBA 4TQUS 3ZHVA 1AXGA 1H2YA 2IUYA 4Q4LA 3GG2A 1YQDA 2BWJA 3E8MA 4LRQA 2HSWA 4NCXA 5CNJA 5WRFA 1Z28A 4IJUA 2QTFA 1XWWA 3HLTA 1VB5A 1Q19A 2DTDA 3NCTA 2BKVA 3WMWA 1OB2A 3JASA 4UBNA 1BDBA 1I3MA 1Q1ZA 2QQ5A 2ZJ0A 3GYGA 3ZH2A 2YBDA 2ZYHA 1QOPB 3ELYA 1K3UB 1P9WA 4JT2A 3QZUA 2P8SA 2Y68A 1A1VA 3DOIA 3DUWA 4EENA 1GZDA 2Y67A 4D0NA 4H08A 1NFFA 3HCOA 2HD4A 2QTWB 4AJIA 1UXGA 5TSDA 721PA 3UHFA 1NONA 2CLOB 2F4VB 2QVBA 1G8SA 2BLNA 3KPYA 2XOEA 2O0JA 1R6XA 1SKYB 1R8SA 3C7KA 4YCAA 4F4UA 1KQFA 4KQJA 3ZXSA 1FFCA 3DZIA 4FONA 4HDNB 3EOZA 4WOCA 2PU7A 1B8OA 5K0GA 3FGOA 5I7SA 2WUEA 4RTKA 1LFAA 1VP3A 1E6KA 1A72A 3DO5A 3BGIA 2CLEB 1UK9A 3ITNA 4UPEA 3GH1A 4IJKA 3RB8A 5L6LB 2A0KA 4UHFA 4BNVA 3PWZA 3ZCSA 4OUDB 4G4SO 1EFHA 1E89A 4ZVNA 4UMEA 1GSIA 3FZQA 4LC0A 2BI8A 1C9KA 1KHTA 4L02A 1JMKC 4TS3A 3LDGA 3LLVA 4N18A 5F7XA 1P1KA 3IUJA 4CF5A 4B5LA 1T4GA 3F7MA 3PDUA 4A1FA 1QP7A 3ETNA 3K4PA 4QGAA 5C7OO 3V1LA 4QC2A 2ZIWB 2Q41A 4IICA 4RESA 2YV1A 2Z30A 3PJFA 4LKRA 3SNKA 3PLAE 3VC1A 2EWMA 1X8LA 3MB8A 4FYHA 1T8RA 2QRPA 4DMRA 3R6WA 3OX4A 1UDAA 5ALNA 4FYYA 4GQAA 4XSGA 4WJKB 1P5HA 2EEPA 3F9RA 5BW4A 2OV8A 2CLDX 2O7SA 2YRXA 1JMYA 3O91A 4ZZIA 4RVDA 3GRCA 2D2VA 1KYTA 2BR5A 4BTEA 5KC9A 1GLVA 1EAMA 2C9MA 1BN6A 1RQLA 3HXPA 4X44A 2OCAA 3T4UA 5EJ8A 3W3ZB 1J9ZA 2VOEA 1LDYA 1GITA 4OXXA 3OLQA 4QDTA 2NO9A 3EWNA 4L08A 3AI3A 4K0RA 3RR2A 3G2MA 1CUDA 1O1YA 2VDWA 2HCTA 2QTHA 1TM4E 4CF3A 5ALXA 2HSZA 2MSKA 4G37A 4P83A 3F6SA 3IAS1 4HDMA 4X1IA 3FOAA 5ALTA 3CNOA 4B09A 3NKVA 4F38A 3AVVA 2WNHA 3QU7A 5GM2A 2O9JA 4II7A 2VHUA 2A1IA 5E1DA 5FBRB 3RK1A 1OJLA 3KXIA 1VE1A 3ANTA 2XQJA 5JZOA 1Q17A 4BN5A 5CVDA 3GJ5A 2OYRA 5J2UF 1RRFA 5KYVA 3AR5A 2CXPA 4B82A 3RS0A 1C9NA 1F6BA 1ZI6A 5COBA 1P3Y1 3ZCTA 4DUPA 3IAS6 3D6AA 4FDVA 4ICIA 4JOCA 3SHFA 5AYVA 1H6BA 1M33A 2PLFA 4G23A 3L18A 2HRCA 4I1UA 4MYTA 4PZAA 1NBMA 1EQAA 2HWKA 4NNPA 5FV7A 4EF4A 2XF2A 1WUJS 1ZD1A 2E89A 4AF6A 2EAUA 2VWQA 2QYHA 3ZD8A 5HSGA 1ISJA 7GPBA 4U7FA 3LGXA 1H4SA 4QM7A 4GKKB 4FUQA 2LDBA 5CX4A 3ZLTA 1TX4B 3EDMA 4HQ6A 4NE7A 2C2MA 2H4WA 1M6WA 2LPMA 4RLQA 1G9TA 2VRCA 3IEVA 1GPAA 4K8OA 2C59A 3SEFA 5EXDA 2FMUA 3FWZA 3D0RA 3PHBE 5P8WA 2P0AA 4WE3A 2GRAA 2E7ZA 2W4IA 3C70A 2VLBA 3ILYA 1MJFA 1S3SA 3WLSA 2G0AA 2NZYA 1VSVA 4BE4A 5KOHB 1O94C 4JC8A 4BMSA 4KRXA 4ZRDA 1CDZA 1KSGA 3M5DA 4XIFA 3CNLA 3TTTA 4Y98A 1NW9B 1TB4A 5KNCD 4UCQA 2ST1A 3LTNC 3H9JA 4Q4DA 5JXHA 4BVBA 3G68A 1UBCA 2RHTA 4KYVA 4EFKA 2OESA 2D4HA 2FXIA 1TPZA 1BKSB 2QX8A 2QIOA 4BKUA 1H65A 2BUCA 4TWIA 4QJ3A 4NCBA 2CXOA 4GSKA 1G16A 2PGOA 2Q45A 5T3YA 2XYHA 4AMBA 1U3UA 4NV3A 4R41A 2AJLI 1NN1A 2NG1A 3ZCRA 5IH7A 4JODA 3LXMA 1G38A 1NJ6A 2GI4A 4PTLA 1KY3A 1H0SA 2OFPA 3IV9A 3KQYA 1ECGA 3M6IA 4U4AA 5HMMA 2ZRFA 1X87A 3KAJA 4GP7A 3O82A 2C1XA 3VU9A 3HSYA 1U99A 2AD1A 2II6A 2DBZA 4J7UA 2FWIA 3GRAA 5ENZA 3T5DA 3W05A 3GLKA 3LMKA 4DYHA 1N5KA 2X5OA 3QLEA 1QYRA 4UFPA 1DO8A 4LRSB 1M8FA 1XDGA 1OH7A 4JV5B 3G6KA 4MPRA 4E31A 2B4AA 1P0QA 1B0PA 4AZVA 2QPTA 4Z1MD 2GYWA 1REQB 1PSDA 4D0LB 4I6EA 1WMBA 2W6ID 1QB8A 3QOWA 5SZKB 2YWJA 3UKOA 4LNUA 3HA2A 5AW3A 1TRKA 2P90A 4BKOA 5BN5A 1TLLA 1W44A 3DVAB 4A5SA 2AR0A 3PFHA 3AVQA 2DUMA 4IQFA 1C30B 5JE8A 1R00A 3ANYB 3ZE6A 2ZXUA 3OLYA 1YQ9A 3TIIA 3T12A 4MYCA 1PT7A 5L3SA 5CUQA 3WIEA 1RM5A 5E9QA 3ZVLA 3UOWA 3OMLA 1DEXA 1OYOA 1N7GA 2AMJA 4TTVA 1PK9A 5EINA 5HQJA 5ICSA 1HNXB 1Y82A 2NMVA 1DBIA 2BFFB 3OLVA 1P81A 3FJYA 4LJ9A 3VYTB 1GPWB 1UOPA 1BRMA 2PZEA 1ORVA 5FFFA 4S35A 1AQNA 1QQAA 3NUGA 3BC1A 4QXRA 3KVVA 1R5BA 2VHCA 3HG7A 3W9YA 4LGCA 5IF9A 3IIEA 4M1KA 2QBYA 4MEAA 1RE1A 1EVKA 4FSDA 4LN1A 3STHA 1ZCFA 3I01A 3JALB 3O3MB 5ALFA 1V16A 2Z5GA 1U1DA 4ALIA 1E5LA 2VJQA 4BX9A 2TSYB 1TC2A 1GQFA 3GFGA 4Z9XA 2QNIA 3RT7A 3O8DA 5LA6F 3HYCA 4EL0A 5EJ9A 2Y2VA 4E5MA 4CMJA 5HF6A 4Z54A 3GGSA 3A1DA 3L8ZA 2GEFA 1JS1X 1EFTA 4FE7A 4UXHA 1VPDA 2AX3A 1K88A 4GKVA 5D51S 7MDHA 4OIFA 1SKAA 4FCTA 1FF9A 1U5BA 3WXMA 2A30A 1YRHA 3B3JA 2R7LA 3GC6A 4TS9A 1U9ZA 1R0CA 2OM2A 4X5OA 1DAPA 2UUBB 2B4TO 1ENZA 1RWXA 3HCNA 1UJBA 5BMVA 1L5OA 3D7LA 1SMKA 5JSFA 3KHTA 3L93A 3NBMA 3U4QA 2I4TA 2W93A 3D6HA 4WK2B 3U31A 4AMVA 3TG2A 2D7DA 2AFHA 2P3OA 1IAQA 5JD4A 1EQ2A 2KJQA 4G0MA 2DKFA 4ITUA 2AB0A 3MJCA 1FYVA 1WPXA 4GP6A 4CKXA 2FA9A 1B93A 4S1TA 1YGPA 4C6HA 1OX4A 3G23A 2RGGA 3U81A 5CLFA 5LUBA 2FFJA 3L05A 3O4IA 4QJBA 4ZTBA 2GXQA 1A69A 2M32A 1UOQA 3T34A 1B3RA 4FX5A 3BD9A 3T7AA 3AWIA 4GRAA 3ZUPA 1UP4A 4NPHA 4D82A 3HCFA 5EESA 2DF8A 1ST3A 4S3MA 4AECA 2QL9A 1ZXLA 1U94A 1G6OA 1N8NA 1WXIA 2XQGA 3EGOA 3KRTA 4TLCA 1IHDA 5DNWA 3SIXA 1A8IA 4KHZA 4HYTA 4JROA 2WY2D 4TL9A 2GJ8A 1LNSA 1G42A 5LCXA 3KZMA 1U4OA 3KOZA 3NHSA 5CEEA 4R1NA 5I7HA 4URZR 3E7DA 4UBLA 3HZOA 1TQHA 3CVWA 4ZMSA 3LRXA 5JUWA 4HB0A 1D2MA 4JXJA 5KQSA 5B6IA 1JWAB 5A3SA 5IU6A 1XUOA 2VAXA 3AEQB 1P7PA 2ZM6B 5SZIA 4YMUA 1N6LA 2N3ZA 3ZK8A 3IKTA 1WXXA 2IXEA 2JLAA 3EGXB 1XA0A 3FPAA 4FFWA 1GV1A 4GI7A 1EP9A 1IZ0A 2GS9A 2QD2A 5GJVC 4HLUC 3BMCA 1E96A 4AQ7A 2FPWA 3IAXA 4M1YA 4DSAA 5ES4B 2PMWB 3JQAD 1HX7A 1ID8A 4Q93A 4V1CI 3HVIA 1E8DA 3BTVA 1NTRA 2QTAA 4YCBA 4BYGA 2HBQA 1E6EA 2GX6A 4BNMA 3R9XA 3JZFA 1PU2A 2QA5A 1F3LA 3FBTA 3K31A 4AY2A 2B3TA 4PRLA 1R3UA 3RFXA 1BYIA 3PQFA 1JXOA 3S28A 5D85A 4LBZA 4YDQA 3FSJX 2QZ4A 4RPCA 1MX3A 5DFAA 3WSTA 3EG5A 2V1XA 1TPYA 5JRZA 3EPRA 2F17A 2DM6A 2W2MA 2WIFA 4X20A 5DYYA 2W2QA 5E6RA 4C03A 4D41A 3M3PA 3O4VA 3CCCA 4R54A 4AD8A 2J0QA 1Z17A 4FMPA 2F9MA 2YN0A 2WIKA 4MP3A 3OCUA 4O2BA 4EG5A 3A9SA 2KSQA 4Z4EA 1CEYA 2R79A 5AFSA 1Z9BA 3A6FA 4DTIA 2IHNA 4DKXA 4YDRA 1KRWA 1ZA1A 2O6HA 1L4GA 1V25A 2YX1A 4ZQCB 1IM2A 4EFMA 2X1MA 1DX9A 1JQAA 1UKBA 2FVXA 4H17A 4E5YA 3MIZA 2ERYA 2WM2A 4G26A 4GS5A 1DSSG 1FRNA 1X9IA 1HLFA 3PXCX 2P3QA 3D6VA 3NB0A 1GZ4A 1W76A 2NYRA 3PWTA 2XB9A 3TLXA 1FP1D 2X76A 3VJMA 1H3NA 1ZBDA 2CNOA 3KKNA 5HOQA 2FPRA 3QW2A 3ITDA 5H59A 3YASA 2GK6A 5AM4A 3WKCA 3PE6A 3KYCA 1JHQA 1N2GA 1QBGA 5IJAA 3STTA 2IU3A 1DKQA 2BF7A 4O5OA 1VIDA 1VDZA 2QTZA 3FYHA 3CU5A 3OBIA 3TSCA 4G0YA 1DAIA 5EP1A 1F8GA 1S01A 3MTJA 3II6X 4PCUA 1GYQA 3D1LA 2H2GA 2OMEA 1CUWA 2JF0A 4P32A 4YR7A 4HDSB 2GK4A 1D2RA 1SGWA 5EHXA 3NP7A 4C7KA 3JYOA 1TUGA 5EA2A 3PEEA 5B3JC 4RHEA 2FN4A 3C5CA 4HFMA 4MKIA 1XLVA 4UQPA 2QMZA 3DHWC 1J0EA 3T0FA 3WRYA 4LJRA 1B1CA 5LXTF 4BGUA 2W48A 1Q14A 4RFVA 1P4JA 1XKQA 3CS3A 4RQUA 1JRLA 2HKIA 3LVQE 4TUYA 5D6NA 4ZJUA 1LU9A 2M9MA 2VF8A 1T1RA 3RIEA 2D0IA 4RTMA 3QI7A 4BFWA 2HY7A 4GM0A 5FD8A 4K26A 4GGPA 1GNQA 1OAOC 1IQ0A 1WCYA 3O1IC 4URWR 3Q72A 4EGCB 2FX3A 1E1MA 3N5CA 2IX9A 4AP9A 5I6DA 2B94A 3W6ZA 5A2GA 4WXPA 4LEIA 3RNOA 3WYEA 9MHTA 1BU5A 2C3OA 2WMDA 2RGYA 4M7OA 2RKOA 5DHRA 5EUCA 4C2AA 3IESA 3MMNA 3K6JA 4U02A 521PA 2F3PA 3SDSA 4P3YA 4PLGA 1EUDA 2A1TR 4C88A 5KQLA 1JE0A 3QX9A 4IZHA 2IW1A 2OO5C 5JTUA 4QYWA 4TRMA 3LW8A 4L22A 4ND3A 2R6ZA 1YA8A 2XKKA 1KSHA 5CT5A 2DECA 3TUIC 2QM8A 4OL9A 3BRWA 4B2PA 4DVJA 1LRJA 1SVWA 3KZOA 5JD6A 3WYBA 1IZ7A 1CUHA 1QK4A 2JCGA 4X8LA 4EG4A 4A1OA 2GCNA 4OGLA 2DHRA 1R88A 1QKJA 2RGAA 3Q7RA 3VZPA 4HH0A 1PX2A 3DBLB 1KPGA 2XAAA 1M8JA 3ZGVA 3GEPA 3E2MA 4L8WB 4NEHB 1FY2A 1K5DA 3RKRA 3GPIA 1EJ0A 3P27A 1J42A 3IBTA 5J4LA 1E2NA 2JAUA 3WK5A 2B9EA 2FE4A 3TGPA 1JLKA 1DWUA 1ECFA 3RSCA 2CLLB 3PFFA 3GJ6A 1F1BA 1NXPA 5DH9A 4EHBA 2IBMA 5CD9A 2DXIA 2JVJA 4KQ2A 4CEHB 2O2YA 4KU4A 1MNAA 3HCBA 4WK4B 1JU4A 3EX7C 2XRYA 2BMDA 3BFJA 4K9OA 3MA0A 4EHIA 3F5SA 4RY9A 4RVHA 5DJ5A 1CEEA 4MITA 2ZBEA 1M2OA 2CJWA 4NU8X 2OVBA 1J5PA 2AG1A 1MIHA 2VUUA 2XRFA 3C85A 3PF8A 2VSFA 4PXYA 4TTAA 2YICA 3ZTTA 5A5GA 1HE1C 2V3VA 3GVIA 2WU3A 4B34A 2FPXA 4UEKA 1PO7A 2K87A 2BDUA 4HK4A 1JP7A 1K7SN 2FXVA 1QH1B 3M3HA 3NKLA 3ZE8A 3AX6A 4QASA 1J0AA 2QR5A 2XCUA 5E7JA 3UFXB 5JH7F 1J90A 3DE6X 3DE4X 5DE3A 2QE7A 4H6XA 3GFQA 4I4TB 4QBFA 2VNKA 3L7BA 3T3IA 5A04A 1BKDR 2IXBA 1TF7A 3QY0A 4NJMA 2PUBA 3HKEB 2B20A 4EHJA 1CJMA 4C3UA 5BQ5A 1RQPA 3E48A 2JB9A 2JI8A 3OZ7A 2ADOA 3KAQA 3OU7A 2I55A 5H7XA 1N6HA 2CLKB 1E7SA 4HWPA 1MVLA 1RWMA 5REQA 1VXRA 2A4MA 3JZDA 1T5TA 3G2LA 4IHJA 3WL4A 4E2FA 1U1IA 3NWBA 4WADA 4U7PB 3WDMA 4BE9A 1R18A 1L7PA 4JEMA 1SZDA 2DJ5A 4JH0A 4QEZA 2XYVA 4ZTUB 4DLZA 4RYLA 5JISA 3HUEA 3SIWA 2NO1A 3ISTA 3SPXA 5LDGA 5HQ3A 1KTVA 1U3FA 1I5EA 2ECOA 3MLEA 1MB2A 5ARDA 3UJ7A 2X1HA 1ZKMA 13PKA 1BE0A 4NECA 3OJEA 1CBUA 4TMTA 4ZZ1A 2Z6VA 5I01A 3EDCA 2J6BA 4TV8B 1V41E 1NXSA 5AOBA 1EXWA 2YV4A 2AXQA 4AY3A 2BP7B 4RCZA 1QIIA 1ZCBA 4WMLA 4MV0A 4CKEA 4ZPJA 4FMDB 5JZVA 4KWIA 2P5TB 1U2ZA 1H1DA 3T4XA 4B83A 1E6UA 3JQBC 4D8VA 1P31A 4J0GA 1RI5A 2J0SA 2VP3A 2A9VA 3CLVA 3GVCA 4DSNA 1R8YA 1G5FA 4MS4B 3F6EX 4BCBA 5CX1B 4KO8A 1CRWG 3GDOA 5FL7D 3WAKA 5KX5A 3GRYA 3BFPA 5BYJA 2GHIA 2VYVD 1E2MA 4I46A 4MR8A 1NW7A 3MPOA 3K8QA 4JLWA 1JIUA 4I1IA 3FLEA 1LJLA 4HS9A 4C7XA 3MAAC 1XB2A 2XE4A 4IMIB 4DXAA 3U9SA 3H0CA 3D02A 4YONB 5CCBA 2BMWA 3DZGA 2DUNA 4PHHA 2ZW9A 3LYUA 5DM70 1SY7A 2XWBF 4LQLA 4WVFA 3EFHA 3BTUA 4YS6A 1GUYA 1NUUA 1MAVA 5CT6A 3ZEIA 5IYZB 4H7PA 4Z2AA 4JP5A 3K2IA 2H1IA 5BW5A 1IULA 1D6MA 5DVZA 1PZFA 4WOKA 3PXBA 5DGDA 1FBTA 5TGTA 3QIVA 2CEAA 2ZT8A 1V3QE 5GONB 1KEKA 1M34A 1BGWA 1X8JA 2FZWA 2QL6A 3OOEA 2QMQA 4FQ5A 3VR6H 3GEDA 1QGYA 3TI9A 2FMKA 4CR6A 4JOQA 1B6RA 4BQPA 2OD9A 4M1SA 1FZTA 3A1VA 4XD7D 5FTKA 1PQPA 2YXEA 3JQAB 1RQXA 2IYRA 5JNSA 1Q57A 1EZZA 4GOLD 3C45A 2V97A 1RQ7A 3CF6R 1ZK3A 1VMEA 2A58A 2ZCUA 3O2SB 2AYYA 1FMTA 4DG5A 3U44A 3I9V1 4X8MA 5DW3A 3SWWA 5A9TA 3KSMA 1NKTA 1KIFA 2H2HA 3NVMB 4IDCA 4CL8A 3GRVA 3K0KA 1UP7A 1BA2A 3KZCA 5DYGA 1O0BA 1CY1A 3PUHA 3JQEA 2C03A 1C8BA 3OJLA 3HVRA 4MDEA 1F8FA 4ZWNA 3B1VA 4N40A 1ZXXA 3LVFO 2CY0A 1RPNA 1IRXA 2QGFA 1A27A 2A2ZA 3ZW7A 2ICAA 2JJ2D 3VZBA 4F97A 4QM6A 1O4WA 1NVGA 3QV2A 1PTJC 3P2IA 4LYEA 3HNPA 4BV2A 3LHDA 2HJRA 2XUOA 3UK2A 4C78A 2JIRA 3K1YA 1QMGA 2VK2A 2JAWA 4JCOA 1L4UA 2YMPA 3OOYA 5JMTA 1ZYUA 1E7YA 1MOZA 2BPOA 3HEMA 5AOAA 4EHNA 2P5SA 1NYQA 2OA0A 2OFFA 3CSDA 4CU2A 1C2YA 1O4VA 1R6DA 1D6NA 3HB4X 3P4XA 1DQNA 1EK1A 4R98A 2YXNA 4MS1A 1AVTA 3H2ZA 2NADA 4U2FA 2ETVA 3OD1A 3R7LA 1A71A 5JCXA 5KNDD 4RELA 2WG2A 2X1VA 1GOTA 3SF0A 3B9QA 3ZWKA 1B1AA 2OCBA 4QVKA 1CF4A 3MT8A 1E62A 4JDUA 5FBQB 5JS1A 4G36A 2V7BA 2SHKA 4IVQA 1RWNA 3OICA 1G3UA 3RUCA 1J20A 1IPHA 3F49S 5K6RA 4ZU3A 1V5GA 4GQBA 5GIOE 4FXPA 3NASA 4Z4GA 4RENA 4KLZA 5BSUA 2I7CA 1EGVB 5FDFA 2JBAA 3IKJA 1Y89A 2FSIA 4OF4A 4EHKA 1Y6FA 3PB3A 3H9GA 3COJA 3LUJA 2WFMA 2VHYA 1TT5A 5H0IA 2O2HA 1BRTA 3VC7A 3MQ4A 2WLTA 1BW9A 3FI0A 3SSOA 4D4JA 2WMYA 4ARUA 1FP7A 3SR3A 1DAEA 1TMYA 2P67A 2FOIA 4CM8A 3CXRA 3OQ6A 4PPFA 4OHKA 3TD6A 3VQTA 3PCTA 1F20A 3DDZX 2BRUC 2EFEB 1RLTA 4KPGA 5H81A 3WO0A 1XDZA 3DZHA 5BV8A 1ZP6A 4PANA 3CM0A 1XRJA 1BH6A 4R8MA 5ICEA 2JCYA 5FHQA 4OAOA 3D0KA 1U2RA 1B8VA 3PFCA 1GA4A 5E6SB 3U7GA 5KBYA 2IIQA 4FHGA 4QYSA 3Q9LA 3KDSE 4QG7A 1HRKA 1VRVA 4JJAA 1URPA 4RABA 3GROA 4FS8A 4MQEB 3I62A 2IITA 2FPUA 1ZI8A 4G8JA 5T3UA 4RAQA 2WIDA 1YC2A 3HKCA 2WQZA 1MNQA 3Q40A 1RABA 1C29B 3E6AA 4Q66C 3IAM6 3TRFA 4JBNA 5D3KA 4KXNA 1R7RA 1UKEA 3KELA 5JEDA 1FP4A 1HOTA 2AFIE 2CF6A 1E2FA 2WDZA 1U7UA 3H8WA 4FEAA 1XLTA 1YFJA 1PNRA 1V6SA 2X4LA 3AY6A 3SDBA 1RYDA 1IPEA 3PYXA 2CV0A 1HDCA 4G81A 1UMDB 4E2ZA 4LIPD 1BD3A 1X3SA 4EP1A 2R96A 5LZ4A 1SOMA 2IQ5A 3HJHA 1V45E 4KLCA 3M4JA 4BVLA 2HR1A 5KNBA 2X2PA 4WINA 4WV3A 4MQMA 4TSFD 5KPDA 1F12A 1RSZA 2OGTA 3ABSB 1Z63A 3G2IA 1X7DA 3FR8A 2ONCA 3IEXA 4MKZA 1XAIA 2NPFA 3H1EA 4QE3A 4RVCA 3PKJA 1ISRA 4O25A 4QFBA 1WHSA 5KWEA 4YGXB 4LXYA 3FYTA 5FUXA 1EVYA 3PXXA 2VN8A 4QUEA 2F43B 2W2OA 1OBHA 3BBLA 5EFOA 1Q2XA 4B3XA 4IDGA 5F7ZA 3SDZA 4I5GA 4ILEA 3HZRA 3FROA 1TRHA 3L84A 1DOHA 4Y2UA 3W7BA 1JDZA 1XHLA 5K0EA 2BTEA 4MYSA 1YT5A 2JJ8A 4E4YA 1GWNA 1YJCA 1G291 1IONA 2VZEA 4UUOA 1WR8A 3AB7A 4CQLA 5JHHB 2B37A 2YY5A 1FTWA 3FMIA 1E2UA 1HURA 1YS2X 3HJBA 3PRKE 5H80A 1IN8A 2IUUA 3RVPA 4G0VA 3HDQA 5F1OA 3SQDA 1CF9A 3L04A 2EARA 3ANMA 4Q4JA 3FWYA 1KNXA 1HQCA 1W0KD 4MLZA 1J70A 1E18A 5EAIA 2O54A 1LDGA 2ZJ8A 1P39A 2IYZA 2F1JA 3WBBA 5DBEX 1OI3A 1LNZA 4A03A 3O03A 3PK0A 2VF7A 2QLLA 3KQUA 4XGNA 4ZAYA 4D57A 3WK4A 2J4DA 3FTQA 3PHIA 4JQCA 2L0XA 3ZQ4A 3D64A 2YNMD 1T8PA 2JAXA 4PAWA 1U6JA 3OFND 3FTEA 2AA3A 4K6CA 1CB7A 1CJSA 3IODA 3P94A 4L5BA 3C43A 4K9NA 4DM3A 4RVUA 1MIOB 4FGZA 1PZNA 1E79D 2A9PA 4F1JA 2KHZA 3BK2A 4QEKA 3DDNA 4TXLA 1LK7A 1UM8A 1TEZA 3W2IA 4UTZA 3DXFA 2XVZA 2E5LB 3IUBA 3JCZA 5DYWA 5DIZA 2ZT6A 5G0SA 4YTEA 5TT1A 4PX9A 4U63A 5EZYB 2AVNA 2OCLA 4R16A 3HEBA 5FPTA 3E5NA 3S1LA 4PGFA 2Z3VA 1P2FA 4R8VA 3C7CB 1CIPA 2YS7A 3C8MA 3GP8A 4ARCA 1IN7A 5E4FA 4ENRA 2YZKA 1JA9A 4KREA 3HACA 1MAUA 3ZX5A 4EQ6A 5LJLA 4I50B 2V6JA 2OXRA 3LKDA 5L53A 3ABRB 2CXUA 2QL7A 3UXMA 4AIIA 5C7LO 1LI4A 3JWJA 2VJMA 4UCFA 3RUDA 4ESHA 3K32A 3WSVA 2NVUA 3HI6A 3LYHA 2Y27A 4OHMA 1Z35A 2BJVA 3B9RA 3NYIA 3WB9A 1PJCA 4QPJC 1Q11A 4K6FA 4L3OA 5K1ZA 3L0ZA 3ER8A 1R0RE 1SB8A 1HYGA 1P73A 2MOKA 3P71T 2XHEA 4AY4A 1J0CA 1NAHA 1Z8NA 2PKRA 3DHYA 4YAWA 3E3AA 3NS7A 5DTIA 3VV2A 4HRVA 2IELA 3EDYA 1U2GC 1ZMOA 3A27A 5BN4B 1SCJA 1AIPA 2WA1A 3OOJA 5DOZA 3VPBA 3OCYA 4HVCA 1QONA 1MEJA 2FLVA 2PMDA 3BOSA 1K97A 1X19A 3PQDA 1E6CA 4U2DA 4IJQA 3VISA 5A3QA 4ES6A 1EUZA 3GT4A 3RPEA 5KTYA 4A8TA 2IT1A 2QUHA 2LDXA 4CTOA 3FUUA 4N49A 2HMTA 4RVFA 2D7JA 4Q7MB 3VTAA 4OTZA 5IFLA 3P9KA 1A9XA 5IKXA 3S0JA 2VTVA 3CW2A 3M83A 2EX1A 4MCIA 1WY7A 1JQEA 1RJWA 2EFYA 5DT2A 1BXRA 1X1SA 3QEBZ 1QAMA 1JHXA 1ZNXA 2X4GA 1IUPA 4Z4CA 5CGZA 2GXAA 1KJQA 2RI0A 2ZYIA 1AKNA 3A3NA 3L0DA 5EZ6B 4E0BA 4OHVA 4UHEA 3ZKWB 4KR9A 2H9IA 2GCEA 2QLFA 4YASA 4OG2A 1QAQA 4HRAA 3R3SA 5B57C 3NAGA 3OQNA 3EC1A 3VR4A 4IXNA 3VR2D 3QBEA 1Z0ZA 3RG2A 4BPBA 1GKUB 2DRIA 3CLSD 4LCJA 3RAPR 2HIHA 4N54A 1P1RA 1MX1A 2Q0XA 2YC2C 1GARA 2NO5A 3BXEA 2ZIUB 5DHQA 4BV9A 4KODA 1NOIA 1RMTA 4E21A 4JIMA 2NAFA 4IS3A 2BJWA 4C5AA 4YCLA 3NT5A 3DZBA 3T3MB 4JB2A 5KTMA 3TB6A 2BH9A 1DE0A 1FS4A 3EZ2A 5BWMA 4JLUA 3VO2A 3U3KA 2CT8A 3LQ1A 5CFQA 2PX2A 3ZHYA 3S8EA 4GPAA 5KHOC 2H1LA 3U7HB 5DWVA 1IQUA 4GOKA 1Z25A 1MX9A 4KN8A 2ZAMA 3CX4A 2N46A 1OSNA 2FETA 5CNMA 5DXFA 3S3TA 3T0GA 2J6CA 4DR6B 1CUIA 3BH6A 3DL4A 3PGVA 2NTVA 2PH7A 1IG3A 4UEWA 2V59A 2X3UA 4P80A 3I1JA 3TSZA 1ZH6A 3GEGA 2IOFA 4HY3A 1TIPA 4IFEA 3R4VA 3SBXA 2J67A 4MPJA 3AOEC 3SS8A 1L5QA 4DDMA 4X64B 4JZKA 5JO0A 2O2IA 3DW3X 2NX2A 1RIFA 3U4QB 2YHIB 2YJGA 2YQZA 4H4DA 4UHBA 5ALOA 1G5HA 4H18A 3VU0A 1M7HA 4OHXA 2Z8ZA 4FK8A 3OE7D 4XGQA 1CRLA 4TV9A 2I3BA 1Q0TA 4P38A 2CVHA 4J3FA 4OJNA 1NY5A 2WG1A 3ELBA 4NMLA 1QG4A 1E2GA 2W22A 2YVKA 1M10A 3K5HA 1EM8A 2H1VA 2YFHA 1ESNA 1WW8A 3F5DA 1F1JA 1LFDB 2X7XA 3JR7A 1MU0A 3A6GA 3O3NB 3PC7A 4L6AA 4M8SA 4N82A 1JB1A 4BB0A 4EF6A 3UT0A 4EHHA 3B82A 1A9YA 5FA5A 1FXSA 1TA0A 2GCOA 4HNGA 1CUVA 4KQIA 4IJVA 4E4TA 3I05A 3EOAI 1RRGA 1PRYA 4MP6A 1XFAA 4JJ8A 4EMBA 6YASA 1INLA 1Z7YA 3BCHA 1ZR2A 2NYVA 1YU9A 4FFRA 2K7FA 1YUMA 5CT9A 4BHTA 1KYQA 1QXSA 2RGRA 1ADJA 1VGVA 2Q9BA 4U2EA 4JY7A 5JPIA 5KJEA 5IJWA 2WZBA 5EFZA 5D2CA 3HL4A 1KWGA 3L7NA 3IPCA 1X7ZA 1EMDA 3HY4A 4QOHA 2HU5A 5DX8A 1YIOA 3KKOA 2LUOA 5HK8A 4J2HA 4DNQA 3I8XA 5HIJA 1JIJA 1Q1BA 2R8XA 2FB9A 4I2VA 1TQ4A 4ME6A 3W8EA 4O8ZA 3S7TA 2QF7A 4IGFA 3OESA 4CETA 4EKYA 4JLMA 5I8ZA 3ZQUA 3AUTA 4FIZA 1CJUC 4BP3A 1VMIA 3IJRA 3PX7A 2PGAA 3D2AA 4KH1A 2L69A 5K0JA 3WYGA 3DCNA 1FRZA 2FWBA 3O5AA 5G0VA 1V5IA 3OFVA 4B3JA 1D4AA 3U7EB 4PFQA 2Q3JA 2YH2A 1SUCA 3WGKA 4MR7B 4TRRA 1Z18A 2Q49A 2QX4A 2ZXEA 1PJQA 1T5LA 1EXMA 1IVYA 3TAUA 3AEXA 1MJGM 4FYPA 4H7KA 4YUVA 1V2GA 1OIVA 1W19A 3NHYA 1GPJA 2PJRA 1IBMB 4DM7A 4PNEA 2ZLBA 5KYXA 2WJGA 4URVR 2XUAA 2VSYA 1T0UA 2X42A 3FKSD 1CR6A 4JLPA 3VZDA 3ZGNA 4YUAA 2FH5B 4HX2A 2VWHA 3IH5A 3I12A 1WU8A 4CKYA 3IDAA 2ZAGA 4LQ4A 4CT0A 2FN7A 2KX7A 1XZFA 3FHCB