3BB4A

Crystal structure of toc33 from arabidopsis thaliana in complex with mg2+ and gmppnp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
240
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDELLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 78
structure length 240
sequence length 244
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb4A00
4LJ9A 1U9IA 2WOJA 2PMDA 1Q57A 5E7IA 3KDSE 4RJLA 2J0QA 3FFAA 1X8KA 5K8TA 1PUJA 4G5QA 4MYTA 3LA6A 4RSGA 4RCZA 4JYCA 1P9RA 1YRAA 1Z47A 4PHHA 1TTTA 1KYIA 2ZETA 2VP4A 3OF5A 3QF4A 5J4KA 3THOA 1XTSA 4JBYA 3SHFA 3GLGA 4LJ8A 1E9AA 4HI0E 2CXXA 1XXHE 4QGHA 4WZAE 1JXOA 521PA 1PLLA 3U6BA 2EYUA 5GJVC 2WBLC 2NTYC 3PUZA 3G82C 1O87A 1GRNA 2ECKA 5L3QB 1XXHB 4ACAA 1JPNA 4IDHA 2YJTD 1UPTA 5A5GA 1X8LA 2XOKD 4MKFA 4EUNA 2HXYA 4JYBA 4Q01A 1SULA 4BWYA 3U4QB 4BLQA 1LFDB 4Q7KA 3GJ6A 3NBZC 1F2TA 1GDDA 2OEPA 4PAMA 2ZQ5A 2Q6TA 4M4SA 4KLNA 3CRQA 2NIPA 4PFSA 4TLAA 3GFOA 2QAGC 2J3EA 2ZSDA 3LW7A 2IYWA 2ZJZA 3QNUA 5JHHB 4ZIRB 3EZ9A 3EC1A 2D7CA 2BBSA 2BMJA 4ERNA 2ZRIA 2LKDA 4B3FX 2X2FA 3THYB 4JSTA 3DPUA 1E2IA 1UDWA 4AKIA 2NMVA 2G77B 4R9UC 5KSYA 4JLAA 1G6HA 2H16A 1ANKA 5C4GB 3LNCA 4MDFA 2VEDA 5TB5A 3PEWA 1E9DA 1G20E 3NH9A 3K0CA 1CJVC 1M34E 3H0KA 2F9LA 5EJEA 1S4QA 2I3BA 2ERYA 4X8LA 3SJBA 1D5CA 4TYNA 4A8JA 2WKPA 4L4UA 1R2QA 1ZRHA 1XB2A 4Q4LA 4BFSA 4TL8A 2YHSA 5E3HA 5KPDA 1IY1A 4PHFA 5IK2A 1Z08A 1M7BA 3JZMA 2F6RA 3K9GA 3C7KA 1SQ5A 2QEQA 4FN5A 5DISB 5HCIA 2GAAA 3SYKA 3UMRA 2VRWA 3B6EA 3CRRA 2VHQA 2OCAA 5FOXA 2FV8A 3MMPA 2HT6A 1R5NA 3I72A 1YJ5A 3W5IA 1E2LA 3CONA 3BS4A 3HYRA 3KJIA 3PEVA 4JJKA 1G3QA 4MRVA 1T3SA 3AVYA 3I8XA 3BD9A 4PO1A 2FPKA 2ZSBA 2O52A 4LCBA 3BIFA 1D8TA 2WJGA 3V00A 3L82B 4U00A 4BECA 1DADA 1XEWX 2IHYA 4Q1FA 4D80A 5KO2A 3UMFA 1YZTA 4WW0A 5JSZA 3ZD7A 1S9HA 3D31A 1II9A 3MG9A 5FTKA 1CXZA 5DGXA 5FOTA 3H2YA 1E2MA 4CEJA 3GP8A 2QMEA 4TMZA 3E1SA 2Z0MA 3T1QA 4NONA 3A4NA 5A4JA 2WWGA 2G0TA 3OEHD 5CYOA 3S1AB 3EA0A 4B34A 2D2FA 4IVPA 2ZE7A 1G1MA 3SJZA 5IHPA 1U0JA 4PHTA 2XNSA 1DS6A 4D4KA 5LB2A 2R62A 3TUIC 5B2ZA 1UKZA 2GBLC 1ESNA 5L3SA 4AD8A 2ZRPA 1AS0A 1NVVQ 1GKYA 3R8FA 3RSLA 1XRJA 3SJAA 3WMGA 1CRQA 2O8DB 2P5SA 3LXRA 4IDQA 2PJRA 2JGNA 3GEHA 4DHEA 4D25A 2J45A 1OHHD 1TNDA 4DUGA 2QRNA 2DWOA 1BH2A 1Q3HA 1ZCBA 2ZR0A 2PEZA 2KBFA 3R7WA 2HXSA 2F7SA 2BMDA 2GKSA 4NPHA 3W34A 3NEJA 2WPDD 2DBYA 3ND9A 1R0XA 2BEKA 1KI4A 1T8UA 4N0DA 4LSGA 3KXIA 2IEYA 5DSZA 2JLYA 4FI3C 1G7SA 1N6OA 1VCMA 1FX0B 1YRBA 2R8RA 2ZAMA 2XX3A 3EW9A 3TAUA 2BM1A 1CIPA 1KI9A 4RD3A 1KJWA 2HYDA 5FTLA 3ZVNA 2NO0A 4PZZA 3KXKA 2DFLA 3BORA 3RYTC 2FFBA 3CKLA 3F3YA 1M2OB 3ZZTA 1RYHA 1KGDA 1W48A 2VBCA 1CP2A 1JJ7A 4ZCMA 1BMFA 2ZYWX 4GP7A 2XB4A 5CLLA 1ZUNB 2BM0A 3A1WA 4JLMA 4TQUS 3UK6A 3X1DA 2F55A 2WVJA 1T6NA 4A0HA 4PXAA 4FCTA 1N5JA 1ZU5A 2Q3HA 4URYR 2QQ0A 2FEMA 3ZLJA 1CTQA 1XBTA 3U5ZB 4CEIA 2V7QD 1W49A 2A78A 2R44A 4NYIQ 1M74A 4QNMA 1NN3A 2GZAA 3LRPA 4E07A 2HDNB 4RKFA 3HR7A 4M9QA 1XEWY 2BBTA 2IC5A 5DE3A 2RH5A 4Q1AA 3CM0A 5FOUA 1WF3A 1ZVQA 2X19A 2XSZA 3AVVA 2EU8A 2QORA 4B3CA 3U60B 4PHGA 2CCGA 4QJ5A 3ZIAA 3TBKA 4PPGA 4L8GA 1JB1A 4PTLA 4CW7A 2CJWB 2O0HA 2GETA 3L0SA 4XTCS 1KOFA 3IPYA 4CZ2A 4LJ7A 5CIQA 4B33A 3N70A 2CBZA 1S9DA 3ND8A 5CJ2A 2RGBA 2FEOA 4B44A 3BH0A 4QJ4A 2A3RA 3KXLA 2B8WA 4US1R 3GQBA 3GJ5A 2OBMA 1E1QA 2Q9CA 3WYGA 4ARZA 4XOIA 3VX3A 1MH1A 1EG7A 1NL3A 1W7AA 1W2GA 1YZQA 2C9CA 4IDNA 5BQ5A 1E2FA 3KTAA 2Q0HA 4J0QA 1WCV1 3KQUA 3WNDA 4WA7A 1MO3A 2GCOA 3B7GA 2BEJA 2FOLA 4IOMA 4NBSA 3OFND 2Z5FA 1KSJA 4TZ0A 2QTHA 2REXB 3KFVA 1YKSA 1E3MA 5FL7A 2FH5B 3EPJA 4KBFA 1XEXA 3N2EA 4NDZA 2GXAA 3B1VA 4CEHB 1US8B 3GJ8A 2AD5A 3RS4A 4BFYA 4TYYA 1XD8A 2AWNA 4URUR 1U81A 1UDXA 1NY6A 3T06B 2ODEA 3ZYCA 4Z1MA 1L4UA 1JPJA 4AKEA 4B74A 3QI2A 1DAHA 2ZJBA 4K8OA 3VR6A 5AJVB 2H8KA 4G5RA 3WP1B 2VSFA 1N0UA 3QXJA 3TGPA 3NBFA 3QY0A 4HYYA 3B1YA 1GTVA 4KVGA 5TVKA 4R7ZA 1U8YA 1Y63A 1NMYA 2EFCB 2FG5A 2E9SA 4OQLA 5JS8A 3DMDA 5FUYA 3CPJB 1E0SA 1R8SA 5KSZA 4GFDA 1GAJA 1GFIA 4QHSA 1ZP6A 2WWIA 1GRQA 4LWZA 3K53A 3K9NA 2IYVA 4HLCA 1ZAKA 1RYFA 1CJUC 2QY9A 1SVOA 1XD2B 2A5FA 3O47A 3QXHA 4CT5A 5EZ6B 3TMKA 5LD2C 1KI7A 4TT3A 3VU9A 4Q1EA 2C95A 2J46A 1CF4A 1KI6A 4GI7A 5EP2A 1P75A 1Z0DA 4K81B 5AJYA 1COWA 4ZDWA 5FPKA 1Z22A 5J4LA 1P2UA 2HYIC 3GMTA 2DB3A 1F6BA 3MSXA 2ASEA 1G7RA 1T0JB 3DVLA 2PEYA 4DLRA 4URWR 3AUYA 1P6XA 1MO6A 2BCJQ 5AUQA 1KK0A 3DL0A 4XVQA 2Z83A 1M7HA 4Q21A 2CHVA 1CR2A 2ATVA 2P6UA 4TTPA 1W36D 3AP3A 5JWRA 2IS6A 2WJVA 3AF4A 4JKYA 4IOKA 2BOVA 2C8VA 3GLHA 3TK1A 3K70D 1S96A 2ZE6A 1OH5A 3PJRA 2CL0X 5TDHA 3AM1A 1E9RA 2RGGA 2D06A 5G3YA 2VL7A 1AIPA 3X2SA 4JLJA 2IYQA 2OILA 2XAUA 4A82A 1K5GA 1B0UA 3B8HA 4I1OA 1GL7A 1IOZA 1E1RA 3C16C 5BN3A 1XCMA 2MSCB 3SI7A 5KPJA 2JEOA 1Z28A 2ZR7A 4URZR 3GLIA 2RGCA 4ZDJA 2ORVA 2RGNA 2W6JA 3WHKA 3P20A 1E2NA 4BPBA 1U8ZA 4PZLA 1DPFA 2OXRA 4XVRA 1MRSA 1FW6A 3OIUA 4F38A 4ZI3A 1AKEA 1YHNA 2MSEB 3OHMA 4EPRA 2G0NA 2EYQA 3C15C 3FFBA 1YQTA 3TNFA 2W0SA 3DMNA 3LDAA 5UKDA 1R6BX 3FKSA 1YE8A 3P27A 5FPSA 2GXUA 2QA5A 1IQPA 2O8EA 1EX7A 4Q4AB 2QU8A 3R9WA 3F0TA 3I61A 4MRSA 3QBTA 4KSCA 1KNQA 4RFSA 3U61B 1H8EA 4FMCF 2BDTA 4BFTA 2NPFA 4NMMA 4YMWA 4AYTA 1WB9A 4BLSA 1OFTA 3U7EB 5KOYA 2OSBA 4B47A 1JXMA 4D81A 1VPLA 1XMJA 5G40A 2AR7A 4PPQA 4EFMA 3JZAA 5F9FA 1Z3IX 4V0LA 5C1BA 3VX4A 2WWWA 1KZ7B 1SXJE 2ZRNA 1GKUB 3PG5A 4QJ3A 3THXB 1G9XA 1W4BA 3LW8A 4ABYA 1YVDA 2LWIA 2R6FA 4LPKA 4FW9A 1SXJB 3E5HA 2O8FA 1W0JD 3I92A 2JDIA 3CX6A 3GJ4A 3ZGXA 4PC3A 1U2RA 3QVUA 1NRJB 2RMKA 5HZKA 1IONA 3T5GA 4A15A 1Z63A 4BZXA 4RD1A 4F93B 3RWMB 1EK0A 4P33A 4DEXA 4BUJA 1G3RA 1ZNWA 2IYRA 1GWNA 3PFIA 1F2UB 2CCJA 3BB3A 1VIYA 2ZANA 5K8UA 3NBYC 3TRFA 2V1UA 1EFTA 3TSWA 4B3GA 1XPOA 3QKRA 3ETLA 2Q9BA 3I32A 1XWIA 3UANA 1K6MA 5P21A 3B60A 3SJCA 3V9PA 4MRPA 4PQRA 4WXPA 1W2HA 4B48A 1W44A 2J87A 1ETUA 1MKYA 3JVUA 2ONJA 1W46A 1O3YA 1E9EA 4PANA 4DT1B 3Q5DA 3THWB 1VTKA 5L8VA 1DOAA 2A5YB 3OAAD 4URXR 1F3OA 2WKQA 3A4LA 1U8AA 3B82A 4RD2A 1NVXQ 3WXMA 1Z0IA 4Q19A 4TMXA 5F9HA 2IYXA 1QHNA 2OAP1 2YZ2A 4UXJA 1RPZA 4E09A 4LHXA 1FMLA 1E9FA 2HV8A 2P65A 4B75A 2XZLA 2FZ4A 1TMKA 1KI2A 3WYFA 3B13B 1C9KA 4NU0A 1FUUA 3TQCA 1KDOA 2ZJAA 4O3MA 1AM4D 4D4MA 1JQLB 1NN5A 4QM6A 1N2CE 1UKYA 2V4ZA 1E2KA 5CDFE 4UNQA 1NVUQ 2OLJA 4O0MA 4Q1BA 5CK5A 4DEYA 1NLFA 1VHLA 1XZQA 3LBHA 1OV4A 1W5TA 3VR5A 1YR8A 1KKMA 1XMVA 3IEUA 3REGA 5J4YA 3EZFA 3N2IA 4NL4H 3BOSA 2O8CB 1NP6A 1UEJA 2R9VA 1QHYA 5BW8A 1NIJA 2ODBA 1EXMA 5A0FA 5K8LA 5KSPA 4L16A 1Q20A 1SXJD 2W0MA 4C0AC 1KI1A 3B1XA 4B6EA 4C0LA 1FNMA 5IT5A 1CEEA 1H8HD 4C0QC 5KUTA 3VAAA 2CNWD 2HT1A 1G17A 2J7PA 2IK8A 2PX0A 2GNOA 4Q47A 3OIWA 3RS0A 2IW3A 2QMUA 1DELA 4WAUA 2ZJ5A 3UG6A 5IRCD 2V54A 3OIYA 4D2IA 5BYKA 1X6VA 3L0OA 5FH9A 2J0UA 4ON9A 3UATA 1N6NA 1ZM7A 4HZUA 2QPOA 3D3QA 3SU8A 4F91B 1MO4A 1GNRA 2CVHA 4DLZA 1AN0A 4NYMR 1KHTA 5C4MA 1G8GA 4IKEA 3TE6A 1XFAA 4Q9JA 4K46A 2ZI3A 4KCGA 2G88A 1W5SA 1XDBA 2QENA 3UWOA 1I2MA 1Q1ZA 4A8JB 2JLWA 4A36A 3L0PA 1WMSA 4QBHA 1NLYA 3T15A 1Q44A 1II8A 1I4DD 1GNQA 3B78A 1OJLA 1NSFA 4YQFA 2H92A 4MRRA 4OHYA 2W83A 1OB5A 2I4IA 1KMQA 5FTJA 5L3RA 3AVXA 3MFYA 1BYUA 3K0FA 2ZS8A 1KO8A 3NBXX 1TF2A 2QAGA 3AKEA 1QHHB 5JLJA 1W36C 2N1BA 5JBQA 3QXXA 4IJMA 4Q4JA 3I5YA 1AGPA 1E0AA 3QKSB 3K70C 3DZ8A 1T4GA 1K8RA 1P62B 5CK4A 5EE9A 3LY5A 1U99A 1EFRA 2WM9B 4WVFA 3LQQA 5TY0A 1ELOA 3HU3A 3DKVA 2HJGA 2AXPA 2YC4C 3KX2A 4G5GA 2GXQA 4LHYA 2IWHA 3W9YA 4EPXA 3GEIA 4ZDKA 3CRMA 4PC6A 2XNDA 3W3ZB 1NBMA 2AHOA 3QVVA 1LS1A 1T3LA 4B2IA 3ASZA 1AA9A 1VG1A 1ODFA 4G5OA 2JLQA 2AFHE 5EXSA 1E94E 1OIVA 2ZI4A 5HTKA 2KSQA 3ASYA 2QQEA 1AJEA 2ZJ8A 4DCSA 1ZIPA 4WZBE 2C04A 2RGXA 3CWQA 1OYWA 3LXXA 1MR3F 2FFHA 2Q3FA 3HU2A 2VPPA 4HB3A 1S3GA 2D3WA 4D4LA 2ZUDA 4TLEA 4JIMA 1WDTA 2ODWA 3BH7A 4NHOA 2ZSFA 1E98A 4V03A 4I1VA 3TSZA 5SZHB 2PLRA 2VHTA 4HDQB 4DLTA 4KFRA 5HCNA 4KJZA 2ANCA 2F3RA 1ZMXA 2ZI9A 3AH8A 3R20A 4F4JA 3GJ3A 1JR3A 1XTKA 1ZBDA 1E9SA 3I62A 3KKOA 2GILA 2YVUA 4P3YA 3B9PA 3QG5A 4LJYA 1W4CA 3GCGA 5HE8A 3VKWA 4X8MA 4EJSA 3K0SA 3WBKA 1SHKA 5DLQC 3TVDA 5C18A 5IK2D 2C77A 2WAYA 3AV0B 4XVUA 1CULC 3QXCA 4M1KA 1VYUA 2GF0A 2CE2X 2J7KA 2OCYC 4Y0VA 3AVTA 3Q72A 2ZEJA 5JRZA 2F43A 4AYXA 1KK1A 3RWOA 3PVSA 2O8BB 2D2EA 3U3RA 4US0R 2QAJA 4MA4A 1XF9A 1S0UA 2VO1A 4RZ2A 1KSHA 3W8NA 5BN4A 2JJ1A 4POAA 5FI0B 3QKTA 1DAFA 4B2PA 2ZRJA 4GT1A 1P61B 4YDHB 3E2IA 4EPVA 1VYTA 4BLTA 4HLDA 1GVNB 1MABA 1G18A 1T5LA 2BIFA 4B43A 4I81A 3BAFA 1GM5A 3GPLA 4W5HA 2P6NA 4IEIA 2QP4A 3ZS9A 1KY3A 2G1KA 3B2EA 4P4TA 1QHSA 2WIBA 2R2AA 1Q12A 3C41J 1E9CA 5DI9A 1NJFA 1E32A 1QHIA 4GOKA 4B32A 1XJ0A 4Q48A 3WRYC 4Q9KA 1ZIOA 1SZPA 1LV7A 2IYYA 4MQBA 3K0AA 1RKBA 3W3AA 4LV8B 2JIZA 4DUGD 3CRVA 1NNEA 5H1YA 4ARZB 3G0HA 1UM8A 4HAWA 3PR1A 3QEOA 2IXGA 2CEAA 3BB1A 4RD6A 1VG9B 3IIMA 4EIWA 3HP1A 2JLRA 1KSFX 2OO7A 2ZSEA 3MWKA 4OK6A 3UIEA 2PLFA 3PUVA 4LBVA 1FZQA 3REFA 1ZUHA 3SZRA 5JRJA 3GFPA 1ZM3A 2JJ2A 4M22A 4MGZR 4TMVA 3ONWA 2CVFA 2H17A 4DIEA 4Q1DA 1SXJC 1XTJA 1OIWA 1XEXB 2R65A 3KB1A 5FPHA 3EIEA 3SFVA 3ADDA 1M8PA 1TQ6A 5JCZA 2RCNA 3AVOA 2QM7A 3DOFA 3KJHA 4MUBA 2AKYA 2QTVB 4HUQB 4JVNA 2IS1A 5EUMA 1TUIA 5AJZA 1BMFD 4W5WA 1Z0JA 4AC9A 2VP5A 5GJCA 1XEFA 2FGKA 1SVLA 1GL6A 2OCBA 2RAPA 4HB2A 5DI3A 3I5XA 1ZNYA 5CB8A 3FHOA 4P4SA 4IFBA 5FBWB 1R5OA 3NG1A 2XB2A 1W0KA 3PEYA 2DFNA 3ZDQA 1IXZA 3K09A 2P3SA 2PZGA 3TH5A 3LLMA 3FWYA 2ZE5A 4WZ6A 4LRWA 1P7CA 1CBUA 2GA8A 2AD1A 5AJWA 2W2XA 4B2LA 4DLXA 4QM7A 4TSFA 1IBRA 1CR0A 3QBVA 2YINC 4LPSA 2D7DA 2DY1A 3DHWC 3WHLA 5BN5A 1N6RA 4AG5A 1U9IC 1AS3A 2XSZD 1LY1A 4IW3B 3ZIAD 4C9BA 4QBGB 4D6PA 1LF0A 3ADBA 3O8RA 1R0WA 4TLBA 4GMXA 3H1TA 1HV8A 1LW7A 1VYVA 2C2HA 2FA9A 3PV0A 2RGAA 3HYTA 2QBYB 4NTZA 3RS7A 1GITA 4FMDB 4NP6A 4GDFA 1N25A 2IUTA 1A5TA 5FTMA 4Z8YA 4TMWA 5JJIA 1EGAA 4B71A 4M1YA 3I3SR 1HT1E 4DC9A 4BE7B 2NPIA 2SHKA 1OKKD 1E1QD 1OE0A 4JLOA 4V02A 1S1CA 1Z0KA 4AYWA 1CJTC 1EFUA 2FSFA 2F9MA 3CR8A 3SE0A 3QE0A 5FOWA 3W5JA 1HEIA 4V0MA 3RVBA 1QHXA 4NYJR 4MGIR 5D3MA 3BE4A 1RRCA 3RANA 3R9XA 2WWXA 1T91A 2XXAA 2EFDB 2GJ9A 2ZRBA 3SHWA 3CZPA 1G5RA 1E9BA 5FL7D 1F48A 1KJZA 4YMSA 1G3MA 1R7RA 1AK2A 3CW2A 1J8MF 1ESMA 3LVRE 2BWJA 1NN0A 4IDOA 3THXA 3U6KA 2WZQA 4WXRA 2WJIA 4AKHA 2ZVPX 2XEXA 4Z1MD 3TJZA 3BFXA 3KKMA 1GP2A 1DVRA 2RKOA 2VQSA 2ZAOA 3CIOA 2XGJA 2YWFA 1FTNA 3EC2A 2PCJA 2ZRCA 4NCIA 1IHUA 4QG7A 2EW1A 1YR9A 3C4JA 4GZLA 4N3NA 2X2EA 4KFTA 2QP9X 1E79A 4QXAA 5J4HA 4V0KA 3VKHA 1OB2A 2N42A 2ZJ2A 3LAWA 3OEEA 4JZKA 2RB4A 1GL9B 2OBNA 3K0CC 2V8OA 4PSKA 4M9XA 3RS2A 4F4IA 4ZKEA 4C7OB 5L3QA 1FFHA 2FZLA 1VDZA 1XXHA 3NDBB 4DDUA 4TT3D 4A8JC 5M04A 1S1MA 4OHZA 4EPWA 2AXNA 1G8YA 1J70A 1FNNA 3IILA 3AQ4A 5FR1A 4G5SA 1COWD 5IF9A 6Q21A 1G21E 1PLKA 3T12A 2O8FB 2BBOA 1RJ9B 1OFIA 2CK3A 1SVKA 2GJSA 4UNNA 4AKGA 3OE7A 1W36B 3KB2A 1GKIA 1UBGA 3K70B 4YONB 4EDHA 4ZIRA 1KMHB 1DTSA 2HLDA 1XPRA 4BLOA 4QOSA 4R2IA 3RC3A 3LFUA 1JALA 2WIAA 2HEIA 3THYA 3EWSA 4A0GA 2V9PA 4EPTA 1Z0AA 1OXTA 2ZRLA 4NCHA 1Z29A 1HTWA 4Q1CA 2RHDA 4C2UA 1E1RD 3AUXA 3QPVA 1WP9A 2C9OA 1OIXA 2JLUA 2DYKA 4DCVA 1OF1A 4H9GA 2ZRHA 2W6JD 1XD9A 1DG1G 3GJXC 5F3WB 4C0KA 4OI2A 3AF1A 1QVRA 2OXCA 1HT2E 4XSGA 4JVMA 5D3QA 3SYNA 2G9NA 4ZV4A 2AK2A 3CLVA 4BLRA 3UWKA 1CJKC 1OH8A 1XNJA 3Q9LA 4H1UA 4CIDA 2BVNA 4LGMA 4BRUA 2QRZA 2AKAB 4E5UA 3HPRA 1M7GA 5E4FA 3QENA 1GIAA 3ZVRA 5HPYB 1KNXA 3FKSD 1DARA 3VNUA 4ASUA 5EP4A 1DAIA 3ICEA 4Z51A 3CX8A 5JEEA 4KBGA 3IKJA 2VH5R 3C5CA 3KKNA 4HEJA 2V55B 4N0EA 3CPHA 3KJGA 1H8ED 2O5VA 2FWRA 4GRAA 4KFUA 5DYGA 4JVSB 4JMPA 3SYLA 3OESA 5AWFC 1LTQA 4JLNA 1JBKA 5KNCA 1OSNA 1OXXK 4P4UA 2A9KA 4ESVA 3DOEA 3R8CA 1W4AA 2WJYA 5AK0A 2CDNA 4LYFA 4TYQA 3FYHA 2AN9A 2GJKA 1N0VC 2WMOB 4JKIA 1NY5A 1FP7A 1NMXA 4H1VA 1WBDA 3FHTA 1VKJA 1YR7A 1IAQA 4C2TA 1C4OA 3X1WA 2JDID 2VP6A 2JASA 4IOLA 4LHZA 5AUOB 1U90A 2FNAA 1IN7A 1HA3A 4BZQA 4PQFA 4G3XA 3S1AA 1G291 1G7TA 2AK3A 2HCJB 5IDVA 3LX5A 5CIWA 4EAQA 4XTRA 1T5IA 5DIFA 4DLVA 4PQYA 2XJ9A 3KKQA 3PXGA 2VTKA 4UNRA 4GMDA 4ITRC 3TUJC 4OBEA 4FXPA 2DFKB 4PAOA 5HKKA 2FSGA 5EXPA 3PITA 4HZUB 4HATA 2E87A 1RRFA 4CGZA 2EWVA 4M1TA 3TIFA 1II0A 2H7VA 2PX3A 2EFEB 4Q4HB 2C98A 5JECA 2IBMA 4M2LA 4OK5A 1IXSB 5LDDC 4EFNA 4PZYA 1WE2A 1A2BA 2GZDA 3R9IA 3W90A 5F98A 1DG3A 2PMKA 3A36A 2Q21A 4FCWA 2IL1A 5TMPA 4YMVA 1KAGA 3TW4A 2CCKA 1FX0A 3I4LA 5DN6A 4ZPXA 3M6AA 1D9XA 4QBFA 2B6HA 3CR7A 3O8DA 3ZS8A 3BB4A 3B1WA 2R6CA 3K9LA 4BEJA 1X3SA 4LI0A 4BFVA 2RHMA 4QHYA 5JFGA 3O8BA 4AWXA 3VMFA 2QGNA 4GZMA 1NG1A 1Z07A 5BXQC 5KTYA 1OFHA 1E2EA 3DM9B 3SS8A 1W47A 5AJXA 5SZJA 1MV5A 2EFHB 1WA5A 2IS2A 2KJQA 2CLCX 4DBLC 2BJWA 2JAQA 4IHQA 2PBRA 4PC1A 4KI0A 4D26A 1TEVA 1HQYE 2DR3A 3W8RA 1R5BA 3GJ7A 2P6RA 3GLFE 4G0NA 1N6IA 1ONBA 4MKIA 4W9MC 1RC8A 5KYKA 1R0YA 3FVQA 4QKQA 3IBYA 3CH5A 1OXVA 3EZ2A 2IA5A 1UBFA 3GLFB 4LJ4A 2OLKA 5EXTA 4KHZA 1SVSA 3PUWA 4B35A 5H8WA 4EQ6B 2VIIA 2J7PD 2CJWA 2IWRA 3PIRA 3X1ZA 5JEDA 1AS2A 4ZCIA 4XJXA 1G3IA 2J9RA 1KO4A 4M1OA 2YOHA 4Q02A 3ZQ6A 5FOSA 3KQNA 2K5UA 1ZC3A 1JR3E 3P26A 2ZRAA 3ADCA 1N6HA 5JJKA 1G5TA 1KK2A 3U44B 1N3BA 4YXWA 2VA8A 1RZ3A 1RRGA 1ZM2A 2AWOA 4L9WA 4Q00A 4JL5A 4TYWA 1MOZA 2QUZA 1PV4A 3NHBA 3RABA 5JHGB 3RHFA 2JLZA 1P4SA 3X1YA 1D2MA 1XX6A 2WSSA 2ZJOA 2O0JA 4LK2A 3CPEA 3GLGE 2EWWA 2ZRMA 4QC2A 1UEIA 4MRNA 2IYLD 3FE2A 5JWHA 3QF4B 3FB4A 3VTKA 3GLGB 4CEHA 2GEDA 1L7VC 1US8A 1GNPA 2GAOA 5JI2E 4IXNA 1OXUA 4IVRA 5CM8B 4G1UC 2F43B 1VECA 4V0OA 4TQAA 1RRPA 3NXSA 2KB0A 1FQJA 4L15A 2AX4A 2YOGA 2QPAA 1QF9A 3EA5A 4IRUB 3TR0A 1BKDR 4BFXA 4BGDA 3QJYA 2QPTA 1EFRD 2ERXA 2QE7A 1LF5A 2H57A 4XD7A 1VCOA 2J0VA 4MGKR 1Q3TA 1XJQA 1F2TB 3HWSA 4JT2A 3U3JA 5KNDA 3EIHA 1QDEA 3U7GA 2F3TA 2XNDD 3AP1A 3P32A 1AZTA 5EZ5A 4HAXA 2RGNC 1JQJC 3AEZA 4MH0R 1GG2A 4EKDA 1XD2A 4P0TA 3SR0A 2D4HA 2ZIAA 3LBNA 4CDGA 2GRJA 4DCNA 3V4FA 1I4TD 4IXMA 1F5NA 3BWDD 4MYHA 2ZS9A 1Z5ZA 2Z6VA 3EWAA 3MRSA 1KTVA 1P73A 4PSVA 4S35A 2UVQA 1E2HA 3K0AB 4C4PA 2BMFA 4B3XA 4JLVA 2NQ2C 1T8TA 4AG6A 2HF9A 3AF3A 3RRMA 1UF9A 1E6CA 4TZ6A 4NE2A 4TWZA 1IY2A 2V1XA 1R0ZA 1JR3D 3I8SA 1JNYA 4LBWA 3LO5A 2G83A 3IUYA 2CL7X 2ONKA 3CNLA 5JZVA 2W6IA 2EFGA 2JLXA 2ZI5A 3CWZA 2OAQ1 3W6NA 2J5XA 1NMZA 4UXIA 4BFWA 4DKXA 1UKVY 1GILA 5GJBA 3BJIC 2UZ3A 1MRNA 1RW4A 1S2MA 3RRYA 3MWYW 1M1YE 2NZ8A 5FOVA 4EFLA 1H65A 4DB4A 1TAGA 1ZNZA 3ZVMA 2V3CC 1P2TA 4DXAA 4JL8A 2ANBA 1V43A 3IIJA 1P72A 2ZI7A 121PA 3FGNA 4I1UA 2JJ1D 3IQWA 5JSZB 1VG8A 3A1UA 2WKRA 2FDCA 4Q4AA 2XJ4A 4LYAA 1HY3A 3VR2A 5HR5A 4CEJB 4XH9B 1W1WA 4FWIB 8OHMA 3M1IA 4DDVA 1FL9A 4GBMA 1MO5A 3AGQA 4DLWA 1E99A 1V5WA 1ZNXA 4HLQB 4W5JA 3IEVA 3SQWA 2IF0A 3T35A 4Z8XA 4GSYA 1D9ZA 4ZCLA 1NVVR 4RZ3A 1IN4A 5J47A 1ZC4A 1IN6A 2MMGA 2QN6A 5L3SB 2OCPA 1E4VA 2NO1A 1XZPA 2NOAA 3BFVA 4KSBA 4HUTA 2IYTA 1KSGA 3EARA 3A4MA 4I99A 2J0SA 4O2LA 3KUDA 4X8OA 3SEAA 1OYYA 1TQ4A 1QVAA 2ATXA 3R7WB 1GUAA 2B92A 2XZOA 2CNWA 1CU1A 2JIZD 4CYMA 1Q1BA 1OW3B 3OZXA 2P0EA 3P4XA 1IJFA 1HURA 2PZEA 2J41A 2ZI6A 4QBIA 3RS5A 2QZ4A 3K0EA 3WMFA 2Q9AA 1F2UA 3IBGA 4US2R 5SZIA 5GADl 1HH4A 3BFKA 4LJ5A 1QBKC 1HE8B 1KY2A 2D74A 5EE3A 2D62A 2EQBA 4S2EA 2GEVA 2QMOA 2QT1A 1TF5A 3QUSA 3T5DA 2CLDX 2YOFA 4GOJA 4DDTA 4XWOA 2YNMA 2JJ2D 2ZXUA 5FBVB 5FFMA 4KO8A 4RZUA 1TEXA 1X86B 3DO6A 2FSIA 4DSUA 4KXFB 4B73A 1KDRA 4DT1A 4C0JA 3THWA 4LJ6A 4DLSA 2KI5A 4JS0A 4RY2A 1QZXA 3SQXA 1PJRA 1Z8FA 3ADKA 4DJTA 2GBLA 4GPTA 3SC3A 3TVTA 4NYIR 4F92B 1Q21A 1MT0A 421PA 2ZRDA 4CEIB 4DCUA 3C8UA 3PEUA 1P5ZB 3EXAA 3L0IB 1XCGB 3QPWA 1FP6A 4DIDA 1D2NA 5TXGA 4BEBA 3KFXA 1W0KD 2VLIA 1JI0A 2ZROA 1PUIA 4OHWA 5FPYA 5JI3E 3A6PC 2BKUA 4DCTA 2WHXA 5J5CA 5HE9A 3A37A 2IF2A 5CYPA 3V4RA 2ZRKA 5ANRB 4LBZA 3EPKA 3W6PA 1L8QA 3L43A 1XU4A 4TSFD 4BQSA 4A6XA 2OM2A 4OI1A 4Q9LA 3ZZUA 2ZM5A 2B7CA 4QNRA 4DSTA 2BCGY 1BOFA 2FPLA 5CDFA 2WV9A 4KITB 2B21A 2O8CA 5AUNB 4KU4A 5B58C 3IO3A 5KSOA 3N5CA 1E2GA 4HLUC 3L8ZA 2X77A 3BK7A 5EXXA 3AGPA 4U02A 5J40A 1YR6A 1XP8A 1Z2CA 2V6IA 3TKLA 1A1VA 3EPHA 4F4CA 2IYSA 1ZM4A 4BASA 4Q9IA 4BRWA 3SBEA 2QNRA 2JLVA 3LBIA 3KQKA 1LB1B 1VG0B 2FU5C 5H70A 3NTUA 1ZUIA 1OLOA 3KTAB 3CRW1 1PLJA 1OXSC 1SKQA 2GCOB 2VHUA 1VIAA 3P1JA 2LKCA 3Q7PA 1E96A 3NHAA 2PL3A 1JJVA 4JJZA 4WBSA 2KBEA 1PVOA 4Q66C 1J7KA 3RNLA 1KO1A 4RVCA 3RDPA 1NKTA 2GF9A 3WBJA 1G6OA 2C99A 4GL2A 4IOJA 3IHLA 2FJUA 2I1VB 1T3HA 5GVRA 4JT4A 2R6DA 3U3OA 3H4MA 4OJKA 2OESA 4JLKA 4UJ5A 4RD4A 3P4YA 4C0BA 3U3KA 1TQDA 4NYMQ 4TN1A 4B3DA 4GOXA 2IXFA 2NGRA 4A2WA 4TL9A 5G41A 1T0HB 3TW8B 3K1JA 4B3BA 4C0HA 5E95A 2REBA 3NC1C 2QMHA 3QF7A 5CB6A 4LJAA 2Z4SA 5CITA 1EX6A 2QGZA 2H18A 3T61A 3T1TA 1QHHA 1E79D 2WMNB 2ZREA 3Q8XB 2DPXA 5FUWA 3OEED 1BO6A 3H84A 3QKSA 5FTNA 3ZD6A 4TTRA 1TPZA 4YC7A 2ZE8A 3VU9B 2A7QA 4JBWA 2XOKA 4HAYA 1KI6B 5E7JA 1X1SA 3GEEA 3B9QA 4EJSC 4PO9A 1NSTA 1NN1A 4HB0A 1YZNA 5AR1A 4A2PA 1ZD1A 4I1SA 2YWHA 4M9ZA 3RS3A 5C46F 3VR3A 1TQ2A 2WAXA 4OI4A 3EPLA 4PC7A 5KNBA 2WWYA 3LQRA 3PCRB 4OQXA 3U3MA 2P5TB 1JEDA 1FUKA 1WXQA 2CK3D 2GHIA 3KKPA 3GLHE 1G64A 2GCNA 2NO9A 4RCYA 4X8HA 4D4JA 3OE7D 1DAGA 4WIAA 2KWIA 2VSOA 3F8TA 1YZGA 4FIDA 5KDLA 4D0GA 1KIMA 3ZJYA 1E2PA 1TU3A 3BGWA 2GTPA 2J1LA 2ORIA 3GLHB 3NEYA 4FMDF 2YKGA 3MUFA 3BBPA 3C5HA 4RKEA 2HLDD 1N6LA 4HAZA 4LDJA 4OYHA 4ESHA 3GLIE 4OK3A 2NO6A 2C78A 1EWRA 4XSHA 1IJEA 1SGWA 2GCPA 4QGAA 1DBSA 3QPUA 4Q18A 3RLFA 2P2LA 2GVDC 4CRWB 3GLIB 4DB2A 3CUEF 4M9SA 5EP1A 3ZZ0A 2G3YA 2IHBA 2RGEA 2ZYTX 3CH4B 3FMIA 2C96A 4MKHA 3VR4A 1DE0A 4NKRA 4LX0A 1OFUX 3T34A 2W00A 2F1RA 1X1RA 5C2JB 2IX3A 1DEKA 3LH5A 2Z43A 2HUPA 1NF3A 1AQYA 2CLSA 2IUSA 1JECA 3AP2A 5CJPA 4U7DA 1UKEA 4TYPA 5FBQB 4XWKA 2GESA 2O8EB 1TL7C 1R8QA 2QP3A 3EIQA 1G4AE 1P9WA 1OH7A 1HUQA 2OBLA 4Q5IA 3HR8A 4RFSB 1KDTA 1YZKA 2PZFA 4ASUD 2X8AA 4O2RA 1WQ1R 4RFVA 4HSEA 1K5DA 5E7MA 5FBLB 4B6FA 3MLEA 1E4YA 2R6AA 2YWGA 2O8BA 3HU1A 2GVZC 3QIAA 3Q3JB 1CJMA 4OQMA 2FGJA 4DWJA 4LYJA 3VFDA 2QSYA 3VNVA 2VF7A 3M0EA 1NJGA 3RAPR 3U4QA 2G6BA 5CLQA 2ZUCA 2P67A 1S3SA 2IXEA 4ZI2A 3CNOA 3FTQA 1XCPA 4P32A 3OEHA 1ZU4A 4BLPA 3FPAA 2PJZA 1GZSA 3CF0A 1G7CA 5FUVA 2H1LA 2BMEA 3CB4A 3EZ6A 4JVLA 1KI8A 5BWMA 3D6TB 2WTUA 3KJEA 5CM9C 3FMPB 4OQNA 3LV8A 2OUKA 3PQCA 1N6PA 5EE0A 3SBDA 3D8BA 2OT3B 2OV2A 3AF0A 4UXHA 4N1AA 2IUUA 1OHHA 4JL6A 5HKKD 1BS1A 3QKRB 4AY2A 3C14C 3PENA 1DAKA 3GD7A 4PO8A 1IM2A 3K09C 3SFZA 1N0WA 1NKSA 3VHLB 4A4DA 4DVGA 1I2DA 1T9HA 2PCLA 4R2HA 4OI0A 2GZHA 1OKKA 2WPDA 4MGYR 3NIBA 1E2DA 1Z6GA 1CR4A 1Z83A 2JJ8A 3NKVA 1S8FA 1G8HA 1KO5A 2GEUA 2A30A 2XZPA 3AKCA 2WOOA 4M1WA 5DYIA 4A2QA 4A1FA 1KJYA 5BYJA 1UFQA 4TMKA 4YDSA 1N5KA 1ZW6A 3MGCA 1FQKA 5DN6D 3HPQA 3B5JA 1BYIA 4E03A 1BIFA 1XTIA 4UNPA 3VQTA 3PUYA 1QG4A 4AK9A 5FI1B 2BKEA 2G1JA 3MWJA 1DO0A 1FPMA 1C1YA 2YWEA 3W6OA 4C0SA 4KAXA 1UAAA 3FDIA 4PAQA 1N5IA 3NC0C 2OG2A 4TTQA 1XMIA 2H5EA 3UMSA 4HUQA 4Z54A 2JCSA 2FMXA 1P3JA 3BC1A 4FMBB 2BV3A 2ZR9A 2V7QA 2A5DA 3ZH9B 3IIKA 3X1XA 4KVAA 2L0XA 2IS4A 2MSDB 4HDCA 1G19A 4FD2A 4QRHA 4DSOA 1G8FA 3AVWA 2XTNA 3T1VA 4R98A 4ZDIA 3U7FB 2DFTA 2WSMA 4R71A 1Z6XA 1TADA 1NIPA 4M53A 2FX3A 1E2JA 1TUEA 1SVWA 1CR1A 1WBBA 3TUZC 4U5XA 1Z6YA 4MYUA 2JLSA 4DLUA 1W4RA 1G5PA 4DLYA 4M1MA 3TAHA 1J8YF 4HAVA 1E0JA 2J0UB 4A0RA 1NG9A 2B8TA 2QBYA 5FBRB 3KQHA 3DDCA 2O8DA 4ZKDA 2JA1A 3FKQA 5KHOC 2E1RA 1P60A 1SHZA 2YYZA 3MCAA 2ZU0C 4A9AA 4NCJA 1JEEA 1ZYUA 2W58A 4YLGA 2ZJYA 3QEJA 2DWQA 3LWNA 4NH0A 4YXWD 1Z0FA 1G16A 1UBEA 4E22A 4LYHA 3FMOB 2EVWX 2J59A 3UXMA 3GFTA 621PA 4YMTA 5DNYB 1QHGA 1RFLA 2Y8EA 1II8B 3K8YA 3OFNA 3RRNA 5G3ZA 1G3UA 4TQ9A 2B7BA 3MWLA 4LUCA 2OHFA 2GJAA 2WSSD 3NVAA 5AUPB 4IEEA 4MKGA 3LLUA 2HF8A 1KDPA 1ZM9A 2QI9C 2UKDA 3K0FB 4IFEA 4NZYA 4PR0A 3ZVLA 4M0LA 5GJWC 2I1QA 2QAGB 4NYJQ 5KDDA 4LBYA 1UADA 5DHFA 2ZU6A 1Y3AA 5FR2A 2ZS7A 3CBQA 4CT4B 4BFZA 4Q4JB 3LVQE 1N6KA 2FSHA 3B1ZA 1SVIA 3NWJA 4OQFA 4TLCA 1HE1C 1L4YA 4TMTA 3RRZA 4XWAA 1AZSC 3DEFA 1E0KA 4JLDA 2BJVA 4QHTA 4C3ZA 2CL6X 2ZRGA 2ORWA 1AQUA 2NZJA 1FMJA 2ZRFA 4FMCB 2ZPTX 4XIGS 5FUXA 3AF2A 4IVQA 3BERA 3EX7C 1NBME 1FTSA 2FN4A 2IEZA 2TMKA 1CKEA 2PT7A 4MITA 2QE7D 3CO5A 2OE2A 2QG6A 4LHWA 2GWHA 4XD7D 1QG2A 2C5LA 5B57C 4OHVA 3DZDA 2VP2A 1R4AA 1UJ2A 2N46A 3VKGA 1KK3A 2VP0A 1U94A 2FFAA 3AB3A 4LZZA 3UPUA 3CZQA 1VMAA 3QOFA 4JLBA 2GJ8A 4TL6A 5EP3A 4A6PA 4KLZA 1M6NA 4C7OA 1XJCA 2CE7A 2GDJA 3WNCA 4M21A 2A5GA 5JMTA 2A2ZA 4I4LA 1DO2A 2QL6A 4IDPA 1AGRA 4OHXA 4UQOA 2AFIE 4JSYA 1LNZA 2GXSA 1J2JA 2C03A 3AVPA 3CF2A 5KU1A 2CMKA 1SVMA 4NCKA 2XITA 1RIFA 2PH1A 2W2TA 4BZPA 1PZNA 3FHCB 5DH9A 3ICQB 1RJ9A 1U98A 1P9NA 1NI3A 1ZD9A 3CNNA 3WYAA 5B64A 3E70C 4LY6A 3WY9A 2X1VA 221PA 1FOEB 3QSYA 4AI6A 2Q3MA 3AKDA 3NDPA 1YU9A 5JS7A 3L8YA 4GP6A 2ZITA 1OT3A 1KMHA 4II7A 5JCPA 3EG5A 4LC1A 2FPMA 4EJSB 4L5BA 4M8NE 1IN8A 1GOTA 1YZUA 1ZJ6A 2DCUA 2VYFA 2W6ID 3F5FA 3FMFA 4A0FA 1AKYA 1RVDA 5J4VA 4CVNA 4ACBA 3KZ1E 2WJJA 4DSNA 1J99A 2QM8A 4KV9A 1A7JA 2WJHA 3KUCA 3QKUA 5HZHA 5JJLA 3QG1A 1ZINA 1CLUA 3VHXA 1EFCA 2YV5A 4UJ3A 4D0LB 4TLDA 2CHQA 3EZ7A 3QQ5A 4A92A 2BHRA 4PPFA 3RSOA 1Q1EA 3RC8A 3KQLA 3TQFA 1G8PA 1P2VA 3NH6A 4JBXA 2JATA 2QTFA 1JR6A 3K9HA 3GJ0A 4OKSA 5TARA 3AVQA 2A5JA 2ODNA 1D6JA 1XMSA 1DAMA 3MJHA 1KKLA 1UBCA 2W2VA 2ZTSA 1A4RA 1MABB 4F7WA 1KZGB 3KL4A 4Q9HA 1NBMD 2QROA 4DRZA 5B30A 2REOA 1KAOA 4LV5B 3UKDA 4BFUA 2VP9A 1OH6A 3A1SA 1VHTA 1TF7A 3CF6R 4O25A 4FINA 2O0KA 1QRAA 4OJQA 1XTQA 2RGDA 3HJNA 2FE4A 3A58B 5EE1A 5SZKB 3Q7QA 4B76A 3HDTA 2QT0A 4LOAA 1EESA 3SDZA 4WOPA 4Q03A 2NO7A 1TU4A 1WRBA 2VF8A 2ZUBA 1W0JA 4LC0A 3UG7A 1P2SA 2MMCA 4FWTA 2OFOA 4PC2A 1Q22A 1A2KC 5EE5B 1B23P 5LB4A 5EQTA 1NVWQ 2IT1A 3ECCA 3H86A 1Q1QA 2OFXA 5DO9A 3QXSA 4Q7JB 4RZXA 4HB4A 1HYQA 1EWQA 1VCNA 1Z6TA 4MUAA 1E69A 3AVUA 2R6GA 2GK7A 4OL0A 1Z2AA 4ILEA 4KYUA 1Z06A 4JLPA 4P31A 5TV2A 2YC2C 1ZCAA 3A8TA 2OZEA 4ZO4A 3IQXA 1R10A 4QL3A 1SKYE 3G5UA 3I73A 5LBIA 3SNHA 3AKYA 721PA 5K8IA 5LPNA 1SKYB 4Q7MB 3WP0A 2WICA 2BBWA 4MYCA 3IPXA 3LD9A 3Q85A 4Q4HA 2F1JA 1HQCA 3BXZA 1IY0A 3L2OB 3U7HB 2DWPA 2XTMA 3OAAA 1GRRA 4NCNA 3DKPA 4HZIA 4KODA 2IYUA 4M1SA 3FOZA 2VHJA 3BH6A 5G53C 2VHCA 3A1TA 3MAAC 4D0NA 3BRWD 3O8CA 4FCVA 4Q7LA 2UZIR 3A1VA 3LX8A 4UNSA 2AL7A 3OIVA 5DI3B 3VR1A 3Q5EA 5FPTA 2FFQA 1JAIA 4P4SB 1X8JA 4DDWA 1F60A 1U0LA 4HLUA 1G4UR 1VCIA 2LCFA 4Y0AA 2IYZA 3CX7A 2V6JA 4QGFA 821PA 1E2QA 1YZLA 2F1HA 2XTZA 1Z6AA 3M4YA 5FL3A 4EPYA 1EFHA 2ZYVX 3TLXA 1GSIA 1CS4C 3DM5A 1LVGA 1OPXA 4V0NA 4UKDA 2HJVA 3U2QA 5GVSA 3WMEA 1JAHA 1TX4B 2BC9A 2Z4RA 3IGFA 4AURA 4HDOB 4LV6A 1CRPA 5EUQB 1RE0A 1ZD8A 1XTRA 1Q0UA 1I4LD 3IDQA 5JWOA 3J81k 3MD0A 4RD0A 1NLZA 4L9SA 2DHRA 5KDOA 2F1IA 5ELXA 3IHWA 3SOPA 2GK6A 2VSXA 4GNKA 1SXJA 2CHGA 3PUXA 3I1FA 5H68A 1DAEA 4QFMA 3WRXC 4G01B 3D7MA 4KYIB 2PT5A 4LHVA 1H8HA 3ZQJA 1J90A 5F2EA 4W7SA 4PPNA 4PSAA 4AIIA 2ZSAA 1IXRC 1L2TA 1KI3A 2FF7A 4C30A 4YMUA 3GLFA 4V0ME 2OFWA 2QSZA 1U0HC 1IN5A 3MJRA 4HAUA 4EQ6A 3EAQA 4TL7A 4D82A 5DHAA 3T1OA 4DZZA 1XPUA 1KO7A 5D3MB 1N5LA 3WNBA 4QGGA 5L3VA 2WWHA 3B85A 3EASA 3IO5A 2XXAB 1LS6A 1D2EA 3TR5A 1A82A 1G41A 4MDEA 3SN6A 2ZYUX 3JVVA 4PX9A 2HCBA 3U44A 2KE5A 4CF7A 2WWFA 5LD2B 2NG1A 4URVR 2C9YA 4KFSA 3TSOA 2ZVQX
chains in the Genus database with same CATH superfamily
4LJ9A 2NNLD 3ZY5A 1Y4ZA 2WTXA 3M70A 2PE5A 4PIMA 3RT1A 1OZGA 2WI8A 4Z4CA 4RMHA 5I8PA 3JR7A 3QLUC 4O0LA 1WZ2A 1H2AS 1G98A 1O8CA 4MYTA 4R8RA 2FJ0A 3OQ6A 3BTUA 4JYCA 4UMFA 1P9RA 1C1XB 3WRVA 3K5HA 1X94A 3RJ9A 2EZ9A 2Y93A 2ZETA 1AD2A 1P0MA 3MJCA 4HC4A 3VA7A 3QF4A 2H0RA 2XF8A 1RXIA 3C7CB 5T8KA 3SHFA 2OK7A 1UP7A 4R0MA 3BF8A 3CX3A 4QGHA 5MDHA 5T57A 3C3CA 3BGVA 1IM8A 1XZAA 2EYUA 4DABA 3PUZA 1IQRA 2C59A 4QPZA 1TQHA 4AS1A 1D1TA 4TLLB 4IDHA 1Z13A 2X22A 1T1IA 2YJTD 3WK6A 2P5YA 4FIZA 2PR7A 1J33A 4B09A 1X8LA 2XOKD 1ADGA 1J5XA 1OTYA 3HBNA 4E2YA 3ZE2B 2A9FA 3U4QB 4QXMA 1QAMA 5F3RA 3H2GA 3L8HA 1E6KA 4Q7KA 3AB7A 4LF9B 1F2TA 2OEPA 2VOEA 4PAMA 2ZQ5A 1J07A 2HPHA 4DA7A 4D9KA 4PFSA 3PCTA 4PWZA 2QAGC 5KNBD 1XTZA 5K3BA 4BGUA 4FK8A 1S89A 2JCGA 3V8PA 2XNJA 3DQZA 3JASB 5FWXA 3U0VA 2R5WA 4D8XA 1YA4A 1K3UB 2VPXA 1RCFA 1D1QA 1VHQA 3LBYA 3RG2A 1FTQA 1VFPA 3UXEA 4BXOA 2FRDC 5JVDF 3EZ9A 3H9GA 3JVDA 4O8CA 3EC1A 4A10A 2NU7B 1HNZB 3ZW8A 4MCAA 2OP0A 2M1XA 2BMJA 2LKDA 1H94A 1P9OA 3FMVA 5A7HA 5THQA 1VKHA 1WBJB 2JI8A 3NAQA 1P5JA 1A2OA 2QSJA 2QVCA 2WC1A 3D6FA 1RWOA 3G3EA 3OZEA 4K6FA 4JJ4A 5JDCA 1KF0A 4H0FA 1GA1A 5AI6A 3MIZA 4CR6A 4D99A 5IT4A 2I34A 4HBZA 4YP0A 3RVKA 2XWPA 3PICA 4Y67A 3W6UA 4ARSA 4OOFA 2ADMA 2XIQA 5AW9A 3PEWA 4P7GA 4QSHA 2IDMA 3K0CA 4V1CI 3H0KA 2N9UA 3WSWA 5EJEA 1HXHA 1RTKA 1S4QA 3JQFA 1W4ZA 4R31A 3BL5A 5IXSA 4EHDA 3WMXA 1YC2A 3P4UA 2WKPA 4MVJF 2WDZA 3K8QA 4Q4DA 4CIBA 1MJGM 1XB2A 1E18A 1XOIA 3K0KA 2XA2A 4PHFA 1RMQA 4RWEA 3WGVA 2L19A 3JZMA 2O5EA 3G2PA 2F6RA 3NJ4A 3C7KA 2QEQA 3BQMB 5LQJA 4M83A 1SOMA 3H5IA 4QVKA 1AZLA 3PBKA 1YJQA 2P9JA 1QUEA 2YJ3A 3CRRA 4IF6A 3EHDA 1VLMA 3AQIA 3VR6H 3F4BA 3I72A 4MWZA 3FAZA 1CUHA 3GOHA 4BTLA 5EAIA 5FF9A 3W5IA 1RHRA 1U1GA 1K4MA 1KR2A 1RLUA 2HI0A 2VJMA 2VZEA 3BS4A 3G7UA 1D7AA 4PG4A 1NM5C 1Z4MA 5G1NA 3HP4A 5BMOA 2RBGA 5A03A 4PO1A 4X84A 2PUAA 4LCBA 1R16A 5EKTA 5A06A 4QQ8A 3EXIB 3L82B 4HD8A 1GU0A 1DADA 2GZMA 3UH0A 2H51A 4CF5A 1N1GA 1YZTA 2CL5A 4DNXA 2IHJA 3ZD7A 7ABPA 1S9HA 1ID1A 4OQ4A 2QYSA 3O5AA 4GGPA 1W25A 3H2IA 5FTKA 4RENA 2XBUA 4BGVA 2Y27A 1DZIA 3GP8A 4H17A 3VTFA 4JBNA 1EVZA 4H3HB 1XJWA 3MLBA 5TC4A 3T1QA 4OATA 1OGYA 6AT1A 1VQ1A 1BGVA 4EABA 2X58A 3EA0A 1NYLA 2D2FA 4HWSA 4IVPA 3ROQA 3MS4A 1G1MA 5AK3A 4MVXA 3SJZA 2XNSA 1DS6A 4NENA 2NVUB 4I9NA 4UHCA 1C30B 3IP5A 5B2ZA 1UKZA 4EITA 3EDMA 4CMCA 4XW2A 4ZYVA 1AS0A 1FVOA 1NVVQ 3UT0A 3VZPA 2E6UX 1ZK2A 3WMGA 2SKEA 4WFQA 1CRQA 1QMPA 2P5SA 1NVTA 2JGNA 3GEHA 5FIUA 1OHHD 1MQ9A 5BV1A 4YMLA 5F1KA 5KJCA 1MIOA 4RKQA 1BKSB 1Q3HA 2NXCA 4KE9A 1U6JA 1ZOPA 1LPMA 3IAS6 4I55F 1HQKA 2B1RA 4MHOA 5EFOA 1H6CA 3ED1A 3AUFA 2BMDA 3V1MA 1XZEA 5BP7A 5JWOA 2ZTLA 1WMFA 3GBSA 2X0NA 4M0EA 3C7TA 2P9GA 1EEXB 5K3AA 3CO0S 3DE4X 5ALNA 1R0XA 2BEKA 1JX6A 2ZLBA 4HN2A 4XASA 2YHUA 2Y3IA 2JIRA 4G8JA 2IEYA 5DSZA 4FI3C 1N6OA 2ZAMA 3N7TA 1YRBA 1YC5A 3DDUA 1P45A 3WWEA 1R00A 2BM1A 2LP4Y 4IJVA 1CIPA 4AJOA 2JZNA 1O89A 3LDGA 4X71A 1KJWA 4L08A 1PF7E 2HYDA 3HFJA 5M3BA 2WSLA 2WG0A 2OCIA 2FPSA 4IDFA 4YPFA 1N0HA 3RYTC 3G2JA 3OQMA 1G8KA 5CBKA 4DAEA 3A0RB 5K0SA 1V8OA 1Z26A 2PKCA 4O4LF 2XB4A 3OZWA 4JLMA 5TQ0A 1E3EA 2V74B 4X1OA 2EX4A 1CUUA 1N5JA 1ZU5A 1JDTA 3URMA 4NDNE 1RWXA 1PN3A 3CNBA 4URYR 1RXVA 2VAPA 1CTQA 1XBTA 2ZJFA 4CEIA 4Z9AA 3DHYA 2ODQA 2CFIA 4NZNA 2A78A 1L7NA 1M74A 4QNMA 3HJHA 3DLHA 3AFMA 3LRPA 3MNFA 2HDNB 2WYIA 2UDPA 2YVLA 1USKA 1EX9A 2P4HX 4II3A 4MPJA 4M9QA 1XUOA 1XEWY 1QH8A 2I29A 4D0RA 1NFRA 4FNMA 3I64A 2I6GA 3KZOA 3MCUA 4OVKA 3ZVKA 4Q1AA 1SHLA 3KP1A 5FOUA 1JDSA 4HOYA 3JWIA 4X1KB 2QORA 2PKXA 3U60B 4PHGA 2BI8A 2CCGA 4BWVA 4QJ5A 5BT8A 4PPGA 1JEOA 5EMNA 1XZHA 5AOBA 1HDYA 1DWPA 1A1SA 1CZHA 4JOQA 5CVUA 4TV8F 4DY6A 5CIQA 4B33A 2QJRA 1KP3A 2VPTA 4RE6A 1W75A 2CBZA 2IOYA 3KPVA 3BMNB 1W0CA 2FEOA 3TOXA 1QQTA 1YQQA 1IIRA 3NOQA 1RDFA 4CL0A 4R2XA 5CFQA 1YDMA 4DF3A 4Z4FA 3WTCA 1E1QA 4ARZA 1FPQA 1WMAA 5KWIA 1RQPA 4NNJA 2YUTA 1QORA 1W2GA 5K6AC 2H7CA 1ENPA 2R68A 3KO8A 1E2FA 4YJHA 1PWYE 1JHYA 1ULSA 2Q0HA 2YW9A 4J0QA 5AKEA 3PIDA 2JANA 4ZTZB 2GCOA 1YZ3A 1QG6A 2GZRA 1C8KA 2BM9A 3B36A 4IOMA 4MCHA 3TGWA 4NBSA 1D2CA 3VOTA 1WTAA 3OFND 2Z5FA 4TZ0A 2IH4A 2REXB 1P39A 1E92A 1YKSA 4XFJA 5L4SA 1PT8A 3UT6A 4B0PA 3L8CA 3IUPA 4JQOA 2C5FA 2FH5B 4KBFA 1C4KA 4D56A 2GXAA 3HB9A 4A1OA 1EWVA 1US8B 1PSDA 2AD5A 3ZPXA 2JAXA 1LX7A 4URUR 1ZKDA 4V1CB 2X0DA 1NYRA 4ZAWA 1UDXA 1NY6A 4KBYA 2D0IA 3M6IA 1MH9A 3NASA 3FNBA 3WIBA 2PQ6A 5TPWA 5HIAA 2WM8A 4DWWA 1N36B 1I3NA 1NUHA 4K8OA 4TV9F 1E61A 3LUAA 4K1LA 3AESB 2A88A 3TW8A 5I7HA 1QLWA 3TGPA 3NBFA 3QY0A 4WGGA 3B1YA 3F6BX 1BH6A 1QFZA 5TVKA 4LQDA 1BRTA 1V35A 1GQFA 2FG5A 3DMDA 5FUYA 1E0SA 2AN3A 1XKLA 2GSDA 3RVPA 3W2HA 3H17A 4WTOA 2NSLA 3ZH2A 1UR5A 5T67A 2YJNA 2WVHA 4FLMA 4GVPA 4YUWA 1I3KA 3HUFA 3HKDA 2FB9A 2NZXA 3TE6A 1CJUC 1HYGA 1XD2B 1Y3BE 4DMLA 5LD2C 2FSUA 1KI7A 4KXUA 4TT3A 1SKMA 4Q1EA 3QWAA 2XPCA 4AJJA 2VUTA 2WWRA 2F67A 4GI7A 1CF4A 1I01A 1P75A 1R0BA 2JGIA 4G84A 5AJYA 5FPKA 5J4LA 4GL2A 4Q39A 2DQSA 3GMTA 2DB3A 1F6BA 4PBTA 2E3JA 5HQ3B 1DQSA 1P4RA 3DVLA 1J8QA 4L4XA 2PEYA 2WTNA 2OK8A 1ATZA 3AUYA 1GU7A 2JVJA 4V3CA 3D3WB 2PX2A 4DMGA 1U2PA 3WKAA 2B3TA 2P6OA 3FRHA 2WF8A 1YQGA 4ZCRA 4ZHQF 3VH4A 3AI2A 4MI3A 2CHVA 3FUUA 1CR2A 3QOYA 4XEUA 2HWKA 5DWDA 3AOEA 3I9OA 4GUDA 2OHXA 3IQZA 5ADUS 1O5TA 1GUZA 4JKYA 1Z0UA 4KO3S 4D8TA 3S99A 3O8OA 1QE5A 4M88A 3WKCA 1DWQA 3I3OA 2O54A 3PJRA 2CL0X 4DJJA 4DR6B 5DHSA 1M6YA 4RU1A 4IH4A 1AIPA 4OCZA 4MEAA 2OILA 3VZRA 1K5GA 1U2EA 1QIFA 3H4VA 4UHKA 1B0UA 1J0XO 2LVBA 4I1OA 4GRIA 1IOZA 1QRRA 3C16C 1P74A 3DV2A 4YI3A 4LX8A 1BC5A 5EC8A 1OZAA 1SHUX 4IGEA 1UAGA 3RSCA 3WGQA 2JEOA 3GLIA 2IH5A 3UICA 4G0VA 2PY6A 1PFKA 4CQNA 3IHKA 1ZX1A 2XUIA 1A7KA 3BBLA 4MLCA 3U9TA 5CFNA 1E2NA 1R66A 4U4AA 4HBGA 1LD3A 1ZLXA 2HTEA 4L3WA 3I2HA 4XVRA 3SQOA 3HUEA 3ZU5A 3OIUA 1T34A 4WGFA 5FNVF 4DIBA 1QH0A 1AKEA 2G6TA 2XB9A 2Z2JA 5EG5A 5SICE 1RLOA 3ZCXA 4ZI3A 1U4NA 1KPHA 3RT9A 4ENPA 4GQAA 4RC9A 3ACBA 3DLBA 1PE0A 1OJ7A 3TAXA 3TNFA 1K89A 2W0SA 3DMNA 1E3QA 2OGWA 4J0DA 3O8LA 1NYQA 2O9JA 3WZMA 3NBAA 3UKOA 3ADOA 1YB2A 3D81A 3SLRA 1LPPA 1OI2A 3B89A 2X41A 1T4DA 3N74A 4L7QA 1D5WA 4RK4A 4WK0B 2QU8A 3PDIB 4AULA 3R9WA 1LFAA 2JS7A 3QBTA 2O4CA 2IFTA 4MV9A 1NQWA 3OZIA 5BW4A 3KB6A 5TT0A 4DMMA 2W2PA 4KQ6A 2BDTA 2H2IA 2NPFA 4LY9A 4G4JA 3M6FA 4AYTA 1LI5A 2J4FA 2Q3BA 4BLSA 5KOYA 2GNAA 3CPSA 2YZKA 3IOYA 1Z4QA 1A50B 3IP3A 3IULA 4LSMA 1VBMA 5K3DA 4D81A 4X64B 3ZY4A 1Q5PA 1ISFA 2ZYRA 4D9EA 4U9HS 2NZ2A 3JZAA 3CR3C 1TA9A 4V0LA 4YROA 5C1BA 2XCLA 2PGIA 3BSSA 4GR5A 4AJIA 5DTEA 2ZRNA 3K6SA 2BSAA 4DMCA 1ITZA 4ENSA 3KK0A 5K05A 3NRBA 1DT5A 3SC2B 2GZ2A 1W4BA 3LW8A 1YVDA 2LWIA 1SUWA 5AK4A 1QYXA 1SXJB 4YACA 4QTUB 4ALKA 3I92A 2XT0A 3CX6A 1I32A 1RM0A 2BFFB 2J6CA 4E5VA 4GUAA 4ZRMA 2D1RA 1UBNA 3D8RA 4QIHA 2RMKA 4QEKA 3IPAA 4CTKA 1RABA 1WSAA 5F7ZA 5BUSA 4N39A 4B8YA 4A15A 1FS6A 3CH6A 4G63A 2H5JA 3DYVA 2EX1A 3A3PA 3RIHA 4E30A 1MAHA 3BUSA 1G3RA 2YV1A 3V6MA 1W94A 4BLUA 3FVRA 3JATB 4PG8A 3OM1A 4NI5A 4OQYA 4F5ZA 3HFRA 4RYDA 3T0IA 5D6NA 5HBRA 3CA8A 4GX5A 5JH7F 3FI9A 1PNQA 3K4HA 3W5DA 3H04A 2WIKA 1ZJYA 1XWIA 3LK6A 3PR3A 3UANA 1OA1A 3B60A 4KKXB 5P21A 3UOAB 4L2IA 4LNUA 5K51A 1WPRA 4KZKA 1RS0A 2VNHA 3MRVA 4MR8B 2QYTA 3SPXA 3EGXA 4M76B 4EY5A 5F7XA 1MKYA 3QPCA 1W46A 1O3YA 2Q7XA 4M36A 4PGAA 4BX8A 3WK4A 2HH9A 3THWB 1NVBA 3OAAD 4JY7A 3LPNA 1F3OA 2WKQA 3A4LA 1U8AA 3HEBA 4HY3A 3ZWKA 3OU7A 2Q6KA 2E4WA 4S1WA 2IYXA 3W2GA 4A5OA 3A6DA 2HJHA 2YZNA 4IYRA 2X5NA 4MUMA 4DM4A 1RI5A 1FBNA 1L6RA 3PQ3A 2R7KA 4UXJA 2C4KA 4MQUA 2FUEA 1BXZA 1KRHA 2YQ5A 1EDZA 1NXVA 3M6WA 2FZ4A 3QITA 1QR2A 4PGGA 4XWYA 2XZLA 1RHKA 4UMDA 2HCFA 3W8DA 4ENRA 5AI4A 4NU0A 2WRZA 5IUNC 2MOKA 9LDBA 1VKRA 4Y6SA 3HH8A 1TU0A 3NYRA 3O7WA 1JQLB 1N2CE 4QE3A 4LF4B 1E2KA 4FKBA 1QX4A 4UNQA 2ZPAA 5FORA 4PRYA 2CJYA 2OLJA 3ER6A 1FYXA 1NKVA 1P44A 1GTZA 1TXGA 2B2CA 4RIIA 2N47A 5LQSA 4E51A 1NLFA 1YDGA 1YXMA 5BY2A 5KS2A 1W5TA 5DDIP 1YR8A 2XKBA 1KKMA 3BCHA 4N8DA 3REGA 3VR5A 3EZFA 3N2IA 4NL4H 5ALMA 1Z39A 4CDRA 5CVVA 4EI7A 2O8CB 4TPKA 4CKYA 1NU8A 1UEJA 3GUYA 3CZAA 5JISA 1QHYA 1NIJA 3P52A 5A0FA 4FYXA 1JIJA 1UIMA 1RYNA 4BNHA 1PVDA 1U28A 1SXJD 2DULA 1YB7A 2W48A 2HQSA 4FI3F 5FA8A 4CMGA 1KI1A 1SURA 1HEUA 3QELA 1FNMA 2I0FA 3K9CA 2YBEA 2NYUA 1H8HD 1C3JA 4I8XA 3MTIA 4L6AA 1NFFA 2M6RA 4JMLA 4RPJA 2YMQA 2X2OA 3W5UA 4DNPA 5KUTA 2Y92A 5FJJA 4RMGA 3TD6A 1G17A 1UT5A 1K08A 5KTOA 1GZHB 2J7PA 1T8RA 5KZMB 2ASVA 2GFHA 1A8UA 2GNOA 3TLYA 1ZFNA 4Q47A 3OIWA 3RS0A 1H6DA 2B69A 2DPYA 4M9UA 4C21A 1UCFA 3IXQA 2FWNA 3UG6A 3VPXA 8LDHA 4B3SB 3OIYA 4D2IA 5BYKA 1KYYA 3WDLA 5F2KA 1P1CA 2J0UA 2ZIGA 1VIVA 1PAUA 4ON9A 4EYQA 5FH9A 1OWNA 3TN7A 3IYLW 3SU8A 3RADC 5HJ5A 3T9FA 2W93A 4J3JA 1ENOA 2AOUB 4NZZA 1NQXA 1QTIA 2CVHA 3AG5A 1AN0A 3M6VA 3OCXA 2ZT7A 3NR2A 3PQ6A 2Z8YM 3BIOA 1J8DA 1MX3A 2E5FA 1GSOA 3LQ2A 1R12A 1XQVA 2QN2A 2X9QA 4IKEA 4Q9JA 5GONA 1GHTA 4FLEA 4EA7A 4O4IF 3ESBA 1XDBA 3PFNA 1LSJA 5T41A 1WMSA 1Q44A 2I87A 4LRQA 3SMVA 1I4DD 4YR9A 2RAVA 4CLRA 2CV0A 1EUQA 5AKLA 3CYFA 4HYEA 4CR7A 1Z0ZA 5EWJA 2CLIB 3W6ZA 5KMGA 4MRRA 2W83A 3P2IA 3TMAA 2DLDA 5FTJA 2LXNA 2VPYA 1U4OA 2IEAA 1BYUA 4DYHA 4DBVO 1KO8A 1U2DC 3HL0A 4DXHA 1WW8A 4C4OA 4EHNA 1GCOA 1Y4SA 5MFPA 1HDEA 2C7GA 2IPOA 1QHHB 3P9SA 2GZ3A 3TW6A 1XZLA 1JQ5A 5JLJA 1FVXA 4NR0A 1M6WA 3Q98A 3STTA 2J67A 3QXXA 4L3VA 1R0CA 3IQEA 5I7RA 1O6CA 4N5IX 4KN5A 3RIGA 3RFUA 3VYWA 4WNCA 1H0KA 2Q1YA 2IZZA 1LQ2A 1K8RA 1UJ6A 2RH9B 3OA2A 4H4DA 2B35A 3D6HA 2DQYA 4HK4A 5CK4A 1MNQA 3LCUA 3LY5A 5JCOA 3E2PA 4F04A 1EFRA 3ORSA 1SIUA 1OR8A 4FOOA 4YJ3B 1KDYA 1ELOA 2YZMA 3TKYA 4RM3A 2YHBA 3STYA 3SHQA 1X14A 2QUIA 1NF2A 3NIGB 4PZ9A 4XUCA 5BQ3A 3GEIA 3ZGYA 3CRMA 4PC6A 1GGFA 5JSUA 4I3FA 1TJYA 3T8YA 1NBMA 3KYCA 2EKPA 4MVWA 4PINA 1PFWA 4XAQA 3EGOA 3OY2A 1LS1A 3SR4A 1T3LA 5DNUA 4AMGA 4GBED 4B2IA 1QGDA 2WLTA 1AA9A 2XH8A 3R76A 4GSKA 4OGLA 3TQIA 2PZAA 3IUQA 3SBXA 3VI3B 1DDOA 1C9YA 1E94E 2DBRA 1PK8A 3DZJA 3GB9A 4DILA 2NYVA 2KSQA 2QQEA 3BKXA 4Q9NA 4YP7A 4BYGA 2VQ3A 2C04A 2C7QA 4XJVA 3ZCSA 4BIMA 1O7JA 1I30A 2FPUA 1G5FA 2CLMB 2CWWA 3CSSA 2M98A 5D5PA 2O3SA 1SC9A 4D4LA 3ET5A 3VDXA 2GBPA 1FFGA 1WDTA 2ODWA 3BH7A 1M1XB 2PD6A 1H2XA 1VL0A 1WZNA 1E98A 1CY1A 1U6IA 1W9MA 2ZT8A 4MMYB 5IUKC 3AZOA 5TR9A 4MUJA 3RI3A 4F5WA 4ZZ3A 3BXFA 1G8AA 1MA0A 3UHOA 3R9XA 3W4KA 3MS2A 1PZFA 4BKOA 5HCNA 3FLBA 4KJZA 1M0SA 1QGAA 2F3RA 1ZMXA 3AH8A 3K0HA 3Q10A 3R20A 2HC9A 1HEYA 1OBHA 4K3UA 1K7YA 4Z53A 3LDHA 4J94A 1XTKA 1ZBDA 1E9SA 3KKOA 2VKQA 4KN8A 4FSDA 3B9PA 1BNCA 3AM4A 3H16A 1RPNA 1IQUA 3DBHA 3VZBA 3DMRA 3VKWA 5JC1A 3AHEA 4MI1A 1C1DA 3WBKA 2ZDQA 5DLQC 1C50A 5JSHA 3LUFA 3ZWPA 5C18A 1EGHA 1M2KA 3V8EA 1QNFA 1R0LA 2C77A 3OTOB 1WDMA 3U4DA 1AKQA 4XVUA 3CVYA 2FQ1A 3UWPA 1MDFA 2WIJA 1I9CA 5FB3A 2JFNA 4XB6B 2GF0A 2CE2X 4HVLA 3R4VA 4Y0VA 2I4LA 1ZESA 1GRCA 1WF6A 2ZEJA 2NXWA 2E82A 3PNLA 4G1BA 1CUFA 3SQNA 1ECBA 2J9FB 3Q0TA 3GRPA 4V24A 3ZV5A 1ZI6A 2O8BB 4EEXA 2QAJA 1OI4A 1UZUA 1N3IA 1SPXA 2G71A 5BN4A 2JJ1A 1ZI8A 5GINE 1ZOSA 2ALJA 1SY7A 4L6CA 4OIFA 4Q3AA 3RBZA 2NUTB 3RVOA 3WB9A 4BHTA 4B2PA 2ZRJA 4GT1A 4CM5A 2V0GA 1LTHR 1ULAA 3S6JA 4YMHA 1CQPA 4ZOQI 3E2IA 3UT5A 4C5CA 4DDHA 4YPVA 2FRVA 1I2AA 4HLDA 1G0NA 1QH8B 3QU9A 4OXYA 4B43A 4BGEA 3HWRA 3GPLA 3B6KA 3UYLA 2XRFA 2O7NA 4Q3EA 1KY3A 3B2EA 1NR1A 3H2ZA 4ZOAA 2IDZA 2PQ2A 3DBLB 3ESZA 1M6HA 3LGXA 3MWEA 3IQHX 5E9WA 3NPAA 3UB4A 3UB3A 4URHA 1QHIA 1YFJA 1BKYA 1CCWA 1JVBA 3IOBA 3Q8KA 2AXQA 1X7XA 1M5RA 4DIOA 3GRRA 4RPGA 5DGDA 1WL8A 1W30A 4WFKA 4L51A 3R8XA 1SBIA 1V0JA 5BYBA 2A1UB 4BTVA 4MQBA 3K0AA 3MINB 4DMKA 2QRVA 1DHTA 1VMIA 3C39A 3FDFA 3W3AA 1N5MA 5EJAA 4ARZB 4KE7A 4K40A 4BKRA 1YOVA 4E14A 4JXKA 2CEAA 3BB1A 3ENWA 3IIMA 4K9NA 4ZOLF 4N3CA 4D45A 1ZR4A 3QVMA 2HW8A 3CE9A 4RZQA 2QYHA 2YV3A 5B3JA 1ACMA 1KSFX 3RIYA 2EBFX 1IEWA 4ZOEA 3FPBA 2PS1A 2AT1A 2QTMA 1FZQA 1C0LA 1L5FA 1U2ZA 2WNHA 4KXYA 2ZIXB 3WHIA 3AC0A 2K7FA 4TMVA 1S2NA 1J9ZA 2FEXA 5KJFA 2DUNA 2H17A 3NEAA 4Z2AA 5B2EA 5JAPA 2XEDA 1XTJA 3KB1A 1QPGA 16PKA 1B8OA 2GPAA 1DZ3A 3BFJA 2D5CA 3FI0A 4PLYA 5FPHA 1QFMA 5LA6A 4YJ2A 3GEGA 2FMTA 1LJ8A 5K0CA 1T9DA 1DXQA 3RKUA 3ZZNA 3BK1A 3IALA 2XYVA 3NCTA 3KJHA 1H1TA 5ITWA 2AQ8A 4J4HA 5AJZA 4H0CA 5DHPA 4W5WA 4J75A 5GOTA 4AC9A 2VP5A 1T0PA 4FCCA 1O97D 1SVLA 2I66A 2VNJA 2WE7A 4GIBA 3EXFA 4DE5A 1VDMA 4WKOA 3GDOA 3MGAA 4KXLA 2A9RA 4IFBA 5LOVF 1ZGGA 3PEYA 1EK6A 1QU2A 4DR1B 2ZBQA 1LSOA 3GG9A 2P3SA 3JQRA 3TH5A 3BD8A 3FWYA 2QR2A 2ZE5A 3C8HA 2DM6A 4UEWA 4WZ6A 3HKDB 1EE1A 1U2GA 3IS3A 3KXPA 1YS2X 4ZJUA 2VBIA 1XHFA 4HNHA 5H82A 5CB4A 4YLEA 1X9HA 4DLBA 1N6RA 1AHHA 3FR8A 1U9IC 5FWAA 4AG5A 2QG4A 1LY1A 4IUYA 5CLFA 1H2YA 1GV0A 2P7IA 4J0KA 3WLRA 4BQRA 4D8WA 5KX5F 5HF6A 5I7SA 2YBDA 1C1HA 3G89A 4GMXA 4QQKA 4ZGWA 2RG7A 3QFFA 1SWVA 1JDBC 5K4HA 1DTEA 2BRUC 3ROTA 1B15A 3IE0A 4ZU3A 4KUGA 3GLUA 1GITA 3NC4A 4H3VA 3SY8A 5EPUA 1YMUA 3DMTC 4FZVA 1UXGA 3O8NA 4TKZA 4YRPA 3VC7A 3HA5A 3AEKB 1NUTA 3PHCA 5EZSA 1W76A 2QRPA 4KWTA 1CDOA 3F47A 3OEWA 4QUIA 4UUAA 4BE7B 1ZW1A 3NHJA 4D9NA 1TCUA 3G6WA 1E1QD 1DKUA 1OE0A 3M1AA 3NHYA 4OUDB 5ICCA 1Z0KA 4IKOA 1EU1A 3O8OB 1EFUA 2FSFA 2HDOA 3VUEA 1BWSA 4FXOA 2CY0A 4B48A 4G1FA 4NYJR 2BN4A 5AI9A 1Z35A 3R3HA 3KE8A 2XXAA 3TLKA 3GCWA 2GJ9A 3ZX5A 5GAJA 1G5RA 1IQ0A 3ZD9A 1BXGA 3TMYA 2C83A 2G76A 5JYDA 1RQ2A 2RHGB 1HQDA 3OZBA 3L0CA 1VZ2A 1PZEA 1SKAA 3TVYA 2VC2B 1GQYA 4BNJA 3GT0A 1CZNA 3GJYA 3THXA 3M5WA 1UFKA 4BVLA 2LDXA 1T1GA 5KQGA 3Q7EA 1KEZA 2EJWA 4YTEA 2EBHX 4KR0A 2C2KA 2HJSA 4INOA 4IG9A 4WXRA 2AFVA 1FU8A 4KRXA 5D7BA 1BE8A 2DGDA 3DQQA 4TKMA 3RU3A 5CW2A 1Y42X 3TJZA 1PFUA 3EIFA 4NOLA 1WWKA 2VQSA 1GA6A 2XGJA 4WACA 5U4XA 2PCJA 2ZRCA 3JAWB 1M54A 1KDVA 3OQIA 3WISA 4EY7A 5IH7A 1DC4A 2XVZA 4DC0A 1FP1D 4RGBA 1OT5A 2XQKA 4I50F 1O95C 4V0KA 1IG0A 5DGCA 1V8DA 4DA6A 2P90A 2CXQA 4NQZA 4X60A 1IFXA 2YCBA 5ED4A 5BSKA 1KR5A 4PSKA 1OU0A 1V2GA 4EW2A 3VZQA 3IAUA 1KHHA 1F9AA 3GI1A 4HDNA 4TWJA 3V5NA 1PL6A 4ZN6A 1ST3A 4DDUA 1ISJA 1VKNA 4TT3D 4HDRB 1S1MA 4TS9A 3K6SB 4EPWA 1C7EA 2NXNA 3QM1A 3EZYA 1ZH8A 3IILA 3AQ4A 4WLNA 5ENDA 5ERYA 5JU6A 1QTQA 2VHYA 5KREA 5IF9A 1CLEA 2WP8J 2Z5LA 3IR7A 3MJEA 1UMBA 2PQ0A 1PLKA 1COZA 2M9MA 3T12A 1Z5PA 4JJ8A 2BBOA 5EMMA 1YFZA 3QPAA 4D41A 5A4DA 1OXMA 3G8AA 2B1JA 3OF2A 3D1VA 4C0WA 5TF0A 4LVCA 1O03A 2O3QA 3UGQA 3KB2A 1V4NA 4O08A 1P1RA 5LBTA 4CFZA 1E1NA 1TD9A 1WSWA 3AR7A 3GNLA 3K70B 3B51X 4XB2A 2YFQA 4IIDA 3OU2A 1EZ1A 3VTZA 5FJIA 4ZIRA 3G0OA 1KMHB 3NGXA 4EHBA 1XPRA 1AUXA 4BLOA 3IVXA 3RHSA 1SIOA 2C42A 2O59A 1JALA 3V4OA 1EB9A 1ZR2A 4UHJA 3AR5A 4EW6A 4DA0A 1Z0AA 2C2WA 1OXTA 3FN4A 3JYPA 3QBJA 4RF4A 1ZCZA 4Z5XA 1RKQA 4FE4A 2RHTA 5DEIA 3DFFA 4ZJYA 4G9GA 4V3BA 2RHDA 2QXYA 3GT7A 1KC3A 2WYHA 4D92A 3ZE7A 2FDCA 2PRSA 4U6NA 1ZDMA 3VPGA 4YAFA 4DCVA 2JLAA 4H9GA 4Y2UA 1S02A 2W2KB 1LZKA 4GDMA 1DFIA 3AF1A 2OXCA 2CHUA 2IDKA 2I9PA 2PTGA 3MAGA 1M2VA 4F2PA 1HMPA 5HRCA 2RARA 1VA5A 4RTLA 2AK2A 2C31A 4EB0A 1X8XA 1RE1A 4BLRA 3FGOA 1M73E 4EYSA 1XNJA 4CIDA 1QQAA 1E8NA 4Y1GA 2ZUEA 2QRZA 1G2QA 2AKAB 3ZVRA 2FHPA 3BGDA 5HPYB 2C57A 2AH5A 2RSLA 1QDUA 5FI3A 3PE4A 4JI7B 1G1AA 1ULUA 4ASUA 1EZZA 3SYRA 2SBTA 4XRRA 4Z9FA 2CJPA 4KBGA 2ZB8A 4KUHA 3IKJA 2LE0A 3C5CA 4CM9A 2XYQA 5B5SA 4N0EA 4DWVA 3QMWA 4I9GA 2ZZMA 4GRAA 5DYGA 1JSCA 4K86A 4MI6A 4JMPA 4KO4S 1J0DA 2Z98A 3ZWDA 4MWGA 4ZHSA 4RK7A 1LTQA 3C7DB 1UBRS 1MQAA 2OVFA 3IMKA 1Z68A 3ZDCA 5KNCA 1OSNA 1OXXK 2VCEA 4P4UA 4PY2A 2A9KA 5HP4A 3M89A 3QQPA 2IW1A 3C6MA 4DOMA 5I4KA 3FWNA 2CYBA 5DLDA 5BNZA 1TMOA 1JDZA 3WGNA 4TYQA 1E60A 2FFJA 2WMOB 3FYHA 2R6R1 1NY5A 1T5HX 2PZJA 3KU4A 1WBDA 1VKJA 1OC2A 1C7JA 4KWHA 4NG4A 5B4TA 1D03A 1SQSA 3M3HA 3PC4A 1CZLA 1WUTA 4P92A 1C4OA 3X1WA 4G0XA 5AUOB 2JASA 2PFGA 4L78A 1U90A 4NPCA 2CJXA 1DKPA 2YXPX 1DRKA 3ETNA 1WABA 3FZGA 4J1TA 4PQFA 2OV4A 1YBVA 3TZLA 4G3XA 1MVNA 1SC1A 3ZNNA 2HCJB 1QVVA 4M1EA 4OHMA 5IDVA 2XGOA 5KQRA 5CIWA 2R8YA 4EAQA 1XYGA 4X00A 1T5IA 3GFVA 3QBEA 4TXHA 4DLVA 1L4KA 3LOQA 2OO5C 4PQYA 4JP1A 2GKOA 4LOJA 3H65A 2BFEB 4ZT4A 3CVVA 3OUUA 3TUJC 4PAOA 2DFKB 4JR0A 5HKKA 3OFVA 1C3VA 3KT3A 3PPIA 2H4WA 2VUHB 3OPYI 4HATA 5A0TA 1MAWA 1C0IA 3TIFA 2H7VA 4WXEA 3FYSA 4QOHA 3QZUA 3KQWA 4M2LA 1DQRA 4OK5A 1E8MA 4ZCTA 3DEKA 1JA9A 5AI0A 5GONB 3OE1A 4MUKA 3R9IA 5F98A 3PGXA 3IXMA 3H9EO 1DG3A 3L6OO 1D2AA 2HPZA 3I53A 3ZKWA 4G26A 5KTSA 4BVHA 2QLBA 3WS7A 3D59A 1T9GR 2FP4A 2WT8A 3OZUA 2F1OA 2DWUA 2I65A 3I4LA 5DN6A 2OHJA 2OBFA 1I4OA 3M6AA 4ZPXA 3GIDA 4YRMA 1VL8A 1WAMA 3O8DA 3E3AA 3IHTA 4K9OA 3BE8A 3B1WA 3R7DA 3SXJA 5JCXA 1VMEA 2HU7A 3ACCA 1M8GA 3K9LA 3SM3A 4CKXA 5J2UB 1NX6A 4PGFA 4QHYA 1YHZA 3ZV3A 1FTYA 3O8BA 4AWXA 2FZGA 2V45A 2DPMA 1E3WB 2GEKA 1JI3A 1M2OA 2BGNA 1Z07A 2P5UA 5IN4A 3T7RA 4DCMA 4NZMA 5BXQC 1OFHA 1VE3A 2QX6A 3A9TA 5J43A 2GUGA 3EPRA 3SS8A 5AK6A 2LTAA 2I7XA 1PNOA 1WHTA 3CFYA 5JLAA 4LRTB 4F3CA 1WA5A 2GO7A 3VSBA 4CMIB 1DTWA 4YAGA 5CA0B 2BJWA 3KLBA 4W4TA 1HT3A 2KLHA 1UINA 2I22A 2PBRA 4PC1A 3VR5D 3GGSA 3LVFO 4YASA 1KRWA 1VLLA 2A9QA 4L28A 1R5BA 4L1KA 5LUAA 2IHUA 3KBBA 1OBOA 5LU8A 2CXTA 3EA4A 5EKDA 2IPMA 4CG0A 3FCEA 3P94A 4JSRA 1C7FA 4GI3A 8AT1A 5FOQA 2P6RA 4RJTA 3F71A 1MC1A 3Q3VA 4W9MC 3IBYA 1NT4A 3EZ2A 4QAJA 4JA0A 1FFSA 3HM2A 5FWYA 2E4YA 1TI7A 4G5YA 5EXTA 2I7VA 3PUWA 5ARDA 2BF7A 1FRNA 2J7PD 2WJ4A 5LWHA 3LTNC 1M0WA 3E0QA 1IVNA 4TWRA 2UUBB 3PFBA 3T7AA 1XIVA 1KO4A 4M1OA 2XGMA 1Y1PA 2YOHA 4Q02A 1JAZA 1GRVA 1ZC3A 2OHVA 3C1AA 4O4HF 4OQDA 3RROA 2ZRAA 5JJKA 4DA4A 3DBVO 3UJAA 3GN2A 3DCYA 3E53A 1U3TA 3K72B 2O2XA 2VA8A 4X6UA 1U0OC 4JL5A 4TYWA 3AL2A 4GLJA 4S2UA 1BX0A 1IPEA 3NHBA 5JHGB 2VZ8A 5F3DA 1FFXA 3UMVA 3KOUA 1T1SA 5I9SA 3JALB 2BLLA 2ZJOA 1ORHA 4OMUA 3SDSA 3CPEA 1JDBB 3DF9A 1QZZA 3MC1A 4QTZA 3VPDA 5GIOE 3EEOA 3GLGE 3TZKA 3HKBA 4QC2A 2VPQA 2II6A 2JI6A 4MRNA 1T15A 3B3JA 4CKBB 1SJ9A 4MAMA 1MJNA 3ULKA 5J3JA 1DC8A 4YR7A 3S29A 1HLFA 5DM0A 1L7VC 4RVNA 2GAOA 5IX8A 4JQYA 1GQOA 4IVRA 3U9SA 2YWDA 4ZYLA 2Y1EA 2H52A 4UATA 1DAPA 1EH5A 4H2DA 2NSYA 2KB0A 2DTDA 3M1YA 5IJWA 3RV4A 5FA6A 4AO7A 5HF9A 1ZA1A 3EA5A 4IRUB 4DCOA 4Z4HA 2OV8A 4RY9A 1BKDR 1DBRA 3TR0A 2PRIA 4PXSA