2OV6A

The nmr structure of subunit f of the methanogenic a1ao atp synthase and its interaction with the nucleotide-binding subunit b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MELAVIGKSEFVTGFRLAGISKVYETPDIPATESAVRSVLEDKSVGILVMHNDDIGNLPEVLRKNLNESVQPTVVALGGSGSGSTSLREKIKQAVGVDLWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type ATP synthase subunit F
publication title NMR solution structure of subunit F of the methanogenic A1AO adenosine triphosphate synthase and its interaction with the nucleotide-binding subunit B.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Hydrolase
total genus 23
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2ov6A01
3AONB 2OV6A 5KNDH 5KNBH 2QAIA 2D00A 4IX9A 3VR6H 3VR4H 3W3AH 3VR5H 2I4RA 4RNDB 5KNCH
chains in the Genus database with same CATH superfamily
2JKYA 1EFHA 2H2HA 5KC8A 4URFA 4OQ4A 1JQLB 2I9PA 3OU6A 4TX1A 5K3SA 4NFYA 1H0HA 4OJKA 2BFBB 1YE5A 1TVKB 2UUPA 3EXAA 3LCCA 3LQFA 3CJQA 3NBFA 1SWWA 2O2HA 4ANFA 3A1TA 1MG5A 3MPUA 4X64B 5LLSA 3EOAI 4M86A 5CNMA 5D00A 3QEAZ 5ESXA 1U8AA 1ZONA 3LCUA 1NWCA 2HMYB 1N7HA 3B2EA 4O2BA 4UQOA 5TQVA 4BVFA 1KZ9A 4DL9A 1T6YA 3LDGA 3KJGA 4HAXA 2JGAA 3OEED 3UHFA 5L53A 4RTOA 3SM9A 3EUWA 3FGZA 4MRVA 5AKXA 5T4FA 1JMKC 2IE8A 3MS7A 3D7MA 1L4MA 1T9AA 1WKVA 4NENB 3GLSA 3FOWA 1G8AA 3ACBA 3W5UA 4CTMA 1ENYA 1NZJA 3TW8A 1T0HB 1X8LA 3M4YA 4AD8A 1WUHS 2NSDA 3RS0A 1MVNA 1NOJA 3DE7X 2C2XA 3AEUA 2I4LA 4RKQA 5FI0B 1QAMA 4ID3A 3KQVA 4JJKA 1FVFA 4CDNA 5A06A 1WP9A 2GM5A 2WHPA 4CG3A 4WEOA 2QT0A 5ALTA 2O2YA 4P7JA 3DEZA 5L4NA 2AQKA 1YVDA 1HQKA 4Z4FA 2H8GA 3ZVRA 3A9SA 1K06A 3GCDA 4G1EB 4MDYA 2EL9A 2P1RA 3MS4A 2X8LA 3EPJA 1RMTA 2RC6A 4Z0TA 5L3QA 1JLLB 1RWXA 3SJCA 1W34A 3SIRA 3G0BA 1TM1E 4EY4A 5K3FA 3U4QA 3U31A 5BSMA 2H7VA 1F1BA 1Z2EA 3QEOA 2O2SA 4BMVA 5DTIA 1CRLA 1ORWA 3ZJ5A 5FLKA 2I6XA 2C77A 2VSXA 3SJBA 2QTGA 6REQA 1DADA 4Q39A 2ID7A 4QDOA 3RVKA 4Y3UA 3S1SA 1ATIA 1S02A 1X15A 4L57A 2CE7A 1P61B 5KNDD 1W9MA 4G56A 3K0FA 1RC0A 1I4OA 2WHEA 3FPGA 4UHDA 1ZJYA 3I8OA 2ZZMA 4OAPA 2GD6A 1OHHD 4TS4A 4DIKA 2A5GA 5ISMA 3ZU4A 4MEBA 1P2UA 1T8RA 1ESDA 1UKBA 3G82C 4UCXA 3S55A 4AROA 1E9VA 2P2CA 4F9GA 3ZKWB 1J56A 3IAM1 3H5NA 1EVIA 5HQTA 3CBQA 3N6VA 1E92A 4EFMA 4AJKA 4Z54A 4Q82A 2IZ5A 3PKZA 4KLNA 2AFHB 3I5AA 4R3WA 5L51A 1DLJA 2P9CA 3ORSA 3ZDEA 4Q48A 4ZCIA 2GEUA 5GONA 1YUMA 4QYIA 1EDDA 5CCEA 3HM2A 4OK3A 4UXHA 3WK8A 1ML4A 4BQEA 3ZHCA 3AW8A 3KCQA 2CDBA 1XMIA 3ZWVA 3FW1A 4KFSA 1H93A 1PSZA 3F7OA 1XPUA 3WZMA 2ZULA 2KYRA 3DDUA 3DTVA 1KZGB 3G6KA 3U3JA 3J80A 1H5NA 2QMEA 4EEZA 4X93A 1GAXA 5J59A 1OPRA 2GHRA 1C2TA 1E3QA 2P7HA 5EE0A 5FWYB 3TNJA 2O3RA 1CZUA 3DL0A 3GLHA 3QU9A 2QJRA 3ZI7A 3KR1A 1J09A 1PFVA 1T5HX 4L9AA 1LBSA 4FOLA 1O94D 1XTQA 1QIKA 2ACEA 1ZNYA 4FLEA 1X19A 2OHIA 4KBGA 3IJRA 4M8NE 5LP6F 1G6Q1 2J9GA 1RCUA 1P2GA 3IHWA 5C5EA 1W6RA 5CB0A 5KNBD 3QQPA 4IUCS 5FAXA 5IN5A 1V37A 1ITZA 4P7KA 3R2JA 5LUBA 3CLVA 3X2FA 1QKKA 2W2KA 3DG9A 1LEHA 3LT2A 3P97A 2OZLB 1AXRA 4TROA 3U80A 4DCTA 3QVTA 4LVOA 1UM9A 1PEDA 4O5AA 3OZUA 4MKFA 4OEHA 5KS2A 2Y6UA 4FBGA 2AVDA 1RAEA 1BVRA 3MCUA 4UFOA 1DKMA 1POWA 4UVHA 2AMFA 3I5XA 4JYZA 2FOLA 1PUIA 1XUOA 3A3KA 3CUKA 1C7IA 3NW9A 1QU3A 4V39A 4G63A 3G3EA 3HMQA 3TTUA 3WGTA 4MUJA 2EEPA 2Q5FA 4TKVA 2FWJA 4ZRMA 2CJXA 1FRFS 3C45A 3LAWA 1ADJA 3MW8A 4B3HA 2BFWA 3LF1A 3VNVA 1OOEA 1OXXK 1RLOA 3KVOA 1WBJB 3Q9NA 2EATA 3UAGA 3VHLB 1M76A 3BRQA 3C8DA 4MA5A 4MW7A 3CVXA 4LCBA 2H00A 1UOOA 3NJ4A 4HDMB 4QJBA 3GRAA 2FWIA 1V8ZA 1RAGA 3GFOA 2BKVA 5AM1A 3U0BA 1BJKA 1UMBA 2DKOA 1CB0A 2VJPA 2Y1KA 2E5FA 3FVQA 3V97A 4RTMA 4WZZA 4KVZA 2H4ZA 1DFHA 2HWKA 2CHEA 3ENVA 4M99A 3P4UA 4PYOA 4P53A 3KQWA 4WMLA 2I2CA 3ZZMA 3SC4A 2IZ1A 4Q7EA 3FAKA 2GUGA 3WGMA 1Z5UA 3M83A 1HETA 1MN6A 5IJWA 1CJMA 3O9ZA 4BKUA 1YMQA 4HZUB 1JYSA 1Y6ZA 2CXRA 1J0CA 1WUIS 4ZEWA 4ATNA 3BD8A 3H8WA 2BSAA 3QKWA 5AKIA 2YY5A 3DMNA 2XE4A 5AM5A 5A0FA 2CNKA 2ZZKA 5ICGA 3CRRA 4M7PA 2QR3A 3H2ZA 4PE5B 3SHWA 2PX0A 5EP1A 2YMPA 3DOHA 1C41A 4REQB 1KI2A 1PQ4A 4URVR 2EKLA 4FK8A 2C83A 1EMDA 4QSMA 3RYHA 1G4UR 3FI0A 3LC1O 1T4CB 4TVBA 2O8FB 4D81A 3G8AA 1YZKA 2IDJA 2WSBA 3WTBA 4O63O 3EH2A 5K51A 1NW5A 1OAOA 3I4LA 1YZTA 1A5TA 1QZTA 3DT6A 2NUTA 3P27A 3ZY6A 3FUCA 2XMSA 4MW6A 4A0RA 5TPZD 4WKBA 4IFTA 5CA0B 4IX1A 4W82A 3GIDA 3IQFA 4UMFA 1T6ZA 1BCSA 4LS3A 1VP3A 3ONNA 3NRBA 3Q41A 4PSUA 4MQ6A 4DLYA 3QF4B 3OICA 3JAKA 1UBGA 4LBZA 1IK6A 1Q6ZA 5A9RA 3G5MA 2IPOA 4YAGA 1TU3A 4F4HA 4TSKA 2LW7A 5CM9C 2RGEA 5LYJB 1GCIA 2F3UA 2ZSJA 3EF0A 4F85A 1WZ2A 1LLQA 1ZQ1A 2GEBA 4MWTA 1N3LA 3NDIA 3WYNA 4MS1A 1IYZA 4YROA 5DYNA 1YL7A 2DBRA 3CSUA 4MVWA 1E3SA 2H1RA 5LDHA 5AM3A 3QQ5A 2A9VA 2NMVA 1GDHA 1PTJA 1Q1AA 1V95A 2HN9A 2I6TA 3M9WA 3TLKA 1WCWA 3UHAA 3CF6R 1MKYA 2XEXA 2IPLA 3E1KA 3M89A 4BQPA 4CUZA 5LKAA 3DA8A 2EL7A 3A8TA 3M3HA 4PAMA 4KHPB 1Y80A 2F90A 2GT1A 2ZT6A 3OQVA 4XSGA 5IDYA 4XIGS 3EEOA 1MRNA 3AUFA 5AI6A 3BMQB 3ZEAA 2Z4SA 4KZKA 1ZH8A 2NVOA 1RE0A 4J07A 1ZINA 1G9TA 1N2EA 1MX3A 2EGUA 1OROA 1U2EA 3Q2OA 4MQEA 3H6HA 3JQBA 3CEAA 4HNSA 1RAHA 1FTWA 4IDDA 1BXGA 1RYFA 5FLYA 3ZHQA 3R7WA 4WN3A 3WLOA 3VDQA 3HB9A 3DOCA 2FP4A 1A5BB 4K6OA 4WA7A 4C0SA 3H4TA 1XZNA 3NHAA 3NT4A 4QPCA 2PJUA 5DX0A 2TSYB 5CLLA 1C7FA 3K9GA 1V39A 1N2SA 1PQWA 5EXDA 5ICCA 3HKEA 5D3MA 5IEBA 4CFSA 3C6KA 4RZUA 3M4ZA 4R9VA 3S8EA 2XOKD 1X8JA 3YASA 3FOEC 3EAFA 1IE3A 1KVUA 1O6FA 1W4ZA 3SYRA 3ZDCA 1J9EA 3TDNA 1UC9A 3MJEA 4HRXA 3IIKA 3B8EA 4TT3A 3AEKA 2QS9A 4D7AA 2QR2A 2F9MA 2P40A 1Q22A 2QSUA 3I01M 3LBHA 1W0CA 1JLHA 1O7JA 1RQPA 1KR5A 1ONSA 3MUEA 2G4LA 4M76B 5I9BA 1EH5A 2WIKA 4YRZA 1JQKA 4Z3OA 2Y67A 1NASA 4CV3A 3TECE 1D4ZA 1EGMB 1QH8B 1WAMA 1FSZA 1KU6A 1ZP6A 3JVUA 3MT8A 5HBGA 3SEFA 3O8CA 1E6KA 4CKCB 2XJ9A 3EN0A 1JZTA 5I3CA 4G4SO 4GO1A 1WU7A 1L1QA 2PLWA 4MYHA 4G4JA 4LECA 4NEGA 1T43A 2E37A 3N8DA 4RLSA 1ZN2A 1FRZA 3CX7A 1HH4A 4EB3A 3KWMA 4D02A 3SF8A 3K0CC 3FCYA 5HK8A 4Z2YA 5JISA 4NYIR 2GBFA 3D59A 3ZU6A 1QORA 3NHKA 4UHJA 3R5JA 4HAUA 2OXCA 3DXFA 3ROQA 1E6WA 2SKDA 3FCCA 5ETJA 3KSAC 1EGAA 1WW8A 4ZYZA 5A03A 4UZFA 2CE2X 1ZMTA 5C8YF 3EUEA 1KSJA 3QX7A 1SMKA 2EIXA 4TT8A 5DZSA 4IJMA 1FLVA 1S4QA 4IZOA 1AK2A 1C7EA 1IQPA 1EGVB 1FXWF 3GJ8A 3LXRA 3HEBA 5KKAA 4EA9A 1NR1A 1XCMA 3FDZA 1TD1A 3N2EA 3S2YA 3WSTA 1X1QA 4RY8A 2VPXA 3N5CA 5C1PA 1DU4A 1WMEA 1Z33A 1XSEA 2B4QA 2IYUA 1JXAA 3REOA 4HQFA 1D2EA 3QJYA 1L7MA 4ZVKA 4EA8A 2ABWA 1JW9B 1I1QB 1STOA 6YASA 2FSIA 1SVMA 2QUKA 3DZGA 4YJ3B 3ONDA 1H2AS 1TTHA 3DM5A 1UINA 2Q5LA 3QBDA 4Q1CA 5FADA 3RVSA 3SQNA 5GIPE 1R66A 4I99A 3TSOA 2RKWA 1NPTO 3HLYA 1WE2A 3TCNA 3K4HA 4KXXA 3R7SA 4MLZA 1JHXA 1U5AA 2MWMA 2VRNA 3ITNA 4MGIR 5DN6A 3ZVKA 1MB9A 1JKXA 1BD3A 4NHOA 2I91A 2EG5A 3OCWA 3FNBA 3VU1A 4CR8A 4RIFA 4DA6A 2QMQA 2Q3LA 3C39A 1EE2A 3P45A 1XMJA 3U4DA 3LY9A 3RJTA 4B33A 3OZDA 4U2FA 1Z06A 1JR4A 2A3NA 4HXGA 3LA8A 1LLUA 4YREA 3TIIA 3K0HA 3QI2A 4QBHA 1FDVA 4W1QA 2BEVA 1FF9A 2QQ5A 2XVXA 1M54A 1P4GA 2JLQA 3D1VA 3OJXA 1FUYB 3SP1A 2CT8A 1OBFO 4GZ6A 3V4OA 1TC2A 2VI5A 2R85A 4QFMA 1NOKA 1JHAA 1IXKA 2P6RA 3QEKA 1NOIA 1Y9EA 2IV3A 4ZO7A 1ZH4A 4YUXA 4WUTA 3M0EA 4N5NA 4ZOLA 2C4TA 4Q01A 4UUPA 4BNUA 3J81A 4LVNA 2GKOA 3P9SA 2IYFA 1X1CA 3R6GA 3S7ZA 1TFRA 3PTZA 3RKUA 4UOQA 1L9KA 1QYWA 2BZSA 1QYCA 2I3BA 3NYRA 1LTHR 4DR6B 4ESEA 1YJBA 5HF6A 4C08A 4AY4A 2EKZA 2AVNA 1Z4PX 1T5BA 4LY3A 1T9BA 2JFPA 5AVSA 4YCNA 4QTZA 5SY9A 3ZKAA 5EAIA 2D4HA 2WV7A 4RD4A 4G85A 1B93A 1KDRA 1X0VA 4XLZA 4OXIA 2IOFK 2GM4A 4WCVA 1WXDA 2O8CA 3AFNA 4MVJM 1P2BA 2HIAA 3CCBA 3GNTA 3QXHA 4KYVA 4XCXA 4CMKA 4TYWA 3O9VA 1Z39A 5LP6C 1FYWA 4ML3A 9LDTA 4ED9A 2PD4A 2I67A 4RVSA 5E1MA 3CW9A 1JZQA 4J3NA 5T3YA 3H2BA 1B6RA 2VPZA 3LHKA 4EM6A 5B30A 2EP7A 4OPMA 5JECA 4JIMA 2Y1XA 1ODFA 4IHKA 3PR2B 4PZAA 3RSZA 3S2EA 1AKUA 1UBFA 2VNAA 2PLRA 2TECE 2F1RA 4UC0A 5F35A 2GYYA 1U3UA 3DFKA 4B85A 1E1KA 4R3UC 3RM3A 5DV9A 3C2QA 4LI0A 1C3EA 2FV8A 3ZTYA 1J8FA 1ODCA 3S2IA 1N3BA 5CH5A 4M1MA 5IJAA 1PN3A 1V2GA 5IRCD 1XTIA 3GLUA 2VFAA 3GARA 2ECKA 3RS3A 1X2EA 1JSZA 5FNZA 1T3TA 5DLQC 2Q9UA 4COKA 1GEEA 2GA9A 3E81A 2YFKA 4LOHA 5KWIA 3C7TA 1XZCA 3AF2A 4KQHA 4RD6A 2YFQA 4MLPA 4Z3DA 4AURA 3JVIA 1NNI1 2VPIA 3CSSA 1B16A 1B41A 1EU1A 1O6BA 3N0RA 3IDAA 4TMVA 3S81A 1C4OA 4KQJA 3JYQA 2QN3A 4YAEA 4MGKR 1XAIA 4GSYA 5FA8A 1J8YF 1XXHB 3CKLA 4LGYA 3Q7TA 5K4HA 2RHJA 1VMAA 1P91A 4ZVNA 4QJIA 4RM3A 3L18A 3CF2A 4PLZA 4Y1RA 4R7TA 2R86A 2FN9A 4P5PA 4H7PA 4R1QA 1PEAA 3VI3B 4CG0A 5K0JA 5ALDA 1SCBA 2XT9A 1CEYA 2PZFA 3AJ8A 1Y9AA 5CLGA 1VSUA 5BSUA 1JU9A 1U80A 4HI0E 1EP2B 5DIFA 3PNBA 1B3BA 2ODNA 3PNSA 1AIPA 1SKYE 3IP8A 4UAJA 2C4KA 1ESMA 3VDRA 4PINA 4BWFB 4LNHA 2ODBA 5BWMA 3N2YA 4RPIA 1RLTA 5C7OO 2CYCA 2WT9A 3N0XA 3O82A 1YU9A 2WM2A 3LCVB 4WKPA 3TTSA 4CODB 2F2TA 3PDIA 4TLEA 3UOAB 4DQKA 3JR3A 3PFFA 1AUVA 3CX3A 2XT0A 5IBPA 1BWRA 1R5NA 4HQNA 4HLDA 1YB2A 2JH3A 2OAGA 3F96A 4QLAA 2JH8A 3TIGA 3DEYX 4J4BA 3JYOA 5AICA 4AS2A 2Q9BA 3PXEA 2C5SA 2UYHA 1DVRA 2FSVA 4XI9A 5CP8A 4EG8A 5BN3A 2DEUA 3SYMA 4RD2A 4Z9FA 3GZJA 1L5FA 3JW8A 1U2GC 2RG7A 4FGSA 3V1YA 4B0PA 1WB9A 4DMHA 4MUAA 3N2GA 5CH8A 1I94B 1JI3A 1HA3A 1IY1A 3W5DA 1S89A 2B21A 1T24A 1X7DA 2WABA 5AI8A 4KNVA 1ZM7A 1U6IA 1H69A 2PUJA 2JF0A 3PIIA 1XZBA 4MINA 4A16A 4C6RA 4EHKA 4ERNA 3HRIA 1OASA 3F6SA 1E64A 1M1NB 1GKYA 3WMRA 3CURA 3ZS8A 5LNK6 3SWWA 1SVUA 4HQLA 4GM4A 1N75A 4C0LA 3P7MA 5IXSA 3QYJA 4I4LA 2QSYA 4DXAA 4XWKA 2UUAB 4ENPA 4DV2B 3G8BA 3LC0A 3STYA 1KOJA 5DGCA 4A6EA 2PSHA 3DM9B 5BQFA 2DT8A 3CJRA 2OORC 3SSNA 5C7YA 3FPSA 5IHPA 5AJYA 4BWVA 4JQSA 4JI4B 2L19A 1QIIA 4Z1MD 4G0XA 3ASYA 3RJZA 3BAFA 2C9YA 3L4SO 3PSHA 4TLBA 1W29A 1HDOA 1KI6B 2GK7A 1H22A 3W4KA 2VRWA 4BGIA 3RQSA 5J47A 3DUFA 4HB4A 1SG6A 3PQ5A 4NAVA 5JARA 2QV7A 2PFGA 4J1NA 4WFIA 2Y68A 2ZWAA 1E3WB 3KEGA 2XB8A 2HJVA 4RMNA 2J6IA 3TR5A 4UPVA 3WK9A 5HOQA 2AYXA 1FLDA 1P1CA 3HL4A 2O8BA 1BSVA 2NADA 4BNKA 3EGIA 1CHNA 1A96A 3LWBA 3IC5A 5J9FA 4DV0B 4FXPA 2IHTA 1ZGCA 2ARKA 1ETHA 4LC9A 4IDOA 1H23A 1T3GA 2ZE7A 3LUHA 1VCIA 4OMFG 5FNVF 2A0YA 2YS6A 4ZMBA 1Q74A 4EQ6B 2JLXA 1K6MA 3H1AA 1ZNXA 1A5ZA 3ROPA 4OJYA 4PSVA 4IZHA 3UWOA 4XEUA 1PDWA 4LYFA 4QEDA 3TZCA 2VDNB 4DSNA 2REXB 3KOWA 3CPEA 3ZGVA 1W76A 2GR9A 1I3CA 4QUGA 1W8DA 5F3WB 2O52A 1NGSA 4Q05A 1PHRA 1KORA 1YHZA 2WKQA 4FOTA 4TMFA 4X0EA 2QM8A 5JW6A 2O19A 2R44A 4DRXA 4RJJA 4ZTZB 2MOKA 3ZBPA 1WLYA 2XB6A 2CMFA 2X6TA 3E8MA 5AJTA 2OYRA 3TLJA 4M0UA 3AHEA 1Z2PX 4CM6A 3DHWC 3O03A 4QATA 4NOKA 4PG4A 4E7OA 4QUKA 3VTZA 3A10A 3I6QA 2HV8A 4LSWA 2YJ5A 2OYSA 3P2KA 3NQ41 3BMXA 4NBKA 3WQRA 1E8DA 3GXBA 4N3BA 1G63A 5EWJA 3QEMB 1EE9A 1T4BA 2OESA 2PA3A 3KQLA 4KDEA 1JBKA 2JIOA 1ZMBA 5K0SA 2X1VA 2WQ6A 1F14A 4RTJA 4PRZA 1ZYUA 1QV9A 2Z4RA 1K8XB 3HNOA 1Y3IA 3DMGA 4HLCA 3BHIA 1KI9A 1IIRA 1DNPA 2BFNA 2FSGA 2AW3A 3BD9A 3GGCA 4NPAA 2CDRA 2NUPA 4G9BA 5EZYB 5ILQA 3HCBA 2PS9A 4CMBA 1LPOA 1X7HA 1AMOA 5E9WA 5AOVA 1WVIA 2QAGB 4WK6A 2E4YA 1H4QA 5SZHB 1TYBE 3DF7A 4MW4A 2X7JA 3U4HA 3AF1A 4XPZA 4EVSA 2R4UA 1TW3A 2XUZA 2F8SA 2ZJ3A 3MB5A 1UZMA 4TKUA 3DOIA 3NI2A 3FB1A 3UG6A 2IP2A 1JBQA 1Z25A 3WLAA 2H4HA 2E85A 2OUKA 4FJ1A 5JQGF 3MK31 1YS6A 1D0SA 3ILSA 3KQQA 2VAVA 2PK3A 2X23A 1PEYA 1EK2A 5DTMA 4K3VA 4DB4A 2YWFA 2QK4A 3IKJA 4PYQA 4FOOA 3EASA 3FM9A 1IZZA 5DLEA 4L0DA 3GLGB 1XN1A 2CNLA 1GTSA 1E1QA 1Y9JA 3ABSB 5F77A 2YV4A 1HOTA 3GDWA 2DLNA 4EFNA 1FS6A 1HNXB 1ZGBA 4P83A 2PZMA 1RQGA 4I8XA 5C5DA 4N3CA 3DXYA 1B8PA 4AP5A 3LJKA 2DTEA 2LV8A 1GRRA 1HDYA 1XZPA 1FY2A 1WTCA 1RQ7A 3OPYA 4U7FA 2ZI3A 1M34E 1Z3IX 2YIMA 5TRTA 3UTCA 2E18A 1AKYA 2PRIA 1GZ6A 2AOUB 1E1YA 3F5DA 2AK2A 1BRMA 4N5DA 2QORA 1C0PA 1DDOA 2W5UA 4Y6SA 2JIDA 1B73A 3GRPA 5SZKB 2R65A 2HAEA 2DPGA 2JFOA 2Q9CA 2Z8YM 3HY6A 4TLDA 5THXA 1OB2A 4LZLA 3SSAA 3BHNA 4HN9A 5LQSA 4CTNA 5L6LB 4EK9A 5D6OA 4V0QA 5CTAA 4WV3A 4BEBA 4H7FA 1Z8NA 3LKDA 1IXZA 4XYGA 2BGKA 9ABPA 3R9XA 4YEDA 4INPA 1K0UA 5EINA 1Z4QA 3A1VA 1MW9X 1R15A 2ZLBA 3H9QA 2XAUA 3CUWA 3IBTA 1L7AA 3M4JA 4FC6A 4QPNA 1CUVA 4WADA 2OAQ1 4KCGA 2C03A 4TRMA 1Q1EA 1T4MA 3GJ7A 3N2IA 5FTJA 1PR2A 1XOIA 5EYPA 5HUQA 5BW8A 3CVJA 1QGED 4JXZA 4DSZA 3PE3A 2UYCA 1DG3A 5ANRB 3HJGA 2XMBA 1HV8A 3A6LA 5KKCA 4XDHA 3KUCA 4J76A 2A57A 1AJEA 2JFBA 2FTKE 1TQHA 2HADA 1KXJA 2WD7B 5CR9A 1HT3A 5KINB 2VLIA 1L8AA 1L7DA 1O6CA 4H59A 1DXQA 4M0FA 4BJ5A 2PT6A 4QVKA 3EVFA 1S2NA 1C7ZA 3WO0A 5DK6A 1W4BA 5JDIC 1GGKA 1Z83A 1KK2A 2BFMA 4HTFB 2ZJAA 3TNDA 1SZDA 3FFWA 2GBPA 1NXXA 1TADA 1U90A 4BFSA 2JBHA 1E94E 5GWXA 3RDPA 3STXA 2MSCB 1OILA 1PS8A 2ZXFA 3VR1A 1NBAA 3QYFA 3GLKA 5KREA 3R09A 3DE6X 2P2NA 5TJ9A 4A0HA 5JCXA 3PT9A 1XKLA 1Z6XA 2R7NA 2ROQA 5KYKA 4PHGA 2ZPTX 4NBWA 1T5DX 4RVDA 3G7SA 5DHTA 2R6R1 4RHCA 3LQ2A 2C8VA 3KZMA 1KS9A 2J0EA 4AMVA 5DASA 1H8EA 1IVYA 1SNYA 3JQ7A 4CMIA 4XAQA 2QD5A 2QRGA 2HF7A 1M6WA 5EHNA 2ZWOA 3UVEA 4FGZA 4GOJA 5DWQA 4XWTA 3WB0A 3ED5A 1DLIA 4QXOA 1BVHA 1NUQA 1WMFA 4GMDA 4H6VA 1EJ0A 1ZBDA 2XVMA 1G42A 3TMKA 1WP4A 1T5IA 4CCSA 4AG6A 2QUAA 3GUYA 1SRRA 1ARZA 2BDTA 5A1TA 1YDWA 3LX5A 4O4IA 3D3EA 1PJZA 1DBPA 1M1YE 3F71A 1XTRA 1PLLA 2HA4A 4WL0A 5AXAA 3WOVA 3DOUA 4B6GA 1CE8B 4OBWA 1R0ZA 2BGMA 1S4MA 1KI4A 5KVQA 3FNRA 3FBTA 3WGZA 4OQNA 1R0CA 2I3DA 2ZS7A 3LLMA 5TS3A 1ULBA 2CFRA 1L5GB 2RHBA 2D5IA 4U4AA 2UZ4A 5CDGA 4DY6A 3RC7A 5JOQA 3QA3E 2OQVA 1XTPA 2Y71A 3KJXA 3DBHB 2W6JA 4JS0A 2AXEA 1FPMA 1KBOA 4J1TC 4MULA 2FEKA 4YJ2F 1KNQA 1Z7WA 3T3IA 2XZDA 4K9NA 1ZJ4A 2C57A 2QMZA 1HFWA 4KPUA 4MEJA 1EFVA 1JJAA 3FCEA 4MCAA 3QY0A 2AYYA 3M2TA 3I9NA 4DPLA 1F48A 2QRVB 1SXIA 1EE1A 3CQ9A 2DT5A 3SKYA 4BQIA 4O2AA 4H1HA 4U8HA 5A3QA 1WDTA 4HQ6A 1CG6A 3I5YA 5J4VA 5TF0A 3VZCA 4LZWA 3BWEA 4BKQA 2D0IA 1LJLA 4KZPA 5B64A 2K7FA 3RK0A 4CMGA 4DCPA 3N9IA 4X61A 1XF9A 2MCFA 3ZWOA 4FHDA 2BCEA 4JI8B 4DFDA 5JMTA 4WA8A 1KIMA 2NO0A 1CX9B 5F1YA 4LMRA 5HDQA 4H3HB 1G2IA 1NKSA 2R2AA 3MWKA 3U7QA 3ZK7A 3PTLA 2PXAA 2YCBA 1TMYA 1Y8QA 4NBUA 5CIQA 1MIOA 5F21A 2YIVX 2JJQA 5BUSA 1GZUA 1W5AA 2Q6VA 3WYEA 3QHAA 2F00A 2O5RA 2BV3A 4L3VA 4MLDA 1HKHA 1QJCA 1ZHHA 3IPLA 2PZ8A 2VAMA 5EGSA 1PFKA 4AKSA 3VHRA 1ETUA 5A4KA 5C81A 3HBJA 1KO8A 3JY6A 3PLRA 1TRKA 1KZ1A 1AQNA 4EUSA 2PZKA 3NM6B 1OZ0A 2AWNA 2FPWA 2RCYA 3PUHA 4GLBA 4L8WB 3PC6A 2HQRA 5TV2A 5CDFE 1ZIOA 4YCJA 2O0JA 1YRBA 3A4VA 2IBMA 3NTRA 5B6PA 4D9MA 3DAOA 2YJGA 5J2UA 1MTOA 4GMFA 1MFPA 4JMPA 3AVVA 1Q1ZA 3LH5A 3SXUB 4OYYA 4WEQA 4RD1A 4F1WA 4D99A 4WBNF 3EIFA 1UBTS 1XWFA 2DECA 5FJIA 5F9MA 7REQB 4CQJA 4AKTA 3M1YA 5EJFA 4RELA 4J03A 2Z6AA 2ZT8A 4YCSA 5JZ9A 2FZ5A 3O95A 1NN5A 2VNJA 3EVGA 3PL1A 4MVJG 3T5TA 2Z2JA 3W90A 4HT3B 3PD7A 3FX2A 5DCUA 1A2KC 4RVCA 2NU7A 3WS7A 3GH3A 1UEXC 4XWAA 1LSJA 3DD1A 4JD5A 4RK4A 5TPZA 4HO1X 4ZDKA 3AY3A 3TRIA 1Z4LA 2G9QA 4CQLA 3PUJA 4LYHA 4F1KA 3UHJA 1AGPA 2JCVA 4DR5B 2O5EA 3HABA 3BIXA 3FXAA 4JVMA 1USIA 4LBYA 2J07A 2B7CA 4Q3AA 3R0QA 1IOZA 2PY6A 5GV7A 1EUCA 3T1TA 3B70A 4TTSA 2EFHB 4P2BA 4KMSA 1VXOA 2R8ZA 3JD3A 2C1ZA 3LC7O 4PR0A 3REGA 3A4TA 4DVJA 4PWYA 1YQWA 2FSUA 3FPAA 1ORVA 3RUIA 1HLGA 2X4LA 2QNRA 3E9RA 4JUIA 2W6OA 3AI3A 4IDBA 4XR9A 5EIBD 3EVBA 2B8EA 5JC1A 2BGGA 1UQRA 4UE2A 5BR7A 3D6FA 3VR0A 4MW1A 2JLRA 3JVEA 5HQ3B 1VPEA 5AKEA 2V7QD 1SA0A 3DUWA 2GXSA 2WRZA 2WC1A 4PNZA 5DYWA 1GVNB 4WZAA 3IPRA 3CA8A 3S4YA 1OBHA 2GO1A 2P2LA 5HF9A 3QFRA 2APJA 2QOEA 1RYDA 1JH9A 1IHUA 4GICA 4PPNA 5H4HA 2ZXEA 3ZTWA 3UK7A 1H1DA 1CBUA 1HURA 3VR3D 4TM8A 1IQUA 3S8MA 1E8MA 1RD4A 3A05A 2I1WA 4YCAA 4LF7B 5LA6A 2C9BA 1M0EA 2IRWA 3DEAA 1GA6A 4JSTA 4YAOA 3SAJA 2R8PA 4B5KA 2QD1A 4DUPA 3TLBA 1V1RA 1PGQA 2HRRA 1V9CA 3BKWA 4MUNA 4RKFA 4FMCF 4HDSB 3FHLA 2RCNA 5D7BA 1C9JA 1W59A 3Q6NA 4M53A 5IASA 4NOJA 1CUFA 4YJGB 2CL7X 4CV2A 1TJPB 3KKEA 3CLKA 3IALA 3KHKA 1Y1KE 5MFPA 2F4VB 1I2AA 2FPSA 4FMDB 5F7OA 3FF4A 3I9LA 2F17A 2G71A 3OIFA 2VP6A 3VSCA 3WX0A 4DABA 4QE3A 3ESXA 4JC0A 4O4LF 2XTMA 3RFTA 2E82A 4LWQA 1EP9A 3QBTA 1R8SA 3NTVA 3FRIA 3GWGA 1IXRC 1KY5A 4YP0A 3RYTC 1AB5A 1NVAA 2GM3A 1WSBA 3I61A 4F8YA 1GNQA 5IKOA 1KYWA 2P3OA 3PJRA 2H5IA 4HWKA 4D3FA 3D6HA 1FOEB 3CTMA 1Y42X 1G8GA 3IEXA 1ML3A 4JHXA 4TUYA 2UUOA 4MXDA 3DVLA 2FPGA 2O8DB 2CXHA 3ZWNA 4WXEA 3BDVA 1AN9A 4IICA 2ZB3A 3RS4A 2QZZA 2WMOB 5KSOA 5ICFA 3T7CA 1W35A 2JGDB 3NHBA 4WOCA 1RFLA 3N8NA 3VJKA 2A7XA 2ZBVA 5C51B 1G3UA 1HM5A 2Z9CA 3QBEA 5AQEA 5B1DA 3U7EB 2C5HA 1BO6A 2LGJA 1DWOA 3SC2A 1Y9ZA 3JQGB 3LV8A 4I1RA 4CTJA 4D4IA 5COBA 1YJXA 1SIUA 3PITA 4KDRA 3QM1A 4DMFA 5ALWA 5KQMA 4KO4S 2ZU6A 2ODPA 3EZ7A 5DWVA 1BJTA 1TLFA 2YW9A 4L8YA 5KKNB 1QYVA 2P2SA 5JC8A 3SX4A 4Z4GA 3K53A 4HEJA 5TF4A 4AZ0A 1E9DA 1GZDA 4OLHA 4WUVA 4L9WA 5T8KA 3U40A 1U7OA 1FLAA 1S7CA 2HFKA 2LDXA 1ZUIA 5BR4A 4BKRA 1ZUNA 5KHAA 1DAHA 5JVDA 2O8EB 3E82A 1NR5A 2JK0A 3BM5A 3O73A 2ZVPX 1R0LA 3C3MA 4Q4JA 4ER6A 3D6AA 4Z7NB 1SVOA 4HB3A 2AX4A 2QENA 2FU5C 4GDMA 4UNPA 3HS3A 3V4LA 5CXQA 3KV3O 3RQIA 5F51A 4X84A 5JCZA 3KM0A 4CIWA 1Y7LA 1RKXA 2H1FA 4J7UA 4RL6A 1E66A 2Z3WA 5LXTA 1SQ0A 4ZZ1A 2F3TA 5AW7A 2F9FA 3P2IA 3UAZA 1ODSA 3H1FA 1EWYA 2ERCA 3LGAA 3RFXA 1NUTA 3PEEA 4XCVA 3VAAA 4D6YA 4RADA 4DCCA 2CGEA 1CEXA 3OHPA 1N9GA 2BMAA 3ASZA 3RREA 4WOKA 3KKPA 2R6DA 4H4DA 2FSFA 2I65A 2JVKA 4I08A 4MP3A 4BLQA 3SICE 4ZQGA 3JQAD 5B1YA 3IPYA 2MR5A 5DB4A 2QVCA 1DMRA 3QJGA 1QNLA 5AXCA 3HYTA 2JRCA 4CLDA 1SIWA 2W8ZA 3TZKA 4YRFA 2JL1A 2P35A 4P4UA 3UFXA 3DLCA 3W9UA 1NDHA 1IZ8A 3RANA 3ZLVA 4FDVA 2CBGA 1NLZA 2Q49A 3DOEA 3HP1A 4ZT5A 1EUQA 1KY2A 3DMRA 4ZAVA 3C1UA 4UD2A 2HMSA 3G0GA 1XD2B 4A4DA 2B0JA 3W77A 1O58A 3HMKA 4L07A 4YMIA 4CF4A 1Q7CA 3DVAB 1K7SN 3EXEA 4PIMA 5DTEA 4GF5A 3L6BA 2PUCA 3LKVA 1H85A 1L4UA 1AHIA 4L0QA 2C9CA 3E3AA 4NJEB 5CFOA 4PFQA 2C0PA 1N2HA 1QK4A 3HJRA 3DWGA 1PL0A 1QIEA 3I3SR 3O4GA 3Q8WA 1P0PA 2AV6A 2IDKA 5EIOA 5IM5A 2O3TA 3RS7A 4XVUA 2V7GA 3N6RA 4M1QA 1MW8X 4E2WA 5ALIA 2J9YB 2QTVB 1MDBA 2XA2A 4J1SA 3R7FA 1B3RA 1WV0A 3KV1A 2DQSA 3DHNA 5AJZA 5D7NA 5FTKA 2X0EA 3V33A 4F3YA 3HVRA 4PLVA 1BAPA 5EIEA 5IXJA 1J42A 5AHXA 1P17A 3KAQA 2A33A 4HDAA 1ESNA 1CULC 4Q1FA 1HTBA 4C6HA 1XU9A 2O1XA 5E2IA 4CUJA 1TM7E 1G5PA 1Y4UA 1Y8AA 2I1LA 1XF1A 1JEAA 1PRYA 2Y2VA 4YTEA 4FFLA 5KVVA 2EKQA 2H1HA 1BMFA 2V9CA 2XB9A 5LMNB 4G5QA 3RGWS 4MRNA 5EE3A 1GAJA 2VVTA 3CLSC 4AYWA 4PY2A 1W7AA 3KZXA 2IU3A 3CF0A 4OB6A 1FDTA 4TXLA 3TOZA 2B8TA 2ACVA 3ASVA 2Q4RA 4LSMA 2LCFA 2GN8A 2XZTA 5HMLA 1VDZA 1O0SA 4L76A 1YULA 1FNDA 4HQKA 4G23A 4KPEC 4EYEA 3HCAA 1ZVMA 1QRSA 4Q03A 4DB2A 2EC5A 3PA8A 4NFLA 4CKBB 1CZHA 4GECA 1DZIA 1ADGA 1E2MA 1N7JA 1PS0A 1GL6A 1ZL0A 2W2TA 1A3CA 1I10A 3EDMA 3U7IA 4B2IA 4FTWA 4JLOA 3R5SA 2A0FA 1OT3A 1P7VA 4UHHA 4BUZA 1Y9DA 3CX6A 2W42A 2JGKA 1P0QA 4BNIA 2P79A 5ALFA 3DDNA 3HDQA 1EM8A 5GM2A 1PVDA 1MX5A 1ZJZA 1I0LA 3A0RB 2M9MA 3A3OA 4LHWA 2CL6X 5CH3A 5FWXA 4WCFA 3WKAA 3D6JA 4IVPA 3HHEA 4G8JA 2W8BA 4G0PA 3UT5A 3ZTTA 2L2QA 4NTZA 1XJQA 1KPIA 5HDBB 1UK9A 4IHJB 3SF0A 3T95A 2J9FA 4AKEA 3I9V1 4CLEA 3ZI0A 4R2IA 1GN9A 1HDZA 3H75A 2NX2A 4RPHA 1FTNA 4KXLA 1B00A 4JZYA 3TL2A 3BCRA 1G8JA 4E12A 5LMUB 4BMCA 1XZHA 5BSKA 1ZK3A 3QMWA 5GQSA 1EK1A 3AVPA 2HBYA 2HX1A 1BEZA 3AB8A 4IIUA 4UAUA 5CB4F 2ESRA 3FOAA 4XLLA 2PV0A 4YHBA 5FA5A 2I76A 1VIYA 3IXMA 1U11A 1FFCA 1Y98A 4EY6A 1W36C 2VSYA 4QNNA 2QRMA 3IS3A 4JLVA 3BL5A 2MMGA 3RYFB 1L6RA 3C3KA 5HTKA 1JTFA 1IJFA 1HT1E 3ECSA 2PYIA 3MINB 1JQJC 3ON5A 1N5IA 4HQOA 4TKMA 4KR7A 1FFAA 4JJIA 2RH4A 4URUR 4EDHA 4JKYA 4JSRA 4RE5A 1T13A 4HH1A 1R37A 2PIDA 3MELA 3PWTA 1E8NA 5DP2A 1EWRA 1NUPA 1G8KA 4E14A 2ANCA 2JGLA 5LSAA 3BILA 3VKWA 5KYWB 1QV6A 1IMOA 4JOQA 1DKRA 2EHDA 2ZRAA 3EVEA 4Y2XA 2IUUA 4QFCA 1C9KA 4B7CA 4DBVO 4UTOA 5B3JA 2CUTA 1JAZA 2NT3A 2WAXA 2XCLA 4FUTA 1L4BA 5EVCA 3ZBQA 1VMEA 4WLNA 3LG2A 1JU4A 2QAJA 2SKEA 1RM3A 4ITUA 4KRXA 4UAVA 1JALA 1W2GA 5AVVA 4CIAA 1GG8A 1JB9A 1I4LD 5DBEX 3T4XA 5KAPA 4BMDA 5C18A 2JGRA 3SZMA 1SKQA 4CKYA 3COJA 3HWX1 1OBCA 1QHHB 1IG0A 3I83A 4J16C 5FR1A 4G5OA 2JD2A 2ZS8A 3R6WA 5HA5A 3IFSA 3ZHZA 4ZEVA 2Q50A 1I6WA 2IPMA 3PZBA 5JMPA 4P7GA 2K87A 4JJ8A 1CV2A 3AETB 3DKRA 2QYHA 4O4JB 5HM8A 3IDZA 1DELA 5BUCA 5IAEA 4QGSA 3VH4A 3IP1A 3WLMA 4FKMA 4EA7A 2PVSA 1QF6A 2W93A 3V7WA 3FTDA 1T2CA 3KJFA 3U3ZA 5JFOA 1M7BA 3M81A 2LRHA 4UEKA 3OP1A 3L6EA 2Y0PA 4NZNA 4RZ3A 1DUIA 1Y48E 3A3NA 1MD9A 2J0UB 1FMJA 1QDUA 1X7YB 1Z5OA 2YFYA 4ZVQA 5EHXA 1QYXA 2HIHA 3WAGA 4NH0A 3R5FA 1QANA 3G2IA 3SJ7A 4XOIA 1LPBB 4Z2AA 5AUPB 3QV1A 1CERA 5IJ9B 2FY8A 4RABA 4WACA 1W48A 3NANA 5ULLA 3OKPA 4B4OA 4E5VA 4F2DA 1KAHA 4EYQA 1G9XA 1NAIA 2FUCA 3NPMA 1QFZA 5AW0A 1MA0A 5CYFA 5E1OA 1UPUA 3K2BA 4UAGA 4AW9A 1VG0B 5GJWC 4JJEA 1WNTA 4IKEA 3VDNB 1LF0A 5A6SB 2OMEA 4L51A 5EXPA 5TT0A 4G5SA 2V0GA 1KAEA 1U8XX 4X1KA 3SXPA 2YJ3A 2VCHA 4JWKA 1K5DA 1BROA 1Q3HA 1PZEA 3D7NA 1Y1RA 1AY0A 4MRAA 1OLSA 2YOGA 3G59A 3TLCA 5CA0F 4W7IA 4J0EA 5JYBA 1W0KD 4UJ3A 1VHTA 4TN5A 5B55A 1EP1B 3GROA 3IGFA 1PDVA 3T9CA 3ZIAA 3B3AA 2O5VA 4EECA 1NC3A 4LC0A 4NBSA 3K0BA 4C4TA 1P9WA 1K8QA 1E4EA 3DKIA 1E4YA 2J7PA 4II7A 1TO2E 1I30A 3AEXA 4DLWA 2F8LA 3NWJA 5KVAA 1GLGA 4RJKA 5ENDA 4MUHA 2VRCD 3ANXA 4GMHA 4HDRB 3H5WA 1SY7A 1TMGE 2QUJA 3OD1A 3FD8A 3D8SA 6Q21A 1FEZA 3KUUA 4DKXA 3EGCA 3T8YA 1SKAA 1ZRSA 2C42A 5DTRA 4CKEA 4D4KA 3GW8A 2VAXA 5KX5B 1KERA 1S3IA 2CJWA 2VSQA 3E5RA 4I5FA 4EUNA 3PC4A 1TLLA 1N0VC 2NXCA 1X1EA 3DDWA 2OGUA 4RA9B 1VGQA 3IULA 4URHA 2V8OA 1I3NA 2BM8A 1XQ1A 4F2HA 5ICMA 2XQFA 1SCKA 3OE7D 4LZJA 3W2TA 2BBSA 1M83A 3GUZA 1SUEA 3JWIA 3OX2A 1QF9A 3DSRA 3E9MA 3H5LA 2QSJA 1ZX1A 3SSOA 4EHLA 3OLVA 3LLCA 5BSWA 3RLFA 4DSUA 4GVXA 1DSSG 2IHJA 4EAQA 4RA6B 5I7FA 2PR7A 1QOZA 1M1YA 1XMSA 4CRWB 4LXHA 1N34B 4Q1VA 3UT0A 1ZJJA 3OF5A 1UXHA 1K97A 1U63A 1JLMA 1O5IA 5CFPA 1RBQA 2Q28A 2O06A 3PFNA 4K46A 4M9CA 4FZJA 3VTKA 2H2IA 2EEZA 3EFHA 4CKWB 1XMQB 2JBAA 1M0SA 2R97A 1IZ7A 1OGJA 2GGSA 4TXNA 4TXHA 1SC9A 4ZT2A 1M2VA 2VJBA 2HBQA 3E48A 3PRJA 5KTYA 2H1OA 2H11A 2A3RA 3DZKA 2DCUA 5LQUA 1DX4A 1YR6A 2HT6A 2Q4EA 3LHFA 1TO6A 3AM1A 4HNUA 3CPHA 4ZYVA 3KEOA 1F0KA 2AD5A 2FQYA 2AZTA 3SM3A 3UQZA 1RRMA 3FFXA 1TJYA 4OHMA 2GNPA 1KJYA 2X1HA 3ANSA 5EJIA 5AVJA 3TD9A 3V4VB 4DCMA 2BFDB 2IKQA 3K70B 2O3JA 1YFJA 2XSZD 3NEPX 1Z4NA 1AH2A 2RH9B 4MVJF 5K4GA 1JLRA 4ZMSA 5B58C 2GM9A 2QTHA 1KU0A 3GJ5A 4W5QA 1U2ZA 3CGGA 4Y2SA 4RQAA 3QMVA 1NT4A 3LFTA 1N2JA 2CHFA 4IRMA 4Q19A 3V4FA 5I48A 1IY2A 5HRCA 4AF6A 4QX6A 4BASA 1EFLA 1UJ2A 2AEFA 5EMJA 4LFAB 4LK3A 1ZCAA 1VJCA 2R66A 3SBOA 3W04A 2H4XA 4RWEA 5JU6A 1NBME 3ZE7A 1W2WB 5T3UA 4AI6A 1A82A 1H3EA 3T5AA 3VR2D 3PDWA 4I4TA 4IOLA 3AIKA 3C3DA 4L4UA 2OG2A 3Q1KA 4E30A 4MYTA 1T1JA 1EX6A 4QGBA 4B6EA 1ZHOA 1DBVO 5JSYA 4EARA 2NP6A 4L27A 1T5LA 2IEIA 1BMQA 1N9ZA 1R10A 1ST3A 1UJ6A 4MB6A 4YRJA 4BJ6A 3BN3A 2Q29A 2H2FA 3AZQA 1UAYA 4LXUA 4FQ7A 4IS2A 1QGUB 3OFJA 4AUMA 2JFHA 2ZSEA 3MGKA 1P7PA 3NHUA 2RBKA 3JAWA 1X13A 2PV7A 3EYAA 5FORA 3RUCA 1EESA 4MVXA 2YUIA 8ATCA 3CUVA 2AOTA 5U1PA 1MC1A 2JAXA 5DPMA 4J0GA 1KAQA 4ZI7A 5AXBA 4KO8A 1JGTA 4G1VA 5FUXA 1RPZA 1JMYA 1MA3A 1SCDA 3P32A 1RC1A 5CDFA 4DE5A 1CY1A 2OCIA 4ENUA 1PK7A 3THSA 3WLLA 1GG2A 3QLVA 3ZDXB 3F8WA 1VLZA 5IHXA 2CWWA 3WJAA 3MTIA 1K66A 1HL3A 1EIZA 1NVDA 2AW5A 2DE0X 3NG1A 2RHGB 4DXHA 1EWKA 5EXTA 3K70C 3FFBA 2VH1A 1U8ZA 3VO9A 1GFZA 3GEPA 5FOWA 3WRYA 1W25A 1Y5RA 3ZJ4A 1OWPA 3C3PA 2II6A 4B09A 2P67A 1XQVA 4KQXA 4DAOA 2D7DA 1AMNA 2FEXA 1YMVA 2PBFA 4QO7A 3AUTA 1GSIA 4M8KA 3V8RA 4WNAB 1JXOA 4AJJA 1BE1A 1VMDA 4D0GA 4DF3A 5IT5A 1VBFA 2VYND 3KPWA 1EEXB 3ZBUA 1DC8A 2W83A 1JR3E 1M8FA 2VSNA 2X42A 1KYQA 1QIFA 3U4AA 3FYHA 1OYOA 4HHEA 4A82A 1XJ0A 4D9BA 1G18A 2OXFA 2YW2A 5IF3A 3FDJA 1U7PA 3TZLA 4E4TA 3RAEC 2BE7A 3SHVA 1OZAA 3I28A 4URZR 1DC3A 4B3BA 2BHNA 1G3RA 1NBIA 2XRFA 3K31A 4BO6A 5KYNA 2XXBA 3C8UA 2ZR7A 4O0MA 5FPQA 3AHFA 4HUQB 1KEVA 5T4EA 4FFDA 5IZCA 3EDCA 2P78A 1PD0A 5I9TA 4BWYA 3UMYA 4Q4AB 2VUSA 3ICCA 1QOQB 3LWNA 5LFAA 5CIYA 1JHQA 4GVLA 1QS0B 1CLUA 1JG3A 1LWOA 2Z9DA 3U3OA 1JTEA 1FU8A 2YOHA 4FS8A 4FYMA 4DLSA 4P32A 4EB6B 1AHHA 5AUNB 3NYWA 1OXVA 4GSLA 3F7TA 1XQ6A 1YBAA 1B15A 1GNLA 4O1HA 3V8MA 4N4AA 1CUBA 1ZJ6A 4IWNA 2XUIA 5G3ZA 1C1YA 1RAAA 3NDPA 2F55A 2QZPA 2WNHA 1CUCA 4YLYA 3QTBA 4OBBA 3B1KA 3W4IA 1LY1A 3OFKA 1K5PA 3LWDA 1CQZA 3FIJA 4S3MA 1Z6TA 1CEEA 1Y1PA 4FE4A 4LNUA 1R6TA 3H5OA 4G9GA 4B17A 8MHTA 3SVTA 3T9FA 4OX9Y 5JDCC 4HDNA 1CW2B 1G41A 4HDOB 4WECA 3VOBA 1QM5A 1Z0KA 2I2WA 2X9VA 4NMLA 4R54A 4S24A 5A4AA 4RDHA 3R9WA 2N1BA 1E0DA 2QYSA 5KPJA 3PWKA 4DR7B 4EYSA 3VR4H 5DJ5A 3L6RA 4G1MB 3TLGB 4HWPA 2KX7A 3L8GA 1C0KA 2NVBA 2R00A 4MQMA 5J5AA 2I99A 5EUCA 5JSQA 3E15A 5LB4A 1FSGA 3LP6A 3GZNA 2KPOA 4QUIA 1W73A 3KB1A 4CLOA 4GAEA 3Q3EA 2EKDA 2IUSA 4U9HS 1NYTA 2HWWA 4LMPA 4OGWA 4PGFA 2BM0A 2FPOA 3H1PA 4FFSA 3BKXA 4RHXA 3A6FA 3U60B 4IDPA 5K3AA 1C81A 3EQ2A 2HK7A 2I55A 1RNLA 3ELDA 4DV6B 4FT4A 4OXRA 4F5WA 3L4JA 1UT8A 2ALJA 3TXAA 5BVHB 2O3QA 4C14A 2JZNA 2G9ZA 2GZ1A 2PG3A 3FSJX 1SZPA 1QAOA 4KH1A 4TL7A 1PJTA 3I2YX 1XZKA 3B60A 4HBGA 3NOVA 5H4GA 1P0FA 1J8MF 1T5TA 2HPAA 2XQVA 3BGOS 3KQOA 4Q9KA 5FPTA 3UW3A 3THWB 1JWLA 5ICSA 1O8BA 4NYMQ 4QEZA 2QB5A 4BLVA 3VNSA 1GV1A 3I2HA 1IUKA 2XBLA 2KBEA 2J09A 2QLJA 4QHTA 4TMZA 3OZCA 3IEKA 1SHZA 3JASB 4BJ3A 2HM7A 2P9YA 5BMVA 2PYZA 1S9DA 2VDWA 3ZG6A 4LZZA 4TQGA 3C15C 4Y2YA 1M0WA 1VJRA 2FPXA 2ZR9A 3GUUA 3GLFB 5KYVA 2R96A 3T7SA 1WCIB 3FFTA 4TL9A 5EMKA 2CD9A 4DWWA 1E5XA 1L4LA 4X71A 5I6DA 1H2BA 3ELWA 4QEKA 1WCXA 4D4MA 4DILA 1V7CA 4N0PA 4LPSA 4D80A 4GYKA 5IJ0A 2FGKA 3P0HA 2JCGA 2VP4A 2ZJ1A 4KE8A 1T2DA 1Y1TA 2B94A 3EQ8A 3IVMA 2ZWVA 3VDXA 2DRIA 2A4KA 2Y9MB 3F3SA 5B7QA 4HLUA 2PEZA 5BT8A 2AJ8A 5AMXA 1CZNA 2GPWA 2R6FA 1AUQA 3P9QA 4HFJA 4JXJA 4LW8A 4B6PA 1W94A 3THXA 4JDPA 1Z0UA 2GOYA 1UFKA 2P6UA 2OOKA 3K8OE 3ZBTA 1RYBA 4EGCB 1Z4IA 4CEHA 2O3UA 3HJBA 4L8FA 2YZKA 2FEWB 4EGSA 2VPYA 3KLPX 4YRGA 5JSZB 2YYSA 3B2QA 4ZCQA 2DQZA 2CNWD 3EPPA 3GG9A 4KYUA 4ZV4A 4QM7A 2H54A 2YZMA 5JPIA 5ADHA 1H3NA 3EVAA 3OTQA 1OH6A 2IOFA 4INOA 4RHYA 3OVMA 4KVGA 4CHGA 4U7JA 4QPJC 1QFSA 2DUMA 2YXLA 1JIJA 3D4NA 1MENA 2VXYA 4MRRA 2YFHA 7MHTA 1P9OA 1WUKS 3MIIA 4TTPA 7YASA 1DC6A 3P2MA 2JD0A 3VBEA 1XEWY 3BGSA 3JTMA 3LY5A 3PQEA 4IUYA 4UE6A 2OQRA 4UU1A 3R74A 4N76A 1MGOA 3TIXB 3TW8B 5DYIA 1LTKA 3FJYA 4R83A 5D85A 1E5VA 5JH7A 2JLCA 2PIAA 3AEUB 3NGLA 4R6WA 2QX7A 5ARDA 1RXVA 3ACDA 5DGIA 2FDCA 2C2OA 2WHPB 1XHEA 3NBMA 4ZOEA 4FHFA 1LFDB 4CUKA 1ZZGA 3L4KA 1TTTA 1G5HA 1MVOA 1IZ0A 3L5OA 4CMEA 3O7MA 1CUUA 3THRA 2KQUA 3OWXA 3DEJA 3VOTA 1JHOA 1R16A 1QFXA 4G1CA 4HVLA 1NN0A 5H1YA 4IV0A 2O8NA 1AKRA 2YWEA 5K3FB 1O6ZA 2QUIA 4GLOA 1OFGA 1D3AA 2WWTA 1SXHA 2XUJA 3NIDB 4EVRA 1QDLB 1X1DA 2EWWA 1W47A 1EFPA 1BN7A 2XVYA 2BKAA 3AC0A 3GIWA 2ZBQA 3ND6A 1JDVA 3ZWBA 1AS3A 5FL7D 6REQB 4MZDA 3MSXA 1HORA 1WW3A 3PFHA 3I09A 2OV3A 4L50A 1PT9A 3BFJA 4RD3A 5THKA 2QRHA 3K0FB 3LUDA 1U2RA 1YFZA 2OOSA 1V6AA 3D2AA 4TOIA 4UTXA 2HRQA 1GG5A 2WNSA 2CKDA 1FNNA 2IQ5A 3UH0A 1U0BB 3CZ9A 4C1BA 3JRXA 2IYNA 1I7PA 3OTIA 4R2JA 4K9PA 2X22A 4KWEA 4Q1BA 3GH1A 1Z5NA 2RC5A 3WYCA 1KP2A 2V65A 3E4CA 3DT8A 5JWHA 1JEYA 2A5FA 1GL7A 3BCHA 2OBBA 3NJ8A 3VISA 3PZRA 1SHTX 1MOQA 4B75A 4DV7B 3QLTA 2A94A 5DKFA 1FPQA 1VJGA 5EJ5A 4RSGA 4CIYA 5GONB 3DNPA 1F8UA 4QYIB 3B6MA 2XADA 4F97A 4JOSA 4W9MC 3OUUA 3HACA 1UMDA 5CT5A 4BV2A 2ZDQA 3NEYA 1ENOA 1Q2XA 3QENA 3N75A 1C8BA 3OJ0A 4B3DA 4ZZ0A 4KQ1A 1MRSA 1HEYA 1FNMA 3ZV5A 2A35A 1NWHA 5J2TA 1OXBB 1PZGA 2HMAA 3DTVB 3JVDA 4UDOA 2AX3A 2MSEB 3ROTA 4F6RA 3GJQA 4D45A 2CZCA 4H6XA 1ZD9A 3OIGA 2QGFA 1H2WA 3V8EA 3RYIB 3GFTA 1B14A 3RS9A 4CQMA 1W581 1I4DD 4MV1A 3COYA 3TAXA 5LIPA 3U3MA 4H1TA 1D7OA 1BU5A 1VL0A 2NPIA 3GLVA 3GLHB 4IJVA 2CL0X 1RQLA 3K9FC 1ZR4A 4MS4B 1R4MA 2WF8A 1Z6GA 3PQ3A 2E5WA 3SIPA 2NACA 3OX4A 5AW2A 3T7IA 1JHVA 3WLIA 1M2OA 2R1VA 5FI1B 3BXXA 3W9BA 4BX3A 3TZQA 3IOEA 2OILA 1CUGA 4GM0A 4IHQA 4NXNB 2WV9A 5EFOA 1V7ZA 1DXYA 4CM4A 4FFBA 5KQLA 3ZJVA 1W96A 3JRWA 4D56A 5CJJA 2D1RA 2W2KB 3FCUB 3SC3A 1WY5A 1Z5WA 5MGBA 1HXHA 3TM4A 1UM9B 3LE8A 3NRJA 3P2OA 4XJSA 4N40A 3TMYA 4BFYA 3SX2A 3GQBA 4L5IA 3L1UA 4GKJB 2B6HA 3WGHA 2E49A 1FP7A 2FR1A 3CZRA 3ORQA 3Q15C 3VZDA 1OH7A 1H4VB 3RHZA 4L4SA 2WPDD 1WDKA 2OQ2A 2PMFA 4IXMA 1E63A 1GGMA 4JLAA 4RULA 3P9RA 4HJXA 2IF2A 2ZG6A 4PZCA 5FWAA 4O2LA 1QHGA 4UVIA 5F9FA 1Z35A 4QKQA 4XM1A 1S2LA 4TKVB 2FPUA 5CYPA 2DXIA 4Z3KA 1YHNA 1P1KA 1WPQA 3E9DA 2K7ZA 2ZYWX 3GOQA 4K3UA 3K1TA 4M46A 4N0MA 4MI9A 2XUPA 2R6ZA 3AMVA 4NV3A 2XB2A 2AEEA 1EBUA 2GDZA 1QLWA 2V1UA 2I7CA 2F1HA 3NM5A 3O94A 1IC6A 2AB0A 2Q27A 1TL7C 5TGZA 4ZPJA 2HEIA 5HZGA 4AKIA 2PX3A 4AF8A 2QGNA 2FSSA 4LWZA 5BYJA 5IXYA 1UMBB 1CQXA 2H29A 3SHTA 3RC9A 2J0SA 1LKZA 4ARBA 3R9IA 5K0FA 3LX4A 4XUEA 4A0GA 5B5SA 4E07A 3W4JA 2W22A 5EKDA 2CV1A 2B1IA 2ZYHA 4IJ6A 1T25A 4S1NA 1WLSA 3RFUA 4UHFA 4YLEA 3WG9A 1G21A 1ORTA 1Z2OX 1DJLA 4K0RA 2QDKA 4BMYA 5BY2A 3EA0A 1TQDA 4MNTA 4A2WA 4G67A 1Q1QA 1MB3A 3U9SA 4DMGA 2RH8A 5IVKA 4PCUA 4YJFA 4C89A 4EJ2A 4Q7LA 1FLNA 4RGQA 5EVJA 1TB4A 4UUBA 3MFYA 1BVUA 1OJ7A 4ZO9A 3WKBA 3LQ4A 4LE1A 3HKCA 5IAAA 1N5OX 4PQGA 5A5EA 1LX6A 1FSSA 3GDHA 3T7KA 3N7AA 1G3IA 2JFQA 2WFZA 1RWWA 4GMKA 1PLKA 4TV8A 1SXPA 2ERYA 3QHQA 1VB3A 3BCSA 2WUEA 1GYQA 2FQXA 1BA2A 1JYFA 2AJTA 3LWZA 4PPYA 3WADA 1QUFA 3RTAA 1K6XA 2NUTB 1XFDA 4Q1AA 2XCQA 2YHIA 1P6XA 4LE0A 2HA5A 1JDSA 4OBEA 5BNFA 1GHTA 1G20E 2XMZA 2GN4A 5ITVA 1YA4A 2DKNA 2AXNA 1BCSB 1RJ9A 4WASA 2G63A 2QU8A 4IRUB 4BZQA 1ZSNA 4TXJA 1OWNA 1DAMA 4FWIB 4G97A 4NOMA 4PFSA 4ZZ2A 3H9EO 3LXXA 1XTBA 3JAKB 4BVAA 2AGVA 2Q8NA 2V4ZA 3G2MA 4ND5A 1VJDA 2I2XB 2BIFA 2XGOA 3RSQA 5F5XA 1R0BA 2XUGA 3A9RA 3CZCA 2VZ8A 4CT0A 4GKKB 5G4KB 5ALZA 3X1KA 5HZMA 4GBMA 3GLIA 3PYXA 2BGJA 3VC3A 3PNQA 5C32A 1UDBA 4C4AA 2Q4DA 4MS1B 2OCDA 3ZV6A 1VRCA 4BO4A 3G2HA 4GSKA 1V3UA 1MB4A 2ZYVX 3F6PA 3C98A 4P4LA 1QIJA 4W5JA 3TEFA 4W7SA 1Q0ZA 2JAQA 2RK4A 2J5RA 2WVHA 4RH0A 3K6SA 3DB1A 2XD9A 1V1JA 5FTLA 2C3UA 4GHWA 4D4LA 3GEBA 3KKOA 3UWKA 2P1ZA 2V5AA 5JWRA 4CEHB 1VE7A 3LSTA 2ZIWB 4BXOA 1Q21A 4ZVUA 4KSYA 5BORA 2EW1A 4ZPXA 1NMZA 1TAQA 3I6ZA 4HRYA 5TB5A 5CM2Z 5BVGA 3B20A 1ZCZA 3NBZC 4TS3A 2R8RA 1XTSA 1ZN7A 4RAQA 1NW4A 4I6GA 1TGYA 5D51S 3I37X 3VR6D 2Q3FA 4DLZA 3M9XA 3P0EA 4ZGWA 2XEDA 1H5UA 4H1VA 4HDKA 4ENWA 5C8XA 4PX3A 5K0GA 3BD6A 4B3RB 3G02A 2W90A 4MHOA 4MMXB 2HU5A 1YAJA 1WQ3A 4R71A 3AR3A 3R7WB 2PKQP 1NMXA 1OAOC 2FP4B 5LQNA 5EJ2A 4M36A 3PU6A 2Y92A 4TTVA 1XZQA 3UKDA 3V8BA 3GZ4A 3KJEA 3BWDD 3GAFA 3R23A 3ZCUA 4LWOA 3T15A 1FJHA 1A9TA 1ANKA 4H0FA 4YP7A 5BSVA 1A2QA 1W85A 3H6KA 1CKEA 4MR7A 1XTVA 3EQZA 4FDUA 4H7IA 4EG4A 1SUFA 5D3MB 1R9JA 1ADYA 4HN4B 2WUDA 4URXR 1L5NA 5DU2A 1ISFA 3LBFA 4YMUA 3IMEA 1R6VA 5AJXA 4ZRNA 3FTPA 1R4NB 2J41A 3M5DA 4I3GA 4Y2QA 3DHEA 3O8LA 2QRPA 3AEKB 3QGMA 1HFEL 1L7VC 2ORYA 4M87A 4I3HA 2A0WA 2NUAA 1YQTA 4I5GA 3T3NA 3G88A 2OV2A 1XAHA 2CV0A 3I72A 4IWXA 3H7IA 2IT1A 1D1PA 2EBFX 3QXJA 4Q21A 3IPXA 4DY4A 4QLBA 2CF6A 1RRFA 3LHSA 3MTQA 4Z8XA 4R2HA 2JLAA 3K1JA 5REQA 5CEFA 4XD2A 3NUGA 1G0NA 2V54A 2RGWA 2HGZA 1PTJC 3R8XA 2BP7A 3NWBA 5EKXA 3VJRA 3WIUA 5DM1A 2I8CA 2JHFA 3I0MA 1HE8B 1KMQA 3HL0A 1USVA 5AHRA 3SF8B 4F3TA 1JQ5A 3EVCA 4NBNA 4E31A 1G19A 1LI5A 2OCBA 4P3KA 1V4BA 2Q5IA 3OC6A 3X44A 3SHFA 2VYVA 3OJFA 3U17A 2ZJOA 3AHGA 4QNRA 1U3VA 2ZS9A 4CZ2A 2JAUA 4EZBA 1QKJA 3E9QA 5I7RA 1BMDA 4CGZA 3JQBC 1D1SA 1X70A 2H2AA 2CVOA 2IS2A 3F9CA 4GS5A 1PWEA 2DF8A 3QE4A 5EMLA 3LX6A 2R1ZA 1WSDA 4YUVA 1SUPA 4J0FA 5AW5A 3KSRA 1J2TA 3Q2KA 2OCXA 3HUDA 3PRHA 4JEHA 5CW2A 3ROXA 3WRVA 2F43A 4OOEA 1UBSB 1UEIA 4RVGA 4UEOA 1BNCA 2EZ9A 3IUNA 3R76A 2QLTA 1SD2A 1JG7A 3BWMA 4Y18A 2RJ3A 4HUJA 4DNFA 2FF5A 4LY0A 2X2OA 4L74A 3IV6A 4F6CA 5JJIA 2ZTUA 3MLAA 4QQNA 4XIJA 3I5MA 5DW3A 2CMHA 1IAVA 4I55F 4I5EA 4ID9A 4N39A 3UJAA 1Z6AA 2DUWA 1P7WA 3H3JA 3LU1A 4OHRA 5JCPA 3BMNA 3PI7A 4KE9A 2ZJYA 1RDFA 1QCCA 1IVSA 1REQA 3WDSA 2Z1DA 3RRNA 5EHQA 1OQAA 2AUMA 4PVDA 3QE0A 3RFCA 1ONPA 1TPYA 3VKFA 4US2R 4BP8A 5DHFA 1U28A 1CXZA 1ISSA 1MU0A 4L85A 4LOJA 4B8YA 5DNUA 1DAOA 4YAJA 1E2DA 4LJ5A 3WQHA 1Y1SA 4XIFA 3QVMA 4B6OA 1NONA 3MGGA 4C43A 4MS3A 3EA5A 1IQRA 3DWFA 4RS3A 1F1JA 1EVEA 2A9FA 1JR3A 4UW9A 4EKNB 3GEIA 3GEGA 2IVFA 4J0IA 2P4UA 4LTMA 1QYDA 4M55A 1GITA 3B13B 1P75A 2G25A 1FMLA 5KWEA 1XI2A 1G55A 4ETNA 1Z37A 1FL9A 2HNAA 3P9KA 1GTRA 2P9JA 1TQ8A 5T4BA 5CVVA 1EFDN 1W4LA 2FLWA 2QG9A 3GRZA 3W6PA 5HFJA 3LL4A 4JOBA 4E5KA 5EMMA 1GNRA 4IF6A 1H4SA 4B73A 1E2LA 2XUHA 3EBOA 2M6SA 4EJMA 1WBBA 5ALJA 2PAAA 3M6AA 4BIMA 1DI0A 1CHDA 3F97A 2QV0A 5C1IA 3UJ6A 2FJPA 2NAFA 5LB2A 2ZJZA 1C1DA 2ZU0C 5BOVA 2WM3A 4OHZA 4IVQA 3S1AA 1YR9A 4BNLA 2K2WA 4JAVC 1IUPA 3TDMA 1RI4A 4UBJA 1LDYA 2BMFA 4QU9A 4WI1A 5BSRA 3IT3A 1KK3A 2Z56A 3QWHA 1PJSA 4IXNA 4RYLA 3TW4A 3NOXA 2O8CB 3DDCA 3CT4A 2ZIAA 4UREA 4DS3A 5LLTA 721PA 2RMKA 2PXXA 5AVRA 1Z0DA 3PC8A 4KNWA 2A86A 1J0XO 2GBLA 2ODQA 3OM8A 4MICA 3OAAD 4Q9AA 4YR7A 4QOGA 1FJXA 2FETA 4KQCA 3CRNA 2V0NA 2HY7A 3FPHA 3IBGA 3IKLA 3T3EA 1YK1A 4OF4A 2AWOA 5LBIA 4XH9B 4ZQFA 4C20A 3UWDA 1JDNA 3MMSA 3A04A 2BGLA 4K6GA 4B81A 5JO0A 1U0TA 1PG0A 4DHEA 3RU3A 3DBVO 4R2WA 2FQQA 2A5DA 1M1XB 3ONFA 3KT3A 3L6OO 1XJCA 4FS3A 4OUDA 1O9BA 3EZGA 4C7MA 3U61B 5SYNA 1SQSA 5ENVA 1LI7A 1P2DA 5D3KA 2M6LA 2JLWA 1I6LA 2YBEA 4FHGA 2IYLD 2L82A 1VIDA 3D5QA 2YR0A 3P9NA 2C61A 1QX4A 1K3FA 3K71B 4B7ZA 1XROA 1FZQA 2OQIA 3AR5A 3VR5H 4DJ5X 4MCJA 5BN4A 4MB2A 3SXJA 4RHEA 4X8HA 2B9EA 1IBSA 1Z3CA 3AXSA 5JBNA 1TX4B 4NZ9A 1P1JA 2HUPA 2OCAA 4MKXA 5CDHA 1F8FA 1SN7A 4PXYA 5E95A 4LMBA 1AUOA 1TK3A 2PL5A 3GRUA 3A7DA 4WXHA 4DQUA 5GTDA 5IWAB 1NBHA 2C0QA 421PA 1IJEA 2MINA 1XPRA 3Q0TA 4DZTA 2RHLA 1EM6A 1XXLA 2Q3EA 2JFZA 4DDKA 1JF8A 3QMMA 3NGXA 1GA4A 2N75A 1ID8A 1BIFA 5HEKA 1P0CA 3VPCA 4JA0A 1W49A 4MJXA 4RPCA 2XLBA 4UVGA 1N6OA 4CIXA 4Q9JA 3M34A 1TEXA 4I0WB 2MT9A 4GBGA 1PR1A 5BWNA 3DONA 3NNNA 1T0PA 1FUUA 4Z9AA 4Y0AA 2NQ2C 4CCYA 2YV5A 2P3SA 1KAMA 2P9QA 2V3WA 3DE0X 1ZAKA 3HYNA 1P73A 1WKBA 3LPNA 4Q3BA 3A6DA 4TXMA 3UMRA 3VO1A 2RGRA 1CQJA 3UMBA 3THOA 1Y5LA 3WLKX 5FOVA 3K16A 4F93B 5ILOA 3PDIB 3JALA 1S1CA 4C4XA 3L9WA 1NF2A 3UTDA 3E9EA 4R8LA 4RGBA 3TF5A 4Y98A 5L40A 1BOFA 4NU5A 4AUEA 2C5AA 4WBSA 2VHQA 1UBUS 4KU4A 4IHAA 4BNDA 3QOYA 3A11A 1X7ZA 4JT9A 5BQPA 1UDAA 3BOSA 1IBMB 1ZITA 3V1KA 3HU3A 3NONA 3MGAA 2PRJA 4M49A 3ER6A 5HM6A 3N2GB 1ES9A 3AERA 3GY0A 5EIAA 4Q4LA 3QVLA 2VF8A 3G6WA 1N0IA 3I2FA 4P86A 1LVGA 4DCGA 3NUQA 1EJ6A 3R4VA 4B76A 2AQ8A 1BGWA 1JWAB 3GJXC 1DAIA 2F3RA 1P2TA 2O7SA 1S0UA 5AWFC 3WWZA 5K5EA 1Q77A 3EBPA 1RZRD 5JS7A 2IX3A 5DNWA 2AS0A 1RXYA 1S8FA 4QOSA 5TVGA 3V1MA 4C0KA 4LQCA 2ZUVA 5KU7A 4IIYA 3AR2A 2KWIA 2OAEA 2WG0A 1CT9A 1KI8A 1JHUA 4D0RA 3NLLA 3LDFA 3EFOA 4O1IA 1XCJA 3O8DA 4KDCA 5F3RA 3U39A 5SV2A 4LHZA 1F6WA 4Z86A 3V6LA 3NATA 1FP2A 3OQIA 1B23P 1Q11A 5A7FA 1O5OA 1PP4A 1BXZA 3DUFB 2H9IA 1AK1A 1WS6A 4YRAA 3U44A 4RKYA 2LZ0A 2O7RA 2QE7D 4MGZR 1ZOOA 3G0OA 4DCOA 1RYNA 4R16A 4YX9A 4Z0NA 2O8BB 1D1TA 5HJEA 3RV3A 3BE4A 3IMCA 3CUEF 4V02A 4E6PA 2O05A 2V6FA 1R5OA 5DM70 2GH1A 3BSSA 3HE3A 3CZ4A 2OXEA 2GD1O 3AU9A 1XZEA 4JVSB 2FSVC 2OUIA 2VRBA 4G0NA 4GL4A 1BHSA 3DDOA 4IV5A 4BVBA 3QK7A 3UWSA 3KUKA 3LVQE 2Y77A 5CU7A 3EDQA 1ORRA 4UVDA 2ZIVB 4M6WA 1GO2A 4DVGA 3PA6A 2ZRQA 4FYXA 4QU5A 2YVQA 1L0BA 1UADA 1QIHA 1RU3A 5FBLB 3IMKA 4UHEA 2MYUA 2PX2A 3L8CA 2PDAA 4DRXB 2PLAA 4CM5A 1DQPA 2V3VA 2O1EA 3BTSA 2H1CA 5KYYA 1P1RA 5FX2A 3ADCA 2JIZA 2JFGA 1W30A 5BW5A 2Q6KA 1FIUA 1OX4B 1NLYA 4YUWA 3B53X 2X0JA 1P1BA 1M33A 3VPXA 3L7KA 3P8ZA 4FR0A 2R2GA 1N0UA 3W5HA 4OCZA 5EWJB 1MOZA 5EEGA 2AN3A 4A5SA 2AEMA 5DK4A 1MJHA 2GPBA 1J24A 4MIYA 3RWBA 4E13A 5FQOA 4AJ1A 3HXQA 1QG2A 1DKOA 2O2ZA 3H18A 4K9KA 1SHLA 3LBYA 1JLSA 2MSNA 2EZTA 3KQTA 2YVAA 4N7RA 4XQGA 2CFOA 1XGKA 1UEJA 2CHQA 3GT0A 3N3BC 5EKUA 1L5LA 4ARIA 4RXUA 3E70C 3F9RA 2NUPB 2JG3A 3RIXA 1P39A 2D6FA 1NVEA 2C2GA 3ICPA 4DIDA 5C1DA 3H2GA 3T1QA 4N0EA 3VR4A 5B7GA 3OEYA 4LF4B 3W1WA 1GZ7A 1GCUA 1KJ8A 2O7QA 2AKEA 2H8KA 3IBSA 1E7RA 1ULUA 1OZHA 4RYDA 3SZOA 4JGIA 4Q3CA 1N4DA 2ONYA 4PC1A 4HCJA 5AESA 3EXG1 1L4KA 1A5AB 1ZOIA 4EBBA 5KOYA 4M7WA 3SQDA 2ZRJA 5M3BA 3KKZA 3L0YA 3OQPA 3N70A 4HNAA 1LK5A 1NRWA 4JZKA 4U6SA 5LD2B 3KL2A 3RVPA 2WJAA 4G0MA 2HNKA 5CT8A 4J2HA 1QYIA 2B83A 3OKCA 2YH2A 3EXG2 4FSXA 3NMUF 2X0RA 4P38A 4IQ8A 2FCRA 4M9ZA 3VVMA 4OXXA 4V1CA 1YIAA 3IX7A 4FZ3A 2GI4A 1DKQA 3UNXA 2ZSIA 2C2MA 2WZCA 5CNIA 4CL0A 3ML1A 3O3MB 4DR3B 2QL9A 3NYQA 2NWQA 3SZRA 3QE2A 5DI3A 2LCIA 3BT7A 1QNFA 2GCOA 3KKLA 3KEFA 1DEXA 1X14A 2I2DA 1HRDA 2F62A 3TZHA 3HJCA 3T7DA 4F06A 4ZKEA 2POQX 3UXMA 1F2TA 2ZRDA 3OPYB 2JAHA 3DPUA 3EIXA 1QVVA 1ZAYA 4ER0A 3PXCX 8ABPA 5IKXA 2GFQA 1XV5A 4N5LA 1EFRA 1T6XA 1NNLA 1V16A 5JSFA 1EFTA 2VA9A 4ES6A 1E1MA 4JL6A 1RVDA 2BMVA 4L8VA 2XDYA 3IQWA 4KNYA 3RUDA 1C14A 2O2JA 3LDAA 1OX6A 3HSKA 4IDNA 1R8XA 3H0CA 4D8XA 2P5YA 2VF7A 3UJHA 3TRKA 4B4VA 4GPIB 1UBRS 1H05A 2VHJA 3TOVA 4MPPA 2Q3MA 3PGMA 1QK3A 2JGJA 3P4XA 4PYMA 3R9XB 3FSGA 3OO0A 3W2FA 3OI7A 1F4LA 3OPQA 4PSCA 2Y99A 1G1MA 4BLPA 4CBVA 4CEJA 1QDEA 1V71A 1JBEA 1AGRA 1FXWA 5DRTA 2IK8A 4H2DA 4WW0A 4OYHA 1OVGA 4BHTA 5EYPB 1KEWA 2BR5A 3ZCPA 4AO7A 1BVYF 2CVHA 2JAWA 3E9NA 1ODLA 3GEMA 1CVRA 3IRUA 1MB2A 4F2WA 2JCBA 4P7BA 3DE5X 1V96A 3VKUA 4R2MA 5JD4A 4CF5A 1KP9A 1U3TA 3BUSA 3F73A 4ZCSA 5LD2C 3HYRA 3ND8A 3PVZA 1JPJA 3BREA 5JD5A 4B0OA 1FW6A 1YV9A 4QDJA 5CG2A 3EXHB 3OTOB 1RI5A 3IPAA 3P5BA 1P29A 3CSDA 3KKMA 1JG6A 3ND9A 3W6NA 4AB1A 3H9JA 4R69A 2I2BA 3D1JA 3JQ8A 3BZWA 3QKRB 3URKA 3V9AA 2J5KA 4RKRA 3WV4A 2PGNA 4CLRB 1DFGA 4AULA 3E5NA 1K5GA 5SICE 1RCFA 2NO9A 3R41A 4KQIA 3I92A 1WL8A 3TJMA 4A3SA 1JIUA 3ET5A 1E3EA 3N2KA 4Z4CA 1NMEA 1SU4A 3E7DA 5CA1B 1ISIA 5TQ2A 4C6SA 4NYJR 3BRSA 1QOPB 2YN2A 2ZYIA 1SUBA 3JQPA 4BNVA 4CN8A 2AFIE 3EW9A 1LDGA 1T1GA 1NMSA 4J0KA 1KOLA 5KQPA 3C4VA 2NU9A 4IQ4A 3I04A 2C8LA 4BAZA 2UXBB 3E18A 1V11A 4UKDA 2IH5A 3JQ7B 1ONOA 4U5QA 4CMIB 1G20A 3WWCA 2AOVA 2UXCB 1JJBA 5BRAA 3IEVA 4UUNA 3VDMA 1GTMA 4XD7D 3ZOKA 3FOFC 3JSAA 4PWZA 2ZCVA 1N6HA 3VPAA 2WTUA 1I3KA 1DWPA 1SBYA 2GEJA 3PX3A 3SEZA 3SLKA 4D4HA 4EVQA 3HZOA 4UQLA 3H2IA 4C21A 3TZ6A 5A05A 2H17A 3TINA 4HAOA 4D0LB 4F6LA 4DDUA 4CFYA 3FPBA 5B3KA 2HT1A 2IXEA 1MEEA 1N7GA 2REBA 4OTZA 4XPIA 4ZICA 5L7WA 5D3QA 4QIHA 1T29A 1TF7A 2I7DA 3PJGA 5EKTA 1YQXA 3OQ6A 4AUKA 5I4KA 1RJFA 1X74A 3KFLA 3CWQA 3LW8A 1VI2A 2QRNA 4KOAA 1OR8A 3RSCA 4DV3B 4UUQA 2M1XA 3IVXA 5A7GA 3AFHA 3BXFA 1M2KA 2NZJA 3I9JA 3MD0A 5JMOA 2MR6A 1JA9A 3MUNA 3A6PC 2X9QA 1DGQA 4PZPA 2VG8A 4N3NA 5HNKA 4BY9E 5DX1A 2CYBA 2ZITA 3UOGA 2C00A 4PAQA 3CVVA 1T6BY 1QPZA 2WHYA 3UO8B 4RSHA 4YA6A 4YXFA 5KJ6A 3IUMA 3L0DA 5IK2A 3ZZNA 4GPAA 3AG5A 4QRIA 3TE6A 2JZCA 4KPUB 3S29A 3UJ8A 1KIAA 3PXBA 1S6YA 2R48A 1TCVA 1E2HA 2EDAA 4R1TA 2FP3A 3TXYA 3ZDBA 3EYWA 2QTAA 5IX8A 1NVFA 4O2AB 4TLCA 4HNTA 3HA2A 4L3WA 3QVUA 4WLEA 3RO7A 4AAYA 5JAZA 4LTDA 1YHYA 3MERA 2R6JA 1NATA 5D5PA 3Q85A 2FFQA 1K08A 1DOZA 2AG8A 1NI4B 2KLHA 3A4NA 2GF2A 1TE2A 4QJ5A 1A4UA 3KU1A 4CF3A 3IL2A 4H77A 3M6VA 3IO3A 2CWDA 3AR8A 3HSYA 1B0UA 1XZFA 2CN1A 1EB8A 3E2PA 1JAIA 3HGTA 3ZV7A 1MH9A 3I2GA 4YT8A 1IHYA 5FR2A 3C1OA 3NXKA 1T8YA 3U7QB 3R5HA 4PFKA 5C7LO 4BVLA 3N8KA 4PR3A 4HB0A 1BHO1 1JE0A 2GLXA 4RU1A 4Z9BA 5J63A 1OV4A 3NH9A 3K6RA 1TIBA 4X97A 5KYTA 3WLSA 3LP8A 1RBZA 5FUVA 2XUAA 5KDDA 2PGJA 3PD0A 4QSHA 2DWUA 1TMKA 2XQIA 3WIVA 5K3CA 2H57A 4OHWA 1MV5A 5AW3A 2P8SA 3NV9A 3H13A 5CIWA 2EHJA 2BKXA 3PGJA 3MMPA 4HUTA 1T9ZA 3FCXA 1CSEE 3TR0A 1WG8A 1XPOA 2NYUA 2BELA 3L0BA 4Q9IA 5D1HA 4CYMA 3RC8A 4DLAA 3LCMA 3ISVA 2VNKA 5SZJA 3AKCA 3QW4B 5TLSA 4GQIA 1SK9A 3UKOA 2OCPA 1OH8A 2EBWA 3K5HA 5TX7A 5C35A 4V03A 2WK1A 1T5OA 1N6RA 2DBQA 4D79A 5JTUA 1ECBA 4XGIA 5A4JA 1IZYA 1C3OA 1TDJA 3PGXA 2JIMA 2DUUA 4UBMA 4FVTA 1SKUA 3AYZB 3ZZ0A 3KRTA 4BMZA 4KHZA 1A9PA 2WQZA 4WLVA 3L8EA 1TKRA 1M2GA 2NU7B 2LKDA 3L4BA 2OGTA 2IDZA 3RTCA 4G3XA 4U0JA 3BDIA 3N86A 2WU0A 2J9RA 3ZJTA 2PNJA 2C0CA 4YAFA 1UZUA 3TK1A 4KTVE 2X7XA 1X1TA 3BTVA 3JD1A 4V0NA 5BR8B 1XEFA 1EUCB 2MMCA 5I8ZA 4QUAA 1XVVA 1OTHA 1PR9A 3K15A 1GSHA 4IRXA 4O8ZA 4BGEA 5DCWA 1ACLA 2AFVA 5IARA 3HCDA 4OJQA 3U5TA 3C6XA 1BS1A 4GT1A 3WGQA 2FX5A 1H2HA 3FZGA 4UTNA 4X41A 1YR7A 3EMBA 2M6RA 3LFUA 1IQ0A 2GS9A 2XX3A 3S2ZA 3F2VA 3GHYA 4KWIA 1ZGAA 4E7PA 3WLFA 2FFJA 4IILA 1Y7IA 1QGAA 1YDMA 3RAJA 4MKIA 1W5FA 3IE2A 1ULSA 4LF5B 1BE8A 3HA7A 3QUCA 2WDPA 1P31A 1E1LA 2JANA 1QGOA 1SA0B 2EQAA 4OQMA 4WBXC 5CGZA 5ERGB 3QFHA 4MDFA 2BTEA 1YSCA 4AFNA 1X3SA 3WIOA 4GXRA 1ABEA 2BVNA 1W4CA 3F78A 4PFJA 4U1RA 5DT9A 4AJNA 2JNWA 2Q1WA 2YHSA 3AM5A 3BDAA 2DWOA 5E6SA 2JFVA 2Q6TA 3R40A 5CX4A 1HSZA 4NATA 4HNQA 3OFNA 821PA 1B8OA 1J2UA 5DYTA 4YAWA 5FNVA 5BN5A 2A1TS 3IESA 3AEQB 3LPAA 2V58A 3R3ZA 3G8DA 4UPEA 4M7OA 3HP7A 1BQEA 1QIGA 1GQSA 2H31A 2QLMA 3S0JA 1QGDA 4IFBA 2OC9A 1PZXA 3GA7A 3OFSA 4E5YA 2I9KA 2PGXA 5EG5A 1NJ6A 2F8TA 5CITA 1KVRA 1YDFA 4LJ6A 2JHAA 4GP9A 3TRDA 1UOQA 4F8JA 1GTJ1 3L04A 3B3GA 3O8NA 1CEQA 2D2VA 3E23A 5H83A 1AX9A 4LJRA 2EVWX 4HX9A 1NE2A 1UKEA 4BMPB 1K86A 5IUNC 1IEWA 1HE5A 1FP6A 4J3FA 5E6RA 4RQTA 3ZGLA 2WYOA 3EIEA 3FN4A 4OB7A 5JADA 1D2AA 1Z29A 2V7WA 3L3BA 2XAAA 3O1IC 3CJTA 4NONA 1Q0LA 4IEEA 4QTTB 3EWAA 3U3XA 4D8VA 5K3DA 4RD0A 4BRWA 4IBOA 4JV5B 1U81A 4JJZA 3PEWA 2GPTA 2FN3A 4EHBA 3G8YA 3AF6A 2EW8A 2BGUA 1X86B 1IUNA 3VO8A 2PL3A 4IIJF 3EG9A 3MWLA 3W5SA 1JHZA 4RSRA 4BX2A 3NKLA 3DL2A 4ILEA 4TTTS 4MVJH 5T57A 1AF7A 4XSHA 1DIGA 1KY4A 2FUG6 3CB4A 3M6UA 4P9NA 4QPPA 4RKWA 3HK2A 5K3EA 1EHCA 1TIKA 3DS8A 1P80A 2EKPA 5TMDA 2O0KA 3CH7A 3H1BA 1BE0A 1GRNA 4AYTA 2XYQA 1NP7A 1ZMXA 1Q14A 2GPNA 2QX6A 2V97A 1GKLA 1IDOA 4Y6PA 3VX4A 1MABA 5JS2A 3LXUX 1YCDA 1DARA 4BNGA 4AZ0B 4YFYA 3PGA1 4O08A 4O33A 3VV2A 5HZKA 1H8HD 1X39A 3CXUA 5JXIA 2R751 1NN1A 1QO9A 1AMUA 1V1MA 2HIMA 3AV0B 5IVDA 4N49A 5CRIA 1R7RA 1UCFA 5KOIA 1ZUNB 4RANA 5JVDB 2V1XA