3DV2A

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from bacillus anthracis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
187
structure length
187
Chain Sequence
RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Structure of nicotinic acid mononucleotide adenylyltransferase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 49
structure length 187
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3dv2A00
2A88A 4MUKA 1X8XA 2JANA 3QTBA 3SZ3A 1KH2A 1M8JA 3KT0A 1QRTA 1EFVB 4J75A 3ZJUA 1YIAA 5DEOA 3CLUD 5DK4A 3CVVA 2CV2A 1TYCA 1XJQA 1IQ0A 3ZGZA 1MAUA 1O96A 4U7JA 1QRUA 4MVCA 4E1AA 3L92A 2H29A 3M5WA 4MW1A 4KR9A 3FG9A 3MXTA 1H1TA 3UC5A 5FO0A 1PFWA 2X1MA 3RK1A 4JXZA 4KR7A 3MLBA 1KP3A 3IODA 1WQ4A 1YUMA 3F3MA 2PFSA 2WB2A 1GTRA 5TGTA 1O97C 1U0BB 4OJMX 2WSIA 1J20A 1TFUA 1YI8A 2J09A 3C8ZA 1M1ZA 2QJTA 4ZT5A 3E27A 5KHAA 2VXOA 3JXEA 3FOCA 1N78A 3X1KA 3G6KA 1O6BA 2IP1A 2J08A 3H05A 4PBTA 1R6TA 3H9BA 1T9GR 3N8HA 4HPWA 2CYCA 1COZA 2E18A 3FH0A 4AQ7A 2J07A 3Q10A 2C5SA 4OUDB 2A7XA 3VU8A 3UY4A 1PFVA 2WQ6A 1MBZA 4ZCTA 4MUJA 2GM3A 1QQTA 4U8HA 1VL2A 4KPUB 3IVGA 2XRZA 3CR8A 1N2HA 5FO1A 1YIDA 1DNPA 4QBTA 5KWVA 1UFVA 1KQOA 2O8VA 3N2YA 2AKEA 3GLVA 2A86A 1A8HA 3CVXA 1O94D 1O0BA 4GU5A 3SZGA 4QRDA 1EE1A 3UOWA 2E21A 4NX2A 4PBSA 3ZXIA 4XFDA 1XNHA 4H3SA 4MUHA 3IMGA 2V0CA 3KT3A 1K4KA 2RD2A 4YP6A 4MWDA 3KFLA 3LE8A 1GZUA 5TS2A 1OBCA 3PRHA 1I6KA 2AZXA 3CLSC 3IUEA 3HFJA 4MW7A 1HYBA 2YWCA 3ELBA 3FNRA 4MULA 1NURA 1H3EA 4ARIA 1NUQA 1EFVA 3RFFA 1WKBA 4RPIA 1FFYA 1Q77A 2JAXA 3IDFA 3K32A 3FY4A 4MAFA 1NP7A 5BNZA 4EG3A 3COZA 3CLTC 4EGAA 3VGJA 2J4DA 4EG6A 2ZP1A 2CFOA 4MW4A 1YULA 2QTRA 1ZUNA 1MJHA 3A2KA 4QREA 1GTSA 4P2BA 1N2BA 1N2GA 1JIIA 2J5BA 4I6JA 2GOYA 3NV7A 2GKSA 3IOEA 3ILVA 3VRHA 2HGZA 1B6TA 1N2OA 1OD6A 4ZCSA 4F3RA 4AS1A 1KQPA 2DXIA 1V8FA 3IH5A 4KKVA 1OWMA 5F23A 4ZCPA 1F7UA 4ND7A 3SEQA 4ZT3A 3NBKA 4MW9A 3P0JA 1EFPA 3GUZA 2QUIA 5IJXA 4RUKA 3FWKA 1GPMA 2DPLA 1EXDA 4U63A 2ZUFA 4PBRA 4CDMA 1TYDE 3HZRA 3LOQA 2DUMA 1EJ2A 3SEZA 3I05A 2DERA 1N2EA 4OUDA 3OP1A 3PXUA 3ZJTA 5EKDA 1D2RA 3ISJA 3LCJA 2H2AA 1U7XA 3PNBA 5HUJA 3UMVA 4KPUA 1OWLA 3D6VA 1N2JA 4XSVA 1VLHA 3X1JA 4CDNA 3H99A 3H97A 4NATA 4DJAA 1Y42X 1JILA 4EF6A 2A1UB 1EFPB 1NUPA 1IVSA 4EG7A 2QTNA 3IUBA 4ZT6A 1U3DA 1NSYA 2CSXA 1U7DA 3CLRD 2PZBA 5J59A 1MB2A 3H9CA 4YP5A 1NUTA 1KP2A 4DDHA 4MLPA 1TYBE 1O95D 2AG6A 1MAWA 4XFJA 4MVYA 1ULHA 4EG5A 3CLUC 4YP7A 1CT9A 4MUNA 4G6ZA 1GLNA 4ND6A 1JMVA 1O5TA 3HGMA 1G59A 2HZ7A 1PFYA 1NI5A 1IQUA 1I6LA 1WJGA 1MC1A 2IELA 4UZEA 1N2IA 1JZQA 1N75A 4DE5A 1QRSA 1GN8A 5TEWA 1NUSA 1IH8A 2A84A 5J5AA 4G5FA 4I6GA 5FNZA 4NAHA 2QUHA 1X6VA 4CT0A 3FI0A 1H3FA 2VTBB 2DETA 4Q93A 1IHOA 3DO8A 3ND7A 1JECA 4A91A 2CV0A 4ZCQA 1MB9A 2EL7A 4CQNA 3DV2A 4NAUA 2X3FA 3RK0A 2E89A 2WQ7A 4JYZA 1XNGA 1QJCA 3TNJA 4FZJA 1WOYA 4WSOA 2D13A 1T6ZA 3FETA 4ZT2A 3AIIA 3Q4GA 1JIKA 4MVXA 1EUYA 1J21A 1KKUA 2Z3VA 1BS2A 2CUZA 4L2IB 1QU2A 1GAXA 1M83A 1KH3A 2PIDA 2CV1A 1VBMA 4J76A 1S4MA 2O5RA 2Z09A 2A1TS 1WXFA 3A4IA 1EUQA 1WXIA 3HL4A 1TEZA 1SURA 4HJRA 3TQOA 2CYAA 2OV4A 4MUEA 3G5AA 3ZIUA 3KT6A 5J58A 2X1LA 3D6UA 2NSYA 4YMIA 1WY5A 1O97D 3COYA 4JXXA 1JGTA 1ZH0A 1IRXA 1T9GS 3AFHA 3N9IA 4G5YA 1T6XA 4WNYA 4NZPA 3MMXA 5AHWA 1O94C 4MWCA 3FHJA 1JEEA 2EJCA 1QTQA 4EG4A 5HUHA 1RQGA 2YWBA 1F7VA 1PFUA 4K03A 4MWBA 4ZCRA 5H16A 2NZ2A 2A1UA 3N05A 3SYTA 3DLAA 2OQ2A 3HV0A 3RHSA 2QJOA 1N77A 3DPIA 2D5BA 4I6EA 1TYAE 3SP1A 1J70A 4NDAA 1F4LA 4R0NA 5TEVA 5KCMA 1PG0A 4EG1A 1IFXA 4Q16A 2IJGX 3IVCA 1JIJA 4MW2A 2DEUA 3P0IA 3SDBA 4DDMA 3KT8A 4X0EA 1QNFA 3L93A 2QJFA 2DLCX 1IQRA 1LI7A 3NBAA 3AL0C 2Z08A 1G8HA 3P52A 5HG0A 3PNYA 1WQ3A 4TS1A 5K0SA 1KR2A 1N1DA 3A05A 3ZJVA 3CVUA 3AG6A 4JZYA 4S1OA 4R2LA 2CT8A 5DASA 3AG5A 3RBAA 5H7XA 1WZ2A 2DR2A 2VTBA 2PG3A 3Q12A 2I1LA 3S3TA 2A1TR 4DLPA 1KH1A 3UK2A 1VBKA 1NYLA 3CLSD 4MWEA 4HK4A 4ZT7A 4ZT4A 4BWVA 5LFAA 1M8PA 3ZXSA 3TQIA 3ND6A 2PZAA 2TS1A 3IMEA 1O96B 1MRZA 1JHDA 2QTMA 3INNA 1WXGA 3BL5A 1WXEA 1PG2A 1N3LA 1FYDA 2BTEA 3CVWA 4ARCA 1G8FA 1K92A 1NZJA 1V47A 1NUUA 2HMAA 3U1VA 2E0IA 4EFKA 3FDXA 2ZUEA 2BYTA 1WXHA 4L2IA 1XNJA 3CLTD 3MLAA 1MOPA 3ZUGA 1VBNA 3TZEA 1T6YA 3ND5A 2YY5A 2JA2A 3A04A 2CYBA 1ILEA 1KQNA 1KAQA 4MW0A 4PY2A 2QUKA 5LM3A 2PXHA 3GMIA 3CVYA 4K0RA 2A4MA 1P7PA 3TS1A 1J1UA 4MQ6A 3IOBA 1TQ8A 1YUNA 2X0KA 1Q15A 1J09A 3TZLA 1Q19A 2YXNA 3P0HA 1K4MA 1R6UA 4R2MA 1J1ZA 4KR6A 3IMCA 3COVA 3CLRC 3QTTA 4MUGA 2V0GA 1R6XA 1OBHA 4UZFA 1O95C 2RE8A 5LLTA 1U3CA 1KORA 4DDKA 3MUEA 4GRIA 3RJZA 1KAMA 2XRYA 1LI5A 4HJXA 3G59A 4JFAA 5K0TA 3PNVA 1I2DA 4MW5A 3FIUA 1ZH6A 2B7LA 1Q11A 2R5WA 4MVWA 4YBRA 1OWOA 1M8KA 3HMQA 4MW6A 5IHXA 3IVXA 4DNXA 1G8GA 5DB4A 2D54A 5JBNA 1QU3A 3K9WA 1K97A 3X1MA 4MUFA 3CA8A 1LW7A 4EG8A 1I6MA 2G36A 3OTWA 3IOCA 2PZ8A 4MUIA 3QE4A 1O0CA 1M8FA 1M8GA 1ZJWA 3AKZA 1JEDA 4F4HA 1H3NA 3COWA 2QUJA 1OWNA 1F9AA 1OWPA 1JZSA
chains in the Genus database with same CATH superfamily
3L5OA 4PM4A 2A88A 2YBEA 2ZROA 4MYTA 1TMKA 2H2FA 1AK1A 4U0KA 1M1UA 5IJWA 1XPOA 3GCWA 2O0KA 5FOQA 3DPSA 4CI0B 2QYSA 3G9XA 4CIAA 4JB3A 1N5DA 4AMBA 1C0KA 1F1BA 4R1PA 5EIEA 1IDOA 1AOXA 3BG5A 1TUEA 1EXMA 4RZHA 3UPDA 2VAWA 1DRKA 3UHJA 4EATA 5JZVA 3ROZA 3WYBA 3HU3A 4DM4A 5LQJA 1XMPA 2JCXA 4DBZA 2YMQA 4MR7A 4O2LA 1QFZA 4OAOA 3NNNA 4NG5A 3G6WA 1JAIA 3AJ8A 1GZ3A 5EP3A 4AZVA 4C7KA 4TRMA 4ZIRA 2OKCA 3BRQA 1ZL0A 4MW1A 2HT6A 4NQZA 3FG9A 4JLJA 3BIJA 4A0FA 3UC5A 2Y92A 2X1MA 3GNSA 4HNHA 5G3ZA 4JBHA 3HCOA 3PE3A 1LW6E 4P83A 4CIWA 1R0KA 2CXUA 3FGOA 3L79A 2Y1DA 4KTVE 4ZCLA 3SSMA 5AUQA 1IZ8A 1G2IA 4GGOA 3ML1A 3TLXA 2G6TA 2WWXA 4FVTA 5B53A 1R66A 3G88A 1T9CA 3Q87B 5EIBD 3VU0A 2XKKA 4UTXA 4DGQA 3C0KA 3NG1A 5JS7A 4CGYA 4IVRA 1JLMA 3FVTA 4FFVA 3SG0A 3IFSA 2ZRJA 4BEWA 2PKQO 3Q41A 2VXOA 3A3YA 2BEWA 1JSLA 2AC4A 1QOPB 4WECA 2ATVA 3D6AA 3C7KA 4MR7B 3MD9A 2WYHA 2Q5HA 2KBFA 2PUVA 3QXGA 1F9EA 3DW3X 2IP1A 1YS6A 4LJ5A 1N3YA 4WVFA 5D1NA 2NWQA 4ZIRB 4J16C 5KYTA 3QUTA 3UFXA 1XAHA 1Y6RA 3C85A 1AT1A 4RADA 2O07A 2QUAA 2AZ4A 2EWWA 1E92A 3DB2A 5LYYA 3RTDA 3SQDA 4FKZA 3DQZA 1U6IA 1OLOA 1ZK1A 4AZ3B 3AQIA 1I0ZA 1WW3A 3NAZA 5F64A 3V46A 4QDTA 1XDZA 3W2TA 1KZGB 3LRTA 2DU8A 1JXAA 3W5BA 1VJ1A 1YVPA 2IU3A 4IF6A 4RS3A 1MBZA 3FUCA 1E2JA 2OCAA 3R09A 4OV6B 4UUNA 1DQYA 2G04A 4CF6A 1QQTA 3N0XA 2J41A 2IH5A 2I3BA 2NO5A 4MQLA 2FN8A 2JARA 1EI9A 1HLDA 4RKYA 5KKNB 4DLBA 2C0PA 2WU4A 4RHFA 5CHYA 2EFJA 1U5CA 2CC2A 5I48A 2EJVA 4XEHA 3KQWA 3WO1A 4HNVA 1LC0A 3BHIA 4Q4DA 4UMEA 2IZOA 4AJEA 1PL6A 1ND5A 1S2GA 3DE2X 5JH7B 3GDOA 3ZVNA 2BH9A 2PXXA 3DDNA 4RZIA 4TQGA 1PQPA 3UFXB 3WNZA 3ZZ1A 4FQ8A 1BQ4A 5AJTA 4KFSA 1CS4C 5EZ5A 3AQ4A 3GJRA 3EVFA 4GWLA 2GFHA 4YPFA 4D3FA 3SSOA 4DJAA 3OKCA 4IOJA 1ST3A 3TM4A 1VL8A 2AW3A 4RZ2A 3T5CA 3MQFA 2HWKA 4YT2A 3LK7A 4FYYA 3IE1A 1ZMXA 3VDQA 1EDDA 4OLHA 3HFJA 4WTOA 4BDTA 1E9CA 3KKPA 4OKNA 4M98A 4QDXA 4MJXA 4JYMA 1C8VB 3WTBA 3EW9A 1PV4A 3QXHA 3Q3VA 4WT7A 1IN4A 3SKVA 3ZIAA 3BE8A 4JSRA 3KTOA 4IFBA 5DYIA 5AW1A 3HR4A 2AXNA 3TN7A 2R6JA 2B8NA 2XGOA 4JJAA 3A1SA 4UDNA 4CNQA 1KQ3A 4ZREA 3ZZMA 1OV4A 1IC6A 2BC9A 2JAXA 4EY4A 2ZJ6A 5JXIA 2O05A 2WK1A 4KZKA 2CMKA 3FKJA 1HOXA 1X80A 3AFOA 3GJ0A 3EFOA 3QLEA 4W82A 2J1LA 5CX1B 5GVRA 1I01A 4BU0A 4LSWA 1FXUA 2I2DA 4HYTA 1TGYA 1QQAA 1WWKA 2ZP1A 1PWZA 3ZQJA 2WYUA 3FYSA 1PDVA 4G8BA 2IIQA 5ENZA 4J9UE 5EKXA 3JALA 3PLRA 5JV5A 4QBHA 4BC0A 2NZJA 1N2GA 3O7MA 1OFHA 3QE0A 4IKEA 1N8NA 1WCXA 3NNSA 2RB5A 5IAGA 4R1SA 3B1VA 3UJCA 1CY7A 4ARZB 2B8EA 3ILVA 2XMBA 1QUFA 1U63A 3OEED 4TYQA 2OHGA 2GPNA 3GNTA 2G1AA 3R3YA 2OCBA 1AKWA 3IEMA 1I7LA 1BVYF 5F23A 5J1SB 4QEDA 4ZQCB 3H1AA 4RV4A 3BE5A 3SZUA 1OFTA 5BMVA 4UNSA 5I45A 3MUFA 3K6SA 3BDAA 1RI5A 4U1RA 3CSDA 4ZFNA 1W0KA 1U28A 4ADSG 1JTFA 2NXCA 4UEOA 3KYCB 3THRA 3RV4A 3SBDA 2YXPX 3KKEA 2CBGA 2E5FA 2LP4Y 2NNWB 3EHDA 1C3EA 1D6NA 3OPVA 3RTGA 1DFGA 1U2TA 4YV2A 4HPXB 1XALA 2DUMA 1FDUA 1U7PA 1Y8ZA 2ZYWX 3OCUA 2ONKA 3GJ7A 4FOSA 4I2VA 5TVKA 4RVHA 4E22A 1W7AA 4CRWB 4D97A 1WUIS 1THGA 2ZBFA 4G4GA 2VOEA 3OCWA 2BUBA 2A9RA 2JCBA 2XI4A 3U40A 5DBOA 1B0PA 5HTOA 2B99A 5IZCC 1BXZA 2X14A 2H85A 2D1SA 4BNGA 1CUVA 4MQFB 2VQSA 3DAPA 4IIXA 1RQXA 5IASA 3H99A 4KI7A 4BFSA 1OZHA 3WKBA 2ZI6A 4R2XA 5FOSA 3AP3A 5A0TA 3FDZA 1WTAA 1FXWA 2HSEA 1LSSA 1U7OA 1XZLA 5ALIA 5LZ8A 4B7CA 4UEWA 5KYXA 3FOFC 2CBZA 3LZ6A 2XZPA 3WXBA 1R6DA 2PZBA 3RM3A 1EUCA 4TS3A 2GM9A 1IU9A 2ZYDA 3I92A 2GAFA 3I12A 3L4BC 3QWFA 5C4MA 4YIHA 3WJ1A 2HCBA 3I58A 4NBSA 4OHRA 1O95D 2I03A 5AT1A 4R6XA 5G4KB 1YCFA 3C97A 4FBGA 3BZWA 3F4LA 4WACA 5KBYA 1YA6A 2XEXA 3LT2A 4HGNA 2ID9A 2XMCA 2QTLA 1BRTA 4FMDF 4RTRA 2IS1A 1EE2A 3OTQA 3A7DA 4LYEA 5CW1A 2CJWA 3ANNA 5BSWA 3HYSA 2IL1A 3A10A 3EZLA 3NKFA 4JT9A 1U98A 4HUJA 4WMLA 3KAQA 3UHFA 1TW2A 4R84A 1JMVA 3H5LA 1G59A 2JGDB 3RS5A 2KW5A 2C8VA 3KQUA 2PYZA 1OQAA 3M2PA 1VHTA 4WDQA 4YP0A 4MSUA 4TKUA 1I3NA 1DU4A 5KYXB 1FTGA 1VBFA 1PT5A 2C2OA 1SVUA 1ZLXA 2Q1SA 3K31A 1UKVY 4NOLA 2F3SA 4LQCA 3ZEAA 3SSAA 4CM6A 3UH0A 2WJAA 1WPXA 1NATA 3PQCA 3VI3B 4BVGA 1U0GA 5IJZA 4W5RA 4DAOA 2IEBA 1VSBA 3QZUA 1VKOA 2H0AA 4IWNA 2QD3A 3QK7A 1DDIA 3QOYA 4IRUB 4J7UA 3G2JA 2D4HA 2C8KA 2ZANA 4A91A 5TSDA 5JIBA 5EPOA 2QX4A 1RHKA 1K5HA 4QAJA 1SZDA 2E89A 4S12A 3WGMA 3KE9A 1XI2A 4NE9A 5K3OA 5T6MA 3JYPA 4G0OA 4JLVA 4ER7A 2F1JA 1TKBA 4CTMA 1WOYA 1M0WA 3I04A 2QRHA 1A82A 3O8BA 4RQAA 1UBFA 1T6ZA 2P1ZA 5CLIA 4K1LA 4C6SA 4DILA 5BOSB 4XSHA 4MCHA 4EW2A 1L7RA 3T0GA 2HQSA 4MA5A 4W5OA 1FDTA 4NE7A 4G24A 3IP1A 4DJJA 4WZ6A 2EGGA 1Q0TA 4L95C 3L7DA 4OL0A 3U4QB 2PANA 1AGPA 2FZGA 2DTDA 2O1SA 3EVCA 4QWWA 1QPZA 2HY7A 1LSOA 3HCBA 4AMGA 2AE2A 3MMSA 4TYPA 1EX1A 3TMAA 4D9KA 3IQWA 5JPIA 2G06A 2VDVE 2ZWPA 3F67A 3LBFA 4MQUA 2ZBVA 5HMLA 3WK9A 4WCVA 5IMSA 4HGQA 5KHLB 1K5GA 3VDMA 1RRGA 2Q5EA 1K6MA 4O4IB 4JLKA 3Q9NA 1KJ9A 1E96A 3K1TA 5FTKA 4JXXA 3TW0A 1NT4A 2BEVA 4FGKA 1KEKA 1KAGA 2CD7A 4JITA 5F1YA 3SIPA 4OLFA 4EK9A 4ND5A 5EJFA 4AKIA 1MQSA 4W7SA 3DOUA 4RFVA 2FWAA 3OZCA 4XCXA 4E33A 1KEEA 2B8TA 3RREA 3SBEA 3U26A 4GE3A 1QTQA 4QVKA 2QT1A 1I5EA 2Z4TA 3K70B 1RXYA 1EE9A 2D5AA 3DXFA 1E9BA 1P1KA 5M2QA 1G6Q1 1V9CA 1B15A 4IQ8A 4ARBA 1M2EA 2IHZA 2AFIE 1CY0A 1PG5A 3AU9A 2WLTA 2ZS7A 4PAOA 3IVAA 3W79A 3IEPA 1QHGA 3RAPR 3VR5D 1TB4A 3D2BA 4G97A 4OYHA 3WKEA 4CLDA 4CM7A 1SD5A 5C32A 1YBVA 5JSQA 1D6JA 5T7BA 4OU5A 3GVPA 2FHSA 4G0QA 3R41A 4IQGA 2IOYA 4H18A 1P73A 4P4UA 4QYXA 4TTIA 2VF8A 4AJHA 4PNPA 3M3DA 4DCPA 3RVSA 4JB2A 5LLDA 5D3ZA 2G1KA 4KEAA 3CZQA 3L0DA 4MPPA 3VR5H 2XY4A 2FWBA 3D8HA 1J7KA 3GIDA 4OHOA 3WI7A 4AX8A 1P8AA 5KX5A 5F98A 2BEVB 2FQXA 3I0NA 1DEKA 4X0EA 4UREA 3S1AB 5BT8A 2FPLA 4FOTA 5JYCA 2I4LA 1LI7A 3TIXB 4JKIA 3TOSA 5A5EA 5E7QA 2H1HA 2OD2A 1JDSA 5IAJA 5TY0A 1SCIA 2IQIA 4DCNA 5DWVA 5CBKA 1KSFX 3PNYA 4RPJA 1IMJA 2Z95A 5K0SA 2P77A 2ZSEA 2DY1A 2TMGA 5A2QA 4PG7A 5CVVA 1L7BA 1N3BA 3KOWA 4Z86A 4Q6WA 1NBWB 521PA 4AIIA 3DDZX 3AG6A 2H7CA 2CMHA 4CCWA 4F60A 4DC1A 3EG9B 3PL1A 4MUXA 3ZDYB 4CLRB 3Q8MA 3MS4A 2W2LA 4GECA 2HD4A 2RGWA 3T35A 2GLUA 1E3TA 1CUUA 1EBBA 3MXOA 3GFSA 2IUEA 4ABTA 3URMA 5C80A 4ESVA 2Z5GA 2ZEJA 4GDMA 5CHEA 2VQFB 5C8YB 4Z4FA 1L5ZA 2HA6A 4QOGA 2DPMA 2GT1A 1FFXA 2PZAA 1SXQA 4RDCA 3RLIA 3EEYA 4X5OA 3BJMA 4LGCA 3NXSA 3OH8A 3R7LA 1Z36A 2V45A 4ID3A 4G09A 5PGMA 2ISQA 2RK4A 2A9KA 4MIEA 3ZDDA 1G8FA 1M5TA 3DMTA 2O2HA 3JU3A 1XVIA 1Q0UA 1U2GA 5ALZA 2XWPA 3GX1A 5EXDA 4ZEXA 1YMUA 3U1VA 4C04A 1IXSB 1B41A 2NYVA 3MA0A 2QR5A 2P6PA 1ML4A 3HACA 1OCEA 1LTHR 3ZUGA 3GPLA 3KXPA 2CKDA 1ZNZA 1C9EA 1TJ5A 5A6VA 2IYLD 4EO9A 5C8ZA 3A04A 4H6XA 3RHFA 5ILGA 2JFQA 4YXWD 4B3DA 5HRUA 5H4GA 1XP5A 3SQMA 3UUWA 3N07A 4MMXB 1EBUA 1J0AA 2V5AA 2A35A 1U8UA 1G3QA 1Z6TA 2BJHA 2FKAA 4ZC8A 1SC3A 2ZBRA 1ECLA 3PHIA 1ADCA 4RGVA 4WW0A 5A5VA 7ABPA 5IVKA 1Q15A 5BUQA 3H6GA 4R16A 4FX5A 3G17A 1VJ5A 2VXBA 4XE5A 3WRYC 1K4MA 4CIDA 3IPCA 2B2XA 3MPUA 2C3MA 1J0DA 2QKYA 3AI1A 3T7IA 4AO7A 3ELYA 3LUJA 2RAUA 5A0FA 4PC3A 4HX9A 2D7DA 4D25A 2UZ1B 4N3GA 2FX2A 5DX0A 1U1FA 4N0EA 3DWIA 2QP4A 1YQQA 3BMQA 5EJ6A 1RCTE 3EBLA 3MGAA 3BICA 4NNOA 4PWZA 4C87A 1A71A 1DL5A 1ZGAA 2V9PA 3T61A 5KSYA 1SOAA 3U44B 1YZVA 4XD7D 3RBZA 3U4MA 3OJXA 3MCAA 4KP7A 3OF2A 2DHCA 4GRIA 5EEHA 3RJZA 3AR2A 3DJYA 1B00A 1VPTA 2C57A 3S1SA 2I6UA 1QIFA 3W8EA 3FIUA 1SBZA 2MSKA 1O57A 3H4MA 1XTBA 1M8KA 3LA6A 4MRAA 4ZQHA 1BA2A 1G1MA 1FPMA 3H3XA 4IINA 2YL2A 1CR2A 4B2PA 3KWLA 3LF1A 1JHXA 1C50A 5AIAA 2W93A 2JFNA 4TQUS 4QOIA 2BKUA 2QM7A 1JYSA 4OJNA 2PPLA 5C1IA 1WMBA 2J3IA 4QYWA 1I6MA 2R7MA 3IURA 3K4HA 3LMKA 3MLEA 1RBQA 2O06A 2QRKA 1QHXA 1EGMB 2HDWA 3BJRA 3ZJYA 5LQKA 4UNIA 4P98A 1JDNA 3GDHA 3NIGB 3ONEA 1HLGA 3L6BA 3A70A 1NU6A 1E1QD 1XWWA 1QIKA 3IIJA 1A76A 2H06A 4OI1A 3BYZA 2OWDA 4KAAA 2BFCB 2WT9A 4J1TC 4G0MA 3V5NA 3WGIA 1OGJA 3FTFA 2QZ4A 1S2IA 1OOEA 2HK8A 4IIDA 3JVUA 4DG9A 4W5QA 4EI7A 2B0CA 5KWIA 2Z2XA 1QRAA 3K20A 2PO7A 1R4MA 4B8WA 2ZWIA 4QDOA 2OGTA 3E15A 3I1FA 4DPMA 4G0UA 1HDRA 2C5FA 2J45A 3DWGA 1D5WA 2FJPA 3L4BA 3O8OB 3LKVA 3DA8A 3REQA 3W06A 4Y9SA 1B8VA 4ZYUA 3DNMA 3IT0A 4M1QA 5EWJB 5BV2P 5DI3B 4KPEC 4S2UA 2WR8A 1FJ2A 1E1CA 3TEFA 1F8XA 2Q6VA 2R6R1 4X92A 2WFMA 2Q6OA 2Z9CA 1R7RA 2Y1WA 1DWUA 4AUKA 3IV9A 1D2CA 1KK0A 4GEGA 1YNSA 2XUIA 1GNVA 4M0LA 1AKEA 1YHYA 3FUWA 3HI4A 4Q9NA 4R71A 1TJYA 4G84A 1FDVA 3OX1A 1ECCA 2QNIA 4XOIA 3JAKA 4GOMD 3WRVA 1GILA 4LDAA 4OHYA 4LDJA 2C4MA 4ZOEA 4LJAA 4MA0A 4NEQA 3EZNA 3E27A 4QUKA 4ZT5A 5KHAA 2TECE 2JCSA 3D7KA 4L74A 1MO2A 1OLSA 3MJVA 3E8SA 1ZMRA 3O2QB 3UWKA 2JGNA 2FY8A 2VDRB 3AVPA 2ERXA 4ND4A 4XZ3A 2GPTA 2QD1A 2V7UA 3FSGD 4FSHA 4PIVA 3L0BA 2AOWA 2LDBA 1R6TA 2BLNA 2EBWA 2GK4A 3K0AA 2C96A 2NTNA 3TW6A 4HPWA 4E5NA 1ONPA 1GCIA 4DMGA 5UKDA 5L4SA 3FH0A 3S8YA 1OH8A 3M4XA 1E2FA 4I8DA 3VR2D 4J0HA 1K89A 1ZVKA 3C3MA 3EXHA 4HNGA 4CM4A 2O8DA 2W00A 1PU2A 2QSZA 1LF0A 2VT7A 3U09A 2Z2IA 2IOFK 3JSXA 2ZK7A 4MUJA 4BX2A 1JVSA 4CMJA 4OIFA 9GPBA 1T8UA 1F3LA 3LP8A 3GYBA 1M2HA 1XCBA 3LLUA 4BP3A 4C0XA 1T24A 4ME6A 5CH8A 1IWBB 4C4OA 2H3HA 4ER3A 1M6WA 3PFKA 4DSTA 1TF5A 3CR8A 3PB3A 1XEAA 2LWIA 3MTJA 4JIMA 4ALIA 3AKYA 1XJ5A 3GLSA 2C2WA 4EEZA 3ZWPA 1OLSB 2B1RA 1EP3B 2O8VA 2HWWA 3IHKA 3NJ8A 1VHQA 1NBME 1G5IA 1M54A 1CQZA 2RBKA 5EI5A 3RVJA 3AERB 4HUTA 3LY9A 5JCZA 1M76A 1EDBA 1JZTA 4RCYA 1O0BA 4I9HA 1SVOA 4E31A 5A3SA 3ZI0A 2ZYVX 1FDWA 1KMIY 3K0AB 3PQDA 3IMGA 1YDGA 3SHWA 3QA3E 3DWFA 3PGVA 2QMEA 1GG2A 1N6IA 2R3SA 2A94A 3WL4A 4RENA 4IMPA 1JIVA 2BY4A 2WF8A 2VK4A 4PLVA 4ICIA 5AK3A 3RJ9A 3JQPA 4BMCA 2WFAA 1ZS9A 3HMKA 4H16A 4PZLA 2Z2JA 4IQFA 3RFTA 3OZAA 4MR9B 1TCVA 3O95A 1KC3A 1NZFA 3GLIE 2A1IA 4MW7A 3EFHA 4QRHA 1X1EA 2R6AA 1A4UA 1NW5A 2YWHA 3TTSA 4AKGA 3DBLA 1BU8A 3FNRA 1IPHA 1BXKA 2COEA 2F3TA 3P9YA 4MULA 4BNIA 1R9MA 3C14C 3FTDA 1B6SA 4G5SA 5KMGB 1N0WA 2XUGA 2CLDX 1P2TA 4BIMA 1ZWKA 1E2UA 4KXUA 2LZ0A 2CLHB 2I0FA 3DMRA 4MLCA 1G5FA 4IZ6A 1Q7BA 3IDFA 3LGXA 1K7SN 1EMDA 3QFSA 3R0QA 3MTIA 1GZSA 1UR5A 1UWKA 1ZIXA 1JHVA 4KV9A 3UEOA 4AN4A 2PS3A 3WK7A 4EH1A 3O8QA 1PQUA 3U7JA 1BKYA 1K1EA 2GEKA 1YRBA 4RGBA 1J56A 1E2EA 1ZMTA 2FZCA 3OT5A 4MEJA 3D4OA 4UUPA 2BVNA 3FPHA 4UU7A 3NNDA 1X7WA 2EHJA 2GBGA 2Y71A 5E4TA 5DFAA 2CXHA 1QG4A 3ENQA 4C3OB 4PQFA 4M21A 3INYA 4LDZA 1VMAA 2ZU0C 1GUDA 2HN9A 3G9TA 2FMFA 1DTSA 4PHTA 4CETA 1FX1A 1QORA 2IEAA 1RWKA 3EXIA 2GKSA 1E62A 4LAFA 3B7WA 1PR0A 2HI0A 4TL7A 2NVUB 4M38A 3TPCA 3V3TA 3VRHA 1NW6A 2XWBF 3DBLB 2H59A 4NMMA 1JG2A 4IXTA 5JDCA 4JI4B 4JB0A 4N54A 4LXHA 3CZRA 3FMGA 1CUJA 5AJVB 3OTOB 5FPPA 2OBLA 5K03A 4BFZA 2FW8A 3O8DA 1U9YA 4FGUA 1PZMA 1RZUA 5ALPA 2CFCA 3DH0A 5ALYA 3F8TA 5ADUS 1A72A 3GBSA 4MW9A 2C94A 1EZ4A 3ZWBA 2PBRA 1SU8A 1VL5A 3WYCA 2C7OA 2AMJA 2APJA 3NGLA 3JTEA 1ZESA 2XBLA 3FWKA 3WLOA 1RXVA 1GPMA 3DMFA 2CFRA 3GOQA 1H1DA 4RYDA 4FLMA 3F90A 4UOEA 3VPCA 4RKEA 4OSOA 2VYNA 1QHHB 1IEVA 3ZHUA 3HV2A 3LOQA 3QKSB 4GOXA 4AP5A 5CYFA 4C2BA 3GVIA 3EUAA 4R1QA 4RDIA 4HGZA 5LBUA 5EIXA 3MJDA 3PDUA 3R5FA 4JI6B 2CXXA 3LZCA 4OUDA 3OP1A 5LXTB 1V26A 4BV2A 1CUEA 2W2OA 4XQGA 2P3QA 5EHNA 1Z4LA 3MCVA 3FKQA 1JPJA 2JAWA 3VM6A 2JI4A 4HDKA 1OXTA 3RSCA 1VRCA 2VPIA 3EC2A 1CP2A 2WMOB 1AZWA 1V35A 1V7ZA 4CHTA 3IA7A 1VLHA 4PLGA 4CDNA 5JNLA 5T67A 5CLGA 3AM4A 2DHEA 2QK4A 2AX4A 2XB9A 3ID6C 2UXCB 1GPJA 1SEPA 5D00A 8ATCA 1CS0A 3IUBA 4PWYA 3KLPX 1NSYA 3S68A 4HBGA 1DJOA 1SM4A 1B0ZA 2MYUA 3H9CA 4YREA 1U4OA 2D5IA 1T36A 2FVYA 4M8SA 4P31A 4WESB 3TQRA 3ITDA 4Y18A 1NQAO 3EGXA 4LXUA 2J67A 4UZSA 4DIEA 2QPOA 1KI6A 3PP8A 3WRYA 1OU0A 4KLZA 4X00A 3I09A 5LQRA 1HNXB 3BAFA 3H6KA 2CN1A 2FUNB 5FBWB 3DXYA 4P5DA 4HXFB 3M89A 4IUYA 4HDKB 4KQ1A 1G19A 1HZJA 1ZGHA 3PLNA 1K3TA 3JAMA 2I7CA 4C4AA 3QWHA 1KY4A 1QLHA 2OFOA 4EGCB 3UKOA 2GD2A 2QG9A 4GIBA 3A7EA 3LVBA 5JBQA 2ZI3A 1RSZA 4J07A 3W77A 1NBEA 2X5OA 4QOSA 3MERA 5BYBA 3ZW9A 1P1HA 2IELA 1JNXX 2FDXA 3PWZA 4D6PA 3DGFC 4DE5A 4XPZA 1YR2A 1YJXA 4GWKA 1IHDA 4EAAA 5DP2A 1KRWA 1KE2A 5ITZB 2YCBA 3MVEA 3TCKA 4A26A 1OGIA 3ZWYA 2H7XA 4NCAA 3F9RA 4E14A 3RE1A 2ZZMA 3WJAA 1NFQA 1ZUD1 1EWTA 3REGA 2DQYA 2DWQA 3IRUA 2XNHA 2GA8A 1PR1A 3K35A 4DR3B 4HO1X 2AX3A 2PTGA 4KXMA 3U7IA 1RWVA 2ZIVB 2LIPA 3HVRA 2PMFA 2B5WA 3AK4A 1M10A 4GZ5A 5ALXA 3TZKA 1G66A 1IY0A 1OBFO 4B3RB 2PUHA 5KQRA 1QJCA 1QFYA 2DKNA 5A04A 3FMIA 1NTRA 1L5GB 5EE9A 1J23A 3J7AC 2WTUA 4L3OA 2NU7A 2VDJA 5JO0A 1H2BA 4XIGS 4BZQA 2IXFA 1QZTA 3FF1A 5KNBD 1ULZA 2DULA 1UBJS 1KKUA 2AIRA 5EIHA 1QS0B 2Z3VA 3Q72A 1WCIA 4TVOA 3OBIA 4H2DA 3UK6A 1B26A 3WHIA 1HNNA 1V16A 3GDFA 3PTAA 2J3DA 3G5UA 3GFVA 4W1SA 1L7XA 1ZKMA 3PHJA 1ORHA 4M1MA 2E48A 3ON5A 3QLUC 4ZMRA 1IUOA 5KNBH 1ENYA 1FDIA 1G63A 5KNDH 4HJRA 1QVRA 1FP4A 2KJQA 4WOJA 3SN6A 4MUEA 4BMNA 1TKRA 2BFMA 3ACCA 3WLPA 4ZEVA 1RYBA 4J2OA 3ZR4B 1YA8A 1PWYE 2FSVC 3CTMA 1EPUA 2HH9A 4RJKA 3VXKA 4LUCA 3COYA 1AQIA 3TE6A 5LZ2A 2AWNA 2D2XA 1I10A 4WAUA 5HBRA 2HSWA 3P9CA 2J9GA 3DHVA 3T3NA 3DCNA 2HFKA 2IXTA 1O94C 4L5YA 2GEVA 5MDHA 5SYNA 5DTIA 4CM9D 5E7JA 1DWQA 4Y2RA 1V1RA 2CE2X 3DTVA 4YRCA 3RYIA 4F9TA 1EFRA 4UBLA 1ND6A 1KDRA 3TK1A 1FRNA 4G56A 3CB4A 1CY8A 1RT9A 3BCUA 4GG1A 2Q5IA 3NALA 1MF7A 4WXMA 3KOZA 2C4NA 2V7XA 4M54A 2A9OA 1OASA 4RTPA 2JJQA 4MQ4A 3HN7A 5DLPA 3NBXX 2WI8A 4CWAA 4XGQA 3DPIA 1QIHA 2Q8NA 4LXTA 1Q7TA 3CZ5A 3I6MA 2OCDA 3HSKA 10MHA 3ROKA 2CNWD 1KJJA 3DAHA 4EG1A 4TRRA 2W90A 2Y0CA 2FKNA 4R5MA 3BEDA 4Z4IA 2DEUA 3MINA 2J31A 2YN2A 3LD9A 5ELLA 1N5OX 1P9LA 4ZPXA 4HLDA 3OETA 4LJKA 4DSNA 5JI2E 1UDBA 4HMPA 2WSSA 3I4LA 3I5MA 4MH0R 3OFKA 4YAWA 1NYTA 1E2DA 3SMVA 5BWMA 2XF2A 3BGVA 3RYIB 3D6HA 3W7BA 1N7HA 4NMXB 5LP6F 1XFDA 3OIVA 3IQGX 1A9ZA 1MX1A 2A58A 4ALKA 1G20E 1PS9A 1YDHA 1DOAA 3GZTB 4OA5A 1KVUA 1XDWA 3A4TA 5ECYA 5JJCA 2ZWAA 3ISVA 3SYMA 1IPFA 3ANSA 3LRXA 2QN6A 4ZO4A 1YT5A 1RJWA 2EERA 3BE4A 1JF8A 3DZGA 1YS4A 4CE6A 4EY5A 1XNQB 3WG9A 4J0GA 1E4OA 5DHQA 2ODWA 2VK2A 3RBAA 3ZI4A 1EU1A 4HFMA 3UYLA 4RD6A 4TMVA 5D5PA 3C3KA 1AKUA 4PZCA 4PHHA 1NJGA 2BE7A 4UEKA 1ZOSA 4YJ2F 1KEZA 4MGHA 1UZNA 4RHCA 1WLSA 1TZMA 3JASB 1TF2A 4MCAA 2CXOA 3V4FA 3KEOA 4EENA 5B4VA 2XLCA 3C5CA 1ULAA 2ZWMA 2O2JA 5ICSA 1M8PA 5JSYA 3L8HA 4I36A 5CB4B 4DY4A 5MFPA 2RGUA 4DSOA 1Z0IA 4HZGA 3WDKA 1YTUA 2QTMA 2VPTA 4BU1A 2YZNA 1X7ZB 3D1LA 1UPTA 3E53A 4G1BA 4ED9A 3K8QA 5KSPA 1SUFA 3X1DA 5CNIA 4JYPA 3UV3A 5C1OA 1JLRA 4HYYA 3U0VA 1ENOA 1NZJA 3VPGA 4D9EA 1XKXA 1LBEA 3IALA 3HN6A 4AY2A 3RVRA 3C3DA 1JBQA 1R4AA 3U7QB 1U6JA 2QMHA 5IDQA 1P1IA 3HO1A 1WXHA 1G21A 1GEGA 1AGRA 3EX7C 1VZ2A 4X62B 1G7RA 5FYQA 5EA2A 1MOPA 3SC4A 1H1LA 4K26A 1NVVQ 3PHGA 2YV1A 1WDWB 4UJ5A 4HL6A 3TZEA 5D6NA 5K45A 2ZTHA 4MTLA 3F3KA 3ZE2B 3A4VA 1WTCA 2ZBPA 1JHRA 2OR3A 2FPRA 4MEBA 1JKIA 3RHTA 2ONZA 3HB7A 5K3CA 5H3CA 4YPVA 3IP7A 3JQEA 4H1TA 3UAOA 1YS7A 3O1IC 3QV1A 4RPCA 3B5JA 4LQDA 3EXG2 1NX9A 1V1JA 1UBNA 4IFIA 1WAMA 2JGFA 2WIAA 3E4CA 3ZIDA 2P91A 3EA4A 4KBGA 3K1JA 1Y48E 2JC3A 3K9NA 4PTZA 1SHJA 3QTTA 1I1NA 4GEKA 1E3QA 5I8WA 4RJ2A 2WYOA 3E5MA 2FFHA 1G21B 5J5CA 4W9MC 1Z68A 1P3Y1 1T8WA 1UOOA 4NXNB 5BV7A 1P2DA 5AOVA 2PRKA 2Q3BA 2ZKIA 3BWDD 3OLWA 3AHFA 3ABZA 1R5JA 2ECQA 1ABBA 3Q5DA 2HK6A 2YDXA 1UEJA 4FUQA 4I8XA 2PFGA 2UYYA 3NBZC 1DXYA 3OIWA 5BSGA 2H54A 3LFHA 4BB0A 1LZLA 3SBOA 2WKRA 4JFAA 2PSSA 4IAOA 1JG1A 4W7IA 3JQGA 4YJFB 4YBRA 1EDOA 4NV0A 3L7JA 4JX8A 3TGLA 2NG1A 1NHGA 4RSMA 5BQOA 2GO1A 3Q2IA 5DSZA 4D9JA 4RPGA 1G8MA 2I2AA 3SHVA 4LE1A 3ZVKA 3OKAA 3S29A 4UD6A 3ROFA 4KO4S 3BWBA 1G291 2O3TA 4FHFA 1G5RA 1NDUA 2BFDB 4RK6A 1JWAB 3NWOA 4INOA 2AVDA 1GCAA 3ORRA 1JPVA 1F6BA 3UXYA 3KPUA 5AM5A 1Y4AE 2II6A 4M7RA 4NCKA 5JR3A 2TSYB 3A14A 2JFYA 1ZM3A 2FZWA 3HFRA 4WDRA 4EUSA 1KZ7B 3VJMA 2C4VA 3F6RA 4LNHA 4OK3A 5DYGA 2QW8A 1EDEA 3KKZA 4BCDA 3ZV7A 2X4LA 4CF7A 2UYHA 2OORC 3IV6A 4M49A 1ZINA 3P32A 2BSAA 2F3UA 3FD8A 4DB2A 2WUDA 1F48A 5JROA 1EFVB 3JQGB 2I22A 2AR0A 3PXBA 5FHRA 3PUXA 5TMEA 3ABSB 1B0UA 1RQLA 2OXRA 1KU6A 2UUBB 2CJYA 1LTQA 3IP5A 2O7RA 2VR1A 1SXIA 3D0KA 1UT6A 3FZNA 3MJRA 4GMGA 2JPDA 3DVRX 4G86A 4DEVA 2L18A 2RARA 3EJWA 3FI9A 3FNFA 4JP3A 3MS2A 4Z53A 3A2LA 1T29A 4WN9B 4YXFA 1GLVA 4Y6RA 4QD3A 4WA7A 4FFSA 3WB1A 5AM4A 4FMCF 4HXYA 4OHCA 3OF5A 2I4RA 5KVVA 5A1TA 3GZNB 4BNNA 2J87A 3EIHA 5JS2A 1U2PA 1GIAA 2VLBA 5CA0F 3GRKA 3EZ7A 4IDPA 3F71A 2ILVA 5KKCA 1MZPA 3RSSA 4N76A 1KFBB 1OF1A 1WS6A 1WQ4A 5JC8A 1WBJB 2CDCA 2RGBA 3IERA 5KVCA 2AKAB 3A6JA 2K2WA 1M0TA 4EGSA 3GP8A 1ZAYA 4EPWA 3QBJA 2YJZA 3WL8A 5JBIA 2XQKA 2YV2A 1OIWA 1QVVA 4GYJA 4RFLA 4DIBA 3KKKA 5CTJA 3UWPA 4ER5A 3AR9A 3C8ZA 2UV8A 1M34E 1Z8HA 1CR1A 1Z2PX 2IY7A 2GCGA 4LJYA 4DV4B 3H17A 2PVPA 3QPWA 2ZRPA 2AD1A 2EFYA 5T8KC 4FM9A 1FFSA 4OYRA 3F6SA 4AUEA 2BRUC 1SCQA 4AJJA 2D7CA 4CV3A 4LOAA 3H0CA 1NDHA 4YCSA 1Q91A 2XTMA 3BK1A 1DC3A 2NAPA 2QPAA 4MS3A 4QBKA 1RE1A 5HE9A 1SHLA 4ARAA 4RD0A 1JLLB 2BFNA 1ECFA 1ZC4A 1E9SA 2VF7A 4ZQGA 3VFDA 2BDUA 4DXAA 1RC8A 1QWOA 4UPDA 2SNIE 1QGAA 3DL7A 1RC0A 5AK6A 1PZGA 1T5DX 3OEHA 5FPKA 4UCWA 5CXXA 2I7TA 3PA8A 1JP7A 1RAEA 2BTQB 3RSZA 4BJ1A 5B4UA 3IBFA 1MO6A 1YR1A 4DBVO 5F2OA 1M2NA 1ETHA 1MU0A 5HJ2A 4O3MA 1NJSA 1I2BA 4FS3A 3H19A 4X65B 4QBTA 2PWAA 4KV7A 3OPMA 4BVJA 3PX2A 3BA6A 1KQOA 4N40A 3ZV4A 1NNEA 2PX2A 3S1LA 1XU4A 1U3WA 2XEDA 2FPIA 4D4IA 2F4VB 3GRVA 3X1YA 1H69A 2IYQA 4AG5A 2BJWA 1AB6A 3NT4A 3KBBA 3U56A 4XFDA 3AOEA 2VRBA 3WV5A 1KY5A 3WL3A 1BMQA 4K87A 4J03A 4ENTA 2BMDA 3LQ2A 1YWGO 3ZPXA 1HKUA 4YP6A 3KCQA 5IDXA 4G0ZA 4MHOA 3LQ4A 4Z3DA 5FKJA 4MP3A 4EA6A 221PA 4X66B 1GZUA 2K7FA 1O94A 2OO3A 3WIDA 2DSNA 2KM1A 1QX4A 2QORA 3K9CA 2WE7A 5AKHA 3S2ZA 1QIEA 1UEXC 5FUWA 3TR5A 4XWAA 5BMOA 4MQEA 3HXTA 4EJ0A 4PSVA 1O77A 2HA5A 2XV1A 2H11A 3D6TB 2A8YA 2BZSA 1L8XA 1M67A 2VF4X 4LN1A 1NURA 2O0HA 3KKQA 5AD1A 1X7HA 1RLOA 5IVDA 4XWKA 1QK4A 1RYEA 1YU9A 4QOFA 4BE4A 4ZRMA 3CJRA 1N6OA 1G4UR 2QXTA 3PGXA 1TT7A 3R0VA 1NW9B 3LHFA 4MV5A 3V9PA 3OJLA 5I5EA 4HF7A 5LN1A 3KL2A 4BFLA 4F6RB 2PGAA 1WU8A 3DOFA 1HTWA 4S0ZA 3VKVA 4ZTZB 3N70A 5EXTA 3M5DA 2O8FA 3ILXA 1NXOA 2FP3A 1QHIA 4MW4A 1SXGA 1YULA 2R1TA 1CYDA 4TYWA 1A96A 5GGYA 3ZXXA 1W0CA 5KDDA 5IJ9A 4PFJA 1EHYA 3S99A 4U7DA 2QYHA 3BIFA 3K5IA 1XMIA 1AU9A 1CR0A 1D0IA 4D0GA 3P2EA 4OMCA 3GLIA 4AY3A 4UBNA 3WLJA 3A1CA 3D8NA 1GPH1 4DARA 4FUTA 3ZZ0A 4DLZA 3TSWA 3KVNA 2WHEA 4HX5A 4YRJA 3OZVA 4YUWA 4DBLC 1II0A 3MGGA 1WNFA 4BGDA 4O1HA 5BQXA 3WE7A 2LTAA 1ZJZA 1FMLA 3WIOA 5I7AA 4LGMA 1V8FA 1XQVA 2AG5A 1HT1E 1HWYA 1U2DA 2CL5A 3I01M 2AEJA 4L15A 3CISA 5ELMA 3UHAA 1NQWA 1Q84A 1XZJA 4DIMA 2H1IA 5B6PA 1X14A 1Q95A 1GVNB 4BV8A 2PLAA 2VP6A 2ZYGA 3IAEA 1LLQA 2AV6A 3HKDA 3KR1A 4CBVA 1PS8A 3VHXB 2OXFA 4D6XA 4XWWA 1GV1A 5HM6A 5JS1A 2V0NA 1ZN7A 2NXWA 4BLTA 2J0EA 2O0LA 1FYWA 1SMKA 1VE9A 4FCTA 3OHMA 1E6UA 1L7OA 2R1TB 5B1SA 4BUCA 4J29A 1BMFD 1E0KA 3D7RA 4EF5A 5IJ9B 3BBLA 1T26A 1RWWA 5L3ZA 1RAAA 4Z7NB 5H02A 4LHEA 2X15A 4NMHA 1WSBA 1MT3A 3K0EA 5A4MS 1NBHA 5KJFA 1YJCA 1JQJC 4HZIA 4CL2A 2I34A 1NJ5A 4MB6A 1KQGA 1C81A 1OIXA 4MUAA 1E2BA 1VLQA 2EATA 1D0SA 4RXTA 2WWVD 2CWWA 4GKVA 4ONEA 3PC3A 3SAJA 2AOUA 3GWGA 4DA6A 3RSOA 1YRWA 3ET5A 1W8IA 3OF3A 4EB0A 4AY4A 5BV1A 2FFJA 1NPDA 1JILA 3GC6A 3MFQA 4PPYA 2G3YA 3WDLA 2JD2A 4C0JA 1IVSA 1L8AA 4DKJA 1OROA 3DTNA 2VZ9A 3KS9A 3AUFA 1X1QA 1GNLA 4HQFA 1FP2A 4PG8A 1YJAA 5J59A 2P5UA 3WLNA 4B5KA 2UZ4A 4FKBA 5AQEA 5BQ5A 3CIOA 1LK5A 2Q9UA 3AY3A 1NM5C 3B6MA 1D4FA 3LL7A 3PC4A 2WHRA 4LHWA 4RF5A 4ER0A 3D5EA 4EY3A 3ELUA 3GJ3A 2O7VA 4LZPA 3NASA 2RHGB 3SQOA 4D92A 3DFIA 4QPPA 4N7RA 1NGSA 1TLFA 1VA4A 2XZDA 1IJKA 3T95A 1WVMA 5IC5A 3WY9A 3O6VA 5IYZA 1S01A 2CXNA 3JAWA 4K88A 3OD1A 2B3TA 1K7YA 3HJUA 1EINA 1MHPA 2OC4A 2VNIA 2W6OA 3N8NA 2OA0A 4UPEA 3P2MA 4F3NA 2B8WA 3DHNA 1ESEA 4ND6A 4TMXA 1O5TA 1EGHA 1Q0ZA 1MX9A 2P4HX 1IQUA 4NY1A 4N47A 3ZDXB 1P31A 1L5VA 2H17A 1THZA 1B3BA 3I0MA 4G4SO 3T5GA 2WAOA 1NRWA 2F00A 4JBXA 4KC0A 3PSAA 5FQOA 4LMRA 5SYMA 1UJ5A 2W4QA 1L3BA 5HF5A 1N4AA 4GD3Q 4PE5B 5KTSA 3CCFA 1XTRA 2SHKA 3OP4A 2IF2A 5IRCD 1RXSA 2MYPA 3NHUA 1ODTC 1LJ8A 3RVMA 2WQZA 5F5LA 4LFAB 4N5IX 3PKZA 3ZW7A 3RJTA 2Q4DA 2RFLA 2XCSB 4RLSA 3JQ9C 3JQ8B 1GTZA 4PPQA 5IYZB 1DDGA 1BWPA 2CGEA 3JAWB 4ZD6A 4KN5A 4D9MA 2DHRA 1IY9A 2PUTA 3B2EA 2QTBA 2GETA 1KSHA 3H2KA 1RRMA 4GXQA 2EHDA 2FRDC 4F3CA 5AXCA 4ZT2A 5CNJA 5JW6A 1B3RA 5FLXA 1KZ9A 4XQCA 3Q4GA 4WXPA 3RF7A 2OV2A 3L8FA 4EL0A 1BN6A 1IEQA 3QFTA 3K05A 5AKJA 4HH0A 4AJ1A 3AW9A 1M83A 1ODKA 5TGZA 5CVDA 3OY7A 1SQSA 1KMNA 4KUGA 4PICA 2I8CA 4CEHA 1Z2OX 2UZIR 2IVFA 1CWUA 2VYQA 4EGJA 3PQ2A 3P9RA 4UD2A 5IP5A 3ZDAA 1XYVA 3WLFA 1OZFA 2CYAA 4DREA 1NULA 1AMUA 1RQRA 1W59A 4QOEA 4MRPA 3O21A 4OGKA 3WKAA 3ZWXA 3RB8A 1IOLA 2LV8A 1T4BA 3D6UA 3C5EA 3SQNA 2R44A 5EHQA 4C4YA 4CMEC 1Z17A 5FBKA 4F96A 5FYDA 1EBFA 3N9IA 2NXEA 3F6BX 3R3SA 2A9JA 3I04M 1XQ6A 2DBVO 4KXVA 1XTSA 1HK7A 2GD0A 2OQRA 2XW6A 4BVKA 2D0DA 2ZRGA 2IITA 3CUVA 2HSGA 4HDCA 1KO7A 2IBMA 2K7ZA 4ZOLA 5AJUA 5E6UA 3STUA 4E7PA 2RKBA 3NBYC 5FI1B 3W7AA 4F91B 5DIZA 1JT9A 1JHUA 4NYJR 3ZBPA 3KB1A 1UOEA 3CRNA 4LOHA 2OG2A 3GXBA 2GTIA 4Q1VA 4H1WA 4OQ4A 5GONF 5DHPA 2WTXA 4R8MA 4Z3OA 1L3CA 2HTEA 2Y0DA 1RRKA 2ZBQA 3HV0A 4WOPA 3RHSA 4CEHB 1U0TA 1E4YA 3DL0A 3T3DA 1QM5A 2RHLA 2IU6A 3I9OA 3ZEIA 1JJIA 3F0TA 3QUBA 4XUCA 5IM4F 2D8AA 2VK1A 2HLDD 5B58C 2ODQA 3L6RA 1ID8A 3RIGA 1U3VA 2G6BA 2H0RA 2ZPTX 5IC6A 1AKMA 4QGBA 1SFRA 2BRUA 2AJTA 5EY5B 3WISA 3A6PC 3LI2A 3UCFA 1DRJA 2PUBA 4EFLA 3KQNA 3WBBA 1POWA 1KJYA 1XXHE 4ZVMA 2NV6A 3RK4A 1JKXA 1IIRA 2VRCD 1NMXA 2X6QA 3QJGA 4GKBA 1FBNA 4ZOLB 1S3SA 3WMWA 2I9KA 4KYUA 5E6UB 2FQQA 3N0WA 1DEXA 3OFND 4HB4A 3GT4A 1ZRMA 3DT8A 1QO0A 1XVTA 2RC5A 3VAAA 5FO0A 4K6OA 1YZFA 4RH0A 1XRQA 4KO3S 2WBLC 3QU4A 4COOA 4KYIB 1XTJA 3GT3A 3OQHA 2WYWA 1CJTC 2JH3A 4S1OA 4PZDA 1U3UA 4H4DA 2HO5A 2QR3A 1VB3A 3WNCA 2FW6A 1L4NA 4FYJA 4N6GA 3RWMB 3CC8A 5BWOA 4A0HA 2I6SA 1XRJA 2GPWA 5KINB 1WVIA 3P8ZA 2XMZA 4K8OA 1IYZA 1YHNA 2BFFB 4YHBA 1T5TA 2CDRA 3PQEA 2KYRA 4IDFA 4LHZA 4NLLA 3TD6A 1BHSA 4L4ZA 4OP3A 1A8PA 2PSDA 1S9HA 2QN8A 3LQKA 4E4YA 2DX7A 3NJ4A 3DEHA 1E99A 1YR3A 1KKMA 1WV1A 1ZGZA 2A92A 3ASYA 4OYYA 5F2EA 5LFAA 5CD1A 1KK3A 4PHGA 5IH3A 1UUFA 1QGYA 4WLVA 2DGDA 2DWOA 3PQ8A 3E3OA 1T9ZA 2GYUA 1SBHA 2G25A 3BN3A 4U02A 3OC0A 4TMZA 3ACBA 2HL6A 3U16A 1X7YB 5ADVA 2CVFA 1UJCA 1IJEA 1XUOA 1V47A 2X8AA 4V02A 1A9YA 2G71A 5BVHB 2O3UA 4BO8A 2KMLA 1Z4PX 4O8ZA 1FVOA 4BVFA 3KPYA 4CZ2A 2C2HA 4IDBA 1MABA 3P71T 5K8JB 4UCFA 3MRXA 4ESHA 1FTNA 1ITZA 5LDGA 3WKCA 3ADBA 4AJKA 2CY0A 4CJXA 2FW1A 3N7TA 4ISBA 1Q1QA 1LFAA 2Q1XA 3LCRA 4LOJA 1ILEA 2ZRDA 3TFQA 3AJRA 1ISJA 3OBBA 1RMTA 5BNTA 2CLEB 1WDKA 2QUKA 1GEEA 1RI3A 3I6ZA 5AI0A 2PT6A 2PGDA 5FI0B 1W34A 3KQKA 2CNNA 5JMPA 3RLFA 4I5IA 3KB6A 1T2EA 4GP7A 3ICQB 2R6DA 1AC5A 3N2KB 2G4CA 4ZVOA 1C4WA 4CU2A 2Q4TA 3FPBA 4RKWA 1U8CB 4M88A 2F90A 3B70A 3NEJA 4K6FA 1URPA 3G68A 3TZLA 1IG0A 7GPBA 2GZDA 5I9NA 2HA2A 1A3CA 3JX9A 4OB6A 1W4ZA 2YUTA 1AIPA 4QUEA 2Q99A 1IY2A 2LIVA 2QHXA 4FYVA 2C31A 5A71A 3ZJ4A 1MEEA 1R74A 1Y7TA 3JR3A 4I08A 4EKDA 2IDKA 3QJYA 4RPLA 1MABB 1KXZA 3EIFA 2YOGA 5SICE 3PXXA 2XA1A 4WZBB 5E1OA 4NHOA 1VKNA 1HTBA 1ODSA 1ONBA 5DYNA 4OJQA 3HXOA 2K6GA 1KDZA 1FA9A 1X1BA 3GFFA 1KO4A 2HDOA 2QJWA 1XTQA 3H1GA 5A05A 3CUYA 2JHAA 2BR5A 1WB6A 1C5KA 4RYLA 4XEUA 3R4VA 2G07A 3OIUA 1FYFA 3QM1A 3ZV6A 4I50A 3HA2A 5K0JA 3G59A 1PJLA 5EUCA 3MTDA 3BK7A 4D6YA 1L5WA 4L5BA 1NVAA 1PNVA 4K2AA 1NF2A 1N3IA 3ZLUA 3SE7A 1I36A 4Y0AA 4YDHB 4BWGA 4AQYB 4QTYA 4GT1A 3RRYA 4F1WA 4EVSA 4CMCA 3SZOA 4FB4A 4HDSB 4LWOA 2ORWA 1XN1A 2GDZA 2FZ4A 2R6GA 2ROQA 5FOVA 3T1NA 4EABA 1FVXA 1T1IA 1VYTA 1CXZA 1DG1G 4Q05A 4IDQA 2D2EA 3AVYA 3PHHA 3L7MA 3DO5A 3CZAA 4JGIA 1SG9A 1CEXA 1N8TA 1T0PA 1DV1A 3A1FA 3LXUX 4KN9S 3RVNA 1JE0A 3MT0A 2V9CA 1TAGA 3MD0A 4L9AA 1V5GA 3NRBA 4XUDA 4B7ZA 2WVGA 3N6RA 3HY4A 3ZHZA 4TUYF 1K08A 3B1ZA 4MVJA 5AYVA 3PENA 5EWMB 1M8JA 4WOBA 5IAKA 2CVZA 3NBMA 2R4QA 2ZFUA 1TZCA 2B4RO 1ZNQO 1JNYA 3UWSA 3LXMA 4I9GA 4CEJA 3CY6A 2DT5A 1JG3A 3FCXA 3Q15C 3CPEA 3QKTA 4I3HA 2JK0A 3K5HA 2RJ3A 1NM5A 3URKA 5K5EA 2XKJE 4ACAA 4H3KB 1GJRA 1DLIA 3AHDA 2GFIA 4F2HA 1KMQA 2X5KO 1H1TA 4JP5A 4RVOA 1M72A 2QI9F 2Y9PB 3AFGA 4IDOA 4INPA 2G7ZA 1LPBB 3S6JA 4BLSA 2CCKA 3QSYA 3CH6A 1TQHA 4YJ3B 3LVQE 4O33A 1TJNA 4CL3A 2LXNA 4D81A 3DT9A 3THWA 3F3MA 4E6EA 1PSWA 4GYKA 1O97C 3LC2O 2VUHB 3PYMA 4KYTA 3VH3A 6REQA 1XSEA 2NMVA 1H8ED 2JJ2A 1F38A 1FMFA 3QE9Y 2V7VA 1TFUA 2I6TA 3EISA 4C05A 4KREA 5JNSA 1ZM7A 2J09A 2VBCA 1CW2B 4BKPA 4F93B 1RKQA 5JU6A 2FOIA 4PC7A 2HQOA 2UYQA 4QU9A 5JQGB 1G42A 1WP9A 3JWIA 3V48A 1PYDA 3CV3A 2QQEA 4CEJB 2FW7A 4M8LA 4UVHA 3X1KA 2FPXA 5A1JA 1HYHA 4RIGA 3VZSA 1UINA 1IM8A 1KPHA 1C9JA 1SKYB 2A0XA 1AMNA 4LY9A 4QYTA 2H9YA 3PJFA 3UUFA 1I32A 3T1HB 2YWDA 3E82A 4G0XA 1WZNA 2BGRA 3ZWKA 4DMLA 5IC4A 5LNK1 3D2LA 2PZFA 1F17A 3FR7A 1A5ZA 1MZVA 4MUMA 4FONA 5BMVF 3DNFA 5KYWA 2QTGA 5KQSA 3SJAA 1I3KA 5FPTA 4QPNA 2VPPA 4U2KA 4DRZA 3RS7A 2RGGA 3U62A 1ZY2A 4J2HA 1Z2DA 3A0RB 3VV2A 2XCRB 2JIZD 2EU8A 2I4OA 1IY1A 3DE0X 4OPMA 2ZYRA 1U2QA 3FDFA 4NV1A 1EVJA 1W35A 1FB5A 1EM8B 1IAQA 2C2MA 4HC4A 4NR0A 4OGGA 4RY9A 4Y98A 4PCUA 3VYWA 4BLUA 4HNRA 2WF6A 3HCEA 1JMKC 3KG2A 4IHAA 2O8CA 2F67A 4ETNA 3RYFA 1OI4A 5JXWA 1NRIA 3BFVA 3FZGA 3QPUA 1OXMA 5DRTA 1T35A 1XL0A 2MOKA 2ZYIA 3FFTA 2J3KA 2Z5FA 1BXRA 4EMTA 4DMCA 5FV7A 2R9VA 4TWIA 1REQA 4TKVB 3EVTA 1TA0A 1P9NA 1E0DA 3G0CA 4CMEA 5IK2D 4MLZA 1FK8A 2H7VA 2ZU6A 5BR8B 4FFLA 2RD2A 4J4BA 1O03A 3OQBA 1DJPA 4ZI7A 1I5RA 3MEQA 5KYWB 3R3HA 3KYBA 2QGFA 2WFZA 2EP8A 4UDOA 4ZEMA 5FBVB 3IQZA 1DKLA 2HU7A 3DF7A 1FXWF 1KI2A 2AZXA 3CLSC 1QQBA 3QV2A 1C9DB 4PQRA 1GCGA 4RD4A 2A5GA 3FYUC 3FCSB 4QNRA 1DC4A 3QOWA 3TYXA 1UMCB 3ENVA 5G0TA 1RE0A 2IGBA 2QXUA 2XCUA 1WOMA 2VK8A 2ZUSA 5K51A 4CL0A 3UJ8A 4P7GA 2EFDB 1U99A 4QO8A 1WKBA 3FMVA 4EPYA 4B3FX 2GZSA 3KUUA 5A4AA 2AJ8A 1BXRB 1QF9A 3FWPA 1P6QA 4L4SA 3N39C 1HO3A 3SLRA 1REQB 3CLTC 2H2HA 4BS9A 3DHYA 3EMVA 3PT5A 5FNVA 2A3RA 4DR7B 4C0LA 4JY7A 2P3LA 2J3HA 3WL7A 5DN6D 4YAGA 5IVPA 1D9ZA 4QREA 2OLKA 3CB2A 5LB2A 1NLYA 4ESEA 1OVMA 2WU1A 3K9BA 4UM7A 2PUCA 4I55B 1XMQB 1Y7IA 2C5GA 2R11A 3EDRA 1JHQA 4Z99A 2Z0MA 2Y05A 5AVJA 4EI2A 1DAFA 1VKRA 1Z4NA 1U4SA 3PQ6A 1P5RA 4F1KA 4DR1B 2W4IA 4WLEA 2DXIA 2XUFA 1QYXA 3IUJA 4NOKA 4KKVA 1XD8A 2BGLA 3OC6A 3Q11A 4OXRA 5ALUA 3UMJA 3W2FA 3E2IA 4PZ0A 2B83A 5K3FA 2FF7A 3MSXA 2WJHA 3S55A 1B6RA 2XNSA 3DMNA 3E3NA 3KUCA 3AVWA 4C9BA 5LMCA 3P0JA 3RPEA 1MAVA 2O1EA 3TKYA 3I2GA 2BSXA 4B81A 3ZWWA 5FNVB 4U63A 1J2EA 3KPWA 2YC4C 5E3IA 3ZHBA 3BT7A 5GM2A 3WWCA 1QHYA 4C22A 1V6AA 4Z0PA 2VP9A 1EJ2A 1H23A 4JLSA 1E7SA 1E4EB 2ONCA 4PXAA 1N2EA 2IEZA 3LVRE 1YQEA 5BSVA 3B1YA 2F8SA 3N2EA 4Z5XA 1OE0A 3GF4A 4EKYA 5A9RA 1TMOA 2NOAA 3GNQA 4L5CA 5ALMA 4C3VA 1P4JA 4C6RA 5B2FA 5CCEA 2Q07A 3WIBA 3VSDA 1X3SA 1MB4A 1R00A 2X0JA 3KQOA 4KDCA 2G70A 4M7WA 1FUIA 3UH1A 4KLCA 3PXGA 3W4IA 4JJ4A 3X1JA 2XADA 1NI4B 5FWYA 2G09A 1JBEA 2PS9A 3IUSA 3ZS8A 4AJOA 2CNKA 2P9CA 4YCLA 3GCXA 4X54A 4JP8A 2IZ5A 1USGA 3B78A 1IVYA 4R9RA 3CUSA 4M1KA 4H1UA 5CA1A 3DM9B 4GI1A 4JEIA 4QVGA 3CLRD 2Q3EA 1O3YA 1YB6A 4NZMA 4CMAA 1H2WA 5L3RA 1L4BA 1C7JA 3I83A 1SCNE 3R75A 5EGNA 3AUXA 2UXDB 4GM4A 1T5OA 1F8GA 4NXMB 2ZTSA 1MMFB 1ZW1A 5CT9A 5DHUA 5E95A 1JI3A 3O4GA 3IPAA 3V4SA 2QAJA 3NIDB 4EYSA 3C6XA 4FZ5A 1Q44A 2H07A 3BCRA 4DLUA 2AN3A 2IGTA 2V8BA 3OWOA 4LDQA 1LSUA 1F2VA 1W9HA 2IP4A 2VQ3A 2XXBA 1LNSA 2OB2A 3DFKA 4U7PB 5GV7A 3KDAA 4AXBA 1QR2A 2HRCA 4HWTA 3ZHTA 2XF8A 4NFSA 1D2GA 3BJZA 3T5TA 5AVOA 2AN9A 1BH2A 3F8WA 1KMCA 1U5BB 1Z0JA 2WWFA 3D2AA 4EW3A 5KX5F 4UZEA 5C35A 4RK5A 1E20A 1JZQA 5U1PA 4M0MA 3KHSA 3W5AA 1EVQA 1FXSA 3CZPA 5IJAA 2C3OA 3F2IA 1IH8A 4GVPA 5DT2A 1Y9EA 1AQJA 3MBIA 4UBOA 3G9ZA 4JT4A 1NYRA 3K72B 2PPVA 3OQIA 4GW3A 1M33A 4JU9A 1VG8A 1WUJS 2YXBA 1B7GO 2D1TA 1BGXT 1FMCA 3DO8A 2JLYA 3K70D 3G2HA 4ZCQA 2QWXA 4FN5A 4X1KB 1KOJA 2PD3A 1YJ5A 2XAUA 3AL2A 5HIJA 3YASA 3DV2A 3T4PA 1EAYA 1L4HA 3TNJA 2GXSA 4X7RA 4WSOA 1YKFA 1LLUA 5BSHA 1SO8A 5EJ7A 3DLTA 4WOCA 1U0RA 3S1AA 2ZUTA 4M1TA 5IKOA 1V7QA 4LXQA 4I1PA 3ETDA 4JL6A 4P0TA 1W0JD 3B7PA 3BIOA 4D9CA 1CUWA 3USCS 4A23A 3C3EA 5M34A 1MW8X 2GJAA 3D0QA 4OQZA 1QU2A 1JKFA 3H5NA 3ODGA 1PJ3A 2JVJA 2AI2A 2X23A 2O5RA 2B7BA 2A1TS 3QIAA 3VTZA 2RK3A 2HSJA 1KERA 3BD8A 3DOOA 4PZYA 1JHAA 4LJ7A 2G5GX 2R00C 1FSGA 5B7NA 5AW4A 5DYWA 2VWHA 3D8RA 4FGZA 2VJKA 1FL9A 4PGMA 3E7PA 4B73A 4L8YA 5GP1A 1PTKA 3GU3A 1EP1B 4GZLA 2GLXA 2P5YA 5KJ1A 1J22A 4KLAA 5B1EA 2QVBA 1ZCBA 3EWAA 4RBNA 4NWIA 1XQWA 3N58A 2YWEA 4GPTA 3WAKA 2UKDA 3P9KA 4JB8A 4BRZA 2JBAB 4A8JC 5A2GA 1TQDA 1AV7A 1SH7A 2H9AA 2IHJA 3F6YA 4CU5A 4DGSA 2WTBA 2BGJA 2VSYA 4LRTB 3ZGNA 4H35A 3ZG6A 3CKMA 4K2HA 4AZ0A 4DSZA 3KOOA 5C2JB 5CLJA 4WY8A 2IZ7A 2IXBA 1N7JA 2P7IA 3QBVA 1J90A 2A5LA 3FNBA 4AF8A 3FHCB 1I7QB 1XEFA 2OM2A 3RYHA 1PFUA 3K7EA 4W1QA 5FQNA 5G0WA 1PI3A 2O5EA 3VZPA 2YJGA 3S2SA 1RAIA 4LS3A 4CM3A 2AMLA 3HO8A 2ZIAA 3BWXA 5FDFA 2JFZA 6YASA 1N9KA 2XCIA 3SS8A 3WHLA 5K09A 2BBOA 2QJOA 3FHOA 3BD6A 2HEGA 3LIPA 2QSJA 4URFA 4EM6A 1DP4A 3EY9A 1AMOA 1R27A 1JVBA 1KR5A 4HXEB 1YOBA 2QMZA 2OLEA 4UARA 2Q6IA 3QPDA 2QLJA 4UU8A 5DHRA 5E1MA 3IQHX 4EUHA 5A4FS 2J3QA 4U2DA 3D6JA 4BNHA 1TVMA 2I7VA 5IG2A 5CGQB 4V0RA 3W5IA 2VEDA 5CVTA 3IOMA 3IL2A 4B0OA 4FEGA 4BVAA 4U5XA 2FB9A 2RHOA 4KQ2A 4Y7DA 3KTDA 2ZOSA 4CTOA 4AJIA 1GQSA 3P52A 3UC9A 4GSLA 1Y6ZA 4BATA 3B52X 5FEUA 4Y2TA 2J4FA 2Y1EA 3Q8XB 3QG5A 3I28A 1J8MF 1UC9A 1M1YB 2YVLA 3QW2A 3G2NA 1P29A 4Q02A 5B1YA 3PX7A 4KQKA 4X8OA 4S1VA 1YFKA 3WDMA 4JVSB 4B4UA 5BRAA 2IVZA 3W6OA 4EMSA 3MGBA 1DC5A 3RFXA 4CKBB 5JCJD 4DV0B 2Q3HA 4DC9A 5KAPA 3ENKA 3U61B 1O6CA 3F6CA 3U31A 3G2LA 1O6ZA 1Y1PA 4N9QA 2R48A 4KQWA 4M89A 5E4JA 4ZVPA 4CCYA 1GNTA 2A1TR 2VBFA 2HYDA 2X8JA 2ZYHA 1KZYC 3NM4A 3OX2A 4NBNA 5KU7A 1XXHA 1VBKA 2QLMA 2FPWA 4MWEA 2IV7A 3SKXA 1Y1KE 3TIFA 1MAAA 1DBWA 1I4TD 4Y30A 3W9YA 2I2WA 4JDPA 5H3LA 4CF4A 5AW7A 3ZXUB 1Y4DE 3WGQA 2W43A 2EXXA 4FLFA 3BL5A 4IDGA 1ODFA 3EQ8A 3M2TA 1DI0A 4Q34A 5L3SB 3PGKA 1I13A 1XRMA 3HKEA 4R98A 3Q2OA 4IILA 1C1YA 4Z8YA 3WOHA 4KACA 5ES4B 1ZRSA 1XYYA 2FF5A 1YOVA 2AZDA 2ZWVA 1N0IA 1S5PA 4C4SA 1A5TA 3FTCA 4P7BA 2AW5A 4D4KA 2GHQA 2WJIA 4ZPJA 1P3JA 2GR9A 3OUZA 3TW8A 3UV6A 3UTDA 3U3OA 1U7ZA 2Q1TA 4ZAVA 2UVQA 4HT3B 1DDOA 2HCRA 2Z8YA 3SFTA 1XLUA 1YZNA 3W3AD 1X94A 2CNBA 3D9QX 3LFUA 3DBOB 2WG0A 1J97A 4RW0A 4CCYB 3GV0A 1OX4B 3NWPA 3ZH2A 1CUFA 5ISMA 5KWEA 5FUVA 4BO2A 1VMIA 4KR0A 3U9LA 2QTFA 3W7VA 1KP9A 2A4MA 5LMZA 1GHTA 4JL5A 5EFOA 1CRQA 1HG1A 1QFSA 2PGXA 2GERA 2X2PA 3E1GA 5E4FA 2H57A 5ECGC 1ULBA 1Z4KA 2V7TA 3OIFA 1RXEA 3FTPA 5C7YA 2X2EA 1GWNA 4JBNA 1D0VA 2HNBA 4LK3A 3K6JA 4BFYA 4OF4A 3KYDA 2EW8A 1VJCA 4FFRA 1I0IA 1FE8A 3I5XA 1ZEMA 3FFAA 4IRMA 4LZLA 1C0PA 2Z98A 2XX3A 5AK4A 2K5UA 2PDAA 1AHIA 1UJBA 3DFZA 5F52A 3FYUB 1EAMA 1KO8A 1R6XA 2UAGA 2BFWA 3WR5A 4K46A 1T3ZA 4XPIA 1IUNA 3AONB 3L8DA 5I7SA 4K8RB 1RLUA 1R8QA 1T3LA 1XA3A 2F1KA 2UVDA 2XTNA 1T0IA 3CIFA 3EGDB 3H5VA 1UM9A 3IEUA 3PWSA 5F3RA 3I76A 3SE0A 1XZCA 3W5VA 2P8JA 3E18A 5CYOA 5F1PA 3NTOA 2WJ3A 1QH1A 3JZDA 3STVA 5IF9A 4TOIA 1J25A 2OBBA 4M8IA 5AXAA 2OHXA 1MD9A 4D7AA 3Q0IA 2POCA 1W44A 2VPZA 4TV9B 1LQUA 1JVNA 5CIWA 3L07A 3TZBA 4YRPA 1Y7HA 1E3WB 1WU7A 1NYQA 2E3JA 3C74A 4Q3EA 1ZSNA 4MS4A 5CLLA 3ZCXA 2IH4A 1JR6A 3KJHA 1T2FA 4LMPA 5BYJA 5TQ0A 4UTPA 2RONA 1QG0A 4UQOA 2WUWE 4CMIB 2VJDA 4NBWA 5TQ2A 3U7RA 2YW9A 5HXAA 1O0CA 1T2CA 5FV4A 1M8GA 1SC9A 3UZUA 3AKZA 3DZCA 5KNCD 2W42A 4MKHA 4B4WA 4XPIB 1QDEA 3OOYA 1NOKA 1DIBA 1XRLA 4MWOA 5FLYA 1I30A 3ICEA 3V2HA 3ZTYA 1XD9A 2VCYA 2QX6A 3CF4A 4M46A 4Y1FA 3GLTA 5I9SA 3VR3A 4CFYA 3JW8A 4YRSA 5KNCH 4CQMA 5BN3A 2Y1FA 3L02A 4XGNA 1K4YA 2ACEA 3VQTA 4D44A 1KOGA 2H7YA 2OXIA 5AW8A 2JLVA 2KX7A 1W87A 2RH8A 4ND1A 5CW2A 1TDJA 4C4XA 4IOKA 2B2NA 3GVHA 4GC9A 4HNSA 3INGA 1IM5A 2IIVA 1W52X 1HA3A 5JAZA 2GN9A 1IQ0A 1AKYA 1IBRA 1O96A 4JP2A 1IXYA 1EX7A 3LLVA 4X85A 2ZUUA 4Y2PA 5D3MB 1CETA 3L92A 2V1XA 3VVCA 3KETA 2Q9AA 2PD4A 3SEAA 1EX9A 2AGVA 2WRZA 4RF4A 1N9GA 4WEOA 3MUOA 1QIIA 1YS2X 2OXTA 3T7CA 1PWEA 2DY0A 5JVDA 2VTEA 3AM5A 3QNMA 3EF3A 4QUGA 1KEUA 1VFPA 2QRLA 4DWJA 1GQYA 1QV9A 1Y5IA 4Q1EA 4YH1A 3EZGA 5DZSA 2NP7A 3WDSA 5GAJA 4BOYA 1EFAA 2I66A 5SZHB 4CQMB 1A9OA 3IAS1 3N53A 3DDWA 4PS0A 2ZCJA 3KXKA 2G4LA 4PSAA 1ANKA 5JAIA 1K7XB 1ZU4A 3L7BA 5C4GB 5EIOA 1HMPA 3THXA 3O3OB 3FOCA 4LBYA 2ZXFA 3QPCA 1WETA 2Q4OA 4NI5A 1FP7A 2FW9A 1PNOA 3TL2A 4J3FA 2FZ5A 4IIJA 2ZM6B 1KKLA 2IDZA 1ZBQA 2CYCA 5L9AA 5FXMA 3RSLA 4A9AA 3IAM6 1R16A 2XOXA 1SK9A 5THKA 5KOJA 2HDHA 1H2AS 5BNFA 2J6CA 1P62B 2O14A 1IOVA 2BR3A 5IN5A 2ZJ8A 1YB4A 3CNOA 4EO4A 3M5CA 3ZD9A 5ALRA 5ADWA 5ERGB 5TPWB 2F1RA 1II9A 3N76A 4KPUB 2EQBA 5IUNC 5TV2A 2P2DA 1YV9A 2DFPA 3FMFA 1NVBA 1GA6A 3I8XA 2LBPA 2HBQA 4NULA 5D2CA 3RC1A 5IT5A 1FDOA 3UGKA 3O9ZA 4AYWA 5HKKA 1TIKA 1RW4A 2DPHA 2G83A 4OHVA 3H1PA 1A8HA 4L0QA 3CPSA 3DZHA 3Q5GA 4IWYA 5B58T 3WGTA 3WGUA 3JWJA 3OEWA 3V00A 4CT5A 4A0RA 2Q2QA 3VOBA 3H11B 2CFTA 3BWYA 3EGEA 3ZXIA 4IIJB 1B4DA 2G0NA 2X7JA 3W5HA 5JSFA 2UUCB 3QKRA 3GAFA 4Q3DA 5CAEA 4A8JA 2C9OA 1T5SA 3DEFA 1S7GA 1E18A 4DRYA 4DWWA 3VO8A 5KOJB 1E66A 4YMWA 2BBSA 1F12A 3ZE6A 2Z83A 1O8CA 1DQPA 4CM5A 1YZQA 3R3ZA 4UBMA 2FUCA 1IN6A 3M6LA 3ZCQA 3C5WP 4DRXB 3ND8A 3NPMA 1J5PA 3GEPA 3PK0A 2EFCB 1O9GA 4QQ8A 1N8SA 4JR2A 1L5SA 3ELBA 1WA5A 5BORA 1YFZA 1QF6A 3DAFA 1H3EA 1CZNA 2F64A 2HF8A 4YT8A 3WOVA 4NYMQ 1O8BA 1R4NB 3M49A 4OFWA 3V33A 4D41A 5JD4A 1CR4A 2C7VA 3LU1A 3WMGA 4MITA 3HVIA 3R6WA 4D8YA 4OD0A 3MYYA 4FJ0A 5A3RA 3EGWA 1DG3A 2HMWA 2XUOA 2DPYA 4TTSA 3S7ZA 4F46A 2YKGA 3GD7A 2GTPA 5FP0A 2CVOA 2C5EA 4HD8A 1X3LA 4WK2B 5K0EA 3QKRB 5K6AA 2A3NA 2VAVA 1G5QA 1T2VA 2I65A 2J7PA 4N0MA 4A8JB 4AY5A 3D1JA 4WKOA 4UHEA 4PYMA 3RT9A 3IS3A 4TZTA 1IULA 3QVMA 3A2KA 4J91A 1LDYA 2YC2C 1HT0A 2F3QA 4D0NA 4GXNA 1YDFA 2MYNA 1RWOA 1JKJB 4PFQA 2IE0A 1CUZA 1NE7A 5TARA 4B9AA 5KQLA 1YZUA 1ZK2A 3IOEA 4Q7KA 2EFGA 1Z75A 1A7UA 1OD6A 4ZCSA 5SZIA 4AYTA 3ZV3A 4X60A 5JJBA 1C8KA 2OWEA 4KRFA 4GI7A 4PSDA 1PWHA 4NC9A 3G0OA 2C2XA 4C0WA 3C70A 1NW4A 1XVLA 4M0UA 4WD3A 3SKYA 4D43A 4JOCA 2GCOB 4EJSC 2CF5A 2ALJA 4Z1MD 4R9SA 5ERYA 1A50B 1XZEA 4MTCA 1W25A 1JFLA 2V7QA 4RUKA 1HQYE 4OEHA 3ESXA 5HKBA 3WQRA 4UAVA 1QH8A 2MSCB 2ZAGA 3AJAA 4NYIR 4YMTA 1L4KA 2PRJA 8ADHA 3E7FA 1EFHA 4MPDA 4QFBA 4BFXA 5HRCA 4G07A 3BSWA 4IRXA 1TM7E 4POOA 1ZCJA 2CHQA 1JG4A 3E7WA 2IK8A 2ZAYA 3LBYA 3AWIA 1RJEA 2VQDA 3UW3A 1FNCA 2ESRA 3V55A 2CSUA 2F55A 2H2DA 2WW8A 3LCJA 2NAFA 2A5YB 5ENVA 4DMUB 1EXVA 1EA5A 4Q9HA 1CIVA 3A25A 3U3RA 3QLVC 1SUEA 2XRMA 3N86A 2OFXA 5FJJA 3RAEC 3QIVA 2VHTA 4RETA 2NU8B 2GAAA 2QQFA 3KP1A 1X19A 1ZVJA 5LQSA 2FPGA 1TQ2A 1NV9A 3ME5A 2YNMA 3IDZA 3UICA 1RRPA 1JIUA 1ZD5A 4BTEA 1D6SA 2GPSA 1SIOA 2GH1A 2OAQ1 4JBIA 4CPDA 4HTFB 4JNKA 1OXXK 2FMKA 2GPAA 2ZRQA 3D81A 4FHCA 4S05A 4FMDB 3P27A 2QTNA 4LPKA 3L43A 2ZI5A 5HOQA 5IJ0A 3SDZA 2BHNA 1U3DA 1V1MA 3PI6A 4ZDWA 3KEGA 2DLNA 5ICGA 4R69A 3EG5A 4F8YA 2DTXA 1YJ8A 3LF2A 5DKFA 4XR9A 2RAFA 4TTPA 4DDHA 1XMOB 1G60A 3I9V6 3ANMA 1XD2A 2NSDA 3QF7A 4RPKA 4DBLE 3LSTA 1C9NA 3AF5A 1G7TA 1KHHA 4LW8A 1KVTA 3CRZA 4IXWA 4IIVA 4QM6A 3A28A 5LQAA 2BGNA 3CO0S 4FC6A 1Y7LA 1ZL2A 2O54A 2FPGB 4M9CA 4F4IA 3MS7A 3DLCA 4HVLA 2PAFA 2BLLA 3L6EA 4H7EA 1YE3A 3RT1A 1MC1A 1UT5A 2CL0X 4TXNA 3V42A 1XJWA 4QLOA 4MP8A 1I4EB 5JPCA 1UK7A 5K8TA 1NUSA 1MOSA 2I33A 2ILTA 4V03A 5IJ0B 2D74A 2ZSBA 3D5QA 3HDVA 5DCUA 3O2JA 4NAHA 1NLMA 4WGGA 1USWA 4EW6A 1TF7A 1CDZA 5DJ5A 1JEJA 3KZVA 4YMLA 1FS5A 3BTUA 3I1IA 5I51A 3Q7IA 2Y4OA 1XD2B 1BQEA 2FV8A 5G0VA 4B48A 3C39A 4UJ3A 4TLAA 2DFTA 3VH4A 5E2AA 1E69A 5CLFA 4IOMA 3EIQA 3ZLVA 3C6KA 4PGAA 4YWHA 4L7VA 5LDHA 1D07A 1A2BA 2D13A 1GLGA 3B6KA 3OE1A 4LNUA 3SXUA 4AN1A 1E64A 2E4WA 1DO8A 3A8TA 4DZZA 1Z37A 3FBWA 3O1LA 4HLNA 2BD0A 3SF8A 4G0WA 3KLBA 2DUWA 3DQPA 2Y0EA 1FFAA 1TM2A 2J48A 1Z5PA 1BS2A 1YCGA 4OP1A 3EXEA 4DIKA 1NQXA 2H6EA 3HPRA 3LT1A 2LGJA 1DB3A 2OD7A 4WLUA 5AKXA 2ZGVA 2I55A 3BWEA 1KGDA 1VCOA 5D7BA 1WXQA 3HGQA 4BNXA 2C58A 4US1R 1SBQA 1AN9A 3RUIA 5JRZA 1ZYUA 4P4GA 3P2YA 4XGKA 4IY1A 4KWHA 4JASB 5BNIA 3MIIA 3E2MA 2YIVX 1EFRD 1RBZA 3A3NA 4UTNA 4Z0NA 2NSYA 3JVIA 4RNCA 2IRWA 4R5HA 1T9GS 2QW1A 3U0BA 5T57A 1FRQA 4BP9A 2VN8A 3JYHA 3ZNOA 5FL7A 2G08A 1QBGA 4U39A 3SXUB 3OG9A 2R7LA 1YS9A 1LC3A 2XDWA 1YBFA 3AFNA 1Y3HA 3J80A 1T25A 2HLHA 2JDID 4DYDA 4JC5A 4GF5A 1WLYA 2AOXA 3DXZA 4GMDA 4BWYA 2NZ2A 3WNBA 2H4YA 4XI9A 1RXUA 2J9ZB 5DNDA 4FDVA 1EESA 3I37X 1W9MA 1X7GA 2O1XA 3AHIA 3DC7A 5ALJA 5JFGA 3AFIA 3GPBA 1C3JA 1UXIA 1Y82A 3C6MA