2OV6A

The nmr structure of subunit f of the methanogenic a1ao atp synthase and its interaction with the nucleotide-binding subunit b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MELAVIGKSEFVTGFRLAGISKVYETPDIPATESAVRSVLEDKSVGILVMHNDDIGNLPEVLRKNLNESVQPTVVALGGSGSGSTSLREKIKQAVGVDLWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords V-type ATP synthase subunit F
publication title NMR solution structure of subunit F of the methanogenic A1AO adenosine triphosphate synthase and its interaction with the nucleotide-binding subunit B.
pubmed doi rcsb
source organism Methanosarcina mazei
total genus 23
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2ov6A01
4IX9A 2D00A 3AONB 2I4RA 3VR5H 2QAIA 3VR6H 4RNDB 3VR4H 3W3AH 5KNCH 5KNDH 5KNBH 2OV6A
chains in the Genus database with same CATH superfamily
4FGWA 3B85A 4LXGA 3F6SA 4W7IA 1NMXA 2WAOA 3CLSD 3AUKA 2A57A 1G5TA 4QXOA 2HREA 3SOPA 3LP8A 4MYHA 4N7JA 1IAQA 3JRXA 4JXZA 4IGKA 4OMFG 4DPLA 2XB6A 3FFBA 2B61A 4MW2A 2BSQA 3QRWA 4WOJA 5ECGC 3A6JA 3I34X 4I14A 1GL6A 4J1SA 4GICA 4IWXA 2VPPA 3SYTA 1G64A 2RD2A 2IVFA 3IJEB 2X0KA 4BNDB 3OO0A 5EIXA 5FBQB 4YJ2A 2HA0A 5AUQA 2N46A 3U39A 1G8PA 3OP1A 4DCCA 2GN9A 3LUAA 4LRXA 4R9SA 5CHYA 3VZPA 4JBGA 2Q5HA 2VTVA 3HMKA 2W83A 5IZ4A 3BXZA 4D46A 1QG4A 2BMDA 2ZPUA 2HIHA 5CDSA 3TQSA 1M1NB 3RC1A 3NIWA 4YRJA 5H81A 1MXFA 5F2KA 1KGSA 1AA9A 1ZNYA 2AS0A 5JDIA 4W5TA 4ZAFA 5JU6A 3WDKA 3AMVA 1XTUA 3W5DA 2UXBB 3GEGA 3LXUX 3E27A 3HY4A 4E15A 1B15A 5A5DA 2XX3A 4UREA 2RGRA 1BE6A 4MQ6A 4EPXA 1J2YA 2QRHA 2A30A 3LY7A 1EINA 5LIRA 1EUQA 4BE7B 1LEHA 2AC4A 2HL6A 4LY0A 4ZJYA 3T5MA 3ZD7A 4OLHA 4N8EA 5EEHA 1JXMA 3RREA 2JCVA 4TWJA 1CDEA 1POXA 1EFKA 2PUWA 3MTAA 5EMLA 4PZDA 5H0IA 4KQ6A 5JROA 2V3VA 4W5WA 3WSWA 3JS5A 2EYUA 3NHPA 2W2TA 5EZ6B 3FTPA 3LS2A 4LXIA 4JC5A 2GRJA 3M6XA 3HA7A 3EMBA 3JQ7A 4NU0A 5B53A 1EFCA 1KOFA 1MU0A 2FHPA 3AY7A 5DRTA 5IAKA 4AQ7A 1U9IA 1M66A 2VF2A 3SX2A 1V43A 4V3BA 3WWPA 2VZ8A 4NABA 1RPZA 2IOFK 3SKXA 4KP7A 1FCJA 1UEXC 3ROFA 3TQCA 2FW7A 2EKQA 4WLFA 2NUTA 4Y0AA 1WTAA 2CLHB 2VUSA 4LSMA 3LDUA 2B1RA 2C61A 1V16A 2XWJI 3DDHA 4HEJA 4NBLA 4TKZA 1K9VF 3W9BA 2Y93A 3GGDA 3QX3A 3EOBI 2C5LA 2ZROA 3I05A 3V8EA 5CUQA 4OP2A 4LOHA 2XWQA 4FS3A 1JKIA 4IXDA 3CVVA 1NIJA 4ZD6A 4OI1A 3ANYB 4FNAA 1U9ZA 4ENWA 2OUIA 4LOIA 2YXLA 4Q03A 5AVRA 4PWYA 3TIFA 1V2HE 1O08A 1PFKA 2QRUA 3HL0A 3N8GA 4HO1X 5DWQA 4BLPA 3HXTA 1SIBE 5MGNA 4Y2YA 5IWAB 1M54A 1PZMA 2YYSA 2AZTA 2P2SA 3U4QB 4R84A 1KYIA 3IQFA 1KYYA 3L8FA 4FFLA 3FI0A 4LXQA 4NDAA 4EG8A 4F84A 5AVSA 3KOZA 4GRAA 5TMEA 4D92A 4QPDA 2P4QA 4JCOA 3KV3O 3MFYA 3L4KA 5EYPB 3T99A 3PRKE 3GP3A 4J43A 3DLCA 4EQZA 3BYZA 4XR4A 5BWMA 5H82A 1OVMA 2ZUBA 3IR7A 4B6JA 1HWYA 1QM5A 5L7WA 5T41A 3D7SA 4QOHA 5KNDH 5TV2A 1LW7A 1VM6A 3GFQA 4XB1A 3LP5A 1YNOA 5DX8A 4PG8A 5HK9A 1N2IA 4YCBA 1PR9A 1PUXA 5IMBA 3AVQA 5CT9A 2WD7A 2NUAB 3W8EA 3D0RA 4UAVA 3UJAA 1EJ2A 2ZWOA 1ZK3A 3MOGA 1CB7A 1M33A 3PKIA 2O7QA 3HCNA 3QG5A 3C6XA 2DFTA 4IIFA 5BQXA 4HS9A 1IU9A 4BO3A 1HZZC 2WMDA 4RKQA 3MWGA 4LV6A 5KNLA 1N8TA 1VSBA 4PGMA 1O89A 1N0HA 4AY4A 5EHZA 2ZZKA 3RUPA 2Q0XA 4L5AA 1GILA 1CXZA 1LJ8A 1X92A 1E77A 2GSWA 1ZN2A 1DG1G 4HUQA 5JDCA 2C20A 5IKMA 2OOKA 2RHBA 4A2WA 2BRUA 3AVOA 3ZDYB 4RDIA 2A9JA 3E15A 4M99A 3B6JA 2IYWA 1Z8FA 3MVEA 3U1TA 4AYXA 3T8YA 1R5NA 1TZ2A 3CO5A 2HU8A 3L0IB 5DKFA 3UUWA 1XZKA 3EZLA 3SK0A 3IXQA 3MQFA 3NRCA 3BF7A 4ZVMA 1TC2A 7MDHA 3RC8A 1KS2A 4FQ5A 4LQCA 1N3YA 3KE9A 1BX0A 1PVVA 1RJ9B 4GX2A 3QYFA 1RBZA 4DIBA 1A97A 2NO1A 4MVJG 5L51A 4GBMA 5CT4A 2AFIE 1EDZA 1XUOA 4PYQA 1N1DA 3OTGA 3SX0A 4O4HA 1PD0A 1W29A 1Y63A 3PENA 1ZK1A 3PPWA 1C30B 1N6IA 3KSMA 4MLPA 1PUJA 2HSDA 2W11A 2BMEA 4ND8B 1G55A 3OJ0A 4PSAA 2HLNA 2WSIA 3OPYB 2JNWA 3HDQA 1XJCA 5JCJD 3KJIA 4TN1A 1RC8A 1BHO1 1JQ3A 4JVNA 4C30A 4FJ2A 4Q4AB 2H1SA 3NVAA 1GCIA 3V2IA 4F5WA 2F1HA 4S04A 1PGQA 5JAOA 2BOVA 2OORC 3D7RA 3T7JA 3B1ZA 4OQPA 1CUUA 1O7JA 3QBEA 4FYPA 4HN2A 2IDKA 3EEBA 4L50A 5EUMA 1G8AA 1R7RA 2OBXA 1R4MB 2XQFA 5U4QA 3UMJA 1OZ0A 3ORRA 3VPSA 5FWNA 2I4MA 3ZJ4A 1W52X 2PX2A 1UWLA 2PKEA 3ETLA 5JI3E 2BTEA 1QIHA 4XIIA 1GTRA 1IJEA 1ENOA 3NJ4A 4P83A 4IFBA 1ULBA 1N4DA 2QZ4A 1JR3E 2QT9A 1T1IA 1IHYA 1YA8A 1N34B 4MYDA 2QD4A 2I62A 3QTBA 3GDOA 1WW8A 4AF7A 1XK6A 4OYYA 2CYBA 1C7JA 3LYAA 4OP1A 4Z7JA 2FZVA 2ZT6A 2IP1A 3DGFC 4JLMA 2AA3A 4EY3A 2PVPA 4Z0PA 5IAJA 3OIFA 4ZHQA 5L8VA 5J1SB 1R6VA 1JAHA 1YZFA 4TV9B 4F38A 2V1XA 2JGDB 3OOYA 3R6TA 1DDOA 3MS7A 3DMNA 4MSUA 1NN0A 2ASVA 4KQHA 3CG4A 1DRWA 5GZ1A 1HDIA 3O2JA 1Q0RA 3ZUPA 4DE5A 3WKEA 3RRXA 1U5AA 4J2OA 4NBNA 1E9CA 2WWVD 3T3HA 4AU1A 5HZHA 1OLXA 2YNMC 3CISA 4DUGD 1KY4A 3HB0A 2E4WA 1WVIA 2I87A 5ALVA 4R2LA 1CZUA 3RFTA 2QENA 4RWEA 1FU4A 1ZKDA 3FNRA 2C94A 5T6MA 4B82A 4WKBA 1E6LA 4F4IA 1TJ4A 4CFYA 3KE8A 3W90A 2Z2KA 8AT1A 1JGTA 3GJYA 1IN5A 3QKSA 4DUZB 4FN5A 2BEUB 1T2EA 6NULA 4KR9A 1ZW1A 2PU5A 2PLNA 3GBVA 4FHEA 2CYCA 3A32A 4LYJA 4J3NA 5A7GA 2GETA 4PLZA 3R9WA 4G0UA 3QELB 2CT8A 1VG0B 2P67A 5A9SB 2IZ0A 3CVUA 1AOXA 3ETDA 1QHEA 1LGYA 1WSDA 2Y1XA 4G9EA 3UMMA 1KO5A 2AN3A 1WBJB 5BV2P 4XUCA 4XFKA 3KTOA 5D51S 2R7KA 1V9SA 4PCLA 5T8KA 1CSEE 5FO0A 2IW3A 2JZCA 1CUIA 2DBVO 1E1YA 1E0JA 1Z8HA 2JGLA 4EUFA 4U7WA 1XNQB 2I4RA 3HP1A 1KDYA 5BR7A 3D5QA 3DNPA 1BHQ1 1FFGA 2RGCA 4ALJA 4D9MA 2QLLA 4LHEA 5F1OA 2XE8A 5FBVB 2QI9C 1QV7A 2C9DA 3PFFA 2AFVA 1HNNA 1ZH6A 2H2AA 4BFTA 2W8ZA 2ZWIA 3MJFA 5D5HA 3E0QA 3E05A 1M0EA 1NLZA 3H75A 1VLMA 3A8TA 4E30A 5C81A 1U0OC 4E08A 4C08A 3VNUA 4GS5A 5C4IA 1E79A 4JLVA 5DHRA 1ULSA 4K88A 5B2ZA 4CMCA 5IJXA 5KKAA 4KUHA 4Q4HA 4CLHA 4MKGA 4NMWA 4E21A 2CUNA 2QRPA 4EP1A 4AP9A 3CRZA 5CXUA 3E3OA 4D5GA 3U7GA 4X1KA 5JSQA 3OMLA 2PV0A 3IMKA 3GB9A 4BPBA 2CXXA 1KQ3A 2CUTA 4P1ZA 5EKDA 2I3ZA 3QOXA 2CNOA 2IL1A 4QPZA 1F7UA 3WL6A 2NZYA 4E7PA 1YFZA 2XADA 2V7WA 2I3BA 1KIAA 2VDJA 4EAQA 1EGHA 3HXQA 5FWYB 4ZQHA 1AHPA 1PEKE 4PR3A 3RYCA 1WXEA 1BN7A 2VDVE 3BM5A 3VJKA 1XN4A 3AEYA 2B7CA 3RODA 1V11B 1KJYA 4OXYA 4KRFA 3P7MA 1FMTA 3B9PA 5JQGF 4ZI2A 4OBXA 3DVQX 2EX0A 4NJEA 3OQJA 4DC0A 1MRNA 4P82A 5G4LA 3D02A 5C3UA 2VP5A 2P4EA 4Q3LA 4RADA 3ZY3A 3L3BA 3GEEA 3DDZX 4NWIA 4KMOA 1B42A 1OZHA 3QWAA 3JR7A 4IS3A 3EGVA 3KCQA 5CA1A 3OSZA 3AU9A 4ZC1A 2HJVA 2UUAB 1BROA 3O1JC 4P08A 5C8YF 5A6SA 4QNMA 1QLJA 2R1VA 1H9CA 5JJKA 2KM1A 4LTMA 1WXXA 5I7HA 5FA6A 2WHRA 1C81A 2W6ZA 3SF8B 1Q17A 1BE1A 4MUMA 4OBEA 4BNIA 3A6PC 2WPDA 3HJGA 2VUIB 4NZYA 1SQSA 2C2BA 4ZQIA 5IRCD 2A5JA 1E89A 4LPKA 1YBMA 4OQXA 3QNUA 1RP7A 1JLKA 4QGHA 1H0KA 4EFMA 1C3OA 3U0VA 2B4AA 4UTPA 2I0FA 3PG5A 4KQWA 2E4VA 1VSQA 2RB5A 2SKCA 4UZFA 2AEJA 4YP5A 4ZQBA 1T6BY 2WW8A 2CK3D 4FBMA 1ZH0A 3O8BA 4ZRNA 1EQ2A 2IIVA 2OZVA 2ZSKA 4IDPA 3STYA 3TAUA 2AG5A 5TB5A 3GF4A 4WASA 1U6IA 4ENQA 1NUSA 5BP7A 3RJZA 4AI6A 3CEMA 2ZG6A 1CZKA 4LC0A 2Q21A 3Q8XB 2YINC 4D0SA 1AXEA 3RO7A 1EXMA 3H1AA 3THSA 4YECA 2IZ5A 3RVLA 1Q16A 5DNAA 1P1IA 3E7WA 4QKQA 4WLUA 1YRWA 3KXDA 5B7NA 3OTOB 4JJ7A 5FLYA 3OZVA 3R3HA 4NZZA 1NPTO 4U9HS 3LOUA 2PWZA 3CT6A 2G6BA 3MERA 3MTDA 3CU5A 4CM9D 4EB6A 3WNQA 3LVFO 3HUFA 1M7HA 3JD1A 4HZGA 1XG5A 3R7WB 4M2LA 2DUNA 3I1YA 2AB0A 2J6HA 3CEPB 3VPAA 3WE7A 5JAPA 3W4IA 1RMYA 1TJ5A 3EXHA 1K7SN 3A1EA 3HGTA 5DNWA 1E2FA 5C5DA 1A8IA 3ZK8A 2BP7B 3KEGA 4BUCA 4FI3F 1LI4A 1FTWA 4TOIA 5TMBA 1MMFB 4L0CA 1YRYE 2ORIA 3UYLA 4GKBA 4R1NA 3DDWA 2PAFA 3BBLA 3P9PA 4F7DA 3AF6A 5TX7A 2X3YA 3GFSA 3GP8A 1MX3A 2YH2A 1U7TA 2QBYA 3PPIA 1T3GA 4IM7A 1WD5A 5LIPA 3ABQB 2EGUA 4TTTS 2G1PA 2GUGA 1CDZA 2X9LA 2XYVA 3I9V6 5KAMA 4I5EA 1YS6A 4OKSA 4JI2B 2H4FA 5AVWA 3WA6A 4Q9HA 3EXFA 3D64A 4JHXA 1F8UA 1GPH1 1DX4A 2I9PA 2Q1YA 1JFTA 3RTBA 1NL3A 1OPRA 1U2PA 3W2IA 3MTJA 4QLBA 2HJWA 2DQ4A 4KXNA 4IHKA 3C7CB 4PNZA 4DMCA 2CKDA 1H2FA 2GFIA 1NYTA 2ZJ6A 4BEWA 3JPWA 4GLLA 3CRVA 1UWKA 2B20A 2HJHA 3B48A 1UPBA 3CNEA 3D7NA 4Q02A 4BO6A 3UWKA 4ZN6A 3CBQA 2H1HA 2I33A 3VDMA 3VNBA 1OH6A 1L5SA 1B2RA 2CXHA 3SIWA 3UUGA 5GIPE 1K08A 4Z86A 2Y1DA 4LXXA 4KK3A 1NF3A 2ECOA 5GONA 2ESRA 5T67A 1TKRA 2O7RA 1GYQA 4FM9A 2A0FA 1RWMA 3AFIA 3ELDA 2QGFA 4FN4A 5H83A 2RHGB 4UPDA 3NV7A 1SUAA 5B37A 1D1PA 4ESHA 2QV7A 2EGHA 4IIGA 3ZVNA 2JGRA 2R48A 2ORWA 2EKLA 3ST7A 4ZREA 2FSHA 5EE3A 2NT3A 2Z8XA 3ZPXA 2FOIA 4F3RA 3EN0A 1I7PA 1VCIA 1YDMA 4YTEA 2HTFA 1RQ7A 1TQ2A 3KQTA 3DL4A 2YDYA 3DFUA 3TLCA 4XOUA 2Q50A 2ZU6A 2PSJA 5DLEA 4AF8A 4ADSG 3I5XA 4P0QB 3IODA 2XWPA 3NATA 4R5MA 5G1NA 1IBCA 5AO9A 1DQPA 5EKUA 1S1MA 2PKCA 1L4KA 2V8BA 2GX6A 3BIFA 5HUQA 2Q3CA 3RS8A 1H94A 4Q3EA 3MK31 4YLYA 2VUUA 1E9AA 3BMNB 4M1OA 4FXPA 2XVMA 4GLFA 3SFVA 3RAJA 3UMCA 2RBEA 2JRLA 2NN3C 4LJ5A 3RSOA 4DDUA 4M0FA 4LVCA 3UG6A 4PVCA 4HGRA 5ILOA 3NCTA 1FRZA 3FWNA 1Y1TA 3N3AC 4U7FA 5AW0A 2G1JA 5EOVA 5CCXA 3L8GA 4OIFA 1LDNA 1BWSA 2RI1A 4NP6A 4S1NA 5ERGB 5K99A 5HJ7A 2BUBA 1GUFA 5AOBA 1NVEA 3B8HA 3G2KA 4WJZA 4KYIB 4FZ3A 1TIPA 1J0EA 1WX1A 2COEA 1GQOA 3AB8A 3KJHA 3BX1A 3ONVA 5ALXA 5F64A 1IVYA 2BKVA 4PQFA 4EYQA 1B8NA 4H17A 2R1TA 3IIIA 4NR0A 1XAGA 1S8FA 4P4SB 5HGXA 5JBNA 1K63A 1NT4A 2IE0A 4QXMA 5FLXA 1LW6E 1D3AA 1D4FA 5B5SA 4FT4A 1FUEA 3VZCA 1WP4A 5EP1A 1DQRA 3PJFA 1TLTA 3CVOA 4QBIA 3G8CA 4TSRA 1RKUA 2ADOA 4ZCSA 2QL9A 3UGJA 4DT1B 1UKAA 2IHYA 1N57A 3CM0A 3ILSA 4BFCA 3N2GA 4MV3A 5EPOA 3GN1A 2HRBA 3T94A 3VU8A 1EXVA 4RW0A 1P9WA 1IWPB 2PS3A 5IEBA 4XI9A 1AN0A 3LT5A 2QEQA 4H3SA 1L8XA 1WUHS 4Q7LA 2VSQA 3CNBA 3NR2A 3K6KA 4LC9A 3SZ3A 1FZQA 2BFBA 2XIJA 2PT5A 4QAJA 3B7GA 4YJHA 1UXGA 2C9YA 1OXTA 4DKXA 1PQWA 2Q0QA 3AINA 4OI0A 2A59A 4MGZR 4PN7A 1LSOA 1YL6A 4RKWA 5EWMB 3WNVA 4B6OA 2XT0A 1E96A 1NFFA 2PSHA 3GGPA 1QFSA 4JJIA 5D01A 2I6QA 4IUYA 3VNQA 2MMCA 3EMDA 3WB1A 4MIOA 1L1FA 3OURA 4XUEA 3AJEA 2C92A 2A5FA 4U7PB 4LUCA 4B7XA 1YVDA 1EXDA 1S2IA 1Y3AA 2R7AA 4B76A 3IT3A 3QW2A 3ESXA 2BLNA 2H1FA 1ID1A 2ZTLA 4FJ1A 1M6VA 1QVVA 4LWQA 1XQYA 4PICA 3LUBA 4PF1A 5DMHA 4B7AA 5K2OA 3PC6A 5C35A 5TY0A 2I7TA 2QL6A 3T7SA 3DFFA 5KINB 4DLSA 4YT4A 2ZUWA 1FSZA 1CERA 3N05A 2JI9A 3SJCA 1DFIA 1S3FA 2ZYAA 3SHVA 3WL3A 1XMJA 1EGVB 4ZOCA 2Z9DA 4CG2A 4DIUA 5K20A 4RACA 3V1YA 5FBLB 1VLVA 3H2KA 3EEYA 2F17A 2ODAA 3PYMA 4LRUA 4BHTA 4EI7A 5LQKA 1IB6A 2HPAA 1C7FA 4KU4A 1RI2A 3T34A 4BC1A 3IUMA 5FULA 1JIIA 4IDEA 3RVDA 1RAIA 1NX6A 4BGIA 4URVR 2HGZA 4B3SB 1XLWA 5CMLA 1N2HA 4UCXA 1OZAA 3K70C 4JYPA 2WWTA 1VQ1A 1F1BA 2DPGA 4IRXA 2AHOA 4NENA 4K26A 1GPNA 3FMVA 5TF4A 2RE8A 4P81A 3T3GA 3NH6A 4NNJA 3GZNA 4F72A 4Y8VA 1FX0A 3JW8A 1G42A 3I5AA 3ML1A 4IR7A 3UPDA 2Q28A 3L7DA 1JL3A 3RC7A 3UN1A 5JSFA 1BNCA 3Q0EA 4TX1A 4RHTA 4JGGA 4QDTA 1E92A 4Z7NB 2JK0A 4X1YB 4JSTA 1TO6A 4XRRA 2Q3EA 1I4DD 4MGYR 2J7PA 4WNAB 5E6RB 4DM3A 1HURA 3STXA 3O2NA 3JVVA 1QP8A 2D00A 1PZGA 3JYPA 4S1VA 1I2DA 5J63A 3QWBA 3TTXA 1JN0A 3DZJA 4ZFNA 4K9LA 3WOVA 3MWDB 1IK6A 3ZZ1A 1UBCA 1IZ7A 1XRMA 1Z3CA 1GNPA 3L7NA 4FHDA 3LC1O 4HDNB 2CHUA 1JZTA 4IMIB 4M6WB 1LDGA 1S1CA 2W6PA 3M4NA 3A4IA 4Q66C 4M9ZA 2N1MA 3SD7A 4PO1A 4CV1A 1I7DA 1Q1ZA 4GX1A 1VJRA 4MRVA 5SV2A 3WAGA 4HH1A 1PFUA 2HK7A 3DF9A 3N28A 2A3NA 2ODNA 1CVLA 2G5CA 4ZZ0A 2NV0A 4UBKA 1V0JA 1YSCA 4LCJA 3F6RA 4CUJA 2V7QD 4GDFA 5FI0B 1Q19A 3EVZA 1Q50A 5LPNA 4I8XA 4N3BA 3QY0A 1MX5A 2P6MA 3CKMA 1ZHOA 4TRMA 3GWGA 1HYQA 3UMGA 4UARA 2BJVA 3C4JA 2V7VA 3Q7SA 1VE5A 1Q77A 1COWA 2GERA 1A5BB 4QTZA 1VLQA 4V0RA 5DK4A 1ICEA 1B1CA 4B33A 3E3AA 4JI0B 4KXYA 5E2IA 3LJKA 2VPWA 1IXSB 1XRQA 2LR0A 5K01A 4RULA 1KVTA 4DBLC 1SUPA 2WJIA 2E48A 5DM4A 3VQTA 1NKTA 4QYIB 3RUCA 1CR2A 2C58A 5BR8B 4JB2A 5ADWA 3FVVA 3QKRB 4MH0R 3GXBA 2E21A 3ZYZA 5EE0A 1G291 1Y3IA 4BKOA 2VDWB 4UUAA 4HB2A 3SG0A 1VKRA 3WIBA 3THWB 3JQGA 1HFJA 4D8VA 1QO0A 4LPSA 4LXUA 4UULA 1JFFB 4PPFA 4WTOA 3TIXB 4BB9A 4DMRA 4YGYA 4XD7A 4HZUB 2VDQB 2ACKA 1BA2A 3GCZA 5JZOA 1IVSA 4QUIA 5ILQA 1CR4A 2RJOA 1OXMA 2KMLA 5LB2A 1WPRA 1BEEA 3AUFA 1WCXA 4MV7A 1EDBA 3ASZA 4DCPA 2O57A 2AR7A 4CR8A 2HU5A 1FLDA 4KBGA 3Q6NA 4R2XA 5J2UB 5BYAA 1HNXB 2X15A 1ZM9A 1B73A 2GN0A 1YRHA 4RHUA 5CM2Z 5AVZA 4F9EA 2MINA 3TGWA 3WZLA 2IZZA 1RKXA 1VMKA 1DSSG 2C83A 1B0AA 3KKZA 2HWUA 1KFBB 4HDRB 3CZ9A 4TYPA 2EZ8A 4H0NA 5F73A 2QQ5A 3AG6A 4IIJF 4O2BF 4PQGA 5ECYA 1J4AA 2I7XA 1MA0A 4P2BA 2FPSA 4R1QA 1TUIA 2TRSB 1A3CA 3A10A 3V8NA 5HKKA 1E98A 1RRFA 3IKTA 3VRHA 3NRBA 2JAUA 2H63A 3DWIA 5AVXA 4NYJQ 1DI0A 4UTZA 3RVPA 3RRNA 4JIGA 1X9HA 2IHVA 1ODCA 4MHSA 1Z37A 4KR6A 3GJ4A 1O2DA 2PZMA 1L7PA 3NGXA 4Q7KA 4O02B 2IA5A 3RGGA 4BBPA 5HIJA 3PR2B 1VL8A 4S1PA 2XQIA 3M3DA 4BN5A 4U7TB 4RA9A 3RLFA 5KWVA 3JAWB 3BSSA 3HV2A 2WTEA 1FU8A 1UFRA 4MROA 2DRIA 3RR2A 3W78A 2VP4A 4EO4A 4I8IA 3DFKA 4OA5A 2AFHB 4IF6A 4RETA 3G5LA 3SE0A 5KNBH 2XZLA 2QU7A 1DE0A 4O4IA 3T7TA 4QNRA 1KY2A 3SIPA 4J0IA 1C1XA 2OAEA 3ZWWA 1KQPA 3PDWA 2P6UA 3L1KA 5EP3A 3TEJA 1SG0A 1XDBA 4MUGA 2WU8A 1Z18A 2GJ8A 1GTMA 4Y2QA 4D3XA 3N2LA 2OA0A 3ADOA 1HFEL 3GVPA 3WYGA 2ILTA 4BN4A 1YQ9A 1JEOA 1QIEA 5DYIA 1R0WA 4WA7A 5AK4A 2Q07A 2YWDA 3PNVA 2EX4A 2PJRA 2AJTA 1KSHA 4LAFA 4O3MA 3HSKA 4H7KA 4MVJP 4BU0A 4OHFA 5CGZA 4YMSA 4ZVNA 1E5TA 1GZDA 4YUVA 4QEKA 4TV8F 4QUGA 4BYGA 1VDZA 2V7PA 3FSGA 2FR8C 1NMYA 2RHCA 2QMQA 2C8VA 3D2CA 4NV1A 1DBIA 1GPAA 2NU7A 2FDRA 1WXIA 3IKLA 4HOYA 4TVSA 1N0IA 3GDGA 2AFHE 1BZYA 2XF8A 2FZLA 3L4SO 4FOSA 2P9YA 2J07A 3GJ3A 3PLNA 3PRYA 4RLHA 5REQA 2FTKE 5JCOC 1P6QA 2RAVA 2R79A 4OA8A 3GJXC 1DAPA 5I6DA 5L3SB 2JLUA 2DE0X 1JG4A 4Q34A 1TNDA 3LHSA 3OZXA 4YEDA 3ROQA 2C9CA 1T5SA 3EIXA 5IW8A 5A9TA 1MJFA 2VK2A 4W1QA 3F73A 2EFDB 1RAAA 2VHYA 2WUFA 3IEKA 1EM8B 3CZQA 2EKZA 3UIEA 3KFXA 1K8RA 4MYSA 4D6PA 1SXJA 1E1RA 2JL1A 2AD5A 3W79A 3ZBUA 1M1XB 5EP2A 1G41A 1FNDA 3ONEA 3I5YA 3PCRB 2C82A 1KAQA 2QW1A 3HVJA 2YC2C 1QPGA 1HLPA 3QXHA 4MQ4A 2GZHA 4F12A 1I2AA 2RGXA 4R51A 2CUKA 1X6VA 2PMFA 4TT3D 3HSYA 1MO5A 1P81A 1Z7YA 2D1QA 2W6JA 3CCBA 2Q6IA 1XCOA 3FROA 2QW8A 1I32A 5K0ZA 3FUXA 1K8YB 3E18A 4WV3A 2IYTA 3N3BC 4C4TA 4EK9A 3GLIA 3M6LA 4ZPJA 1MFZA 2VRCD 2Y0PA 4W99A 5KTOA 1CVIA 2O8BA 3EYWA 1E0DA 1LI5A 3ZOZA 1D7OA 2P11A 5DVZA 4WMLA 2BKEA 2QN1A 2VTBB 4H0FA 5A4DA 5DNDA 2AZXA 5HE8A 3LDAA 3KAJA 2GZMA 1Z4KA 1YDFA 4BV9A 5I7EA 3QJGA 3RLIA 3VJRA 4IDGA 2ATXA 2OQ2A 1QP4A 4D8XA 1C3EA 1GOTA 5JW6A 1QMPA 4L8VA 3IUPA 1A27A 3AF3A 4KFUA 4B4UA 3ZGVA 3FBTA 1RWWA 1M74A 4NYIQ 5AW9A 4PIPA 3OCWA 3EA4A 4KWEA 3N5CA 1C0EA 1OREA 4OM7A 4RPGA 2JKZA 3FHJA 2P5YA 2FRXA 5J58A 5DYWA 1YJ5A 2NVOA 1QZZA 2CVZA 2OXEA 3ROZA 2E6UX 2PD6A 3IOBA 2P1DA 3O38A 4DILA 3CFYA 3GEIA 4CLXA 2XUPA 2C2MA 1HC7A 3PGJA 4HCJA 5IARA 5K0TA 2D3WA 4ZALA 1C9YA 1TTQB 1P77A 3CZCA 4QU5A 3O93A 3Q7RA 3G9TA 3L5OA 3PYLA 4TS1A 3SY8A 2EFEB 1J8DA 3LUPA 3NTXA 4OMCA 1R8YA 4PFJA 3L8ZA 4RJJA 5F2OA 2VC2B 3H7AA 1PR0A 3A3PA 3KJEA 2IH5A 4I3FA 3ANTA 3C4VA 4E6EA 3PE6A 4GXTA 3ZQJA 4Q1AA 3HA5A 4DBVO 4ZDKA 6YASA 2NTJA 1JZSA 1TMGE 1UJBA 2ZYDA 4LE0A 5KYUA 4EVSA 3O9MA 2EL9A 4O2AA 4O3FA 4LSGA 2HW8A 5C7LO 1WF3A 2IJGX 5IVHA 1AG9A 2Z9CA 5F9HA 1RYBA 4R0VA 1ZXLA 2CFSA 4XPIB 2B83A 3EDOA 2GF2A 4Z7QB 1SEVA 5CBPA 2J32A 1A9XA 1N1EA 3VR6A 1O03A 1E5VA 2ERXA 2O7SA 2DCUA 4AURA 2W22A 1BMFA 2V97A 2L18A 2QQ0A 3AU8A 3GT0A 5DLPA 3FTFA 4HVCA 3CUKA 2QLNA 1QX3A 1UKYA 4FBGA 3I52A 4E09A 4J9UE 1R4NA 5DFAA 3L7IA 3O47A 4FHFA 4NFHA 4CKEA 5BV7A 2BGTA 4MEBA 1G21A 1H6BA 1IIBA 4XVHA 3W06A 1R74A 3NWPA 1UEIA 4KWHA 4WBSA 1RRCA 5FYDA 1ORRA 4KREA 2FMFA 2IEIA 4KLZA 3IBGA 4ZRDA 1QQTA 5FH9A 3V7YA 5LD2C 3DE6X 4MR9B 5IKOA 1KDPA 2Q4DA 1XEXB 2R4TA 1JYEA 3A37A 3FTQA 3IOEA 4IXNA 4K3VA 2FGJA 4HAUA 1EVJA 4HPJB 1RYHA 1YR2A 3H3XA 3VR2D 4W5NA 2QSUA 2WZQA 4IWNA 4NF2A 2ZQYA 1TEHA 3KVRA 3V34A 2JAWA 2ZRJA 5HFAA 2BDUA 4Z0HO 4OMDA 2PS0A 5MF6A 2DQYA 2V59A 2WEKA 1NY6A 2WJAA 4TLCA 1TQDA 4YCDA 5EQJB 1Z06A 2C2GA 3QFRA 3T1YB 4FDAA 4WJKB 2YUIA 3G2HA 4PCAA 3H5AA 4DIFA 1B0UA 5FJJA 1LBTA 2D2FA 5FAXA 1RHMA 2YZ7A 2XXAB 5CFZA 5B58T 1DFGA 3GJTA 4F11A 3FMGA 2HRQA 5EIOA 2AI1A 4JOCA 2RFLA 1SUEA 3NYWA 4TRRA 3WG9A 2IS1A 2VJPA 1KU6A 4PFSA 4Z1MA 4A6XA 4XLTA 4XVQA 5KYTA 2F1IA 3VA7A 2AMLA 1L3CA 1RXYA 3P2IA 3AKDA 4XTCS 2X14A 3DZIA 3INGA 4WFQA 4WEQA 1GZSA 1RZUA 2OV3A 1JG1A 2RC5A 4AFNA 4KH0A 3ZIAA 3IV6A 3HBLA 3TQRA 4ASUA 2VDOB 3SVTA 4PRYA 1IXKA 2ID8A 3NOOA 2CMHA 2DU8A 4JJZA 1TAUA 3ESZA 4TYMA 5DGCA 2RK6A 3Q1KA 1QYCA 2OKCA 3O1HB 1B76A 5FPHA 3N59A 3GI1A 5L4NA 1DJQA 1TF2A 2A1TR 2GCGA 3O4IA 4R6WA 2Z6QA 3GBPA 3PYXA 4URUR 1EFHA 4C6TB 5JADA 1F5NA 2V7UA 4GOOD 2AOTB 4ZAZA 4D56A 3QEBZ 1UDRA 3KXLA 4ZANA 4BV2A 1TL7C 2XA1A 3HGQA 3LLMA 4G2TA 1RLIA 2YJ5A 4ICIA 4Q05A 3AHDA 3Q6IA 3UHFA 2PN1A 4KQEA 3UUFA 4MVJD 1ZL2A 1OOEA 5FNVB 2GWRA 2ZTUA 3GRCA 1JEAA 3H19A 2R8YA 1QANA 5I48A 4IGIA 4V38A 4WK2B 1RQ2A 3P9IA 3FPKA 4NCJA 2A92A 4HR7A 4J0GA 4NFSA 3WQQA 5IUJC 2F90A 5C52B 1SZCA 5HJ2A 2IGBA 2C96A 2X9NA 3AUXA 2QTVA 2X2PA 5THXA 3ZZNA 5DSZA 4GYKA 2PKQO 4N48A 4A4DA 3M4ZA 2YZGA 3IE0A 4P6VF 1KERA 3EG5A 1VCOA 4L76A 3M5PA 2UXDB 2D5IA 2BMFA 4KDCA 2QTBA 4U7JA 3EYAA 2A1UB 2H85A 4A5SA 3OQ6A 4QA9A 4OLBA 1L4BA 4NHOA 3TB4A 1D0IA 2AQKA 3I3OA 4CLOB 3NUZA 4E11A 3KR2A 3BXEA 5CJ2A 3KVYA 4KI0A 4NXNB 1X8JA 4B3IA 3UT0A 4EAAA 5BW8A 3AVPA 4NBVA 3TUIC 1RBYA 2XMRA 2JZNA 5JFTA 1TIKA 1ZHHA 1RLTA 4DMMA 3F7TA 1A8HA 4KSCA 1JXAA 4IV8A 1FMFA 1FFWA 2DBYA 3QHAA 1KMNA 2P3QA 2OE2A 3LO8A 4WZ6A 2QR2A 3IUNA 1YJAA 4FDLA 1JHDA 4NU5A 3LBIA 3ZUGA 2J5QA 4LMPA 1RIIA 2OBNA 2OCGA 4JB0A 3GG9A 4J0QA 1E1QD 1QLWA 3MJDA 2GCEA 4LDAA 3WJ1A 3N6RA 4C0XA 4YMTA 1FYVA 1NN1A 1UBHS 3OLZA 3LP6A 4HDKB 1UBMS 3W4JA 3S8YA 3G9UA 3WSVA 1W0KD 4KXQA 2X40A 5E2AA 4R41A 3TRIA 3VOBA 4EENA 2CSUA 4KDRA 7ABPA 3FB4A 4I1OA 3WNCA 1GKUB 3HCPA 5BV1A 5LKAA 1JR3D 3ECCA 2V3CC 2Y1EA 1A9TA 1Z8NA 1JV2B 1T9GS 3FA2A 4OXQA 1T35A 3PX3A 4CZ2A 1J00A 1G6KA 2ZJ4A 3W05A 3FHOA 2C03A 1DTWB 5JISA 3TM5A 1UM8A 2GSDA 3BTSA 1ZOOA 4I08A 2IYRA 1ZLXA 3EUFA 5KQSA 2HDOA 1J1UA 1VIYA 3R5XA 4KZKA 3T5AA 2LBPA 4FFSA 3GNQA 4X54A 1A8SA 1GZ7A 4TL8A 4N0DA 3B3JA 3CBGA 3TPZA 2XUHA 1XKTA 3IUSA 5AHKA 3ZU5A 1ZJYA 4ZK6A 3UAYA 1XCGB 1XU4A 3AIOA 1EGMB 3STWA 3K70B 1X77A 1LPPA 3VHLB 2OXFA 4RV9A 2V7BA 4M22A 3LIPA 3PDCA 4ZA2A 3ZXIA 3IILA 5AI8A 2C54A 4ZTUB 2GLUA 3A2KA 4C05A 1QO9A 5KWEA 2IVZA 1XU7A 3RV3A 4KQJA 1B23P 5ALKA 1O96A 1EP9A 3IOCA 1JIVA 1X7WB 4M83A 5HF9A 2GAOA 5LUBA 2VYNA 1YC5A 2Y77A 4DHEA 1N2SA 4JGBA 4MB0A 4X41A 2A7XA 5B12A 1WSWA 2IOQA 4E5DA 1GSOA 3V4VB 3LQQA 3TFQA 1E9SA 2PX5A 3CRNA 4JL6A 5KEIA 3PEWA 2Q1TA 2M6RA 2UVQA 4EELA 3NTLA 3MLAA 4EY7A 5J43A 4ZT2A 4C06A 1Z0DA 4K9SA 4LRSB 1XZGA 2Y2UA 4I4TA 1C9EA 2HQBA 2R6GA 2J9XB 2REQA 3PJDA 5CDHA 3C5HA 1KEEB 1WR8A 1ENPA 1Y4DE 1WCWA 3EZ6A 5AJYA 2PUFA 1P4RA 4B6GA 1Z2OX 3COJA 3R41A 5C53B 2A1TS 3UJ3X 3VISA 4DLZA 1EFUA 5AFSA 1JHVA 4CYMA 5KDDA 3HLYA 2UYCA 4MW6A 5KYWB 2Z3VA 2XVZA 2BTOA 1FTYA 5JSHA 5I51A 4C3VA 1S7GA 4K6CA 5KNCD 1RAHA 3RASA 3ZCQA 3CN9A 4ON9A 1SU7A 13PKA 1G18A 4CBVA 2P1ZA 4EB3A 4K03A 4ID9A 1LRJA 3QEAZ 1ZRNA 2C9OA 4MIYA 4AJ4A 3N39C 2H7YA 5JG7A 5KJEA 3WI7A 4AZ0A 1KO7A 4C4PA 4MPDA 4QJ5A 2V0CA 3K7EA 3NHBA 5CLJA 4MIKA 1DKMA 1U6KA 2JB9A 3L06A 4B6EA 4ENPA 1JH8A 2YHIB 4YQEA 1L7DA 1N25A 2BF4A 3VKHA 2OV6A 2VVTA 1F6DA 3BORA 1HMPA 2JFBA 3K0AB 3RU9A 3T3MB 4EGSA 1NVAA 1ZUNA 2H3HA 3H65A 1I0IA 4JIMA 4UUBA 3WYFA 3OIVA 3AF1A 5TGZA 2CLKB 2LTAA 3AXSA 3DBLA 3BH6A 3ZDFA 1QRRA 1XP5A 2PT7A 3ZS8A 1D6MA 1Q14A 1XLTA 3DQPA 3GQVA 3L4EA 3AP3A 5K3EA 1GRVA 4D7AA 4P58A 1M6NA 1G0OA 2ACEA 3BSWA 4Q37A 2HHHB 3U4IA 3P19A 3MIZA 2Z56A 1KEPA 2NSJA 3HDTA 4HNRA 4L6AA 4BCCA 3N2YA 3H8JA 1YVPA 2WHQA 4Q9AA 1NW5A 1ST2A 2DWPA 1MZPA 4GL4A 4AL4A 5JATA 1UT6A 5CVJA 1EKXA 5IULC 2X8JB 3Q98A 4OB6A 5DHTA 4G5QA 3G17A 2HEIA 2ZI5A 3ETGA 5I9TA 3QHPA 1NW7A 2VSNA 3QU4A 5TNXA 1RRKA 3GMIA 1ZVVA 1XJ0A 4Y2HA 2QDKA 4DMLA 1XZAA 3OIUA 4KGZA 2CXOA 2RHJA 4YH1A 4EHHA 1SULA 4CNBA 4FQ7A 2ONZA 4DBLE 3ZWKA 2ZJAA 4BMZA 1YMUA 3TD2A 2BH2A 2FVXA 2P9HA 3DMRA 2WYIA 4UAJA 5D86A 1OVGA 4GR5A 4UM8B 1R6DA 3MMPA 4IY1A 1YR6A 5ALWA 3SBEA 4YX9A 3NVMB 3WKDA 3SHOA 3KAQA 2PKRA 2JCBA 3KUUA 3LBFA 3ZWMA 2X9GA 4BLTA 2QD2A 3O4RA 4UASA 5KC8A 3DZBA 3HM2A 3N58A 2EW2A 5A06A 4Z6KA 2Z8YA 4NOMA 2NO7A 4NZPA 1PGOA 2HBZA 3ZW7A 5BSGA 2YV1A 3RBXA 4CM4A 3ITNA 3QX7A 1TO1E 4QU0A 1IZ0A 3QUCA 1YZUA 2BONA 4NDZA 2C88A 3UHPA 4ZJUA 3EPKA 3OZBA 5B7PA 4C5CA 4N01A 3SM9A 2UZ1B 4JKOA 1T24A 1X3LA 4CLDA 1N9KA 3WAKA 3BBPA 1E1NA 2H7CA 2FW8A 3OJFA 4ZOEA 5E4FA 4INJA 1GQSA 1RYEA 4GOND 1O6BA 5K2MA 1XMVA 4UM9B 3N70A 4R1MA 2R1UA 4HFJA 2SCUA 5C8DA 2J46A 2BRUC 1O87A 2HWKA 1RWPA 4HF7A 4ROSA 3UAOA 4LY9A 3UWMA 3WRXC 3DZFA 3FNGA 4IIXA 4Q6WA 1Z5VA 1H93A 5AK0A 4CEJB 2XDYA 3GFPA 2PL5A 2JGJA 3KZKA 4X00A 2O14A 1K5DA 5K51A 3GNSA 1F4VA 4FX5A 2W4QA 5KVAA 5EJEA 4OU4A 4COOA 2RC6A 2X0FA 4HLNA 5L9AA 4XDHA 2CD7A 5HQTA 1NVWQ 1VE1A 1GAEO 4XLZA 5BPHA 1MENA 1S3SA 1P1KA 3HR8A 1RLJA 2B1GA 3IUQA 4PHCA 3AJAA 3IT0A 3PV0A 3R5JA 2OYRA 5ALYA 1C41A 3VR4A 2AD1A 1MDFA 1T1JA 1AM4D 1IBSA 4P3NA 5U9CA 4U2FA 3JYOA 5ALUA 2BJHA 1JAXA 1TCUA 4LW8A 3WNBA 3IBSA 3G2LA 3R20A 1G5HA 1Y7PA 4RY2A 3E3NA 2ZI9A 1CQIB 1ODTC 2XRYA 3ISJA 1LJLA 4D0RA 4XDYA 3BJZA 2QMYA 3T7CA 5MDHA 2CYAA 1SCKA 1UM9B 3TD9A 4EHNA 3OKFA 3V8RA 5K03A 1SWVA 4V0MA 2GVZC 1NYQA 4QOIA 4PZCA 4QWWA 3HXOA 2M6SA 1UBNA 4RXMA 3RT7A 3EQ7A 2Q7XA 4OOFA 4KR7A 3SMVA 1NNSA 2Q3DA 1FNBA 2F1OA 1K97A 3D8TA 1EUCA 4BVGA 3B5IA 1U0EA 1P1FA 2AW5A 2BWJA 3B1KA 5CIWA 5EWJB 5KNDD 1U2EA 2N1BA 4W9NA 2VDRB 4JUFA 2YN4A 3CLUD 3DHNA 2UV8A 4LX8A 5EQTA 4DMGA 4IX9A 1U5BA 1XMQB 3ORQA 1TK9A 4O4LB 4L4YA 3HTXA 1T5DX 3B3QA 2NP7A 3JQ9A 3OFNA 3QYAA 1G17A 2X41A 3TLBA 2I2BA 3JQBA 1RI4A 3Q3JB 4C0KA 3BL5A 2DBQA 4NZMA 4QATA 5L3RA 4JJ6A 1KI8A 1Q57A 3G59A 3IPLA 4KR2A 2BFWA 1GG9A 3DBHA 3WYBA 1HT1E 2VT2A 1YCFA 1L8AA 2VFAA 4LWOA 4RJ2A 4DLLA 4D45A 1O1YA 2Q0HA 4KXUA 5BNTA 1IEQA 4BLSA 2A86A 4KVAA 1VKJA 3ZV5A 2IHBA 5JD3A 3O90A 3BB3A 1JA0A 2C4UA 1OIWA 1WE2A 4IRUB 4UHFA 2EWMA 3RC9A 4WW0A 1H05A 2BW0A 4G24A 4BQSA 1KI3A 4DN6A 4BIMA 5BN5A 1UQUA 3TK1A 1XPUA 1VHJA 1B74A 1HE2A 3DD1A 1AJEA 1M7BA 2YMLA 1XQWA 3C5EA 3H11B 1UAAA 1S8NA 4P4NA 3LLUA 2IS2A 3LPDA 2D0IA 3IYLW 5HIIA 1RYDA 2QVXX 2V7XA 1MOSA 2B1QA 4HQLA 1IHDA 1NN3A 4MWCA 1B6SA 2OZLB 4ZV9A 5C3MA 1JHMA 3MW8A 4LTNA 1Z4JA 3ANSA 2HDHA 4D8WA 4DXDA 5KVSA 3K9QO 1BU8A 3HO1A 1YJBA 2TMKA 5HKLA 4WFJA 2B82A 3QVGA 1T1EA 1ODFA 4YRIA 1KDRA 3JWIA 3VR3A 4D5EA 3FVQA 4J16A 2HLPA 3VDQA 1GG2A 3RF6A 2J3KA 2B4RO 3DL2A 1BJRE 3UQYS 4GM0A 3ZLTA 3SMQA 3E5MA 4MOWA 3RH0A 5B6JA 3EXEB 3LBNA 1JUDA 1ABEA 4JJAA 3S2FA 2FWMX 1XRSB 3CW8X 4CTJA 1M0WA 4KQCA 2GJ9A 4RJLA 3U7QA 4UOEA 4BXOB 2ZYSA 4MVJF 4GAEA 1TX4B 1WLYA 2IKSA 1C1DA 2WMYA 2R1ZA 2ZBFA 5DNUA 2ONKA 2BFDA 1JSLA 4XVUA 4F91B 3OT1B 5AICA 1EE2A 3G0OA 4GHWA 4BJHB 3I2YX 1FP6A 4J9VA 2RH8A 3REOA 1NUUA 3UK6A 1X1CA 1R0YA 4TXNA 4EVRA 4WBNA 1MA3A 3DMPA 3JYQA 5C51B 4AVYA 5L6MB 4B3JA 4DYDA 1GNSA 2CNDA 3CF4G 3ANLA 1YBVA 4I7EA 4F2HA 2HF2A 2I2WA 3GRAA 2C0PA 1M6YA 2CGEA 4DV3B 1NP3A 4JT9A 4ZARA 1Q95A 2PLRA 3QF4B 1T36B 4HG2A 2H7VA 2C7GA 3E9QA 4DABA 1HOTA 2HNAA 1J8YF 3B1JA 2O1XA 3DKKA 4MMXB 4WOBA 4DGQA 2WHXA 5JAUA 3A9UA 3OJEA 2C07A 2QQGA 3ETEA 4LZAA 3U44B 2PQ0A 1AXRA 3H6HA 3KXIA 2Q1XA 1JA1A 3Q8MA 4IO1A 1IQ0A 2YL2A 2I1LA 3PKJA 4CDMA 5LD2B 1Y8QB 4RHCA 2Z09A 2E85A 1RDFA 2RIPA 1O77A 2ZR0A 1SHKA 4DJDC 3VR5A 4MZDA 2YVAA 1EEXB 3IOYA 3QMPA 5AVJA 2O8FB 1NOKA 2DPYA 1ZU4A 2OKGA 4H1VA 2LCQA 3ZJVA 3PWZA 3L0OA 1H1LA 2NYAA 4Q5IA 1CWUA 1PZXA 1W0CA 3C5WP 1CE8B 1KDVA 2ID4A 4BTVA 2PRJA 3INRA 5HS6A 3ZDXB 1IOLA 4I50F 1EK0A 1X86B 2DUJA 4P32A 4PZ0A 1SBHA 1YB4A 4E14A 1TKBA 1WPXA 1Z5PA 2EX1A 1BXKA 2FB9A 4DYHA 1AUXA 3VMFA 5IF3A 4N8DA 4PBTA 1T4MA 3C6YA 3MA0A 3AFGA 3MUNA 5CA0F 3OC6A 2OBBA 3AETB 3A6ZA 2W2KA 3RYFB 1YZHA 3KKPA 3O0DA 1XKLA 2HUPA 5C1DA 2F7SA 4AY3A 3QITA 2ZWMA 2QSYA 1BWRA 3A2MA 3D6NB 4I2NA 5E38A 5JJIA 4NOLA 1W2WB 3RVNA 4D4LA 4Q12A 2L69A 4BWVA 3L7MA 2GVDC 1L5KA 1L7QA 3HKCB 3THYB 3OZ7A 4YJ3F 2IITA 2FMKA 4XIGS 4K5QA 4AJ2A 2OBFA 4L1KA 5D00A 4DSTA 1M2VA 2B4YA 3A1FA 2EP8A 3AW8A 4XAQA 1YQEA 1N0UA 4BVBA 4D3DA 2MSDB 3WTBA 1ISPA 2V7GA 4G0YA 4Q9JA 3QPVA 4QUKA 1HT3A 3I42A 1TZJA 2G4VA 1Y7HA 4OQFA 4EUKA 4M55A 2PX8A 1LU9A 3AYXB 3VH4A 1ADJA 2D5BA 2CWDA 3EMKA 4RA6A 2VRBA 4UAUA 5CVDA 3I0NA 1JRLA 3I9V1 3D2AA 3SCZA 3ZH9B 1RWBA 4YAGA 5JEDA 4Q9LA 5DK6A 1E9BA 3F97A 1U1EA 1ARZA 2LUOA 4JASB 1B41A 1J9GA 4KVFA 3IULA 4GPD1 3O4HA 3V7UA 2WTMA 5TEVA 3IXMA 2BT4A 2GRAA 3OU6A 3K0FB 4J29A 4QEDA 5I9MA 3ROMA 3EPJA 3LD9A 1NZFA 3VPXA 1RAEA 1HEYA 4IAOA 4P5EA 4Q9NA 3W5AA 1F38A 1C1YA 3KTAA 5JANA 4ZO7A 1Q1NA 3O8OB 5DHUA 2RHLA 3U26A 3AESA 3JQFC 4EJ6A 1XA4A 1BC5A 1KU0A 1WY7A 4BX2A 4TZKA 4EMTA 1A95A 3G6WA 2BUCA 4LFCB 4AJHA 3PIRA 3F3KA 1DLJA 2NPOA 2PD3A 2Q6LA 2GR9A 3LNTA 3PQ8A 4K46A 2GT1A 2A35A 2D7JA 2WF5A 3B9QA 5DIFA 2PRIA 4FB5A 3MB5A 2F48A 1RRGA 5JLAA 1KK2A 1U1CA 2X8LA 3ICPA 1R5JA 1UZLA 2Q3JA 1Y6FA 3Q9LA 4WXEA 3ZE1B 1MGPA 3FHCB 3E58A 2DQSA 1NQOA 4EPVA 3AI3A 4MGEA 4BN0A 2JGMA 4HGOA 5B3JA 3TZQA 3PNQA 1IUOA 3LPMA 3EEIA 1Y33E 3W3ZB 6Q21A 3BL6A 4ZYVA 3VYVA 3IBTA 2RSLA 3FHLA 5ICSA 1RYZA 1NJSA 3CH6A 1FSPA 4OM8A 2VF4X 1QGYA 3D5TA 1HUQA 3FFWA 3K9NA 5ELLA 3L7JA 4A7PA 8GPBA 5EHXA 1XNJA 1Z45A 2Z2ZA 2N9UA 2BEWA 1WP9A 4OP3A 4D9BA 3HCOA 3NC0C 2E4AA 3E35A 1NBOA 1D03A 1TU4A 4JDPA 1SVUA 1QAOA 4UKDA 4YRBA 3JASB 8ABPA 1CB0A 4YLGA 4GU5A 4RZUA 1UMCA 4GKVA 2WNSA 2O52A 3Q5GA 1AKVA 1GDHA 1O95A 2Y67A 3TI7A 2PRYA 3A9CA 1G5QA 1USIA 1BHJA 5IDVA 1PKEA 5F5NA 4CG0A 3KL2A 4L08A 2UAGA 3T4EA 2IPNA 4JLUA 4JNCA 2WI8A 1ZUD1 2OHOA 3G1UA 2PMKA 3GAAA 3OAAA 4LYFA 1VI5A 3ZCVA 4JI1B 3ZYCA 1S4MA 1U7DA 1N5DA 1QORA 2BGRA 3IO3A 3SDZA 2FUEA 4PAWA 3ICOA 4BX8A 2X22A 5FBWB 4BKMA 2N47A 4UTVA 5JFGA 1P31A 1AKRA 1WLSA 2QMOA 4WRRA 4G1EB 3SC3A 5IG2A 4Q7QA 4JQZA 1QQ6A 5CDFE 3DWEX 1QQ5A 2ZAIA 1T15A 2WDPA 5AHWA 3PQ7A 5LP6F 2EF0A 2GEKA 3VYUB 3A05A 4L2IB 1CK4A 1GV1A 3VKWA 1SEPA 1OC2A 5C32A 4OGWA 3VC3A 2AUTA 4L5IA 4UFNA 2J6CA 3KVVA 3LC0A 4HWRA 3IGFA 4TQUS 3SKVA 2JS7A 4BPRA 4CTKA 3WV4A 3O1IC 4B74A 3EPLA 1RYFA 4RWZA 3OQHA 1XFDA 2ZLBA 3PC8A 1RM5A 5BN1A 1R3DA 3QWHA 4PC2A 2IKQA 1E7QA 2P4HX 5LBTA 1EYZA 3A26A 4NYJR 2AH5A 5IFKA 3G7SA 3FOAA 1A69A 3O84A 3K0EA 1MB4A 3A58B 3OIDA 4CM8A 2Z6AA 4F96A 1ZIXA 4OKNA 3ZW8A 2RI6A 4ZQEA 3FHTA 4HN9A 2OB1A 2ZAMA 4M8IA 4DSUA 4KQIA 4LWZA 3ZJYA 3OJCA 2W8BA 2BMWA 4GWGA 2VSYA 1PE0A 1Z36A 3G0IA 1ZGAA 1D2RA 3HVIA 4NY1A 5E2BA 1NRIA 1ID8A 3U31A 4YMUA 5KYYB 1ZC4A 2C5EA 3U3MA 4XQGA 2XMSA 5K3AA 1F12A 1HG0A 3AR6A 1VBKA 2Y0EA 3CKKA 2BDEA 2DY0A 1W8IA 3SHWA 1IATA 4HWGA 3RC2A 1IXRC 1TT5B 3B3GA 3QXGA 4MCAA 3JQ7B 3WWYA 4OFWA 2RGNC 3QIAA 2YYAA 4LY3A 4RGYA 5FF9A 4ETWA 3CVYA 1F0NA 2Z2JA 3ADBA 3OX4A 1POWA 2B94A 5KYGA 3JTMA 2F3UA 4AMYA 4ABYA 3RW9A 3F6PA 3DMTC 3GLVA 2YTZA 3ENVA 1W25A 1HY3A 2X76A 4MV5A 4RD0A 5MFPA 2FZCA 4OBBA 4RZQA 2CDRA 4QBKA 5CB8A 2PUDA 3JWGA 3N8DA 3SEFA 5DWDA 4BCDA 2Q2NA 5TGDA 2WAYA 5CYGA 2E5LB 3AHHA 1WNTA 3D6VA 3NUQA 4KWCA 3DQQA 3CV3A 1XTRA 3OEWA 4ENUA 2YZNA 2BR3A 2HPHA 5IXYA 3WP0A 4BP9A 2NU9B 4LFBB 4QRDA 4TYWA 2JFXA 3ZCXA 4YP7A 4YCLA 3NO4A 3ZCUA 4OHYA 3WMRA 5E6UA 3QUQA 1XO1A 3DBRB 4ZYYA 4QO7A 2NZUG 3AV3A 3NCHA 1P0QA 1ZPDA 4DDKA 1BWQA 5E7JA 4ZOAA 2D0OB 4AS3A 2XDQB 2Z83A 4V0QA 5IN4A 2NVUB 3BCHA 4WN3A 4UE3S 4YIHA 1JAYA 2IS4A 3KSUA 4EFKA 3GYGA 4JJ4A 5C7YA 4ZVOA 3THXB 2FE4A 1JT2A 2IS6A 5EPEA 3TX6A 1T9CA 3RU3A 4GP7A 3BK7A 1P6UA 3NYQA 2ZK7A 3HADA 2FEOA 4I55A 4JYAB 2I1QA 5LNK1 4HDSA 4KYUA 4M1SA 1RQLA 2ECQA 3CX7A 1K5HA 4O08A 2G82A 3Q5EA 3B6IA 2H52A 3WYAA 3F8TA 4ERXA 1GNQA 1EDOA 1KTVA 2FF5A 2ZITA 3DEJA 4FIZA 4ZYLA 3FKSD 3IV9A 3V1KA 1E94E 1SM4A 3FDZA 3MRXA 1ULAA 1VL6A 4II3A 5TRTA 1Q21A 4PRKA 2ZRQA 4UMEA 1BRTA 2GHQA 2XUKA 2ZIVB 3O83A 2YZ2A 2GN8A 4TXMA 3DO5A 3GT7A 3QE2A 3PFWO 1QOZA 1COZA 4KLNA 1XDSA 4F71A 1V5GA 4XQ0A 2N75A 3T52A 3TZCA 1NF9A 3A9SA 4Q3OA 4ZEXA 5EWLA 1HK7A 4D57A 5H5JA 4DQLA 4RTJA 2IXGA 2QTAA 2NMVA 5ER6A 2NQ2C 3A2LA 3DJFA 1DIGA 3AJRA 4X7BA 1EIWA 3V5NA 3DMFA 3DTVB 4TKUB 4WQMA 4E03A 3CZAA 2WSSD 1ZXBA 4WLVA 3VPHA 4DYVA 1SOMA 3KOUA 4OSPA 4WEOA 2YS7A 1ZK4A 3T1QA 1NXOA 1RLOA 1T5OA 3VHQA 4RTQA 3K6SB 3HBNA 1P61B 3ZD9A 4ZKDA 3U7RA 4JEUA 3FNEA 3HUUA 2PU7A 4F4CA 5AVVA 2ZIXA 4PC1A 4GGMX 3TEFA 4E5SA 4MUYA 3KETA 1KDOA 5J2TA 1LBHA 3RIGA 1K2WA 2H0RA 2C04A 2ORYA 1XB2A 3K5IA 4OHUA 1DJPA 1XI2A 1PLLA 3RSLA 4QXRA 3U2QA 4OHBA 5ESDA 1UFVA 2LRHA 4OI2A 4OYRA 2DUWA 2R62A 3BGDA 3EZ9A 1TRKA 3G5UA 4HDMB 4IIYA 4G67A 4S0ZA 2JIZD 3AGPA 4D9IA 5AM3A 2XITA 3D5EA 4PHTA 2PZBA 4Q19A 3P9XA 1X8KA 2W93A 4LK2A 1Q7GA 2P2NA 1Z29A 4IDCA 2J1LA 2LCIA 4LEIA 4PFKA 2LW7A 4W5JA 1R4ZA 5ALNA 1ZH2A 2VNIA 1P44A 4KZPA 4AROA 1VYUA 4FMDF 4A82A 2RAUA 3TKYA 4MWEA 5F3RA 4PLFA 3QMVA 4RK4A 4XPZA 2IW1A 1BMDA 3T3EA 5JS7A 4S0XA 1G3UA 3SHTA 1CYEA 3RRFA 1QE0A 3R44A 4ND5A 4ITUA 4JLPA 5JZSA 5HP4A 3GDWA 1IPHA 4RO0A 3T5DA 4GM1A 3RS4A 3V1UA 3V7WA 1XTBA 1GTVA 4G4SP 4QSHA 4ZHQB 4G1MB 3QKWA 4KQ1A 3RTAA 2OAP1 4GC5A 5A62A 4YT2A 1OUMA 2HSEA 3Q2KA 2FR1A 4DM4A 2MYTA 1PG2A 2OMKA 2ZTVA 4CCYA 4CETA 4UUQA 3WRYC 3OT5A 4JLWA 1HE4A 1QHGA 1DMSA 1RD4A 1TVCA 1U0HC 4PYKA 2WIJA 2E55A 5LQSA 4F5YA 4F46A 4Y0VA 1VOTA 3AHGA 1W34A 4OHCA 4JEMA 3TLMA 4EUNA 5C80A 1EWTA 4DXHA 3NEPX 4DZTA 3WGQA 1SKQA 5MFZA 2AL7A 5ALHA 4ZZ3A 4EHFA 2XOKD 1ZWKA 1UDAA 2JHGA 2HOQA 5GY7A 4FFPA 4H7EA 3OPYI 5EZYB 4KFRA 2HFJA 3QKSB 4K0KB 1DBRA 1ACLA 1N6NA 2DF8A 1M76A 1OKKD 3DEIA 4HNSA 1KK3A 2EFYA 2EV9A 1XAHA 2H51A 2JD1A 2W2OA 2BPOA 3BMCB 4G8JA 4CN9A 1ZVJA 3K9GA 4J0DA 4RDHA 3AHCA 3PC2A 4QWMA 1X7DA 1HYEA 3UXMA 1GL9B 5FTKA 3W9SA 2O2YA 2FOXA 1MVNA 4JBHA 1JTEA 1J1ZA 5D6OA 3C6BA 3FY4A 4H3VA 2WD9A 4EW1A 5JWOA 1VLHA 5TMDA 1DADA 3PUXA 4RMHA 1FEZA 5AQ1A 4O2RA 5BUSA 5KVVA 5CVCA 1U3UA 1Z74A 2GK3A 2YW2A 5FTMA 6AT1A 1KO1A 4U2BA 1N8SA 1UBOS 2R00C 3HYSA 1GYRA 1HSZA 1K4MA 3EMVA 3KKLA 3OD5A 4KQFA 2Q7OE 4MYCA 3K8ZA 4C4ZA 3MILA 5AM4A 2SHKA 3WBJA 1QQAA 1DMRA 3SVZA 1WABA 3F2IA 2HADA 1OFUA 4YRZA 5JMTA 5K8IA 1IC6A 5K09A 3GUHA 3CVJA 5CYFA 4DMFA 4PSCA 4BMYA 1GRCA 4DQ0A 5KSOA 3FPJA 5CH3A 5I7VA 4J6FA 3HYNA 4DCNA 3ICQB 4KRXA 3FOCA 3SZOA 4DNPA 3T1HB 1YZTA 4JZKA 4X1KB 2AV6A 2N42A 2P7IA 4W6ZA 3ZVRA 3T9DA 4YP9A 1CUAA 5AD1A 3H5NA 4UNRA 3TOCA 4D4JA 2YHBA 4DLBA 4CTOA 1Z0KA 3BEOA 1PVOA 1I10A 4N0PA 3W6OA 4M1EA 5I9BA 2A14A 2QN6A 1KBOA 2HBYA 2HRDA 1O0BA 3PFBA 2HU7A 3IS3A 1PBTA 2WBLC 2YRXA 5I9NA 2XCUA 4RK7A 3WLFA 1OX6A 5DOZA 2UYGA 1XEAA 3WBFA 5K8JB 5I7FA 3O3MB 2X7XA 4PANA 3JD2A 2UUBB 4DR7B 1P3DA 5BWNA 1NLUA 3S0JA 5AW8A 4MLDA 4UHEA 3UY4A 5LDDC 4J0CA 2WWRA 3AWDA 4QARA 4ND7A 4P33A 1A2BA 1RWVA 2R8EA 3WWCA 2ZTSA 2ZW9A 1JDBC 3CB4A 1ZJ5A 1J0DA 1MQ9A 3R4CA 3QE9Y 5JO9A 5CA1B 2A7QA 2EZ4A 3PCTA 2LCFA 1ZJZA 1DV1A 2PG3A 1F0KA 3QZUA 2P41A 3F3MA 4R98A 5CD1A 2BYTA 3B70A 5A6SB 1F7VA 2FPPB 1N8KA 1LBIA 2R1VB 2PSFA 2ISQA 4W5OA 5GINE 3V3KA 3ZZTA 4A10A 4F9FA 5A3JA 1JIKA 5K3DA 4B85A 5BXYA 5HS4A 1BKSB 3C3WA 3CF2A 3AB3A 2HMTA 3VU0A 2HWYA 3D7LA 4H1WA 2DWCA 2M32A 1KEWA 4E2ZA 2GZSA 2PX6A 1M7GA 3KLBA 4IP0A 2Q4BA 9MHTA 3RFVA 3G89A 2W6NA 3ESYA 2W0SA 1Y4ZA 2GN6A 1VE9A 3W6UA 3U4QA 4MIEA 4ZV4A 1MABB 1Z22A 1ULTA 5AI0A 3IQWA 5HDBB 4CMHA 4BMNA 3PUJA 4AIIA 1CFZA 2PBLA 4I9UA 1TEVA 1U11A 3GAZA 1QYRA 3U7HB 4CMEA 4GBED 3QVXA 4X6XA 5FFMA 2KLHA 4LI0A 1WQ3A 3ILVA 4Z53A 4B87A 3KO8A 3V4SA 1P7PA 4QX6A 3EGDB 5J5CA 2EKPA 3SX4A 2QN8A 4DEVA 5BSEA 3ZZUA 3EF1A 3G79A 3D2BA 4ZEMA 1A4IA 1CIVA 1PEDA 1WMSA 5EI5A 4EW3A 4NCAA 2NUAA 2Y0CA 5B3KA 4C01A 3IHTA 4EB6B 3TFWA 3NTUA 5AKXA 3DCNA 5HJEA 2XZOA 1X1RA 5ARBA 1E6UA 1SKMA 2XB2A 1Q5PA 2LKDA 1E2MA 1UC4B 3O91A 3HP7A 3M1AA 3FCYA 1DDGA 3ZHCA 2VHVA 3MWEA 2JDID 1XZIA 4FCWA 4YJKA 5FNZA 1A50B 5DLQC 3ZXSA 3HNOA 2BFOA 5LLDA 5F51A 1YOBA 2H2HA 2V03A 2WKQA 4IPTA 1TMKA 1SG9A 3SSNA 3CF0A 3ZKAA 2QBYB 5D1NA 4ZICA 1T4CB 3IJ5A 1FDOA 1NZDA 1W87A 3W1WA 4N47A 2YV5A 3LDGA 4YQYA 1YBFA 1Z5UA 1MG5A 1XPRA 2DKFA 4R2MA 3ZU6A 2RBGA 1RJ9A 2WIGA 3T12A 2I2CA 3FCSB 2Q5JA 2GRUA 1QK4A 3K5WA 2R4QA 3N0TA 1ZZEA 4K9DA 3CNOA 3L84A 4F8JA 3DZHA 3NXSA 2D5CA 4KHZA 5KYXA 2QE7A 5JSKA 4N5DA 5JZMA 4KBYA 2YJTD 2GI4A 3ETNA 3IT1A 3OPYA 1MGOA 4C2AA 2IX3A 3S5UA 1T2VA 3E3LA 4GKKB 3Q0IA 4Q4AA 1C80A 4Q7MB 4DJEC 3KZCA 3LUHA 3HYCA 5P8WA 4WGFA 2JJ1D 2Q27A 2PIDA 3KBBA 4S05A 2EVWX 2CF5A 2CWWA 1GITA 3RSGA 4B81A 4BECA 5K4GA 2ON6A 1KAGA 4Y2XA 4BQIA 5KTNA 3UKDA 2AQHA 2FA9A 1EFRD 4MR7A 4A91A 1Y80A 3N8KA 1KJNA 4QT0A 2RARA 3V8BA 3W3AH 1G8FA 2FKAA 3DT9A 2OXIA 3UW3A 1QVRA 2IZ6A 1QRDA 1DAEA 5CVVA 2ZIFA 3B82A 2OO7A 3LU1A 4DR3B 1B8UA 1QQBA 3ZE9A 3CH7A 2GM4A 3AERB 3RHFA 3HB5X 4U5QA 3WQSB 4D97A 4TV9A 1AKEA 1RM0A 3E9NA 3AM1A 3T7EA 2GJ4A 4I99A 4PNPA 2XDWA 3LG2A 1NYLA 2GJAA 5H9WA 2OHIA 3QM1A 4Z4IA 3L7KA 3Q3HA 4A73A 2HJRA 4IF4A 4OQNA 4UD2A 1NHWA 2QRGA 2VQDA 3I37X 1SQ0A 3AONB 1H9BA 1R2QA 3OEHA 4IXMA 3GFRA 4POOA 3TSAA 2DFDA 1PD1A 3PZRA 4I1UA 4NL4H 2NU8A 5I7OA 3NM4A 4J0FA 5JD5A 4LV5B 2IUUA 2AXEA 2UYOA 1O94A 4A0HA 2EL7A 3BMQB 1DZIA 1EFTA 1W1WA 1WBBA 3VC2A 3DE7X 5EXDA 3I30X 2WFZA 3VZDA 2ATEA 4YAIA 4LOKA 1ZNZA 3HY3A 2PUBA 1LK5A 2BEUA 1I7SB 1VXRA 4GG1A 2FWIA 2F59A 3TECE 3FKQA 2GVNA 5IN5A 3R3YA 1CC1S 2GK6A 3TSYA 1G8JA 1P5RA 1ZY2A 4RAOA 2I9KA 3QELA 1GZ4A 1BOFA 4Y9UA 4DSAA 3KR0A 3N53A 4PR0A 5A9SA 1O9BA 2OM2A 5I8PA 2G40A 3H86A 2ZJOA 5IUKC 2VYFA 5CJPA 1W1IA 3AZPA 3COPA 2J45A 3NDPA 3ZI4A 3PS9A 3CG0A 2AG0A 1E2BA 3PGKA 1K68A 3WICA 2Q5FA 2A67A 2OCYC 4Y3UA 4ZYXA 1RZRA 3RWMB 2QIPA 1O9GA 4RD4A 2GYUA 3VPCA 2C7VA 2Z3ZA 1V5EA 5DM1A 5DU2A 2XRZA 3BWYA 3AIIA 1XQ6A 3D3JA 1IHPA 3HI6A 4BGVA 2C95A 5B36A 2Q6OA 4HDOB 4M1WA 4NPHA 3IUYA 3NPAA 4YJHB 4REMA 3FNBA 1FY2A 4WN9B 1N77A 4FPXA 2VEDA 4IVPA 2O0KA 1TGYA 3F9IA 4XASA 4G2NA 1QVWA 1TW2A 3FJ1A 4G9GA 2P2DA 1P5ZB 4HFRA 5DM60 1E3IA 1HM5A 2PMWB 2OVFA 1UJCA 3J81k 1R8SA 3HRIA 3U4MA 1YB7A 1EUYA 1PDWA 2W90A 4RX1A 1SB8A 2VQFB 2C9BA 4RFSA 1Z4OA 3N7TA 2WILA 4TTIA 4DY4A 4EKGA 5AW6A 3KDAA 1U2QA 2QMEA 1SHUX 1MAWA 5ULLA 4QM6A 4IV5A 5U4XA 3NAQA 5KCMA 1JIXA 1R8XA 2J0EA 2WJGA 2JAXA 4KI7A 1SA0B 3SYNA 3TTUA 4KAXA 4C2TA 5JH7F 4MQUA 3KKNA 1ZM4A 1NUQA 1ZG3A 2ZKIA 1QWOA 1V11A 3ECSA 5IDYA 2FFAA 3SF0A 1C8KA 1RT9A 1R3UA 1Y5RA 3QEJA 5EMHA 2GBCA 1X19A 4WADA 1ZM2A 1B14A 3IVGA 4KO8A 5F12A 3D8RA 1AF7A 4BFZA 1ZOSA 3QKTA 1Z68A 2OBMA 2Z3WA 3DHVA 4KOEC 4D42A 4AZ3A 2PDAA 1OB5A 4PC6A 1KRWA 5SZJA 1P1CA 1UK8A 4O5AA 2XUGA 4LDJA 4GUAA 2FUCA 3TW8B 3ICVA 3GZNB 4AO6A 1KMMA 5I4BA 1FX0B 2IQIA 1Q1EA 4FYXA 3RS5A 5B1EA 5M04A 3OJLA 3PA8A 2X0RA 4Z0NA 1AUQA 2E3JA 1NASA 3RQIA 1Y3DE 1Z7GA 4KCGA 2VJOA 4CIYA 3ADDA 2XWSA 1J9EA 4PPQA 3VKUA 1XOIA 3ABSB 1CFJA 2VP6A 1U8AA 2P30A 1M6HA 2VTDA 1URPA 3SF8A 4BZXA 4JXXA 4CL8A 4Z8XA 3SBDA 3WAJA 3ME5A 1B7GO 3VR6H 2X86A 2XUDA 3DR3A 1L0BA 1Y8CA 3M5WA 1BYIA 1XTVA 2IYVA 4IEIA 5FA5A 3WWOA 2C2WA 4PC3A 1U02A 1Z4QA 4YY3B 4JYCA 3CPEA 3TSWA 2ZRDA 1K8QA 1QRAA 4F04A 5IKPA 2ZVJA 4PYOA 1UPCA 4MDEA 3GRUA 4JB3A 3X1ZA 1JIUA 5GGYA 4KIGA 3U09A 1I2BA 5LZ8A 3TBHA 1NQAO 1U5CA 3EARA 5FKJA 3EFEA 1T10A 4UHDA 3Q7QA 1DAKA 2YBDA 1HQYE 1ZMRA 3TZLA 3FRHA 4LQ4A 2Z1MA 2PS1A 1YZQA 3BWBA 1N32B 1AUPA 1FFCA 1QUFA 3BXOA 3HNRA 4HQRA 4AP5A 3LTNC 2WM8A 3ZNNA 2OXTA 1BN6A 1A2KC 2YJ4A 4CMGA 2H2DA 3N8HA 4UFPA 4FT2A 3NHAA 2QV0A 4M8NE 3P1JA 1RLMA 4FKMA 4RD1A 5AXAA 3UBMA 2BAGA 4XUGB 3ZR4B 4DG8A 4K6FA 4ARIA 3SPXA 5HX7A 2BMVA 3MCVA 3W5IA 5KTMA 2AC2A 4Q0MA 1MO3A 2DPHA 3S1SA 2HIMA 4P8RA 1Y98A 2X4GA 4M36A 3QPDA 1VE3A 2F67A 3EVFA 3L5KA 2J7KA 2QL5A 3OCJA 4GP6A 5GZ6A 1RHRA 1G5IA 3JQGB 4HDCA 2X6TA 1U2ZA 2YHUA 2E4XA 2XYHA 3PCXA 4CFSA 2TYSB 1DQSA 4N4AA 5DHPA 2UYQA 1JX6A 2Z4TA 3IIMA 3NS7A 4TTSA 3PTZA 1WL8A 1Q20A 1LS1A 1SOAA 1K5GA 4XIFA 3SEZA 3TLGA 4BE4A 2ATCA 2OGWA 4MQEA 4YCAA 1ZKMA 2J3MA 1DKNA 3NUGA 2QTCA 3VNSA 3P9YA 4WINA 1EJ6A 3DLIA 4Y2RA 1X74A 4G1BA 3X44A 2E89A 2ZUVA 3DV9A 4J94A 1P1BA 4WDQA 2WY2D 3N0WA 1Z4NA 2WLSA 4HSGA 4AWBA 1J09A 2AX4A 1U80A 3UJCA 4MNTA 1T0UA 2HXYA 1LRKA 1YO6A 4PW0A 1H3EA 3P0HA 1NX9A 4BNJA 4Z4FA 1AK9A 1ZSNA 1CY7A 1C4WA 4OXKA 4JU8A 2IYOA 1SC3A 3TTTA 1E7YA 2O2EA 2PNFA 2BCGY 3IFSA 4FSDA 1D2MA 1W35A 1GPLA 1Q0SA 1H4TA 1BEUB 4Q7JB 3W2EA 2VWHA 3PXGA 2ZQZA 4B3HA 5ES4B 4BAUA 1YI1A 1FVHA 1PX0A 2PVSA 2HQOA 4IFIA 5JRDS 5ADUS 1YB6A 3NYIA 2AN4A 2VHZA 4OHPA 1YR7A 1ILWA 5E8JA 2OCPA 1KGDA 4D81A 3ZQKA 3C1AA 3TINA 3U3XA 1DLIA 2VO1A 5JPCA 4P84A 4BMPB 1PV2A 1Z4IA 3OIWA 1DXHA 1GWNA 3RUFA 3LBAA 4E7OA 2BLLA 3E53A 4IKEA 1Z5NA 4KKVA 2CZGA 4QUEA 2J0UB 1GQYA 2E6KA 2JGAA 3GYBA 1UZMA 2YXPX 4JT8A 5AM1A 3SQWA 4LG1A 1MJHA 3H16A 4NDNE 1SZPA 4YIKA 2JFHA 4FS8A 3FM9A 1BTOA 3HYRA 3WGUA 1PGPA 4J7UA 1GAJA 3A6HA 4JH0A 2YFKA 3DXFA 4PLHA 1Q11A 4ETNA 3BMNA 1DKUA 1WV0A 4JEHA 5C8VA 4JUIA 1A4UA 3DE4X 1C1XB 4JOSA 5EZSA 4GI5A 4KBFA 4N40A 2GCOA 2XNDA 1AQIA 3UM9A 1UBTS 3EAQA 4TMYA 3RD5A 4FOLA 5K0SA 3IA2A 3KVNA 2WIKA 5E1DA 1G8YA 3D6UA 4FHZA 4EECA 2FMUA 1YDEA 1RQNA 2BTQB 1ODLA 3R0JA 1TQ8A 4FU0A 2WFAA 5DGXA 3PFNA 3JQQA 1KEKA 3GJ7A 2AMJA 1H6AA 2OGSA 4G07A 4BYMA 4I36A 3O4VA 4GFDA 2C57A 2NSYA 2UDPA 3PK0A 5KHOC 1PSDA 4B71A 2ZI3A 3I4LA 4MWZA 4ZU6X 1NDUA 5GOZA 3D81A 4LF8B 1C3XA 2REBA 3KD2A 1LFAA 2CJYA 4WESB 1Q0UA 1PLJA 4LDPA 3NVDA 2NU7B 3RYTC 2ASEA 1C9DB 3P2JA 4Q21A 1QHSA 5FCDA 4UNIA 1M9NA 1Z82A 2B3DA 4H3KB 5DCUA 1TM5E 1AKUA 3FYUC 1P4HA 1ZIPA 4RV4A 4WKOA 5REQB 3BB4A 1CJVC 2ZS7A 2Z6VA 3GGJA 3QJ5A 4DT1A 2FQ1A 3VU1A 4RTSA 3K2IA 1XFAA 4URFA 1CVRA 1XDDA 2Q5LA 3REGA 1F6WA 3IKVA 5P21A 4B5LA 1YT5A 3P9KA 4W9NC 3LYUA 4GKAA 4OEHA 1CLUA 5A5GA 5COBA 4C4AA 2J30A 2IK8A 3AXTA 2VHQA 1FLNA 1TADA 4LGCA 5AJHA 1E3DA 3JQBC 2PKWA 1LI7A 3I9KA 1UK9A 3PDHA 4RM3A 5EWMA 4O63O 1P9RA 3DT8A 3GP5A 4R7GA 4ZU1X 2JAQA 1ECGA 1WDWB 2DSTA 3WWZA 1N36B 1Q0LA 2EBUA 3H84A 2IH2A 2WT8A 4TS4A 5SZIA 5CLHA 1JDBB 5L53A 2AOXA 2O8BB 3ILXA 1QV6A 1S3IA 2QT1A 2V1UA 1W49A 3IAM6 2PWYA 3QBDA 4XWAA 1JMVA 1TM2A 1L7AA 2I1WA 3H97A 1SR8A 2IU3A 4M0DA 2GM9A 2J0VA 3FI9A 3MINB 1QH9A 4CMAA 4TUYB 1Q1AA 1FDTA 3KYCB 5B7QA 4FE3A 3JXEA 3E6AA 2NTVA 3FTCA 5KSWB 1I4OA 3CY6A 2C5BA 3U40A 2XB4A 2KW5A 3LCJA 1DELA 1Z0FA 3WXMA 3UMSA 3BQNB 5ITWA 1KEZA 2FY8A 2HMYB 3D1JA 1RCFA 1ZRHA 2P65A 2EOAA 4KQGA 1L5GB 4B1FA 1PWEA 1Q1QA 3UJNA 4DFDA 1KBQA 2XSZA 2OC4A 3SHQA 4B80A 4EO7A 3NWEA 3OM0A 5CIQA 2JI7A 2O48X 1FPQA 2I7VA 3IDFA 2BHNA 3ROTA 3TLZA 3KAKA 4KXLA 3FUWA 1H8ED 1X0VA 1YE5A 4EABA 4AMBA 4QOGA 4CI9A 4X1YA 4MJ7A 3GMDA 1E7WA 1PV1A 2QZPA 3LZDA 4YAJA 4NESA 5HKOA 1DOZA 1QTQA 5ALLA 2I29A 4XYEA 4EVIA 2NSLA 2XUAA 4AUMA 4K9QA 3JSXA 5I7WA 3JQAB 4PLCA 1VJGA 2Q3BA 2WHYA 2WJ3A 1IBKB 3FLBA 2C8JA 2EC5A 3MWDA 4O2AB 3W7AA 1AK1A 3DD5A 1UZAA 1WZCA 2QK4A 4HDNA 4M6WA 1A9XB 5ECDA 2BKLA 1HZZA 5EJ7A 2KQUA 2G80A 3AO0B 4BTEA 3UK2A 3OFJA 3WK4A 1H2EA 2WAMA 3FRJA 3DOFA 4F6RA 1KRXA 4JD5A 1KXJA 2UUCB 3GEHA 2D62A 2HGSA 4FYKA 3ORHA 1OT5A 3M4JA 3PNBA 4DCSA 2X4LA 1AB6A 4CKEB 4UNQA 4UBJA 1ZI8A 1BGVA 2VJQA 4GMDA 1W5BA 1G21B 3GA5A 3M82A 4I66A 3HRHA 3X43A 2CV2A 4WCDA 2P5UA 1G3MA 3KWFA 1UDCA 4DVGA 3VR2A 5IM4F 5BORA 2V6GA 3H05A 3ETHA 1Z7BA 2ODWA 2WC1A 3A1DA 4Q24A 3S5JA 5A2QA 3B1VA 1L4HA 1QR6A 2Y2VA 3O73A 1KVQA 1TKAA 1Y42X 4H16A 2EW1A 2GPTA 4G1FA 2O20A 5IHPA 4A6DA 2VQ3A 1LBSA 4QYIA 1JF8A 1CUZA 2GBLC 1M8FA 1SKYE 1I1OA 2JFGA 2Q45A 3CUSA 4MMYB 1N1MA 3I1FA 1MT0A 1NZJA 2VDWA 2K7FA 4BQRA 2XA2A 4GEKA 5ARDA 3NX4A 3I92A 3THWA 1NFRA 3GVCA 3RTEA 4OATA 1UQRA 4URZR 1JFFA 2RMKA 4DY6A 4X95A 1H2HA 3LXMA 1XMXA 2OORA 4HZUA 3ZGYA 2R6ZA 2NQ8A 2BFMA 3NNNA 2FWRA 4CF4A 1PQUA 1G21E 4WIAA 3OX3A 1KQNA 3C15C 2DXIA 4MI1A 4HWSA 2IOYA 3KSRA 1OFHA 3B2EA 4RM2A 1PYOA 3ZCSA 3HG7A 2D7CA 2BGNA 3MGBA 4OQLA 4WNCA 5FPYA 1L4NA 2ZUTA 4FILA 3X1MA 3HRKA 3IP3A 5J2UA 4KR3A 1XMPA 1G7TA 2NADA 3I9FA 4B46A 1XF1A 2QPLA 2V5AA 2VHEA 3NHZA 5AXCA 3UNXA 3EEOA 4GC9A 4F2WA 4DQXA 1TYAE 1QUEA 2ZIEA 5KKCA 1KZGB 2ZRGA 3RG8A 3X1KA 1DAGA 1P39A 2FEPA 3TCKA 4HDRA 1VSUA 1Z0AA 5FPPA 3GRFA 2P91A 4Z9AA 1BDJA 3UK1A 3OY2A 2GA9A 3CNNA 3OSUA 1IEVA 5KX5F 2NWQA 4GKJB 3JQEA 3RFCA 1QDLB 5HOQA 2AMVA 3F67A 3K5PA 4PZLA 2EEPA 1DBSA 2J08A 4YPOA 4DV5B 1OASA 4C6SA 1Q0ZA 1DCKA 3B38A 3F4KA 5KSZA 4EG1A 1BIFA 4MUFA 2FZKA 1MR3F 1K9SA 1ZD4A 1TJPB 4N9WA 3C5VA 2YNMA 1JG3A 1FFEA 4L6CA 4TKVB 5CVEA 5LOVF 3TQIA 1BFKA 3LX5A 4Q15A 3VR4H 4C7OB 4RK5A 5GGXA 2O59A 4R2IA 3VMMA 2P2ZA 4ESEA 3K4QA 4E5NA 4X71A 3LCCA 1BO6A 4Q3AA 4X62B 3L7BA 4X63A 3ZLJA 1KNXA 5ALEA 1TB4A 1TZMA 3IPCA 1Q44A 1N3LA 4NARA 1AHNA 3ITEA 4C7VA 2JH9A 5GQSA 2FEMA 3AY3A 2QTVB 1QSGA 5D5QA 4RIHA 4GXQA 1PNTA 2EJWA 4EF4A 4YJGB 1T9AA 2IYNA 2UZAA 4MCIA 1HFWA 1NHGA 2HRCA 4KH1A 5JBQA 2VDPB 4MCJA 2PHZA 4HYQA 3DAHA 4J4TA 4BJ5A 3AZQA 5DI9A 5LM3A 3D54D 5CCDA 5T7BA 1YQTA 1WCYA 1HQKA 1W581 2IYEA 2QD3A 3HCAA 2DT5A 4QFDA 2JF0A 1XHEA 4KC0A 5NLLA 1W5SA 3QV1A 3G0DA 2X4DA 2ODPA 3INNA 4W1PA 4J3JA 1CG6A 5ALTA 4CIWA 3TM4A 1R6TA 2Y68A 1Z6QA 5KIAA 2Q9BA 5JJCA 1FJHA 3KOWA 4ZC8A 4CLRB 4IDFA 4DCMA 4C7XA 1CEEA 4MRNA 5CB4B 4AQDA 1XZHA 2J4CA 5JVDF 1H5UA 2RKWA 1R0RE 3JZMA 1L7XA 3BCSA 3CONA 4FGSA 4O2BA 4C0AC 4F85A 4BNNA 1GCOA 1P6XA 2R60A 3TTSA 3P2EA 1WRBA 5I5EA 9LDBA 1J5EB 3R6WA 3ITKA 2E2WA 3IAXA 1SXPA 5E3IA 3VSCA 1YU6A 5JAIA 2JCSA 3I04A 2VZEA 1JPJA 1Y3FE 3JU3A 2V8OA 2EXXA 5F5LA 5CCEA 1BMTA 3IUJA 4QXAA 5L3SA 2BGWA 2DFNA 1MIOB 3DEKA 3JY6A 4FDVA 3IUBA 3EJWA 1XK7A 3C4QA 5LA6B 3I28A 2LIPA 1NT2A 2YMPA 1R00A 3FLEA 1N2BA 4BO4A 1WQ4A 4A8JC 4F3NA 2MR5A 1EM8A 3MM4A 4G0OA 3ZHSA 4YCMA 2Y3IA 1ZBQA 5DT2A 4OH1A 3UCFA 1XEFA 4TVKA 2JGKA 2OLJA 1I3OA 4PG6A 4XFDA 1TYZA 1W75A 2QROA 3I6ZA 4F1JA 3PLRA 1F8GA 2NXWA 2G5GX 1MAUA 2ZJ8A 4JBNA 4CTNA 5IYZB 1C2TA 2GTHA 5KTSA 4DPKA 1ZVKA 4G41A 3FGZA 1FYWA 3UMBA 3D3NA 3Q0TA 2YY6A 4P4GA 8ATCA 3AKEA 2WP8J 1WWKA 3QQ5A 2OP0A 4MDYA 3BTVA 2GFQA 2AZDA 4F45A 1WULS 4NU6A 1FDVA 3AZOA 3G5TA 4JVLA 4KRYA 4XWYA 2BL4A 4P22A 4HPXB 1YRQA 1A5TA 2WIDA 4ALIA 1NC1A 1WZIA 2HHCA 2JA1A 4UEWA 2VTBA 3TXAA