3DV2A

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from bacillus anthracis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
187
structure length
187
Chain Sequence
b'RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Structure of nicotinic acid mononucleotide adenylyltransferase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 49
structure length 187
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3dv2A00
2B7LA 3P52A 4JFAA 3TZEA 1IFXA 1JZQA 2H2AA 2J08A 4ZT4A 3L92A 4KR6A 3K9WA 2X1LA 3H97A 4G5FA 3PRHA 1TFUA 2QJOA 1FFYA 1I6LA 4KR9A 1SURA 1XNHA 1QTQA 3IDFA 1JGTA 4MLPA 3TZLA 3SZ3A 5KCMA 2ZP1A 5DASA 4CQNA 5LM3A 4ZCPA 2CV0A 1QU2A 3X1KA 1H3FA 3QE4A 3CVYA 1T9GS 2BTEA 1Y42X 2CUZA 2CYBA 5DK4A 1I6MA 1S4MA 2ZUFA 1N2HA 1COZA 1WQ3A 5DEOA 2YWCA 1U3CA 4QBTA 1EUQA 2NZ2A 4MW0A 3SYTA 1IRXA 1IHOA 3FIUA 1KKUA 3ND7A 3TS1A 4KKVA 4MWCA 2GKSA 1WXGA 1LI5A 1R6UA 4DDMA 1O95C 3COWA 4MUGA 4DE5A 1VBNA 3CLSC 5KHAA 4PBSA 1N2EA 4S1OA 2DEUA 3KT0A 2PZ8A 2V0CA 3BL5A 3M5WA 1EFPB 3UK2A 1EFPA 5K0SA 1O0CA 2PXHA 3RK0A 3Q12A 2A88A 3H99A 1NUUA 4P2BA 2J09A 1Q19A 4ND6A 3K32A 1QRSA 1YUMA 3DO8A 1MRZA 3MLAA 2HZ7A 4CDNA 3G6KA 1F7VA 5FO1A 4G6ZA 3KFLA 4EF6A 4MQ6A 5K0TA 1JECA 1NUTA 3HZRA 3CVWA 1A8HA 1OWLA 2DXIA 3MLBA 4WNYA 3FWKA 3H9CA 3CVUA 4RUKA 1EJ2A 3FETA 1EE1A 1G8FA 1NP7A 1WXIA 3LCJA 4XFDA 3TQOA 1N75A 4MUFA 3SZGA 4F3RA 1EFVB 4QREA 4JXXA 3SDBA 2PZAA 3IMGA 1YIAA 1JHDA 1B6TA 4H3SA 4YBRA 1J21A 1EUYA 1XNJA 1TEZA 3ZJVA 2E18A 4KPUB 3E27A 1KR2A 2CYCA 4KPUA 3G5AA 1U0BB 2A84A 1MAUA 2VTBB 4MWBA 1GLNA 2YY5A 4XSVA 2CFOA 1NUSA 1MBZA 2Z08A 2DPLA 3ZJTA 3FY4A 2JANA 3UC5A 3IVCA 1TYCA 1GTSA 2DUMA 1QQTA 2QUHA 1NUQA 4ZT7A 3FG9A 3ZXSA 4ZCRA 2QTMA 5IHXA 1M8FA 3UOWA 2X1MA 1J70A 2IJGX 3N05A 3MXTA 5TEWA 3ZXIA 4FZJA 5F23A 2O8VA 4MW4A 3COYA 1QJCA 3SP1A 1G8GA 1GPMA 1N2IA 1YUNA 2YXNA 1N2GA 1KQNA 4NDAA 1MB9A 1KH2A 1OBCA 3FI0A 5HUJA 5KWVA 2X3FA 1YIDA 3DV2A 2A86A 3F3MA 4AS1A 4UZFA 3CVVA 3P0JA 1PFYA 4MW7A 1O96B 2PFSA 1Q15A 1X6VA 1O96A 1HYBA 2YWBA 1IQRA 1O6BA 4E1AA 3INNA 3PNYA 3OTWA 3ZGZA 4I6GA 4OUDA 2G36A 2QUIA 2PZBA 4MWDA 2A1TR 1T6YA 2QUJA 3IODA 1N3LA 3ND6A 4WSOA 3IUBA 1ILEA 2JA2A 4MAFA 1ZH0A 1YULA 3ELBA 4ZCQA 3FDXA 1JEEA 2E21A 3A2KA 1NZJA 1NSYA 1ZH6A 3IUEA 2TS1A 1H3EA 4RPIA 4MVCA 3S3TA 2QJFA 1CT9A 1KH1A 4MWEA 2HMAA 3ZJUA 1Q77A 1EXDA 5JBNA 1WXEA 4DDKA 1R6TA 3GUZA 1WXHA 5TEVA 4AQ7A 1OWOA 1O94D 1JIIA 1K4MA 1MJHA 3A04A 4J75A 2D54A 4TS1A 2WB2A 1GN8A 5HG0A 3CLRC 1O5TA 3I05A 2AG6A 1G8HA 3N9IA 3RFFA 3MUEA 3NBAA 3IVGA 3A05A 2D5BA 3AFHA 4EG3A 1XNGA 4UZEA 1J1ZA 3AG5A 2X0KA 5IJXA 1OWPA 4U7JA 3QTBA 4MW1A 3AKZA 4F4HA 2EJCA 1BS2A 1K92A 3L93A 3CLTD 5TS2A 4BWVA 4U63A 2H29A 3CR8A 4EG6A 1M1ZA 2Z3VA 4ZT2A 1KP2A 1PFUA 3AL0C 4GU5A 1MOPA 2E0IA 4NAHA 2DETA 2J07A 3IOEA 4ND7A 3SEQA 1LW7A 1M8PA 1M8GA 3ND5A 1M8KA 4MUJA 2GOYA 2ZUEA 3PNBA 4Q93A 3GMIA 1KAQA 5FNZA 3COVA 5LFAA 2WQ7A 4X0EA 2RD2A 1JMVA 1IH8A 1K97A 4K03A 4ARCA 4NATA 3FOCA 2R5WA 3UMVA 2XRZA 4ZT3A 1H1TA 2CT8A 3P0IA 4HJXA 4MUIA 4EG4A 3D6UA 1V8FA 4ZCSA 1O97D 4YP6A 1N78A 2BYTA 1XJQA 4ZT6A 5J58A 1QRUA 1GTRA 4K0RA 2IP1A 3H9BA 3TNJA 2J4DA 3PXUA 3DLAA 3RHSA 1N77A 4CDMA 1OD6A 3KT8A 1I2DA 3ILVA 1VBMA 1UFVA 4ZT5A 2EL7A 1NI5A 2AZXA 3OP1A 1T9GR 4MVYA 3LOQA 4CT0A 1U3DA 4I6JA 1U7DA 1WZ2A 1M83A 2RE8A 4YP7A 1LI7A 3HMQA 3IVXA 3FH0A 1NYLA 4JXZA 1KAMA 5HUHA 1WJGA 1IQ0A 2D13A 3ZIUA 4EG8A 2CV2A 1TQ8A 3Q4GA 3IMEA 1J09A 4GRIA 2E89A 3FHJA 2V0GA 2WSIA 1D2RA 1KH3A 2J5BA 3JXEA 3A4IA 1VL2A 2A1UB 1TYAE 4R0NA 5EKDA 2A1UA 1KORA 2PG3A 3IOBA 4OUDB 3CVXA 1DNPA 5J59A 1OWMA 2O5RA 4HPWA 3CLUD 4EG5A 1RQGA 4L2IB 1I6KA 1WY5A 4L2IA 1JZSA 1TYDE 1NUPA 4OJMX 4JYZA 3VU8A 2QJTA 4MVWA 4HK4A 1T6ZA 1PG0A 1IVSA 5FO0A 1VBKA 5AHWA 3NBKA 3U1VA 3N8HA 3AIIA 1O94C 1N2OA 5BNZA 3IMCA 1NURA 3X1MA 1OWNA 3DPIA 4DDHA 2PIDA 5J5AA 2I1LA 3HV0A 4ZCTA 3LE8A 4YMIA 1OBHA 4QRDA 4EG7A 2NSYA 1Q11A 4EG1A 1KQPA 1J1UA 4J76A 1MAWA 1J20A 2QTNA 1ZUNA 3MMXA 1MC1A 3CLTC 1N2BA 1N1DA 1P7PA 4PY2A 4HJRA 1WQ4A 1PFWA 3HGMA 3N2YA 3IOCA 4ARIA 1X8XA 4A91A 1ZJWA 4R2MA 1QRTA 3SEZA 3QTTA 4I6EA 2OQ2A 3FNRA 3UY4A 4DNXA 2A1TS 2DLCX 3X1JA 1GZUA 4KR7A 5DB4A 4NZPA 1JIJA 2IELA 2XRYA 3CA8A 1YI8A 4U8HA 3G59A 2GM3A 1IQUA 1T6XA 1ULHA 4NAUA 4NX2A 1QNFA 3AG6A 3Q10A 4G5YA 4MVXA 2HGZA 2VXOA 1O95D 1PG2A 2WQ6A 4YP5A 4PBRA 1O97C 2DERA 3CLRD 4MUEA 4XFJA 3CLSD 4MULA 4EGAA 2A7XA 3TQIA 4MUNA 3GLVA 2OV4A 1JEDA 4MW9A 1WXFA 3COZA 1H3NA 4MW2A 1KP3A 5TGTA 1JIKA 3HL4A 3PNVA 3ZUGA 1MB2A 1F7UA 2JAXA 3KT6A 4DLPA 4R2LA 3RBAA 3IH5A 2AKEA 1G59A 1JILA 2C5SA 4MW5A 1WKBA 1QU3A 5LLTA 4MUKA 4MUHA 3KT3A 2A4MA 4JZYA 1U7XA 3RJZA 3VRHA 1EFVA 1V47A 1KQOA 3VGJA 3D6VA 2Z09A 1VLHA 2CSXA 1O0BA 3HFJA 1N2JA 4EFKA 1F4LA 1M8JA 4MW6A 2VTBA 3CLUC 3NV7A 3H05A 1F9AA 1R6XA 2CYAA 5H16A 1GAXA 3P0HA 4DJAA 1PFVA 1TYBE 3RK1A 2QUKA 4PBTA 1FYDA 2CV1A 5H7XA 1K4KA 2DR2A 2QTRA 4Q16A 3C8ZA 1WOYA 3ISJA
chains in the Genus database with same CATH superfamily
4A9AA 2B7LA 4ME6A 3WRWA 3C6KA 3AQIA 5K2OA 4FFOA 3GEPA 4B8WA 3PK0A 4M1OA 1F7VA 3SQLA 3MB8A 1O4WA 3OQIA 1X1QA 1CS0B 1I2MA 5DNCA 2XYHA 1SULA 1Y63A 2UZ0A 2W4IA 3JQFA 2B1RA 1JLLB 3R8CA 3O8OA 3PFHA 4HQNA 2RGBA 3Q9SA 2W2NA 2BZSA 2CJFA 4RL6A 4IQ4A 4EAQA 3OJFA 2WM8A 1PJRA 3SICE 4KKXB 4KR9A 3P2OA 1J99A 2ZB7A 4KR2A 4HPXB 2RGRA 1IN7A 4WVLA 2YYSA 3TZLA 2GI4A 3G88A 4NCIA 4KPFC 4LJRA 5KCMA 2JGAA 4NCXA 1KJYA 5LM3A 3ZWPA 1CUAA 2CFCA 4GMDA 4LDJA 2RGCA 1SQ6A 2IZ0A 5J1TB 5JV5A 2Z6QA 1FNSA 1GYRA 4F9TA 2CCKA 1TI7A 2GCNA 3C3YA 1P7ZA 1AKNA 5HTKA 3UM9A 4CLHA 3KOWA 5DRTA 3U13A 1JQJC 1Y6RA 1U9IA 2O2ZA 4R9VA 4KVZA 4M8LA 4W5QA 1D4ZA 3DEYX 1HE3A 1BDIA 1FMCA 5FA8A 4XTRA 2YDXA 3RIEA 1U3CA 1UMDA 4RTNA 4DQDA 3QXCA 2WIFA 1EUQA 3KJNA 2XJ4A 1KSJA 3GRKA 3DMYA 4M22A 1YJCA 4AKHA 1FDVA 4WK6A 4LBWA 2J0UA 1KRXA 1CZOA 3EZYA 1I0LA 5IUKC 3EDOA 4QYXA 1DB3A 2W0SA 4GQIA 3TO5A 2O1EA 2XF8A 1Z4PX 1NJ5A 1M1YA 2PRKA 3E9QA 3FYUC 3O2NA 1F3OA 5H59A 1VYTA 3ONFA 4AJ9A 4C20A 1S8FA 3IT2A 4JA2A 1AA9A 1UBOS 3EF1A 4G1EB 4TWAA 3CIFA 3CJRA 5LMCA 2QT0A 2G28A 4ZEXA 3RUDA 3T7EA 3VZSA 5JO0A 1OLOA 1V6SA 5B53A 1AK2A 2R65A 4QDKA 2Z6UA 1BO6A 4KE9A 3I01A 5LZ2A 3DF7A 4UUOA 3V8QA 3DUFA 1L4EA 4Y98A 4OQYA 1QIMA 2R5NA 3RSQA 3VOAA 4X24A 4FNAA 3RLFA 1ECLA 3AR8A 2C2KA 2QN2A 2YJ6A 1P1KA 4L50A 1AN0A 4O5AA 4OKNA 2PXHA 1RKBA 2NU8A 1QK3A 5A1JA 2A58A 2IT1A 5B7GA 1D2EA 1E8DA 2BBSA 3ZK9A 1W5AA 5C35A 1QG0A 1NVUQ 3OAAD 3PYLA 3UUGA 5JMOA 2IDZA 2KBEA 2X9QA 4DIDA 4EVRA 3DO8A 3HA5A 4L8VA 4RTOA 1Q95A 1QIKA 3MLAA 2BEKA 4OLHA 3VHQA 1PV1A 3M0EA 1XN4A 4HRYA 4N82A 1DWOA 4V0ME 3UAGA 4ALMA 4AMGA 5KOHB 3FLEA 3P9YA 4QATA 5EHNA 1KYTA 1TUBB 2ZUUA 5EJFA 3U0BA 3NGMA 1SFRA 4CEHB 3SJUA 1FSGA 1OZGA 2XNSA 4MOWA 5KNBA 2GESA 5IVKA 3DE7X 5FPYA 5F77A 1EE1A 3LOUA 4R6WA 4IXTA 4ZHQF 1I1NA 1PK8A 1ULZA 1V1RB 4Q4JB 4AS2A 2N1MA 2PWBA 5J4KA 4CFSA 2WKRA 3IXMA 1G9TA 2A9QA 3AHHA 3FYSA 3FVRA 5CNJA 5JSKA 4YX9A 3CGGA 4R2JA 1KQ3A 1RJDA 3E7DA 3OCXA 1EKXA 1B7GO 4RS4A 5LXTF 4FP9A 3DE2X 1EWQA 5CTAA 2R60A 3D64A 1NF8A 2AYYA 4JYCA 2A0UA 4PLHA 2WF5A 5C8XA 3BMXA 1MAUA 1P7VA 2H2FA 1ZUIA 1GL3A 1D8TA 2FW1A 5EJ9A 1OC2A 3AESB 5AM2A 2IWHA 1O5OA 5EZYA 3FR7A 4C4XA 4DMKA 2GNAA 4I8DA 2IX3A 4L0DA 1ZBDA 3JARA 1HFJA 1BSVA 2BEUB 3FNIA 3DFFA 4REQB 4I3FA 4LJ5A 1J4AA 2BIFA 2V6BA 1L7AA 4UU7A 4QOEA 1GPWB 1L5FA 3H7AA 1DU4A 1FQWA 5BP7A 2RBKA 2W22A 3CNLA 3OJCA 4OO3A 4DS3A 5B36A 4WT7A 5ALGA 1C80A 4LFAB 1E62A 5HIIA 1J0DA 1C7ZA 2KX7A 4R5MA 4ARZA 3NBXX 1QJCA 4C07A 4DDVA 1AO0A 1YVPA 2NMVA 1N2GA 3TPZA 1YZ3A 3A1DA 4TZTA 3IAS6 4EHFA 4F4FA 2JIDA 1JR3E 5CFNA 3TW0A 4UZFA 4I3GA 2BKUA 1KZYC 2QSUA 3C5CA 4NE9A 2FX2A 4F97A 2DPYA 3VU9B 3PHLA 4Q7JB 3ZV3A 3EB9A 1O87A 3M33A 2V0NA 1QDLB 4OQDA 4XYGA 1XKXA 1ZRNA 2JFBA 1JBEA 3GPLA 2HB6A 1KOFA 2CMFA 3NH9A 4N6GA 3WRXA 4MWDA 4ZQIA 4RPJA 1IYZA 3SEAA 1WB9A 4M0MA 3ZE6A 4JI4B 1Y3FE 4FZ5A 5E7IA 4AF7A 1NMZA 5BPHA 3KU4A 2IYSA 1SQFA 1TPZA 3RBVA 2EYQA 1JB1A 1PDOA 2JCGA 5AK6A 4R1PA 5CRIA 3O31A 4MAFA 1YULA 3BRSA 1E3WA 2QN1A 1DAOA 1FDSA 3QLVA 4AJKA 4YMUA 1V3QE 1G2PA 1PTJC 3OECA 1VPVA 4D4IA 4TMKA 2XUQA 5TVKA 4YALA 4CI0B 1C14A 2WBLC 4ZICA 2TS1A 2WE7A 1T0JB 4B3CA 1C8KA 2REQB 2CE7A 1E98A 2IU6A 1F8XA 1YQQA 4DZTA 3QEMA 1DUSA 3O8NA 3ZHCA 1CKEA 4NZNA 5TQVA 3L01A 2R6JA 3BSSA 3QVXA 3AM1A 1AUOA 4LDRA 5EJ5A 2UU9B 1A1SA 1KY2A 4ODIA 3NHBA 4IIUA 3L82B 1Y1QA 4H7KA 1FFXB 4I8IA 3H9UA 4TS1A 3ZH9B 3IAUA 4IWXA 5HG0A 4BKQA 5IJ9A 3I05A 1G9XA 1HLGA 2QZSA 1IY9A 4M1SA 3W5UA 2J3IA 3UXHA 3VC7A 1JJAA 4DJEC 3EWAA 3H1AA 2GDZA 3RRXA 4KZPA 3VZDA 2Q6TA 3AFHA 5EQDA 1GA6A 2GK7A 4NC9A 5KSZA 1JLRA 2XUDA 4ZVLA 1PJBA 1XHFA 4OAOA 2P27A 2DY1A 4GPTA 2GJAA 3K1JA 1KWKA 1Y7LA 2C20A 5AKJA 2I2BA 3PNOA 4LV5B 5TQ0B 4C4AA 4NHOA 2HRZA 4EG6A 1GGNA 2Q8QA 4JT8A 2P35A 2NVWA 4TX1A 3QPWA 4XDZA 3OF5A 3OA2A 2IHJA 3IV6A 3V80A 3WIOA 5BURA 4B83A 3Q0EA 2CLEB 2IXGA 3A2MA 4P3KA 1CETA 4PZCA 3I04A 1RLIA 2ZZKA 3TIXB 1SB8A 2I4MA 4W1RA 3FWZA 4MUJA 4ETNA 1FZQA 5C5CA 3WNVA 2ZUEA 3EBPA 3HUEA 2I4IA 3F74A 3R0QA 3KG2A 4J9VA 1QHSA 3P96A 5F21A 2EFHB 1WW8A 3MUOA 2FR1A 1TK9A 1TKAA 1R3DA 1EJ0A 4KLCA 4XM2A 3SGLA 5ABPA 3TEFA 1YO6A 4PLFA 2C03A 3MJCA 1XFDA 4NL4H 4UBMA 4Z49A 9ABPA 4I5DA 5D85A 4JUCA 2JLZA 4GMXA 1EFDN 3P0IA 1RBQA 1YJ8A 5H3HA 5DMXA 4WBNA 5SZIA 2IZ6A 5JS7A 1XZCA 4HTAA 3D6UA 4C0AC 3WYEA 1VKZA 3ZVLA 1UPBA 4TV9A 3D3WB 4YROA 2JL1A 2Q3BA 3SBXA 3TVTA 1OH8A 1F1BA 3HBLA 1XV5A 1QRUA 2FMUA 3A28A 3OQHA 3GFVA 3C1OA 4K86A 3H9BA 5ALXA 3P2JA 5B7NA 2E4XA 2J4DA 4B5KA 2J9ZB 4BP9A 1H2ZA 1FFAA 3GP3A 4IJQA 3WWCA 5K6TA 4QVGA 2QVYX 3BWYA 3WQQA 3G9ZA 4KFCA 3TQTA 1A97A 5FWYA 4KX5A 4UNQA 1WF6A 3LOQA 1M66A 2AOTA 1JQAA 4BV9A 1HX7A 4Q0MA 1A27A 1UZUA 2SHKA 2JLAA 1IM2A 1WZ2A 4X6XA 3ZWYA 2VSFA 4I08A 4MLDA 5T3UA 3V8MA 4DR7B 1W52X 5TR9A 1NUHA 3Q2OA 4EW2A 4ZI7B 5HZKA 2FQXA 2ECPA 4X20A 3RIYA 4XIJA 1KAMA 2A59A 5BVHB 3CTPA 3V1NA 4RVSA 3WLOA 1IE3A 2I1VB 3QJ5A 4M0DA 2FJUA 4IVPA 3VU1A 5G0VA 3WL7A 2J5BA 3OT1A 1SIOA 1VL2A 2AJBA 4W7HA 5DGXA 4CETA 1E2KA 4RPLA 4BLWA 1ILWA 5JPCA 1H05A 1KORA 3Q1KA 3IOBA 3VR4H 4C0XA 1LQTA 4IOLA 3ZY2A 4TZ0A 5JJCA 1DIBA 3FWNA 1PYDA 2EXXA 1IL0A 3ETNA 3NHJA 4MAMA 4R0VA 5B1YA 1NN5A 5JCZA 2NU9B 1WY5A 4JU9A 3VAZA 1TUGA 1ZZGA 3GC6A 2CFRA 3MJ4A 4P22A 5F3WB 4UAGA 4B87A 3KR0A 2DR3A 2NPOA 2ZB2A 1PV2A 2VKQA 3GFRA 5TRTA 4Q6WA 5BNIA 1E3TA 3AJRA 1KK3A 1BA2A 3D0KA 4ZRNA 2VZ0A 5EY5B 2BR5A 3ON5A 3BERA 4MA5A 5HIMA 2ZKIA 1VZ3A 2I34A 3E70C 2CLLB 1HLFA 4KH1A 3WFZA 2XWPA 4QJIA 5I7AA 4CEJB 1N5KA 5GWXA 2O0KA 3GA0A 1L5RA 2AQ8A 2DRIA 3EZ6A 1DC4A 4PZPA 1WUTA 4INOA 2PD6A 5I6DA 5C34B 3MINB 3O8CA 3KQKA 2XE8A 4M99A 1TEVA 4DG9A 4HDCA 1SY7A 2A2ZA 4C21A 4D6PA 3WL5A 3FWHA 4PYQA 4JUDX 2D1RA 4YRFA 1LCIA 5LLSA 1J9GA 3RH0A 1Y1LA 2CW5A 1UPFA 2YC2C 2P2SA 3HHPA 2PJUA 2F3UA 2RKBA 3F0TA 1U2GA 5LWHA 1J1UA 5BNTA 5K0EA 1KTIA 2ATIA 2OVBA 2UVPA 1MTZA 2OILA 3E1SA 5ENVA 4LJSA 4F8JA 3KOMA 5ITSA 1Y3DE 3ILSA 3GOHA 4GS5A 1RBZA 1U0OC 4ZTZB 5KI6A 3DUWA 3GLQA 4OKIA 1P2FA 1GPLA 3U31A 3ICOA 2PMEA 5C80A 2XQIA 2FEMA 2QX4A 3VM6A 2VA9A 2R00A 1P91A 4AQDA 5GONF 1VKRA 3MCAA 4HMOA 2DG2A 2WMDA 2TRSB 1D03A 1P77A 2GB4A 2WFMA 4W1SA 3PYMA 3D6AA 2FQ1A 1XELA 3EZ2A 1SUWA 2ZJ5A 4M1YA 4RZUA 5D8DA 3T9FA 3TLCA 1OBVA 1PEAA 2KLHA 4ARAA 5IWCA 4K6HA 5IARA 3RABA 3W5AA 1KDTA 2QD3A 3ICPA 2AVNA 3CA8A 3KJEA 5CITA 3I62A 4NPHA 1JHVA 1JIVA 1JKJB 1V11A 2WWHA 3KQYA 4JXJA 5FTMA 1ZXLA 3FHOA 4PV7A 4NX2A 3MNFA 4MRPA 1IEQA 5J2UF 4A0GA 4Q9NA 4JVMA 3RYFB 4XQEA 3U09A 4FHZA 2G17A 1RWXA 2IS1A 3GO4A 4W1PA 3C3BA 2HLHA 4DSOA 3S1AB 1U31A 3B9QA 3E9CA 5DNYB 3U61B 1FS5A 4DJ5X 1WMEA 1XF9A 4QFCA 4HBZA 4KXMA 2D1QA 1Z39A 2XHZA 3K0FA 2J4FA 3F46A 3K4PA 4V0MA 5LQSA 1A76A 1H3NA 5K0LA 1E64A 4ZHQA 1YL7A 3U9SA 3USCS 3HVIA 3IALA 3LCUA 1PWZA 5K8TA 5LP6B 2HA6A 4OCZA 4QGGA 3D6MA 3KUUA 3FPEA 3HP1A 3CUUA 5C46F 1ISGA 1TD9A 3FF1A 1JT9A 1NTOA 3I9OA 4KMRA 1FP6A 2FPUA 5HKLA 4XAQA 3WK5A 4IIDA 5C8ZA 4BPRA 2Q1UA 3MTAA 3PLRA 3L46A 4H77A 2C54A 2CVOA 4NV0A 5LXTA 3GLSA 3IHTA 4YRQA 1XQVA 2NQTA 4A2QA 4MUYA 1GNLA 5F1PA 4XYLA 3Q11A 3BB3A 4ZKEA 4GBMA 2C96A 3FMIA 2GBLA 2AC4A 3WL3A 1W6UA 2W4MA 3HXOA 5B7PA 3VGJA 4K9QA 4QC2A 5KOJB 1QPGA 4JIMA 1SCIA 2C29D 1U2QA 1YBVA 3W5SA 4FGJA 2OFXA 4BLVA 3E03A 2C88A 1GNPA 1AZLA 1QG6A 5DLEA 3LA6A 4CM3A 1IZ9A 1GL9B 4S1WA 2JIZA 4HYYA 4BNGA 1OMOA 1SXJE 3B7GA 3Q8WA 4W5JA 1P45A 3VVBA 3SFZA 2OHFA 3PC7A 3DC2A 1KYZA 3TQRA 1BN6A 1OV6A 4WN9A 1DOZA 4J1NA 2G5GX 1X77A 5B1SA 2QTFA 1L2TA 4YMVA 3U3XA 4ZAYA 2VJOA 1E0JA 2QGNA 2VHWA 2X8BA 4JJZA 5FBZA 3ZWVA 3GEDA 4F2GA 3L18A 4OIFA 3BXOA 1ADGA 3NO4A 2ZU0C 5E7QA 3VYUB 4C4RA 2ZQ5A 4LY3A 5LQRA 2XOKA 2EX4A 4FDUA 3ZQKA 2OWEA 3DMGA 3QI7A 1Q0LA 4JR0A 5B57C 5HHTA 1AA6A 2ADMA 3LQFA 3JWGA 4RF5A 2IYYA 2F59A 1KZHA 3BZBA 1AXRA 1FW8A 1DQNA 1JA9A 1P19A 1PWXA 2IL1A 2VS1A 3GEBA 3IAM6 3TIVA 1I7SB 4NYIR 2ZIUB 4F2DA 1NIJA 1TFUA 2C7PA 2V1UA 2RAUA 1YZGA 2YHAA 3CCCA 3NJ4A 1QTQA 2EQ5A 4PLPA 4LWOA 3WB1A 1T0HB 1ZR4A 4K6KA 3LY5A 1HDRA 3BPSA 4OQZA 2AOVA 1EEXB 4NBRA 2JVKA 3WGMA 2IXTA 2WJVA 1LSOA 4FYPA 5DLYA 3MYYA 2H54A 4MA0A 1CQIB 3CVYA 4WKBA 2ZJ1A 1KU0A 3GZNB 1DBVO 3OY2A 1CJUC 3R9WA 2R44A 3QG5A 5B58T 4FR5A 2QRHA 1VKOA 2NXEA 1XDSA 1PT8A 5JSHA 3ZQ6A 4CLDA 4BB6A 1QYVA 4JKYA 3NC4A 2Q8NA 2O7NA 4HYQA 5J4VA 1PR1A 2XVXA 1WWKA 3WKBA 2J45A 2XZPA 5JJIA 4B48A 1Y6QA 3BEDA 1RYZA 3D6TB 2XUFA 3URMA 1A8UA 1NV8A 2QT9A 1A5ZA 3AXSA 3IDOA 3LUFA 4MWCA 4QPDA 2Q49A 2I03A 2C8LA 1GRQA 1NI4A 2Y9PB 1IB0A 4ISCA 4A8JA 4G0WA 1Q1GA 1MX9A 1ISIA 1QB7A 2VQSA 3AJEA 4EHAA 1VE9A 3J81k 4C87A 3I5YA 3WA7A 3W8NA 3JSXA 3C6QA 4ONEA 5JEDA 2WJ3A 2ZW9A 3QITA 2I5PO 2QE6A 2WJZB 3EK2A 3HCAA 4PBSA 4LQDA 3F6YA 1R9GA 5KNCA 1DX4A 1YE3A 1NWHA 2E5FA 4P31A 4EHBA 2W7TA 4MP8A 5E95A 1U6IA 1LDEA 2HBQA 2WSYB 2VDRB 4ESEA 1GGVA 1TMYA 4PSKA 4FSDA 1KETA 4BB9A 1PZGA 1JWLA 1ZQ9A 4XYEA 3CR7A 1YRHA 1LWNA 3TLYA 5IDXA 3B1KA 1NF3A 1IMOA 2FN7A 4J2TA 1L9KA 3L2OB 2WIAA 1RYBA 1Q1BA 2A88A 3QG1A 2AMFA 2H1SA 1Z6QA 4FN5A 3KXKA 4GYWA 1P1JA 5FUXA 3TB4A 4PNPA 4EPRA 8ADHA 1PR0A 3LPCA 4TXMA 3ZYZA 1KPIA 3K9BA 3KOUA 4JP3A 2V7UA 3L7AA 3QELA 3X0DA 4B6OA 4EKIA 1W5EA 3RC1A 1YC2A 4PHHA 5IF9A 3GX1A 1R9NA 5FO1A 3QVKA 4ZOQI 4MQ6A 1NBME 4OQQA 4YHBA 2PO7A 4OU5A 3ZKWA 1W5TA 3GPIA 4LUCA 3Q3EA 1LF5A 5AW6A 3PC2A 1E3LA 3MLBA 5K09A 3JVIA 2IXBA 2UXCB 3AVWA 2W37A 2QE7A 3C8DA 3SPXA 3R0VA 4ECAA 4BY9E 3KAQA 3H5TA 5CJ2A 4CT4B 1E4EA 1C9JA 4X84A 1GLVA 2GHTA 4FFDA 4X8HA 3VOSA 4NPAA 2ZBEA 5DSZA 2ECOA 3LT5A 4ZOEA 8MHTA 1EFVB 3R7WB 5CVDA 1RJ9B 4LWZA 3LZDA 4XLLA 1ZIOA 2XNJA 2FVXA 3H2SA 3Q3VA 3LUHA 2Y0EA 3LCMA 4HF7A 1N7GA 3U4DA 5TIIA 1XD2A 5AVRA 3HJFA 3I4FA 2JIBA 2FN3A 2Z5VA 3T5CA 1MH1A 4MQEB 4PSDA 4AG6A 3AEYA 1IN1A 2C4UA 3OPVA 2CVZA 3H8WA 1U28C 4DR6B 1KR2A 1NIPA 1TA0A 2J3QA 3SF8A 5KTMA 2VDWB 3BIOA 3G5AA 1GGEA 4FW8A 3RU7A 2XDYA 3TE6A 1PW5A 3DL7A 3UT5A 4F7WA 5CDFE 2G9RA 1Q3HA 2FPGA 3AF5A 1D1QA 1IAQA 4KAXA 3QKSA 3ZZMA 3JAMA 3FY4A 3K96A 4ON9A 3ZIAD 4GDFA 2I2WA 3MBOA 4M0CA 4MITA 3V8BA 4Z7OB 1I7PA 5JMTA 5GZ6A 5LA6B 1CIVA 2NV0A 1VOTA 2BHLA 2ZIAA 2XTZA 4L8FA 2V7GA 3LECA 3BULA 5AM4A 3V6MA 1E7QA 3P9SA 621PA 5KHLB 5L53A 4MVJP 2OP0A 3OQOA 4M9CA 4UM9D 4DG5A 2M9MA 1U9IC 4HGNA 2IYAA 3A4YA 3MVEA 1J97A 5J2TB 5HMLA 1SHZA 3VR5D 5C2JB 1H9CA 3L0CA 5BR4A 3WGGA 1R0WA 5LYYA 4I9NA 1ZONA 4K9PA 4EKEA 4JU8A 1C4OA 4RZSA 1SU4A 1K5HA 2NG1A 1HNXB 1XVAA 4Y2TA 3ESQA 5L4LA 1NMXA 4JEIA 4JT9A 3WTBA 4KE7A 2X3YA 2CLOB 3SI7A 1QK4A 1SU6A 4F0JA 1MQSA 5KQMA 2VUIB 2RJ3A 1FLAA 4JB2A 3U3KA 1W0CA 3GRFA 3PL1A 2RMKA 1BS9A 3E9ZA 4N7BA 1OFUA 3I8SA 5FP0A 4PXYA 4NXNB 4PO8A 3AGQA 3LM8A 4E7OA 1Y8AA 1BRMA 5DO9A 4BX9A 1S8AA 2Q1TA 3LXRA 3JVEA 2R1VA 1E5VA 2Y76A 4DLBA 5BQ3A 1U0JA 3HP7A 2OHGA 4NULA 4OXKA 3X1WA 1X80A 3IX7A 4C5CA 1C1HA 4CG3A 2DYKA 4FFSA 3KEFA 5AOCA 1PHPA 1DC6A 1E1KA 2FPOA 4GX5A 1D0SA 1T43A 2OCBA 3HXPA 4CL0A 2V3WA 3UTCA 121PA 2XGGA 1JPUA 1YZKA 2E7ZA 1UMBA 2PUGA 4IQGA 4KIWA 4B8ZA 3KHTA 3MZ0A 2H6EA 5FOQA 3RSFA 3NYWA 1Y7IA 5I7EA 1Q77A 4V1CB 1EXDA 4X61A 4D5EA 3PWKA 1RWMA 3NAQA 5AUPB 4UQLA 5I4KA 4XYBA 3RUCA 1RM3A 4IGIA 4Q7QA 1MJHA 3HLKA 3W9YA 2EFDB 3GN1A 1O9GA 1FBTA 2D54A 1GU7A 2QRGA 4IUYA 2VK4A 4XIGS 5GONA 4DBVO 4L5BA 2MINB 3UQZA 2VUSA 1CBUA 3UGTA 4EMBA 2O54A 5M7EA 2Q0XA 3AUKA 1N25A 1VCMA 3IVGA 4HTFB 3RSHA 1G5HA 2W2VA 2R6CA 1Z0KA 3TINA 1WDLA 5G0WA 1R37A 2DULA 3Q9LA 1R8XA 1O57A 2WJ4A 3IJ5A 2H59A 4B4WA 2IHUA 4N5IX 2Q5QA 4U7TB 2RHRA 1KFEB 2BTQA 2G5CA 2RGAA 2X0IA 3OZVA 4CGYA 4DXDA 3THXA 3HHEA 2NVOA 1Q6ZA 1H42A 3H5WA 1BWSA 3ORYA 4C2UA 1ELOA 2YIMA 3JW8A 4ZI3A 1A7UA 3HM2A 5J2UA 3Q3JB 4R2IA 2QVLA 3AI2A 4R1QA 1MOPA 1T3LA 2Q2WA 3KWFA 2QTHA 3QFTA 2OHIA 3HCEA 4XKJA 3S99A 1K6MA 3WK8A 5BWBA 3FZYA 3EBOA 3GLFB 6Q21A 4DNOA 1PL8A 4YRKA 1TW3A 5C7OO 3VO2A 3VH2A 3RANA 3ERCA 5CCXA 4OLJA 3EEFA 1FP4B 2A14A 2IYLD 3GMTA 5IXJA 1MZVA 3CT6A 5C4GB 3A06A 3K6SA 3I28A 3VJRA 3PEYA 1SUSA 1Q21A 1IH8A 3R74A 1X9IA 3K0AB 5FHRA 2VTEA 3MGKA 5IH3A 1H1TA 4TTSA 4ZRDA 2D1YA 1DPFA 2FFQA 3MTJA 4I1VA 4UBJA 5D3MB 2HPVA 1SCAA 1TQ4A 3P5SA 3TM4A 5BOVA 1Q1ZA 3L1JA 1X8KA 2ZUTA 1O54A 1H2FA 4ZQGA 2NPFA 2BYTA 1P5HA 1G21B 3FZEA 4Q34A 2WDZA 5DXJA 1VJ0A 3TNJA 3RBZA 1KVTA 4HNSA 1VL8A 1TA9A 1JJFA 3G2NA 3G2QA 5I8WA 3DE5X 3JYQA 3N2EA 3V7WA 3VNBA 5DHTA 2Q9UA 3WRXC 2GPAA 1QR2A 2Q0HA 2ACEA 2HF7A 1VIMA 4D4JA 3ORHA 3DBRA 2QR2A 3NWJA 2P5UA 2P4EA 4CKEB 1QVVA 5IDQA 1JHAA 1BE0A 4YRZA 2HJWA 2B0CA 1Z0DA 4NDZA 3VSAA 3ECAA 2J87A 3N2NA 1LTHR 3D7KA 5FTLA 1SXJA 2C4NA 3A25A 4KDEA 5AIAA 2Z2XA 3WMXA 2Y0BA 2PXCA 4JXZA 2AJ8A 3PNMA 3GA7A 4QOFA 5M3BA 1SWVA 3EF0A 4IS3A 4MO2A 1EBBA 1T6NA 4QBGB 2NUAB 4EG8A 4WZZA 2CV2A 1PUXA 2BGLA 1OAKA 4FMCB 1FCJA 5K99A 3PC8A 2FXIA 2IY9A 1SCDA 2E89A 4HS4A 2V9CA 1IK6A 2MYPA 3DJFA 3QFHA 5AI0A 3WBBA 5K8CA 2CLDX 1YD7A 2RGNA 5DGDA 2ZYAA 1FLNA 1V8OA 2C4HA 4N4AA 3TD9A 4F5ZA 4KDCA 4UU1A 2PG3A 4YCBA 4Z1MA 1CY7A 2J41A 3CVXA 2G9VA 3GDGA 4G0OA 1KVUA 3EVDA 4MGZR 5IAJA 4H08A 2XNCA 5CGZA 2FG5A 2DT5A 3QE3A 1RQGA 2ICAA 1I6KA 3K1AA 3LQ2A 4LAFA 4XTCS 5FV7A 4ITVA 2FPIB 2A8YA 3LMKA 4YTEA 5K3FB 1DIHA 4S2EA 4DC9A 3HJNA 5FWDA 3RAEC 3EBLA 5HW0A 3DNMA 1YQXA 4MVJE 2AG1A 2F4NA 1RC8A 4PNHA 3BRQA 3P2YA 3PFIA 4OMCA 3HYNA 4OOFA 3WAGA 5C5IA 3A3PA 3HB9A 3PHHA 4BX2A 2JNWA 4P92A 4MVJF 4E31A 2AFIB 1RCUA 1AQYA 1DINA 3ROTA 2I4TA 2YRXA 4TKUB 3O4HA 3AJDA 2EAUA 3OUTA 2GBIA 4KXFB 3UJDA 3ZBUA 5IZCC 4F3YA 1P2VA 4MVJM 1G19A 1K89A 1I5EA 2JJ1A 4TZKA 4UBKA 3INYA 4UEWA 1C0KA 1T5DX 5FUVA 4O2BF 2GF0A 1JDTA 2RB5A 1EGVB 3K09A 4PG7A 5EGSA 2YL2A 2O2XA 5LUBA 5HOQA 3GJ5A 1VPLA 3OX2A 3KETA 1KQPA 4DJJA 1EA7A 4YAWA 3OF2A 1ZUNB 4PF1A 1T9AA 4O4HB 1Z83A 3OP4A 2C2XA 5T4BA 3INRA 1XXLA 3CLTC 2IU3A 4LA4A 1KHHA 2QMYA 2ZWAA 1KI1A 3FNFA 3EWSA 4Q9KA 2VP5A 5KYVA 2C1XA 4D4GA 1T24A 1WR8A 3A1NA 3DMPA 4Q47A 3SS9X 3N75A 5DCLA 4A91A 3GJTA 1YI0A 3C6ZA 2I3ZA 4NNPA 1WP4A 4L9RA 1Y1KE 5FRDA 3T1VA 1ZHHA 2EV9A 4KJZA 5JHHB 5ES3A 1SNYA 1W9MA 1O03A 2R84A 1KF0A 3RSSA 3HDVA 1YDHA 2YFYA 2DLCX 3N2GA 3NLLA 3SYLA 3ABZA 3QKRA 5BQFA 3OTGA 1GAWA 2NZUG 3EE6A 2WMOB 2I1QA 4RPHA 4BGEA 2Q4DA 1Z7YA 3ADOA 1UXHA 5KX5F 2ONJA 4RFLA 3RHFA 4CQMD 4DSTA 5LYJF 5JWRA 2XUZA 1XEFA 3DPSA 3ESBA 1NGSA 1QZTA 1O95D 4WVFA 4V1CI 3U3MA 3NV9A 4RQBA 4RAQA 4FMDF 3R5XA 1FF9A 1AZSC 4MULA 4DLAA 3T9EA 2FF7A 3A0RB 1K5DA 2XIJA 3LLMA 1VKNA 4BHTA 5HFNA 2RC6A 5TLSA 3ZVMA 2I6XA 2X2OA 1L8AA 4JELA 4RA6B 4CMEA 3MD0A 1NBMA 2G88A 5TPWB 1EI9A 4J43A 3QUQA 4GRAA 3MRXA 4MVJG 3JAWA 1I7QB 1FVOA 1Z73A 3KT6A 1T4BA 3LF1A 4JZKA 1DG9A 2BP7B 2OXCA 5CVTA 2Q62A 2QPTA 2FDRA 1G59A 4H31A 1YZVA 3FMVA 3Q0IA 3S2GA 1X9GA 2O2EA 3LX8A 2GAAA 4M0PA 4QDZA 2Q5EA 4MUHA 2QAIA 4ZANA 2NVUA 4I1PA 4MUAA 3FBTA 1YSCA 3AFOA 4XCQA 3LL7A 5CDTA 3I58A 3QLJA 3EWIA 3G0GA 4J90A 3WLTA 4QOGA 3RJ9A 1VMKA 2AUMA 3SQMA 3WDSA 4RDXA 2RBEA 3F8SA 3QUTA 5E0KB 4AF8A 3O2SB 4RK7A 2IYEA 4P5DA 3KIPA 4UHDA 4G0VA 3USES 5F51A 4EELA 2I3DA 3WYNA 1OGIA 2I3GA 4WZ6A 3I73A 3OZ7A 3QPDA 4JB8A 4QYTA 3MTDA 2BBTA 3MJRA 4GYKA 1HNZB 4B71A 1G6Q1 2ZCUA 3DBHA 1L4NA 1M6YA 3FMPB 1PR2A 3GUUA 4BNWA 4F9EA 1GM5A 2Z6VA 3FOWA 3H9EO 1UBSB 2QXYA 3O3MB 1GVNB 1VMAA 5KJ6A 2FWPA 5GV7A 3U6BA 2DQKA 1RXEA 2UYYA 4PBTA 4NP6A 4DCJA 3ZTTA 2VQDA 4O1MA 4FQ8A 3C8ZA 2FYTA 3MQ2A 5BT8A 3EPJA 3V55A 5BPFA 3G2PA 2VAVA 4Y6GB 2XCIA 1W0JA 4Y0NA 3WZLA 1TTQB 1U2GC 1MJGM 4PQGA 3T41A 5I7HA 5KSOA 3DT6A 4I50B 1TXGA 3BXPA 2YZKA 3ZGVA 4BVGA 1T1GA 4ZDIA 2WSSA 3GH1A 3OVMA 4FGKA 4LCEA 4HDKB 4MPRA 1PQYA 5EKUA 2VHTA 2IXEA 3D9QX 4RZQA 4RLHA 5AJXA 2X1LA 4EG5A 2AOUB 2AYZA 3DBOB 4LGCA 3R76A 3OCVA 1T9ZA 4DLUA 4GM0A 4NQZA 1A9XA 2XYGA 4NBKA 3AI7A 1MC5A 2DZDA 2R00C 4ZV9A 1E9RA 3DVRX 3G0BA 2GD2A 3MJFA 4KQ2A 4FDAA 4JL6A 4BX8A 3NTUA 1W35A 1LBQA 3U60B 5BYAA 1TLTA 1FW6A 1Z0IA 2FPWA 3LQRA 2C42A 2P8JA 1D4OA 4IG9A 4JBWA 2V58A 3S7ZA 4XE5A 1E9CA 1T9GS 5DK4A 2JFUA 4QEDA 3RPEA 1WMBA 3PQ8A 4KQCA 5E38A 4M1EA 3S2YA 1AUQA 4BV2A 4PG8A 3ELUA 1QCYA 4G65A 2I78A 2P4SA 5HJ2A 3RDPA 1P9LA 1M6EX 1WDKA 1XTQA 2X58A 2DUJA 4R9SA 2GPYA 1G9SA 2P3OA 2CLMB 2O4UX 3ENZA 3HADA 4TRJA 3GI1A 1IHOA 3HCWA 4N6OA 2F7SA 2IEGA 4NARA 3RYCA 4R8RA 4CUZA 3NHWA 5LQUA 1KO7A 2FEPA 3DHWC 4R1TA 2OMEA 3THYB 2HX1A 1SRRA 3ICQB 2XXAA 2V1XA 4OY3A 1DAPA 4JQOA 4F9GA 4DMFA 1ND5A 2D5IA 4W5NA 1A50B 2P77A 5EHQA 1PFKA 2X4LA 3WO0A 4LHEA 1OGYA 1DAGA 1YQWA 3REQB 5CLHA 4CMGA 1F12A 1TZ2A 3FYCA 4HQLA 2PUJA 3M4ZA 3VR3D 1K6JA 4W9MC 1OLSA 4S1OA 4Y1RA 3C3WA 4L57A 2YWDA 3GL9A 1A8QA 3M4XA 2BM8A 2WG1A 5THXA 4KTTE 2GN9A 3G2LA 3PXBA 1UC9A 1XRPA 4WNCA 5DGTA 5K0SA 1V8DA 3F6SA 3HA7A 2C77A 3I42A 4OHMA 1RAHA 4QG7A 3UNXA 2RHLA 3KSDO 1SCUA 1B14A 4TT3D 3D7NA 1T1EA 2ENUA 3D8SA 3VO8A 4BMNA 4TV8A 1P62B 4DMRA 3P2IA 4JHLA 2DECA 5G3ZA 3FYUB 1A96A 3RNLA 3T4XA 3ZHXA 3TAHA 1BWRA 5DNDA 1IBKB 1K8ZB 3E22A 5GPBA 4LXTA 1WY7A 2F1OA 3Q6IA 1SBQA 2WF7A 3R0IA 1JECA 1SBIA 1Y9JA 1JTFA 2B94A 3WLSA 1TTTA 3SSNA 2HXYA 1S9HA 2CZQA 1U98A 4LV6A 4KJXA 2Z5GA 1CU1A 4RUKA 1NP7A 2XWSA 3D2AA 3LCJA 5IT4A 1WMAA 4D9HA 4EF5A 2PSFA 4NJOA 1RVDA 4IIGA 4MUFA 4DCPA 2WU1A 4IGFA 4M83A 2ZTUA 3FM9A 1YIAA 2FPLA 3K72B 1WHTA 3LOPA 3M9XA 3L6BA 4G0QA 2HCBA 1YRQA 2P9JA 4I0WB 2OLJA 1H0HA 2C00A 2XT9A 1ODFA 3VO9A 2BGNA 4K9NA 3GVCA 3KM0A 4DYDA 5HM6A 2E18A 3R7NA 1MB0A 3BXXA 2BD0A 1ONSA 1OYVA 2WHPA 3IAFA 1N7HA 3INTA 3AKDA 1J25A 2VYCA 4FDLA 1CUYA 4K9MA 1GLNA 4IX9A 3L4SO 4LRWA 5CAEA 5JU6A 4LF4B 1NUSA 4F3KA 4FB4A 1K8YB 2VDVE 3L8YA 5AW2A 4NTZA 1OOEA 4NJMB 3P9KA 4D2IA 1WUJS 3QBEA 4MDFA 2G7ZA 3SJAA 1QZXA 3AF1A 3M4YA 4NOMA 4OI1A 3KSBC 1EDDA 1LA2A 3II6X 1UOPA 1PL6A 5F2KA 3VSDA 4EAAA 1H4QA 1Q6YA 3DEHA 4QUHA 1BX0A 3DDOA 1YUBA 3LQYA 2O2SA 2QTMA 2ODAA 4MRVA 4R3NA 16PKA 4XD7D 5HZHA 3HXQA 3C4VA 3MJEA 3NXKA 4YO7A 1XTPA 4BNKA 4MYTA 4WXPA 4KRFA 3RKSA 3X1DA 1Q2XA 1BFUA 2QQFA 3AI1A 3BWVA 1PCXA 1S0UA 2LV8A 2YMQA 3O91A 4JC8A 4WCDA 4ZVKA 4B17A 1LY1A 2N0SA 4MW4A 4Z3DA 4BNLA 2B99A 4BV3A 4DANA 5LKRA 3KQOA 2QY9A 4KSBA 2H4YA 1P4GA 1RXCA 2VN8A 4IGKA 3ETJA 3I2KA 4JLSA 3DYIA 4JT4A 3CRW1 1FDRA 2R11A 3ED5A 4YLEA 1EJBA 3F6BX 4ND2A 1PTKA 2PSHA 2OQVA 1TCBA 1Q15A 3M5CA 3PHCA 4OIMA 3TSAA 1Y5LA 2GHIA 1ETHA 2OC9A 3WMRA 3V3KA 3INNA 4FDVA 2XEXA 3P0EA 3NI2A 1B1AA 3HXLA 4KW7A 1SZCA 2XDQB 3V1KA 4Z4IA 4A8JC 4BO7A 1KI2A 2CBXA 3N2IA 5DM2A 3TI7A 2VHVA 5K4AA 1J0EA 3QLTA 1V9LA 3FCUB 1CDDA 5CIQA 5T4HA 2EFEB 3MWLA 3ND6A 3CX3A 4WSOA 3I5AA 4ZQFA 3TX2A 2A94A 4A8PA 2O8BB 1R8YA 5ALEA 3PUYA 3WLFA 5AIBA 2CKMA 3IAHA 5AW1A 1XRQA 3UKDA 1IU9A 5LZ4A 3IHLA 4NOLA 1TT7A 3JWPA 4W7IA 1MB4A 2PGXA 3MJSA 1ZS9A 4HN4B 2NUPA 5AXDA 4EI9A 3IB3A 4P5PA 2OUKA 3WYDA 1NSYA 2AKYA 5FL7D 1AOXA 5FB3A 2AFHB 2BGRA 3Q98A 4DKXA 3H1PA 4DV6B 1IDOA 3KZNA 4CN9A 2XE6A 1E1DA 4E5SA 4EHJA 1HE1C 2CLHB 5ERGB 5KTOA 1VSUA 3U40A 1R15A 3OE7A 4GR5A 4QFDA 4RC9A 3UAWA 4YRDA 4BC0A 1E89A 1Z2OX 4GZLA 2QBYB 3ZJUA 1ZM7A 1A95A 1WZIA 2NO9A 1ESMA 1EZ4A 3D0OA 5EHGA 3VBCA 2YV1A 5EIBC 4LE0A 5BN4A 2IVZA 5EAIA 1XCOA 1YDMA 3CGWA 2FTKE 3KEGA 4EPWA 1JIIA 1Z4NA 1QPBA 4J75A 1GDDA 1NYRA 1JR4A 5F7JA 4BMSA 1U9YA 1E2PA 3P9QA 2Y77A 3TRJA 4KSYA 1TF7A 4DRXA 1A5BB 2L17A 3U7RA 3T12A 1KEUA 1P74A 8ABPA 3CC8A 3NTOA 5DSXA 2ISCA 2C7RA 3NANA 2XE7A 3MTQA 1TVKA 3RHZA 3VOBA 3N0TA 4S0ZA 1ISJA 3KLPX 1V8BA 1V2HE 1XDZA 2P2DA 3KHSA 2CSUA 4Y2YA 1RPZA 2PKQO 1AV6A 1KJ9A 3ZNOA 2F17A 3VTKA 5KX5A 2XMGA 5EWLB 3NC0C 5FI5A 1UPCA 1RWQA 1ZINA 5EZYB 3BD7A 3VKHA 1IHYA 5B3LA 2XNDD 1G6KA 3O03A 3HB4X 1PFUA 2BEWB 4MJXA 1JKIA 2CY0A 3DXXA 1KE2A 3WK4A 4YJ3B 5ALYA 2WWXA 5COBA 3SEQA 3LVQE 3GPBA 1PL7A 1M8PA 3T34A 3DTYA 3ENNA 4PVCA 4Z7QB 2ZR7A 3S81A 4HHEA 4OQ4A 2ZRLA 3AR6A 3NHYA 3FDIA 5JAMA 2JLBA 4LF9B 2C99A 3AETA 4J7AA 3X43A 3SLKA 4UOQA 1W5BA 3L6RA 3OX4A 3VZRA 4OAQA 1CJCA 3EZFA 5DM60 4ARCA 4EFDA 3FOCA 3SM9A 1A9QA 1RRFA 2PYZA 2LIPA 3BJMA 3JU3A 4W82A 2V7QD 5JCJD 1YA6A 1S96A 1Y6ZA 4I4TF 3RS4A 2BGMA 2VPWA 4WW0A 4TTPA 1BHQ1 1KFBB 2B4KA 3ONEA 4MUIA 1LJUA 3PXXA 4BKUA 1V26A 1BOOA 2I99A 1NOKA 3EDRA 1QZUA 3QJGA 4ALLA 3OQNA 3G89A 1POXA 2CUTA 4M9QA 4C2AA 3LUPA 1TZBA 2HH9A 3CINA 2P41A 1N5OX 4J07A 4DGSA 4UVIA 1GTRA 2IP1A 4POAA 4ZAZA 1IBSA 2DTEA 2DPMA 4O29A 3RHSA 5CFZA 3SS8A 3FCYA 2FQYA 2QENA 1DTWB 2ACKA 4EL5A 2K87A 3KPYA 5JXJA 5ALSA 5DHAA 3X2FA 2JIMA 2XJ9A 4RTPA 2B1GA 6AT1A 3OOSA 4MWOA 1G7TA 5BN5B 4ZO7A 5E2BA 3SS7X 3UWKA 2QTLA 1JLSA 3HWSA 4EB6A 4KR3A 1N2XA 2NWQA 2G4CA 4GXQA 5GGYA 2ZYDA 2PAFA 1FTNA 1SXGA 1J42A 1VYUA 1W0KD 2R6DA 3OUUA 3WV4A 5GM2A 3SD7A 3MF4A 1IJBA 1DZIA 2VDOB 4L6IA 3LS2A 4PFQA 4YJFA 3L4BA 1MJGA 1WJGA 3AM3A 2QJWA 5IDWA 1U0GA 2RGGA 3DMRA 4YWJA 3ZZNA 3B7PA 2ZSJA 1OIWA 3IHKA 3IMEA 1GFSA 3Q4GA 4Q9LA 2J6BA 4ZJYA 4NDNE 5CIWA 5AW3A 2ZRQA 4BKOA 3A8TA 3MN1A 4WOCA 3Q2KA 1PS8A 3HR8A 5I9NA 5E6SA 1YZYA 4RDCA 2AJDA 4EY5A 3KYDA 1NT4A 3PI7A 4PTZA 2BFNA 4FQ7A 1OWMA 2W90A 4M9UA 2I55A 1FFEA 2HA4A 1DAKA 4HPWA 4HWTA 1T4CA 3D8NA 3DPUA 3G0OA 1JXAA 1ZNXA 1V3VA 3LHDA 5D86A 3ZWBA 1KEKA 4AO7A 3AEKA 1EG7A 1NJGA 3R7SA 5EJ2A 4AECA 3H11A 5HX7A 5CB4F 1BYIA 1UH5A 5CD1A 1NNUA 3D7SA 4L0CA 4MH0R 3QUSA 3GAZA 4KCGA 5TX7A 3RT1A 4EUNA 2YZGA 4B31A 3CX8A 4WESA 4OHBA 4BEBA 3ANLA 3AM5A 3I2HA 4LX0A 3OPYI 2DMRA 1XKQA 1VSTA 3KSAC 3KDSE 1QHFA 2YC4C 1XZDA 4HAZA 4KWEA 3QHPA 3VKVA 1XCLA 1VL6A 5KS2A 3X1MA 3RTBA 5FBRB 3UYLA 3SQWA 3DPIA 3U3OA 3NAGA 3RKRA 3IJPA 5GM1A 5B3JA 1QGUA 1T4MA 3V1LA 1ZN2A 4RABA 2IYZA 4PYKA 1H6BA 1NMSA 3LK6A 3FHCB 5KMGB 1M0TA 4PQYA 2CJYA 4TMYA 2ZRJA 2V98A 4HSEA 3AY0A 4MKGA 4QRDA 4I36A 2FPXA 4G8JA 4RZHA 2Z1DA 4EG7A 3QYJA 2D06A 2D3WA 1B3BA 3K5HA 4UHFA 5BO5A 5TT1A 1IUPA 4GSLA 1HRDA 4U2DA 1CUGA 3CIOA 4QNNA 5T67A 5E6UA 2HZBA 4UTPA 1BTOA 1QFMA 1U11A 5E1MA 3ISVA 1W1UA 4BVEA 2H2DA 4L28A 2CJXA 5TJHA 1A2KC 1EX7A 1GNRA 2FJPA 4YRCA 1PZXA 4G24A 1YK1A 4ITRC 3ZV4A 1G8PA 1PKXA 2HHAA 2YIVX 3HB5X 1C7EA 3M1LA 3SVZA 2QKYA 4YYEA 3NWPA 3BD8A 3S27A 1HC7A 3F8WA 1AQIA 2I7DA 5DIZA 1WABA 4ZYWA 4TL8A 1JJIA 3KZXA 3ONNA 4DNXA 1GZUA 3QA9A 1XZFA 5FOSA 4G4SP 3RS2A 5A4IS 1WU8A 4U8HA 4PHGA 3QK7A 4CLOA 3OURA 3DXFA 2BH2A 4HNVA 1TEXA 2C9DA 2HLPA 4U2BA 1G98A 1RM4A 5BYKA 1CJKC 4RV9A 3KRTA 3MSXA 5ISMA 4MVXA 5J1SB 4FEGA 3ED1A 4UTRA 3A3YA 1EIWA 5ALPA 4K6FA 1XUOA 4QDJA 4F96A 3OEED 4ZZIA 3IT0A 2RGUA 1IULA 4U5QA 3G8CA 1QRAA 3GLVA 1W34A 1NP3A 2YZ7A 1B8UA 4Q4DA 5I9MA 3TRDA 5AVUA 3JR3A 4E5YA 1GY8A 1IK4A 3TD2A 2DJ5A 2PGNA 1SXJC 2H5JA 3QBDA 4J16A 4Z5XA 3KSZO 5BVGA 3GEEA 2JJ2A 4U7FA 3AUFA 1K08A 2BFOA 1E7RA 1MB2A 3NONA 3EOZA 3V4ZA 4D82A 2QRVB 1ZJJA 2AG5A 1DIOB 3PC8C 5AJHA 1RBMA 2G83A 3LF2A 3WRVA 4GO1A 4CMIA 1MPXA 1RNLA 2G1AA 3D8UA 2QMUA 2RGNC 3EAFA 2VHQA 4IYJA 4XQGA 5BYBA 2BMFA 1TQHA 3AP2A 4DQLA 5H1YA 5HP4A 1JR2A 5DULA 5GP1A 1IPHA 3TRFA 1J90A 1ZU5A 2AMLA 3QPVA 3PRYA 5CLFA 3T3EA 4DVGA 3WGLA 1CZLA 3DTVA 1XTBA 3HBNA 4DADA 4DMLA 4L9WA 3EASA 5ILGA 4XJSA 3KOOA 2ZK7A 3VR2D 3ZI7A 2Q8PA 5IM4F 3G0HA 3QE0A 2EZ8A 2G7MC 2G3YA 3RVKA 3OIWA 4L75A 4F85A 5BW8A 5LQJA 2P30A 4JUFA 5CA1F 2O19A 1X1EA 4YA6A 1AE1A 2Z3ZA 4IF4A 1CUJA 4AXXA 2Z2IA 4WOJA 4YJGB 2NT3A 4D45A 1B0UA 1CE8A 1GTMA 3H0EA 4CODB 2HT6A 3H05A 1J07A 2PVPA 4XX1A 3CVJA 3DB2A 1FYEA 4P7BA 4A7PA 5L4SA 3K2IA 4RESA 1PFVA 2NSDA 3R75A 3F49S 3CLVA 2SICE 4UU8A 2NV2B 3R8XA 3CW9A 4HVTA 3M2PA 4CKBB 2P78A 3VYRB 4D6YA 1WOYA 2XWJI 3PWTA 1EK2A 4NBLA 5ICMA 3P52A 1M6HA 1PQWA 1GU0A 3FZGA 5K9ZA 2YJNA 3HCDA 2O07A 3HUDA 2E4ZA 2YXBA 1JS1X 2DPGA 4YPFA 1R16A 2QRUA 3GFTA 1CQWA 4OM8A 4PZDA 5I9SA 5B37A 2BFEB 3RVSA 1J8MF 3V3TA 2IHZA 4AMUA 5WRFA 4FCTA 5J47A 1PSZA 2XLBA 4PCLA 2OESA 1KQGA 1XCPA 1ISFA 3ENVA 4WJKB 1KSGA 1E8MA 4E2FA 1C3VA 5AM1A 4S05A 1SXQA 3QWFA 1ZISA 2ZRNA 3AU8A 3M6WA 3QENA 4QA9A 4BRSA 2FZGA 4J91A 4RULA 2I6TA 4ZVTA 4CLXA 1R5BA 4ZU1X 4BX0A 2W2OA 3RF6A 2PZKA 4O2AF 4W5HA 4I5IA 3UW1A 3DD5A 1CLEA 3ZDRA 5B4UA 1A69A 4P1ZA 5HTOA 1P6QA 1KEEB 1WUIS 1XZAA 1NW5A 5C3MA 2CUZA 5FBKA 4WA7A 3U1BA 3LDFA 2D74A 2O3QA 2QTWB 2JAUA 2C07A 3QXJA 4HNGA 3RS7A 4C6SA 3DGEC 1KRWA 1I94B 4EEXA 3L7NA 3F9IA 1ISHA 5BW5A 1W30A 3CB4A 5BV2P 1XAGA 4CIWA 1TO2E 4TMWA 3WICA 1TLFA 2UUOA 2ADFA 3PRKE 3T3PB 2IHBA 1P7YA 3AT1A 3N5CA 3IE1A 1L5SA 1Q91A 2W6JD 5IT9A 1JHZA 3VX4A 1Z5ZA 4AZSA 4KQFA 2HNAA 4HZUA 3E53A 3EH2A 2GCOB 1TJPB 2VUHB 2QB5A 3W7BA 2GZ2A 5IVDA 1SVLA 4BNVA 4KXYA 2VH5R 1J5PA 3ZS8A 3LWBA 4CGZA 3FR8A 2PL3A 2EBFX 4C0QC 4MUGA 1JNXX 5JSZA 1E2EA 1BDMA 2HHLA 1XMQB 1BWPA 1O6CA 1T8PA 3GGDA 3HYCA 1AG9A 1CUXA 1CZKA 1XZGA 2IIPA 3HABA 4LVUA 4RZXA 1PSDA 1W88B 4UNSA 4TQ9A 3D7RA 2YX1A 5ECDA 2VEDA 2M6SA 1P6UA 1R0YA 1G2QA 3PS9A 1A9PA 1ACLA 2A5GA 4L3OA 3OE5A 2PZ8A 1VI5A 3DLIA 4JJ8A 4MQUA 5M2QA 1CY0A 2GAFA 2PUTA 2ONYA 1FNBA 4JWTA 1DT3A 2PX6A 1HT1E 2ZUSA 3RWMB 2ANBA 4R1UA 4BAGA 1QGOA 1USGA 1FYXA 1HL7A 5DP2A 3DAHA 5EWJA 4V0KA 3R7AA 3P1JA 2FGKA 2WTBA 3CRMA 1NYQA 3ABSB 5T6BA 5I9IA 2W2TA 4NG5A 1Q19A 4HFJA 4QKQA 3EG9A 4YQYA 1EVZA 4EHNA 2XVAA 2F8TA 1N6KA 2QQEA 3OU7A 4WV3A 1LDGA 5JADA 1JRLA 5LUAA 2A5YB 2ZWPA 3PV0A 3DEZA 4OI2A 1GUFA 4WXEA 5JD5A 2ID9A 2X7HA 4CM9D 3K0SA 1XWWA 3WIDA 5KYUB 1PIWA 2WAXA 4JLOA 2JK1A 2OYSA 4PX9A 1EUDB 1NF2A 4KV9A 4EA6A 4OQNA 2G9NA 3B3AA 3UCEA 2ZUBA 1GEEA 5LMUB 1P3DA 1V1MB 5PNTA 3WMFA 4D3ZA 1RPAA 1TPYA 2NO5A 3GJRA 3U9LA 4RNDB 4RFSB 4QREA 1GAQA 5FTWA 3UJ8A 4LK3A 4D9EA 3TXXA 3VDNB 4HUQA 2QVCA 4KK4A 4U39A 3DWIA 2QZZA 2VHXA 3I9JA 3SDSA 1E2DA 1Q0QA 1MAAA 1LPOA 5LQDA 4AN0A 5HXAA 1TVMA 3QF4A 3NM6B 3O8QA 3T1QA 4DQXA 4URWR 3EGXA 2GWRA 2VBCA 5DNWA 2Z9BA 1NASA 1NX9A 3GD5A 4INZA 3GLGE 3DWFA 1Y1TA 1QX3A 4WZAA 3JR7A 4RIHA 3EEQA 4H59A 4LSWA 2BEVA 4IEFB 3GNLA 4FOOA 1EDEA 1GL7A 1RWWA 2K2WA 4BVHA 3PVSA 1VGRA 3L06A 1BQ3A 1N7JA 2HFJA 2BFPA 3IKLA 3IVCA 3V97A 1IRIA 2B4TO 2X9NA 4U2CA 1QQTA 4B45A 4LZLA 3PXEA 1KA9H 1AUPA 3L8ZA 4LXHA 3WBJA 2RARA 4LF8B 1VXOA 5DK6A 3FLAA 1UK9A 3PZRA 4UXHA 3S1SA 2FDXA 4BXOB 3LUGA 3OQIB 4S1VA 3LLCA 4S3MA 2HO5A 5FLKA 3DHVA 3UJHA 1N2IA 4OBXA 5IKOA 4RQAA 1I32A 1Z28A 4H7DA 4II2A 4E88A 5HUJA 2JS7A 4TOIA 2PSSA 2HJVA 1B8NA 2JGDB 2X7XA 2C61A 4J2HA 5EE0A 4ZARA 1WIWA 1EWYA 4HXEB 2NP7A 4COKA 3DQPA 4WJLA 4M8KA 2PQ0A 4ZHSA 1CW2B 1Z38A 4L8WB 1JDBC 3IT1A 1Z8HA 1SZDA 3OTWA 2RGEA 2FRXA 3WC4A 2PFGA 3H5LA 4NECA 2WHQA 4ND4A 3RFUA 4RE6A 4UOZA 2A1TR 2FW9A 4KAJA 1OI3A 1T6YA 5C0OE 2J31A 1OFUX 4G85A 1CVIA 5EOVA 4BN5A 4E2ZA 4MI3A 4DB4A 4GKJB 4BVJA 3D7LA 3MA0A 4PGMA 5K3BA 3SFTA 4JBHA 3GG9A 2M98A 2C2MA 1JEQA 4FNMA 5EC8A 4BTVA 5AW4A 1SVNA 1BVYF 2XH8A 3A1FA 1AQNA 2IPOA 2J3EA 2C31A 3MD9A 5F1YA 3DE6X 2YJ3A 3FAZA 4TRMA 1VBFA 3ELDA 3HKDA 2XB9A 2QTTA 4LRQA 1RXWA 3KZCA 1ZJ5A 4KTVE 3K8OE 1XHEA 3AIMA 5KPJA 3K9GA 1UKZA 2ZETA 4MP6A 2GCIA 1G5QA 4HGOA 4MKHA 3T4UA 2ZJ3A 4IJUA 1R6TA 3T3IA 3K53A 1M1YB 3W9SA 3LTNC 1QCDA 3OX1A 4JLKA 5TEVA 5AXCA 4L7QA 1B8VA 2H07A 2AN5A 3LTEA 1LFAA 3UUWA 2H7XA 3ZYCA 2XCTB 3SWWA 1SUBA 1EFHA 3CLRC 4CMCA 1Z56C 4W1QA 2JAPA 1BFKA 3CF4G 4M87A 1VLLA 2WSLA 1PDWA 3DUFB 3QLUA 4TTRA 1G64A 1HDYA 5DWQA 3CKMA 3I2FA 1OVMA 3IMKA 5AK3A 2V4ZA 1KY3A 2ET6A 3ZHUA 2OHOA 3QU4A 1Y7HA 1XP5A 4Q1DA 4QECA 4OK3A 5SICE 1GPJA 1L3CA 2C3UA 3MK31 4HQFA 4Z53A 2XWQA 2NU8B 1LPMA 2GEBA 1EHCA 4J7CA 4KXQA 1N0WA 3HA3A 3SKVA 1SVIA 1Q0TA 4R54A 1AK9A 1LBHA 3TCNA 1SBYA 3HEAA 1MH9A 1YR3A 4ZT2A 2REXB 1K2VN 3QZUA 2GAIA 1XZNA 1IXZA 4DPMA 4ZK6A 4F38A 4NAHA 2CF5A 2GNPA 3E18A 5IAKA 2GASA 3TN7A 1FRZA 3GHHA 5A4FS 3E9RA 2IOFA 3RIMA 4DR1B 2MR5A 1FDOA 3WLMA 1DIGA 1J9EA 2HNBA 3O0DA 4QGBA 2SKEA 1W29A 3ESZA 5A0TA 2E49A 4PZEA 2Z5FA 1KAQA 1P3Y1 3ZCXA 3T7IA 2JVJA 2GNOA 4TROA 3TLZA 1I3OA 1BEUB 2J9XB 3KOYA 2X22A 4PFSA 2P79A 2X76A 4LZJA 5JY6A 4RCVA 2C7VA 4IJKA 4RFVA 5JYBA 2JLWA 1FU4A 3OICA 3PE4A 2CV0A 2HSGA 3IEXA 4YQZA 4NH0A 1J2YA 2NT4A 1UOOA 4PN3A 4OGWA 1LVHA 1QQ7A 4Z3KA 4UBNA 4XOIA 1XJ0A 2AR7A 2NNLD 4IMJB 4Y9UA 1PK7A 2E1PA 2B35A 4CR6A 1N78A 1QIDA 2IPMA 2YVKA 4RMJA 4E3ZA 5B3KA 1VLMA 5IM4A 3PGMA 3C1TA 1DFHA 4MLCA 4A26A 5C4IA 1C8BA 2EARA 3VZQA 4DWVA 5CA1A 4EECA 1YCDA 1O58A 2UKDA 3A31A 3DLAA 1TM7E 3JARB 1NVXQ 5F76A 3SBDA 1UT8A 1XLUA 2NV6A 3REOA 4CDMA 1QF9A 3ASUA 4J9UE 3AR7A 5DYNA 5FULA 4Q4HA 3BMNA 5AJWA 2A9PA 3TECE 4AXBA 1C3OA 1FTYA 1IMJA 3BGDA 2O1WA 3QY0A 4FFRA 3DVSX 4I6JA 2NXNA 4IQFA 4CKXA 1KEZA 3PR1A 4F5DA 3MQ4A 4X8OA 3BXZA 2XV1A 5AVOA 3HGQA 1XK7A 2AW3A 4BLOA 2B0JA 3L0YA 5KNLA 1GKUB 3A1WA 4U6NA 3P8ZA 4B3GA 2PUWA 4H16A 4BCBA 2ZI6A 1PD0A 2AT1A 3FJOA 3HLYA 5TMPA 1APBA 1JR6A 2YW9A 5HA5A 2DUUA 3O9MA 2PTHA 4FVTA 3TRKA 2XYVA 1YF3A 3O90A 5A3JA 1T2DA 3VQTA 1COWA 3PC6A 4Q1FA 2BR4A 2NW6A 3KLBA 2CXQA 3FKSD 3DB1A 4NF2A 2LNDA 4IOKA 3PA6A 2A1UA 3ET4A 3GJ3A 2NYVA 4R0NA 2WD8A 2OXTA 1ORVA 5DHUA 5F1OA 2I6UA 2YTZA 2XVZA 3P9ZA 4FCVA 4I9UA 1ONBA 1BKDR 4DR5B 2JHFA 1IXRC 4DUZB 4A0QA 5CXSA 1DGQA 4F93B 2B61A 2NACA 3GDOA 1JLHA 5ERYA 3U4AA 5EJ8A 2YV3A 1NLZA 2QJTA 4X95A 1XPUA 1T6ZA 4YUAA 3K15A 1KSFX 1VBKA 1ULSA 3GP8A 3M3DA 1UXKA 4O2AA 4S0XA 2YWFA 1FLDA 1II8B 5AHWA 5EXSA 3OEHD 3TFQA 3I0MA 3S5UA 3PLAE 1U7WA 4LJ6A 4EKGA 5JH7A 2W58A 4AFNA 4ALKA 3LIIA 5DGHA 2GA8A 3OKCA 1DRVA 4ND1A 2XUKA 1UFKA 3BCRA 2YN0A 1HETA 1A71A 1WNTA 3HV0A 4GYJA 2FE1A 1XTKA 3EMVA 5DXAA 1BD3A 5FR2A 2ZJ8A 4UNNA 2VJBA 2LW7A 3BAZA 3E7XA 4JOCA 3ROGA 3W8RA 4CT0A 1YHNA 2ZRIA 3EY4A 3UXEA 2OFWA 4LISA 1N57A 2VXBA 4KOAA 4M46A 1JDZA 1UDAA 3MMXA 4HT3B 1BJRE 4FILA 4J0FA 2H2GA 4P0PB 1GQQA 4KP7A 3SVTA 4PY2A 1L5NA 3TLXA 1I7DA 2ZIWB 4HLNA 4TLBA 1X42A 5AHRA 1T2VA 1Q7EA 2WT4A 5A0FA 4EJFA 1DCFA 3FBGA 4G37A 1DAMA 4CM4A 1NBOA 1XZBA 3TJRA 4ILEA 4MEAA 4PAQA 4QOJA 5KPDA 3R6WA 4H7PA 3URKA 1R6AA 3IURA 3PFNA 4Y8VA 2HY7A 2I4LA 3FVTA 5A4KA 4UCXA 5CP8A 2GZ3A 5SZHB 2YBDA 2MDTA 4TLCA 2FMTA 2YNMD 3IE0A 2UAGA 3VKWA 4EA9A 1JIJA 2LE0A 2WKQA 1KJJA 1L3BA 4WERA 1ZP6A 5JATA 1W5FA 5L95A 4PVDA 5LMNB 2P4QA 3UJBA 2GM3A 2JRLA 1CNEA 1PJ2A 3N6XA 1Q7RA 4HAVA 3PFCA 1PVDA 1DBPA 2VNIA 3IPAA 2X86A 3DR5A 4LZPA 2XODA 5DF1A 4ZTBA 4TM8A 5FUBA 3WGOA 4DM7A 2RB4A 2WPDD 3DNFA 3E2IA 4BZXA 1WBDA 1QQ6A 3CZ4A 4PBRA 3IRVA 4OJTA 5ERXA 4US2R 1K5GA 4A3SA 3DMFA 1N9KA 4ZOLF 3NC1C 1YL5A 4Y1EA 3HKCB 4WUTA 3BH0A 2JGKA 5FXMA 1WZNA 4BLQA 1D6JA 4JI5B 5AM3A 1QUEA 2PWPA 2QPLA 5DBEX 3FSRA 2JCXA 1BCSA 1IJFA 4NH4A 3OZCA 3HU2A 4WBNB 3C70A 1YOBA 1JB9A 2XNKA 5JYDA 2WABA 3HDGA 1YRYE 4B6RA 1F7UA 6CHYA 1VMIA 3ZEAA 3FZNA 4IIJF 2FWMX 3BWBA 2RIRA 1SH7A 5T4EA 2JKZA 4G5XA 1O1YA 4E22A 1E3QA 1I3KA 5EZ6B 1A7KA 3G2HA 3N2KB 4FJ2A 1Z6AA 1FRNA 2BKEA 3DE4X 3ID6C 3PCRB 3UMRA 5C9ZA 4F84A 5LLTA 2WNSA 3C24A 3K1ZA 1CHDA 2VHCA 1FP7A 2X77A 1FK8A 3CLKA 2P7IA 3GLKA 3JQ6A 2AB0A 2ZR9A 3QWAA 3QVTA 4J4BA 1DX9A 4JBYA 1LNQA 1T35A 5IYZF 5KTTA 5FWYB 3TYXA 2H4WA 2JLQA 2PPLA 1NKVA 1G3MA 3OM1A 4H1VA 4KO1S 4LEIA 1ZA2A 4FCWA 3WMEA 4UOEA 1XWIA 4ZV7A 5P8WA 4AY4A 3UA3A 3GLGA 1EB9A 4YGYA 4KDFA 4OTZA 4PCUA 4X20B 1UJ5A 1U6KA 2XZTA 2Y1XA 5HYVA 4AK9A 2J9RA 2VNAA 2ZRKA 3W2FA 1F6BA 1VFNA 2D8MA 3OT1B 1C8LA 1ZMTA 5B3JC 3W5DA 3WGIA 3ZX5A 2A33A 1UKCA 2E3JA 3E84A 5UKDA 4BQSA 5GTDA 3E8MA 1SIUA 2OWDA 1OXTA 2H57A 4GPEA 2GN2A 4PRZA 3D5TA 4FINA 3RWOA 5JC8A 4A27A 4YVFA 2Q29A 1PG5A 4PLVA 1DC7A 1Y7PA 1TYEB 4E12A 4JFAA 4DEYA 4NZZA 1S8NA 1P8AA 5G3YA 4A5OA 4DWJA 1IFXA 2VLIA 1Q16A 3OZRA 1ZD4A 4ZXPA 1H5QA 4K6MA 1KS9A 4KR6A 1F8UA 4BGUA 3NIDB 3CUWA 1TGYA 4IWNA 3IBSA 1CZNA 4ZDWA 4EVIA 3IVAA 3SLGA 1GFIA 1M74A 5AT1A 3HK2A 4ZMBA 3D4IA 3FUWA 5HIJA 4V02A 2IV3A 3G5UA 3T3HA 4B6EA 5K0GA 1QHNA 3TF5A 1Y9ZA 3GLUA 4BFVA 4AJ4A 3DG9A 3WFJA 2B4AA 3LG2A 4UE2A 2JLXA 4OP3A 4QQ8A 2E4VA 3EQ9A 4AJIA 1J6UA 2R1ZA 2RAVA 3SOPA 3WJ2A 5KNDD 5F12A 3OZDA 3TLBA 5F3RA 2P2NA 4GKVA 3FSJX 4LCBA 2I54A 1S4MA 2VPIA 3NASA 1N2HA 1NSFA 1COZA 3Q7QA 4JK3A 3UK7A 2XADA 2Q9AA 5IUNC 2UVPB 4BNUA 1TW2A 1M6VA 3T54A 2VT2A 1M0SA 3HSSA 3OZTA 4WACA 4JJAA 3HO8A 3HACA 3QHQA 1MOZA 2D8AA 1T3SA 5D5PA 3ZHYA 2PBLA 1C9KA 1JEYB 2XYRA 3AUSA 2OBMA 3WIUA 4K28A 2QZJA 4QPPA 4AW9A 4U8GA 1WCIA 1NQAO 3KU1A 1SKMA 2OO7A 5ICCA 1JF8A 2PJDA 3ESAA 1VCNA 2V8BA 3B36A 4FFNA 4OXIA 5SYMA 3W2GA 2D0OB 5EP4A 4DYHA 4G07A 1CERA 3I1FA 4QGFA 2YZMA 4J16C 1G5FA 2ZPAA 1ISMA 1QP0A 4M7WA 2NXJA 3G7UA 1AQ6A 3H2HA 4UHKA 2QM0A 2XMRA 3LP6A 4L51A 5IM5A 2F9LA 5C1OA 3TZQA 1GT6A 3CLHA 4GF5A 3EGDA 4WY2A 1UKYA 3WHIA 1UKAA 4RL4A 4EHIA 3HCOA 1RJWA 2P2CA 2DEUA 4W5WA 1ZL0A 3F5SA 2XA1A 1HYQA 5TARA 4B6PA 1SG6A 4TL9A 3W8EA 1MEEA 3ZDCA 3BFJA 3GUVA 3M5WA 1GPH1 4RH3A 3UK2A 2ZJ6A 3K9HA 1KJ8A 3OSZA 4OGGA 3THWB 3HY3A 2P1ZA 2J30A 5K01A 4E14A 5E6RA 4LOHA 1XZPA 3A6GA 3M9LA 1E1CA 5H8WA 3E3AA 2GM4A 1NVAA 1U4NA 2QYTA 5DV9A 4CYMA 5K4GA 2XD9A 4JASB 2BTOA 2VNKA 2VG8A 2BGJA 1EWVA 4KWTA 4HWOA 4G8BA 1ZRHA 4B2PA 4ZHQB 5A02A 5JFTA 2A9JA 4XARA 5U9CA 1LC3A 3N53A 2FUG1 1N5IA 3PC3A 5EJ7A 4O0MA 4HDAA 2JGFA 3LPLA 1QPZA 4D9MA 1EQ2A 1FXUA 2VHEA 3KZ1E 2BJWA 2G9QA 2XXBA 5BV8A 3V00A 1U0RA 4QT4A 1B73A 4CF7A 5GJCA 3H9CA 4D9IA 3CVUA 5LXTB 3PEWA 1EJ2A 2RKOA 1Y4SA 1C3XA 4D46A 1H1LB 1I2AA 3HS3A 3PWSA 3SJZA 5LJLA 2MSKA 4JNKA 4EENA 4OYRA 1E0KA 1KEPA 3JTEA 2NSJA 4RGYA 2J6IA 4ZP1A 1WSDA 3BE5A 1HE5A 4JXXA 2PUAA 1LFDB 1M5UA 3KD2A 3LBAA 5TMDA 4D3SA 1IM8A 2AZ4A 4TLMB 1P6XA 4UBLA 1AHPA 3QSYA 4BKRA 2PKEA 3K2BA 4TTJA 5E4YA 1AKTA 3Q5DA 4EQZA 4EOGA 4LDAA 3RBXA 1ZGHA 2QAGA 3TEJA 1TEZA 2R7MA 1W48A 5YASA 4GIBA 2VDQB 3H6KA 4KPUA 4DILA 1U0BB 1FPQA 3ZVKA 3C5WP 4HAYA 2Z9DA 5MDHA 2CFOA 3KD3A 3QNWA 4QXMA 1NX6A 3UV3A 3L9XA 3QH4A 4QJBA 3GB9A 1UDBA 1V4BA 3M83A 4WE3A 1WZEA 1E5XA 3QU2A 1O6GA 1U2EA 4WN9B 4B47A 4QQFA 3OQBA 2QN7A 5EE3A 2ZBQA 1NI3A 3W1WA 2HCJB 2P6OA 2KS6A 1ZR2A 2C5AA 4FHGA 2Y1KA 2FSUA 4FJ0A 2OD7A 4NCNA 2O8FA 2DWPA 1J70A 1VFPA 2A9KA 2OAGA 3DMDA 2E85A 1FFSA 1B93A 4H60A 4MPJA 2WUWE 1E2LA 4BCCA 3WNZA 3ZGNA 3HNPA 221PA 4Q1CA 1U8XX 3RS3A 4OMDA 4EJSB 3Q1LA 3M82A 1WA5A 2W6QA 4PN7A 1JKFA 4AJNA 3SQOA 3QBVA 1U63A 1OBCA 1R0CA 3ZCUA 4P35A 1JSCA 1XU4A 2IF2A 1VCOA 1FRQA 1QFZA 2KWIA 5K8UA 3CVVA 1Z3IX 4H3KB 3WTCA 2AE2A 2XQJA 4P36A 5AVVA 4PYOA 5IVPA 1CR2A 1IQRA 2ZBVA 4YLYA 1Z0FA 3ZU6A 5B7QA 3PSAA 4CMKA 2WNHA 1VB3A 5FV4A 1Q14A 3ABOB 1GFWA 1ST2A 2D4AA 5FWXB 2YVQA 1E3EA 3ESRA 2G36A 4C7BA 5HSGA 1NVEA 5IZ4A 1M10A 1QM5A 1XA4A 3IP3A 4DY4A 5ED4A 4AY6A 1GJRA 1BDJA 1KZ7B 2WRZA 2QUJA 2YXPX 1DG3A 4BUCA 4OV6B 3UENA 2EATA 4RMNA 4YY3B 4GOKA 1W49A 2OSVA 4IGEA 1AIPA 3BBPA 4OHFA 5JVDF 1U8TA 1FNMA 1YWGO 3D7MA 1Y5MA 1FTGA 1MORA 1V7ZA 5EHIA 5LIRA 3I61A 3ZDAA 1EVEA 4MROA 3EN0A 1ML3A 3QKUA 1DLJA 5KQSA 1G66A 2OFOA 5LN1A 4YCAA 4Y6RA 3B1WA 3NIWA 4PGGA 3GJZA 2BKVA 3SIPA 3B52X 3WYGA 2C9OA 3AVUA 2WZDA 4LRSB 3KLOA 4MDHA 3EXIB 1OLXA 4R3WA 1U5AA 3TPFA 4UPDA 5FOXA 3ZK7A 1E7YA 3AHCA 2ORWA 4AMBA 4X54A 1XMJA 2JD1A 4KRYA 4ZGGA 4L4UA 2FWAA 2WHEA 3GCWA 2OQRA 5JBNA 1WXEA 2ZWIA 3VC2A 1YBAA 1NI4B 3Q7TA 2NU6B 5DOVA 4X94A 4A8JB 2HBYA 1X7XB 4PSCA 4XRGA 2VNSA 4KV7A 2X7JA 1MABA 1O94D 1ZD3A 2JAHA 2GEJA 3H1TA 3V4OA 3RQIA 3CCBA 2VSOA 4YC7A 2Q6VA 4G1FA 2PQ2A 4Z2AA 3JQRA 2X6RA 5FTNA 1A3CA 1XRLA 1LPBB 3G6WA 2XR1A 2X8JA 3A9UA 2GO7A 3BMOA 3PDWA 1P31A 1DDOA 4JJ7A 2FV8A 3IQDB 3PSHA 4ZO8A 2JIOA 1PI3A 4UZEA 4ZO9A 4G4GA 2NO0A 1N32B 3RD5A 3DR3A 3NKLA 1QHEA 3B20A 2YIJA 2W4QA 4MW1A 3OJ0A 4F4HA 3HXTA 3D1VA 1A4RA 4HLUA 1L8XA 3ZDZB 1KQFA 3A36A 4BWVA 3LV8A 4CLEA 3QXSA 4IO0A 4IBOA 3FF4A 3LPDA 4X1KB 2QG6A 1HV8A 4FN4A 4DRYA 2IU0A 3OMXA 3TLMA 3WLHA 3WWPA 4DMUB 2XOXA 4H4EA 3ZY5A 4YRIA 2J07A 4ZOLA 5DEIA 1KC3A 2D0IA 2EGHA 4YRJA 1DXQA 3ZWMA 1SQ0A 3V34A 4D0RA 1NA5A 1P0MA 2DKNA 3WGQA 4N3BA 2FWNA 3Q7SA 2WTMA 3TWOA 5EFZA 2VP6A 3SBEA 1IZYA 1DKLA 2JFYA 1N3YA 4R0MA 4FUQA 4TLLB 4UJ3A 2UUBB 3COVA 3FPSA 2PSJA 3H83A 1E4EB 3IQZA 4IRUB 5CTJA 4PQRA 4WCFA 3SC3A 1JFLA 4PC3A 4MARA 5EG5A 1LSUA 3RFXA 4TTVA 1Z5UA 2DU8A 4IIJA 1UCFA 2J1LA 2P4HX 4TKVB 1JAIA 5DHPA 3LDUA 3LGAA 2XRZA 5JCPA 1H0SA 1JG2A 3ZVRA 3BIJA 3KZKA 3P19A 1OHHA 4GG1A 2NO7A 4OAPA 1P2SA 4NLLA 3JQ8A 2AOXA 1CJMA 1WNFA 2O2HA 3SF8B 4REOA 4WLOA 4CM4B 5IYZA 1QE0A 2ZEJA 3QRWA 5D1HA 1EB8A 3AERB 1ZVQA 3N86A 1RWBA 3RS9A 1NQ5A 3T5GA 3VDQA 2FPGB 4ILKA 3RAPR 2NZXA 3QKSB 3JS5A 1XQYA 3WHPA 3RUFA 3ZGXA 2ZYWX 3PJDA 4MQMA 3OC6A 3BQMB 5BN3B 3PUJA 2IE8A 1L5HB 2HTEA 2Y0CA 2ZU6A 3K5WA 3LVFO 4HR7A 3VOTA 3MT7A 4D8UA 1U3DA 4R40A 5DBGA 4G9EA 5JRZA 2J5KA 2RE8A 3ZNPA 4TMVA 5IJ0B 4ZRMA 2DBVO 3K8QA 3P26A 1Q1QA 3ZIAA 3R7DA 1S7CA 3VDRA 2ZDHA 2RHDA 2XTAA 3BJEA 1QP4A 1RU3A 4IGAA 3UZUA 4LECA 3OX3A 1AV7A 3IQHX 4XA8A 2C2BA 1ZNZA 5IP5A 4PAMA 1S2OA 3ZIUA 1ZIDA 1P2DA 1NQXA 2J6HA 2P2GA 3I12A 3KQQA 2H8GA 3KTAB 4IMRA 4BEWA 2WSIA 1AM4D 2BMVA 3RUAA 4AKGA 2MYNA 1QS0A 5JXGA 4OBEA 1GKKA 2Q41A 1GYQA 4UPVA 4XUGB 4LVNA 1YASA 2C1ZA