3BB4A

Crystal structure of toc33 from arabidopsis thaliana in complex with mg2+ and gmppnp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
240
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDELLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords T7I23.11 protein
total genus 78
structure length 240
sequence length 244
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb4A00
2QI9C 2IF2A 1BH2A 3DMNA 4NDZA 2A3RA 1FL9A 1SKQA 2BWJA 3TLXA 2XOKA 2O8CB 4IFEA 3ND9A 4I99A 4W5JA 2QGZA 1LF0A 2QAGC 5KPDA 1E4VA 2KI5A 1JALA 5AUNB 5B64A 3K9NA 5G40A 2FPMA 2ORIA 4CRWB 2H57A 1X8JA 1OFIA 3RLFA 5JJIA 3IBGA 3EA0A 2G77B 1NLZA 3ADCA 1ZM4A 4A9AA 2PJRA 1H8HD 1DARA 4IOJA 1CR0A 2QTVB 4LJ8A 4OI4A 5KNCA 3LBNA 4HLDA 4AYXA 4D25A 1Q20A 3J81k 2FEOA 3IKJA 3KL4A 1ZU4A 1IXZA 3SFVA 3SJZA 3N2IA 3VR4A 3T1QA 2ZJ2A 1U9IA 2BBWA 2W2VA 3TSOA 2WVJA 4JKIA 3VKHA 2REOA 4EIWA 2QTHA 2QRZA 5GVRA 3C15C 1U8YA 3ZQ6A 4JZKA 1YR8A 1ESNA 3KQLA 1QRAA 3RWOA 2OILA 3BE4A 4DXAA 2ZREA 1W2GA 1ZW6A 2Q3FA 4U5XA 1OJLA 3BBPA 4OK5A 2GXUA 4LV5B 4YMUA 3KJEA 3TUZC 1WMSA 5C1BA 1JPNA 2PX0A 1AA9A 3KKQA 4HEJA 1U9IC 2F3TA 3EZ9A 5C4MA 1FZQA 2C9OA 2ERYA 5FTJA 3REGA 2C8VA 1ZIPA 2GA8A 2O0HA 3GMTA 4US2R 1Q12A 3I8SA 1T5IA 3SEAA 1Z6XA 4Q1DA 4ASUD 3R7WA 2ZRAA 3Q9LA 3EZ2A 2JDIA 1Z6GA 2J41A 3CZPA 1KK2A 4HAYA 4CIDA 4ITRC 3CM0A 4URUR 3KKOA 2HXYA 2QPAA 4P33A 4XWAA 1OB2A 3W9YA 5CLQA 2IYVA 1QHIA 1SULA 4G01B 4JL5A 1TQ2A 1UFQA 4QNRA 5BW8A 3NEYA 4TL6A 4URWR 1SZPA 3RS0A 2WAYA 4WZ6A 2OBNA 3VR5A 2IYRA 3B1WA 3P32A 1ZP6A 1CLUA 3M1IA 3QXSA 4DT1A 1D6JA 4DUGD 2UZ3A 1QG4A 3U3MA 2AWNA 1G21E 4OHWA 3UXMA 1D9XA 4TLEA 1OXUA 2DWQA 3IPXA 4M1SA 2CL6X 1GIAA 1T5LA 3R8CA 3CPHA 1RRGA 1HE8B 2FSFA 1KI6B 1N6IA 4D4LA 3NBZC 1RYHA 1VYUA 2W58A 2EFGA 4BFYA 4OQXA 3QXCA 4TN1A 2Z43A 1I4TD 1IM2A 4TT3A 4A0RA 1BOFA 3FFAA 3H84A 1G6OA 3HR8A 3U3JA 4LV8B 3X1DA 4LY6A 2VTKA 5K8UA 2V1UA 5KDDA 4GI7A 1Z8FA 1TF7A 4B44A 5L3SA 2FFAA 1E9FA 3FPAA 3KKMA 1XEFA 3UG6A 1LW7A 2AKAB 2GVZC 3CR7A 4KCGA 4DCSA 2DPXA 3AKCA 1Q1QA 2ZJOA 5G53C 3F5FA 2QAGB 4M4SA 4QFMA 4QJ4A 1YZTA 1HQCA 3UMRA 1ZNXA 3FHTA 4OHYA 2WM9B 4AI6A 1IONA 2XB4A 4DLZA 3E5HA 4AKEA 4DCVA 2IYSA 4ZI3A 3PUZA 3VU9A 1KO5A 1XWIA 4XSHA 4DUGA 3SQXA 1K5GA 2A78A 3IEUA 2BCGY 4BLSA 2ZXUA 4ILEA 3U60B 4HB3A 2FU5C 4BFXA 2ZRPA 1Z08A 4L5BA 1VG1A 4C4PA 5F2EA 2MMGA 5JECA 1KSGA 5DLQC 1E9DA 1H8HA 2FN4A 4EKDA 3HP1A 3U6KA 4KBFA 3ZZTA 4LRWA 3I1FA 1WA5A 2OG2A 4H9GA 2R6AA 1E0SA 1TEXA 3AKYA 1MKYA 2QA5A 3HR7A 1MO4A 2ZQ5A 4A15A 3HU3A 1GKUB 2VEDA 4RVCA 1UKYA 3QIAA 3LX8A 3QBVA 2ZYTX 4C7OB 4Z54A 5EUMA 4IW3B 4UKDA 5CDFA 3FMIA 4A6XA 4EPYA 1LV7A 1KZ7B 4HDQB 5KNBA 1T8TA 4QBFA 1FPMA 5TVKA 4JBXA 3TQFA 2QP3A 3THXB 1R0WA 4KXFB 421PA 1XD2A 2QE7A 3R9IA 4BEBA 821PA 4IXNA 3TR0A 1DE0A 2EFDB 3E2IA 1CR1A 1P2SA 4Q4AA 4Q5IA 2QL6A 2RB4A 1FTNA 3B82A 2G3YA 1P73A 2BOVA 4LBYA 5IF9A 1WQ1R 5JMTA 5JWOA 4F4IA 3FMPB 4UNRA 1CBUA 1X1RA 4KO8A 2H7VA 2RCNA 3B1XA 2WKQA 1F2TA 2EYQA 1FOEB 2OHFA 1OH5A 4TYYA 3O8DA 3FMFA 4MKIA 3OIVA 5KTYA 2RGBA 1IOZA 3WMGA 2GJ9A 4YMVA 3W3AA 1Z6AA 4HATA 1J8MF 2GEVA 1OXXK 4MKFA 4M53A 2ZE8A 1SXJE 4LUCA 3VX4A 2ZVQX 2BM1A 3I62A 1E94E 2ZJYA 4B75A 5EXTA 1BKDR 1NF3A 3CWQA 4N0DA 4MYHA 4I1OA 4HAWA 2WJJA 1BMFA 1DAMA 4A0GA 5JS7A 5J4VA 1VDZA 3V4FA 5KDLA 3CRRA 5J5CA 3FFBA 2BEKA 1OV4A 5L3RA 1PJRA 4YC7A 1VCIA 4R71A 2GAOA 4TSFD 2VL7A 2Z4RA 2IXFA 4S35A 1OYYA 4LJ7A 4BRUA 4OL0A 4LJ6A 1DEKA 4BLOA 3SE0A 2VRWA 4OQNA 4TMXA 5FPSA 4RKEA 2ZRNA 1S9HA 3GJ8A 1WP9A 4RSGA 4DLWA 5KO2A 2JIZA 3KXIA 1OFUX 3F3YA 3N2EA 2XTNA 4DRZA 8OHMA 1M7BA 2JLRA 1ZIOA 2WIBA 4YLGA 5FTLA 1QHGA 1EFHA 1EFTA 1W0KA 2FMXA 2YV5A 1E2IA 4MYCA 1KAOA 1W4CA 1ZM2A 3CF2A 3CPEA 1NN3A 2OUKA 4BEJA 5DHAA 3FKSD 5DN6A 3ZD7A 1SKYE 4IOKA 2ZYVX 3U44A 5B58C 4Q4HB 3ZIAA 4AKIA 1R0ZA 5CM9C 1KTVA 2JEOA 2D06A 2EFCB 2V55B 2W6IA 4DEXA 2I3BA 1N6LA 3M6AA 3QXXA 3A8TA 4QC2A 1P4SA 2PZEA 2J5XA 3WP0A 4DCUA 1AJEA 4GZLA 4MDEA 5DO9A 2GK6A 2J46A 4MKHA 4DZZA 2CCJA 2RMKA 5H1YA 1U90A 5JSZA 3A37A 1NY6A 1Z2AA 5JCPA 1R7RA 4HAZA 1TU4A 5E7IA 2JGNA 1S1MA 4P4TA 3DMDA 1NJGA 3I61A 3T1TA 2ANBA 3QF4B 5DISB 1U81A 4RZ3A 2I4IA 3MAAC 2WOOA 1ONBA 2WSSA 1ZUHA 2JJ2D 1LNZA 1WE2A 2VBCA 4Q01A 3TBKA 1IN4A 5B2ZA 3L0SA 1CEEA 3KB2A 2HEIA 4CEJB 4NH0A 1MRSA 4ZPXA 1ZMXA 2DFTA 5TV2A 1GRRA 1XEXB 5FBQB 3WHKA 3TVDA 5LBIA 4B71A 4CT4B 1XTQA 3FGNA 3GQBA 1AKEA 3QKSB 3UG7A 3AGPA 3C4JA 3AH8A 3CPJB 4AKHA 221PA 2ZS7A 2ZUDA 1YJ5A 4TZ6A 4TQAA 4MRPA 2CE2X 3KQNA 2R2AA 3GLIA 3A4NA 2C9CA 2YWGA 3LNCA 1WCV1 3ZVNA 1UKVY 2WJGA 2R6CA 2IS2A 2VP9A 4GPTA 3AF2A 2CCKA 3BERA 3BH7A 4XWKA 2UVQA 1Z0IA 4V03A 2B8TA 3A4LA 4CW7A 4QG7A 4ARZB 1QHNA 3W6PA 2ERXA 3ZZUA 2IK8A 5FL3A 4O0MA 4EDHA 4EFNA 4QGHA 3UWOA 3DOEA 3LWNA 1J7KA 3X1XA 5K8TA 4JLKA 1CRPA 1D2MA 2ZTSA 2GXQA 3HU1A 3LX5A 5FUYA 3T12A 2H5EA 3T61A 2H16A 5LD2B 2VP5A 2AR7A 1KK1A 1FUUA 1J70A 2BV3A 1UBCA 2P0EA 1G3IA 3PVSA 4IOLA 3OF5A 4OYHA 1EWQA 5DHFA 2GDJA 4JLMA 3KUCA 4S2EA 1LFDB 2C2HA 5AUOB 5EP1A 5EP3A 4CEHB 1Z47A 5DI3A 3FHOA 4PC1A 4MQBA 3MSXA 1Z0FA 3IHLA 2O8BA 3K9HA 2NIPA 4PC2A 3VU9B 3NG1A 4EQ6A 1UADA 3NH6A 2H17A 1SXJB 1ZVQA 1HH4A 3TW8B 4DEYA 1XMSA 2Q6TA 4IJMA 3LY5A 2I1QA 4C0QC 4C9BA 4LHVA 4RD3A 1U0LA 3NXSA 2ZANA 4HLQB 1NBMD 4MRNA 5JEDA 2Q9CA 4PHHA 1UEJA 1E2DA 4ZDJA 1RJ9B 5FPKA 4LSGA 1OPXA 2BM0A 1HT2E 4ABYA 1NP6A 1PLLA 1XMJA 1NN5A 4B3XA 4EJSA 4IHQA 4C0LA 1II8A 3B1YA 2VHUA 4IOMA 1LTQA 4OHZA 1D2NA 621PA 4AYTA 2NG1A 3KQHA 1G5RA 3MJHA 1Z63A 4A4DA 1YVDA 3MCAA 1CS4C 5KSPA 1TUIA 1V5WA 4K8OA 1DG1G 3AKEA 4OI2A 2IYZA 4OI0A 5SZHB 1WRBA 4OHXA 3VX3A 4LBWA 1E1QA 3A4MA 5AUPB 2WTUA 2V7QD 2OT3B 1KKMA 1X8KA 2A9KA 3N5CA 4MRVA 1QG2A 2YC2C 2N42A 4RKFA 3CBQA 2G83A 4PSKA 4YXWD 4PZYA 4EFMA 2ZPTX 2QMHA 3U2QA 3U3OA 3W3ZB 5KSZA 5L3QA 1TQ6A 3LXXA 2RH5A 1BO6A 4IEEA 1JJVA 3RWMB 3UWKA 1KJWA 4E22A 1VIAA 1ESMA 2IXEA 3RABA 2G1KA 3PENA 4Q02A 2BHRA 2AX4A 2XJ4A 5P21A 2N1BA 3PEUA 4F4CA 1FP7A 1TADA 2H92A 2VP4A 3RS3A 4LZZA 4R98A 2DY1A 2XSZA 3B1VA 4MUAA 5BXQC 2CLSA 4JL6A 3BFXA 1SGWA 2O5VA 3QVVA 4FCTA 4NYMR 3P4XA 2ONKA 1JAHA 1OXVA 1Z6TA 2V4ZA 1AS3A 4ZCLA 4L16A 2QP9X 2XOKD 1QBKC 2IXGA 3B2EA 4PC7A 2JDID 1S3SA 5AWFC 1COWA 2J7PA 1MABA 3KJIA 1PLKA 1XDBA 3I92A 2A7QA 4NMMA 521PA 1AN0A 3OEHD 3QKUA 4C0HA 4AK9A 2G0NA 4ACBA 1IY1A 1G8YA 2GKSA 1KK3A 1N6HA 2FZ4A 4XTCS 5E4FA 2HCJB 2ZU0C 4UNNA 1ZRHA 1R5OA 3I72A 5HKKD 4UXHA 2RGGA 4XVRA 1FQJA 2H8KA 3H4MA 1X1SA 3NBFA 1G18A 2CHVA 3LH5A 3NHBA 4GSYA 3LO5A 5HPYB 4PPNA 1OFHA 3WP1B 2GWHA 5KOYA 1KJZA 4AG6A 1XF9A 1IY2A 4IFBA 4IDHA 3AKDA 2O8FB 2VP2A 4ACAA 1CULC 2BJWA 2P2LA 4C0BA 4KITB 1Z06A 2QP4A 4BFTA 3WYFA 1SHKA 3JZMA 3AP3A 3HDTA 2DCUA 4KBGA 2ZM5A 1XCMA 1Q1BA 4DB2A 2WWGA 4TLDA 1T9HA 1QHYA 3ASYA 5FOSA 4M2LA 5EE3A 3DL0A 4JYCA 1RZ3A 1W49A 4QM7A 2F1HA 4HB0A 1RW4A 1KMQA 2QEQA 2VA8A 3MG9A 4PC3A 3AP1A 4UNQA 1MO5A 4Q1EA 1W7AA 3WY9A 2JJ2A 4A2WA 1N25A 2BMJA 2RGEA 3MFYA 5EQTA 5A4JA 2X1VA 3EX7C 1EG7A 2ZR7A 3U7GA 4XVQA 3RHFA 3A58B 4G5SA 1X86B 2JJ1A 3K0EA 1KIMA 4IVPA 1M74A 4HUQA 2VH5R 3T1VA 1PZNA 3GEIA 1P5ZB 2OFXA 2OAQ1 3NDPA 5DH9A 4E07A 1FFHA 3RANA 4HYYA 3EZ7A 4JLPA 1YZQA 3CNLA 3IBYA 2RGDA 4JBWA 2RKOA 2ZJ8A 4ZDKA 4ZKDA 4DDTA 1GG2A 1GUAA 1Q1ZA 3H2YA 1SVOA 2ZI4A 5GJWC 1N3BA 2NZJA 2XEXA 3F0TA 4KSBA 3U4QB 3CNNA 4Q21A 3SOPA 1NKTA 2IS4A 1UJ2A 4GRAA 3SQWA 2ZI7A 2ORWA 2AL7A 3HJNA 4EUNA 3RYTC 3RNLA 1HV8A 2X19A 3DOFA 4RFSB 3P27A 2CK3A 3PUWA 4Q48A 2DB3A 2CNWA 2AK2A 2BMDA 2CDNA 2IUSA 2VO1A 5KUTA 4NCIA 3SR0A 2GHIA 4JKYA 1XEWY 4ZV4A 2BBTA 1YE8A 4LBVA 1SVLA 4TLBA 1FNNA 4D2IA 4F92B 5D3QA 4B6EA 5FUWA 5UKDA 2WWXA 1VMAA 4P31A 1VG9B 3UMSA 2J0VA 2GESA 5EE9A 2YNMA 4C0KA 3CUEF 3KJGA 3PG5A 4ASUA 1ZD1A 4QL3A 5EZ5A 2XX3A 1JQJC 2CLDX 2UZIR 4D6PA 1Y63A 4XH9B 1O3YA 2NPFA 3U7HB 4BZXA 1KY2A 2PLFA 3QNUA 1US8B 1UEIA 2IEYA 4BFWA 3FMOB 4CF7A 4JVMA 3BH0A 2VHCA 3GJ6A 2XZPA 2LWIA 4CEHA 3HU2A 3DPUA 5D3MA 5E95A 1U98A 4LPKA 2C96A 4Q1BA 1S2MA 2VHTA 4DHEA 2NQ2C 4PANA 4LWZA 4I1VA 4BFSA 1KI6A 1NSFA 4Q47A 4Z1MA 2JLWA 3ZVLA 3OHMA 1NL3A 5DN6D 1IN5A 2MSDB 2QORA 1E9EA 2CE7A 2ZSEA 3DM5A 3H86A 4US1R 2R9VA 3I73A 3KXLA 3A36A 2N46A 4AURA 2PEZA 5E3HA 4X8MA 4QJ3A 5JBQA 3EZFA 1G8PA 1HURA 3G82C 1NKSA 4JYBA 3QPUA 3TAHA 5HCIA 2BCJQ 1Z6YA 4WA7A 3W90A 4B48A 1E3MA 2EW1A 2BKUA 1HQYE 4BE7B 2G6BA 2ZEJA 3LFUA 3ZJYA 4EFLA 1LVGA 1LS6A 1R5BA 4LK2A 4TLAA 4MGYR 1KI8A 4F93B 3O8RA 3NBXX 3W34A 1R0YA 1IXSB 3LBIA 4G5OA 4BRWA 2GZAA 3FE2A 3K0FB 5TARA 2IF0A 2P65A 3LBHA 4DCNA 4F4JA 3ADBA 2IUUA 4TQUS 2W83A 1DG3A 2XTMA 1G1MA 3PEYA 1IXRC 4U02A 3QEOA 1NVUQ 3BWDD 5IHPA 3UATA 5HTKA 4Q9HA 3IO3A 1SXJD 4PQRA 5A5GA 1JJ7A 3L8YA 1DAFA 1O87A 1XJQA 5E7MA 2I1VB 2R6FA 5HE9A 2QBYA 3UIEA 2B8WA 1XPOA 1JPJA 1E79A 2SHKA 5FOTA 2ZU6A 4B47A 1KDOA 2IA5A 3CB4A 5EUQB 4DLXA 3GP8A 2FPLA 4NYJR 3A1TA 1ZCBA 4QKQA 1E2EA 4XWOA 4XVUA 1S4QA 2F9LA 5BYJA 1H65A 4P0TA 3I4LA 1J8YF 3W5IA 4BLQA 2QN6A 2XTZA 3GLFA 4LHXA 3AVYA 1AGPA 4ZCIA 4POAA 5L3VA 4RFVA 1E9BA 1E2GA 5CJPA 1N0VC 2QZ4A 4DWJA 4FI3C 4DLVA 2KJQA 1GNQA 2YOFA 1JNYA 2DBYA 1PUIA 3SFZA 2QAJA 5BYKA 1IQPA 5FFMA 5F98A 1XXHE 2QM7A 2YZ2A 1OSNA 3CO5A 3I3SR 3L0OA 2AXPA 3TAUA 4E5UA 4JL8A 1G7TA 3GLGB 1KI7A 4WIAA 4YMTA 1X8LA 1ZCAA 1R10A 4RD0A 1MABB 2VSFA 1F2TB 2OV2A 4HAVA 4NHOA 2ODEA 1DS6A 4W5HA 3WNCA 3M4YA 4HLCA 2TMKA 2W6JD 2XGJA 4PC6A 3VMFA 1Q21A 3B85A 5JLJA 1DAEA 4KJZA 2OFOA 1JXMA 1VHTA 1HEIA 4PQFA 2NO0A 1DVRA 2R8RA 3TKLA 2BIFA 2WHXA 3DHWC 5CK5A 5FPYA 1B23P 1XEWX 4HI0E 4OQLA 3CX8A 2AD5A 3MWLA 4B3BA 3UPUA 4ESVA 1XTIA 3VHLB 4D80A 3IPYA 4KFSA 4M9XA 4LJ9A 3SU8A 2ZJAA 2RGNA 3BGWA 3MMPA 1Q0UA 2FWRA 4A6PA 3OESA 4AWXA 2ZAOA 5JRJA 1OH7A 1DAGA 1GNPA 1VHLA 2W0MA 5KNDA 4V0KA 3TJZA 1VG0B 3MWJA 2NO7A 3FTQA 1PLJA 3AF1A 2W2XA 3CX6A 4MRSA 4HZUB 1AS0A 2X2EA 4JLBA 3CRQA 2QU8A 1Z3IX 2OESA 1VTKA 3QY0A 5TXGA 1EESA 4LHYA 5JI3E 1E2NA 4B3FX 2QY9A 2F43B 2HV8A 5L8VA 3Q5DA 4Q9LA 3R9XA 1GFIA 3CNOA 4ESHA 1XB2A 2BBSA 3NDBB 4MGKR 1A5TA 4DKXA 1U8AA 3BIFA 4TMKA 4LJAA 1ZD9A 3A1UA 3K09A 3U44B 4A8JC 3QKRA 1KK0A 2R44A 3WHLA 5GJBA 1OH6A 2ZYWX 4G5GA 4ZCMA 1W0JA 3HYTA 4B32A 2RAPA 3MGCA 4FD2A 5ANRB 3BFKA 5FL7D 4BFZA 5EXXA 2BMFA 1L2TA 1MT0A 1R5NA 2O8EB 4Q7MB 3RAPR 1FX0A 2RGCA 5JI2E 1F60A 1ZNWA 4Q7KA 4B6FA 4EJSC 3QI2A 2WPDA 3TVTA 5JSZB 4A8JA 1NN0A 2PLRA 2HUPA 1W48A 2GCOB 3FYHA 4TLCA 1CP2A 1Q3HA 4A2QA 2QT0A 4PZLA 1JXOA 4F91B 2Q9AA 4NYJQ 2WIAA 1IN7A 4HDOB 4JVLA 4KVGA 3ZS9A 1UF9A 1KI9A 1XCPA 5FBRB 1YR6A 3BOSA 1EX7A 3C7KA 3B1ZA 1Q3TA 4Q4JA 3IUYA 4TL9A 3S1AB 1P72A 1XTJA 4BUJA 1CJUC 1ZD8A 3X2SA 3SDZA 4IXMA 1E9AA 4DIDA 2V9PA 4NPHA 3EC2A 1SXJC 1IN6A 4ZI2A 1TF2A 1SVIA 3NC1C 3TQCA 5DE3A 4HDCA 2IWRA 2GK7A 4D4JA 2VHQA 2B6HA 2PEYA 4U00A 3CF6R 4Q9KA 2IS1A 4DLUA 4JBYA 4GOKA 4M1TA 2QMUA 1OE0A 1P9RA 2C98A 1Z07A 3RRNA 3QEJA 2VHJA 3OE7A 4QGAA 5JJKA 3T06B 3AVOA 2FJUA 1CIPA 1NIJA 5CIQA 3DM9B 5LD2C 2ZI6A 2CCGA 1QHHA 1VPLA 4AIIA 2FPKA 5C18A 1QVRA 2JATA 4H1UA 4ON9A 3EC1A 2ODBA 3L8ZA 2FGJA 3SYNA 2YHSA 2O8CA 4C0AC 2WMOB 1FNMA 3KUDA 4PZZA 2Q3MA 1JI0A 1N5LA 3JVVA 3AF0A 1XFAA 1NN1A 3TR5A 1KDPA 2C78A 1CU1A 2J1LA 3H0KA 3WXMA 2HJGA 4BZPA 3G5UA 1NVWQ 5IK2A 3NTUA 1XP8A 1QZXA 2ZE6A 5G3YA 3RDPA 1NSTA 3TH5A 1DOAA 3BK7A 4RCYA 1U2RA 4CZ2A 4AKGA 2D2FA 1XZQA 2OXCA 3CONA 3KJHA 1KO1A 2HF8A 2JJ8A 4RZ2A 5EZ6B 2CHQA 4F7WA 4DSOA 3CW2A 3PUVA 3KQKA 1K8RA 1M2OB 1RKBA 3B6EA 4PHFA 1W0KD 3O8CA 1R0XA 1RIFA 3FWYA 4WVFA 1L8QA 2GEUA 2GCNA 4KFTA 2F6RA 5DSZA 1XJCA 2JIZD 3GJ7A 4RD1A 4DSTA 3HPQA 3B9PA 2EVWX 4KLNA 4TTQA 3VKGA 3K0FA 4TMTA 2CLCX 4KFUA 5EE0A 1WBBA 3SS8A 1GZSA 2ZRIA 1GITA 2BC9A 4JLAA 4W5WA 2PZGA 4BZQA 4CYMA 3BFVA 1OHHD 1N6OA 4BASA 1E79D 4FCWA 4M1MA 2D62A 3NBYC 2FZLA 4HB4A 2OSBA 4PX9A 3H1TA 1EWRA 3VQTA 2ZUBA 3LW7A 2AN9A 3ASZA 3GLHA 2ODWA 5FL7A 4M1WA 4TMWA 4W7SA 3GLIE 4M9ZA 2ASEA 2NZ8A 4TYQA 1YZKA 4PPGA 2PMDA 4GBMA 1KZGB 2QMEA 4LJ5A 1HTWA 2FFBA 4LDJA 4LV6A 2AXNA 2KWIA 2WZQA 3ZVRA 3ICEA 2IHBA 2EWVA 3U7EB 2C04A 1ZM3A 3IGFA 2XB2A 4NTZA 1EK0A 1VECA 2WJIA 4JLVA 2J3EA 1DAKA 4FN5A 2F55A 4X8HA 2OE2A 1G8FA 2OLJA 4PPFA 4IDQA 4NONA 3VTKA 4DIEA 1E2JA 4MGZR 3C14C 5FOVA 3D31A 1G3UA 1F2UB 1U8ZA 2J45A 4Q00A 5JWRA 1GL7A 1OIVA 2QROA 4RD6A 5H8WA 3EWAA 1KGDA 2EFHB 2WJVA 4O2RA 4DJTA 1NBMA 2IUTA 2GJAA 2ZR0A 3TE6A 3NWJA 4WZAE 5J40A 3PUYA 4QJ5A 2G88A 2VSXA 4B3GA 4KVAA 2QQEA 1G5TA 1Z2CA 1AGRA 2YOGA 3DZDA 2CJWB 2BMEA 2IYYA 2YYZA 1CXZA 3R9WA 3DKPA 4H1VA 5L3SB 4LYJA 1ZU5A 2YOHA 2A5GA 3SI7A 3T5DA 4B35A 3TW4A 4PAMA 2JLQA 4PQYA 5EJEA 2ORVA 4ZIRA 4B74A 2WJYA 3VKWA 1W4AA 3D6TB 1L4YA 2PL3A 3A1SA 3QG1A 1E4YA 4M9SA 1AIPA 4NE2A 5GADl 1WB9A 1N5KA 3X1YA 2YC4C 1R8SA 3KTAB 1KHTA 4Q1FA 3BD9A 2OXRA 3LXRA 1TL7C 4II7A 2ONJA 3QPVA 1WBDA 4FWIB 1FTSA 3G0HA 2WAXA 1W5TA 1G64A 4GZMA 1NLYA 1J90A 5FTNA 1ZC3A 1E2LA 3QKTA 2R62A 4JJZA 4TL7A 1LF5A 2RGNC 3EWSA 3VNVA 4HSEA 1GVNB 2A5DA 4W9MC 1S0UA 2W6ID 2QTFA 3REFA 1KJYA 2Z83A 4JLNA 1ODFA 4OK3A 4DLRA 4F38A 2GXSA 4PPQA 1M8PA 2ODNA 1CJTC 4WAUA 721PA 2VYFA 3AEZA 4KYUA 3B7GA 3BORA 3LW8A 2D7DA 4NL4H 1JEEA 1N0WA 1YHNA 1ZNZA 2XXAA 2HLDD 2FH5B 2GETA 4C0JA 1A82A 4XSGA 5H70A 1RRPA 2VLIA 4EPRA 4XD7A 4HAUA 4IVRA 4QHTA 5J4YA 1G8HA 3Q7PA 4DLSA 1XNJA 3LD9A 5EXSA 3TK1A 1KAGA 1EGAA 1KY3A 3BS4A 3EW9A 1Q22A 2Q9BA 2JLSA 4A0HA 3VHXA 4G5QA 4D81A 4DSUA 1BMFD 1Q57A 1QHSA 1XD2B 3CH5A 2V3CC 3AVVA 3RC3A 3GJ5A 2ZRGA 3MLEA 2DWPA 4L4UA 1KSFX 2VP6A 1G3RA 1M6NA 1SVSA 2GTPA 4IVQA 2WSMA 4DDUA 4TL8A 5CYPA 1S96A 1L7VC 1KNQA 1Q44A 2FSHA 5FH9A 2BJVA 2YWFA 3MD0A 2QUZA 3L43A 5BWMA 4KAXA 1DTSA 4A82A 2QG6A 3QE0A 4G1UC 2QRNA 1EFCA 1AZTA 3GEEA 4Q7LA 3GPLA 5CIWA 2B7BA 2GZDA 2PJZA 3THYA 1OIWA 1UDWA 4E09A 4OKSA 5JHHB 4JT2A 2GBLC 2Z4SA 3K0AB 4A0FA 3DO6A 1E0KA 4BGDA 3ZD6A 2VP0A 3OFNA 1N2CE 4BPBA 3U4QA 3T15A 3C8UA 1K6MA 4IDNA 3C5CA 1ETUA 2KBEA 4BLTA 1TU3A 2PT5A 2QT1A 1GL9B 2ZSFA 3IDQA 5DYGA 3VR2A 5CK4A 4A2PA 1JR3A 5FOUA 2NO6A 4B34A 3L0IB 1NG1A 2W6JA 2OLKA 3ZVMA 1LS1A 1TX4B 2QPTA 3AV0B 2GCPA 3QSYA 3RS7A 4HAXA 2WBLC 1G41A 3E70C 3O8BA 2R6DA 4I4LA 4MKGA 1FW6A 1I4LD 4I1UA 4XTRA 1T91A 2CXXA 2PMKA 3FVQA 3LLUA 2FA9A 1Z0DA 4DSNA 1T8UA 2D4HA 2GVDC 2OM2A 4MYUA 2IBMA 5GVSA 3DDCA 3NKVA 1IBRA 1N6RA 4WW0A 5JWHA 2XSZD 1GM5A 4JMPA 1W4BA 2HF9A 4QRHA 2WSSD 2W00A 4V02A 1TQ4A 4Q9IA 2GF9A 4PXAA 4J0QA 3B13B 4OQMA 3QPWA 3I5XA 4M8NE 1KDTA 4LHZA 1Q1EA 1XTRA 3L2OB 3OAAD 1NVVR 1VCMA 2FEMA 4YDHB 2LKCA 2OCAA 3OFND 4V0ME 1HYQA 2VPPA 1E2PA 5BQ5A 1SKYB 2AWOA 2C5LA 3TRFA 4P32A 4D26A 1US8A 2FF7A 3ETLA 2HJVA 2GEDA 4Q4AB 4OJQA 3EPLA 3SYLA 4YXWA 1E69A 4HLUC 3CKLA 1KI1A 5JZVA 2KSQA 1KMHA 5EP4A 2Z6VA 4FMCF 3UMFA 2W2TA 3ZS8A 3ZIAD 2ZYUX 4MA4A 4P4SB 2GRJA 5HKKA 3GEHA 5JJLA 2Y8EA 2Q21A 5AJWA 5EP2A 3K8YA 3SJBA 1UPTA 4L9WA 1S3GA 2AKYA 1E2FA 4A1FA 3C41J 1XPRA 5EE5B 4D4MA 1OYWA 1S9DA 2P67A 1M34E 3KKNA 1W46A 3SJAA 1J99A 4R7ZA 1WXQA 1T3LA 4WZBE 2YWEA 1JR3E 1N5JA 2FX3A 5LPNA 3ZYCA 5FOWA 3EIEA 3NC0C 2A5JA 2GF0A 4QHSA 5F3WB 2ZRHA 4LPSA 3RS4A 2FFHA 5AJZA 4A92A 3MWYW 3AUXA 1YQTA 2FSIA 3HYRA 4ZO4A 2ZRMA 4TT3D 2WWFA 1YZGA 1GOTA 4PSVA 4IRUB 1COWD 2J7PD 4NCNA 1R8QA 1TNDA 2ZSDA 5C2JB 4TZ0A 3ADKA 2PCLA 2BKEA 1H8EA 4DDVA 1M7GA 4V0LA 2VSOA 4P3YA 2ZJZA 4QOSA 1TEVA 3BJIC 4JVSB 1TTTA 4Z8XA 1AQYA 4I81A 2FSGA 2JLVA 3RRYA 1XXHA 2V1XA 1VCOA 3AVPA 3DKVA 4Z1MD 4R2IA 4Z51A 2IW3A 1P7CA 1MRNA 4C0SA 3RSLA 4CEIA 3RSOA 1CJMA 5AJXA 1E1RD 1UKZA 3P4YA 3AGQA 5HZKA 5CM8B 1VG8A 3D3QA 2XNDA 1W2HA 1IJEA 3LVQE 2VIIA 4GFDA 3OIYA 4TTRA 1G9XA 3EIQA 1TPZA 1P61B 2D74A 1T3HA 3R20A 1ZYUA 5CB8A 1DADA 4C30A 1UM8A 1AQUA 1N6PA 1P62B 3EPHA 1BYUA 3QF7A 2ANCA 2CL7X 1NIPA 2IHYA 4QBGB 3MWKA 4JVNA 5FUVA 4KSCA 2D3WA 4URYR 5B30A 1Y3AA 1I2DA 3D8BA 3AF3A 3BAFA 1CJVC 1UAAA 1H8ED 4O2LA 4FXPA 2IS6A 2LKDA 1DAHA 2WMNB 2YVUA 4MITA 3NH9A 4LYFA 5SZKB 1F3OA 1FMJA 3RVBA 1ZJ6A 3GJ4A 4B73A 1GRQA 1N5IA 2IT1A 3GLGA 1E6CA 2O8BB 1E96A 5FUXA 2UKDA 3FDIA 3LAWA 4GMXA 3I8XA 3K0CA 2B21A 2V6IA 2KB0A 1A1VA 3T5GA 1W44A 1CJKC 1Z28A 1VCNA 3WYGA 4C3ZA 2F9MA 3P26A 2XJ9A 2HT6A 5KU1A 4KYIB 5K8IA 2CVFA 2FDCA 2X2FA 1IN8A 4R9UC 5HR5A 3CRVA 2OCBA 3SN6A 3IIMA 1RJ9A 2Q3HA 3PCRB 2V6JA 4Q1AA 1W1WA 3M0EA 3A1WA 3CRMA 4DVGA 3AB3A 1R6BX 1WDTA 4ZKEA 2QBYB 4RD4A 4EJSB 5FR1A 2ZAMA 2F1RA 1F5NA 1R4AA 1OH8A 1II8B 1R2QA 2C77A 1J2JA 4UQOA 2RGAA 2P5TB 3CZQA 3EZ6A 1P2UA 4QGFA 4WXPA 4YMWA 5FTKA 2IYWA 1GP2A 3A6PC 3MUFA 1N0UA 1NVXQ 3Q85A 2IX3A 2BEJA 3WRXC 4DCTA 1XRJA 3QENA 1GKIA 3W5JA 2HXSA 1OFTA 1WF3A 4LYAA 3QBTA 2OBLA 1U99A 4DLTA 2ZE7A 2VQSA 3QVUA 1LB1B 1ZC4A 4ARZA 4HZUA 4BFUA 2ZRCA 1JECA 4D4KA 1GILA 3GLFE 1G7SA 5LB4A 4OI1A 2QPOA 3EPJA 4FCVA 3EASA 4YMSA 5FOXA 2BDTA 4GNKA 3V9PA 3PXGA 3VFDA 3SJCA 1A4RA 1IHUA 3IHWA 2ZRFA 2QSZA 4I1SA 4V0OA 1ZINA 3RS2A 5J4KA 2CVHA 2OO7A 2IEZA 4Q03A 2K5UA 1A2BA 2YWHA 3PEWA 4JIMA 4NKRA 5DYIA 1QDEA 4DT1B 4M0LA 3RRZA 1KSJA 2ZVPX 4FW9A 5TY0A 2J9RA 4M1KA 2FV8A 2AD1A 1IJFA 4M1YA 4TWZA 3B5JA 5DI3B 4MDFA 2P6UA 1DO2A 2NTYC 4UNPA 3SBEA 4BFVA 2O8DB 1I2MA 3THYB 5KHOC 2OZEA 3CH4B 5CITA 2JASA 1KO8A 1FMLA 3K0AA 1KKLA 3KDSE 4N3NA 3THOA 4AD8A 1SXJA 3W6OA 2ZJBA 2GJ8A 3KFVA 1D8TA 4BECA 2IWHA 2RHDA 1T4GA 3Q3JB 3EG5A 1IAQA 1KO7A 1ZUIA 3NEJA 3P1JA 3GJ0A 4IDPA 4CDGA 4L9SA 3OIWA 3LQQA 4Z8YA 5J4HA 1FQKA 5FPHA 3FOZA 1GSIA 4LBZA 4O25A 4Q4JB 4OK6A 2A2ZA 3EARA 1CR2A 5K8LA 4EPWA 2WJHA 3LDAA 5FPTA 3V00A 4JS0A 4FWTA 1D2EA 4GDFA 2JJ1D 4Q19A 3LLMA 3QJYA 1JB1A 1YRBA 1FUKA 2PH1A 4US0R 2C99A 3PIRA 4QXAA 2OCYC 2J0UB 2F43A 4ZDWA 2F7SA 1G7CA 5AJVB 3PITA 4KHZA 4YQFA 1DBSA 1YZLA 5DIFA 1MOZA 2F1IA 3EXAA 1Z0JA 3EAQA 3GLHE 5KPJA 1NNEA 4L15A 4UXIA 3LA6A 3QKRB 1UBEA 4LX0A 5GJVC 5TDHA 4IEIA 2H18A 2G0TA 5FTMA 3DEFA 3VR6A 1XPUA 4KI0A 4D82A 3SHWA 4FMDB 5HZHA 4KFRA 1TMKA 1E9CA 2IC5A 2ZRJA 1D5CA 3L0PA 4Q7JB 1OW3B 3AVQA 1FX0B 3IQXA 1YZUA 3N70A 1M1YE 1RRFA 1EXMA 1UBGA 1G8GA 2OAP1 3OZXA 4EPTA 1MV5A 4TMZA 2GCOA 3GD7A 3Q7QA 1OKKD 4URZR 1YRAA 2ZITA 3R8FA 3P20A 3OEEA 3THXA 2FG5A 2J7KA 3IILA 4KV9A 3CWZA 5IRCD 3JVUA 3GLGE 2F1JA 3FKSA 2GNOA 3WMFA 1JR6A 1XBTA 4NCHA 2JLUA 1G6HA 1TAGA 4MGIR 1CRQA 4G0NA 3VR1A 2FOLA 1KOFA 3U6BA 1RC8A 3TIFA 1VIYA 2WWHA 1KI4A 1U94A 1AKYA 1SVKA 4B2IA 3IO5A 3K1JA 4B2LA 5B57C 5BN5A 3PJRA 2HT1A 3UANA 3E1SA 5KSYA 1DPFA 1U0HC 4HZIA 3WMEA 4XOIA 4Q66C 3B60A 1W5SA 4RFSA 3SHFA 3K70D 1G5PA 1X3SA 3KFXA 1BIFA 3T34A 2PCJA 1UBFA 1E1RA 2C95A 4GOXA 1C1YA 2NOAA 4BWYA 2ZI3A 2GJSA 2NO1A 2REXB 3K09C 3SNHA 3CIOA 5FI1B 2CK3D 3GLHB 2CNWD 3OEED 3AVXA 1NBME 3TNFA 2E87A 3ECCA 3RC8A 1E2MA 1P60A 1W0JD 5HE8A 5CYOA 2WPDD 1JAIA 4FMDF 1AM4D 3WBJA 1ANKA 1RVDA 4ERNA 1E2HA 4LC0A 1T0JB 3BRWD 2IL1A 3GFTA 1C4OA 4KODA 1BYIA 1X6VA 2RHMA 1NJFA 5DNYB 3VNUA 1OXSC 1G3QA 4JLDA 2LCFA 4HUTA 2QMOA 2E9SA 3D7MA 1GDDA 4P4UA 1N6NA 1T6NA 1E2KA 2JAQA 3AUYA 2JLZA 2YJTD 3CLVA 1NMYA 1YKSA 1ZM7A 4GT1A 1YZNA 4LOAA 3IEVA 2F3RA 1VYVA 2NO9A 2C03A 1OXTA 4BLPA 1F48A 3GFOA 2EQBA 5ELXA 3LQRA 2JCSA 1W36B 2KBFA 5KSOA 3CX7A 4CGZA 1JQLB 3K53A 1QHXA 3K9LA 4GP6A 4JSYA 4JJKA 4PAQA 2ZS9A 3X1ZA 3NVAA 3KQUA 5DI9A 5E7JA 2DFKB 1ZAKA 2OFWA 4TTPA 1T0HB 4RJLA 2ZROA 1SQ5A 4EAQA 1G4UR 4Q4HA 4GOJA 1NVVQ 4WOPA 5KYKA 2ZSAA 5F9FA 4DLYA 3OE7D 3ICQB 1G7RA 1VKJA 2HCBA 1NLFA 3EA5A 2J87A 2PBRA 3EPKA 3AVTA 2WKRA 1VYTA 2ZSBA 4Y0VA 4M9QA 4HB2A 4EPVA 2REBA 3TMKA 1NRJB 3O47A 5J4LA 2FGKA 1NMZA 2WWYA 1A7JA 2BVNA 3CRW1 4PAOA 4X8LA 4B43A 5BN3A 4DBLC 1G20E 2ATXA 4DDWA 5JCZA 1K5DA 2O52A 1CR4A 2ZETA 3IIKA 4JLJA 3QOFA 1E9SA 1N6KA 2GILA 3PQCA 2XITA 3RS5A 3DZ8A 3TUJC 5IK2D 1TF5A 3BH6A 2ZI9A 3KTAA 4C2TA 4URXR 2A5YB 4FIDA 4G5RA 2J59A 3C5HA 2CMKA 5IDVA 1Z0AA 2G1JA 1P2VA 5EE1A 3THWA 2VF8A 4V0NA 1ELOA 1P3JA 3MRSA 1XEXA 5G3ZA 1TUEA 1MH1A 3PFIA 5IT5A 3LVRE 2EU8A 5SZIA 2R6GA 3AQ4A 1F2UA 3I5YA 1RE0A 4KU4A 3ZH9B 3U3RA 1E98A 3B9QA 4R2HA 1AZSC 1XJ0A 2CHGA 4NYMQ 4QBHA 2Q0HA 4NCJA 2L0XA 4X8OA 4TYWA 1CKEA 2IYUA 3ND8A 2EYUA 5A0FA 1OF1A 2QM8A 2O0KA 1LY1A 3JZAA 2XXAB 2YKGA 3Q5EA 4Y0AA 4YDSA 1A2KC 3B8HA 2DYKA 4FMBB 5DGXA 4TQ9A 5C46F 3U7FB 2B7CA 1G4AE 1NI3A 1XTSA 3VAAA 1XZPA 2CJWA 3T35A 2NMVA 4PSAA 2IYQA 4O3MA 1CTQA 2R65A 4OJKA 3GJXC 3PUXA 4RD2A 5D3MB 3ZQJA 4UNSA 1ZM9A 2WV9A 3OIUA 2O8DA 1MO6A 1FP6A 1OT3A 2V8OA 2Z5FA 4K81B 3WYAA 5JRZA 1P2TA 2OCPA 4ZIRB 2XNDD 5G41A 4PHGA 4G3XA 5M04A 4TSFA 3X1WA 2V7QA 3QF4A 2FFQA 2GBLA 3SZRA 3BB3A 1KNXA 4CT5A 2HYDA 2QGNA 3FHCB 1XMVA 4XIGS 1GKYA 3BXZA 1F6BA 2QE7D 3AVWA 4CEJA 3EIHA 1Z22A 5H68A 1I4DD 1P9WA 4ZDIA 1KYIA 1GNRA 4B76A 3DVLA 1P6XA 1W36D 1RYFA 2EWWA 2RGXA 3BB1A 3GCGA 3GJ3A 3KX2A 1ZBDA 4EQ6B 2X8AA 3CF0A 5C4GB 3W6NA 4QNMA 3QKSA 3C16C 4Q4LA 2BBOA 4LJ4A 4LYHA 4XD7D 2J0UA 3F8TA 1HUQA 1SVWA 3WRYC 2P5SA 3VR3A 4NCKA 1UKEA 2ZR9A 2G9NA 4RZXA 1T3SA 5EXPA 3GLIB 2IYLD 3B78A 3K70C 5TMPA 3ZZ0A 4RZUA 4E03A 2J0QA 3KXKA 2J0SA 1SVMA 3QUSA 1QF9A 4DB4A 3BB4A 3NHAA 1PUJA 4LJYA 4QM6A 3LRPA 3R7WB 3IIJA 4D0GA 1W47A 4N0EA 2WICA 1XD8A 4K46A 4NZYA 3CR8A 4LCBA 5LDDC 2V54A 3AF4A 1G16A 1EFRD 1EX6A 3QXHA 2IYXA 4JT4A 5LB2A 4MH0R 4GMDA 3GLFB 2D7CA 3OEHA 4DC9A 3ADDA 1C9KA 4B33A 4CVNA 5JEEA 3SYKA 4QGGA 1Z5ZA 4PO8A 5AR1A 1Z83A 4M21A 2KE5A 5AUQA 4LI0A 4NBSA 2FNAA 4UJ5A 3AVUA 3AP2A 1ZUNB 3UK6A 1D9ZA 1E32A 1OLOA 4EPXA 5L3QB 4AYWA 1U0JA 3QQ5A 1DAIA 5FR2A 3SBDA 1NMXA 1KMHB 1QVAA 1S1CA 5JHGB 1UDXA 2QENA 5FI0B 1E99A 2O8EA 1XX6A 2FE4A 2PT7A 3I32A 4LHWA 1G17A 4P4SA 2ATVA 2MMCA 4N1AA 2GZHA 4GL2A 1GWNA 1YR7A 1RPZA 4IDOA 4WXRA 1JEDA 3V4RA 3NIBA 2XNSA 3FKQA 3LV8A 2PZFA 1B0UA 1L4UA 2B92A 1EFRA 1S8FA 1MR3F 4L8GA 3U5ZB 2HLDA 5SZJA 4WBSA 1G3MA 4KLZA 4M1OA 5BN4A 4PHTA 1NY5A 2QAGA 3KKPA 2P3SA 3TUIC 4B2PA 1MO3A 2XZLA 3L82B 1SHZA 2MSEB 2OBMA 2E1RA 3SC3A 3Q72A 1OKKA 1E1QD 1AS2A 3ZDQA 1XCGB 1AK2A 121PA 1BS1A 1XD9A 1XMIA 3IQWA 4PFSA 3U3KA 3W8RA 2NPIA 2JLYA 2HYIC 2QNRA 1E2QA 5JFGA 2WOJA 5CJ2A 1ZNYA 4QHYA 3K0CC 1XU4A 2P6NA 4IKEA 2ZJ5A 4PR0A 1KI3A 2ZRLA 4OQFA 5CB6A 2W0SA 4URVR 3U61B 4Q9JA 4AG5A 5KDOA 1V43A 4NU0A 1NG9A 4BLRA 5JS8A 1YU9A 1EFUA 4FMCB 4MRRA 1XXHB 3PEVA 2GJKA 2JLXA 2XAUA 1TQDA 1QHHB 4V0MA 1OB5A 1E0JA 5J47A 2X77A 3K70B 4YONB 2O0JA 2GXAA 1PV4A 5AJYA 1II0A 4RY2A 2CBZA 4NP6A 4C7OA 2O8FA 1HA3A 3UKDA 1W4RA 2D2EA 3RRMA 3WNBA 5FBVB 4PTLA 1E9RA 4U7DA 2ZS8A 2JA1A 2ZRKA 5CLLA 2WKPA 1PVOA 4LGMA 4B3CA 1DO0A 2GAAA 2C9YA 2PX3A 1KSHA 3Q8XB 4RCZA 1GTVA 3TSZA 3HPRA 5CDFE 2Z0MA 3TSWA 3K9GA 2ZI5A 4B3DA 1KI2A 1JR3D 3FB4A 3GFPA 2ZIAA 5TB5A 4BQSA 4UJ3A 3KB1A 4JLOA 1RRCA 1M7HA 4MYTA 2ZRDA 4NYIR 4PO1A 5GJCA 4AY2A 4TYPA 2ZUCA 4PO9A 5F9HA 1E0AA 1W36C 4FINA 1KO4A 2DR3A 4UXJA 2A5FA 4A8JB 3K0SA 5FBWB 1P9NA 4AC9A 2XZOA 2YINC 3AM1A 4OBEA 4D0LB 1GL6A 3WNDA 1G19A 1HT1E 1JBKA 3OAAA 3BC1A 4HUQB 2DHRA 5FBLB 4TYNA 2QQ0A 2DFLA 1OIXA 1YR9A 4HLUA 4M22A 3KZ1E 4MUBA 4Q1CA 3S1AA 2IYTA 1II9A 2A30A 3PV0A 3W8NA 2OEPA 1HY3A 2MSCB 4C2UA 3WBKA 2HDNB 1IY0A 3THWB 3TGPA 2ECKA 2AHOA 2VF7A 4Q18A 2DWOA 3ZGXA 2H1LA 1Z29A 5AK0A 4JSTA 4A36A 1OHHA 2CEAA 1CF4A 2WWWA 1G291 3T1OA 2QSYA 3QG5A 4NYIQ 4D0NA 4CEIB 1P75A 4XJXA 2EFEB 2P6RA 2CL0X 3ONWA 2AK3A 4GP7A 2DFNA 2AFHE 2ZRBA 2NGRA 6Q21A 2WWIA 1RFLA 4LC1A 1GAJA 4OHVA 1XTKA 1KDRA 3PR1A 1HE1C 2ZE5A 2AFIE 3MJRA 1DELA 4TMVA 3A1VA 4QBIA 3QXJA 3HWSA 1GRNA 1Z0KA 3ZLJA 5HCNA
chains in the Genus database with same CATH superfamily
2QI9C 3O5AA 2NSHA 2IF2A 2TECE 3L4JA 1BH2A 4ENRA 1D4FA 5BT9A 3N0XA 3V8BA 4HEQA 2WYOA 3TLXA 5CCXA 5AMXA 5DU2A 4I99A 2OAEA 4ZEWA 2NSDA 2V59A 4W5JA 4X41A 2W11A 1X1BA 2QAGC 4PM4A 3KOMA 1NQVA 2X9LA 1NVMB 2Y1CA 4KV7A 1HYHA 5A7FA 2GN8A 2P78A 1JALA 3DTNA 5EINA 2QTTA 5AUNB 5B64A 3CUVA 2FPMA 2PSEA 4CRWB 3I5MA 9MHTA 1FY2A 1KZ6A 1X8JA 1Z4QA 4BWFB 4C4XA 1GUDA 3UXEA 1NJ8A 3GAFA 2XCLA 3ADCA 3QVGB 3ZD9A 4IWXA 5FWDA 2PJRA 4IOJA 2CVOA 4TKVB 4LJ8A 1R37A 2I2CA 3ESRA 1DC5A 2DVMA 1UC8A 2R8BA 3FYSA 3H9CA 4HLDA 2C58A 2ADFA 2D4AA 3J81k 5CB4B 1ZU4A 3N2IA 1RRVA 4YYZA 2IDZA 1U9IA 2W2VA 3CUTA 3VU3A 6REQB 1L7DA 4XVCA 1PKXA 4BNXA 4I08A 5BUSA 4XOUA 2QTHA 3C15C 2QLNA 4F86A 1U8YA 4OPMA 3OE4A 4JZKA 5EC8A 2VNHA 1QRAA 4PLHA 4LAFA 3NJ4A 3B53X 4DXAA 3I53A 3R41A 1SRQA 4UTZA 4MUEA 4U5XA 4ROTA 3SBXA 4Q4CA 2A9JA 3O91A 5MN5A 2ZM6B 4WVLA 4C78A 1O5OA 2Y0DA 3KKQA 5HBGA 5JAHA 4JH0A 5KWVA 2VNSA 1NNUA 2EJVA 2H3EA 1QP8A 2GN9A 5FTJA 3REGA 4AJOA 4H16A 3VH1A 1EZ1A 4JT8A 4RENA 3CE6A 1T5IA 4D9MA 3W6UA 1KFBB 4RKRA 1FXUA 3RJ9A 4G1VA 1JQ3A 1Z6XA 3RASA 3SEAA 2CLOB 4ASUD 1U1FA 2CXOA 2LRHA 5CJJA 1GN9A 5IFLA 1V3QE 4YP1A 4AZWA 5EYPA 3WGHA 3EZ2A 2JDIA 1N7HA 2PZLA 1EJ0A 1L6IA 3AEQB 3E6AA 4M55A 4IKOA 5BWNA 2EZ9A 1Z6GA 3QFSA 5FHRA 2J41A 3CZPA 4PZPA 2W37A 2X13A 1UKAA 2P1DA 2QPAA 4HYTA 1LDYA 1OB2A 1H2BA 1C0LA 1NBHA 5CLQA 3R5KA 1PZMA 4QLBA 1MC1A 2IYVA 4G89A 4NZOA 5B55A 5LR6A 1SULA 3ZZ1A 3AFMA 1PD1A 1MA3A 4QNRA 4CMIB 5IM4A 4MVJD 5KTKA 3D3JA 3UV7A 1JEAA 2OBNA 4JUDX 2HIHA 3S44A 5EIEA 4RS4A 1T0PA 3FI9A 5FBKA 4DCPA 3RYHA 4IMPA 1C0IA 5HQTA 3U3MA 1U4NA 4JJEA 1IQUA 5D85A 1QKIA 2XUHA 1D9XA 1SB9A 3UXMA 1OXUA 3S1SA 3L77A 3LBFA 1T5LA 3FIUA 1RDFA 4N7MA 4OP1A 2AI3A 2GYWA 4E2WA 2FSFA 4OHPA 3E23A 4B87A 4QQKA 4ZHQB 3L7CA 3KE9A 3K9WA 4J6EA 1YDHA 3SE7A 1YI0A 3CIFA 2EFGA 3MGGA 2ONCA 2VEOA 4KW7A 5CT4A 4BAUA 4WJLA 1JLKA 3FFAA 1HYEA 3H84A 3HR8A 3O9VA 4A5SA 3Q7RA 4LY6A 3Q40A 1UM9A 5AOCA 1GUBA 1Y8RA 4YRIA 4ZEMA 5IFKA 3LIPA 1Z8FA 2FFAA 3OJCA 2IRWA 5LZ7A 2VXYA 1PYGA 5FXMA 2AKAB 4R2KA 2VYVD 3FCAA 4MUMA 3RYFB 2JVJA 4G07A 3HTXA 4IS2A 2NU7B 1WLYA 3W1WA 4JXXA 1XROA 1ZNXA 4FGSA 2WM9B 2VJMA 1JXQA 4OHYA 3E5HA 3Q3GE 4GM0A 4TKUB 3F6BX 2IYSA 3C5VA 3PUZA 2TMDA 4IICA 2YUTA 3VSBA 3PU6A 4ZCQA 2NV2B 1I51A 4BLSA 3U17A 2ZXUA 2CKMA 1TZCA 3U60B 4HB3A 1QB8A 4BFXA 1L7PA 1OASA 5F5XA 3SY8A 3KOZA 1C5KA 1MJHA 3AL0C 3UH0A 4GLJA 1KXJA 3U37A 2PD6A 5F2EA 4WNCA 4C4PA 1XGKA 2QRKA 1DBWA 3FB1A 1CQXA 3B2NA 3FN4A 1E9DA 2OECA 4K6GA 1CUSA 2FN4A 2Z3VA 2ZTMA 2XYGA 1ZMOA 3U6KA 2Y68A 1ZKMA 3PGLA 3UCEA 1CHNA 3CNQS 2VAPA 5DTMA 2ZPAA 5C0OE 4A8HA 2OG2A 5IC4A 3FFXA 2NTEA 3AZQA 1E0SA 4W9NC 1NBOA 1TEXA 1EFPB 1MKYA 2QA5A 1ZOLA 1JYFA 4A15A 3N3BC 1PEKE 3EBOA 3OOHA 3VTFA 3H1BA 4B6QA 4K6OA 4RVCA 1M2EA 4YAKA 1ZR2A 3TLYA 3QBVA 4YJ2A 3DCYA 1GU7A 1JL3A 4D92A 5A4IS 5A9RA 1EP1B 4IW3B 2A0KA 4UKDA 1NXSA 5CDFA 3RTEA 3FMIA 3KV3O 1FXWF 1IB0A 4RLSA 4A6XA 2X15A 1KZ7B 4HDQB 1ZJJA 5KNBA 1VPWA 2I8AA 2BGIA 1T8TA 2XGGA 3QQPA 1FPMA 4OM7A 4QBFA 1TIKA 1ID8A 1E5DA 4CM8A 4JBXA 3THXB 4DBVO 3S68A 1XRRA 1QK3A 4XGQA 4BZWA 4PRLA 3H4VA 2KM1A 2EFDB 1TGVA 1QCDA 3GLSA 1FTNA 3B82A 2PKCA 4YUXA 5JMTA 4QO8A 4EGJA 5JWOA 2QLFA 4IM7A 4F4IA 2J5RA 4J0DA 4IPTA 2R8EA 5K0CA 1X1RA 2C5FA 2IVZA 4DA4A 4RVUA 1QBGA 3RC1A 1B15A 2VPTA 4YK7A 2A9VA 2PRIA 2XW6A 3AOGA 1YJXA 3ELBA 2EYQA 2P8JA 4F9EA 5BSEA 3PLRA 4H7KA 1TYDE 4NARA 1JT2A 3EGIA 3VH4A 3L4EA 3FMFA 4FKMA 4TYYA 3VYRB 3U3ZA 3DD1A 3TEJA 3A04A 5DM60 1IOZA 2SKCA 1XN1A 2ZBGA 2I7TA 3LTNC 5ILQA 1Z6AA 5EJMA 4HATA 2DFPA 1J8MF 2GEVA 1AB5A 1Z6QA 3GUUA 3PD0A 4G6ZA 2WU0A 2ZE8A 3FOAA 4NHEA 4Y6GB 5EIBD 4HVCA 2Z8ZA 1HDZA 2F8TA 4UCQA 4YJFB 3I62A 1RXIA 2H4YA 2DQ4A 3FW1A 1YBHA 3HB1A 3NANA 1NF3A 3M6IA 3O3CA 4MYHA 4I1OA 4HAWA 5JZBA 5EUCA 3RVOA 4JXZA 2G9RA 1BMFA 5BN3B 3HEAA 4JUCA 5J4VA 5CLJA 3V4FA 3LC1O 3WB9A 2ZYAA 4M0MA 3CRRA 4LI3X 2WWTA 4MICA 5J5CA 1K2WA 2TMYA 2X0IA 3H9JA 3PNMA 3R3HA 4EB0A 3OP1A 2WAOA 1PJRA 4ZARA 1HXHA 4TSFD 3UZUA 4S35A 4BJ6A 2OCLA 4LDAA 2C92A 4FMPA 4M9CA 4NJMA 4BLOA 1NFQA 1IEWA 4OQNA 4TMXA 3T7TA 5FORA 3LF2A 4BMPB 4UC0A 2ZRNA 3W8EA 4EB3A 3L07A 2NUPB 1I2ZA 3HV2A 2EZUA 3W5UA 3ODPA 1V3TA 5JE8A 3F3YA 3N2EA 2I8CA 2XTNA 2PUHA 3R77A 2JLRA 4UDOA 1ZIOA 3PKJA 2WIBA 5FTLA 4DMLA 2F1KA 1PWZA 1PQ4A 1U8TA 3AWIA 1E2IA 3JS5A 1J39A 1ZM2A 3P5SA 5AFSA 2XOXA 1M6EX 3CF2A 3JQGB 4C20A 2NYUA 3CVJA 1QIGA 2TMGA 3WLEA 1ZLYA 2OUKA 5CVJA 1OXBB 4IZIA 1YBMA 4XJSA 5K4AA 4L1KA 5JCOA 2HY7A 2FMTA 1WY5A 3G0GA 4YBZA 4ALKA 1CS0B 4J1NA 4IOKA 4CU2A 5KVQA 2JPDA 5B58C 1KVQA 4J03A 4D98A 4AKIA 1R0ZA 2ZT7A 3AUSA 3UXHA 4LQ4A 3F3KA 3E18A 1OZGA 5CVVA 4CWAA 2QK4A 3JQAB 1N6LA 3QXXA 1TM2A 4ZT2A 1P1FA 2PZEA 1OJ7A 4DCUA 4GZLA 4MDEA 1A9OA 4MKHA 4DR2B 2CCJA 4PN7A 4FGWA 5JSZA 4F1JA 1DEXA 2BD0A 5JCPA 5ALTA 5AJTA 5I7WA 5E7IA 2VRNA 3N0RA 1KIAA 2R6JA 5H80A 2COKA 5JZ9A 1KVSA 4WNAB 5T3YA 2HIAA 4C04A 2ANBA 3QF4B 3M6WA 1DLJA 1RKQA 1U5BB 4KRYA 1U81A 4PCLA 3O6VA 2X0KA 4IXTA 2I4IA 4RZ3A 4JASB 5KWJA 4YEDA 1EXVA 2FQ1A 1P7PA 1ZUHA 1G4HA 1WE2A 2C0PA 2VBCA 4JYPA 4Q01A 4BQRA 4DAEA 1L5FA 5AVWA 2IEGA 1CEEA 3HJAA 4IHJF 3ZH2A 2HEIA 1LLFA 2VDQB 4JI6B 5C37A 4DRXA 1ZH0A 1OILA 1AZLA 2OV3A 3GT3A 4ZPXA 5KREA 1PN3A 4XPIB 5IARA 1VIMA 1C14A 1GRRA 4Y30A 1T1IA 1GAWA 5FBQB 3TD2A 1QGOA 2R8YA 2BW0A 4X91A 4D3ZA 2D6FA 4NOJA 3AEQA 4KGDA 4B71A 3TKYA 4MVXA 4L2IB 3G0DA 1KAEA 1AKEA 4JI3B 4ZT5A 4CMCA 2HLHA 4OU5A 3UG7A 2QQFA 4KH1A 3AH8A 2FZGA 1V7QA 1C30A 4HNVA 2DAPA 4FHZA 3EFEA 4JI1B 5ITZB 2ZUDA 4ME6A 1YJ5A 2GNPA 4RY9A 2XD4A 3NHSA 4TQAA 5DASA 2CE2X 2WFZA 3R5SA 4JQCA 3SFTA 3KQNA 4IBOA 3GLIA 2QZJA 3LNCA 5CLHA 4CLOB 1KMCA 1UKVY 2QD1A 3ORFA 1FP4A 5BYAA 1IH8A 3I76A 2VHZA 1QYXA 3B7WA 1X7YB 3MB8A 2R5FA 4GPTA 4PW0A 5REQB 3WK6A 5B2FA 4XWKA 1ORVA 1KETA 1D1TA 4KKXB 4TGLA 1R64A 1R0LA 2VCYA 3GBPA 4I14A 1JUDA 4QG7A 2E4UA 2RJOA 3CH6A 1QHNA 2GAFA 1FLNA 5C34B 1R27A 2PVSA 5D87A 5TJ9A 3WLKX 3QIVA 1FSPA 5FL3A 4O0MA 1F0KA 4ZO9A 3UWSA 1Q0LA 2G9VA 2JGLA 3V8PA 3W5DA 3DOEA 5A71A 2XKJE 4N18A 1L4MA 9LDBA 3T12A 4UE6A 3T61A 2V0GA 2Q4OA 4QYWA 3ZWDA 2P3OA 1NNSA 3GUCA 2HPVA 1KK1A 1FUUA 3EVDA 3O1IC 1JW9B 1J70A 4KDEA 4QARA 1G3IA 1SCAA 4EK9A 4IOLA 3WL4A 1POWA 1N1MA 1VJ5A 3KUCA 3G89A 1PEAA 3WS7A 1OV6A 4GSKA 1N75A 1U1CA 1JEJA 5EP3A 4GLLA 1EVIA 4E5MA 4C4AA 5HUJA 4O2AF 1XZLA 3CQ9A 3FHOA 4PC1A 1N7GA 4N5IX 5LLDA 3GUVA 5LVAA 1T35A 3I09A 2E85A 3GFGA 2FPPA 3ANMA 3AXTA 4ZCSA 2WJAA 2EL9A 4BO7A 5BQOA 3MBKA 5JOQA 1ZAYA 2LR0A 4C29A 4AICA 3BFPA 1HH4A 4B5KA 4UHEA 3BWBA 5BWOA 1NC1A 2I1QA 1KVTA 2B78A 4C9BA 4RD3A 4YJDA 2WKSA 2EWMA 3VZPA 3S2EA 4D9GA 3NXSA 1A2QA 5FWYB 2D59A 1UPXA 2G9QA 1YH3A 1W5FA 1T9CA 2C2ZA 4IIJB 1X0VA 5ES3A 3TAXA 1Y34E 2BM0A 5F3RA 4Z9XA 4IDAA 4CM1A 1XMJA 4BNFA 1NN5A 3S2IA 1UBMS 4M98A 4PTZA 3OWHA 4ND6A 2FZEA 5DPMA 2WYHA 3B1YA 1ZESA 2OB1A 4BWGA 4C0LA 4CQLB 2UYHA 1X7WA 1VBMA 1O94C 1EQUA 2IE8A 2MSKA 2ZKLA 1VE6A 1AXGA 1G5RA 1YVUA 1NJSA 2Y2VA 3WKCA 4F8YA 3MGBA 3ZX4A 1ZHFA 3GGOA 3IELA 4K6FA 5KOIA 2Z09A 4CHGA 1M5UA 5KSPA 1V5WA 1DG1G 4X6YA 4XWYA 4U1RA 5SZHB 3DPSA 3DTVB 1WRBA 3V80A 4I3FA 3GCDA 2YWBA 4G1FA 2IY9A 1E1QA 3A4MA 4C7KA 4YALA 5EJGA 3WL5A 2A9KA 2QF7A 1UK9A 1UIMA 3FA2A 3V8NA 4EJMA 3CBQA 1Z6ZA 2NYAA 2AW5A 3WWCA 3WGMA 4N8SA 2EKDA 1DRKA 2QVLA 2RHWA 1ECCA 4FYVA 2Y0BA 5B37A 5LQDA 3LJKA 3TW6A 2ZTUA 5KSZA 3OCUA 3PEFA 3REQA 2JI6A 3ILYA 1OX6A 1X87A 1JJVA 3RWMB 1U3WA 3UJHA 3QLUC 2QXUA 4M87A 4TM8A 1GEEA 1ESMA 4XA8A 1UBKS 4Q02A 4F3YA 1T5TA 5ALSA 2W2KB 2BHRA 3OQ6A 4EG3A 2H7YA 5AQEA 2FMIA 4AQDA 4BKPA 1O57A 2PAAA 2WTNA 3O1HB 4PYMA 5KWSA 5KQRA 5A5FA 5D5QA 1I7SB 3H19A 1JT9A 3SP1A 3GT4A 1GZVA 1RXEA 4LZZA 2YVLA 3D81A 2E82A 1GGKA 3NJRA 2IHUA 2OD9A 4MUAA 3U5TA 3MS7A 1NV8A 2Z1MA 2ZYDA 3D0QA 1E3QA 4K3VA 4GVLA 3LUJA 3AY7A 2HK7A 3TZBA 3N9IA 3AEKA 1WU7A 3O9MA 2JIOA 1MP0A 5AW1A 1C1XA 2DR0A 3WTCA 5KNBH 5A5VA 1GZUA 5FJJA 1WXWA 3F90A 2B0CA 3FNIA 5AWFC 2J7PA 3UXYA 2I87A 1T36B 3C43A 4EY8A 1PP4A 1RXCA 4AN4A 3CSDA 1PLKA 2OKGA 2VFAA 2ZWPA 3I92A 3ZXUB 1JQKA 521PA 3PX7A 1RJDA 1RHJA 3OEHD 3R4VA 2HQBA 1YB7A 3WGKA 1IPEA 1SB8A 2L69A 1LX6A 3OTQA 4QOEA 2FZ4A 2OHXA 3DP9A 3FBTA 4XTCS 5DFAA 2HCJB 2IODA 4XIYA 3OHPA 1PT9A 3AUTA 5DRTA 4U9UA 1G55A 1WNTA 5HKKD 1NXOA 5K6RA 1FJHA 2C5EA 2VTBB 5LMUB 4DN6A 3NIFB 3TPZA 3AM5A 1CUWA 1TVEA 2FQYA 3A3KA 3H3JA 2YRWA 2H8KA 1NI4B 3FKJA 3IAXA 3EIOA 1ZJZA 2Q2VA 4QOIA 4G2NA 3ORSA 4GSYA 1K6JA 4I55A 1CUVA 1VZ2A 2Z3ZA 1BKSB 1LJUA 3R1IA 4S1OA 1DAPA 4YRDA 4HWOA 3L0YA 1LBIA 3QYJA 1QAMA 1RRMA 1IY2A 1F8UA 1HDCA 3H8WA 4LX8A 3V1NA 2O8FB 1X38A 2BFCA 4N82A 5FT9A 2VP2A 1N32B 1FS6A 3VSEA 1VKOA 4U6SA 3ROKA 2P2LA 1BCRA 2VPWA 3A6EA 4UCXA 4C0BA 4KITB 3MTBA 3WYFA 4YR7A 4F46A 4YYEA 1SHKA 3FMVA 1PFWA 4KTTE 3RIEA 1YIOA 5JYEA 5A0TA 2DCUA 4PG5A 1XCMA 1Q1BA 4HSGA 3STVA 4IHJA 3ZHQA 2WWGA 4UM7A 2XMCA 2I71A 2WF8A 4M2LA 1O97D 1IWOA 1QQTA 4JYCA 1RZ3A 4QM7A 2FXVA 3DHNA 3G0BA 1E66A 4HB0A 4ZC1A 4CM3A 4QATA 1CDDA 2QEQA 1EUQA 1ZD5A 3MG9A 4GG1A 3ZGVA 5I4KA 1UPAA 2C7OA 4R3UC 2VOEA 3A05A 2JJ2A 2O2ZA 2RGEA 2H5IA 2ZUUA 3DZBA 3IVGA 3MFYA 3WY9A 4A2WA 2ZR7A 3NRCA 1GRCA 4RANA 4WK6A 2M9MA 2O2EA 1F38A 2HKIA 2ZB4A 3A58B 2R97A 4E33A 4NXNB 3WGIA 4R31A 1KIMA 1EDEA 1IDN1 2A9PA 1EJ2A 4G5XA 4PG4A 1L5YA 5CTAA 2OFXA 5DH9A 1T8YA 3U31A 2Q45A 3EZ7A 3ZXIA 3M6MD 1L9XA 1HFEL 2SCUA 5DM0A 2L82A 1I4WA 3IBYA 2RGDA 4JBWA 4KPYA 4DDTA 4AJ9A 1T26A 2Q5HA 2WDPA 1LWNA 1GUAA 1PFVA 1SVOA 2ZI4A 3SAJA 1CQJA 4CKXA 2NZJA 1QZUA 3BA1A 5LP6A 3F0TA 3F6SA 2RGRA 2OZPA 3T0FA 1CFZA 4DG9A 5KWEA 1F0YA 4LNUA 4Q21A 1NKTA 3A9RA 2VHYA 2IS4A 4YH1A 1AT1A 1GUFA 2OOKA 4OG2A 4YUVA 1PDVA 2ZI7A 3PGJA 3LSTA 4PO3X 1GZHB 3MUEA 1O95D 2QIOA 3OPNA 4U2KA 2UUCB 1PV1A 3P27A 1WW8A 2MYTA 2BFNA 4TWBA 2BMDA 1NFFA 2PBZA 3L79A 3R7BA 1SBZA 4KL8S 3O4GA 4NCIA 3FH0A 5AXAA 3UOAB 5JO0A 4IMJB 1EEXB 1YRHA 2QRLA 4OQYA 3QELB 5F1YA 2QB5A 5REQA 5BV7A 1ILEA 2ZIUB 2ZWMA 2G9ZA 3P9CA 1IUPA 4NZMA 4F92B 3KALA 3PR3A 4B6EA 1RWQA 4JBHA 5UKDA 4M0KA 1WJGA 1F20A 1VMAA 2C4KA 1GGMA 2G04A 3H4TA 2WNIA 4CT0A 2NQ8A 5DCYA 3WZMA 1O9BA 3C6KA 2WIJA 3PD7A 4IIVA 4MQ5A 5EE9A 4C0KA 2VWPA 4C22A 3JARA 4ENPA 1THGA 2GX6A 3D8RA 1ZZGA 5EZ5A 1ECJA 2XX3A 1AQLA 3LCRA 4OAOA 1UBTS 2UZIR 3JQDA 3NC4A 3DOJA 3T7JA 4I4CA 1I24A 2JFWA 2VSNA 1MXHA 4WBNA 1DTWB 1MLDA 1JTEA 1PJLA 4X0EA 1KY2A 4PG8A 3IVMA 3EVBA 2UZ1A 3QNUA 1KH1A 3BMNA 3R4CA 5BOVA 4BE9A 5KNLA 2AR0A 2XZPA 1SBNE 3RIGA 2P9JA 4IUYA 3L6RA 3WDMA 2JGRA 3CW9A 3DPUA 2KLHA 2Z56A 1U98A 3HO8A 1E6UA 3BVPA 3LQ1A 1YAJA 2XCIA 3TZLA 5DGTA 3ZDXB 5A3SA 2NQ2C 4PANA 1M8GA 3AHDA 5IKPA 1FBNA 4WLNA 2XGSA 3IR5A 4P0QB 4PNEA 4ZQEA 4Z1MA 5JAIA 3OHMA 4KRGA 4UFNA 2A5LA 3W2EA 2MSDB 2ZLBA 3IKTA 2OC4A 3DC2A 5EZQA 2Q8PA 4OMDA 3DM5A 2CE7A 3S7ZA 4O4HB 1XVAA 4US1R 3U16A 3T1YB 3DOIA 3OQJA 3FHLA 3FRHA 2N46A 4HN2A 4HDSB 3VHQA 4TQGA 4EYGA 1V16A 2IZ1A 1TU0A 4NU6A 5EKDA 2JFOA 5T8KA 2F4VB 2HOQA 1MB4A 3GO4A 5TMEA 3DEYX 1O03A 3G82C 4KOEC 4Q3LA 4UCFA 2CV0A 3MB5A 4GPIB 4WUVA 5HQ3A 3EDMA 3OCZA 4B48A 3CV3A 4YJ3A 2VF5X 5BUZA 3HGTA 1YB2A 4N5LA 2GPYA 1KE2A 3LFUA 4BNKA 2ZKIA 2GARA 4F93B 1KI8A 1FYDA 1XOIA 4HEHA 3O8RA 3A4YA 3P0FA 5BMVB 3L6EA 2RAFA 3AHJA 3ZIUA 5TARA 3LSYA 2M98A 3RE1A 1KVUA 1SPBS 3LBHA 4OHFA 4CKEB 1USUA 1KC1A 1YB6A 4ZRDA 4B81A 5FPQA 4DANA 4JJ4A 4TQUS 1UXHA 1G1MA 2WF5A 1F0PA 3IPLA 4DNXA 5EKSA 4TTIA 2FG7C 5IHPA 4FZVA 5BR7A 1ZA2A 1WDMA 5HTKA 3IO3A 3LX6A 2VXBA 1RABA 1JJ7A 1SK9A 1U2QA 1DAFA 3F1KA 3KPWA 1O87A 4FFRA 3QUBA 2IXAA 4HWKA 4R1LA 5E7QA 3A6GA 3FTFA 2F1OA 2HGSA 4KQGA 4HG2A 3TRIA 3W3AH 1XPOA 1DJNA 1I33A 5FOTA 2ZU6A 4UHDA 4CCSA 4CUKA 3KZKA 4EUEA 3LP8A 3A1TA 2IOFK 4O4HF 1M2KA 3TZHA 2BE7A 4QKQA 1E2EA 3HDVA 1YFJA 4YMGA 2QN8A 1QE3A 2F9LA 5CHYA 5E6RA 2WSIA 3OLVA 5BYJA 4C3OB 1PE0A 4P0TA 4RPHA 4ZQBA 5ECDA 3W5IA 2YV1A 5JG7A 1DKUA 2MR6A 3DAPA 4UCWA 4BVFA 1S2GA 5CT5A 4G1CA 2B4RO 3TMYA 1K3FA 3V1MA 2F64A 3ENWA 3PFCA 3OIFA 2UXCB 2VUUA 4RFVA 1N2XA 1E2GA 2PK3A 2BH9A 1N0VC 2PSJA 2YXBA 4JMLA 4RVFA 1BSVA 2KJQA 4H6VA 2YFQA 1GNQA 2BHNA 1RC0A 2YOFA 5AKGA 2AC7A 5F98A 1XXHE 2YZ2A 5LDHA 1OSNA 2QD2A 3L0OA 3PF8A 1JDPA 2AXPA 2HWWA 3QHAA 3ZE9A 4BB0A 4ZK6A 2MT9A 3GLGB 1KI7A 2QSUA 2WDZA 2QUIA 3NM5A 3QPCA 1CUJA 4QQRA 3SX0A 5IULC 2WTAA 3ANNA 1B3BA 1KFJB 2BI4A 3Q3CA 4RE6A 4WESA 3MGAA 3U4MA 4M54A 4NHOA 4TTTS 2AC4A 2XUJA 5I7AA 1MGPA 3M4YA 1DIAA 4FFDA 3SNKA 4E6EA 2CL5A 1QF6A 2QW0X 2XGJA 4PC6A 1U2SA 4MWEA 3CBGA 2GERA 2BR4A 3CTPA 1IN1A 4ICIA 4M60A 1Q50A 3PDIB 1JXMA 4PQFA 4R2XA 1FMCA 2DE0X 2FQQA 3IDOA 3LVFO 2JK0A 1N1EA 3DHWC 1B23P 1PQWA 3MQFA 4JJ6A 4MUHA 3T3NA 2QAIA 3RT9A 3G7UA 1A9RA 1QPGA 5JNLA 2HQRA 3LOPA 4GLBA 4OXNA 1T24A 5KVCA 3GFFA 1W0CA 4R0VA 1CF4A 2SICE 1ATIA 1T1GA 3SU8A 2ES4A 2VRCD 2ZJAA 2BFCB 3MMPA 3NDJA 4MPTA 1N1GA 2FWRA 1IZZA 2R7AA 4R9NA 1J1IA 1NYQA 4X3PA 3FOBA 1SCJA 2QL9A 3WDKA 2BN4A 4Y0NA 1AO3A 1GNPA 1VHLA 1FRQA 3X1JA 1CUBA 4V0KA 3DOUA 1VG0B 2CYCA 3AHGA 3FTQA 3OEWA 4G81A 4ND5A 4CDMA 4FEAA 4JP2A 2W2XA 3HFGA 3NRBA 2AJCA 1WTAA 3OQVA 4IHJB 4GM4A 5JUWA 1SUIA 3D4NA 1YFLA 1IK4A 3OZUA 1BW9B 3F9IA 4QA9A 2B34A 3IR7A 4LHYA 1KRWA 5LJLA 3X2FA 1YF3A 1JQ5A 4JXJA 4MJ7A 2PWZA 3WB2A 3KD3A 8LDHA 4CIAA 1SU4A 5L8VA 1SBYA 2Y1XA 1T9KA 3CNOA 3ELDA 3I01A 4BKOA 5M29A 3IAS1 3NDBB 1XG5A 2IZZA 1Y3BE 3V8QA 2H3HA 1WTCA 2FE1A 1R0SA 1R9NA 1E4EA 4DXHA 4DKXA 3IMEA 3FLBA 3KOUA 2PZMA 4RS3A 1XRSB 3U44B 4A8JC 3TJMA 4IIXA 1SH7A 1F2VA 2JAPA 1V8PA 3KHUA 4N7JA 4YRJA 4CF3A 4ZCMA 4CM4A 1W4ZA 2QRMA 5HQ3B 1ZK1A 1QCCA 1WQ4A 2BTQA 1ZHOA 1LBQA 3MGCA 5FL7D 3FY4A 3BFKA 3GI1A 5ANRB 5EXXA 5D84A 3T7SA 4QAJA 3WGJA 5HJEA 3QV1A 4YAUA 2VYCA 3LKBA 4Y2PA 2WZBA 3T3GA 1BXZA 1GPAA 2AEEA 4EGCB 3CZAA 1F60A 1ZNWA 1M34A 4B6FA 1PRYA 1TAQA 1NZDA 4NJOA 1NN0A 4DSAA 1HEUA 3JZDA 4QSMA 3T3DA 2HUPA 1MW8X 1W48A 4NBTA 4TLCA 3AEYA 4S3MA 1Q3HA 3IJRA 3LHDA 4EABA 2B4QA 3LCMA 2Q3LA 4F91B 3NOQA 2WIAA 1HE2A 5DMXA 2O8CB 4X85A 3WGGA 2VDLB 2OGWA 3B1ZA 3JQRA 3IUYA 4MLZA 3ZNNA 4EG5A 5FYDA 1N33B 3H7IA 3DLCA 3HSSA 4N6OA 1ZD8A 4GZ5A 4YT5A 3SDZA 2V9PA 3HBFA 4PLPA 3WMRA 4BV8A 1NA5A 2IIQA 3HXPA 4CIXA 1MRZA 1HDIA 2W98A 4AZSA 4HFMA 4CKBA 3CC8A 3WRYA 3ONFA 1JEYB 2QUKA 2VJOA 3O4VA 2IWRA 4Q3DA 2A8YA 3WI7A 5GONA 1PK8A 3IRVA 5KOHA 3DV9A 1RI2A 2I34A 3S55A 4HMOA 4J2HA 4NZNA 2BHTA 3WWDA 2HBQA 2FX5A 2IQ5A 4LOLA 4MV3A 1YSCA 1JFTA 4QVIA 2C98A 4F5EA 4DR4B 4XQGA 5ESWA 3KOWA 4Y7CA 1MVOA 3FIJA 3OE7A 2BE9A 3H8VA 4QGAA 4C0XA 3IP6A 1DTWA 3L8GA 4W7IA 3Q3VA 4WGFA 1KF0A 4J1TC 4U2DA 1SXHA 5DV9A 3M2PA 4W5TA 4HS4A 3MOIA 1J0CA 2ZI6A 2CCGA 3P9KA 7REQB 2EGUA 1AV7A 4EJ2A 4F0JA 1UBLS 4HK4A 1KFEB 4ON9A 2C2KA 3EC1A 2HB6A 4HXGA 3UAOA 3V48A 2XF2A 3ZWYA 3PNKA 2ADOA 3SYNA 4S0ZA 4NC9A 1PGQA 4C0AC 1FNMA 5J43A 3WK9A 2FWMX 4INAA 4LDQA 2LV8A 4RLFA 3GPCA 7MDHA 3MLBA 1JI0A 2BM8A 3KYJB 5C4IA 5F5LA 3S2GA 4HDKB 1B26A 2FEKA 1KDPA 3TR5A 3CYFA 2EIHA 3Q7IA 2I5PO 1I9CA 4BNVA 1LC3A 5IK2A 5AM0A 2ZWOA 3V7FA 1XP8A 4QGSA 5IJ9B 1XLTC 2PLWA 4BUCA 4GX0A 1U2RA 2I65A 2P27A 3V8VA 1XZQA 2OXCA 3CONA 4EG4A 1U6KA 4UOEA 3KJHA 3HFRA 2XB6A 2HF8A 3B7PA 3L1IA 3TLAA 1FFSA 4MTLA 3KC2A 4F7WA 3DZKA 2QV7A 3DGFC 4DSOA 3PUVA 4WEQA 2GJ4A 2W90A 3Q3IA 3WLTA 4HF7A 1QIEA 1R0XA 3R5TA 3E8XA 4X71A 3LOUA 5B7NA 2E49A 3ZY5A 5DSZA 3H16A 4TLMB 2PV7A 5BMVA 1IYZA 2EVWX 3VKGA 4BO3A 1ZXBA 3N8KA 4HNRA 5TC4A 3UV6A 1Q84A 2CLCX 5EE0A 1WBBA 4HGNA 1SUAA 1GZSA 2OVBA 1GITA 2VQ6A 3D6UA 2PZGA 2WM2A 2GBFA 5E3IA 2FUG6 4TYMA 2PWAA 4WJKB 5DYTA 2P0YA 1N6OA 3GCZA 1YDMA 1M3SA 2QZ9A 1E79D 4M1MA 1O8CA 4CFYA 2BH2A 3GGPA 3NBYC 2PKXA 2OSBA 4HB4A 3P5BA 4PX9A 3H1TA 5FNVB 3A6ZA 3L4KA 5DJ5A 2EP5A 3ASZA 3MRVA 4R40A 3BAZA 4TMWA 1IRIA 5K4GA 5IANA 4JP3A 1D09A 1YZKA 4G1BA 2PMDA 4GBMA 4GMGA 1GPMA 5EYPB 5KBYA 1RNLA 5I7FA 4NRDA 3I42A 2FFBA 2SBTA 1DWOA 1C7EA 2F17A 4P9NA 1GT91 2PU7A 2AXNA 3ZVRA 1KPIA 1XZFA 4GKVA 4HYEA 1VHDA 4ZVMA 4KC0A 3DVSX 1HBJA 2NU6B 1ZM3A 1S2DA 3ABSB 1BQ4A 3CNBA 3F4LA 3EOAI 3O7MA 1DPGA 3ZBUA 1GD1O 5TPZA 1RFGE 1VECA 2WW8A 1FTGA 1ZHHA 2IY7A 1K7SN 3W2TA 2N0SA 4O4JB 4INZA 4DNOA 2F55A 3BZWA 2BGMA 1G8FA 3NRJA 3PYLA 4IDQA 4NONA 1CY0A 2O5RA 4DIEA 3I6IA 1QP7A 2ZPUA 3KQTA 1C3LA 2C0CA 4FYIA 1UIRA 3Q8KA 1XWWA 1G3UA 3QUAA 1L5WA 4TVSA 1U8ZA 1L8OA 2J45A 4P3PA 5JWRA 3OFSA 1QVWA 1NNI1 2PMCA 3GMDA 1W87A 2F90A 2ZDHA 2V4UA 2ZAYA 2R47A 2IITA 4UEKA 1DBQA 1Y3HA 2CFTA 1ADFA 2WJVA 4O2RA 1U8XX 4DJTA 1NBMA 1ZDMA 2ZR0A 4LF9B 3RK0A 1QLWA 4WZAE 1FS5A 3PUYA 5JD4A 2GBCA 1J5XA 3KR0A 4RZIA 5CT9A 4KVAA 1LK5A 1AGRA 3W77A 4D9IA 3OPYB 1BWRA 4KE9A 2YOGA 3DDSA 3A6KA 3DZDA 3LGAA 4RZSA 4WACA 1ZJYA 3OY2A 5KYVA 4YCCA 2GUGA 4DNQA 4RAQA 2NT4A 1KXZA 1RJEA 1L7QA 3MCZA 1IG0A 2CVPA 3FF1A 3HCPA 3QLEA 5F78A 4D3FA 3ABZA 4LYJA 1PZGA 4LW8A 4BZZA 1ZU5A 1EE2A 3G13A 2A5GA 4RM2A 3SI7A 3U48A 2WMDA 4WLOA 3RH0A 5BOSA 4KOAA 4D97A 3BSWA 1QYRA 4M8LA 3F46A 5HUQA 3K96A 2PR7A 4IDEA 1ADGA 1ESZA 2P41A 2QI9F 2BLNA 2R8OA 3BTVA 1OX4B 4G26A 2PL3A 4YECA 2IZ6A 5AW3A 4G0VA 4CNBA 5CA1F 4RQTA 1XNGA 1E4YA 2BFEB 1J23A 4NE2A 3MT0A 4ZOEA 5CURA 4DARA 2Q5QA 2YR0A 1OI7A 1VHJA 1XQ1A 3GRUA 3EDYA 2QTLA 3N7AA 1QR6A 4EATA 3LPCA 2WNHA 3N8DA 4Q1FA 3BD9A 3C70A 2OXRA 2XCQA 5ARBA 1KYZA 3QPVA 1CIJA 1H2FA 3N75A 1DCFA 4JEHA 3TZEA 1CUHA 1W5TA 5FTNA 3D4LA 2L2QA 1WDKA 3KSAC 5M34A 2O48X 1V47A 3ZNPA 1E2LA 1TFRA 2OHVA 1CZHA 1DZ3A 2QGFA 5JD3A 4JJZA 5DTJA 3TRHA 3U0VA 2F62A 5ETJA 4KAJA 1BDJA 4BP9A 4REOA 2VDJA 2W6ID 2QTFA 3PNYA 2DETA 1ODFA 4DLRA 1BW9A 4F38A 4PPQA 3AHHA 1O97C 2Q3JA 4F9GA 4YDQA 4PYOA 1UWKA 2ZZNA 4MVCA 3NHJA 3UJ8A 1C7FA 5EJ6A 3LW8A 4BDTA 3TNYA 1M66A 1PX0A 3HWX1 1DZIA 3DJYA 3HDJA 3HXTA 5A1JA 5DGDA 4BBJA 2AGVA 5B3LA 3C3MA 1ZNQO 1CJCA 2HMYB 2KQUA 3E5NA 4LXTA 1CB0A 3QPAA 2IXBA 4E2ZA 3UWMA 1PR0A 2FZ5A 4QHTA 1IMOA 1G8HA 2I4LA 2XOEA 4MV1A 3IT0A 2R48A 3BCHA 1XNJA 4QDJA 1PQYA 1ZGGA 3I12A 5E8JA 1KAGA 2PT6A 3NT2A 4BMSA 1HETA 2X40A 2YN2A 3BS4A 4A0HA 4C5AA 3VHXA 4D81A 3ZU5A 2H08A 1XD2B 5CVUA 5SYMA 1RM4A 4GGMX 3K92A 3VPHA 1IVYA 2X1HA 1JG6A 2P79A 1T2FA 2NAPA 3CKMA 1PNRA 1H2ZA 1ICEA 1M6WA 1XRLA 1Y48E 1SVSA 1AX9A 1DI0A 4M46A 4IVQA 4EFDA 4OVKA 1CP3A 3OCWA 4Y9RA 5I7RA 2F59A 3NBQA 4Z7JA 1S96A 1R6UA 1KR5A 3JD4A 5HIIA 1YB4A 2BJVA