2OV6A

The nmr structure of subunit f of the methanogenic a1ao atp synthase and its interaction with the nucleotide-binding subunit b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MELAVIGKSEFVTGFRLAGISKVYETPDIPATESAVRSVLEDKSVGILVMHNDDIGNLPEVLRKNLNESVQPTVVALGGSGSGSTSLREKIKQAVGVDLWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type ATP synthase subunit F
publication title NMR solution structure of subunit F of the methanogenic A1AO adenosine triphosphate synthase and its interaction with the nucleotide-binding subunit B.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Hydrolase
total genus 23
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2ov6A01
3VR5H 5KNDH 5KNBH 2D00A 5KNCH 4RNDB 3W3AH 2QAIA 2I4RA 4IX9A 2OV6A 3VR4H 3VR6H 3AONB
chains in the Genus database with same CATH superfamily
2LCFA 3ENWA 3UFXA 1YJXA 2ODPA 2Q1TA 3SQWA 2J9ZB 1S01A 1V47A 1FLNA 3N0XA 2FQ1A 1TM2A 2FQWA 3T99A 1AKQA 1CE8A 3I9V1 3P94A 4DSUA 3ADBA 5B3JA 1PZNA 2GZ1A 2W6ZA 5CITA 5DXFA 3RVPA 4C7XA 1TFRA 3G5MA 1MA3A 4OP2A 4G0PA 4CL2A 1PKXA 4MO9A 4D96A 2O5CA 4R2KA 3AB7A 4UBJA 2PMKA 1D2GA 1JEEA 1KC3A 3HRKA 2ZI6A 4MUGA 5ALQA 1DIAA 4KGXA 5TRTA 1R7RA 3T0GA 5TMBA 3WJ7A 1TEZA 1UZLA 5MGBA 2OCDA 2X9GA 1I3KA 4HDQB 1MQAA 4G07A 4G01B 3B3GA 3NI2A 3VGJA 2RGAA 2PYZA 2KBFA 2PUEA 1S7CA 2V7WA 1NQUA 1X13A 4CLHA 3TCXB 2FEMA 2RI0A 4LBYA 2E4ZA 3EOAI 1BXGA 2XKJE 1CWUA 3PFCA 3SSAA 3DZFA 2J5BA 2CVQA 2ILVA 2JJ8A 2X8JB 1ZEMA 1YDHA 2Y1WA 3C6YA 3ILXA 3SDBA 2GM3A 2Q46A 4S1WA 5IJWA 2C78A 3FLAA 2RBGA 4RA9B 1Y4DE 4Q7JB 4G5GA 2FYTA 1MB2A 4DY4A 5KMGA 5EKXA 1G291 2H4WA 1LLDA 2YMMA 1P29A 4X9XA 2G28A 3VR5H 1CULC 4W6ZA 1QBKC 3GXOA 3THWA 3HR8A 2QU8A 3R0ZA 1EP1B 1X87A 3P9RA 1SBYA 3SC2B 5IRCD 2AFHA 5IVHA 2QW8A 3GYBA 1W0CA 1YIOA 1APBA 4B83A 4G1BA 2EZUA 4ND1A 5IC6A 1YS9A 5LJLA 1IK4A 5C1DA 4NECA 1OXSC 3EXEB 1DADA 4M1EA 3WBFA 5H3LA 1ZUHA 3FDZA 3W7AA 1GPNA 1CHNA 2E85A 3F4BA 4TV9A 2FMXA 3WLPA 1XHLA 2PKQP 3D6NB 4ENWA 4Z5XA 2QM7A 1WF3A 5FUYA 4QTYA 5JC1A 1V1MB 3VYUB 1T3HA 2IDZA 2OD2A 7REQB 2XZPA 1N8KA 1NBMD 4ZT7A 1I9CA 1L8OA 2Q3EA 3H1EA 1Q2XA 4AZSA 3F47A 4BMSA 3KO8A 1GQSA 3Q9LA 4FE7A 4HNAB 4DM3A 1MV5A 5BN4A 3H0KA 5CEFA 5CDSA 3KKKA 3O31A 4RXTA 1PEYA 2QI9C 5IKEA 2Q99A 5JI3E 2JKVA 3GLGA 5HYVA 2OE2A 5LUAA 1L3BA 1YBFA 2Q4BA 3O4VA 2WJ6A 3EXHA 1YFKA 2GCOA 4JD5A 5DSTA 2IU6A 1IY8A 2VA9A 1HDRA 3PG5A 3FA2A 2AXNA 2NZ2A 4JXKA 3DCJA 4R7GA 1DC4A 4R8RA 2JI7A 1RC8A 3GNQA 4LG1A 3RBAA 4Q01A 2YFYA 4FCTA 4DCCA 3EA5A 2I4RA 4FSHA 4I3HA 1H93A 3ABOB 5HWSA 3RIHA 1YDGA 2W37A 2QROA 3FVRA 2RJ3A 1AKYA 1L8QA 2NIPA 4R8LA 1QUEA 3DFUA 4JHXA 4WOJA 4KQXA 4XX0A 4QG3A 1MOZA 3THXB 1LWOA 2F1RA 2PKYX 5TT0A 4R98A 2FEOA 4BO6A 2OHHA 1T2UA 1FFSA 1N2EA 4OKNA 1XFDA 4YPVA 2ID8A 1JXQA 1QJCA 3FZNA 2IXGA 2O19A 3WAJA 4RVCA 1JXOA 3AFIA 3QMPA 3P2OA 4JIMA 1TMGE 3EZFA 2RC6A 2PX8A 3DMFA 3DT8A 4GRAA 5DYWA 4P7JA 1DQRA 2RBKA 1W0KA 2G77B 3WTCA 3ZZNA 3EZYA 1T8SA 3GN1A 3IAFA 5ALFA 2OR3A 3D1VA 1BA2A 1H6AA 3OQPA 1JWAB 4JP5A 4QARA 3NKLA 5F33A 4K6CA 5HGJA 3G2KA 4LJ8A 2Y0EA 3KJGA 3CUVA 1ZD3A 2W4IA 3SVZA 4GLOA 1P61B 2YQ5A 4IQFA 3SQDA 2QVYX 4WGGA 4I5IA 5B3KA 3AY0A 3K9NA 1EH5A 4WJZA 4K0KB 1HE5A 4ZAVA 4Q9IA 2JLYA 2YCLA 4ZCTA 2ID4A 3HR7A 4D02A 2F67A 1VLJA 1P31A 3LT1A 4GOKA 3IUYA 3JWPA 3C87A 5CDTA 1O6CA 1P4HA 2VJYA 1NKVA 4WOBA 3TO5A 4E6PA 2D5BA 1N2JA 2J1LA 3SX4A 1ZD8A 2OCPA 3NM4A 4GRIA 3AJ8A 3V3KA 3JQEA 2OB2A 3PFKA 4KN5A 1H65A 3KAPA 4E2FA 1VPLA 4BGEA 5K0CA 1RPAA 1ZLXA 1PBNA 1PQYA 4HZUA 1T4CB 3E4CA 3NANA 5HA5A 2BJVA 2H65A 1VFNA 2WD9A 2CLMB 5DBEX 1OXVA 3WGHA 1OUMA 5BYKA 2JFQA 2WHQA 5MN4A 3TR5A 2I2AA 3T7TA 1MQ8B 1P1IA 2FUNB 1R0LA 4N0EA 5FDFA 1S8AA 1COWD 1FFXA 4QXAA 4DIFA 1Z22A 4WESA 3AY3A 3EBLA 2ZYTX 1E4OA 1DJLA 1STOA 4YAFA 2PU7A 4GOLD 1L7VC 1D2HA 1TYDE 4EUKA 4NCAA 4WLVA 2Z5GA 4UQLA 1CJMA 4OBWA 4WZAB 3HJTA 3LG2A 1EXNA 1NXWA 4A92A 4EB8A 1E9EA 1UDRA 4D79A 3KTFA 1IBRA 4FZ3A 4KXXA 2B1GA 2XUGA 3BGOS 5TB5A 3UKOA 1B0ZA 4KVFA 1QANA 3I9NA 3SOPA 5JQGF 2DB3A 4WY2A 3USZA 1XU4A 1KDRA 1QBGA 3NT5A 1HKUA 3PUKA 3JWJA 3KLNA 1SD1A 4CDGA 4Y3UA 1BHO1 1USKA 2IJGX 3OQJA 2R00C 4NQZA 3W4KA 1P2TA 2NYVA 4ER3A 2Z4TA 2I87A 5I7RA 1ZX1A 2C7GA 2ZLBA 4C0WA 1WO8A 3OECA 1UIMA 2IRWA 1R4NB 3KHSA 4M36A 4DWOA 5JADA 1WZ2A 1TC2A 3EEFA 1GQFA 4F6RA 3LDHA 4WN3A 4CF5A 1YZYA 3KQKA 2VP0A 3M49A 4UXHA 1FUEA 3URKA 4X1KA 1C9KA 1JLMA 1KAEA 2NUTB 4HB4A 4TSRA 3ZJYA 4CF3A 5BV8A 5C18A 2XTJA 1JQAA 2IK8A 3L46A 4J0JA 5E3IA 1Q0HA 5ELMA 5EJ9A 4NIMA 1U1EA 5E8RA 2VZ0A 4BO8A 2PQMA 1EUDB 4UKDA 1JAIA 1KJ8A 1KXZA 3BKXA 1QAOA 2NT4A 2R47A 2ZFUA 3VR5A 3VYSB 4D6YA 4G0WA 4GP7A 3VISA 1O96A 3HABA 2DY0A 4GYKA 3C6BA 2AN1A 4X64B 9ATCA 1ATIA 3KL2A 1IM8A 5AJVB 4DT1A 1GZ7A 1SPBS 2JGRA 3G1TA 4TGLA 1OHHD 2W48A 1YNSA 3F5DA 4NDZA 2ACWA 1JHOA 3UC9A 3H2BA 3JWEA 2CVFA 5HCNA 3WZLA 3TIIA 5K5EA 2FFRA 2VP5A 2R6HA 2VOJA 4H1TA 4ZC1A 3D2AA 2GXUA 2Y6UA 2ZPAA 4R51A 4H7EA 3JQ8A 3I2JA 4J6FA 4CEHA 1EBFA 5KOJA 1F06A 5GONB 1XJ0A 2A2ZA 2BMDA 2QAGA 4FFMA 2BMJA 3JRXA 4FMPA 4XFJA 3CEPB 3T3PB 5EHZA 2HMUA 1OCEA 4N3AA 2BH9A 1N2CA 2Q0SA 1A5SB 3T1QA 1GUZA 2Q9CA 2WD7A 3MJ4A 4PNHA 4PM4A 1RCUA 3HCFA 5DYGA 5F5NA 2RHTA 1L7XA 4ZIRA 3H2SA 1XAJA 2IEZA 1TA4A 2DUJA 1VJ1A 2LRHA 3PPXA 3AJDA 3N07A 5FUQA 3BMCA 3IALA 3QH4A 3EQ7A 3A6JA 1CQPA 5CAEB 3ZV3A 1HG1A 2QPAA 4UCXA 3GLFA 2OVFA 2WYUA 3L6EA 2B8WA 3L7BA 4M9ZA 1MABA 3OP1A 4KLAA 3CW2A 4KSCA 4UBIA 3RVLA 3T9FA 4RVOA 3RF6A 3CIFA 4EG4A 5E1DA 3MWDB 2CLCX 1PL7A 5SZIA 4KK4A 3ZXUB 4UQPA 4EZBA 2WIAA 1X19A 8ABPA 3U4QB 5DCYA 2GEUA 3B20A 1MO2A 3DB2A 5K0NA 2DUNA 1C30B 3QIVA 3KFVA 4RF5A 2XSZD 1EB8A 1WLSA 1VI2A 4QPZA 1OWLA 4RTQA 4IIUA 1EBBA 1DHTA 4ED9A 5KB3A 1XDGA 3ANTA 1P2VA 2QD5A 3EGOA 3LNCA 3N70A 4I1OA 5TQ2A 3T61A 3H8JA 2UYGA 4R31A 4YJ2F 1VHDA 4QULA 2WG1A 2EW8A 2AYXA 1PR5A 2NM0A 1X8LA 3EWIA 4FIZA 4RCZA 4UNNA 3D7LA 1M6NA 3WIVA 5JECA 4BMNA 1B1CA 1VJ5A 3HKCB 2ZSIA 1OFUX 2Y4NA 3FX2A 4DNFA 4KR0A 2IY9A 3OSUA 1X94A 2BM8A 2I1LA 4U00A 4ZKEA 2XAAA 3F46A 3R1IA 1T8RA 2ALJA 3FYTA 1JH9A 1Y33E 3K8OE 5EZSA 4MDEA 4YXFA 4DV0B 4R81A 3GRKA 1T25A 3L84A 1WL8A 4R01A 3AK4A 3B8HA 5K4AA 1O6ZA 4OGKA 4YHHB 2K4MA 1GYQA 5CT5A 4L0DA 5IT4A 1R88A 3VTZA 3S2IA 4DMGA 2OKCA 3RK1A 1KETA 3A7EA 1HURA 3MTGA 2ZM6B 1XMQB 1RKUA 1XBTA 2DQYA 4D98A 4OSOA 4BUCA 4F3TA 2FPXA 2NPIA 4KPUA 1Z7WA 4KWIA 5KWSA 5D1NA 4TZ6A 1ECJA 1XKQA 5G4KB 3QUBA 3V8MA 2QX9A 1KXJA 3RBVA 1FE8A 1E1KA 2QM0A 2W6OA 1RLOA 2HKIA 4YT5A 6REQA 3EASA 2OWEA 2H54A 2QN3A 4A36A 4UE2A 2H48A 3HVKA 3MOIA 4BX0A 2YJ6A 3HVUA 5CW1A 4BGDA 3RVSA 3K2EA 4MW7A 4QXOA 4UM7A 2QUJA 1K8QA 2WT4A 3H9QA 2BTQA 4AQDA 2EHDA 2IYUA 4QODA 3AWDA 2HFKA 6ADHA 2Q6OA 4LECA 1R4AA 5LZ5A 3DVSX 5L8VA 2E4WA 1XZEA 3NHZA 5B53A 4AJLA 1VKJA 1XO1A 3GBPA 4P31A 5JAPA 4I3GA 3A1TA 3NBUA 4Q66C 2I4LA 1AS2A 4JZYA 2DECA 2C0CA 1KEEB 1Y4AE 2HQBA 2JFXA 4LYJA 2XOKD 4OJYA 4ZOEA 3ZZ0A 1XNQB 1QP7A 2JRCA 2Y77A 1S9DA 1V6AA 2PYIA 2V96A 3AUKA 3REQA 4ZK2A 1IDOA 2AEFA 3WNBA 1R0XA 3KXPA 4BEJA 2XT0A 5LA6F 4HEJA 3UYKA 4JSRA 1I24A 2PPLA 1T9GS 3K1YA 4MGHA 3TSCA 4E5DA 3K6SB 2XGSA 2I2CA 3MVEA 1YWGO 1EFRD 1I4WA 4YRFA 2J87A 4Q12A 3SE7A 4P34A 4EHLA 2VQFB 3WFZA 2UV8A 1TAGA 5C8VA 1DEOA 2FFAA 4GX5A 1XTQA 4KYTA 1IL0A 1E98A 1UDXA 2CCKA 3KT8A 3H05A 1DI0A 4FFOA 4IUBS 2CE7A 2E21A 5LQDA 4UE3S 1Y9ZA 2UVPA 4FHCA 3MUEA 3A6ZA 3N1UA 5TX7A 4LSWA 3OJXA 1HYQA 1L7NA 2R7MA 2NUAB 3WICA 5L40A 3S8EA 2FI1A 2AD1A 1UJCA 3PT5A 3MINA 3HKBB 2IYWA 3QTTA 4H31A 1W0JA 4DREA 3L8GA 2ZRGA 4AM8A 2BCGY 4MNTA 1S3GA 5IN5A 5IU6A 4N5NA 1KFBB 1LQ2A 5D3ZA 3K8ZA 5YASA 4AJIA 3W3AH 4C3ZA 4EQZA 3STWA 1O8CA 4HXEB 3OIVA 5FF9A 2OV1A 3QKUA 5CT8A 3VAYA 2ZJOA 4UUPA 2XW6A 3GF4A 4IVRA 5IULC 3PQFA 2B1JA 1QLJA 4G67A 2DAPA 2WSMA 5BWCA 3BD8A 4A8HA 2YIDA 3A0UA 3B9QA 2E4AA 3Q41A 2IEAA 2JGJA 4RPGA 4XFKA 4GPEA 4URWR 5KEIA 1GRRA 1HLGA 1VJTA 4HTAA 3H9JA 4TKVA 1NBAA 4OU5A 3HXQA 3QKTA 1FRZA 3KBBA 3FRHA 1XNHA 4H16A 1VRVA 3ZW7A 2HU2A 5JC8A 2XWJI 1UANA 1JECA 1UOQA 5DM0A 2F8SA 4RDIA 4KXQA 1TO1E 3CW8X 4TMZA 4ZCRA 1OB5A 2FRDC 1X2BA 4B0OA 1SQ6A 2FPWA 1GZDA 1DUSA 4XFDA 5BMVA 4XWGA 3X3HA 1OLUA 4JT9A 5A5EA 4Y6GB 3CB4A 2G82A 1RSZA 5CK5A 3JQQA 4JFRA 4LEIA 5T3YA 5IJZA 3NGMA 5FFMA 1BDJA 4ZCIA 2WPDA 3HBAA 3KYCA 2FGKA 1PSZA 3MTEA 4K6GA 1W85A 4Q15A 3EUWA 1NC3A 4GEKA 1Y1KE 1GA6A 5K0EA 5KJ6A 1RZRA 4TV8B 4EI8A 4KQ2A 3ONDA 2UUBB 5IDQA 1ZD1A 2VDWB 2H4HA 1EVKA 4HMPA 3TLXA 1DG1G 2ONYA 4MVCA 1N7IA 4JBXA 1EFUA 1LCIA 1LVHA 2HMVA 4Z4EA 3QXHA 2ZT6A 3WK6A 7ABPA 1SHUX 2BEWB 3QLUC 4X6LA 2IDJA 1UKZA 2UYHA 4W99A 3PYXA 5K3FA 4D5EA 5CA1B 5THKA 3N8DA 1DV2A 5AUNB 2ZQYA 3J80A 2B5OA 2HSJA 3E7XA 4YO7A 1RP1A 2EW2A 3D2CA 2DFDA 4JSYA 3PDJA 4PZ0A 3FW1A 3INYA 3D8UA 1U9JA 3LY8A 4FEGA 4J03A 4GVPA 4OGWA 5DBOA 4NAVA 4F60A 1IWBB 4IGFA 5I9TA 3WHIA 2J5QA 4DCVA 4NC9A 3UWDA 2GCGA 1DAOA 2HLPA 1A2BA 2ONZA 1C0KA 1EFPA 5I4BA 5BUSA 2Q41A 2HRQA 2ZXUA 1CY7A 1DXYA 3ZV6A 4EW1A 1SCJA 3CJRA 1U9IC 1I0IA 2GGSA 3DBIA 3ZV7A 2H9IA 4DZTA 1E2BA 3ZNOA 2CNOA 3DE2X 3RU9A 3ESRA 2QORA 3ZY6A 4FN5A 4AJ9A 1TU4A 3AY7A 4PN3A 2GN2A 2OXEA 1ZGBA 3BSWA 2XYRA 5A9RA 1XXHE 1VG1A 3KZKA 3R44A 4FKBA 3NHUA 4JLAA 2GYUA 4Q7LA 3UQZA 3VUEA 2O3QA 5CHYA 1GGJA 4WK6A 3OZIA 1TGYA 4NK5A 4OA5A 5FA6A 4O1MA 4RZ3A 1Z4MA 2ZUBA 4F4DA 5LIPA 2P6PA 2YUIA 2YS6A 5BNTA 1T5OA 5HIKA 1UR5A 2OTCA 1E4VA 4PBRA 3MWJA 1TQ2A 4WKCA 3RC3A 1LK5A 4LTMA 4G2TA 4Z86A 4YUVA 2F43B 2VCYA 4F97A 3AKCA 2X23A 3GQVA 4DEYA 2NYRA 2ZB7A 2J7PA 4M55A 3ETGA 4UNSA 2O23A 5E1BA 3ECSA 3UMSA 4DANA 1H6DA 1ETHA 2ERYA 3ETJA 3U4CA 4ZYYA 3HB7A 1S6YA 2IITA 3GN2A 2QPLA 2D6FA 1A9SA 1Y4ZA 3OPYI 2XD4A 3I2IA 4I81A 4LC1A 2IIVA 821PA 1C1YA 2DR0A 4DB2A 2OGTA 1M0TA 1YBHA 4GMHA 3C8ZA 1X3LA 4RKFA 3TL3A 4TYYA 4NOMA 5B2ZA 1UAAA 1PJAA 5JXGA 3C45A 1FP2A 2QZJA 5KU7A 1N6RA 3PJGA 3F6SA 4H77A 4M1MA 4U2CA 4LFCB 3R5TA 2WTXA 3KEOA 3HJNA 1SCUA 3FHOA 1RT9A 4WLNA 3TTWA 2D59A 1CW2B 3A27A 1AC5A 2WI8A 3ULKA 2X1VA 1EXDA 5A5VA 4YVFA 4FMCF 4KR9A 3Q87B 1P8JA 4HWTA 2VRCD 4YJFA 3IYLW 1HM5A 1IB0A 2FEAA 4UJ3A 1B42A 3HLYA 1T2FA 3N3BC 1WCWA 1ZW1A 3AERA 1B0UA 4PBSA 4CZ2A 3V8VA 2CMGA 3OLXA 2O1EA 3CS3A 1KO8A 1NNSA 2WFMA 3AUYA 1GDDA 1MP0A 5FBHA 3WRWA 3VNSA 1NNI1 4FDTA 5L95A 3IEMA 4IINA 4IOMA 1A9RA 3MMZA 3KDPA 3KJHA 3T54A 4BVAA 3LUBA 4NBTA 1GITA 2AR9A 1Y1QA 4AJ2A 1E9CA 3OCWA 5DOVA 3UHOA 5CFMA 5JMOA 3P9ZA 1CS0A 3P9KA 3ITNA 1HF3A 4INZA 1ELOA 3N86A 2I6XA 2MSKA 3PXCX 2X4LA 4V3BA 2AHRA 4ZJYA 2XB6A 4NCXA 5CFPA 4AIRA 3JPWA 4JUFA 4E30A 4FGWA 4I8DA 1T29A 2CFRA 4DGQA 1K8RA 1ZJJA 1BFUA 3V4PB 5JXHA 2WB4A 5HZMA 3JVEA 4A1OA 3GDGA 3LCCA 4R68A 1EM8B 5A3RA 4MZDA 5IP5A 4MUKA 2PANA 3TMYA 4WK0B 1ZP6A 2C9YA 3A10A 4U9IS 1X1AA 2WKQA 3RABA 5HVNA 2EAUA 1TE2A 4Y2QA 2X2PA 5IJ0A 4FEYA 5BSKA 5GPBA 2P3QA 2AWNA 4FYPA 1FZQA 2W2KA 3BJRA 3Q11A 4YCJA 3C24A 3QGMA 3W3AA 5ALTA 1CVRA 2DCMA 5L4SA 3DZJA 4PSCA 4A9AA 1QPBA 2GM5A 4EHFA 3QU5A 2QRMA 5LNK6 2LTAA 4GLJA 3QFTA 2LVBA 3K16A 4GECA 4ICIA 3MEQA 1WHSB 1XELA 4MV8A 3HVRA 3P9YA 2WM2A 3UJ8A 1WLYA 4Q4HA 2X1LA 5KWVA 1C9EA 1WEKA 3O1LA 4UUAA 1RNLA 4WBXC 1N3YA 2HCTA 1W1UA 2FPOA 5ENDA 4GXNA 4ETWA 4NP6A 1II0A 1R0YA 2OBMA 1OZAA 3KALA 3SYRA 4DC1A 4H9GA 3GEBA 4I4CA 2N42A 2ZKLA 3E4DA 2A92A 4OLJA 4TTAA 4A0FA 4D56A 4NAHA 1E5QA 1Q3HA 3DV0A 3OOHA 1KPHA 5K01A 4ZQBA 3ZX5A 4YV2A 1JR6A 3O74A 4GM1A 1P0PA 3AF1A 3IVGA 1UDAA 3R3YA 3ZIAA 3QYJA 4BNKA 5CNJA 1AQUA 1ZBDA 4Q7EA 2C95A 4J4TA 3ZCUA 1T5LA 4ER0A 2ZRBA 4AO8A 4ISBA 2V6FA 1Z0UA 6GPBA 1XFAA 3FJ1A 3GH1A 4GKAA 3AO0B 3GPDG 3ZWYA 1C1DA 4B71A 4Q3DA 2FWBA 3HKEB 4G85A 3D8RA 4J0DA 4JVMA 3U40A 4ARZA 4OUKX 1HL3A 1MIHA 3K94A 2ASEA 1JAZA 1EK5A 1EVYA 2D13A 2QLJA 3DTYA 2CJXA 5DBGA 4BV9A 2J6IA 4BX9A 2CVPA 5KYYB 3KUDA 3U7QA 2JFFA 3E9QA 2JGIA 1Q7EA 3QU9A 4KQIA 4L8FA 5EXTA 3HXTA 3S99A 3Q7SA 3VHQA 9LDBA 1ZD5A 4I14A 3UAGA 4R1MA 3UMJA 1Y5RA 4HDMB 3EXAA 1YQWA 5HM8A 1JI3A 1G5HA 3Q0EA 3A37A 3OF5A 4INPA 2PO7A 3H4IA 2RGYA 4M60A 5ENVA 4AULA 2B34A 2ZI7A 1RQGA 3O8QA 3P9SA 1LDBA 5B7NA 1Y89A 4G56A 3JZFA 4L76A 4S3MA 5FNZA 1JMYA 4F4FA 4Y2RA 4DDUA 3JQ9A 3ETCA 2QXTA 2BM9A 3MNFA 3E9ZA 3WGLA 4QSHA 5L45A 4CKWB 4PR3A 3O2JA 4CKCA 3G7SA 1U9CA 2ANBA 2A30A 3KK0A 5T41A 3PQ3A 1F2TA 1V35A 3FVWA 2K87A 3JV7A 1TEHA 2IP4A 1DGQA 1CR6A 4LZPA 4NPCA 1GG5A 4HAWA 3PNQA 521PA 3BT7A 1X7GA 4Q4AB 1H2XA 2UUCB 2CL5A 1Z13A 1OY1A 4MGIR 3QEBZ 4P35A 1UPUA 3V32A 2VBIA 3PENA 3CF4G 3FCXA 4Q1FA 4MW4A 1VZ3A 3DKRA 1EM6A 1ZIPA 2PRZA 2XYVA 1PS0A 1Z4LA 4DPKA 2F62A 1ZN9A 5FAKA 2GNOA 3E2IA 4IWXA 3GGDA 2PGLA 4HMOA 4MYUA 1IDN1 2YWRA 1SJ9A 3FUVA 1GCIA 3ZVRA 3A6KA 1KJQA 2QLLA 1BX1A 1XA0A 2WFLB 5DCUA 5FOSA 5IJXA 3SHOA 2XR1A 2G9ZA 3AL2A 5BNIA 5EHIA 2QI9F 2GZ2A 4GYJA 4Y1EA 3R75A 3W2IA 4B9AA 5BWOA 1ADGA 4DFDA 1WKVA 3IX7A 2WOOA 5BR8B 4Y98A 4DV7B 4R9NA 3HB1A 4D9KA 1MJGA 3DBRB 3H4VA 4GX1A 4RA9A 3ZQJA 4II2A 3G68A 3WQQA 1ZC3A 3FHCB 1I4LD 3IOBA 3N53A 3V6MA 4BX8A 1DAFA 1Q1QA 5HQTA 4H35A 5JEDA 3R7SA 1GKUB 5DTJA 1X38A 2PRSA 3L6CA 1VL1A 4KPGA 4MW6A 4AURA 4BO3A 1Z8HA 3SC2A 1L7MA 1ZCJA 2TS1A 4IMRA 4R2WA 1IZ9A 3CT4A 4XWOA 2ZUFA 1T8UA 3W8FA 1YI0A 2GNAA 2IXEA 4AG5A 2XWPA 2XQIA 2X6QA 1IONA 3MQ2A 3GJ5A 3S1SA 4Z3OA 4F96A 1JMVA 2VQ3A 3D8HA 3OEHD 5JRJA 2F55A 3F3SA 4TMFA 5ERGB 3EXEA 3K9LA 2P9BA 2Y3IA 3SQOA 4GE0A 2J5XA 1ES9A 1TPZA 4W1PA 4MRRA 5E9AA 2OAEA 2GCPA 2Y1EA 4KOAA 3HPRA 4B3XA 4G26A 2ILTA 4MWTA 1V1MA 3R9XA 5K6TA 2OV8A 1ZR2A 1JR2A 1JU3A 4B47A 7REQA 3K09A 1D5WA 4TYPA 5GADl 4UZSA 1TMOA 4MUIA 3A1NA 4PQFA 3TH5A 1FVOA 2NU6B 1AGPA 3PHHA 3STXA 2BHLA 2ZWMA 1YBMA 3UHFA 2VTDA 2W0MA 1US8B 3O1HB 3DNFA 5AM1A 4DJTA 4JUBA 3RTAA 3L04A 4GZ5A 3MWGA 4B75A 5HJ5A 2Q3CA 1Z0ZA 1I1HA 1Q19A 2F1HA 4GM4A 1NOKA 4G0VA 3CE6A 2QXUA 3OQIB 4ZCSA 4L50A 3FHLA 4I5GA 3IJPA 4AECA 3OLZA 4HNUA 4EHAA 4ZEMA 1K5DA 1BX3A 1L5RA 2VATA 1SKUA 2JLAA 3IPAA 1P2DA 1P81A 3DO6A 1BHQ1 4GWKA 3SEFA 3ZD8A 2YIVX 1AVTA 3ZTWA 2WF8A 2Z6VA 3IEUA 5FR2A 2JI9A 5CG2A 2C9MA 1ODSA 4UAJA 4P5DA 2AXQA 3J7TA 2XZDA 3QVUA 3AKDA 3BWXA 3KOMA 3OH8A 1W36B 1RWXA 3MERA 1E3EA 3THXA 1VPTA 3HA7A 3F8TA 1PL6A 4G65A 3QW4B 4KHPB 1QZUA 2SKDA 1YB4A 4GWGA 4PLFA 2P9QA 1X1RA 4MS3B 4Q3EA 4YRGA 1RLTA 5BR4A 2HA7A 3H17A 4O3FA 1WVMA 2Z5FA 4M99A 4WKGA 2I62A 3WMWA 1XTPA 4H2DA 3WIBA 5CYPA 3M6WA 4GPIB 4R3NA 4PLGA 4UM9B 5C52B 3CO0S 1DEKA 1U4SA 4EATA 1X1DA 2DUWA 2W6ID 1DDOA 4CEIB 5JLJA 1KBQA 1JG6A 2V74B 2J31A 2WHXA 4AZ3B 3IOYA 1BN7A 221PA 2D3WA 2RGCA 2VQSA 3C7DB 4XXHA 3IIEA 3ROKA 3SBOA 5AW5A 3HL4A 2QV0A 4A27A 4BC1A 5C9ZA 1KKLA 5JFGA 4UJ5A 4MVJM 5MFZA 3T5AA 2YDXA 1QG6A 3WKEA 3BK2A 1ACJA 1XZ8A 1A2OA 1IXZA 3C6MA 1V11B 3LHIA 4UMFA 3BL8A 5CT6A 3GLQA 5TF4A 3L4BC 2ZULA 3PITA 4RQAA 3H97A 2N3ZA 3D81A 1PWEA 2FETA 2O7VA 3A25A 4YH1A 3D0RA 2OO5A 4LV6A 1CSEE 1M8JA 2VRWA 2YWDA 1MH9A 2B61A 2D1TA 3JX9A 4IIFA 4ND7A 3I37X 3KETA 1P2GA 1HLFA 3IA7A 3ODPA 1I7LA 3IQXA 1ESNA 1XXHB 2HJ9A 3WAGA 4RV4A 1PNTA 4KP7A 5ALXA 1IUKA 1U81A 4C4OA 3BA6A 4BTVA 4WKBA 4E5YA 1X9IA 5B5SA 3WGKA 3OT5A 5AW0A 2RBEA 5DYTA 2WJPA 4RLQA 3RWOA 1KI6B 3B48A 5J9FA 3ZNNA 2RCYA 5IHPA 3BCSA 2X5XA 3PE6A 3TBFA 3TVTA 1DKOA 2PCJA 5ETJA 4UCWA 5EP4A 5H0IA 5M2QA 3WRYC 1B76A 2IF0A 1F1JA 2ZWVA 4M0FA 4A82A 4F45A 2ONKA 2VJKA 1F14A 1A5AB 4XUDA 3A1CA 5GMOA 3DMDA 3MS4A 3VU8A 4W5OA 3B38A 1OI4A 5ALEA 5FI1B 2FN9A 1M3SA 3DBOB 5KJ1A 4TZTA 2HBZA 4E07A 4WZAA 1XPOA 4DILA 5WRFA 1V4NA 2ZDQA 2RG1A 2AB0A 4YUZA 2GMWA 5EKDA 4HS4A 2VJQA 2HJVA 3GEPA 2QG4A 5HQJA 4DQDA 5JXJA 3N2IA 2Y0PA 3QU2A 2F3SA 4NYJQ 4AF8A 3ZE0B 3P97A 5CA0F 1K92A 1HOTA 2ZR8A 4HNGA 5LQCA 3IA2A 4ZEXA 3IEVA 1T26A 2FG7C 4JLWA 2I2XB 4DDWA 5IT9A 3CB2A 4M49A 3BC1A 4MVJI 2H31A 4GEGA 5JBIA 1PT9A 2GPWA 1NW5A 2A58A 5AUPB 1U99A 1R4NA 3T5CA 4B35A 3PQCA 4EG5A 4AK9A 2IVZA 4AICA 1K3TA 1DARA 1PZEA 5ALSA 3RHZA 4C5CA 2AN5A 4LRXA 1M6EX 3GUYA 3NEJA 2B6NA 3K32A 3AUXA 1CLEA 3DL0A 4MB2A 3D0OA 2DKNA 4WXYB 1Z4OA 1GAWA 4LDJA 4US1R 1CFZA 1QC5B 4CCYB 2NUTA 3C5CA 4ZQFA 3DD1A 2WWTA 5TC4A 1W5AA 2C4NA 5KC9A 3S4YA 4WRRA 1FTSA 5HP4A 5K3OA 2OSBA 3VYTB 3RUEA 2O8NA 3OHPA 1EUDA 2G0NA 1TM1E 3EQ6A 2WWHA 4F92B 4FOLA 4NYIQ 5CVTA 2ZIZA 4JBHA 2NSYA 3LHSA 4NK4A 1F7VA 1S2GA 4B82A 4EUEA 3IIIA 3PEWA 3K0SA 2VUHB 1E3IA 3O5AA 2R6FA 4EZIA 4U7WA 3JQFC 3WGZA 4TM7A 2ZBEA 1A7JA 2RHJA 3QKIA 2JARA 1UWVA 4ZU6X 3WGGA 1ZOOA 3VSDA 3DSRA 1K2VN 4UNPA 3TOZA 2VJLA 2OFFA 2X77A 3C4QA 1KR5A 3JSXA 2JFBA 4MGEA 3A05A 4WKPA 3LQQA 2I3DA 2HO5A 4MQUA 2ACVA 4XD7A 5KINB 3W2GA 4DR1B 1LI5A 1DTEA 1E7MA 3IUEA 3MGGA 4LJ4A 5GONA 1D6MA 1NUUA 3ONVA 3FHTA 3MGCA 2COKA 3TAHA 1FSFA 3H19A 2XOEA 3F90A 3ZWKA 3FYSA 1B8VA 2GCIA 5EMLA 4YQEA 4ZN6A 3EUAA 1MCZA 4Q03A 5EZ5A 2G0TA 4YASA 3STTA 3D9QX 2GBIA 1P2SA 1TTHA 1C4OA 1U7WA 3QXSA 1J33A 1N4DA 2Y1OA 3VVMA 3M82A 1RBZA 3NBZC 4CU2A 5CAEA 3UUGA 2FZ4A 3ZE1B 4NPHA 4ZYZA 4Q21A 1WU8A 3QKWA 3UMGA 4JYMA 3E1SA 4DNPA 5AM2A 1ISGA 4FZVA 1N2IA 4KX3A 3DDZX 1QNFA 3A2LA 4RZUA 4DA8A 2YC4C 3HK2A 4X8OA 2EP7A 2H07A 5TE9A 5KTOA 1N57A 1ZWLA 4BATA 1NVKA 4UATA 5DXAA 2O2CA 3JYNA 3MWDA 2ZQZA 4WJKB 4B5LA 2IHJA 2DR2A 3G13A 1F5NA 2AN4A 3MJHA 2GRUA 2QOEA 3FN4A 2C1EA 1DVRA 3DMHA 2E18A 3GEDA 3H9CA 3KKLA 4XAQA 4ZVKA 5LP6B 3RRNA 3F73A 1RZVA 1FF9A 4DVGA 4LS3A 3WY9A 1RRMA 5THQA 3BZWA 3L1VA 3ZGNA 2B5WA 1P5HA 1U7UA 2NZJA 1LA2A 1X7DA 2BBOA 3DLPX 3DHYA 4FN4A 2B4TO 4XJTA 1KJZA 4Q93A 3QX7A 3CUSA 2CLFB 5NLLA 4AJJA 2WZDA 5C34B 2W2OA 1D8AA 1Q3TA 4MKZA 4N0DA 3G1WA 1UXOA 3O7WA 3NNSA 3PPVA 1C3LA 1DJNA 2D0DA 2EQAA 4U9UA 3U37A 3CVYA 2O05A 1JHAA 3UO8B 2ZYIA 1V7ZA 3TUJC 4D9HA 5G02A 2GD2A 3HKCA 1Q1NA 3HH8A 3C3WA 3FMFA 4BLPA 2I6GA 2WUWE 3HUTA 3MJSA 3RTEA 3MUNA 3SOZA 2YWJA 1NMEA 1ENZA 1ZJWA 1Q7RA 4FYHA 4WW0A 1Z8FA 5JDCA 3A9RA 4BN4A 4DR5B 1QWSA 4W7SA 1QHYA 3M70A 3W2EA 2Y1LA 2RFLA 1VMAA 2JEYA 2VDVE 1ST2A 4MDHA 4Y9TA 5TGZA 3EDYA 4FR2A 2EJTA 1R0KA 3U62A 1AZSC 1CQJB 5I47A 1WXXA 4JXJA 1WXQA 3BZUA 3PLRA 3ZDDA 1A9PA 1VDMA 1KK1A 4JSTA 1WDKA 4MRVA 2PFGA 4DLRA 1T1GA 1E1RA 4FFVA 1VXOA 1VMEA 2Y68A 3BFKA 3IT0A 3AR5A 5HG0A 2VDQB 4MR9B 4DS3A 2JGEA 3WKCA 2UYYA 2WJJA 3R0VA 2WHRA 1KO1A 5G4KA 1I2DA 1R4MB 4PZAA 1IHPA 1T0IA 5KIAA 3I9MA 3E9MA 3KYDB 2GZDA 5TARA 1FTWA 2A5JA 2OG1A 4K1LA 5CFRA 3PC8C 1B8OA 1U4NA 3D8TA 3GR6A 2AKAB 4LWPA 4B2YA 1UBRS 1PJ4A 3DDWA 4KQWA 4Z0PA 1I30A 1OWPA 4QU8A 1SXJD 4W5JA 3FRIA 3L7CA 4KREA 2L82A 3PLNA 2NWQA 1RZ3A 2DTDA 4P7GA 3VZQA 1N7JA 2OORC 4KX5A 1E18A 4A8PA 3ZVMA 2H7VA 3LT2A 3NWPA 2OP0A 4YDSA 3KAKA 1DIBA 3WLKX 1GRVA 1KEEA 3OX4A 5KNBD 3WVNA 1QIHA 4J16C 4D0SA 1U0RA 3OJLA 4CKZA 4EP1A 1Q57A 1WUTA 2CF6A 3U2QA 4YIHA 3VPFA 2IFTA 4W1QA 4CPDA 1LI4A 3E9EA 4TWJA 5TEWA 1SUWA 4GKKB 2ZRJA 1Q95A 1SU6A 2Z8ZA 1E94E 3OQ1A 4GZ3A 3NBAA 5I6DA 3K6SA 1NZJA 2CFOA 2ZE7A 4GRDA 3LQKA 3BRCA 1TK3A 4X8HA 4KNVA 2VYCA 4AY4A 1YXMA 4R40A 2X19A 2XYGA 2APJA 1XDZA 4BE7B 5DPMA 5MDHA 2PE5A 2JB9A 3HM2A 1R8JA 3KJZA 3KYIB 2X3FA 1R0ZA 2HNBA 5LB2A 3T9DA 3ZU6A 4JDPA 1ODKA 1D4FA 1WE2A 3KV3O 3W2HA 1YE5A 2AQ8A 2SECE 5DHRA 2XEXA 2C2HA 3OX1A 1TTPB 5EERA 4E4RA 1DT5A 4Q5IA 3DGFC 4EKDA 1JBEA 2CJPA 2NUAA 2Y8EA 3ROPA 4V1CI 1GM5A 4FGUA 5K4GA 3OTWA 3A6GA 4OGGA 2IUTA 1YCDA 1XDSA 1XIVA 2BR4A 5IYZF 1CQXA 4I5FA 1IHYA 1NQXA 4Q9JA 1XROA 2IPLA 2QEQA 1UJ6A 2YWXA 3PXXA 3PCXA 1XVLA 1CY2A 5EPUA 3CH6A 4IGEA 3UH0A 5ICSA 3VDNB 1I0ZA 4M1ZA 3WA7A 1BGXT 3QFFA 3H3FA 1F4VA 5FLKA 3JATB 4JJFA 5EAIA 1ACLA 4N7BA 1CY6A 1GPLA 2IYFA 1SQ0A 4KYIB 4QJ4A 1ZN8A 1VLVA 4DIKA 1NHGA 1WEHA 4JROA 3DDNA 4O4HB 2P9ZA 4CM8B 2PZLA 2ZJBA 4HEQA 4WLUA 2Z1DA 3V80A 1NG9A 5EJFA 4OBXA 1TUBB 5JZSA 2HXGA 2RIPA 2PWBA 4L3WA 1QVZA 4G2NA 3CUUA 1A7AA 1SURA 1YZFA 3EZ6A 3TFQA 3L7IA 1J6UA 1E1DA 2O07A 4FEAA 3L07A 5ALOA 1PS9A 1CZRA 1T8YA 3VQTA 3MZ0A 3LCMA 1JXAA 1OGIA 1FFBA 1U2TA 3HCNA 1VIDA 1TQDA 3CR3C 2OPHA 3FMPB 2FWMX 2HHJA 1K86A 2QRNA 5I4CA 3DEAA 2BGUA 3HBJA 3DP7A 4JEHA 4G89A 5LQKA 2OK7A 2D54A 3OCCA 1LVUA 1MENA 1MRSA 1OGYA 1UWKA 5AIAA 4EHJA 4DEVA 4LZNA 1PNOA 1T6BY 3SZRA 4AMUA 4MKFA 4TV8A 5D3QA 1LDEA 3KAJA 3VR6D 2ZJZA 2ZJAA 3COZA 2I9KA 5HRCA 1DOHA 4LWQA 3NPAA 3O03A 4MRPA 3ZCSA 1K75A 3JW8A 4N3NA 4JR1A 1MT3A 3CVVA 1V5FA 3NAQA 4CM9D 5AYVA 1XN1A 5UKDA 1ISPA 4DV6B 2YWGA 4JDUA 2GK3A 4TLEA 5CA1A 1Z5NA 4AI6A 1N6OA 2W6CX 3SQMA 3N8GA 3FJOA 4ILKA 4MQMA 1FVHA 4HVLA 3GRFA 2P75A 4CV0A 4H6VA 1U3TA 3TX6A 1EG2A 3KC2A 2BOVA 1KSJA 5KS2A 2X0KA 1EAYA 3LK6A 3CZ9A 4X3PA 1FS6A 5CXUA 4KGZA 1BVHA 3U3KA 3SFZA 3MWFA 3BB1A 1KNQA 5E2IA 1HZJA 3R4CA 1NVGA 5KTNA 1NLYA 2XT9A 1YE8A 3U4IA 1QM5A 1ZI8A 4PPQA 2V1XA 4EEXA 2UYOA 1YGYA 1WPGA 2MSEB 2VUSA 2ZJ7A 4TMTA 4R54A 2H2HA 5EPEA 3RS0A 3T7EA 3TNYA 1PWYE 2P9TA 3GMTA 2O2EA 1VM6A 2UZ1A 3BIOA 3LM8A 4ZOLB 1KOGA 4QPPA 5IXSA 2B37A 4C0LA 16PKA 1XKLA 4QJ3A 1P4RA 4AC9A 1UODA 1RE1A 2IXBA 4LK2A 3V33A 1LDGA 2GJKA 1LB1B 2WG0A 1LX7A 2F00A 4JOCA 2V7VA 4OGLA 3ZI0A 1K2WA 1J7JA 1R15A 1KPIA 2C42A 2X2FA 2AQKA 3AP3A 3DE4X 3LUJA 1PJ8A 3KV1A 2RAVA 4QFDA 5EIAA 3B78A 1M76A 1JJ7A 2Q1WA 4AY2A 1FDSA 1EVIA 1F0KA 3C74A 2ZU6A 4PLCA 4RF2A 2J6BA 1FFCA 2F43A 2XBLA 3GPBA 4YRMA 1RD4A 1D1TA 3B3AA 4Y8VA 3T6KA 4CMEC 4EGJA 2Z95A 4UNIA 4DG8A 2XNJA 3IJ5A 4RPCA 4C05A 5CYGA 1GVHA 4MAFA 3MFYA 4C4XA 3ZLBA 1CUUA 4EIWA 2OO3A 2OAP1 4JQOA 3S1LA 5DHFA 3WXBA 5HKOA 1AUVA 1J42A 2XIJA 1WB5A 3DYBA 2XNDD 3O8DA 1T9BA 2RHMA 4LHYA 1O5IA 2OXTA 2HBRA 3PRYA 4BFCA 5L7WA 2EC5A 2W6JD 3K2QA 3PJRA 4BASA 3HJFA 2CXHA 3FFBA 4LSGA 3U3JA 4BL5A 1X1SA 3ZWXA 2VHXA 3T0IA 4B3FX 3L9XA 5JS7A 2DPXA 4FX5A 5FPQA 1UP4A 4B9EA 5B4UA 3LY5A 2XRZA 4GR4A 1Y5IA 2PSSA 3AHFA 4JU9A 4LTDA 1T9ZA 2O52A 4IICA 5DGCA 2OSVA 4FQ7A 1K7SN 4OHWA 1KDZA 4F8JA 1T3ZA 2CB9A 2NV0A 1N5MA 4LOIA 2EFGA 2Q4OA 2D2EA 5ES3A 3RUDA 1XLTA 3R7WB 1SUBA 2YVAA 3ICPA 2DULA 5KC8A 2I4TA 1H2YA 3RT9A 1V8DA 1AF7A 2EV9A 5A2QA 2L18A 1T6ZA 3ILSA 3A4LA 3HP7A 4CIXA 4ER5A 4MP3A 2PZFA 1SUAA 4H7FA 4TMKA 3TRIA 5CYFA 2XQVA 4NESA 1JA1A 3LP5A 4I08A 3WIEA 2BSQA 3G2NA 1NPTO 1UQRA 4HQOA 4UBOA 5GOTA 2XNKA 3MJDA 4GF5A 1PLJA 4L3VA 2QZZA 1FDTA 4UNQA 3TTXA 3WQHA 2SBTA 4AD8A 3T1NA 4N9WA 3O90A 4RVSA 4JOQA 4WGFA 3H11B 1P44A 1K4YA 3T1TA 3U0VA 2R65A 4X8LA 3GLRA 5CXSA 1GU1A 1E0KA 2EZ9A 3IHTA 5I7HA 1H8HA 3MMNA 3U4GA 2BZGA 4LJSA 2CHEA 1EM8A 1ADYA 5AQEA 3PFIA 4QICA 4UZFA 1VB3A 2H0RA 4XB6B 5B30A 3AUFA 4C22A 3STYA 2ATEA 1XCBA 1NW9B 1P8AA 2RG7A 4G9BA 4IWYA 4K9SA 5BR7A 1UAGA 3AR7A 4FFDA 5E6RB 3HYNA 3FF1A 2DBQA 3CN9A 2H8KA 3EGEA 4HDRB 2RSLA 1ZESA 2GLTA 5ESDA 4LXUA 3ISVA 4EB3A 3ETDA 3E5MA 2HXYA 3U31A 3G1UA 1YS6A 1KHTA 4AJHA 2IXDA 2OBNA 3GGPA 3LX4A 5CVUA 1PJLA 1VL8A 1WHSA 3DDCA 1RYBA 2FR1A 1M2JA 2GZSA 5I9MA 4BRZA 4W9NA 1QVRA 1I33A 1F3OA 4YRLA 1DOAA 3E81A 1PWXA 1QMGA 1SR8A 2DR3A 1DPGA 2JDID 5IJAA 2I33A 4LRTB 4QQ8A 5C5EA 4OHYA 3BREA 1N6PA 1VLZA 4K9QA 2G9NA 3AG5A 4IO1A 2CMFA 4MGYR 2MSLA 1GPUA 2AEEA 1OKKD 2OZPA 4HF7A 1YRHA 3LY7A 3PKJA 4NYMQ 2PKWA 2ONJA 2BM0A 3RYHB 3K30A 3ZZMA 2C57A 4BZQA 1N2OA 4Z1MD 1PFUA 2QF7A 2NQTA 3UJAA 2IYVA 1CJSA 1CUAA 1VE1A 4Y2TA 2NUPB 2QLMA 5AW1A 2W2NA 1QYIA 2B4QA 2ZANA 2VN8A 4HUQB 1GL3A 4KQEA 1PG5A 2WPNA 3BDAA 3C7TA 4OG2A 4ALJA 1ZK2A 3MWKA 4IV8A 4JXXA 1KE1A 1EX9A 3HKEA 2VDNB 4K9RA 4EMSA 5A5DA 4GDFA 2R7AA 1ONPA 1SRQA 2C2KA 4BQSA 4TXHA 4R2IA 2I7DA 1GPMA 3CXUA 3K6KA 4D9JA 4AX4A 3TCKA 4OMDA 5KYYA 1K6JA 4LIPD 2KYRA 3MQFA 4TL6A 1YB5A 3AUAA 5AKIA 1T15A 4DVJA 2AN9A 4HWGA 3U3RA 2QYTA 3S81A 1IE3A 4LYDA 4F7DA 4BWYA 3C1UA 1QOPB 3LKZA 4HDMA 1AJEA 3NHWA 2Q0HA 1IVSA 3LVBA 4PG6A 2NW6A 3KWFA 2GOYA 2PIDA 3AINA 2HBQA 4MPRA 2V65A 1IUNA 2C00A 3DZKA 5JISA 4D0RA 1NE2A 2R8EA 3E5HA 5ALMA 3DE6X 4CG2A 2H59A 3D7MA 1P9LA 1OBOA 5AVWA 4D45A 3A7DA 1DAKA 7MDHA 4D4KA 1YH3A 4CKWA 1J0EA 1B15A 2Q5EA 3AR8A 5HUJA 4BXOA 1IN1A 4EBBA 3Q7TA 1N5RA 3CLUC 4Y7DA 2QP4A 3IDZA 1AKRA 1H0RA 1RJFA 2VHWA 3GH3A 2Q3HA 5DBHX 5IDXA 5IS2A 1ZSVA 3PX7A 1OZFA 4O1HA 1Z2AA 3T38A 3BCUA 2OHFA 1U2EA 2JCGA 1Z08A 1QNLA 1K6IA 1WJGA 3E35A 4G1EB 4JKIA 4ZVSA 2ZCJA 4YJKA 1WV1A 4C7JA 1U02A 1NRJB 1I5OA 4ZAFA 4LOLA 4K3UA 2KLHA 5E9WA 4CGZA 1J8VA 4MEBA 5GJBA 1C8VB 4IZOA 4CT5A 1KEKA 4D8UA 1O6GA 4P84A 3DO8A 5C7OO 2ZSFA 2PT6A 5T4HA 3TOSA 5JAMA 4RULA 5CFQA 3RU2A 4LDNA 2WFLA 4LCBA 3ICVA 3U3XA 2I3ZA 2GO7A 2HJHA 5BO5A 3TG8A 3SG0A 3TB6A 3NC1C 3W8RA 1FXSA 1R6XA 1GAQA 1S4MA 1C3OB 4HAUA 4X6YA 1C3VA 1XRSB 1KYWA 3CH5A 5LMNB 3DBRA 1Q1ZA 5K0TA 1PFWA 4D46A 2QL5A 4TLLB 3WJ1A 1I32A 1M6WA 1O87A 1W93A 1GUYA 3AYXB 4C5AA 5JCZA 3M6VA 5FD8A 4RK0A 2P9EA 1SUSA 3ANMA 4ZVOA 2I99A 4YLGA 1ZYUA 3RT1A 2DZDA 2V6BA 2JLUA 2F1IA 4IDQA 4NZNA 3T5DA 1ZNYA 2FR8A 2H63A 1TLTA 1S3SA 5AHOA 4LF5B 2X5KO 4QJBA 4XGKA 1EWKA 4C03A 2M98A 5F9FA 3IKLA 3SCZA 3SVLA 2GTPA 3LUCA 5SYNA 2BHSA 2LKDA 2YS7A 5KNDD 1N33B 1U31A 3K9WA 4C0SA 1FDVA 1YZKA 4QOGA 2IYOA 2RGNA 3MTJA 4JL5A 2HSWA 2H5JA 2FTKE 7AT1A 1PJZA 4V0RA 1OLSB 5ICCA 2EFDB 4QTZA 2QMHA 2CUTA 4RTNA 1XEWY 2QSZA 3DMNA 3OWHA 4NL4H 3VUFA 1V7QA 2WJAA 1UJMA 5GQSA 3D4OA 1XC7A 5LDHA 1I0LA 3JALB 5CH8A 2VAMA 2BT4A 3TZLA 3NEAA 2EKZA 2R6R1 2DWUA 3GNTA 1SY7A 1A9YA 3OQIA 3EPHA 2DHQA 2R8XA 1MIOB 1NR1A 3VV3A 3ZK9A 3CGWA 4PTLA 4YQZA 4QVGA 3GEIA 3ZYZA 4UHCA 4AF7A 5H7XA 4A0HA 2IY8A 4HX9A 4V38A 2NO7A 2I5PO 4TRNA 1BDIA 3HXPA 1QYXA 4HGZA 2FVYA 1JEDA 1J56A 2QJRA 2I4IA 2WA1A 1MRNA 3BWYA 2J46A 4P4SB 1QG0A 2WAYA 4U6SA 4E4TA 1GQQA 1NZDA 1XWIA 2M6SA 3A4TA 2GPAA 4X20B 4CMGA 1C1HA 2D2VA 1H69A 3AKYA 3LFUA 3IP6A 4RHCA 4LF4B 4JMPA 3AUUA 2OPBA 3OD5A 2QY9A 3UJPA 1QGAA 2CFIA 4C1BA 1AHNA 4PRKA 1F5SA 1FPMA 2J3EA 4EYKA 4MS3A 4HS9A 2HWXA 1MC1A 3Q0TA 1VJGA 4UQOA 4RJJA 4AYWA 2WVGA 3D6VA 4MWGA 5AVSA 3KIPA 4OHXA 5AH0A 1JI0A 1MO4A 1JDTA 1R6VA 3L7JA 3P4UA 3T3IA 4IOKA 4XJXA 3TQTA 2QUIA 4WXHA 1OX5A 2QQEA 3PD0A 1ODTC 4DSZA 1AT1A 4CEIA 3BJIC 3WIOA 1DIGA 1DAGA 1R00A 2NXJA 3IDAA 1YVPA 1J9GA 2ERCA 2FQYA 2XGGA 4E2XA 3BH7A 3OOSA 3FWZA 2X0RA 3L0ZA 4AZ3A 4BMOB 4IFBA 4H6PA 1MB0A 1DFGA 1XJCA 4QHSA 3D3JA 4FHZA 3M4NA 5CPBA 3ROFA 5B2FA 4LNAA 1TCVA 4X1OA 5CR9A 4CFSA 2YN0A 3BORA 1G3UA 1NAIA 3HNOA 3NKVA 2EP5A 4P3KA 1FK8A 1N5KA 1XX6A 1ANKA 1EXWA 3D0QA 4YROA 5FPKA 1VYTA 2VR1A 4BKQA 1O95A 5BQ3A 5G3YA 3ZYCA 3RJMA 1XJ5A 4BU1A 1M8PA 2B25A 4HX5A 1Y1PA 5CJPA 4BS9A 5MGNA 2C5AA 1FMLA 3QNWA 5EEGA 3A2NA 5JZBA 4X7MA 1L4BA 1XWFA 4MO2A 5KYUB 3DXYA 3GA0A 5DM70 2ZRKA 3VJRA 1DQYA 1I4OA 4HCJA 4RF3A 1I3LA 5D51S 2C99A 2BCEA 3BYZA 3EVAA 1QGDA 1YZQA 1XXHA 1IRXA 1XTVA 5TNXA 4FS3A 5C4GB 1N5DA 3BXPA 3H5TA 4FU0A 3QPDA 5KX5B 3O2NA 2CW5A 4RK4A 3RVNA 1XTBA 2A9JA 2SICE 4KLNA 3V8PA 5CCBA 1EG7A 1KI6A 2QV7A 4LXQA 4EGQA 3UJ7A 1DQZA 1DC3A 6Q21A 1ARZA 1RM4A 4JELA 3N2EA 4YDRA 5DI3B 4G0YA 3VC3A 1U0FA 1VSTA 4CHTA 3DBLB 2JKYA 1LRKA 4O2AF 1U5CA 4N0PA 3SHTA 2WKWA 2IZ5A 2CMHA 3REOA 3GPLA 4I1PA 5L3ZA 4B3GA 1GQYA 2F9FA 3ZXXA 4N65A 4S04A 1HNNA 2OQRA 1GADO 1XZHA 1ULAA 2R6GA 4JQCA 1YK1A 4NMHA 1CVLA 2HQRA 1HT3A 4FX2A 4JS0A 3BH6A 4DRXB 2PKXA 1RC0A 4IJQA 4B4DA 4GYYA 1MR3F 1MX3A 4OHKA 1T2EA 2QWXA 3ETNA 4TKUB 3H1PA 4MQEB 2CDAA 3D3NA 4J90A 3MELA 4B3JA 3LPNA 1ZMRA 3OLCX 5T3UA 2PL3A 3TQRA 2RK4A 5JATA 4C7OB 3DE5X 6CHYA 1VRCA 2QX4A 5HTOA 1KMHB 2BHNA 1SUEA 5LKAA 1CD5A 2XE4A 3HDHA 4FE4A 2XDQA 1SCKA 5AK3A 2OXRA 4EO9A 1BKYA 5EZYF 1E77A 1NJFA 4BKMA 3OM0A 4CCYA 1S2IA 1W2WB 1H1LB 1QC5A 2PV7A 1M7GA 4KN6A 2GK4A 2QL7A 1NM5C 4N48A 3NM5A 4TTQA 3SC6A 1BE8A 4JQSA 4MPTA 4XB1A 3TZCA 1D6NA 4Z9AA 2BKEA 3O4IA 3F49S 4EY7A 4M86A 3ND8A 2PSHA 1QAMA 1J39A 4DE5A 1AZLA 1YJCA 4MI9A 5BSWA 2WINI 3KB8A 1P9WA 4EH1A 1KAOA 2QRUA 5KTRA 3TIGA 5A1TA 5INTA 2JFPA 2P2SA 2P8SA 3JZAA 5C4MA 3D5QA 4H1UA 1ORDA 1YCHA 4YCAA 4RJTA 2ZSJA 4W9RA 4X45A 4BKOA 2MOKA 3OTQA 3JAWB 1ID8A 4IFTA 4MV3A 3WK7A 1DCTA 4R2XA 3IO5A 2A35A 3I45A 3Q8XB 3LH5A 2MTBA 4FDAA 1ZRHA 2JZOA 2PSEA 3WMRA 4C4AA 3LLUA 4TS9A 2IU0A 1EEXB 1ODIA 1U80A 2Q0XA 2WU0A 3FCEA 4G1CA 4M0PA 4NBRA 2VZLA 5TEVA 3W6NA 1H8ED 3OWOA 2B36A 3TRJA 3GDWA 1NT2A 4TYWA 1QKJA 1JKJB 4X7BA 5I9NA 4OQEA 1CUZA 2HPZA 5T7BA 2B94A 3GP5A 2YMQA 4CMCA 1N6KA 1OH8A 1C4KA 1JAYA 1U1IA 3V8RA 5BP7A 3OLYA 4DA6A 3H5LA 3LT4A 1PL0A 3H8WA 2WHYA 1JPJA 1NVAA 1SU7A 4OXYA 1E3SA 1XOIA 1ZIYA 2IEIA 3BHJA 3X1XA 3ZWDA 2EDCA 3BQ9A 3DTVB 3E18A 2BR5A 4UXIA 2GKOA 4IDBA 4JUCA 3LHDA 3VZSA 3SYTA 1BSVA 1PU2A 2WHEA 3PHCA 1NP3A 3NZEA 2CCJA 5FTMA 3OA0A 3WADA 3O73A 4S0XA 3ZU2A 5C5CA 2ZETA 3HP1A 5TMEA 2C96A 4POOA 1WAMA 5LP6A 5K7SA 3DL7A 3DE1X 1MDFA 2CZCA 4B46A 4Z2AA 1IWOA 8LDHA 3AHJA 3DMPA 1SVKA 2FGJA 4M9RA 4A10A 2HL6A 3T3DA 3W9UA 1ZJ5A 2NTYC 1L7OA 4Q05A 4BJHB 4MUEA 5CJ2A 5CBPB 1W48A 1E5XA 3LUPA 3NWJA 1U1FA 3CLRD 5CX4A 3OAAA 4IRMA 4Q37A 3H04A 1JYEA 1M7BA 1VJRA 2O7SA 3RT7A 4ZDIA 1A88A 5IARA 1XI2A 3L6OO 1QOQB 4DLXA 2YZGA 2OAGA 3VSEA 5JPIA 3LVFO 4B3DA 3UVEA 4Q16A 3FI9A 3GJYA 4HOYA 5G1PA 3UN1A 5C8YF 1NPYA 4O2LA 3K8QA 1YB2A 4RPJA 1HA3A 1YVUA 1FMJA 5DRTA 2Q2NA 2PRJA 1O5OA 1YULA 1Z26A 1T8WA 5CUQA 4GPAA 3V6LA 4KMRA 4MWCA 4HT3B 5K6RA 2Y67A 4KXVA 5H68A 3B9RA 1CQJA 2Q5LA 4H3HB 3UPDA 2ZBQA 3EDRA 4XGQA 1GL6A 2DPMA 2ZGVA 5K20A 1FLAA 1UC5B 1URPA 3HZRA 2CDNA 2F1OA 3AM5A 2JFUA 3NH6A 4JBIA 4EKNB 3TECE 3GG9A 2WP8J 3PVCA 2BKVA 4O63O 2BFDB 4GIBA 2O50A 4DR4B 4MR9A 4BMZA 1TF5A 2W8BB 4A2PA 1VPEA 4FYKA 2PHZA 1ADJA 3S2YA 2WJHA 1R4MA 1E6CA 1LZLA 1SEPA 1KEZA 1OWOA 3GZNB 1RWPA 3Q3HA 4LJ9A 3UGTA 1YZUA 3TE6A 3UAVA 3CWQA 2IUUA 5FBWB 1IN7A 2WJ4A 3FLEA 3MIIA 4RXUA 4YJ3B 1H0HA 1L8LA 1NJGA 2ORIA 1YIDA 2E6KA 5DH9A 1ZL0A 1NSFA 1KKMA 1JE0A 1QRRA 1XYGA 2PV0A 2VLIA 3NTOA 4IVNA 1AGNA 4KI0A 5LQSA 3I1YA 1U65A 3K0HA 2HOQA 3SJ7A 3DZIA 3IRUA 4DMFA 2Q2QA 3ZGOA 3UMVA 2A86A 4GPD1 3LX5A 4IDAA 4EPRA 2FJUA 1FUYB 2FB9A 4X7PA 3HCDA 5EXSA 2MR5A 2VKQA 5A4KA 1JJFA 3OE1A 5ALWA 2FPLA 2GVZC 3O21A 3THOA 5B2EA 4DA4A 3U7RA 3NW9A 4TLDA 5JXIA 1XGKA 2G17A 2QBYA 3W1EA 4F8YA 3GJXC 5DWVA 4CFYA 1UIRA 1KMNA 1FRVA 2VSFA 3CSSA 4BQPA 1JZQA 2WYOA 3GJSA 1L7BA 2W4QA 4MKGA 4X97A 3ZDRA 5LM3A 4REMA 5T6MA 1YA6A 1CUWA 5AW3A 2I9PA 1G98A 4CTMA 4O08A 5G1NA 4WCFA 3MLEA 1EK0A 1SZCA 3D6HA 5AW8A 2EATA 1HQKA 3SIPA 1SXJC 3M6XA 4IDPA 1UKCA 3F97A 4JLJA 4JOBA 2B8EA 5AKJA 4ZU1X 3LQ4A 3D8BA 2CK3D 2W2LA 4K28A 4CL3A 3RR2A 2Z6AA 3L7AA 4P7KA 4EX7A 4X66B 3KJIA 3I53A 1VL0A 4QIHA 2PFSA 4QO7A 1NIJA 1MJGM 5DHQA 3THRA 5C4IA 1F60A 3MFQA 4AN1A 3D64A 2JFGA 4HPJB 1ISFA 1JEQB 2GF9A 5DE3A 1UC9A 1T4MA 2WJIA 3N28A 4RTLA 5IKXA 3T1HB 1BO6A 4QREA 4X65B 2IEGA 3IMCA 3UJDA 5K8IA 3C1AA 1AGRA 4U63A 5D6OA 3C5HA 1WPQA 3LQ1A 4NSNA 5B1DA 4K9DA 2Q5OA 3A14A 1XF1A 3RTGA 1EWRA 4ZI2A 3JATA 2ZIFA 1CY1A 2V3WA 3D5EA 5FUWA 1UK6A 1WU7A 4MQ4A 4PGAA 4HUTA 3A1UA 4O4HA 1OXTA 2D0PB 4CM8A 4RQTA 4NBUA 4U3JB 4AWAA 3QKRB 2PD3A 1VCMA 5D85A 2CV0A 1TUBA 2QR2A 4IIJB 5A2GA 1Z37A 1IUOA 3CA8A 4KO3S 1O0CA 2RAFA 4KPYA 2QZ9A 2RK3A 2ZSUA 3RQIA 1PT6A 5L51A 9ABPA 4IGKA 1G6Q1 5DNDA 4NQRA 3AF2A 2GFIA 1EX1A 3Q72A 1A5TA 2P90A 5JD4A 3UA3A 5BQOA 2HAEA 3AF6A 4U8GA 1EQAA 2CB0A 4K9KA 4W1RA 5EMJA 1VSUA 4ND4A 4LGYA 4LF6B 1XJWA 4TZ0A 5TJHA 1VFPA 2JHFA 1PK8A 4Z0HO 4D5GA 1AKNA 1IBMB 1YJAA 2V0NA 3LUAA 4G5YA 3RC9A 2O2SA 4IIXA 3PRKE 5F51A 1GUBA 3OZAA 1I2CA 2B7BA 3QUQA 3ZDYB 4AY5A 3FPAA 4EOGA 2FR0A 1ORIA 2XT6A 3AV0B 1H2RS 7GPBA 3C16C 3OBBA 4MW5A 3AKEA 1M5TA 1DNPA 2BLNA 2GA9A 2J3LA 3JQBA 1LC3A 1QUFA 4FD3A 4FJ0A 1MO6A 2IYNA 3I1JA 4RPLA 3KLMX 3NV9A 5EJMA 2IBTA 5F5LA 2HHAA 5DEIA 1Y5MA 2PRIA 1F51E 2I3BA 2WYVA 4QYMA 1L5KA 4ZJPA 1BAPA 4WT7A 1X2EA 2TMDA 4DJ5X 2QQFA 2XUIA 5E4YA 1BVRA 4RIHA 1NW3A 1GA4A 2EGUA 1CTQA 3DE0X 4JC5A 2DYKA 1ORVA 3RSLA 1ILWA 1VLMA 3LOPA 3RKUA 2IGTA 1UKEA 3TAXA 3VR4H 1RWBA 4HSGA 1FQWA 3BCHA 2HR1A 2K2QB 2VF7A 3DDSA 1QTNA 2AHOA 3QA9A 4OHRA 3F1LA 3OTGA 4RQBA 2FUG1 3OM9A 3PGVA 3G02A 1L4LA 4GR5A 4KVAA 2RB4A 2ZYSA 2FZGA 3HSKA 4KB5A 4NONA 4ZOLA 3NMUF 3FG9A 2P2DA 4G86A 1GNRA 2MYTA 4HLDA 3LVQE 1KIAA 3CEMA 3BMQB 3EGXB 4LJ6A 5HXAA 2FW8A 4DCPA 4YRZA 1NBEA 1MEEA 4BNNA 2P0EA 5H70A 3C3EA 1SVMA 1W29A 4Y7CA 4YB8A 5TQJA 3ME5A 1FXWF 4XQ9A 4GI5A 4F1KA 1NX6A 1FLDA 2N9UA 5JUWA 1Z45A 4LZZA 1E4YA 4NF2A 5FHQA 1L7DA 3GMIA 3LYAA 3S7ZA 3U7IA 1IIRA 2PKRA 2BGRA 2QNBA 2OCIA 2OV6A 3QEAZ 1DXHA 1N0UA 2C98A 5LQMA 3G82C 1SGWA 3BRWD 1WA5A 3ZY2A 1V3VA 3CX6A 3I9JA 4HLUC 4UVEA 3P9XA 3LFTA 3C48A 2QQGA 4BTLA 3RK4A 1SWVA 2PCLA 2GPYA 3IOCA 4DLBA 3KFXA 5JD3A 3PNKA 3WWCA 4EYEA 3HA2A 3VPCA 1E1QD 4E32A 4FLFA 5LFAA 1TVMA 1SAYA 5FOWA 1XLWA 3DBHB 1N6HA 4Q1AA 4CV2A 5K99A 1JR3E 4WVLA 1DQPA 4PY2A 4G5FA 3IEXA 2PLRA 4FD2A 4QGFA 4CM7A 4F5EA 4H17A 3AQ4A 3EY4A 1SBQA 2VDJA 5BN1A 1GA1A 1WDMA 3RDPA 3UY4A 2PR7A 5LWHA 1CRZA 3ZS9A 4B87A 3A3KA 5FNVB 1KWKA 1J21A 6ABPA 5EJ7A 3ER8A 5LMCA 5JHHB 5HFAA 1K66A 3JPYA 3OLQA 3GFOA 5HJ2A 4IILA 3R7WA 4BFSA 1QTRA 4BO0A 2C59A 1TLLA 1F0NA 4KUEA 4OHUA 4ZAWA 2I3GA 5LCXA 2XNCA 3DE7X 2WF6A 3FWKA 1RYHA 1TYEB 1P4AA 5LBUA 4DBLE 2XMQA 3HNRA 3QVGB 3AMVA 4EFKA 1L4MA 3KOZA 1KZ6A 4NCKA 2R6DA 1CIVA 1LBSA 1Z3CA 3MB5A 3CTPA 3NHMA 3HJHA 4O4IB 2W83A 5GGYA 1NIPA 3DKVA 3V00A 3IAEA 5L3QB 3IUBA 3D7SA 4PZYA 5EKTA 3A11A 5K6AA 3H11A 3T7IA 2QRJA 1O7JA 3ZS8A 1ZISA 3D6MA 4GOOD 2R68A 3R3SA 4AY3A 3WRVA 3W8EA 1B2RA 4RV9A 1VYHA 2I67A 5KNLA 1XCMA 4B8YA 1UDBA 2BGTA 3ZN2A 3UMMA 5ED4A 5A9SA 4D25A 1PE0A 5C1OA 1D0VA 1PFYA 4HRAA 2EERA 2QN1A 2V8BA 1E2IA 2BGKA 3LBHA 4LGCA 3A6EA 3UWOA 1CVIA 2JZNA 3PQ7A 2C4UA 4YBRA 3GLSA 5CURA 3U0BA 3FB4A 5E6RA 4P3PA 2Z8YA 1YCGA 1R6BX 5DMHA 1V7CA 2VPYA 2O6HA 2X40A 1AV7A 4HDRA 4HH3C 1D9XA 1IAQA 5ITWA 5T67A 4DDVA 4YRPA 2Z56A 3V1KA 5CLJA 1A1VA 1GGHA 1U0EA 1XVIA 3LGAA 3LPDA 4BV8A 5DIFA 1U5BA 5GVSA 1Q1EA 4HNRA 4E08A 1Z4QA 2ZJ3A 5KDDA 1H9CA 2HWKA 3AOEA 1ZVVA 1KSGA 3SDZA 3ROZA 2AJDA 1NLZA 3N8NA 3B13B 4JP8A 4XDGA 4DSNA 1E0JA 1E64A 2ZJFA 4CKBA 4M1YA 3RYFB 1GDTA 5JJIA 4I9HA 3R6WA 1M2EA 5ECDA 2GX6A 2P6RA 3UANA 4RTMA 1B26A 5J47A 1TD9A 3L8DA 1JEAA 2GTIA 4R7ZA 2VNJA 4BVJA 2IS6A 2FUKA 3N9IA 3HJCA 3OZGA 2NUPA 4HYTA 4RHUA 1DFHA 2BFOA 1Q11A 2X1HA 2Y2VA 2UVDA 3FLBA 3OURA 4HUQA 2YW9A 1CIJA 3JXEA 3N6RA 3PI6A 1T5TA 4QX6A 5KI6A 1V6SA 5BSGA 2H2FA 3EIFA 1P7WA 3UMRA 4BMYA 5DX1A 2YQ4A 3VR2A 1ZONA 1WQ4A 2HW8A 1E6MA 5B64A 4KDFA 3LP6A 2ZJ2A 4J4BA 3OZFA 5GY7A 2QTBA 1XEAA 2LDXA 3K71B 1SXHA 5JS8A 1EX6A 5E6SB 4MAAA 4D3ZA 3AL0C 3LQYA 3SIRA 4C0QC 1T4GA 1O9BA 4P5PA 1KWGA 1P91A 5M7EA 5FTWA 1RXIA 3TW4A 4Y9DA 2QX6A 3ITKA 2NO0A 3HJAA 4BNJA 1USGA 5DN9A 4OVKA 3VHLB 4ZODA 5DM2A 4BNTA 2G40A 3I6QA 1I6KA 4M6WA 1O0SA 1WB9A 1OAOA 5B7PA 5IDWA 1NBME 4DV4B 1JA9A 4ZQCB 4IEFB 4PG5A 5CLFA 4IXWA 5KSPA 4DLNA 3AF0A 4YCLA 1QB7A 5JZOA 3G8AA 3G9XA 2UZ3A 3TQFA 2WKRA 5C8YA 4M0KA 1NPDA 4EVRA 4MLZA 5I9IA 4DUGD 4YRBA 4E0BA 4OHPA 3HCPA 2V5UA 1KY5A 4MWEA 4DWVA 4TTTS 5A4JA 1WVGA 4F2GA 1QGOA 1R66A 4QOIA 4LVUA 3ZW9A 5BN5A 4ZT3A 2XXAB 1S8NA 3TEMA 5DBFA 5SYMA 4Q02A 2WSYB 4WI1A 2NVUB 1R50A 3OOWA 4V0ME 1G8PA 2IWRA 2ZZMA 3ZE9A 5JSQA 4J75A 2QTHA 2G5TA 3LYLA 3WI7A 2JFOA 4G9EA 4LDQA 2EIHA 2MSDB 1JXMA 3ELYA 3UGQA 4RJIA 5J4LA 5JV5A 5DN6A 3RFTA 4Q1BA 4CM4B 5BSVA 3EPRA 1Q2UA 1MDBA 1R9NA 5KSZA 1WDWB 2JIPA 2OMKA 4XWKA 1WMDA 3MBIA 4GHWA 4AFNA 3QTBA 1FFDA 1SO8A 4HWKA 4U4AA 1C3OA 5AVTA 4DLTA 3RPEA 4LYHA 3S2EA 4RHTA 4FXOA 5FXMA 4AZWA 5DRYA 3C43A 3IXQA 10MHA 1XRQA 2QE7D 1XMIA 4FPXA 4HLNA 1ZUWA 4ZQIA 3TLYA 4MUBA 1AUXA 5IAJA 2O4UX 2XE7A 3ZLJA 1GRCA 3ZUGA 3V2HA 1O89A 2AJ8A 4TRRA 4AJEA 4GKJB 4JJ8A 4B4KA 2UZ0A 4BDTA 1PZXA 2BFNA 4IYRA 5F73A 3UAOA 2BMFA 2XUQA 3R5SA 4WH0A 1GKLA 4BFWA 4G24A 1I3NA 4XLZA 4EI9A 2VT2A 3Q1KA 4L85A 2GCNA 2MINB 3DEIA 3GFQA 2C20A 4EUNA 3CPHA 2FA9A 3MT0A 2VCEA 4QPCA 1NMXA 3N2ZB 3PRJA 2OZLB 2QVZX 4WZZA 5HIIA 3EIHA 1ZFNA 3K9CA 2DPGA 3JVVA 5IJ9B 3KQVA 3LCVB 1OLSA 5K45A 4YAWA 1O4WA 3DUWA 3GJTA 4DRYA 3T4EA 3HXKA 2HRBA 1YKSA 2XUOA 4UDYX 3RD5A 4CM5A 4ES6A 1O94A 4J2HA 1CF4A 1J0XO 3HDJA 3IXMA 3JALA 1WSDA 2VBCA 1TJ3A 4PCAA 3Q88A 5T57A 4E3ZA 2P5UA 2E4VA 5FOUA 1N7GA 1SKAA 1MIOA 1NX9A 2E5LB 1JILA 1E2GA 1FJXA 1E8NA 1Y3AA 4LKOA 5ALIA 4P3XA 4YUWA 1K7FB 5AVZA 5K51A 4E5VA 5DFAA 3A1VA 4TTPA 3UT5B 2WZQA 3L0DA 3ENNA 3VR3A 3E23A 1V4BA 4P4SA 2DEUA 5AOCA 3RC8A 4PC7A 2AQHA 3FNBA 2P2LA 4MQLA 4E13A 4H4CA 4X20A 2R6ZA 2W6MA 1PTJC 1Q77A 3TZBA 4H6XA 1N32B 2O14A 1D5CA 4CN8A 2Y9PB 5IM5A 4NS1A 2C8JA 4EITA 1G7CA 1CDZA 4B45A 4G0ZA 4O6VA 3N75A 5CH3A 4UPDA 5E4FA 3UOWA 1YIAA 3WL6A 1Z5WA 3NNDA 3TRHA 1Z33A 2XCRB 1WY5A 4TSFA 1FNMA 2AE2A 4DLVA 4URFA 4OV6B 3U49A 4R9VA 2O2XA 4BP3A 2XKAA 3WHPA 1XRLA 1XZAA 2R97A 2O8BA 4NOKA 1YQTA 3SVTA 4BMXA 4FYVA 2QT0A 1RHQA 1EQ2A 2F9MA 2IV2X 3JR3A 5HCUA 1TYCA 4GH5A 4Y2YA 1BYUA 1P80A 3KOOA 3GEHA 4MYDA 3T15A 1W9MA 3WTBA 4C04A 2C3YA 4N5LA 4BB5A 1J24A 3H5WA 2ZI4A 1TZJA 2D0OB 1KMQA 1E2DA 1FTYA 1Q0RA 2GK7A 4FBMA 4B33A 2CBZA 2VDMB 4P9NA 3OMLA 4HB3A 2AJCA 3TVYA 1TYBE 3CYFA 1PQ4A 4MLDA 4XKJA 2PS0A 5J5AA 2HSGA 3RJTA 1RPZA 2BL4A 3OM8A 1TD1A 1XHFA 3QBJA 1V1JA 1IPFA 1Z6QA 2VT6A 5KYUA 4AUEA 4S35A 4JYZA 2FXIA 3NDPA 5FBKA 3RVJA 2VAXA 2I03A 2HMYB 2V6JA 4IQ4A 3AONB 2YWHA 2Y1FA 4TMYA 4DCMA 4IJUA 5LKRA 4I8XA 5AJWA 1TJ5A 2C2BA 3GFSA 3IPLA 2GESA 2PSFA 3Q2OA 1KVTA 4L0CA 1H2FA 1M8KA 2WWVD 3V1NA 3WB2A 4DSOA 1JT9A 3OCVA 3KSUA 3QWAA 1WXWA 1R8SA 3ISJA 2VWGA 3ENZA 4H27A 2BIFA 5JTTA 2Q0QA 3QP9A 4RZXA 2YVKA 2GDJA 4LQ4A 3CPJB 3L4EA 3DBLA 1VKZA 2V6GA 2WUFA 4G84A 5CB6A 4CLRB 4AS1A 3JZMA 2BISA 1NF9A 4QJ5A 4I50B 4CDNA 4HSEA 1QDLB 4H3VA 1JHVA 4PX2A 1D3AA 3IMGA 3ZQUA 3MPUA 2P8JA 3T52A 4W5QA 4L73A 1RJGA 1PT7A 3T7CA 4PHGA 2JIDA 3I76A 2ATVA 1GTVA 2ZTVA 3P4XA 4DRXA 2B4AA 2F48A 4PCVA 3DCIA 1NR7A 4RZHA 3DEYX 3T34A 2VOEA 4TKUA 3IHWA 5EE5B 4BEVA 5I7SA 2GLXA 2OY0A 3PKIA 3CNLA 5JJBA 4X60A 4C7OA 2VNHA 4BO2A 1IBLB 1QFZA 2AWOA 4OQLA 4C0KA 1CJBA 4CTKA 5LLTA 3FR7A 3EZGA 1JKFA 4XVQA 1MG5A 3ZVLA 3QE4A 1KMHA 4AKIA 4LAFA 2PZAA 3FNIA 5B3JC 5A4DA 1JBQA 3L1IA 1HDOA 1W88B 2YY5A 2P91A 4AW9A 5AW6A 1AN9A 2FNAA 2H1WA 5B37A 1H1LA 1ODCA 2PWPA 1PG0A 3ASYA 3C3XA 2GDZA 4LHEA 4RUKA 4TXJA 5EUMA 1Z5UA 4B80A 2HMWA 5C37A 2XMBA 1UMKA 1OXUA 1DTWB 2WA2A 1NU6A 4KBGA 3O75A 1RR6A 3NC4A 5DM60 3E8SA 3S5JA 4DDTA 5J2TB 1OIVA 1Y42X 4LOJA 4JLKA 3GP3A 4KAXA 1DKPA 1HEIA 4A2CA 2KW5A 3FCAA 2XCLA 1BZYA 2CL6X 3RYIB 4ZGBA 5JWOA 2I2DA 4PYQA 4LBZA 2QLBA 1IVYA 1HYHA 1LLQA 1T2DA 3ND5A 4GX0A 3LPCA 4DXHA 3FCYA 4YX9A 2RJNA 1NR5A 3PX2A 2IW1A 1JJVA 2VYND 1H42A 3FUWA 3LTEA 1TA0A 4IX9A 1YMQA 3CUKA 4GUAA 1EBUA 4YLYA 3I0ZA 1IJEA 1G64A 1USVA 3CMMA 2ZIEA 5CLHA 3SQNA 2PUTA 2W2PA 4J9UE 4RO0A 1OFGA 2WWWA 3WZ2A 3W7VA 3GVXA 3O8CA 3ZZ1A 4GSYA 4G23A 1T5HX 2MYNA 4OIFA 3QMWA 4ITUA 4BFVA 1KQFA 2WWRA 3RJ9A 4IO0A 1JKJA 1IQUA 5EE1A 3I2HA 2QGZA 2A9QA 3IP3A 3PUZA 1K08A 5EIBD 3F5MA 4IXNA 2NOAA 2HIHA 1YRYE 4W8GA 4D4MA 3BXEA 4MWDA 1QE3A 3ZNQA 1IUPA 5F3DA 3KX2A 4INAA 4YRKA 1VCIA 5A4AA 3C0KA 1KIMA 2XNSA 4MIEA 2D2IA 1ISRA 1ZCBA 5CIWA 5JRDS 1II8B 2IUEA 3FOBA 4N1AA 1I7QB 4ALNA 1UDWA 4OJMX 1Z5VA 3P8ZA 5KTPA 3STUA 1U98A 3DTVA 3LWBA 4YRJA 2MCFA 2JH8A 3USCS 1CG6A 1XZJA 4UUQA 4HYEA 2Z8XA 5IK2D 3FVTA 1DLJA 4UEWA 1WY7A 1J09A 5JMWA 1BHSA 3EXHC 4Z3DA 3BMNA 2NO1A 4M38A 4NAUA 2POQX 4JLVA 4F5YA 4MX8A 1KJ9A 5AOVA 1PZGA 2BZ0A 1OFHA 4GAEA 1OF1A 4BP9A 1WTAA 2JA2A 4OL9A 2X0JA 1J99A 4J0IA 4XYEA 5CBPA 4KWTA 3R9WA 4D82A 1YRAA 2IUSA 4EQ6B 4JYAB 2QAIA 3EF1A 2AJLI 3EXFB 4V0OA 2UKDA 2H8GA 2P69A 3S2FA 4U2EA 1K3UB 1WZCA 3E9YA 2VJPA 4C4YA 1PHPA 5HMLA 3UWKA 3HFRA 1OC2A 3HWX1 4PFJA 1IN5A 3Q98A 1C4XA 3SFVA 1EWTA 1JVSA 2F3PA 4JYCA 2XGMA 1Y34E 2ZRAA 4FBGA 1Y7PA 2HJSA 5LIRA 3LUGA 5L4NA 4BLWA 1EU1A 3ESBA 1L9XA 2FOIA 4LXGA 2F3RA 1CUGA 4INJA 1MVNA 4LWZA 4EG8A 4CW7A 4M46A 2XZTA 4F06A 4ISCA 1GGKA 1NC1A 1PGNA 1ZK3A 2HADA 3OU7A 4LVOA 3WFJA 1LZKA 3CLKA 3VNQA 2G04A 3EW9A 2BFDA 2P7IA 1CYDA 5AWFC 3U9TA 5BWLA 1IN8A 3CLRC 3MPOA 3VPDA 5KNCH 4O1IA 2W8BA 1B1AA 1MQ9A 3P19A 3LMKA 4KNWA 5TF0A 2V7GA 4HEHA 4EJFA 3CLTD 3KQOA 3ZXYA 3HDVA 3GZNA 1M6VB 2W6QA 3LF2A 3LC1O 4LXIA 3EX7C 2OZEA 2YW2A 4XUGB 3VNAA 5JDIA 3ZJ5A 2VRBA 5L6MB 2A88A 1LVGA 2XCUA 2ZIGA 3Q2KA 1UXKA 2B4RO 2HF7A 3LL4A 5HBRA 2JD0A 5FFNA 4KFTA 3JQPA 1P7PA 1QHFA 1R74A 2RDMA 4KYUA 4M37A 3U09A 2WNHA 3M9LA 2QT9A 2XJ4A 2UXBB 1GFWA 4OYLA 3VJMA 3U4HA 3L0OA 5F77A 2Q45A 1H94A 2YNMD 2YZNA 1J06A 4ZT6A 1CU1A 3H3JA 4EKYA 8ATCA 5H4GA 2XKKA 2CEAA 3EQ9A 3DLBA 1W4AA 4PZZA 5LL6P 1IY2A 1LJUA 2HGZA 3DM5A 4F3KA 3RS2A 1EJBA 3FSGD 2DC1A 4ZAGA 3PHJA 3PT9A 4HKTA 4JEUA 4Q24A 1SHKA 3HQ4O 3ROGA 4YRIA 2QD3A 5D01A 2GZRA 4B8WA 1UMCB 1D2CA 1N75A 3GRUA 2TMYA 5CNIA 4P2BA 3NG1A 4XR9A 2BPOA 3PFGA 5DGHA 3OFNA 5K3CA 4YUAA 1MV8A 4M1SA 3BMOB 4JGGA 1KYTA 4RU1A 3DUFA 2FMKA 2NO5A 2QTZA 3BAZA 4U39A 4I3FA 3MCAA 2BGNA 3DW3X 5AMXA 1YASA 4ZVUA 2O8CA 2EX1A 3V7NA 1Y8ZA 3KVVA 4M7OA 2BBWA 3HEAA 2COUA 1OD6A 2R5WA 3VDRA 4FR5A 1FRNA 4BLUA 1KSFX 1JIVA 4N18A 4LMAA 5D3KA 4QBTA 1LFAA 3B3JA 3KB1A 2C0QA 2XD9A 1JEQA 4IKPA 1QV6A 2FZ5A 1GLVA 4L8GA 3RADC 1TPYA 4FWIB 2PRKA 3RC7A 1W47A 3D2BA 3M6AA 3STHA 4PANA 4EELA 5BN3B 1INLA 3USES 2LR0A 1OYVA 1M0WA 3CR7A 4KXLA 3RYTC 3VRHA 3NJ4A 2P6MA 4L74A 4NFLA 4QBKA 2B20A 1RXYA 1Z68A 3D6TB 4J0KA 3R3UA 5AXCA 2AX4A 1E4EA 3QQPA 2O3SA 1EVZA 5ALNA 1FS5A 1B8NA 3PJDA 3PHLA 3QKRA 4U3JA 5DK4A 5KOHB 3E27A 1LU9A 2PTHA 1GGMA 1XE3A 2H9YA 3H42B 4UTPA 1LNZA 3ED5A 4CWAA 3KD3A 4QNMA 2QTVB 2J0UB 4Q47A 1JAXA 4JENA 5K03A 3PNVA 3R41A 1W52X 3RAGA 4OD0A 1GLNA 4NJEB 5CM2Z 1ZH4A 3I73A 5AJTA 1N2CE 2QRGA 3RF7A 1YUBA 3MT7A 5K09A 4NCBA 2BMVA 2X5OA 2QTFA 5LQRA 1B7GO 4ZI7B 3LUFA 3V4FA 5CVEA 1XVUA 1M66A 4HDSB 1DTSA 1EE2A 1M1NB 2W2TA 3HV2A 4UEJA 3U7JA 3ZWMA 1M72A 4YPOA 3RHTA 1XZNA 7ADHA 2V7PA 2AR0A 4GT1A 4N49A 4CIWA 5LR6A 1EI9A 1W46A 3IBYA 1KJNA 1LPPA 3KSBC 1SIWA 4PC3A 4RADA 5HCIA 1W5TA 1TDJA 3K9FC 1KP2A 3G0CA 3ZWCA 2WTBA 1T1SA 3CSUA 2ECOA 2WQ7A 1W1IA 2ZAOA 4KWEA 1CNMA 2CHGA 2PY6A 1XPJA 2HT1A 5F35A 3MWLA 5C8XA 3K3PA 2DOKA 1W581 3DYVA 3A3PA 2O3TA 3BMXA 5LMUB 3ZHUA 4LVNA 4PZPA 2HZBA 3FCSB 3LZCA 4WXPA 3CCBA 3AHCA 1HBJA 2B0JA 4MA4A