3DV2A

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from bacillus anthracis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
187
structure length
187
Chain Sequence
RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of nicotinic acid mononucleotide adenylyltransferase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
total genus 49
structure length 187
sequence length 187
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3dv2A00
3ELBA 1KAQA 4PBRA 4TS1A 3G5AA 3DV2A 4MUIA 1QRTA 2CT8A 1ZUNA 1S4MA 2O5RA 3UMVA 3ZIUA 2D13A 3TZEA 4EG6A 3FIUA 4PY2A 1RQGA 1QJCA 2CYCA 2E0IA 2X0KA 1WQ3A 1IH8A 4MW9A 3N9IA 1M8FA 2HMAA 3GLVA 4G5FA 1WJGA 2J07A 3M5WA 1F7VA 4MQ6A 3FY4A 3TQIA 2A86A 1F9AA 3RHSA 1VBKA 3IMGA 3N2YA 3PNBA 2J09A 3VU8A 3HL4A 4MUNA 1UFVA 4EFKA 4MW2A 2B7LA 5KWVA 1YIAA 4RPIA 2BTEA 2QTNA 1MAWA 1T6XA 3IOBA 2IJGX 1I2DA 1OD6A 4I6EA 4ND7A 4YBRA 1V8FA 1O6BA 1F4LA 5DEOA 3AG5A 3KT0A 1KH3A 3UY4A 2NSYA 1WXHA 1JEEA 3MMXA 4MAFA 1NSYA 2TS1A 2CYBA 3P0HA 4AQ7A 1JZSA 1WXFA 4J75A 3FNRA 1N2BA 1NUTA 5K0TA 1LW7A 1WQ4A 3ND5A 2C5SA 3TNJA 1KP3A 1K97A 2QTMA 1OWNA 4EF6A 4QRDA 1ZJWA 1G59A 3MLAA 2WQ6A 3X1JA 2DLCX 1N2JA 4MVWA 3F3MA 1M8PA 2YWBA 3A04A 1M1ZA 2X1LA 5F23A 4MUEA 3E27A 3IVGA 5J58A 2E21A 4OUDA 4EG8A 3HFJA 1TEZA 4R0NA 2H29A 1N2GA 2A1UA 3MUEA 1JZQA 2DUMA 3IDFA 4DE5A 1MJHA 1N2EA 3ZXIA 3NBKA 2QUIA 1YULA 2G36A 4ZCRA 1QRSA 3P0JA 3TZLA 1U0BB 3IVCA 3SYTA 3ILVA 3PRHA 1Q19A 1TFUA 1BS2A 3DO8A 1QTQA 4JXZA 2WSIA 3PNVA 4YP6A 1V47A 1IQRA 5KCMA 1O94D 3COWA 3FETA 4RUKA 2EJCA 1COZA 3RK1A 3IH5A 4Q16A 1O0CA 4EGAA 2DETA 2CYAA 1QU2A 4XFJA 3BL5A 3ND7A 1T6ZA 2IP1A 1KQNA 4MVCA 1PG0A 2QJFA 3CLUD 1KORA 4BWVA 4NZPA 4EG4A 2R5WA 2A1TS 1R6XA 3HV0A 5TS2A 4J76A 3P52A 1R6TA 2X1MA 1O5TA 3IMEA 3IOCA 1F7UA 4U7JA 2WQ7A 3CLTC 1QNFA 4NAHA 1N2IA 1GTRA 3MLBA 1J70A 3ZUGA 1J20A 4HPWA 5DASA 2V0GA 1T9GR 4QBTA 3HZRA 3G59A 4E1AA 1H1TA 2OV4A 4YMIA 1O94C 2XRYA 4G6ZA 4AS1A 1N2HA 3PXUA 2AG6A 3HGMA 4NDAA 1D2RA 1U3DA 4ARCA 1NYLA 4NAUA 3FWKA 3RFFA 2E18A 3LCJA 5KHAA 3AIIA 2YY5A 1CT9A 1YI8A 4KKVA 3CVXA 4ZT4A 4G5YA 3A05A 3COZA 3OTWA 3C8ZA 1XNGA 3JXEA 3DPIA 4MUKA 1FYDA 1EFPB 1YUNA 1IHOA 4MWEA 1GN8A 1N3LA 1XJQA 1NURA 1O97C 4OUDB 5BNZA 1JECA 1TYBE 2JANA 2RE8A 5IHXA 1OBHA 4ZT6A 4WSOA 1TYCA 3AG6A 4KPUB 4DDKA 3ZGZA 2PIDA 4ZCSA 4KR7A 2JA2A 1JIJA 5JBNA 3QE4A 4PBTA 1O96B 1I6MA 1VBMA 5K0SA 3KFLA 2HGZA 1NUQA 1MB9A 4U8HA 1KH2A 1M8GA 1R6UA 2D54A 3VRHA 5AHWA 3UK2A 3COYA 3UOWA 4MUGA 3ZJUA 2IELA 4A91A 4MWBA 2Z08A 4DNXA 1KAMA 5LLTA 4JZYA 2J08A 4EG1A 1H3NA 1TYAE 4I6JA 5J5AA 1N2OA 4DLPA 4DJAA 5HUHA 1TQ8A 1EUQA 3IMCA 4ZCPA 1O97D 1WXEA 1N78A 2J4DA 3SZ3A 2X3FA 4GU5A 2PZ8A 2QJTA 4MUHA 2EL7A 1JMVA 4MW5A 3AL0C 2O8VA 1LI5A 2CV0A 4PBSA 2D5BA 4YP5A 1ZH6A 1JIKA 3FOCA 5TEWA 1MBZA 2Z09A 1KH1A 1U3CA 4KPUA 1TYDE 3UC5A 1Q15A 3INNA 3X1MA 3TS1A 5FO0A 4MLPA 3ND6A 3SDBA 3LE8A 4H3SA 5LFAA 1VL2A 4MVYA 2A1UB 3CVYA 3VGJA 4FZJA 4CQNA 2CV1A 1G8HA 2AKEA 1PG2A 2I1LA 4X0EA 2CFOA 2BYTA 1NP7A 1ULHA 1NZJA 3AFHA 1GZUA 2GKSA 3S3TA 3D6UA 2QUKA 2DXIA 2CV2A 1KQOA 2RD2A 1Q11A 1O0BA 4I6GA 1Q77A 1U7XA 3ISJA 2PZBA 1EFPA 1J09A 3X1KA 4L2IB 3H99A 2QUJA 4K03A 3P0IA 2CUZA 3U1VA 1WZ2A 3DLAA 1PFUA 5J59A 3CLSD 4XFDA 3I05A 1K92A 3QTTA 3GUZA 1OWPA 1GAXA 1PFYA 1KKUA 3NV7A 1O96A 4MUFA 3FG9A 5DK4A 3IODA 4XSVA 1I6LA 4MVXA 4GRIA 3RJZA 2AZXA 2XRZA 1K4MA 2E89A 2ZP1A 4YP7A 1Y42X 4QREA 3CLUC 1WY5A 1GLNA 4K0RA 3A4IA 1OWMA 3L92A 2HZ7A 1NUPA 1JILA 3Q10A 1WXIA 3ZXSA 3H9CA 1N77A 1X8XA 1NI5A 1LI7A 4OJMX 2VXOA 1MB2A 1U7DA 3OP1A 5FO1A 1VLHA 4NX2A 1EFVA 3K32A 1OWLA 2WB2A 3CVVA 1G8FA 1WOYA 5FNZA 5LM3A 4JXXA 3CLSC 3TQOA 2ZUEA 1JEDA 1PFWA 4F3RA 2PZAA 2GOYA 4S1OA 1ZH0A 3D6VA 4HK4A 5EKDA 4EG7A 1I6KA 1ILEA 3QTBA 3N8HA 2PFSA 3GMIA 1OBCA 2A7XA 3FHJA 3LOQA 1FFYA 4DDHA 1P7PA 4EG5A 3NBAA 3H9BA 4ND6A 3ZJVA 3ZJTA 2QJOA 3SEQA 1T9GS 1J21A 1OWOA 1XNHA 2JAXA 1B6TA 3Q12A 1G8GA 4MW4A 1MC1A 1T6YA 1N1DA 2PG3A 4MW0A 3H97A 3IUEA 4ZT2A 1XNJA 4CDMA 1EE1A 2PXHA 1MRZA 1QU3A 3FI0A 4NATA 2DR2A 1IFXA 4CT0A 1M83A 1GTSA 1NUSA 4ZT7A 2VTBA 2CSXA 4KR9A 4DDMA 1H3EA 4HJRA 1GPMA 4UZEA 4R2LA 2DEUA 5IJXA 1SURA 2YWCA 3CLRC 1JHDA 4L2IA 1QRUA 4U63A 3IVXA 5TGTA 2DERA 3CR8A 3SEZA 4ZCTA 3G6KA 3MXTA 1KQPA 3CVWA 1EJ2A 1N75A 1YIDA 2OQ2A 4ZT5A 1EXDA 1M8KA 5H7XA 1HYBA 3IOEA 1O95C 1X6VA 1JIIA 3IUBA 5DB4A 4MUJA 3RBAA 2H2AA 4HJXA 4MW1A 3A2KA 4R2MA 1JGTA 1MAUA 1EFVB 3CLTD 1WKBA 2QTRA 3N05A 2VTBB 3COVA 1YUMA 2A4MA 4EG3A 3KT8A 3L93A 2J5BA 4MW6A 3KT3A 4ARIA 1IQ0A 4Q93A 2A84A 1KR2A 1PFVA 3CLRD 1QQTA 1J1ZA 1WXGA 4CDNA 4MWDA 1VBNA 5H16A 3H05A 4UZFA 5HG0A 1DNPA 1NUUA 3CVUA 3KT6A 1IRXA 4ZT3A 4JYZA 1IVSA 4KR6A 3HMQA 4ZCQA 2NZ2A 2DPLA 3FDXA 3RK0A 1O95D 2QUHA 4MW7A 1EUYA 3K9WA 4F4HA 2V0CA 3PNYA 4P2BA 3FH0A 3SZGA 2A1TR 2YXNA 2ZUFA 1IQUA 3CA8A 4WNYA 1J1UA 3AKZA 1MOPA 1KP2A 2A88A 3Q4GA 1H3FA 5TEVA 3SP1A 2GM3A 4JFAA 1M8JA 5HUJA 1A8HA 4MWCA 4MULA 1K4KA 2Z3VA
chains in the Genus database with same CATH superfamily
3ELBA 3KTAB 4UTPA 1U0NA 2PGLA 4YALA 1HY3A 3KJEA 4UMVA 1G9XA 4XFKA 4B47A 4M1KA 4HUQB 2Z1MA 4RS4A 5EMHA 4ASUA 3BDAA 3HCWA 4P4SA 2H3EA 1RYEA 3I5XA 2Q41A 3TZEA 4EG6A 1FDSA 1QCCA 1CZUA 2J3IA 4JLJA 1P19A 1JKFA 1TUBA 3AEYA 3I4LA 4WDRA 5K3FA 4BRUA 4C3ZA 2DECA 2K6GA 1XDDA 3SDZA 4D8WA 1YR3A 3SQNA 1V5FA 2XUPA 2Y93A 5GZ6A 2EX4A 1ZNWA 2IW3A 3NTLA 4FLMA 4KAFA 2VHJA 4MV7A 1GU7A 1YUBA 4DV4B 1NGSA 5A4KA 4YONB 5D00A 3D2AA 3UWDA 5E7MA 4BU0A 2YINC 2PANA 4NABA 1W75A 1XNRB 4QDKA 2H1CA 5H3LA 3V3TA 3WSVA 1B23P 3PC8C 3I9V6 3P0FA 4UTNA 2ZYAA 4S1VA 3GFQA 3T0GA 2C2XA 3W8FA 3ZD6A 4L27A 1DJLA 5D84A 4ER0A 5KNBH 2HWYA 4IGAA 3KB8A 3L7LA 5AOCA 2ODAA 1GYQA 3QXCA 3HJHA 1L8XA 1YRLA 1Y4ZA 2QGNA 1DRVA 2PDAA 3OOJA 4OQEA 4QDOA 4BO8A 1KH3A 3B3QA 1LX7A 1CJMA 3LPDA 4EFMA 2QT0A 1EG7A 4U2GA 1P1JA 3QX9A 4X41A 3ZHXA 2CCJA 3DE2X 1IM8A 1YQ9A 3ZIAA 1KZ1A 3BMNA 3RHFA 5AK4A 4EJSB 1WXQA 5ITZB 1ZY2A 1Z3CA 2G67A 4DLAA 4E5MA 4W5TA 1YA8A 2IYZA 1KI1A 2OYRA 4B0PA 2ODQA 1JAIA 4MHSA 5B36A 2D1RA 4BNHA 2BR3A 4PGHA 4QTXA 1KYIA 1PSDA 1QSGA 3DOUA 2CZCA 4Y9TA 5KO2A 2ADMA 3KUKA 2QYSA 4O2RA 5IZCA 1PZEA 1LDYA 4M1WA 4O4HF 4UULA 1RZRA 2RIRA 3PFIA 3DBLB 4MVJP 1V7QA 5LA6B 1H69A 2W8BB 4DQXA 2G7MC 1T4CA 4P81A 4PZLA 4AP9A 4KBYA 3O21A 1GPBA 1N2GA 5I51A 3MT8A 1LDGA 2OO5A 1PJ3A 2R9VA 1BFDA 4LZPA 3THYB 4ETIA 3DS8A 4BQRA 5CCDA 3ECAA 3TVTA 2DBYA 2PV0A 4UUNA 2XUIA 4R81A 5BSKA 3UMYA 1YULA 4HCJA 1OW3B 1PT8A 1K7FB 3KJQA 4WADA 1WXXA 1T1SA 4MA4A 3KETA 1M0EA 1NJ1A 3H86A 4CYMA 4KMRA 3SKYA 3D8NA 4M54A 1PWZA 3JQ7B 4DVJA 3BRWA 1TFUA 1JBQA 5C5DA 3P2OA 5ICSA 5TB5A 3F6RA 3S0JA 4IKPA 1CZNA 1V47A 4K26A 4AQDA 1HMYA 1KEUA 1GCAA 1T4DA 3ZE6A 5TMBA 1Z75A 3UA3A 1G3MA 3Q3EA 4H1UA 3JVUA 4CE6A 4COOA 3JWEA 4OBBA 3QWAA 1QGAA 3LX5A 1MFPA 2QM8A 3ANMA 1VPEA 2PE5A 1IWBB 3CZ5A 1RYDA 1UBCA 4IL5A 2WV9A 3JVDA 3BL5A 5DCYA 1ZEMA 3I9LA 4MVJE 1ADCA 2KQUA 4MVCA 4R5HA 1WSBA 4DA9A 2DPMA 2BFAA 2HKIA 4H4CA 5BUZA 2YIMA 1J6UA 2R7LA 3HKEA 1RPTA 3KLOA 2EQAA 1VJRA 3VYSB 4GP7A 4M7PA 4PLVA 1SRRA 1JR3D 1NFRA 1QB7A 4RHYA 4DIUA 3P52A 3KZKA 4CJXA 1AA9A 5B30A 2A6PA 2PT5A 2JHPA 3L7DA 4IV0A 1REQB 3W1EA 4YUYA 4U7JA 4LFBB 4DYVA 1KYZA 1M2VB 3WIBA 5C1BA 2NM0A 2CWWA 4UARA 1SC3A 1G6HA 1L4MA 1PN3A 4GO1A 1FNCA 4WEQA 5ALIA 4KITB 1E2LA 1CIVA 1EEXB 2H7VA 5DOZA 1DKNA 3ZXUB 2QM3A 1KRWA 3ZLJA 1SUAA 1T9GR 4LZJA 1XEFA 2B6NA 2C98A 3UMRA 1C8KA 4ZGWA 3AFIA 4XCXA 2G28A 1L4GA 4NS1A 4Q02A 5JXGA 1H1TA 3ZNOA 3L7MA 2GYVA 4UTXA 3WL6A 3NHMA 2P4EA 4G63A 1W0JA 1QYRA 4O4JB 4Q4JB 3AR7A 3R5TA 3ZTYA 2A0KA 2C7QA 1C4WA 2QAJA 3L8FA 3VPDA 4EGFA 1RM3A 3Q7RA 4QM7A 1ORRA 3AIIA 2QVLA 2XXJA 4B3MB 4GPZA 1YC5A 1M76A 1VFPA 1XRNA 2FUEA 4BP1A 1U6JA 3GLGA 2BN4A 2WZCA 2VAMA 1NXSA 1UOEA 2E1PA 3B60A 1XNGA 4X63A 2YZNA 4ZTBA 2G3YA 2ZI9A 4OHCA 4NXMB 3F47A 3TJZA 5BW5A 4C07A 2ZJ1A 1O1YA 1IHOA 2Q5QA 2UUAB 5DM70 4E03A 1DOZA 2HX1A 3OCJA 4E2YA 4NE7A 4Y18A 3QLTA 4WCFB 1HT0A 3LK6A 5B2EA 2NAFA 5IT5A 3IBYA 1UZMA 1NC1A 1NUAA 3IAAA 3TXYA 3PC3A 3NJRA 3HCAA 2BGTA 2WKRA 4JCCA 4PG4A 4CCYA 5JXHA 1ISRA 1SBQA 1JQJC 3WKCA 1UXJA 2HT1A 3Q9SA 3K9BA 1UPBA 5E2AA 1FUKA 1Q2XA 3MRVA 4B4UA 5JHHB 4KDFA 2WTUA 5EE3A 4B6FA 1Y4DE 4PNHA 4GPEA 4L4SA 1JHAA 1QM5A 2AKYA 3OICA 1G2PA 1NQVA 3PQ7A 3FRJA 1QFZA 3PDHA 2E6UX 4BNNA 1MU0A 2BGNA 3UK2A 4AQYB 2WWGA 2IQIA 1YQDA 4RD3A 2V7UA 3PTLA 4M3NA 1MP0A 4WY5A 5BVHB 5C1IA 3LUKA 1VSQA 3ANTA 3LNTA 4F5YA 3KIPA 1F8FA 2ZITA 1XQXA 1N3YA 3D3KA 2GD1O 3B1ZA 3ILYA 4Y1GA 3OF2A 3S7ZA 2UU9B 3Q1LA 1QC5B 2AFRA 4BNGA 5GY7A 3KSBC 1YZQA 4P32A 1JWAB 1ZZEA 3LM8A 3MNFA 3PNLA 4MI3A 4PAOA 5H3CA 3U1TA 3VR2D 3T38A 1B7GO 1TYAE 4M8NE 3UO8B 4H7KA 4FHZA 1PFKA 1C81A 1ZJJA 3K53A 3HRKA 1U0EA 3B7PA 3M81A 5AIAA 2QI9F 1B1AA 1IHUA 2I7VA 4JJ4A 1SUDA 4DM4A 2ZB4A 4DDTA 4J9VA 1JHPA 2PMCA 4ZALA 1H1LA 4NYJR 4ALLA 4OL0A 4N7MA 3DHYA 4N7JA 4LYFA 1NN1A 3OBIA 3PEEA 1VC2A 3SSAA 2B5OA 4LWQA 1TD9A 3ETGA 4JLPA 4QU0A 4G26A 1NVEA 2QRNA 3V97A 5AHOA 5IASA 3ZHCA 2A7QA 4OX9Y 4YI5A 5SY6A 2W4MA 5AUPB 4JC4A 3AJAA 1T0PA 1Y37A 2OAP1 2XB8A 5DHAA 4PHTA 2Q99A 4KRYA 3SHOA 4EPXA 1Y4SA 1Y98A 2PGAA 1YZNA 2Q7XA 3GX1A 4PPFA 3FMVA 1P2VA 2XMQA 1XQYA 4TSFD 5DGHA 1WIWA 3ZHSA 4HB4A 3ZWNA 2IPMA 3OCYA 4RHUA 1HBJA 1ZD1A 4JZKA 3SDBA 4JLWA 4YAGA 5K05A 3JYQA 1SHLA 3PL1A 1O77A 3PQ8A 4I50B 4MKIA 2OT3B 1KO8A 1IZYA 2ZLBA 1UIMA 3M7IA 3M4YA 3PUIA 5AHRA 2AKEA 3EXG2 3E15A 5KOHA 4X0EA 3L0SA 1M1YE 1NP7A 1VCHA 5L3QB 4ARVA 5E2BA 3TQTA 4EKYA 3EZ9A 4FHEA 4LK2A 1BN7A 1FU7A 3KJNA 4YJHA 2HJVA 4QEZA 5AK0A 3T3DA 4F8YA 4NYMR 3KZCA 2CBZA 4O4JF 3R41A 2R8OA 1RYFA 2VJMB 4REMA 3E7FA 3ER9A 5DSZA 1M3SA 4YPVA 1DV1A 3BKXA 3G2JA 2REQB 3F5MA 4IFTA 3BH0A 2Q4TA 3AP1A 4QC2A 3WK5A 4YRKA 3KOWA 2FQXA 2Q6IA 3N8GA 4CEHB 2HPVA 2V7QA 3A4YA 3MWGA 5A62A 2FETA 3BXEA 1PWHA 5JYBA 3RYIA 3BTUA 2IU0A 2XEXA 1LEHA 2H51A 3BFXA 1E69A 1Q0RA 4HEA1 2TRSB 4L0DA 1L5WA 3C8DA 3CGWA 2YXLA 3QW2A 3KVVA 1UEXC 2FR1A 3GLUA 4K1LA 4C3UA 4FU0A 5KYYA 4H35A 1F6DA 1HE8B 3ODGA 1FYEA 5CLQA 2PUFA 3FBGA 4PS0A 1ONPA 4RK6A 1M1XB 2RHRA 2H85A 2FWMX 3AC0A 2XVZA 5J43A 1A77A 2GZRA 3HLKA 3QFRA 5GVRA 1GGMA 2NLOA 1PR6A 2R66A 4ARSA 1Z4JA 1UXKA 3KQUA 3ENVA 2W2KB 1XJCA 1G8SA 1U28A 1ZEJA 2EW8A 2BF4A 2R87A 2V1UA 1GSHA 2Y1FA 4C30A 1Y42X 2IF0A 2YXEA 3VNAA 1Z07A 1RP7A 3D8BA 4YRSA 3EMBA 1MH9A 3KDPA 4W8OA 4EAAA 4ZYTA 2NVBA 2HZ7A 1IJEA 2VCYA 4AJOA 1PR0A 4LZWA 5EFZA 4A0GA 4BO7A 4B2YA 1KSHA 4DY6A 1Z4QA 3W2GA 1MR3F 4RPGA 2WABA 1Q0UA 2FRDA 2FPUA 1JN0A 2FZ5A 3KU1A 1ZUIA 4CQMA 2PQ6A 1AURA 1P60A 1Y6QA 2DLDA 3GLSA 4AU1A 3G2LA 4R9UC 1JYSA 4GRDA 1LBSA 3C6ZA 3CG0A 3R5JA 4JS0A 1ZR4A 4QYWA 3PPXA 3ZCSA 1U9JA 4PLYA 4YJ3A 2I2FA 3PUWA 2HA2A 1M2JA 2VJQA 4PTYA 4WKNA 1GAQA 3NB0A 5DEIA 4D8XA 1UBLS 2ZYHA 4TV8B 4LCEA 2JI8A 2IPNA 2QRZA 1ONBA 4E3WA 4HMQA 1AGNA 3AWIA 3D1JA 5AVOA 2DUWA 3LW7A 1LF0A 4BV9A 5D1NA 3C6MA 2G17A 1TX4B 1FTSA 2A7XA 3G2NA 5LB4A 4F5EA 4F7WA 3LOQA 2A8YA 4GYJA 1FFYA 3ESYA 3Q98A 2M6KA 4DUGD 1EZZA 1KIFA 4ND6A 4EHHA 5T4FA 2OV2A 4LVUA 4X6XA 3HKDB 2VJKA 5EWJB 1JFFB 1NMYA 1VMIA 2H1HA 2ZBGA 3GFSA 3GLHB 4NQZA 4O2BB 4AUEA 2ZR0A 1GEGA 1FFXB 3HCOA 4LQCA 3I92A 3ZZUA 4OHZA 3CWQA 4KL8S 3OZBA 2I6UA 3PVZA 4FNAA 1I3OA 4RTKA 4MW0A 2Q07A 5HYVA 5HNKA 4QGSA 4EPTA 3ULKA 1I1NA 3E9NA 3ASVA 2OEPA 2AX3A 2PUDA 2OWDA 3ZD9A 3LO8A 5IJAA 1ZBDA 3HWRA 3D8SA 4FHGA 4YWJA 2VTBA 2W8BA 3QPBA 3G8DA 3MJFA 4HB0A 3AVTA 2BJWA 4BBAA 2GZMA 3H5LA 3F97A 1GR0A 2JLCA 4CT4B 2B8WA 2C9DA 4PFSA 1GXSA 3KQPA 5AXAA 2WYWA 3CH6A 2GNOA 1HSZA 3RRJA 3SBDA 1SA0A 4EJ0A 2DEUA 3GAZA 2FN9A 2Y1EA 1X3SA 4DIMA 1JHDA 3GJXC 1V1RB 4JBLA 4RH1A 4RU1A 4QVKA 13PKA 3OD5A 1YQWA 3WGOA 4E31A 1WMEA 2AWOA 1T0BA 2VYVD 3P4UA 2WG1A 5A4MS 1B2LA 2ZR8A 1L5QA 2R48A 2WVAA 3AL3A 3KR9A 4JLSA 1GEEA 3G6KA 4NFYA 5F2NA 1YIDA 5KJ1A 4CF5A 3OPXA 2ORED 3EHEA 4B48A 5LZ9A 5JJLA 2FW7A 4RNCA 4QDZA 5EL0A 4ZT5A 2JH9A 3NWBA 1O6GA 4GYYA 3RU3A 5JCXA 4ZOEA 1HORA 1LJLA 4ND3A 5FQNA 4ZQBA 4PLFA 3SXPA 1PZMA 1USWA 2XE7A 2VSQA 4D9KA 4B46A 3HA7A 2AN1A 3GT4A 4BKOA 3EEBA 3ZCPA 4ZI3A 4QBIA 1HLFA 2IDJA 4KQJA 4H1WA 2EAUA 3QEJA 1N9KA 4U4AA 4EARA 2R4QA 3X1DA 4NOLA 3MGAA 1V1JA 1GGHA 1UBJS 2BWJA 1TC2A 1SVMA 2I6QA 2ZTMA 3HCPA 2HEIA 2V9PA 3IRUA 2JKZA 1FJXA 1RIFA 3EVTA 1KNQA 1NOKA 1CXZA 2AJBA 3QVLA 3PQ4A 4ZU1X 3RRXA 3WVNA 2ZRGA 2GSWA 5IH7A 5DFAA 3NORA 1ZW1A 1TM2A 2ORVA 1KMQA 3AI3A 3BIWA 1ZNZA 2VATA 4UUMA 1KJNA 2NVUA 4QARA 4CVNA 3R8FA 3CLHA 4NAVA 1WSAA 2CUKA 1M5TA 3CLRD 3K9HA 5KWJA 1E2GA 1EB9A 1NUHA 3F6SA 2AK2A 4N3NA 3TEJA 5K8IA 5KC9A 4N54A 4NFHA 2YOFA 1PP4A 4L6AA 4MWDA 3VTKA 4CDNA 4CLRA 4MDFA 5EJ9A 1W73A 2OYSA 4GIBA 5EE9A 4WLOA 2XE6A 3GBVA 4Q48A 4DLWA 4EY8A 4JYZA 3BGSA 3V48A 4B76A 3CO5A 3L77A 3DOIA 1FS5A 3AR5A 4U2DA 1I4EB 4JQZA 4NS4A 3K96A 4TYWA 4MB0A 5DE3A 2I3GA 3R40A 1W581 4CKEB 1T5DX 2GBIA 3D8UA 5I5GA 3RRYA 1ZAYA 2QD4A 4L76A 4XA8A 1A2KC 3LPCA 3REQB 4MS3A 3EF0A 5HTOA 1RYNA 4O2AF 2ZWMA 4QXPA 1JR6A 1EKXA 1QH1A 3EGDB 5LU8A 3DA8A 2P6MA 5EXEA 1RAGA 3G7SA 4JI7B 1KSJA 1JHXA 1EWTA 2R00A 3DDOA 4TMWA 4WNYA 3A1CA 2J9XB 4TKZA 2C0PA 4G8JA 2XWSA 3V46A 1C7JA 3DF7A 2AEJA 2I2DA 4WZBB 3JZFA 4J07A 4G9EA 4NC9A 1U99A 4OMUA 1DUSA 3JAKB 4FUQA 5LYJA 3ZC3A 4JT9A 4B3GA 3GEGA 3PENA 3AUKA 3WB2A 3M4ZA 1AA6A 1GQQA 1UZLA 4OO3A 4YAIA 4GWGA 3ZXXA 3WWEA 3V4VB 3TJRA 5CM2Z 1Y1PA 3OQNA 2VP9A 1SCQA 4RANA 3ZIUA 3FTEA 1IN1A 3NNSA 2JJYA 5ALNA 2C78A 5H68A 2X14A 1KYYA 4D1YA 4D99A 1R2QA 1LNSA 5CA0F 2DB3A 2NUPA 4IJ6A 4DLZA 2ETXA 1N7JA 2QQGA 2PXCA 3A27A 4C76A 2PUWA 5T64A 4LJYA 4MRMA 1N2CB 3UXMA 5EP4A 3T3GA 3QLJA 5A3VA 4B44A 4A8JB 3B8HA 1QIHA 4KWIA 1SBCA 1QGUA 4J90A 1L5MA 3SWWA 1T36B 1JXOA 2A86A 3DVLA 2RG7A 1K89A 3IMGA 4G0YA 2J09A 4MUNA 1E1YA 2VWGA 1J2EA 2B7LA 1YIAA 5ABPA 1A8QA 2VH5R 3NHAA 5LA6F 5FJIA 1EXMA 4PSDA 5KQGA 4UFPA 2AWNA 4X64B 4ZEOA 1RE1A 4QJ4A 2O5CA 3FPJA 3EC7A 3GVIA 3OTQA 4KRXA 3PTZA 3ZKAA 3C15C 1ISGA 4TZTA 1BXZA 1UBEA 3TTSA 3U7JA 1WQ1R 4EGAA 1ORVA 4C6RA 5AKYA 1MB3A 1SKYB 2V03A 4UDXX 1Z0SA 3I72A 2J0SA 4MKXA 3B13B 1WXFA 1RYZA 3PNQA 4LZZA 3HR4A 1ZGBA 5ITSA 3GNTA 2VEDA 3DMYA 4R2WA 3CZRA 4A6PA 2XMSA 3L06A 4PICA 1JA1A 1DIHA 4L3OA 2GTHA 3HLYA 1KOGA 3MBKA 3WRYC 4IFIA 4XTRA 4ZEVA 1ZJWA 1PDOA 5J63A 3SJ7A 3NC1C 1ONNA 3WB1A 3OQOA 2BSXA 4JVOA 1BXGA 1YZYA 4I9HA 4B8YA 2I3BA 3JWGA 1UM8A 3E0XA 5F23A 1RAFA 3MJDA 1ODTC 2TSYB 1NY5A 3PT9A 5EIXA 4GGPA 4D42A 4ZVTA 4E5PA 4OCZA 5AI6A 2QSZA 1MDFA 2H29A 3U44A 1KZ6A 1IY1A 1YOBA 1O2DA 4MI6A 9LDTA 4OQFA 3R2JA 1QMPA 1P7ZA 5BOVA 4YAUA 1E3JA 2J3DA 3KEQA 5EUQB 1ISHA 2KLHA 4G1FA 4YRJA 2AD1A 4C6TB 3TFWA 4DLVA 5HZMA 1QMGA 5KTMA 3H0CA 1BMTA 2XNHA 5AI4A 2GPTA 1OB5A 2FXIA 4OY3A 3UK0A 1U2GA 1OE0A 2C84A 3VSBA 3VZPA 5BXQC 2Z1NA 3AQ4A 1SC9A 3W79A 3PNVA 4YJFB 4HUTA 1C7QA 2IC5A 1BXKA 3FWPA 3OLCX 3V7WA 2IRWA 1O94D 4GOMD 1FTYA 1GAEO 1K6IA 1U9IA 4GFDA 4ZOQI 1NXWA 3IALA 2V7XA 2WA2A 2ZB8A 3G0BA 5I4CA 4D25A 4QBHA 4ZOAA 1QX3A 5FA8A 1XOIA 4XYMA 4H18A 2RONA 1OBFO 1KQNA 4CMBA 2OL4A 4TTTS 1A8PA 5EPOA 1DAOA 2HWXA 5THQA 3TECE 4KIJA 3LUAA 1WUJS 3BSFA 3QELB 2XV1A 4LHEA 4UM8B 4E14A 2PS9A 2JGNA 4I5IA 1R6TA 4BJHB 2H1LA 5FCDA 1ZU4A 3JW8A 4MA0A 3W5CA 1P77A 1QO0D 4G2NA 3TN7A 2FPWA 1QNFA 1UBFA 2VAWA 4BKRA 4WXPA 3H04A 3ZUGA 2IS2A 5EP1A 3JQBA 2QQFA 1G66A 4MLCA 2WF7A 1IY2A 3CKYA 3FGOA 1T8TA 3HDTA 3NEAA 3GYGA 1X1BA 5D7BA 2IL1A 2OHVA 1S96A 2NUAA 3SX0A 5KVCA 3KLPX 1DC7A 4KFUA 3R8CA 1ESCA 3L8GA 4AX4A 1O94C 2UKDA 3HP4A 1NT4A 1K7CA 5JCPA 3NDRA 1X13A 5TGZA 2H5IA 5DNAA 4MO9A 3DQPA 2OESA 3B8EA 3P97A 3SKVA 4F9FA 4HYYA 5KB3A 2YRXA 1ZIYA 3JQGA 5JYEA 1J8MF 4NAUA 4F1JA 1B6RA 3KSZO 3EZLA 4NU0A 1N7GA 3RARA 1J7JA 1RXCA 2L2QA 3WZMA 2RDMA 4CM4A 1WUIS 4G1MB 5H5JA 4ZYWA 3DEHA 1YVEI 3FOFC 3TSYA 3VGPA 4G5YA 1RRFA 2HIMA 2IHKA 2VYVA 3A05A 1ORTA 1KI4A 3NH6A 2FSFA 5EHZA 5L95A 2VHCA 4PQYA 4AG6A 1XHLA 4AF7A 3MWFA 2BDEA 4TTSA 5CUQA 1HE1C 2XNCA 1JU9A 4CMKA 1A9RA 1M2NA 2ZYGA 1N3LA 1BCRB 4HY3A 4TS3A 4XCVA 2B21A 2EU8A 1RPZA 4C0XA 3G2HA 1EP1B 3QVUA 1PNRA 2QMOA 5EPEA 4F12A 2RH9B 2PJRA 1WF6A 2WIAA 3DDUA 2VUHB 3P2JA 2Z98A 2KB0A 1W36D 4MDHA 4DCGA 2H92A 3AV3A 1OIWA 4JVLA 5KPDA 4PBTA 5F21A 5JDCA 1XHEA 4AIIA 4G56A 4C01A 4C87A 2VP3A 2X2EA 4HP8A 1W5EA 4FIDA 3KRTA 4QT0A 4HNQA 1JALA 4U2CA 4RK7A 2V5VA 1GTMA 1MRNA 1TAHA 2X22A 3HXPA 3MMNA 3VRHA 4AF6A 4LXXA 1E8MA 3UOWA 2YN0A 1GKIA 1I7DA 3EE6A 3IQWA 3BXZA 3TRJA 3HFSA 4C1NA 1X8KA 5DM4A 1VKOA 4IIYA 1ULUA 5FX2A 2X9VA 4LVOA 5DGXA 3PCXA 3NFYA 4JC5A 1XQ9A 2I7TA 3DFKA 2RHMA 2OFOA 3ENQA 4WESB 3KPUA 1K6MA 2WF9A 1S3GA 4JD5A 4ENWA 1ZDMA 1PS8A 2C03A 4Q4HA 3T7EA 2VJBA 3CB2A 1T5SA 3GO4A 1KXJA 2ZSFA 4EIWA 4B5LA 4KAXA 3HZZA 5B37A 1XN1A 3LX6A 4FGZA 3H16A 3MJHA 5F3DA 1OH7A 4MUHA 2C4UA 4EGQA 2EL7A 3FLEA 5D6NA 5TNXA 4WL0A 5D8DA 4CW7A 4DADA 1HT1E 1I0ZA 2P7HA 1M6NA 3AKYA 2AFHE 3NGMA 4HTAA 4ZGGA 3GLFB 4C14A 3AJDA 2CV0A 3NIGB 4ZQCB 4CMEC 5D1HA 1T1IA 1D1TA 4OHXA 4HNAB 4QOIA 5JRDS 2X3UA 4OLBA 4MIOA 5LDDC 2YN2A 3A70A 5CEEA 2FFHA 3KQQA 3STHA 2NVWA 1MJNA 3ZN2A 2QN3A 2WJAA 2IYXA 4BFSA 2H54A 3LAWA 2DGDA 1VBFA 4K87A 1XGKA 1ACLA 2H7XA 1E6KA 3C45A 4R3NA 4UAUA 5DLEA 2VRWA 3D6NB 1IHYA 1XELA 3ND6A 4L07A 3A4LA 3MCTA 2QVYX 4RFVA 4QUDA 2FP3A 4NBKA 2NTYC 3S8EA 3EVGA 1I14A 4Q34A 3KKOA 4IH9A 2O2JA 5I45A 3QMWA 3M4JA 3TR6A 3WLFA 3L5KA 5IWAB 5ES4B 2BFCB 4EWLA 1UKZA 2QTHA 4KFCA 2BYTA 4PZPA 4LY0A 4LZLA 1LDEA 3EA5A 4DS3A 1PBTA 4ZEXA 3U4HA 2WD9A 1Y82A 3IAFA 4ND5A 4FE3A 4HWPA 5HM6A 3N8KA 2D5AA 3IVMA 4L8GA 1O0BA 2A0UA 4L8WB 1RWOA 3EXHB 1KKMA 3GZNB 1GDDA 4C7JA 4Q3CA 2ISSD 4TLMB 1TFRA 1GLGA 1G55A 3WSTA 2BEJA 1VCNA 2QW8A 4TRRA 2GTIA 5JAOA 3M9WA 4MGZR 2OG1A 1IWPB 5MF6A 2G9ZA 2Y66A 4Q39A 4UEJA 1Z4IA 2CUNA 1K92A 3HU5A 3DT6A 4U1RA 5FORA 1FTWA 3PFFA 1QRRA 4DR2B 4LEIA 1RI3A 2W71A 2XYQA 4MUFA 4D5GA 3H4MA 1BA2A 1JB1A 5DNEA 3RS8A 5DIFA 4HI0E 4JK3A 3SYKA 1BD3A 4F91B 1Z8NA 4G4GA 3QX3A 2DKNA 4KXXA 4M1SA 4HVLA 3FR7A 3NHSA 4XYLA 2PL1A 3O31A 4JSYA 2NAPA 1WUTA 4KQEA 4LQ4A 5FBRB 1WY5A 4JI3B 2D5IA 1BKYA 4I5FA 1QJ4A 1JBKA 3C6QA 5IC5A 2NZVG 2O6LA 1LY1A 1R0WA 2JAUA 4O2BF 4POAA 2O2ZA 5CVTA 3Q1KA 5JU6A 3KHUA 4AMYA 2R8RA 1C3OA 4ED9A 1WPQA 2BELA 4UBIA 3X44A 4UCFA 2Q2QA 3QOXA 3ECSA 2HHJA 4NX2A 1MNQA 2FU5C 4GBED 4Y7DA 1TU3A 5BSUA 1XCJA 2XRMA 1U7WA 3OU6A 1S3FA 4GOKA 2XBUA 3WGZA 3HDHA 1Q92A 5FFMA 3BICA 4MMYB 3T94A 1JJVA 4GEKA 1E3IA 4HAZA 4WK6A 1JEDA 1GZ5A 4F3RA 2Q6LA 2XB9A 5LQKA 1YJQA 2O1XA 3ORSA 1Z63A 1CBUA 1J8DA 2CNWD 2DHRA 3CG4A 1GFSA 1PT5A 1TJPB 3TLXA 1ZOPA 3QFFA 3W9SA 2QVXX 3GH1A 4DMMA 3A6DA 2AK3A 5HGXA 5T6MA 4H6WA 1AVTA 3B2EA 3A6GA 3VDRA 3ETLA 3MOIA 5I7WA 4YJ2A 5DBOA 4X71A 2H4XA 1X2EA 4LTDA 3L84A 4KYIB 1IEWA 1KAHA 1AO3A 3M1IA 3NPAA 4MP8A 2PWBA 1OWOA 4UAJA 1TA9A 4DRXA 5B55A 3F90A 4LECA 3BJZA 4DT1B 1S3IA 2Q2NA 1X9GA 2FPIB 4Z8XA 5LZ8A 4ZN6A 4HFNA 5TT0A 3HSKA 5IVIA 1RKBA 1XDWA 4PRKA 4RDCA 2J5XA 4PQEA 1BIFA 4L5JA 2CC2A 1CQZA 2Z8YM 4R7TA 1NLUA 2EKDA 4R1PA 3EG9A 3C1OA 3DWEX 4P3NA 4O02B 1BVHA 2OA0A 2Y9MB 2ZJ5A 2J31A 3AESB 5T4BA 5DJ5A 1UOQA 2RGNC 1LBEA 1E98A 3L1KA 3SFTA 3R24A 4JASB 3R7FA 4QUEA 1ADYA 3B6MA 3KSAC 1PJBA 4AZ3A 5HS4A 4KIGA 2BHRA 5M3BA 4I8XA 4IQ0A 5DIZA 3V1LA 5HF6A 4NMLA 1JTVA 1TT5A 2R6R1 3AQIA 4GAEA 3WR5A 3ZU4A 2BKUA 2JLSA 1RHQA 3JCZA 2HZBA 5AJVB 1SXJA 2AEFA 2JI9A 3ISVA 4FFVA 4KZKA 1TZMA 3MG9A 4C6SA 4GZ5A 3TAUA 3WQRA 3O82A 4CNBA 4MRAA 4C4TA 4JQYA 3ITKA 3QRWA 5KTTA 2JD2A 4R8RA 1C7ZA 1QVWA 1GG5A 5CX4A 2GUWA 1IULA 3PGKA 4OXYA 5DGDA 3VR3A 4OA5A 2VJLA 3QJYA 3SLKA 2IH4A 4M1MA 2JFVA 1VTKA 5ALKA 3MF4A 1MOQA 1K8RA 2VFAA 1KEWA 2B7CA 1WBDA 4FW8A 3B6IA 3NRJA 2QZSA 5CVEA 3CFYA 3VI3B 4AMGA 3Q9LA 4Q3LA 1XVTA 2PQ2A 4OXQA 5IG2A 1OILA 3STUA 2Y4NA 2GBFA 3EF3A 4BPRA 1FVFA 2A4MA 3F6EX 3PFNA 3VPGA 2DFVA 1AS2A 3BCHA 2HCBA 3IR7A 2BH9A 1NM5A 3REFA 5A7FA 5E6SA 2WUFA 5CNKA 2I7XA 2VTVA 4AN4A 1NHGA 2IQ5A 2XCRB 2Y8EA 2A84A 5FQOA 3ZCUA 5JNUA 3ND9A 1Y8CA 2Q4BA 5EE1A 1KR5A 2H2HA 1QTRA 3G68A 1EUCA 2PSSA 2BMVA 1EA5A 3E2MA 3NVAA 4JVNA 3GMSA 2F1IA 1MVNA 2VPZA 1J8VA 1VBNA 3DBIA 2YVKA 2OM2A 3PQEA 4YA6A 4Q1DA 3NJ8A 3BTVA 4L4XA 2V54A 3W6PA 1Z9BA 3A3PA 3Q87B 1UBMS 1ZRMA 4RKYA 2BDTA 3X43A 3WMEA 5CDGA 3UK1A 2V7QD 2P0AA 2DQKA 4I9NA 4GGOA 1XDSA 3T4UA 2C2BA 3KZOA 4KO1S 3N3BC 1CLEA 1XK7A 1SZCA 4HQ0A 2X9GA 1X39A 4MW7A 2Q3CA 1NP3A 2J6HA 3LBNA 3S2GA 1EUYA 2QUAA 3DEJA 1JDUA 1XZHA 2PYZA 3WS7A 4FYIA 3F7OA 5J5VA 3WIUA 3IA7A 1KDTA 4E12A 2FFBA 3A4TA 4DLSA 2A1TR 4KXVA 1KYQA 2ZUTA 1DIBA 3ZK8A 3MJVA 1F0NA 4P4NA 4GLLA 4NBNA 4L08A 2I6XA 4ZAZA 5CH8A 4J0KA 1UT6A 3VISA 2BKAA 3PUKA 3MRTA 3SP1A 5JQWA 3Q8LA 3ZDZB 1QWOA 4TWJA 4D6XA 2FWJA 2ISQA 5ADUS 2QRKA 3ED5A 4K8OA 4X8OA 2QPLA 4EB8A 3AEZA 3E5HA 3OETA 4BL5A 3DTNA 1IUKA 3KAKA 5KSZA 4NPHA 1GG9A 1EGHA 1HDZA 1Q0PA 5G0TA 4I5EA 3O4IA 2DF8A 4PY2A 4MAMA 5EJ2A 2GPSA 4NULA 2A9VA 4D4IA 3TZBA 4AKSA 1YO6A 4LGYA 2RHTA 1GRQA 3O3OB 3RV4A 5I7EA 2CEAA 3BE8A 1QCDA 1ZNXA 2EGUA 3DSRA 3ADDA 1VIDA 4F56A 5B1EA 5A7HA 4YXFA 5FYQA 3EG5A 5IYZF 1BGXT 1KMMA 1L8QA 3HSYA 3H0EA 3GAFA 4YACA 2ZTUA 1C3LA 4B4KA 4FX5A 4PRZA 3W5VA 4OM7A 4AUKA 4WJLA 1UKBA 3VU0A 3GGCA 3PWSA 1DC4A 4B1FA 1MO3A 1IMOA 5A3SA 3MMPA 5HF9A 4MW2A 4G1VA 4NJMA 2BGKA 3CINA 7ABPA 4LS3A 2WT9A 4D0LB 1E2MA 1YBHA 1R0ZA 1EQUA 4JBNA 4EKGA 2HRCA 5LXTF 1P29A 3O7WA 1OXTA 1CLUA 2NSYA 3CRQA 1WXHA 2O05A 4DWVA 4DSZA 4Y6LA 3TWOA 1DCTA 1XMVA 2GLXA 2R4TA 1Z5PA 1A50B 2GK3A 3LL7A 4KKXB 4XPZA 4EP1A 3LD9A 5JSUA 5CGQB 4R84A 5FJJA 3MHTA 4J75A 2W58A 4WKPA 3PLAE 2IUYA 4AMBA 1PVOA 5A6VA 4JLUA 4MR8B 3I0MA 2J45A 5GADl 1T13A 4X24A 3R4CA 1PQ4A 5ISMA 2CDCA 4CPDA 2JIQA 2G4VA 2ZAIA 3FTPA 2MMCA 3BC1A 4MQ5A 2P9ZA 4QBKA 1G59A 3FTQA 5LQRA 1MG5A 1UPTA 1BHO1 1LV8A 4HRAA 2J6CA 4CM1A 5ITZA 1M8PA 4LK3A 2PIAA 1YS2X 2IXDA 1CUXA 4OGGA 4RF5A 5J58A 4ENRA 2VDRB 1TADA 2JFOA 1NDHA 5BV0A 1F3OA 4R1MA 1T3ZA 3DKRA 3X2EA 1DC8A 3TOZA 1Y3CE 1JZQA 5HZKA 1HFWA 1MJHA 1LA2A 1QANA 1T1JA 1P5FA 2R84A 2R751 2JJ1A 1VG1A 2M9MA 3GLTA 3OM8A 1IBRA 5DM0A 4BKQA 4F92B 1EZ1A 3QIAA 3GLRA 1NC3A 4CCAA 3A1TA 4XEHA 3PRHA 2EKPA 1B3BA 1ZXXA 5I9TA 5DNYB 1XUOA 4B34A 3DO8A 2WHRA 3HDGA 4Q24A 4KCGA 1HOXA 1W4AA 5BUQA 5DXJA 3PKIA 1CUAA 5KCMA 5A0TA 1GR1A 2COKA 2D59A 1YR7A 3FETA 4AO8A 1DG9A 1VJ1A 4TL7A 2Z6VA 4W9MC 2ONKA 3NUQA 4GZ6A 4F3CA 4CL0A 1G3QA 1QC5A 2CCKA 2Q1XA 4FMDF 4L74A 4TSFA 3CNEA 5LQNA 2X15A 4LJ8A 4HGPA 1Z8FA 3JALA 1FDWA 4OF4A 1AH2A 1SKQA 3O8CA 3WHPA 3E9RA 2VO1A 4WLUA 1TL7C 2GK4A 2ODNA 4XARA 5H0IA 3OCZA 5JLJA 3OZAA 3VJKA 4FFNA 1HYQA 3DT8A 3LT4A 4J1NA 1FNSA 3A1WA 1HKHA 2GN0A 2GYWA 3G2QA 2XDQB 4YI3A 2Q2VA 5GM1A 2GHTA 1U0TA 5EUCA 4ZOBA 2RBKA 2GQ0A 2E3JA 3EA0A 1T24A 1SXPA 1P39A 5KKNB 3CLTC 1R7RA 5TJHA 1LXCA 1ZA2A 2H9AA 4DY4A 5L7TA 3L4KA 3NTRA 1NQUA 3D7KA 1KAGA 4HD8A 4HN2A 4QDUA 4CN8A 5CFNA 2R62A 5K2OA 1PX2A 2QR5A 3C4JA 3N0WA 2F90A 2OORA 4MWTA 4BUJA 1Z6XA 1TZJA 2JFGA 3LBYA 2GN4A 5F5XA 2JVKA 5ETJA 4Z9AA 3IMFA 5HIJA 2AQKA 3AM4A 4HLNA 1DC3A 3AF4A 3VR5H 4YPOA 2RHOA 3EPKA 5DTJA 1XALA 1D2RA 2XUAA 4QUJA 5IHPA 4EZIA 1QP0A 5F33A 3JWIA 4KW7A 4BJ5A 1H5QA 1UPXA 1ZCAA 2GVZC 1PS9A 2HMUA 1J22A 9ATCA 3CVXA 1CQWA 1KTVA 5ARBA 1OU0A 3K70D 5LQDA 2SICE 4KTTE 1Z6PA 5P8WA 1NJ2A 3QKSB 3A28A 2HC9A 1ZW6A 1R8QA 1E79A 2A57A 3LFTA 2JFXA 4EF5A 1J5PA 1EA7A 1MIOA 1KJ9A 4Z7NB 3K5HA 1DELA 5TQ2B 1VSBA 5ECDA 1MJFA 1SBTA 1XT6A 4IIEA 1NURA 3ZK9A 5LD2B 1GARA 1TYBE 5DHRA 1YRAA 3KX2A 3HLTA 1XWIA 2Z43A 3DO5A 5FI1B 4MIYA 3BWCA 5AOAA 1KRXA 3R0ZA 4UUBA 1H0SA 1L5OA 1OV4A 3JQFA 3PJDA 3R44A 4IWYA 2FX2A 2FMIA 4XASA 3ZDQA 2PVCA 2X8JA 4UMFA 4I4LA 4ES6A 1ZJYA 2RMKA 2J0UA 1DBPA 2OXCA 3B51X 3GJ5A 4G41A 4MR9B 1J06A 3PE4A 5L3ZA 4P7KA 1PDWA 4TV8A 2HQ1A 4JI5B 5JDIA 4KN8A 5ERXA 4HDOB 2VZ0A 4RHEA 4X7PA 2NXNA 2FUKA 3NI2A 2JGAA 1TAGA 2R6CA 4JP2A 4KUHA 3W7AA 2JLYA 3KJXA 2X7XA 5BN1A 1E9SA 2NYVA 4EPVA 4UHBA 1D7AA 4RHTA 1NW4A 3DL4A 2OSVA 3VMMA 4X1YB 4HR7A 3DMDA 3M9XA 3QA9A 1WKVA 5CRIA 3C3CA 1GGKA 3FDZA 4MHOA 4QGFA 4HNVA 5KOHB 5C8YA 3WLEA 2QOEA 3OSZA 4YNBA 4ZCPA 3TKAA 1IAQA 3BDIA 3KQKA 1JA9A 2JLXA 1SHTX 3IAM1 1RR6A 4JSRA 3NYRA 2QG9A 3U16A 3TIVA 3R0JA 4J49A 3KL2A 3LHDA 4W7IA 4RSRA 4NV3A 2DBZA 1PNOA 2JRLA 4NCIA 3PUXA 3H3FA 2EFYA 3NYQA 2G09A 2J5QA 3FMFA 3WGGA 2ZDQA 1MBZA 3KR0A 2NXJA 3D5QA 4KV7A 1QHHA 2ECQA 5DN6A 4PW0A 4UJ3A 4OL9A 1MVOA 3BZWA 3I9JA 1BE8A 2YWGA 3D3EA 3IP8A 4TLAA 3S44A 2M1ZA 2CNKA 4JHXA 4LQDA 1GDTA 1J2YA 4QWWA 1PJLA 1Q22A 1SU6A 3LC0A 3R76A 1FSSA 2V4ZA 3LWBA 3AVVA 4ZVSA 4DLKA 3ZDEA 1UUFA 3PGLA 2QVCA 2X5JO 3R5XA 2BONA 1W93A 1YJ8A 2HF9A 2JEOA 1UF9A 1Z6TA 3BILA 3MC1A 4PPQA 1E2IA 2B8EA 3TTTA 3CVYA 2IUSA 1RPJA 3FJYA 2VI5A 4B4VA 1NR1A 5ERGB 1PTJA 3RVLA 3OWXA 2CFOA 3C5EA 1WTCA 1WVIA 3ZLUA 5EJFA 4D9MA 2V7GA 5IS2A 1L7VC 3ADBA 1H4VB 3OQBA 4F9GA 4YMGA 3O3NB 3DFFA 2I91A 4ZTZB 4TLLB 3VAYA 1QRDA 3W9YA 1CJUC 1YTLA 3TNYA 2DXIA 2X5KO 2XB6A 3WP0A 3JRXA 2ZZKA 1YQTA 1GNTA 1C5KA 2WWRA 3PPVA 5ALTA 4ZTUB 1AJEA 1C9JA 2C3OA 3CH7A 4UBKA 4PYJA 4EEXA 3K2BA 4P7JA 5G2OA 3LQ1A 4EKEA 2Z9BA 2Q45A 3A1EA 3AIMA 1L1FA 4C7VA 4DC9A 2JH3A 1MT0A 5CT9A 1IJKA 1TECE 3MN1A 1CFZA 3L8HA 4FS3A 1LBIA 3ISTA 2WG2A 2QUJA 1RJ9A 4Q3NA 3TCKA 1E0AA 1GP2A 4HDKB 3TRIA 3L04A 3DR5A 2PMDA 4M7WA 2ZKIA 3VYWA 1QQBA 2OB2A 1F38A 2W2KA 4HTFA 4LJKA 2REQA 3DOOA 4RACA 2WTXA 1KE2A 3OIDA 2O1EA 1FFAA 1OWPA 2A9KA 2GZSA 3W3AD 3NV7A 4QG7A 3U7QB 3VPAA 5K09A 3EZXA 3QVVA 4CKBB 2VUIB 4GGMX 5CXXA 1CDDA 5THKA 4IOMA 3WADA 2HF2A 4O3MA 1SXJC 3IODA 1ZUHA 2XYVA 1ICIA 4DDVA 3WL5A 2UUBB 4LFAB 3N2LA 2AN3A 3VHQA 1ZL0A 3PHBE 4ZPXA 1AUVA 1YVRA 2V6GA 3IT3A 4FLFA 4YP7A 2P3QA 3PFBA 5FUQA 1EMDA 1PGOA 2POQX 3CXUA 4QIHA 2JLZA 2YKGA 1I2ZA 3KZMA 1IXKA 1DWUA 1JFFA 4O2BA 1Z0ZA 1UK8A 4YQYA 1XMIA 3ME5A 4BX2A 2WTMA 1W88B 1D9XA 1O3YA 2J33A 1RWKA 1WXIA 2PBZA 1QR2A 2WOJA 3P71T 3W8DA 4IDGA 3D8HA 2W6CX 4GNRA 4B5KA 1GZHB 1XD2A 1YRBA 2VXOA 3FX2A 2XTZA 4L8YA 3DXZA 4WFQA 3FN4A 4HQKA 3QJ5A 4ALNA 4BFVA 5C7IO 4JJEA 3G17A 2B5VA 3LF2A 3UH1A 8LDHA 5J4KA 1OXVA 3A9UA 1DJMA 3UXHA 4FCVA 1Q17A 3BK7A 3HBFA 2PA3A 3TQOA 4BGVA 4CL2A 3E9EA 3WLRA 3PF9A 4LBYA 1G2QA 2ATXA 4HK4A 5EKDA 4B3CA 4YAKA 4KX3A 3FGNA 1O58A 2I78A 2PFSA 2ORIA 4XPIB 3GMIA 4JJKA 3SGLA 3DMGA 4I8DA 5FL3A 3UV6A 4C4AA 2QSYA 2W6MA 2M6RA 2XIJA 3PA6A 2PNJA 1K3TA 3JATB 2BBOA 3H9BA 5GP1A 4BB9A 3VV2A 1L7AA 3GD5A 1GCIA 4X97A 4RTNA 2XA2A 5MFPA 2ODBA 2QLJA 4YY3B 3ZIDA 3V8NA 5JCOA 4G8DA 2QNBA 1DVRA 3KZXA 5EERA 1H8ED 2DQZA 3R5SA 2A58A 2QTCA 2VDPB 1P74A 1YZ3A 2CEKA 5FEMA 3TL3A 3WGYA 3ZPXA 4Y3UA 2GM5A 3CSUA 3RRBA 2ZBUA 5TS3A 1H8HD 4KQHA 3IUEA 1C9YA 2WU1A 3HZOA 1GVHA 2HH9A 3IS3A 5CYPA 3Q0TA 5EEGA 3UXEA 2PXHA 4PYQA 4A8JA 2RCYA 4DNFA 2AF3C 4ECAA 4I1IA 1JSXA 1R6AA 3EGWA 3PC6A 3W3AA 1MX3A 4CMJA 3BS4A 4NEGA 3EUFA 5BMVF 1A8UA 4YMWA 4AYTA 4D81A 3S1AB 1HDRA 2Q1UA 3K8YA 5DTIA 5HFAA 1L4KA 1VIMA 1XAJA 4IXTA 4KR9A 4DDMA 1Y4AE 1H3EA 1ZIPA 1LSOA 5KHLB 3AY7A 3QBDA 4ZI7F 1GTJ1 3PGVA 1F4PA 2GXAA 3OO1A 3G85A 2OFXA 4GZMA 2X0IA 5COQA 4O8CA 3L6UA 4MGYR 4U7FA 1JKXA 2CNOA 3NOVA 2C1EA 5K4GA 1QRUA 4LF9B 4CU5A 1QB8A 1Y5IA 2X1HA 4YP9A 4F4DA 4XB1A 4ZCTA 2I29A 4R8MA 1TUGA 4QPNA 4B3TB 1XPUA 2OZLB 1DC5A 2YHAA 2ZUVA 1PQPA 1LSUA 2WMNB 2PLWA 3A9SA 3L9WA 3PHCA 3W4IA 3IPLA 16PKA 1ZIXA 1OFTA 2ZRJA 2GRJA 3G9ZA 3LF1A 4UEWA 3VPXA 4C04A 2D0PB 3EVAA 1OXKB 2ADFA 2YRFA 1OVMA 1A1SA 1C4XA 1UPAA 1HM5A 1XCMA 1NV8A 2Z95A 3DZGA 3QHPA 4OP1A 4A3SA 2P4UA 3NC4A 1XWWA 5C4IA 3IE2A 3FNFA 4EL0A 1J97A 2P2GA 5LLSA 4RZQA 3L7AA 1YZLA 2FWRA 4QQKA 4BO6A 4KRFA 2H00A 6GPBA 1U7TA 2C4TA 2HPAA 2QLTA 2RH5A 3CLTD 4CKXA 5AVSA 2DFNA 3GCDA 4Q3DA 5F77A 5HBRA 4H1HA 4QPPA 3KT8A 3L93A 1VE3A 1G6Q1 3QVSA 3U9TA 2PX6A 3QHAA 1GRNA 2Q28A 2I7DA 3LYHA 4F1WA 1J25A 2PUJA 3GLIB 2YWFA 3L0OA 4OQNA 3CONA 3GCZA 4AF8A 3QEOA 3HQ4O 4L0MA 2IT1A 3LY7A 3A0RB 2R1ZA 5E6RA 3VJMA 3C7DB 4ARUA 5K0FA 2H1WA 3I8XA 4U0JA 4F3NA 4YAFA 1NRXA 3LC7O 1OH8A 1E5TA 2ZSJA 1A0OA 2BEKA 4UZFA 3ZCQA 4PE5B 3E70C 2GA8A 4OATA 4REOA 5BSMA 2X8WA 3GA7A 3P2KA 3R3YA 4QOHA 4MSUA 4MWZA 2CXQA 2HU5A 4WECA 2OG2A 2VSNA 5K8CA 4IP0A 3T15A 2PUTA 5HR5A 4FEAA 5H8WA 5CK4A 3WLJA 2XMCA 4WY8A 2YVAA 4PRLA 5CT6A 5FXMA 3A1DA 4B7AA 4XH9B 1VPDA 4DIOA 1TLTA 1UMCB 1Y8RA 4PZAA 4BGIA 2WHXA 1PUXA 1Q7TA 1VG8A 1EK5A 4JL6A 2FR8A 3LYUA 4GXNA 4MV3A 4EVIA 5HKAA 4ZHQF 1EU1A 2G77B 4DNOA 4C6TA 2ZUFA 1HX7A 2W6ZA 5TMPA 4BNKA 2JS7A 4H7FA 5KWEA 4XRRA 3HEMA 1Z7YA 4JGGA 4X3OA 3A31A 1Z34A 3LFUA 1MABA 3EXHC 4FZVA 3RU9A 1H3FA 4D9GA 1MUUA 1YVUA 4MS3B 5KDOA 5J2UA 4F21A 4TVKA 5B58T 1SUIA 4ZKDA 2BCEA 2PQMA 1VCIA 2XMBA 4XJSA 1T3SA 3CEJA 8ADHA 3AH8A 1KAQA 3PNMA 2QV0A 3AL0C 3FPBA 1V8BA 4IILA 4QRIA 1MQSA 4RJKA 1OC4A 3H9UA 2O8EA 4FZRA 2A3NA 4GW3A 4OQ4A 2CT8A 2J67A 3JVEA 4LWOA 4IGEA 5LBUA 3W3ZB 2WNSA 4KSYA 2CXTA 1PO7A 1WCIA 1WQ3A 3N76A 4II3A 3RCBA 4P86A 4EITA 2EX1A 3THXB 2LGJA 4WXEA 3L0PA 3CKMA 5EVJA 5JD3A 2E87A 3VSEA 2DVMA 3CC8A 1WJGA 2FAXA 5CYGA 4GE0A 5I9BA 1Q1NA 1M0TA 3M33A 3M5WA 3BMNB 4BP8A 4DCMA 4ENPA 4RGVA 3PKJA 4MUBA 2GVNA 4IO1A 2W43A 2L0XA 2W6IA 3CUTA 3GF4A 4JJGA 1F9AA 1P0FA 3R3WA 4P33A 4RS3A 3ZGLA 6CHYA 4RULA 3H8SA 10MHA 3WDMA 2QSUA 2WYIA 3WY9A 4BNLA 1PQUA 1SUSA 3C3PA 2GARA 2NU9A 2ZPTX 2GD6A 2ZRHA 3FB4A 1ZS9A 2QTNA 3AFOA 3UK7A 5A1JA 4CEJA 1CRQA 5EWMB 2RGEA 3FNBA 3BB1A 4PZ0A 4TT3D 1XU7A 2OXIA 4KQFA 5G0WA 1TUEA 1VZ3A 4YLYA 3GUYA 3MGCA 1MHTA 1E7QA 3AHHA 3FYSA 5DEOA 2VJYA 3OM9A 3NH9A 4QTZA 1Z4NA 3IQHX 1QHNA 2Q6KA 3N0TA 3L3BA 1Z0JA 1AB5A 1T29A 5CFMA 2OORC 3DBHB 1P2FA 4MVJF 5BWMA 3JQAB 1AHIA 1PHPA 2JZOA 2NZWA 2QLBA 2WM8A 2ZI5A 3M2TA 4MRVA 2R0QC 1RXWA 1NUTA 5DLYA 5AVRA 4GH5A 2OUKA 3M1AA 2GCPA 5JT1A 4K28A 1HNXB 1XZJA 3HEAA 1PW5A 2I2XB 4TXMA 4MI9A 4B8ZA 1S4QA 3BMCB 3OFNA 2GNPA 2IOHA 3M83A 2WQ6A 4FN4A 3VQTA 4FK8A 1P4SA 3U3KA 3FFBA 1N2JA 4MVWA 3U09A 4GMDA 4ICIA 2WB4A 4KWEA 1K0UA 1HFJA 3CUSA 4M8IA 4XM1A 2X1LA 2ZBVA 1CUEA 4US0R 3BGIA 3FOEC 2EFCB 3IVGA 1ZR2A 1PR5A 1QIKA 1S9DA 2HV9A 3THWB 4OI4A 4KIWA 4X60A 3B9PA 3U3ZA 3FUVA 1GSAA 1UPCA 2GK6A 4IUBS 2NOAA 4HGQA 3ZW9A 4B74A 1Z38A 4Z2AA 4WPGA 2C9MA 4NRDA 5IUKC 3W5IA 2E55A 3BXFA 3OJFA 2VPXA 1UC5B 4GR5A 3GNQA 1P0CA 5FTJA 1E7YA 1R8YA 2OM6A 2LCIA 2F8LA 5FWAA 2C92A 3A4VA 4LMAA 4XUGB 2JGLA 3EMVA 3INGA 4IOKA 4N8EA 5JPIA 4EX6A 5B4UA 4FFSA 3B6KA 4QUKA 1NJSA 3W5HA 3AFNA 3DE1X 1WRBA 3ZKWB 4PG8A 4YIHA 1IIRA 1UIRA 2HL6A 2VP4A 2R2AA 1QIEA 4K5QA 3MINA 4YP6A 4BTLA 1KKLA 4JLVA 1LDNA 3OU7A 5EJ7A 4JV5B 1NN3A 3RS7A 3QH4A 3D31A 3Q3JB 3NPMA 4K9MA 1GGFA 2IXGA 3AM5A 2BM0A 3NEJA 3RK4A 4BOYA 4ZRNA 1NVKA 3FTNA 2XVAA 3RYCA 1QGED 2H2WA 5AMXA 4ALIA 1LS6A 2E4WA 3C43A 3P5SA 2IYOA 3OIFA 4UE6A 5FNVA 3FTDA 1VA5A 2DOKA 4L02A 3TSOA 3GWZA 2MSKA 3MQFA 1X38A 4KO3S 1Y80A 2JIPA 5T3YA 2GEFA 3RC7A 3LTNC 3JQ6A 4HN4B 1V45E 2J4CA 3FFWA 2VN8A 1YVPA 3R09A 5AVJA 3GVXA 1QYIA 2H8GA 1CD5A 3D4IA 3G0OA 1E5VA 3D6TB 2PKCA 2NU6B 1O5TA 1Z83A 2WIGA 5WRFA 2C8VA 2LD4A 3IQXA 1RIIA 3NVMB 3WXBA 3ANNA 2ZB3A 3FLMA 1F7UA 2HJRA 1JI3A 3MBIA 5CX1A 3SG0A 3ICCA 5BMOA 8ABPA 4YMLA 4TYNA 3JD3A 3O3MB 2QW0X 2WM9B 3SF8A 5ALVA 5ADWA 4PSVA 1JDPA 3A1VA 1V43A 3P9KA 4I9FA 1WXWA 1NJFA 3F9IA 2NN3C 4KJXA 4O4IB 2QG4A 4GWKA 4NICA 2P2NA 4RV5A 4UEKA 5EESA 5KNBA 2HDNB 3EJ6A 2I2AA 1L7MA 1OZGA 3LQKA 1V48A 2DLNA 5EINA 2YMMA 3EUEA 3EEFA 3RVKA 4CR8A 4AS1A 1ZC3A 4S12A 4EI7A 1FSZA 3Q5DA 2AG6A 2LCQA 1DQPA 2CGEA 5AKHA 1O5IA 1UINA 3DKIA 3OZVA 4FVTA 2H1FA 2N9UA 2ZRQA 4WDQA 3V00A 3WTCA 1HO3A 2CLKB 4IJUA 4M0CA 3KFXA 4R31A 4G65A 3W90A 2P65A 3LSTA 4FZ5A 4DFDA 3FE2A 4LHYA 5JTUA 4FYHA 5ALFA 3RKUA 4B33A 3HR8A 1ETUA 4K81B 5G40A 2QZZA 4PCVA 3HWWA 5GOTA 3VPSA 4FXPA 3AY3A 5E9WA 3DAYA 1UJCA 1JDVA 1HE4A 5B6IA 4MO2A 1N5DA 1TM4E 5BV2P 5J1TB 4TKVA 1MT3A 2ZR9A 4M2LA 3WX0A 1DBQA 1E2HA 3HUEA 2QZ4A 3MWEB 4HZGA 2HSEA 4E2FA 5BNZA 2J48A 1KEVA 4Z51A 4IF6A 3TIGA 3UCXA 5HKKD 5KNCA 2RE8A 5CEJA 5EA2A 4QM6A 4WSOA 1XWFA 3BFVA 2HY7A 1NLYA 3F3SA 1W19A 1FYVA 1XG5A 2RHGB 3T12A 3EZFA 2JA2A 1ZU5A 4JEUA 3BREA 1M2VA 1P81A 3PUYA 5L45A 4J4TA 1V39A 4DKJA 1K9SA 3LZDA 3ZHVA 2ZPAA 3FMGA 4IMPA 4ZXFA 3DF9A 4AWBA 1N2SA 3I1FA 3DT9A 2WTEA 5B3AA 4GXTA 3VNBA 4DDWA 1K5HA 3EVFA 4WV3A 3OMLA 5NLLA 1VDMA 4TXJA 4UDYX 2NXWA 1KVTA 2X5XA 4HATA 1WVGA 4JUFA 2QSJA 4G4JA 3WOHA 1GADO 3LC2O 1DMSA 4PLGA 2Q5FA 1XE3A 1GCOA 4PYNA 5KTNA 2I3ZA 1UKYA 4JB8A 5AW9A 3STXA 1VYVA 4HX2A 1QPGA 1QVVA 3AUXA 5ALWA 5AQ1A 1GL3A 1B15A 1EM8A 3DBRB 1TZBA 2QN6A 1CW2B 1B6GA 1EDOA 3G82C 4GSYA 3AB7A 4BLPA 4OXXA 1TCCA 1M7BA 2QX7A 3E6AA 3M6XA 4HWRA 3TRDA 4AS3A 5K0EA 1R9GA 3GLFE 4C1BA 2HHHB 4I6JA 1IG3A 3FOWA 3AUSA 4ND1A 3DMTC 4LDAA 2BFEB 3G9QA 3JRNA 5BWBA 4GL2A 1DHTA 1SU8A 1KO1A 4LRWA 3TINA 2VHVA 1ECFA 3PDIB 4R2KA 3SZ3A 2PZ8A 4ZV4A 2HMTA 1UQTA 3L40A 4KIFA 4CM8A 4FR5A 1T25A 4ID9A 4KO4S 5NULA 3KQNA 2BEVB 3OQ6A 3ZBTA 3UEOA 4G67A 5CLHA 4K9SA 1KH1A 2FG5A 5MDHA 3G02A 3LMKA 1CDEA 1DT3A 3ZJ5A 1TYDE 3UC5A 1WEHA 5KI6A 2QN2A 1QZXA 4CIVA 3AJRA 4NL4H 3E5NA 4K8RB 3AHDA 1SOMA 2VQSA 3EZ7A 5LYJF 1AN0A 3DMPA 4HF7A 1WE2A 4CRWB 3MK31 4JC8A 1UZAA 2O7RA 1YK1A 1IM2A 4BVGA 1L8AA 2PH1A 5FOVA 3ZHTA 3L6RA 5IARA 3PG5A 3GVCA 1NFFA 3GGOA 3QVWA 5BNFA 1RP1A 3QVGB 1O7JA 4LE0A 4ZMSA 1LW6E 1ULHA 1YDFA 5DRTA 4NZ9A 4MQEB 3KOOA 1E89A 1LCIA 3GRKA 2FPKA 4IO0A 1CJBA 4RV4A 5DNWA 1CUJA 2CV2A 3OQHA 4DWJA 1H9CA 2O2HA 4W5HA 2RGYA 3ZWAA 4PWZA 3INTA 1G17A 5GIPE 3AOEC 3IBSA 1MW9X 4CZ2A 4NQRA 3JQ8A 4M0DA 4FR0A 2DTXA 3GFGA 3CIOA 3P0IA 3PK0A 3PD1A 4JJAA 3SZLA 1WWKA 2FSIA 3ZU3A 3PI7A 4DCCA 4B6PA 1YZUA 4J2HA 1XTUA 4HRVA 3MPOA 2R47A 1VYUA 1JE1A 1ACJA 4B6RA 3NGXA 3K9FC 1TAUA 3NHUA 3DMRA 1YMUA 4FINA 4O1MA 4BO0A 1LK0A 2XLBA 4QOFA 4XIFA 4Y1EA 1CUFA 1LTQA 1V35A 4R1OA 2YICA 1FMJA 4LE2A 4LKOA 4P7FA 4EEKA 5DH9A 1C3OB 4BMNA 4Z4GA 1JYFA 3FNGA 3BA1A 1TM1E 3CLUC 1RKUA 1GLNA 2WT4A 2YFHA 4FFBA 3SR0A 4FYXA 1D07A 1GGVA 5E3HA 3UGKA 3V2IA 3GFBA 3II6X 4G1EB 2VG8A 3G13A 2XR1A 4NZOA 1GZVA 2ENWA 5CDFE 4F9EA 2FPPA 3ETNA 3HB9A 5EWJA 1YE3A 3GXBA 4YN3A 4EI9A 1WW8A 4KJZA 2UZ3A 1NQWA 2YMPA 3Q85A 2XGMA 4ZVQA 2F1HA 1HK7A 1CJSA 5LMCA 4JT4A 1X7XA 3E82A 2LWIA 2HW8A 4MVJM 1JNYA 2OHIA 3U9LA 3CNHA 2IY8A 3N70A 3QPWA 1RAHA 2UVQA 4IIJB 4IX9A 1I6KA 4IIBA 1U2ZA 3F6BX 2V6BA 4G1UC 3WZLA 4DC0A 1QUFA 3N8HA 9GPBA 1UJNA 5ALXA 1ZONA 2OYCA 5JAIA 2CXHA 1CVLA 2EDAA 4B32A 2JGFA 2ZSEA 3IUQA 5A2GA 2OD7A 4OIFA 1P1IA 3H2HA 5G41A 1GO2A 4RLHA 1PKEA 2XGGA 2O7QA 3ZJTA 2HO4A 3JWPA 3PEUA 3EVZA 4MV8A 2VK4A 3AKDA 3QYJA 3I5AA 1MX5A 4RVOA 2IZ0A 4M88A 4L75A 2WF5A 4K6CA 2ZJAA 1W4LA 4EFLA 2WIDA 2YS7A 2VJNA 3MTJA 1N1DA 1JVBA 3SE0A 2HJHA 4DBVO 3H97A 2V9CA 4AZ3B 3I32A 2VPQA 3HUFA 3ODPA 2YZ7A 4ETNA 1N0IA 4EO4A 5FV4A 2OHFA 3DNFA 4WINA 3WO0A 2JLAA 2ZE5A 3IRVA 3ND8A 4LSGA 4QPZA 3MUFA 4BO1A 4DT1A 1ZK0A 1YCGA 1Y1KE 4UAGA 1J9GA 5DXAA 2G0NA 2G1PA 1S6YA 4D8YA 2WE7A 5DOVA 4DIDA 5IVKA 5HIAA 1ECCA 5K0CA 3E7DA 3GL9A 7GPBA 1KY4A 3UT5A 4GBMA 4FPXA 3INYA 4BFCA 4EHKA 1COWA 1TEVA 3SFZA 3SJUA 2FF7A 3DOHA 5JXWA 1N4DA 1XZAA 3HL0A 2VH2A 4IXMA 5ITVA 1T9KA 5SICE 5FKJA 5IUJC 2BV3A 3GWGA 3HS3A 4Y30A 3GEDA 3OPYB 4CKEA 4LXHA 4R3WA 1JJBA 2BGRA 2J85A 4ZPJA 3K09C 5CIQA 3VZQA 2ZWIA 3QY9A 1COWD 4QPJC 3HVRA 4BLVA 1CF4A 2NV2B 1O95C 4C29A 4B6OA 5JSFA 1Z5UA 3I45A 2Z9CA 1CS0B 3G8YA 1PIWA 5HGJA 4Q4AA 1KZHA 4ZAXA 4ZVOA 3FSRA 1CS4C 2WDPA 4Y98A 2BPOA 2DFPA 1PW7A 1KS9A 1GXSB 5CTAA 4BP3A 5HIKA 3ORQA 3ZEAA 5DHQA 5JRJA 2H2GA 3H7IA 5AXBA 1KVUA 1FFXA 4L28A 3N05A 1IEQA 3AHJA 3CQ9A 3AOGA 3IQFA 3QJGA 4XOUA 5ENDA 2D0OB 4CM5A 3TOSA 2RGCA 5EQTA 2P6UA 3JZMA 2QT1A 1J0AA 3ZOZA 1RYBA 5JW6A 4KPFC 1HWYA 3G8CA 4AD8A 1WP9A 1NKSA 1DBIA 1O87A 1E9CA 1PF7E 1MAAA 4Q93A 3D1VA 3LPAA 4UBOA 3TLCA 4AWAA 2N3ZA 2PEYA 3W5JA 4DIBA 2Q1TA 3U61B 1OI2A 3QLVC 1DDIA 3ZR4B 5BWCA 5GJVC 5BSRA 2J4FA 3HKDA 1EX7A 3AR9A 1GUBA 4W82A 3LCRA 4FOTA 4BMOB 4OLHA 3IKMB 4EKNB 3GFRA 4EB6B 5LXTA 3K0EA 4RIIA 2ZXUA 2YMQA 2ZIXA 1XD9A 1BVYF 2A9FA 4ZJUA 3KUXA 1ZMOA 1M1NB 4AULA 3O8LA 1OVGA 4F2PA 2Y05A 3E5MA 3E7XA 1YE8A 1ZJ5A 4M0LA 3H5IA 5FL7D 1ID8A 1K7XB 2QRPA 4RHFA 3FPKA 5CP8A 4CM9A 4YECA 1L4UA 3EHDA 3SBOA 2JFYA 3SZGA 3ZD8A 5KHOC 3FPFA 3ZI7A 3AJ9A 3FKSD 4PC2A 1QHXA 4PPYA 1S1CA 1XXLA 3PE3A 1K5PA 3PVCA 1I80A 4G5OA 4AT1A 4FYKA 4ENVA 3AUUA 5HKKA 1OYWA 4B4WA 3SHTA 5FWYB 3T06B 2H4YA 1KP2A 1QYCA 3BF8A 3D6AA 2WV7A 2G0TA 3ESRA 4MV9A 4O25A 2WM2A 4PCLA 3R9XB 1BEZA 3BPSA 2GM3A 2LDBA 3T7JA 4JYBA 2HBQA 1YXMA 1A8HA 2ZUCA 1K4KA 4YRLA 1F0KA 1UP7A 4E5SA 2GEKA 1SG9A 2VDOB 3EIOA 2V9ZA 2I22A 3CT6A 5DCWA 1I5OA 1YU9A 5F2KA 3K71B 1YF3A 1AD2A 1ZYUA 4MYUA 1GD1O 1AIPA 2AC4A 2B69A 4V0QA 3TGLA 3FLAA 4QODA 1W46A 1VI2A 4MPRA 1IQPA 1L7EA 2ADOA 2W6ID 4DTIA 2PX0A 3OEEA 5A5EA 2ZM6B 2BP7B 4DLYA 1PT7A 3GJ0A 3S8MA 1KOJA 3O8DA 2WSBA 1QK4A 3P4XA 1ISFA 3IX7A 4E46A 3O8BA 1FXSA 3V8EA 4CKCB 5AVVA 4Z2YA 1HNNA 2BI7A 3GLVA 1U8TA 4EA8A 3SDSA 4INAA 3THWA 3CR7A 2AEMA 2ZVPX 2HEGA 1H2WA 1C7EA 1HDOA 3BF7A 4UVEA 2XUHA 1KOFA 3TQQA 4HQNA 2P1RA 3EVNA 2CLIB 1OHHD 2GO1A 4OMDA 5KYKA 3KQLA 3H19A 3R6GA 2BTEA 4LC1A 4D4HA 3DEFA 5CB4B 4NONA 5IAEA 3COJA 1HQYE 4OHWA 1CDOA 4BZXA 4OQPA 5CFZA 2GILA 2ZIUB 4DGQA 4OMCA 1ELOA 1Z3IX 2IYNA 5HJ7A 4B81A 1DC6A 4Z5XA 4LRSB 4QECA 2JD0A 2QBYB 3QY0A 3CUWA 1V5GA 4LXGA 5EZQA 4R1UA 5LQAA 2GZHA 3AXTA 4HLQB 5FBKA 4K6FA 2EYQA 5ALOA 3WK7A 4NHEA 4QEDA 1YGYA 1R5BA 3PQ3A 2IYUA 3VKUA 1S02A 3O9VA 4KQGA 5JWRA 2Q5CA 5KX5B 4R8KA 5KOJA 1H4SA 2IUTA 3BMQB 4NYIQ 3W6OA 1E1RD 1SBYA 3ASZA 3LDAA 3B78A 3UMGA 1BJKA 3DR3A 2IVFA 3JYHA 4CETA 4US2R 4F0JA 3VOAA 1N0HA 1ZP6A 1WHTB 3H5TA 4RVHA 3FZGA 5DW0A 1V11B 3EBPA 1VPWA 2HIGA 1U0LA 4BN4A 2EF1A 4OUDA 5KINB 4V0MA 5IJ0B 3BM5A 2Q9AA 4EI2A 2AE1A 4FILA 2ES4A 3U62A 4MYHA 3IPYA 4FONA 2PEZA 1D0SA 4GLJA 3KUUA 3ANYB 4QGHA 4YO8A 5FI0B 5KTKA 4GQIA 4KLZA 3UUGA 4MDEA 1AB6A 1RM4A 1UR5A 2ZWPA 1N2EA 4CMAA 4GPBA 5A0FA 1L7QA 4GKVA 2YJ3A 3NBKA 4MPTA 1AQJA 2G36A 4TLCA 3SQWA 2PGDA 3P0JA 1XK6A 3PQ6A 2PY6A 3HPRA 2WUWE 3E2IA 3D9QX 2HFJA 1ZUNB 2YW2A 4PYKA 1P9NA 1B43A 1KQGA 1OA0A 1S2OA 3LU1A 4E4RA 3QLUA 3PJEA 5CB4F 3HJFA 2B9EA 5A6SA 3UATA 1YR8A 4ZODA 2QDKA 5C5CA 1KY2A 1UBKS 2AXEA 4G89A 5EMKA 5IF9A 3D8RA 1Z4KA 2WWYA 2Q46A 4Y0VA 2PL5A 2VBCA 5AICA 3VU3A 4LJSA 1YACA 5HQ3A 3T3OA 1G20A 2OE2A 4M9XA 3PGA1 1JEAA 1WCXA 2QKYA 3PT5A 2X2FA 2G9UA 3ZX4A 5DNUA 4FGKA 4GD3Q 1SCNE 3OZEA 1WUKS 3RHZA 4C0LA 5JPDA 3OO0A 5JUWA 2YNMD 2EKBA 4Q66C 3U56A 1TCVA 4OB8A 4UPDA 1J8QA 1T10A 4TQAA 1GNSA 4WVLA 5BN3A 2ONCA 5IT0A 1U63A 1YAHA 3HE3A 1MIOB 2QRHA 3PR1A 3PXXA 4DA0A 1H4QA 3U3MA 4Z4CA 1GZ6A 2YXPX 1H2RS 3D3WB 4NBTA 4DMUB 2LP4Y 4IHJB 1QO9A 4OYYA 4L4YA 3W2FA 5JNSA 2NSJA 5T5QA 5DMHA 3A7EA 4HAWA 1QOZA 1E92A 3CPEA 4TRNA 2I6GA 6NULA 3OZFA 2C95A 2AG0A 1JH8A 4A92A 3T3NA 1HDIA 1FRNA 2ODWA 2Y1XA 2WD7A 4NDAA 5CHEA 5KTSA 2WM3A 3VTAA 2BHLA 2UZIR 2ZUSA 1IXYA 3EDRA 3WGUA 4WWHA 5EAIA 2BLNA 3I2YX 2PWYA 2VUUA 3JYLA 4J0JA 5AW1A 2WPDA 2EJBA 3JQEA 1QR6A 4BUCA 1D0VA 1B0PA 4ZT4A 2CFSA 2C7OA 2IEZA 3Q11A 1AUXA 3I9V1 5ARDA 2RGGA 3COZA 4IV5A 3C85A 3C8ZA 5FBLB 3V4FA 5BOSA 2IH2A 1T1RA 4KSCA 2B92A 5EC8A 4FDAA 1DCMA 1MAHA 3B3GA 1SXIA 2DWOA 2GEJA 2ZCUA 4ZVNA 4UC0A 5DI3A 3VO8A 4ZZ3A 1FRVA 3PD0A 4BMYA 4L15A 3PQ2A 2PUAA 1NW7A 5KSPA 1OBHA 4HHEA 3UJNA 3BX1A 2PAAA 3TLBA 4BGEA 1CIJA 3EQ7A 4C3VA 3OPMA 3QMPA 5JAZA 4KR7A 2Q4RA 2PGJA 4WRRA 4BBPA 2VHYA 4NG5A 4OU4A 1IXRC 3FUCA 4P22A 2BGJA 4BFZA 1LUAA 821PA 1CQIB 1VBMA 2IBMA 4ILKA 3C48A 1X80A 4P53A 4M0KA 3WGHA 3WIDA 5JWOA 3WLTA 5K0SA 2BRUA 1HNWB 4BQFA 4I4TA 1PK9A 3KKZA 4UFNA 3WHKA 2OBFA 4TL9A 4BQEA 4ZHSA 4WCVA 4E6EA 3IJPA 2QDXA 2C5FA 5G4LA 5B1HA 1YRQA 2G06A 3W2HA 3L7YA 1C0KA 2RIPA 5A3RA 2IYFA 5LMUB 2B9VA 3IAEA 3OZCA 4EY3A 2FDCA 1DJOA 4TV9B 4BMZA 3TFOA 4ERNA 4C2TA 1IM5A 2J59A 3GP3A 2P5TB 2Q9BA 4OM8A 2C2YA 2OV1A 2IV7A 2Z08A 4RPLA 3RF7A 2WBLC 1OC2A 1JHOA 4Q4DA 4MGHA 4Z0HO 1A9SA 1U4OA 4Q1VA 4EMTA 4ER5A 4EG1A 1HL7A 4LOLA 3SM9A 3IQEA 4DJAA 2H1VA 3LT1A 4XWAA 5IN5A 2JK0A 4K9OA 4X20B 4MB2A 5YASA 1NRJB 1WU8A 4BEBA 3KLNA 4WMLA 4IDAA 5CT8A 1LK5A 1OLOA 3ID6C 1XNQB 1XEWX 4JX9A 2ORWA 4TKUB 4M46A 5IW8A 1SOWA 1MZVA 3UMBA 1H2BA 2JIOA 2QN7A 1QQ6A 1P9LA 1TM7E 4IHKA 2AJTA 4OK6A 5E8RA 4RCZA 2UXBB 1U2TA 1U2EA 1QE0A 2H9YA 2GBCA 2GRAA 3ICPA 1TTQB 1UMKA 2SCUB 5B7QA 3O1IC 4CQMD 1POWA 4CM6A 3CTPA 1TF5A 1TJ3A 5K3AA 3RVOA 5C1OA 5TVKA 1RQRA 3L8CA 2QTFA 4OKSA 1ESEA 3PWZA 1KI3A 5LFAA 4KVFA 1VL2A 3LECA 2EGHA 3KQHA 4H3KB 1SULA 1JDNA 2D8AA 3QX7A 1EWKA 4IHJF 1EHIA 1XHFA 2HSDA 7MDHA 5LMZA 1ZCBA 2Y0CA 2I1LA 5HIMA 5TJ9A 3V4SA 3W06A 3KXLA 4Y6SA 4MYDA 2W11A 1LU9A 1JIQA 3NV9A 5GGXA 4B7UA 4Q9DA 4B85A 5BP7A 1OFVA 3WB9A 4N8SA 4FGWA 1YBMA 2VLBA 4HNAA 2EFHB 3HB4X 5LQCA 2RD2A 1YFJA 2AZDA 3VXKA 4KDCA 1X1EA 1U3FA 3E1KA 4YLEA 2IV2X 3TDKA 3UC9A 4BKPA 3QOYA 9LDBA 3QPDA 1YS7A 5JAUA 2QQ5A 1L7NA 4DCSA 1OFIA 2GX6A 2O59A 1Q3HA 4BCBA 4M1TA 3U1VA 3U3OA 3OJLA 4N3GA 1JA0A 3RH0A 3NHLA 2RKOA 5KVSA 4NXNB 1R0LA 1TO6A 3BRWD 1C9NA 3EVBA 3F46A 3I05A 3NT2A 2V59A 4TL8A 2OHJA 1KKUA 1RZ3A 4ZJPA 2XQVA 2XYPA 3HKBB 4QHTA 3FG9A 4YXWD 3U60B 4WNCA 2Z04A 3A32A 1QHIA 2XD9A 3BL6A 3HP7A 2F3UA 3QF7A 1QGYA 1IE3A 2FPGB 1P31A 4TUYF 1D0IA 1I6LA 2ONZA 3PYMA 5DM60 4L3WA 4OI1A 1DAEA 4V0OA 3UPTA 1RQNA 2IYAA 2E89A 3B82A 5T4EA 4DWWA 2OP1A 4J4BA 3DP9A 3ZY6A 1OZFA 2QA5A 3IP5A 1J5XA 4QREA 1WPXA 4M53A 3PIIA 3ITEA 2FPMA 4NENB 3EOBI 1Z12A 1JILA 1FX1A 5CLIA 1SUBA 4H9GA 3U3DA 3UV7A 5L3VA 5AUOB 5JJCA 4NK4A 4O2LA 5CPBA 1SXQA 1AKTA 1ULZA 4BCCA 4MYRA 1E99A 2HR1A 4UMEA 5CU7A 2O8NA 2SBTA 4CFYA 2GAJA 5DMXA 3TEFA 3A3NA 1OBOA 4M8SA 5LUBA 1F2TB 2B1IA 5T57A 3NAQA 1JLHA 2CL7X 1H1LB 2FZGA 2AMLA 3D4BA