3SZMA

Structure of human microcephalin (mcph1) tandem brct domains in complex with a gamma-h2ax phosphopeptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
PTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPVMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle/peptide
molecule keywords Microcephalin
publication title Dual recognition of phosphoserine and phosphotyrosine in histone variant H2A.X by DNA damage response protein MCPH1.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 189
sequence length 189
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3szmA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3szmA02
2COKA 3PA6A 3L41A 3PXCX 3PXBA 1JNXX 3K0HA 3PC8C 4N40A 1T2VA 3FA2A 2EBUA 2COEA 4BMCA 3PXEA 2R1ZA 5ECGC 1N5OX 3U3ZA 1L7BA 4U4AA 2D8MA 2JW5A 3HUFA 3EF0A 2K7FA 2VXCA 1IN1A 3SHTA 4JLUA 1OQAA 3UENA 3JVEA 2DUNA 3T7JA 3AL2A 2NTEA 2L42A 3T7KA 2EBWA 3T1NA 1WF6A 3K05A 2XNKA 3SQDA 3I0NA 3I0MA 1GZHB 1Y98A 3SHVA 3K16A 4BMDA 1CDZA 3HUEA 2ADOA 2INGX 3K15A 2EP8A 4Y18A 3PC7A 3UEOA 3SZMA 2WT8A 3EF1A 4OFBA 1Z56C 3PD7A 2XNHA 4BU1A 3PXAA 4BU0A 4XPZA 3L46A 3COJA 1T15A 4IGKA 3KTFA 3QVGA 1T29A 2AZMA 1L0BA 2HTFA 3OLCX 3PC8A 4IFIA 1IMOA 2K6GA 1KZYC 3PXDA 2ETXA 3AL3A 2M2IA 2LE0A 3QVGB 2E2WA 3T7IA 3II6X 1T2UA 2VXBA 3PC6A 2COUA 4Y2GA 4XQ0A 4ID3A 3K0KA 3L40A
chains in the Genus database with same CATH superfamily
4RL4A 4HI0E 1W6RA 1YSCA 2FFJA 3P0RA 2HT6A 2Q6OA 2R8BA 4M7PA 2ISSD 4FGLA 3UT0A 5L7TA 2D5CA 2A92A 1NFRA 3ZU4A 4BZWA 4FCTA 2ES4A 2D1FA 1KBQA 4FJ1A 4U5QA 1UPAA 2R8YA 5DHFA 1PHPA 3IKTA 5AKZA 1TADA 4PFSA 3CUUA 3TD9A 1YI8A 1QORA 4LRXA 4XGIA 3LYHA 3WZLA 5KTOA 4BEVA 2EBUA 2UYGA 5EXEA 4DBZA 2J0VA 4PLPA 3B6ZA 4UAJA 2X4IA 1GPJA 1Z3IX 4QG3A 4N3CA 2OXEA 3FSRA 4C0KA 4RWEA 2YDXA 4TMWA 2D0DA 1KI7A 2PLAA 1WUJS 1JG2A 2R8ZA 1MO6A 2FMIA 2GF0A 2G5PA 2HSEA 2J5BA 3L0SA 3PNKA 4Q47A 4AZ0A 4DCCA 4D96A 4ER3A 5L6LB 2X15A 2YY6A 4E7OA 5AVRA 2Z6QA 2PR2A 1Y1QA 3TK1A 1I0ZA 3L7CA 3NASA 3RU7A 1SHJA 2DUWA 2KMLA 4P2GA 1RAAA 5IZCA 4MW7A 3M4XA 1GQQA 4R01A 2C9DA 3PGXA 3RU3A 1G8JA 3DVSX 4NKRA 1QZUA 4H1UA 2DKOA 2YRXA 1U1GA 3FCCA 4MUIA 4FP9A 1E61A 3W8EA 2FWIA 4ZOLB 1P1HA 4PNHA 2OE2A 3MRTA 1Z82A 5HF8A 2QX6A 3RUPA 5AVVA 4MCAA 2XYVA 2B6NA 2OFOA 1H4TA 4KI0A 1RACA 1SUEA 2HMUA 5DGTA 3T4EA 3VM6A 3W6OA 1N6IA 1QS0B 2F9FA 4S0ZA 4X6XA 3U7GA 3LXUX 3I52A 2DB3A 2XD9A 2ZK7A 3ZHCA 1Y89A 2WAAA 2OSBA 2YHSA 3IKMB 3CFYA 4MR7A 2IU6A 2XQGA 2I2FA 2DFVA 3KOZA 1HZZC 4KIWA 5JZVA 3IVMA 1O87A 4J1TC 5HFAA 3SX4A 3T5AA 3S2GA 1ZL2A 3H1GA 3GQBA 4JOSA 3D3WB 4JK3A 4S3MA 4BFXA 2EGUA 2X0FA 4ZGGA 1QUEA 1R0CA 4ND1A 4EOGA 5JCXA 2ZYSA 1TO2E 2FN9A 2Z1NA 3TIFA 2JRCA 2ZANA 2VTDA 4KR9A 1XU4A 4K9NA 4G5XA 1D5CA 4U5XA 4E21A 3IMEA 5CLLA 3MJCA 2M6LA 1SXJE 3UAXA 4CMIB 2SKEA 1FYVA 4U02A 1B6SA 1MN6A 1EGQA 2DF8A 4MYDA 4UE6A 3V9AA 2OCBA 2MT9A 4P4GA 4A91A 4EEZA 3FFWA 2ZTVA 2FQQA 4DDMA 2HGSA 4CKZA 2V6JA 1DGQA 1YCGA 4KDCA 5CM8B 3PSHA 4KQFA 2DLNA 4M89A 4Z7QB 2ZOSA 4FYVA 2HWWA 1UXJA 3QOYA 4MVJD 2PRJA 5B2EA 3QMWA 3A2MA 4ZP1A 3PR1A 1V8FA 2F00A 1NF8A 1C0IA 2OK7A 5TQVA 3V1UA 3PPXA 2GVZC 1NI4A 3F8TA 4I36A 4YP9A 1P5HA 2G40A 3FOAA 3JQ7B 4JR2A 1X7WA 3Q3GE 4HQNA 2J41A 3A14A 1O96A 1YZGA 2CCGA 3ACDA 5E6SA 3TB4A 2W2TA 5BR1A 2AN3A 2OZVA 1RXWA 4BO8A 1GTSA 2QD2A 1KI6B 4AT1A 3VZBA 4HQFA 2WJ3A 1YS2X 3U3KA 3ZU6A 3IBTA 1XZFA 2Z04A 3PG5A 3UMMA 1RMTA 4KQMA 3NOVA 1GT91 2ATIA 4J90A 1RAGA 1PEKE 2EG9A 2G70A 2XLBA 2ZS8A 1YZFA 4R9VA 4BX3A 4DSTA 1QVZA 5CTJA 1R4AA 4EB3A 2PLNA 3WMEA 3K9HA 4KYUA 1XEWY 5IVHA 4YRCA 5BSHA 2XIQA 4YROA 1DKRA 4BQPA 1W0CA 2ZS9A 1EFHA 5FJJA 1P2GA 2Z4RA 1DWQA 1X7XB 2Q5QA 5CW1A 3VYWA 4M1EA 2HSDA 5JTUA 3KJZA 3P2IA 5EHNA 3WMXA 1ZSNA 4PIMA 2FPUA 3MCUA 4JJ4A 1W1UA 1TCUA 4UDOA 1U3UA 4MWOA 1DTEA 2WF8A 1O6BA 4YJGB 1LNZA 4FLMA 3F4BA 2WG0A 1GPNA 2NZVG 1V11B 4G1MB 4LK3A 3BB4A 3NPAA 1O4VA 4HNQA 4KB5A 3REFA 3H2IA 1XP5A 1K27A 4WCFC 1HE4A 1II8A 3FOWA 1QH8A 4CW7A 2FB9A 5CDSA 4NBTA 1VGQA 2IIBA 3REQA 1BS9A 4MS4A 5C3UA 5TRTA 1KC1A 4B2YA 4Q3OA 5IAJA 5I9BA 1Y9ZA 3CW9A 1VGRA 4AJEA 5I51A 3BXEA 4JP5A 4W5QA 1FFXA 5E3JA 3K4QA 1U7UA 2B30A 2I7CA 2DY0A 5D00A 2QI9F 3OF3A 5L45A 1XLTA 3DFUA 3IJPA 4L16A 1Z63A 3F1KA 4AAYA 5T8KC 3G9QA 2P5SA 1JVSA 1X2BA 3Q6NA 1U3GA 3D4NA 2EP8A 4Y2HA 3ROZA 4RPJA 1EVKA 4W8OA 4MVJM 5A03A 2XOKA 4PCVA 1KTIA 2VUHB 3HMKA 2PZLA 3OQIA 4NSNA 4PZZA 1JR3D 1GCUA 4Q01A 4F21A 2PSJA 1Z56C 3TLZA 3HBLA 4N5MA 3VPHA 1Y3DE 1Y1SA 3NRCA 4N7RA 3R5SA 1V5WA 4GO1A 5AR1A 3MTAA 4WAUA 4UDYX 2VCEA 4PG4A 1UCFA 4U2CA 1O95D 5IDQA 4UMVA 1NAIA 3KTFA 4B3JA 1XAJA 3AEYA 2XSZA 1E2PA 1XTVA 3U62A 3V9PA 3PIDA 1I4WA 3A2KA 1CUIA 1RYFA 3RVOA 1EIZA 4H18A 1N7HA 3FUWA 4BX8A 5JSZB 4QL3A 4XDGA 4YJ3B 1A8IA 4WN3A 1A9SA 4ZTUB 1DC8A 2EEZA 5AI9A 1HQCA 1QRDA 1TA4A 1WIWA 4OQFA 3BFKA 4RO0A 3TBHA 3THSA 1JIXA 3SN6A 3ETLA 5AJWA 4X91A 3K9GA 4XTRA 4CQMA 1WMAA 4F46A 2NZ8A 4V0RA 4Q34A 1AZTA 1XTTA 2WMOB 4YMWA 5FL7A 5ICGA 1HYQA 1LLCA 1IVYA 3QZUA 4NCHA 3RR2A 1IOVA 2A30A 3FSGD 3HG7A 1XVIA 2RARA 3KZVA 1TMKA 4LBVA 4Z7JA 3ZZTA 2NLOA 2IX9A 2WNHA 3MD9A 1U28C 1OGIA 3KX2A 4Y30A 2CNKA 1XKLA 2WWXA 3BTSA 1ZUD1 4GLOA 4WOKA 3UHAA 4TT8A 2C2BA 2OZEA 4ZOLA 3WGVA 3T5TA 1P45A 1Z4QA 4MXDA 1FVHA 3Q7QA 4R3WA 2FW7A 3KFXA 5LXTF 2DWPA 2JJ8A 1VRWA 3U3MA 3H2ZA 2C95A 4H7HA 4ZJUA 4U7DA 1GN8A 1II0A 3DDOA 4DJJA 1YUNA 2YICA 1BU5A 3AEXA 1TVKA 4C7OB 3TXAA 2I2CA 2EJBA 2WHPA 3OECA 3ROKA 5E0OA 1WHTA 2R7KA 1AXRA 1Q1ZA 2PL1A 2ZT7A 4JJ6A 4WLUA 3ROQA 4RENA 2C57A 1IVNA 4JLBA 4WN9B 2PL5A 3V1NA 1W36C 4C9BA 2JIDA 1BJRE 2ZJ4A 3VO8A 3PQ7A 5KX5F 1AK2A 2D5AA 3FPGA 4RPLA 1XCLA 2R8RA 4UARA 5C53B 4OBXA 1M6VA 3S3TA 1ZM7A 2DM6A 1CS0A 1WXXA 1NXXA 4NZ9A 1OKKD 1ULUA 1W76A 3TUIC 1GUBA 3C3PA 3VR2A 1SUPA 4HRAA 1A5SB 3FGOA 6NULA 2YY5A 2A3RA 1PR6A 1IG0A 2ZYUX 3KT8A 3BIWA 1VBNA 4OYYA 2G76A 2QVXX 4WLNA 4CQLB 1THMA 3TZCA 4BP3A 2FJ0A 5L6MB 3PFNA 5TQ0A 2YC4C 4U63A 1GZ7A 1A8QA 3WGTA 4Q9KA 2XKBA 4FOLA 4FYPA 1LX6A 1L7XA 4WMLA 1N32B 4LDNA 4PYKA 1RAIA 5CNIA 5DV9A 4QIHA 1T3GA 3U26A 1O89A 4R5MA 3KVRA 3CO0S 1NJ8A 4KVFA 4AJ2A 1IY2A 1MVLA 1ENOA 4FR2A 4RVNA 3MTDA 3SIWA 3VR3D 1RXSA 1IUPA 1NA5A 3DE6X 5H3HA 3ZE8A 1WDWB 1JHUA 2ALJA 2D7DA 3BWBA 1RKVA 4LZPA 4EYQA 2DRIA 3U7QA 2OV3A 1YCHA 3MUNA 3ANXA 4RF3A 3NYIA 1D1TA 1Z34A 2FN7A 4HYEA 2ZEJA 3UW3A 1PBNA 1A9ZA 2AEJA 1VMAA 1U1EA 1FP1D 1ADYA 2ATCA 2DBVO 1QZ3A 3NBUA 2IYYA 3CUWA 4LNUB 4KDEA 1FRFS 4YMHA 2ZU6A 2FPXA 4RVHA 4ZAWA 2QX9A 2C20A 4DDKA 2AE2A 1ZD4A 4B8WA 5EKXA 3NZEA 1P80A 1B0PA 5JUWA 1LPNA 4QHTA 1LV7A 2IUEA 4FYYA 1ODTC 3PXDA 4DLKA 4YX9A 1OYWA 4UU0A 4HATA 2VQ3A 1X7XA 3ETGA 4UZFA 5ETJA 4QLAA 3WC4A 4C2BA 2XAUA 4GC5A 4KMOA 2C88A 3DEKA 4D56A 3D6NB 1GRCA 1W5EA 4CEJA 1OFIA 4FIZA 4PSVA 3GAZA 1M7BA 2WU0A 5SY6A 3KUXA 4FGKA 5LOVF 3PRKE 4AWAA 3KZNA 1T0BA 1U3DA 5IT0A 3QF4B 1SHUX 2V96A 4X84A 2PK3A 4F0JA 5A1TA 3P4YA 2GZMA 4JQYA 4MPPA 3DVAB 3K8OE 3SE0A 1V9LA 3UMYA 4ASUD 1KO4A 2IZOA 4K8RB 4LXIA 2XB4A 3AKEA 3KKLA 2R86A 4RD0A 3UHFA 1ISHA 1ECJA 2DHCA 3NPMA 3IODA 2FMUA 4AYXA 1YIAA 3G85A 1Z25A 2Y27A 2WVHA 4J2HA 3E7PA 3TFQA 4D82A 5FPPA 3IALA 3NTOA 4ZVQA 3EGWA 4MR9B 5D3ZA 5HR5A 3NGLA 4IOKA 3EUFA 3FZYA 4IQ0A 1O2DA 2Z2KA 4HT3B 3TOSA 1V9CA 4Q4JB 4TN5A 2VO1A 3QU2A 1E60A 2QG6A 3PHIA 2XUQA 4TTSA 3ZDDA 4GXRA 1FDRA 5A2QA 1Q0PA 2LNDA 1Z6GA 3O92A 1E0JA 1C1YA 2REQB 5AVUA 4A8JB 3EOBI 5AK6A 2XXAA 3HGTA 1YB4A 2VPZA 3IMCA 3VXKA 1C9MA 4BPRA 3OLYA 4UHBA 5TMEA 4DG8A 3GJQA 3KWFA 4Q7LA 5GZ1A 4AJPA 3OTGA 5HGJA 3M5PA 2WU1A 3AU8A 1Y81A 3IQWA 2PUAA 4WGGA 4UE3S 1KQFA 1TK9A 3ZXIA 1XPUA 2MSCB 1N3IA 1J49A 3ISVA 4QU8A 4AF6A 2VSQA 1M8GA 2OCAA 4L3WA 2JI8A 5LLSA 5HQ3A 5JU6A 4NDNE 4LZNA 3ZQ6A 3CVOA 1G55A 2FTKE 5JSZA 3T8YA 1ZN8A 4E5MA 3WP1B 3CUSA 3I6YA 2X1MA 1C8KA 4F2WA 2ZUDA 3CUKA 2YRFA 3GPLA 2G6BA 3NGMA 3I92A 3PWZA 4NJEB 1NMXA 1UQTA 4I8IA 4JU8A 1Z75A 4OFZA 3T9AA 2PZFA 2UUAB 1D0SA 1QP8A 2QP9X 4DMGA 5L7WA 5C34B 1EUDB 1M2JA 4CDNA 2PKCA 2DKFA 2VTEA 1GV1A 1JILA 1VCOA 1EDBA 3B1KA 1E3LA 1ODSA 3LK6A 1DAEA 2G63A 2PR7A 1P5RA 3T9CA 1AOXA 1OSNA 2ZRAA 1CLUA 2PYIA 3F73A 2AOTB 3D6UA 2NVUB 1XCGB 2OP0A 3EGXB 3I4CA 3NC1C 1KNXA 1YOVB 2EEPA 3D8NA 2IYLD 3CKLA 3BF7A 4MGEA 4MP3A 3W2GA 2ERCA 1ZVJA 3IUPA 1SIWA 5A0FA 4A6PA 1YOBA 3RUIA 5HM6A 3F5FA 2Z6VA 3SICE 3LBAA 4O2BB 4P3KA 4DUZB 3WWDA 1Z29A 2OD7A 3R0JA 1F1JA 4L5JA 4NR0A 4L4SA 1AUPA 1P8JA 1NVKA 5JRZA 3LUJA 3EGEA 2C4TA 1JHOA 2ORIA 1ID8A 1LDEA 4MP6A 4HDQB 4FI3F 1V8DA 1BMFD 4OY3A 1SCUB 3PVZA 3DAGA 5ILQA 3UMRA 1SK8A 2H4WA 1E7MA 1NDHA 1R0XA 1YJCA 2RB5A 1EVIA 3O03A 5CBPB 2QVZX 3D7SA 3AOGA 5DYWA 3RSGA 1GEGA 4WN9A 1W0JD 5DNWA 3P9XA 421PA 1K92A 1L4HA 3F47A 1HT3A 2NTYC 3RS5A 1OYOA 1UKZA 1H6AA 2YQ4A 1DXOA 2O2GA 1VBMA 3D5TA 4EPVA 2I8AA 1M66A 1HSZA 4HGYA 3IR6A 1YHYA 2GVDC 4PBTA 4QGFA 4XSHA 1Q2XA 1CVIA 4LSGA 2GT1A 3FJOA 5F33A 2KS6A 4EB6A 4K6MA 2IPAB 2XB6A 2AI1A 4I1RA 4MWEA 4E31A 3OZRA 5AOCA 3ENNA 1SA0A 1C1XA 2BKLA 4B3CA 3MB8A 4NARA 4BN5A 1K3TA 4KFSA 5JFOA 5DX0A 2UZ0A 3H9GA 1SZJG 3I09A 3KUKA 4GM1A 3LPLA 3LPDA 5FT9A 1W0KD 2ONZA 4DF3A 1AHIA 1VE3A 3VBEA 5B12A 5IXSA 1JJAA 3J81A 4U6SA 3B20A 4OU4A 1QTIA 3W3AD 4M6WB 1QR2A 2VAWA 4W5OA 5FA6A 1ZUHA 4EHBA 3PEWA 4GX1A 1CW2B 4HVTA 2ZAOA 2B4YA 2NU9A 5DCWA 5CA1F 1V25A 2C3YA 4B47A 2UUCB 1QF7A 2CLHB 3D6MA 4HAWA 4P9NA 4YLEA 3ZS9A 2ZJYA 4GFDA 1XVVA 5GOTA 3WLMA 1H9AA 4DSOA 1S0UA 1DIGA 5I3ZA 3I4LA 3GIWA 1N8KA 1XN4A 5JAIA 1OBFO 1TM7E 3P9KA 1OXSC 1TF7A 4YJ3F 4Z49A 4KN8A 1OXBB 3Q5EA 2O7VA 3MBIA 4L8YA 5FBQB 1NQTA 4NMMA 2RHDA 1UFKA 3K4HA 3HPQA 3NH6A 3WQBA 1CNFA 3GFVA 3R5TA 5EE0A 1SVWA 5DE3A 3Q4GA 1G8SA 4YRSA 3T99A 4OHYA 1Z2CA 4FNAA 3TZ6A 1U1CA 3TTTA 4ERNA 5HHTA 1LVGA 2HF2A 3VX3A 1S4MA 2V55B 3H1FA 5ESDA 4JHXA 2CYBA 3RCBA 2EL9A 3TZEA 3UJ3X 4BWGA 3MMZA 5FPSA 3PQ5A 4LOHA 2QZ9A 2IHYA 2IRWA 4L3OA 2RI1A 5I7WA 3I5YA 1J8MF 3GYGA 4IJQA 2IGTA 2P35A 2C4KA 2JFUA 2VK8A 4I4TB 3GZNB 3OM1A 4PPNA 3WFJA 3JSAA 1U8AA 3E9QA 5LUAA 3WLEA 2P9QA 1AF7A 4QKQA 3P9RA 5CCBA 3G2MA 3LSYA 4XUCA 1A9TA 3ICVA 1KZ1A 4NNOA 5GZ3A 1RPTA 5BVHB 2YUIA 1FY2A 2WM3A 3EOAI 4M7OA 4F56A 1JNYA 1CEXA 1A2BA 2A1UB 2JLCA 3KSUA 4Z9BA 1GPUA 5IC4A 5HNKA 4INZA 1PZGA 2N9UA 4M8KA 1QJ4A 2FWAA 1G4AE 2RJOA 3QF4A 4GKAA 5BYAA 3CWZA 1VLHA 1M5UA 2PZKA 3DZBA 5KVQA 3ZWKA 1LLUA 5LWHA 4CR8A 2GN0A 4LOJA 2CT8A 2EFHB 1UBFA 4GYYA 5KSZA 5KVCA 3C3JA 3G59A 3H8SA 3LCUA 1X13A 4KMSA 4PXAA 1DEKA 1QOZA 1NQWA 2KBFA 1U0LA 3A9WA 3ODGA 1DRJA 3QEMB 4U2BA 5TMBA 1RD4A 2LTAA 1NQXA 3HVJA 1ODCA 2BI8A 2QUBA 4FYWA 3RYCB 2FX3A 3NONA 1FMLA 3FZEA 4FX5A 4TRMA 1GLNA 5EXDA 4B33A 3DL7A 5JEDA 2C78A 1LK5A 4DCMA 2G7ZA 3KUCA 3DOEA 4XRRA 5A9TA 2HRDA 4JJEA 3DZFA 1D07A 4K6OA 1QDEA 4IEFB 2AK3A 2QS9A 3M49A 4OQZA 2REQA 2EW8A 3GI1A 4H7FA 4A8JA 1SPXA 4RK0A 2KE5A 3EVBA 4QDTA 5KU7A 3PHJA 4JA0A 3SJZA 1F8GA 3G5LA 5BMVF 1EK2A 4CZ2A 1KFKB 3QXSA 4O4IA 4K9SA 4BFZA 1NW4A 5BYKA 4DLUA 4N4AA 2Z6UA 1JSXA 1MB9A 1NMZA 1TCCA 1AIPA 1X39A 3LECA 3U17A 5EZYF 4TM7A 5IAOA 1V39A 3O4IA 2V97A 4NPAA 4RPGA 3RSLA 1TMGE 4BECA 1TAQA 1Y7TA 2JAUA 4LDRA 4AMVA 4UU8A 2IDMA 1XTJA 1FLVA 3HV0A 2YMMA 3GVPA 1E8DA 2BBOA 3U44B 4CI0B 3GLFE 1OIWA 1GL9B 2CFSA 3B9RA 4HH3C 3LKDA 3I5XA 2VAXA 5TSDA 1OXTA 2H31A 4IVNA 1GUZA 3GVCA 4YMGA 1RRPA 2C5BA 1NUUA 2HSJA 4FE3A 2GLXA 3ZH2A 2RD2A 2JEOA 1SCJA 5G53C 3ONWA 1CRWG 1TAGA 4P32A 4TSFA 5HJEA 1V5EA 3AXTA 1WXWA 1SO8A 3E4CA 3D31A 1BRMA 4AL4A 5CFZA 1JL3A 3ZIAA 2AOTA 3B1XA 2WUGA 2ECPA 4EUKA 3QLVC 5FBLB 4MQLA 2QNBA 3B89A 4HWRA 2B8EA 2JW5A 3EGXA 4UFNA 1YOVA 2FUEA 1M0WA 2QM0A 3GV0A 2GESA 2VJLA 3AUJB 3CTMA 1OVMA 1U0FA 5AM1A 1XCBA 1EZ1A 3I6QA 1W5BA 3OKFA 4RVCA 1NSYA 2GJKA 3S81A 1UQUA 4HWSA 3N8DA 2Z6AA 3WLOA 4I19A 1L5ZA 2XGSA 2DH6A 5K2MA 1UXGA 4EHHA 1PFUA 4P35A 5FB3A 1EJ0A 3S8EA 1UMCA 4CIDA 1FDSA 5FNVF 5K3DA 1SCUA 3T1NA 4F72A 1XJWA 3FPFA 2IHVA 2MMCA 1JEQB 1OU4A 3B60A 3BHNA 2VDKB 3MINB 5ED0A 4B3MB 5A3QA 1T5OA 3DMHA 4QGBA 2GBIA 2MYUA 2CXXA 2FMKA 5F7OA 2HMSA 4FINA 5COBA 3MT7A 1VJTA 3SBDA 1HNZB 5BSTA 1B93A 1EX7A 1JE0A 2HUPA 3L82B 3PQ3A 3K16A 3CT4A 2QROA 1HDRA 2OQIA 3OSUA 2MR5A 4UTOA 3D8BA 4EO9A 2E0IA 4L4XA 2ERXA 2RE8A 5F7ZA 3VC2A 5BNFA 3SC3A 5LP1A 2P5UA 4OHOA 2ADFA 5G3YA 5KEIA 3L1KA 4EPYA 2Z0MA 4C6TB 1MAHA 3CEAA 4E1AA 2QLMA 1RI4A 1VKNA 3BH0A 5K3FA 3B1WA 3SPXA 2C3PA 4ZT4A 4DCVA 5CG2A 5HUQA 5I9IA 1NFFA 3QWAA 2IDZA 3IVGA 1TKCA 4RSRA 2FPWA 4BJHB 2B98A 2QN2A 2I80A 1XMIA 4IIXA 3T3MB 3QELB 4H7JA 4PG5A 2CDAA 1J8FA 3A28A 3OY2A 1DRKA 1Y6ZA 2KW5A 1BX0A 3QLVA 4CMAA 1Z6PA 3NAGA 1PFGA 1PJAA 3RTAA 5FEUA 3O75A 3EDYA 1SKBA 2GPSA 4W1SA 2DWCA 4BGUA 2FCRA 3MK31 2F67A 5HS6A 2GZRA 5DPMA 1QP7A 3TRJA 4NBRA 4JH0A 3E3MA 1Z4IA 3N8IA 3EXIB 4IOLA 4YAIA 1U5BB 2J3IA 5J59A 5EINA 1YZHA 3LOUA 3JQRA 3K9CA 4ZODA 2AZTA 4XWOA 4Z7OB 4RLSA 5G0WA 1ENZA 2F4VB 1O6GA 1UAAA 4HLQB 1KHHA 1DT5A 2J0EA 2FW6A 3PE6A 1ZISA 5AKEA 5JLJA 1KEEB 3RYTC 4EA7A 3S1LA 5CEJA 1ZK0A 5ENDA 3IB3A 4BNHA 2C97A 2CMKA 3ABZA 2R79A 1HLGA 3KJEA 4OF4A 1QONA 1M1YA 3L2OB 4RDIA 4B3IA 3GLGB 2WTMA 4WCFB 4I4TA 4F12A 4ZN6A 2JAQA 4FQ7A 1ZJ5A 3FHJA 5G4LA 1JI3A 1IB6A 4BAUA 1AJEA 3R3UA 4K3VA 3O3MB 1P4HA 1ZNXA 3D2AA 4MWDA 4PLWA 4DS3A 4FGSA 4W5NA 4TT3A 1H6DA 1QHGA 2WVGA 1RQ2A 3CBQA 3KYJB 5IVDA 5IZ4A 1U2ZA 3N0VA 1YL6A 4MAMA 2A1UA 3N3BC 5SICE 3FN4A 1M34A 4UD6A 1K88A 1OGYA 4JJIA 4P3YA 3GFPA 5FWYB 4CTOA 1O9HA 2C58A 2P9JA 5C8ZA 1GKIA 2IH5A 3AR3A 4ZO7A 1AB6A 3HHEA 4F1JA 4MV3A 4I4CA 3PDCA 4XQEA 3UGJA 4X5OA 3TQHA 2D4HA 4N7JA 1ZX1A 2J7PA 1NPTO 3CQ9A 4K6HA 2HNAA 3B2NA 5FBZA 5HKLA 4NC9A 3WOVA 3OFSA 3QEMA 3ZYCA 1APBA 3B53X 5BNIA 1KNQA 2N1MA 4CTMA 3ESXA 4AJIA 5CEEA 2POCA 4ND2A 1RM4A 2FPKA 4N76A 3BJEA 3R6WA 3PENA 5K8TA 2WYIA 1D8TA 1XI2A 2EZ8A 2ZFUA 1CXZA 1AKWA 1SD2A 3W3AH 5FBVB 4GP7A 4JQCA 4B34A 1RABA 1Y3HA 3UUEA 4XLLA 4ZVOA 3X3HA 4W8GA 3HR4A 1QKIA 1VC2A 2E4AA 2WFLB 5HRCA 3I62A 2WQ7A 5ENZA 5I9TA 5IYZF 2Z8YA 2QNRA 1O3YA 2ST1A 4C6SA 1YIDA 4E5YA 4P34A 3LOPA 3ZGNA 3UBMA 1YACA 3GN2A 3QTTA 2V45A 4I2NA 4CFYA 4RFVA 1HA3A 4JI5B 4AJ9A 3FNHA 3TJMA 5IJ0A 1CUVA 5C1IA 5K4GA 1B8UA 1J00A 1V6AA 4WZAA 4FCVA 5SYMA 4EX6A 3AUFA 1VFPA 1Z07A 2DJIA 1EG7A 4ND8A 2FSSA 5FFFA 4C29A 3SEZA 4Y6GB 2X0EA 2QX7A 3P2OA 4HCJA 4LKRA 4UAGA 4ESEA 4G1BA 3U4GA 2KQUA 3LWBA 4LDPA 3E1KA 3RTGA 2AI3A 1L4UA 3ORQA 5AP9A 1IY8A 4BFLA 1PQWA 4XJSA 5AJZA 3U1VA 5DRTA 4DANA 2H7YA 3FFXA 2OAQ1 3G0OA 1FNNA 4LHWA 2ZYWX 3LFTA 1T5IA 4TXHA 4ANFA 2ZKIA 2XKKA 1JECA 3L4EA 1BX1A 2I7DA 3F2IA 4LK2A 3RVLA 1UKAA 2H4JA 1L5WA 2J67A 2IYUA 3LT5A 1I51A 1RM3A 2H3HA 1NKTA 2JGFA 2CXPA 1NUAA 2O05A 2O2DA 4WNAA 3WLKX 2JFVA 3IBCA 3OX3A 3Q2OA 1BWSA 1UP7A 3DMRA 4R1TA 3HBFA 2RBGA 3FDZB 3LGXA 1M8KA 2E82A 2Q3BA 3J7TA 5E3HA 4A6EA 4RJTA 5CB0A 4EATA 5DM70 4MKRA 3DZ8A 2ZAGA 4DWWA 4JWKA 5TS2A 1JDJA 4ENVA 4J1TA 3FGZA 3TDNA 2P3OA 1E77A 1F8YA 1TC2A 4OV6B 3ZXYA 2CHFA 1G1MA 4LEIA 4B0PA 3LF1A 2QZZA 2FA9A 3VR6D 3ORHA 3MINA 3QEJA 3TQFA 4X1KB 4QNMA 4YMVA 1P4RA 4B48A 1RM0A 1CY4A 4AYWA 1NNSA 2J59A 2P30A 4RM3A 1QE3A 2CJYA 2VJBA 2HJSA 1EESA 2EKLA 5AKXA 2GOYA 3ZIUA 4XGRA 4B46A 2IXDA 4W7IA 1PR1A 3NVKI 1QQTA 2QVCA 2WIFA 4IIYA 4R1SA 4YCDA 2GPYA 2OQRA 3AVQA 2HRCA 3I5UA 1U0RA 5TPWB 4WESB 3I2YX 3RYFB 2OV4A 1AX9A 1ECPA 5LL6P 4JVNA 3SSOA 1HI9A 1C0EA 3ELDA 1VPWA 1QRTA 4JBYA 3SHTA 2JFXA 2J32A 5LB2A 3FMGA 3H17A 2BF7A 4P31A 2J3MA 5KREA 4OQNA 3EEQA 2YCLA 1S2OA 4CIBA 2W6QA 3CBGA 1NOKA 4H7DA 4KWTA 3KPYA 1NNLA 1N2SA 4HQRA 4MITA 2JJ1A 3KTAA 4RULA 3H5OA 1KXZA 1RHQA 4YS6A 4LWPA 4RVSA 4EX7A 1XHFA 1MB3A 4A10A 4BQSA 1HDOA 4EI2A 2H06A 4PR3A 2IE8A 1QDUA 2AJDA 2WNSA 3FWZA 3LDHA 1GN9A 3MJ4A 4G81A 4RGVA 2IIVA 1IH8A 3EYAA 3SJ7A 4EM6A 3OCZA 1PZEA 4LOKA 1G21E 1ZVQA 3NEJA 1E92A 4S1OA 1EFTA 1EAMA 2OYCA 4DJ5X 1A9XA 1NBOA 5BSFA 1BCRB 1TRKA 2Q6IA 3BGSA 4TM8A 3UOWA 2CHGA 1R6TA 3EXIA 3H65A 1EQ2A 5JDCA 4BGDA 1YDFA 2LZ0A 2WG2A 3CR3C 1PS8A 4HN2A 2P79A 4L8GA 1U4NA 1KDVA 4KVZA 1B14A 5HRUA 3KJXA 3CH7A 1OZ0A 4KQ2A 3EVNA 3NI2A 1G8GA 2BLLA 2OXRA 3DTVD 4JJZA 3TJRA 3T35A 3HSSA 3MWFA 3WWOA 4J9VA 3ICWA 2O2XA 4IJVA 1ZH2A 4PC3A 1I6MA 1K06A 4URYR 3ROTA 3ZE7A 4A23A 5A7FA 2I2BA 1ULHA 2D2FA 2HGZA 2IEBA 2NN3C 3IP5A 3CH4B 3K35A 3FYCA 2CNDA 4TZKA 4WCFA 1RZVA 1JP7A 1L0BA 3UIEA 1GTRA 3BFVA 4RJ2A 4ARZB 2YXLA 2PRZA 4YQYA 1ZICA 3WY9A 2VKTA 1QIGA 3E81A 2VT6A 4I6EA 1UPUA 4AZ3B 5A62A 2BM8A 2VJYA 4UBKA 3UXHA 2IK8A 2R85A 2WSMA 3ESQA 4P7BA 4UBNA 3RUAA 4BMNA 1LW6E 2ZM5A 1N78A 4K87A 5C4IA 3A1NA 3FNRA 4AKSA 1UK7A 3RC2A 3VC1A 3IQIX 4PRZA 1JG1A 4RHUA 3S2FA 1KVUA 3RW9A 1C5KA 1IDOA 2C00A 2CDNA 4HFRA 4ID3A 4HFMA 4LJKA 5CVDA 1JI0A 1PG5A 3PIRA 4W99A 5C5CA 3Q9SA 1U1DA 4HMQA 1R6VA 4QXMA 1Q2UA 1BA3A 3Q88A 4XLTA 1EKXA 3RROA 4DLAA 2WTUA 4RZQA 2G28A 3DCYA 3F96A 5NLLA 1ZJWA 4GD3Q 1A98A 2BKUA 3AR4A 1WAMA 3RC7A 3VSCA 3EWNA 2PMEA 5TVKA 5BMVB 1RS0A 1KRHA 4XVUA 4AWBA 3DB1A 2NTVA 1WZNA 1UM9A 4XQGA 5DWDA 3HR8A 5D7NA 3FA2A 3TLKA 2WD9A 3HKEB 5H0IA 1E8MA 2QD4A 2WFLA 4L27A 3CLSD 2C04A 1XZIA 3OU6A 4Z9YA 4BFTA 1MO4A 1GPKA 1IWOA 1NMYA 1NLYA 1PJZA 4KYTA 4IKPA 4HNAB 4G8JA 3SBOA 2QPOA 2BGKA 1HFWA 4ZK2A 2FKNA 2ZVDA 1G3RA 4V2IA 5H3LA 1G66A 4IWNA 5CX1B 4MVYA 1IEQA 3NTRA 4YRTA 1AB5A 4D9GA 2QL9A 2Y0EA 3IPCA 3PEUA 2F3SA 1L4GA 3LUCA 4CM9D 1U3FA 2DBRA 4QSMA 1JXOA 5I01A 3A32A 1ARZA 2K7ZA 1YH3A 3CT6A 5CLIA 5AJXA 4AQYB 1MTOA 4B80A 4P8RA 5DO9A 2NPIA 2ZJ7A 3Q98A 4CIWA 4PNZA 1ORDA 2WDZA 3AMVA 521PA 3LX8A 1J8DA 3HXQA 4GZ6A 1KC3A 4J0CA 3Q85A 2HQRA 3NETA 1GNTA 1EG2A 2DQZA 1TIKA 1UJBA 2WUFA 2XNSA 4HQOA 5ECWA 5EQFA 2F9LA 5EKDA 3E2IA 1JR6A 2D5BA 3IRVA 1UBJS 5GGYA 3OT5A 3LRTA 1LKZA 2UZIR 5JJBA 1RRGA 3ITNA 2Q50A 4C78A 1I2AA 4BP1A 5AKGA 4ZCPA 3O8CA 2D6FA 3N1UA 5AXAA 2WF6A 1USWA 1YZUA 2V3WA 4XPIB 2F1OA 5CDFA 1YFZA 2Z56A 1KFCB 2INGX 1EFRA 5HJ5A 3HO8A 1PZXA 2W6MA 2XTMA 1FFDA 3FDZA 3ED1A 1GKLA 4OKIA 4QUGA 1P74A 3GAMA 1IY9A 2XGOA 1I6LA 4B6JA 4CLEA 3TNYA 2XAAA 3GB9A 3MCTA 1B8NA 3I9JA 2ZYAA 4YT5A 5H7XA 3BUSA 3LCRA 3V1TC 5L3SA 5DLEA 2YKGA 3MWDB 5H4GA 1E79A 3GT7A 2IW1A 1QRSA 2O1EA 1JUDA 1EWYA 1Z6ZA 2H2WA 4KRYA 4EWLA 2O7NA 3BFJA 3PHLA 2SECE 4KQ1A 4ON9A 1MHPA 2LKDA 4G41A 4BRUA 5H8WA 3WXBA 3M89A 2J0UB 2RHCA 3WTCA 1A3CA 1ULZA 3MJRA 4XE5A 1VB3A 5JNUA 1OLOA 1HR0B 3B52X 1V1JA 4C5CA 3CVYA 1L7VC 2W98A 1OI7A 2Y1EA 1X7GA 1YGPA 3B5EA 2WFMA 1QO0D 3QH4A 4ILKA 5AHXA 2YV5A 1KZHA 3DEYX 2D13A 4D57A 4IZ6A 1ACMA 1QVWA 1ZH8A 2ZVJA 4JU9A 2PUWA 1P77A 1P75A 4MQMA 1B43A 3DBLA 3A8TA 2JLQA 3RYFA 2CLMB 2HV8A 2XYPA 2CFCA 1Z8DA 3KELA 2JKVA 3OJFA 4MB2A 1QHXA 4FYJA 2IP2A 4BC0A 3SHFA 3HUTA 3K71B 1VP9A 4RLFA 4IDQA 5IKPA 1DO0A 2G80A 4BKUA 2EKQA 3MWGA 3WSTA 4NOKA 2VHXA 5CYGA 2XTZA 4BLTA 4C5AA 3NYWA 1RJWA 2Y8EA 3UJNA 3KQUA 4KRFA 3INRA 3DT8A 1UJ4A 1XCPA 1YDEA 2FWJA 3TOXA 3T1VA 3WIBA 4BVGA 5KOJB 1WXQA 3Q3CA 5HX7A 1EVJA 1LBHA 3AG6A 2XZTA 4P4SA 4KXFB 3UFXA 3N70A 4R9RA 4V1CB 5TQ2B 1UKCA 1TB4A 1Z08A 2D5LA 4LDJA 2OILA 3NIFB 3GLIB 4CN8A 5BPFA 3VNRA 1K5HA 4DSZA 5A5DA 1VE9A 1F9AA 4O3MA 1Z0AA 3LIPA 1M6NA 3PTLA 5HK8A 1OH5A 2CMGA 3C7CB 4ND3A 3K92A 3TRIA 4P7JA 3VO2A 4V0MA 4L74A 1UDWA 1XX6A 1IU9A 3EDRA 1QFZA 1FA9A 2OAEA 3NAZA 2BGTA 4HSGA 1HK7A 4WBSA 3DZHA 3G0HA 2W93A 2C2XA 4R1UA 3UTCA 5IW8A 1L5RA 4YRZA 4BNNA 3DO6A 3C41J 5CXXA 1OXKB 3IHTA 4B82A 4PYQA 3SR3A 1KF0A 1UOOA 1RRCA 2NIPA 4RY0A 2R6CA 5ICMA 3D0RA 4I4NA 2WIJA 4H0FA 2ZCJA 4A5SA 3IIEA 5A4MS 1YULA 2IYOA 4NULA 2GAJA 2C5GA 2UYOA 1NLUA 4C0XA 1ODLA 2C9YA 1FUKA 1Z18A 3RFFA 2ATXA 4YRQA 2G4LA 4ARBA 1NFQA 4BNDA 3GP3A 2DG2A 4DJDC 2PV0A 2H54A 2HZ7A 4QBKA 3EGCA 3WGNA 1H5UA 2C96A 1X7DA 2Q3CA 1RQXA 2F3QA 3VDQA 3VR6H 1YBVA 3GPBA 3LPCA 4D9KA 1EVZA 4PAWA 1LRJA 3ODPA 2ZB7A 3UXEA 1HXHA 5CD1A 3S55A 3OSZA 1BXRB 2HDOA 2PY6A 3JQFA 3U61B 4F4DA 4F4HA 1A95A 3L7YA 5CVJA 5AXCA 4RZ2A 2ZBFA 3O94A 1ZIOA 1EGMB 2CDCA 1V3QE 2FK7A 2XQKA 3GPDG 3FJYA 5KU1A 1D4FA 2D74A 2YWFA 3U6KA 2OECA 2V7GA 3H11B 4HAUA 4S24A 1D6JA 2LVBA 1ZK2A 4MI9A 3ROFA 3CRNA 4QUEA 3HB7A 1VHWA 4DNOA 4BU1A 4CM3A 1EK5A 3OLQA 2AHRA 3NGXA 2FR1A 2YZ7A 4YUWA 3X1KA 4B6OA 1A7UA 2IWRA 2RGXA 1DHTA 3OVMA 3RG2A 1NP3A 4Z0HO 1EUCA 1G41A 3V32A 1WULS 1HDCA 3AV3A 4DMLA 8GPBA 1ZRSA 1OB5A 4ZI7B 2P2NA 4G0NA 4DUYB 1UADA 2BMEA 1G2OA 3PDJA 3SK0A 2UZ4A 3QJGA 2X9VA 2JANA 4CHTA 4J75A 4L28A 3QLUA 3TVTA 3R3VA 3KT0A 4GWLA 2DR2A 4UCXA 2FSPA 2HHAA 2MINB 4HH1A 5FWAA 3ZHUA 2YFQA 4CM5A 1Z0ZA 5BSWA 1GQSA 4TV8B 4UOEA 4HNRA 4CTKA 2DXIA 4HNAA 5FL7D 2JG3A 3HJFA 3HUDA 5L4SA 3CRMA 1F12A 4S2EA 4ECEA 1BN7A 1JKMA 4OFWA 4Q9NA 3HBNA 3VNQA 3ACCA 5C32A 4UAUA 5CX1A 5MN5A 2OXTA 2VQEB 3HKCB 3QU5A 2A9OA 5EZ5A 2HYIC 3EFOB 3KSZO 4FB5A 2JVIA 4L4ZA 4DXHA 4ZHSA 3ZCUA 3IHWA 1CK4A 5D6OA 4DY6A 2H4YA 5GVSA 4G5FA 4FKMA 5IMSA 1U81A 3WYCA 4L15A 4Y8VA 3N6RA 4HEA6 2CUKA 1AC5A 4PS1A 4X63A 2CHQA 3HFGA 4JLWA 1WOYA 3FCEA 1G0OA 5ITWA 1KMNA 2I2AA 4MIYA 3IOYA 3MTEA 1Z6QA 1YQUA 3C3DA 2I1WA 5FOQA 4AMBA 2ZJBA 1CTQA 4A0RA 3FTCA 1WV1A 5TEVA 4WFJA 4BV2A 4BVLA 3VPAA 3MB5A 1V8ZA 3EWAA 2VHZA 1ZWKA 4HTFA 2RK6A 2ZR8A 1V41E 1QH9A 4TTIA 5K0EA 2VFAA 3T3EA 1J22A 3D6TB 1JDUA 1WU8A 3BFXA 4JQSA 1DI0A 1JEYA 4AY4A 1FBTA 3IAHA 3RV3A 4ME6A 1J8QA 4G4SP 4E2FA 1XQ9A 2IHBA 5HYVA 2F17A 3QBTA 4Q4AA 4YQFA 1RAHA 4UTXA 2XA1A 3GAAA 4TXLA 1R0KA 3RSOA 3IC5A 3SEQA 5BRJA 3W5AA 1SXJC 1C1DB 3U0VA 3AY7A 3QXGA 1EHCA 1G38A 2NVWA 5H1YA 1N6KA 2J08A 2WOJA 5IN5A 1X19A 1OT5A 2FEAA 1B42A 2V65A 4KX5A 4LZWA 3RVSA 4DADA 3V2UA 3LDUA 3MWDA 3KQKA 1FTYA 1P29A 4ZEXA 3HY3A 4EW1A 5KKNB 5I9NA 2P4QA 3GWGA 3HU3A 5T4HA 3DZDA 5ALIA 2WJPA 2X8JB 9LDTA 3A3PA 2J0UA 2HREA 3IAEA 3VU9A 4LX0A 1TU3A 1Z74A 1HTBA 1TUGA 1CJUC 1CBUA 3EW9A 3LS2A 3WGYA 3GP8A 2A9PA 4EGFA 4GI2A 1Y33E 1Z7GA 3I1IA 4E11A 3V2HA 1ZCJA 1I1NA 1Y7IA 1Z4MA 1M73E 4OXXA 5CA0A 3LP6A 7GPBA 2IDKA 1PO7A 1E1QA 1VKRA 1N1DA 3BE6A 4WLEA 1GTG1 1DT3A 4BMYA 4XWAA 2VDOB 1H3EA 3DDSA 2IUSA 1K4MA 3QF7A 1BHQ1 4PAOA 5EQDA 2QIOA 5TGDA 5JCPA 1YZTA 1H2FA 1QF9A 4G97A 3CCFA 4NAUA 3WMWA 2WJGA 1EE9A 1KH2A 3GEDA 4RXTA 3SFVA 3ZWBA 5B64A 4QOHA 1CUAA 4UTZA 3K0EA 4CLRA 5DM4A 2GKOA 2AZXA 1CB0A 1VKJA 3O4HA 4N49A 2UVPB 2G1JA 1MTZA 2HPVA 2Q9CA 4G5YA 4U7FA 3VYSB 3F0TA 1T0IA 1CJVC 3O4GA 1QB8A 4YUZA 2QN6A 1HE8B 3ETDA 4EVSA 3W5IA 1OVGA 1ZI8A 3QVGA 3FCAA 3VPDA 1J1UA 2PXCA 1DKNA 1WDMA 4EZIA 2EJTA 3FYDA 2FWMX 3RS7A 1XU7A 3MPOA 3P9ZA 1U8YA 3RLFA 1Z5UA 1C41A 3O8QB 5DN9A 1A9OA 7REQA 4F4IA 1KI2A 3G5UA 4IG9A 3AB7A 2WAMA 3HDGA 3ZS8A 4BO9A 4E5VA 3EZFA 3FFAA 4S0XA 2AD1A 4W6QA 3BWDD 2YWCA 1CY1A 4I5IA 2IV2X 1L7DA 3LHIA 2DE0X 3LHFA 5COQA 1IBMB 3WL7A 4LECA 3IYLW 3OEHA 4KTTE 1JFVA 5ALGA 5HILA 2WP8J 1TF5A 1P6QA 2Q6LA 3R3JA 1OGJA 4FIDA 4TRRA 5LM3A 4AULA 1CUUA 4JVOA 4LI3X 2AWNA 5GONF 4A7PA 1G5PA 4RA9A 1WUHS 1U2DC 3HCAA 2X14A 3P8ZA 3GJ4A 4UHHA 2WJIA 4MLZA 3BS4A 3SLRA 3L7AA 3SDBA 1V7ZA 3UVEA 3ZLUA 2CB9A 3EARA 3RT9A 3ZWQA 2OORA 3JV7A 3IUMA 4A8HA 4CCYA 4ZHQB 1P7ZA 4JROA 1O97D 1QP4A 3AERB 3C1UA 4F7WA 4JD5A 4MH0R 5AK3A 2IYNA 5JWRA 1QU3A 4JBWA 4FJ0A 1P31A 1Y6QA 1TK3A 2AEFA 4MICA 4BRZA 3THWA 1Q57A 3BT7A 4J1QA 1V1MB 2QXTA 1ZMBA 4UC0A 2PGLA 2Y1WA 2C4UA 1H23A 1MKYA 5F2EA 2ILTA 3CRZA 3B1VA 1T6BY 2FR8C 3MT9A 5A04A 1PFYA 3T5GA 1GKUB 3ABSB 3WB1A 3CF6R 3H97A 4A0QA 4DCGA 5B3JC 3K0CC 5D01A 1BYUA 3BL8A 3DVLA 3H11A 4RD1A 1N5IA 5JSQA 4ENWA 2WYUA 4I1YA 4J7AA 3D7KA 1D0IA 5IKEA 3AEKB 2EQ5A 2UUPA 2Z43A 2XNJA 2JLZA 5JBNA 4FOTA 3GFBA 1DCTA 1GYRA 2J4DA 3ANLA 2HIAA 1L7MA 1XKXA 3GG2A 1VYTA 5AUNB 1ZHFA 1LUAA 1AK1A 2OESA 3JR7A 4WNCA 3AIIA 4GPD1 5B55A 3ND6A 3V2GA 1PF7E 3DCNA 5EP2A 2PKEA 5AXDA 1XPRA 1P2VA 3T9BA 1RHUA 3NBKA 2IYSA 4KIFA 2FYTA 4KG7A 5A6VA 3IH5A 2I4OA 3L0OA 2XCOA 4M1TA 1AT1A 1A50B 4MB0A 2XTJA 3FPJA 4YONB 3O0DA 3ZDYB 2P3LA 1IUNA 2C7OA 3L8YA 3ZDAA 3EZGA 3JX9A 1SBQA 1XA0A 2Y93A 1JIJA 4DTIA 1IXYA 3ROGA 1GQOA 1F9EA 2ADOA 1EDDA 5EUCA 3BK1A 1ZXLA 4JIGA 1UDAA 1EFLA 5LZ8A 5KKCA 3ZJ4A 4WOBA 4I81A 5F23A 3PFWO 3ZY6A 2Z5LA 3EHDA 1CERA 2IF2A 3Q8XB 5G0VA 3CJQA 4KMMA 3FHTA 1CVRA 1UEIA 3U4AA 3U3JA 1JBQA 2OPHA 1ZOIA 3FVVA 1YWGO 4INOA 4U3JA 3WKAA 3BE8A 3TM5A 4ETIA 1T8PA 1ZNQO 2PFKA 3HCOA 4QNRA 2JI9A 4OOEA 1RM5A 1M2FA 2N47A 2A7XA 4JOCA 5EEGA 1D04A 2CFRA 3GDWA 4MUAA 1S7CA 4D3FA 2RGDA 1B6RA 3O4FA 2XT6A 3KYDB 3OX1A 4XEUA 3KQPA 1WW3A 1TLTA 3BWVA 4EW6A 4AKTA 1JHAA 7MDHA 3KXIA 5FNZA 3BMNB 1DG3A 1KTVA 1OREA 2IY9A 1UWLA 2ZGVA 3CX4A 2Q8PA 3EW7A 5U1PA 4QZVA 3VI3B 1MJGA 4D5GA 4ZAZA 4ESVA 3VDMA 1BHJA 1HDYA 3NFYA 4UQOA 2AB0A 3K0BA 1R9JA 1ZIYA 3QENA 2V7QA 4PFQA 2IELA 2ZBDA 2QQGA 3AF2A 3AP3A 3KYCA 3QPUA 3FCOA 4KMRA 3ZNPA 5T4FA 3CINA 2I6UA 3ITKA 3X44A 1GPH1 4DBVO 821PA 5FUMA 1NYTA 3PNYA 4L9SA 2IU4A 4OL9A 4DQ0A 1FYFA 1W73A 1E6KA 1X9GA 4H3KB 1P73A 3G49A 4FFRA 4OJNA 4LJAA 2X8JA 3O8RA 1XLUA 3KALA 3REOA 4QPZA 2XZOA 3UWPA 1Y48E 2H57A 5EHXA 1VCMA 2GH1A 2PVPA 2ZJZA 2ZIZA 3EXFB 3ZLJA 3EAFA 4O4JA 1I94B 1E0SA 4TKVB 5J9FA 3H84A 1AXGA 3BH6A 3OCYA 5FHQA 1UDCA 5KYKA 1NNEA 1GQ2A 2QRLA 1Y9DA 5DTMA 4BB9A 4DAOA 1AVTA 5CLGA 2YYAA 2P6UA 3JRXA 1FW8A 1Q83A 2I4MA 3V48A 4P5DA 1P5FA 2I7VA 3GVXA 5DK6A 1ZDMA 1LA2A 2B78A 1EX1A 2VNSA 3LG2A 4I9FA 5TIIA 2XA2A 4B3BA 3EC2A 2R9VA 3CLTC 4EFKA 1H3FA 2G77B 5FLEX 3OJ0A 4X1OA 4X8LA 1A5BB 1DAGA 3SY8A 5JNSA 3OIYA 2I6XA 4K03A 4OOFA 5KAMA 1UBUS 3FR7A 1UBNA 2ZSKA 3CRQA 4KXMA 2P68A 3TX2A 3IBGA 4BX0A 1GDTA 2BFFB 3AY6A 4KI7A 4MEBA 3UKOA 4MQEB 5IUJC 5IJXA 2H4HA 1UINA 1AS3A 1I2CA 5BN4B 3VR4A 3EZLA 4BNVA 1JLKA 5A5FA 3MOSA 2XQJA 3G5MA 4QAJA 4RZXA 5F64A 3A10A 2Z3WA 1V37A 1Y3BE 2P5TB 4CE6A 4J0QA 3Q1KA 1Z17A 5ULLA 4DCPA 5IABA 3HO6A 1V8BA 3S7ZA 4LRYA 1NRJB 3FWPA 3R6TA 4A8PA 4CVNA 4KNWA 3D6AA 3RIHA 2IC5A 1J56A 1DJOA 3N0RA 1FX0A 2E4ZA 3G7SA 1VXRA 1LBTA 3OQ6A 4DN6A 2G6TA 4MUFA 3H86A 3RBXA 3WGHA 1JR2A 3C3MA 3FETA 1K7CA 4YXWD 4TV9A 2HSGA 5LP6F 3QSYA 2H7CA 3GPIA 1J6UA 4CKWA 5LOVA 1EZ4A 4YAKA 5F3RA 1UP6A 3OFVA 4ZHQA 4FQ5A 4ZT7A 1E4EB 1UOPA 2ZIFA 2HHLA 1EM8A 4R3NA 1MB4A 1ULTA 1COZA 2WOOA 4XUGB 3PRYA 4TQAA 3IA2A 3GNLA 4RANA 2VG8A 3GRAA 2J5QA 1FMJA 2AZMA 3DO8A 4GQIA 1RHKA 2B69A 1M10A 5I45A 2IH2A 2Q1YA 5B1IA 1LJUA 3S28A 5I7VA 2FFRA 1E2UA 5BQPA 3GJXC 3QI7A 3P45A 1PT5A 4M3NA 1UANA 4OAPA 2D2EA 4RY2A 4TWZA 4V3CA 4YQZA 5AUPB 2E2WA 2VHYA 2IYFA 3AFOA 2HIHA 3BOSA 2ASEA 3QNUA 1TL7C 5TR9A 5BN1A 3AEKA 1FMTA 2DAPA 3TTUA 5K3OA 3FPEA 3D4LA 5A5EA 3E9EA 2XCTB 2BBTA 2YMLA 3T5CA 2P9ZA 4A36A 3A6HA 2AYZA 1RBZA 4NPCA 3AUSA 4XWWA 3DR5A 5CBKA 4DMUB 3MZ0A 1ZIXA 3OTHA 3TB6A 1Q6YA 3DZCA 4LBZA 4IJ6A 5FUWA 1L5HA 1FIUA 3ZTWA 1SUBA 3L77A 2C7BA 2Y68A 4Y2TA 5JVDF 3WR5A 3WX0A 1KAGA 2HF8A 1T2EA 4KTVE 1YFJA 3ZWYA 5AOVA 1WRBA 3KKQA 4AROA 1CG6A 3MTIA 3G6KA 4URFA 1FEZA 1FDVA 1JJ7A 3MLBA 1LF0A 4GX0A 4JKOA 4DIUA 1LSUA 2GEFA 5K7SA 3NHKA 3CWCA 1KMCA 3FNEA 2CLCX 1N5DA 4HTAA 4LN1A 1QGYA 2GCPA 2MYPA 2P4HX 5TGZA 3H9EO 2UZ1B 3NALA 3PUYA 4N5HX 4OK5A 4FZVA 4URHA 4DV1B 4GP6A 4G9BA 2O5RA 2IQ5A 4QT0A 5LNK1 2XDWA 4YDHB 1C14A 1RZ3A 2DQYA 1XG5A 2AA3A 5KYTA 2QUKA 1PL0A 2VQSA 2I67A 3VPFA 3OI7A 3OZBA 5MF6A 1Q0SA 1I4TD 2O2CA 3HWX1 2G09A 3EEFA 4U7HA 5FI5A 3GGSA 5K6TA 5MGBA 1ISSA 3AONB 1WEHA 2QMZA 4N0PA 2BR4A 1E3MA 3BMOB 4PLYA 2V5UA 3EQ7A 3LVBA 5DIZA 4CM1A 5LQRA 1W88A 5E2BA 4G1FA 3IVRA 4ITVA 3KQHA 1IE3A 3QVJA 2DCMA 4IMPA 3ZNOA 1UC4B 2PTHA 1G2PA 1JVNA 1CUCA 1PT9A 4KSBA 2CBZA 4JCCA 2QK4A 1IN4A 2V3VA 3L9WA 3IILA 3LO5A 4KV7A 3IDZA 1IIRA 2P2SA 4EA9A 1AKRA 1L7EA 1BWQA 1NZFA 3LDAA 4AXXA 4EGSA 1T9BA 2IU3A 4IGIA 4RMGA 3PRHA 2G17A 3TMYA 5LQDA 5KNCD 1VJ5A 5EKTA 2EKBA 1JHVA 4AMZA 1XMXA 3E9YA 4D92A 2GM9A 3A7DA 3KAPA 5CLJA 3CNQS 4REQA 3QGMA 3RF6A 3JQCA 3NC4A 1N4AA 5CFNA 1MFZA 1W8DA 4IBOA 4BLVA 1PBTA 2X42A 3EXFA 2YWBA 4MQ4A 3C5EA 2NP6A 5IBQA 5A7HA 2RGNC 3IERA 2XUAA 3A6EA 1DV1A 1I2MA 2IVFA 2X0RA 4L85A 4FMCF 3T4XA 1XF1A 4RFLA 4LTNA 1X80B 3L0DA 4QRDA 4NENB 5JC1A 3HA7A 4DR5B 3BMXA 1PJTA 4BTVA 4BXOB 2BI4A 5DYNA 1YTUA 1Q3HA 4JSRA 3BSFA 3TZHA 4EFDA 1LRKA 5FV4A 1P3Y1 1IPFA 5CA1A 3HCBA 1NJSA 1XZMA 1W4BA 1VPVA 4IJ5A 2JFQA 4G0VA 3JWIA 4HLDA 3KZ1E 1ZUNB 4N8SA 4AY3A 4CM8B 5DHPA 2PGNA 4EW2A 1IB0A 3ETCA 2BCEA 1QP0A 3RS4A 1ZBDA 1RYEA 2YTZA 3AFGA 3KWMA 3MAGA 4L8VA 4R6WA 1RZRA 4S1WA 3RJMA 1H6CA 2TYSB 3E0QA 4XD7A 2BC9A 2V3CC 3SXUB 4H17A 2GEUA 3G0BA 5I9SA 6AT1A 6REQB 1YZLA 3CMCO 1C8LA 2R60A 3WNQA 1O03A 1Z13A 3HP4A 1YRQA 1DIRA 3DR3A 3IQEA 4UDNA 1NJ5A 5LMCA 2QBYB 5ALVA 3EIXA 3TGWA 1Y7HA 3AUAA 2X9LA 3HCNA 5KTMA 4L76A 3HCWA 4IV8A 5JSYA 1RC8A 2VWQA 1W6UA 2WPDA 2A35A 4FNGA 3AZOA 4RV4A 2R1ZA 1D4ZA 4LISA 5JT1A 2H1LA 3CISA 3P96A 2O9JA 3GC6A 3SZRA 1Y5IA 1U2EA 2BR5A 1L5GB 2RHMA 1KMQA 3S0JA 3OZCA 4ENRA 3IAM6 2R65A 1G6Q1 4KR0A 4JR1A 1JHPA 1AE1A 1Z0IA 4YUYA 2XBUA 3PX3A 4LCBA 5LDGA 3WLFA 2Y05A 5A4AA 2VXCA 5THXA 2C94A 4JODA 1RYYA 5HS4A 4Y9RA 2A0UA 2YXPX 2GQ0A 4JC4A 4L73A 1IN8A 1ILEA 2BEVB 1PVDA 1Z2OX 4DCNA 1QHIA 4OP1A 3W8FA 5DX8A 3RVDA 9ABPA 4RSGA 4EA8A 3LFUA 3DMPA 4NESA 1YVEI 3KJIA 3A4YA 4IF4A 5CW2A 1OC4A 1WMDA 1QG0A 4GWGA 5EMLA 1BVUA 2PD3A 3I8XA 5E8RA 3FTEA 2GNOA 4M88A 5TVGA 1T8WA 3B5IA 4UUQA 1C50A 1SNYA 5E8JA 4F1WA 3B13B 2YWXA 3O8BA 2ECOA 1VP3A 2AOUB 4N6NA 2H52A 1LLQA 3BZUA 2OM6A 2F3RA 3DE7X 3R9WA 1MBZA 2AFIB 2GZ3A 2E9SA 3ICQB 5DW0A 1HEUA 4NDZA 3N2EA 2RK3A 1A82A 3O73A 1W29A 4PSCA 3EF1A 3ZOKA 1KHTA 4YRGA 1HNWB 1XPJA 1L4YA 1A27A 3WK7A 1UWKA 3M6VA 5AI6A 3LQ4A 5TMPA 1ZEMA 2ACWA 1FVXA 2QGZA 3SZGA 5BMVA 4DRXA 1K75A 2A5FA 4D42A 4Z86A 1JSZA 5HFJA 2C3MA 2VF2A 2WJ6A 2GB4A 3FWKA 3L46A 3RJ9A 4FKBA 3ZWWA 2HIGA 2PQ6A 3FPKA 4GXTA 2I7TA 5SY9A 3WK4A 5FUQA 4D9NA 3U4HA 1TIBA 1XO1A 2QRHA 5D6NA 5EZYA 4HGNA 1VSVA 4BE7B 3HCEA 1EXWA 2E6KA 2HXYA 3A36A 2NPOA 3H7IA 1E2MA 3NANA 4MYSA 2ZVQX 4IGAA 4KOAA 2FVYA 3JTMA 4C2AA 4EUSA 2HO5A 1MOZA 3IP1A 3MQ4A 4GT1A 4Q4LA 4M8LA 1W48A 1DOAA 3LI2A 1X1RA 5DM60 2CNOA 4C76A 3K1TA 5KOHB 1MRNA 3IBSA 3OP1A 1JH9A 2VF4X 1IFXA 2H2DA 2Q45A 3KVOA 4UUMA 4WZBB 4CFSA 2Q6VA 4ZRMA 1GV0A 2OZLA 1YA4A 2JLRA 4WVFA 2W70A 1L5YA 4BJ1A 5CVTA 1DZIA 3AJAA 3EHEA 3OHSX 3PEYA 3H4IA 1RVV1 2GHIA 1RXCA 3BREA 3EDOA 1SXJB 1UK8A 2VJAA 2VPTA 4TLEA 1GARA 2PAAA 1U9ZA 1TD1A 3H6HA 3QFRA 2FRVA 5U4XA 1MIOA 3DYVA 3RJZA 3LCJA 1OI4A 2WFZA 3C3XA 1KEPA 1A97A 2Q8QA 4N3GA 3OOWA 3SF8B 2G0NA 2VKQA 1H94A 2WT4A 4BLSA 5F5XA 4UEQA 4Z3DA 2I87A 1N6NA 1QCDA 3TR6A 3EX7C 2EFJA 4RF5A 5AH0A 3ICOA 2J33A 5LZ4A 5FNVA 1JR3E 3RRJA 3MSXA 5AW8A 3G23A 4RADA 3BHJA 1T4MA 4P36A 5FR2A 5K3CA 3VDRA 3NBQA 4KR2A 3A3KA 1FQJA 5FIUA 1IZ8A 1PLKA 2PA0A 3W5VA 5LJLA 4B4UA 1ZK1A 4IUYA 4OIFA 4NWIA 1XOIA 1N5OX 3A2NA 3BCSA 1H1TA 2JFNA 3LKZA 3MLEA 4WFKA 3LL4A 4S35A 1CDDA 4RYLA 4BWYA 4F5DA 2O3JA 1LS6A 3EGIA 1IHUA 2FSVC 2FR0A 1IM5A 4OXQA 2FAXA 2Z2JA 1I32A 2FK8A 1BXGB 4LWQA 2X76A 4JA2A 2WSSD 4CCSA 1Z37A 4GECA 5BN5A 1HDZA 4BY9E 2P1DA 4XFJA 1KS2A 3DTNA 3GEMA 2PFGA 4C22A 3CJTA 2QM3A 1SZDA 1M1ZA 2L42A 1HYBA 1JPNA 3S2YA 3AB3A 3JU3A 4NENA 2X13A 2PD6A 5K2OA 3E7WA 5LQUA 3H5LA 1SFRA 1N0UA 3AIOA 4KXUA 4BE9A 1KXJA 3FROA 2OD2A 4PX2A 1SB9A 4JT2A 3RUEA 5KVSA 3F3KA 1ZN7A 2WG1A 5INTA 2WHRA 4Z54A 3Q7EA 2QUZA 3IDFA 3Q7RA 1ZUNA 4IFBA 1VL5A 4CM8A 1YKGA 3F78A 3ECAA 3QY9A 5JMOA 4BQIA 5IWAB 3VZCA 3QVSA 1NC3A 4R05A 5DASA 5BT8A 5AD1A 3ZV6A 1H93A 2B4RO 3QUBA 4OREX 2Z08A 3UJAA 4KFCA 1QRRA 3OZ7A 4RHXA 3OQPA 2UXDB 3IIIA 2VDVE 1K7EB 3QEBZ 4JQZA 4IGKA 3A9UA 3JQPA 2JNWA 2BFDB 1WLYA 1MO5A 1LI5A 1B7GO 1XDDA 4FFMA 1QO9A 1XMSA 2I4RA 3N58A 1GTL1 3D2CA 4Y3UA 4CR6A 5F1YA 3D3QA 3NW9A 1IHXA 4RKYA 2W2LD 1G5TA 1PZMA 3C8DA 3NBAA 4QUDA 4ZALA 1JJIA 2XXJA 3L1JA 4OLHA 2REBA 1NONA 3CNHA 3EN0A 4BMPB 4ND7A 1BKDR 1MG5A 3Q3EA 1KOLA 1T2UA 3IXLA 4MKZA 4OXYA 1FYXA 4K6KA 5DHAA 3E5RA 3WWZA 3JAMA 3WLQA 3EE6A 1RI3A 1RLMA 4H16A 5KNCH 4FJ2A 4BOYA 3BD6A 4OJMX 1GGKA 2X7JA 1WTCA 1L1RA 1NM5C 1Z2NX 2F1IA 3K6RA 3D4PA 4NU6A 1LC0A 3WBFA 1JDNA 2BDEA 1ZM9A 3WIOA 1FFCA 1KIFA 1YS6A 2H00A 3CTPA 1BX3A 1KMIY 1SXHA 3R41A 1U65A 2W5UA 3GRYA 4IX1A 3CMMA 4XARA 4ZKEA 2L2QA 2RHOA 3JWJA 2GX6A 2X8AA 4Z4FA 4G0ZA 5TLSA 4X8MA 1V1RB 5FF9A 1JSLA 1S2LA 4U7GA 3BD8A 4IYJA 5BVGA 1OU0A 1PT7A 4D8XA 3K30A 4QJIA 3WWCA 4DAEA 2HHCA 3RYIA 1OAOC 5FJIA 1G9SA 4U2KA 2O1WA 1DVRA 2ZBUA 5EJMA 3HVIA 5IYZA 1NUSA 2CB0A 3TIXB 4YCJA 4B7ZA 4O1HA 4RHTA 3TQSA 4M9UA 3IV7A 4GGPA 3VPGA 2W2XA 4KZPA 1CT9A 1H2AS 1VG0B 3QYFA 4LKOA 1W4AA 3TBKA 4K9OA 5FTJA 2XWPA 1P9NA 3PX7A 3E9NA 4BO7A 1QV7A 1THZA 4ZT6A 4ZV9A 4EAAA 3MELA 3LZDA 5L3SB 4RTNA 4WXPA 5L4NA 2FE4A 2P9YA 2V6GA 3FPLA 3K4PA 4MQFB 3ML1A 1VMIA 4MW2A 2W0MA 4FSDA 3A70A 4MCHA 3NHPA 2CGEA 4C4ZA 4EUNA 2QAIA 4KQ9A 3CWQA 2ZUSA 4LGYA 4YAOA 3VR5A 5BP7A 2OC9A 3L1IA 4XCXA 4C0QC 5K0CA 4S1PA 2XYRA 5AFSA 3DLCA 1N0WA 3LY9A 5B7QA 2A57A 5TDHA 3VZSA 3IXMA 3WRWA 2WZQA 2QL5A 3M1LA 1VMEA 1W1WA 1ZK4A 2IV3A 1M54A 2DU8A 2X8WA 3BXXA 4PONA 2R00A 1T3TA 3ZHXA 3KZXA 4BZPA 1GR1A 5SZIA 1BDMA 3DMTA 2BCJQ 5EWLB 4LYAA 1A4RA 1QIEA 2YHUA 4WE3A 1MLDA 4B74A 3S70A 4BNFA 4PHCA 2SKCA 3MQFA 4MKGA 1JFFB 2Z3ZA 1SXJA 2WKSA 3OZTA 4N9WA 2Y1DA 3ABRB 5LQCA 1U2SA 1WX1A 4WNYA 2O3RA 4GH5A 4ZAYA 4GM0A 5IKOA 3DMDA 4RFSA 5JS7A 5GJWC 3OCWA 3OCXA 1BDJA 1KZ4A 4R0VA 3UV3A 1PGPA 1KDOA 4PQRA 5TF0A 4CL0A 1F4LA 2PO5A 1KKMA 1QLWA 3K5HA 1ZNWA 4OX9B 2IYRA 3A1EA 3BCHA 4YGXB 5C8DA 1ZR2A 4KACA 2C98A 2RKWA 2A0YA 4TOIA 1JBKA 3V6LA 4H35A 5IBRA 5CITA 3LA8A 4YPVA 4L5CA 4CHGA 1TKBA 4H1VA 3VKUA 2B1JA 2JGLA 4Y7CA 5E7IA 3TLXA 1TF2A 1GYPA 3HYNA 1KY4A 3K09C 1F3OA 4QQFA 1G20E 1P1KA 3I1YA 3KR2A 2I0FA 1O6CA 1JDVA 2BGLA 3C8UA 2DFLA 6GPBA 2BGGA 1M0TA 1NN3A 3OPQA 4CBVA 5I4IA 2ZB3A 3RVJA 4K1XA 3CLVA 2PWZA 3DBRB 1SY7A 3E27A 3I42A 3Q9NA 1E89A 4HOYA 2R8OA 5HW0A 1YBFA 4E7PA 4YCSA 3RB8A 4F3CA 5TNXA 4HAZA 5LQKA 3PQDA 3RC3A 1J7JA 1M1YE 1OWMA 4L07A 4KC0A 4DCUA 3CZPA 5A4IS 2LCFA 3UY4A 1DBRA 1GGJA 1FU4A 2JCBA 1A72A 1PR0A 4TTQA 4NZZA 3E8XA 3UK7A 1I2BA 4I08A 3THXA 1J1ZA 3TLGB 2HPAA 2KYRA 3O84A 5HPYB 4KKXB 1I7DA 1PJ3A 3M3HA 4MTLA 1AGPA 4UXHA 3D2BA 3B3GA 1E2IA 3EIUA 4XOIA 3RRNA 4EVIA 2ATEA 4O8CA 4HWOA 4BMOB 3ZU2A 3AETA 3GA0A 3UJ7A 2JJ2D 4IDNA 4HQKA 2JIRA 3T4PA 3UJ8A 4CKWB 3RHTA 3A05A 2OVBA 1EGAA 3JALA 3S27A 2OCXA 3ITEA 3M6XA 4KVAA 4HAYA 1Z8NA 4JELA 3JD2A 1SUFA 1RI5A 1G8FA 5KYWA 2FN4A 2BM1A 3O4JA 1Q3KA 4HWGA 4KPUA 4RV5A 4RTPA 1G3UA 1EFUA 4FUTA 2DX7A 3QA3E 3RC9A 2IYTA 4E5KA 5IXJA 1SUAA 3BJZA 4YRMA 2Q2VA 1BW9B 5ALSA 1H5NA 5E9QA 3TSAA 4EYKA 4HAOA 4KRGA 1B74A 1DPFA 1SMKA 3BGOS 3Q7SA 4W9NC 5B7GA 1PJLA 5GTDA 3DLHA 1OQAA 1XBTA 5F4ZA 1GTMA 2BF4A 2QLBA 5REQA 1G64A 2BHSA 4D25A 1D1PA 5FTLA 2PX0A 2MSDB 1XCOA 3TKYA 3HXPA 4X3PA 4DA4A 1BWPA 4EF6A 4YIHA 2IEYA 4D80A 5BSVA 1NVVQ 3VV2A 4X71A 3AO0B 3IL2A 1NF9A 1CP3A 1YA8A 1FBNA 3OO0A 3NJ8A 4UQPA 5F9HA 2VJDA 5DNEA 4CI9A 2J9XB 1NVUQ 3MMSA 4UHDA 4R8SA 1E9DA 1UKVY 1IK4A 5GADl 2OLKA 2FR8A 3ST7A 1F0PA 4CDMA 1N7JA 5C7YA 1NI5A 3KKOA 5ESXA 1NUTA 1R2QA 2ZRJA 3LD9A 3OZGA 4L5BA 3DPSA 4NZMA 5L9AA 1D2MA 2FW0A 4NCIA 6LDHA 3UT5A 3PD7A 5BSRA 4RTKA 2PGOA 3C8MA 3WK8A 3SQXA 2HOQA 4O4HA 1A2KC 1GQYA 2QM8A 5F3WB 2AG6A 3V7YA 3VOTA 4QJ3A 1T15A 4NQRA 5L4LA 4LCJA 1I2DA 3QRWA 3O1JC 5JS6A 1VHLA 1G16A 1R5OA 4HMOA 1RIIA 2G3YA 4ZOAA 3JD0A 4YT8A 1ZCFA 4KOEC 3PC8A 2C0CA 2Y1FA 4MQ5A 1QSGA 1NJ6A 1ZVKA 5ALWA 4LRQA 1NJGA 1K2VN 1Y42X 4TTRA 1AGYA 4GG1A 4H27A 4O2AF 5EEHA 3SC2A 3VHLB 4GBMA 1UJNA 3M8KA 5BUCA 1MNAA 4HZUB 1ELOA 4WFQA 721PA 2CXTA 3S6JA 1UXIA 2JHGA 2BTQB 2MYTA 2ZKLA 4GZ5A 3EXEA 4CT5A 2QX8A 3A4LA 2UYCA 3OJEA 1TKRA 4BJ6A 3DKPA 3OQMA 3MIZA 4LYEA 5JQGB 2OHIA 5HOQA 5TT0A 3DV0B 2POQX 1N77A 2JGJA 3DMGA 1FRZA 1YC5A 2M9MA 3UK2A 4ZIRA 2P69A 3L6RA 2CLEB 4ZQCB 4O33A 4A1FA 2GSWA 1B16A 3SMQA 3WK9A 4BB5A 1VE1A 2GFQA 1Y9AA 2Y0PA 3EZNA 3H0EA 4HLUA 3KBOA 3GLKA 4X85A 5JNVA 5LPNA 3QMMA 3QKSB 1YVDA 4R68A 4EY7A 2ZRLA 3Q9LA 4MS3A 2O8FA 1XZAA 1S3FA 3I9OA 1TA0A 3OF2A 1H65A 5ARBA 3RC8A 3NBYC 4QPPA 1LWOA 2Q1SA 3B6IA 4FYHA 2XCRB 3QWHA 4FX2A 4XX0B 1IY0A 1NXPA 3O82A 4CKCB 1KETA 1Q7EA 3G82C 3CVVA 4QO8A 1N2GA 4JNCA 1DRWA 1ZHHA 2NX2A 2IUUA 2Q2WA 4KXWA 1DWOA 2DQ4A 3L6OO 3UAOA 3ZGZA 3KJGA 5EWLA 1AKYA 5ECGC 1KERA 4I3HA 2ODNA 2DY1A 3AYZB 3DTYA 1N36B 2VP2A 3RTBA 2QL7A 3VI4B 3I2IA 2X3UA 4B85A 5DYIA 5BNZA 1G7CA 1Z5PA 1ZMTA 3G8AA 4FMDB 5K0LA 4ZZ0A 3CEMA 3RWBA 4OQEA 2VCYA 4C04A 2ZAIA 4K0RA 4D9MA 5FI0B 2XKJE 4JUAA 4LE1A 6REQA 3DW1X 3LSTA 3NKLA 3H9CA 3ZCXA 2ID4A 2CXRA 1OWOA 2PLFA 4GZ3A 4QFMA 4JUBA 3SEAA 5HZHA 1QIIA 5DNYB 4P0PB 2D1RA 1E1DA 1ZXBA 1D9XA 4PCLA 2FLWA 4XEHA 4AU1A 1E9RA 3K6SB 1QM5A 3ZE2B 4YMSA 1XZDA 4ER6A 1O5TA 3FLEA 3RH0A 3ENVA 5BW8A 2VAMA 4DUPA 3HLYA 1UK6A 3F7MA 2H07A 2VLBA 4IDPA 1PJQA 3BIXA 3LM8A 3JYLA 3IIJA 3MILA 5FEMA 5HMMA 3TTYA 3MRVA 4XFKA 4LFBB 4COKA 4ZCIA 1MG0A 3VVCA 5EJ4A 1Z5NA 1KKUA 4C20A 2JGKA 1BDBA 2B9VA 3LWDA 2I5PO 1F48A 2WR8A 3U9TA 3DBRA 3QFHA 1Z0KA 1M1UA 1Z16A 3TEFA 1A5TA 1KI8A 1P61B 5HA5A 5K01A 1M2VB 1PS0A 2ZJFA 5JXGA 2PYDA 4KWIA 4OQDA 3VUFA 4Q7QA 3PA8A 1SOWA 1ISMA 3L8EA 1VCNA 4A73A 5CB8A 1WUTA 4E6EA 1VSQA 3NHRA 5KJFA 1V43A 3SHOA 1K8ZB 2I3ZA 1KOFA 2DKNA 2HXSA 2YN0A 1DO2A 4LRSB 1F6WA 3T7AA 3E7DA 5I8WA 4RQAA 3KWLA 3W5UA 3QKUA 5E2IA 3TEMA 2IS1A 5G0TA 3QJ5A 1OV6A 2HDWA 1RPAA 3O9VA 4QEDA 4TWAA 1QZTA 2VEDA 5IDWA 2EAUA 1YK1A 1NE2A 5IWCA 4I50A 1TOAA 1GPAA 3PFCA 1K8QA 1NC1A 2BFCA 2ZWPA 3BXGA 2DUUA 4G86A 4OI4A 4NCNA 4IWXA 2PWAA 3EY4A 3PEFA 4A27A 1AQUA 3AJ8A 3ZKWB 4LJ9A 4TL8A 2KI5A 4C4SA 1Z12A 1AHPA 3GNQA 2GJ9A 3CZCA 4MYUA 1K8XB 4OMUA 5GM2A 1CZHA 1EBBA 4PHFA 5H9VA 2VDNB 1XTQA 1TZKA 1T6XA 3MIIA 2Q5HA 3D1JA 3L04A 5ER6A 2ZRFA 3VVMA 1ESDA 1EVLA 4KH0A 2R44A 4LZOA 3RSFA 5FHRA 1IXRC 4YLYA 1N8TA 2O4CA 2HN9A 4FOSA 1H2EA 5H9WA 2GRAA 5JJIA 1GTVA 4ALMA 3D3JA 2W2NA 4IXWA 5AIBA 1L5NA 1YE3A 3FSEA 4X61A 5JCJD 3RIGA 2AXPA 4F91B 3ILHA 2AJ8A 4OO3A 2IHKA 1L7OA 3HC7A 4OQPA 1FL9A 1GCIA 4U9IS 4BQEA 2ZULA 1KR2A 1JPVA 3VISA 3VNSA 1NU6A 1K97A 2MR6A 2XUJA 2BGJA 3D5EA 5AQ1A 3ESYA 2OO5A 4MIKA 3WGQA 4ZOQI 2MIIA 2NNLD 3FW1A 1E18A 3QFSA 4NZYA 4P53A 4DR4B 4GR9A 4FYKA 2V1XA 1V16B 2YINC 1G6OA 4OL0A 4JXKA 2XWQA 3BRWA 4Q6BA 3OPYI 1T9KA 3A9CA 3QBEA 1E9VA 1Q19A 3TAXA 3GA5A 1G1AA 1FYWA 1NBWB 1SC1A 1TKAA 3GT4A 2QWXA 4ZT2A 4OHVA 4R31A 4YQEA 1GU0A 3BJIC 3VVBA 3CRRA 3GCXA 3GVHA 4JLAA 4KV9A 5B1SA 1YMVA 4YT2A 1UIMA 3HXLA 5KB3A 4UJ5A 4AJ1A 4B31A 1U0EA 4Z4GA 2H2FA 3F71A 2HFJA 1VJGA 4MRSA 1FRNA 4CF3A 4C0JA 3G9TA 1X74A 1K98A 3INGA 3IO5A 3SIXA 1BD3A 3FPSA 4BNLA 4KXXA 1B0AA 4Q7EA 1KDYA 4OK3A 4RS3A 4DNFA 5L95A 2B25A 2C03A 2TRSB 3ES9A 2FOXA 3HI6A 2JFWA 4GM4A 4QUKA 2H2IA 3IIMA 2VH1A 3E1SA 5CDFE 5JDIA 1B3RA 2BDTA 5FBHA 1E2JA 4QGHA 1TVEA 4FZRA 3KR9A 1CJMA 3COZA 1KR5A 2C77A 2P2CA 1CJBA 2HK7A 2L19A 2ZPAA 4D1YA 5A6SA 5KDOA 1J5EB 4B76A 2AR7A 2PVCA 3DEZA 2R66A 4B5LA 3G8YA 1P1JA 2DTXA 4R2JA 1JHQA 1Q7TA 1PSDA 3KQWA 1T0JB 3GEEA 4CQNA 1T1IA 3HY4A 1EFAA 1SBTA 1NVVR 1IATA 5KI6A 3EH2A 3THYB 4Q02A 4KHZA 1OMOA 3KLMX 1N1GA 3JCZA 4L5IA 2XXBA 2XNDD 2CFIA 2QJRA 3I2FA 4LY9A 4C08A 2AGVA 3D9QX 2AKYA 3I01A 4IIFA 1CS4C 1KYIA 1AKTA 2AQKA 2GK4A 3B9PA 3H9UA 4RACA 5LB4A 4HV4A 2W71A 3BMCA 3KQVA 1YJ8A 4R71A 3VPCA 3ZCSA 4D6YA 2C3OA 2XNCA 3PLNA 3PB3A 2CUZA 3ER9A 2QYSA 3M9LA 4FDUA 5EJ5A 3KKPA 5DRYA 3FUVA 3W6UA 1ZC4A 1VBKA 2Q6KA 1OZFA 4CKCA 1Y8CA 2UYYA 1YL7A 4GZLA 4R2KA 1J5PA 4B84A 2HO4A 5JSKA 3HEBA 1I01A 1O54A 2CJWB 1N5JA 4JL5A 3C6MA 2X6RA 5JAOA 2WM8A 2XDYA 2H8KA 2FZGA 1I10A 1U8FO 4LWOA 5IVIA 4EL0A 4MIEA 4OUDB 1GQFA 4R1QA 2VTBA 2ZRNA 2WKQA 2XGGA 3LYUA 3QITA 3VH3A 1G3MA 3NIBA 2BEJA 4ZOEA 3QE2A 1ZUIA 3ORSA 2ZJ5A 4JLPA 4B1FA 4LHYA 3B1FA 1ZJ6A 1J0XO 1KI4A 2NYRA 2QF7A 4FNOA 4BGIA 3DO5A 4KJXA 3RUCA 2R62A 3GZJA 1SBHA 2I6TA 3PXCX 5LMUB 4KAAA 1DBSA 1TDJA 3IEXA 1U2GC 1ZGBA 2O3QA 4X7PA 4XVRA 5FADA 3JZIA 4LVNA 3K6SA 4D4LA 4CETA 4I0WB 1U0SY 1TM2A 3ADDA 2OR3A 4DOMA 5JASA 2WWGA 1HMPA 3EDQA 1P0CA 1AZSC 3ZCRA 3HKBB 3OT1B 3DEHA 4N40A 3PHCA 5HKKA 3V80A 5DLPA 1NP6A 5IC6A 4EIWA 4EPXA 2REOA 1OPRA 3IKLA 5IH7A 3OFND 4JEHA 4WY2A 1Y3CE 4GMHA 4KQCA 2PX4A 1CJSA 4TKUA 2DPMA 2VATA 4R9UC 4C05A 1MO3A 3RGWS 2R3SA 1FFBA 4WCVA 4ZT3A 1DUSA 1SB8A 1M2VA 2WIAA 3DBHA 3FKQA 3PC3A 4UOQA 1AK9A 3EG9B 3L0PA 3EXHC 3HRKA 2LIVA 2IHJA 4LBWA 2V03A 2VSXA 4S12A 4MARA 4FFVA 1FFEA 1KVRA 3HMQA 5AVXA 3UCXA 3VR4D 3CHYA 5LLDA 4I1VA 3NDBB 3WHLA 4MV5A 3DKVA 5DEIA 1C3OB 2QRVA 5JY1A 1B6GA 1KK3A 4OGLA 3T54A 2I6SA 2QGFA 3ADOA 1SU7A 3JSXA 4RMJA 1QK4A 1R37A 4MJ3A 2OG2A 5ANRB 3U3XA 1PL6A 4ENTA 2Y6UA 1Y63A 2R48A 4UCWA 2D3WA 2PZBA 3LW7A 3M6IA 5J4YA 1E3DA 1UWCA 1FLDA 1ZJYA 3BBLA 3T12A 1WPRA 4CWAA 5HTOA 2HWUA 3ZH9B 1V71A 2NU7A 3WO0A 1E5QA 3TOCA 4MVJF 3N6XA 2WSLA 1RXEA 5AJTA 3UUWA 2PRSA 4BO4A 2IBSA 1PVOA 4W82A 3RUDA 4EP1A 3HY6A 4GZMA 3OURA 1KO1A 1JZTA 1X2EA 2B1QA 2XQVA 3GFTA 2C07A 5HCIA 1A4UA 4R16A 1SVLA 3LAWA 4MI1A 2HKIA 3B3JA 1XTUA 3AFNA 3HDVA 4WNIA 2NU6B 3NYQA 3OEEA 1WZUA 3N8GA 5KWIA 2NSYA 4AB1A 5J1SB 5GONA 3DOFA 3MW8A 1SUCA 2ZBVA 3WL6A 5IZCC 4Y2JA 1AQJA 4WBNA 1A1SA 4P93A 1A9PA 2J4FA 4NCKA 3RF7A 4P86A 1WNTA 3PNBA 4FMDF 9ATCA 2PUGA 2FPRA 1WVIA 5HF6A 2QNIA 2QD3A 4GHWA 1C9DB 4Q19A 5K20A 1PNVA 4RH0A 4QJ4A 3UH1A 3OA0A 1G0NA 2AFHA 4XR9A 3SKXA 3SXPA 1QLHA 2A8YA 4DQDA 1LBIA 2RGBA 2H65A 1DOHA 4JKYA 1JEEA 1MABA 1GPDG 1E6CA 4QEKA 1RJ9B 2M2IA 1H1LB 2CXUA 4EQ6B 1F8XA 4RPIA 2PJZA 2FDRA 1OLUB 4QYTA 3LVRE 5HF5A 3VYRB 5JH7B 3PQ6A 5EWMB 1NSFA 2XPCA 3BB1A 3DA8A 2W2OA 1DWUA 1JLLB 1XFDA 3HSKA 3GLFA 4X44A 4D0RA 2PUJA 1VPEA 2Q3DA 4HRVA 3ENWA 1BHSA 4HDKB 4BQNA 3DHWC 4V0OA 1RI1A 1ST2A 3TZLA 3ZXUB 3L41A 4U8GA 2GPNA 3QUSA 3ADKA 4RGYA 1AMNA 4HGRA 1YZ3A 2Q29A 3GLHB 1XZBA 4YV2A 1T3HA 2Z83A 4YPFA 2YBEA 2Y9PB 4NNPA 5AI5A 3TI9A 1H2BA 3V8QA 3ZBPA 3ZGOA 4NNJA 3VV3A 1YZVA 1CQZA 3EZ6A 2GTIA 1GGFA 1UT8A 1SHLA 4OB7A 2GPJA 1PU2A 3QV2A 2YOHA 2OWEA 2ZQZA 3H99A 3K9QO 1IWPB 3DWFA 4MCJA 3SG0A 4ZQBA 3DKRA 5I47A 4NEGA 2QTBA 2W83A 3KCQA 5E7MA 3RREA 1HO3A 2YW9A 4NE9A 4YRDA 3U48A 3ZD8A 4EPWA 1ZAYA