3BB4A

Crystal structure of toc33 from arabidopsis thaliana in complex with mg2+ and gmppnp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
240
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDELLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords T7I23.11 protein
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 78
structure length 240
sequence length 244
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb4A00
2P5TB 5DSZA 3TGPA 3PEWA 4XOIA 1XZQA 1E2KA 4LHXA 3UWOA 4NCJA 1XPOA 1VHTA 5JBQA 2XZOA 4JSTA 1P73A 1KKLA 2GK7A 3CONA 3IHWA 4QGHA 2QM7A 2OM2A 4CEIA 5FBQB 4ABYA 4B3CA 1U8YA 4DB2A 1ANKA 1DO2A 3QPVA 4FWIB 5FR2A 1KK1A 1Z2AA 5JCPA 2XJ9A 2QUZA 4O2LA 4NCIA 3GPLA 2QE7A 4LX0A 1GWNA 4B6FA 2W2XA 4OKSA 2CDNA 1DAGA 1X1SA 2PZFA 1XEWY 4IDNA 4Q4JB 2OZEA 3T12A 4H1VA 2C95A 1WDTA 3BFKA 4A8JB 4ACBA 2ZR7A 5JS8A 4WOPA 1L4YA 1DAHA 3AP3A 2CEAA 4PC3A 3AEZA 3WHKA 4WAUA 5KUTA 3U4QB 1Z2CA 5AJVB 2J87A 5HPYB 4UQOA 4Q4HB 1UBCA 1RPZA 1KY2A 3BH0A 3B60A 3CPEA 2ZM5A 2GJSA 3T5GA 1GNPA 2PCLA 1Q22A 2F43A 1IXSB 5FBWB 1GUAA 2BHRA 1EESA 2OUKA 4OJKA 1M74A 3BB1A 5C2JB 4Z8YA 3RHFA 1R5BA 3RRMA 1F6BA 1TF2A 1AQUA 1I2MA 2IWRA 3DL0A 4Q4AB 2JJ2A 2ZRAA 4G5QA 2NTYC 1KI9A 1UKVY 3OAAA 3FKSD 2KI5A 5L8VA 4LBYA 2N1BA 3C7KA 1WP9A 2XOKD 4OQLA 4XVRA 3RSOA 3VR3A 1QHSA 1ZU4A 3A1SA 2ZTSA 1XJCA 2VHCA 1NRJB 3GJXC 5HKKD 1KHTA 1V5WA 3RVBA 1OKKA 2REXB 1EFRA 1WCV1 3FDIA 3ZIAD 3K0AB 1NVXQ 3C5CA 4V0MA 1DG1G 2GZDA 4C2TA 1OV4A 1FNNA 2XTMA 4PSKA 5JSZA 1Z0JA 1Y3AA 1DTSA 3B7GA 2OFOA 4G5GA 3Q5DA 4JLDA 1TU3A 4QBIA 2ZRJA 5FPYA 1E2GA 1OLOA 4QNRA 4U5XA 1KGDA 1FMJA 4NE2A 3UG7A 1ODFA 4CEIB 3EPKA 2RGAA 2IS1A 4MUBA 4GMDA 2DFKB 2BMJA 3EWSA 1EX6A 2VL7A 2FOLA 1UEIA 1XP8A 4LRWA 1TQDA 1PVOA 3JZMA 1NVUQ 3MWKA 3KXKA 3L2OB 1OSNA 3S1AB 4IDOA 1ZC4A 2QPTA 1YE8A 2AX4A 3LY5A 2IF2A 3U2QA 4LJ4A 1D9XA 2GXAA 2DB3A 2MSEB 4I1VA 4EJSC 2QQ0A 1EWQA 3I32A 1SXJE 2ZEJA 3E2IA 4IW3B 1E2QA 4LCBA 3EG5A 3KQKA 4NYJQ 3TLXA 4Z51A 1G8PA 2LKCA 3KQNA 2GJAA 1NKTA 4MRNA 1Z47A 1CJVC 4D4LA 5B30A 4LY6A 1U0JA 2RGNA 2NO9A 1SXJA 5FPSA 3RRZA 1T8UA 3EIQA 4JKIA 2ZRFA 1R8QA 4FCWA 2EFGA 2QP4A 5DN6A 1OB5A 4DLXA 4AWXA 2OAP1 3EARA 2ZJAA 1W36B 2F43B 1KO5A 3EZ6A 2PJRA 5EXXA 3HPQA 1QZXA 2WBLC 3IIKA 4M1KA 4EDHA 5B58C 2RCNA 4ZCIA 5AJXA 1JJVA 4DCNA 2HXSA 5CJ2A 2OILA 4L15A 2FEOA 2GCOB 1Q12A 2QAJA 1KO1A 4YDHB 3UWKA 2WMOB 2F3TA 4TQUS 5LPNA 3BC1A 5BN5A 4OI2A 2G0TA 1IXZA 1CJTC 1R6BX 3H2YA 1XCMA 3H1TA 2QRNA 2RB4A 4BE7B 2MSCB 2V4ZA 4RZXA 1GRQA 4JYCA 2JLWA 2EWVA 1BKDR 3THOA 4MGYR 1E3MA 1RW4A 4P4TA 3JVUA 4V0KA 2WJYA 2Q9CA 2ZYUX 4C7OB 2C9OA 5CK4A 5KNBA 1P60A 3SI7A 3AF2A 3SBEA 2KWIA 2OXRA 3DZDA 4A9AA 1M1YE 1AA9A 2J59A 3WNDA 4LJ5A 4P0TA 4Q02A 4O25A 3AQ4A 3QG5A 5JSZB 3QENA 1NKSA 4LK2A 4US2R 3NEJA 3B5JA 2QG6A 3EIEA 2BKUA 1XRJA 1BIFA 3F0TA 4LJ7A 2GILA 3TR0A 1AZTA 4G0NA 1BYIA 721PA 3NHBA 4IVPA 2QPOA 2LCFA 3WRYC 2CL0X 4YMWA 3GMTA 3IEUA 4RZUA 4ZCMA 1YRAA 4LBZA 5HCIA 1XD2A 5JI2E 4V0NA 2QT1A 4JZKA 2ODNA 3T06B 2J0QA 1Y63A 3LW8A 3L43A 4IDHA 1DPFA 4KCGA 4TQ9A 1G17A 1Z0IA 3BH7A 1GFIA 4DVGA 4D26A 4CYMA 1ZP6A 1G3MA 1GNRA 1YZTA 2DCUA 5DH9A 1KNXA 2GBLA 2QMOA 3KUCA 2FV8A 1JB1A 3QUSA 3R8FA 2ZS7A 1EWRA 4AD8A 2GZHA 4F38A 4NDZA 4A15A 1MV5A 4ZDJA 3HYTA 3CLVA 5AUNB 4C0LA 3PITA 3A1TA 4YMVA 1U98A 4MYHA 2VHUA 1XX6A 1MO3A 1EG7A 2XX3A 4DT1B 3BXZA 1D8TA 1QVAA 4Z8XA 1XXHE 4ON9A 1DG3A 3MRSA 1VMAA 2GCNA 4IHQA 3M0EA 2WJVA 3DZ8A 4TSFD 1SKQA 2FNAA 1TL7C 2F55A 4POAA 5GJBA 4C0SA 4A0HA 1DAFA 1OH7A 3GQBA 4DXAA 3W5IA 4JLVA 3OE7D 1XD9A 2QTHA 4YXWD 3K9HA 4C0BA 1OFUX 2BIFA 1XDBA 2IUTA 2ZRKA 3Q9LA 5SZIA 2IYQA 3ZQ6A 4FW9A 5KSYA 4CDGA 5GJWC 4D4KA 1P72A 4FI3C 4PZZA 1MABB 3TQCA 4I1OA 4HYYA 3GJ3A 1P5ZB 4JT4A 1DAKA 4BRWA 2YV5A 1OYYA 4DEXA 2YC4C 5CYOA 4DSOA 4MRSA 2FFBA 1S9HA 4DLUA 2XSZA 2LWIA 3UMSA 2NMVA 1OPXA 2R6GA 4CIDA 2VSFA 1ZCAA 4M22A 5FOTA 1JECA 3LD9A 2FGKA 4AIIA 1JEEA 2D62A 2QTFA 1G8FA 5DIFA 2CJWA 3KXLA 2MMCA 4F91B 3I92A 1FTNA 2IC5A 5IRCD 5L3VA 2BKEA 3U3JA 1F5NA 2WPDA 2NZ8A 2YWHA 5FTNA 4KYUA 2NGRA 1NBMD 1XTIA 3HYRA 4AG6A 5IDVA 5DHFA 1BH2A 4DIEA 1RJ9B 1AKEA 4LI0A 5TB5A 1ZYUA 4XD7D 4DCVA 1VECA 2FPLA 3SHWA 4BFSA 2IYXA 2P65A 2BBOA 1W0KA 2BCGY 3NXSA 4GZLA 3LXRA 4HI0E 4QL3A 2JDIA 5KDLA 4TQAA 3RAPR 1TPZA 1W1WA 2WZQA 2DHRA 5F3WB 3CF2A 1GDDA 3H86A 1HV8A 1X6VA 1NY6A 1ZD1A 2QP9X 3CPHA 3KKQA 3P4XA 3TKLA 1KDOA 1MR3F 4B3BA 3GLHB 2Z0MA 4JLAA 5EP2A 2AFHE 2FWRA 1D2NA 4UXHA 4DIDA 4NYJR 1G291 5FFMA 1G4UR 1H65A 3ZS8A 3C4JA 5DHAA 5AJZA 5G53C 3ZVNA 5E3HA 1Q44A 1CU1A 2Z83A 1E0KA 1XB2A 4L5BA 1IN6A 4M9QA 2D4HA 2WOOA 4AI6A 1GP2A 1NN0A 2F7SA 3CF6R 4HAVA 3V4RA 4YMUA 4MKFA 3CWZA 4R9UC 2QORA 4KHZA 4P4SA 5EQTA 4M9XA 1XJ0A 2KB0A 4N0DA 4Q03A 1PUIA 2I1VB 1GNQA 4A92A 1OJLA 3HP1A 5G3ZA 2V1UA 3EWAA 1AGRA 2B8TA 5G41A 4GT1A 4LV8B 4P3YA 2JJ1D 3MWYW 4OK3A 5JS7A 4RKEA 1KO7A 1SVSA 2CLDX 1KAGA 1NI3A 4RD3A 2WV9A 1WBDA 1LB1B 2FU5C 4D0GA 3OIVA 2PH1A 1N6IA 1WRBA 4HLUA 2GESA 1LTQA 5CIWA 4LZZA 2JJ8A 4BRUA 1QHHB 1Q3TA 2IYSA 4QHTA 3UANA 2EYQA 4Y0AA 1J99A 2WWIA 4HAZA 1KZ7B 2Q6TA 3I61A 2CK3A 1YQTA 1NMYA 1IJFA 5FOXA 2B21A 1CR4A 1E79A 4V02A 4ACAA 4PPNA 5CB6A 2ZSFA 2Q0HA 1OXVA 2A3RA 5EUMA 3FHTA 3WBKA 4WVFA 3N5CA 1R7RA 1CR0A 4B33A 2QL6A 3N2EA 3NVAA 5DI9A 5FOWA 1AN0A 1CF4A 3WYGA 4ASUA 4CEHB 2FZ4A 3PUZA 1DARA 1GSIA 2WJHA 4DEYA 2BBTA 1CIPA 4OQNA 5J4HA 2AR7A 3SHFA 2J9RA 2ZS8A 3TVTA 1VCNA 1NG9A 1G21E 2PT5A 2GCPA 1E0SA 3T1VA 1H8HA 1OH5A 1MO4A 1UDWA 3W6PA 1UJ2A 4S35A 4URZR 1S96A 2P6NA 1U9IA 2Z5FA 4DB4A 4GL2A 3G0HA 2OT3B 1FX0A 2IK8A 2D7DA 1WQ1R 3CWQA 2ECKA 2A5FA 3M6AA 5FL7A 5J4YA 4UNRA 1X3SA 4CEJB 2VHJA 5F9HA 2PX0A 4MDFA 4JVNA 5AUOB 4C0AC 4A1FA 2D2FA 4EAQA 4EPXA 1KSJA 1ZM9A 5AUPB 2C03A 5JWRA 4ZKEA 3KFVA 3QPWA 1GIAA 2LKDA 3BFVA 3V9PA 2OFXA 1VTKA 4QKQA 1C9KA 2VHTA 3B82A 2A30A 3F3YA 4P4SB 1ZW6A 2FA9A 3IQXA 4WBSA 5H8WA 2IHYA 2PZGA 5KOYA 3IPYA 1RFLA 5A0FA 3CF0A 3AF0A 4PR0A 3HR8A 1CULC 4KU4A 4XH9B 1NLZA 5B2ZA 4ZKDA 3TUZC 4RCZA 1N3BA 3TE6A 4JIMA 1VCOA 2DY1A 1SZPA 3TMKA 1W2HA 1Z6AA 2G3YA 2ZREA 4LSGA 3GEIA 1QF9A 3QG1A 2ZITA 2FFQA 3C14C 4DJTA 2QAGB 1OFIA 3LLMA 5DGXA 2WKPA 3KTAB 5H70A 2ZROA 5JECA 4CT5A 3U44A 2OLKA 4LGMA 2VP6A 4M1TA 5GVSA 1WE2A 2O5VA 2XNDD 4QJ5A 1W5TA 4ZO4A 1TEVA 2G0NA 2QSYA 1DADA 1SVIA 4X8LA 1M7HA 4CVNA 2G77B 1R5NA 4PPGA 3LH5A 4X8OA 2OBMA 2ERXA 1XJQA 4BQSA 2FFAA 1BOFA 1UKEA 1YZUA 5HKKA 4ZI2A 4Q4LA 3NBFA 3VR6A 5CITA 5LD2B 4A36A 2JIZD 3GFTA 3WMEA 5F98A 4KJZA 2J46A 1KJZA 5CM9C 4M4SA 1S1CA 2IXGA 3AKEA 1QG2A 4DDTA 3VFDA 4D82A 5TDHA 1S2MA 3GEEA 3OIUA 1VG9B 4US1R 1RZ3A 1E4YA 1R10A 1YR8A 2BOVA 4DKXA 1VIYA 1VPLA 3NKVA 3NIBA 2ZU6A 4TL6A 3IBYA 1I4DD 2A78A 5DISB 1NVWQ 3UPUA 5IF9A 3MGCA 3SN6A 2QBYA 1Z29A 3KB1A 2ZRDA 4M0LA 4ZIRA 4BLPA 1E9EA 3SS8A 3KQHA 1RVDA 5KSOA 1GL6A 1AGPA 4C0JA 3SJAA 1QRAA 421PA 4LC0A 1UBFA 4K8OA 1XCPA 1QG4A 4TLDA 3A6PC 3OIYA 1N6HA 3LQRA 1Q1QA 1VYUA 5IK2A 3X1WA 1P7CA 4RZ2A 1KTVA 3TUIC 2WSSD 4AG5A 1J2JA 3A4MA 3ASYA 3BWDD 1SQ5A 5KO2A 2FF7A 1TADA 3GJ7A 3WNBA 4Q1AA 2GEVA 2IYVA 2V7QA 4F4IA 4QRHA 1S8FA 2NO1A 3TJZA 3HPRA 4F4CA 1U90A 1MKYA 5EZ5A 1KJYA 3D8BA 3TRFA 2WKQA 1UF9A 5FUYA 3D6TB 2ORWA 4Q7KA 2R6AA 4C30A 3LDAA 1GM5A 2ZPTX 2JCSA 3EC1A 1I4TD 3BD9A 2QMEA 5DYGA 4XVUA 3IBGA 3LXXA 4EFNA 4A0RA 1UAAA 2GEDA 4EPVA 1Q21A 2CE2X 5JFGA 4I4LA 2VPPA 2EFEB 5K8TA 1JR3A 4PXAA 3RWOA 4BLOA 1UEJA 2RGEA 1RRPA 2O8FA 3OIWA 4A0GA 3G5UA 1N6NA 3PFIA 1PZNA 5G3YA 1HEIA 2H92A 1E2JA 4BWYA 3UG6A 4F92B 4TL9A 4IVRA 3QE0A 2AN9A 3SR0A 1E9AA 3E5HA 1IN5A 3DOFA 4UJ3A 2DWQA 3CH4B 2H16A 4OL0A 3W8RA 2REOA 3PCRB 1W4CA 3QEJA 4UNPA 1ZIOA 3U7HB 1YZLA 2ATXA 1E32A 2ASEA 1EFCA 2WJJA 3KZ1E 4D4JA 1OIXA 3X1ZA 2R9VA 2H8KA 5EUQB 1G20E 3A4LA 4I81A 3B85A 2F9MA 1YJ5A 3FPAA 4U02A 1YR6A 1N6LA 3EAQA 5JI3E 2EW1A 3B8HA 3RRNA 1ETUA 1C4OA 3THXB 1F3OA 3AVWA 2WIBA 4BFYA 2YNMA 1JXOA 2HJGA 3B1WA 4BLQA 3FE2A 4XWOA 5JHGB 1G19A 3GLGE 4QHSA 4K46A 4ZIRB 1GG2A 1JAIA 1HE8B 4OBEA 4UJ5A 5CK5A 1C1YA 2WOJA 4GZMA 4RJLA 1ZJ6A 5AJWA 2AHOA 4FMCF 2WWGA 3A8TA 4LBVA 2FEMA 4JJKA 1E9FA 2YWFA 4LUCA 5GADl 2WIAA 3BB3A 4ESVA 1VKJA 2ANCA 1SHZA 3GLGA 1K5GA 1FMLA 2VIIA 1RE0A 4MYCA 4MQBA 4PSVA 4Q9IA 3NC1C 5C4MA 1EFUA 1Z3IX 3ECCA 2B92A 4XWAA 5C18A 3BFXA 1GRNA 3LLUA 1OXXK 4Q00A 4D4MA 3AP2A 2Q3MA 4Q1FA 2VO1A 4EPWA 5TMPA 3CPJB 2H5EA 3RC3A 3BERA 1KMHA 4PHGA 1DS6A 5HZHA 3TIFA 3M1IA 1U94A 5JZVA 3AVYA 4LYJA 3JZAA 1D9ZA 2Q9BA 3L0PA 5DI3A 5SZJA 2O8FB 3VR4A 2AD1A 4RFSA 2WJIA 3TBKA 4Q9LA 4DHEA 4TT3D 4R98A 3OE7A 1KMQA 5CM8B 2JLYA 2ZE7A 1FP7A 3DMNA 1F2TA 2ORIA 2WWHA 2C98A 3TR5A 1QHGA 4JBWA 4PAQA 3K9GA 2XNSA 2PX3A 1LVGA 1T8TA 3NWJA 3OHMA 3ZZ0A 5BYKA 4KYIB 3TAUA 1OHHD 2Q3FA 2W6JA 1KO4A 2ZYTX 3L8ZA 4ILEA 4ERNA 4WXPA 2OCYC 1DAEA 4WIAA 1EGAA 2ZETA 1OIVA 3K9LA 3WNCA 2H57A 3RS3A 3NTUA 2ZI5A 4DSTA 1NBME 1VCMA 1JQLB 1TNDA 2J0SA 3PV0A 1L2TA 3QKRB 4URWR 4B3GA 3PUWA 5E4FA 4FCTA 2GNOA 5KNCA 3VHXA 4KI0A 4QBFA 4IJMA 1TQ4A 1E1RA 2N46A 2H18A 1KI6A 2AK2A 1NBMA 4CGZA 4P31A 5L3RA 4WA7A 5JWHA 3HU2A 4HB2A 4QOSA 1S3GA 3VR1A 1E2PA 4D0NA 2QTVB 1SHKA 2QRZA 2JLRA 5BWMA 5ELXA 4EJSA 2HT1A 1G6HA 2IUUA 1XMSA 3K70B 3AUXA 3QEOA 1NN5A 4NPHA 2AKYA 3D31A 3QJYA 1EX7A 1E2DA 1YZGA 2F1IA 4LYFA 1UM8A 3W6OA 2JA1A 3BS4A 2ONKA 4Q1CA 2C77A 2W6IA 1YHNA 3K09C 5FTKA 3V00A 1BMFA 4QGAA 3B9PA 1T5IA 5BQ5A 4Q18A 4YMTA 4KFSA 2ZJYA 4D81A 2HLDA 1E2MA 3DOEA 4FMDB 1FQJA 5FI1B 4EUNA 2IXEA 1ZMXA 4AKHA 3SEAA 4EPTA 2V6JA 5FI0B 1T0JB 2O8BA 3T34A 3MAAC 4DLYA 1ZU5A 2VF8A 2P2LA 2ONJA 1BO6A 4PSAA 3EZ7A 4MYUA 3MJHA 4FINA 2QGZA 3THYA 4LDJA 2GXQA 4C0KA 1M34E 1W47A 1TEXA 4Q48A 3BORA 4A2PA 1KKMA 1GZSA 1E2HA 3ZD6A 2ZRNA 4JBYA 1Z0FA 2O0KA 2UZIR 4MUAA 2Y8EA 4GP7A 3CX7A 4EIWA 3CRQA 821PA 3NH9A 1JJ7A 3CBQA 2ZE6A 4HB0A 2GK6A 3KJEA 3U3MA 1E1QA 1XMIA 1D2MA 1N5LA 1HUQA 1NF3A 4ARZA 5FOVA 3UMFA 3NH6A 2VSXA 2IYRA 4UKDA 4EKDA 4PPQA 1MO6A 3FGNA 1E2IA 2ZUBA 4JT2A 3U7FB 1T9HA 4PZYA 1QHIA 5M04A 3K0CC 1NL3A 4YQFA 3DDCA 4GBMA 1JAHA 3VKWA 4M9SA 1T3LA 1X8LA 3BK7A 2O8DA 3KL4A 2C99A 2JLZA 5P21A 1VCIA 5D3MA 3TK1A 2ZAMA 4AKGA 1M8PA 1QVRA 3KDSE 1QHXA 2VEDA 3NEYA 1U0LA 8OHMA 1S1MA 4NCNA 2ZYWX 4EJSB 2ANBA 2CNWD 2IF0A 2J7PA 3ZDQA 3IDQA 2C2HA 3EA5A 2ZSEA 1RC8A 2R2AA 3CH5A 4MH0R 2IEZA 3VKHA 2GF0A 5KDOA 2VBCA 1K5DA 3AKYA 3GJ5A 1E9SA 4JLKA 4XTCS 4O3MA 3OEED 4LYHA 2ZJZA 4OHVA 1LS1A 4ZCLA 3T1TA 3O8CA 4QNMA 1GTVA 1EFHA 1NLFA 3QKSA 4DSNA 1G64A 5E7JA 2CVHA 2PBRA 2C04A 2VQSA 2WWFA 1N0WA 1Z0KA 1NSFA 3KJHA 3KUDA 4W5WA 1FFHA 3SQXA 5TVKA 2IBMA 3KQUA 3THWA 3IIJA 3ZD7A 1G16A 2IXFA 2QROA 3B1ZA 4RZ3A 3MD0A 1E69A 4CF7A 2QMHA 1IXRC 4DLRA 3I8XA 3BH6A 2D7CA 2FFHA 4Y0VA 2A9KA 1WXQA 2OCPA 5K8UA 3PENA 3R7WA 3H0KA 4OJQA 1ZRHA 5GJCA 4CRWB 1G6OA 4B34A 1YVDA 2RHMA 1OIWA 4FXPA 2HUPA 3RS2A 4E22A 1RYFA 3QI2A 1YKSA 4JJZA 2ZSBA 2PLRA 3PEVA 2P5SA 1SXJB 4BLSA 3I5XA 3LX8A 4OYHA 1KDTA 3KJIA 3RLFA 2H1LA 5LBIA 3EZFA 2JLQA 3K0FA 2BVNA 1T91A 3K70D 4PO8A 1Z6GA 4OQXA 4MGIR 3BGWA 4A6PA 3LX5A 2WAYA 2WJGA 4RD1A 3WMFA 1GVNB 3LNCA 4Q9HA 2FE4A 2JATA 1LF0A 2GTPA 1XXHA 1GITA 2NIPA 4IOLA 4TMWA 3T61A 2G1JA 1SKYE 3U7EB 3AVQA 4AYXA 3AKDA 4B74A 2BCJQ 4ZPXA 5TARA 1S9DA 5LB4A 4YLGA 3CX8A 4QBHA 3IIMA 3DKPA 3LV8A 4L4UA 5CDFE 3G82C 4DC9A 2GXUA 2ZVQX 4DUGA 2I4IA 3TH5A 3C8UA 3RDPA 4HUTA 3BIFA 4DCUA 1XMJA 2PEYA 2JGNA 2PMDA 4R7ZA 1E4VA 2QE7D 3C41J 1KJWA 4B76A 2FDCA 2IEYA 5KYKA 4Z54A 1G3RA 1CP2A 2QA5A 3I73A 1R0ZA 3FFAA 5CDFA 4DLWA 5L3SA 3TSWA 3U3KA 1UBEA 2DFNA 1P2TA 3KB2A 1R8SA 2C96A 2BBSA 1ZM7A 4HZUA 1IOZA 3OEHD 3LW7A 5FPKA 2E87A 2WSSA 2W2VA 1G8YA 3U61B 1XEWX 1P2UA 1W0JA 3RS4A 1R2QA 4BUJA 5FTMA 3K9NA 1AS0A 3QXJA 4B3FX 2FX3A 2XB2A 4B48A 1FUUA 1XD2B 3Q8XB 2ZJ2A 2XZLA 2XJ4A 2N42A 1CKEA 1EK0A 4C9BA 3DHWC 1TQ2A 3O8RA 1KZGB 2G88A 3GFPA 4J0QA 4MA4A 1W36D 2WAXA 1MO5A 1NIJA 2GJ9A 2EQBA 2OSBA 3EPJA 2QP3A 3FHOA 1P9NA 1P3JA 5K8IA 1P61B 3HJNA 1P2VA 2IYYA 3I8SA 1JPJA 2QM8A 2F6RA 2JJ2D 1FL9A 1MRSA 3OAAD 2GAOA 5JJKA 4A6XA 4PC2A 4TMXA 1HYQA 4TTPA 2J5XA 3L82B 4B47A 1E2EA 1MOZA 4K81B 1T3HA 1ZD8A 3CO5A 1YR7A 4LOAA 3AV0B 1II8A 1OKKD 1G9XA 1EFRD 4PPFA 1HY3A 4PC1A 4WZ6A 3CNNA 3AM1A 1MRNA 2ODEA 2YZ2A 3VKGA 4JLOA 1F2UA 3CNOA 3FHCB 4EFMA 2DFLA 2KBFA 1CTQA 2EWWA 2GWHA 4OI4A 2EFDB 3T15A 2NO0A 1XXHB 1UPTA 2O8BB 2KBEA 3EXAA 1G3QA 1RYHA 2GEUA 4NONA 1E96A 2ZRHA 3AF1A 3OFNA 4CW7A 3CZPA 5H68A 4LHZA 4V0LA 2IYWA 2BEJA 2BWJA 2IUSA 4ZDKA 2W0MA 4LC1A 1KI2A 3Q72A 1AIPA 1I4LD 3MLEA 4RD6A 3WY9A 2G83A 4MRPA 2F3RA 5JEEA 1CR2A 2BJWA 4QXAA 4U00A 4JS0A 5L3SB 4EQ6A 1KSFX 4XVQA 2OO7A 1ZIPA 3B78A 2B6HA 4M53A 2CJWB 2G1KA 3IPXA 3VAAA 4PHFA 4Q9JA 4B73A 4IKEA 1ZUHA 5EE9A 3QY0A 1S0UA 1KK2A 3B1YA 3VHLB 1AK2A 3WYFA 2AWNA 2CHQA 1SXJD 3IO5A 4Z1MA 3GLFE 2ZRGA 4RKFA 4OHWA 3AH8A 2JLSA 1A5TA 1L4UA 2J0UA 1XCGB 3DPUA 4OHXA 4BPBA 1WMSA 5DN6D 2KSQA 4QJ3A 1AS3A 2W2TA 3UIEA 2R6CA 2HYDA 1NVVQ 2ZRCA 3UKDA 4LHYA 4TYWA 2P67A 2RHDA 2A5DA 4TL7A 2QPAA 4PHTA 3GLFA 5JEDA 1OFHA 5FTLA 4M2LA 4RVCA 4N3NA 2B8WA 4JL8A 4Q19A 2AKAB 3LVQE 3AVTA 3I72A 1RRCA 2TMKA 1Z6TA 5TV2A 1PLLA 4JLNA 3MSXA 4KFTA 2CE7A 1HURA 1E0AA 4G1UC 2QQEA 4NMMA 4NH0A 3VX4A 2CVFA 4TN1A 1G5TA 2V55B 3VU9A 4LJ9A 2RGDA 5AR1A 5AWFC 2VF7A 2WTUA 2BC9A 4KV9A 3TSZA 5FOUA 3K1JA 3SJCA 4DCSA 2ZRBA 4GOXA 5E7IA 4W5JA 2VYFA 5A4JA 4OK5A 2J3EA 3K53A 4XTRA 2B7CA 1QDEA 5AJYA 3L0SA 1VYTA 4GOKA 3TW4A 2XXAA 4PQFA 1FNMA 1PJRA 2ZI9A 4AC9A 2A5GA 1HT1E 4KODA 5LD2C 1Z22A 1G5PA 2RGCA 3LA6A 4EQ6B 1Q57A 4AKEA 3FKSA 3ICQB 2OFWA 1O87A 2YC2C 2XOKA 4D80A 3VR2A 5J4KA 4TMKA 1HQCA 4V0OA 3ADCA 3W90A 1DAIA 3GD7A 1JNYA 3ZIAA 1FQKA 4DLZA 3LFUA 1Q1EA 2O0HA 4O2RA 1OF1A 4QM7A 3ZVMA 1R0WA 2WICA 4BFWA 4F93B 1U99A 2VA8A 1NMZA 4N1AA 4MKGA 1ZNWA 4P33A 4GI7A 1WBBA 3P20A 2FN4A 4URYR 4YC7A 5FPTA 3U3RA 1G7RA 2FPMA 3T1QA 3O47A 2ZR0A 4RY2A 5EP4A 2AWOA 4NCHA 2VLIA 3X1YA 5JRJA 4TMZA 3SNHA 1FX0B 2R65A 5HE9A 3EASA 2X19A 3WHLA 1JBKA 2O8CA 1WA5A 2CLSA 4O0MA 3CM0A 1U0HC 5EXTA 4OHZA 1N5IA 3DEFA 4NYIQ 1GKYA 4F4JA 4QGGA 4X8MA 3SE0A 2D74A 3HU1A 1DE0A 2ZRIA 1M7BA 2JLUA 3U7GA 1N0VC 4ESHA 1ZINA 1FZQA 2R62A 3FMPB 3QXHA 1SVWA 1BS1A 1G8GA 3GLIE 1DVRA 3AVPA 5FBRB 1Z6XA 4GOJA 4GDFA 1ZCBA 5JJIA 2BMFA 3IUYA 2OXCA 2RGXA 4QJ4A 2WPDD 3CKLA 4GMXA 2XXAB 1N6RA 3QVUA 4FWTA 121PA 3RABA 5BYJA 2V1XA 3LWNA 3TNFA 1W46A 3WP0A 4B2LA 1P2SA 3EC2A 3I62A 4HDQB 4RD2A 3B9QA 2F1JA 1NP6A 3U44B 2UZ3A 3QVVA 2HV8A 5J5CA 1B0UA 3QXXA 3Q7PA 4QHYA 1AS2A 2JDID 2ZI4A 1A2BA 1G7SA 4DDUA 2PT7A 2Z6VA 4NYMR 3GJ8A 1GKIA 2CNWA 2Q9AA 3PUXA 2IX3A 1S4QA 3HR7A 1N5JA 5DE3A 5E95A 1AZSC 3LBHA 3VNUA 1PLJA 1AJEA 2C9CA 2WVJA 2JAQA 2A5JA 2YOFA 5DLQC 4B3DA 2ODBA 1RIFA 3E70C 2HCBA 1RKBA 1KNQA 2V54A 3AB3A 3OEEA 4Q4JA 1V43A 4PC7A 2GF9A 3KKNA 2ZJBA 3AP1A 5B57C 3KXIA 3CRW1 3D3QA 4KLZA 1N2CE 3W3AA 2P6UA 4HZIA 2AK3A 2ODWA 4E09A 4LJAA 1W4AA 4JLJA 4U7DA 2QBYB 2FSIA 3ZVRA 1NVVR 2O8EA 1Z28A 5FTJA 4QGFA 3WRXC 5JMTA 2ZS9A 4NKRA 3PR1A 5EP1A 2O8CB 3FMIA 5FUWA 4LBWA 1R0YA 2BBWA 4D0LB 1E94E 1HA3A 1Q1ZA 2OG2A 1SVLA 5EE1A 1PUJA 3LRPA 4OI0A 1JALA 4JVMA 1KI3A 1Q0UA 3GEHA 3PQCA 3A1UA 1IQPA 4MGKR 1RRFA 2MSDB 3RANA 2FSHA 1LY1A 4XSHA 3SYKA 2YWEA 3QKTA 1W49A 3N70A 1P9RA 5KNDA 4RFVA 4TZ0A 1HH4A 2DR3A 3KX2A 5H1YA 3MFYA 1XTJA 3LAWA 4I1SA 1AQYA 1J8MF 1UDXA 3I4LA 5GJVC 4BZQA 3ZGXA 2XAUA 2C78A 4H1UA 4NCKA 1XZPA 3AKCA 2VP5A 1KI7A 4HLCA 1IJEA 3GP8A 3VNVA 4JYBA 2ZSAA 4A8JC 4QFMA 1OYWA 2XTZA 3O8DA 2OAQ1 3DM9B 4KSBA 2QSZA 5CB8A 5JJLA 4AKIA 1E0JA 2G6BA 4JVSB 3W3ZB 2IS4A 3IEVA 1E79D 3K0AA 2OLJA 3LBIA 4TSFA 1CS4C 2DBYA 3RNLA 2ZJ5A 4G5OA 1A4RA 3EZ9A 1TUEA 1H8ED 3NDBB 1KOFA 4YXWA 4ASUD 2GVDC 5KSZA 2GJKA 4B71A 5BN4A 1X1RA 4I99A 2B7BA 4EPYA 3SOPA 4GSYA 2WWXA 1VG8A 2OCBA 1KY3A 3UK6A 4A2QA 2HYIC 1XPUA 1H8HD 4LJ8A 5EXPA 3KJGA 2V9PA 2NPIA 3W8NA 3PXGA 4FMDF 1LNZA 2XZPA 1IN8A 2QMUA 1XTSA 1GKUB 5EP3A 4ZI3A 2PMKA 3K09A 3W9YA 5FL7D 3NBZC 3LO5A 3S1AA 3KKOA 3AF4A 1DO0A 5CLLA 1XEFA 5EE5B 2O52A 4M21A 3L0IB 3V4FA 2BJVA 2VSOA 3RC8A 4NL4H 4OI1A 4NZYA 4MITA 3NC0C 4IFBA 5AK0A 3OEHA 4RD4A 4MKHA 3EZ2A 3K70C 1XBTA 2ZE5A 4M1WA 2ZIAA 5HR5A 3QF4A 2O8EB 4M1OA 5KPDA 4JLMA 3AGQA 2YKGA 3BRWD 3EIHA 1FTSA 4IRUB 1FOEB 4FMCB 1M7GA 5J4LA 4XD7A 4WZAE 3FMFA 4B43A 2BV3A 3A1WA 4KBGA 1HE1C 2CL7X 4LPSA 5C1BA 3QXSA 3L8YA 4OQFA 3GJ4A 3B1VA 3QBTA 2C5LA 1U81A 2Q3HA 3GLGB 1XFAA 4X8HA 2FSFA 2HJVA 3W6NA 2QN6A 1KDRA 4NYIR 2ZSDA 4C3ZA 5BXQC 3ZLJA 2HDNB 1N6KA 1US8A 4PO9A 4IEIA 1W4RA 2GCOA 3VR5A 1G3UA 3H84A 3D7MA 2J0VA 4HDCA 1CJUC 4V0ME 2D06A 3RSLA 2CCJA 3FB4A 1F48A 4TL8A 2QENA 5CLQA 3PIRA 3U3OA 4BLTA 2K5UA 1KMHB 4HLQB 3QQ5A 1GAJA 3H4MA 1ZUNB 3K0CA 4C7OA 5HE8A 4A0FA 4AURA 2ZJ8A 3SJBA 4LHWA 1AKYA 3X1XA 3I3SR 4AK9A 5DI3B 2P3SA 3Q7QA 5FBLB 4B2IA 4RFSB 3P32A 2W58A 1M6NA 4QBGB 3ADDA 2IS6A 2X2FA 2QNRA 1A7JA 1NMXA 1F2TB 2JEOA 2O0JA 4DRZA 2QI9C 3P1JA 4L16A 3SJZA 2Q21A 4FIDA 1PV4A 2FMXA 2ZUCA 2CHVA 3Q85A 3SBDA 1W36C 3T35A 4DDVA 1A82A 1R4AA 1UADA 5G40A 1ONBA 5EE0A 3WBJA 2VP0A 2JJ1A 2I1QA 4I1UA 1RRGA 1XWIA 2ZYVX 4TWZA 2PLFA 2VHQA 3LBNA 3PEUA 3QNUA 4B75A 2J7KA 4GNKA 1M2OB 4N0EA 3I5YA 3CRMA 1X86B 1GOTA 5IK2D 2R8RA 2ZE8A 5DNYB 2WWWA 5HZKA 3J81k 2MMGA 2G9NA 5J40A 1P62B 1A2KC 4R71A 2IYLD 2V7QD 1KK0A 1KI6B 3ZZTA 4DSUA 1UBGA 2JASA 2NOAA 2NZJA 2OEPA 3QF4B 1E9CA 2P6RA 1ZVQA 3N2IA 3QPUA 2YJTD 3W34A 2GAAA 4DT1A 5GVRA 5FOSA 1PLKA 3DM5A 1IAQA 1FP6A 5C4GB 4BZXA 4G01B 1Z06A 1FW6A 1T6NA 4L9WA 1YU9A 1JR3D 1T5LA 1D2EA 2EU8A 4A4DA 1NG1A 4HAYA 521PA 3A58B 4RSGA 1OFTA 1US8B 3DO6A 3KKMA 1W7AA 1Z6YA 1Z8FA 4C2UA 4G5RA 4DLVA 1TMKA 1KI4A 5KTYA 1SULA 2AXNA 621PA 4C4PA 1NSTA 1N6PA 1ZD9A 3RRYA 4DLSA 1ZNZA 1E2NA 1MABA 1VG0B 1YRBA 1DBSA 2CL6X 2J1LA 1QHNA 2ZRMA 4PAMA 1P4SA 4UNQA 5DYIA 1E2LA 2IYUA 5SZKB 3HWSA 2YWGA 3W5JA 3AVUA 1JPNA 1XF9A 5TXGA 5IT5A 4NTZA 1NLYA 2FJUA 4M8NE 4R2IA 2P0EA 2HEIA 1EXMA 4DBLC 5BW8A 2GDJA 2RGNC 1VDZA 1SXJC 4TLCA 3FYHA 2NPFA 2KE5A 3THYB 2V6IA 4IFEA 3R9XA 1Q3HA 2QT0A 2NO7A 4Q47A 3NG1A 4C0HA 4DDWA 2FG5A 1J90A 1CLUA 1G1MA 2Z4SA 1CR1A 1U8ZA 4GRAA 2DWOA 1RJ9A 1JR6A 2F1HA 3RS5A 4A2WA 1XEXA 5DO9A 4ARZB 4EFLA 4PHHA 5TY0A 1UKZA 2I3BA 1FUKA 1OT3A 3AUYA 1JI0A 1KYIA 3GLHE 4HEJA 5C46F 1VG1A 1VIAA 2XNDA 1COWD 1OW3B 5HCNA 3DVLA 2C8VA 4DWJA 2BDTA 5F2EA 4KITB 1L8QA 2L0XA 2Z43A 4FD2A 2EFHB 2UVQA 2ZQ5A 4MKIA 4HB3A 2O8DB 1BYUA 2A2ZA 4XJXA 5D3MB 2JIZA 3GLHA 5EE3A 3SU8A 3LVRE 3F8TA 3EW9A 2GZAA 4BASA 1U2RA 1NNEA 4NBSA 2IT1A 4BZPA 2YOGA 1B23P 1G5RA 1MT0A 2ZU0C 1IY0A 1KSHA 5E7MA 4BLRA 5JLJA 2X1VA 1NJFA 5KU1A 1GL9B 4C0QC 4DZZA 2ATVA 1J70A 4IOJA 1Q1BA 3BAFA 1JEDA 1XMVA 3FVQA 4IDQA 2RH5A 3C15C 4WZBE 4IOMA 3SDZA 1N25A 2GJ8A 4JLBA 2PZEA 3QKSB 2BM1A 4W9MC 3ZH9B 4HAUA 2J41A 3FTQA 3IKJA 3NBYC 3ONWA 4OQMA 3ZZUA 3B13B 1YR9A 2W6JD 2GBLC 1ESNA 3GJ6A 2IYZA 2Z4RA 2ZI6A 1NY5A 2A7QA 3THWB 1T4GA 2ORVA 2VRWA 1OH8A 2FH5B 4RD0A 1E6CA 5CJPA 1TQ6A 3QSYA 1G4AE 1VYVA 2BMDA 2XB4A 2YHSA 3CIOA 1G7CA 1QHHA 3IGFA 1IN4A 2F1RA 4R2HA 3FWYA 3AVVA 4MYTA 5ANRB 4GFDA 1YZNA 3R7WB 1KSGA 1IY2A 3VMFA 1E1RD 3R20A 3IO3A 1IN7A 4KFRA 4PC6A 3A1VA 4PAOA 1CRQA 3K8YA 3AF3A 2AFIE 2YOHA 4H9GA 3KKPA 4Q01A 5KDDA 4Q7LA 1XEXB 3DKVA 1TF7A 3MWLA 2AD5A 4CEHA 2WM9B 4A82A 1F60A 2DWPA 2A5YB 2HF8A 1DAMA 4TLAA 3K0FB 2ZRPA 3QF7A 3EPLA 4ZDIA 4IDPA 4S2EA 4B44A 3CRRA 4BFTA 4GPTA 4LV6A 4TLEA 1G8HA 4IXNA 4Q66C 2WKRA 3EPHA 2R6FA 3K0EA 4V03A 5SZHB 4L9SA 2FZLA 3C16C 2DYKA 2ZI7A 2ZVPX 3BBPA 2W6ID 4HAWA 2HT6A 1BMFD 2ZUDA 1CRPA 4D2IA 2OHFA 5L3QA 4BEJA 1XPRA 3NDPA 2IA5A 4CEJA 2GETA 2HLDD 4E03A 3QBVA 2DPXA 3ZVLA 4YDSA 1TU4A 4PTLA 3MCAA 5CYPA 1CJMA 2FGJA 4OHYA 3U6BA 3BB4A 1SGWA 1CEEA 1SKYB 1ZUIA 2YINC 1QBKC 2C9YA 1Q20A 3WMGA 3CRVA 2EYUA 3Q3JB 1NN1A 3BJIC 5FL3A 4NYMQ 1ZM3A 4HLDA 2RKOA 1W2GA 4IVQA 3ZQJA 2E1RA 3ADBA 3MG9A 4HZUB 4FN5A 4Q7MB 4KAXA 1W48A 5EZ6B 3WP1B 1X8KA 3SQWA 4QG7A 4IOKA 4MDEA 1TF5A 3X2SA 3REFA 1OB2A 2IS2A 2NG1A 2GHIA 4HUQA 4KLNA 1E1QD 2QAGA 2CLCX 3SFZA 1W5SA 3K0SA 3KTAA 1U8AA 4NP6A 1ZC3A 2RGBA 5KHOC 1DOAA 1CXZA 3FOZA 3QIAA 3PVSA 3B1XA 4MRRA 4NU0A 4KSCA 3R8CA 3RWMB 2ERYA 1FPMA 5FBVB 2J45A 3HU3A 4NHOA 4KVGA 2AL7A 2EFCB 1L7VC 3SYLA 5FUXA 4Q1BA 1Z0DA 2W00A 4BFUA 2IYTA 1CJKC 221PA 1WF3A 1KIMA 2E9SA 4W7SA 2WSMA 3M4YA 3GCGA 3PUYA 3AVXA 4LJYA 3IHLA 3UATA 1AM4D 2HXYA 3GFOA 1T0HB 2X8AA 4TT3A 4HB4A 3HDTA 3AGPA 4ITRC 2EVWX 2VP2A 3UMRA 1H8EA 4DCTA 1SVOA 4AYTA 3OESA 4TYPA 4PO1A 4JKYA 4GP6A 2J7PD 4KVAA 1II8B 2ZANA 2ZR9A 2PCJA 2D2EA 4II7A 2QU8A 2YVUA 1LW7A 1OXUA 4QC2A 5IHPA 1F2UB 3P26A 3CX6A 3MMPA 4PQRA 3WXMA 2CCGA 2PJZA 1E2FA 1OHHA 2QAGC 1XNJA 3TW8B 3CB4A 1P6XA 3EX7C 3ADKA 4TMVA 2ZI3A 2HF9A 4HLUC 3VQTA 1IM2A 4P4UA 4PFSA 3TVDA 4D6PA 5B64A 5L3QB 1WB9A 3R9WA 1R5OA 1KI8A 2V3CC 4RCYA 1GRRA 5FR1A 5JRZA 3PUVA 3KQLA 1A1VA 1N0UA 4OK6A 4LPKA 4HSEA 2WWYA 3SC3A 2JLVA 2GA8A 4UNSA 1OH6A 3IQWA 4KO8A 3U6KA 2BEKA 2OESA 4ZDWA 2GRJA 3A37A 4IEEA 4Q5IA 1JQJC 1NN3A 4XSGA 3L0OA 1IHUA 2XTNA 2R44A 1CBUA 4MGZR 1HTWA 1G3IA 4PANA 2ZRLA 2IHBA 1UFQA 3SYNA 1II9A 1OXTA 4E5UA 4M1YA 2KJQA 3SFVA 3TQFA 4XWKA 1OXSC 5KSPA 5J4VA 1HQYE 4LJ6A 1W44A 3LQQA 3ZJYA 5LB2A 2QEQA 1XTQA 1X8JA 4JSYA 2VTKA 5F9FA 1U9IC 2IL1A 1GILA 4HUQB 2WMNB 5FPHA 5HTKA 1II0A 3ZYCA 4TTRA 1Z07A 4TTQA 2J0UB 1Z5ZA 2PEZA 4JMPA 1QHYA 2BM0A 2CBZA 3FKQA 4M9ZA 1J8YF 3RS7A 2H7VA 4JL5A 3U60B 1R0XA 3A36A 4ZV4A 1JXMA 3ND8A 3NHAA 4LWZA 1KK3A 4QM6A 4AYWA 3QXCA 1W4BA 4LYAA 4Q7JB 3GLFB 1TX4B 4YONB 3GJ0A 4PQYA 4BFZA 1NIPA 5KPJA 2CMKA 2CHGA 3CW2A 4TYNA 1ZNYA 4BFXA 1LF5A 2CXXA 4B32A 4HDOB 4TLBA 1ZNXA 2GVZC 3OF5A 4HATA 1I2DA 4LHVA 1K6MA 2CCKA 3VTKA 4KBFA 3T5DA 1E9DA 3THXA 4DUGD 5JWOA 1UKYA 3C5HA 1E99A 4CZ2A 4LV5B 3U5ZB 1LFDB 4CT4B 2XSZD 4MRVA 3VU9B 3B6EA 3PG5A 3QKUA 1HT2E 1NJGA 2VH5R 4G5SA 4B35A 5J47A 2RAPA 2AXPA 1ZBDA 4KXFB 4US0R 1YZKA 2IW3A 1TTTA 3RYTC 2D3WA 1Z83A 2W0SA 3RS0A 5FH9A 4HAXA 4B6EA 3CZQA 3NBXX 2ZXUA 3B2EA 1ELOA 3ASZA 1KAOA 1ZM4A 2QGNA 2UKDA 1OE0A 5EJEA 1K8RA 3GLIA 4Q9KA 3MJRA 4W5HA 3TSOA 4FMBB 4URXR 1W0JD 4G3XA 1O3YA 3R9IA 5CIQA 2GKSA 2X2EA 4URUR 1D5CA 1JR3E 1KO8A 1SVMA 4WW0A 2RGGA 3CNLA 3BOSA 3CR7A 4Q21A 1Z08A 4FCVA 1W0KD 1Z0AA 3KFXA 1T3SA 4D25A 2DFTA 1KI1A 3JVVA 4L8GA 2RMKA 3P4YA 5UKDA 2SHKA 1LS6A 5JHHB 4AY2A 4JLPA 4XIGS 2PL3A 3EA0A 2OCAA 1S3SA 4KFUA 2IWHA 4BFVA 4DLTA 2VP9A 3IILA 4IXMA 3SZRA 1ZAKA 3BE4A 3QOFA 1MH1A 1G18A 4Q1DA 5AUQA 2NO6A 2OBNA 4B3XA 1VHLA 4TZ6A 4E07A 1E98A 4UXIA 4M1MA 2JLXA 1E9RA 1J7KA 2XEXA 4BEBA 2QZ4A 1IBRA 1DELA 2W83A 2NQ2C 1XTKA 2HCJB 1P75A 2VP4A 3MUFA 5D3QA 4TMTA 4BGDA 2QY9A 1G41A 4A8JA 4F7WA 4JL6A 6Q21A 1EFTA 2FPKA 1GL7A 1D6JA 1XD8A 3A4NA 2F9LA 3FMOB 4UXJA 1Z63A 3UXMA 1KDPA 3U4QA 1YZQA 3ZS9A 1SVKA 3P27A 4PZLA 4M1SA 3VX3A 4Q4HA 1XU4A 3MWJA 4WXRA 5A5GA 2XGJA 3F5FA 3OFND 2YYZA 2ZAOA 4Q1EA 3WYAA 3FFBA 1ESMA 2GXSA 4P32A 3REGA 3QKRA 5LDDC 4YMSA 3PEYA 3OZXA 5K8LA 2OV2A 3Q5EA 4UNNA 1E9BA 2OBLA 2H17A 3DMDA 2FSGA 2OE2A 2XITA 3ETLA 3ND9A 4B2PA 1DEKA 3TAHA 3I1FA 4BECA 4Q4AA 3CUEF 1N6OA 3AVOA 2R6DA 4URVR 3TUJC 3X1DA 5BN3A 2X77A 4JBXA 1TAGA 2ZJOA 5EXSA 5FUVA 3PJRA 1TUIA 3O8BA 1G7TA 4EPRA 3CR8A 1COWA 4JVLA 2CK3D 1ZM2A 3GLIB 1N5KA 1IY1A 1P9WA 2WHXA 2V8OA 3E1SA 3T1OA 1XTRA 1LV7A 2REBA 4Z1MD 1IONA 3ICEA 4TYYA 4PX9A 5JCZA 2BMEA 4TYQA
chains in the Genus database with same CATH superfamily
2H63A 1WL8A 2ZUSA 3PEWA 3LIPA 2UVPA 3D9QX 3RFUA 1E2KA 3QFRA 3UWOA 4NCJA 1VHTA 1DX6A 3TR6A 5JBQA 3N76A 2EATA 3NEPX 2C1ZA 3MAGA 4JJGA 4P7GA 1UC9A 1YKGA 4ARAA 5GONB 1WF6A 1Y81A 1O0SA 4DSAA 3IHWA 2AJTA 4QGHA 4R8VA 1NAIA 2R84A 3QLTA 1C7JA 2YNMC 3QWFA 4OCZA 4U7TB 4MHTA 2OCDA 4B3CA 4DB2A 2PT6A 3QPVA 5HILA 1TZMA 3MC1A 4PLVA 1I94B 3W1EA 4MAFA 4NCIA 4QQRA 2PRSA 3NASA 4BVJA 2XZTA 2FK8A 3FHLA 4M0KA 5AK4A 2LNDA 2ZSUA 1X1SA 1ZJ4A 3ELBA 4IDNA 2IEGA 2OZEA 3GCZA 2VNKA 2CMDA 3H1GA 4P7JA 1ZHFA 4H1VA 3BFKA 4MUKA 4P4NA 4CN9A 4DQXA 4ACBA 4UPVA 2ZR7A 2DPHA 2FMHA 2B61A 3V8EA 3NQ41 3WA7A 3OI7A 4EJMA 4PC3A 2NSLA 1EYZA 3AUTA 4OU4A 3LPAA 4NBWA 1PR1A 3VPHA 3R6LA 4CM9D 2J6IA 1ILWA 3U4QB 2C1EA 3C1OA 1KEVA 2BZ0A 3Q6NA 4ZGGA 4UQOA 3DEZA 4Q4HB 1GPDG 2NUTB 4HNQA 4XQGA 1K6XA 3BH0A 3NKLA 3R0QA 3C6MA 2ZM5A 2GJSA 2C3YA 3K2QA 4FYKA 3T5GA 3OT1B 1Q22A 2X22A 2OBBA 1BHO1 1IXSB 1NUSA 5FBWB 5K3BA 1A8UA 3ZDZB 4EKYA 1EESA 3CF4G 3V2IA 3IAS6 2AR9A 1C1XA 3PGXA 3RHFA 3RRMA 2EZTA 1N36B 2JIMA 3WGNA 4RJTA 1YS6A 3KBOA 3LCRA 1AQUA 1F0NA 4R1OA 2QD3A 3ZTYA 2C5EA 3EZLA 3ZIDA 3KS9A 3KBBA 5IVIA 1UKVY 3OAAA 4X3CA 3KKZA 1CUWA 3FKSD 3SF8B 4XPIB 3AHIA 2PD4A 4RTSA 2I34A 2C54A 2IZZA 3A6JA 3TIIA 1UFOA 4P36A 1WP9A 4OQLA 3RSOA 1ZIDA 3BMNA 1HGXA 3A1SA 2RIPA 3OQPA 4MB0A 2ZTSA 4KH0A 3OT4A 4FFPA 5JXWA 1NZDA 1C41A 1KHTA 3ZIAD 4AF6A 1U7TA 3F74A 3A9TA 1NVXQ 3K0AB 3K5PA 2HWXA 4V0MA 1DG1G 3NWBA 3FRJA 4N03A 5JNTA 2A1UA 3QVGA 4FQ5A 1INLA 1PJZA 3AW9A 4TM7A 1Q95A 3R44A 4Q15A 4WN3A 2WAAA 3RSCA 3UUGA 5JSZA 2LPMA 4QDXA 1Y3AA 2WG2A 1DTSA 2E4UA 2OK7A 4GPAA 2QR2A 3Q5DA 4QBIA 2ZRJA 1JDSA 4KQEA 2BLNA 1A76A 2GASA 1E2GA 2YDYA 2XQJA 4QNRA 2Y0EA 4JITA 2XUOA 4OJTA 1BFDA 4D44A 4Y67A 3MTJA 4W1QA 4M76B 1DOHA 4D7AA 2EBWA 3QE2A 4MUBA 4XX1A 4YECA 3LUBA 5DRYA 1Y4ZA 4R1TA 3EXIA 5JG7A 2BMJA 4HF7A 5GP1A 1EX6A 3FFWA 3GMSA 2XOXA 4EFDA 5JNWA 4QO8A 1I3MA 2XCQA 2G9QA 1P1JA 5DYYA 3RTAA 3FH0A 3L2OB 4RXUA 4EHIA 4LJLA 5TIIA 1MQ8B 1YE8A 2GO7A 2AX4A 4KXWA 2IF2A 2QMYA 4LJ4A 4DLAA 2QQ0A 3M3DA 3PFCA 4OFWA 2PAAA 3CXUA 3DEYX 4IW3B 2XBMA 4GWGA 1E2QA 1NR5A 5I9BA 3UW3A 4EG1A 3IV7A 2VDMB 3KQKA 3TLXA 1Y8CA 1JW9B 2IHJA 1CIVA 3LT5A 4M8LA 3OJFA 3ISTA 2P9BA 2R2GA 4W1SA 5LJIA 2H52A 3E7PA 5K5EA 2R7KA 4RK5A 3WC4A 3DOUA 4LY6A 4YT5A 4RO0A 5CH8A 1MGPA 1W88B 4FYMA 2PDAA 1V4NA 1Z13A 2QP4A 3T7AA 1D0IA 3NYRA 3P2KA 4FZRA 4P3XA 4X45A 5MF6A 5AOCA 3WB9A 3EARA 3N0WA 2ZJAA 5DGIA 2CC2A 4P6VF 1IHYA 3UF0A 4ZJYA 2PJRA 4YA6A 3IKLA 3B3QA 2WBLC 3IIKA 4X7BA 3ZLBA 2FR8A 5B58C 4JMLA 4TTAA 5AJXA 7MDHA 2Y05A 4MS1B 3IAEA 1KU0A 5CJ2A 3ZHVA 3WRYA 4L15A 3B6IA 1Q12A 2OCXA 2QAJA 1KO1A 4MRMB 3CH6A 2WMOB 1L8OA 3BC1A 1XK7A 1SVNA 5BN5A 5LPNA 4O4IF 3MILA 3WOHA 4U39A 2GZ3A 2A1TS 4NBUA 5DLPA 4ZGWA 5BUZA 2E1PA 3EVBA 1V5EA 4JYCA 1VL5A 1GSOA 3L8CA 4F2DA 2EWVA 2VDUE 3CR3C 4BO8A 2JJMA 2UUBB 1RW4A 4KW7A 3JVUA 4V0KA 5A6SB 4OQ4A 3RFXA 2P2NA 3CVUA 4TKVB 1DCTA 4GSKA 1RAEA 1UBSB 2EEZA 1T5TA 3FWHA 1WW3A 4MVJP 2ZPUA 3AF2A 1VCHA 2OXRA 1TC2A 3V8PA 1F7VA 1M1YE 2UAGA 1DAOA 4LJ5A 2YIVX 3M4XA 5PGMA 4E33A 3AQ4A 3ZV3A 3DLCA 3VU3A 3WB0A 1NKSA 1Z25A 3DOJA 4OUDB 2QWXA 1AH2A 2UVDA 1PYGA 3NEJA 4UD2A 1GQSA 4EHNA 1SK9A 2BKUA 2YWBA 4AVYA 4F1WA 1SUEA 1U3WA 3FPGA 5I4BA 4X1YA 1XZLA 3K1AA 1BYIA 721PA 2Q28A 4H18A 1ORRA 1T9GS 3AHFA 4JDPA 4RFLA 4MROA 1KIFA 5IYZB 2QPOA 3H7IA 3O8NA 3WRYC 4EEKA 2YQ4A 3RCBA 4QUHA 1QV6A 5K51A 2GRAA 4ZK6A 4F45A 5EXEA 1YRAA 3ANSA 2E7ZA 1JGTA 1KL7A 1H4QA 4Z7QB 4V0NA 1QU3A 1NJ6A 2QT1A 2QVYX 2GLXA 1D09A 4LFCB 3RRFA 1V8ZA 2NUPB 4JI8B 1Z0IA 3BH7A 4ITVA 4NZ9A 1H23A 4D26A 1XNHA 1SELA 4CYMA 1VI2A 2ACVA 1NYRA 4UUMA 3U3DA 3ZY6A 4TWJA 4ARVA 3ZR4B 3NTLA 1GNRA 3OFKA 1U04A 2MYNA 3HWWA 3R09A 3HB5X 4JZYA 4MKXA 5DH9A 1JB1A 1GTZA 1SJ9A 2OENG 4ND1A 3SVLA 1EA7A 1EWRA 4AD8A 2WK1A 4NDZA 4R3NA 2QLNA 4MV8A 3G9QA 3U3XA 3CLVA 4MYDA 5D3ZA 3PC7A 3QV1A 4D8XA 1LSUA 3NORA 2GS9A 3A1TA 1TEHA 3PITA 4BGUA 2VHUA 1GGKA 1ID8A 4BVGA 5BSGA 3TQRA 3BXZA 3JAKA 4YUXA 3BYZA 3WO1A 1XXHE 5CT8A 5AHWA 5F5XA 5IJAA 5K0LA 4QRIA 1DG3A 4DBVO 2GCNA 4UM9D 1WZUA 1XKLA 2JFZA 1XXLA 3A05A 1XRLA 1O97C 3HA5A 4REQB 5AHXA 1BKYA 3OE7D 1D2RA 1EBBA 2CNLA 2HDHA 2IHUA 3K9HA 3M5WA 1DJMA 3TZ6A 1KFCB 3IOEA 5KSYA 1LPPA 3ZDYB 2C00A 1R4ZA 5SYMA 3T0IA 1Q77A 3MFQA 4OTZA 3G2IA 4YUVA 1FFAA 1SD1A 4MUXA 4P0PB 2IE8A 2KX7A 4F6RA 2G70A 5KYXA 4M0FA 2IIQA 1JHZA 3EBPA 3QA9A 3IMEA 4BUZA 3ZWVA 1DAKA 2B4QA 1P3DA 3K20A 4P5PA 1SCDA 2NVUA 2O9JA 2QM3A 4WESB 4DEXA 4F21A 4WBNA 1S9HA 4RV5A 2XSZA 3F8WA 3N2NA 1UIRA 4CIDA 1QZTA 4HVLA 3OPQA 1SR8A 1JECA 1T1EA 1VKRA 3ISVA 1MNAA 3C7DB 2P68A 5GV8A 4AIIA 5EJGA 4LRXA 1A5ZA 1ORTA 5CFPA 2OFFA 2CJWA 1U2SA 3VNRA 2XYRA 4BMDA 3ZTWA 5IRCD 4UVDA 2BKEA 2ZCVA 3U3JA 2BZSA 5EG5A 3BG5A 3KYCA 4L1KA 4MVCA 1SBQA 2CNBA 5LOVB 2NGRA 1NBMD 4AG6A 1VHJA 1BXZA 2CHUA 2R8ZA 4DIEA 1MJ5A 4LI0A 5TB5A 3CZ5A 1QGUA 3PBKA 5A0TA 1CUXA 1K97A 2PN1A 3M4JA 2FP3A 1A95A 1A50B 3JPWA 1CQIB 4HC4A 4UCWA 2DF8A 3EH2A 4OJYA 5I51A 2I9KA 3N7UA 3LXRA 4MLDA 3KTFA 2JDIA 1D4OA 4I50F 4MARA 4NY1A 5F2OA 5KDLA 3SX4A 2ID9A 3B6JA 2DHRA 1G8AA 2WF7A 2XADA 1GDDA 3H86A 1HV8A 3EX7C 3FGOA 2WHYA 2DEUA 4MVJE 5ITZB 4MDYA 1F0PA 3FPEA 3NP9A 4AUMA 4JLAA 4L9AA 2OO3A 4G1CA 4LJSA 3ZHYA 1BGWA 1D2NA 2AOUA 4JJIA 5EJ2A 4NYJR 4DIDA 5FFMA 5DIZA 3SDSA 2ZIXB 1EQUA 3UMBA 2V03A 3NGXA 1FBTA 6ADHA 3A4IA 1ZBQA 4OGLA 2RHHA 2PD3A 2O5RA 4Q9AA 1E0KA 4X1KA 1WKCA 1CQPA 1IN6A 4BMYA 4AI6A 1CE8B 1XLTA 3AG6A 1NN0A 3U7QB 1W96A 2VHXA 1J9ZA 3T9CA 5HXAA 4GYKA 4BNHA 4R9UC 2QORA 4WV3A 5HQ3B 4M9XA 1X70A 1QQTA 5DULA 4Q03A 2AF3C 1BVRA 7MHTA 3PSAA 1F4VA 1U0TA 2D0DA 3DBVO 5EIOA 4A91A 1IC6A 4RTPA 3O2QB 4A92A 2G8NA 3EWAA 1AGRA 1NI5A 3RVMA 1CFZA 1F38A 1K7XB 1W30A 3LC0A 3WL5A 2CKDA 4U4AA 4BNDA 4UDOA 4P84A 3CVYA 4D92A 5JMWA 4Z4GA 3EGCA 3TQHA 1XG5A 5D1HA 2UZ4A 4PSDA 4WZBB 4RK1A 1A8PA 4K9MA 2ZB2A 4D4HA 5AI4A 4FCCA 2A0KA 4QWMA 2I1WA 4UOEA 5CCBA 1WRBA 2B25A 3E9DA 1A9SA 2JJ8A 2JCVA 3AERA 5D7BA 5DOZA 1CF9A 3CJQA 3HN6A 2D1TA 3ZWPA 3OMWA 4Y0AA 1HLDA 2PJDA 1FNCA 3L18A 5DP1A 3EQ6A 2Y1KA 3H4VA 3EVAA 4NJEA 3ZW8A 2MSWA 3T3HA 3ZV4A 2G5GX 1N2OA 4HAZA 4PPYA 3U39A 2CK3A 1YQTA 4ZI7B 5K0JA 3I61A 1VKHA 2J4CA 3HP4A 4V02A 1TRKA 4AY6A 2ZSFA 2A9RA 5T6BA 3AL0C 3F1LA 1JLLA 3N5CA 2FEAA 4BBJA 2QL6A 3DTVD 3N2EA 2B1QA 4ASUA 3ZE9A 4BV8A 1QCYA 4FB4A 5EHXA 1DARA 3CNQS 3PDUA 5K8VA 3UAYA 3NETA 2R7AA 4EWLA 4LDRA 4N9WA 3IE0A 4JEIA 4OG2A 5AKGA 3A11A 2ECOA 1CIPA 1X7YB 1XKQA 1YJAA 4KLAA 1F0YA 3TBFA 5J4HA 1XL0A 2F8TA 4F12A 2ZS8A 3QUQA 1BDIA 3GN1A 1E0SA 1BHQ1 1C9JA 1UDWA 3OUTA 4UARA 4S35A 4DB4A 2Z5FA 1W0CA 1W75A 1R4MB 1POWA 3JZFA 3LC7O 4Q7EA 1FMTA 2D7DA 2UYCA 1WQ1R 4V39A 2P6MA 5J4YA 4IDDA 1X3SA 1ZWLA 3LT4A 1HYBA 4R9NA 5F9HA 2PX0A 4CFSA 1OTYA 5KKCA 5AUOB 2D2FA 1AF4A 1KSJA 3AETB 4BHTA 5EPEA 3M3HA 4G81A 3QPWA 1GIAA 1L6RA 4KYVA 2UZ1A 2OFXA 2VDLB 4KOEC 4UHBA 1AHHA 4RM3A 1C9KA 4UTZA 1RQNA 1KFKB 1B0ZA 1TKCA 4GLBA 2G4CA 3KFLA 3LC1O 2BD0A 3PPYA 4I4TA 5FDFA 3IEKA 3JWHA 3H18A 5DPMA 1RFLA 1HKHA 1VJTA 4N82A 4XH9B 1CVLA 1I5OA 1NLZA 4LIPD 1M6YA 1T2NA 2IDMA 4RE5A 1N3BA 5B2ZA 4HFRA 3HJGA 1C0LA 1WTAA 1VCOA 3IXMA 1JWLA 3L04A 3TMKA 1M6HA 1Z6AA 2Q1SA 2M6LA 5K0TA 3QZUA 2E6UX 1TW3A 2CXRA 4LSGA 1I8TA 3LGXA 4FHZA 4RK4A 3X0DA 2O54A 1XE3A 4DJTA 3GA5A 5BRAA 2WKPA 1NVAA 2J6BA 3UT0A 1DSSG 1KYWA 1CUZA 1OI7A 3UJ6A 1ISRA 3ROEA 3WB2A 4CT5A 5BMOA 1VSQA 3E3OA 4CM8B 2OLKA 1MO2A 5EIAA 2YMLA 4M1TA 4QJ5A 4RPKA 3Q3VA 1W5TA 4ZREA 3MYYA 1NW5A 5J2TF 3RD5A 1DADA 2GZRA 4X8LA 1C4KA 5ISMA 1WOMA 1IMJA 1Y5NA 3M9XA 3UC9A 2OBMA 4S05A 1ZVVA 4ND7A 2JG3A 3V8MA 1LDGA 5HKKA 3IULA 5EWLB 3VYUB 4Y6SA 3AY0A 4EF6A 3RVLA 1GYPA 2M32A 3NBFA 4Q4LA 3WMEA 5BNTA 3CT4A 4X3OA 4KHPB 1FSFA 1R9JA 2J46A 2ZSJA 3SQNA 3MTIA 4IJVA 3TZQA 3GVIA 1S1CA 4J03A 4M0MA 4XQ9A 3I0MA 4ZTZB 2ZJ4A 4FBGA 4Y2HA 4D82A 2H2GA 2MHCA 5C5EA 4AS2A 3V8VA 3KG2A 2DPLA 1F6DA 2X7HA 3H1EA 5HVNA 2HAEA 1E4YA 3SR3A 1YR8A 1AQJA 2QJFA 4FHEA 1XNQB 4MWBA 2NUAB 3HM9A 1U1FA 3M8KA 3FIJA 2A78A 3UAOA 1JE1A 5CB4B 3SN6A 4G0VA 1P2DA 4LWPA 2FN7A 1Z2DA 1AGXA 2VDRB 4S1NA 5LQDA 5KYVA 3WX0A 5KSOA 1MC8A 3SD7A 2CVQA 3LY8A 4C0JA 3I2IA 4BPBA 2E2WA 1ZO8A 2OHHA 2Y27A 5AVZA 3O3CA 4TLDA 8ABPA 1I3OA 3OIYA 5A3RA 3LQRA 3TUIC 5C8VA 4FHCA 1GQFA 4ZJZA 2QVCA 1J2JA 3A4MA 3F97A 3K5IA 3WGHA 4EGFA 2H29A 2JFPA 1SQ5A 3H2JA 1TADA 5D5QA 1UANA 2GFQA 3DHEA 2BFBB 2DR0A 1I14A 2IYVA 4FHDA 4C4SA 4ZCPA 1KWKA 2YHUA 4AM8A 2VZEA 4V1CA 1KJYA 2AB0A 2ZG6A 3GFGA 4MIOA 4HGRA 2JCSA 1F14A 3EC1A 1KZ6A 3M6VA 4B4DA 5BV8A 1Z3CA 1R4NB 3UXEA 4KQHA 5DYGA 2QMEA 1XOIA 2BKLA 2HQOA 3QVTA 1MH9A 3E3NA 4AJNA 2HPVA 4EFNA 5JMOA 1UAAA 5JFGA 3W6ZA 2B6NA 3T4PA 3GFSA 1JR3A 3T4EA 2APJA 2DPGA 4PXAA 3GA7A 3RWOA 1CT9A 1UEJA 1SOWA 2G9VA 2HRDA 2RBEA 2QRMA 3FSGA 1MVLA 4HD8A 1ZA1A 1QH0A 1IHOA 1L9XA 3LWBA 4A0GA 4I55A 4FE7A 3IAM6 4RTLA 5G3YA 3KSAC 1E2JA 1MBZA 1Z8NA 2YJ4A 3KPWA 4I55F 2ZKIA 4I5EA 2E0IA 3SG0A 4D9GA 2J9ZB 1HFJA 1H0SA 2H16A 4LVNA 4NBVA 3W8RA 1UK9A 3X3HA 3EOAI 3QEJA 3O90A 2GPWA 3FNGA 2OQ2A 1A4IA 2R7NA 3AWIA 2G9RA 3LQYA 3QOYA 1L3BA 3FUVA 3AJ8A 2R7LA 1E32A 3VNAA 1JSRA 1V5IA 3K9FC 1EM8A 4P4GA 4NMWA 1ZOLA 2Z1MA 1QP4A 5GV7A 3LGAA 4B40A 3FPAA 1JFFA 2PSDA 2NT4A 3D8HA 1T36B 3ZJUA 1RAIA 2PWZA 2ON6A 3B8HA 4MR8B 3RRNA 2AN4A 3S0JA 1F3OA 1RXIA 3AVWA 4TWRA 4A73A 3GVPA 2UV8A 5G0TA 3O75A 1ECPA 5JCOA 2VNSA 4INZA 1JXOA 1BSVA 4I19A 4MW0A 2EDAA 4O2AB 3S5UA 2P4EA 3WQSB 3GJSA 3FE2A 4Z9FA 4H7PA 3H2BA 2YXBA 4IJKA 1GTL1 4ZIRB 3ESCA 4UJ5A 1HE8B 4OBEA 4UHJA 2D8AA 3H1FA 3ZU5A 1BWRA 3PWZA 3JRXA 3O03A 4HUJA 3KJFA 2I3DA 3L7YA 4OH1A 2QTVA 5KQGA 5LQUA 4YRDA 1L4KA 3HVJA 4HRXA 3L1JA 3WZLA 1A04A 4LBVA 4E5MA 5K0BA 3RS9A 5AW7A 4ESVA 2G04A 3BB3A 3OFVA 3STHA 2ANCA 3GLGA 1QZUA 3AEUA 2GX6A 2O7SA 2ZOSA 3PPXA 1PTJA 1FMLA 2VIIA 4MQ5A 5BSKA 2A86A 4TYMA 3KVNA 3FTEA 4GR9A 5LP6F 4WEOA 3QX3A 2GSWA 5EZSA 4UEQA 3ECCA 4XWAA 3DFZA 2V9CA 3LLUA 4D4MA 3D64A 3Q10A 4K9RA 1L5GB 4Z3DA 6YASA 4I08A 4NBTA 4F71A 2VZLA 4JC5A 3FNQA 1Y9DA 5K8JB 4RYLA 5JRDS 3BERA 4L57A 3BKXA 3WGMA 3KQQA 1L4MA 1XZMA 4DUPA 4PHGA 4QJBA 3HV2A 4JQCA 1QO0A 2CSUA 3B1KA 3PCXA 5HZHA 2VPQA 3AVYA 2V3WA 3DDSA 3NBQA 1IBLB 1PO7A 1IBSA 1UPUA 3L0PA 1JR4A 2WU4A 4C29A 2AD1A 3HJHA 2QRUA 5JCJD 1PQUA 1UPXA 3OZUA 1JZQA 3LT0A 4Y3UA 4ZHQF 4M83A 1MTOA 1T6BY 5CM8B 1VJ5A 2PS3A 4DWVA 4WJZA 1FP7A 2BM8A 3DMNA 1H1LA 2ORIA 2WHQA 3NBAA 4RH0A 5T4FA 5GMOA 3U80A 2ZDHA 4J0KA 3TR5A 3OLXA 1H6CA 4RY8A 3V4VB 1V1RB 5B3AA 1DRUA 5BQ3A 2YJ5A 3HG7A 2YBDA 2X23A 5LP6C 4IINA 3ZWBA 1KQ3A 1E5XA 3ZZ0A 4INOA 2F59A 1XN4A 4PRKA 1EINA 1OHHD 3L8ZA 3AVUA 1YJXA 1RWOA 1T2EA 1UWCA 2ZYTX 5F52A 3G0OA 3SK0A 5BVGA 1BS9A 5ALJA 1T4CB 4WIAA 1HX7A 2ZETA 3K9LA 4K9LA 3NTUA 3RS3A 1YB6A 2CNOA 1FRFS 1VCMA 4RJJA 5EFOA 3ESYA 1EK1A 5C31A 5IKOA 2LD4A 2XE7A 4B6GA 1BAPA 4MMXB 4D97A 3PGKA 4HNAA 4DMHA 4F97A 2X7XA 4KI0A 1TQ4A 2N46A 1KI6A 4FGLA 3EUAA 3QUBA 3KCNA 4FGSA 5ALKA 3SZLA 1TEZA 1T1JA 1W25A 1D8AA 2X0FA 5L3RA 2B8JA 2ZIFA 4HGOA 2R00A 3P2IA 1JVNA 1S3GA 3VR1A 1E2PA 5D01A 2REQA 2EG9A 1UQTA 1X19A 2X3UA 3GLKA 3R3UA 4HPJB 2UYQA 3A32A 5K0CA 4YVFA 5ELXA 1G6HA 3LYLA 5JFTA 5F3RA 1TXGA 1EK6A 2YHBA 3RG8A 5KVQA 2EL9A 3AUXA 5JAZA 2QD4A 6REQB 2AKYA 4QFBA 1OBFO 2AQHA 2D5LA 5L4LA 3QKWA 3W6OA 2AJLI 2W2MA 4C4OA 4X65B 1QFZA 2G40A 1MZPA 2HU8A 1AT1A 2W6IA 5FTKA 5GM1A 3QLUA 3H9EO 5JVDF 3FMVA 1EUQA 4HKTA 3VPBA 4R1QA 4C7JA 1HEUA 4G6ZA 5CX1B 4GKKB 1FU8A 4KIUA 4GVPA 3TO5A 4CNBA 3ILSA 2ZJYA 4EG6A 5KKNB 1LBEA 1NUTA 3DOEA 2Y1XA 2YZMA 2HLHA 1OVGA 1PQPA 4Q34A 3TKAA 2FPRA 1ZPDA 3G2JA 3LQ2A 1ZMXA 4AJLA 4PYJA 3SEAA 1ORDA 4L7QA 5TF0A 1QIDA 1UP6A 3IURA 4URFA 1EK2A 3PRHA 2O4CA 3RRBA 4R1SA 4DLYA 1ZU5A 2WUVA 3KSDO 1P7ZA 3MJEA 1XDSA 5TMEA 3FZEA 2QGZA 1PNTA 2Q99A 3FDJA 3IIIA 2OSVA 4HDSB 4LDJA 1TEXA 1SRQA 2X8LA 3BORA 1Y48E 1KKMA 4FDUA 4R69A 4HPWA 1RR6A 4EHHA 1BC5A 3IUNA 3WGOA 1UZLA 4DVJA 1TDJA 2BEUB 4LOKA 4Z2AA 4MUAA 3UPTA 1JFSA 3CX7A 1MIHA 4BATA 3NH9A 3IERA 1GVHA 3QWBA 3S6JA 4J1TC 3U3MA 1ZN9A 5IT4A 1N5LA 1HUQA 1NF3A 1HRKA 5FOVA 3UICA 4QFCA 2BFEB 1PQ4A 2P41A 3NH6A 4L51A 2IYRA 4UUNA 5BYBA 4JI5B 2DM6A 2CV0A 3E7DA 3BJZA 3U7FB 1RJDA 5KC9A 4PTZA 2I87A 2GB4A 1N0HA 2Y2VA 3IJ5A 3OHPA 1H69A 4IUYA 5M04A 5CJJA 1QU2A 4GECA 5HMMA 5I4IA 3FNEA 1R3DA 2JFOA 1JAHA 2HBRA 3PQ5A 3VBEA 4AP9A 4L76A 4ZT4A 1BN7A 3BK7A 3N28A 2O8DA 3JZIA 4V24A 5DCYA 2JLZA 2YQ5A 5KNLA 4KQ6A 4CM4A 2WM2A 2NSHA 3KCQA 1FRVA 1VL8A 4EY6A 3KDSE 3G5TA 3KE8A 4H27A 4ZICA 3EMVA 1ORHA 1UDAA 1GNTA 2ETXA 4JHXA 1A7KA 1HDGO 4DRXA 5FV4A 1PHRA 1XLUA 2F8LA 4EJSB 1O58A 2Z57A 3W9BA 4B84A 4XZ3A 5IMBA 2AZ4A 3RTGA 3FVTA 1YCHA 3V7NA 5C3MA 2AA3A 1PW5A 2C2HA 2HBYA 4KQ1A 3CH5A 3ITKA 5K6RA 1T8YA 5DK6A 5IT0A 5DLDA 3OX2A 4KQMA 2G28A 4CM7A 2O7VA 1V4VA 3HDGA 5JXJA 2ODPA 4OAOA 2ZRQA 3K7EA 1Y3HA 3VTAA 1EGHA 3G2OA 1IY9A 4QNMA 1BXGA 1M1XB 1RYBA 3BRSA 3W9UA 4DV3B 3NYWA 3QKSA 2HF2A 4G0XA 5ALTA 1XMQB 4FNGA 2AMFA 3R7DA 3FLEA 3ZG6A 1L3IA 3KYDA 1FYDA 2CVHA 3M33A 4JYZA 2XXJA 1R6AA 2GBPA 1X7XA 1DPGA 5AW1A 4AP5A 3SQXA 3DE3X 1FFBA 2NVOA 4GR4A 2QROA 1X9GA 4CMJA 1PR3A 1E69A 3GARA 2QMHA 2XDYA 4IJWA 1Q83A 4R9RA 4HFJA 4KIJA 4DLRA 1O96A 3BH6A 3I8XA 4LTDA 5FBZA 3RK0A 4Y0VA 1LH0A 1N2HA 1WXQA 2QIOA 2D6FA 4MVJM 1V7ZA 2YS7A 4XJSA 2PLNA 2HCTA 2NXNA 3BGSA 5GJCA 1G6OA 2R48A 3PYLA 4CRWB 1MG5A 1OZHA 2PL1A 5LKRA 2LGJA 2WE7A 4FJ1A 3LO8A 1D6MA 3FPSA 4EHAA 2XVYA 3WIEA 4DF3A 5KBYA 3CPSA 1TYZA 1YQWA 3QI2A 2FP4B 8LDHA 4K2HA 1W4ZA 2ZSBA 4MW4A 4DW8A 2PLRA 3E5RA 4KIWA 2BE9A 5ER9A 1USWA 1SXJB 3OA0A 4RDCA 5FCDA 4OYHA 2CXSA 2FE1A 3BGVA 3F4LA 4CLEA 5H7XA 3QHPA 2WUWE 4HJRA 4QDJA 5ADHA 2JLQA 2IZ6A 3N8KA 3NAQA 3UK0A 1GL3A 1ZD3A 4C20A 1UBUS 3LS2A 4FFMA 1OJ7A 1NTOA 2XODA 3G0DA 4OQXA 4MGIR 4OHFA 4GH5A 3BGWA 3RBAA 3LX5A 2I80A 4UU7A 1TMOA 3I52A 1XMOB 3SFTA 1C14A 3AT1A 3T61A 1LF0A 3JALB 1XXHA 5JANA 4AZ3A 4AYXA 1SKYE 3U7EB 3AVQA 1OOEA 2X4DA 3LUGA 1LVHA 4WFJA 1QC5A 1GA1A 3P2YA 4ZPXA 4QELA 5TARA 3DTNA 4EG4A 2BW0A 3DKPA 4X7RA 4L4UA 4AWAA 1JQKA 2V98A 1OA0A 2P4HX 5EQJB 2I4IA 4UHDA 2YWJA 3CLUD 5FPPA 4N01A 4QVIA 2PZAA 2ZTVA 4MA0A 2OP1A 4JUCA 4L4ZA 1XMJA 2JGNA 2P9HA 5I7HA 2HSEA 1W59A 3AFIA 1B6GA 1KFBB 2IEYA 4DDMA 2W2OA 3ABQB 3HYLA 4I6JA 5ECYA 2QA5A 1GCOA 3I73A 3NFYA 1SPBS 3FFAA 3N2ZB 3O3MB 4GMHA 3SBXA 1CD5A 2I62A 1QOQB 2DFNA 1RHUA 5HF9A 4C7MA 2C96A 1PW7A 3NJRA 4QASA 3ANMA 4HZUA 3SXUB 5DHSA 3OEHD 2O3SA 3FY4A 3OX3A 4JAVC 5CA0F 5FPKA 4DMRA 1JKMA 2W2VA 5HEKA 3VBCA 1XEWX 1ZGZA 4OQZA 1QKJA 4IGIA 4D4GA 1DP4A 4R3WA 3PI7A 4ALIA 1GTJ1 1SOVA 5K4GA 5C5IA 3EPPA 3K9NA 5B55A 3MWEA 1AS0A 3TF5A 1LLQA 3QXJA 3ACCA 3DE1X 3Q8XB 1SKMA 3OT5A 2ZJ2A 1OBVA 2UZ0A 2FEXA 1TQ2A 2BI8A 1KZGB 2EJUA 3GFPA 3GR6A 3FPBA 4I6EA 5L45A 1RWKA 3JQ9C 3B12A 2GH1A 2EQBA 1OLXB 3MS7A 2J3IA 1N3IA 4IEFB 4CPDA 5K8IA 4OATA 1P61B 2C9DA 1Y8AA 4HOYA 3P0EA 1P2VA 1YA6A 3A31A 2VHEA 3QELB 3NM6B 2VDNB 3I9FA 3H9JA 3VOTA 1WMBA 1ZUD1 2R68A 1YR3A 2JJ2D 1FL9A 1KP3A 3FPFA 1QJ4A 2V0NA 3A1FA 3FWNA 3OTWA 4K28A 4W7HA 4QG3A 1BH6A 3CRNA 1R0RE 2BTOA 4HQ6A 4AU1A 1KVRA 4PC2A 5JJKA 4TMXA 1NVBA 3LTEA 4KGVA 1P5HA 5A4FS 3L82B 2C7GA 3RUPA 2X8JA 1MOZA 1X0VA 3VVLA 2NQ8A 4K81B 3C3XA 1SAYA 2YXEA 3FYSA 4IUDS 4ZXFA 5KJ1A 2ONYA 5JASA 1YRYE 1JQ5A 7REQB 4CKXA 4CIWA 4RGVA 3WFZA 3ZGLA 1TJYA 3DV2A 3N74A 2NU6A 5BUCA 3CNNA 4M54A 1MRNA 2YZ2A 4TSKA 1WB6A 4LYDA 3VKGA 2EX1A 5TE9A 4HDKB 3FHCB 4EFMA 1T29A 2C9ZA 2EGUA 4OI4A 2DTXA 3T52A 3UJCA 3I83A 3ZX5A 1UPTA 2GNPA 3WGZA 2KBEA 4B5KA 4ZOLF 3TWOA 1E96A 2ZRHA 3B51X 1WCIB 3T7TA 2Z6UA 1UMCA 4WE3A 5FADA 4BX3A 4CW7A 5H68A 3JYNA 2PWBA 1W85A 2IYWA 2BEJA 2W4MA 2J3JA 2IUSA 5CCDA 4ZDKA 3W2GA 2W0MA 1IM8A 1CY2A 4LC1A 4DNFA 5ICEA 3EQ2A 2L19A 1AIPA 2JHFA 2SKDA 4RD6A 4ARSA 3BGDA 3C5WP 4IV5A 3AHGA 3N1UA 4MRPA 4YUYA 2IVFA 2ZQZA 4Y1FA 1VHQA 2YDXA 4I6GA 3JAWA 4XVQA 1UMBB 3K35A 2OO7A 1ZIPA 1ZHHA 2B34A 2XDQA 5AI6A 2R25B 5ALSA 3Q7EA 1QRSA 1QE3A 4R1NA 3GLVA 5B1HA 3OTIA 1DEOA 1VJCA 2FMUA 1D7OA 4B3JA 4JH0A 1N5MA 4EG0A 3TPCA 3WLRA 4XWWA 4BNNA 2Q5LA 5JNLA 3SVZA 5KU7A 5FQNA 2BEVA 2IYEA 1KPHA 5D3KA 4QECA 4YB8A 4IH9A 3WYFA 5ERYA 2CHQA 3IO5A 3UJBA 1D1PA 4Y7CA 1M0SA 4BLWA 3AH8A 2I2BA 1A5TA 1L4UA 4ZHSA 2Z5GA 1WMSA 5DN6D 2WTMA 2KSQA 4C4XA 2AXEA 2W2TA 1JA9A 1QGOA 2R6CA 4J2OA 5CT6A 5DGDA 3KQPA 2FXIA 5ENVA 5BT9A 4LHYA 3T4UA 4C1NA 2P67A 2RHDA 4BNWA 1FLDA 2QPAA 3GZ4A 5EIBD 4DGSA 3KZVA 1Z9BA 3FPCA 1SCIA 3DULA 2ZYRA 3DD5A 4N3NA 1B74A 4U8HA 3O2SB 3X2FA 3GJZA 2AKAB 2TMKA 5JQWA 1OX4B 1YDWA 1WXDA 3JARA 1L7MA 3H3XA 4EF5A 2Y77A 1JMVA 5JC1A 5GPBA 3W4JA 3MSXA 2CE7A 2GERA 2QUIA 1C29B 1QTRA 2G63A 4NMMA 3O1HB 5H80A 2ZFUA 3VX4A 2JAHA 1G2QA 1U02A 4R7TA 3VU9A 2RGDA 3O4IA 3D6FA 5JZMA 2VF7A 2WTUA 3QXGA 3PFGA 3SNKA 4KV9A 4RZIA 1UJ6A 3CMCO 2ZRBA 4FGZA 4AT1A 1XVAA 4GOXA 4GGPA 4JT9A 1RP7A 1RXVA 1XYYA 1QDEA 2P8SA 1FP4A 2WKWA 5AFSA 1QP8A 4CIXA 3C6YA 2HFKA 2Q62A 2FRDA 2ZI9A 4XDGA 1TJNA 2ZT5A 1ZWKA 2JA2A 1E66A 5G0UA 5I4KA 4DA4A 4CN8A 3CW9A 2NU9A 3AUKA 4I5FA 5DYTA 5LD2C 1G5PA 5L4SA 2Y1GA 2JI4A 1U8EA 1XAJA 2YJGA 3MEQA 1I9GA 4J07A 5FFNA 1NLUA 1VZ2A 3Q6IA 1UKCA 4LEIA 1YK0A 4O4HF 1CUAA 1WZCA 3IQGX 3ICQB 4CKCB 4LC9A 3QMMA 2X13A 2WFLA 2YHAA 3I2YX 5DBHX 5EWJA 3WLQA 1VE7A 2XOKA 1UQUA 2QZSA 1WULS 4TMKA 1HQCA 3ADCA 4YWJA 1S8AA 4HYEA 2VDJA 3FZYA 5DNUA 5LQRA 4WK0B 4GEKA 3RYFA 5IULC 2WSBA 3FLMA 2DSTA 3LFUA 4ZVVA 4BBZA 2FW9A 5H8WA 3I53A 1MFZA 1IMOA 3ZVMA 1R0WA 2GN9A 2GYVA 4JP8A 4LRSB 1EXDA 2JGDB 3P9XA 5TR9A 1NMZA 2OD2A 2HC9A 3I2HA 4NFSA 4OY3A 1THZA 9LDBA 1ZNWA 3M4NA 5I48A 4IIEA 4KXXA 4URYR 2P40A 3TLBA 2PGDA 2Q2VA 3HJTA 4YC7A 1ZI8A 3G2KA 3S2GA 4C5BA 1G7RA 4IIUA 3RKRA 2DJ5A 5ADVA 5CMLA 5K0ZA 2YFYA 3I09A 1B6TA 2ZR0A 1TM1E 3C97A 4I0WB 1DC3A 4KQCA 2QM0A 1F8YA 4CHGA 4ID9A 3U0VA 4QUJA 3AJAA 4F9TA 3X1YA 3N9IA 5KKAA 2Q8PA 1J4AA 4GZ3A 2O8CA 1JEQA 4IX1A 3WYDA 4I3GA 1TLTA 3A9VA 2FW0A 4O0MA 3CM0A 4XGRA 4ZT3A 1R9MA 3TMAA 2HSGA 1P6QA 1ML3A 4F4UA 1GN9A 1G21B 4BCCA 3RAFC 4QX6A 5K09A 4JB0A 1TT5B 1YD7A 1Z0SA 2E49A 2OZVA 2ZRIA 3DEHA 3DTTA 3OC0A 2VDKB 2P4QA 4AZ0B 5EJFA 1FZQA 1PK9A 3OOJA 3PC3A 4GZ5A 1WB4A 4ETNA 4P8RA 1S8OA 1SVWA 4FTWA 3VTZA 1BS1A 3JX9A 3N2YA 3GLIE 3L4SO 5JQGA 1DVRA 5BURA