3SZMA

Structure of human microcephalin (mcph1) tandem brct domains in complex with a gamma-h2ax phosphopeptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
b'PTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPVMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Microcephalin
publication title Dual recognition of phosphoserine and phosphotyrosine in histone variant H2A.X by DNA damage response protein MCPH1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/peptide
total genus 57
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3szmA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3szmA02
2COKA 4BU1A 1T29A 4OFBA 3SZMA 3U3ZA 3OLCX 2ADOA 2HTFA 2COUA 3KTFA 1L7BA 2K6GA 2M2IA 1T2VA 1WF6A 3K0HA 1Y98A 3HUFA 2R1ZA 1Z56C 2DUNA 1OQAA 1L0BA 3K05A 3SHVA 2L42A 1IN1A 3QVGB 2EBUA 3SHTA 4BMCA 2D8MA 3PXDA 2E2WA 4XPZA 4XQ0A 2EBWA 3EF0A 2EP8A 4BU0A 3PXAA 3I0MA 3PXEA 2XNHA 3II6X 3I0NA 3T7KA 1KZYC 3L40A 3COJA 3QVGA 3SQDA 3PC6A 3PD7A 4JLUA 2JW5A 1N5OX 2ETXA 3PA6A 3K0KA 3PC8C 5ECGC 1T2UA 2VXCA 3HUEA 1GZHB 2LE0A 4BMDA 3L41A 3AL2A 4ID3A 3EF1A 1CDZA 2AZMA 3UEOA 2COEA 1IMOA 3PXCX 1JNXX 3K16A 3K15A 3T1NA 3FA2A 4IGKA 2INGX 3PXBA 4N40A 4Y2GA 4IFIA 3JVEA 4Y18A 2VXBA 3L46A 3PC7A 3AL3A 3T7IA 3UENA 2XNKA 4U4AA 2WT8A 1T15A 2NTEA 3PC8A 3T7JA 2K7FA
chains in the Genus database with same CATH superfamily
1XQVA 4LNUA 3ZWCA 5EVJA 2HEGA 3HCBA 2FRVA 3FKJA 1ELOA 4QTUB 2QORA 3LUCA 5BSWA 5U4QA 2QHXA 2F43A 4CR7A 4B75A 1T1GA 2DTEA 1CF4A 3AIOA 2VT3A 5DH9A 3TXYA 3FYUA 4QUKA 4X8MA 2WJ6A 2AD5A 4TQUS 3BK1A 1P80A 1NJGA 1YKSA 3IQHX 5KNBA 5CT6A 3X1XA 4OLAA 5CA1A 2G09A 4PZUA 2MSEB 3INYA 3IUJA 4REMA 1QE3A 3ZV7A 2QW1A 1JXOA 4B0OA 1RHKA 1A2KC 1XFDA 4CDGA 3EVNA 1DV2A 3BMQB 1UAYA 2XMCA 5AOCA 3QVJA 4O4LF 4YJ3B 5TS3A 3GLGA 3LLMA 4YAOA 1SXJD 1WDKA 4G0PA 1IHUA 4R2LA 2YQ4A 4HWKA 4QWMA 3HBMA 4TMWA 3SDZA 4CDNA 4EW2A 3ELBA 4PTLA 4R05A 3FI0A 3Q7RA 3VHXA 3ZG6A 4DADA 4Q4LA 1SHZA 1ZJ5A 2X2EA 2D8MA 4XX1A 1QGUB 3EIFA 3FJYA 3ROZA 3H17A 1A04A 1UFRA 3I52A 1OYYA 3WDSA 2WFAA 4KGZA 4E2WA 1ATZA 1VTKA 1H22A 1KVRA 5K4HA 3QEBZ 1CY0A 2FJUA 2HCFA 4CMCA 3THYB 1AO3A 3ANLA 1NW7A 2ARKA 2V0NA 1W1UA 2WF6A 4QBTA 4D6PA 4FYWA 1JXMA 2PUTA 1Y3IA 2OCIA 1NLYA 3N2KB 1T9ZA 1T8PA 3N07A 3O84A 4LHXA 5CMLA 4RF5A 4D8YA 2HGZA 4ZCIA 3RRXA 2R6FA 1P39A 1KOGA 1KRWA 5FBRB 2CNDA 3A0RB 4RTQA 1YKGA 1Z06A 3DOJA 3LX5A 2FPLA 3ACCA 3C7DB 2B2CA 4INOA 4YUZA 2NXWA 3WMWA 2XRMA 1E7QA 1C0EA 4E30A 1FDOA 5AVXA 4ZC1A 5IYZB 2Q3HA 2WBLC 5DP2A 5BR7A 3NOOA 4GX2A 5TDHA 1H94A 4HZGA 3RVLA 1KH3A 2E6KA 3PR3A 5HIKA 3GDFA 3KUUA 2GETA 4HZIA 4K40A 4NE2A 3ZVNA 1N0HA 3AFGA 4YLYA 5AJWA 1ZIXA 3KD3A 1UT6A 3GX1A 2QRMA 3PKZA 3TRJA 2XT0A 2X1LA 4I66A 5AW5A 3NBAA 4HEA1 5FX2A 2D4AA 3C39A 4KIUA 1BMFA 5ICSA 5J2UF 1R74A 1T3LA 2PA3A 2XUPA 2VHVA 3U7QA 4GMDA 4AY3A 2B4YA 4OHUA 2PJRA 4PYRA 4B48A 4RAOA 5DOZA 1OZHA 5IEJA 2G40A 3REGA 2VHXA 2PZFA 5DM70 3OIUA 4P0QB 2B83A 1T6ZA 3WJ7A 3CLRC 4GEGA 1M9NA 4BAUA 2X8AA 2WKPA 1QBGA 6REQA 1KAGA 1X7YB 1FZTA 1JDUA 3FR7A 3I04A 4ZD6A 4KIJA 4EL5A 4Z3OA 1Q50A 2NP6A 4W8HA 2FG7C 3WGTA 4WZAA 4KCGA 4CEIA 1QGED 5L95A 1IQUA 3IELA 3QYFA 4ONEA 1NJ6A 3IAUA 2PXHA 3OIDA 4IAOA 3UT5A 2H7YA 2AMYA 4I5FA 4K9RA 1RW4A 5TJHA 2AN4A 3GAMA 1QZXA 4L16A 2COKA 2FA9A 4PZCA 5DYNA 5JPIA 2PQMA 4BU1A 1BJRE 4RWEA 1QMGA 3ZYCA 1UKEA 2ZQ5A 5K6AC 3I62A 2GYUA 2HEIA 2ZWAA 3B7PA 3EXG1 4G85A 3KJGA 4ND4A 5JCJD 3JWGA 4PAMA 5LLSA 2JHFA 4LWOA 4LC1A 2Q28A 2IEYA 3ZE8A 1XMIA 3AK4A 2J0EA 2FMIA 2G72A 3WL4A 2HYIC 3JAMA 3G0BA 1GD1O 3R5HA 5GVSA 2Z2KA 2WF9A 2RKWA 4LJ6A 3BCHA 3MCAA 1Z0UA 3EDYA 4GICA 4XQ9A 3WO0A 5HHTA 1T5OA 1L8OA 3HGQA 4K87A 2VJPA 3R6TA 3SFZA 3TNFA 1DV1A 2JAHA 3DF9A 2VZ0A 1R6AA 2CLFB 6LDHA 1KWKA 4YQFA 5IM5A 4MKXA 3AF3A 4ZGGA 5K0GA 3DDWA 2PX2A 1W94A 2C4KA 5GAJA 1E63A 2C4VA 3JVDA 3T7DA 3WKCA 4DLLA 2IS6A 4B3RB 3E81A 2GBCA 2PQ6A 2QMYA 2R87A 2VPYA 1M2OA 4FTWA 4MGKR 3H5VA 1YMUA 1X8LA 2JZNA 4LYDA 4A91A 2W71A 3G6WA 3OP4A 5A4AA 4RY8A 3MT9A 2GZAA 3AB7A 2IU3A 1YBAA 3VR2A 2GHQA 2FX3A 4CETA 4E1BA 3DLBA 1B26A 3L40A 4FMDF 3RYTC 2A78A 3U4HA 3ZV3A 4ARIA 1JHUA 1ZNWA 2J0UB 3QVLA 4FX5A 1W4AA 2JLAA 2OORA 3LVQE 7REQB 4LJKA 3K0EA 4RQUA 4LDZA 1ZH0A 4M1ZA 3LLUA 1BN6A 1P9NA 1WB6A 3D8RA 3NCTA 5I9SA 4K0RA 4OI2A 4OPMA 2JIZD 3RO7A 2XQFA 4AKTA 4X1IB 1LKZA 4BNDB 4A27A 3L02A 2MOKA 1JIKA 1T4MA 3KQUA 4AK9A 3OQ6A 1PGOA 2V7QD 4GSKA 4KQ6A 1X7WA 2Q1SA 2WJYA 3J80A 5L3SB 4F45A 2P5SA 3I6IA 3Q10A 5EE0A 3EZLA 5FKJA 2IX3A 5K0LA 4RLFA 3D0KA 4GXQA 4KDRA 2JEYA 2PSSA 4M4SA 1S4QA 5EP2A 3X2EA 2BCJQ 2DERA 2CCJA 1E8NA 1S8FA 2G0NA 1YE3A 4ZCQA 2AWNA 3WLAA 5JS8A 4WVLA 4DBZA 3T06B 3BRWD 3TVTA 2H7XA 2W6CX 4M9QA 4BV9A 1X13A 4ND8A 4RLQA 3KLMX 4X66B 1YFKA 5GY7A 2OLKA 1NMXA 2BM9A 2ZSAA 3TPZA 3KQPA 2Y77A 3SQMA 2C97A 3AHHA 1UH5A 4EAQA 2I0FA 4AF7A 4R1UA 1ADBA 1QE0A 1YZYA 4K46A 5E1DA 1QP7A 3U4QB 2F8TA 3LY5A 1M2VB 2FWRA 4MNTA 4Y1EA 3ZY4A 5KSYA 4FQ7A 2WD7A 3VPBA 1NMYA 1E5VA 1L7DA 1XMPA 3O3MB 4BDTA 2BGLA 1U99A 2RJOA 4MWOA 4NBTA 4JC8A 4EM6A 5EJ9A 5FPKA 1J0EA 1HNXB 4HAIA 3AUKA 1OX4A 4YT8A 1CY7A 4OX9B 4DCJA 1OC2A 3HBNA 3M6MD 3LPMA 3IL2A 5TT0A 2PQ2A 3U16A 1HLDA 1SOVA 4JJ6A 4Y6OA 1SXIA 4ND3A 5EIEA 2C1EA 3DBLA 3HSKA 1H5UA 4DCUA 1H85A 4DCVA 5LQUA 3CF4A 4TTJA 2F1JA 1LW6E 2R6AA 2QN2A 4C0QC 3DDUA 3LP5A 5E3JA 2P62A 4BQRA 3C15C 5CBPA 1BOFA 1UKVY 4YRNA 3H5RA 3ZCUA 1AOXA 1MCZA 2AXNA 1PR3A 4YT4A 3FOFC 4IJUA 4H31A 4PGFA 5BUQA 5JMTA 4ZVNA 4GIBA 1ZVJA 1UFQA 3NOVA 5BQFA 1F06A 3OZFA 4RQTA 5CBKA 1BXKA 3RC2A 5IAAA 4MZDA 3STYA 4QFCA 2XCRB 3G9XA 4FDMA 5B1SA 3QQPA 4JUAA 1CS0A 4XKJA 3C6ZA 1M0SA 2OFWA 1DJOA 3O4HA 4ZIRA 5LOVA 1ZICA 1E2KA 4V0ME 4RM2A 5COAA 4AT1A 3PL1A 2O8CB 1PEAA 1TLTA 4NSNA 4GOXA 3BCUA 5CPFA 3M9LA 3ASYA 1JU4A 4PZYA 3IDZA 3O8BA 1R8SA 1ZOIA 2I2BA 4P31A 2IEBA 1ZSNA 4EG6A 1GFSA 1VLHA 2ONCA 1NM5A 4PG4A 3EW9A 3L7DA 1IXRC 1QO7A 4RPKA 1W4CA 1VIDA 2HSJA 4HNAA 2R68A 1ESDA 1N2OA 3VPFA 4LGVA 5AHWA 1I2ZA 1NU8A 1PD0A 2ZR7A 4JJFA 1RHMA 2ZB4A 4DJAA 4GUAA 2HRBA 1H65A 1NLFA 4TL7A 1Z6GA 4RZSA 1JDZA 2IDKA 4NYMQ 1UMDB 2NO6A 3PX2A 5EMHA 1QYXA 1JVBA 1FDIA 2PUDA 5FI3A 1UFKA 2PAFA 2NVWA 1D4ZA 3A9WA 4RORA 5GGXA 1YZFA 1U2SA 5BUCA 3NT2A 121PA 1PDOA 3P26A 5JTTA 3C7TA 2J3EA 5F12A 4Z9YA 1DC7A 4I6JA 1MT0A 4NESA 5GWXA 3S2IA 3WC4A 3GLFA 2C84A 4RD1A 3A4VA 2ONYA 3HA7A 5K3FA 1WCIA 4AKGA 1L7QA 2PUHA 1RQGA 3OZIA 5IP5A 2WQ6A 3UOWA 4OAQA 5BN4A 5JYBA 5GIPE 1QVWA 1T1EA 4TMZA 2QX9A 3VR3A 4YUXA 5DIZA 1Q6YA 4RF4A 3IMGA 1CUGA 1TF5A 1KEVA 4XWGA 3ECSA 4L8LA 4D8VA 3QIAA 3LCVB 4II7A 4O33A 3RROA 2NO0A 3DTTA 3OU6A 4LJYA 3IHTA 2FRDC 4R01A 3WNQA 4QBIA 2WJ4A 1J8MF 3KR9A 1IZ7A 3TKAA 2P6RA 2D0DA 4O2AA 2ZJOA 2JJ1A 2OGTA 1P9OA 3EZYA 2JLZA 4KPGA 4AJEA 2XUIA 1U3GA 1QTNA 3OD5A 2DCMA 2ZB2A 3GUYA 5IBQA 2P79A 1JI3A 2QYOA 5E95A 1GG9A 3L7IA 4EBBA 2P7HA 2EL7A 3B5EA 1CUUA 1A5SB 1QPBA 1CB0A 3HSYA 1O6FA 3R8CA 5JQWA 1TZ2A 3EUFA 3LX6A 3RYIB 3EMKA 4Z6KA 2OT3B 1KAHA 2PE5A 5DWDA 1Y81A 1AD2A 3GQVA 4U5XA 3UANA 1AF4A 1U94A 2XWQA 4BFSA 1R1DA 1XTUA 4UQOA 4BGIA 1GCUA 2FB9A 4WLEA 2XTJA 4RVSA 4YEDA 5K03A 4EZIA 4LOAA 3UB2A 4CM3A 4N0QA 3X2SA 4CLRA 3DAYA 4Q93A 2REQA 1K8RA 4XVUA 3TBKA 1U7HA 5F9MA 4CW7A 4TVKA 5TB5A 1QF6A 5DM4A 3RWBA 1RWXA 1C7IA 4MVJF 5B1EA 1GTZA 3HKBB 3NX4A 4QNNA 3EYAA 3ZLTA 1VYVA 4G8JA 2VHTA 1DZIA 2LNDA 3IPAA 4JIGA 3ST7A 1SUDA 1EFUA 1GA6A 1JEQB 1BMFD 1ZD9A 2GDJA 3N2GB 3NDIA 4L8FA 4R7ZA 5AKGA 9ATCA 3VR6H 1JE1A 2OV8A 4RSGA 4Z0NA 4D0GA 3RODA 4AWAA 2VYVA 1V8OA 1IBRA 3DJYA 4TXNA 4COKA 1UXIA 4HHEA 5E38A 1ZNYA 4DSNA 1OWOA 1P7ZA 2QTHA 4AJ9A 3EEIA 3K09C 3E9DA 2H3HA 4DR3B 2XNCA 1AA6A 1WBBA 4OBEA 3TZBA 3NTOA 4DM7A 2NZUG 4GMHA 2FZLA 2ORED 4OLHA 3QU4A 2ID7A 3KT8A 2XJ9A 3GUHA 2ZVPX 3QXHA 4BVFA 1RMTA 2ZP1A 1AKMA 1DQPA 3EFEA 1DAHA 2XNDD 3HR8A 2I7TA 3X2FA 4PX3A 3EZFA 2F3SA 3G7SA 3EWSA 4UNNA 2WWFA 4OU4A 5I9BA 3FTFA 1BMQA 1FXWF 3EN0A 5AJHA 1TEHA 5C51B 4XUDA 4DSZA 1N6HA 4FB5A 2VF4X 4EYGA 3WGYA 4CKWB 3UZUA 2VL7A 3NHBA 3FOWA 3T4EA 5F78A 5KINB 3PFFA 2B8WA 1A8UA 4MCAA 4CN8A 5JYCA 1G5FA 1D2GA 3SF8B 3ADKA 2XY4A 1E7YA 4NAUA 5JWOA 5FQNA 1UKCA 4XASA 1ZOLA 3KO8A 3L8EA 3B1JA 5GOTA 3SEQA 1SCUA 3KE8A 4B74A 5I4CA 3OU2A 5MF6A 4JB0A 4GU5A 3GBPA 4I1SA 1JX6A 4Q47A 4UBKA 4UU8A 2WJ3A 1Q19A 4DIMA 4ZYXA 1AZWA 1T5LA 3IS3A 1ZNZA 4K7JA 5I4KA 1V8ZA 4Q9KA 2R00A 5K0JA 2RGNC 1GYQA 4HYYA 3BPSA 2JEZA 4X1YA 2R4UA 2NXNA 3ITDA 2VHQA 3PV0A 4RJIA 1XCMA 1R50A 3DXYA 5JSYA 3ZCSA 1FSSA 4XR9A 1M2GA 1X80A 5CA0A 1EVLA 2QJFA 4BNXA 4QXPA 2BP7B 4EY5A 1JQJC 2AYZA 3S2EA 1U4NA 1ODJA 1JG1A 1OZAA 2OBLA 1JHMA 2INGX 3HRIA 3OPQA 4FC7A 4Q4HB 2ON6A 2JFYA 4K05A 2A58A 2Z9DA 3GDWA 4NYJQ 5BUZA 2B25A 3WRYC 2CNKA 2IQ5A 4J16C 1ZI9A 3VR2D 3AWIA 1ONPA 3ZXSA 3M6LA 3FFBA 5H80A 2V65A 2UZ4A 4BLSA 1FXUA 2OV2A 4YP0A 4FCCA 5TPWB 4BUZA 1WPRA 1KYZA 1ZGAA 3MWJA 3NTXA 1WDLA 3VJMA 4TTQA 4ZI5A 4CFSA 3BAFA 8MHTA 5TS2A 1T5BA 2OG1A 4FIZA 4QSMA 1J4AA 5B36A 4G1UC 3S2YA 3AUTA 2Z9CA 4Y2HA 4UM9B 5KX5B 3RRBA 2E48A 3CMMA 4TN1A 4QUBA 4EX6A 4H15A 2FFAA 5CFPA 2Q5JA 1F51E 2N75A 4Q4AA 4QDTA 3MQ2A 3OOYA 1JSXA 3T94A 2FEXA 3CR3C 2YRWA 4GVXA 3H5WA 2XCLA 4HL6A 1T6XA 1ZRNA 4PLVA 3TMAA 1EGVB 1KK1A 1YS2X 2CLDX 3O82A 4MRAA 1R6XA 3DUWA 3LKDA 1CRQA 1K8YB 3ABRB 3U3XA 2X41A 2X8JA 3D4BA 3JD2A 2B4TO 2QU8A 3LIPA 1MPXA 2AXPA 3DAGA 4E31A 2DPYA 4C0LA 1I51A 4I50F 3W5JA 2PH1A 3B60A 3OJEA 4QRDA 4GHWA 1XZMA 5CA0F 1Y0BA 2FPPB 3ZGLA 5DNCA 2PS0A 3GNLA 1RYHA 4TT8A 4NBKA 1QHNA 1PUJA 2AE2A 2PFKA 1JQKA 1U5BB 1DS6A 2J6IA 2JHPA 3CW8X 3QFTA 4C0WA 4TT3A 1Y3DE 3HHEA 1PW5A 1CJCA 3DL7A 3MXTA 2XMQA 4TYQA 5CH8A 1T26A 3QEMB 4UJ5A 3KHTA 1LI4A 3EXFB 1OKKA 4MYCA 2AOXA 1R0RE 3CRQA 3ZHSA 2PKRA 4R8RA 1HSZA 4L57A 1X42A 2Y76A 5LBUA 4NEHB 3RAJA 4ZC8A 4PRKA 1M1YB 1N0IA 1N8KA 4WDRA 5EINA 1QP8A 3BXGA 3UJDA 2I6FA 3Q8KA 3FWYA 3ADOA 3PHJA 4ZICA 1EUDB 4OQYA 1ECCA 3UICA 5HUJA 2ZUBA 1E7MA 3QIVA 3IBTA 1ENOA 2WU4A 4PC1A 2OCAA 3D81A 4EYOA 1Y37A 4LMAA 3A1WA 2CXPA 4HDMA 4EUHA 5LXTF 2ZETA 4M7WA 5DVZA 3SOZA 4IJWA 4D56A 2ILVA 4V24A 1DKLA 3K4QA 1U5AA 1USIA 1V39A 2CBGA 2PRZA 3OTGA 1KQNA 3PC6A 2X7JA 3O8OA 1Z13A 3BRCA 3AESA 3I3OA 1EKXA 4PANA 5P21A 4AECA 4BLUA 2H52A 1UP7A 3VX4A 1N6RA 3TMYA 2WB4A 1ILWA 3I12A 1DAIA 3AP3A 4Q9NA 1TJPB 3VR6A 3GJRA 1SD2A 1PJ3A 1XZDA 1XF1A 3LUKA 5CT4A 2J32A 2FWMX 1H8HA 1SUEA 3BS4A 1VJTA 2RK3A 4NKRA 5KYWA 1F4PA 4R1OA 4BDSA 3OQOA 2VDWA 1TYEB 4EDFA 5JZBA 1FP7A 3NM4A 4QU8A 4BATA 4UU1A 1IVSA 2IFTA 1NQVA 1YF3A 4OHWA 3KM0A 4ID3A 2GVNA 3EF1A 2P6OA 5JY6A 1XCPA 3F47A 4JJZA 2WVAA 4HB0A 4N5DA 1JNYA 5ALLA 2HJ9A 2ZE8A 4LY9A 2X6TA 3TMKA 4QELA 1J0AA 2G9UA 5A4IS 2IHJA 3MD0A 3GCGA 3WMEA 5BR8B 4P3KA 3ML1A 4CM9A 3PEEA 4IHJA 4TRMA 4CMEC 1FSFA 2HJGA 4YAKA 3DEKA 1P72A 2YXLA 1ZOSA 3PPIA 2A57A 5B1IA 5LQCA 2RC6A 3GMIA 4BLVA 5K8VA 2EG5A 4P0TA 3IO5A 3L1UA 4URZR 1RQNA 5FT9A 1VJRA 2P9ZA 5LYYA 4LJ5A 3FKQA 4OBWA 3GGPA 5BN3B 4DV0B 2ZZKA 4LSGA 1OXTA 4QXAA 5KNCH 2GT1A 1K7SN 1FMFA 5IMSA 3PXUA 2J1LA 3WGGA 2HJHA 4M87A 1PZGA 1X9IA 3L8MA 1P5ZB 4FHZA 3VISA 2HMVA 3W2EA 3UJHA 4OI1A 4BCDA 4H1VA 1YVEI 5SYNA 5FPSA 5KJ6A 3RVQA 3HBFA 1E1NA 3IALA 4YXFA 1O6CA 5FV7A 2YZNA 3Q4GA 4M6WA 5EMKA 1P5FA 2GM3A 3VR3D 3BIFA 2ZIUB 4G81A 3L8YA 4QOGA 3FNRA 1ADGA 3DA8A 3BK2A 1FFXB 1PNTA 3GA7A 4KLZA 4HN9A 2PVSA 3QF4B 1C9MA 2NPOA 1NURA 2BT4A 5IHPA 1QQTA 3PHIA 5DDIP 5G4KB 2QEQA 3OM1A 4U7PB 3CF2A 3D6AA 5B58T 2QRJA 3IDQA 1RAIA 5C5EA 4Y2YA 1TMKA 1TM1E 4OGWA 5F1YA 3FGPA 3GLIE 2JJ1D 3FPEA 4RF2A 2V9ZA 2WOJA 1ULBA 3T7TA 2P8SA 4AY4A 4CUZA 2B0CA 4CMGA 2EX4A 3UA3A 2ZQZA 3AETB 4QODA 2FFRA 3O95A 5K9ZA 2JGAA 1U7WA 1O54A 1O4WA 1ZBDA 2AKYA 3DCYA 4UU7A 4RHCA 3LJKA 5E8JA 3L4SO 3P9NA 1Z5OA 3B8EA 1L5HA 2X3YA 4AYTA 1QB7A 4FYJA 3JATB 3GZNA 3IOEA 4LCEA 3PKIA 2BEVB 3RFTA 4R8KA 3AVUA 3Q40A 4WY5A 2ZT5A 3P9XA 2BCEA 2JFXA 5DW0A 4PG7A 4DY6A 3SQNA 3IIEA 4I6EA 2IYVA 2YH2A 4EKYA 3P2JA 1ZG3A 3SCZA 4ZI2A 2HOQA 3TZEA 4NQZA 4Y2XA 1G21A 4PLGA 4EHHA 1XU4A 3GHHA 4NZ9A 2GA8A 4NTZA 4DREA 3W2FA 3RT9A 4KXYA 5G0SA 4WXYB 5EXSA 1ESMA 1M2NA 2XDAA 2Z1MA 1RXVA 2XD9A 1M54A 2ZCVA 3I6QA 4BXOA 2JGNA 2VYVD 1YJ8A 5JEEA 1NY6A 3DUFA 3G9QA 4RNCA 7ADHA 1ESEA 3PWKA 1YVRA 3SHOA 1UJ5A 3H1FA 2OILA 3B5JA 2Q99A 1P62B 3N3BC 4Q1VA 3WS7A 5AUPB 2FSSA 2P9BA 1D2NA 4M38A 1M6EX 4BEWA 3ZS8A 5KIAA 3EQ7A 1YHYA 5EJFA 2XE7A 4L22A 4JWTA 2FPGB 1LD3A 3CG4A 3GCZA 3P2EA 1WTAA 1BXRB 1EUCA 2PGAA 3NUZA 1QFSA 3VDNB 5HFAA 2UXBB 1LI7A 3WV5A 5IAOA 2IW3A 2R5WA 4BO0A 1U8TA 2Q5QA 4DMGA 3ZZUA 4D0NA 4KPYA 2BJWA 2EFGA 3Q6MA 3SR4A 1MP0A 1UT8A 2CL7X 4KIFA 3NT4A 5KOHB 5D2CA 3BSYA 3N9IA 2PUBA 4GECA 1U7TA 4YAWA 1B8UA 4NCNA 3PITA 5G02A 5GZ1A 4CL2A 3ZY2A 1YCDA 2G17A 1Q0RA 4GLOA 3Q8WA 1PS9A 4UEOA 1II8B 1SCQA 1C0LA 3QX8A 3HVUA 3L0YA 2B34A 3AQIA 1VE1A 3KQVA 3HB9A 1G7CA 5FOWA 4BX0A 5IRCD 3PJEA 5CM8B 1SRRA 4YRBA 5EHXA 1G8FA 2XYQA 2WIFA 1EWVA 2BH2A 5KVAA 4R2XA 2GF9A 3BUSA 4KH1A 2VC2B 3DMYA 3BHNA 1FNCA 2GK6A 2Y1KA 4DCSA 5CFLA 5IC6A 2DHQA 4QSHA 4NLLA 3WAJA 4RZ2A 3VOTA 1YVDA 3N5CA 4R3UC 4MJXA 1LVGA 4B43A 1HYBA 4IFTA 4KZPA 4ARBA 2XVYA 3ADCA 1T4BA 2B69A 2NU8A 2ZYIA 4DYVA 2XRZA 1A72A 2H5IA 3JY6A 4WNYA 3GWGA 3TI9A 3W5CA 1GVNB 4PRZA 3SHTA 4C5AA 4MW4A 2Q3JA 5TQ2B 4JGIA 2A33A 4Q05A 1MC8A 1PFVA 4W5NA 4JR0A 4NZNA 1HEIA 2PX3A 1IJEA 3ROPA 3QNWA 1Q3HA 3TLMA 4E4YA 1PR1A 1T9KA 2QSJA 3LA6A 3HP7A 4F21A 2V7TA 4E4TA 4I8IA 2DC1A 3UKOA 1QWSA 4CHTA 5KNCA 5DLDA 2WD9A 5D3MB 1KYIA 1VXOA 4JI7B 4G89A 1ZDMA 2F64A 4WIAA 1IBKB 4M0DA 4RACA 3SQXA 3QUCA 1Z33A 3SSOA 2HV8A 4P22A 1MKYA 1S7GA 2BFBB 2FXVA 5BQ5A 2EQAA 2FQ1A 4UPEA 3T0FA 1NDUA 3CRNA 3DAOA 2QOEA 3HH8A 2QX7A 4JFRA 3SQWA 2BHRA 4HWOA 5CM9C 4G5RA 1BS9A 1E5TA 1IN7A 1AF7A 3V1NA 5COQA 2NUAB 4C0XA 4CT5A 1R4NA 4IG9A 2ZWVA 1NE7A 4R9RA 3QUQA 2Q2NA 4RDXA 1QF7A 5IEBA 3G2QA 3LUDA 3WXBA 4DUPA 5A1TA 3Q87B 3ESYA 3CLTD 2XVMA 4RJJA 3P1JA 3RNOA 4PIVA 1PLJA 4KR3A 4OGFA 2GPNA 1SC3A 1YE8A 1I2CA 3DYBA 3LBHA 1LPOA 4TT3D 4YK7A 3TTVA 4P3OA 3OFNA 1QQ7A 2NZVG 1E1LA 2A8YA 4ESEA 3TGLA 2C2WA 1TZCA 3R9KA 1BDIA 1QHYA 4FNAA 1OKKD 1Z3IX 3I72A 1ZPDA 4D3ZA 2ZTLA 3NRJA 1E7WA 3HG7A 1K2VN 2IUSA 2ZSJA 2YFQA 1ISIA 1A2QA 3EOZA 4MV7A 4R1TA 3Q9NA 2CNNA 4X1KB 2R1VB 5JCZA 5JDIA 2Y1GA 5T57A 5B3KA 1E1CA 4ZALA 4IFIA 3ZGVA 4XSVA 2G06A 4PF1A 4KDFA 3EWAA 3T99A 3HB0A 1HM5A 3ETJA 4WOJA 2VJLA 2I7CA 2IOFK 4HVAA 5CLGA 1WEHA 2FMFA 2WINI 1MZVA 2O9JA 3NTRA 4GX0A 2NZ2A 3O31A 3NUGA 4OMDA 1SZPA 1NRXA 3WSWA 3EC2A 4AZ0B 1SCBA 2WG2A 4P54A 5CB0A 2NXJA 3AEKA 3T5CA 3ZDXB 5B3LA 2X42A 3UBTA 4M1OA 3SXJA 4XUGB 3VR6D 2N46A 1TADA 5ITWA 1SVOA 1OZ0A 2Q1YA 4LMRA 4F4DA 4KYUA 1H8HD 2O3QA 1QHHA 2B6HA 1VMIA 1G66A 1CR2A 2N0SA 1G20B 4GLLA 1RABA 2Z58A 2OYCA 3D8UA 1MJHA 4FW8A 4D8XA 4JLDA 4UE3S 1T6BY 3GGSA 4Y7DA 4QL3A 2CV0A 3NBFA 4U2GA 4MQEA 4HNSA 5EP1A 4FZVA 2AZXA 3Q72A 2RKBA 3GJYA 4G2TA 1JG6A 3D7LA 4AI6A 4KAXA 1E2NA 3EVTA 1J8YF 1HUQA 3EWNA 3OZSA 2JD0A 4IH4A 2JGMA 3DZHA 5KWVA 2LCQA 821PA 4PAWA 1EINA 4CM9D 1UFVA 2VQEB 1JR4A 3CH7A 4N0MA 2GAAA 2PKYX 3ZWVA 1LC3A 3TZ6A 2J8ZA 3Q7TA 4B4DA 4B3XA 5KSWB 4TTTS 2ZE5A 4A2WA 1HE8B 3BJRA 4PINA 5AR1A 2IT1A 2JGKA 3JRXA 4I4CA 4CKCA 3HYLA 1UQRA 4BCBA 5DB4A 1RP7A 2XNHA 3M89A 1KJWA 1X7XB 4FM9A 3OKAA 2PMWB 2X0KA 3OQMA 1Y6FA 4E2YA 1K6JA 5K8LA 1JKJB 2CJWB 1D1TA 2QZ9A 1TU0A 3AM4A 2PKQO 5LSAA 1Y8ZA 1BE8A 1M0EA 5AKIA 3VZSA 1TIBA 4LXYA 1ISFA 3BGDA 2OZLA 4IX9A 4LXHA 3SFVA 2IUEA 1XDZA 3FUUA 3MJ4A 5CFRA 3ABSB 5ER9A 2EWMA 4B8YA 4LX0A 4FOSA 4R2JA 1JHYA 5CFOA 1Z25A 4BC0A 3JQPA 4JAVC 4KR2A 1Z0IA 1F5NA 2PBRA 3V4LA 5C52B 2K5UA 2OVFA 1VIYA 2R5NA 1OFHA 2UYQA 3FM9A 4XE5A 3PC8C 2NIPA 4HS9A 2G63A 4OF4A 4JKYA 5HTKA 6ABPA 2ZSFA 1GZHB 3A14A 3FD8A 1U1IA 4O1MA 5E6SA 1Q0ZA 2IEDA 3GFQA 3ZEAA 1R9MA 3WDKA 2JFUA 4IIVA 4AN4A 4P82A 1VFPA 2G4LA 1EPUA 4DJ5X 1S96A 3LG2A 4B4VA 5FLXA 4RELA 2X6RA 3E53A 4JC5A 4JEMA 1GRRA 4JCOA 4ZRDA 2Q4DA 2PGOA 2ZGVA 3K2EA 4P5EA 1SN7A 4U7JA 2WJPA 4B7AA 1MA0A 4NBRA 4RKQA 1G64A 2VLIA 3FLEA 2MTBA 3A6PC 3LT4A 1XELA 4MPPA 2IPXA 6AT1A 4DJJA 1K6XA 1IM5A 4JSTA 4GLJA 4OHFA 1B23P 1SUWA 2WYVA 1IHPA 3F8WA 1H1DA 5I7FA 2X77A 2BFMA 2WE8A 1UJ6A 2A0XA 2TMKA 3GLVA 1P1BA 4HH1A 2QTFA 4XSGA 3RYCB 1PLKA 1BKDR 4F4HA 1FMLA 1PSWA 1Q16A 1T13A 1UK6A 4OJQA 1JMVA 3KQWA 3A6JA 4LDPA 4QJIA 4WINA 2FTKE 4P98A 2NV2B 1ZXBA 3H9BA 3Q2OA 1KI8A 3ENNA 4OFXA 2Z08A 1JLLB 4OLFA 5EJIA 5B4TA 2V9CA 4B83A 1ADFA 5CDYA 2JIRA 1OASA 1MGPA 2IOQA 1JIUA 4D9HA 1LPBB 1KC3A 1HOXA 2P5YA 2MSLA 3A6KA 2LVBA 1FS5A 1ZGGA 3A4IA 5IVDA 4EGCB 2W4IA 1EZ4A 5F3DA 3LF1A 1R66A 2X15A 2BVNA 5LCXA 3LT0A 1T5SA 2QF7A 3DULA 3IUSA 4XI9A 1EVQA 2QAIA 5IJAA 4EA6A 1WZ2A 4IDCA 1MA3A 1XZLA 2L42A 2XMBA 5DBHX 2VKQA 3FPHA 3A4TA 4H3HB 3UATA 3IDSA 2CGEA 4AX8A 1VMDA 3O91A 2O05A 4WESB 4RM3A 1NKSA 3RQSA 3WDMA 1KY3A 1IPHA 1OHHA 1VJ1A 4LV8B 3HP4A 2I7DA 2K2QB 4UPVA 1FFGA 3RK1A 3NDPA 2ICAA 3THWB 1ZEJA 2QRHA 4RS3A 2VYCA 2J48A 4LTNA 4W5OA 5DRYA 3CNNA 4NYMR 1SRQA 4ALKA 4MKZA 4ZKDA 3N0TA 3S0JA 1AS2A 1CZOA 4G0ZA 4LXGA 1PQYA 1YQGA 3TOCA 5DWQA 3VZQA 4IKEA 3K1TA 1H0SA 2FW6A 3ROTA 4L3WA 3LO5A 3O74A 1KAQA 2HU5A 4L4RA 1LH0A 1YA4A 2W2KB 1U9IC 2C2HA 4MWDA 2PGNA 3H2YA 3WGKA 3N8DA 2VPZA 1F60A 5K8IA 3BRQA 3FCEA 4G5FA 5DKFA 4C05A 1SXQA 1R10A 3DC2A 4GKJB 1GGNA 2I1LA 1W35A 3VMFA 1N3BA 1TF2A 5FUVA 1R27A 2BUBA 4JLNA 2XUZA 5I5GA 3SM3A 1W36B 1C30B 3V42A 3DO5A 4OD0A 1CETA 3T1TA 5LUBA 4BS9A 1C7FA 1BG6A 2C4MA 4GWKA 3EULA 4RA9B 4EPVA 4ER0A 5JCOC 4WJKB 1J8QA 1XCOA 2OTCA 2X9VA 3Q3EA 3DKIA 4ND2A 4LF8B 1Z74A 3S8MA 1MC5A 2I29A 1U2RA 1L1QA 1ONBA 1RXSA 1Z4IA 2GSWA 2PX6A 1F8XA 4ZQHA 3ZBQA 2W90A 4R2HA 1YR8A 4BMOB 4QM7A 3SMVA 3RFCA 4BFLA 2ZJZA 3IMCA 3A4LA 3ENZA 4CG3A 4MYSA 4DUYB 5HRUA 3CPJB 2COEA 4BNZA 4IFEA 1L2TA 4MRVA 4EQ6A 1P1FA 1XN1A 3QK7A 5C8DA 4ZT6A 2HIMA 2YN0A 1QH0A 1XF9A 4IOMA 1Z5WA 2LIPA 1C9YA 4MYDA 2JRLA 5KNCD 5C1PA 2W22A 3DDSA 2ZIFA 1GV0A 3EIHA 3IOYA 3KXDA 1PV4A 1WSBA 4LHSA 4H4DA 3OOHA 1TO2E 3VYVA 4DM4A 1J7JA 3GT3A 4I55B 2FK8A 3O90A 5AVJA 1P4RA 1Q1EA 1E8DA 2VUIB 4YGYA 2G5CA 2EKBA 1UBLS 2VQDA 3FETA 4JC4A 1WDWB 1U2TA 4RVNA 4DTCA 1II0A 4ZGWA 3IE0A 4OQNA 3UAXA 4V1CA 4P4SA 1P4AA 2EF1A 5KOIA 2O8BA 1D6MA 1CYEA 1H3FA 5AOVA 4KN6A 1RI5A 4NI5A 1FFBA 4N8SA 5BSGA 1RWKA 3U56A 3ADDA 2RGAA 3NAZA 5DBEX 1MAHA 5JH7B 2NYAA 3S1AB 4YH1A 3HY6A 1V9CA 2IRWA 4PZZA 4L4UA 1PWHA 4Q3CA 1K0UA 1US8B 3ED1A 3HO8A 4TTSA 3V8NA 3RRJA 2WU8A 4K81B 4ZGBA 3TJRA 1KS9A 3A36A 3EZXA 5CVDA 3UKDA 3LHDA 3UK1A 1GQSA 1BE1A 1JR3E 5J2TA 4FHFA 4CJXA 3O2NA 5FOSA 3OFND 1UBEA 4PPQA 1DU4A 2A1IA 2ENWA 1AS0A 2HF2A 3NEJA 3SJUA 1N2CA 4DCPA 1NMEA 3CMCO 3C6YA 1TLLA 1NJ8A 1VE3A 2C7QA 3BGOS 5ALIA 1CF9A 1VA4A 1WMAA 1KSGA 4AJ2A 3UYKA 3I28A 3V8RA 1K3TA 1IDOA 2FDCA 2HA7A 2PZEA 3W5AA 4JODA 5L3QB 2GXUA 1GQYA 3V6LA 1IZ8A 4OIFA 1C8KA 4IGFA 2I2XB 1QHSA 7YASA 2Q1WA 2NNWB 4LGYA 4XQ0A 3TR5A 4JZYA 3SYMA 3BYZA 3H42B 4ARSA 5JVDB 1FRVA 2BEWA 3CH6A 4U6SA 3K3PA 1AV7A 1BCRB 4UJ3A 4CPDA 1FU4A 1MRSA 5CVVA 4CL0A 2VPPA 3OFKA 1F0NA 1UK7A 1Z2AA 4KWCA 4FXOA 1E4OA 1V7ZA 4K5QA 4X95A 1PE0A 1YRWA 3ZOZA 4XDHA 4ZZ1A 1Y3CE 5CDFA 3TTYA 2Z04A 3ZNOA 4G0QA 1YJQA 1XMXA 4NL4H 4X71A 2P4UA 3P9PA 1FYXA 1VXRA 4QOJA 2C9ZA 3C1UA 1DG3A 4PFSA 1G2QA 3BXHA 4NENB 1IJKA 1CW2B 1JTEA 2BFFA 1V0JA 2I4MA 1QCDA 4HH4A 3HTXA 1OAAA 4CKWA 2I2FA 3NIBA 2CXOA 5EXTA 4F8EA 3R7BA 1RRMA 2NUPB 4BNVA 1GRQA 1QS0A 2NGRA 1NWHA 2PKCA 3NHWA 2ABWA 1FNBA 3LPAA 1W2HA 2VXCA 3H2JA 1J00A 3CZQA 5DI3A 3VNUA 3T9AA 2REXB 2Z6QA 4IZHA 1GUDA 4E5VA 4TUYB 1XQYA 3L6RA 4CLOB 1PTJC 1L5KA 5IPFA 1CQPA 2J9FA 5JISA 3IULA 4WADA 1VSBA 3ZZ0A 5AW8A 2ZBDA 3B1VA 1OE0A 3HWSA 2YXNA 3DVRX 3QNUA 4R1QA 2NZJA 1G42A 2GX6A 2QYSA 3OO0A 4PXAA 2UVQA 1QH1B 3N2YA 2IHZA 1E3QA 2X1VA 2Q3EA 4X1IA 3ZWXA 4EMTA 5JNTA 4HAVA 2X58A 4JLAA 4JI6B 1DIRA 1XKLA 5C34B 5F7OA 5IAEA 2YY7A 4JVNA 4TWBA 2ZIXB 4ZCTA 1EFCA 4CNQA 1L7MA 3JAKA 4F2PA 3VZPA 2DQKA 2OOSA 4KQFA 4W9RA 1VJDA 1L9XA 3I6YA 2QD3A 2O20A 5DEIA 1JH9A 2PZAA 5F2NA 2ID9A 3BEDA 4JI0B 1TM4E 2F2TA 1E2GA 2OV3A 2GZSA 4WQMA 1GGVA 521PA 5AVZA 3WL6A 2XECA 1IXKA 1EXDA 1DIBA 3ZJ4A 1T5TA 5F4ZA 3EDMA 4NF2A 2UUPA 1AKTA 4CIXA 3GCDA 4MWCA 4FD3A 2L2QA 1E6EA 3CSUA 1IY9A 5BSUA 4TS9A 3ROGA 2BGGA 4BO5A 5J58A 1DAFA 3M6VA 2QRQA 1MIHA 5TEVA 2M1XA 1KI9A 4YV0A 2GAJA 3WL7A 2CMFA 3EQ8A 1C4WA 3FIUA 3Q0IA 4MLDA 2ID8A 1JG3A 1FW8A 3BKXA 3LWDA 1I13A 3PJDA 3IJ5A 3SC6A 5DNDA 1VKNA 3T9CA 1MXHA 1V2GA 4HNTA 3KQQA 2CF6A 2R6JA 1UM9B 4RCYA 1SVUA 5CXQA 3PGA1 2PUEA 5CEEA 3DV0A 3N8HA 2EFDB 3BIOA 3RI3A 4TKLA 4UFNA 3F8TA 1S2MA 3GI1A 1G98A 5HF6A 5LR6A 1TW2A 2H51A 2GO7A 1QQBA 1E2BA 1Z7GA 4LZJA 1Z62A 1UXHA 3DPUA 3QKRB 1X9GA 3R0VA 4FJ2A 5FRDA 1PQ4A 5EUQB 4BKPA 3NQ41 4CE6A 1A1VA 5JARA 2XZLA 3OZBA 2Q46A 3VRHA 2XCIA 1T34A 2I3ZA 1ZQ1A 2JGJA 2IJGX 3GJTA 3SY8A 1I1OA 1JEAA 2JBWA 4CCAA 3AM1A 1B4DA 4TV8B 3MNFA 1F6DA 4OJTA 4S24A 4IXNA 4MW0A 2P9JA 2VRCD 2YHUA 3UBMA 4CI0B 4H1WA 3PRJA 2XVXA 2EQBA 4GKBA 2GQ0A 1SVSA 2Q6OA 3GW8A 5HEKA 3LPNA 1G60A 1EFKA 1B73A 4KR0A 2YJTD 1IVNA 5C8YB 4CIWA 3OQHA 3QLTA 3A9UA 2B1RA 4R69A 1P2VA 3ZHVA 1SELA 3UMYA 3J7AC 4FWBA 2DPLA 1JZSA 4RMJA 3G1TA 1A95A 1TAHA 5DM0A 2G0AA 1P5HA 3UK2A 3ZHBA 1J70A 4LEIA 4G0UA 3S70A 4YJ3F 1TEZA 5H3HA 1X1TA 3DE6X 3GEGA 1C9EA 3FLAA 3Q98A 1D2AA 1KEZA 3PGJA 4O4JF 2E0IA 2O50A 5AKJA 3ETDA 1RQ7A 2REBA 5H4HA 1J2YA 5A6SA 3KQLA 1JPVA 2QX6A 1Z07A 4INAA 3AF5A 4HLUA 4Y6PA 4S0ZA 3U81A 4MW7A 1NNI1 3WHLA 3COVA 5J4VA 1IMJA 1B3RA 2HGSA 5CAEA 1FUUA 3KSDO 4BMVA 4Z9FA 2VPWA 4QATA 2I8AA 3H97A 1SXJB 1TJNA 8ABPA 3TEJA 1GL6A 5BO5A 1GCIA 3ACDA 4AFNA 3EEBA 4LNHA 5K2MA 1OI3A 1VIAA 4D99A 4N5MA 4JLVA 5AVTA 1NQXA 4M9RA 4RD6A 5H3CA 4AQYB 1VJ0A 3LF2A 4YASA 3E9QA 3G5UA 4KO4S 5AIBA 3WGIA 1PV1A 4R0NA 1RWVA 4G4GA 4CKBA 1RQLA 1XZEA 4MXDA 4F3CA 4FLMA 5EIBD 3VU3A 2GARA 1SQ0A 1OU4A 3AKDA 4PZEA 3N58A 4AO8A 3FUCA 3ZW8A 2VNIA 1P44A 2PZMA 4Y98A 1DG1G 5CX1A 1V43A 5JR3A 1H2RS 4Z7JA 1F9EA 3CTPA 2DB3A 3EXHA 4YJKA 4RH1A 2XA1A 1YR2A 4WKGA 5I9MA 1QV7A 1WW2A 3E8XA 1H66A 4AG6A 2GZ2A 2O7RA 3FSEA 3RAGA 2IWHA 1MO4A 4LCJA 1I3OA 1Z34A 1F5SA 2NUTB 3QEOA 2ZBUA 4OXYA 4JUCA 3OBIA 4M1MA 3F1KA 4HEHA 2VSQA 3PVCA 4JBGA 4PM4A 4WFQA 1ZMOA 2NAFA 2JD1A 2OAQ1 4S1NA 5AJXA 3TH5A 4HDKB 4DY4A 3VC2A 3H16A 4URHA 1R5JA 4N7JA 4Y2VA 1OX5A 2CJYA 1J25A 3EGDB 3KZXA 1XTTA 3IESA 2EJBA 3IIMA 2Z8ZA 3QNMA 2Q1UA 3GLSA 5DNAA 4IKOA 2ZSIA 3ZDDA 3QEJA 1FEZA 5EERA 3ZWAA 2ET6A 1H3EA 5KNDH 3VHLB 5D51S 2GD6A 2C0CA 2P90A 3HVRA 1ZAKA 2OYRA 3GEEA 1MH1A 3M4XA 2Q7DA 3Q5GA 3ON5A 4D3SA 2XKBA 4F5YA 1QCZA 3ZHZA 5CCXA 4I4LA 4I2NA 8OHMA 1K0FA 2PZLA 3TZHA 5F5XA 3PEWA 3NIWA 2OZPA 1C5KA 3GZ4A 5KKNB 4YDRA 4B47A 3AKZA 1MAWA 4C7KA 3T5TA 1RZRA 1KZGB 4RVCA 5LA6A 3IQXA 1BVUA 3BWBA 4FDTA 4Q4DA 1K5HA 3IUMA 4W1PA 1I9GA 4L72A 3TTUA 3ONNA 1SB9A 3QPWA 4HLNA 4XIFA 1VA5A 1CYDA 2WHPB 1I14A 3P0EA 1IOZA 2EF0A 3PP8A 1O0SA 1OBFO 1WXXA 2WA2A 4UE2A 3TQQA 4DIOA 3PZBA 4MW5A 1PN3A 1KDPA 1QFZA 1O8BA 3ABQB 4KPUB 1AIPA 1GUYA 4ECEA 3KKEA 2BEKA 4Y2TA 1IAQA 2GJAA 3IB6A 4C6HA 3MIIA 1QHIA 2VF5X 2AFIA 3CVYA 5DCYA 1GG8A 2JAOA 3IT0A 1XVIA 1OIVA 3V97A 4FDVA 1I3MA 4MQFB 3V4FA 2Y99A 4DMKA 1ECPA 1CQJB 4MRNA 5AVSA 2XCUA 2ETXA 3RFUA 3KJQA 3UJPA 2F8SA 2E4YA 1EGQA 1UANA 3S7TA 4YPOA 2WSIA 1E0DA 4MIEA 4KVGA 2IITA 4DRXB 4F2HA 4B32A 1RYYA 4AIRA 1R6TA 2AZ4A 2NVUA 3OOJA 2DFVA 2ZITA 4HNUA 1JXAA 1Y9AA 3V3KA 3NTVA 3ICCA 1VC2A 1M8PA 1JIQA 2LGJA 4IDFA 1ZONA 3KJEA 1NBIA 5ELXA 4C1NA 1UM8A 2FZKA 2IIQA 1W88A 3UHOA 1CUFA 2DR0A 3EPPA 3GRAA 5JZOA 2IBTA 1T4DA 1TCCA 2PXAA 2R2GA 1KQOA 3FUTA 5BMVB 2AN1A 5I4BA 4K9SA 2P40A 5TQ0B 3I5UA 1YZVA 3E35A 1AHNA 1PR6A 3RSHA 4B09A 4Z4IA 1EFRA 2XCSB 3E22A 2GCOB 2BI8A 4GM0A 4L5YA 1ZZGA 1Z0KA 1MJNA 3PC3A 4BFXA 4CHGA 4EHNA 4RX1A 1WB4A 3PWZA 1TE2A 1SEPA 2J7KA 5TY0A 4CV0A 3B3AA 3K6JA 3IQIX 1M7HA 2VRWA 1LFDB 4HGRA 1ST3A 3A2LA 1EWTA 3H13A 1IY2A 1P0IA 1S9HA 1E3EA 3I37X 5L7WA 2V3VA 3DWGA 1E58A 3TQSA 4ALIA 3F2VA 2QPTA 2ZUEA 1Z15A 4CF7A 4JYMA 4OIMA 2OK7A 1FA9A 3R5SA 1Q44A 2P27A 2ZIWB 2ODQA 2RONA 2ZYDA 2FUCA 2P9GA 2XXBA 3KKOA 3TLJA 2VQFB 1EJ2A 2GZ1A 3C3BA 3O6VA 5ALHA 3ZHOA 4KPEC 2GCIA 1JDBB 2IHUA 2DBYA 1EJBA 5FA8A 2V54A 3LGXA 2UYGA 1KZ9A 5IKMA 3BQMB 4CV3A 2JCVA 2ZBRA 1I1QB 5JI3E 3FG9A 1AUXA 1GJRA 1QLWA 3N8IA 3P0HA 3TSZA 4BRWA 4CF3A 2B6NA 2AUTA 3MTAA 5FR1A 1QUEA 1VKOA 2GYVA 5CFQA 1GKLA 3ANTA 1BC5A 3JR7A 3FZYA 1WB5A 3CY6A 1GAQA 5E4JA 1XGKA 3EX7C 1M3SA 1O7JA 5DYYA 2J46A 4CKYA 2KSQA 5L9AA 2QP4A 4S12A 5A6VA 1G55A 2Y27A 1Q7BA 3NI2A 5IU6A 1E3LA 4N3GA 3RHFA 4J6FA 1BW9B 3TSYA 4A26A 1Z63A 3NJ8A 2WPDA 1F12A 1TJ4A 2V6FA 4XDYA 4GVLA 4I14A 1GP2A 3T7KA 3LL7A 3ZVMA 2B7LA 1XXHA 2O3TA 1X7HA 3VC3A 4IUDS 1BNCA 4JI3B 4YJ2B 4B6PA 2PSJA 4JQYA 3BCRA 1ZM2A 2VEOA 2CYBA 1XDGA 3GC6A 2IYPA 3L01A 4LRWA 4M1TA 4HC4A 3FPAA 3HKDB 1B6GA 2RKOA 3HDTA 4UKDA 1DIHA 4C78A 4F6RA 4FMCB 2MU1A 4X92A 1U1DA 2E87A 2Z4RA 1KSHA 3GJXC 4XWOA 5C18A 5K8TA 1X1CA 4UDYX 1UBGA 5HW0A 2RAPA 4FS8A 2JIMA 3L1VA 1O0CA 1WXWA 3IJPA 1L5YA 1L5FA 1FFDA 1M2WA 2AMJA 3TJMA 3B70A 2JLCA 2Q5IA 1ZCZA 2B21A 1T2FA 1B41A 1EFTA 4HFRA 4WJLA 2GMWA 3K6KA 1RLIA 2BD0A 2GCEA 2D7JA 1T4CB 4AZTA 3P45A 2PU5A 4DLPA 2P3OA 5AP9A 3K31A 4UFOA 3KAKA 5KNDA 1A9TA 2C3OA 2PRYA 4FT2A 1JU3A 3DLPX 4GD3Q 4WCFB 4CIDA 5B5SA 3CE9A 3GGGA 3UEOA 1UZMA 1NBAA 1GKUB 4DOMA 3K2BA 2QT0A 3K35A 1V7PC 1VHWA 2BR5A 3P9RA 1R12A 4FQ8A 1XHLA 3BRSA 4M37A 3W6UA 4E46A 4F5DA 1IXZA 5BNZA 3ROQA 3LT5A 4BCCA 2YHIA 5L8VA 4EJSA 4D9KA 2CLSA 2FRXA 5KMGA 2AR0A 4CIAA 3LTNC 1B8VA 3TSCA 2JEOA 5HBGA 4AF6A 4H7PA 4ZVOA 3T3NA 1NX9A 1I3NA 4QPPA 4YRLA 1KI4A 3NAGA 4EG8A 2Q6KA 3DBVO 5AFSA 2PR7A 3FY4A 2VJMA 4JS0A 1BVYF 4GMGA 3C3MA 3G0GA 3LWNA 5D01A 4A8PA 4TYYA 3B20A 1KJQA 2NM0A 2R84A 4I08A 4YMSA 5T41A 1FX0A 3CZPA 3SZMA 1VHJA 3KYBA 2ISQA 2F43B 4WGFA 1M74A 3GJQA 4FSDA 4A15A 1FJGB 3AGPA 1PG5A 2HXSA 1NW6A 4J0IA 3FYUB 4QBHA 3WK5A 4BE9A 3EPKA 1QYWA 2AYXA 1L7AA 3L7JA 3P96A 4I5GA 3PT9A 4PLHA 4XRRA 3V5NA 4EHAA 5CA1B 2C7PA 1Y9EA 5E7JA 2QGNA 3B89A 3LC7O 3IV9A 2C5GA 4NFSA 3SOPA 1FQKA 4NARA 2BGNA 4R41A 4ZVRA 1MO3A 4ZHQF 1AK9A 4E5SA 4DMLA 3IOMA 3NP7A 5JG7A 3GRVA 2XDYA 4PC2A 4J75A 5AQEA 3EASA 4M22A 1VG1A 3PNLA 3WG9A 3DTYA 5JXJA 3JARB 3SHWA 1SUCA 1SZCA 3AFOA 4IV5A 3W6PA 1JWBB 2ZVDA 3E2PA 3NWEA 3AKCA 2R6HA 3QITA 4KW7A 3RF6A 1WXHA 2YY6A 3U7JA 4YIHA 1OD6A 2VDVE 2FUKA 5DXAA 3PFWO 2AK2A 2FWNA 4KSCA 4EQZA 4B0PA 4AP9A 2APJA 1JQEA 1LY1A 5E9QA 1ZUWA 5DN9A 2B1JA 1GNTA 5PNTA 1L3IA 4QU9A 3ZH2A 3AILA 3O93A 5F73A 1DUVG 3GLUA 5CW1A 4JI4B 5AD1A 5BMOA 5HPYB 4Q3AA 4XOIA 2F90A 1KDYA 1DO0A 3RBXA 4UEWA 4U9IS 3L18A 3KUDA 4KO2S 4D4HA 1TVKA 2QQGA 2OHJA 3LWZA 1ETUA 2HPHA 1AUVA 2Z30A 1SU6A 3ENVA 1QTRA 4L4ZA 5F3RA 3RVSA 4PBRA 2R7MA 3OF3A 4MO2A 5LDDC 3RVDA 4K6KA 1PYGA 1XXLA 2H2AA 5HA5A 3TLKA 3SVLA 5A4MS 4CQNA 2NSHA 1E79A 3D31A 5KDLA 3FPKA 4PIPA 4L51A 4MCIA 4TVBA 2GXSA 1Z4PX 3ND5A 4C14A 3GRKA 4PGGA 5EI5A 3OCJA 1DEAA 4CM8A 3PLRA 5JSHA 5HCUA 2ONZA 3HR7A 3ZW7A 2J5XA 1I4TD 2PUFA 1JHOA 1ZMTA 4W6QA 1P2TA 5BWMA 2UDPA 1YQXA 2QG6A 4JB8A 3WZMA 4E1AA 4JWKA 3QBTA 4MINA 1ABBA 3N0RA 1RMYA 3DO8A 3MAGA 1V35A 2EJUA 4G36A 3U7QB 5TX7A 4RPCA 1XALA 4N3NA 4W5HA 1SUSA 5EUBA 3ZYZA 5EG5A 4D9JA 5T5QA 3R74A 3I9JA 1RZRD 3YASA 1AKUA 4XLTA 1OAOA 2FK7A 3I9V1 4GKVA 4CUJA 4UUPA 5AW7A 4M8LA 4R9NA 2P7IA 1JQ5A 4A2PA 4F4CA 1DKQA 1YB5A 3VU1A 5C81A 2Q3BA 2V4UA 5ENZA 2FPRA 1C3OB 5T6MA 1JGTA 3H83A 4KACA 4M7PA 1Z22A 5FI1B 3BWEA 4NBUA 2ADMA 4WZAB 4KQXA 1G59A 3SSNA 4CEIB 1W8DA 3VAZA 4ENTA 4GKAA 4GOKA 4KLNA 4MQ5A 5EEHA 3RSSA 3UT5B 3KYCA 1KI6A 2OXFA 2HNAA 4QDKA 2ZVQX 2VAVA 2XB9A 3ZBPA 5SY4A 2A1TR 2IEAA 3LTEA 4S0XA 1A50B 2NU6B 1JV2B 3VH3A 1HNWB 4NG5A 4PC3A 1LK7A 1E18A 3ETGA 2QM7A 2IUYA 4R16A 1KI2A 3RW9A 3T3MB 4OKNA 3A6GA 2HNBA 2DWQA 3CLUC 5DK4A 4QFDA 4BIMA 4EITA 4LF6B 4DR4B 3HUTA 2CWWA 3TRIA 4O4HF 1WPGA 3H2KA 1KMNA 2BBWA 1GSAA 2D54A 2ECKA 2FEAA 3OM9A 4UEQA 4LRYA 4RMIA 4CN9A 5IBCA 5JMOA 1HTBA 2XXJA 3HXMA 4MROA 4BN0A 4FJ0A 2DE0X 5K99A 1F0PA 4L50A 3FAZA 5EYPB 4QJ3A 5LZ9A 2CNWA 3JYHA 4C7JA 3TECE 3LVRE 1NAHA 2NYVA 1OUMA 4BYGA 1AXGA 5EPEA 3QLVC 4OK5A 4WK0B 3CVXA 1JE0A 3BK7A 3Q1KA 1Q1BA 2XUQA 4Z0TA 2Y4OA 4NJMB 1Y5LA 1TA0A 1KJZA 1QFJA 3R7LA 1TZKA 4LJ8A 4UBIA 3T8YA 1EFRD 3CW2A 3Q7IA 4PNEA 5EFZA 2EKDA 3KTAA 1E94E 3IE1A 1LVUA 2HHHB 3H7IA 4BNHA 2HIHA 2KPOA 1M2OB 2Q8PA 3F6CA 1TFUA 1K6EA 8LDHA 2YMLA 4QLOA 5KX5F 1GARA 1FW6A 1REQA 3L4BA 2AN3A 2AA3A 1XB2A 3E8SA 3ORRA 1IQ0A 4K6MA 3RIXA 5EWLA 5HIIA 3V8EA 2E5LB 1PS8A 4B3TB 1GQFA 1UBJS 1Q74A 2OV6A 4ZWNA 3OU7A 4BP8A 3PWSA 4MGEA 3TN7A 1MV5A 3FH0A 4US0R 3GP5A 1KO7A 1U8UA 2B5OA 2YJZA 1H5QA 4U2KA 1PO7A 1VP9A 4OHOA 5EIFA 1EFPA 1M2EA 1P4HA 4PNZA 4QTXA 3K9QO 4TMTA 4JJKA 4CQLA 3AKYA 3OQBA 3SD7A 3ZKWA 1POWA 1Z29A 2R86A 5IW8A 4G0XA 4QARA 4TYMA 5IDWA 1K9VF 3H6GA 1SPBS 1RYEA 3OY7A 2C57A 3AVOA 1X7WB 1ISMA 1X0VA 3DOHA 4J1TC 4OMCA 5KQLA 3N0XA 3KL4A 4Z7QB 1W1IA 5HGXA 2J9XB 1E3IA 1SBZA 1MOPA 3C8ZA 2MWMA 2O3RA 4MQMA 3AR6A 3DOEA 3RABA 1ZWKA 4A6DA 4BQNA 3GJ8A 1EZ1A 1MX1A 3A7DA 2H5EA 4D45A 4JB3A 1M34B 2CLHB 2D8AA 1WZUA 4IV0A 3W5DA 4YRMA 3OZAA 1FL9A 4HN2A 1C8BA 1BEZA 2WPDD 3PK0A 3PQCA 2QD2A 3MW8A 4YLEA 4TYNA 5IDVA 3STHA 4U3JA 3H2HA 3KG2A 3VO1A 4MAAA 3HSSA 1ZJWA 4EO7A 3EB9A 4O02B 1XN4A 1Q2UA 5AKYA 3A1FA 3JQRA 3MELA 1I1HA 1L3CA 2F7SA 4XPIA 1UBTS 3I34X 1BU8A 1LBQA 2XEXA 4B2PA 4D5GA 5C7YA 3S2SA 2EATA 2JG3A 4UD2A 1JVSA 1WXQA 2D0IA 1OX4B 3ESDA 4WA8A 3RUAA 3FCXA 1CRPA 2F62A 4J3JA 4ZOBA 4EOGA 1O2DA 4MWZA 1HOTA 1PJRA 4V2IA 3I73A 3NTQA 3GEHA 4JKOA 3FVQA 1MVLA 2FKAA 1GPUA 1D5WA 3CR7A 4WD3A 421PA 4BKOA 5B30A 1ZMRA 3K73O 4OBXA 2C4NA 2HCTA 4GWGA 4QX6A 1ZR2A 1LDBA 2QPLA 3OM8A 1OA1A 2KW5A 2QVCA 2XOKA 1E99A 4KK4A 4WRRA 3NMUF 5CBPB 1T9AA 5KNDD 2SCUA 2X0NA 4KHZA 1KDZA 4K9KA 5HXAA 3VKGA 4K6OA 2HU7A 1QLHA 2FUG6 5LZ7A 1Z56C 3FLBA 2RHDA 3CEAA 4RJKA 1HK7A 4V38A 3SDSA 3ETLA 3BJMA 5KYYA 3KSZO 3TLAA 2GNOA 3K70D 1U2DA 3HDGA 4WWHA 3IAHA 1CS0B 4MEJA 1CP3A 3EGCA 5EIOA 1W36C 4D8TA 3CG0A 4XXHA 4MV0A 1Z0JA 2BTOA 3DL0A 4WBNF 5K05A 5LOVB 1RNLA 4G0MA 1BROA 4EUFA 3RSOA 3WV4A 2ZJ2A 5KJ1A 1MLDA 3H9QA 1UKAA 4JT4A 4JC0A 1AY0A 3JWPA 1DCMA 4OH7A 2XVAA 1JR6A 3U17A 4QG3A 2HHLA 4BB5A 3K8ZA 3FFAA 4TKZA 3AR5A 1Q1NA 3BVPA 3F3YA 4XYMA 1NVBA 2HWUA 1UDAA 4G07A 4KFCA 2GN8A 1ODFA 2CXHA 3TO5A 2XX3A 3LQYA 3R40A 3OZWA 4BFTA 5EXPA 1TO1E 4DVGA 1CDEA 1GUAA 1MW8X 4AW9A 1Z6AA 1AHIA 5DLPA 3I1IA 1TCBA 3DZJA 3FKSD 4MYUA 2H4XA 1MEEA 1NVUQ 3GP8A 3O4FA 2H7VA 3TZLA 1J09A 1K2WA 1P1JA 2I65A 3G3EA 4ISCA 3WIEA 1XNQB 5KHAA 3HDHA 4L5CA 5FI0B 4C2TA 1QYCA 5CJJA 5IH7A 1E3WA 3OE1A 3TQIA 1X3SA 4CTJA 3NJRA 2C8KA 5F9FA 3GLFB 4RD2A 3KAJA 1PGNA 4X1OA 1KARA 1PFYA 2ATEA 4QAQA 5DSXA 5K3FB 1WCIB 3TW6A 3VNAA 1PEYA 4AP5A 4D80A 1L5ZA 3MLBA 4LY3A 5A4FS 4JP2A 2EW1A 3H18A 4I4IA 4BGDA 5I7UA 2I33A 4IQ0A 4QTZA 4UBOA 2CXXA 1P1CA 2GZMA 1WS6A 2YWFA 3L0CA 3O4IA 5BN4B 5LD2B 1FSPA 3DT8A 3C1AA 3G68A 1AMOA 2FE1A 1Y5RA 5EWMA 1ZD5A 1DGQA 3EHEA 4QGBA 3HBAA 2Y2UA 2QUHA 2YYYA 1GPH1 1NR7A 4LW8A 1OIXA 3IOBA 3W1EA 3EFHA 5DXFA 1C50A 5JRZA 2P4EA 4RIIA 4X7BA 1LPMA 3WGHA 4JQOA 5KTMA 2J0VA 3KQHA 2B1IA 3GZTB 3T9EA 2OFOA 4KODA 3LCMA 1JH8A 4JZKA 1NBWB 2CJPA 3I76A 4BFYA 1DL5A 1WQ1R 4O2AB 2Q6VA 4ITVA 5AJUA 2Y67A 3MJRA 1YL5A 4F5ZA 1BWRA 1YIOA 3GRUA 1Z8NA 4MLCA 4QNRA 4Y2GA 2WF8A 3VGPA 1KK3A 3BL6A 1RJEA 2C9BA 2PTHA 4DQDA 3ZV4A 4MZXA 1THGA 4KRYA 3RWMB 1EDBA 1SKUA 1G5PA 5JJIA 5GMOA 4P7JA 3S2GA 1A3CA 3SIRA 1Q15A 3BXZA 4M0LA 3WWCA 2O3UA 1MV8A 3CSSA 3G23A 4DQ0A 5K0ZA 3DL4A 1E79D 3C3YA 1OCEA 3MCVA 4QA9A 3IV7A 4BFUA 5E2AA 4EDHA 1Z8DA 3ANMA 1KK0A 4IGAA 3U09A 5AOAA 1QF9A 2C5HA 4DKXA 3ASUA 4R2WA 5B6IA 2ORYA 3AVWA 1JG7A 3KLNA 5E7MA 2QI9F 3KTOA 4CLRB 1KP2A 4REQA 4EGFA 1GAXA 1XAJA 2REQB 2RCNA 1QONA 3FNFA 5DT9A 2VBCA 3LBFA 1D5CA 4KE9A 4X3OA 3VJKA 4LRTB 4LE0A 4IDPA 1YZ3A 2W98A 2VWGA 5EUCA 3ZE2B 4AO6A 2DBRA 4W8OA 4BO4A 1IBCA 3UA4A 1BX1A 4IH1A 1EK5A 3ICQB 3K0AA 5E3HA 4RPIA 2XWSA 3PRYA 5EE9A 2A4MA 4WK6A 3ZZNA 2IHNA 5KTPA 2FX2A 2IHKA 2CMHA 3ULKA 2PMEA 4L78A 3CYFA 5IM4A 2RH4A 1RE1A 2QW0X 3HFRA 1HA3A 3DFKA 3TLCA 4D0SA 3EG9B 5CDGA 4KP7A 1GA1A 2IYXA 2VYNA 3B12A 1N1DA 3CKYA 1I0LA 4Q7EA 4XB1A 1IY1A 4BLRA 1X1RA 4N76A 1JHXA 3L49A 3TOXA 1F2UA 4CI9A 3IAS6 5FBLB 1A9XA 2FW8A 4LOKA 4A0QA 5IWCA 2ASEA 3KLBA 4KE8A 1TXGA 3U62A 3BD6A 5KU7A 4BZZA 3BFVA 3OQIB 1PKXA 5HKAA 1XRPA 5JFTA 1DXHA 1UDRA 1VDZA 4LFBB 3I5XA 1ECBA 5ALJA 3K0SA 5KSZA 1WMDA 2JVJA 5GONA 2ID4A 3F3MA 2N9UA 1KVQA 3KR0A 4MYRA 3L7YA 1WP4A 1N6OA 1PJ8A 2HUPA 1C7RA 4NCHA 4V2UA 1J23A 4JCCA 4MYTA 1KEEA 3ZGXA 3VZBA 4BNFA 4I81A 4H59A 4E22A 2ZLBA 3DE3X 5HILA 5JWRA 1CE8A 1QAOA 1U81A 2FOIA 4QUIA 1J1UA 1YR7A 4RTNA 2HO5A 1BDHA 4H6XA 3ID6C 1VBMA 3MWEA 4KQCA 5EP4A 2WDZA 2NTVA 3BJIC 4D4MA 4WI1A 4ACAA 5B2ZA 2R62A 5BSTA 1R6VA 1USUA 1MC4A 1M1YE 1W5SA 1Z5NA 2CNWD 1HC7A 4NECA 1CJMA 5DYGA 1SU4A 2XZDA 3AFNA 4QLBA 2V5UA 2FR8A 7GPBA 5EQJB 2QRUA 3RUFA 2HFKA 1FVFA 4X1YB 5DK6A 1TRKA 3TEMA 5T3UA 2VR1A 3G88A 3RFFA 3DFIA 5K3EA 3OX4A 4HG2A 3V2IA 5CA0B 1XVVA 5ALYA 4RXUA 4OO3A 1B15A 1CJTC 3FB1A 2WAAA 3IV6A 2GHRA 3KELA 1GTMA 3PFBA 2BYTA 2C3UA 1JEYA 5AHKA 3E9ZA 2FPSA 2LCIA 5K0NA 4LFCB 1C0PA 2VWPA 5TV2A 1V11A 3GT7A 2O2JA 2R4TA 1S1MA 3PEFA 4CT0A 3K0CA 4KMOA 4EA7A 3OI7A 3NAMA 2FI1A 4E5PA 1QU2A 2C07A 2VSOA 4UZEA 1U0GA 1THZA 3G1WA 4PN7A 4DG5A 2PGDA 4NV1A 2Z9BA 2J33A 1RKXA 4M60A 4YRFA 3LVBA 2OXTA 1Q14A 3TL3A 4MGYR 5KYVA 4D81A 1SCAA 3C3EA 3IAAA 4WN9A 1CQXA 3TYXA 1GT91 4D4GA 2O1SA 2RHGB 3OFJA 5HJEA 5JAOA 4ZTZB 2DEUA 1JPNA 1RCFA 4JVOA 4DJDC 2F3QA 1GGFA 2BKEA 5T4EA 3TS1A 2C5SA 2WPNA 4HEA6 2R65A 4FFBA 4Q0MA 3I1YA 3HU3A 5BQOA 1H3NA 3B7GA 5U1PA 4KQIA 5IKPA 4I5IA 4R1MA 3LCCA 2VAWA 4Q4AB 3IBSA 3S5UA 4E7OA 3H8WA 2QIPA 5ILQA 3QYPA 2GJKA 1A1SA 4CRWB 4IZ6A 1M1UA 3Q11A 1YRYE 4FGKA 1FBTA 1SBNE 2ECOA 4K9QA 1WHSA 1YTLA 3BXFA 4GPBA 4LOHA 4TTRA 4UVIA 3PTZA 5AI9A 5ECYA 3U3MA 1C29B 1E2EA 4NFHA 4RFSB 3BGIA 3MM4A 4RHXA 4RK5A 2Q7OE 1NP3A 1P60A 1TM3E 2Y92A 1VRVA 1LXCA 1UKBA 2CKMA 5DU2A 5GM2A 1YB7A 4C89A 5CG2A 3I61A 3G89A 4PSCA 4QQRA 2JHAA 2JFHA 4ATNA 1MX9A 2B1GA 1XDDA 1HTWA 4QUJA 1NVVR 1T0IA 1U7UA 4U9UA 1ZU4A 1A76A 2GKGA 3LUBA 1JJBA 4GWLA 5EMJA 2DULA 1B3BA 5BP7A 2XAAA 3GFFA 1KWGA 2CLLB 4ARZA 4ZEOA 4C88A 4M53A 3ICOA 2WJGA 2VNJA 1P1KA 3HEAA 2O06A 4O29A 3PHCA 2J9YB 2N42A 4MIKA 3ZCRA 1ZW1A 4CV1A 2WIJA 3HL4A 3I5AA 4DV7B 4B3FX 5EMMA 3QKWA 1LVHA 1UBNA 2FMXA 2ERCA 1NW5A 2HDWA 3D3JA 1C7QA 1MABA 1MD9A 2OQVA 2CYAA 1K5PA 4TPKA 3HZOA 5DTQA 1NVMB 3C14C 2PRSA 4DBLC 3JPYA 1RBQA 1JTVA 2Q4TA 1SXJC 2PYIA 4PPNA 3O9MA 2FW1A 2OSVA 2Z2YA 1VLZA 1QRDA 3KQYA 3PIIA 3DT9A 4HDMB 4JT2A 3SR3A 4PWZA 3VI3B 3VOBA 5IUJC 1OW3B 4E12A 1J5PA 2XOKD 3AW9A 3B6IA 3PJFA 3BXPA 4LWZA 3ILYA 4MV6A 1C3VA 4N48A 4CF5A 2QIOA 3O8OB 4U2BA 2RMKA 5HK8A 3X1DA 4D79A 3NYWA 1JWLA 1UPFA 1XCGB 4K88A 3KCQA 3VHQA 4HWSA 3K4HA 4CCYA 1N77A 3UMSA 3GNTA 3X1KA 1SQGA 4MIYA 1DARA 1UXJA 4WK2B 4XFKA 4LSWA 3UCXA 3ZQKA 2E7ZA 2ZR8A 5KYXA 2GS9A 2F9LA 2SICE 2VDWB 1N2JA 2EIHA 3CZRA 4NJEA 1PR0A 4Z3KA 3OTQA 1ZD3A 1DFIA 1W93A 3KZVA 4CR8A 4ZYYA 3I58A 3A25A 3ABOB 4FMDB 2YYZA 2BUAA 3MOSA 1VI6A 3OLYA 3JTMA 1OFIA 3Q6IA 1TVMA 3ZK7A 3RD5A 4BLPA 4EPRA 3QVKA 4FMPA 4DEXA 4PIMA 3HO6A 1GA4A 1OXUA 3EIUA 4MWTA 4KXFB 5LNK6 2W00A 4O5AA 2IYTA 1SXGA 2I67A 1MXFA 2X3UA 4FW9A 4UDNA 2KHZA 1Z6PA 4QFMA 1YMVA 3FAKA 3GJ3A 3FROA 4P7GA 5FCDA 3THYA 2DJIA 1RPJA 1C0IA 1P2GA 1HI9A 1E77A 1XA3A 2WHXA 3GL9A 2XXAA 3BWCA 5TE9A 4IIBA 3PNSA 1OYVA 1CY8A 1FZQA 2WTBA 3LQFA 3MCZA 1XYGA 1KYYA 4HRYA 4I5DA 1WL8A 1DELA 1FY2A 3T0GA 1HLFA 1NVXQ 3RG2A 5A5VA 2VF8A 1IULA 4JJ7A 3FJOA 4MUAA 4DLVA 3ZD7A 1TI7A 3LFTA 4NP6A 5ALMA 4GLFA 3WYCA 2FAXA 3GXOA 2MHCA 3KFLA 2QTWB 3W1WA 3L8GA 2DY1A 4PSUA 3WQHA 3A2KA 2Z6VA 4C0BA 3ZD8A 4IUCS 3HUFA 3O73A 5LKAA 4OHZA 5KQRA 3ZKAA 2C0QA 3C43A 5FTKA 1CP2A 2WIAA 2V7UA 4XD2A 5AHXA 2VHZA 4K8OA 1ZSVA 3A9VA 3CWQA 4RSHA 5JO9A 3HM9A 2BSXA 1TK3A 1SOMA 1N8TA 3R3ZA 4R98A 5ALTA 3RJMA 1N5JA 4X7PA 4IUYA 3B36A 4B46A 1MVNA 2TMGA 2Q41A 1RWNA 2UKDA 1HDOA 3PDCA 3TVDA 1VMKA 4LJSA 3SQOA 4A03A 1H9AA 4PAOA 5SZHB 1ORIA 4BVLA 3ZXXA 3C6BA 1NXXA 3FMOB 1ZNQO 2I2DA 2ZBPA 1H4QA 1LTQA 1L4GA 2WWGA 5FFNA 1IRIA 1ISJA 3HU5A 3NXKA 3KD2A 3NBYC 1ZMXA 1FQOA 3L7NA 5LZ2A 1DXYA 3EXEA 2TSYB 2GTIA 3CBGA 2HMYB 2JGEA 5A05A 4ER6A 3CCCA 3K7EA 4YRPA 5BNIA 2DPXA 4B71A 2WW8A 3HFJA 4FD2A 1M33A 2H1VA 3FPCA 4UVEA 4MVJP 3HVHA 1N7JA 4X6UA 2CNBA 2WP0A 3P0RA 3GARA 4DTIA 3R6WA 1ENYA 1EYZA 5K3SA 3QKSA 2JGRA 1UBRS 2B0JA 2XITA 3IPLA 4YMTA 1D2MA 3JYPA 2AJDA 1VG9B 3IAXA 5CB4B 2KB0A 3D2LA 3QY0A 4JUFA 4QQKA 4WERA 3HJFA 1VJGA 1J39A 3BIWA 3H1PA 3EZ7A 3HEMA 4N7BA 4BXOB 1Y1SA 1G291 2RB5A 3DUFB 4PTZA 4R2KA 3U44A 1D9ZA 2GJ9A 4M83A 5MN4A 4PLWA 1HQDA 2AH5A 2O0MA 2Q4BA 2A0KA 1H2YA 2VYND 3L41A 4PAGA 4QJBA 1A7JA 3TX2A 4DSOA 3IVMA 1F17A 2NQTA 2AJ8A 4C3UA 2YMMA 2QW8A 2I9KA 1JQBA 3BEOA 2C7VA 2UAGA 3EVCA 2ZJ0A 4HYEA 4RCVA 4Y2PA 4KSBA 4F71A 5CRIA 4EECA 4GMFA 4DNOA 2Z83A 1EUCB 2CBXA 4B6OA 2XT9A 5ALGA 2ZKLA 1DO2A 1JDBC 2JIQA 1RI1A 4HLDA 3BG5A 4IY1A 5CFZA 4GYYA 4XQCA 2EZUA 2G9QA 4R3WA 3U37A 2EGHA 1BN7A 3QMVA 3UT0A 2ZJAA 1JDPA 3SBOA 5YASA 4J94A 5ALOA 5AJYA 1ZD4A 4GP6A 1JAYA 2NTEA 3HM2A 3MTEA 4CMKA 4LDQA 5ICMA 5EMLA 2FSIA 3IXQA 2DSNA 2WEKA 1N6LA 3WNDA 3DOIA 3QLUA 1JW9B 2ZRHA 4XEUA 4PO9A 1KPHA 3G79A 3SYNA 5E4TA 4BJ6A 3PFCA 3QVWA 3G7NA 4MDYA 1HDZA 1DUSA 2DFTA 1CUJA 1F3OA 4J7XA 2CMKA 2JLXA 2Y1CA 1XG5A 2OZVA 3G1UA 4K6GA 2BEJA 2ZXFA 3CJRA 4J07A 1TMOA 2L17A 4RVFA 3TGWA 1ZIDA 3ETEA 4RY9A 5JNWA 4NU5A 2AI3A 3QSGA 4RFLA 3MUEA 1PIWA 3D6VA 3FYTA 4XM2A 2IZ0A 2M2IA 4RTOA 1NSYA 2Z98A 3FUWA 3MUOA 4R83A 4U2FA 2W48A 5E7QA 5FNVA 3ITKA 5H83A 5BQXA 1DAPA 1EXWA 2H85A 4M9ZA 3WGQA 1X1BA 4FBMA 3PUHA 5LLDA 2V3WA 1A8SA 1XMOB 1OFTA 4OXRA 4P35A 1T0UA 4IWNA 2KMLA 3U1VA 4ICIA 4QO7A 1EFVB 4BBAA 1ZXXA 2FSVC 1O8CA 3ZXIA 2NU8B 2QSUA 3WQBA 2Q5LA 3C8UA 4KITB 1IUKA 2J08A 2YC4C 1GL3A 4C07A 1WKVA 3F67A 4DABA 4XSHA 2FCRA 1G20E 4DIBA 5I3CA 4FE7A 3ZH9B 1E2LA 1ECFA 3ZQJA 5HJ5A 3MGAA 5JJKA 2O4CA 5ALRA 3IODA 5FLKA 3WJ2A 2HR1A 4FKMA 1J6UA 4G1FA 4WCFC 3T7EA 4C7OA 2CEKA 1XCBA 2UVPA 4KVAA 1L4BA 3RARA 3WK8A 1L7EA 1EUQA 3AERB 3IDFA 5FL3A 4J9VA 2W58A 4LQCA 2RDMA 2ZRNA 4MQBA 5EFOA 3UUGA 3KX2A 2Q3LA 3WISA 1SUBA 1UKYA 4B4KA 3TBFA 5HR5A 4LFAB 1A7AA 2WLTA 3GMSA 2P6NA 3IX7A 4WXEA 4CMIB 2B2XA 4HV4A 1G9XA 1JG2A 5FPPA 3MD9A 2OA0A 5DTIA 3W90A 2XKAA 4MUBA 4G23A 2AFHA 4YQEA 2FHSA 4EG0A 2AFVA 3K4PA 1R4NB 4JQSA 1ZI8A 2KWIA 5CVJA 3GJ6A 1DMRA 1OJ7A 5A2QA 3B6MA 1KJIA 1EVEA 1CSEE 1KTVA 1ZQ9A 2PRJA 3DTNA 3H4VA 3UHPA 4C7MA 5L40A 2QL5A 2C00A 4IRMA 3STWA 1VYTA 1J5XA 3K5WA 3WKDA 4PG8A 4NXMB 3C98A 2Q2VA 1L8AA 3DWFA 4O4IF 1SHUX 5HS4A 3NXSA 2ZIZA 3FYUC 1H8EA 4UEKA 3T1NA 3UY4A 2DWPA 4NICA 3DZDA 3PXBA 2GGSA 1O9HA 3T3IA 3HXOA 1RHUA 4KKXB 1T0PA 1IDN1 3JAWA 3FNHA 4LNAA 2E9SA 5ICEA 2Y0BA 4ER3A 1PNQA 2R6R1 3CQ9A 2I4IA 2WSLA 2H59A 5CXXA 1KORA 4BWFB 5B4UA 4D2IA 2VDOB 2J3MA 4BNGA 1WVGA 1NQOA 4KQJA 4BEBA 2L18A 5ER6A 4PPYA 5EQFA 1Z12A 2VNHA 4LOIA 2ZREA 4YHHB 3IQDB 4EFLA 3RNLA 1JLHA 5H16A 1GPYA 1OIWA 3TTWA 5FDFA 3KVRA 3AEKB 1Z3CA 1LGYA 1S8NA 1A2BA 5EKUA 1U11A 5ESDA 1QLJA 3WGOA 4IHKA 2DKOA 5IUNC 3OLCX 4CCYB 5E8RA 4EFMA 3PEYA 1QHHB 3ETHA 5HGJA 1APBA 5ERXA 2CB9A 3PNQA 4YUWA 2VHCA 1CR6A 1BHO1 3PC4A 1QSGA 3DB2A 5IN4A 1ZBQA 3GLHA 3PE6A 2FPKA 2FUEA 4L95C 3TM5A 4MQEB 3ZDAA 5FBKA 1W48A 2PMKA 2X6QA 4MRMB 4MEBA 3LX8A 3SNHA 1V9LA 1LPNA 2OCGA 3GXBA 5ERGB 2DPMA 1M1NA 5LM3A 4N5HX 1MFPA 1SUFA 1KIFA 2J3HA 4BMNA 5IZCA 1SB8A 2QTAA 3DAHA 1GUZA 3ORSA 1CJBA 2XYGA 5DYWA 2FRDA 1DBVO 1YDEA 3CEMA 1XMJA 3ZDRA 1JIXA 2RHCA 4XPZA 4TVSA 1R0YA 4KR9A 1ZMBA 4GSYA 4O1HA 5KREA 3DZGA 1EM6A 4JJ8A 1CEXA 1FQWA 3T5MA 4P93A 4R1LA 4CKCB 2QTVA 5AI6A 1P9RA 5HF8A 2HQBA 2LXNA 5MN5A 3FWKA 3PFKA 3RT1A 1ZN8A 1E2DA 1RT9A 2P2DA 4GOOD 4M3NA 2GEBA 3NGMA 2YWRA 1BKYA 3B1FA 3FMVA 5AM1A 3HLYA 2W70A 3UWKA 1XAIA 1N36B 4H7IA 2ZT8A 1NLUA 1WCXA 1GZ7A 4F60A 1NLZA 4PLFA 2OZLB 2CNOA 5ELMA 4PN3A 1MORA 5KBYA 4RVHA 4MWGA 4EGQA 5E6UA 4DUGA 8ADHA 5ECWA 3VV3A 3O3OB 2W6IA 1LDGA 4LAFA 1MG5A 1ZUHA 4AMYA 1M2FA 3P9QA 1U7XA 3P20A 3PLNA 5K5EA 3L1JA 4JGGA 3HXQA 3A4YA 1UXOA 4FMBB 4OHBA 4U5QA 3BQ9A 4HWRA 4G1VA 4RK1A 5SZKB 4ND1A 1D2CA 3H5OA 4LBYA 2QN9A 5A7GA 1FFYA 3F97A 1G5RA 5LQAA 1KAEA 2IYWA 1SHTX 3IUYA 1YHNA 3UMJA 1XRNA 3H8SA 3KUKA 4H0NA 3NB0A 4BX8A 3E5HA 3IKVA 2BCGY 3PDHA 4JBXA 4OOEA 1I6MA 2Z4SA 1S7CA 3GELA 5DWVA 2VQSA 2W43A 3MG9A 4IIJF 4JQCA 1JVNA 2IX9A 4X20A 5DBIA 2AW5A 2XT6A 3S99A 4BNTA 2WJAA 1V95A 2PPLA 3SP1A 4PPFA 3F7NA 3FA2A 5CB4A 5JSZA 4NMMA 1P2BA 2YVUA 3VO8A 4LF7B 1RRVA 4ZCRA 5LXTB 4G56A 1K7EB 2HPZA 3EAFA 4KI0A 5BOVA 3H3JA 3TIGA 5LYJF 5BSFA 4TV8F 4HNHA 4TN5A 2DZDA 1W9HA 3QTLA 4XRGA 3L46A 4D5EA 2G1PA 2QBYA 3VU0A 1P0PA 4JBWA 1ZD2P 4ZOLA 4ZVUA 1DNPA 4WACA 4NZPA 4RENA 1T1IA 1WMSA 5E9WA 4ZVKA 1GL7A 1Q6ZA 2ZJYA 4F38A 4JK3A 4A3SA 5C8YF 4EPTA 4IDNA 2QRZA 2YVLA 3AUSA 4ZQGA 1QFMA 2GWHA 5JD6A 1X7GA 1P1IA 3PRKE 1BQ4A 3AC0A 3L79A 1SBCA 2CYCA 1G1MA 2QLTA 3GUCA 4G2NA 5J47A 3WB0A 1FRFS 3KEGA 4OAPA 4UBLA 1C3JA 3PT5A 3DDCA 2B92A 4AY6A 3DW3X 2CL6X 1E2MA 2I1WA 1ZJ4A 1QO0A 1MAUA 1YDHA 5ES3A 2ZBQA 3ZIDA 4FILA 2JI6A 1P75A 1XVAA 1RTKA 4MWEA 3WMFA 4LBZA 3TZCA 4HZUA 5FEUA 3KKKA 1JR3A 3A9CA 3P2MA 4QQNA 5DX0A 3KQMA 3JQCA 3UWSA 1QOQB 4UOZA 5KHLB 3WKAA 1FFSA 1P74A 1SWVA 2G71A 5TGDA 4EFNA 4RJTA 2OEPA 2OORC 2QVZX 1VHQA 3T34A 3JSXA 1L0BA 3TPCA 5DZSA 2AZTA 1Z5PA 4X97A 4U2DA 3G5TA 1KQGA 1KVTA 2WYIA 4LC0A 3L8DA 3NHJA 4QYIA 5AKKA 3S4YA 4B6SA 2FSPA 1NASA 1XMVA 1FLVA 2QSZA 2VSNA 4FDAA 5LQDA 3OZGA 4DFDA 4L8GA 4LMPA 1Z0AA 3CVJA 1BS1A 3CT4A 4JV5B 1RFGE 1CLUA 2ZQYA 4Q1BA 3SZGA 2DBQA