3DV2A

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from bacillus anthracis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
187
structure length
187
Chain Sequence
RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of nicotinic acid mononucleotide adenylyltransferase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
total genus 49
structure length 187
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3dv2A00
4A91A 3HZRA 1YIAA 2J09A 4ZT2A 3KT0A 1HYBA 1IQ0A 4MVWA 4DDHA 1WXEA 4MWEA 2B7LA 1T9GS 4EG1A 4JZYA 3SZGA 1BS2A 2CFOA 3VU8A 2DLCX 4EF6A 4MW4A 3KFLA 4EG7A 1I6KA 5LM3A 3SDBA 5FNZA 4ZCPA 4J76A 1X6VA 4NATA 4ARCA 2J08A 1O0CA 1QJCA 1JZQA 2A1TS 1OWPA 3MLBA 1LI7A 2XRZA 1KH1A 2DPLA 3COYA 3CVWA 1CT9A 1NSYA 3G59A 4RUKA 4F3RA 3GUZA 2QTRA 1N1DA 1O94C 1MOPA 1J21A 1N75A 2CT8A 1K97A 1T6YA 4EG4A 2GM3A 4QBTA 5LLTA 3F3MA 1M8KA 3KT3A 1JGTA 4MVCA 3FDXA 4NAHA 5KCMA 2J5BA 3FI0A 1TFUA 2QTNA 1MBZA 1WJGA 5HG0A 3MLAA 1OWNA 1K4MA 1U7DA 1N2HA 1Q11A 1GTSA 2QUJA 4HJXA 1PFUA 1T9GR 2DUMA 4KPUA 2DETA 3ZUGA 2VTBA 3K9WA 2AZXA 2CV0A 2CUZA 4CT0A 1JEEA 4DJAA 1IHOA 1FFYA 1I6MA 2QUKA 1M1ZA 3FOCA 3FNRA 1KH3A 1J70A 2R5WA 3IOBA 1M8PA 4I6JA 1NYLA 3ISJA 3PRHA 2BYTA 1WXHA 1KP3A 1GAXA 1EFVB 4CDMA 2Z3VA 3KT8A 4YP6A 1O96A 4ZT5A 3SP1A 4HJRA 1UFVA 4XFJA 2QJFA 3L93A 2QJOA 2PG3A 3COVA 4H3SA 1YIDA 3UY4A 2IP1A 4S1OA 2ZUEA 3U1VA 2PIDA 3FH0A 4MUJA 5H16A 1MAUA 2PZ8A 2X0KA 1ZUNA 2X1LA 3CLRC 4MUHA 3GLVA 3TZEA 4KKVA 5LFAA 2D5BA 3LOQA 4PBSA 1NI5A 1RQGA 3IOEA 1N2IA 3IUEA 3CLTC 1QTQA 3ZGZA 2EJCA 4MULA 4UZEA 1G8GA 5KHAA 3ELBA 4JYZA 4XSVA 1U0BB 1JECA 3A05A 4HPWA 4I6GA 4OUDA 1V47A 3DO8A 1VBNA 4MW1A 2XRYA 2ZP1A 4HK4A 2CSXA 1KKUA 1KR2A 3FIUA 2A1UA 1EFPB 4MW9A 3K32A 1IFXA 1NUPA 4MUGA 4NAUA 2CYCA 3HFJA 2Z09A 5DK4A 1ZJWA 2TS1A 1MRZA 2CV1A 3HMQA 5F23A 1WY5A 4U8HA 3OTWA 1MC1A 3KT6A 3IVGA 1TYCA 3CVUA 2HGZA 2WQ6A 1JZSA 1QU2A 1TYAE 1WXGA 2YWCA 4JXXA 1PFWA 3CVYA 1KP2A 3FG9A 1N2JA 2AKEA 1JMVA 1F7VA 5J59A 1F7UA 3IODA 4YP5A 3Q12A 1WQ3A 3N8HA 4L2IB 1NZJA 3DV2A 4KR9A 3FY4A 1KQNA 4MUEA 4AS1A 3IH5A 4J75A 5HUJA 3CLUD 1I6LA 1EFPA 3IMCA 4F4HA 4DNXA 2CYBA 2CYAA 1OBCA 1QRTA 3C8ZA 1ILEA 1KQPA 1A8HA 1R6TA 2DR2A 1LI5A 1N3LA 2H29A 2D54A 4PY2A 4EGAA 3ND7A 3TQIA 3UC5A 4FZJA 4R2LA 3FWKA 3AG6A 1N2BA 4G5FA 5TEWA 3CLSC 1Q77A 3NV7A 4ZT4A 4ZT6A 5BNZA 4KR6A 2A84A 2DXIA 2NZ2A 1KORA 4ZT7A 3VGJA 3COWA 2VTBB 3SZ3A 2EL7A 3PXUA 4RPIA 1U3DA 1NURA 3MMXA 4MW5A 3ZXSA 4CDNA 2JA2A 3H05A 3ND6A 1O97D 1KAQA 2A7XA 1LW7A 1ULHA 2E18A 2ZUFA 1OD6A 4U63A 3AKZA 2CV2A 1GPMA 1EFVA 3N9IA 1MB9A 3UMVA 4DDKA 1JIKA 5K0TA 1SURA 3S3TA 3Q4GA 1G59A 2O8VA 3HGMA 1JHDA 1EUQA 1IRXA 4JXZA 3H9CA 1S4MA 1K92A 4ZT3A 1J1UA 2A4MA 1QU3A 3DLAA 1N2GA 4MVYA 1O95C 5EKDA 3IVXA 3UOWA 1I2DA 1O95D 1OWLA 1VBMA 1TYBE 4EG5A 2X1MA 4MW6A 2WB2A 1WXFA 2QJTA 2YY5A 1Q19A 2WSIA 1DNPA 4ND7A 1TYDE 4I6EA 1O94D 2Z08A 4MWBA 2G36A 5IJXA 1EUYA 1PG2A 5TGTA 3PNBA 1GZUA 2GKSA 1OWMA 2YXNA 3I05A 4EFKA 3NBAA 1OBHA 4TS1A 2JANA 3Q10A 3X1MA 3G6KA 1U3CA 1O0BA 2RD2A 4MAFA 4MWCA 4MUNA 1YI8A 3LCJA 3ND5A 1M8JA 5IHXA 4OUDB 2HZ7A 1MB2A 3CLUC 5J58A 2WQ7A 1QNFA 1M8GA 1N78A 1WKBA 1K4KA 4R2MA 3TZLA 4E1AA 3IDFA 2RE8A 1P7PA 4K0RA 4EG3A 1J20A 2DERA 2NSYA 1QQTA 1X8XA 5H7XA 1QRUA 4YP7A 3PNYA 1VBKA 1H3EA 3GMIA 3RBAA 1B6TA 2HMAA 3SEZA 1YULA 1MAWA 1PFVA 1R6XA 3P0JA 3HL4A 3P52A 2E21A 1XJQA 4MW7A 1NUUA 1H1TA 4DDMA 3RFFA 1NUSA 4KR7A 1XNHA 2PZBA 1EXDA 4ARIA 4NZPA 3N2YA 1WQ4A 5DB4A 1YUMA 4Q16A 4WSOA 4EG8A 3INNA 4NX2A 4MWDA 4MW0A 4ZCQA 5AHWA 4U7JA 1J09A 2QUIA 2DEUA 1FYDA 4XFDA 1U7XA 3CLTD 3ZJTA 3AIIA 4MVXA 1OWOA 3P0HA 3ZXIA 4WNYA 2X3FA 3H97A 3D6UA 1TQ8A 3ZIUA 4DLPA 1F9AA 1NUTA 4R0NA 4YMIA 4NDAA 1JIIA 3A04A 3H9BA 3VRHA 1VL2A 1XNJA 3CVVA 3NBKA 2GOYA 4K03A 1N2OA 3RK1A 4MLPA 3X1JA 3RHSA 1T6XA 4KPUB 1TEZA 5FO1A 1PG0A 2PZAA 3L92A 1Y42X 4UZFA 3SEQA 3TS1A 1O6BA 1M8FA 3ILVA 3HV0A 1IH8A 1R6UA 4PBRA 3CR8A 3COZA 3G5AA 4G5YA 4MQ6A 1YUNA 1COZA 1JEDA 3MXTA 3BL5A 2E0IA 3JXEA 1PFYA 3LE8A 3QTTA 4ZCSA 4MW2A 3CVXA 4OJMX 4ZCTA 3AFHA 4QRDA 3UK2A 1J1ZA 1V8FA 4QREA 4L2IA 3RJZA 1T6ZA 1Q15A 3QTBA 3D6VA 1GTRA 1JIJA 3ZJUA 3IVCA 1EJ2A 3OP1A 3IOCA 3IMGA 3TNJA 2V0GA 1NUQA 2IJGX 2VXOA 2AG6A 3SYTA 2I1LA 3FHJA 2V0CA 2PFSA 5HUHA 3P0IA 1G8FA 4PBTA 1KH2A 3FETA 2J07A 1WXIA 2PXHA 4Q93A 3H99A 1JILA 1F4LA 5DEOA 1IVSA 2BTEA 5TEVA 5KWVA 5TS2A 2OQ2A 3PNVA 4ZCRA 1WOYA 1H3FA 4EG6A 4AQ7A 1G8HA 2C5SA 2D13A 1KAMA 2IELA 2YWBA 1N77A 3IUBA 1NP7A 3MUEA 2O5RA 1MJHA 1O97C 3A2KA 3QE4A 2OV4A 1WZ2A 5J5AA 1VLHA 2JAXA 1O5TA 3AG5A 4P2BA 3CA8A 4DE5A 1D2RA 3E27A 2H2AA 1H3NA 1ZH0A 4GU5A 3M5WA 4X0EA 2A88A 3CLRD 1M83A 5DASA 5FO0A 1IQRA 1N2EA 5JBNA 3N05A 3TQOA 3X1KA 1ZH6A 3A4IA 4MUFA 1IQUA 2J4DA 2QUHA 1GLNA 1GN8A 3RK0A 2A86A 3IMEA 3AL0C 4MUKA 3CLSD 4G6ZA 3ZJVA 2QTMA 4GRIA 4JFAA 2A1UB 1XNGA 1QRSA 4YBRA 4CQNA 3DPIA 4MUIA 2A1TR 2E89A 1O96B 5K0SA 1KQOA 4BWVA 4ND6A 1EE1A
chains in the Genus database with same CATH superfamily
2I7XA 3DR3A 1T4CA 3ED1A 1LBHA 1UMBA 1ILWA 1NNSA 4UQPA 3VC7A 1SBZA 2VHJA 5LB2A 1M33A 3KQQA 4OHCA 4DDVA 1G38A 3T9AA 4CVNA 1YI0A 5JSUA 2Q5LA 1N9GB 2FF7A 3DDZX 2G07A 3PI7A 2FWNA 4Y6PA 2PL1A 4C04A 1BS2A 1HXHA 2PWYA 2RBKA 3LO5A 4IDAA 3LDFA 4M9QA 4OI2A 3RQIA 1ETUA 2BSQA 2HBZA 1A7AA 5JROA 2BFCB 2PLNA 2M1XA 1XRQA 2F1OA 1MR3F 2DUNA 1PR9A 3OOEA 4HDNB 4OHVA 1E5LA 4ARCA 5C8ZA 1L7VC 4TMTA 4XWTA 1BMFA 2ZE8A 3DEAA 3PSAA 2EQBA 2PUBA 1BWPA 2B3TA 3G9ZA 2JAQA 3EE6A 3OP4A 5FEUA 5I7OA 2PQ0A 3WRWA 2A5LA 1JTEA 2OD2A 1GQOA 3GLGA 2ZJFA 1TJNA 3HNOA 5KC9A 2JGRA 1QZUA 2ZWMA 2XZDA 3OH8A 5K8LA 1J1IA 2H51A 3TLXA 3CKMA 1YR2A 3PGMA 5I7EA 1CEXA 2GBPA 4F3RA 1GPUA 3C8UA 2A94A 2XB8A 4WY2A 4EG4A 1DXYA 1OC4A 5IX8A 5P8WA 5IC6A 3SEAA 1GZDA 1TK3A 5E6RB 1GQRA 2F64A 2F43B 2PUTA 2XTAA 3CKYA 3O93A 3QSGA 1IBMB 1ZL0A 2FJUA 1P7WA 3U26A 3LQQA 1ORDA 4TRMA 1S89A 4BNUA 3SS7X 1UBUS 1FFEA 3EXG2 5CXSA 1OX4B 2FEKA 2H4WA 3FFWA 3VTZA 1WJGA 4ICIA 4NQRA 2B8NA 2JFUA 1U7DA 1WU7A 4ENVA 1N2HA 1QGZA 1TF5A 2O2EA 4M53A 3RYCA 4YNBA 2EWWA 3GG2A 3B3AA 1UXJA 4CEJB 3N0WA 5LP6C 4C3VA 5K2OA 5LLSA 4D81A 2XE6A 3CNHA 4ARZA 1AKTA 4EW1A 4MRSA 2J9GA 3MT9A 2P69A 1Z4KA 4NU0A 3R7AA 3U4AA 4DAOA 1GKIA 1L5VA 4CODB 3A31A 4FD2A 5DHUA 1W5BA 1GZSA 2XXBA 4YGXB 4C4YA 3LUHA 3O9MA 4CCWA 2JZNA 1KZ6A 1VIAA 4Z3KA 4IBOA 4QYTA 3IOBA 3K2IA 4P3OA 3K16A 3LUJA 1EVJA 4TTVA 2WQZA 3HP1A 2XXAB 4RK0A 1EFVB 1OJ7A 1UKZA 1ZDMA 2WD7A 3M3HA 4CDMA 4CMKA 2D0DA 2HXSA 2NSJA 1CB7A 3PEEA 1EK6A 1OMOA 2FG6C 2Q4BA 3EARA 1K8ZB 2ZG6A 4FQ7A 4KMRA 4LVUA 3BGSA 3DC2A 4NZ9A 1V3VA 5ALYA 3ZD8A 2CXNA 1KSHA 4ITRC 4JLPA 3NYQA 3UY4A 1ORRA 4AS2A 3D2AA 3HWWA 2AW5A 4KWEA 3RS5A 1KYYA 3KIPA 5E9QA 4BECA 3OUUA 5FOWA 2X19A 4C2AA 1DO2A 2PRSA 2YS6A 5HYVA 1EWYA 4YJHB 2I91A 3M2PA 6GPBA 5MHTA 2I6UA 2NP6A 4MV0A 1ZUNA 4LY9A 2WT4A 3GLVA 3AILA 4QO7A 5A2GA 2LNDA 4GMXA 4XDYA 1D07A 1NI5A 1NMYA 2RGCA 3GGGA 4J07A 2IYLD 2ZJBA 1TD1A 1NAHA 3FPSA 4PLPA 1SZJG 4V0MA 4WLOA 2ZYDA 4WZAA 4ZU1X 1PYGA 1C1HA 1W35A 3T7RA 4JYCA 4WEOA 4N6GA 4ER0A 4G4SP 3X44A 4HAUA 1D9XA 2X15A 3TTWA 2IE8A 2EJCA 5JCJA 2AR0A 4DJEC 1VYUA 1E89A 2V6JA 2ZB2A 3DB1A 4EVQA 5F9FA 1U0BB 1E2BA 3T4PA 1Q2XA 3F98A 2GPYA 3O4GA 1WB6A 3LBHA 1YDWA 5CVCA 3RW9A 4MV7A 1YJQA 4XIJA 1J5XA 3AJ9A 4YCBA 4UHBA 3WSTA 3ZEIA 2Z1MA 1DQNA 2JAHA 3D02A 3GGOA 3GJYA 3MTBA 2ECOA 4YYEA 3ZWKA 5HDQA 2F17A 3SIWA 2UYGA 3UV6A 1L7DA 1NP3A 1PRYA 3V48A 2Z09A 3TTSA 2G5PA 2GPWA 4HUQA 3FDJA 4X61A 5BMVF 3T7KA 5TNXA 4KFTA 4IIHA 3DDUA 3I5UA 4DV1B 1QZXA 1YWGO 2AMLA 2NU8A 1K75A 4EQ6A 2ZE6A 2P40A 4G1UC 3VU9A 3HN7A 1YZQA 3W6OA 3ID6C 3L7IA 3IVGA 1YSCA 5JCZA 2WQ6A 5G4KA 2AFHA 2GEJA 1BGVA 3KHTA 3H17A 3L8DA 5HTKA 4Y6QA 3ZH2A 2FW9A 1HH4A 4QECA 3GQBB 5ALQA 2WLSA 5IJ9B 3OC0A 1YDHA 5ELMA 3BGOS 5GINE 3D1VA 4JC0A 1F7VA 4MYTA 1M0WA 5TE9A 1CIVA 3I9V6 2QTHA 2UVDA 4JFRA 5EQFA 4MQEB 5K4AA 1AKUA 1C4XA 3MAJA 3V8EA 4B3RB 3DR5A 1GCGA 3WLQA 3N2LA 1HZZC 5E8JA 4B4VA 1TO1E 3TFWA 4D8VA 3R5HA 2W6PA 2CYBA 2F4NA 1UBFA 3RYHB 4ZZ0A 1DSSG 1KQPA 1JXOA 1X2BA 2VUUA 2VRCD 2YJZA 4HS4A 5ED0A 2H29A 2W2OA 2YNMA 3L9WA 1S02A 4UM8B 3U48A 2NNWB 3KHSA 1I7QB 2NSHA 5T67A 2YOFA 5CVJA 4RJIA 1E3MA 4BKRA 3T5TA 4D26A 1IBSA 2QR5A 4OXQA 5CYOA 2DPXA 3RJ9A 4FR5A 4H35A 1HWYA 4CBVA 1HTBA 1M3SA 1YVUA 2OBLA 3KXDA 2O8DB 4QXQA 3WK7A 2QYSA 1T43A 2W2VA 4NMXB 2VQEB 2R00C 3NIBA 5ALPA 1DAFA 2IZZA 3KLPX 4FX2A 1G8KA 4YJHA 4ZOLA 3E3AA 4C1BA 4E5VA 4B2IA 4RLQA 1FS5A 2JLSA 3EWSA 5KVVA 1KJQA 1QLWA 1T3HA 3HFGA 2CEKA 2JA2A 1OXKB 1DT5A 3B5JA 3DQZA 3H04A 4DUZB 2OZLA 2GPNA 3ER6A 1DOAA 3PDIA 4DMGA 1A7UA 4G1EB 4P3YA 1SVIA 4NBSA 4YT8A 1R7RA 2CLFB 2I1QA 2HIHA 2XCQA 5ILGA 1Z16A 5EFOA 4ESOA 1U4NA 1X2EA 3Q9UA 1D4OA 1XLWA 3E22A 1B42A 1EFVA 3F8WA 1UJ2A 3I61A 3NIDB 1RAGA 3EMBA 3BWVA 5E2AA 2O8EB 2ZVDA 3FCEA 3NGMA 3GRKA 1E79D 3A3OA 3EXHA 2PMWB 3OUZA 5CYFA 4AY5A 3KSDO 4Q1AA 4CQJA 1NTRA 3N0XA 1W0KD 3AVOA 4AUKA 5CH3A 2D3TA 2PRYA 2W2QA 1JT2A 2AOUA 1HG1A 2C04A 4IW3B 2H0QA 4RV5A 5L7YA 1QCCA 4N12A 3TQRA 4YXWD 3BA6A 2VQ6A 1YE8A 3QP9A 1KBQA 3KD3A 3O0TA 3PKZA 4TVOA 4UMEA 2VI5A 5LQSA 1O95D 3IEPA 3LDHA 4OGGA 4XVUA 4CR8A 5ILOA 3CUVA 1E3DA 5MN6A 4L08A 4R8VA 2VRBA 3V1LA 2ZI9A 4LQLA 1AUPA 1O94D 4X1KA 4B7AA 1MEJA 4MDHA 3M7IA 4AECA 4E0BA 1CP3A 2FP4A 3PFHA 3BORA 2HDOA 5DBOA 4UW9A 4ZAVA 5FWDA 2GN9A 2O7VA 2QL9A 4ZV4A 3IMFA 2H5IA 3V1UA 3I05A 3IUJA 3HLKA 3WYDA 3RUFA 4U2CA 4C4ZA 3F96A 3PGXA 1T2VA 4YV7A 4BGUA 3BH0A 2JIQA 1G3RA 3MUOA 3ZU6A 3SMQA 3OAAA 4HGPA 5CA0A 5ALEA 3FBWA 1DRVA 1PVOA 1GN9A 2BM1A 3LXMA 4XWWA 1L7XA 2UYYA 2G5TA 5MFPA 2O19A 2BR4A 3NWBA 5C7OO 4BL5A 1Y98A 2PS9A 2JHGA 2Q4TA 4L4RA 4X3OA 1DBQA 4HV4A 1M8JA 3MINB 5A2QA 4D3XA 2ZSDA 5IHXA 1W6RA 4FM9A 4DB2A 2OYSA 2QZ4A 5HQ3B 2ZWOA 4FE4A 2J3DA 1G98A 4QUDA 1K4KA 4TTQA 1XCJA 3CW8X 5FFMA 1IDOA 4E1AA 2ATCA 3Q8MA 4PHFA 1UJMA 2FZ5A 4NYIQ 4I9FA 1UXOA 1PVDA 5KYTA 1IZ9A 1U9IC 2C8KA 3E58A 1YAHA 1JYFA 3GRYA 1RRVA 2IDJA 4KPGA 1XZDA 2ONZA 5EIHA 2M6LA 4A0HA 4CMCA 4EHDA 2XMGA 1UJBA 1Z36A 4PLVA 3PITA 2FGJA 2PT7A 1Q1AA 5F4ZA 5HCUA 3RS3A 1AV7A 1J56A 1Q7BA 2FMIA 4IZHA 1BVHA 5DBIA 3O8NA 3GAZA 4MPPA 4A2QA 4CU5A 1KEVA 3VR6H 3NONA 1GU0A 3IE2A 2I3AA 4CHTA 4MO9A 4W5RA 4TLEA 5TX7A 2JD2A 1HZJA 2WIFA 1XTJA 2YY6A 4JXJA 3H5IA 4MP3A 4RY8A 3M70A 4JP8A 1AXEA 3E35A 4KO2S 2PO5A 2V03A 2R7KA 1XNHA 1M5TA 4AZTA 3JD0A 2BLNA 1DT3A 1EUDA 2WZCA 1Z6ZA 5DB4A 3VPGA 4NCNA 1U04A 3L7YA 4GOMD 2J8ZA 4UD2A 5C4IA 2HRBA 4O63O 3ZX4A 1NBHA 4O6VA 3RTDA 1J42A 3OD1A 3LVBA 1FFSA 1PJ2A 3VPDA 3H4VA 4BFLA 1C81A 1ZUWA 3O8OA 4HFNA 3TGWA 4F2PA 2IPAB 3DKVA 3ZHOA 4Z49A 1ULZA 5A4JA 4BFWA 2AD5A 4DR3B 3B7WA 5IYZB 1CB0A 1CE8A 3LY7A 3OEHD 2PRKA 1ZEJA 2QMEA 5FADA 1CRZA 1OFTA 3GUVA 1O9HA 2AGVA 3V8NA 1L8AA 5C7LO 1Q74A 3A9RA 5TPWA 4Z9FA 3VU0A 1JIVA 5KNBA 4QFDA 3D3QA 4D57A 4CU2A 4DXDA 3U4MA 2GO7A 3RS4A 1QONA 3Q9NA 5KJ6A 3BMQA 4UHFA 4K1LA 4PLGA 5CYGA 5K0BA 4CFSA 4LK2A 1CY7A 4PTYA 1C8KA 2PANA 3PENA 2O50A 1MVLA 3HCCA 2VPQA 4W9NA 3FRIA 3IQDB 1NLUA 1JSLA 2ACEA 4WJZA 4BQOA 2ID4A 4MLZA 4P3KA 1Z9BA 1T2UA 1UKAA 5GJBA 1Z74A 4LQDA 3HV0A 4HGNA 4B6GA 4GAEA 3RU3A 4PWYA 2CXOA 2Q3BA 3CCCA 4DCVA 2X5JO 4PC2A 3WIUA 4MQ6A 4MV8A 1NZDA 2ORVA 1UEJA 3H16A 4M0FA 4Y6SA 4KR0A 3LQKA 5GZ1A 3BL5A 3I83A 4II3A 4ETNA 2Z95A 4N9QA 2IBSA 1JAHA 3RUPA 1EX1A 1PS8A 1FDUA 4K1XA 1A50B 2C5EA 3JVEA 1BH6A 1P5JA 2B83A 2ZM6B 4XQCA 3JX9A 1TQHA 3N76A 4H7PA 4RK1A 2XYRA 2BMEA 4AJ1A 5ADWA 3ND8A 1UMCB 1ZD5A 3BIFA 3CINA 1KVUA 3F5FA 1E2NA 3EMKA 3CJTA 5FA5A 2PSSA 5BRNA 5JSZB 4OB7A 4PO9A 1Y33E 1XIVA 1HZZA 1M0TA 3D6MA 1PEKE 5HIIA 5K51A 1NYRA 1GNSA 4Q1DA 4MI6A 1TVKA 4AG6A 3RDPA 1CDDA 1MQAA 2YVLA 3FHJA 1ZUD1 4DY4A 2V0CA 4HZUA 1Z4MA 2BISA 2I2AA 2R6HA 3QLEA 4OYRA 2G4LA 4D8YA 1RLMA 4I4CA 5G0WA 3TKLA 1IUPA 3MD9A 1ZK3A 1NWCA 1J99A 4UNIA 1QHHB 1Z34A 2SNIE 2AZMA 3G13A 3T7EA 4LOIA 4WOPA 1BX1A 4GEKA 1C3VA 2BGTA 4F04A 3UFXB 1JW9B 5ES4B 5KWVA 5F5LA 1BW9A 3I92A 2QSJA 2WJ6A 2BMWA 4LRTB 4IG4A 2P90A 4D3FA 2C96A 4EPWA 5EEHA 2J87A 3QKRB 3QY0A 2TYSB 2OM6A 5AVTA 1VKOA 5IXSA 3LSTA 3WGNA 3KEOA 4GL4A 3R5SA 1U2GC 5LP1A 5CMLA 1SXHA 3CF4G 1SG0A 1XTPA 2C9MA 3D6FA 4G85A 1QFSA 2C2XA 4U9IS 4DSUA 2R6R1 5JPIA 3OIWA 3P7MA 2VHQA 3DAYA 3VI3B 2H0RA 3OT4A 3AG5A 1IAQA 3AYZB 2EQAA 2JZCA 3E27A 4BJ3A 3T34A 3HB4X 3IAXA 3VO1A 4NCBA 13PKA 1U7ZA 4FC7A 2VKQA 4WDRA 1SG6A 1W8DA 4FW9A 1OT5A 2HO5A 2JKVA 3DTVA 1ZH6A 2A14A 5IVIA 4R1NA 5TVKA 3ZWBA 2I29A 3UGJA 5ALNA 4GYWA 1P33A 4PZ0A 3MB8A 4QSMA 4AY2A 5KYYA 2J5QA 1FTQA 3OPYB 4RMIA 2X42A 2FZGA 2HBRA 3LOUA 2QTMA 2FMUA 5C4GB 1US8A 4BB0A 3U16A 1V8OA 2A1TR 3DZCA 2X22A 1LLUA 5B1YA 2PRIA 4DTCA 1X7YA 3IV7A 1L7PA 4UFOA 4E5SA 4J7XA 4X71A 3TNFA 1EXWA 4I1UA 4JVOA 4DSTA 3VYUB 3EH1A 1GY8A 4WKCA 4BVGA 1VE7A 5EXDA 3IKTA 1MOQA 3P26A 4L6CA 4J29A 4DJFC 3SI7A 2R25B 3ZWDA 1QK5A 4KUEA 1U3WA 2BI7A 2QY6A 4CG3A 4W5TA 3KSBC 1DIRA 2XBUA 2AE2A 1RP7A 2ODQA 3ESZA 3MJ4A 4A2WA 4DLUA 3BFKA 4M55A 3FROA 4QFBA 3WQSB 3E9DA 3CH7A 4R2KA 3HN2A 4UJ5A 5DHPA 3IQXA 2FFRA 2A78A 1E66A 2A8YA 3ZI0A 4GX0A 5TVGA 2X4IA 1J33A 2W6QA 4TX1A 4DDHA 2ZZMA 3V4SA 1DQYA 2UVPB 3JQPA 3SZGA 3ZZ1A 1ZN8A 4K6OA 5SV2A 3U3JA 2XNSA 3F1KA 5CIWA 4URVR 2O7SA 4HS9A 1Y8CA 4GYYA 2HY7A 2I6GA 1K5DA 2W00A 3KAKA 3L49A 3SPXA 1EWTA 1TQ4A 3B6ZA 3TRDA 1F5NA 3MELA 2VP5A 3WB0A 2VJMA 1H2AS 3FZEA 2C9ZA 1X1BA 2M98A 3VR0A 4K6MA 1ZD4A 3HVHA 3SX2A 2GZRA 3FVTA 3VKGA 2PSHA 2PA0A 4RAQA 3PQCA 3C6KA 4LBZA 3WISA 5C5DA 2WTUA 1IM5A 2C3OA 2YJTD 3OZWA 4IL5A 1YB1A 3PC8C 3V1NA 1BAPA 2FX2A 2NZJA 1E3QA 1T8WA 1O94C 2FPSA 2GCGA 1ZJ6A 2HRZA 3PNSA 1RMQA 4QDKA 5JBIA 5JUWA 5KYUA 3TI9A 1LI4A 3VNAA 4RJKA 3GFOA 1E6KA 1ORHA 3IKVA 3KKEA 3AINA 1JGTA 4ABYA 4DV2B 1KPIA 4E3ZA 4PHTA 4BN4A 4WOCA 3ZGLA 2YRXA 2D1YA 5U4QA 1Y7TA 3CPSA 4H2DA 3EVDA 3NHAA 2FWMX 3D2LA 5GONA 1VLQA 3AGQA 2IX9A 5T64A 3ETEA 4G1FA 2O1WA 1LB1B 3PGJA 1HLPA 4DA0A 4EGJA 5EJ9A 1AGXA 5CHYA 2PX2A 2SKCA 1HOXA 2QRVA 3QWHA 1V48A 3VKWA 3SLGA 3TO5A 2WP8J 1E5TA 1X9GA 1VCHA 1WABA 3RJ5A 5IJ0B 1QFYA 2HLDA 3OEWA 1JEEA 2VVTA 4YUAA 5EKSA 1ZY2A 3ODGA 1CUWA 4R2WA 5HZKA 2R1TA 2EJVA 3W34A 1EK0A 3NJ8A 4C5BA 3BKWA 3FTNA 2ZJ2A 2QBYA 4TZ6A 3HWX1 1OXMA 2MINA 1GGJA 3BWYA 4W7IA 3PRHA 1WXHA 4RKWA 4JOQA 4FOTA 2O4CA 3ZDFA 4YN3A 1EFHA 5EFZA 3B9BA 3VOTA 4YP6A 5BT9A 4C0WA 3ZW8A 1MHPA 1DG3A 1P44A 2WNIA 2IW1A 3ZWMA 2WLTA 3TAXA 2R6DA 2ZXEA 1H2EA 4PZAA 4UDYX 3TR5A 5CB0A 1XRLA 4IQ4A 2O9JA 4C7KA 1B6GA 3A6EA 3LCRA 1N1EA 3WKBA 4ZEMA 3U7FB 3O91A 1E1YA 4PNEA 1FSFA 4NKRA 1USIA 1ZK1A 2D1QA 4GX1A 3RLFA 3DCYA 3PQ3A 3RC8A 2FP3A 1AIPA 2PIDA 2D7JA 4P5PA 1YFKA 1SPXA 3ED5A 3A4NA 4GLBA 4WIAA 3R7BA 4RIHA 4ISBA 3TZ6A 2Z3ZA 3VDNB 3JQ8A 2QN6A 1H5NA 1FRQA 3FWZA 5B7QA 2A0UA 2KW5A 4B7XA 3OCXA 1HL7A 2Z30A 3M6MD 3OAAD 4D9BA 2WV9A 1ECGA 3I45A 4W8GA 2IUUA 4C2UA 3H11A 1TI7A 3L8GA 3LPAA 3CJQA 1W48A 4RMGA 4DSAA 1C4OA 3ZGZA 4AU1A 1D9ZA 4Y0NA 1A0OA 4GBGA 5CLGA 4E5KA 2YICA 4GUDA 3T5BA 5JI2E 4I55F 1RXVA 9MHTA 2IYQA 3D2BA 4TLBA 1JR6A 1RNLA 3A05A 2J46A 1I4TD 4F7DA 1I3CA 1MJNA 3DA8A 2C7BA 1L4LA 3JWGA 3KTDA 4RCZA 3CW2A 5JSYA 3V3KA 5ABPA 4M2LA 4MV1A 2CSXA 4GQIA 1TKAA 3W2IA 1TD9A 2A1UA 2PX4A 3G1TA 3KYCB 5AXBA 1R6AA 1Y8AA 4MGZR 4HDRB 1KHTA 1NNI1 2QVLA 1YACA 3QW2A 5E4FA 3WWCA 1T1IA 4DIFA 1VFNA 1BA3A 1X80A 2IV3A 4YJ2F 3WV5A 3AT1A 1B4DA 4XAQA 5BMVB 3GB9A 2C0PA 5SY4A 3NGXA 2NQ8A 4EL0A 1GZ5A 1M72A 4ZXPA 3KO8A 2B21A 2WAOA 3EYAA 4CE6A 4E88A 5CFNA 3CVUA 4Q6BA 3ME5A 1QO7A 3Q8KA 1E1LA 2KBEA 2OFOA 3CVYA 1NNUA 4RM2A 3S70A 1U98A 2KQUA 3FYUC 4M7RA 4LRQA 2G6BA 1FCJA 2ZBUA 3HEAA 4QATA 4TUYF 2H2WA 4XGKA 4B75A 1QK4A 4YP5A 3TE7A 1LGYA 4TMYA 1VLJA 1Z6GA 2AG0A 2GTIA 3KJQA 3B38A 4FSDA 2XNDA 4KR9A 1OYOA 2Z9BA 5ELLA 4EUNA 4B7CA 4JKYA 3V9PA 3VSCA 3C15C 4UNRA 1MOZA 5DGXA 5C46F 5JWOA 1DCKA 1ESNA 2CYAA 4WZZA 3I73A 3IPCA 4IDOA 4NEQA 1CPYA 4AZ3B 2QQ5A 1BZYA 5ICGA 1TM1E 4FE7A 4K9NA 3AU8A 2R8XA 1J9EA 1TPYA 4KJZA 2Z2XA 1GPKA 2B34A 3FSGA 3EEQA 3IPXA 4QRIA 1UANA 1W9HA 2PBLA 5I7AA 3USCS 1PZHA 3FWKA 1TXGA 2NV0A 4BNMA 8MHTA 4HATA 5EIFA 1OASA 3Q5GA 2VDUE 2RC5A 2XW6A 4EGFA 1A5BB 1QH9A 4UOEA 3MJVA 2KX7A 3H5WA 1PWEA 3VJKA 4BFSA 3FTFA 3T9FA 2ERCA 3S5UA 1B0AA 1Y6GA 2CCGA 1GFZA 2Q99A 4HRYA 1H1LA 1AHIA 2A67A 1PDWA 1R8JA 1SKBA 2A84A 3K6RA 4RJLA 5B36A 5KQLA 1UK9A 5KOJA 1EDZA 3W90A 4RD2A 1FLDA 1K3UB 4LWQA 4BLUA 2OG2A 3EVTA 4WNIA 1W0JA 2IEBA 1WX1A 3IPLA 3KTOA 2YWEA 1IY8A 4OHWA 2D5LA 4FGJA 1E3TA 2J3QA 1LZLA 1WZEA 4AJPA 1CRLA 4RMJA 1T3LA 4DMCA 1M66A 3BQ9A 4M83A 4MKZA 3BIWA 4OHKA 4CV3A 3QVWA 4EB8A 1J24A 1V7ZA 1OI2A 1TCBA 2QLNA 4U6NA 3TYXA 5E6RA 1AXRA 4C2TA 5DCWA 1O8BA 5GVSA 1RQNA 5TS3A 2AMFA 4FNGA 4PZ9A 3KKZA 5G02A 1LTQA 3FOZA 2GCPA 3QEOA 4MA0A 2Y0CA 1UZLA 5E0OA 3JTEA 5JYCA 1U90A 2BSAA 2EVWX 1EUQA 4EFNA 4TVSA 3K5PA 5GP1A 1E5VA 2ZSIA 5K0ZA 1VKNA 3JVVA 4GOOD 4UAJA 2B8EA 3SJUA 3HABA 4ER3A 1SBQA 2GZ1A 5LPNA 1KSJA 1YQQA 2XTMA 3PVZA 1YZVA 4FBMA 1DI0A 3SQMA 4BU0A 1VJTA 2WKQA 2E6KA 3RB8A 4D8UA 1I2DA 3ELWA 3EGDA 1H5UA 4O4LA 2J0EA 3R5FA 5A4AA 2X1HA 3JYPA 4MTCA 3SXUA 4YPVA 3INRA 1I1NA 1IMJA 3M5PA 1BXRB 1SIWA 4HGOA 4TL9A 4UEWA 5CHEA 5M29A 3O4FA 4ZEOA 1ECBA 2OQVA 1ZH2A 3TDNA 3FYCA 2OXCA 4E1BA 2I62A 5JRJA 3EZ2A 3ORRA 2GAIA 2WD8A 4MPTA 4Z9XA 1AA6A 4DNPA 1DWQA 3Q15C 1CUXA 2AK3A 1HI9A 2ID7A 4V2IA 1WM1A 2HJRA 4ZO6A 4TTSA 5C31A 5BV1A 4W9MC 1TLTA 2IVZA 2FLKA 2HTEA 3VOAA 5A5FA 5JEDA 3E15A 1XHFA 4BRUA 2Z1NA 1NULA 4FYVA 4S1PA 1OBHA 2C3UA 1ULSA 2XGGA 2JGJA 3CO0S 4YASA 5AYVA 3UMMA 4X65B 8AT1A 1NR1A 4YAWA 3AR9A 2ORWA 5CDYA 4BWFB 4PS1A 1OIVA 4F4IA 3ZWYA 1O0BA 2XUPA 2VK4A 4K5QA 4OJYA 1PX0A 4MUNA 4INPA 1S9HA 4IIUA 1I9GA 1N6KA 1ZP6A 1ZMTA 4TT8A 5BSHA 5KVQA 4AN1A 2AUMA 3MW8A 1MXHA 3OKPA 3ZTTA 2C59A 1H8HA 5BXYA 3LCUA 3QMVA 4YJ2A 4X1KB 2O3JA 2VP9A 1FEZA 3L6EA 4UCXA 2JH3A 4QOFA 5I9LA 5KTSA 1OFGA 3SJZA 16PKA 4O8CA 1VCMA 3EGIA 4JB0A 2AEMA 4WNAA 1TC1A 4DCTA 1X8XA 2XB6A 3CT6A 4NMWA 1G16A 4WN9A 1T3TA 5IN5A 5LWQA 2FMFA 1UMDA 1MO5A 3QNUA 2Y05A 5EWJA 4YP7A 1KL7A 1HNWB 4C6TB 3ZTYA 1B6TA 3LZDA 2A5JA 1N8TA 1XMVA 1ZJ5A 2LPMA 3BJRA 3DBRA 1Q0ZA 3P0JA 3PLRA 4GRAA 3R23A 4RL6A 4EX6A 1QBKC 4YRPA 4J16C 4YRIA 5CUQA 1W36D 5LA6B 3ZW9A 4PYOA 5DLEA 4EPXA 4LZAA 1KERA 4EA7A 3UXHA 1X7WA 2JCYA 4K2AA 1GG9A 1T2FA 1W0CA 4L0QA 1C3OA 1SNYA 4M99A 4XRRA 3W78A 2WSSA 4NZPA 5AKZA 5HKAA 1AKRA 5HMMA 2BGGA 3WJ7A 4KGXA 3TFOA 2WFAA 1OTHA 3TPCA 2GDJA 2I03A 3UK1A 3GLRA 4KDEA 5DKFA 2IHKA 2JJ1A 2JLRA 5AHWA 1TCAA 5ALRA 2CL7X 4RA9A 4S2UA 5IYZF 4KKXB 2J30A 1LC0A 1EX7A 4UEJA 1NBEA 1CQJB 2HCTA 3G3EA 4Q3LA 3ZJTA 2JJYA 2QAGB 4JI0B 1X1QA 3VYRB 4EBFA 4RPKA 1QQBA 4FSXA 1PT9A 3D6UA 1O03A 3G9UA 5CB8A 3AWIA 2V7QA 2C03A 3PQ4A 4JB2A 5DT9A 3ZY2A 1P1HA 1XJWA 3BBLA 2QN1A 4XWOA 2AJCA 4BVLA 5IANA 1DAEA 1CDEA 3QNMA 5JVDF 2HT1A 2GOYA 1U2SA 4K03A 3GCGA 3HZHA 3IIMA 3VU3A 2IEAA 4GEGA 4B4UA 1S2NA 3OPMA 1LNSA 2CVZA 3B9QA 4BNFA 5U9CA 3SU8A 3VMFA 3MWEA 3EODA 1O6BA 3BMOA 1E3JA 1GSAA 3FHCB 3TVTA 3W5UA 4E30A 1YA6A 3F9IA 3RAJA 3ZIAD 3GRCA 1KOFA 2ZJ3A 2R7LA 4J3JA 2E1RA 2B7BA 3D3WB 5FV7A 2GEBA 2Z2KA 3OSZA 4IUYA 4YMSA 5LQAA 1FJHA 1YJBA 2QLFA 2ZJ0A 3QEBZ 5AKEA 3OFVA 3AZQA 1ECFA 3A32A 3N07A 3A11A 4JBHA 3RFVA 2Q7DA 4W5NA 4WRRA 2IBTA 1HY3A 1J1ZA 1AC5A 2PX8A 1TQ6A 3EXEA 2XDAA 3FOWA 4IH9A 1R50A 3CLVA 2PWPA 1I5RA 3GWGA 2R4UA 2X6QA 1QDEA 1QWSA 4RVDA 3SK0A 4DABA 4F56A 1AZTA 3V4PB 5J43A 1SXGA 3E2PA 2CJPA 3QTBA 3G9TA 3IVCA 1UOPA 1GLVA 3Q7PA 5D3QA 3ZJUA 3UAOA 3OEEA 4OQNA 3O3CA 4RS3A 5K6RA 2VP6A 3IOCA 4YJDA 4I14A 5E9AA 1YR1A 4BV2A 1W4CA 2WYUA 3NX4A 3KM0A 4TQUS 1UJ4A 2O2YA 2P6NA 1OH5A 3PQ2A 1S8NA 1UT8A 1Z0ZA 4O5AA 3MQ2A 4YP0A 3SHWA 4BQSA 1YZ3A 3OI7A 3W05A 3QVKA 4YJKA 1G8FA 2Y71A 4F3KA 2BUBA 3LT2A 2OECA 4OLBA 2ZVPX 1RZRD 3OF5A 4FYKA 1SVKA 2GBFA 4HQFA 2N1BA 1K9VF 4L27A 1XL1A 2ZTVA 4BKPA 5HIAA 3TTTA 3R6WA 3TEFA 3WRXC 3GGDA 4PFQA 4E2XA 1RIIA 1DUVG 2WFLB 3EXFA 3N7AA 2PCJA 3JCZA 4IRUB 5CT5A 2FFQA 3VR3D 2F8SA 4X1YA 2CNOA 3QF7A 4LW8A 5F33A 1H3FA 1XALA 5GGYA 4CF6A 1T8YA 2IH5A 4NZNA 3DFFA 1PQYA 1I80A 1XLVA 3JWHA 4AM8A 1KE1A 2QP9X 3GCWA 1KEZA 3NH6A 3MUEA 1I8TA 2IP4A 2JK1A 1XRSB 2CJFA 2YIMA 3UHJA 4NJMB 1EHCA 2C9OA 1BXRA 1SBYA 1C1XA 4O2BF 1IN4A 2DYKA 3FVRA 4UBKA 3RKRA 4COKA 1UPUA 2WKRA 3WQQA 3F6EX 1X19A 5A3QA 2O2SA 3ASVA 4ROTA 3EBOA 1EXDA 5FULA 4XIGS 3UEOA 3LDGA 4FLEA 2JIPA 4X0EA 2YDYA 1JHQA 3MGGA 4MB6A 1Z4JA 4GH5A 4PLTA 4LZPA 3ZLVA 5H8WA 3TTVA 4YV1A 3HB0A 3E8XA 2HA0A 2J4DA 4BQIA 3NR2A 5CDUA 1NBAA 5FQOA 4D9CA 4G0OA 4ZVNA 1JWLA 1YL6A 1JPUA 3NH9A 1CD5A 5BNWA 1TLLA 4YO7A 3CLSD 3PDUA 1TM7E 1UBMS 3RUAA 3CPHA 1M6YA 4RGQA 2AIRA 3VKHA 4OLJA 5FUWA 1WDTA 4AN4A 4M9CA 1Y5LA 3WOHA 2AOTB 3I5MA 2GQ0A 4OD0A 1XWIA 5JD4A 4ZDJA 3SD7A 2RAPA 3KD2A 1D6JA 5EIAA 3A2NA 5JY1A 4TLAA 4ZJYA 4MR9B 3INGA 4AKTA 2GSDA 1Z5VA 3G2HA 3MTIA 5CJJA 1KS9A 4QXPA 1D7OA 4W82A 1NRIA 2OV8A 3TUIC 3FOEC 2HW8A 1P45A 4LY3A 1XAJA 3GF4A 3B2NA 2QRZA 4ESHA 1I10A 2CSUA 2NXCA 3DW3X 3EFOA 3F5QA 3JD2A 1Z5UA 1OJLA 3R09A 2X0JA 5AI4A 5DCYA 1EEHA 3PIDA 1AF7A 1KI1A 1XLTA 1ONSA 3C5CA 3IHWA 4YC7A 1UMDB 1ZOLA 1A8UA 2DSNA 3CF4A 4J6EA 3MTGA 4MO2A 3RC1A 4E51A 2B0CA 3SDSA 2F55A 2RKBA 2NT3A 3GFBA 1L7BA 2JIZD 1NJSA 2RJ3A 4GOND 3EVNA 2BJHA 3VU8A 2O1EA 1E9VA 1DXHA 3TFQA 1CIPA 3KSAC 2F8LA 2WHXA 2Z8YM 3WL7A 4PG5A 1QR2A 1AZLA 1OAOA 1SHJA 1U02A 2PX3A 3LBFA 3NJ4A 3D8UA 4IINA 5HKLA 1GTG1 1ENPA 2CBZA 3HRKA 4BX8A 1JZQA 4C0XA 2FUG6 2GK6A 3MLBA 1Z7EA 3E05A 3BJEA 1Z0AA 1X86B 5BN3A 6REQA 1U5CA 2MSEB 4KYVA 1U3VA 2IEZA 2NNLD 1UXGA 2ZZKA 5DNEA 5JPCA 3UB3A 3T5AA 3U1TA 4UMDA 1EAMA 5IF9A 4UOZA 2X5KO 1TZCA 4JROA 2GJ8A 5LU8A 4QU5A 4RCVA 3DLIA 3S8MA 4EO4A 2MR5A 4CMEC 3K6SB 4IG9A 4FLMA 2VHTA 4D42A 1WULS 3U62A 3V8RA 4BMPB 3FDXA 1JHMA 1UBSB 1I2AA 2BUAA 4HDMB 4PTLA 1FJ2A 5AKJA 1J39A 5TDHA 5B6IA 1QYVA 5J3JA 2QN3A 4D9EA 3QMPA 3R3VA 4V38A 4YJ3A 4HAZA 1L0BA 3WKCA 4RTQA 2PUGA 2CKDA 2Q2OA 4GXNA 4AF8A 3PFIA 3L8EA 2IKQA 3HY4A 4KSBA 2H1FA 1NQWA 2I2WA 4AC9A 2WK1A 5IVKA 1YJ8A 3FSRA 2DETA 3SXUB 2RMKA 1UFOA 1KYZA 4CV2A 2ZUDA 4O4LB 2IYVA 1BROA 1ZPDA 7REQA 1XVLA 4OJNA 3B1ZA 2E4ZA 4BEBA 1CU1A 2HPAA 2QDXA 2WSYB 4R4JA 3FLBA 1X7GA 4PE5B 1POXA 4RHUA 2VSXA 1SXJE 3AJRA 5CBKA 2O8BB 1T0HB 5FTLA 1QIHA 2BJWA 2Z5GA 3SC2A 3DZ8A 1UBEA 1N8NA 4TZTA 5CVUA 3TD9A 2YV1A 3OQIA 4L8FA 4ZRNA 1H4SA 1B2LA 3DLCA 1MB3A 3G85A 4RVNA 3E2IA 4UAUA 4DQ0A 4RYLA 5KMGA 2QVYX 3K4PA 3HPRA 4EH1A 5BT8A 2QPTA 4B7UA 1QQ6A 2CW5A 4A8JA 3RSLA 5IKMA 1HR0B 4QT4A 5GAJA 4I9NA 2XQJA 2NO7A 2Q0XA 2FPWA 1VE3A 5BW8A 2D3WA 4E14A 3FYSA 2M6RA 4INZA 5HIKA 3OPXA 3F71A 4FLFA 1E32A 2C07A 3L93A 5E9WA 3S2GA 3TQHA 4CT4B 1ZAKA 2ZRHA 3AKCA 1GD1O 3JD4A 4DCMA 2UDPA 4B3CA 5IC4A 5JJLA 4XZ3A 5EP3A 3LVQE 1PYOA 2RB5A 2IYTA 3ILSA 3UYKA 5C1DA 3TLJA 3KLMX 5AM2A 3VAZA 3MSCA 1U6JA 1CRWG 1K4YA 1U7UA 2UYCA 4W8OA 5K0EA 2HNAA 1UBHS 3C3CA 1QHIA 5PGMA 4YIKA 1RYDA 4J1NA 2QD5A 3TGPA 3HM2A 3HADA 3I0ZA 1CHDA 2XITA 2FB9A 3G0BA 3IC5A 5CGQB 4PINA 4O02B 1U2DC 5JPDA 3TF5A 4G0UA 1UEIA 5FHRA 3TTUA 5J9FA 2AHOA 1ZMOA 2W6NA 5KSPA 4CF3A 1ZOPA 3MZ0A 4DPKA 4DWOA 3FD8A 4G5SA 4N40A 3LXRA 4B3XA 3KOZA 5KNDD 5TMDA 5KYNA 1XDBA 4MUYA 4QT0A 2CJYA 2HC9A 4C6RA 1KVQA 1KP9A 4XSVA 1DMRA 4QOEA 1CY2A 2J31A 1PW7A 3LYHA 4QDTA 5HKKA 3F78A 4X54A 4OUDA 2Q5QA 3VKFA 2FEXA 2GO1A 4LHXA 4KXFB 5AO9A 2FZVA 4O1HA 1WUIS 2AMYA 4TL8A 4EHLA 3V1KA 4GZ6A 1A04A 2VHXA 4HQ6A 3CGGA 5CK5A 2D5IA 2IGBA 1DRKA 3K32A 4QOHA 4RF4A 5P21A 3DPSA 4IV8A 2PKQO 4RXMA 3D5QA 4LCBA 2CYCA 2LDBA 3KWJA 1M2EA 5I3ZA 1ACLA 3HH8A 1QG6A 3WAJA 2SICE 1KZ7B 1MABB 4FQ5A 1E6MA 2IXEA 4LG1A 4ZI5A 3KXIA 1CZRA 4K86A 4NE9A 5REQB 3WGZA 5CBPB 1E6CA 2OCXA 2MHCA 3HUEA 1JI3A 1RWBA 5A62A 2QI9C 1GYRA 1WCYA 4YAOA 3T38A 3T3EA 1SVLA 1B8UA 4KMSA 4RZSA 4OPMA 2IPMA 2AC2A 5LMCA 5H81A 4LYYA 5IJZA 4REMA 3QM1A 4IKPA 1F7UA 1SXJA 2BRUC 4D8TA 1LPNA 4D0SA 1AKQA 2HLDD 5EHIA 1KYWA 1KBOA 4QFCA 3K1AA 1EP2B 3M6LA 5LC1A 1M7BA 2CFTA 3BTSA 3F3KA 2GNOA 1OKKA 3S1LA 5HUJA 2Z1DA 1CUCA 1F5SA 2XYVA 1P5ZB 1UDAA 1CY4A 1KJJA 2C77A 2EKZA 4LJ9A 2H1CA 3R3JA 5TV2A 1RACA 4J16A 4B73A 3L9XA 2YBDA 4Q9DA 4DQLA 4Z1OA 1R6VA 2EF1A 1JJIA 4YUYA 3RYTC 1IIBA 5A03A 3ASUA 3RIXA 3PUHA 5A6SB 3MN1A 3G1UA 3KUKA 4OX9B 1YDEA 2E4YA 1SK9A 2R48A 2WUFA 3KAPA 3QKSB 3L8FA 3EDRA 4C3UA 1FIUA 3FNBA 1G291 1U8YA 5DYNA 3GO4A 4DV0B 4LXUA 4MCJA 4ZT6A 2P0AA 3E03A 3CUUA 3I04A 4FVTA 3M6FA 5JLAA 3TRJA 4E33A 1P77A 1CQIA 1PLKA 3QNWA 2GSWA 3PU6A 1NXOA 4B6OA 2WZDA 1QB8A 1NVVQ 1Z45A 2OHJA 4I2VA 5ENDA 2C83A 1G7TA 4AX8A 3R3XA 4QBFA 1RQLA 2WOOA 4GLJA 1ZC3A 1A77A 4Z8XA 5JXIA 2PZFA 2YUIA 1NURA 2X41A 1HYHA 4BNTA 3OBIA 1MX1A 3R9KA 1QIFA 4XB6B 1CS4C 3JYOA 5K45A 3OHMA 1J8QA 3PEVA 2F9MA 4GR4A 4HYQA 4UBNA 5BR1A 2C00A 2LD4A 3I5XA 1V45E 4RYDA 4Z9YA 1YQEA 3SQOA 1KFCB 3OZ7A 2O6LA 4AX4A 5ERGB 4ENPA 2UU9B 4OFZA 2JGDA 1WDLA 1NW7A 2AKAB 3V7YA 3GPBA 2VEDA 1LW6E 4IGKA 5DHTA 4XX0B 2VDJA 3D43A 3GLHB 4CIDA 1DE0A 1U80A 1NRXA 1XAIA 1V25A 3S3TA 1W6UA 4BLQA 2EFHB 2WE8A 3UJCA 2O8VA 4E70A 3M6AA 5MN4A 3AR3A 3I0MA 3ADOA 4AP9A 4UBJA 5LBTA 3QVGB 4ZPJA 2FPKA 5F3DA 1JDUA 4IFTA 2CF6A 2ZBFA 5BSEA 1IHUA 3A3YA 3G2IA 2QV7A 3KELA 3AXSA 4HYTA 3RYIB 1FUUA 4LXYA 1IB6A 1JG3A 2VXCA 3MWLA 1OWLA 2VAMA 1H8HD 3I8OA 3LP6A 4M49A 3VPCA 4DCCA 1FZTA 3PUZA 4PRKA 5AW5A 1ZUIA 3FCXA 3ZCTA 4A15A 4LJRA 1X14A 3BF8A 4AJ2A 2Z08A 3JZFA 3FW1A 4L5IA 1DC4A 3EIHA 4OGLA 1WZIA 4IWNA 2JRCA 2WUWE 2VJYA 3FCCA 3IAS1 4CM8A 4CV1A 2AYXA 2Q4DA 3W8RA 2BTOA 4P84A 1DOZA 1QS0A 1SKQA 2CFIA 4GP7A 4MVJG 3TOXA 3AFOA 1K6IA 2YS7A 2GZMA 1BKDR 3HKCA 5DM1A 2OCPA 2FOIA 3OZXA 4G23A 3VNVA 5JNVA 4QC2A 5BN1A 3WA6A 1F51E 2C1ZA 1P0MA 3CRQA 3E1KA 1JAXA 2J3HA 1J4AA 1QYXA 1UWVA 1WUKS 1X1AA 2F8MA 3HHPA 2RD2A 2Y8EA 3BD7A 3IXLA 1XMOB 1VRCA 4HC4A 5KREA 4IYRA 1VPEA 2ROQA 1YI8A 4G4IA 5LP6B 1S4QA 3ZCUA 2QLBA 3LVFO 5E95A 3SFVA 1E1QA 3GNQA 4B34A 1KZ4A 4S12A 3FPHA 3NVAA 3K8OE 4MR8A 2H52A 2O2JA 3DQQA 5HFNA 4A0GA 5BUZA 1W36B 1M0SA 3Q0TA 1OYVA 2RE8A 3QXCA 2B1JA 4TLCA 2OCLA 3GJXC 2JHAA 3HGQA 1VKZA 1J8YF 3AIOA 3UMGA 2AOVA 2GBLC 1AV6A 3COSA 4K6CA 1SQFA 1TU4A 5ECDA 4WJKB 1V7CA 4CIXA 3OX4A 5E2BA 3PHHA 3LPDA 5BSMA 3TJRA 4PIPA 3U4QB 1QRUA 3GLFB 3IP3A 2ZR0A 2W37A 2ZYIA 1H3EA 4ND3A 3EGCA 1PGQA 2QSYA 2QTCA 2TMKA 4H4DA 4C4RA 4JGGA 1NBME 4KW7A 4TVBA 1EBUA 4QVIA 3UKOA 3CEAA 1BD3A 2XKBA 3JZAA 4URYR 3HXOA 3ZBQA 3K9GA 4YDRA 3P9NA 3GQVA 4I5IA 2ZYHA 3F47A 3FHLA 2GN4A 5F3RA 1BKYA 1IRIA 4PHCA 2VZ0A 4X66B 1FVXA 3V97A 3DM5A 1VA4A 4YONB 3QJGA 4MROA 4NX2A 3P96A 3DMHA 3NIWA 1EFAA 1HE3A 5EP1A 5JAQA 5AW3A 2W58A 4HT3B 3CLTD 5DFAA 3F46A 4OBEA 3UAGA 3HG7A 4QWMA 2VJQA 5IYZA 1Q1QA 2GBCA 3MCVA 4Y9RA 5DWVA 4XGNA 4DY6A 1OFUX 5BUSA 1CNFA 4YV0A 2BGRA 1CUVA 1NUTA 1YMQA 4KVFA 3ASYA 1X42A 1I4DD 4L78A 5EL0A 3HYSA 3OCCA 4BQRA 4U00A 3S1AB 3AERA 3EZLA 4D9JA 1E3SA 2FHSA 3NBKA 4DIEA 1ARZA 4YXFA 1GLGA 1P5RA 1K68A 2RFLA 3BFVA 1N9KA 4HLNA 1B73A 2ZPTX 3L92A 3B70A 1EVYA 3IBFA 3BL8A 4E11A 2IC5A 5DPMA 5LXTA 3QX7A 2HJ9A 1IB0A 2O23A 1HEUA 3BAZA 3EB9A 3TCKA 1JVNA 1LLQA 1XXHE 4ZHQA 2WTAA 2QE7A 1E69A 1FDRA 3JXEA 1E0SA 4J0QA 3ESRA 1PSDA 1PTJC 3V1YA 4U2FA 1DS6A 1N6HA 3UK2A 4H6XA 5M3BA 4HPJB 1KE2A 4DMHA 1SCKA 3HZZA 5CCEA 4I3FA 4OSPA 4TMXA 4INAA 3FCOA 2QM7A 4B3BA 4LX0A 1MGPA 1MVOA 5C35A 1DG1G 3UH1A 4RVGA 2FCRA 4G24A 1I7SB 3VNSA 3HLTA 2R85A 1UODA 1N1GA 3GELA 4IEEA 1KRWA 3HB7A 4FGUA 3MINA 1TAHA 3K53A 3ZNPA 2XMQA 1JP7A 4ZDKA 2EJWA 2IJGX 2WJVA 2AG6A 4FHDA 5CTAA 4PZLA 2Q21A 2WWXA 3DL7A 1AZWA 1OAAA 3JALA 4H7JA 4JB8A 4LWOA 3K0AB 3L7KA 4OA8A 2VR1A 2C3PA 3VHXB 3GLHA 3HJBA 4OHBA 5KYKA 2QR2A 2ECFA 3WP1B 2ENWA 1NDUA 3WLHA 2BR3A 1Q0LA 4NDZA 1PV2A 2QL7A 3BICA 4KXVA 4N1AA 1P18A 4PR0A 1X9HA 1TM2A 4Y98A 5DMHA 1SM4A 5FI0B 5TEVA 4ZGWA 3BMCA 3ZHSA 2FP4B 4PGAA 2X13A 4BASA 4ZGGA 3QUSA 4F12A 3PRKE 1MUUA 2A4KA 2C7GA 3SKVA 4DQXA 1OLUA 1UPAA 2JAUA 3BIXA 3LYAA 4HVAA 1NP7A 2XEDA 2VCYA 4M8SA 3NOQA 3ZLUA 2ZETA 4C6HA 4UTNA 2ZU0C 4YJGB 2XQVA 2X7HA 2OFWA 3RWMB 1Y6JA 1R6BX 1VJRA 4NBLA 1KZYC 2V4UA 4TRNA 2HF9A 1NDHA 4DN6A 4D79A 5IMBA 2Y9MB 3CA8A 3HCFA 1EH5A 1V6AA 2GX6A 4HTAA 3WL8A 2O8CB 5LIRA 3NPMA 5LJIA 4CI0B 3SKYA 2QNBA 3LHFA 4Q9NA 1S7GA 4XYGA 3NKLA 2W6ID 1QLJA 1BXGA 3IUYA 2DB3A 5KDLA 4UDNA 1C9JA 3QKSA 4FJ2A 2GFIA 3AEKB 1Z7WA 3KE9A 5K05A 1VJDA 4Q4AA 4RK6A 4U5QA 2NO0A 1J06A 4N8EA 3UJAA 2XAAA 5IUJC 4JUFA 1DBWA 2ZRQA 3IIIA 1H8EA 1Y9JA 3ZU4A 3DHWC 2ZQYA 3EGXB 2AOTA 1W94A 4YMGA 4HH0A 2FPIB 5MGNA 4KNVA 4DCUA 4UTPA 4HNAB 4Y6LA 3JRXA 4PC3A 4Q1CA 5BWBA 2QZSA 1KQOA 3NASA 4US1R 5HBGA 4NHEA 1P0QA 5EUBA 1FMJA 1SBNE 1DWOA 4IILA 4QRHA 4EA6A 5IEJA 1V5FA 2WG2A 3NBAA 4OREX 3WTCA 4AJJA 1NBWB 5TLSA 5EUMA 4LQCA 5EP2A 2J7PD 2EGHA 4GM4A 3TRFA 1P5HA 5EINA 4GPZA 1Y3DE 4FHZA 1QCDA 2RG1A 5C1IA 4RDXA 4IRXA 1V5GA 1DHTA 5FFFA 1MO4A 2OA0A 3TMYA 3R3WA 5JARA 2NU6B 5ERYA 2BF4A 4GYKA 3AP3A 1BYIA 4FYJA 5JFOA 2FNAA 2ZW9A 3BGVA 1TA4A 3GAMA 1XD2A 1TU3A 3W6ZA 4CTNA 5ELXA 621PA 2KS6A 3RVPA 1N2CB 5AKYA 3KFLA 3ZDQA 2XUKA 2FN3A 1XAHA 3H0EA 3GIWA 4A8HA 2D1FA 1UZAA 5FNZA 1X6VA 3ZS8A 2GEFA 5JFGA 1ULBA 5C34B 4BFZA 2FSPA 2GTHA 3P27A 5C4MA 5HP4A 2ESRA 4EK9A 1NG9A 2YZKA 4I1YA 1M2NA 5IWCA 4JI4B 1ZUHA 2XZPA 1T26A 3K09A 4I4NA 5I4CA 4PX9A 2XJ9A 1DO0A 3GDHA 4LKOA 4BTEA 3K96A 5F76A 1G5RA 3O1IC 4X8HA 1E58A 3NEYA 2REQA 1EQAA 4CCYB 1N4AA 1NL3A 4EECA 3H1PA 4WXPA 4WL0A 4TYMA 3PD0A 4NBRA 4EW6A 1J2RA 5C1OA 4P22A 4TGLA 2W4IA 1PV1A 4WZBB 2QQ0A 3F3MA 1FRZA 2WFLA 4TQ9A 2O1XA 4LPKA 3WAKA 3W5DA 1G6OA 1C8LA 4QWWA 4AMZA 3WJ2A 4BNLA 4BVBA 1UBNA 2WM8A 4JSRA 1ES9A 3HSKA 2FUG1 5F1YA 1KK2A 2JLXA 1V43A 1M6WA 2WMYA 1NF3A 1Z8DA 1Z2NX 2O7QA 4WAUA 5DSZA 4NEHB 2ZM5A 2OP1A 1GVHA 3F6YA 4TMKA 3DHYA 4LJ5A 3WIDA 3BE4A 2C2BA 4EAAA 4FS3A 4YT2A 5MF6A 3CHYA 5KSYA 3TWOA 1XKLA 1ZRHA 4AZWA 3EPJA 2C88A 1Z33A 3G0IA 1ITZA 2QZ9A 2XBMA 5CT4A 4LXQA 4G2TA 3DQPA 1Q2UA 1USGA 1WDKA 2BZSA 2DFLA 3C8HA 3NAQA 5HRUA 4OATA 4XE5A 4ZEVA 1M8PA 3JQFC 1GGFA 1NYLA 4CMAA 1E6LA 3UMSA 1T5DX 4U6QA 1GAXA 3L7CA 5A9SB 3BRQA 3O4RA 1EK2A 5DRYA 5ANRB 1Q1GA 2VT7A 4U7HA 4V1CI 4EJMA 2HUNA 3CN7A 4HN2A 4H6PA 2IHJA 3P2EA 3IE0A 1Z68A 2G82A 3G2QA 3WLNA 5J2UF 4RIGA 1J9ZA 2C98A 2O3QA 4H3SA 5BOSB 1LBSA 3NDRA 1G17A 4RNDB 5K3OA 1H93A 1JIXA 1MC8A 4JQSA 1V5WA 1A8IA 1KMIY 5JZVA 5A7GA 2YV5A 3GRPA 2HM7A 4KO4S 1J25A 1RD4A 4TL6A 2ZRPA 2GK3A 2PTHA 4KQXA 4R16A 1W581 5EIOA 5J5CA 4F9FA 1PCXA 2J1LA 2QENA 1LBQA 2X8AA 4LJ7A 4P6VF 3TCXB 1ZKMA 3QI2A 4CUZA 5I45A 2DWUA 3GBVA 4M22A 3LHKA 1Y1RA 4DJDC 3PKIA 4ODIA 4EKIA 1GG5A 2FU5C 2QAIA 3LOQA 4GRDA 4PBSA 4WOKA 1Q0TA 1PR5A 4R2IA 3AUXA 2BM8A 4OXNA 2AG1A 1Y8RA 4BTLA 1A72A 4O3FA 4EPYA 1JG2A 2C7RA 3CLTC 1P39A 4KDFA 1B74A 2ATIA 1WHTB 2RK4A 3EH2A 3LBIA 3QVVA 4OU5A 2ZRCA 4TT3D 5DISB 1OA1A 1I30A 1CDOA 1CUSA 4N7RA 1PNTA 1JHRA 4KX3A 4MYCA 4NYJR 4R7ZA 2NSLA 4I1OA 4JYZA 4OOEA 3L4BC 1YNSA 2HBYA 4KN5A 4NCIA 3VA7A 4OX9Y 1D1PA 1V35A 4PCVA 5LKAA 3PRYA 5JJIA 4M0MA 1BH2A 1LX7A 2COUA 3IEIA 3QOYA 3TB6A 4BIMA 3HWRA 4AAYA 4EUFA 1IFXA 1NUPA 2FSVC 5AJYA 3E3LA 1ONPA 1QGUA 1CUZA 3K15A 2QJWA 1XZAA 3HFJA 1X7WB 2BDEA 3DAOA 4IVNA 1BX3A 4IJMA 3FCUB 3QUBA 3GXBA 2FN7A 1ID1A 5DTQA 3E1GA 4ZI3A 4A03A 2DRIA 2WA2A 3KXKA 3UBMA 1V4NA 3GQBA 1J2YA 1P7ZA 4QU0A 2NAPA 3G8AA 3SY8A 1ISJA 3ZIDA 3M49A 4WFQA 5IZCC 5LN1A 1JR3E 3AWDA 1KP2A 1FQJA 1JPVA 4X91A 3SSOA 2PJZA 5IDWA 3ZK9A 1X77A 4HBZA 1F1BA 5B3LA 3P5SA 5CU7A 3D0OA 1OHHA 1YKSA 5U1PA 3PUKA 5FORA 4P0TA 1WQ3A 2RDMA 4PSVA 2G0AA 2YIDA 5DN9A 1NZJA 1ATZA 3BHMA 2ZAOA 3DV2A 2WTXA 3PXDA 4JLJA 4MV9A 3UJ3X 2CD7A 4X6XA 1M76A 3AH8A 1B15A 4PEVA 2GD1O 1VHLA 1EVLA 2NUPB 1HA3A 1RABA 3LHSA 5CFMA 1VI6A 3LUGA 1MW8X 1PN3A 4KP7A 1RI3A 1LI5A 2VBGA 5LLDA 5F21A 3EPLA 3U0VA 4DBLC 4EGAA 1UL1X 2PO7A 4PANA 1OXVA 2O2XA 3ND7A 3TQIA 4XJVA 3TM4A 2ASEA 2GCEA 1GIAA 1Z4QA 3LYUA 1Z6TA 3JQ6A 4JBIA 2F8TA 3AG6A 3T7JA 4CCYA 4MKFA 4O0LA 1KJNA 3RPEA 3N2IA 1FW8A 4YAIA 4RD3A 3BTOA 3DT9A 5FPQA 1L1FA 4ESVA 3I28A 4C4AA 4IICA 4OXYA 3OOYA 1ND5A 5I4KA 1PJ4A 2JA1A 3A26A 4GKJB 1WG8A 1QHSA 2C9DA 1HE8B 2FF5A 3WLEA 1OE0A 2DXIA 4PAQA 4CM4A 1W30A 3ESXA 4ZT7A 3AVVA 1J2EA 4M7OA 3PCTA 2NUTB 4H17A 2DBRA 2RSLA 4H7EA 3HUTA 5C81A 2EARA 2XNJA 3WWYA 2G1AA 1XJ0A 4GQAA 2N9UA 1VDMA 3A1EA 4KSYA 4J43A 1Z12A 3GA0A 5D7BA 3LLCA 4BAGA 5CFLA 1QV9A 3UXMA 3KUUA 2Z4RA 4B6JA 1F2TA 1OILA 1ZH8A 2XUQA 2PUJA 4KIWA 4JUDX 3HBFA 2HTFA 1R8QA 2WD7B 3T4UA 5ADUS 3HUFA 1T4CB 5FPKA 3J80A 2QTLA 3WC4A 5DYWA 2C4KA 1FP4B 1N5LA 2MYTA 4JLMA 2I3BA 3B5IA 4TMWA 1T1GA 4BPRA 1TKRA 3HGMA 4A10A 3U0BA 2BKAA 1HM5A 2RGWA 1DGQA 3W3ZB 2XRFA 1CXZA 5AVOA 4Z4HA 2Y0EA 4O59O 1GA6A 1K92A 2I2BA 5AVYA 2GYUA 2QX6A 3C6MA 3LJKA 1TRKA 2OL4A 5I7SA 5TF0A 4MVYA 1CJKC 3QBDA 3ZH9B 3L4KA 2GD6A 4R8RA 5LZ7A 1KIFA 3K3PA 4EELA 1TYBE 3ZG6A 3ADPA 1U7WA 4NMHA 1XHLA 3UG7A 4NJEB 3CNBA 5AUQA 2C5AA 1M6VB 3PTLA 4FNOA 1Y5RA 4PFJA 4XQ0A 1B3BA 4CM1A 1BKSB 2W22A 2NUBA 1EE2A 2P9YA 1GYPA 2GILA 1T8SA 2Q9UA 4IEFB 4M1EA 1LPOA 4ON9A 3U9LA 4G1MB 1GU1A 4QASA 3AM3A 2P3QA 3RABA 1ACJA 1MN6A 1JB9A 4QVKA 1J7JA 3ZHYA 3EFHA 2OLKA 3WGOA 2CL0X 1SVNA 3FGOA 3N0VA 1Q14A 3T4EA 5B7PA 4R9NA 1CR6A 4NSNA 1U3GA 2OWEA 5DNVA 2H16A 5KNCH 1TIBA 1XMXA 2IYPA 2OR3A 3FNIA 1JX6A 5H68A 4NFYA 3HI6A 3LK7A 1ZXBA 5FJJA 4ZVOA 3WX0A 1ZHOA 1XD9A 3ZE1B 3ICVA 4MQFA 4KYIB 1A1SA 1VGVA 2NTNA 2YH2A 3PFFA 3R5KA 5K3SA 3NBUA 3GJRA 3VZCA 5B1DA 1M2HA 1QNFA 3RVSA 1ODIA 4R2MA 3MC1A 2IW3A 2NO6A 2P4EA 1I1HA 2PT9A 2JZOA 3VHQA 3TSOA 3R3UA 5EWMA 5HKOA 1GPBA 4DS3A 5BMVA 4K0RA 1Q22A 5T5QA 1R5BA 1P0IA 2IUEA 2P9CA 2V97A 3M0EA 4D4JA 2M1ZA 3FSEA 3HKBA 5DTJA 3IQIX 1PS0A 2ABWA 2VLBA 3FJYA 1CP2A 1FX0B 1QIKA 1V8BA 4MP8A 1VBKA 3E5MA 3ESBA 4KAXA 4F5YA 4GOKA 1YULA 1NI4B 1ZGJA 3GMTA 2WSLA 4JDPA 4GHWA 3BE8A 3B89A 2IBMA 3ETHA 2C0QA 1X7XA 3QG5A 4UFPA 4ALMA 2VF7A 2IUFA 3AIKA 3KSRA 1E9SA 2IY9A 5HIMA 3U09A 3HJRA 2OOKA 1A9SA 1SIOA 3N74A 2CL5A 1ZD2P 2QHXA 4DA8A 3RBVA 4D1YA 1P4HA 3GEHA 2BKXA 3VGPA 2Z4SA 2FFJA 4JT2A 1ZGHA 5G41A 2GN6A 4BGIA 2MYUA 5KAMA 3IP8A 4FOSA 5JAOA 3PZRA 4I08A 1J9GA 4NBUA 4OAPA 3CEPB 4JY7A 4JN6B 2J85A 4O4IA 4WN9B 3DF7A 3SF8B 2PJRA 1VB3A 1GTMA 1OWOA 2NPOA 2ERYA 1SCDA 2PNFA 1SKUA 5AUPB 3ZUPA 3G5LA 2AJTA 4V0RA 1IM8A 3ZIUA 1E92A 1H2ZA 4U39A 2I5PO 2EATA 4RDHA 2XDWA 2HAEA 2Y99A 1FFXA 1YCFA 1SH7A 3F4LA 4LHEA 3QBTA 5ALDA 5I9SA 4BVHA 2J7KA 4EI8A 4CIYA 4KTTE 1YD7A 2AG8A 4IHJB 1ZJZA 3AQIA 4E7PA 3PQ5A 1JJFA 4G9EA 1FOEB 3P19A 5IC5A 4NV0A 4X45A 2UYOA 3T7SA 3ZJ4A 3VR6D 1PG0A 5B3JA 2ACKA 4ACAA 5BSGA 1FA9A 3ONDA 1TO2E 2D4AA 4MVJH 1QOPB 3M4YA 5IT0A 1RHQA 2REQB 4J0HA 3KQTA 1C1DB 1TMKA 4NZZA 2QBYB 2XX3A 1ULTA 5LKRA 1CR0A 3UAYA 1VE5A 1DX6A 1R4MA 2WOJA 4ZJZA 3K70C 1QFXA 2WJAA 5CM8B 3KDSE 4G1BA 3WL6A 3SVTA 3WDLA 1PHPA 2D2XA 3TBHA 2YOHA 2R8RA 4TWIA 4Y2VA 1YCHA 4KBFA 1QPZA 4QEZA 4YECA 5CX4A 2WVAA 4N03A 2P2CA 3LG2A 4UVDA 5CLQA 2VHEA 1U5BB 1K27A 1I33A 1OVGA 2GN0A 2HIMA 3ENQA 4G8BA 4MKGA 5G1PA 5THQA 4HN9A 1DPGA 2FG5A 2WVGA 1UUFA 3FYDA 1GPAA 3NXKA 4P54A 4QA9A 1CIJA 4JJEA 5A4FS 2FPXA 2IDZA 2PMBA 4MKHA 1RZUA 2AOXA 2YIVX 4KE6A 1V6SA 4OXRA 5TJ9A 2XVXA 1KXZA 5D6OA 1DKLA 4AG5A 3GCDA 4MGYR 1OLSB 4IDPA 2GNAA 3RRNA 1RQXA 3HDJA 5CR9A 5BOVA 1RC8A 4ISCA 5CXUA 2Z8XA 2H57A 3OIVA 4UTXA 1YQDA 2DP4E 4OUKX 2PFSA 4JCOA 1DIHA 1W0JD 1GU7A 5DE3A 3QMMA 5IW8A 4GOLD 2H48A 3IURA 4IM7A 1SUIA 3DZFA 5CA1A 2J07A 3H5OA 4R01A 4WY5A 3UK0A 3D3KA 3C3AA 3K5WA 5DEOA 4PO8A 5CT6A 1SVWA 2XUDA 1ZJYA 4RJ2A 2QL5A 1WOYA 2H2GA 4C78A 2O8FB 1YS1X 2BMDA 3R7LA 1XDSA 4ETMA 1TB4A 2IELA 2N46A 2R1VB 3C1TA 3I2YX 5DCLA 1OOEA 2WBLC 3EDQA 3TR6A 5B5SA 2PH5A 5I8WA 3ZV5A 4NS4A 4RENA 3QE4A 5FOVA 4B40A 5KTKA 5CAEA 2HRDA 4E31A 3UWKA 2D1SA 2VYND 1D8TA 3TIIA 3E18A 4OFBA 1D2RA 1KGDA 1H3NA 1SCUA 4HWPA 2XTJA 3I9NA 3FDIA 3MCAA 4MTLA 3DDCA 3O21A 821PA 2HU8A 5AICA 3CEJA 1QTIA 3RTBA 2HSGA 1XXLA 2GXUA 1JL3A 3GK3A 4RJJA 2GPTA 3N05A 1YS2X 1GTZA 3QEAZ 4JD5A 1X9IA 5CNKA 5IXJA 1KJWA 1AHNA 1DQPA 2VNKA 4PGHA 4LHZA 4R31A 4GGOA 4RMNA 3RT9A 2ODEA 5LOVB 2E4VA 1BN7A 1FU4A 3P9CA 3H1EA 3RIGA 3BBPA 5EMNA 3WK6A 4POAA 1VP3A 2CY0A 2CUNA 4A92A 3QPBA 2NM0A 2FW6A 3GD7A 4V0QA 2WA1A 4CV0A 2Q9CA 3EIXA 1M1UA 3GPLA 3ZIAA 4IHKA 3X1XA 1S3IA 1UM8A 3HJFA 3WGIA 2XLCA 3SKXA 3BXFA 3KEMA 2GF9A 4CG2A 3FMFA 5TT0A 3QEMB 1PGPA 1BE6A 2AX4A 4YRDA 4JP2A 2NU9A 4UU1A 5L3QA 4BWVA 2NU9B 4S05A 1A9XA 3PUWA 1WSDA 5ALGA 4BKUA 2LR0A 2HCBA 3SZMA 4A91A 2IH2A 1UDRA 1UM9B 1FNMA 2RAFA 2ZIAA 3GJ3A 4JA2A 2AN4A 1XTTA 2AI1A 4H1WA 2JFFA 3UATA 3VUEA 4B3SB 4ZTBA 3NMUF 1UOQA 3V4OA 5IUNC 2GARA 4F3YA 1J0BA 3ELYA 5GVRA 4TL7A 3KQHA 5I7RA 2VUSA 3QLUC 2V9ZA 2DPGA 4S35A 4UTVA 3P1JA 3WKEA 4YIHA 1KK0A 2ZBEA 2GN1A 3L7AA 3ZHBA 2DLCX 1HTTA 1GGMA 1W96A 1HDRA 1RHJA 1ZZGA 2BMJA 3ELUA 3NP9A 1H23A 4EG7A 1V8ZA 4KQJA 5JD6A 4WKBA 3ESDA 3O3NB 3QKRA 4CQMA 4PWZA 4MVJF 4JVLA 2EZ9A 3AUFA 4CR6A 2OHOA 2BCEA 2VDOB 1QWOA 4YUWA 1PW5A 4C0QC 4JA0A 4YT4A 1C30A 1DEAA 1W8IA 1NC3A 2CUKA 1EJBA 4XSHA 3G59A 4ZQHA 1HBJA 3RTCA 2AVNA 4OMUA 1A9TA 4GVPA 3I1YA 5TARA 2XLBA 4Q39A 3AF3A 3KV3O 1JR4A 2UUCB 1WSAA 2P9QA 1UPFA 1E64A 3NHZA 3W8FA 3T1HB 4A0SA 4X44A 1T6YA 1QV7A 1UQTA 1JH8A 2NVBA 3LA6A 3GLHE 4NOJA 4YQEA 1N5IA 3ROXA 3NT2A 1OU4A 4QOGA 4Y2GA 4FT2A 5C8YB 3UFXA 1MQSA 2PD6A 4PYQA 1NVFA 5HQTA 4OQLA 4MUMA 4Q34A 4QDUA 2EKPA 4YP9A 3SHVA 3NIFB 2QTNA 3WYFA 5L3SA 1ZVJA 2DY1A 3LP8A 4U6SA 4WCFA 2B5OA 1XD8A 4UBLA 2ZBGA 1WXWA 3FWPA 4KLAA 5DLQC 1F48A 4BNYA 4MICA 5AM1A 4M4SA 1XU7A 2EHDA 3D0KA 3VTFA 4IMPA 3TBKA 4ECEA 4F97A 4DCGA 1WHSB 1F8GA 1X87A 1UKCA 2YZMA 3DEKA 4I81A 1VLVA 3K35A 5BV0A 1SZPA 5FWYB 4D3SA 1EM8B 2IK8A 1Q5PA 2JI8A 3HNPA 1U8UA 2BEUB 2YWXA 5AP9A 5AW9A 3W5VA 2WWTA 5GOTA 2KWIA 3V46A 3GJ7A 4BIIA 4XWKA 5EIXA 1HT2E 2JEYA 3V34A 2GVZC 2IP2A 1XV5A 1NX9A 3QOWA 3QXJA 5JYEA 1DL5A 2GHQA 3UPTA 4U7PB 1YBVA 5DN6D 2I6TA 2R62A 2PJDA 4XGRA 4EYQA 1V71A 2EFGA 3FSJX 1GR0A 1Y4ZA 3G8YA 1EK5A 1BDJA 1JKJB 4RF3A 4IMIB 3GJ6A 4UCFA 5F9MA 3E7FA 4L7VA 1YMUA 4XFJA 2UUOA 1Z2OX 2QQGA 3C3EA 5TQ2A 3FRJA 4MGEA 3FF1A 1B8OA 3HM9A 3P0RA 4F9TA 4H9GA 1LVUA 3OOHA 3OLQA 4TTPA 4NEGA 4R84A 5IDVA 1E60A 1SU6A 3I23A 1HDZA 4CKEB 3KQUA 4NU8X 3UWOA 1ZA2A 2YXLA 1FU8A 5HM6A 4B47A 1ZIOA 2AE1A 2OMKA 2ZSHA 2BEUA 4MHSA 4OFWA 4DSZA 3ZVKA 1N6PA 2IU4A 1D4FA 4BJHB 3IRUA 4W5WA 3G8CA 4Z2YA 4A8TA 4BGVA 4YMLA 3N53A 3LXUX 5BQOA 4KKVA 3RSQA 5JTUA 3EQ7A 4IQGA 5I9TA 5JOQA 3NBQA 5CVTA 1KZ9A 3ETLA 4OP1A 1TAGA 3BX1A 4FFNA 5ED4A 2Q5CA 3JTMA 4ZMRA 3UPDA 1N3IA 3P9SA 2E5WA 5IABA 4W6ZA 1Z6PA 4PYKA 3H8VA 3MTAA 1FMCA 4FFMA 1FNBA 2EOAA 2PYDA 3KOWA 1AGYA 3DWGA 5KHAA 2NO9A 1IUOA 1DC6A 3PWZA 4YRJA 1SUFA 2YXDA 3RRMA 4HEJA 3DNPA 3PGKA 4LVOA 3IPAA 5CDFE 3DT8A 3U13A 1W47A 1H42A 2RBEA 3VPFA 2XVAA 1KR2A 1RYYA 1JDTA 1RBQA 3L43A 5CFQA 4HRAA 4MUGA 2VK2A 3C4JA 4LSZA 3DWFA 4ZK2A 5C0OE 1XZQA 5MDHA 1JQLB 1IJBA 4MIYA 4RDCA 1PJZA 1LSUA 2WTNA 3CYFA 4CKXA 3C70A 1PP4A 4YRRA 3EPHA 2LXNA 1EESA 3AL3A 3DF9A 3HMQA 4TKLA 3W3AA 1V95A 1NHGA 3WHPA 4Q1BA 1HYGA 3HFSA 2VEOA 3U44B 4XFKA 1U0RA 3OPQA 4ZI7F 4RHTA 2ZSAA 1JUDA 1JZSA 1H5QA 2AH5A 2I7TA 3CWCA 1N92A 4H7KA 4HKTA 4B09A 1J5EB 4BDTA 1U0HC 4FFSA 4UREA 2VZEA 1C3JA 4DZZA 2ZSEA 3FG9A 3IEUA 4WXEA 3W7AA 1NIJA 2AKEA 2A57A 1PJAA 3DV9A 1ZJJA 2EW1A 3LTEA 1OXTA 5J2UB 2XT6A 1BE1A 1FTGA 3OJ0A 4G9GA 4PZZA 3W4KA 1WP9A 3EC1A 4BRSA 4YAGA 2RGDA 5L3QB 2HV9A 3KQPA 4KN9S 3Q8XB 1NWHA 4ZGBA 1MNAA 3B3GA 1GOTA 4F4HA 1X7YB 1HE4A 2ZR8A 4A23A 2JJ8A 3DNFA 5IARA 4WD3A 4H77A 5EIBD 1ZGBA 4ZYWA 3ZNOA 2Q0SA 5INTA 1VECA 1HDCA 3CLHA 1LPAB 3BSFA 3VTAA 1A2BA 4GICA 4AS3A 3TQFA 4LN1A 3BHIA 4HX9A 3L01A 3MUFA 4DC0A 1ADBA 1ZRSA 4MLCA 4A9AA 4HNUA 1A95A 1MIOA 2P4UA 5KVSA 1DINA 4BEVA 4R51A 2F1RA 4CYMA 3O03A 1JJAA 4L5AA 3UUWA 4NZOA 1G1AA 1YHNA 3H5AA 4YRMA 1MAHA 1WPRA 3ABOB 2D2EA 4MITA 1AY0A 4IIEA 4W9NC 3ULKA 3WBJA 2AOUB 3ENKA 4LECA 5K3FB 1A7JA 2R84A 2ZR9A 3VBEA 3OMWA 4RE6A 2WJZB 4FHCA 1RMYA 4KRXA 2R1VA 5LMZA 1IEWA 1F4VA 4D9FA 3BZUA 2PKXA 5NULA 1KAQA 2J4CA 2M6SA 3VISA 5JQGF 3NTOA 3A4MA 1TM5E 2DQ4A 1KXJA 5BXQC 1XTKA 3L7MA 2HPZA 5DNCA 1JF8A 1JIUA 3EISA 1KFKB 2ZDHA 1MMFB 1JFFA 1MB9A 2HHAA 2W8BB 1NBIA 3AEQB 1TW3A 2QF7A 3K0CC 1DC8A 2HF2A 1MFZA 2Q9AA 3MILA 3Q4GA 3ZS9A 1KOGA 1NVTA 3HO8A 1W85B 2HCRA 1SHTX 3I9KA 4IV0A 4RLHA 1VE6A 2CHUA 3G0OA 1NKSA 2ZAYA 4ER5A 4JXZA 3H9CA 4HDAA 4WESA 5DRTA 1FNNA 4NVRA 3V8PA 3LVRE 3UGKA 8ADHA 2Z4TA 3WMRA 2WTMA 4A36A 1AK9A 1GKYA 2RGGA 3O7MA 1YVEI 2RAVA 3CISA 4GR5A 4PZYA 4CKWA 2P41A 2IEYA 2G1KA 3QI7A 4FHEA 5CB4A 5ADVA 3I8SA 3THWB 2YCLA 4FU0A 9LDBA 1I4OA 1KY5A 4QIHA 1KMHB 5TSDA 5JSZA 1T36A 2ZBDA 3MOGA 5GZ6A 3AM5A 4L51A 2ZJ7A 3CZMA 1WXFA 2H31A 4RWZA 4PF1A 5EZYB 2WQ7A 3PA8A 4EYSA 1CX9B 4ARVA 2JFHA 4KO8A 5K5EA 3NOXA 2PQMA 3TXYA 5JECA 2ZFUA 1RWNA 3FGPA 3CU5A 5ES3A 1S1CA 2C95A 2FSHA 3DMPA 4RK7A 1EWVA 2P0YA 5JS2A 2VOJA 1REQA 2FEMA 3AB3A 4N3AA 4Q1VA 3FPCA 1XMSA 4JJ6A 4ROSA 5H02A 2A6PA 4JKOA 5BNIA 4Y1FA 2OSVA 4Q3KA 3SR3A 4Z6KA 2E87A 3N2GA 5KKNB 2PGDA 4CZ2A 1DCTA 2PZMA 3LKBA 4TLMB 1P4JA 2P5SA 3NNDA 4PAGA 4CM7A 1DKOA 5EZ5A 1QDUA 1K8QA 2FOLA 5E7MA 2NO4A 3AR2A 5AHOA 4MB2A 4QFMA 3F1LA 1UC4B 1YMVA 2ZIZA 2YJGA 4YRFA 3HXLA 5EE1A 3DWEX 5T8KC 1E9CA 3HEBA 2ZS8A 4D9IA 1R4NA 3LUKA 2IOYA 1UC9A 2HQBA 4P5DA 3PPYA 4MQ4A 3CNNA 4KLRA 2C20A 5TMPA 4FFDA 4JLOA 2VJAA 4IJVA 5AXDA 2D1TA 2DERA 1CUIA 1QGOA 1BJRE 3QE9Y 1QQTA 1Y0BA 4G2NA 4QG3A 5BPHA 9GPBA 1L9XA 3DEZA 1NPTO 3IFSA 1DIAA 2Q6VA 3JPWA 4PGGA 3TXXA 4DCOA 4RA6B 3U80A 1MAWA 2QMHA 3KQKA 4R0MA 2GWRA 2E21A 3GDGA 1JDBC 1P9LA 1V16B 4MAAA 3RSSA 1DV2A 5KO2A 4H1VA