3DV2A

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from bacillus anthracis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
187
structure length
187
Chain Sequence
RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Structure of nicotinic acid mononucleotide adenylyltransferase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 49
structure length 187
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3dv2A00
3SZ3A 1V8FA 1H3FA 4RUKA 4DDHA 3P0HA 3FOCA 5K0TA 3OP1A 4MW7A 2GKSA 3CVXA 1U3CA 2D54A 4MULA 4MVCA 3KT0A 3A04A 2RD2A 5HUJA 1O0CA 1JEDA 3ZUGA 1X6VA 4G5FA 3TZLA 1KAMA 1D2RA 1TYBE 3UK2A 1O94C 1BS2A 2A1UA 1QRTA 3FETA 4L2IA 4MWBA 5HUHA 4EG6A 4RPIA 5TEVA 1N2OA 1I6LA 2BYTA 4EG3A 3KT6A 4MWDA 2QJOA 3CLTD 3PNBA 2G36A 4OJMX 4NDAA 4NZPA 3ZXIA 1PG2A 4E1AA 4R0NA 3IOEA 3IMGA 4MUNA 5JBNA 2WQ7A 2PFSA 5H7XA 1LI7A 1Q11A 2CUZA 1PFUA 1KH2A 1NI5A 3SP1A 2D5BA 3PRHA 4MW2A 4MWCA 3CLRD 4MW5A 1GTSA 3D6UA 3ISJA 4DLPA 1T6ZA 3N05A 2AG6A 1EUQA 1IVSA 1R6XA 1NZJA 2V0GA 3HV0A 2QTRA 1Q77A 1GN8A 1O95D 4EFKA 1ZUNA 4PBSA 3VRHA 3HL4A 3IMCA 2A88A 4PY2A 2A84A 3PNYA 1B6TA 1QRSA 1YUMA 2A7XA 1O97C 2A4MA 4AQ7A 1M8FA 4K03A 1QU3A 2CYBA 1JECA 1N2EA 1VBNA 1M83A 3L92A 3KFLA 1Y42X 3IOBA 2NZ2A 3VU8A 1XNGA 2ZUFA 1ZJWA 2DLCX 3AG6A 2J4DA 1QRUA 3H9BA 4CDMA 1GTRA 5FNZA 4ZCSA 5HG0A 1O97D 1U7DA 2WB2A 3Q12A 5K0SA 4MLPA 3IDFA 3ZJVA 2AZXA 1WXHA 4WSOA 1HYBA 4MAFA 2J08A 4U7JA 5DEOA 1N75A 4QRDA 2X3FA 1X8XA 3ND6A 1COZA 1RQGA 3P0JA 2ZUEA 4GU5A 4F4HA 5IHXA 1FFYA 2E89A 1KR2A 1IFXA 2QTNA 4MVYA 3P0IA 4JYZA 1IRXA 2XRZA 2Z08A 2HMAA 1M8PA 4L2IB 1OBHA 3ELBA 2YWBA 1EUYA 1QU2A 4QBTA 2E0IA 3N2YA 2O8VA 4ZT4A 1H3NA 1YUNA 3FI0A 4WNYA 3IODA 5J5AA 1J1ZA 1WXGA 1OWOA 1QTQA 4EG1A 4DDKA 2TS1A 4YP7A 5DK4A 1TYDE 1JILA 4DDMA 1OWLA 4CDNA 4J75A 4XFJA 1WXEA 4Q93A 1ILEA 3S3TA 2BTEA 1T9GR 2A1TR 3INNA 1J20A 2YWCA 1NUTA 3CVYA 2A1TS 4MUFA 3TS1A 2B7LA 1GAXA 4XSVA 2PG3A 3RBAA 5DASA 1K92A 4YP6A 2X1LA 3CLUD 1NP7A 4MVWA 2QUHA 4MW0A 1KKUA 1F7UA 3QE4A 5KWVA 5FO1A 2QUJA 1N78A 4U8HA 4YMIA 3COYA 1YIDA 1LI5A 4ZT2A 4PBTA 2DERA 3ILVA 2JAXA 2DXIA 3FY4A 1H3EA 4I6EA 4ARIA 2R5WA 1JMVA 3COZA 1NYLA 3DPIA 4MW9A 3AKZA 2PZ8A 1QJCA 3DO8A 3DV2A 3UC5A 1JZQA 1N77A 1O94D 4NATA 1I6KA 1K97A 4HK4A 3CVUA 3MLAA 1O96B 4KPUB 4UZFA 2WSIA 1T6XA 3RFFA 2JANA 3LE8A 4JZYA 1K4MA 1PFWA 4ND6A 1TQ8A 5IJXA 4KR9A 4MUIA 3IUEA 3A05A 1O0BA 1KP3A 4HJRA 3PNVA 2CV0A 5EKDA 3RHSA 1WXFA 2QTMA 4ZCRA 1A8HA 3FNRA 3NV7A 1KQPA 1VBKA 1F9AA 3FH0A 4ZCPA 4MUKA 3MUEA 1IHOA 3MMXA 3TQIA 1JIIA 4KKVA 1N3LA 1R6UA 1Q19A 1J70A 1VL2A 4PBRA 5TGTA 1TYAE 1GLNA 3G5AA 4JXXA 1OBCA 4MUJA 1U0BB 1KQNA 2PZAA 1F7VA 1N2HA 2I1LA 2X1MA 2C5SA 4MW6A 3RK0A 2NSYA 1MBZA 1NUQA 3CLSC 1G8FA 3DLAA 4K0RA 2JA2A 1N2IA 2CYAA 3HFJA 1UFVA 1NUPA 3FWKA 3GMIA 4ZT7A 4ND7A 3A2KA 4MQ6A 1PFYA 3BL5A 2ZP1A 3QTBA 1M1ZA 1O96A 4KPUA 3IH5A 2CT8A 4MVXA 4FZJA 3GLVA 2DR2A 5DB4A 4ZCQA 1WKBA 5H16A 1G8HA 1K4KA 2RE8A 1WZ2A 1MRZA 1VBMA 1R6TA 2E21A 2IP1A 3NBKA 1JIJA 3VGJA 4A91A 1GZUA 1J1UA 1MAUA 3K32A 1EFPB 4JXZA 3ZJTA 3IVGA 3JXEA 3SEQA 4ZCTA 5LM3A 3Q4GA 1IQ0A 4UZEA 3QTTA 4S1OA 5FO0A 3HGMA 1OWNA 3F3MA 2HGZA 1MC1A 4MW4A 1MB2A 2YY5A 1WQ4A 3COVA 1OWMA 2XRYA 1JIKA 1F4LA 2VTBB 1EFVB 3C8ZA 1I2DA 4MW1A 2IJGX 2CV2A 3D6VA 3X1MA 4J76A 1IQRA 1IH8A 4I6JA 3CVWA 2DUMA 1MOPA 2CSXA 3COWA 3P52A 1JEEA 2AKEA 3KT3A 1KQOA 3A4IA 4EGAA 1TEZA 2QJTA 1PG0A 4JFAA 5AHWA 2QUKA 2YXNA 3G59A 4I6GA 1ULHA 2VXOA 1U7XA 3TZEA 3CVVA 3MLBA 3CA8A 4H3SA 3FDXA 1EFPA 3IOCA 3X1KA 4P2BA 5BNZA 3U1VA 4DE5A 3CLTC 3AL0C 5LFAA 4NAUA 3ZGZA 3FG9A 1XNJA 4OUDB 1J09A 2A86A 3AFHA 2DEUA 4NAHA 2D13A 2VTBA 1EFVA 1WQ3A 4R2MA 1I6MA 3CLRC 3SYTA 3UOWA 4XFDA 2CV1A 3H9CA 1YI8A 3I05A 1NUUA 1OWPA 2H2AA 4ZT5A 3IUBA 5KCMA 3PXUA 1M8GA 1CT9A 2GOYA 1EE1A 3ZXSA 1O95C 1N2JA 3TNJA 1NUSA 3KT8A 2IELA 1MJHA 4G5YA 5J59A 1EXDA 2OV4A 1N1DA 1TFUA 1OD6A 4CQNA 3H05A 1NURA 4AS1A 1QQTA 1QNFA 1KH3A 2OQ2A 1PFVA 2Z09A 4ARCA 1YIAA 1WY5A 3L93A 3OTWA 1SURA 3SDBA 2HZ7A 2H29A 1WXIA 3IVCA 4NX2A 3LOQA 1JZSA 4ZT6A 3RJZA 3AIIA 3G6KA 5J58A 2WQ6A 3X1JA 4MUEA 4OUDA 2CFOA 1NSYA 3RK1A 2DETA 1GPMA 4HJXA 5TEWA 1N2BA 4CT0A 1EJ2A 1KORA 2GM3A 4KR7A 4DNXA 1O6BA 3UMVA 4KR6A 2X0KA 2EJCA 1J21A 4DJAA 5F23A 1M8JA 1DNPA 4ZT3A 1VLHA 4MUGA 2J09A 1ZH0A 2EL7A 4MWEA 4X0EA 4YBRA 1IQUA 1MB9A 2QUIA 1O5TA 4Q16A 1U3DA 3CLSD 3CR8A 4EG5A 3N9IA 3FIUA 1XNHA 4MUHA 4EG8A 1T6YA 3N8HA 4EG4A 1G8GA 3GUZA 1XJQA 1KP2A 2V0CA 3H99A 2PZBA 2DPLA 1S4MA 3ZJUA 2Z3VA 4EF6A 3MXTA 3FHJA 4G6ZA 1M8KA 3H97A 4R2LA 3ZIUA 4QREA 2A1UB 4U63A 3IMEA 1KH1A 3HMQA 3Q10A 1G59A 3UY4A 1KAQA 3E27A 1LW7A 1N2GA 3TQOA 2PXHA 1H1TA 2QJFA 3M5WA 1TYCA 1WOYA 2J5BA 3LCJA 5LLTA 3HZRA 3ND7A 3ND5A 3CLUC 3K9WA 2CYCA 4EG7A 3IVXA 3SEZA 4TS1A 3AG5A 1V47A 4GRIA 5TS2A 4F3RA 1YULA 1Q15A 2E18A 3SZGA 1MAWA 4YP5A 4BWVA 1WJGA 5KHAA 1FYDA 1ZH6A 2PIDA 1JGTA 4HPWA 1JHDA 1P7PA 2O5RA 3NBAA 1T9GS 2J07A
chains in the Genus database with same CATH superfamily
3AF2A 2CFCA 3F78A 1U2PA 2B4YA 3MTJA 3WRVA 3HKDB 1L5GB 1KDTA 4HDAA 4O02B 5JOQA 2EHJA 4DB4A 2UYCA 3G9XA 1S3SA 3VPHA 2J7KA 4TSRA 1MTOA 4EZIA 1J56A 3MQFA 2BGIA 2C7GA 3C3YA 3FTDA 3NANA 5BQFA 1P91A 3JS5A 4NY1A 5REQA 1O94C 2A3RA 2LVBA 3E4CA 1W4ZA 5HUHA 1CJBA 2C9CA 2HCFA 1ATIA 1FBNA 1X15A 2FRDA 5EXPA 4BAUA 3U61B 4QPZA 1M66A 4DLAA 3BWYA 1ZPDA 1Y9EA 4PG4A 1XRMA 2QM8A 3PHCA 2HC9A 5DBFA 2GZAA 2ZRFA 3CV3A 5KJCA 3T1TA 1AF4A 2N9UA 2G36A 3R3UA 3E9NA 1KDOA 1XDWA 2C2HA 3WMFA 1HETA 4XSHA 1KYZA 3BL8A 1DAGA 2RJ3A 1ZSYA 5JBNA 4BB5A 4TVKA 2NXWA 1XTRA 2R7NA 3A2MA 4O1HA 5IDYA 3ZV7A 2CUZA 3ZDEA 4ZOLF 2OAEA 1U8EA 4RANA 4F9EA 4L4RA 4UNNA 4EHDA 3F96A 1UINA 3HO6A 1YNSA 2QQ5A 4AF7A 3O94A 4JEHA 4F04A 4DSAA 1U5BB 3MZ0A 4K26A 1F0KA 4JKOA 2X7HA 5H68A 2PBZA 2Q5LA 2RHOA 4FGLA 2ILVA 5AHKA 3T3DA 2P91A 1ZUNA 4A6XA 2C4UA 1PEKE 1TVEA 4HX5A 1N1MA 4YT4A 3BGOS 4JP5A 1FQOA 5EPOA 4EX7A 1PUXA 3QH4A 5C8YF 1B6TA 5KWJA 3G89A 1KAEA 1XVAA 3R5FA 4MGYR 4LJ6A 2G40A 4QLAA 4C4PA 3GDFA 3CPJB 1JECA 2DWCA 3PA6A 1JZTA 1MX5A 1NVBA 1AXGA 2VPWA 4G3XA 4W7HA 1C30A 1FW8A 3EXFA 4KLCA 1HDIA 5ALJA 3VZPA 5EAIA 5BURA 3AF1A 3HC7A 1CR0A 1XA3A 3UXMA 4DAOA 1D7OA 2OXEA 2BE9A 5DWVA 4QVIA 2IZ6A 1P6QA 1L3IA 1E3WB 1YE8A 1Z7EA 5KVQA 3IERA 3FTPA 5K99A 1FP6A 3AHIA 3IAFA 2Q5IA 3K9CA 1AF7A 4MQLA 1TGYA 2RC6A 3VM6A 2QR5A 2OG1A 1GN9A 1Z0UA 5I9IA 2ZOSA 4Z9YA 3E9QA 1IXSB 3ZHUA 1TOAA 4RFVA 2XBMA 1WV0A 2FWAA 1J9ZA 1XYYA 3G5LA 3LPCA 1KQ3A 4IYJA 1IAVA 4NU5A 4EL5A 2HRCA 5FWAA 4RABA 3QXHA 1J1IA 3OE7A 3PITA 5CUQA 1JTFA 3VVBA 4YRIA 4RJIA 2ZUEA 1I80A 1YDFA 1SVSA 2BAGA 3QJGA 4D44A 4KACA 2HWUA 1SZPA 5CDHA 5KTMA 3RVJA 4I1SA 5EPUA 1QMGA 3LKBA 1TPYA 4Y1RB 5FYDA 1NVVQ 3UPUA 4EPYA 1KJQA 1O6GA 3VR6H 2AE1A 1ULZA 2W9XA 4ITVA 1RNLA 1SBCA 2IOQA 1P0FA 4NABA 2HU8A 2NO7A 1E1NA 3IESA 3TKLA 2ICAA 4TTSA 3KQLA 1E63A 2I99A 2V7QA 4TKMA 4YI5A 1GCAA 1YUNA 5EMHA 4LJSA 4XCXA 5IVPA 2VBCA 3LQFA 4DEYA 3TIIA 1A72A 3CNQS 3IODA 3HO1A 4HDRA 3IQZA 2V6MA 2GVDC 1X87A 3BKXA 3K0AA 1K4YA 4N5LA 3OZ7A 2SHKA 1W9HA 3ZWKA 5LWHA 4QTZA 4Y6GB 1RP7A 2NU6A 3R9KA 4A0QA 1UDXA 2ZDGA 3KDSE 3QU9A 1B6RA 4Q7EA 3DFKA 2FCAA 2AWOA 2XTJA 2CD7A 1FU7A 1JS1X 1KEUA 1PG5A 1WCWA 5JI2E 2XZPA 4ZYLA 3RUEA 4M6WB 1HDXA 2BMDA 1ICIA 1NW3A 3OIYA 2PKWA 3CVYA 4WCVA 3NRJA 1F2TA 1M2WA 4I2VA 2PG3A 4II2A 4XSVA 2J3MA 5JD5A 5AHOA 3M6FA 4K7JA 1KBZA 5J2UF 3FUXA 2ZFUA 5KNBA 3J80A 4A6EA 4KQCA 3LTEA 4AJLA 1W85A 3H5WA 3K6RA 2HK9A 4IDQA 4MW0A 5LKAA 4FE4A 4ZVKA 3TRKA 3SPXA 4P3YA 2XIQA 3EGXB 4E14A 4F38A 3B52X 3RTCA 2YYSA 2D3WA 2I22A 2IYLD 3ME5A 4BOYA 3BJRA 4XGKA 1WUHS 4DCNA 1Y5IA 2YVUA 5HKAA 1XYVA 2RKWA 1LW6E 1Y5RA 3FPFA 4L57A 1BDJA 3FNHA 1QAOA 4HYTA 3ICOA 2VSQA 3AF3A 1BRTA 2HLDD 1B6SA 1OLUB 2PZMA 4Q1BA 4XB2A 5HK8A 4B79A 3UGJA 1YRHA 2BUCA 5FAXA 3HJFA 3MQ4A 3OPYB 3DPIA 4AG3A 4BVFA 1RMQA 1QHHA 4IJMA 3OZFA 2RONA 1KA9H 1QGUA 2ANCA 4V0SA 1QJCA 5IBRA 5A3VA 3WRYA 4HLDA 3I6IA 1P5ZB 5JZVA 1FLAA 4W6ZA 2PX8A 3ZWVA 1FXWF 3KTAA 4A26A 2XAAA 5JNTA 1F5NA 1X7ZA 4Y6SA 5T4BA 5CPBA 5TMBA 3NX4A 1BKYA 1QYRA 4CEIB 3JX9A 2J3DA 2AZMA 1LGYA 1XEAA 3CKLA 2J1LA 1R9MA 2W83A 5FHRA 1EVEA 4PLPA 1MGOA 2JGDA 3G0GA 1QF6A 2V9PA 4AYXA 1O9HA 3ZUPA 4HJRA 2II6A 2H07A 4TTPA 2AXQA 2H4WA 5C5EA 3F5QA 5FA8A 3IPRA 1HMPA 2J6HA 2REXB 3A3YA 4Q02A 1P45A 4S1PA 3FH0A 4EYSA 1BN7A 4BUJA 1XPOA 2CXNA 4DA7A 2C2KA 4JSTA 4S2EA 4YRQA 1B00A 1N0WA 2IHTA 2HQOA 1QGOA 3IJPA 3TE7A 5GPBA 1SJ9A 1I7LA 3DKVA 1ACJA 2PYZA 5ALXA 1VPDA 3JTEA 4R2WA 3MPUA 3O82A 1K6IA 3CH6A 3TL6A 1NHGA 3DCNA 5A5GA 1DQNA 1SOAA 5IAEA 1DRWA 2O2GA 2ZAGA 3AKDA 2W43A 5HFNA 3MTAA 3CGWA 3DGFC 3U7RA 4YMLA 1S2DA 3UV6A 5F5LA 3PNLA 4XVHA 1N5RA 5BOVA 2CWWA 3A6EA 2WPDD 1UBHS 1U8CB 3AFGA 4MKIA 4V2UA 3LU1A 2WWVD 1T3GA 3REQA 2AYZA 1HORA 3HBMA 3EPRA 2GK7A 4HD8A 4GZ6A 5TF0A 5A6SA 2NO6A 1PVOA 4FJ1A 3UT5A 1CVLA 1EVZA 4LE0A 3QMPA 2I2BA 3IH5A 4PAGA 1XCLA 3L8ZA 1R74A 4TXNA 1MRSA 3KYIB 4Y0VA 1BX3A 4NMHA 4ZK6A 3ZI4A 2DR2A 4OF4A 1BEUB 3CLKA 4PYJA 1PFQA 3NUZA 3S4YA 2A67A 4LX8A 5KVCA 2IQIA 1JHMA 3S40A 4W9RA 1EJ0A 3ZK7A 4HQOA 3UAXA 1V39A 3DD1A 4H7PA 4JH0A 4RMIA 1JIJA 4D9EA 2A5LA 4ON9A 3SEQA 2DGDA 4CWAA 1JKJA 5KYWA 2VJMB 3DE2X 2V7GA 8ABPA 2XYQA 4FD2A 1J5PA 1QQAA 5DISB 4MIYA 4JYMA 4AF6A 3SNHA 1DPFA 4D8XA 1ZUIA 4RKFA 4GKBA 1Q21A 1YE5A 3S70A 3U81A 3VA7A 1E5TA 3CMMA 2DSTA 3WJ7A 3ZU5A 3COPA 2SBTA 3CRMA 3FWZA 3PFKA 3QUTA 3DAHA 4ZCLA 3SC4A 4ASUA 3ZCTA 1Z2PX 1JPNA 2OUIA 1K0FA 4WCDA 3MS2A 3U31A 4O1MA 4D3YA 4I5IA 1SUSA 4UU7A 1H9AA 3RCBA 1UBFA 3VHXB 4BQOA 3DDNA 3Q6NA 2FKAA 3RR2A 3ZOZA 4RSGA 1JHOA 3CZMA 5AOVA 4RK6A 3M9LA 2QUBA 3R0IA 4REQA 4AUKA 1V1MA 2UDPA 4MRSA 4H9GA 4ZVVA 1EGQA 3L0IB 1QWOA 2A9OA 3JQ7B 4TV8F 2O59A 2CNWD 5F2OA 4V38A 3U2QA 2I4MA 4KU4A 4L51A 2HF8A 1FP4A 1X7XB 3P9ZA 4KSCA 4RCZA 1PLLA 5AW1A 3PKIA 1VE6A 3MA0A 4FQ5A 4NOJA 4OHRA 5ERXA 1F2DA 1SXHA 5BSMA 5A4KA 3U19A 1OBOA 4EFDA 3IA2A 2YMQA 1FDWA 2ATCA 1B8OA 3KQVA 5AVWA 3D7NA 3CURA 4ZHQA 5CTAA 2BCEA 3KUDA 5ECGC 1FU4A 4DE5A 4BO9A 2R1UA 4GEKA 1MD9A 2FZ5A 4HNSA 2RI0A 1MHPA 4LWZA 4QBHA 5B53A 1MOZA 3WP1B 3AL0C 5SICE 1KPHA 1Z63A 4GZ5A 4CL0A 2PUWA 2C7QA 2ZI4A 1F3LA 1XNJA 4OUDB 3D5QA 4BKUA 2GDZA 5JXGA 5HZHA 2IXEA 5AXBA 3KSBC 1XT6A 1NXWA 1YS9A 4ALKA 1Q0RA 3DTNA 2X3YA 4XAQA 5FTNA 4J0EA 5KU1A 4D3FA 2D5AA 2GFQA 1ENYA 3HB5X 4RD3A 2COEA 2IEZA 3GBSA 4X61A 3TRJA 4XFDA 1E6WA 4IQ8A 3V8QA 5B3JC 1HYHA 3QKIA 2A57A 1RW4A 2XQIA 3ELWA 3NDPA 5KOHB 2DLDA 1LV8A 2QBYA 3J7TA 3PXUA 1RSZA 3SKXA 1R4AA 1Q0LA 1N7JA 2XTNA 4AVYA 3T7KA 2YS7A 4GP6A 1EXDA 1M0TA 1KYYA 3NVAA 1VCNA 4NYMQ 1GEEA 1NRIA 3S1LA 3U56A 3DDOA 1W19A 1AKMA 1W52X 3L7IA 3LMKA 1UPFA 2ENUA 3AETB 1IULA 3BWBA 3E70C 5CXXA 5IC5A 1P3DA 3IHWA 3WNDA 3P19A 5K7SA 4AKHA 1ND6A 3BRWA 4LDZA 1QHXA 3IVMA 3Q7RA 2VJOA 2WMNB 1IUNA 1II8B 3G7NA 3ZZMA 1FMFA 2QS9A 2REBA 3ACCA 4ZEXA 3KJZA 3ZHVA 1RPJA 2CLOB 3ESYA 1P18A 3K5WA 4JI3B 1EKXA 4M0PA 4PRYA 3G2OA 4V0MA 2ZRHA 4KLRA 1YZGA 2FGJA 1T2DA 2VQ6A 3AR4A 3R7SA 1RXYA 3ZY4A 4ZGBA 1THGA 3R0VA 3VJMA 2PO7A 1JXMA 3LH5A 3WDSA 1ABFA 3G8AA 3TNDA 1A8SA 2I9PA 1CRLA 3BXEA 3OSZA 4YAFA 2YMPA 3QPUA 3GDOA 1SXJD 1RZRA 4YMWA 5EJMA 4FFRA 1PNRA 5AVYA 4FMDF 6NULA 3B6JA 2YZKA 2QP3A 2C29D 2GQ0A 3W6OA 2QT1A 4XB1A 1H69A 3LBIA 4D3ZA 6LDHA 4RBNA 2FFRA 2IYSA 3B1FA 3TTWA 2GSWA 2BGKA 2IUTA 5HKKD 1AGYA 4MVJG 1XELA 5DN9A 1M6HA 4CN9A 3CUYA 4LCBA 5MF6A 1PNTA 4Y2RA 1XZAA 1MB9A 3C7DB 5IKPA 1W96A 3QPAA 3WGVA 2TRSB 4LTDA 3WQBA 3JWPA 3TVYA 4QOSA 2W70A 1A5TA 1OYVA 3CLSD 3I73A 4PIMA 3ZY6A 2VHYA 4ND3A 4DLSA 1O77A 4UU1A 1W35A 4R1NA 4QL3A 4LUCA 3R5HA 3ZWPA 2HIHA 2IIQA 2BKEA 3PLNA 4C30A 4GI2A 5F9MA 4CT5A 1LLDA 2P75A 2XDWA 4Y67A 5F3WB 2AI1A 1NVUQ 1BDMA 1GPH1 1NC3A 1J0AA 2G80A 3C85A 3QKWA 1S3GA 3T0FA 2XXAA 2CLDX 2PUJA 2Q62A 3QX9A 4HXEB 1G7SA 1NVAA 1H8HA 2O23A 2P0AA 3W9SA 3VXKA 4N0EA 5E8JA 4BMYA 1A9XA 2JARA 2FEAA 2P9BA 1QHFA 3MMPA 4FBMA 4NHEA 4DLKA 1SXJB 1D9ZA 2W8BA 5BSKA 1MJGM 1V5WA 2YN2A 1K3TA 1RKVA 4OB8A 4G07A 3DW1X 1THZA 4LA4A 4C4SA 3EBOA 2B69A 1YR6A 5KNLA 2PXXA 1KS9A 3PR3A 4J0KA 5HS6A 3E3NA 5GIPE 5KX5A 2XOKA 1NG1A 3MGCA 5KPJA 3ZZTA 3ID6C 4R31A 1Z0AA 2PV0A 2QD5A 3NNDA 4EG7A 4QULA 4PCLA 2RAFA 2YYZA 4M49A 3LHFA 3GFGA 1UC5B 3L1HA 4NCIA 5EXXA 4GW3A 4TS1A 4N48A 4ZOLB 5E9WA 1DELA 2D7JA 5M2QA 3D0OA 3EVBA 4MIKA 4PWYA 4X1YB 4ZHQF 2NYUA 3DEHA 4HDKB 3H9JA 4Q1EA 1E3DA 2F9MA 2JJ2A 3TTXA 5HE8A 1T36B 4IVQA 2O8BB 5IYZF 2HN9A 4P98A 1UANA 5AK6A 4DXHA 4GQIA 1EP1B 3SNKA 1PDWA 1QB8A 4BPRA 3UB3A 1NMQA 1DVRA 1WA5A 2D2VA 3L77A 4WL0A 4Q12A 9ATCA 1KI7A 1U3CA 4JK3A 3FROA 4JP1A 3UATA 2ATEA 3OFVA 5GOZA 4LN1A 2VTDA 3SIXA 4RCYA 4CUZA 3GEHA 2WKQA 4DMHA 3QVJA 4EQZA 1YL6A 2VF2A 2WHPA 3KXKA 1D2RA 4IH1A 4EIWA 1Y3HA 5H4HA 5K03A 3S1AB 3OJCA 3SZLA 3EQ7A 2A1UA 3K2EA 4DMGA 2FX5A 3B3JA 3WQHA 3WLQA 2OXTA 1ZIYA 1XGKA 3PXAA 3KAJA 1GCOA 3WIEA 3EF1A 3PFNA 4LC1A 4MI1A 4DCSA 1ZOIA 3JQ9C 3R44A 2BYTA 3WIUA 3KSDO 2YNMA 3PNBA 2WYOA 4IIVA 3WV5A 3HKEB 621PA 1ZNWA 2G3YA 3NWEA 3RSOA 1J06A 3KOMA 2C2GA 3OTGA 4R6WA 1K7YA 1LV7A 1ZH4A 2A5GA 2HA7A 3OCXA 5J5VA 4QJBA 3ZXIA 3HM9A 1GU1A 1NBIA 4BZQA 4D7AA 4IRUB 1LI7A 1DC5A 4LJ7A 1L5QA 1WU8A 2Q21A 1RXCA 5U1PA 2D5BA 1WZCA 3AR7A 3AEKB 1PWEA 4ZAXA 1FDSA 2O1XA 4D5GA 2E7ZA 4W5WA 4BC0A 3I52A 2NQ8A 1YR7A 1P74A 1Q14A 3K0CC 4LWOA 1EK6A 3MUFA 3HUEA 3JAMA 2PRIA 2DT8A 3LP5A 1R6XA 1TE2A 2QRQA 3AMVA 4BQSA 3QKRA 3DV9A 1TTPB 1ZD2P 4H35A 3RC7A 1PQ4A 1ZINA 3IBFA 1M0WA 5KJEA 4HAWA 4XI9A 4JVLA 3VNUA 3V4LA 2ZXEA 2X22A 3TCXB 4CMIA 3EPLA 3DP7A 1AQ6A 2I6GA 4R8KA 5FCDA 1QRSA 1YCDA 4GKKB 2BFNA 1TUGA 2B4AA 2D62A 1MV5A 2R7LA 3K0HA 4MWZA 1E2MA 3UT6A 2P9YA 1UXIA 4MPPA 3PQFA 4D45A 1YQ9A 2IPMA 4YQEA 5IN5A 3HJHA 2C7VA 3ORFA 4QJIA 1TCAA 1NFQA 1Y3BE 4D79A 1GKIA 3VU8A 1MT3A 1TVMA 3NIFB 4NENB 4IXNA 5ALSA 1GOTA 1Y4ZA 2PAAA 4MI3A 4KQMA 4XQCA 3ET5A 3VPXA 3JSAA 1HL3A 1U2RA 4CDMA 4CMKA 4DYVA 4G67A 3WLOA 3O4JA 3VPBA 1MR3F 4Z0HO 4L27A 4B7CA 4NARA 1VMDA 4O0MA 2W2LA 1SMKA 4TLDA 2WB2A 4AROA 4NMMA 1P7WA 3CF4G 2YHAA 1LFAA 1CE8B 1NULA 3DAYA 4GOKA 4PTYA 1XRLA 5IABA 4BN0A 4CIBA 4FYHA 1P2FA 4XXHA 2QRJA 2XE6A 3D8TA 4KRYA 3C2QA 3ER8A 1LPPA 2F00A 4DNFA 3KSAC 5C9ZA 4IOLA 5J2UB 1VKHA 1K7SN 2E89A 3P5BA 4JQYA 4PG7A 5E1MA 4BNYA 4XM2A 3UMBA 3FTFA 3ZE0B 1PYGA 1SBIA 2RHLA 3UJHA 3VX4A 3GCZA 3S1SA 4IEIA 1DJQA 5CJJA 6Q21A 1DAKA 1R0LA 5JXIA 1Q1ZA 3ZVRA 2X5KO 2OBMA 3D4IA 3MYRA 3JWIA 1YIOA 1U2GC 3NM5A 1OBHA 2RGDA 4AY6A 4GX1A 1UMCB 4QGSA 1D6MA 2E4AA 1KE1A 1Z62A 4N3GA 1LTHR 1UP7A 4X1IA 3HBLA 2DULA 4EUKA 3SSAA 4AI6A 1XRNA 5A4AA 3SLKA 1CFJA 3GQVA 4U0JA 3I28A 5HW0A 5ES3A 4L8FA 5J5AA 1J6UA 1JDUA 1PSWA 4HUQB 4JLBA 5EFZA 5ER6A 4DC0A 1R0ZA 1RABA 4MEAA 2JJYA 1L5FA 3C4JA 4Y2YA 2CMFA 4BASA 2WF9A 4RH0A 1QBGA 3N2GA 1GLGA 4FTWA 3A3OA 5I7WA 1TPZA 1YZNA 3OE7D 1QHYA 1TJ3A 5L7TA 2J5KA 2VT2A 1O6CA 4Z0NA 2OCLA 3LYAA 3EMKA 1XVVA 3M4ZA 3OCWA 4Q4HB 1T13A 1XQ6A 5INTA 1S89A 1OHHA 3UN1A 3EXHC 2INGX 3OETA 4JBGA 1NF8A 2OFXA 1ZUNB 5KSPA 2VXBA 1BDIA 3WLFA 2HPVA 4BLUA 4DQDA 1Q7EA 1RLIA 1DJLA 3OPXA 4HV4A 2X1LA 4BFTA 2ODWA 2QZSA 3KB2A 5ES4B 1N5JA 4HBGA 1Y98A 1L4HA 5FP0A 1Z74A 4ZU3A 3ZWDA 5HRCA 3S7ZA 4TMFA 5A03A 1R4NA 2F6RA 2FPGB 3H83A 3O9MA 4MMZB 4NF2A 3X1ZA 5B6JA 4RTLA 5JCPA 2I2AA 4RTQA 1E32A 4IOMA 3GBVA 3R3ZA 3ZCSA 3C3AA 3OU2A 4IIDA 1HZZA 2PEZA 3AFOA 3HN7A 3KC2A 4RHYA 1KS2A 5IP5A 3RRZA 2ZROA 1O87A 4K9NA 1TCUA 2OGUA 1LI4A 1Z2AA 1KO7A 2WWXA 1QG6A 2QR2A 2G72A 2LPMA 3MUNA 2NPFA 4JQSA 1H3EA 3HWSA 1JSXA 1XQWA 2ZTSA 3L7CA 1SCKA 4J91A 4RKWA 5T41A 4AJOA 2I4OA 1UBCA 2JK1A 2HK8A 4V1CB 1LDBA 1V16A 2RCYA 2PJZA 2FZCA 5C3UA 3CF6R 1KZ7B 3VDXA 3BSSA 3RREA 1RJGA 1VLLA 2BEVB 1MXHA 4UUOA 2WJ3A 3AHCA 4JKIA 1LA2A 2GAJA 3D3NA 4NBUA 3SYKA 4BDTA 2XVAA 5ULLA 2LIPA 4C6RA 4EO7A 5IT9A 4EGSA 1T3ZA 4XQ0A 4Z5XA 1KK3A 4FGJA 3PXBA 3DP9A 3LE8A 4P5DA 3RJ5A 5KNBD 1QDUA 2J0SA 5CLLA 2KSQA 1TQ8A 2OC4A 4TLEA 5IF9A 3ZGLA 1KSFX 4RCVA 4OFBA 3LXXA 1G8KA 3IUEA 1E0SA 2I2FA 5T5QA 3RH0A 4AJ9A 2XW6A 1ESDA 1FVHA 1S5PA 3T4PA 4CLXA 3RHSA 3TEJA 3OFSA 1A7KA 3C8MA 4HNGA 3CF0A 3RKRA 1A8HA 1FFCA 1FNMA 3DMTC 3FNRA 4WAUA 3T5CA 4FM9A 1HXHA 3H2SA 4OCZA 4WA7A 3URMA 5IDVA 1YJBA 2CVFA 4BZPA 4RELA 4DPMA 1BO6A 4G1CA 3OAAA 4K6KA 1A5ZA 4BMVA 4R8SA 1ZGGA 5CW1A 1CFZA 5GONA 5C32A 2NLOA 3U3MA 4EJ0A 3KSZO 3AV0B 4AD8A 3CJRA 5KQRA 1U0BB 1RHUA 1A9OA 2PZAA 3DLCA 1G42A 2R6CA 4RD0A 5MHTA 1IBSA 1HV8A 4KW7A 2QRNA 5ED4A 1ZKMA 3U3KA 3NIDB 1A98A 2H9IA 4K0RA 4V0NA 6REQA 3AUXA 1MQAA 3BF8A 2R44A 3EMVA 4RF2A 1OYOA 3GFBA 3OCUA 1ZI9A 3FWKA 5D00A 3X3HA 4ZVNA 5EHQA 1UC4B 3U7EB 2ZP1A 1JBEA 1F2TB 3QVGA 3IIJA 3HPRA 3WWCA 4G8BA 4R2XA 2MR5A 3C0KA 4FYMA 3UPTA 3MJRA 4LOHA 2V4MA 4TV8B 3CZ4A 3LUHA 1PR2A 4INZA 3TAHA 4L4SA 4QVGA 4Z1OA 3N75A 1X1BA 1U1FA 3AERA 2FK8A 1XI2A 4LJ5A 1DCFA 3RIXA 3U3OA 3IR6A 1VBMA 2EX0A 2CDCA 3RS7A 2FETA 1LRLA 5ALDA 4NICA 4X6LA 1JLHA 3VC3A 4KIUA 2CFIA 1W76A 3OQ6A 5DI9A 1CNFA 4KP7A 1ZVMA 2G06A 1IZ7A 3KLMX 5DFAA 2XB2A 3DVSX 4PN7A 1SIOA 1HDZA 3OEHA 1IUOA 1FFWA 3NAMA 5AKEA 3W5CA 3NEAA 1TM7E 1ZGBA 4BKRA 4F4DA 1Z0IA 4DUGA 2CLEB 5JY1A 1EM8B 2W8ZA 2XD4A 4K9MA 1GQQA 3BPSA 4JCOA 5ARBA 3PEUA 1LSJA 3NOXA 1JIKA 4M1QA 3EGDB 1QHHB 3OU7A 3B9RA 1XTJA 3DBHA 3KOZA 4UDNA 3L4BC 5F5NA 1E0AA 3U26A 2ZI9A 1IUKA 4RFSB 1UAGA 1YVDA 3TOSA 1IH8A 5DE3A 1QH1B 3KTAB 3W0LB 1D0SA 1HKHA 1Y5NA 4BLPA 4BBPA 3LBNA 5HJ5A 3PPVA 5K6RA 2PVCA 3I8XA 3QF7A 1SWVA 4PINA 4RVDA 3V8BA 3P52A 3P9XA 3HS3A 2VHZA 3BFPA 3UK0A 4B7ZA 5HR5A 1JEEA 2WUFA 2XWJI 3PT9A 3VVCA 3GN1A 2GTPA 3AM5A 4CM1A 2IIVA 4Y1EA 4GI7A 2FQXA 5A4JA 3GLIE 3KDPA 1PW7A 1BA3A 1TO2E 4YMHA 2X8AA 1UKCA 1XA0A 1GU7A 1QTNA 4X20B 2QJTA 1VJGA 2DJIA 2ZBDA 3FVWA 2J3IA 3STHA 4QOJA 4ZYWA 5FWNA 1HFWA 4LGMA 5KWEA 3CUEF 3IJEB 4I6GA 3FKJA 5DCWA 1BA2A 2AMVA 4AX8A 2IUFA 1ZMBA 2O05A 1HQYE 1U2EA 2ODNA 3YASA 4R81A 3N76A 3MWFA 1J8VA 1PNOA 2HMUA 1RE0A 3BIJA 3LPDA 4LZPA 5CD9A 5ENVA 3QIVA 2I4LA 2Z83A 2Z9BA 3IRVA 4OXKA 1ECGA 3JPYA 2ISCA 4KR3A 3WRWA 2ZS7A 5IW8A 5I7RA 3M8KA 2BEKA 5L7WA 4I50A 4ZJZA 4MQMA 2CVHA 4UE6A 3WLJA 4Y7CA 1QSGA 2GHTA 3RAPR 2B3TA 4ASUD 3W5IA 4CFZA 2CVPA 3KPWA 4FJ0A 3DF7A 1DC4A 1YB7A 4EG0A 4PSCA 3Q8KA 3H2YA 5AOAA 1BRMA 2VTBA 2YZ7A 3G2IA 3Q8LA 2C83A 1QP0A 1XTBA 4Q3NA 2CDBA 2JVIA 4HB4A 4RX1A 4DBVO 4AO7A 1JX6A 5IX8A 4KEAA 3BCSA 2FE1A 4FMDB 3I05A 4M0FA 3UFBA 1PDOA 4ZK2A 4XDZA 4TYYA 2WFMA 3GCWA 4J3JA 3ZVKA 3O03A 5BYJA 1YVUA 2DWPA 2IIBA 3C7KA 3HCAA 5C1BA 2ST1A 1QJ4A 3ABIA 3HSKA 1TFUA 1WKVA 3RKSA 4C0XA 3K1TA 4ZU6X 1A77A 5HM8A 1BHSA 1ZK4A 4OAQA 3WISA 3AF6A 4C0SA 3LFUA 2GN8A 1GL3A 3I32A 2LZ0A 1QGDA 3VPDA 3IEXA 4YCMA 5IPFA 4WZBE 3TX6A 2DHQA 1P61B 5KYWB 1WY5A 3PD7A 1NU8A 1G41A 1T35A 3K6SA 2JH9A 1WD7A 3V46A 1SURA 2WM9B 2NV6A 3UPDA 1ZNQO 2XUHA 3A0UA 5GONF 1QG2A 3WYBA 4A4DA 4F5EA 3VGPA 4J16C 3VAZA 2XNKA 3RSSA 3F6EX 1HWYA 4M2LA 4ZT6A 4BO7A 1HQCA 3W5JA 5JXHA 4G0VA 5J58A 3CVOA 2NT3A 1MQ9A 3TPFA 2G9ZA 3OOWA 5JAQA 4UUBA 3T1QA 2C3YA 3H4VA 3KQTA 3HBNA 2GN4A 3ONVA 2ZRBA 3DMGA 2V1UA 1F2VA 3L07A 4OXQA 5FH9A 5FLYA 5TSDA 1CW2B 1VYTA 3O84A 1NVEA 1TIKA 1ZCFA 1J7JA 4UUMA 5SYMA 3ZBUA 4KXVA 1V1MB 4PX5A 1IMOA 4X97A 3ZXXA 2O8CA 3EC7A 2GPJA 1XVLA 4WCFC 1GPWB 1GNQA 1VP9A 3OMXA 4BQPA 5CB4F 3WHLA 5LLDA 5CLQA 4KHZA 1QPGA 3DL0A 5IM5A 2AC4A 1JUDA 1R0KA 2CDRA 2BCJQ 1A82A 1KYIA 3ADBA 3EZLA 1AU9A 3CNLA 1VRWA 3V48A 4XYLA 3T5AA 4H18A 4C7OA 3B9PA 3PD0A 2WEKA 4LY0A 4BLVA 3H5TA 3R9WA 1E8MA 3FPBA 3D6AA 4ZVPA 3GJ7A 4ENSA 2AYXA 1PUJA 4KXXA 4BX2A 5CB8A 5LIPA 3M6AA 1XNHA 4ZHQB 5LVAA 1DG3A 3ESZA 1L4KA 5LQNA 1PJQA 1C7QA 3OM1A 1QP7A 5IYZB 3RS0A 4Q3BA 3WKAA 1JHVA 2BFPA 2PZBA 3PQCA 2B34A 4KWHA 1BQ3A 2CF6A 1GZ5A 5E9QA 3ZJUA 1OAAA 1V43A 4LS3A 4WRRA 3UUGA 1IM2A 4MP6A 1MFZA 1RZRD 3SE0A 1PT8A 5ICEA 2Z5GA 3E4DA 4I36A 2FMXA 5HSGA 1E4OA 3SHQA 1ZR4A 4HFRA 1HDRA 2OXCA 3FGPA 3Q40A 2CC2A 3LSYA 3IMKA 1A50B 1W8DA 2JGRA 1D6SA 1N2GA 3O2JA 3DLPX 1OZFA 5E3HA 4RKEA 4DHWA 4TYMA 3KZMA 2IXAA 2XKJE 1WP9A 1IVYA 3TQSA 5EE3A 5JISA 2ODBA 4Y8VA 3C4VA 1WCXA 2JAUA 3K9WA 4J49A 4EHAA 1UJ5A 3IS3A 3REOA 2XYGA 1NQUA 4X3OA 4A82A 4ABTA 1Y1TA 5D5QA 3LUKA 1V47A 2DQ4A 1KIMA 2M6RA 4ML3A 4FHGA 3OFNA 2YQ4A 3FB1A 3O9VA 1PT6A 3L5OA 3A36A 4NWIA 4F46A 1J97A 3K71B 5IBQA 5HILA 3W7BA 3ERCA 4DLYA 3JQCA 2A9PA 4RUKA 1EHIA 2QN2A 3WG9A 2OHJA 3IAHA 3KU4A 2FFBA 4Q6WA 4D8WA 4MW7A 4PHTA 5IBCA 1ANKA 1H8HD 2OYCA 2WJ4A 1FYVA 3VV2A 4M7PA 5KMGB 3K0BA 1NASA 2PKQO 2YH2A 4ZRDA 3RAJA 3WLSA 5IMSA 3W90A 2RD2A 4BFYA 5G0VA 4C87A 5KDDA 1ICEA 2XPCA 1CYDA 3CUTA 1IIRA 3BFKA 3NZEA 2C1XA 4FNGA 1S1CA 1VMKA 4PC2A 2JFBA 2DTXA 1SBNE 3KKZA 1QHNA 4J0FA 1Z5PA 4ZQHA 1WDKA 2EZUA 4DADA 2DHDA 2FF7A 3MRSA 4QE3A 3NGMA 2IHVA 3R74A 5BQXA 1BMFA 2PRSA 1FP2A 1FL9A 3CPHA 1R8SA 4PYQA 2Z8YM 1XK7A 4P7BA 2XOKD 1K5GA 1Y6JA 1I2BA 2OXRA 4KQ6A 1T9ZA 4AZSA 4P38A 3GJRA 2PGIA 2HH9A 3KYDA 3K70C 3TD2A 2PRZA 1EWYA 3OMLA 3TTSA 4MWTA 5FFMA 1TZKA 4A8JC 2EKQA 1PN3A 1IATA 1W1WA 4EUEA 1SD5A 2HA6A 5DF1A 4MW5A 2JJ2D 1EFRA 3NBUA 4MPJA 3MRTA 1ZEMA 4WKPA 3ISJA 3WV4A 3ZD8A 3RTDA 2V7WA 4AUEA 2HJ9A 2WICA 3HNOA 1ZH2A 3LDGA 1MQ8B 3SZOA 4HS4A 5CGQB 2KI5A 1G98A 3TTVA 1VDMA 2Q4OA 5ICFA 3VJKA 1LH0A 1L5HB 3L4EA 3IAM6 3JARB 4M9QA 1Q1NA 3GL9A 4R98A 2HFJA 5JSKA 3VX3A 3ZCUA 1NF3A 4L28A 3E3LA 4JUAA 4JX9A 1CUUA 1XXHE 3SHVA 3TQQA 5HWSA 3JWHA 1N0HA 2VHQA 2ZIGA 2DFLA 2A84A 3ECCA 3UWKA 4CQJA 2PJRA 4H2DA 3IT1A 1VHJA 1W5FA 1M8FA 4Z8YA 2NTJA 5EZYF 3IAM1 4KMSA 1IDN1 2I62A 5EEHA 4XYMA 2R4QA 3L92A 2CLMB 4UEQA 2YNMD 4L4YA 4RACA 3A0RB 2LXNA 1OXBB 3QVTA 2Y0EA 4BHTA 2WU8A 1LLUA 4N76A 5IFKA 3LBAA 3QEAZ 3SBDA 2NVOA 1OH5A 3AG6A 3OIVA 5J23A 3TYXA 1QRUA 1M2OB 3P20A 4RPHA 3EG9A 3FPAA 4AZ0A 4D6YA 2RH9B 1G7CA 1T0HB 2E9SA 4NS4A 4QICA 2JZNA 2G1JA 3GLFA 1U7DA 5AK3A 4ESOA 3EW9A 4FK8A 3B9QA 4PR3A 4AYTA 5EG5A 3PSHA 4PPQA 5IJWA 1HYBA 1JR3A 2J08A 4Z99A 5BQ3A 5LOVF 1JEYA 2D2FA 2VRCA 4LRTB 4C20A 3C8DA 1Q0QA 3NNSA 4ESVA 5AKYA 1Q2UA 1XUOA 2WU4A 2QRPA 3BILA 3VU3A 2OSVA 2ZQ5A 3HRIA 4Y18A 1PJ8A 3DXZA 1J2EA 2Q3LA 1A2BA 1WEKA 1V9CA 3GA5A 4LI3X 3LC7O 4KWCA 4D0GA 1H42A 2AEEA 4C2AA 2QTNA 4U7WA 2R1VB 3TMAA 4KXNA 4V0QA 5AO9A 2ECOA 2MT9A 2REQA 4DV5B 1F0NA 1OYWA 1KRXA 3EWIA 4NECA 1YQUA 4DUYB 3RRYA 3MB5A 1U5AA 5E4FA 4QOFA 2HA3A 4NNOA 4WVFA 5C3MA 5LZ9A 1Z8HA 4D25A 4FOPA 3ZDCA 3MXOA 3N2YA 3DE0X 5F33A 3FD8A 1FTSA 2HK7A 1Y4UA 1YKFA 3DHVA 3H9UA 3LNCA 4HX2A 4M0DA 5AYVA 1I1HA 4WNYA 1AUQA 5BYKA 1Q5PA 3JQ6A 4ARSA 2F8SA 3WRXA 3MWEB 4DEVA 1FRVA 2G82A 5D7NA 1U1GA 1VSUA 5SY4A 1Z4NA 3AFMA 3TECE 4JMPA 2PS3A 1EK1A 2W2LD 3T41A 4CG3A 4OOEA 1E3JA 4DDTA 5C37A 4JYAB 5DLQC 2QY6A 2R6GA 4CDNA 1V5IA 3PQ6A 1TT5B 2G8LA 1WXEA 3LX6A 5TQVA 3LDAA 4ZODA 3GXOA 5L4SA 3J81A 1RRCA 1R0RE 5KDOA 3F1LA 1A1VA 1AKTA 3EUEA 1J20A 1Z5UA 2EZ9A 2NU7B 3A6LA 3QKRB 4MUFA 3IIKA 4HUJA 4KH0A 2DUUA 3ZU4A 5KSZA 4JASB 1P0QA 5KEIA 3O5AA 4CDRA 2IYZA 1K75A 2G1KA 2B20A 4KUGA 2CL5A 2B8JA 1RRGA 1VXRA 3IJ5A 3O31A 3O95A 4LZZA 4TYWA 4N8DA 2B36A 3VR2A 4E15A 2WSSA 2XBLA 3LUJA 1GDDA 1AKUA 1NMZA 1YZVA 2PL1A 4JBLA 4V24A 1L1EA 2P3OA 3HJCA 5GM1A 1XZDA 2EF0A 2QL9A 3JU3A 5K0LA 2QU7A 4AJ2A 2C2MA 1EFTA 2FPPA 3G82C 2MINA 1L4FA 3LOUA 4PZUA 4YMIA 3WY9A 2ISSD 4C14A 1E8NA 3FZNA 3DC7A 3O7WA 2Q0SA 3E82A 4LW8A 1OTHA 4YEDA 4EHLA 5TQ0B 1LS6A 3FCCA 4NJMA 4UQPA 5AKIA 3K4PA 4A8HA 4EWLA 5KHLB 1WW3A 5FL3A 4QNNA 4BLWA 1IXKA 3D2BA 4NMWA 5M04A 3E0XA 1C7ZA 2BR4A 1A4IA 1YDMA 4PHGA 4JODA 3OPYI 5DSZA 4CM8B 1H2RS 4LJKA 4O6VA 3FA2A 3W5VA 1SUDA 4P32A 1N6RA 3GQBB 3NTQA 4W82A 2V65A 2F59A 5CHYA 5HBRA 4AZWA 1J0DA 1IB0A 2PZKA 3VDNB 1NY5A 4KXFB 4KQIA 2Q1XA 4BV2A 4XD2A 1CXZA 2NO9A 2QRMA 2FSHA 1OHHD 1K86A 5BV8A 3DMTA 1XEFA 1GKLA 2QLTA 3RHFA 5CDSA 3N0VA 4F9TA 1X3SA 2HHJA 5G3YA 2IF2A 3LUGA 5FL7D 5DNUA 4FT2A 2PNJA 1YA6A 3EISA 5B1IA 5JEEA 1O03A 2CNBA 4I9UA 1AN0A 4KG7A 3AVWA 2H59A 3CONA 4NU6A 1L5VA 4FHDA 7AT1A 2QSJA 5JG7A 3RC2A 2C1EA 4BFZA 1V3VA 2ZSJA 3GIWA 3WL5A 1PQPA 1Z37A 1Z13A 3BB1A 3NC1C 1E4EA 4WDRA 2F1RA 1YRQA 3BGVA 1VSBA 1AZWA 2RDMA 3GRZA 2Z5FA 2CY0A 5EIBD 4AUMA 4ZYYA 5I4BA 4X6XA 4N0DA 3SFTA 4CCYA 2DKNA 3CT6A 3GDGA 4MKGA 5B30A 1TK9A 1XCBA 1OIWA 3GGOA 4JWKA 5KNDA 5MGNA 1F06A 2Q5HA 1SD2A 4RVOA 1HL7A 1KDRA 4BO8A 1KAHA 1A9YA 1M2FA 2P77A 2YY6A 2V4ZA 3TGWA 5BWBA 4QFMA 5EHZA 4LK3A 3A6HA 5BWOA 1OZGA 4DRZA 1U80A 4KX3A 3KB8A 3MAAC 4NHOA 3C8UA 4BEWA 2JA2A 2AEFA 1VECA 4GD3Q 5I9SA 1P1CA 1GQ2A 2P78A 3D6TB 1B7GO 2QG6A 2EFJA 3KKPA 1YO6A 4K8OA 3TRDA 3UCFA 1P4AA 3PJDA 4C2TA 5FJIA 5A3QA 2FR8C 3OM9A 4L6AA 5SZKB 3PDIB 4LVCA 1G3QA 3RUFA 1YRYE 4HO1X 1YOVB 1SQ5A 4BNTA 4X7RA 4KPUA 2CL0X 1Y9DA 4CF5A 1Y6ZA 2CZQA 3H84A 3BMNB 5JJKA 4CLRA 3ONEA 2R8ZA 4Y9TA 5ITSA 2JD1A 3LQ4A 4ZCQA 4MV8A 3KIPA 4OBWA 3TNFA 1P2SA 2LWIA 3CEAA 4RPJA 2LRHA 3MRXA 2VH5R 2OD2A 4KQ9A 2FUCA 2VRNA 2IP1A 3EZGA 3NBKA 3B9BA 4HZUA 4EA6A 4DXDA 1OASA 1OAOC 4UCFA 1BHO1 3JXEA 1SHTX 3TSCA 2RG7A 4PPNA 1L5KA 5A3SA 1DMSA 3EZNA 5LM3A 2ACWA 3S2YA 4N40A 3T8YA 2VUUA 5CJPA 3HB9A 2AMFA 1ZYUA 1NRWA 5DHQA 4RVNA 1NVVR 4O0LA 4PYLA 4OHOA 5KTPA 1CZLA 1WQ4A 2UZ0A 3BWCA 4P5EA 4DCTA 1BXGB 3KE8A 1U9CA 4F6RA 5D6NA 5D3MA 3GJSA 3FOAA 3MTQA 3DOOA 3FAZA 3TSZA 3OE5A 3PF8A 4EVQA 5BWLA 3HB1A 3DLTA 1IY8A 4NMXB 4R41A 3QEMB 1W1UA 2EYUA 5A9SB 1CVRA 4KWEA 2PFKA 1O5OA 3R41A 3FGZA 3K2IA 2C9OA 2WJZB 4HNAB 4IDGA 5B2EA 2OQRA 3QA3E 4RTSA 2XADA 4DBZA 1RAIA 3IC5A 3I4LA 5I7UA 5JNWA 4V2IA 4AO6A 2L17A 3NHUA 5HKKA 2F1OA 3IPAA 1H1LA 2PSHA 3SMVA 2XQGA 4K46A 5JHHB 1JPVA 3G59A 3JYOA 1XPUA 1CQWA 1LPAB 1WUYA 5B6PA 3UJNA 1Y6GA 4L6IA 2YWHA 3OBBA 2RARA 2GSDA 3UW1A 1NPYA 5JATA 2IYEA 1VJ0A 3Q5DA 4G1MB 2ZJ8A 3R77A 5JWRA 2X4IA 2PQMA 3RGWS 2LDBA 4DUGD 3D0QA 4UHEA 2J9XB 3QPVA 4RSMA 2EZ8A 4U1RA 4B4WA 1YFZA 2VDQB 1D1TA 3AGPA 3IO5A 2XUPA 3A3NA 1UMBA 4QAQA 2Y4NA 4XTCS 1J2YA 4FOTA 3NBZC 3JALB 6REQB 2JFHA 2QA5A 3ESCA 5E0OA 4YACA 1WQ3A 3ABRB 2QROA 3GRYA 1D9XA 1N6NA 2IHJA 1ZWKA 4DPKA 4EF5A 1AJEA 3BXZA 4JI7B 3ZQJA 3HP7A 2GDJA 4ZT5A 1N5DA 1HFKA 1RJ9A 1OX4B 1VKNA 3SQLA 1WX1A 1SU6A 3VAAA 4PNHA 5CB4B 1TVKA 2QG4A 5EP2A 2VRBA 5J59A 4DUZB 2OV4A 4N7BA 3SSMA 3RSHA 2WOOA 3F67A 5I9TA 4CYMA 5CFMA 2AC7A 2NV2B 3E8MA 5GP1A 4E5NA 2ZDHA 3AUTA 2JNWA 4G8CA 3VZBA 2OBLA 5KPDA 3CJQA 3O6VA 1LDMA 1V9LA 4ID9A 2YOHA 4YCBA 5G53C 5HM6A 1SB9A 3VYUB 2O54A 4FYIA 1E2BA 3EUFA 2Z09A 1PNVA 1YIAA 3PPYA 1G20A 4GWLA 4XD7A 4F60A 1SCUA 3W7VA 1AVTA 3RPEA 1F1JA 2N46A 3WBFA 1HZJA 3U4DA 4ADSG 3IVCA 4CM9A 3D3WB 3HVKA 3RC8A 1M6YA 1ML3A 2QD4A 4Q19A 3OQ1A 3KWFA 5DYIA 521PA 1A9SA 4INJA 3RJZA 3FBWA 1IC6A 1MW9X 4NESA 1ZMOA 1LU9A 3R8CA 4OU5A 3H1GA 3ZTYA 5AI9A 1FC0A 5HIJA 4BJ1A 3WK5A 3PNPA 1E9EA 2F1JA 4LCEA 5FXMA 3BA6A 4P84A 4C4RA 4YJ2A 1W4AA 1U11A 4UEWA 2J0QA 1E5DA 2FW7A 2W90A 4X8MA 1CUYA 4C5BA 2H08A 2WD9A 4PICA 3I6BA 3JQAB 4O4HF 3THWA 4Z53A 2X0KA 4ACBA 1KEZA 4GYKA 1LNZA 1E6MA 4B4KA 2ZUWA 5WRFA 1UC8A 4OFWA 2K2QB 1ZK2A 4WOBA 1Q84A 3WYDA 5BQ5A 3V3KA 3THYA 4XIJA 1NM5A 5JXJA 1PQUA 3PGLA 2R47A 4JJIA 3PIIA 1BCRB 4BQIA 2WOJA 3DBVO 4YBRA 1ORHA 4OKIA 3V2HA 1T9CA 2J9FB 1T0UA 2XMDA 4HEHA 3FI9A 4QXMA 3BRCA 5TVKA 3ZQKA 4Y2QA 2NZJA 1P33A 2BFOA 4GMDA 1T1SA 5IVIA 5LA6A 4ZCIA 5K51A 1BWSA 1WMBA 2CMHA 3VH1A 1OZHA 3N9IA 1E20A 2W71A 1QS0B 4JX8A 2O3QA 1VIAA 2YXLA 1NNLA 1BE0A 2ZR8A 1E1LA 2E1RA 1T8YA 2E85A 3R3WA 4QYTA 3M4NA 4YN3A 4D82A 1W7AA 4F7WA 5JSUA 4KMRA 1JJVA 4IZIA 1R18A 3B3QA 5KYXB 1YB4A 4GP7A 1TF5A 4UHCA 1Z88A 4OAPA 4K6HA 4YECA 3D8NA 4XIFA 3CR7A 2WD7A 2Q2OA 2XY4A 1YVRA 1R0CA 4XUCA 4F84A 2FRXA 4ZQGA 1A27A 1V0JA 3WK9A 5IEBA 3C3EA 4GLLA 3KYBA 3Q87B 3FPCA 4B0OA 1INLA 3E1SA 3M5CA 3DGEC 4M8KA 2H18A 4UNPA 4QGBA 4ZV9A 3V4SA 1E7QA 2ZKLA 4EQ6A 4ZZ1A 1UZAA 3AVYA 3FYDA 2GCNA 1AN9A 1NN0A 4ZRMA 1TKAA 5DMHA 3IUSA 4GDMA 3PGJA 4U2CA 3B13B 5JRJA 3QELA 1G2QA 2DBYA 2IHBA 3HKBB 3O7MA 3OLVA 1DI0A 1V4BA 2I4RA 3CCFA 3EARA 4KYUA 4BNLA 2GK4A 1XEXB 3IO3A 1O6FA 1EJ6A 5EE0A 3AEYA 4HLUA 4BKOA 3TZ6A 4F4IA 1OFHA 4C3UA 3WJ1A 3K9FC 2WTAA 3M6IA 1W36D 2XF2A 2ZTMA 4M1MA 1S8AA 2C3UA 3LFHA 4C2BA 2XR1A 4WUVA 3A58B 4P80A 3NTLA 3QI7A 1EUDA 5EE1A 5AK4A 4MMYB 5E6RB 4I55B 4LRXA 5DTEA 2Q4TA 3CB2A 4CU2A 4CVNA 4JJ4A 1XCPA 4GGMX 1RQPA 2BSXA 3QBDA 2YHSA 2EZTA 4OGKA 3ECAA 3FOCA 1E62A 1PVDA 2IU3A 5FDFA 5BNWA 1TECE 5EIHA 2Y6VA 2I5PO 3OC0A 3QOFA 4WGGA 3PC7A 1M2KA 3EEQA 3T3GA 4DQLA 2UXCB 5FOWA 5GJWC 3LD9A 3NC0C 3EQ9A 5ALOA 5HUQA 3IGFA 1TYBE 5ALNA 3GP3A 1HT0A 3OPNA 3LF2A 5EZYB 5HIMA 3HN2A 3R9XB 1E7RA 2WSLA 1M33A 4BFLA 4DJTA 2B1JA 3DTVB 4L8GA 1FPQA 3MTEA 3GRPA 2WAMA 4EG6A 2PWPA 4DXAA 2O8CB 1GZ4A 3NO4A 3GN2A 2JF0A 2GJ9A 3SM9A 1A95A 3INGA 2ZRPA 1BFKA 3SFZA 3A7EA 1FEZA 4RZHA 3BTUA 1A04A 4HMPA 1D07A 2ERCA 2R6JA 2C78A 4UAUA 4I8IA 2HBQA 1D2EA 1U7TA 4R0NA 3IMGA 4MV6A 4YCCA 3DZCA 4QX6A 1T3TA 3HZHA 3JY6A 3HO8A 5BNZA 1SK9A 1Y6RA 2PS9A 4R1MA 4EO4A 2NP7A 1NPDA 3FLEA 1AA9A 3ZCQA 3TAXA 1JIQA 4DKXA 3B6IA 2QN3A 1M0SA 5LOVB 3GUCA 1BDHA 4NYMR 3TDKA 3DEZA 3UVEA 2BGTA 5FBZA 3CH7A 4IIEA 4RDHA 3DWEX 4EY8A 4HYYA 3HWRA 3TR5A 1PFKA 2ZEJA 1KI6A 2OB1A 2WWHA 2PQ6A 4HC4A 1UC9A 3VRHA 1MAAA 4LXTA 3L7OA 1CEQA 5FJJA 1P29A 1MGPA 4NTZA 4ZYZA 1T9HA 1PKXA 3IV7A 2P62A 3ZHBA 1G1AA 1Y7HA 1PTJC 3GNTA 4GAEA 3BEOA 4EA8A 1P6XA 3K05A 3U7HB 2F1HA 2IU0A 4F71A 2QTTA 5K45A 2VP5A 5KO2A 5M5BA 3Q7SA 5H1YA 3HP1A 1BE1A 1KVUA 1LS1A 3KHUA 2EDAA 2E3JA 3E35A 1M5TA 2ERYA 2QGFA 2VYVA 3M3HA 2QUAA 4O2BF 4PS0A 2P5UA 4N5NA 3SYNA 5LMUB 2HSEA 4OI4A 3ZPXA 5AJUA 1HT2E 4WV3A 3DZ8A 3H86A 4JR1A 3K8ZA 5BVHB 2C4KA 3IUYA 3NBFA 3EX7C 4AS3A 1MIOB 1EFRD 1S4QA 2OGWA 1ZRMA 3ZYCA 2DPYA 4CMBA 3KVYA 2J33A 4EOGA 2HA5A 4YB8A 2BGUA 1Z68A 2HM7A 2CNOA 7REQB 1DXHA 5E6UA 4QRDA 4MW4A 2QE7A 2KX7A 2PMEA 1SB8A 1DOZA 4AJNA 1JFFB 4TPKA 2VH1A 3OQPA 3D31A 3CUWA 4ZQCB 8MHTA 1DIAA 1S2MA 2QF7A 5F35A 4ND8A 3N7TA 3QGMA 3UWSA 3G0DA 3X1YA 3C4QA 1QE5A 2X9QA 1LX6A 4TMZA 3RC1A 4L07A 4MRNA 4LISA 4IICA 3AWDA 3A4VA 5SY6A 2HMAA 1XDUA 3KVNA 4X1KA 3RLFA 5AVSA 5JS8A 2HX1A 4AB1A 3AQIA 3CC8A 4AMUA 1ODCA 3E3AA 3NH9A 5F4ZA 5LPNA 1E9VA 4JI1B 1C14A 4WKCA 4RDXA 2JG3A 4PYMA 1NOJA 4L0CA 4WIAA 1OX6A 1DJPA 4NYIR 1FSSA 4KXWA 2OAQ1 4MI9A 1OVMA 4KCGA 1XZIA 2H5LA 4EJMA 2VJLA 1CR1A 1Q0PA 2ZCUA 4HAXA 1FPMA 2VEOA 3ZW8A 1D2GA 2XYHA 2I6XA 1AG9A 2QPOA 5LD2C 1NXVA 4W5NA 3BHNA 3HHPA 4HH4A 4OD0A 1S01A 1XLWA 1JHPA 2TS1A 4TGLA 2QD2A 3ZY2A 4OJTA 5FUQA 3EULA 4TZ6A 1TYDE 4D9GA 1TB4A 3DVLA 1JR3D 3WQRA 3IV9A 3KELA 1YQGA 2VRCD 5FYQA 3F9CA 1UDRA 3UW3A 4IFIA 1Z0ZA 2BFBA 4Z4QA 2OFPA 2OD7A 3LPMA 5P8WA 2JKZA 4ARZB 1TD9A 2NXEA 1POXA 2JL1A 2XKKA 5CR9A 4GSYA 2GBLC 4LVNA 4NC9A 3DOCA 3VNAA 1RQRA 2OV1A 1DC6A 1SHZA 2WP8J 1FSZA 1QR2A 1RKXA 2F64A 2YFKA 3LHDA 4YT5A 3RTGA 2EG9A 2JGMA 3LVQE 3JQEA 1HOTA 2RHBA 4DPLA 4WY2A 1PBTA 3D0KA 3RIYA 4WFIA 4FZVA 2QTAA 1BJKA 1K5PA 4MB6A 4Q24A 1UP4A 3AB7A 3PQ4A 5CX1A 3VOTA 3ZDFA 5LYJF 1ZQ1A 1SQFA 2KB0A 2QIPA 3COYA 4I2NA 3W1VA 1I2ZA 5DGDA 3IBSA 3VSEA 3D4NA 1QZXA 2P4QA 4MEJA 1SC1A 1TXGA 4ZQIA 5TARA 1HNWB 1X1QA 4DLNA 2RH8A 1E79D 4PSAA 1ECFA 2AK3A 3UHOA 4V1CI 1E9DA 3BTVA 3RS2A 1JMVA 3O92A 4AZ0B 4NEHB 3PC8A 1IG3A 2QTLA 2ZI6A 4JQZA 2VHWA 1FU8A 1MV8A 3OZGA 4Q3AA 1MENA 4ZRNA 4CG0A 1JMYA 5TGZA 2F17A 3E2PA 5AVJA 2ENWA 3PS9A 2OCDA 1SHJA 4IHKA 3T7TA 1ZG3A 2HWKA 3PC3A 2ZYUX 3KVRA 2NP6A 1DEAA 1DGQA 5GMOA 3S0JA 3DXXA 3RFFA 5DSTA 4L8VA 3VUEA 3SYMA 5C5IA 3KOYA 1MEJA 4EL0A 5IJXA 3HSYA 5DW3A 4BJ3A 2A0YA 5ELXA 1BXRB 3I3SR 1OZ0A 1KP3A 1PI3A 2DY0A 3CPSA 1EDDA 3W3AA 3VKGA 1NJGA 6ABPA 1FJGB 3OCCA 1E92A 2AMJA 1OREA 4H7FA 3T5DA 3VHRA 1MC5A 4KZPA 3EC2A 4CKWA 4A7PA 1Y4DE 3ENKA 4QWMA 1AT1A 4QDXA 5EWJB 4CF3A 4YR7A 3U6KA 3K4QA 3QV1A 3TQIA 3ABQB 1YVEI 4ZGGA 1C50A 1WDTA 4GM0A 1XLVA 3WDKA 5BXQC 2NWQA 2PL3A 2FXVA 2WIBA 2YV3A 2ZAIA 3ZCPA 4BMSA 5BY2A 4E4RA 1JDNA 2XE4A 1TYAE 3EXHB 4KH1A 4TYPA 5CVEA 4PZDA 5D7BA 1BGVA 4HQLA 2EAUA 2PQ0A 2C9MA 3AY3A 3PNSA 4JJ7A 1E2UA 2B6HA 4RD6A 2NSHA 1T4DA 2WAXA 3DEFA 4BCBA 3VPSA 4DKJA 1UM8A 2WJAA 4QQNA 4BLTA 3JYLA 4CFSA 5BRJA 3A6FA 1YZUA 4LDQA 1W29A 2P3QA 1G6OA 1QYIA 3L6UA 4DCPA 2JI7A 1II9A 4C2UA 1IN1A 2C4HA 1ZVKA 3BYZA 1XZKA 1C0KA 1WPRA 1SHKA 1YR3A 3EF0A 3FR7A 4XW2A 3UFXA 2OE2A 4J6FA 1COWA 1MO3A 2A3NA 3TLGA 3M89A 1NT4A 4ALNA 4OHZA 1BFUA 3TIXB 2FAXA 4WN3A 4O33A 5DGXA 1R1DA 2MWMA 3BZUA 1XLTA 5K05A 4LMAA 2HK6A 1T0BA 1B0ZA 1P19A 1OB2A 1JLLB 4CTKA 4N6OA 2I29A 4G85A 4QYIB 1VJCA 1CS4C 2E21A 2OZKA 3QVOA 2MINB 4LMPA 4EJSA 2H00A 2ATXA 2Q5CA 1N1EA 4QM6A 3VPCA 4GSKA 4DIDA 3AOGA 3PE6A 5JSZA 4MHSA 5KNDD 3GVCA 3BM5A 2JIDA 4R16A 1PL6A 1U7UA 5DYTA 4BQEA 2XMZA 2C5HA 3UAGA 4FE7A 3RSFA 1NSTA 4NK4A 3EWSA 1OI3A 1UJNA 3EFOB 3NHZA 4Y2GA 5G0SA 1D2AA 5IZCC 1F4LA 1UIRA 4M9UA 5FRDA 4OPMA 1WS6A 3LLSA 2P11A 4YASA 4B8YA 2WYWA 1H5NA 3NW9A 4FBGA 4LNUA 1DTWB 4KVFA 4F4JA 3BFXA 4ZA2A 5JSFA 5AIBA 2D2IA 4CQLB 2YRFA 1IEXA 1TU4A 3R0QA 5DWDA 4JC8A 1HFEL 2OBXA 2QRHA 2Q28A 3MTBA 4IGIA 1LF0A 3DZIA 4V03A 4P92A 4MX8A 1EHCA 4X7PA 4K1LA 5ARDA 5LQRA 4PZAA 2IS2A 1OT5A 4TKUA 4B3BA 2AH5A 2ZB3A 1M2JA 2UKDA 2VA8A 3MCAA 2ZJ0A 1E1QA 3WLHA 4QM7A 721PA 1PG0A 4H4DA 3I42A 4YAJA 4TV9A 1L3BA 1K3FA 2ETXA 1JAYA 1E4EB 1MAVA 1OC4A 1TIBA 2XX3A 3LL7A 1SXJE 3PEFA 1LBQA 4IZ6A 1K8ZB 3R5XA 1F6DA 1EZ4A 4L5JA 4H3SA 4MR7B 4XCVA 5ALRA 3BBLA 2WAOA 4CCYB 5K3FA 2R5FA 4M99A 3FPKA 4K9KA 1CQXA 1VL8A 1CUZA 2QZZA 3UJ6A 1FX1A 1KO4A 1T1JA 3KJEA 3CW9A 1TL7C 2F3QA 3QSYA 1A5BB 2EGGA 2WLSA 3KSMA 2DKFA 2NVBA 1CDEA 3G3EA 4I81A 4JI5B 4F2DA 3SC2A 1I7NA 2ZIEA 3DUFA 2A0WA 4K3UA 1TF7A 2ZJBA 3UHJA 4BVBA 5KYUB 2B98A 2I3BA 1DLJA 3AFHA 5EZSA 1AKVA 5DHUA 1DQRA 3EIWA 1L9KA 3OM0A 2A94A 4HN2A 3EMBA 1I30A 2EOAA 3UXEA 4AY2A 3FWNA 3I04M 3K7EA 4YVFA 2F48A 4C3OB 4OA5A 4O4HB 1F6BA 1UOOA 1WB5A 3MHPA 3EIUA 1WTCA 2XI4A 3R5TA 3S99A 1CT9A 1JHXA 1K98A 4M9XA 4F1KA 1P5FA 2GJ4A 1WG8A 2OCPA 1YDEA 1N3IA 1UT6A 1LEHA 1R12A 1DKPA 2WIJA 4JLKA 2I66A 4M21A 2JEZA 2Z5LA 3KB6A 5I01A 1WRBA 1USIA 5KIAA 2JIMA 1M2VA 3OTIA 2WG1A 2NQTA 1I5EA 3ZU6A 2PS0A 5AI0A 3QFCA 4WOPA 1CF4A 2ONZA 2WTNA 4GS5A 4R51A 2P68A 2CW5A 3NDIA 3PNOA 1EWQA 3H19A 2QVYX 1C7JA 1F4PA 1JVBA 2G04A 3DDCA 4R3WA 4ZO8A 3DFUA 1JJIA 1WXIA 2HA4A 5DHAA 2OM2A 1U28A 1JSZA 1M1YA 1VYUA 5HQTA 3PTZA 3LOQA 3S2IA 2PVSA 4HS9A 2VTEA 4HXGA 5LQCA 5K8TA 2FB9A 3O1HB 4HTFA 3VKFA 1JXQA 2JASA 2CXRA 2ODEA 1XG5A 1TJYA 2DWUA 1GP2A 3TW0A 1L7OA 4IPTA 2VYCA 1VXOA 2VIIA 3WL3A 3MJHA 3Q98A 5TEWA 2L42A 2ZT7A 1SG9A 3VHLB 4CT0A 1Z4JA 2Q5FA 4E5MA 1SULA 5JZSA 1HNZB 2O0KA 1CJTC 4KN9S 5JS7A 5FWDA 1J21A 2BLNA 4BVJA 4DJAA 4CW7A 1K8QA 2NX2A 1Y8QB 3L6BA 4Q39A 3GRKA 2ZUCA 2DPMA 5K4HA 4X6UA 1W5SA 4E31A 4WMLA 1PQYA 5ALMA 4J1QA 3DQQA 3VJLA 1BGXT 1RWKA 3A4MA 3A1TA 1FRZA 2XA2A 3JVVA 4KNWA 2FOXA 5K3SA 4M8LA 1WHSA 3D6MA 2NAPA 4JEUA 2HB6A 5ARCA 1JG2A 3T9EA 3FCOA 3V32A 2A9JA 2IYXA 4LC9A 4H59A 4FUQA 4CM9D 4QU0A 3I12A 3FJYA 3L1UA 1U6IA 2A14A 4ZN6A 5FPKA 2ES4A 2ZQYA 2YHBA 2GJKA 3JAWB 4B6FA 4EB0A 5IJ9A 2J7PA 4GO1A 4PO1A 3DBLB 5AW3A 4QSMA 3Q2KA 1E6UA 2VP6A 3C3XA 3HDQA 3O8RA 4GRAA 4PHFA 1ISJA 3I53A 4H0NA 5BWNA 3NEJA 4CTNA 2Z2IA 1YXMA 1SR8A 1UFOA 2OHFA 1Q7RA 2W2MA 3THSA 3A1CA 1KDPA 1G2IA 4R69A 4U63A 2LBPA 2VC2B 4L0QA 4P35A 3WMEA 4C03A 1RS0A 4B87A 3IR5A 3SC6A 3UY4A 4AT1A 4CV0A 5F98A 1ILWA 3DO6A 3RS5A 2PXHA 2EW2A 1H1TA 2IDKA 3CIOA 5IEJA 2PQ2A 2OZLB 4IW3B 3I01A 1EG7A 1UWCA 5KNCA 4IV5A 2F8MA 3K0FA 5ITZA 1Z25A 3G0BA 2PGOA 2HV8A 2QPTA 1N33B 3TL2A 3ZIDA 5HTKA 1SXGA 2A78A 4E7PA 4MUXA 4OHMA 4NNPA 1F8UA 5E3IA 1NBWB 3T3PB 5GJCA 4CR8A 3GPLA 3ICEA 4RXTA 3ONDA 2FGKA 3KO8A 4WACA 2BTQB 2GYUA 1LDGA 3UJDA 1EM6A 4BWVA 3D2CA 2O2DA 1IN8A 1RFLA 1WJGA 1FYDA 2VUSA 3PVZA 4HDCA 4QDZA 5EZ5A 4RVHA 2O5RA 1OXVA 3DBRA 4F0JA 2ZLBA 5T8KC 3IUNA 4XX0B 1KI8A 1OXXK 2XWBF 1GPYA 2QX9A 2OY0A 3SYLA 1N6KA 3EIXA 4WCFB 4OLAA 3GJZA 1VPLA 3PVSA 3W5DA 4MULA 4HAVA 2Q5EA 3WZLA 5B58T 5I8WA 4GC9A 3NEPX 1LSSA 5FOTA 5FFNA 3M1IA 1DC3A 3EHEA 2WDPA 3F74A 1P2BA 4MV0A 3EJWA 4L3VA 2X8WA 4HLNA 1NNUA 4MYCA 2UZ3A 4U9IS 2OHHA 2B21A 4LTMA 3RRFA 1L8OA 1ZZEA 3BMOA 3JQPA 3OX4A 1BD4A 4H60A 4OQPA 3AR8A 4HLQB 3FUUA 2FPUA 4YGXB 3DZHA 2Z95A 1XK6A 3AR3A 1KNXA 3M81A 1PT7A 2HTFA 3JD2A 3KKNA 3HDVA 3PGKA 3T9DA 3L46A 4O2BB 3EASA 5A71A 4CMJA 1GPKA 2PX3A 3MJSA 2XUIA 4HXFB 1CQZA 4NDAA 4WESA 1EU1A 5EGNA 2X0FA 4JWTA 4NFLA 1AQJA 2HWXA 3TGPA 1EAMA 1MJFA 4LRUA 2WQ7A 2Y27A 2BFCA 1EP9A 3NFYA 3KKEA 1QCDA 2VZEA 3DBOB 1RM5A 3WSWA 2DCUA 4YCJA 4PWZA 3GH3A 2EFDB 2NYVA 1LJLA 2QK4A 1S2IA 5K4AA 4Q4JB 4ENWA 1NXSA 2PCJA 1JFRA 5FUMA 1UM9B 4JL8A 4K86A 1OIXA 3LT1A 5FR1A 1S2GA 1EFUA 2CJWA 4NYJQ 1P2DA 1YJCA 1T6ZA 3DB1A 4YJ3F 1AB5A 2I3GA 5CIQA 1GZSA 3U7IA 3X1WA 3WA7A 1JDVA 3BWXA 3K15A 4P3OA 3G23A 2QTRA 2BL4A 2KJQA 3ZCRA 2ZJFA 2XWSA 1B1CA 1Q0ZA 4DT1B 4GOND 4IQ0A 5BSTA 4X62B 1GL7A 2QTGA 2YVLA 4KE7A 3LP8A 4OU4A 3ZCXA 2B8TA 1EB8A 3C3BA 4U9HS 4JMLA 2EWVA 5ITVA 3REGA 2ROQA 3VSBA 1UXGA 4EPWA 4YJGB 4BYGA 2D7DA 5BR7A 3SZRA 1YUMA 4QGGA 5IUNC 2ECQA 1HLFA 4FX2A 5JAIA 1QU3A 3IR7A 5CYPA 4J0DA 1K7CA 4EQ6B 2IYAA 3NETA 1U7WA 4KV7A 4IJ6A 1H6CA 3DC2A 4MYRA 3SKVA 1EWRA 3DHEA 3STTA 3WLMA 3AU9A 4ZO7A 3NVKI 5JIBA 3RYHA 4ODIA 4HDSA 2O8NA 2Z2ZA 3F7MA 1M0EA 4MGHA 1KNQA 4G41A 4GVLA 3ED1A 5KQSA 1ZR2A 3L82B 5H5JA 7ADHA 3U1TA 2Q2QA 4JJAA 3G1TA 1R15A 4A03A 2GILA 3IBTA 4Y30A 3GFFA 3ABSB 3OKFA 5PGMA 1EGAA 2MHCA 3P2OA 1Z4MA 2X8LA 3ASZA 3FWHA 4I3GA 3SSOA 4AURA 5JE8A 2BEWB 4FFBA 3LQQA 2H51A 5EIXA 1WLSA 5NLLA 2WT8A 3H6HA 2UUCB 2AF4C 3O93A 2C0QA 1T4GA 4FIDA 4ESEA 4MAFA 3AOEC 4F1WA 4F2PA 4S1TA 1WHTB 3UMGA 1SNYA 4PX9A 4WKNA 1YRLA 1NWCA 4IGEA 4QQRA 4JJKA 3P0JA 3N8DA 2Y0DA 5DN6D 1FFYA 4GOLD 1X1CA 2GEFA 5LC1A 5BN5A 4C01A 3RIGA 5TQ2A 1U90A 3CTPA 3TLJA 2WNHA 3A3PA 1KMHA 3K70B 3I2YX 4RQAA 2PUHA 4UFOA 3TZQA 2DFDA 4RJJA 1L5NA 5B3KA 3N2IA 3IUQA 4A8JB 1SPXA 2Q8PA 2Y9PB 4IIUA 3ZXUB 3T3HA 3FNEA 5GAJA 1Y1PA 3T1YB 1CZNA 3U4QB 3V33A 2VYVD 2FPIA 3GAMA 4MI6A 4AZ3A 5C7YA 3TI9A 3OX1A 3OC6A 5LIRA 2PD4A 2B9VA 13PKA 3LO8A 3ZTTA 5TPWB 3UTCA 3D6JA 3AKCA 3H0EA 5KYNA 3MJFA 4GWGA 3B78A 2VDWB 1MABB 3G68A 2EQ5A 3FW1A 4UUQA 4HVLA 4XYGA 4C0LA 1I6WA 2BELA 2CN1A 3I1FA 4P36A 1G19A 1KZGB 3KQYA 2GM4A 4QOGA 3L8YA 2O4UX 5JAUA 5TLSA 4OHXA 3HJRA 1I01A 2AJBA 3HBJA 1JILA 3P9YA 4BFWA 4BDSA 4DBLC 2GA8A 1FMJA 1YKGA 1WVGA 1KEVA 4K6MA 1PJ4A 3FSGA 1TMYA 2QE7D 1U8FO 4KLZA 2K6GA 4YHBA 1CF2O 1Z75A 1FXUA 2O4CA 2CEKA 2J6CA 2QRZA 5JH7F 3QK7A 4X41A 1DAOA 4RWEA 3UG6A 4DRYA 1I4DD 4YP6A 1NSFA 1E4VA 1KFJB 2G28A 2Y0CA 3D4BA 3QA9A 1U1IA 1IBCA 1RI4A 1X8LA 3Q8WA 4Y2TA 5F4BA 3NASA 5DI3B 3U9TA 2H1VA 4L95C 5LL6P 1RTTA 4OQ4A 5C53B 4WHMA 1GZ3A 4GOJA 2VHTA 1VG0B 3Q85A 2ZU0C 4GEGA 4CNBA 3E5HA 4YMTA 3PL5A 1PSZA 1PR6A 2CXXA 16PKA 1VE5A 1TUBA 3HCFA 3QU4A 3KKOA 5E3JA 2Y1CA 4TQUS 4E3WA 4GI5A 2BFFB 4P0QB 4AJJA 5JFGA 4GC5A 5HIIA 4YRNA 4RLHA 3MGAA 2BRUC 1M5UA 2LCIA 3KVVA 1Z08A 2AN4A 5E7MA 3UH0A 4QTYA 1ORIA 1JL3A 1TRKA 2OWDA 5LSAA 2IW3A 3AJ8A 3EDOA 1VB3A 4MDFA 5BN3A 4IDHA 1B26A 1N8TA 3PU6A 1EX1A 3AI3A 4X3PA 2ERXA 3UHFA 3PQ7A 1UADA 4FNAA 2O8FB 1QVVA 4RXUA 3JQ8A 2YS6A 4U6QA 5H9VA 2YRXA 3TOVA 3F7NA 4QYXA 1WCV1 2YV1A 1Q95A 3IALA 4WH0A 4Q9LA 3PIDA 2XGOA 3QYFA 1YJ8A 1Z5VA 2GVZC 2OVFA 2EIHA 3E7DA 5F9FA 1KY4A 2JEYA 3AR2A 3FDZB 1DQSA 3L7JA 3DBIA 3MLAA 4XDGA 5TS3A 3WGYA 3KQHA 4DLTA 1L6IA 3WWYA 3W8RA 4URHA 1CUIA 2OORA 4BX3A 4HB0A 2X40A 1WUTA 4KYIB 4MDHA 5FA6A 2UUPA 4KQEA 4KR9A 5A5FA 2PS1A 1TEHA 3WIOA 1ST3A 4A0FA 4FGKA 1E58A 4EMUA 1ETHA 2B99A 1I3NA 1JEQB 5B4VA 1E60A 2HHAA 4G0QA 4ZCRA 2DECA 5IASA 3WLKX 1E9RA 2CMDA 4Q4AA 4K2HA 3DVAA 3Q3HA 1XHLA 2O0MA 4YJKA 2ZT5A 4MUKA 3GARA 2RK6A 2G08A 4H6PA 1CUAA 4N3NA 4EAAA 5AI5A 2QAGA 2MU1A 4TT3A 4ZKEA 1ADBA 5JDIC 1V1RB 4R2HA 3K6KA 1FFXA 3HVUA 1GADO 2XCSB 1R5OA 2VYNA 2CXSA 1TO1E 3GR6A 3O4VA 1U3UA 1XZ8A 1OBCA 2PAFA 2Q3FA 4J8PA 3HVIA 4M0MA 4MVJA 4EEXA 2LW7A 2P4SA 2ZYIA 2WZBA 3GP5A 4L15A 1BH2A 3I39X 1YA8A 3BICA 3AZOA 3WZ2A 1WMFA 2C77A 1VJ5A 4XPIA 3GLHB 3SE7A 3ZY5A 2KM1A 5AI4A 4NU8X 4ZI7B 4MQEA 2CHVA 1GTVA 2FG7C 5K09A 3R3JA 1V41E 2BONA 2RI6A 3CWZA 1FYFA 2YVAA 1TZMA 4GBGA 3GV0A 1C3OB 1B16A 3KKLA 4HAUA 3E0QA 1N2CA 1LKZA 2D5LA 1E4YA 4I4CA 3T1VA 3W2IA 4PZYA 4F1JA 2DSNA 2EP7A 3K4HA 1ZKDA 1O96A 2AG1A 4KNVA 1QK3A 2FEPA 3ZH9B 2RGRA 1P7CA 3X2SA 5JAMA 2WFLA 2ZUBA 4GLBA 3W3AD 4AP5A 5J4HA 4GPEA 5TJHA 5J5CA 2NQ2C 1YDHA 1SEVA 1MRZA 4OQEA 4PCVA 3D0RA 4F12A 4MOWA 2HMYB 1U8XX 1W8IA 4MZDA 5CVJA 1GXSA 1LSOA 2XSZD 5BW8A 2JAPA 3WGNA 1FNSA 4RHTA 1YK0A 1U0SY 2V59A 4IF6A 4LY6A 5T6BA 3SFVA 3V7NA 3F71A 1B0AA 4IGFA 2IWRA 2HGZA 5C52B 4YMGA 4PZ9A 2XB4A 2OAGA 5F5XA 2FFJA 3HI6A 3A9RA 1UBEA 1OWMA 2GYVA 3BB3A 4QA9A 1FX0B 3KKQA 1TTQB 1GG2A 1NI4A 1AO3A 1E9BA 3LY8A 4TLAA 2F43B 2Q3HA 3VTZA 2QL6A 2H1SA 4JCCA 1KTIA 4D2IA 2C7PA 1X7HA 3HYSA 4J76A 3ZJ5A 2VG8A 1R0YA 1COWD 1U04A 2FN7A 2GLUA 2YJGA 3IBGA 3UGKA 2PGLA 3COWA 3TIVA 1JDJA 3OG9A 2QGNA 4AXBA 5CURA 3MF4A 1SH7A 1KQOA 2CHEA 5K3DA 1N5LA 1FIUA 2O20A 4LSZA 1PGNA 2BISA 1NKSA 1JHRA 4W5RA 3V1LA 4AN4A 1YQEA 2OZPA 3EVCA 2QUKA 1DIRA 3F6BX 1WUIS 1GFWA 1HNNA 2IHZA 3L6CA 4IS2A 5DNAA 3KXLA 4CKWB 4CKCA 5KOJA 3AXSA 3GCGA 3FFBA 1Z7GA 3CA8A 4D4LA 3LPNA 3SWWA 1A9RA 1EFPA 1ISHA 1G64A 3ETEA 3FMGA 3KTOA 3LYLA 4RGVA 4DANA 2J4CA 4G63A 2PR2A 3UAYA 4K8RB 1LK7A 1QNLA 4YUAA 2GD0A 2MMCA 4GGOA 4TVBA 1BMDA 4G4GA 3WLRA 1K3UB 1AUXA 1X0XA 4Z6KA 1H23A 2YJNA 1Y6FA 3GRRA 4QDOA 3CW8X 4DNOA 2BKAA 4YREA 2JS7A 2YHIB 5G2OA 4HUTA 3VV3A 5FEMA 1JFVA 3AONB 1PK9A 2V7XA 5FNVA 4HMQA 3ZYZA 1I7QB 2ZSEA 1G4UR 1TAHA 4QU5A 1CQIA 5J3JA 1P1KA 4IZOA 1YI8A 1I94B 2EBUA 2ZRCA 3JRWA 3TLGB