2OV6A

The nmr structure of subunit f of the methanogenic a1ao atp synthase and its interaction with the nucleotide-binding subunit b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
b'MELAVIGKSEFVTGFRLAGISKVYETPDIPATESAVRSVLEDKSVGILVMHNDDIGNLPEVLRKNLNESVQPTVVALGGSGSGSTSLREKIKQAVGVDLWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type ATP synthase subunit F
publication title NMR solution structure of subunit F of the methanogenic A1AO adenosine triphosphate synthase and its interaction with the nucleotide-binding subunit B.
pubmed doi rcsb
source organism Methanosarcina mazei
molecule tags Hydrolase
total genus 23
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 2ov6A01
3AONB 5KNDH 5KNBH 3VR4H 2D00A 4RNDB 3W3AH 5KNCH 4IX9A 2OV6A 3VR6H 2QAIA 2I4RA 3VR5H
chains in the Genus database with same CATH superfamily
4EM6A 1N8TA 1OHHA 4LUCA 1LLDA 4FM9A 2DHRA 2G82A 2YWJA 2AD5A 1XAJA 2I7DA 3WE7A 4M9RA 4ZI7B 3E9YA 1GPKA 4HLNA 2AEJA 2AK3A 4ESVA 4ZEXA 4AO7A 3ZBQA 4PVCA 3BQMB 5DHFA 5KU7A 5FNVB 5B3KA 2HREA 1GUYA 4GGMX 4GBJA 5HCNA 5LN1A 3FUVA 2A6PA 1J1UA 3K6JA 1PWYE 4E0BA 2ETXA 4DIKA 4FEAA 4Y2QA 3DFKA 4DMGA 3TLBA 1NAIA 4RPGA 2FE4A 3IR7A 1SCNE 1IZYA 3RRZA 2HLPA 1D9ZA 4WLUA 2FUCA 4H0CA 3RWMB 2HBRA 2M98A 2WM8A 3VH2A 3ZY5A 5B58C 3AYZB 1XMVA 4RQBA 4YXWA 3R9XA 2QP9X 1LGYA 1Q57A 2YWRA 3GVHA 4YFYA 5EVJA 2OAEA 3K6RA 1TA4A 1QRDA 2FZGA 5LOVB 1OYOA 3LPDA 1C1YA 1LVUA 4W9NC 2AUMA 2I2XB 4HAYA 4O2RA 4Q05A 1CZKA 2HWXA 4MROA 5C5IA 3T52A 5BMVF 1V1JA 3QEAZ 3PPWA 5BWBA 2R7LA 3WTCA 5HCUA 1E1DA 4O33A 2FZLA 3HY6A 3L6BA 4ND3A 1H22A 1LD3A 1HY3A 3LWBA 2IV3A 1FYFA 3U09A 4BV2A 1QGAA 1E1NA 1SVLA 2AOUB 4I1IA 3AHDA 3NHYA 4E03A 1R4ZA 2UVDA 2J6IA 1YB4A 4MUIA 2ZAIA 4OIFA 4X5OA 4I4NA 1QFJA 3SC2A 2X15A 3WGNA 4PAWA 1XEXA 1VKJA 4EB3A 3L9WA 4YWHA 1LBHA 2FFQA 5HP4A 2UZ3A 3IGFA 2QVCA 3VU9A 4NZOA 13PKA 2I2DA 2WBLC 3I3SR 1IHOA 1B8UA 1J24A 1M75A 2HDNB 1GQRA 3BFJA 2R1VB 3NJ8A 5DLQC 3KCQA 1B15A 3F73A 1M74A 1V5WA 1USWA 1P19A 1XQVA 2B4RO 4MR9A 2I3DA 4RCYA 2C94A 1T1RA 5DSTA 8OHMA 1ZZEA 4RK5A 2FEKA 2MSKA 2WZBA 4TLMB 4TYQA 5DI3A 2QY6A 3THOA 3R0ZA 4DQDA 2VF7A 2XAAA 3A1TA 4O4IA 4ZARA 4I0WB 1MRNA 4KEAA 3K9HA 4EJMA 1KC3A 3EPPA 4JP8A 5C8YF 3WWCA 1II8A 4BB0A 5A04A 2DY1A 5HGJA 1GKLA 2AXNA 5FOTA 5JBQA 5IM4A 5CA0B 2XXAA 2WAAA 1WO8A 1A9XA 1C7IA 2GASA 2HPAA 1JDSA 2OCYC 3AB8A 2N75A 4HB3A 4OGLA 3EPLA 3N2YA 4GM1A 4IJKA 3HLKA 4NBRA 4DWOA 1YTUA 2H1FA 2V3VA 3C3MA 3K30A 2P0YA 3CVWA 4WXMA 2CSXA 1ILEA 1ZOLA 3O9MA 4WVLA 3HO8A 1CZLA 3MLEA 3L8HA 1BAPA 2FY8A 3B1ZA 3LKDA 5B7QA 2JGEA 1Y8QB 4YRSA 1FSSA 1PR6A 5D3ZA 3BL6A 4Q3EA 1G1MA 1P18A 3HZHA 4KWCA 3RBAA 2C2ZA 3GVIA 3A1FA 2ZANA 3ED1A 1Z37A 3UK7A 1E18A 1WRBA 2GS9A 2V6JA 1F3LA 3RK0A 4F4CA 4UEQA 1RPAA 3Q7QA 3MMXA 5IZCC 3L5OA 2HC9A 3DMDA 1MT0A 3F6BX 2WKQA 1NXWA 3E81A 1M9NA 2XYRA 2B4QA 3RSQA 3KZVA 4LNUA 1NULA 4JJFA 1W5AA 1ZBQA 4CQLA 3TTTA 1J4AA 3U56A 2WMNB 2BFEA 4O0LA 2VPZA 4MRPA 3ILVA 5G0SA 1VBNA 4Q39A 4BVAA 4J8PA 4B3DA 3H3XA 1HRDA 2ZUDA 5F77A 4DQVA 3HL0A 3R5FA 4U00A 3PQ7A 5GQSA 2O8CB 2O19A 1RWOA 5KWSA 4Y1GA 5BN1A 2ID8A 3GLKA 3MIZA 3DB2A 1ORDA 5H70A 5TF4A 4QBTA 4CKEA 1KRWA 1UC4B 1OH8A 1DSSG 2QR3A 4U7FA 4RPCA 2RGAA 4QQFA 2AI2A 4P3XA 3OT1A 1HEYA 2DPXA 3E35A 1FP4A 4AF6A 3UMMA 3IILA 1EE2A 4A2QA 2G4LA 3WKBA 2CY0A 5DZSA 3CG4A 5L53A 1YT5A 2WU0A 2B35A 3NOVA 1GA4A 2RI1A 1XZQA 2W48A 3AJDA 3IA7A 1OZHA 2EZ4A 4OB6A 2ZBEA 3BDVA 5DBOA 1PFGA 2HQOA 1CR2A 1TM3E 1G17A 2G07A 2J41A 2DFKB 5JD6A 1OBHA 1WXXA 4AN4A 1YBVA 5K8TA 2NAPA 3NHKA 4NCAA 1NJ5A 5CHYA 1FTWA 2JBHA 4K6GA 3GCWA 1NMSA 2JGLA 2ZIXB 5EUMA 4ZVOA 2WWVD 3RJZA 2EFYA 2WDPA 2JBAA 1D6MA 1E1LA 3G2OA 3KOOA 3LQ4A 3BIFA 1T4BA 1PFWA 3G85A 3IQIX 1U94A 3N59A 4LBWA 5E7JA 3T5DA 3TIGA 3O4JA 4OATA 4UM5A 2EFGA 2N47A 3N39C 3IKJA 4B6EA 1A8IA 3CE9A 2CT8A 1SHJA 5E1OA 3PUJA 5GZ3A 4JJ4A 1IB0A 1KU6A 1GUDA 2OFXA 3HBMA 3ZW7A 4NJEB 5DYIA 4DJFC 3AOGA 4OH1A 1V7ZA 4KXMA 1TCVA 1WXEA 1YACA 3AR2A 2B83A 4FBGA 1MVOA 4DLRA 1A4XA 2DBRA 1UBRS 1QIHA 3HEMA 5CNMA 1QC5B 5AKGA 3IXLA 2JLYA 2FCAA 4JC8A 5IUJC 5IANA 2OHVA 2VSNA 3MTDA 4RD4A 1RQGA 2APJA 3BMOB 3I04M 2ATVA 4RD0A 2R00C 3TX2A 1PFKA 2YNMA 5BSEA 1C1HA 2G83A 1N2CB 1ECJA 4OHZA 1IN5A 1L4GA 1MB2A 1W73A 1A2BA 4IRMA 2QBYB 2Q4BA 3I6YA 1TPZA 2QSZA 3MUFA 3AK4A 1DEAA 5JE8A 3UHPA 3ZC3A 2EF1A 3H18A 4K86A 4EKIA 4IXDA 4U8GA 1QFXA 1RTTA 5T4BA 4CR6A 1GPWB 6NULA 1P1JA 2HXSA 1TA0A 4DR4B 5JSQA 3IBGA 2ZB7A 3AERB 3G2NA 2CUZA 2O2JA 4KPEC 3TFWA 2PPVA 5JVDA 2IVZA 2OYRA 1GEGA 5DGIA 1KR5A 1K5HA 5ELMA 3G82C 1NQOA 3HYCA 1YMQA 2O0JA 3LLSA 3LHIA 3MSXA 4OK6A 1AS0A 5KZMB 2H0RA 5LMNB 1L4NA 1IU9A 3VNQA 4I1RA 5EJGA 2QN1A 4B85A 3W6UA 3QMWA 3DL7A 5D51S 2IHZA 2Q2QA 3AW8A 5IABA 4NC9A 1H1LA 1OBOA 1ODFA 3EIEA 2RKOA 3K9NA 2EOAA 4H7EA 4KX3A 3UCEA 3G0OA 3BC1A 6ABPA 3HBJA 1Y42X 1G6KA 2HA4A 2HH9A 3ORFA 5TMEA 1KXZA 5EJEA 2QVLA 1HSZA 1T2DA 3AFHA 5EE1A 4D0LB 3L5KA 1F8YA 3N58A 1EH5A 4WBSA 3RQIA 3OTIA 4BKOA 2QE6A 2CUKA 2X6TA 2JVIA 3FZYA 1RI4A 1TVEA 3JQFC 3W34A 1L8AA 1EFCA 3K9QO 1GTZA 2PX6A 5I8WA 4LQDA 4KQ9A 5BT9A 3SJAA 5ECYA 3GLFE 1I1HA 3THSA 3KG2A 1KZGB 1NNI1 4V0OA 2AXQA 3COSA 4F5YA 1EQ2A 3WWEA 4OA8A 1OV4A 3ESQA 4XUEA 5E1MA 4IGAA 3L0ZA 3BN3A 1GV0A 3QITA 2C88A 4UAGA 4Y18A 5E6RB 5HDBB 1A50B 4J91A 2QG9A 4H3HB 5A9RA 4BVHA 1XG5A 2FOLA 5KYUA 3I6IA 1AQIA 2JFPA 4R05A 1YB5A 1IJFA 1TF5A 1SCJA 2JJQA 3CPHA 3GQVA 5JH7A 1LX6A 2AG0A 1H4SA 2Y71A 3BFPA 3RUAA 2NPIA 3ENNA 3S1AB 3BK2A 2R7NA 1EHIA 5AQEA 1U28A 5GJBA 3ZJ5A 1C1XA 3KOZA 1OI3A 2SKEA 1N0HA 1RYZA 3G7SA 4FC7A 3ZN2A 4C2BA 4WBXC 2W0MA 2QVBA 3AEYA 2AWNA 3WAJA 3QLJA 4UOZA 3IDQA 3HCNA 4U9UA 4PNPA 4DLBA 5AJXA 5K0NA 5AYVA 2HJWA 3JVDA 3QFHA 4RVDA 4ZOLB 1NMXA 2PBZA 1J42A 3BRWA 5EMNA 1OH6A 3B13B 4YMTA 1E5LA 1UJCA 4EYSA 3PPIA 3OF5A 2BEJA 4MCHA 4QPNA 1K3UB 4YRMA 3OEEA 1OB5A 4Y9DA 1FFAA 4G5OA 4IDCA 3D6TB 1UBUS 2RJNA 3ED5A 3Q9NA 3ZY4A 4HG2A 3UJ8A 4PXAA 4KQ6A 1PZHA 3KEMA 4TLLB 3QBEA 2CVHA 1HL3A 1RBYA 2I4IA 2IGBA 3PGA1 3R7SA 3RFXA 1FQOA 5CB4A 2EGUA 1FE8A 2EW8A 3NU1A 3OLZA 4RFLA 3TXAA 3CZCA 3RYFB 2ECKA 1IZ8A 4INZA 1C7QA 1RJGA 1SFRA 4PWYA 3UENA 1SUAA 4ALNA 1D8AA 1EEXB 3DQPA 2IUSA 4KUEA 1Z35A 4P1ZA 4PCLA 4R8KA 1CIVA 3RNLA 2Y2VA 2PRJA 1YZTA 4I4TB 3GA5A 3Q9SA 3UHOA 4MH0R 3NHZA 3U9SA 2P9EA 2VYVD 2YJNA 3OWOA 1PUXA 4RH1A 1IMOA 3A04A 4ER0A 3A2MA 3QP9A 4NATA 5L3QA 1IIRA 3K9LA 4AKEA 2YW2A 1A9PA 1OIWA 2H6EA 3H1GA 7ABPA 4E5UA 2DR2A 4YJFB 4HYYA 1FOEB 3W4JA 4NZYA 4ES6A 3NEYA 3NHPA 3T15A 1NQWA 1EK5A 1QLHA 4EY6A 2HEGA 5JY6A 1A8SA 1GQ2A 3UK0A 2VHJA 1QG2A 4X66B 4MUFA 1A7AA 1DRUA 1XDUA 1ID8A 4G0QA 4MZDA 1SXJD 2I0FA 2GZSA 4JQSA 5AIAA 1U3VA 3HR7A 4BJHB 1IWBB 3A3NA 3OCZA 3P2KA 1FRNA 4LZOA 1RJEA 1HFEL 2FX3A 2CJWB 2GH1A 4BTVA 4CLXA 4I55B 4WJLA 1CS0B 1EP9A 2ID9A 2OQVA 5F7OA 3LUPA 2C2WA 3H0CA 2PGAA 3PHGA 4KBGA 3S5JA 2LCFA 3GNTA 4LSZA 4NAUA 1DUVG 1JT9A 4BEVA 1ETHA 2ZJ3A 2XYHA 4E2FA 3ZZMA 2PK3A 5ECDA 3GLRA 1CDEA 1ZN2A 1FSPA 2QTWB 3QU5A 1M5UA 1QXSA 3LYAA 1W6UA 4L9SA 5ALOA 5CIWA 3TIIA 2KQUA 3IOEA 3MOIA 4XLTA 4IQFA 4EARA 2E2WA 4UREA 2V6GA 5KX5A 5G02A 3H4TA 1T8UA 4FI3C 3VKUA 3GUYA 1CY8A 1E2PA 2KM1A 5EJMA 1OA1A 4FMDF 1HE2A 5GJWC 2GM9A 1EFAA 4LYEA 1J8DA 2O8FA 1U0HC 3JZIA 4F3YA 2ZE8A 2XQGA 1YJAA 3A9TA 2IDKA 5CFNA 1XRPA 4FYMA 5G0WA 2NO5A 1UZUA 3AEQB 1WLYA 4G1UC 5DTJA 1NUAA 1XVTA 1YI0A 3GLHA 3HC7A 4GX2A 1J8FA 1S4QA 2BUCA 4PU0A 2W90A 1MOSA 4TWJA 1QR6A 5T4EA 4G23A 4YCMA 3PUIA 4DZTA 4MRNA 3K6SA 4G2NA 1BRMA 5CEFA 1C0KA 4HF7A 1CWUA 1NKVA 1JFFA 2W98A 2BZSA 1BYUA 1JR2A 2PH7A 2WZDA 3HDTA 4Q01A 3ST7A 1H2RS 3OFKA 4YBRA 5FORA 3U9LA 1M73E 1LW6E 3M9LA 2ZQ5A 3N2IA 1MPTA 3J7AC 2VHYA 3C3WA 3X44A 3HXOA 4XX0B 4QECA 1ZZGA 4N1AA 2ZJFA 2WJJA 2A59A 1HLDA 4EG3A 2UZAA 3DSRA 3NT5A 5F4BA 5ANRB 4BAGA 2X0FA 4B43A 5I7VA 3VSEA 1TI7A 4GI1A 4CDRA 1GGKA 1EP3B 1GSHA 2ZJAA 1XJQA 4ISCA 4J1TA 1Z4JA 4Q16A 5JCJD 1X14A 1RXVA 3FVQA 2E6KA 2WABA 4MR8A 4OHYA 3O47A 2JFXA 1BOFA 2C5BA 2YVKA 3QVKA 2VQ3A 3VDQA 5E9AA 4C4PA 2ZCVA 4F3NA 1CZUA 3ZVNA 2IYPA 3AZPA 4FLMA 4NDAA 1VOTA 5LKRA 5I9BA 1V3QE 3WLRA 2DULA 5AVWA 3AW9A 4DMLA 1FZTA 3IPXA 4XJXA 1W0KD 3U7IA 3MBKA 1U9CA 3QENA 3ENQA 4IV0A 4R84A 2J3IA 3MWLA 4Q02A 5FT9A 2RGRA 1TKAA 4S1TA 2QTVA 1EZZA 1KO8A 2Q6LA 2XDWA 3B51X 4O4LF 3JAKA 4HNTA 1TPYA 2PTHA 2Q49A 3DLIA 1BX1A 3LPCA 4TS4A 1AQ6A 4J2OA 3MFYA 3I01M 3PFHA 2SICE 4IDGA 4DLTA 3BREA 2H4XA 3BB4A 3TLAA 3QKSB 4L07A 4UJ3A 5CB0A 3TOXA 4OGGA 1P74A 3GLIB 1ZW6A 1MQ8B 1ODTC 2H07A 2QMEA 3LWDA 2JLWA 2V5UA 1AA9A 2FRDA 3D8UA 5IYZA 4ZDWA 5DHTA 4PSVA 3FPCA 1LPSA 1RQ7A 2Z3WA 4MV4A 2D7DA 3R4CA 2H8KA 1VMKA 4HPWA 3F96A 1B0UA 1PDWA 2JGMA 3H2GA 5BYAA 4C7OB 2GA8A 3C48A 4FWTA 2HB6A 3A37A 2AZ4A 1GPAA 3OQIA 3QPDA 1PEDA 2IV2X 1YZNA 3ZEIA 2HMSA 1G2OA 4EGJA 2IYXA 1WMAA 3KFXA 2I6SA 1ZJYA 1QVVA 3ZX5A 1FUKA 4ZANA 4F38A 3WP1B 1UBHS 1B8PA 2RG7A 3KALA 1UBMS 1FNDA 3WLMA 4KLCA 4O6VA 4KQWA 2R5NA 4PG4A 1J1IA 1ORRA 4D8YA 1RLTA 4GOXA 1C7JA 1QF9A 2GZAA 3KKOA 4DARA 3FNIA 3IMKA 1XLWA 4MJ7A 4ETMA 1NLFA 1TM4E 3HA3A 4QDKA 4DIFA 1EVJA 5BWMA 1G9TA 3P9YA 5B1IA 5E38A 2KW5A 3B12A 2W2OA 2XCLA 2YHIA 3NYQA 4Q7EA 3REQB 1L4LA 2A0YA 2Y9MB 3DNMA 4A16A 4HFNA 4DVJA 5D1HA 4PO9A 3UQYS 4EHIA 2FRVA 2XBLA 2X0NA 3SQLA 3CLRD 5B6IA 2G1JA 2IPLA 2QP3A 5JCOA 3UUGA 3C8DA 3LDUA 4NARA 3Q0IA 4KRFA 3N1UA 4TN1A 3IJ5A 3LRPA 2P1DA 4XDZA 1PF7E 1DAOA 1IATA 1KHTA 1QLWA 4MUYA 3UKDA 4XEHA 1M34B 3FMVA 1L5YA 1NIJA 1NHGA 1O9BA 2YNMC 2A9JA 4RFVA 2WE7A 5CFLA 1VA5A 3VU1A 2FZCA 4B83A 4IG9A 1FZQA 4ITRC 3W1WA 1GAXA 2CE2X 4BLVA 1GZVA 3CA8A 4H7IA 4RENA 5HF9A 3FOWA 4DEYA 4YXFA 4FOOA 5GY7A 5HUHA 2B0JA 2IBTA 3T3HA 4ECEA 4BC1A 4FBLA 1XN1A 1L8QA 4NYMR 1Q1ZA 1KAOA 1T6XA 1E96A 2W2QA 3TFOA 2XMDA 4DTIA 1S89A 1YCDA 4G5RA 5CT6A 5EINA 5TMPA 5DMXA 3CW9A 1U5BB 5EHIA 4CL8A 2PXAA 2V9CA 4MARA 4GUDA 1BKYA 3DUWA 4L08A 1GKIA 3IT2A 3SI7A 2FKAA 3JWPA 3NBUA 2C9DA 4FR0A 1GZ5A 1SZDA 5C7YA 2HJSA 2Q6IA 1XZKA 3Q3HA 4DSZA 1C8BA 2B4KA 3VPFA 5EJ4A 3F5SA 3TX6A 5HRCA 4P54A 3DT6A 1DO8A 2QMQA 4ND5A 4C6TB 1EHYA 1N77A 2CHGA 3W90A 1R6DA 3T7KA 2PZEA 4IUCS 1T9KA 2X8WA 4GPBA 2FW9A 4YUZA 1QPZA 2GGSA 3CXUA 5G40A 2ISCA 3IVGA 4JJKA 3IIIA 1KI1A 3SHQA 1QAMA 5TGTA 2AZMA 4WZBB 4YV7A 2MYTA 5AHOA 3U7QA 3DW3X 3UGTA 3W06A 4UPEA 5LLTA 5EIXA 4FFMA 3RSHA 4K7JA 3AVTA 4J0HA 5A1TA 3P9IA 1OTXA 1R0WA 3PC8A 1X7ZA 3EXIA 4TTAA 4NI5A 1PRYA 1QGZA 1UR5A 4ZVNA 4TZ0A 3EFOA 5KS2A 3I2JA 4LFBB 2IZ5A 2KMLA 2W8BA 3DL0A 2P4EA 4QJIA 1X9GA 2PS0A 2MIIA 2WIBA 5K4HA 3L04A 1Z74A 3L41A 1C30A 4YJHB 1KI6A 2PQ6A 4H7PA 3ZDFA 1OZFA 1OKKA 2J5KA 4BQRA 4ZOQI 5GWXA 2X77A 2I8CA 3B1YA 4NZPA 2FPXA 4BMPB 1C7ZA 3A0UA 2WJAA 3BD9A 1J8QA 4LPKA 2IIPA 2XUAA 4CNBA 3U16A 4TTIA 2YZKA 3D5QA 4TMZA 3RRFA 4N7MA 1U28C 4M0LA 4KQMA 3PQ2A 2ZYHA 3P9KA 3UWOA 3OKCA 4C2TA 4DYDA 1VL0A 3LP6A 2QKYA 2VHZA 1XKLA 1YVPA 2J85A 4U2DA 4NU6A 3TW6A 1A9RA 5HF5A 1J90A 4ONEA 4HTAA 1SPXA 5F3RA 1GT6A 4PG8A 3IEPA 1MORA 4CMGA 4ENRA 3L6EA 2WTNA 3L4KA 4KO4S 3PXBA 5REQB 2PD3A 4GRIA 1C7FA 3G88A 5LA6B 2DPYA 1XC7A 1XZGA 1T15A 1AB5A 4MS1B 3T4XA 4YR9A 2G5CA 2ZJ6A 3HN6A 1ZSNA 4EUNA 2RHBA 1R66A 2BKVA 4HTFB 1AN0A 2IEBA 4IH1A 4X20B 3ZJTA 3H5TA 4GSYA 5CJPA 4HEA1 1W5SA 4LRSB 5EZSA 5SY4A 1TAQA 1QH9A 3BF8A 3E6AA 3LCJA 3G5LA 6REQB 3SEZA 1ODIA 3O4FA 5CNIA 1DINA 2QRNA 4P4LA 4WLVA 2ZWOA 5A4KA 5BSGA 1YIAA 3I64A 3PRYA 1L7DA 4C5CA 3NT4A 5B64A 1CP2A 5AJTA 3D2AA 1E1RD 3EQ8A 3WA6A 1JEYA 3K9CA 2EFJA 5I9IA 1J5EB 2HLHA 3UJ7A 4G25A 3PGMA 3SZUA 1W76A 4MV3A 1U2SA 4PZUA 4W7IA 2FZWA 5TPWA 2JIZA 3TAXA 2WD7A 3LCUA 4Q1DA 1N57A 4NHOA 4W5HA 5BYJA 4D5GA 1M5RA 4HNSA 1X8LA 3M6LA 3RCBA 3JU3A 3A58B 1BCRB 4C3UA 1EVQA 2W6JA 1XRQA 4P36A 5KYWA 1EXNA 2P2DA 1CDDA 4ZTZB 5CPFA 4HOYA 1RXCA 4OMDA 4EPRA 2AJTA 4LRWA 4M36A 5JAOA 1B1CA 3H1BA 4ZHQB 4DCSA 3NAQA 1NKTA 5CR9A 1X13A 2VRBA 5HG0A 1JFRA 2Z09A 3TGPA 1HQYE 1GGEA 4JMLA 3D54D 2J3HA 4CGZA 1S8NA 4FK8A 3S1LA 3ETNA 4XXHA 4MVJF 3JWGA 1N8SA 2FW7A 2WF8A 3II6X 4PZ9A 4F8YA 5KTRA 4ZCQA 1N2HA 1JXAA 3F9RA 3GEPA 4BZPA 4JSYA 3IQWA 2VP4A 1UBJS 1ML4A 5B2ZA 4KOEC 4YJKA 2GPYA 5FB3A 4JEUA 1E9DA 1OFVA 5GVRA 3WBBA 1NNSA 5KNBD 4Q19A 2A92A 3CLSD 5EP4A 1N4DA 4G24A 1WCYA 1WPQA 4DPKA 4FTWA 3ZXYA 2H5JA 3O5AA 3WFIA 1FBNA 4B44A 1QQ5A 3BF7A 3N8GA 2MWMA 1R15A 4XQGA 4ZZIA 1LQUA 2HO5A 3IP9A 3KJHA 5T4HA 5DW0A 4G1CA 1Z6GA 2D1RA 3TIVA 1EK2A 4Z0TA 2W4QA 1LV8A 3EZLA 5CDTA 4H1TA 3EG9B 4Q1EA 3CKMA 5DTEA 3IHKA 1VL8A 4DXDA 1ZG3A 3WYCA 2WW8A 1KPGA 1SCQA 1RYHA 5TB5A 1AURA 1H4TA 1JDVA 3DE7X 1UKVY 4DJEC 4NABA 4IYJA 1XQWA 2GCGA 2ZRPA 4OAPA 4OQFA 3RLIA 1RHUA 3BJZA 2GD6A 1UQTA 2PKQO 4M1WA 1MABB 5ALPA 2HY7A 3DHYA 4Q9HA 5DWDA 1C8LA 2P2ZA 4K87A 4QOJA 3GCXA 3MIIA 1QANA 4Y8VA 1KVUA 1N6LA 3PUXA 5K0GA 3AIKA 1R3UA 2NZJA 5I01A 3HE3A 5HWSA 1U99A 4CETA 1I80A 3T3GA 4J1TC 4GKBA 1G9XA 4DM4A 4E09A 5DX8A 4BFUA 2H92A 2C96A 2QTCA 2C61A 3QVOA 1OAAA 1Z26A 2WT4A 1JLLA 4R98A 3T7DA 1KYWA 1AGXA 3HSSA 3KKEA 1RKBA 3THYA 1QQTA 3UK1A 2ORIA 3PFBA 4FFLA 4M1EA 1BWSA 3QWIA 4KZPA 5BR7A 2R751 2XGGA 1RJDA 4PX2A 4F93B 4KLAA 3GT0A 4KAFA 1J2YA 4DIOA 1KEUA 5K2MA 2HBYA 2WTMA 3RKRA 4CFYA 1UMBA 2GRAA 1P2GA 2AD1A 5BSHA 4FHEA 1CPYA 1DP4A 2XEDA 3ZDDA 3BX1A 5TS2A 1V9LA 2X0EA 2QDKA 3BYZA 5A2GA 5ELXA 2BJVA 1WB9A 3HRKA 3RVBA 2QE7A 3W1EA 2Q29A 2VYNA 4AX8A 1J2RA 4LRYA 3V7YA 4XWKA 4Q47A 2Y0BA 4Q9AA 1MV5A 2ONYA 3M6MD 4ZYVA 3JZMA 1QM5A 1ZCJA 2H4HA 2Y67A 3GDWA 4MGHA 5CU7A 3VU8A 3ER8A 3ZHUA 5K8JB 2FRDC 3LL4A 4Y2JA 3SXJA 1JDZA 4LHYA 4LTDA 4QJBA 4FYJA 2Y1OA 1HYHA 1VHDA 4G1EB 1X7DA 3V34A 1LI5A 1N2JA 1XCLA 4ARVA 1SVIA 2I6QA 3B5EA 3IBSA 1M1UA 3SHWA 1Y6GA 1YV9A 3TS1A 3INGA 4ZVMA 1VYHA 4ERNA 1DRWA 4BNMA 2Y99A 1T0BA 1BG6A 1PGQA 2ALJA 2CZQA 4IVRA 3V33A 2WPDD 4ACBA 4LWOA 1JDBC 1JH9A 2VSYA 4CM4A 2VWQA 4LK3A 1HA3A 3W8RA 1V8FA 1EJ2A 4B33A 3SSNA 2WF7A 4DA9A 5J58A 3G2LA 4B5LA 4CTMA 2BBOA 3FROA 3N07A 4R2LA 4Z9XA 1BVHA 1UPBA 4HPJB 3RC1A 4AO8A 3AKEA 2B5WA 5E9WA 1OA0A 3G1TA 4CM7A 1FTQA 1LQ2A 1KF0A 4XJSA 4MRSA 2BFFA 3DM5A 5IJ9A 1J0DA 1GCGA 1FX0A 4GRAA 4NK5A 4BASA 4V1CI 3CZPA 1NHWA 5IEJA 4MV9A 1J2EA 3CEPB 5ENZA 4H15A 3UXMA 2OORA 3DBLA 2G1PA 3AR5A 3G8DA 1NZDA 4B3XA 3ITKA 1SCAA 5AOAA 2D1SA 4YRLA 4A8TA 5JMWA 4YLYA 1KEKA 1NP6A 4LXIA 2GKSA 3AT1A 3HDJA 3RC9A 3UJ3X 2GCEA 3KLNA 1F2VA 2W6NA 5DGTA 1MHTA 4NOJA 4JLJA 3QNWA 2RSLA 2WM3A 4KQ2A 1XU9A 2P65A 2PUEA 1X38A 4FMCB 3G3EA 2IHNA 1UDBA 2JGKA 1FPQA 2WF5A 2NU6B 2I4NA 5TEWA 4D56A 5B2FA 2OR3A 1RAAA 3JARA 3SKYA 3I9KA 1UC8A 1VHTA 1RLMA 3TW4A 2NZYA 3DDUA 3HMQA 3QE4A 3DB1A 4MQFB 4RF5A 4XX1A 3THXA 4CV0A 3ZD8A 1KI8A 2OAQ1 2PXXA 3QOWA 1HDEA 4PLGA 5D3MA 4WFKA 5IH3A 3STWA 5LLDA 5CD1A 4LA4A 5F5NA 3RRNA 1KS9A 4Q9DA 1LVHA 1EFVA 2FQWA 5B4VA 3Q41A 1AZSC 3DEZA 3CN7A 4V02A 2ZYUX 3GBVA 3OKPA 4D0GA 2GEUA 2Q5LA 1IZ7A 4L9AA 3B2NA 1N2CE 5LUAA 4QNNA 5AVRA 2QRQA 3K70B 1H0KA 1DIHA 4DMFA 3I6MA 2J87A 4NU8X 3ITDA 4BNDB 2UUOA 1R6XA 2B4AA 3FVRA 1PJ4A 5LNK6 4MYDA 4RMGA 4ZU6X 1TFRA 4HFRA 4TUYB 4EHLA 1E4EB 4GOLD 3AY0A 1RAFA 1ZLXA 4QHSA 4O2BB 1D6NA 1QV6A 1W2HA 1E6UA 1NQTA 2WJGA 4JIGA 1L5SA 1V37A 1L2TA 5J2UB 2MSLA 1SOUA 2VDRB 3CX8A 3LBFA 3MWDA 3LY9A 4YPOA 4BO9A 3QPWA 4WZAB 3PC8C 4ZZ0A 1XVLA 4G37A 3FR7A 2Z6UA 1HT0A 1UZAA 2B5VA 2PGOA 4GG1A 1R74A 1CLEA 3MHTA 1HI9A 1PI3A 1JLSA 3E22B 4DUGA 4ZJPA 4M83A 5K7SA 3ABIA 3MMNA 3WK8A 1OLUA 1TO1E 2C97A 1V5EA 1QYWA 2X8JB 3FYUA 1S0UA 3K8YA 3O8OA 4LQCA 3OQNA 1H0SA 4DSAA 2VDNB 1G8HA 1GZHB 2ZBPA 4F12A 1VMEA 5K3OA 1LWOA 3LPNA 5BNFA 5A7FA 3TL3A 4BO3A 2ZZMA 2Z2IA 3Q8KA 3RABA 2HF9A 2RGXA 2XH8A 4GZ6A 5TV2A 3IDAA 3U6KA 1T4GA 4XD7D 1RHRA 3BULA 4CKWB 4G63A 2WJHA 2VXCA 3I6ZA 1F06A 3HXLA 4TROA 2R87A 1NF3A 3H11B 5HHTA 2NUPA 2K7ZA 5C7IO 4JQZA 3R0JA 1E98A 1UWCA 4L5CA 1Y81A 4OXIA 3IEKA 3K4PA 2EKBA 1NLZA 2QMYA 2HOQA 3AY7A 4U7GA 4PYJA 1NVAA 3VNVA 3G9TA 3CUKA 2GUGA 2X4LA 4H27A 2VQFB 3PQEA 4U7PB 4F5WA 4GEGA 3SFVA 1R64A 4LZPA 1WF6A 2JW5A 3HUUA 1JHDA 3GD7A 1A5BB 1CDZA 1Z4QA 1EGQA 1FDOA 4N54A 1AKYA 4P6VF 3T4UA 4M9XA 3QVUA 1JKJB 4N76A 3D02A 3AR3A 5LZ5A 4CHGA 1GL3A 1V7CA 2I80A 1ZVJA 3HU5A 1KMCA 3MD9A 3PQDA 5BN5B 4ZCSA 1Z5VA 3QPUA 2WA2A 5FULA 2JIOA 5IBQA 2HJGA 1QPGA 1TQ2A 4UD2A 2VP6A 1QQBA 3DV0A 4TWBA 4OP3A 1TRKA 4MWTA 1GZUA 4PXSA 3RREA 1E6WA 4LZWA 3GLFA 3NRJA 2YICA 4MB2A 2B92A 4ZO8A 4BFCA 4EA8A 2HCJB 1C0IA 3ESZA 4KFTA 3O6VA 5KBYA 4B2YA 2UUPA 1S2NA 4Y1EA 5KQRA 1MQ9A 2M6SA 2J4FA 4RVUA 3ZK8A 2F00A 1A2QA 1P62B 2IYLD 1BEUB 3KHUA 5CXXA 3OAAA 3T3DA 3W5SA 2CK3D 2Z9BA 3G2PA 4X62B 1MTZA 4LJAA 4O1MA 4U5QA 3W0LB 4KREA 4KWTA 3H99A 4PO1A 4W5WA 5JFOA 1Q77A 4C04A 5U4QA 4D92A 3DGFC 1KRXA 3ZU6A 1E3IA 1FNCA 1DKOA 4EFLA 1KZ6A 4OSEA 1R0SA 4P53A 1GGHA 4BOYA 4Y6RA 4W7HA 5T57A 4DC0A 1Z0UA 4ZVTA 4R3WA 3LT5A 3NGMA 2Q2OA 3OMXA 2F3UA 2IODA 3ZY3A 4L76A 5CA1B 1Y3AA 2ZJBA 2ZUUA 3F5FA 1PR0A 2MSWA 4LHSA 3DZDA 4PANA 3H87A 1XI2A 1GZ6A 2VLBA 2EIXA 3E1KA 2XWSA 3FYCA 4KSBA 5GONA 1F8GA 4RH0A 3RQSA 3RRMA 1QOQB 3O8CA 3GXBA 1GCAA 5BY2A 1RC8A 1QZ3A 3CC8A 3O84A 4B9AA 4E5DA 1OT3A 1PEAA 3LLVA 3MHPA 4ZHSA 1VMIA 2V7UA 2WKPA 4QDZA 4MW5A 3N8DA 6YASA 3ES9A 1ST3A 3LC1O 2Y68A 2AJDA 3O95A 3SZ3A 3V7FA 1UKBA 2GCIA 5EJ7A 2BDEA 3V1YA 1N9ZA 2O8EA 4JL5A 1YA4A 1XCGB 2MSEB 1Y1QA 3DVAA 4C7MA 5IKPA 4CTNA 3JWJA 1X19A 2A9QA 3WK6A 4UE2A 1Z0IA 5KNCD 4Q9JA 3OOYA 4ZMSA 4YT2A 3U6BA 3QXSA 1AKEA 1IBCA 4I66A 4PFKA 1T8TA 2ERYA 1P5FA 2IZ6A 1KMIY 2P5UA 2QY9A 3K6KA 3SBEA 4GC5A 3UOGA 3U4MA 421PA 2R1ZA 3S28A 3CX4A 3COPA 2RHLA 4IFTA 3P45A 3RRXA 1ZI9A 1Z68A 1NXXA 1UPAA 3FWZA 1ZWKA 3CZ4A 4GMXA 4TV9A 2QGFA 1RP1A 1I6LA 3D2CA 3HGMA 5B30A 4G9EA 4WA8A 4W5QA 1QIEA 3O73A 4MWZA 1X2BA 4KPGA 1J2TA 5GADl 3AU9A 3OKAA 3W8EA 2J09A 4LRUA 1YL5A 3OWHA 2JI8A 3V4ZA 5IEBA 1O57A 1XAHA 1GYPA 4UBLA 2DB3A 4CLOB 1BNCA 3MRXA 4AXXA 1WZUA 1H2ZA 2XZPA 1Y3DE 2RGBA 1EA5A 3OA2A 3QPBA 4OJNA 1KO7A 3BB3A 4P98A 1UXIA 5FIUA 1XNRB 3JD3A 1TVKA 3N2KB 2UYHA 3QLEA 3OT4A 1FC0A 3PD0A 3WQBA 2QMHA 3K5WA 4BB6A 3U7FB 1WP9A 1BCSB 4MRAA 1ETUA 3O4VA 4BBPA 4QEKA 1Q7TA 4TVOA 3VX4A 3HM9A 3TOCA 2YFQA 1NRJB 1F14A 5H82A 2CVFA 3NNDA 4A92A 4GU5A 1CUUA 1CFZA 2YXPX 4GQBA 2J7PA 3CH7A 3GMTA 2D0DA 1P9WA 2RD2A 2XD9A 1OASA 3C87A 2VOJA 4MVYA 5AVZA 1PVOA 1FXSA 3HCBA 3MG9A 2QZ4A 5KIAA 3SSMA 1RFLA 4LV6A 2YJ4A 4XQ9A 5T8KA 3DH0A 4FKBA 3MJ4A 4P7KA 4JI6B 3RS7A 1IONA 2UYYA 3FPEA 5C0OE 3UWDA 4D99A 2OM2A 5AM2A 3W2TA 4J0KA 2FAXA 4RMIA 5DSXA 5CXUA 3ZDEA 2FPKA 4DW8A 2Y1DA 1XA3A 2TMYA 5LP6A 2VP0A 3IKMB 5TE9A 5HKOA 5B1SA 3T7EA 3DMYA 2A1TR 1DQNA 1I24A 2FUNB 4MAMA 4WDQA 4R9UC 3U1TA 2JH9A 1TB4A 4N6GA 4Z86A 3DMGA 2GN6A 4BB5A 1MB9A 2WG2A 3NUZA 1YRHA 1YZQA 1VI6A 3AONB 1J0AA 1P2BA 4ND8A 4DLPA 3WLPA 5EFZA 1NRXA 1VZ2A 5FOUA 1SAYA 2V97A 3G89A 2EFEB 3NRCA 5J47A 1IK4A 2DHEA 1M2GA 2UYGA 2M6KA 1T9CA 4LWZA 4K1XA 2UAGA 4IMPA 3HU1A 1PNVA 4KXYA 1F7UA 2LIVA 2X9QA 3EH2A 4ZAGA 2C3PA 5JD3A 5AW7A 4PR0A 1ZWLA 1TTQB 4O8CA 2WU8A 2X8BA 2ZYVX 3ZCUA 2ISQA 1ZIPA 1Z88A 3R76A 1NA5A 3GPDG 2PBLA 5IAGA 4F1WA 2PWYA 2VNKA 3EUFA 2CFIA 5JFGA 1DC6A 1UJ2A 5B3LA 1JZSA 1V7PC 4HATA 4PBSA 4HAOA 1J97A 4UDYX 4US1R 3VJMA 2F8LA 3PF8A 4BO6A 5MHTA 4CVNA 1L5MA 3JQRA 1N7HA 5AKYA 4LQLA 3QTTA 1U8ZA 3L7MA 2OORC 1FFEA 1E0KA 3NAZA 4NEGA 4PAMA 3ZV7A 2ADOA 4IDPA 3MWEA 1L5LA 3HACA 3SZGA 3UT0A 2XB4A 1S3IA 4JGGA 3O9ZA 1QCZA 1QKJA 3PFNA 3K0CC 3HJBA 5AFSA 4U39A 3R7FA 3A6HA 5UKDA 4N41A 2VTBB 4KGDA 7YASA 3DBHB 3QQ5A 3I2YX 4GZ5A 1MC5A 5I4CA 2CFTA 2C4UA 5JXIA 4L3OA 3PZRA 1IUOA 1Z0JA 1NY5A 2JFZA 1KJ8A 3GBPA 4TMFA 3RT1A 4P7JA 4D3XA 1GTL1 1ADGA 2C57A 1R0KA 4MS3B 4HNVA 1DTWB 3FGZA 2V6MA 1NPTO 1KEPA 3SC4A 3RAEC 3EQ9A 1ECFA 1D2HA 1E79D 3L7DA 4YJGA 5D1NA 4EHJA 4IIBA 1KI3A 4QTUB 3AEUA 3ICCA 1EAMA 4UHBA 3G1WA 2P2NA 5DM2A 2AEFA 3DC7A 4XH9B 2FH5B 4JZYA 1G5FA 2QNIA 2WUDA 3DZHA 1S9DA 1K89A 2WYOA 3GRKA 4JFRA 3I01A 1ZD3A 4PLYA 4RADA 5ERXA 3TUIC 4AMVA 4M38A 3R9WA 4TGLA 4BVBA 1DMRA 2PEYA 5EZYF 3CRNA 2MDTA 3RVOA 1K8QA 3CUEF 1HG0A 3QWBA 4J9UE 1GXSA 4QD3A 3LNCA 3OUUA 1HFKA 2Q9AA 2BEVA 2WK1A 4B34A 3WRVA 2RONA 1REQA 3FMOB 5BRJA 3DUFA 2A84A 1E9FA 1SVWA 3E5HA 3MTGA 3V9PA 2PAAA 4BS9A 5C46F 4FD3A 3U0VA 1QHHB 4IS2A 3L7NA 1QB7A 1SCDA 2GA9A 1M6EX 3DEYX 3K9GA 4HNQA 1E62A 2L17A 4NE9A 1GRRA 4OQNA 5AUQA 1SQGA 4GWGA 3QOXA 4HQ0A 4KG7A 1T9ZA 3MK31 4LDPA 1J0XO 1R12A 2OL4A 3T8YA 4A6DA 4E22A 1TCUA 2AC4A 2C9MA 3ZDRA 5JI2E 1VPVA 2GJ8A 2R6HA 5IAOA 5F2NA 3JYNA 5EZ5A 4D44A 2VQSA 3IMEA 2GEDA 4UFPA 4RK7A 5A3SA 3S2GA 3FYUC 1ESNA 1NN3A 2HWYA 1NG1A 2P0EA 4G4SO 1HMPA 4PZPA 3O8DA 3L77A 5I3ZA 1SA0B 3AVPA 4RD6A 2NYVA 1BJKA 3IIEA 3IRUA 4R51A 1JHQA 2E4ZA 4XTRA 2JH3A 1H6BA 1A76A 2AL7A 3P71T 4WZBE 1DIGA 3S40A 3D2LA 4UW9A 3WB0A 3LVFO 3ZVRA 1Z4PX 3WYBA 1CUGA 1OH5A 1XKXA 1ZJ5A 3JD0A 4FWBA 2BT4A 1T2VA 1ZR2A 1Z36A 2PH3A 4MA0A 1JI0A 1NBHA 2BF4A 5EC8A 1U1FA 2QPLA 4D9GA 2MMGA 3SIRA 3KQKA 3H1TA 4PO3X 4O8ZA 2ZSHA 1K2WA 3OZAA 5DPMA 3KPWA 5THQA 4ZKEA 3WYDA 2QA5A 3GLUA 2PGIA 3ND8A 3DZIA 1W88A 2J1LA 3PB3A 1KP3A 4KGZA 2AYZA 4K5QA 1OROA 5CYPA 2A5JA 4BWVA 3HWX1 5IC6A 4F3CA 4Z49A 2AMVA 2FR0A 1N6KA 1QZTA 4P4TA 4TTJA 2HD4A 1PVDA 5HSGA 4MB0A 1LZKA 4A7PA 2IU0A 1KOFA 3OX4A 1TJPB 4YAOA 3OQ1A 2ZRBA 3LGXA 1OY1A 3A6DA 1E2IA 1G8AA 2H4YA 1Z2PX 3NRBA 3J80A 1RZVA 3JQ7B 1F9AA 1GU0A 2O7SA 3JD1A 3HHPA 1K86A 1PJZA 2XI4A 3WA7A 4EY4A 2Q8NA 1FRVA 2BMDA 3ZV4A 4DF3A 1DQRA 2VJPA 5CB8A 1PN3A 4LS3A 1DTEA 1HWYA 3EEYA 1QUFA 3SG0A 2OYCA 4HY3A 1GTG1 1ZH2A 3L1JA 3TDMA 1MD9A 2F43A 2XJ4A 3CLVA 1VECA 5HKKD 2K4MA 4FB5A 2EFHB 2F7SA 5BNWA 2WE8A 4GBMA 4MDYA 2A1UA 3LFUA 3QTLA 3TGWA 4AJEA 4OI0A 3AWIA 3U49A 1C1DB 5J2TA 1TL7C 1W581 2EQBA 1V4BA 2VK2A 3D6MA 3LXXA 3H9CA 4X1YB 4MAAA 2QLBA 4HWPA 1R8QA 3UGKA 5BORA 1UKAA 2EX0A 1KEEB 4CCYA 2Z5LA 1NW8A 2P2LA 2RDMA 3MTJA 5T4FA 1LU9A 2R8RA 5HPYB 3V1MA 1J23A 3Q7PA 5GZ1A 1IEWA 5LQMA 3DT9A 1Y6ZA 1K0FA 3DDCA 2W71A 3FN4A 3DR5A 4L3VA 1JKMA 4RO0A 1NT2A 1T3HA 2HA5A 1XIVA 2G40A 4QDUA 3VAYA 2O14A 2I4TA 16PKA 3H9UA 4CKBA 4Q9IA 2H59A 3UEOA 1R4NB 5AD1A 2DWPA 2NTNA 4IHJF 1AM4D 3M49A 4Y2TA 5JJIA 4EW6A 1J49A 2K6GA 1P44A 3ECCA 4ZQGA 2RHGB 4BNJA 5DHQA 4PLPA 3IPRA 4OBXA 1Q7GA 2BISA 1XWFA 2X9NA 5P21A 2R6CA 3TQFA 3EXFB 1HZZA 3FTQA 1RBZA 2XOKA 5T3UA 1DOHA 2REQA 3WG9A 3PFCA 2A5YB 4MITA 3M83A 3EUAA 3QU2A 4B47A 4KH1A 5IZ4A 2I2CA 3BRQA 4J76A 1K3TA 1OOEA 2OBNA 3HFJA 1MH9A 1G66A 2FHSA 3HNPA 1NN0A 2JB9A 4QAJA 4XDGA 1DBIA 1V41E 3GX1A 5I9SA 5AVYA 4MO2A 2OB1A 2ZIFA 2MR6A 1N1GA 2FSHA 2BP7A 1BE1A 2KSQA 3N6VA 4QXPA 4RYLA 4D42A 5C4MA 2IDMA 3AINA 3KAJA 4V0LA 5ICMA 5CAEB 4BX3A 1XD2A 2WSLA 3C98A 5EGNA 1JMKC 5E4FA 2D2VA 5D84A 2PPLA 1GAJA 3PQCA 3SHOA 5KO2A 4WNCA 5J4YA 4RHTA 2OXCA 5JAMA 4BXOB 1XNGA 1E7MA 2Z4SA 4GGOA 4YCCA 5EHNA 5I45A 4Q7KA 4GKAA 1VFPA 1ZIDA 4X7BA 3LA8A 4HZUA 4QFBA 2OK7A 1UAGA 3QOFA 4FOTA 5SZKB 4BU1A 2GM3A 4EEKA 4UHHA 4CF5A 4K0KB 3OMWA 5TQ0A 2PCLA 4C43A 3V1UA 1ICEA 4WBNA 1SBIA 2WSSD 4E6EA 4UASA 4N01A 3N6XA 1EDOA 1SXJA 1VI5A 5A03A 3H2ZA 4P33A 4JJIA 3GLGB 4GI7A 3IJEB 3LBHA 2AH5A 5F35A 3IVXA 2PMEA 1H6AA 1W4RA 1P9NA 1Y8RA 2VUTA 1D0SA 2EIHA 1KSJA 2HKIA 2QW1A 4RWZA 3D2BA 2Q0XA 2OE2A 3NUQA 1Y5MA 2V9PA 2J30A 3OEHA 1KJNA 4UMFA 5H3CA 2VBFA 1EP2B 1NLUA 2GFIA 1D2EA 2B2CA 1H65A 2JGDB 2QRMA 4HDNB 3PI7A 1ZRNA 3T4EA 5JYBA 1I7SB 1B1AA 3C1TA 1C8VB 4DM7A 5FUQA 2P77A 2PD6A 3DZGA 3S2ZA 1NBOA 4Y2RA 1R3DA 3ZX4A 1VIMA 1GTVA 1EE1A 4TMTA 1J5PA 5IHPA 5KCMA 5TGDA 1KJJA 3HI6A 3HKBA 3NIWA 3G8BA 3JVUA 3VR4A 2XA2A 4G85A 1E1CB 1DT5A 1V11B 4ZOCA 1KFJB 1OX6A 1IN8A 4Q24A 5DYNA 5CG2A 2DXIA 2OGWA 1B16A 3LQRA 3N76A 3SFTA 2XWQA 5EERA 2JJ2A 1QONA 4BCCA 1DX6A 2YUIA 1C8KA 4JJEA 2AOUA 3DOFA 2OKCA 1FB5A 3GRCA 1KMHB 3FUWA 2CV0A 3QELB 4NH4A 1H3FA 3F6CA 4MWDA 3CZQA 3OM0A 2ZDHA 3M33A 3V6MA 4C14A 1Q6ZA 4CN9A 2W7TA 3OFSA 4RGYA 5I4KA 4YROA 1I7LA 1GTRA 4JXZA 2BR4A 2B7BA 4Q15A 2JJ1A 4B6SA 1VL1A 1JSLA 1BDHA 1QH1B 2R1VA 3AZOA 4F6LA 3ZD7A 2YC2C 1JR4A 3AVOA 3W4KA 1COWD 2BFCB 4ZICA 1X8KA 5HM6A 3QYPA 3EAQA 4FMDB 3GAMA 3TDKA 4JBIA 5CCEA 3L0DA 2VQEB 3LOPA 5HOEA 2VHXA 4OXQA 1AVTA 1DRVA 2Q3LA 5EHZA 4BQOA 1JFSA 3ZWKA 3R5HA 4MQEA 5JCJA 2HIGA 1CUCA 3WGGA 3ZW9A 3UFBA 1Z5WA 2GVDC 3DO8A 5JS2A 4AECA 2WIDA 4EW3A 4INJA 2FEWB 3VISA 1JMVA 3UJBA 3V8VA 4N0PA 4HN4B 4JU9A 4H4DA 4IOLA 1QHNA 1ZVQA 1CEXA 2CXRA 3HCPA 1ADYA 1Y1PA 4I9HA 2O2XA 3FOCA 5HA5A 5KTNA 1NI4A 1RHKA 4GXNA 3QLUA 4DAEA 1Z7WA 2EG9A 5CFRA 2XCOA 3FDXA 2ZTMA 2A58A 2PUAA 3ETJA 4UCQA 5DKFA 3CEAA 1JQJC 2KI5A 3A1SA 3NLLA 1W0KA 3MMSA 1YRBA 4R54A 4R4JA 2HSDA 3IR6A 5JASA 1ADBA 1PZXA 2YRFA 4QG3A 3GT7A 2CYCA 3GZNA 1PLJA 4G4IA 4M1OA 4QDJA 4UNQA 4XPIA 5EMKA 4BTEA 5A4DA 1NVXQ 5LBUA 5JTUA 3ZWDA 3F9CA 2NM0A 1JE1A 1CZRA 1TU0A 2GHRA 1IULA 4P3KA 2CE7A 3ZVMA 5ICEA 4DM3A 1MCZA 4X41A 1I94B 3KOYA 5JCXA 1GRQA 4QDOA 2L82A 4U0KA 4F72A 1RXWA 4AXBA 1JVNA 4C29A 4DPMA 4TYYA 1ZSYA 3N0TA 2WWTA 3GJYA 1L4FA 1QOPB 4YFVA 3FY4A 1O4VA 3U3MA 1MJNA 1Q17A 4GR5A 4PEVA 1QO9A 2WJ3A 3H6GA 3TZKA 1L8LA 1LDNA 1V71A 2J7KA 4HHEA 3EZ6A 4KH0A 3K9WA 1PW7A 1VKRA 5H7XA 121PA 4FMPA 4MI3A 4TQAA 1TC1A 2AOTB 4YQYA 3ZJ4A 1YR9A 2GBLA 1PYOA 2C7VA 2JASA 3DO5A 1G64A 1ODCA 2J45A 4II7A 4JKOA 5E4YA 5F64A 3PP8A 4Q9LA 2PLRA 1MO6A 1X39A 3AF5A 1AGNA 1G2PA 1L8OA 3LT1A 1ONOA 2YS7A 2WDZA 3C3YA 3VR4H 3NXSA 4F2GA 3OJEA 2E85A 2P9TA 4LDZA 4N5DA 4EJ0A 4Z3DA 5FX2A 5HKAA 2ZRKA 3NORA 4MUGA 1F2TB 3I37X 1GKKA 5KQGA 2ZU0C 4G36A 3GP3A 1SG9A 2IXTA 2OHJA 3Q40A 4JLOA 2I5PO 4P5PA 4W1RA 1GEEA 2PKRA 3WO0A 3EXG1 3X2FA 4X1KB 4C7XA 5ETJA 3DMPA 1TUBA 4WE3A 1GCIA 4ZOAA 2JS7A 2X0KA 2WKWA 1E8MA 4ALLA 3MLAA 2COKA 2JFBA 3O3OB 4GX1A 3IE1A 4CMEC 5LQNA 1PWEA 3KQNA 2JK1A 3DLCA 4M99A 3DE2X 4OU4A 2X3UA 1JR3D 1Z7BA 2N3ZA 1I9CA 2IHBA 4OUDB 3S2UA 2DVMA 4TWAA 3KVOA 1HYBA 3L84A 4NBSA 1FLVA 4WN3A 1OIXA 1UT8A 2HX1A 5ED0A 4UNSA 2FSFA 3FPGA 4KIWA 1NF2A 2YN4A 4NV1A 3CEHA 4HS4A 4PPYA 4BX8A 5BUCA 3T7SA 1GRNA 5JXHA 1QRTA 5MGBA 3DT8A 1FJHA 2VZEA 3DJYA 3AESB 4PLFA 1IRIA 1T9GR 1TAGA 3NP9A 3BQNB 3EIWA 2OD2A 3ER9A 3RVJA 2WHEA 1II9A 2DPHA 4P3PA 1CJSA 1C3OA 3JX9A 1M8KA 1ZUWA 2YFKA 1CE8A 2D6FA 5ARDA 2F17A 2VRCD 1PFQA 1R10A 2H2IA 4RX1A 2G63A 3F4LA 3I8XA 3WNQA 4A1FA 5TSDA 1JBKA 1FS4A 2WG1A 3MQ4A 2ECQA 1T5HX 4Q4HB 1L4UA 1OWLA 2ANCA 4K6MA 3VR6D 5F9HA 4KE7A 1O96A 2OXEA 2WEKA 4KXQA 1GUZA 4HKTA 4Z3KA 2FK8A 2VJBA 3GI1A 1SD5A 3DKKA 3A06A 3MJEA 4N5MA 5FWDA 4B6JA 1CLUA 8MHTA 1RABA 4DLSA 2OHHA 4Q48A 4OK3A 3TB6A 4D9CA 2XKBA 2YY5A 1NMZA 3FHTA 4WH0A 1VG8A 4HDSB 2FK7A 4D0RA 3L46A 1OFIA 2E5FA 2A9FA 3QXJA 3K7EA 4ND4A 1I0LA 5AIBA 4BGDA 1FP1D 4FGZA 3RVDA 4YGYA 3TINA 4HB0A 5KYKA 2RGDA 1WWKA 1DADA 1KSFX 2WHQA 4QUBA 4XYGA 4Y2PA 1GHTA 5EQJB 3SJBA 5HJEA 2I03A 5AK3A 4E88A 1JSCA 1BFDA 3CT4A 3LOUA 3P0HA 4II2A 3L8GA 5AKEA 4JI3B 2CEAA 3CXRA 2PIDA 1NYTA 1X7GA 4GUAA 4HVTA 3TLXA 1YA8A 5FA5A 3A05A 3BL5A 3EPRA 3TVTA 5IFKA 1Z6XA 4GPEA 4PLZA 2F64A 3OPVA 5DP2A 1NNEA 4FYKA 3UHAA 1N6OA 4L51A 4CG1A 4CV3A 2BCJQ 2LE0A 1SVUA 1URPA 3LK7A 3PS9A 5IU6A 2A7XA 4WK2B 1Z75A 3Q10A 1VMDA 2O2DA 1M6HA 4HQRA 2ZIWB 1N0WA 1NJ2A 2V6BA 2QX9A 2YWGA 4J07A 5TVKA 5IVPA 4GMHA 1MC8A 4CUJA 4IVNA 4QQ8A 1DEOA 4YGXB 3SHVA 1YFLA 1BXKA 2CLLB 4A15A 1YJQA 3LUJA 2GRUA 5EWLB 2NZVG 1RQRA 2NQTA 2ONKA 3P9RA 1UBLS 3OECA 3WIDA 3NO4A 3CSDA 3DL4A 4GICA 2ZAGA 3PWZA 4XB1A 3A1WA 1SBHA 4I36A 5FYQA 2QVGA 4DTCA 3U19A 3EPHA 3MT9A 3VJRA 3ADKA 5A05A 3N86A 3VYTB 4AQ7A 2TYSB 1E92A 4YJ3B 3ZZUA 2OZLB 4HVAA 4P8RA 5E9JA 1O97D 1VE6A 1YB1A 2OVBA 3GG9A 3MOSA 1L5GB 4KI0A 3MM4A 3KOWA 1Y98A 2JPDA 5IWCA 2CL6X 3C3JA 4UHKA 3U7EB 5GVSA 1ZUIA 5BO5A 1N2GA 1H4QA 1FIUA 4NBUA 2XUQA 1F2DA 4TTVA 3QFRA 4LY3A 2SCUA 4P34A 1WVMA 5BUSA 2CVOA 2CDBA 4R0VA 2BTOA 2XVXA 1FTNA 3EDRA 1NVUQ 4ENQA 2GTHA 1CQXA 3FYTA 3I23A 4TLDA 2C2KA 5KNDD 1IUNA 1VM6A 4BFVA 2XCRB 3V42A 3F0TA 4PFQA 3O74A 3PHJA 3WAGA 4ALIA 3IIJA 2PNJA 4IIJB 3BIWA 5G4LA 1SB9A 3MTAA 1CULC 4X92A 1QORA 2O0HA 2NTJA 1QH8A 2JLBA 1WD5A 1ZD5A 1RRCA 2G1KA 3LY5A 4F7WA 3EFBA 2R6FA 5ERGB 4H0NA 5A3QA 3WV5A 3C7TA 1VGQA 4RVGA 1A71A 1SXJC 3H0EA 2FZKA 4IH4A 4BLTA 4J75A 1T5DX 5CLGA 1ZSVA 4AJ1A 4DCTA 4XWOA 2IHJA 5J63A 2C03A 3QUTA 4I4TA 3FTNA 4FEEA 3MGAA 2D7CA 1NSFA 2NTYC 1VRVA 1T8RA 3MCVA 5IUKC 5MF6A 1Y9EA 1KTVA 3K5PA 3FB1A 2Z3ZA 1E3EA 1PQUA 3ETHA 2IOFK 5DLDA 3IKLA 1E0SA 1F20A 3FXAA 3H2HA 3COWA 2EU8A 1R9NA 5AHKA 1B6SA 1BW9A 4BBJA 5BRAA 3R7WB 4HAWA 1K6MA 1YI8A 1R0CA 1WKBA 1NFFA 3BGSA 4IDNA 3PSAA 3GOQA 4C89A 2XZTA 4E32A 1GU1A 4YR7A 4E30A 4IJ6A 5KNBA 1NBIA 1VYUA 2P79A 2JL1A 2BRUA 2VPQA 4JI7B 4LYFA 2W93A 5EE3A 1BWRA 1QRRA 1JIJA 5FLKA 1I1OA 4R7ZA 3KOUA 4WLOA 4WV3A 5C37A 5GGXA 5KYVA 3U5TA 1M0WA 4M2LA 5FOVA 1N25A 1SXPA 2WJPA 1Z25A 4GWKA 1PJLA 1WQ1R 2GJKA 4PYIA 3Q7SA 1NM5A 3K2BA 2TMDA 4KSCA 5JZBA 1JB1A 1QP0A 2A35A 3A1DA 4FW9A 1B93A 2Z3VA 1F7VA 3T9EA 2BSQA 3MA0A 1JQLB 1EVLA 4Q0MA 5AW4A 3FGOA 1Y8ZA 1AQLA 3K1YA 1HC7A 3ODPA 5AI0A 3ZNNA 5KYTA 2D62A 3LC7O 3K0AA 4HCJA 3FCUB 1G19A 4YHBA 4FIDA 4Y2XA 3SYLA 3UMVA 4F91B 1SUFA 2H63A 5CXSA 3CF6R 4NONA 3EXEB 1IXYA 1T8SA 4OBEA 4TT3D 5K0LA 3HVIA 4MICA 3DVLA 3CZMA 4N18A 3O91A 2Q6TA 4FX5A 3V8EA 1LTQA 4M0FA 3EDYA 4AP6A 4JKYA 3E27A 1RZRD 1W4BA 3EYAA 2X1MA 1ZMXA 2XNSA 4UKDA 3VC2A 4G56A 3ZE0B 4D82A 1WXHA 4R16A 1K4KA 1JH8A 4IO0A 5ICSA 1WTCA 2ATCA 2QJTA 2EARA 3AL3A 1A27A 5IW8A 1CT9A 4ZYUA 4BO5A 2XUFA 2MR5A 1P31A 2GYYA 2R6DA 4NS1A 5DOVA 3RYIA 5ARBA 2UZIR 3ND9A 4EYQA 3RG8A 2GJ9A 2P7IA 1QAOA 3AI2A 3G0HA 3SZMA 1RHMA 1OAKA 3GHHA 4ZQIA 2D06A 5DX0A 4ZAWA 4CM9D 2ONCA 2Q6KA 4OK5A 5AVKA 3LUFA 3QLUC 2HCRA 3WMWA 3TD2A 1B2LA 1TYAE 3IXQA 1QBGA 3IERA 2CBZA 1N9GB 4UUQA 1SKUA 3UH0A 2J9XB 1AKUA 3UAXA 4CFZA 2G7ZA 4EW1A 3RUPA 2H54A 1MB4A 1O8BA 4IJ5A 4CIBA 4I6EA 4LDJA 1ONSA 1MAUA 4DXAA 3SF0A 3Q0TA 3MWFA 2B3TA 2C82A 2BBTA 2O4CA 3EXHB 1ISSA 3REFA 4O2AF 5FJIA 3N0XA 4JVOA 3HABA 2BDTA 2EKQA 4OQ4A 1DS6A 2WWIA 2DBYA 1P5RA 2JGJA 2QGNA 3BG5A 4IEFB 4UDOA 3VGPA 4DCMA 5CDYA 1THZA 1MJHA 3CUYA 2XDAA 1UUFA 1KOGA 4PX3A 4U2EA 3D4NA 1PKEA 2B7LA 3OZWA 3L07A 4NENB 4ZDIA 4B71A 1WEHA 2Z4TA 4RANA 2FW6A 3UJHA 4E1VA 4DR5B 3PEYA 4US0R 3I4FA 4D1YA 1FDSA 4Q00A 1BRTA 4UXIA 3JQ8B 2C5LA 1CUSA 1NBMD 1P80A 2GBLC 2JKYA 2XMRA 2YOHA 3L4BA 5F98A 3U4CA 3EIOA 4B31A 2QRZA 3OJWA 3R7AA 3JAWB 2D1YA 2OHGA 2FQQA 5M3BA 8GPBA 1MO4A 1TK9A 2RGNA 3AEKA 4JX9A 4M0MA 1EXVA 1NG9A 3E8SA 4GPZA 3MF4A 2RK6A 2BEUA 4N9QA 3KKLA 4MW6A 2OCIA 2QX6A 1W47A 2TMKA 2Z8XA 3MQFA 3PVCA 1Z82A 4E07A 3ANNA 3VTFA 3HKEA 4Q21A 4LZZA 3VU3A 4JVMA 4GSLA 1O0SA 4JWTA 1KY4A 3CR7A 3EZ7A 4Q03A 4LI0A 3CLRC 4EHAA 5KNLA 5CCDA 4CE6A 2DEUA 2O5CA 3VUFA 1ZICA 1NP3A 2QLNA 3F6SA 1CZNA 1XA0A 1NYQA 1VHWA 4Y1RA 1TTPB 4EG4A 3F5MA 4NPAA 4O4HF 3CUTA 1WY7A 1EUDA 2X6RA 1HV8A 3Q1LA 5BURA 4QFDA 1IY8A 3ZU4A 1YA6A 2AI1A 1GGJA 4D9EA 1E9AA 1QKKA 5I4BA 4HUQB 3ZNQA 1CNMA 1G18A 1A7JA 1VG1A 3CU5A 4BBAA 1N5MA 4KRYA 1P3DA 4CFSA 1NRWA 4TKZA 2IEAA 2FPUA 3L1IA 4G0YA 3QVGA 1UINA 2OXFA 5I7UA 2DQKA 3C5HA 3MFQA 1V6SA 2Q21A 1DV1A 3O4IA 4PM4A 2G9QA 3NANA 4GXQA 4LDRA 1Z7YA 5CEEA 4BFTA 3QYJA 2ES4A 2J6BA 1OZGA 3U4IA 1K4YA 4C4XA 1JIUA 4Z4FA 2QXTA 1GTJ1 2V65A 1G98A 1P9LA 4B6GA 4US2R 4HDKB 2C77A 4NIMA 3AF0A 3BMCA 2GN0A 3M70A 1S7GA 2QLLA 5BV2P 1V9CA 4EPWA 1DWUA 3D7MA 3QF4A 2NVBA 3ZLUA 2BMWA 2CLCX 2X0RA 3ZV3A 1TTTA 3C5VA 3FYSA 4KDFA 1O95A 5CVJA 3SY8A 2VPPA 3ACCA 4FYWA 1QGOA 4M1KA 2CF5A 5JPCA 3ZI0A 1LDEA 4OM8A 2WTXA 2QW8A 2A94A 3LDHA 4G0WA 5LZ7A 1G8GA 2ERCA 2ILVA 1U6IA 3GK3A 4YMVA 2OTCA 3LUAA 5H5JA 3MB5A 4QGHA 2P9JA 2AVDA 4N4AA 2YJ3A 2CNWD 3BCRA 3E9DA 3K92A 4HI0E 5AHXA 4Y2HA 2V4MA 4NMHA 4DG8A 2FGJA 5FUYA 1NATA 1N75A 4MW9A 1X9IA 4JB8A 5JCZA 2OBMA 1OFGA 4KLRA 1J8VA 2ROQA 5KKNB 2AI3A 4Y7DA 4Q4JA 2J3EA 3KV1A 4X3PA 4WKBA 4FGUA 4S24A 1KPIA 4R0MA 3RSGA 5FO0A 1IK6A 4WLNA 2QM3A 3EOBI 3LP5A 4C88A 4LWQA 3R3ZA 1Z4LA 2PL9A 2DP4E 3G9ZA 4N5HX 1UXOA 3AC0A 1SULA 2E7ZA 2WWXA 3GO4A 4INAA 1YFZA 4B79A 3C39A 4AUKA 3OX2A 4XD7A 5EXEA 4NDNE 5TT0A 2ABWA 2O2SA 2Y05A 3ZJYA 1FP6A 3NBAA 3BPSA 4NV3A 4M86A 2H85A 1JA0A 1ZUNA 3RVNA 1PD1A 3O8BA 4OTZA 4IVPA 3HPQA 1ZN8A 1YHYA 3O3NB 3DTNA 4AS3A 1R5JA 2YHBA 4ZJZA 4FHFA 2HU7A 1TT5A 4BLRA 1N2BA 5AUOB 1CQWA 2AX3A 2JZCA 1TOAA 3AI3A 3FPLA 2JF0A 4YMWA 1UFOA 5H9WA 1E3WA 3LBNA 4RTOA 4M6WA 3FI9A 1DHTA 4V3CA 4F46A 2EAUA 2O8VA 2ODNA 2WF9A 1EDZA 5ALRA 3HWWA 3P0IA 4BAUA 2G5GX 1GLVA 2WIGA 3KD3A 2VJAA 3P97A 3PXAA 4TRRA 4WAUA 4BRUA 4OQZA 1CQJB 4AJHA 1L7PA 2YQZA 4FX2A 1SXHA 3OU6A 4DR6B 1JQBA 3C1AA 3PNQA 2EERA 4Z4IA 1QUEA 1ULAA 2OBXA 4Q37A 5F9MA 1DAIA 2ATXA 3I9FA 5FBWB 2GETA 1XE3A 4GSKA 4I1VA 1E1QA 4ROSA 5DXFA 1YUBA 1VJ5A 2RK3A 1ICIA 4CIYA 3VV3A 3DWEX 1QYDA 3JYLA 3NIBA 4C9BA 1THGA 1A8QA 3O4HA 1KWGA 1C2TA 1ZS9A 2O8DA 3DWGA 3EGXB 4AG6A 4B84A 2HW8A 1JF8A 3KT0A 2B4TO 3HB7A 3GRUA 2CK3A 3G2IA 1QSGA 2FR1A 2EBUA 3GLSA 3I9V6 3PNKA 4RV4A 4F4IA 4QU5A 3EGVA 3PR3A 4BQFA 2NVWA 3N70A 1FK8A 2DWUA 2X7JA 1SCUB 2PA3A 4B74A 3BILA 2VKTA 5IJAA 4M55A 5FKJA 5AR1A 4HPXB 5C8XA 3O0TA 3R9IA 3WSWA 2P5TB 1NQAO 3A0RB 1ZEJA 4Z0NA 5KINB 1W75A 4RDHA 1PZMA 3TNJA 1QO7A 1SGWA 3W6NA 4XCVA 1A97A 2FP3A 3P0FA 3JCZA 1G8YA 3STUA 2IU6A 2VBIA 3B70A 3BWXA 3GFOA 3M81A 1T9AA 4KAXA 1U98A 4W8GA 4C08A 5L6LB 2IS2A 3LX8A 4YQZA 4AICA 3N7AA 4LF7B 3DKVA 3O8QA 2OHIA 3ZTTA 5AXCA 3PTAA 3CX6A 3IEXA 1W0JD 4L74A 5FFMA 1AK2A 2G9VA 4ZREA 2H65A 4GM0A 3W6OA 1MV8A 5AH0A 3HWRA 4BIMA 5LWQA 1PR1A 2RC5A 3VNUA 2WUVA 4HN9A 1I3OA 4ARZA 5JCPA 1EFDN 4AQYB 2GEKA 4M49A 4EI7A 1BA2A 1ZQ9A 3NJRA 2NU8A 5F7XA 3IHTA 3PUVA 5DTIA 4DSOA 3ZI4A 3MCTA 4DT1B 1OJ7A 2H3HA 5JSZB 1L1EA 4ZDKA 1Z7GA 2PKEA 5DMHA 2HM7A 4OL0A 4DANA 4CQNA 4BLSA 1U9IA 3CLSC 3GLGE 1W9MA 3AEZA 4UPVA 4MKRA 5KNCA 2ZVJA 1LWNA 2C2BA 2PO5A 1ENOA 4B6FA 3ZCRA 3L7YA 1F5NA 1VA4A 1IJKA 1HYQA 2R25B 2PX4A 1KZHA 2XHEA 4REQA 4ARBA 3FOAA 4MRRA 3M6WA 2BHNA 4N6OA 3C45A 4IX1A 4XM1A 1NM5C 2LKDA 3GT3A 1MZVA 3U7HB 3ZE8A 4G5SA 5DIFA 4QLBA 1ORTA 2JFQA 5DF1A 1YE3A 3NEJA 3KPYA 4MHTA 1CR6A 3B7PA 3IS3A 1U2DC 2ILTA 2VDJA 1XOIA 2HA6A 2PZ8A 4PZLA 3HH8A 3ZZ0A 1O6GA 5AM1A 2AQIA 3G6WA 4B3BA 3Q5DA 2AZTA 4ZODA 1PL7A 3T34A 3GFRA 5EWMA 3TQTA 1APBA 2VKQA 4BN0A 1FRFS 1LBTA 2FQYA 4XE5A 3T99A 3KYCA 4L78A 4CR7A 1VL6A 5CW1A 1ZRSA 3I0NA 2X86A 2RC6A 4EECA 3WLHA 2QAGB 4D6XA 1JYFA 3RYCB 1J33A 5DHAA 4KE8A 5LXTF 3SC3A 4P08A 5IF3A 1OPXA 2AIRA 2FW0A 3EJ6A 1JPUA 1KEVA 2O1WA 2CDAA 2ID4A 3OFVA 5AT1A 1Z2CA 3WRWA 2QRJA 4DNPA 5AICA 3T1NA 3JZAA 1K27A 1LSOA 2WJIA 4FFSA 4PV7A 4B0OA 2Z1NA 1GG9A 3KR9A 2NXWA 5J1TB 4LF4B 1JJAA 1KS2A 1ND6A 2C5GA 2NV2B 1SQ6A 3C7AA 2H18A 3ZHOA 1XF1A 1KEZA 5AOBA 5SZJA 4BWGA 1TF2A 2E55A 3V4VB 1CYEA 1G4UR 1RWBA 4RK4A 4W9MC 5E4JA 3MINA 2R48A 2IWHA 4QYWA 4KBYA 1EK1A 2ARKA 2IHUA 1NVVQ 3FR8A 3HNRA 4K46A 1XEWY 4UAJA 2YMLA 3RWOA 4A6EA 5KNDA 5KREA 3QYFA 3A27A 3LWNA 3PHCA 1KYVA 3WGOA 5B6PA 2HRQA 1CKEA 4YQFA 3TM5A 5IC4A 3O2NA 4EWLA 1K5PA 1RMTA 2ZSEA 2PUGA 3MJTA 4JUAA 3AQIA 4LJ9A 2IIVA 4NHEA 1YKSA 2XVYA 4JEMA 3EDOA 4XVRA 3PC7A 1WOYA 3OURA 2OXIA 3H65A 1VE5A 2QROA 4D4JA 4OP2A 3FNGA 5FL7D 1CY1A 3FKQA 3SQNA 4TSKA 1J2JA 1SXQA 4JL8A 5FWAA 2GXSA 3IB3A 1DXOA 4WLFA 3ZXUB 3ESRA 1ARZA 1E3JA 2PT6A 3KB2A 3PIRA 1XHLA 2BM0A 4OFWA 1DAFA 3PXCX 4WT7A 3TSCA 3UCXA 5KUTA 1I4EB 4Q4AA 1XNQB 4CEIB 3B38A 4CF6A 4TV8A 3TKLA 2WI8A 1CSEE 4HQNA 2G67A 5HE8A 1KQFA 4WADA 2F1RA 3D4PA 4UDNA 1QQAA 4GC9A 2JLSA 5JSUA 3EN0A 4WCFB 4CF4A 1QLJA 2ACVA 3EVDA 3H7IA 1RCUA 2QLTA 3IEIA 3OJLA 2WVHA 2XUKA 2DUMA 1VKHA 2E1PA 3TG2A 5AKKA 5COQA 5KNCH 2ASVA 2JFHA 3L7LA 3QFCA 1U0TA 5ESWA 5GV7A 4U9IS 2CFCA 3TCNA 2Q3HA 4MHOA 5DGCA 3B6EA 1CF2O 4OL9A 2R1TB 5B37A 1Q20A 1HM5A 3U4QA 1XP8A 1EFPB 2PRKA 1TKCA 2JKVA 4DOMA 5K3SA 3FNFA 3ZHTA 1AHPA 1L7NA 5EGSA 5EQFA 5HE9A 2VOEA 2FFBA 1CETA 1W29A 1Z0ZA 1CJUC 5U4XA 3L7BA 3LT4A 1ZJ4A 3DTVD 4D45A 4V2UA 4DMMA 4ABTA 2IZ0A 4IWYA 4K9RA 4EX6A 4UBNA 2NZWA 2RI6A 5KHOC 1AGYA 2YIMA 3AO0B 4RPJA 4Y0AA 1U8XX 2PQ2A 3AUSA 3NTRA 5E95A 2Z6QA 3KT6A 3SLKA 4Z1MD 2QAJA 1RKVA 5CLJA 1JFVA 1E58A 2HDOA 5JS8A 3Q5EA 4B3RB 3L6RA 4WUVA 3STHA 2NPFA 2VJMA 1N8NA 4UUPA 4FI3F 1YBAA 4X7MA 2B0CA 2WRZA 4QODA 1GUAA 4QOFA 1ZW1A 1GGMA 4CJXA 3ZIDA 2VF2A 1R18A 2YV4A 5DCUA 2ET6A 3HDVA 1H2FA 1TADA 3N2ZB 4X8LA 3UHFA 4YHHB 1DFGA 4Z4GA 4BUJA 3QA9A 4EKEA 2L19A 5ADVA 4ZQEA 2WTAA 3WYEA 1GGFA 2FN4A 1R6TA 4ZI7F 1OT5A 4FJ1A 2BHLA 3DXXA 1DKMA 1LTKA 3RH0A 4UVIA 4OMCA 2OCDA 4X7RA 1RAEA 5IM4F 3MJVA 4EITA 4UUNA 4NCXA 4C22A 2VF4X 1CUJA 1LRLA 2BR5A 3AOEA 4BRZA 5FFNA 1XQYA 3W5VA 1ZOOA 2OD9A 4P4SB 4G8CA 4ZA2A 3DKRA 2JHGA 4R9SA 2IH5A 1J8MF 5KVVA 4QNRA 2C20A 2FRXA 2XB8A 4KHPB 4Z7OB 3QUCA 4DV0B 1JU9A 1T3LA 5J4LA 2VF5X 1BHO1 2X19A 3NOXA 4HH1A 4RTRA 1OWOA 4QPZA 5JNVA 3H5VA 3QGMA 1WAMA 5ED4A 2X9GA 4EJ6A 5B1EA 3ZHYA 3ILHA 1D9XA 5A5GA 1T2CA 3ZJUA 1RWKA 1HR0B 3X0DA 2JD2A 1ITZA 4LJ4A 4MEJA 1PZEA 3G02A 2P9HA 3JR3A 3L0SA 1SO8A 3D3EA 5EZYB 3RGWS 4MP3A 3S99A 4JI8B 1J9EA 2XA9A 1O94D 2GZDA 2P2SA 5JYDA 1UKZA 2WTBA 1AN9A 3EA0A 2ERXA 2IW3A 3M82A 4JENA 3L6UA 3QJGA 4MHSA 2ZYIA 1NVKA 3TRDA 3LLUA 3AKYA 3B48A 2V03A 4PONA 2OPHA 3RUHA 4Q7MB 2FFRA 4AO6A 5DEIA 4YRCA 3O90A 4HNRA 3GPIA 2P5YA 2NXCA 4IQ0A 4RMNA 1ZY2A 2VZ9A 1E6KA 1SG0A 1UQRA 2GN1A 4OF4A 5BP7A 4R5MA 2L0XA 2NNLD 4BCDA 1Y5RA 2VCEA 4C2UA 5H4HA 2IEDA 4FR2A 3FWYA 2RHOA 4M46A 1PQ4A 4M8SA 3IE0A 2XNJA 3OPNA 4N0MA 2AQHA 2GBCA 3CTPA 1M2KA 4O4JF 3KQLA 4DR3B 4KXLA 5D5HA 1EJBA 4BLWA 2PKWA 4PQEA 3WGTA 4D0SA 3DMFA 4IV5A 1P0PA 2NUAA 3DHEA 4NK4A 3IQDB 1IPHA 4R3UC 1DO0A 1KDOA 3ZK7A 2NP7A 3WGYA 2C0CA 4EB6B 3T7TA 3LYHA 3ESDA 2QG4A 3NDJA 1H2YA 1TVCA 3V1KA 4E4TA 4C78A 3ZYZA 4FFBB 5CA0F 1MIOB 4DBVO 4PZ0A 3I52A 1OBFO 1Q92A 1XNHA 2JI7A 1KJYA 4IFIA 4G67A 4N3BA 1T9DA 2W6OA 4RVNA 4WJKB 3U3KA 4D8WA 4UU8A 2A57A 1OJLA 3AM5A 1FYDA 3I42A 5EEGA 3VZPA 3IDSA 4IH9A 1HDCA 4EJSB 4CL2A 2JCBA 4H59A 3ZKWB 3F7MA 2P9CA 1JPNA 2J07A 4L4XA 5EOVA 2OXTA 1E20A 3BEDA 3F8SA 4CQMD 7ADHA 3JWIA 4IMRA 4AVYA 4HWSA 2D7JA 1JKJA 1ZGHA 3I76A 1BXGB 2LBPA 5BN5A 2H52A 2R60A 1ZHHA 3BWEA 5H02A 3AR7A 4KVAA 5CM9C 2JGIA 3JASB 1OVGA 1RKQA 4NX2A 3HA5A 2VCYA 2PT7A 3GP5A 2HA7A 4TLCA 1U0GA 3QF7A 4B3CA 5CUQA 2ECFA 5T3YA 1N6HA 1A9YA 1RXSA 2I3ZA 4DV5B 4BLOA 3MXOA 4CDMA 1XRLA 2NNWB 3EK2A 5EMJA 5ALTA 5DP1A 4BY9E 3AM4A 3D6HA 1IBKB 1R88A 2O50A 3ZD6A 3HJNA 1Q16A 1IBSA 1SBNE 1VLMA 4R2IA 2ST1A 4JP2A 1MVNA 1Z3IX 2I8LA 3CWQA 2PSEA 3QJYA 5EKSA 3TLZA 5C8DA 5LMUB 1R4MA 3H4IA 3LUKA 1ZD8A 4Y9UA 4TSRA 3OIGA 2PZBA 4W1SA 1UP4A 1UOPA 4MUMA 1KWKA 3EQ7A 1MC1A 2O23A 4LX0A 5JVDF 1O9HA 4KDRA 3HYLA 2ATEA 2J0SA 5CDSA 4FNMA 3RSCA 1O7JA 3SNHA 1DKUA 2O57A 3R8XA 2GFHA 1G5HA 4D4LA 3R3XA 3TVDA 1JAIA 1J09A 3R3WA 4WLEA 4UUMA 2QSJA 1YQWA 3DNPA 4KVFA 5CVEA 3LV8A 1ZKDA 4RDXA 5JNUA 4XFDA 3U3XA 4J16A 2G08A 1WV0A 4M8LA 4GOOD 4J29A 4YIKA 4IHJB 3RWBA 1E2MA 4M9QA 3V2UA 4QEZA 2MMCA 4A2WA 1WB5A 2QNRA 3KSDO 3KZNA 2IRWA 4FDUA 2YR0A 5DTQA 5FF9A 2BR3A 3V80A 4MVJM 4PN7A 3ESYA 1JYEA 4JODA 1XTPA 1CQIA 3I5MA 3BSSA 4YPFA 4B4WA 5LYJA 2RB5A 3G0GA 2ODEA 1FLNA 3LL7A 4R1LA 1EINA 2OXRA 1A8HA 1ODKA 4U1RA 3WOHA 4ZMRA 5IBPA 4HEJA 4PNHA 4XSVA 4B48A 1KI2A 4GECA 3RJTA 1QYCA 2GF2A 4RTNA 3TOSA 4X9XA 3BZBA 1Y4SA 2OWDA 3R7BA 1N9KA 4UE3S 4HXFB 3G49A 1XZNA 3SE0A 4FHGA 3KUDA 4R2XA 1WHSA 2HWKA 4MVJE 3BMQA 2F55A 5CYFA 3IR5A 4IKPA 1CUVA 3RDPA 2VK4A 4DJJA 2FUEA 3GUHA 4WGFA 4N82A 3HR8A 1QYXA 2ZYAA 3CCCA 4YYEA 3H05A 4ZPXA 1VJ0A 5CK4A 5TRTA 5IPFA 4BJ6A 4PVDA 3JR7A 1HOTA 4HDMA 1W30A 4ENWA 4DEVA 3SAJA 2J6CA 1VI2A 3UZUA 2KS6A 1ENZA 2ZDQA 1FFSA 2IOHA 2OV6A 2WYIA 2KBEA 3PRKE 1Z4KA 4JJ7A 5KTSA 1CR0A 2A0WA 2CLSA 2RHHA 2XKJE 1TRHA 2OBBA 1UH5A 3NWOA 1O6CA 1A5AB 2H5LA 3PBKA 1ES9A 2IPAB 4FEYA 3G23A 3N9IA 4HMQA 1RYNA 4MRMB 3BH7A 3X1ZA 4C4ZA 5F2OA 4B7ZA 1GWNA 2CCKA 4IDAA 5LZ4A 1FMFA 1DXQA 4J0QA 2Z1MA 2QT9A 1HPLA 5AKJA 1C41A 2AWOA 2X1VA 2KX7A 2YMPA 4IIYA 3O2JA 1GAQA 1SVSA 3SK0A 3STXA 1YS6A 2HQ1A 3C85A 2WFAA 5ER9A 3VZDA 1DGQA 3RTCA 5G0TA 2UYOA 5AI5A 1I0IA 3IUBA 3QMVA 2Q3MA 1YB2A 2NUTB 1MGPA 4JQYA 1BX3A 3C14C 3NPAA 5FEUA 1O3YA 4YREA 3CNLA 1Q0TA 1WULS 4PE5B 1COWA 1MAHA 3U48A 1YONA 5BMVA 3DBRA 2RHCA 4ZC8A 5KYYB 3AUKA 2H4JA 3G59A 5CT4A 3AILA 1KK1A 1UM9B 3L6DA 1U0NA 2G1AA 4EFMA 1PK8A 1YK0A 2OGSA 2OOKA 4F2HA 3SXPA 2FFHA 2C7PA 1Y4AE 5HW0A 1OREA 1BJRE 2SHKA 2VFAA 3Q2IA 3H4MA 1Q74A 4PPGA 1X8JA 4DV3B 3MAGA 4MUBA 4TTSA 3WLKX 1TO6A 3VYSB 5A5EA 1RPTA 1XZEA 2G0AA 5K0CA 2EDAA 4R31A 5CTAA 1JTFA 5ALIA 3F9IA 4F9TA 1KP9A 4S1NA 2Z2ZA 4MMZB 2DQSA 2VRNA 2B37A 3DMHA 1MO2A 1T36B 1UPFA 2I8AA 4WKCA 3SIWA 2CZCA 2RGCA 3ASZA 2JFUA 5C51B 5KSZA 2IPOA 1WSBA 3Q72A 3EIXA 1V16B 3T7RA 2LVBA 4DRXA 2A30A 2UZ0A 3CY6A 3FYDA 4C7JA 5L3SB 2G9ZA 4HXGA 3AR4A 1OXTA 1RFGE 1VJ1A 2PZJA 4TMVA 2O1XA 5E0OA 1SVNA 4CM6A 1MAAA 3C6XA 4AZ0B 4DA8A 4HFMA 3WLOA 5JHHB 3DCNA 5BSTA 3OTHA 1J06A 3CF4A 5C8YA 4C0SA 4EO9A 2WV7A 4G0UA 4Y1FA 4Z2AA 4X45A 1EKXA 3HCRA 4X65B 2IBMA 1P0MA 4M21A 1IOLA 4HNGA 2XQIA 1UL1X 4NNPA 4ZOLF 3UMCA 2Z08A 3WLIA 5KC8A 2W6PA 2HBZA 2Y1FA 3P2JA 4J3NA 4UQOA 2W42A 1N5DA 2AJBA 5DGDA 1H2WA 1H05A 5E1BA 3AY3A 3QFSA 2H9YA 1JSZA 1JHOA 3NYWA 4G2TA 3GLQA 2WNSA 3UTCA 1I36A 4UJ5A 3BORA 4RJIA 2AVNA 4KU4A 4AC9A 3EWSA 3VH4A 5AVOA 3PA8A 1WCIB 5HRAA 5AKLA 2Z2JA 3SQXA 4IR7A 1HTWA 2CWDA 4MJ3A 3S7TA 1X1EA 3OTOB 4U9HS 4ZIRB 4LOAA 2PUHA 1SU7A 1VGVA 3P9QA 3NBQA 3E1SA 4HXEB 3RRJA 1I5EA 3PT9A 4FCVA 4HNAB 3MILA 1ZGCA 3ELUA 2WIFA 3AOEC 4DHEA 1WQ4A 3NTLA 1N5LA 4WK4B 3PUKA 1JU4A 3VSAA 3GVXA 4NCBA 2UYCA 4DR2B 2NSHA 2PEZA 3QEJA 4PQRA 2V8BA 3KYJB 2Q3EA 3Q3GE 5B1DA 5FWYA 1BE6A 2O3SA 2CMFA 2XHZA 3AL2A 3KJXA 4FYYA 1KP2A 3OEED 3G0IA 1FTSA 1HETA 1Y9AA 5CM2Z 5ALXA 1GRVA 5CFZA 5E1DA 1Q0LA 1WMSA 4C0JA 2PX3A 2HPHA 3KEGA 2J48A 2QN8A 2BYTA 4NOMA 5JO9A 4MLPA 1HDYA 1GCUA 1KY3A 2H7YA 4IXWA 1ZPDA 1F51E 2R97A 2A4MA 3WK5A 1WX1A 1Q1BA 4FT4A 1P45A 2W2MA