3BB4A

Crystal structure of toc33 from arabidopsis thaliana in complex with mg2+ and gmppnp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
240
Chain Sequence
b'EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDELLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
molecule tags Hydrolase
source organism Arabidopsis thaliana
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
total genus 78
structure length 240
sequence length 244
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb4A00
4RD4A 1AGRA 5H8WA 2NO7A 1E2FA 1G291 4OJKA 3LXRA 3SE0A 3QKUA 5BXQC 1N6PA 1ZUIA 2Q6TA 5H68A 3FOZA 2J0QA 1E1RD 4JVLA 2ORVA 4JLAA 1G5PA 2QTFA 3FB4A 4MKFA 3UG6A 4B3FX 3GLIB 3ICQB 2E87A 2W2VA 2CL6X 2JCSA 4M22A 4Q19A 2DYKA 3SS8A 2OXRA 4XH9B 4YDSA 2JLWA 2GDJA 1E6CA 4HB3A 1G7TA 4IFEA 3OHMA 3BJIC 5AR1A 1MRSA 2WJHA 2FV8A 4MKIA 1CR0A 2R6FA 3W5JA 4JLJA 4Z1MD 1RVDA 2ZITA 2CNWD 4B2LA 2FEOA 3LAWA 4JT2A 5G41A 4F4CA 5JWOA 3KXLA 2YOFA 5KO2A 1FNMA 2PBRA 3B1YA 2QMHA 4GT1A 2ZJ5A 1ZCAA 1UF9A 2ZR0A 1VCOA 3EZ2A 4IEIA 4TMZA 1Z07A 2ODEA 3EASA 3T15A 2ZRDA 4X8LA 1X86B 4DDWA 5HR5A 1E2LA 1W2GA 1DAIA 5EE0A 3W6OA 4AWXA 3BH7A 1L2TA 2NO1A 3DL0A 1UBEA 4LBZA 1BYUA 3EC1A 4I1VA 1N5JA 2VP6A 4DLYA 1VECA 2V54A 2NO6A 3W3ZB 2EQBA 3MGCA 4QKQA 2VP4A 1P3JA 2XNSA 4Q1EA 2BHRA 1IN7A 5CITA 3TRFA 2CBZA 2CCJA 4PC7A 2G88A 2MSCB 1ZRHA 4Q5IA 3AV0B 4L8GA 4IJMA 1RRCA 5FUYA 1KI6B 2RGEA 4MRPA 1QBKC 1HE8B 2JDIA 1SKQA 3PXGA 2HT6A 5C4MA 3S1AA 2Z4RA 1N6NA 1KDRA 3SBEA 5AUOB 4RD6A 121PA 1OSNA 2QNRA 1IXZA 4A36A 3MCAA 1QVAA 1A2KC 2KE5A 3DZDA 4FD2A 1LTQA 1T0JB 4JLPA 3U3OA 3BS4A 1EESA 3B9QA 2GEUA 4Q9IA 1NMYA 2CE2X 1XCGB 4HYYA 1CBUA 3THWA 1X8KA 4QG7A 4CW7A 2OE2A 4XVQA 1KMQA 2HUPA 3NEJA 2FSHA 4C4PA 1W0JD 2V7QD 4ILEA 2EFDB 4I1SA 2ZVQX 1C9KA 2O8EB 2NPFA 3THWB 2EYUA 1Q3TA 3A4LA 2GXUA 3WYAA 2FU5C 3AF1A 1UKZA 2IEYA 3B5JA 3Q72A 1RRFA 3LLMA 2G77B 3ZYCA 3CRQA 3QKRA 4P3YA 1YR9A 3GEIA 5KSZA 3NBFA 1XJQA 1GNPA 3EIHA 3B85A 3C16C 4RD1A 5GJCA 1MRNA 1CR4A 1VYVA 1YQTA 1XXHB 2GJ9A 5CIWA 1U98A 5FOSA 3LWNA 2J9RA 4TMKA 2OAP1 1LB1B 5CK5A 1GVNB 4KFTA 4Q4JA 2ZS9A 1NJGA 4WW0A 2C8VA 2H92A 3TJZA 1W36D 1DO0A 1R0WA 4Q9HA 2QROA 3QI2A 4N3NA 4DLSA 2A7QA 3TQFA 1I4DD 2OG2A 3PEVA 4B47A 1E2IA 1NLYA 2RH5A 2ZU6A 1P7CA 3KQHA 3GQBA 1Z0JA 4JJKA 4DT1A 2BMDA 3TIFA 5EXSA 1KZGB 3OIYA 4N0DA 1GAJA 1QG2A 1Z28A 2VP5A 1GZSA 3BFVA 3ASYA 3KXIA 3REGA 5IT5A 1XTKA 2REBA 1JJ7A 4F7WA 5K8IA 2IXEA 4Q18A 1HQYE 4HAWA 2I3BA 1Q20A 3HWSA 3TKLA 3L82B 3KKOA 5GJWC 1NNEA 4Q1BA 5B2ZA 4QHTA 1LW7A 4BWYA 2GZAA 4D0GA 3MJHA 2A5FA 2UKDA 2WJYA 4TL9A 2JJ1A 5EUQB 1S96A 5JJKA 1PUIA 2RGXA 4QGGA 1WBBA 3GLGA 4RCYA 5EXXA 1BO6A 4I99A 3AVTA 2QU8A 5JEDA 2BKEA 1KNXA 2G1KA 4QC2A 3UPUA 3AH8A 4PPGA 1JECA 5IHPA 2AHOA 2P5TB 3QEJA 2FFAA 4ARZB 4RFVA 2G83A 3QXJA 1RYHA 1WF3A 2FF7A 3K0EA 1RJ9A 1BYIA 1G9XA 4HLCA 2C98A 1G3MA 2ZRBA 1XMSA 4LPSA 1N5KA 3RHFA 3SYNA 4B33A 1NF3A 1KJZA 3NDPA 4HB4A 4KAXA 3AKDA 3VTKA 4MDFA 3SFZA 1E9AA 4TYQA 4D81A 1E2JA 3BB1A 1T3HA 2F1IA 3DOEA 2BJVA 2ZJYA 3EARA 5AK0A 4CVNA 2ZE7A 1I2MA 1J99A 3W6NA 4DCUA 2ZAOA 5FOXA 1G3RA 3C5HA 4QNRA 2IYQA 4FW9A 5HE8A 4DLTA 5CB6A 3R7WA 4CZ2A 1KKMA 2HYIC 2IYSA 2ZJ8A 1ZD1A 3GJ3A 2OT3B 4ZCMA 4BZQA 2DFKB 5FPYA 5KPDA 4RFSA 1UKVY 2IYWA 1KO5A 2ZRCA 1KI3A 3UG7A 3BC1A 3PUZA 4D4KA 5JHGB 3LLUA 5FOVA 4AG5A 2WJIA 2YWHA 2YHSA 3QENA 4B2IA 4PANA 4Q1CA 3TVTA 1U81A 2FSIA 1D5CA 3FDIA 2GAOA 1ZBDA 5FOUA 3TR0A 4PAMA 3R9IA 1T0HB 3KJGA 4TTPA 1N0VC 4A1FA 2P6UA 2QP9X 4QXAA 3SZRA 4I81A 1ZU4A 1I4LD 2FFQA 1AQYA 2O0HA 4NCKA 3RC3A 2B6HA 4A15A 1W49A 1ZM3A 2QM7A 2H5EA 3ZDQA 2IEZA 2LWIA 1TUEA 2V55B 2HDNB 3PEYA 5HZHA 4Z54A 3QXXA 3EWAA 1FUUA 4UKDA 3VX4A 3LX8A 4TMXA 1J7KA 5P21A 2CLCX 2ZPTX 3GLGB 5E7MA 2XAUA 2EFEB 3H86A 2RCNA 5TV2A 1S3SA 1TU4A 2VTKA 3I8SA 2NQ2C 4HUQB 4AKHA 4C0HA 2FFBA 1D2EA 3RS3A 2J7PA 3BIFA 1GL6A 2F1JA 4C0KA 2IYLD 3QOFA 1JQLB 2JAQA 1BKDR 4G1UC 1BMFD 4G5SA 1JR3E 2ZRJA 3GMTA 2G0TA 5C4GB 3OAAD 4CIDA 4D0NA 1R0ZA 4NCIA 1ZNWA 5TB5A 1ZCBA 1LF5A 1X3SA 3B1WA 4DSNA 2SHKA 1E94E 4KITB 4HEJA 4HLDA 3UMSA 3HU3A 4GP6A 1NN5A 1Z8FA 2ZI6A 4V0KA 3IHLA 3D31A 2A30A 3W8NA 5B64A 2EFGA 2KBFA 4UNSA 3CRVA 3U60B 1TEVA 3FTQA 1NY6A 2RMKA 1JR3D 2X2EA 5E7JA 1E1RA 3SI7A 2HXYA 1FOEB 3KUDA 2CLSA 4QJ5A 4DZZA 1VG1A 1OF1A 3QQ5A 4BFWA 5FL3A 2OFWA 3ADCA 1R5NA 2PX3A 2X19A 3KZ1E 4EQ6A 4M9XA 2AXNA 4JL6A 3VX3A 1ZJ6A 5EXTA 2IK8A 3L0IB 4KI0A 4ZKDA 5G3ZA 4B44A 3A4MA 3P4XA 1P9NA 4BQSA 3HJNA 4QBFA 1XCMA 4AK9A 1R10A 2ZYWX 3P20A 3MWYW 3DMDA 2R6AA 1IY0A 4HDQB 1II8A 2IBMA 1E2QA 1OE0A 1IY1A 2FNAA 4Q7MB 1RYFA 4H9GA 2GVZC 3MSXA 1NIPA 1W4RA 2PCJA 3OEHD 1F2TB 4P31A 3TMKA 2NG1A 1NLZA 3A36A 5EZ6B 5EE3A 1AK2A 1CJKC 2WWHA 3AF0A 5HCNA 4UNQA 3SJAA 2HEIA 3OIUA 3I5YA 1W0KD 2IT1A 2WMOB 4F91B 1S1CA 2F43B 3PUXA 4HAUA 4UQOA 3BE4A 1CEEA 2ZE8A 2I1VB 2RGGA 1GDDA 4P33A 4DDTA 3QPWA 3EC2A 2JJ1D 4HDCA 4DCTA 2B7CA 3SBDA 1XFAA 5AUNB 2VYFA 1VCMA 2OBMA 3PEWA 1S9DA 4U5XA 3U6KA 3E2IA 3GFTA 1ODFA 2RKOA 3QVVA 1OH6A 1M1YE 1UM8A 4BFZA 3KKQA 4US2R 3BFKA 3LBHA 5FTJA 2WHXA 4NU0A 1J70A 2IYTA 1TQ2A 2ZRMA 3DEFA 1EFRA 1XB2A 1Q3HA 2QA5A 2QI9C 1CJMA 5EP1A 2JLYA 1J2JA 1FTNA 1QHNA 3H84A 1XTQA 4W5JA 5DSZA 1G64A 1NSFA 2CCGA 3V4FA 5HZKA 5BN4A 4Q7LA 1MT0A 1G8FA 4TT3A 1XTJA 3PENA 1TNDA 1NBMD 3K9NA 4NPHA 2J0UA 4UNPA 4EIWA 4NCHA 2FX3A 2R6GA 3NHBA 4FMCF 1IM2A 3T61A 4LK2A 4MRSA 4D6PA 3SQXA 4LJ7A 4YXWA 4PZZA 2AWNA 2IHBA 3OZXA 5L3QA 3AVQA 3OIVA 1PJRA 1TQDA 4BPBA 4FWIB 5BQ5A 1Q1ZA 4DVGA 4PQYA 2PZFA 4IEEA 3K0AB 3PR1A 1GSIA 2AKAB 3THYA 4JSYA 1QHIA 5CLQA 1XXHA 1A7JA 3CH4B 2GEDA 4EPYA 2VH5R 3C5CA 3HYTA 2GESA 1WCV1 4L5BA 4ZO4A 3C15C 4LHZA 1MH1A 3GEHA 2QBYB 4IOLA 2YWEA 2ZRIA 4Y0VA 2WAYA 1OFHA 1I4TD 2FGJA 1JR6A 3FHTA 2BBSA 4V0OA 3T1TA 1Z29A 1G4UR 4O2RA 1B23P 3MUFA 3RNLA 2W2XA 3IHWA 1E2GA 1RZ3A 1AZTA 2NGRA 4US1R 1OIXA 3AVXA 1G8PA 3I73A 2KI5A 4S35A 1OV4A 5FTNA 3UWOA 4JIMA 5DYGA 1II0A 4PHGA 3T5GA 1OFTA 2B92A 3CNOA 1A2BA 3CF6R 3VKHA 2GHIA 2D74A 1KY3A 1KOFA 3G0HA 1DAGA 4IVQA 4V0MA 4BECA 4G5OA 1YE8A 1GFIA 2O8CB 2QP3A 2YJTD 1V43A 1KI9A 4KVGA 4C9BA 3GLHA 4HLUA 2PLFA 4CT4B 1Z0DA 2O8BA 1M7BA 3IKJA 2H57A 3X1XA 4G5RA 4B3GA 5DI3B 4EPTA 4D80A 2FZLA 5B30A 2CCKA 1GP2A 1Z63A 5CK4A 1K5GA 2ZRFA 5E95A 5K8UA 3IEVA 4BFYA 3LQQA 2PMDA 3U4QA 4LX0A 4II7A 5J40A 5JLJA 2P3SA 2ZVPX 4OHVA 2OESA 4M9QA 1GKYA 1UDWA 2W83A 3BRWD 4BRUA 2WKPA 3NKVA 4KBGA 2P0EA 4HLUC 3KQLA 5HTKA 2RB4A 1R0YA 1E69A 2DWOA 3BERA 3KXKA 3N2IA 2OCBA 2RGDA 3WMFA 3R9WA 1F48A 2B8TA 1EFUA 4P32A 2CE7A 2R8RA 4LY6A 2IF2A 5LD2C 4DSOA 4JVNA 1FNNA 3QG5A 2ECKA 4H1VA 1JAIA 3F8TA 4Z1MA 4XD7A 4XVRA 2VHTA 1GRRA 4HI0E 4YMWA 5K8TA 3CB4A 821PA 1JR3A 2ZRLA 4GZMA 4IW3B 5B57C 5L3QB 4YMVA 2FPMA 2Q9AA 4NCJA 5GADl 4QOSA 4AI6A 2ZYTX 3LV8A 4GOJA 4ESVA 2Q3FA 2D2FA 2EU8A 4NYMQ 1DADA 1K6MA 2OBNA 1NBMA 4ZDWA 1HT1E 3CM0A 4I1UA 1S8FA 2YVUA 3ZZ0A 5FOWA 1KSHA 5JJLA 4WOPA 1VCNA 1X1RA 3L8YA 1XTIA 3F3YA 1NIJA 1VPLA 2HJVA 3A1WA 1G21E 2WWFA 1KI4A 3BK7A 4BUJA 3I1FA 1E2PA 1KHTA 4E5UA 3K0FA 4IXNA 4KODA 1TF7A 2YC4C 2GCOB 3T1VA 4BE7B 1WMSA 5DLQC 3LDAA 1T3LA 4XOIA 2P67A 2QENA 2R6DA 3CZQA 3TSZA 5JCPA 4OQFA 3C4JA 4RCZA 3AGQA 4PAQA 4N1AA 5JI3E 3ADKA 3ZVRA 3VNVA 3C7KA 4Z8YA 3TVDA 2OFOA 2Z43A 4B34A 3NHAA 5UKDA 2HCJB 2O5VA 4URVR 1GNRA 2IYYA 4FCTA 2EFHB 2F3TA 2ZEJA 3BH6A 1WA5A 3OEED 1U0JA 1W2HA 3IO5A 3F5FA 4JLMA 2H18A 3CX6A 4LHVA 3JZMA 1KZ7B 3NBXX 3KDSE 4JMPA 4CRWB 3L2OB 1YZNA 2V8OA 1EX6A 3GFPA 2P6NA 3CWZA 1DS6A 1DG3A 1GUAA 3W6PA 4AY2A 4K46A 4P4UA 3PUYA 2PCLA 3VR4A 2A78A 3HU2A 3EG5A 4NYJQ 1SXJE 5F2EA 1SVOA 1P2TA 5AJWA 3ZQ6A 4PO1A 2BM1A 2CXXA 3TR5A 4Z51A 1E0KA 3CR8A 3I3SR 3RC8A 5KU1A 2IYUA 2IHYA 2ZRGA 1II8B 3I61A 4LZZA 3PCRB 3KTAB 3MMPA 4DSUA 2A2ZA 1QVRA 4TLCA 4W5WA 1GNQA 2OLJA 2EWWA 2JLSA 3BAFA 3EZ6A 4DDVA 1H8HD 1G19A 4TL7A 4EKDA 4Q4LA 3LQRA 3GPLA 3Q5EA 3GLHE 5SZJA 3Q85A 2XNDD 2QP4A 3NDBB 3EZFA 4D82A 3HR8A 4HB0A 2QMOA 4R2IA 4IRUB 3CPHA 2EW1A 3EA0A 1QHHA 3WHKA 4FMDB 1HT2E 2XX3A 3CNNA 2QQEA 2Z83A 1W4CA 1W36C 1ZINA 3D8BA 2GXSA 4CGZA 1KTVA 1G8YA 1VHTA 5HPYB 4LV6A 1P60A 2WWWA 2VRWA 3FE2A 4MUAA 4RKEA 1GKIA 4L9WA 1V5WA 3K8YA 3WBJA 3DDCA 2CHQA 1ZUHA 4POAA 4ZDJA 5KSOA 3RSLA 2VF8A 1U94A 1ZVQA 3X1WA 1F2UA 4Q4HB 4FMBB 4AKEA 4BFUA 1OXXK 4Q9JA 1CLUA 1P72A 1FUKA 2QEQA 2ANCA 2ZSFA 3OE7A 4UXHA 2FFHA 3VAAA 2W2TA 1PVOA 3AVPA 4A4DA 4P4SB 1EGAA 2J0UB 2ATVA 4TSFD 1VIAA 4FMDF 1NKTA 2W6ID 1RW4A 4LI0A 1W4AA 4BFXA 4HAYA 3GLGE 4DLWA 2RGBA 2GXAA 4TZ0A 1SULA 4Q4JB 4PC1A 4K81B 3IEUA 3QEOA 3Q9LA 4W9MC 3CLVA 4JLNA 1PLJA 1QF9A 1JQJC 3FPAA 3JVVA 4IDOA 3SOPA 3CUEF 1JI0A 1VDZA 4RD2A 1D8TA 3ZD6A 4JLKA 3CRRA 1A5TA 1LY1A 4KYUA 4DBLC 1NMZA 4LC0A 3ADBA 1NI3A 4Y0AA 2IXGA 1R7RA 3CX7A 3THYB 1IJFA 5KUTA 2R62A 4LOAA 2FDCA 4KV9A 3QJYA 4PC2A 4XJXA 3HU1A 3EPKA 1XMVA 1LS6A 5AWFC 1UBCA 1UDXA 3K0CA 1E96A 3CF2A 3Q7PA 4NCNA 4YC7A 2F55A 4PQRA 2PMKA 4Q4AA 4M2LA 2C96A 4RD0A 3UMFA 4E22A 4C2TA 2R9VA 3DPUA 3O47A 1G7CA 4A92A 3ONWA 3FFBA 1XD2B 4B32A 3QY0A 4E09A 2B7BA 4BEJA 1JJVA 1G3UA 3TSOA 4AC9A 1XF9A 1OPXA 1KKLA 2RGCA 3DKPA 4M1KA 4OQNA 2CEAA 5CJPA 3TH5A 2C9CA 3OESA 3T1QA 1AS2A 3PVSA 4KU4A 5CYPA 4B43A 1C4OA 4NHOA 1N2CE 4MGKR 2WWXA 1G8GA 1JPNA 2AFIE 3MAAC 1AS0A 1GL7A 4R98A 4TQ9A 2FG5A 5FI0B 221PA 1G18A 2D7CA 1IONA 4WAUA 4TWZA 5D3MB 3CNLA 3TW4A 2D4HA 4QGFA 3AB3A 5EP3A 4JVSB 1QG4A 4GFDA 2AK2A 1UEJA 3QE0A 2ZYUX 2IWRA 1Y63A 2QRZA 3AKEA 5D3MA 1ZM2A 1PZNA 4LJ8A 3B78A 2QAJA 4LSGA 2QUZA 4EQ6B 2OAQ1 3GLIE 1ZUNB 4X8HA 3TE6A 2P2LA 4E07A 3EIQA 1VYUA 3VR2A 1OFIA 1N6OA 1SVIA 4EUNA 5EE5B 5AJYA 4M0LA 3JZAA 4JYBA 5AJXA 5DNYB 3VNUA 2WM9B 3FMIA 1AN0A 4LBVA 3ZGXA 5E7IA 4KFSA 3HPRA 4MKGA 2GILA 1CKEA 5TVKA 4U02A 1N6HA 5KHOC 4OBEA 2FMXA 1LFDB 3A6PC 1T5LA 1ZM7A 1KY2A 2C9YA 4A0FA 1VMAA 5JJIA 1NN1A 1EK0A 3HYRA 4Q00A 1OKKD 2A5DA 3T06B 2V4ZA 3OIWA 3R8CA 3KQNA 2TMKA 1NMXA 2FA9A 3AF4A 2O0JA 3L0OA 4ZIRA 3ZD7A 3DM5A 4N0EA 3NC0C 3IBYA 1K5DA 1DVRA 1KI7A 2F43A 4LC1A 1R0XA 621PA 1GTVA 5SZKB 4D25A 4TLEA 5JRZA 1Z06A 5IRCD 2J1LA 1J8YF 2WMNB 3M6AA 1COWA 2GCOA 4PPNA 3FVQA 1N3BA 3GJ8A 4LUCA 3VQTA 4CDGA 4DEYA 5AUPB 4ZDIA 5J4LA 4IDNA 4DXAA 3GEEA 1FQKA 4WBSA 1ONBA 3LW8A 1HEIA 1KGDA 3LO5A 1G7RA 2CL7X 2FSGA 2ONKA 1QHSA 1TF2A 2WAXA 2ZANA 1M8PA 2A9KA 1D2NA 1JXMA 4RKFA 1W0JA 2BIFA 1KO8A 2V7QA 5TDHA 1FX0A 3ICEA 4B48A 3FYHA 2X1VA 2MMCA 2F7SA 2CHGA 3EZ9A 4PPQA 4PPFA 3LNCA 4WZAE 3NIBA 3WP0A 1LV7A 3QXCA 3LVQE 4PR0A 3ZZTA 3CX8A 3SN6A 4LV5B 4JL5A 1S9HA 2F1RA 4NL4H 4J0QA 4JLVA 2D2EA 2QMEA 5L3RA 1XNJA 1GIAA 4LDJA 4LV8B 3RS0A 3K70D 4JLBA 1UPTA 1OFUX 6Q21A 1CJTC 1YJ5A 2VQSA 4G5GA 4DLVA 3WBKA 1VHLA 1XCPA 5D3QA 4X8MA 4Q1AA 4E03A 3B2EA 3U7HB 4B3CA 1DE0A 1RIFA 4GMXA 4MYHA 4B2PA 1Q12A 1NSTA 3I62A 2ZI5A 2E9SA 2CMKA 4QNMA 4TSFA 1XBTA 3D6TB 1XMIA 4KLZA 3FKQA 2BEJA 4OJQA 1ZIOA 3QF7A 1U90A 4ACAA 2WWGA 5KNDA 4EFNA 1NJFA 1RFLA 4TT3D 1G6OA 1E9SA 3L0PA 3B6EA 2J59A 4V03A 4QHSA 4F92B 4MDEA 1Z2AA 5FBWB 4DEXA 2J45A 3I72A 4TL8A 5C18A 3VR1A 5FPHA 2HLDD 1VYTA 2ANBA 1U8YA 3O8DA 2FOLA 2Q0HA 1JEDA 1DAKA 1IBRA 5HE9A 3SHFA 1OIVA 4JT4A 4C7OB 2XOKA 4L16A 3MWKA 4B73A 3EPLA 1ZAKA 2Q3HA 2QTVB 5FH9A 1E9CA 1VCIA 3CWQA 4XTRA 4QBHA 3K70C 2A5JA 1JAHA 2NZJA 4BZXA 1HTWA 3WRXC 1XWIA 4Q66C 4PX9A 1XDBA 3FHOA 5A4JA 1OH7A 3RRNA 1FPMA 1FFHA 4IVPA 4GMDA 4A6XA 1LVGA 5DI3A 3UKDA 2CJWB 2QSZA 2H7VA 1U99A 4US0R 3RS7A 2BMJA 3T1OA 4C0LA 1AM4D 3Q5DA 5GVRA 4A82A 1MO5A 2F6RA 3BWDD 4MH0R 4DC9A 1Z2CA 2Q21A 4UXJA 3EPHA 3P26A 2J46A 5CDFA 4EPXA 2X2FA 2I1QA 2V1UA 4FI3C 1Q22A 1DTSA 1OKKA 3ZS8A 1A1VA 1MR3F 1TAGA 3ZIAA 3N70A 2GBLA 1GM5A 4MKHA 3A58B 3A37A 1P73A 1FP7A 4OK6A 1KI6A 2VHQA 5J4VA 1ESNA 1D6JA 2G6BA 1NN3A 2VF7A 2Q3MA 1JEEA 3IPYA 4RZ3A 2QORA 5IDVA 4BGDA 4GSYA 3M0EA 5F98A 3ASZA 2JLUA 3REFA 3SU8A 4GDFA 1CTQA 3CPEA 1XPUA 3ZVLA 3O8CA 1P2SA 4ARZA 2ERXA 3D3QA 1SVWA 3NH9A 1QDEA 1X6VA 3NC1C 3R20A 3OFNA 4BLTA 5CM8B 4OL0A 2XITA 2H8KA 4HSEA 4HATA 3AQ4A 2JATA 1DO2A 3IUYA 4G0NA 3CKLA 1L4YA 1TPZA 4AIIA 1NL3A 1RJ9B 1W0KA 3VR5A 2R65A 3CZPA 4UJ3A 4IDPA 5FUWA 3CH5A 2GA8A 2BBOA 3K0CC 5EQTA 4M21A 4F4JA 1DOAA 2REXB 4PHTA 2IW3A 1DPFA 5FTKA 2D06A 4M1YA 2JGNA 3X1ZA 2DB3A 2BC9A 5EXPA 1O3YA 2RHMA 5LB4A 1OYWA 4Q1DA 1KI1A 1U0HC 4A2WA 4DLRA 4TZ6A 2IWHA 1E2EA 2PZGA 1MO4A 4EJSA 1XD2A 4DDUA 1W7AA 2J87A 3P32A 4JKYA 4GZLA 1TQ4A 2ODNA 3NVAA 4HB2A 2WJVA 4ZV4A 1GRNA 3W3AA 3ZZUA 1NG9A 1MO3A 1OIWA 1CU1A 1U8AA 4BLPA 4EJSB 2ZRNA 3RYTC 2VA8A 1IJEA 1I2DA 3PUVA 4M1OA 4Q9KA 3CONA 4NTZA 4G01B 5DI9A 4QL3A 2QL6A 4HAXA 4GP7A 3RABA 3GLFE 3RS5A 2HXSA 3BFXA 3PG5A 3AKYA 4MRRA 2WSSD 3LBNA 4LJYA 4C0QC 4CT5A 5A5GA 3LVRE 3GP8A 3X2SA 4EPRA 5IK2D 1KSGA 2V6IA 5JWHA 5DHFA 3K9LA 3AF2A 3QF4A 5CDFE 1G7SA 1Q0UA 1NVVR 4U7DA 4EPVA 1E99A 4O25A 2ZI3A 2YWGA 3AUYA 4V0NA 4BEBA 4UXIA 4RZ2A 2IYVA 4KYIB 1MO6A 1Z83A 4NONA 4IKEA 1Z0AA 4JBXA 4HAZA 1UBFA 2JLVA 4H1UA 4C0BA 2ZJAA 3SEAA 4AKIA 1Z6YA 1Z0IA 3PV0A 4CEHA 1MABB 2O8FA 1KYIA 4HUQA 1Z3IX 2ZI9A 1EFRD 3OF5A 3DM9B 3MLEA 1T8UA 4MUBA 4CEIA 5ANRB 3EIEA 2OCPA 3A1SA 4AYXA 3CO5A 4WXRA 5JZVA 1BS1A 2GETA 4M9ZA 2BMFA 2WIAA 1AKYA 1Q44A 2ASEA 2ZUCA 3CRMA 4CEIB 3BORA 2XNDA 3EZ7A 3RANA 2LKDA 4OK5A 4HUTA 1W44A 3AVUA 4L9SA 1E9RA 2HF9A 3W34A 5FBQB 1G6HA 1MKYA 3EPJA 4ZIRB 2FZ4A 2OCAA 3ETLA 4A0RA 2XTZA 3U6BA 2N42A 3E70C 3HR7A 4L15A 4QRHA 3WP1B 1T3SA 1CR2A 1N6KA 4LCBA 3ZS9A 3T5DA 1ZNXA 4AYTA 4EDHA 1N0UA 2VHUA 1KI2A 3OFND 1XEWY 2LKCA 4Q21A 3WMGA 3GJ5A 2WOOA 4KLNA 3TK1A 1FW6A 1XTRA 2OO7A 2QGNA 4OYHA 4EAQA 1Z0KA 2YKGA 2PT7A 3K9HA 4YMTA 1P6XA 3CW2A 1W47A 1F3OA 2KB0A 721PA 4BLSA 3SFVA 1N6RA 2XSZA 3PEUA 1XU4A 2G1JA 1F2UB 2OEPA 1OB5A 3B1ZA 4MYUA 3A8TA 1KAOA 1P2UA 4OQLA 3BH0A 4PC6A 1CRQA 2R6CA 2QZ4A 3VHXA 3AGPA 2BKUA 1HQCA 1BIFA 1IN8A 4Q7KA 2ZI7A 4ACBA 4CEJB 2ZJ2A 2W0MA 4NBSA 4A6PA 3BOSA 1FTSA 2DWQA 4GRAA 1VKJA 1KO7A 1YR8A 4RZUA 2Q9BA 3CBQA 3U3KA 1E2HA 1X8JA 2KSQA 5JECA 3KFVA 3TNFA 2XTMA 1P5ZB 4RJLA 1AZSC 4PHFA 3EW9A 1OB2A 5G53C 4A9AA 4LPKA 3NXSA 4BLRA 5JSZA 1HUQA 1Z6AA 1F60A 4M4SA 1Q1QA 2NO0A 2DFTA 2FEMA 2DFNA 4TMVA 4ZDKA 2NO9A 3I92A 4IXMA 1CIPA 1RKBA 5SZHB 4DUGD 1TUIA 5DYIA 2BCGY 4M53A 3UXMA 1XRJA 1DAFA 3W9YA 1PLLA 2REOA 4FN5A 2YYZA 4CEHB 2WOJA 4QBIA 3VMFA 4BFTA 2GZHA 1MABA 2ERYA 4AYWA 4OHYA 1Z47A 3KJHA 4A8JB 2R44A 1CRPA 4DLXA 1J90A 2KBEA 4UNRA 4DB4A 1HY3A 2Z0MA 2BVNA 1XEXB 2DFLA 4TYYA 2IS1A 5CIQA 1EX7A 5FBVB 1D2MA 2JLQA 1P9RA 2W6IA 3TQCA 1KJYA 3I32A 1E79A 5DH9A 1JALA 1TMKA 1ZW6A 1AKEA 1KNQA 4ZKEA 4MA4A 2ZQ5A 5AJZA 5KSYA 3TUJC 2VSOA 1GRQA 5L3SB 3KJIA 4O3MA 1R5BA 3M1IA 2WZQA 2BBWA 1YZKA 3X1DA 5LPNA 1M6NA 3CIOA 4BLQA 3K1JA 4PTLA 2ODWA 2RGNA 5FR1A 5GVSA 1T5IA 3GLFA 1H8HA 1ZM4A 1ZC4A 2N46A 3KFXA 2JDID 3NBYC 1MV5A 1YHNA 5L3SA 3HP1A 5M04A 4WXPA 4PQFA 4FXPA 4ERNA 3CF0A 1C1YA 1NBME 5FBRB 3SJBA 2GF0A 3U5ZB 4QHYA 1YZQA 3U3RA 3RAPR 4HAVA 1YVDA 2AD1A 2J41A 1CP2A 1YZGA 2PT5A 3ZVNA 4LGMA 2IS2A 1WXQA 4Q47A 2CVFA 4ITRC 521PA 2O8BB 5FBLB 4LJ4A 3BB4A 1II9A 1VIYA 4LJAA 1L4UA 4FWTA 4R9UC 4O2LA 1Z6XA 4PO9A 4U00A 3NBZC 4URZR 2QM8A 1P61B 1NVUQ 4DCVA 2QRNA 1PV4A 2QT0A 3KQUA 1X8LA 1KDTA 4TQUS 4LHYA 5C1BA 2EFCB 4Q48A 3I5XA 3K0SA 1ZP6A 3PIRA 3LRPA 4CEJA 3JVUA 4V02A 1QHHB 1UAAA 1NY5A 3LY5A 5AJVB 421PA 1F2TA 5CYOA 1M2OB 5BWMA 2Q9CA 3RRZA 3TUZC 2IXFA 5CJ2A 4LYHA 3KKPA 4DSTA 2HJGA 4ASUD 2VIIA 3P1JA 2PX0A 5JEEA 5E4FA 3LX5A 3U4QB 2BMEA 2HT1A 1OXUA 4GL2A 2I4IA 4C0AC 2WBLC 5FUVA 3Q3JB 4LBWA 4NYIR 2WTUA 4WIAA 2OLKA 2GVDC 4QGAA 4L4UA 2GBLC 1N5LA 5ELXA 3WYFA 4EPWA 1QZXA 3C8UA 3MFYA 4Q1FA 2ZR7A 1KI8A 3DZ8A 2FGKA 3LXXA 4M9SA 4LHXA 5J47A 4A0HA 1T91A 5FPKA 3QKSB 1UKEA 2B21A 4IOKA 4OHZA 5CB8A 2ZSEA 3B1VA 3KUCA 2LCFA 2XZOA 2AL7A 1WBDA 2AX4A 4A2QA 4GNKA 1XJCA 2RAPA 2VLIA 2W0SA 4XSHA 1KK0A 4MRNA 3SQWA 1IN4A 1R8QA 4Q4AB 4WVFA 1US8B 4IOMA 1W46A 2VL7A 1E0SA 1HH4A 2YINC 2OSBA 1UFQA 5EJEA 1E2DA 3RRYA 3SYKA 4XVUA 2K5UA 1S1MA 4IFBA 4NE2A 5K8LA 2QPAA 4B74A 5FUXA 3MG9A 1GG2A 1R8SA 3IIMA 2J0VA 1ESMA 4M8NE 2PJZA 3WRYC 3IBGA 5DE3A 3KJEA 2QE7A 3G5UA 4AD8A 4ASUA 1G5TA 3CR7A 4JBYA 2BWJA 3U7FB 3L0SA 3QF4B 1XD9A 1DEKA 1LF0A 1YRAA 3B1XA 3SYLA 3NWJA 3AVWA 4XWKA 2ZS7A 3A4NA 2ZE6A 2JA1A 2NPIA 2WICA 3K0FB 4JLDA 1G16A 1AA9A 3TGPA 2C5LA 1E9FA 1N0WA 2AK3A 2CK3D 2O0KA 2X8AA 1G20E 1RRGA 5FL7D 2XTNA 3CRW1 3DVLA 4FCWA 5JSZB 2OILA 4B71A 2O8DA 4LHWA 3B13B 4ZI3A 1GL9B 5LB2A 3P27A 5L3VA 1CXZA 2XEXA 1N25A 2BDTA 3OE7D 2QAGC 4JLOA 1E1QD 4RY2A 4TLAA 1ZIPA 3Q8XB 2WSMA 3P4YA 1EFHA 4UNNA 2ZAMA 3MJRA 4KBFA 1Z08A 3PFIA 3IQXA 3VFDA 2IX3A 2CL0X 3KX2A 1IOZA 1ZNYA 1SHKA 2PLRA 3KKMA 2PEYA 2HF8A 4YXWD 3MWLA 1DAEA 1GKUB 2YWFA 4LRWA 2ZSBA 3EA5A 5JS7A 4Q9LA 2WPDD 2ZUDA 2GK7A 1WRBA 4TL6A 1FMLA 1SKYE 2P6RA 2FPLA 2D3WA 2KWIA 3UATA 2PH1A 2AFHE 4HLQB 3RRMA 1ZM9A 1WB9A 1FL9A 3D7MA 2A5YB 3MWJA 1YR7A 1M74A 3B82A 2ZS8A 1XEWX 5JCZA 2DHRA 2H1LA 4YLGA 3E1SA 4MYTA 4PFSA 4LYAA 4PC3A 3RSOA 1G41A 5A0FA 5KDDA 1D9ZA 2ZRKA 1S2MA 3U3JA 4BFVA 1CJVC 1N5IA 1SHZA 2ZSAA 5FPTA 1Q21A 2F1HA 4KO8A 2D62A 1GILA 3IILA 4A0GA 3U3MA 2KJQA 1P2VA 4PAOA 3FMFA 4QBGB 5TY0A 2OBLA 1RRPA 2ZYVX 2JIZD 5FPSA 3AVYA 1SGWA 4PSAA 4XWAA 1SXJD 2W6JD 1EWRA 4MQBA 4W7SA 4DCSA 4TTRA 2WKQA 4I4LA 4AKGA 2AR7A 4LJ5A 3RWMB 2VPPA 4ZCLA 3RDPA 5KSPA 3B7GA 1T4GA 3B60A 2MSDB 1N6IA 1XPOA 2IUTA 2P5SA 5KDOA 4QM7A 3FMPB 2FWRA 1VG9B 1KMHA 5H70A 1UBGA 4KSBA 1SVKA 4B3BA 1ANKA 1BMFA 3TW8B 2QSYA 3KB1A 5B58C 2C99A 3L8ZA 3RWOA 4YQFA 1JB1A 2UVQA 3ECCA 1YZLA 2RHDA 1H8EA 2ZETA 5LD2B 4YDHB 4LYFA 1E4VA 3DO6A 4XWOA 2J7KA 2ZI4A 4NZYA 4A8JA 1KK1A 2GRJA 2O8EA 2ZJOA 4MYCA 2FSFA 1COWD 5JBQA 3KQKA 2GF9A 1Z0FA 1TF5A 1NVWQ 3LBIA 2R2AA 1QRAA 2JLRA 2ZRHA 3LW7A 1SVSA 1M7GA 1ZNZA 2BM0A 2GJKA 3PQCA 4OHXA 4ZCIA 4Z8XA 3T12A 4F38A 2YOHA 2ZE5A 5JFGA 2HCBA 4PO8A 1K8RA 4BLOA 3QKRB 1F5NA 2AXPA 3N5CA 3QVUA 4URWR 3QXSA 4OKSA 2VHCA 4JVMA 1SVLA 4JZKA 4EJSC 1E2MA 5KNBA 3C14C 1FMJA 2QTHA 5J5CA 3TSWA 3DMNA 2WSSA 5G40A 1ZC3A 3QXHA 3L43A 4HDOB 4GOKA 3IQWA 4TQAA 4DWJA 4F93B 2ZUBA 2DCUA 2EVWX 1E1QA 2PEZA 2F9LA 5E3HA 1ZD9A 4IHQA 1Z5ZA 4BASA 4B76A 4NYJR 4D4JA 1QHXA 3AP3A 3THOA 4QGHA 3IGFA 3VU9A 1JPJA 1IHUA 1XTSA 2YV5A 2IUUA 4ZI2A 3QPVA 5J4KA 5DIFA 3IDQA 3GJ0A 2A5GA 1E2NA 2ZIAA 1KIMA 2ZREA 4EFMA 2VP2A 4TMWA 3NH6A 4KHZA 2QN6A 4JS0A 3KTAA 4URYR 2DR3A 3RVBA 1E98A 5JWRA 4KXFB 1IXSB 1NVXQ 2FPKA 1OXTA 1U8ZA 5KNCA 3E5HA 4A8JC 4YMSA 3WNDA 1NP6A 4OI4A 2OM2A 2E1RA 3QNUA 3OEEA 1F6BA 3A1VA 1RPZA 3NTUA 1W1WA 3ZH9B 1OYYA 1P9WA 4GI7A 2QY9A 4D4LA 2DY1A 3AEZA 3UWKA 3T34A 3K09C 2CJWA 2IS6A 1OT3A 2OZEA 2OHFA 3PUWA 4NMMA 4M1MA 1GITA 4HZUB 5L8VA 1NRJB 1AQUA 4DUGA 3ND8A 3H1TA 4P4SA 1O87A 2RGAA 4OI0A 2C77A 5JRJA 4URXR 4Q03A 2DPXA 2V3CC 1A4RA 1CJUC 2C95A 1OHHD 2ODBA 1M7HA 4HZUA 1T6NA 2JJ8A 2ZJZA 4DKXA 1OH5A 5GJVC 2YZ2A 3GJ7A 1AJEA 3KKNA 5HKKD 2UZIR 3EAQA 4NKRA 1IQPA 3K09A 4MGIR 1UEIA 2BJWA 2H16A 2ZXUA 2JASA 3AP2A 3H0KA 1GWNA 2C78A 2QAGB 3QKSA 4R71A 5C46F 1DBSA 2ZSDA 1XP8A 1OJLA 2JLXA 2D7DA 1XEFA 4DIEA 2ZR9A 3QBTA 5FI1B 3THXB 5KTYA 2GCNA 2A3RA 2GTPA 4FINA 3M4YA 4R2HA 3SHWA 3TLXA 1JXOA 3U44B 2AD5A 1OLOA 4RVCA 1KK2A 2XZPA 3WNBA 5GJBA 4B3XA 4AG6A 1NLFA 2XJ4A 2WJJA 2GEVA 2JJ2A 3GD7A 1DAHA 3SJZA 2RGNC 4NH0A 2WVJA 1E4YA 4DHEA 1U9IA 3VU9B 1OH8A 1ELOA 4B75A 1KSFX 1BH2A 2FH5B 2CVHA 2OUKA 1KDPA 2NOAA 4RSGA 5J4HA 4TN1A 2GWHA 2J7PD 1ZD8A 2F9MA 3AKCA 4IDHA 3SNHA 2XXAB 1B0UA 1KJWA 2NTYC 2ZJBA 4WA7A 3VKGA 4XTCS 4JSTA 5EE1A 3PJRA 1CS4C 1KK3A 1P75A 3K70B 1KDOA 1E79D 1S0UA 4KFRA 5F9FA 1OHHA 2XXAA 3K9GA 3IIKA 1YRBA 2OCYC 3G82C 3GFOA 2O8DB 1EG7A 1HV8A 2WIBA 1JBKA 5CM9C 4O0MA 1ZMXA 2ZRAA 2H17A 3AF3A 4P0TA 5LBIA 3EX7C 1DAMA 2N1BA 2PZEA 2V6JA 4WZBE 3WY9A 3FWYA 4TYNA 4A2PA 2QE7D 3HDTA 5BYJA 3GLIA 4IOJA 2QPOA 2GAAA 5CLLA 5JS8A 1NN0A 1UJ2A 4XSGA 1WDTA 3TAHA 3U61B 5F9HA 5TARA 2UZ3A 2CNWA 1XXHE 4LWZA 4OI2A 4PZLA 4R7ZA 1ETUA 4JJZA 2IL1A 2IS4A 3EWSA 1G17A 1NVVQ 3UIEA 5BYKA 3R8FA 3V9PA 3VR3A 3W5IA 2ZRPA 2JLZA 4OK3A 1XMJA 3NG1A 4D0LB 1LS1A 5BN5A 2WJGA 8OHMA 1M34E 1XEXA 2J0SA 4MRVA 3ZJYA 1YR6A 1CULC 1Q1EA 2JIZA 3BD9A 3UK6A 1IN6A 1SXJA 2W6JA 3VR6A 4B3DA 4PZYA 2XGJA 3OEHA 2J3EA 1IY2A 2O8FB 5DO9A 4TYWA 2GJSA 1T8TA 2L0XA 3QUSA 1W36B 4B6EA 2QAGA 2XZLA 5F3WB 1EFTA 2XJ9A 1FQJA 4OI1A 3U7EB 5EP4A 3CPJB 4KVAA 5DN6A 4ABYA 4M1SA 1IXRC 3GJ4A 4DLUA 1E9DA 5DISB 1TQ6A 1R4AA 2XSZD 4TMTA 2B8WA 2IC5A 2VP9A 4BZPA 2GZDA 2WWIA 4NP6A 5BW8A 5JHHB 3THXA 1YU9A 4RZXA 4V0LA 4KCGA 3MRSA 2HYDA 1Q1BA 5HKKA 3ADDA 3QIAA 5EP2A 3O8RA 3R9XA 2NMVA 2VSXA 2OXCA 4D26A 2IUSA 3FFAA 4ESHA 4WZ6A 1E0JA 5EUMA 5G3YA 2FN4A 2FJUA 2QMUA 4LJ9A 3BBPA 4X8OA 1N6LA 3WMEA 1R2QA 4KFUA 3SJCA 2CHVA 2GJ8A 3SC3A 3UANA 2IYZA 4LBYA 2G9NA 1KO1A 4CYMA 1IN5A 3QG1A 3AP1A 2PL3A 3TAUA 1E0AA 1KMHB 4KSCA 2OV2A 1D9XA 3B9PA 3BB3A 4YMUA 2NZ8A 3AVOA 1U0LA 2OFXA 4MITA 2XB2A 1L7VC 2CLDX 3A1TA 4MGYR 4TYPA 2XB4A 1Y3AA 2CDNA 3QBVA 1WE2A 4AURA 4LJ6A 5EZ5A 4M1TA 3MD0A 3V4RA 1R6BX 1AS3A 1XX6A 4G3XA 4NYIQ 5C2JB 1Z22A 2IF0A 1W4BA 4OHWA 4DCNA 4DB2A 2ORIA 4I1OA 2VP0A 2PJRA 5BN3A 3GJXC 4PSVA 4GOXA 4Q01A 5H1YA 1YKSA 2BOVA 3T35A 3KB2A 1NG1A 4JL8A 4ZPXA 3C41J 5FOTA 4C0SA 1SXJC 1Z6GA 2Y8EA 3ZIAD 1E32A 5JI2E 1H8ED 1ZYUA 4BRWA 2X77A 5JMTA 1VTKA 2QG6A 2QPTA 2ATXA 1E9BA 2BCJQ 5KPJA 2Z6VA 4B6FA 4QJ3A 1G4AE 3WYGA 2HV8A 3F0TA 2C04A 5FTLA 1A82A 5KDLA 1XZPA 5J4YA 1EFCA 4V0ME 2ZTSA 5HCIA 3FKSD 2IYXA 4OQMA 4DIDA 1SXJB 1FZQA 2AKYA 2ZU0C 3UMRA 2WKRA 5IF9A 4OQXA 3QSYA 1KAGA 4BFSA 1EWQA 1XD8A 4XD7D 4C7OA 1PUJA 4JKIA 5EE9A 5FL7A 1LNZA 5KOYA 4KJZA 2ONJA 3LH5A 1AGPA 4QFMA 3RS4A 5IK2A 1RC8A 1J8MF 3IO3A 2V1XA 1NKSA 1SKYB 1R5OA 4FMCB 4HZIA 3W8RA 3AVVA 1DELA 3W90A 5FFMA 2MSEB 2DBYA 4FCVA 2V9PA 3K53A 2G0NA 4TLDA 3TUIC 4C30A 1SQ5A 4GPTA 3X1YA 3IIJA 1PLKA 1L8QA 1P4SA 4CF7A 3GLHB 4QM6A 1HURA 3OAAA 3GLFB 2W00A 2YC2C 4XIGS 2O52A 1TADA 4TLBA 1UADA 1KO4A 2VBCA 2O8CA 1FP6A 2DWPA 3LA6A 3BXZA 2JEOA 2VSFA 2QGZA 1U9IC 2WPDA 2WV9A 2ZM5A 2C03A 1WP9A 4UJ5A 3S1AB 2J5XA 1G1MA 1IAQA 1VG0B 4Q4HA 1DG1G 3A1UA 1G3IA 3WNCA 1XJ0A 1CF4A 2BV3A 1UKYA 5SZIA 3I4LA 2IYRA 3GCGA 3LD9A 1TEXA 2YNMA 1VG8A 1HA3A 4PSKA 1SZPA 2W58A 2C2HA 5DGXA 3QPUA 4Q7JB 4RD3A 2F3RA 4EFLA 2WWYA 3VHLB 2CK3A 3AM1A 1G3QA 3N2EA 4YONB 4S2EA 3U2QA 3FKSA 4P4TA 5DHAA 3EXAA 2GNOA 3FHCB 1OXSC 1Z6TA 4D2IA 1T9HA 3ZLJA 1E3MA 3RS2A 2GKSA 1CR1A 2FE4A 4NDZA 1XZQA 3FGNA 2QT1A 1S4QA 2GCPA 3AUXA 1BOFA 2HLDA 2VHJA 3DKVA 1TU3A 1W5TA 1W5SA 1KSJA 3GJ6A 4GBMA 1Q57A 2EYQA 2VO1A 1DARA 3V00A 1SVMA 1AIPA 1YZTA 2XOKD 2Z5FA 2MMGA 1EXMA 3I8XA 3PITA 1E2KA 1RE0A 2IA5A 3H4MA 4IVRA 4Q02A 4NYMR 4C2UA 3H2YA 3DOFA 1P62B 4JBWA 3K0AA 4F4IA 3U44A 4DRZA 2GK6A 3R7WB 4JYCA 1YZUA 2NIPA 2C9OA 5DN6D 3J81k 2QQ0A 2G3YA 1XPRA 1OXVA 4PHHA 1U2RA 4TTQA 1HE1C 2QBYA 3ZQJA 3ND9A 2AN9A 4DLZA 4C0JA 3NEYA 4DT1B 2GXQA 4IDQA 1H65A 3QKTA 2BBTA 4QJ4A 2EWVA 1FX0B 1US8A 2YOGA 3U7GA 3ZVMA 1W48A 3DHWC 4RFSB 3VKWA 1TL7C 1WQ1R 5FTMA 4FIDA 1G5RA 4LYJA 3KL4A 1HYQA 5AUQA 4DJTA 4MGZR 2AWOA 5LDDC 2ORWA 3TBKA 3LFUA 1QHGA 4ON9A 4M1WA 4PXAA 4W5HA 3SR0A 3FMOB 2JJ2D 1MOZA 4C3ZA 1X1SA 1S3GA 2GJAA 3Q7QA 3B8HA 3IPXA 1JNYA 2BEKA 2Z4SA 3O8BA 4K8OA 5FR2A 2VEDA 1OW3B 2P65A 3WXMA 1E9EA 1QHYA 1TX4B 2ZROA 5KYKA 5TMPA 4G5QA 3HPQA 3RLFA 3SDZA 1G8HA 3BGWA 4B35A 1ZU5A 4D4MA 4URUR 1TTTA 5TXGA 3WHLA 1GOTA
chains in the Genus database with same CATH superfamily
1YJQA 1YFJA 5K99A 5TGDA 3HACA 2DOKA 2SBTA 3WL7A 5FV4A 1BROA 2VYND 3DYBA 3PZBA 4FW8A 1A88A 1JHDA 4OJKA 4WD3A 4RTSA 3MJDA 5FWNA 1E3TA 3SE0A 1GLNA 3QKUA 4PYLA 4RXTA 4YRFA 5BXQC 1ZUIA 1WHTB 2ILTA 2Q6TA 2DQ4A 1DKOA 2OGSA 4YVFA 4JLAA 4ZTZB 3O4HA 2QTFA 2HRBA 2O7VA 3FB4A 4B3FX 4ARBA 2W2VA 2CL6X 1PFUA 4LXGA 4EK9A 1VRCA 1WXEA 3O4JA 2OXRA 3SS8A 3ZDXB 1CNFA 4OHPA 4U9IS 3GROA 3NIGB 4HB3A 3YASA 3IB3A 4U8GA 2RH9B 4IFEA 5IDYA 4LYGA 1DQYA 2P2YA 1MRSA 2VYCA 2FV8A 2ZWVA 3BAZA 3CF4A 4JJ7A 3WWEA 2Z2IA 3KS9A 1JHOA 3L9WA 4RHXA 4RTJA 3C98A 3QOYA 1EAYA 4IMIB 1X94A 1C81A 1E6EA 1IXKA 1V7PC 2FLWA 4KR0A 2X22A 4AXXA 3T41A 2J9FB 3RYIB 4PLYA 4ZO8A 1V1MA 2R4TA 5JWOA 3DBHA 1EWTA 4N7RA 4BP1A 5KO2A 2PBRA 4HUJA 4GXQA 4HOYA 3ICOA 1W30A 4K9QA 5ADHA 4ZN6A 2Z5VA 4EY6A 1SNYA 1RKUA 2BHLA 1Y3CE 1HE3A 2XWPA 3T15A 2ZRDA 1L0BA 3RSQA 3RTEA 2WE7A 1V1MB 1V6AA 3WGKA 5HR5A 1E2LA 1OI2A 5A9SB 4G23A 4GYWA 5EE0A 1UJBA 5DWQA 1L2TA 2NO1A 3DL0A 1TJPB 3EC1A 2I4LA 1TYBE 1UFOA 2IJGX 3F74A 5F3DA 1ECGA 1N5JA 2ZB4A 4KX5A 5H3HA 1VECA 1TLTA 5BSHA 2XH8A 4ZVKA 3MGCA 1E20A 3BK1A 1GCGA 2VP4A 1L1EA 2PSDA 2XNSA 1T26A 3C6ZA 1RP7A 1YU6A 2CBZA 2CCJA 1X70A 2ST1A 4QLOA 2XNKA 3X2FA 3EA4A 4UU1A 2HDWA 4CV1A 1CFJA 1N0HA 3W3AD 1KAEA 1QIDA 2V74B 4I6GA 1HE8B 2JDIA 3V8PA 1TK9A 3ABZA 3PXGA 3BG5A 3W79A 5C4MA 4M1ZA 1TCUA 2VF2A 2Z4RA 1DMRA 4IH1A 1CUCA 1KYTA 1PWHA 4AU1A 4XFKA 3VSEA 4RD6A 3IP1A 1OSNA 3DZBA 3P9CA 4NU8X 4WZAB 5LLDA 3WB2A 3DUFA 3FOCA 3RPEA 3N0VA 2XYRA 3LHIA 3ZGYA 3H2SA 2GM3A 4JB3A 4KVFA 1V8ZA 4LZOA 3VSCA 1LTQA 3JQ7B 4JLPA 4U6SA 3BS4A 1FU7A 3QVXA 3V4ZA 4DV5B 1XDWA 1WB6A 1NT2A 5DNAA 3U3DA 1N9GA 1CYDA 1YACA 2CE2X 3NOXA 4OBXA 1QYWA 3IV9A 4XVQA 3VGPA 1SBNE 3NEJA 2FSHA 4CLXA 4C4PA 1T9AA 2JBAB 5EKXA 3GDOA 1LJLA 5IYZB 4K6HA 3MS7A 5EEHA 3G8AA 4ILEA 1SUDA 1E5XA 3NNDA 4KWIA 1WLSA 1JFLA 4DYDA 5DX8A 2GPSA 1Q3TA 2CLMB 4AUKA 3QM1A 3M2TA 4QUJA 1E89A 3UT0A 4M8LA 5LYYA 4EATA 1N36B 2VQFB 3RKSA 4RF4A 2IUEA 5AKYA 2C5SA 4DCJA 1MGOA 1N2BA 3TIXB 1Y7HA 4OXYA 3VDQA 3NYRA 3RYHA 4JC0A 3VZPA 3JTMA 4KZKA 4ARVA 5KSZA 1AF4A 1XJQA 2WA2A 3NBFA 4Y2RA 4CLEA 1I5OA 3WLEA 3C16C 2RHGB 4I0WB 4E7OA 3WSTA 4UAJA 1CR4A 2GJ9A 5CIWA 1XXHB 2H2HA 3BXEA 4DABA 2J9RA 2OAP1 4AT1A 1P2FA 5CK5A 4MUGA 4EHIA 4PQEA 1C8LA 3AW9A 4U2CA 1RXYA 3H42B 3P97A 1PWXA 3HCNA 4NX2A 4DV3B 2JB9A 3K35A 5ALVA 3CT6A 3AL0C 1KEUA 1LDMA 3IVMA 4F04A 2QROA 4N3NA 2H0QA 1TZJA 2WSLA 4DCNA 2FW7A 2OG2A 1MUUA 3EXG1 2NVWA 3O2NA 2AZMA 5J43A 2ZU6A 1P7CA 5TIIA 3KQHA 3C45A 4C87A 3OF2A 1ECCA 1B41A 3TOXA 1Z0JA 2WZCA 4JJKA 4P4LA 3JQGB 5EZQA 1M5TA 4ZVRA 1O0CA 3IEVA 5JS6A 5BMVB 1JLKA 3IPLA 2XZDA 3DBOB 1KPIA 2OC4A 3HFGA 2GAFA 4MUHA 3WYEA 4PQGA 3SWWA 2AXEA 4BLUA 3KXIA 3REGA 4QUHA 2REBA 5JY1A 1RWXA 1JJ7A 3IRUA 4YV2A 1DL5A 4F84A 2B20A 1OREA 4IIJB 1T5TA 4MVWA 3MOIA 4HAWA 2Q7DA 1Y7TA 1P0MA 1L5ZA 1ZO8A 3KKOA 3M6FA 2X7XA 3HSKA 3L7AA 1E7QA 4JU9A 4Q1BA 5D1NA 4DLKA 1HL7A 3AIMA 1FFXA 3TINA 1A9YA 2A5FA 2UKDA 2X6TA 3H75A 4WY2A 4BDTA 3HH8A 4PLTA 2RGXA 2PZMA 2R8YA 4QGGA 2QNIA 1KXZA 4DY4A 5DHSA 4ZK6A 2C88A 3GLGA 2OQVA 4UVGA 4U7JA 4XXHA 3TI9A 2ACEA 2BRUA 3OD1A 1BO6A 4QAQA 4YT5A 5FAXA 2WVAA 4FYPA 1HFWA 5F2KA 4DMKA 3G5MA 5DP1A 1GG5A 1OU0A 3GNQA 2V7VA 3OE1A 2MDTA 5TQ2A 1KNXA 4J3JA 4QC2A 5DNEA 3TX2A 4YCCA 1JECA 3RIYA 4XZ3A 5I9NA 1XTPA 2AHOA 1R9MA 2GPAA 3EFEA 3LLCA 4WT7A 1DFIA 4X3OA 3QXJA 3ZBTA 4KPFC 2N1MA 5T6BA 3GPIA 3K15A 2PXHA 4P92A 2QLBA 4QYIA 4JKOA 2FF7A 4L6CA 1HMYA 1MW9X 4DA9A 3O26A 4FDMA 1VMIA 1N75A 1XLWA 4UPVA 1JIUA 2ZRBA 2DGDA 2JFWA 5GZ6A 5G2OA 1P7VA 1V39A 3DD1A 4G5HA 4HB4A 2IH5A 3N86A 4I5EA 1FIUA 1NT4A 2C97A 3SFZA 4TYQA 4D81A 3QUCA 4DLAA 2QMQA 1ATIA 1WUKS 3A31A 4BUCA 2ZJYA 3HLKA 5AK0A 4CVNA 1GSHA 2Q0QA 2HPZA 1I2MA 1VFPA 1RCTE 2EQAA 4U2BA 3TIVA 1G3RA 3C5HA 1ADBA 4GYKA 4FW9A 4MIOA 3FPEA 4PBRA 5C1PA 1OZ0A 2QN1A 4Q34A 3ACCA 5CU7A 2HYIC 2ZJ8A 4NXNB 4ZCMA 3OD5A 1FXWF 1UC4B 2DCMA 3ONEA 1WHSA 5ALEA 1JHXA 4Z3OA 5BOVA 4HXEB 1ZGZA 5B1DA 3BC1A 4I3HA 4MDHA 5YASA 1MX3A 2QQ5A 3MMZA 4PCVA 4RQBA 1S4MA 3ORSA 4ZCQA 4CQLB 4EB0A 2C8KA 1G2OA 2YHSA 4HGRA 4X95A 5K2MA 5C8VA 1F7UA 4H4DA 2A0KA 4Q1CA 4GLOA 1PR2A 5IJ0A 1VIMA 1S2IA 1D5CA 4N7MA 4J43A 4CV2A 3CHYA 1OA0A 4PAMA 4C3UA 3U0VA 3AKZA 2VVTA 1M75A 2PK3A 4GXTA 4TTPA 3IXQA 4WDRA 1EXVA 4GICA 4QXAA 4XLLA 3IBFA 1JIJA 4KGZA 2X4IA 4C5BA 4CM5A 2JLCA 3RHZA 1AQYA 1OMOA 3HMKA 3CG0A 4X9XA 1PBNA 4NFLA 1ZI8A 3WIUA 1GGEA 3G2QA 3TLGB 3VC7A 2QV0A 1Y42X 3A0UA 3CGWA 3GN1A 3ZDQA 1PL7A 2A5LA 1WUIS 2HDNB 2HL6A 2OP1A 4Z0HO 4Z54A 5JECA 2YFYA 3QXXA 4H08A 1F12A 4WOJA 3R74A 4UKDA 2PSHA 4MMZB 4E30A 3B3AA 2HF2A 1T2NA 1J7KA 3KT3A 4O1IA 2CLCX 3JAMA 5IBPA 4I8IA 4EHDA 4EKGA 1X0VA 3THSA 2EFEB 1M67A 1HM5A 1KP9A 1QKJA 3RBXA 2I3ZA 2VTKA 3DB1A 4BMPB 3KQTA 2I3DA 2FJ0A 4ZOCA 4EZEA 3H7IA 1LI4A 2WA1A 1OZGA 3TJRA 1VM6A 2W93A 1GQSA 3GB9A 4N82A 1D2EA 2X4GA 3O8OA 3FCOA 5EHNA 5TT0A 2CV1A 1GL6A 1I0IA 2F1JA 3HQ4O 4OJMX 1JQLB 1WABA 4RU1A 3QK7A 1BMFD 4WFIA 3GMTA 2G0TA 2J5RA 4DMLA 3QYAA 1U0TA 3EQZA 4M99A 3B1WA 5TB5A 4DSNA 2P4SA 1E94E 1TU0A 3AC0A 4HEJA 4O5OA 3UMSA 4I1YA 3HU3A 4GP6A 1Z8FA 3ZCUA 3IHLA 1XZLA 3W8NA 3P5SA 5KTTA 4E2WA 4R84A 3FTQA 2GBIA 2HXYA 1ODJA 5AM4A 1E3JA 4F5EA 3IT2A 4IIJF 4DZZA 4WLNA 1OF1A 2VPIA 1CR6A 3U1VA 3ADCA 1M83A 1R5NA 3KZ1E 4CF4A 2JGRA 3F4KA 2IU6A 5DHTA 4JL6A 4NZNA 5JSYA 2GTIA 2QIPA 1CZOA 2IK8A 2D1TA 3L0IB 3ZX4A 4ZKDA 2IY7A 2AI1A 1TUBB 2HD4A 5G3ZA 2JPDA 3T7DA 5HWSA 5INTA 5K3AA 3H6HA 1NXTA 2IGTA 4QBFA 4CR6A 2V58A 3OTHA 3P20A 4LK3A 4L6IA 3U4AA 3PC3A 1YCHA 3KKLA 2NZWA 1Z7WA 3CZCA 4H7PA 3LDFA 4HDQB 5E1DA 4Q7MB 2QZSA 3DBIA 4IIGA 1GZHB 1JFVA 2CVPA 1FJ2A 1DUSA 5DYYA 3OEHD 4HRXA 4Z3DA 1F2TB 3AJ8A 3TMKA 2FMUA 4BNKA 5EZ6B 4BNYA 4MGEA 1JG3A 3C5VA 1CJKC 2WWHA 2LPMA 3HYSA 4I4NA 1NE7A 5TMEA 3R8XA 5HCNA 4CLHA 2O0LA 1YIAA 4UNQA 3SJAA 3M6UA 1TO6A 2HGSA 4PV7A 3LPAA 4KPGA 2IT1A 2H6EA 1I24A 1S1CA 3AHFA 4HAUA 4J1TC 4HEQA 4CL8A 4F91B 3F5QA 3R6WA 4EUFA 2MYPA 4ZJPA 1ZIXA 4NHEA 4RVFA 1EKXA 2I1VB 1USKA 2OV4A 4P33A 3ZYZA 5F2OA 4HDCA 4DCTA 1N9GB 6NULA 1XFAA 2VYFA 2I6SA 1VCMA 2EGGA 3MIIA 2RJ3A 2C4TA 3R6GA 1P2GA 4FFNA 4P93A 3GFTA 2M2IA 1HO3A 3HB9A 4ZV9A 1B76A 1JR2A 3BRCA 3O38A 1WV0A 3UAVA 1JTEA 4DNXA 1OH6A 3PQ7A 3FPCA 5CH3A 3V2IA 1GZ7A 3BFKA 1JAXA 2WAMA 3LBHA 2WHXA 4N0MA 4QVGA 2FR1A 3VAYA 5J2UF 1TQ2A 1DC4A 1BSVA 4Q3BA 1EFRA 4WK0B 1H5UA 2V5AA 1HG1A 2GHTA 2DG2A 2QA5A 2QI9C 2VBGA 2YZGA 2K7ZA 4XB6B 3H84A 4W5JA 5HP4A 5HZKA 3PUKA 4QLAA 2AGVA 4F21A 3NDRA 4D9MA 1MT0A 3KR9A 1H2WA 2X5OA 3IELA 4V39A 2G8NA 3G68A 5BNZA 2P5YA 3PENA 2IXDA 2V7TA 2Q62A 5LMZA 1NBMD 3QVKA 3BDVA 3K9NA 3QHAA 4NPHA 2QRMA 3COYA 3I53A 4YV7A 4NCHA 2R6GA 3R77A 4KQFA 3USZA 1YDEA 1UDRA 1R4ZA 2WG1A 4BVJA 1Q0TA 3ZGZA 4MRSA 3BWEA 3KSZO 4D6PA 3SQXA 2ZPUA 1R27A 3OZXA 4KLCA 4C7BA 1F3LA 1TQDA 4FDTA 2XCTB 4V0RA 1VJDA 4FWBA 4U5QA 5TT1A 5HDBB 4PQYA 4IEEA 4EUHA 5EG5A 1SA0A 1CG6A 3PR1A 2B4YA 2XAAA 4ZO9A 3RTGA 1UZMA 2AKAB 4NESA 5C34B 4JSYA 5CLQA 2VCYA 2XBLA 1A7JA 2H3HA 1LTHR 1QFXA 2CFRA 3HYTA 1EVZA 3GVPA 4L5BA 4YJ2F 4ZO4A 3F7OA 3K0BA 4LHZA 1T5OA 1G66A 2A9FA 2Z95A 1QHEA 3CCFA 3A1DA 3C8DA 2HA5A 3GEHA 3JWEA 4BTEA 4Z4GA 3AINA 2A9QA 1FTWA 4DPKA 1JR6A 2C29D 3Q0TA 3FCAA 4I50A 1BA2A 2BBSA 1CF9A 3H2JA 2AR9A 3OQ1A 4I55F 2D54A 2B2CA 1G4UR 3EDMA 4LY3A 2AEMA 1BX1A 1ZN8A 3EFBA 4Q93A 2Q4BA 3W5AA 1AZTA 3HADA 1OIXA 1BFKA 3ZU3A 2IPAB 4MQ5A 5FTNA 3UWOA 5DYGA 3TZ6A 1IXYA 4FE4A 3ZCTA 2EKLA 4PHGA 1Y9AA 1M5RA 2FRDA 4F1JA 3CF6R 3ZHSA 1ORRA 2VK4A 4UBNA 2D0OB 3ESXA 1I7DA 4IVQA 4BECA 1JJIA 4L3VA 3FAKA 2GMWA 3BIWA 3L04A 2UZ1A 4KQEA 2FSPA 4KR7A 3GLHA 2PLFA 2AQKA 3ILXA 4CT4B 4KGXA 3R0XA 1LRJA 2A0YA 5LLTA 2C4HA 4RVNA 4MEBA 3SC2A 1C2YA 3P0FA 4LF4B 5DI3B 1AD2A 4IL5A 4B3GA 1WPXA 2OG1A 5B30A 1QTRA 3PGLA 4O4LA 3OLQA 4QU0A 3TLKA 4DA7A 3RYCA 4Q12A 4ZOEA 4I4IA 2EF0A 3C3KA 1RXEA 5H16A 2NSYA 1M3SA 3O7WA 3G13A 2PS9A 1J49A 1I33A 2ZBRA 3BWMA 5ES3A 1EWKA 2GHRA 4OHVA 1B15A 2NU7A 3DAGA 4M9QA 4BRUA 1E3IA 1NFQA 2JIMA 4I36A 4KBGA 5I4BA 5LQAA 2P0EA 3GRKA 4O33A 1EPUA 1FX1A 1I0LA 2HU7A 3DL4A 1QC5B 3FNBA 3WMFA 1MB9A 2FCAA 3BERA 2JGKA 4R5MA 5AVTA 5KTRA 2WJ3A 4DQLA 2B8TA 3QVGB 1VBFA 3NHKA 4DG5A 2IF2A 2JGFA 1Z36A 3QG5A 4AKSA 3ABIA 5K6AC 4L3OA 3E9EA 2IY8A 4WZZA 3ZZNA 3E7FA 3WIEA 2B1QA 2PJUA 4Z1MA 2M6KA 4YRBA 3RUAA 3HDGA 1G8AA 4JDPA 4XVRA 1GRRA 2Q1WA 2Y1CA 4ZYVA 3HBMA 3OOYA 3ERCA 3UQZA 1JR3A 3JQAA 4IW3B 3D4OA 4X1YA 5FBHA 4DQDA 2BL4A 2FPMA 4NCJA 1D2GA 1MHTA 4B5KA 1FTGA 3L8MA 2PT6A 2CV2A 3IXMA 1L3IA 4ESVA 3LZDA 2VWPA 3UA4A 2D2FA 2YBEA 4JU8A 1NBAA 4HH4A 4C4AA 1R37A 4NYMQ 2OKCA 5EYPB 1DADA 1KRHA 2P2GA 3BD7A 5ALQA 4ZDWA 1N4AA 3AR2A 2HA0A 4EM6A 1DTWB 3WB1A 4BBJA 2D8MA 3L8YA 1XTIA 4OPMA 3T1HB 3KT0A 4DZRA 2ZT5A 2WWFA 1NXSA 2JVJA 1DTWA 1GTMA 1KHTA 2I6FA 3LPNA 4PLVA 4BQEA 1T2AA 4IXNA 4RVHA 4S0XA 1PFQA 3N39C 4XEUA 4MVJI 3WIDA 3MIZA 1DJNA 4DMFA 2Y1EA 4XOIA 1T3LA 3C5EA 2P67A 3CZQA 4ZAFA 3TSZA 4ZJZA 4ZOQI 2VAPA 1R3DA 2GEJA 3GO4A 5HMLA 5JCPA 3MINA 5MF6A 2RD2A 1CNEA 1TCBA 5DJ5A 4PAQA 3BWBA 3PNLA 3ADKA 3MQFA 2HWXA 1QX3A 1X87A 2I4TA 3GUVA 1IQ0A 3L6UA 4TKZA 4UD2A 2Z43A 3EW7A 3NHAA 1WY7A 3C3DA 1MW8X 4QOIA 1I3NA 2IYYA 3AHEA 2EFHB 2F3TA 3BH6A 3OEED 4OJTA 2YHUA 3UAZA 5G0SA 4V1CI 4J1NA 1TUGA 3F5FA 5CURA 1GGHA 3JZMA 4QUIA 3HCAA 2GB4A 3WG9A 4OX9B 4ZT4A 3K1AB 4BVGA 1PJTA 1UJMA 3LT5A 3L2OB 5DWVA 1Q1NA 5JSFA 4HBGA 4I5GA 3HJHA 5G4KA 3TM5A 1EX6A 1RPAA 2P6NA 1LBQA 4XQEA 4C01A 5AJHA 3OX4A 4E4YA 1YIDA 1F9AA 1DG3A 3GGJA 4HPXB 2AFHB 2CUNA 3PUYA 4P4UA 2C92A 5EWJB 1SXJE 1Y5NA 1SVOA 1L5NA 1VYHA 3O91A 3A4IA 3NOQA 3NKLA 4Z51A 3CR8A 3I3SR 4KXXA 5H83A 3R40A 3RC8A 1YRLA 3AYZB 2IYUA 2YRWA 4MI6A 4PN7A 5IAKA 4LF7B 3FUUA 1FQOA 1II8B 2AW3A 4UVIA 3C3JA 4LZZA 5TQ0B 3MMPA 4BUZA 2F3UA 2JAPA 3ABOB 2A2ZA 2F00A 4NECA 2H63A 3BD8A 4ZTBA 1WJGA 4ES6A 2AYZA 4UHEA 1P6UA 1IM8A 1GNQA 1E3WA 1J8VA 1TCAA 3C6MA 2EWWA 1U5CA 5LP6A 1NNSA 3IAUA 3ZLBA 4LZPA 3JQGA 4QBKA 4XYMA 2I78A 3MWDB 1NV9A 4M76B 4K3VA 3ZUPA 3QPBA 4D4IA 4CIXA 1B2LA 3KPWA 1QQTA 3Q85A 3EXIA 4LOHA 3N87A 4CI0B 1SIWA 2B82A 5LM3A 1K8QA 3MRVA 4KO3S 3NDBB 3ZIUA 3NCHA 5HRAA 1DIGA 2P9BA 3GH1A 3HR8A 4HB0A 2QMOA 4IRUB 2PV0A 3CPHA 1STOA 1QHHA 2FP4B 3B38A 4Z9FA 1JNXX 1OZHA 4AX8A 3FCCA 3WGVA 3CNNA 4WBNB 2WILA 1ZINA 1NQTA 2BI4A 4CF6A 4LQLA 1KTVA 3LA8A 3O9ZA 2NUPB 2VJKA 1CVRA 3GGGA 5HK9A 5EKUA 2R7KA 2NXWA 3HUTA 4G1CA 3AIIA 1D04A 2UYOA 4AMBA 2WWWA 3FE2A 3AR8A 1C30A 5ALRA 3R1IA 1G9SA 3WBJA 3LY8A 2ZAIA 4XQ9A 4EGCB 3RSLA 1J2TA 3F1LA 4YI3A 1FRFS 1ZVQA 3LOQA 2UXDB 1F2UA 4XYEA 4GU5A 3ZK7A 4AKEA 5LQMA 4PFJA 3VV3A 1DGQA 2QEQA 2ZSFA 3JRXA 4UXHA 2FFHA 1P1JA 2RARA 2BR3A 3FR8A 3VAAA 1CEYA 3M1LA 1PKEA 2E4WA 2PKWA 4KYVA 1VLHA 2ATEA 4M7RA 4A4DA 4LC9A 3LKZA 5KWSA 4DR6B 3TOVA 4MUKA 3VR6D 4P5EA 5I4CA 4BAUA 4NCXA 1ZSVA 4AZTA 4FNOA 4Z4HA 2W2MA 1N4DA 1W4AA 4EJFA 1DX6A 4IIDA 3H2BA 5C37A 3Q9UA 3GFQA 5LKAA 3LT0A 4DKJA 3HCFA 1Q1AA 4EGAA 2BP7B 2PUDA 5K03A 5AQ1A 5IC4A 4JLNA 1TK2A 4ZI7A 1QF9A 2YRXA 1JQJC 1ZA2A 3FPAA 2O2ZA 1I30A 4WKOA 1PR5A 1JQAA 5GY7A 3PPXA 3ZD6A 2FHSA 1GGKA 3CRRA 2GGSA 1IWBB 1LY1A 4JLKA 4KYUA 4MPJA 5DYNA 3QOXA 4EITA 1EXNA 1A8SA 1NMZA 4I3FA 4LC0A 4X6LA 1NI3A 1GU7A 4Y0AA 4BYMA 5GTDA 3HA3A 3II6X 4RM3A 3W0LB 1CC1S 2NN3C 2LNDA 1TM7E 2PFSA 4I50B 2I3AA 3WI7A 3V7UA 1W9HA 2HFJA 3QJYA 3PX3A 4XJXA 1UPBA 2G17A 3WVNA 4YLYA 1N78A 1LS6A 4O2BA 1YAHA 4L8LA 1F9EA 5IT4A 4NCNA 3Q9NA 4YC7A 2O3TA 1J0EA 2F55A 5FOQA 1W59A 1BDMA 1QX4A 1RMQA 1X1QA 1MJNA 3D8UA 4Q4AA 1WD5A 3ROTA 1M6HA 4RD0A 4C2TA 1YVPA 3KETA 2R9VA 2VA9A 4KO1S 2X14A 4BGUA 1G7CA 4A92A 4GDMA 3EYAA 5HUHA 4WA8A 3R5TA 5EWMA 1DCFA 2V4UA 3DCNA 2IEAA 3OJ0A 3QY0A 5COQA 5FNVA 5TGTA 4E09A 5I9TA 4BEJA 5AXCA 5KQGA 3DF9A 1ST2A 4MW0A 4AC9A 3OT1A 1AF7A 1KKLA 2R4UA 3DE5X 4GSLA 1FFAA 4BNUA 4TRJA 2O3SA 4V2UA 4AFNA 1KY5A 4CKYA 1XRSB 2GN4A 3N6VA 4ZCRA 3MWGA 3WSWA 4IRMA 3X1JA 1R12A 2JHAA 2XD9A 4X0EA 3QEBZ 2IZ1A 1T1EA 2CLKB 4BTLA 2BLLA 4B43A 2D5BA 5ALIA 1QRDA 2HREA 1ZMOA 3SK0A 4C06A 4MGKR 3M6LA 1BC5A 2HJHA 2C2BA 2CKMA 4JYMA 4MUYA 4DNFA 3FWPA 3X0DA 1SBYA 1G18A 4FEEA 2D7CA 4LVCA 4Q05A 2K87A 5FWDA 2O1XA 4WBNF 4ND4A 3UB2A 4H18A 4DL9A 4IQ8A 2PX2A 4MQFB 4FI3F 1D4AA 1QG4A 4GF5A 1SBQA 1C4XA 1KGSA 1PSZA 3QE0A 2ZYUX 1C3EA 5AICA 3SHVA 4M3NA 5D3MA 4OYLA 1ZM2A 5B2EA 1Z82A 3UYKA 4LJ8A 1AMNA 1FFSA 3FTDA 3R6DA 4PF1A 4EQ6B 2G9QA 5IT9A 1A9QA 4Q3NA 3GLIE 1ZUNB 4IAOA 1OWNA 2C84A 1N1EA 3LL4A 4X8HA 2O2GA 3OQMA 1QZ3A 3BMXA 3EIQA 4E07A 4L78A 5BVGA 2FWIA 1Y5RA 3GEGA 5LDHA 1UMKA 3VNUA 1CEQA 1TZCA 5LXTB 2WM9B 1NJ6A 2IVFA 4Y2SA 5E7IA 3FOAA 3HPRA 4TTJA 2OC9A 2VDWA 5TVKA 2UZ4A 2HTEA 3I34X 2KLBA 3NV7A 2FMXA 4Y7CA 4REQB 3GOQA 4R1SA 3PNKA 3IXLA 1EYZA 4D9NA 4HSGA 1EINA 1I8TA 1KY2A 2C9YA 2HPVA 2JZCA 1PDWA 3MYYA 4OHCA 4R1LA 4Q00A 3RG2A 1QPZA 3HTXA 3AT1A 4M1EA 2A5DA 3R8CA 3OIWA 3MB8A 2Q5OA 1WQ4A 1N2XA 3HVIA 1TAHA 1C7JA 3PYMA 1QQBA 2H2IA 1S2DA 1C9MA 2HFKA 3L0OA 2Z3WA 4E21A 4ZIRA 3LPLA 5E2BA 3JQ8A 3G0GA 2FMIA 3PT5A 3IBYA 4FSDA 1NAIA 2F43A 4N0EA 4RGQA 3ZY5A 4BO1A 621PA 4D25A 3L6RA 5AKEA 4LAFA 5JRZA 2E3JA 1NV8A 1KQOA 1J8YF 2G36A 3M6AA 1TLFA 3TPCA 2I2WA 4NJMB 2IEBA 1COWA 4D8TA 3KBBA 3FVQA 1KYXA 3DXXA 3OZEA 2CDAA 3JQ8B 4KMRA 3VO9A 4CDGA 1FDIA 3L4JA 4WXHA 3V97A 4LMPA 1MB2A 2VHXA 3JQ7A 1JVBA 1SCBA 2HHAA 4MJ7A 4NK5A 5CNMA 1HEIA 2Z2KA 3E7XA 4UUNA 2Y93A 2BGNA 3ODGA 2QMYA 2P9HA 3DHVA 2Q3BA 4EECA 2CGEA 3JAWA 5FUBA 4CCAA 5KTPA 2IHKA 2A9KA 2W2QA 1D2NA 3DULA 4RADA 1NXXA 4HDSB 1FX0A 1PJ8A 1TE2A 3R3UA 3GOHA 2X3YA 1GUZA 2KM1A 1QO0D 3BTSA 1ISSA 1LK7A 4PPQA 4EGQA 4HX5A 1QANA 3LNCA 2ECPA 3RK4A 3O1HB 3RU2A 1L5RA 5FRDA 1OAOA 3WP0A 1F0NA 2WT4A 3G79A 3MT7A 2UXCB 3L8CA 3R3YA 2YCLA 2PVSA 2N75A 3IUPA 1VLLA 1DRUA 1EUDA 4YMGA 4RK0A 1Z5NA 4R8SA 2WQZA 2SKEA 1S01A 4LDJA 1GIAA 4DM4A 3H1BA 5FI5A 6Q21A 1JT9A 4HWRA 4F6RA 4ZQEA 3V6LA 1VHLA 5MN4A 1TZKA 4NBTA 4UMEA 3GV0A 4G9GA 4Q1AA 4REOA 1OLSB 4X66B 4ND8A 1UAAA 1XVLA 2HC9A 4QDKA 3TXYA 4B3CA 1Q12A 2YV4A 3OLXA 3TOZA 4WPGA 2QTAA 3PA8A 4QNMA 4TSFA 4F3RA 5K4GA 1NZFA 1H2HA 4PLGA 5FKJA 5BN4B 5K45A 2BEJA 1ZIOA 4FEGA 3E9ZA 1U90A 4ACAA 1WLYA 2WWGA 5EHZA 5EJIA 4GKBA 4EFNA 1NJFA 4WVLA 4TT3D 4KIJA 1RRVA 4F2WA 2GTHA 1ARZA 2EIXA 4BE4A 3P19A 1GCAA 4F9FA 3KR2A 4MDEA 1BG6A 4ZANA 4TYMA 2M1XA 1E1NA 2WUDA 3FDZA 3OU7A 4JZYA 2J3MA 3ANNA 5FPHA 2V7UA 3N07A 4EUSA 3AM4A 4X62B 3CVXA 1WUHS 1DAKA 4FE3A 4C03A 2H5IA 1YQWA 1GJRA 5HE9A 3VNBA 3ASVA 1OIVA 2P7IA 4JT4A 1EJ0A 2BFOA 1XP5A 1IBCA 3ICWA 4ZCPA 3FDZB 1CS0A 1G2QA 4L16A 5AXDA 2ZATA 1ZAKA 2H29A 4YMIA 4ZREA 3EPLA 1VCIA 1ES9A 1JR4A 4XTRA 1QIKA 6REQA 4JBIA 3FWNA 2W2LD 4LZNA 1EBBA 2A5JA 2NZJA 4Y2XA 5IVIA 3V1TC 1JSRA 2VNSA 1BXKA 2P3QA 2EGHA 1V9CA 3JR3A 3K9CA 4R0MA 1GYRA 3RRBA 2OZKA 3MPOA 1G8KA 5MGBA 2XIQA 5E0OA 1FFHA 2I8LA 2YX1A 1U1FA 4IVPA 4K9SA 1DG9A 4QUAA 2R1UA 1MZVA 2B4TO 4IIJA 5HA5A 2DXIA 4L74A 3VR4H 1TEHA 1U99A 3C3MA 3T1OA 4CMIB 3Q5DA 3KTDA 3CEAA 3FAZA 3WL6A 1F8XA 2F6RA 2CHUA 1VE6A 1Z2CA 4XCQA 5EL0A 4JI5B 3RVMA 3VU8A 3ABSB 3R3WA 4UXJA 5ILOA 3W9BA 2J46A 5CDFA 4EPXA 2X2FA 1TKCA 2IDMA 1ZLYA 1Q22A 1DTSA 4FI3C 1ISPA 1QCYA 4O3FA 3ZS8A 2X0NA 3IBTA 4JUDX 3NYWA 4LKRA 4G4SO 3CZMA 1TDJA 2GBLA 1GM5A 1CUXA 1ODIA 4LF6B 4L5AA 2J4CA 3TTWA 4DDMA 2J6IA 3UV7A 4CM8A 5B3KA 1QP4A 1NU6A 1P73A 1TMOA 1XL0A 1X8XA 1WDMA 1VBMA 3GRVA 2B35A 2VZ0A 1X1TA 3L02A 1D6JA 1G21B 5IDVA 2QORA 3H05A 1N92A 1DBVO 2HSZA 2Z1NA 4JELA 5EHQA 5L7TA 5LXTF 5F98A 2QLJA 1I36A 3ASZA 4QXQA 2A9JA 1CTQA 3ONFA 4MS3A 3E9YA 3TFQA 4M36A 3MTEA 2EHJA 4WJZA 4O02B 3V9AA 2H2GA 4INJA 1DJQA 3DLTA 1T4BA 1X7YB 2LRHA 1ULZA 4BP9A 1WDKA 4HNRA 2LW7A 1PG2A 2ZUSA 2QZPA 1Z88A 1VIDA 3LCMA 4BEVA 2XITA 3HJUA 2H8KA 1EI9A 4HATA 4OG2A 3AQ4A 2JATA 3BA6A 1DO2A 3RGWS 2R79A 4X7RA 1EGVB 1T25A 1UJ6A 2NSJA 3IUYA 1ZOOA 4AIIA 1SB8A 1RJ9B 3KB6A 4O4LF 4UJ3A 5DT2A 5L95A 1UP6A 4JI3B 3PDWA 1USUA 4IDPA 2IYEA 5FUWA 5BOSA 4PTYA 1CUEA 3L4BA 1O89A 2D06A 1JVNA 3W7VA 3D8RA 3L6BA 3PNOA 3ROZA 3X1ZA 2BC9A 5EXPA 2RHMA 5LB4A 1ZW1A 5HMMA 1P2BA 1A7KA 1OYWA 4I6JA 4K28A 3PDIB 2GSDA 4MPDA 1ZGJA 5AM1A 2NV6A 1M2WA 2X5XA 4O4IB 2GO1A 2OYCA 3T0FA 2A6PA 1AY0A 3GFBA 5T41A 2IHVA 1FC0A 3NVAA 3P0RA 3QFFA 3E82A 2WJVA 4HB2A 4WN3A 3V7FA 4E2YA 5IX8A 1MO3A 1OIWA 1S5PA 1F4VA 1CU1A 1KEKA 1YNOA 5ADVA 2XWQA 2YICA 3KM0A 1ZH8A 4Q9KA 4FYXA 2W8BB 3CN7A 1WXFA 1XLVA 4G01B 4NTZA 4MSUA 1VBKA 5ES4B 5GZ3A 3VHXB 2YJ5A 5K3FB 3PC4A 2NTEA 1LFAA 4BKRA 3NR2A 1ESDA 4LXYA 5A7HA 2WSSD 3LBNA 1A72A 1POWA 1U2SA 2X1HA 3ONNA 2HA2A 3LVRE 3GP8A 1JDNA 1SC4A 4HDMA 2XQIA 2UZ1B 4QQKA 3P9PA 4JOBA 4QO7A 2HIAA 1SKBA 1VGRA 2PANA 3I2FA 2V6IA 2Q4RA 2XECA 1I3OA 4U0JA 1CZRA 2AMFA 3H5IA 3PKZA 3K9LA 4EUEA 5CDFE 3D6JA 4U7DA 4GE0A 4YJHB 5HF6A 1RBYA 2GLTA 1PK9A 3R44A 4FOTA 3INNA 4V0NA 2R00C 1DOHA 4ZYYA 4KYIB 4IWNA 4WLVA 2J3QA 4NONA 4Y2TA 4HAZA 3HU5A 1UKCA 2OZPA 2QTZA 1Y9EA 3E61A 1EX9A 3HDVA 5ALSA 3RTAA 2ZJAA 3SEAA 1Q2UA 1SM4A 4ENUA 3HI4A 1AXGA 3INGA 2L18A 3QHPA 4HUQA 3AWIA 4DQUA 3LC0A 3NYIA 2IPOA 5HQTA 4MUBA 2R4QA 4J0JA 3B6IA 1ZICA 4OSPA 2Y0EA 1H0HA 3EIEA 3G2MA 4LZLA 2JFVA 3AIOA 1REQB 2JH8A 4G8JA 5EWLB 4DJDC 2CXSA 2H5LA 4JXZA 1SOAA 1IATA 1PW7A 5BR1A 4DR7B 1DI0A 2X0IA 8LDHA 3RU7A 1VGVA 1AKYA 3BWVA 3S0JA 3BMOA 2E48A 1J0CA 1CCWA 2RK4A 3EVEA 1RM5A 2V96A 1SUFA 3I45A 3MBIA 3PJFA 5F3RA 5JDCC 4HUTA 2ZDQA 1HETA 1E9RA 4OQDA 4D8YA 4DN6A 3RSZA 2ZIVB 4LA4A 1G6HA 2Z8ZA 2PZKA 3EPJA 3ANXA 1UWLA 2JCGA 3NBMA 2RGWA 4A0RA 2QXYA 4OYRA 1NTOA 3E70C 4IS3A 4QRHA 3U6BA 4B7CA 4ZEXA 1AKVA 1VPTA 2XKKA 3ZS9A 4LF9B 3NUGA 2I7XA 3ILVA 1ZNXA 4AYTA 3V1YA 3ANTA 3WK5A 1SOUA 2PD6A 3LC7O 1VSTA 3LY9A 1GPAA 3OFND 1HDRA 3UMJA 3GJ5A 4MV5A 1L7AA 1IY8A 2ZQYA 3TK1A 1XTRA 4ZGBA 4A5OA 2VJCA 4N39A 4PZ0A 5LC1A 1TD9A 1Z0KA 5AIAA 1T9CA 2PT7A 2XF2A 3NFYA 1W47A 4EYEA 3C2QA 3WKAA 4G0OA 721PA 4BLSA 3IB6A 3I23A 3ITNA 3H8SA 1KJIA 4U3JB 1ZIYA 1YMVA 4N5DA 4CM1A 3AI2A 4RDCA 2VNKA 4OQLA 1KAOA 3ZKAA 3U1TA 1CRQA 2GFQA 2R6CA 4OGFA 3AGPA 1Q19A 5KHLB 2XMQA 3M3HA 4Q7KA 5KIAA 3U7JA 4CEJB 1U7WA 1P39A 4UUQA 2ZJ2A 1E60A 2NV0A 1RHJA 1FP2A 3FCEA 1EX1A 1TVKB 3E7WA 2VP3A 2P68A 2GRAA 1PZGA 1YR8A 4YUYA 2Q9BA 4S1NA 4W4TA 4YAIA 3ZWKA 3U49