5IBQA

Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
287
structure length
287
Chain Sequence
MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal structure of an ABC solute binding protein from Rhizobium etli CFN 42 (RHE_PF00037,TARGET EFI-511357) in complex with alpha-D-apiose
rcsb
source organism Rhizobium etli
total genus 122
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA01
1ZESA 3LKBA 5D2CA 4YCSA 1FFSA 4W5QA 1BA2A 1ZN2A 2R25B 3CHYA 3LTEA 4O1HA 4RK7A 1XHFA 3OLVA 2PAFA 1QP4A 4LZLA 2HPHA 1QO0A 1BVHA 1JFVA 3I45A 5FBKA 4Z0NA 3H5TA 5HQJA 4OG2A 1DCMA 1Z17A 2FEKA 3TMYA 3RVNA 3NBMA 2FW0A 4FE4A 2WJAA 4IMJB 1NXXA 3H5OA 1JBEA 2QW1A 3FGZA 4Q6WA 3BRSA 3NNSA 1ZDMA 1Z25A 1OXBB 3F7NA 3VNBA 2E4VA 2NUBA 2LUOA 2IKSA 5JS1A 4RV5A 3LUAA 3QELB 3H5VA 3QLVC 1FFWA 1Z12A 3D02A 3LUGA 1JYFA 1XWWA 2MYNA 2PL9A 4MS4A 3O74A 1A04A 1NXPA 5KC9A 1GLGA 1W25A 4F8JA 2ZAYA 1ZAYA 3KSMA 1GCAA 4TLLB 2L2QA 2FQWA 4L4UA 1DG9A 1JH9A 3CG4A 2JBAA 4IRXA 1F4VA 5FWYB 3MIZA 4G0YA 4Y9TA 1YK0A 2GBPA 3FMVA 1J56A 1ZGZA 3HEBA 2PUFA 4ETNA 3HUTA 3QLTA 2FEPA 3TX6A 1QQBA 2PLNA 4E7OA 3C3WA 3O21A 3T38A 2QU7A 4MR7B 4XASA 5EWJB 4EYQA 1BDIA 2FMFA 1Z2DA 4O5AA 3ROTA 2LBPA 4JB0A 3R0JA 2JVIA 2LP4Y 4MQFB 1JFTA 2J48A 2FQXA 1TJYA 4N41A 4G0QA 3CU5A 4MR8A 5TQ0B 3HM9A 4G0MA 2IPNA 3CS3A 4NCBA 3H5WA 4PE5B 2P9HA 3CTPA 3LUHA 5EWMA 1PNTA 3VNAA 5KWSA 1LBIA 1FFGA 4PYRA 3RH0A 1E6KA 1URPA 2NT3A 5HM6A 2MYUA 3N6VA 1WETA 3KLOA 3G85A 4EYGA 3OLWA 2DRIA 4LE2A 4Q6BA 3SM9A 3C3KA 4UHJA 1D1QA 5E3JA 1DBQA 1L5ZA 3N0XA 1VPWA 3DBIA 4F12A 2IPMA 4MS3A 2JCGA 1D2AA 3BBLA 4Z9BA 2WY2D 2QV0A 3O1HB 3UUGA 3QLVA 3IPAA 4RY9A 4EGSA 5JNUA 2FXIA 1YS6A 3RVOA 5BQ3A 3LOPA 4MYRA 4G0PA 5KQGA 2HSGA 1ISSA 3N53A 4N03A 1DC8A 4G97A 3IP6A 1U8TA 2A9OA 1DBWA 3GT7A 4NCAA 4MQEB 3EDCA 3N0WA 5CNJA 2L18A 1D5WA 4G0XA 3H75A 3A0UA 3K4HA 3OQMA 4B09A 5KQMA 2ID9A 4KQCA 2PUGA 3E61A 3GWGA 2OENG 3UKJA 5GQSA 4RDCA 1ZVVA 4NV3A 3W9SA 1A0OA 1MB3A 1SXIA 3TB6A 1B00A 3JVDA 4DN6A 1ZH2A 2IYNA 4YGXB 1YMUA 1QNLA 1EFAA 4Z99A 4OBBA 1NXTA 4RSMA 2JVKA 2PUCA 2B1JA 3C3MA 2WRZA 1EHCA 4RK6A 3Q41A 1YS7A 2B4AA 4P98A 2FQYA 3OQOA 4D6XA 2QSJA 4QYWA 4TN5A 1MAVA 2WWVD 1MB0A 3KHTA 2TMYA 4M88A 1T34A 1NTRA 3CFYA 3KLNA 4D74A 1Y1LA 5KI6A 3NHMA 2XDYA 3TD9A 4JB2A 3C6QA 2KYRA 4MAAA 4XAQA 1QO0D 2O20A 4GPAA 3FFWA 3MQ4A 3JPWA 1EWVA 1ISRA 5IUJC 1H9CA 3JS5A 3SQNA 2F8TA 4JAVC 4N47A 3O75A 2GKGA 4H60A 1SD5A 3OM0A 1RXIA 1F51E 1NATA 1R8JA 3KS9A 4IGAA 5TQJA 5IULC 3L6UA 1Z13A 4KMRA 5CHYA 2E4WA 4ZMRA 3LUCA 3NHZA 2YHAA 3URMA 2FKAA 4OLAA 3EQZA 3I09A 4MS4B 4ZPJA 5C5EA 1SXHA 1M2EA 2MYPA 1Z18A 4ZJPA 3H1FA 2FMIA 1C4WA 3NNNA 2WB4A 1BDHA 3DGFC 2JBAB 3JTEA 5TPZA 3UK0A 5T7BA 2FVYA 4EYOA 3EULA 1PEYA 3GRCA 4L85A 1PUXA 5IEJA 1KRWA 3QLUA 1LJUA 3OMXA 3RVJA 3O1JC 5IUNC 5CNKA 5F64A 2E4UA 1JF8A 4JOQA 1E6MA 4KK4A 2PUEA 4G0OA 4EYKA 4ML3A 3G1WA 4EVSA 2R48A 3LUKA 1LJLA 3HCWA 5JNWA 5JNVA 5KQPA 1FSPA 3RVKA 2H0AA 3QX8A 3K9CA 4OTZA 6ABPA 2R4QA 4FB4A 3MMNA 3C97A 3OO1A 1RZRA 3A10A 3QEMA 4RXUA 5FWXB 3IP5A 1E6LA 2PJUA 4MRMA 4PEVA 4UHKA 4Z4GA 2JK1A 1PNRA 4ETMA 3H1GA 1SRRA 1AB6A 3O1IC 4RK4A 1VKRA 2X7XA 4WT7A 3IP9A 2HQBA 3RVQA 3H1EA 4WWHA 5EWJA 5TE9A 1DJMA 1OXKB 4MS1A 4CBVA 3O2JA 4YP9A 1I3CA 4MR9B 1USIA 3DGEC 1BAPA 2FMHA 2V0NA 5IBQA 1ABFA 4MS3B 2I6FA 3IP7A 5TPWB 1L5YA 1D4ZA 2FSPA 1QMPA 1LK0A 3Q15C 5C5CA 2PE5A 4WUTA 2OQRA 1EWTA 5DGCA 2ID7A 4KRFA 3IDOA 3Q7TA 4YR7A 3M6MD 1U2QA 3H5IA 2L17A 1Z2EA 3GBVA 5EWLB 4W5TA 4RK5A 1P8AA 1P6QA 1U2PA 1USKA 3IPCA 3MM4A 3EAFA 3T8YA 5JNTA 1NXOA 1Z15A 6CHYA 5I4CA 3OM1A 3SG0A 2FLWA 4RKRA 1XHEA 1HEYA 3BRQA 3LUDA 1BDJA 4EY3A 1JDNA 1QQAA 1JYEA 3LMKA 2H3HA 2QVCA 2RJNA 3HJFA 3BREA 1ZGGA 3L49A 3OMWA 4DQDA 4H3HB 3GBPA 4MPTA 1A2OA 1U0SY 4ZYLA 4Z4FA 1E2BA 4OLBA 3FFXA 5DKFA 2W42A 5KQLA 2BGGA 2E4ZA 3CRNA 2PKXA 4KZKA 1ZHHA 3JY6A 2FLKA 3I42A 4KPYA 3M9XA 3QLUC 3CKMA 4RWEA 4YO7A 3F6PA 1M2FA 2QR3A 3A0RB 3MF4A 3RVSA 4PICA 2AYZA 4YWHA 3DZDA 3SAJA 4G0ZA 4KVFA 1DC7A 3HUUA 3RVRA 4Q7EA 1VRVA 3N0RA 1PEAA 3BILA 1JX6A 4JASB 1IIBA 3Q7RA 3EODA 5TQ2B 2RJOA 2FN9A 3CNBA 3LFTA 1DCKA 1JLKA 3HXMA 2FN8A 3HK2A 2NZVG 4IMIB 3CG0A 2VUHB 3CZCA 4P1ZA 4TLMB 1NXWA 4XFKA 5IEBA 2GX6A 4RZSA 4RK0A 5BR1A 4LX8A 3JVIA 5JNSA 4N0QA 1NY5A 3GA5A 4QPJC 2PUAA 3DLBA 3HVRA 2HQOA 1JWLA 3CZ5A 1CEYA 3CLKA 3OQNA 2IDMA 1JFSA 3NNDA 3FDFA 4EVRA 2JRLA 4YV7A 4YS6A 1K68A 2WMYA 1GUDA 4YLEA 2RDMA 2ZWMA 4Z4HA 2CWDA 1TVMA 1TMYA 1APBA 4O1IA 4E7PA 3B2NA 1QP0A 4S04A 2WJWA 3S99A 5ED4A 4RY8A 4ETIA 1KMIY 4Z9AA 2IPAB 3TO5A 2A9RA 2AYXA 1RPJA 5TPZD 2M98A 4HYEA 4JP1A 1TM2A 2GI4A 3KYJB 3Q7SA 5T3YA 3RQIA 4MLDA 4RU1A 1USGA 2MSWA 1DRKA 5B3JA 1D1PA 3LUJA 4IILA 4Z4CA 3QELA 1YIOA 1EAYA 3QEKA 1QP7A 3HZHA 4LRQA 2CD7A 2E4XA 2JB9A 2QZJA 4WXEA 4XXHA 4GNRA 4EUKA 4NICA 1PHRA 1M5TA 2NT4A 4QYMA 3RVMA 1LBHA 1KGSA 1JHZA 2CHEA 2IPLA 5FWYA 1GCGA 4TMYA 4KREA 1ZH4A 4KQ9A 1DP4A 3OLZA 1RZRD 3O2QB 4MR8B 3HDVA 4RXTA 3QEMB 4D6YA 2HJ9A 3OLYA 4MRMB 1CHNA 5EWMB 1RNLA 3KYIB 1YMVA 9ABPA 1VLZA 1YVUA 3EQ2A 3MYYA 4LDZA 3JPYA 4OATA 1Z26A 2LPMA 4YRZA 4RS3A 4RY0A 3E3MA 3T95A 3QK7A 4F06A 4KV7A 3F6CA 3P9YA 4MR7A 1ABEA 3O2SB 2VYCA 3GYBA 4QICA 1MVOA 3ILHA 2E4YA 4MQFA 4MS1B 3EGCA 1YTUA 4F11A 1AB5A 2JVJA 5HKOA 5TQ0A 1P2FA 2A9PA 2FTKE 4RK1A 1U04A 4XARA 5FWXA 3KCNA 4H3KB 4LE0A 1UDRA 5FBHA 2GWRA 1MIHA 2L19A 3LUFA 2M1ZA 3KG2A 2P4UA 3MA0A 3SY8A 4ZMSA 1QKKA 3N8IA 2CHFA 5IX8A 3T6KA 4HNQA 1P6UA 1W9HA 3HS3A 4Z4IA 2VK2A 4N76A 5DCLA 5JS2A 3EJWA 1GUBA 1RXEA 4MR9A 2LIVA 4EVQA 2PUBA 4RXMA 2YHBA 5JNRA 5TPWA 1TLFA 2QVGA 5HSGA 3N75A 4N0PA 2PUDA 4HNRA 4KNYA 5CNMA 2PMCA 3GL9A 4MLCA 7ABPA 4MGEA 3D8UA 3KKEA 4XLTA 4F3TA 5IUKC 1M5UA 3RVPA 4Z4EA 1DBPA 1CYEA 1JDPA 1NXSA 3H5LA 1ZY2A 1SXGA 1S8NA 1YK1A 2MSKA 2N9UA 2MYTA 1K66A 2FMKA 1Z16A 5DLEA 4FE7A 5EWLA 4LDAA 5IC5A 5KC8A 2NZUG 3QX9A 5B3JC 5BRAA 4KFCA 2QXYA 1DZ3A 3SNKA 3HSYA 1EWKA 3OO0A 4WZZA 4PZ0A 3HO1A 1KRXA 1DCFA 4MQEA 3I5AA 3OLXA 2PL1A 3F73A 4RKQA 4IF4A 2FEWB 2VUIB 3KJXA 4JA2A 3ILYA 3GV0A 5DTEA 4HNSA 3Q9SA 2MSLA 4W5NA 3H6HA 4WXMA 1NXVA 2HQRA 4W5RA 3A3KA 4NQRA 5ABPA 2IOYA 2Q5CA 1C0EA 8ABPA 3LKVA 3FFTA 3RVLA 4W5OA 3HV2A 2R47A 1JL3A 4KK3A 1QPZA 2RGYA 4LE1A 5CNIA 5BRJA 5PNTA 1DRJA 4DADA 3DLHA 2A9QA 3M9WA 4G86A 2F8SA 3ROFA 4S05A 5GOTA 1ZITA 3H6GA 1FQWA 5TQ2A 3HDGA 3KTOA
chains in the Genus database with same CATH superfamily
2ZUFA 1R8XA 2AOWA 2EQBA 4GHWA 4RAQA 5KCMA 4B85A 2QM7A 5G02A 3SC4A 1KE2A 3SR3A 4DEYA 5LFAA 1G8KA 3B7GA 1PKEA 2FW6A 1DC5A 2XCUA 3VO2A 5LB4A 1YR1A 4CKYA 1QP4A 3GAZA 4E51A 2ZBPA 2J6CA 3KNZA 3Q8LA 1UXKA 4IMPA 4PX5A 2Q0XA 1LTQA 1GQSA 3HCRA 5JCJA 4XWOA 2Y8EA 3BH7A 2PNFA 1NXXA 3H9JA 1TVKB 1ISHA 3ANNA 3I05A 4FX2A 4DCCA 2PVCA 5E4YA 2ZYAA 4MGYR 4LDJA 1WXGA 1T3ZA 2J9RA 2IU6A 1K8YB 1YGYA 2Y9MB 2C98A 3LPNA 2QRZA 4FOTA 1WBDA 1W46A 1YOVA 2X2EA 4UHFA 1RHRA 1QOQB 3HVIA 2VAXA 4TV8A 2ZQYA 4JUAA 4EJ0A 3VHLB 4X20A 5AQ1A 1XJCA 5AUNB 3QLVC 4RTLA 2J31A 2I91A 2FPPA 3DAOA 1RLTA 3C7DB 3G2MA 4Y9UA 3ZDAA 3JX9A 4QBIA 3JQGB 1DDOA 5JJKA 2XNSA 4F97A 5FWDA 3NANA 1E7YA 3LGXA 4BQIA 4I8DA 1ZH0A 1TCAA 1ZJ6A 2J9FA 6PFKA 2E5LB 1X87A 2PR7A 5HIIA 4A7PA 5I51A 3WICA 4Y0VA 4CKBB 4MWOA 3VPHA 5T64A 5EZYA 2PZKA 5SY9A 2O5VA 1ZGZA 1QKJA 1GFWA 4MWEA 5K99A 2IH2A 2FEPA 1FTNA 5EE9A 2J5XA 3IBYA 2IHJA 2JAOA 1RQXA 1OASA 4NF2A 1F8YA 1JEJA 5BP7A 3HO8A 3U26A 1T1IA 2BMJA 3VH1A 3FZYA 5JZSA 4RPKA 4BFUA 4DBZA 5JSQA 2J48A 1N6NA 1JPUA 2WSYB 2IHBA 4P4SA 2DJ5A 4IP0A 4O4HF 1KDOA 5EG5A 3F0TA 1E5TA 3CU5A 4A6DA 4E13A 2VTBA 3CS3A 2AFIB 2XYHA 3VZDA 1QP8A 3H5WA 1FZQA 3DF7A 4KEAA 4B40A 1N77A 1XLUA 1LVGA 3CRQA 1KMMA 2DPXA 5TMBA 2H54A 2WFLB 2XTMA 2Y77A 1X1BA 4JHLA 4LFCB 3ROQA 2I99A 4HATA 3A6EA 3TIFA 3P2JA 1K06A 4PYRA 1E6KA 1BFDA 2OMKA 4P93A 3DAHA 2IL1A 5CJ2A 2JL1A 3TQFA 3SZLA 1MNAA 5T4EA 4J2OA 3EOAI 1DBQA 4QFDA 4FX5A 2V7PA 2DU8A 2D1TA 4JLSA 1JA1A 2IPMA 3FMGA 2JCGA 5AXCA 4LJRA 1VE6A 3IMKA 1NGSA 4LHWA 3DULA 4UW9A 4OQQA 1OBOA 1R8QA 3CRW1 2AUNA 2IYRA 2BM9A 3DMFA 4OBEA 4ZU1X 3UUGA 5CEEA 5LU8A 2PY6A 2RHWA 5AM5A 5G3YA 3ZV7A 1YDMA 3KOUA 3QLVA 4DR5B 4E5MA 3Q2IA 2PPVA 1FX1A 1PYOA 2CYCA 1FP7A 3ORRA 3F1KA 1VBFA 1SZCA 2B30A 3FCCA 3O4HA 1ADYA 5ISMA 2WAAA 1YQUA 3A9WA 3L93A 3UGJA 3TRHA 3PZBA 1XELA 3SE7A 2G07A 4IG4A 3AFMA 1GCOA 2AEEA 1XXLA 2A5YB 4KIJA 3D1JA 4PQGA 2O5RA 1X13A 1DBWA 4RMGA 3ZU3A 3PEFA 3CVJA 2JIPA 3PC2A 2QUBA 2FX3A 4OM8A 1QHHA 3FSEA 4XCXA 2CXHA 5F3DA 3SR4A 4YJGB 5TDHA 4PG4A 2VDWB 3K4HA 2QZZA 3BZWA 4C0HA 2JLXA 3UKJA 1TMGE 1E5XA 2JJ1A 4OHVA 5T8KC 2WJ4A 3R2JA 2ZRDA 4FSXA 4M9CA 4WCFA 5DBFA 3U9LA 5JROA 2BGWA 1E59A 1XQ1A 2ILTA 3OZXA 5HK9A 4YGXB 1CZHA 1QNLA 3IVAA 4WDRA 3R8CA 4YV0A 4M8SA 4TMTA 3OPXA 1FPQA 3DC7A 3FCEA 1YQXA 4HQOA 2AZXA 4XIGS 1Q6ZA 2P1ZA 2FW7A 3FRIA 4NCKA 4B31A 3HHEA 3M6VA 4ZT2A 2FNAA 4REQA 4C0QC 3MW8A 4RPJA 3TTVA 2G70A 4P0PB 4X91A 4TMWA 5ANRB 2OV2A 1CF4A 1TEZA 1L4UA 1SIUA 3Q0EA 4KE8A 1OW3B 4OYYA 5DRTA 4ES6A 5KCZA 3ER9A 5ELXA 1NFRA 4ZVTA 4NPCA 2KYRA 1IOWA 4EMTA 2IW3A 1C9MA 2QTTA 3GGCA 4OFWA 4X6YA 1GKKA 3I4CA 3WGTA 2I6SA 4DYHA 4YP7A 1QLHA 1EWVA 5CDSA 1I7LA 3MTJA 4QDTA 4A26A 2JAQA 3GLGB 4MDFA 5AP9A 1M2JA 3LQ1A 4YIKA 4IXWA 3R7WA 1DOHA 3NFRA 3BTOA 3TCKA 2VT7A 3DZBA 1KEPA 3WA7A 1QU2A 4D1YA 2W5UA 1VSVA 4S24A 4UBOA 2SBTA 1QTQA 5HUHA 3ZEAA 2IU0A 3EDRA 4IGAA 1DAGA 1EVLA 1F8UA 1Q0TA 2LKCA 4S2EA 5CLGA 5IH3A 1FNCA 3DNMA 1YBVA 1Q0PA 3AFOA 1ZM2A 3R5TA 3GCWA 3DZGA 2V5AA 4DMKA 3GRPA 3JYHA 1QYDA 4X8OA 1GTVA 5DMHA 1U0NA 4LXGA 4OQPA 1Y37A 1PR4A 4F1WA 4WOJA 1OV6A 1Z4IA 2YNMA 1GRQA 3FBWA 1XAHA 4R5HA 1XJWA 4U2FA 4F04A 5T8KA 1NUSA 1TJ4A 2F4VB 4ZGWA 3WGUA 1WULS 1GQRA 4C7JA 2OOSA 3FVRA 1OKKA 2QYHA 4L85A 4BNWA 1LZKA 1ZVKA 4U4AA 4DLLA 5BR4A 5KNDH 3QYPA 4G01B 1ZCBA 1KI1A 1NXQA 2VXCA 3I2FA 3I9LA 1CJTC 1JG2A 2VHQA 4K40A 5KKAA 1POWA 3RKUA 3WWYA 3ZKWB 3GP8A 1KMNA 2QN3A 3G6KA 2PUEA 4MKIA 1T24A 3PFHA 1MPXA 1XCGB 2OHFA 3ZY4A 3RC3A 6REQB 4Z51A 4FNGA 2IV3A 4QUJA 5JNVA 2ZIVB 3PD1A 1BE0A 5JQGA 2TSYB 3K9CA 1UZNA 4ZO4A 3QE2A 2H4ZA 4X1YB 4H7EA 1ODJA 2QTVB 1O5OA 2V98A 3NWBA 3I2HA 4UM9D 4DY4A 3TKLA 2QLLA 2DAPA 4G8BA 1RJ9B 1Q21A 3RTAA 2J9YB 1JG7A 3TH5A 4DLTA 4OXKA 4AO7A 4YDHB 2C2HA 2YYYA 3QOFA 3WRVA 2ZXUA 4C3UA 2XYGA 1PNRA 4L8FA 2ABWA 3G9QA 4IY1A 4MVJA 4WVFA 5BORA 3HB4X 3WRYC 1DOZA 1YCFA 2WG2A 3IQGX 3SMQA 4MGZR 3TBKA 5I7VA 3NZEA 5AK4A 5J4HA 2Y93A 3QEBZ 1KC1A 5JSYA 4X8MA 5K8VA 4RCVA 3HXKA 2XW6A 4MW0A 4ZYVA 1KP2A 3EGXA 3PQ2A 4NVRA 1I4OA 4Y2JA 1SFRA 3MUEA 2RHLA 3RLFA 4BTLA 2JLRA 5ALDA 4OHZA 1J0AA 4BLTA 2JGLA 1RHQA 2UXBB 3PUKA 2GHTA 2FP4B 4NABA 1XZPA 2AE2A 5FTKA 3OEHA 1YB2A 3F46A 5J59A 1WL8A 2BEKA 3FJ1A 2A33A 1O1YA 3SJZA 5AVYA 1E0AA 3EPRA 1X8JA 3GBVA 5KYUB 4EY5A 2I9KA 4GOMD 4QJIA 2N1MA 4D42A 3SC2B 4KN9S 2FLWA 3ZHCA 5CB0A 1HEYA 1X7YB 3FUCA 2YJ3A 1HUQA 2WV7A 1EGVB 2BBOA 4JJEA 4EHBA 1QOZA 1E89A 4PLCA 5JVDA 1PZMA 2Q8QA 1U1CA 1A95A 1TYDE 2W2LA 4G8CA 2BGGA 3CIOA 4MRPA 1CRWG 2YBEA 3RROA 2IBMA 3OZ7A 1B26A 1XP5A 1T3SA 1OFTA 1IZ7A 1SUIA 1YQWA 2FSVC 2NWQA 3BXFA 3EXFA 3QLUC 4IJWA 1BJTA 1TO1E 1JMVA 2WUGA 1NFFA 3NEAA 3OZGA 3SC3A 4C88A 2XYRA 1L4KA 5BOSB 5C8VA 3U44A 2CUTA 4N54A 2ZTLA 3GFOA 1OYVA 3U5ZB 2MR6A 2XNDD 3H1PA 4GC5A 3T9EA 3VZSA 4HYQA 4MWSA 3FE2A 4OGGA 4XJXA 4DC9A 5B12A 3TNDA 1E2KA 4UAGA 2VTDA 5CR9A 5CYFA 3WRYA 4N8EA 4OI4A 3HVHA 3UATA 4EW3A 1RAGA 3GLHB 4YQZA 5U4XA 3VC2A 1MX1A 2PA3A 1LPAB 3MT0A 3QFCA 2HLPA 4BBZA 3ORSA 4Q16A 5CM9C 3CPEA 5TT1A 2GX6A 1KVTA 2V7XA 2AOUA 2VXYA 1HGXA 3PXEA 5BR1A 3DV2A 4AS1A 4MV3A 3I0NA 3N2KA 3JVIA 1EGAA 3R75A 2GZMA 2Z5LA 4OXXA 4DXAA 2ISCA 2V6FA 1DEAA 1FDRA 1YJQA 3EE6A 2AXEA 4ZU3A 5JLJA 1C8LA 5ARCA 3LT2A 1NQOA 3OQNA 4BMVA 1M2NA 3SSMA 2AZTA 4AUKA 4URVR 2VF2A 1N7GA 5DP2A 4A15A 2VBGA 3IPRA 2RDMA 4ENPA 4AJEA 3BRWD 4RTSA 3C1TA 1IG0A 4OX9B 3A1UA 4AJLA 1USVA 3DFIA 5CAEB 3L1JA 4TSRA 5JE8A 4LVUA 4ZZ1A 4R1NA 4C30A 1S4MA 1UKYA 2QNBA 2WJWA 2X40A 3NIDB 4J49A 3JV7A 4DPLA 3RYCA 2HSEA 4INJA 5IM5A 5BN4B 1QRUA 4KIWA 1U3UA 4EJFA 1U81A 5KDLA 1OV4A 2RKOA 4Q21A 3JQCA 1OWMA 1QYCA 3LHDA 4AJ1A 4BLVA 5T3YA 5I48A 1HOXA 1OVMA 2BFEB 3N1UA 1O5TA 1E2NA 3AEQA 2FSVA 2W11A 4AECA 4AZ0A 2O23A 5KZMB 1FYWA 4JENA 2Z3ZA 4NBNA 2QUKA 2W93A 1Y4UA 1N4AA 5FTJA 3WLHA 4F4CA 2DT8A 4B45A 1IZ9A 2NN3C 1XPJA 3P5SA 1Y4SA 4EUKA 1XKXA 2J9ZB 5REQB 1PHRA 3V00A 2CKDA 2C7QA 3VR1A 4A0SA 2FN7A 4LXIA 3ZPXA 1WU8A 4LVCA 2A0UA 4Z0TA 4GMKA 2CHEA 4E15A 2IPLA 4RVDA 1Y7TA 5CDGA 3R5FA 1NDUA 4JQYA 4MR8B 3S40A 4D79A 2PEYA 2J67A 2PBFA 2B4QA 3QBJA 4G5GA 3RU9A 2O2HA 4AAYA 3U1BA 3BH6A 3P2KA 1YR7A 3KYIB 4B84A 3O31A 4TL9A 3T9DA 1O89A 3OTQA 5FBZA 4KGXA 5ED0A 1PJRA 1PW7A 4KXQA 1HQKA 1SZPA 3E3MA 4JELA 2VEOA 2VWQA 2G4CA 3HLKA 2MINB 5LA6F 1MC5A 4Q47A 4EL5A 5LMCA 1MOSA 1Q7TA 3EZ7A 4ZC1A 5L53A 2X8LA 2ZP1A 3FI0A 3BOSA 4FN5A 3G9XA 4Q9IA 1U02A 2AJ8A 2JG3A 2OBLA 2H31A 3T41A 3ICWA 4E1VA 3A6PC 2LD4A 1HR0B 1Y4DE 2ASEA 3ZNNA 3EUFA 3HP4A 2YUIA 1RYFA 2H6EA 4MZXA 3JTMA 4JEUA 2ORVA 4QFCA 1FNDA 1SOVA 2V7GA 4Y2YA 5JG7A 4XCQA 1MJNA 2VVTA 1CRPA 2QQ5A 4B8WA 2CMHA 4JYBA 4OIFA 2J32A 5CVJA 5D3ZA 3TQCA 2RAVA 2CSXA 1L4GA 1R6UA 3NTVA 4N3NA 1BHQ1 2OV6A 1B2LA 1TJ5A 4W8OA 3ROXA 3H99A 3UPTA 1G59A 1IHXA 3O83A 3KJIA 2ORWA 4IL5A 5DM70 1DKLA 5CX1B 1FE8A 4EVQA 3FZEA 2OSVA 1JHVA 1YI1A 2C82A 2YHBA 4UXIA 1E2LA 1XEWY 3NIBA 3TD2A 5TLSA 4XIIA 5F2EA 4F9GA 2VTEA 2IP4A 5JO9A 5KWVA 4FZ3A 4XI9A 2IHZA 4XLTA 3UPDA 9MHTA 4JLKA 3TAUA 4MVXA 3OM8A 3H5LA 3SJUA 4LF8B 4JCOA 1SVMA 4D45A 4K87A 4JI2B 4B79A 5HOEA 4NBLA 3ADPA 3QVWA 3D8HA 1GARA 1T25A 1VKNA 2NZUG 4GYJA 3U3KA 3VU3A 2G04A 3HDHA 4DQXA 2X5JO 1Q84A 2B3TA 2OCDA 2A0XA 1G5RA 4PGHA 3UBMA 1TZMA 3ZHUA 4K81B 1NBIA 1P7ZA 2E21A 2GEJA 1P5JA 1ECLA 1AA9A 3MWGA 3P8ZA 3I3OA 2E1PA 2ZSBA 3A6FA 4FJ1A 4YMSA 1RADA 2Y1WA 4PZYA 3EBLA 5E4TA 3AIIA 3V33A 1ND6A 3ZVLA 3V2UA 1KR5A 1X3LA 4FHDA 5K6TA 5L4LA 1XK6A 3E9QA 1TQHA 1JVSA 3JQDA 2QMEA 4TL6A 5BWBA 5IJ9A 1XBTA 1H1DA 3AL3A 3DHNA 4YMTA 1CHDA 3IQDB 4JI0B 3RUEA 2BZ0A 1OAKA 4KKVA 4EH1A 2Y1OA 1IB6A 4IZIA 4OP2A 3CBQA 2ZJ4A 1YU6A 3OPNA 2HNBA 5H9VA 5IDVA 1Q11A 4E5SA 1EESA 4HUQA 1C1DA 4RL6A 3KQWA 5PNTA 3C2QA 2WJHA 3H1BA 2VJQA 5HFAA 1S1MA 2J85A 3LXRA 4X64B 4S1TA 2QP4A 2SKDA 3H6GA 5SY6A 5ALSA 4DJJA 3IL2A 1A82A 2O06A 2WTUA 1C3OB 4DBLE 4CCSA 5DX0A 4ZICA 3VPXA 3W06A 1FLNA 1N0UA 2PCJA 1UXIA 2BMAA 2JFYA 2XQIA 4LTMA 4KWCA 2R25B 3KEMA 4B6OA 1F9AA 4MTCA 4XA8A 3QKTA 3BTSA 1PBTA 5AM0A 2IHUA 4CMJA 2JHPA 5E6UA 4D25A 1K98A 3I45A 4H6WA 5BNWA 2P6PA 1VDZA 2AQIA 4PNHA 4QYIB 4HRVA 3G59A 1SCDA 5K3DA 1T3LA 1XZLA 3OOHA 2G1UA 1L5VA 2C7RA 5LN1A 3D6NB 4J1NA 3EXHB 3EVEA 2GZSA 5EXXA 3WB0A 3WGNA 4DJEC 1NF9A 5JDIA 4DHEA 3T12A 5I7HA 3OIYA 3WHLA 2WVJA 4GQBA 3WFJA 2NU6B 3C6ZA 4EPWA 1SIWA 2XMPA 1GYRA 4B1FA 4OP1A 4BNKA 3HYTA 1YCDA 2B7CA 1H0RA 3EVZA 1FS5A 3FOWA 3D6UA 4Q9LA 1SUSA 2CZCA 1OT3A 4FS3A 5CU7A 1CUVA 1P4RA 3EGVA 4L27A 3B1WA 3MHPA 1LQTA 1N0HA 3P0JA 5D7BA 3SYKA 1NVFA 3KVRA 3LYHA 4KIFA 5EJ2A 4GVXA 4RZIA 1J23A 2VO1A 2YWHA 4FGJA 4FTWA 5IW8A 1R3DA 4DMUB 2PSJA 1IXYA 1C1XB 5JAPA 2FZWA 1SCBA 3X1MA 1GEEA 1YIAA 4EEKA 3G7UA 3FMVA 3PDUA 1I3NA 1IIRA 2OHVA 1T0UA 2BHTA 1GU7A 2JBWA 1GD1O 4B0OA 4P3KA 3T9CA 1X9IA 1KJNA 2Y4OA 1Y8QB 4LY6A 1F1JA 2QX8A 2VKQA 3EOZA 3TX6A 5AVTA 4HAOA 5CURA 2ZUEA 3O21A 4FKZA 5DWDA 3R76A 1OIWA 3HUFA 3KPUA 4HQ0A 4XASA 5FHRA 2IEGA 2ACVA 1GV0A 3RFUA 2R1VA 3SQDA 2IF0A 1ZIDA 3CC8A 2Y99A 5TQ0B 4WN9A 2FZKA 2ILVA 1A9XB 4PE5B 3E9ZA 2Q4BA 3QI7A 1R27A 5L3QA 2E9SA 2HWUA 3RJMA 3RS5A 4A8PA 5ELLA 1AGNA 1FFGA 1VGVA 3L9XA 2XGMA 2SCUB 3A6LA 4PZCA 3MXOA 1EFDN 4RLHA 9LDTA 2VBFA 1XEWX 2OV4A 2CDCA 1JEYB 5AVUA 4F86A 3CISA 1N8KA 5BRNA 4HEA1 6ADHA 1MA3A 2AHRA 2QD4A 1NPYA 2CK3D 2RGEA 1E9SA 3KV3O 1FL9A 1PLLA 2LKDA 2WILA 3NO4A 2LR0A 4H6XA 4RWZA 3U4HA 3ANTA 5B5SA 1UANA 4N49A 1W4BA 5CBKA 2YN4A 3B70A 5KPJA 2VJLA 4LV5B 1W0JA 3H16A 5DTIA 1RU3A 2X6QA 3OZRA 4POOA 1XD9A 1PU2A 2X9LA 4NMMA 1SN7A 2Z8YM 3LOPA 2H00A 3JAWA 1VB3A 4IDQA 1TA0A 5I7SA 3TL3A 4A6PA 5K6AA 1AN9A 3RKSA 1E3LA 1YAJA 3TOVA 3U6BA 4RHFA 1PFQA 1SVOA 4P3XA 3PXUA 5I9TA 3U3XA 3CYFA 4MW4A 2A9OA 3GT7A 2VF5X 4TSFD 2O7SA 4LZOA 2BZSA 4MQEB 4NCAA 5CNJA 3RAJA 1D03A 1D0SA 3K5HA 4DIMA 3T3DA 4B3IA 1UJBA 4KQCA 2HREA 3GWGA 4WADA 5HE8A 4GD3Q 2GN9A 1XEXB 3K1AB 3F3KA 5GQSA 4CM3A 4U39A 2PTHA 2G17A 2Z4RA 1XAJA 4D97A 3WO0A 4JGBA 3AVYA 1ENZA 5FPQA 1QHYA 4Q18A 4NOJA 1NG1A 4RJKA 4AJ9A 1YMUA 1BEZA 1BRMA 1YJ8A 2CY0A 3AIKA 3IEKA 3ZC3A 4D9MA 5IM4F 1YFZA 3V4LA 5FFFA 2IYQA 2JVKA 3C3MA 4EJ6A 3W05A 3VR3A 1AUQA 1UEJA 1R9GA 2H9IA 4GDMA 5CVEA 5F3WB 1R9JA 3VNQA 1X7ZA 2R7KA 2PGAA 1LW7A 2IDZA 3PDWA 2QSJA 1XDUA 4CLRA 1CP3A 1OU4A 2BEVB 4ZI7A 4FFSA 1C4OA 3UHFA 2BT4A 3H9GA 4BZWA 1Z5GA 1U99A 3NBKA 3SS9X 4EJSB 2DP4E 4WEQA 5F5XA 4M36A 2N3ZA 4DV4B 1JEOA 2LXNA 5ER9A 3C15C 3PHHA 1ZMOA 3IEPA 3QE9Y 1WMSA 3GVCA 2R8PA 2QRMA 4OLHA 1NVEA 2X2FA 4J1TA 2ODEA 3WS7A 2VF8A 1JQBA 2ZE7A 5I7FA 4OHYA 3AR3A 3DT8A 3GJXC 5CHEA 1NYTA 4JB8A 3DAYA 1Q1ZA 2UV8A 3M0EA 3TI7A 3H2ZA 2V3VA 3C6KA 2ZIZA 3AF1A 3DVQX 2WU8A 1VHDA 3OM0A 4IQGA 4LV6A 1KYIA 821PA 4KRYA 1F2VA 1RQ7A 4NQZA 4E31A 2ZRCA 5DOZA 5JD6A 5CHYA 2HLNA 1U2GC 1NZFA 4P0TA 2C7PA 1SXQA 2UYYA 1Z6XA 3V1MA 2P3LA 3SLKA 3TR5A 2YH2A 2ADOA 2HMTA 4HQKA 2HQ1A 1RWWA 3PFIA 5KMGB 2AEFA 2E49A 4MS4B 2Q6TA 4LGYA 1YIDA 2VDLB 5LU9A 1D9XA 2B5OA 5DTQA 1G17A 1R5BA 3ROGA 2HHJA 4XTRA 2JFFA 1WDWB 3C8UA 3FVVA 3NAMA 3V7NA 3PJFA 3V5NA 3EIEA 3ZHOA 3RAGA 4DLXA 5IEJA 3WB9A 5FP0A 4ZCLA 3LQKA 1O94D 4TN1A 2QP3A 1TECE 5JZVA 5DXAA 3ETHA 4JOQA 2VS1A 3S2EA 4A73A 1OXSC 3DFKA 5KNDD 1KWGA 3CUSA 3NIWA 4OMFG 4L28A 2BGMA 4TQGA 5KQPA 2QPLA 2VH2A 1DJOA 1U0JA 2COUA 2PGJA 3GPCA 3JWGA 3NC1C 2VZEA 3OT5A 3RVKA 4B3BA 5DNUA 5JD4A 4ZAYA 2C0QA 3M1YA 2CUZA 2FW8A 2ZSFA 1P1FA 1QZ3A 1C30B 2I6GA 1W1IA 3A10A 3GN1A 3KHUA 4P32A 4ZEVA 5IKXA 4MRMA 4OAOA 1GGJA 2R2GA 1NVMB 3EZ2A 4Z4GA 2VHCA 4AJHA 2O19A 1LLFA 1QIEA 1QIHA 5AQEA 4KLNA 4DT1B 2X7XA 3WL7A 3HU1A 1XZGA 2GYWA 3TE7A 1TPYA 5TE9A 1BCSA 2OORC 3BFVA 1MIOB 3NAGA 4Q3LA 4AJNA 4CVNA 1AMNA 2VJMB 4ER5A 4OQXA 3R7NA 3OC0A 1CY7A 2LDBA 2FMHA 2V0NA 2J5RA 1TQ8A 3BGVA 3R0ZA 4OSPA 1DWPA 3NWOA 2OZLB 5C5CA 4PSKA 4I1UA 1U2GA 3UK6A 2Z1MA 3TGLA 3EEYA 3V4PB 2BHNA 2IIVA 3GX1A 4QRHA 1LRJA 4HPWA 2VJOA 1Z2EA 4OCZA 5BSWA 2YV2A 2HJWA 5E6SB 4W5TA 2QX6A 2XUIA 3MRTA 4YUAA 1NN3A 5ITZB 1RP1A 1Z56C 1PJCA 3VXKA 3LDUA 5KOHA 1G98A 1RXCA 4B87A 1AMUA 1G8JA 1UOPA 1W48A 3O91A 5DO9A 3RFCA 4BUJA 4C08A 3U1VA 4MX8A 3UK2A 5IPFA 1JHMA 3CZMA 4F6CA 4EY3A 3HCEA 2VDVE 3A8TA 5HFJA 4TROA 5JAOA 2BMWA 1XJ5A 2DSTA 2NVOA 3EA5A 3F67A 3LY7A 4OGFA 4DC1A 5B4UA 1N2EA 2RB4A 2J0QA 1BXRA 4E5UA 5JBQA 1CG6A 2P1RA 2QD5A 1ONBA 1RMTA 3CRNA 3ENKA 1ZHHA 4FCCA 1KO8A 2JLZA 3I42A 2NACA 2PT7A 5JCXA 1H42A 4US2R 3IH5A 2XXAB 4I3GA 4ZHQB 5BQXA 4JYCA 2EARA 2WD9A 5FUYA 5LYJF 2Q2WA 1YNOA 1KWKA 1IPHA 1VYUA 3JD3A 5DOVA 2ZG6A 3MTQA 2ZSHA 4BVFA 1KXZA 2OSBA 2YWFA 3BXOA 3V4RA 3C3AA 2JA1A 4UU8A 5CPFA 3OJLA 3UOWA 2DSNA 3GJ7A 5DWQA 1ZJWA 3D0RA 3H8VA 1VIAA 2JJ2D 2JI6A 5TQ2B 4FONA 2ZKLA 4D4JA 1PR1A 1ELOA 1LY1A 2RJOA 2V4MA 5DNVA 4QG3A 2O59A 4BAGA 5HKKD 4HQNA 1F0YA 2HCTA 2OORA 3IDAA 4BCDA 2B9VA 1M8PA 2GJSA 3ND7A 3K94A 4OI2A 4R2MA 4L9RA 3IQZA 4C01A 4Q7QA 3MOIA 3PEYA 3KPVA 1AS3A 5B2EA 1CFZA 1AKVA 1XEFA 4GOLD 1CQPA 3TLKA 3WJ1A 2P5SA 1GCUA 3IHKA 4CIXA 4JEMA 5EMHA 4M0PA 1EFPA 1KJQA 2XQFA 3GGPA 1ULUA 2PUAA 3DCYA 4GDFA 2ZCVA 2EZUA 4QDKA 3NMUF 1W6UA 4GF5A 5LZ2A 4FP9A 5FBLB 3NNDA 3LQRA 5IFLA 3C1UA 4N6OA 4YS6A 1W29A 3JQRA 4HB2A 3V46A 5C7IO 1TW2A 3KQUA 3A2NA 1TVMA 1YB6A 1YCHA 1XDSA 3G13A 1GPWB 4GRAA 2D5AA 3TJRA 2HDOA 2PU5A 3VI3B 2OG2A 4QZVA 5KVSA 3NFYA 1NWHA 1DWUA 3LC7O 3ZK7A 4DMRA 2FUNB 1REQB 3R5KA 3U4QB 1OCEA 1KBOA 2WG0A 2OHIA 1SHKA 3C4JA 3IAS1 1U28C 1SVLA 4RY8A 5ECGC 4BAUA 4BB6A 1O96B 1IJKA 2H2DA 4G4IA 1OX4B 3F7TA 4IDDA 4MWGA 1T2EA 1TGVA 2JFNA 1LQ2A 3LIPA 3TO5A 1HSZA 2ZAGA 4AKSA 4MKZA 1E2DA 2F9LA 4QOIA 3WYFA 3W6ZA 2PLFA 3AF4A 3M1IA 5DPMA 4WSOA 4MCJA 4HFNA 4Z0HO 2IIBA 1DLJA 5CDUA 3K31A 3K32A 1TD9A 2H3EA 4FMPA 4OUKX 2VJCA 2G76A 2GN4A 3HCAA 3MIIA 1PVOA 2QENA 3TLJA 4D8YA 4YPVA 1LNZA 2KQUA 1UDCA 5JNLA 4D7AA 3PE6A 3LDGA 2ASVA 5AJHA 5M3BA 4EY7A 4ZV9A 3VZQA 5JSZA 2CYBA 4CT5A 5KPDA 3BD7A 4KPEC 2JEYA 2ZIXB 1AG9A 1BWRA 1Y9AA 5FF9A 3UTDA 3T99A 3DDSA 3AM1A 1GCGA 1QCCA 1ZH4A 1WM1A 5CDTA 3U5TA 4UM9B 1WZ2A 3NTUA 4QXOA 4C6HA 1QPBA 2VPYA 1OZHA 2FZEA 1NUAA 2IY9A 1PT7A 1ZJJA 2RAUA 2Z0MA 3ITDA 3JRNA 3IEVA 4K2AA 2I6UA 3FYDA 3PF8A 3EFHA 3QK7A 3GRFA 4JYMA 4LA4A 4PNZA 5FLYA 1UMDB 1NG9A 4OJNA 2PT5A 1L7XA 2VP6A 1B93A 3WYDA 4CDNA 3VVBA 5ESRA 3PGLA 3R8FA 1XALA 2ZUSA 3DE4X 3RJ5A 3S2UA 1KTVA 4TYQA 4O4IA 3VBCA 1AB5A 2D1SA 4M9QA 4X97A 3HGTA 5JSFA 3GEHA 1IXKA 3BE4A 4FKMA 4L08A 3ZD8A 4H31A 1SHZA 1QH8B 2ZE8A 1IWBB 3PLAE 4CMKA 4TVKA 4V0OA 3U7RA 2WA2A 3FPLA 5KNLA 5JJIA 2Q49A 2HR1A 2CHFA 2VCEA 1BX3A 2ZPTX 4L4RA 3HBJA 5HCIA 5LQMA 3RIMA 4F7WA 2I1VB 3CPJB 4NENA 1PV1A 2NZ2A 3VPBA 4FBLA 2Z4SA 4TUYB 4Q7KA 8AT1A 5FOQA 2WEKA 1WPQA 4RD2A 3DNFA 2FJ0A 2W2PA 4X94A 4DJFC 3VSBA 1EUYA 3HN2A 1THZA 3U44B 1VL6A 2AN3A 2BFCB 4L16A 1RFLA 3IKMB 5JS2A 3HV0A 4IUCS 4J0KA 4AICA 5JXJA 2R2AA 4CLXA 3AHIA 1MB2A 4RXMA 4L5CA 5TQVA 4BLSA 1TLFA 5FFNA 4YXWD 4FGUA 4PVDA 1XEAA 1Y0BA 3BQ9A 5CM2Z 2C3YA 2OBNA 3UKOA 3VNSA 2AOXA 3AI2A 4P38A 3AHDA 1VCIA 4PC7A 4IUBS 3H13A 4QJ3A 4X1KA 1R16A 3QVKA 4NAVA 5AVWA 1YR2A 2DECA 2OM2A 3CIFA 4HNAA 5IC5A 5I9LA 1HRKA 4I4TB 2OCXA 1DC6A 2IVFA 5E6RA 1THMA 1G8YA 5MGBA 4R2LA 3WBKA 3Q3CA 1G18A 2V9CA 3GZNA 1KSJA 3QX9A 3VC3A 2F48A 1QHGA 3LLCA 1ZL0A 1A8IA 1VCMA 1O6CA 2QXYA 1KO1A 4OH1A 5H3CA 3OPYA 1ZD9A 3W4IA 1EWKA 5WRFA 2IEBA 3OCJA 4WESB 4CXMA 4XQEA 3PDHA 3OESA 1GGEA 1GQ2A 1HEIA 4R54A 3CF2A 5F9MA 4IF4A 5TX7A 1T9CA 3A31A 3MJ4A 4ZO8A 2DR3A 1PGJA 1H2HA 4RYDA 5D51S 5DTEA 1KOLA 4HNSA 1X9HA 4C5BA 1FQJA 3LCJA 1ACJA 4JIGA 3WWOA 3HYCA 3AP2A 2VJNA 4W5NA 4HNVA 4N8DA 4TM7A 4YRLA 4NQRA 4FCVA 4CL2A 4M8NE 4HDAA 4C6SA 4D9IA 2WT9A 1P60A 4D9JA 1X1TA 1X8KA 3AFNA 3BAZA 1G6KA 3KZVA 5F1KA 4C7XA 4QQNA 3KKMA 2G1JA 1DAEA 1ZCAA 2I4LA 1B6RA 2VHVA 3CX6A 3GRAA 3RR2A 4D9BA 4G2TA 2PZMA 5AHOA 1S8OA 3GPBA 1Y1RA 1WKVA 3CB2A 1U6JA 4HNHA 3H83A 4R7GA 2CJFA 3IQWA 3SBEA 3UMFA 2NNWB 2O2XA 4ILKA 3LPMA 5EUMA 4KCGA 3RYFB 3S8MA 1RKXA 1G7CA 3ZHSA 4D3YA 2C7BA 3P1JA 2Y0CA 2YXDA 1PJ4A 1OMOA 1W75A 3I53A 3VNUA 1M7BA 3E84A 1FS6A 1X1DA 2HPHA 2QF7A 5FV4A 3TZ6A 3PZRA 3B1JA 4GOXA 1E4EB 3B78A 3TMYA 4ND8B 1FDIA 3BULA 4Q7LA 3QEAZ 1H69A 1Q3KA 1PNVA 2QDKA 3H5OA 1JG3A 3DT9A 2I9PA 4K9SA 3Q3JB 2VYVD 3AUFA 4DARA 3KC2A 2J0UB 4D0NA 1ZDMA 1X7XB 3CZ9A 3M5WA 3KQSA 2GT1A 2BUBA 1AMOA 4FXPA 3T1VA 3ZE2B 3PD7A 1U94A 4WNAB 2QKYA 3VYUB 2ZYHA 4Z1MD 1QKIA 1RWOA 1RQLA 1BKDR 2EHJA 5AW1A 5LBTA 5IK2D 2JFQA 3H5VA 1FFWA 5JFTA 2XB4A 2Z2ZA 1QC5B 1WX1A 1VL5A 2X2PA 2NUTA 3TIVA 2R00C 3HB5X 4LZJA 1Y1KE 3PR1A 5DHUA 4N18A 4FZJA 1F2UB 1R9MA 5ALUA 3V8RA 1J8DA 4E6EA 2AJLI 3G8AA 2R1TA 1XCJA 2HIGA 1DEOA 3LC0A 4K9QA 4I55A 2BH2A 3HTXA 3EMKA 1RE1A 4NMHA 3EDMA 3QJ5A 4E09A 3L82B 2IKQA 1UWLA 3I1YA 2JAWA 1BWQA 1TD1A 1FFHA 4IWXA 4LOAA 5DI3A 4BJHB 1KVSA 4YJKA 5F2NA 3G02A 1JBKA 2OM6A 3HR7A 1NBWB 1N0IA 4ZJUA 2CXXA 3UHOA 1GPUA 1NLUA 1FFDA 2JGRA 1NI4A 1CJMA 3FOBA 5TJ9A 4OFBA 2IEYA 2CL0X 2MHCA 4MEBA 1NJFA 2WF9A 3TSAA 4EYEA 1JMYA 1ORVA 2P4HX 3LIIA 4WXRA 5K3BA 4U1RA 3GEPA 4GQAA 4EF5A 4NHOA 1FRZA 4JUIA 3IOBA 2HMWA 4EGFA 1MUUA 1G8SA 3OOJA 4IQ4A 4LRXA 4TYYA 3HE3A 1N3YA 5HS4A 5D6NA 3LHSA 1RLIA 2OQIA 3EVCA 4Q82A 4YT4A 4DLNA 2X2OA 1G1AA 3BIFA 1XN4A 2O2YA 4ARZB 4OHPA 3RU2A 4CE6A 4UCFA 1RBQA 3KD3A 1URPA 3DT6A 2O8FA 5GZ1A 2DFPA 2DXIA 2EIXA 3AEUA 2Y1EA 4ZCSA 4PX9A 1K88A 3KX2A 4MITA 1JEQB 2I66A 3GCZA 4GOOD 4J4BA 3KB6A 3GFVA 1Q3HA 1Q50A 1K2WA 1CX9B 1HQDA 4BNXA 4R8VA 2ZRQA 1US8A 1D2AA 3BBLA 5FOTA 2BFBB 2QV0A 1XCOA 2VP0A 1I13A 2BP7A 3PKZA 5G1OA 3VV3A 1A9QA 3DOOA 4LHEA 2P78A 1WKBA 2PUJA 3G2HA 4GBGA 2I78A 4H0FA 4H1VA 1JQEA 3TVYA 1ZQ1A 1CIJA 1RBYA 3AGQA 3RRNA 4MQ5A 5IBPA 4P5DA 4ZIRA 4OK6A 3MUFA 1DO8A 1NBMD 2ES4A 2ZJ1A 4V0MA 4DLWA 1SNYA 4L07A 3GCGA 5H3LA 1X1SA 3WGOA 1PQ4A 3HCDA 4Q00A 4WXYB 3C7TA 2QQFA 1XRRA 3AVQA 1ZMTA 4G24A 4CFZA 4URXR 1OJ7A 3O6VA 2AK3A 2WHEA 4ZT4A 1PS8A 1YHNA 4ZEOA 1WMAA 3OQMA 2HX1A 1PQYA 1U0BB 1E6WA 1T1GA 5EP3A 1MG5A 4CT0A 2HFKA 3ADBA 2P75A 3E0QA 4UE2A 3VUFA 1UDWA 2HM7A 1RRPA 4HWSA 3EVDA 3ODPA 4IWNA 3W5AA 1T13A 3MILA 5JHGB 2I0FA 2QJTA 2EX4A 1XTZA 4M9RA 5JS7A 1G3UA 4Q37A 2DTXA 3UAYA 1PX0A 1VXOA 2ZRPA 5ILQA 4QYSA 2VJYA 2OGZA 3AFIA 4ZCTA 2EEZA 2Y1KA 2ATIA 1W5BA 5AM1A 3A1CA 3REQA 5CB4A 4X8LA 4UMDA 1UXJA 3JASA 4WBNA 3SXJA 2HKIA 1KFKB 3HL4A 4RJJA 1GTZA 4CF6A 2UZ1A 5I8WA 2HZBA 1OROA 3AW8A 1M6NA 1HE4A 3FH0A 3G68A 2YZGA 1UODA 2HB6A 4QSHA 3ANLA 1W5TA 3KJQA 3S6JA 3GDWA 4D02A 1Y1PA 3SZ3A 2XDYA 2C7VA 3L92A 4N9WA 4QGAA 3PQDA 2CYAA 3DYBA 2I3DA 2ZJBA 4M83A 1NRJB 1C7FA 1EB8A 1QTRA 4ND7A 1R6VA 2YCBA 3JPWA 1HDCA 1PUJA 2HBZA 2QR2A 1DRWA 3KZCA 3PXBA 3CB4A 3PKJA 3TQTA 3V7UA 3VR5H 3WR5A 3WL8A 3JWIA 4KHZA 5AESA 3M1AA 1UP7A 3M9LA 3MWDB 2NUAB 1T0IA 1UJ2A 1NE2A 3G6WA 1F51E 4MA4A 4EO7A 4QLOA 2XQVA 3C5EA 4IXDA 3SDBA 1YZKA 3R9WA 2AI2A 2C0PA 3PGVA 1CS4C 4Q19A 1EBFA 1ZM4A 2WZQA 5K1ZA 4TV8F 1IBLB 4AZVA 4XEUA 1FU7A 3D1LA 2P9JA 2Q5HA 5B1YA 4B80A 5FOSA 1QS0A 3BZUA 4K6HA 2PZFA 3KQKA 1E66A 2NXNA 3G7NA 1PZXA 4DIBA 1H8HA 3AEKB 2B2XA 4X6LA 5D00A 3DGFC 3WXMA 3QVLA 4DA4A 5CXQA 5HJ7A 2PX0A 1OGIA 2WKPA 3EULA 5ALLA 2XUOA 1GP2A 5AH0A 1PUXA 2Q21A 3ZNOA 4IX1A 3C24A 3MN1A 4YDRA 5A62A 4M55A 5FUXA 1GLVA 5EZYF 2JIRA 3ZDXB 5LQRA 4XYGA 2X9QA 3P0RA 4HDSB 4NMWA 1AZSC 2CLKB 5AVXA 4QXPA 1P18A 2DPYA 4QUEA 2WWRA 4COOA 5DYIA 3S8EA 1EINA 1GN9A 1W9MA 2WKWA 2D0PB 3CE6A 3PUZA 3G8BA 3Q3HA 4O4HB 4CMIB 1GZDA 4ABTA 3IOCA 1OHHD 2HEGA 4MIEA 2QD2A 3BMNA 2ENUA 1N6KA 2X86A 2YFYA 3JYLA 3LBFA 2PH1A 4JP3A 4CHGA 2D7CA 4K9OA 4PNPA 5HOQA 1Q7RA 3QA9A 3MGKA 4CCYA 1W4RA 3ZU6A 3AC0A 4RA9A 4YREA 1J5XA 3JALA 3BMXA 3LX8A 3JWJA 1QE5A 1LPOA 3M3PA 2V0CA 2Z30A 1S7CA 1PSDA 4J16A 3H1EA 4P35A 5AJWA 4E32A 5IRCD 3Q5GA 1W4AA 2H18A 5EWJA 2BM1A 3K8ZA 3TXAA 3U80A 5IASA 2NU7A 4CBVA 2G9RA 2XCQA 4EGAA 5ICSA 4I08A 3R0XA 4EFMA 3NORA 4BPBA 4A3SA 2ATCA 2QOEA 4N8SA 1G1MA 1P1JA 1OC2A 4XSVA 3I76A 2NZJA 5J63A 2WHRA 4FHCA 1C3VA 1N5DA 1XAIA 1XA4A 1JIKA 1X19A 2EFEB 2QTMA 2XUJA 3SJBA 1XVAA 3T7DA 3OQIB 5BV0A 3Q0TA 3M6MD 1I9CA 4JC0A 3LDFA 2L17A 1H2XA 3FOEC 1FVHA 1KHTA 3QVTA 3CLSC 3RT9A 3FYUB 3THWB 4OXRA 3UVEA 2YYSA 3RB8A 2GGSA 4ZQBA 1IPFA 2TS1A 2CB0A 3BGOS 3FKSA 3OLQA 4IJUA 4MMZB 3KOMA 1NC1A 4FK8A 1NXOA 1Z15A 2KBFA 3L7MA 3DBHB 3DKIA 2DT5A 3SZOA 3WK5A 3THOA 4AMZA 1YA6A 1Q22A 2A5JA 1A71A 3THRA 4TQ9A 1A4XA 1JDNA 2PYIA 1MJFA 2ZR0A 4UDXX 4XCVA 2XDQB 3NJ8A 3RGWS 4RULA 2C95A 3P94A 4NULA 3IAAA 2X5OA 1JU4A 3TW8A 5J4LA 2EW8A 3I23A 4H3HB 1A2OA 1U0SY 3BIOA 4Z4FA 1TU3A 2I7DA 3AG5A 3N3BC 1L4YA 4WX2B 4FEYA 3LRPA 1MQ9A 4OLBA 4J8PA 2XY4A 2E4ZA 4C05A 5MFPA 4X1IB 3QEJA 1XJQA 3KKKA 1YGPA 2PGDA 1VHQA 4DE5A 4BS9A 3RVSA 4C43A 4RIEA 2FOXA 1AHHA 2GTIA 3SHTA 1VL8A 2F9MA 4MHTA 3G9UA 4QNRA 3FMFA 1N6OA 2C3OA 3LX5A 3TOZA 1G42A 1I4WA 4TXJA 2Q28A 2XB6A 1XSEA 3RFXA 1LCIA 1V48A 4S2UA 2GZ1A 2YFKA 3VQTA 2RGBA 2ERCA 4R05A 1RHJA 5L4SA 1V7PC 1B3BA 3DG9A 5B58T 2A1IA 3QF4A 2B4YA 2VHZA 1VI6A 3E2PA 3M4XA 4J0HA 2LNDA 4HX9A 5IEBA 2ORYA 1ECGA 4QULA 1KPHA 3GB9A 3HFSA 4IZOA 2GNAA 1AM4D 4F6LA 4CG0A 2OGWA 2DFVA 4AXBA 4HS9A 1I9GA 1E3SA 1DJPA 1NJ8A 4WN3A 4AY4A 5JANA 3CH4B 2DPHA 4GRDA 3DQPA 4DB2A 3FTEA 4XOIA 1NMEA 1UPXA 2AXPA 3HKBB 4CF7A 3RHTA 1AK1A 4C0JA 1YE5A 1VP9A 1RQRA 2WMYA 1QGYA 2WIKA 2ZWMA 3BDVA 3OC6A 4P8RA 2V9ZA 3S0JA 3W8EA 1TMYA 4GLFA 4CR8A 4CGZA 1R5NA 1PDOA 1UBTS 1NJ5A 1P7CA 2P2GA 5AVSA 1ZSNA 1EE2A 1NYQA 4FW8A 1QH0A 1M67A 3CX7A 2GK6A 3P96A 3RV3A 3JQ7A 5EP1A 1W2GA 1E1RD 4B2PA 4YJHB 2F8MA 3RTCA 1YRLA 2PLRA 4ARAA 4C2AA 1RI1A 3JRXA 5HXAA 4KTVE 2W2KB 3LTNC 3WYBA 2JLVA 5JAZA 3T7CA 2HA0A 3PCXA 3TFWA 3IQXA 2FU5C 1JLLA 1TM2A 1ZMBA 3OZEA 1YRYE 2AJBA 3W3AH 2Y1XA 3NHWA 1FYDA 2AG8A 4BCBA 2H2AA 2UYOA 3K96A 4M6WB 1JZQA 4MV6A 5K8TA 4PGAA 2J7PD 4XGKA 5JH7A 2XTZA 1R4AA 1V7QA 4JKIA 5H9WA 2ATXA 3BC1A 3OT1A 5K0JA 2AFHA 1NUUA 3TKAA 2DVMA 2I65A 4LGVA 4Q9JA 5AKHA 1T8PA 3KJZA 3QE4A 2H08A 4QATA 3L5OA 5HCUA 1UJ6A 4CJXA 1NKTA 4CG2A 4WQMA 1WSBA 3G2IA 3I92A 3MWFA 4OJQA 2B92A 1ZZGA 4FWBA 3SIPA 4DUYB 4GSKA 2BE7A 1M0EA 2OC4A 3PNKA 1SKAA 5JQGF 4QO7A 3X1YA 2O4UX 4HVTA 3O2QB 5KTTA 3ZQKA 3L40A 1CJVC 2ZIUB 4C78A 2C4WA 3CJTA 4J94A 3ZGZA 3GAFA 4BNGA 5KYGA 5L3VA 4E4TA 3QHQA 1HYGA 2ATEA 4LDRA 4KC0A 1UOQA 3I6IA 2JBHA 4ZOLB 3JD0A 2EJVA 3GGSA 4RS3A 4MVJF 3FOCA 3OQ6A 4G0NA 5EXPA 1A98A 3KFVA 3GJZA 4MR7A 1SXJD 3CURA 4ENVA 3UJ8A 2WF8A 4LRYA 4YGYA 1DQPA 3MT9A 2AW5A 3Q12A 4HF7A 3ZLJA 3HY6A 1P1BA 5KYTA 5IDYA 3C1AA 1OYWA 3DE3X 1TGYA 4RABA 2JLYA 3EF0A 1ZOLA 4D57A 1UBOS 4Z1OA 1MO6A 1MA0A 4URFA 5FBHA 4PHCA 1YBMA 3UW3A 3LUFA 4TVOA 3RFFA 3GHYA 1XK7A 2VHXA 3C48A 4ZMSA 3PGKA 3QSGA 3T5PA 3HCOA 3O8QA 1JQ3A 1RDFA 3EGDB 3DDCA 4Q4JA 4Z4IA 2FK7A 4D4IA 5EAIA 2PX4A 1WW3A 1VZ3A 4DVJA 3UC9A 2EBFX 4CKEB 3QTBA 3ZZ0A 3C5CA 3DDUA 1NI3A 1YONA 4WFQA 3KJNA 5D3MB 4HNRA 1U3TA 4Q39A 3P5BA 4EGQA 1CYEA 1A69A 1QF7A 1JDPA 3NI2A 2FR8C 1OPXA 1CRZA 1SXGA 2PV7A 1QIIA 4L5YA 1MX3A 4C07A 2WYOA 3HI4A 3IAFA 3M2TA 5JVDF 4PZDA 2IBTA 2RARA 3HU5A 5DHQA 3RC1A 1AQ6A 5B3JC 4L73A 5AKXA 1EHYA 1YJXA 3RTBA 5F7ZA 1DBIA 3T5DA 2PXCA 3DMRA 1DGQA 1JIXA 4ANFA 2VHUA 4G9GA 5CLLA 4GNKA 2FPOA 2I3BA 2AI3A 2QN1A 4BAZA 5AHRA 2KS6A 4YY3B 4J1SA 4MKRA 1CJBA 1W47A 3OTWA 3BCSA 2FEWB 1DG3A 4R3WA 4ZRNA 1CZUA 3GV0A 4DGQA 1HE1C 3AP1A 3CW8X 3JQ8A 4OXQA 2VDNB 3KSDO 3OCZA 1J25A 1W0CA 5ITVA 2Y1CA 4O0LA 4JS0A 1WAMA 4YMUA 4DUGA 3ETLA 2IBSA 1PJQA 4Q1VA 2O54A 1SG0A 4GIBA 3UBTA 3BEDA 2WA1A 1JL3A 5JTUA 3V8MA 3M4JA 3COSA 2Q9AA 4XWGA 4ZREA 3C6BA 3FX2A 1DRJA 2QK4A 2Z1NA 2A9QA 2JHAA 4MP3A 4DNFA 3DP7A 2FZCA 4EB8A 1U9CA 2PSDA 4OPMA 2R8BA 4ERNA 2O7QA 1YACA 2YS6A 2V1UA 4DEVA 2V6IA 1ZESA 4KO3S 4M1EA 4QFBA 1RRMA 5DVZA 5LCXA 5C32A 2RI1A 3QV1A 5ARBA 1CDZA 1UDXA 3HGQA 3R0QA 1ZYUA 5IN5A 2A4MA 3NOQA 4CUJA 4YT2A 3HBMA 4PPNA 1QDEA 2ZRBA 3NJ4A 1WDLA 2C58A 2HPVA 5TXGA 1X6VA 4BFLA 2A0YA 4MCIA 3PA6A 2JK0A 3DTVD 3TQIA 5JAUA 2XJ4A 3KUKA 1CQXA 5K01A 2O05A 3OMLA 4GZ3A 3RVNA 2P91A 5KREA 3K73O 4MUMA 3JVEA 4TT8A 3LHIA 7MHTA 1JJAA 3FTPA 4URUR 4TVSA 1V0JA 2BCJQ 1KZ1A 4KAFA 2PSFA 4CQNA 1OXBB 3GJ6A 4GH5A 3MNFA 4D3ZA 1H93A 1NBEA 2E4VA 3UMRA 4FWIB 4X41A 3VNBA 2G4LA 4F91B 3U7EB 3CRVA 1EUDB 1OBVA 1YVDA 2AKYA 3ESXA 1KJZA 1Z0UA 1VLJA 2WZCA 2ZYDA 1FOEB 1IY1A 1PLKA 2BBTA 2Y76A 4G0WA 3R3UA 1M2GA 3AF5A 3QELB 4KACA 4KU4A 1MNQA 2XX3A 1F2TB 2W43A 2ZRGA 1PYDA 2PL9A 1OLUA 1ZRMA 3PHJA 3GFRA 4UEOA 4CETA 2O8CA 4YMHA 5EERA 2LZ0A 1GLGA 1LFAA 4C87A 3H04A 2ZYIA 1NC3A 4A4DA 2JBAA 5JRJA 1FJGB 1F4VA 4BMYA 16PKA 1RBMA 1WIWA 1QZUA 3N2GA 1PT8A 2OFWA 1RYMA 1JV2B 3TLGA 1LDMA 2B5WA 2AQKA 4JP2A 3HKDA 4FGWA 3GFBA 2D4HA 3PICA 2YHSA 1LV7A 1GNRA 1VL0A 5I3CA 5JS6A 2SHKA 5K20A 1UK9A 3HUTA 1WDMA 2X8JB 4MCHA 1HRDA 2LCIA 5AM4A 2IFTA 1XZFA 3VPFA 5FX2A 2QU7A 2GAFA 3GJYA 3PDCA 3TW4A 2A30A 2Q3LA 4IZHA 1QVAA 1V41E 2JI4A 4JB0A 2LIPA 5DN9A 4BJ3A 2FUKA 4LWZA 5DHSA 3A70A 2B3DA 1CUDA 4N6GA 4Q4AB 2O7VA 3SIWA 1VMKA 1LXCA 3TUJC 4ISCA 3JZMA 5DZSA 3DMDA 1ORWA 4MI6A 3UJ7A 1E32A 4NCBA 2EJTA 3DKVA 3USZA 4OA8A 2P9HA 2P69A 3QOWA 1NVBA 1FVXA 3KJFA 3OBBA 1M2VA 4ZV7A 4K03A 1EJ2A 4IDPA 4XVHA 5HTKA 3WMEA 5IT0A 5CRIA 3SM9A 1P7YA 3HHPA 4D8TA 1L5ZA 1NF3A 2CHUA 3QJYA 3TTXA 1MO4A 3A9UA 1W88B 3L06A 1OFIA 4V0SA 2XA9A 4IFIA 3FWKA 2HWWA 3H4VA 4PIMA 5CVVA 4LTDA 3LQFA 4FGZA 5C8DA 3ZWKA 3QNWA 3FDZA 2FRDA 2F00A 1V5IA 2HTFA 4JR0A 5LQCA 1JNXX 3L79A 5JCOA 4HQLA 3BPSA 2Q2OA 1U4NA 4MYRA 3S2FA 2F3SA 4NFLA 3QQ5A 4UMEA 1TTPB 1IY0A 5EXSA 3FNEA 1SXJE 1YAHA 3IGFA 1D4FA 1ISSA 1O4VA 4GPIB 4JBIA 4U7JA 3UT5A 1VYHA 3P0FA 3V8VA 2NTEA 2AUMA 4UC0A 4QU0A 1P73A 1CF9A 1SCKA 4ARVA 1LPMA 4YRRA 5I9MA 4I5DA 2TYSB 4HJXA 2R7NA 3HXOA 1NT4A 2XIJA 1CUUA 2ID9A 4PZPA 2E3JA 2FK8A 2EATA 3NGLA 1Y9JA 4PYJA 1QSGA 1TVEA 4FFWA 1OYOA 4JX9A 4M98A 3AH8A 4U2KA 3DV0B 1KYZA 3NQ41 2PD6A 1YA4A 2YC4C 4PFQA 2Z98A 2BGNA 3QUQA 1GVNB 4I50B 421PA 4BL5A 5EJEA 1EZ4A 2HD4A 1E61A 1T8TA 2FZVA 2RHCA 4KYTA 3O9ZA 3H0EA 1NXTA 3MRXA 4RSMA 1MTZA 1XTTA 2D5IA 3CMCO 3HJHA 1RQ2A 3KUUA 3VYSB 3OURA 4RAOA 2BFOA 2RFLA 4N0DA 5AI6A 1GZUA 4RK6A 1GV1A 1XKQA 1IOZA 1H4VB 1COWA 1KYVA 1Z29A 2EKZA 4CWAA 1NNEA 5JXGA 1P5ZB 2BN4A 2WJ6A 1UFRA 4RUKA 1CZRA 3DQQA 3PHGA 4MULA 4US0R 4DCJA 4FZRA 3O5AA 3I9V1 3UB3A 5BUZA 2V0GA 3ZWOA 3VHXB 1BA3A 4IEEA 2IXEA 4HBZA 3RJTA 1UMCB 3BIWA 1IOVA 4CLHA 1NW4A 1UWCA 2W6MA 3N70A 1TZCA 1U7UA 221PA 3W7BA 3GRYA 2EDAA 5MF6A 2RHMA 5LB2A 1WP9A 3QVUA 4Z86A 1IATA 4PZAA 5EJGA 4ZAZA 4WIAA 3HMQA 3ZJVA 5B37A 5EQFA 4R2WA 1FLVA 2H65A 3P4UA 4MI3A 4ZI5A 2E48A 3IE2A 2JZCA 1LKZA 1XZMA 1TIKA 3P7MA 2A7XA 1L7OA 5G0TA 3VR5D 3E23A 4G5FA 3UFBA 1Z2AA 3M6IA 2PZLA 4H4CA 5T6MA 4ZMRA 3GN2A 3NHZA 5JMWA 2VNHA 3UB4A 3SU8A 5KNBA 3ZUPA 4TV9A 2GEDA 3ICPA 3M8KA 1DU4A 3UGTA 2QJRA 1NF2A 4MB0A 3BQMB 2YZKA 3D3WA 2OCBA 4JCCA 4WBXC 3FLAA 2WIJA 3ZWPA 1M2EA 2ZVPX 1THTA 2B8TA 2IE8A 1S2IA 4TL8A 4Q9NA 3R7LA 3PWZA 3SEAA 1PX2A 3R5XA 4REMA 1G5IA 3NP9A 5DYNA 2WB4A 2XMGA 4BE4A 4UEKA 4LAFA 4EVIA 5T7BA 3C41J 2Q0HA 1MR3F 1VPEA 4JBWA 2MR5A 4JC5A 1N9KA 4DSOA 4LGCA 1VQ1A 4FPXA 4AWBA 3GLIA 3OMXA 3RU3A 3KB8A 2C5AA 5BVGB 1O9BA 2V58A 5F64A 4WBNB 4ZCRA 1HL7A 4QDOA 5FEMA 4CN8A 1WTCA 3H9UA 4PPGA 3D7SA 2PAAA 3IPLA 4JZKA 1WB9A 3PFGA 4EMUA 4OU4A 5JNWA 4Y18A 5SZKB 2G0TA 1SQSA 4P80A 1JDBB 2Q2VA 3L04A 1SEPA 1ISFA 4AROA 1SCAA 3HDYA 4LKRA 2ZROA 2XE7A 2R84A 2DQ4A 2PQMA 2FQQA 4WZAA 1YSCA 1ESCA 2IU3A 2PJUA 2X19A 1UXOA 1AUPA 1F4LA 3DE7X 1H3NA 2ZGVA 2HHHB 2DR0A 1LD3A 4RQBA 3CCCA 5BUCA 2V7UA 3ZDYB 1XMQB 2PA0A 3EFBA 3HJTA 4QL3A 4RM2A 4TKLA 3TLCA 4BNDA 4EFKA 2HQBA 3OA2A 2KMLA 2NZYA 3L0YA 1MC8A 4IDAA 3GT0A 4PQYA 4E4YA 2VDQB 3H17A 3L8FA 5LDHA 1JDVA 1UT8A 1GKLA 3RREA 4F9TA 5KYNA 2BE9A 3L02A 1KEUA 2EJWA 2C7OA 2FZ4A 1XTKA 4JBXA 1B73A 4ENTA 4QG7A 2OQRA 3BHJA 4YYZA 3OP4A 3CR7A 3EX7C 1R4NA 3COWA 5LJLA 4ND3A 1HMPA 5A4KA 1WLYA 4KXUA 3VHRA 4KRGA 3BE5A 4J9UE 1Q1AA 2XHEA 5DHTA 1P8AA 5D87A 5GADl 3L0PA 1GNQA 3NBQA 3TXYA 1I10A 2PR2A 1F5SA 2BCEA 5IVDA 3EXEB 1E79D 1KMHB 3ZZUA 1UCFA 1J0BA 4PFJA 3OM1A 1IUPA 1HNZB 2YVLA 3RYTC 4I5EA 3UQYS 5DW0A 7ADHA 1BDJA 4YAJA 1M8FA 1YQEA 2XRMA 1RYYA 4D3DA 3HJFA 5L51A 1R50A 1ZUD1 2Q6LA 2HCFA 4MJ3A 5EMNA 2YC2C 5JXWA 4ILEA 1UC9A 4A8JA 1HURA 2PX2A 3IUPA 4V0QA 1C2YA 4ZQIA 1UT5A 2ZJYA 3NX4A 1M1NB 2IYXA 3ET5A 4QWWA 5IXYA 3T4XA 4RCZA 2WTXA 3K30A 1XIVA 3W1VA 5LOVA 2ZT5A 4BATA 2REOA 4JJIA 5E9WA 3D4BA 3PG5A 5DHFA 1KSFX 3F6PA 5ERGB 1AZLA 1M2FA 1IM5A 1Z7YA 3AF0A 2JGDA 4WOKA 1PWXA 1T8WA 3W2FA 4HX2A 4ENUA 5ICCA 2XCLA 1LSSA 2J3LA 4FOPA 4CDRA 1KQGA 1QDLB 3AUUA 3PFWO 3W8DA 2WINI 3HUDA 3K92A 3OZTA 3OOEA 4GZMA 1NLYA 3BILA 3QSYA 1T8YA 3EODA 4K9RA 1XDZA 4MA5A 4AUEA 5A5GA 1X74A 3CNBA 4XJVA 1NRXA 2HIAA 5EC8A 3T5CA 4DKXA 4G81A 4DUZB 1DPGA 4ZI7F 1RLUA 2ZS9A 4FR5A 1ZEJA 1QYIA 2EERA 3HK2A 2V54A 3V7FA 4YRNA 5LKAA 3H11B 5DGIA 1JILA 5C8YB 3DS8A 4AY6A 2XMQA 5FV7A 1B8VA 3D8RA 4AWXA 3PWTA 2F59A 1IXZA 1JIIA 1KJ9A 3UF0A 3FDIA 4LYAA 5K3OA 1VBNA 1TQ2A 2CL7X 1U0RA 2ZB2A 4L9SA 2WIGA 4Z3OA 1M8JA 4BVBA 4P7BA 3MBKA 3AJRA 4I9GA 2CVPA 3BJZA 4B5KA 3ZVKA 1FP2A 4NZZA 2Q1SA 3RK4A 1XD2A 3OTGA 3PEEA 4YLEA 3RSOA 4E3ZA 4RTMA 2AG1A 2QMUA 2X1MA 3H87A 4MJXA 2HNKA 3LKDA 4M0LA 4BUZA 1P0FA 3SC6A 4EECA 3I39X 4AU1A 3RSFA 3I9FA 5C5DA 2ZRIA 3ZX5A 1R4MB 1NW9B 2R8EA 1LPPA 3FZGA 3MCUA 3O8OB 1M34A 1DARA 1NU6A 1L7BA 1N2SA 5HS6A 2ZUWA 1SM4A 1AUXA 3S1AA 1D1SA 1OZFA 3MMSA 3MCTA 2YHUA 2PD4A 4RCYA 2PM8A 2EWMA 2YNMD 1OBCA 2P2LA 2PZEA 2B61A 2WMOB 2M98A 2H4YA 1EA5A 2G1PA 2Q5EA 1QUFA 1T1EA 3RQIA 1UBFA 2OHXA 3B5IA 2ETVA 4MLDA 2MOKA 2FV8A 4QPDA 4Z6KA 2BFDB 2IYVA 1D1PA 1Z4PX 5K8CA 4MOWA 1Y33E 2YTZA 3LUJA 4KQHA 3TPCA 5FPPA 2RI6A 4C20A 3ND9A 1WXIA 1QU3A 1AS0A 1SIOA 1V71A 3JD4A 1M5TA 3L01A 4NICA 4PAWA 5K6RA 5TGDA 1H2ZA 3CN9A 1GCIA 3FLMA 3AR9A 4UAUA 1A3CA 3KTDA 4X66B 1GDDA 2NO6A 4NFSA 1C7QA 5FOXA 5IWAB 2BHRA 1DIAA 2J4CA 4C4RA 1VECA 2QAIA 4D6YA 1CS0B 4AW9A 5IBCA 4PYQA 1NAHA 3UCXA 3OOYA 4IEIA 4AF8A 4R9UC 1AK9A 2F8LA 1A9ZA 2WU0A 1E1NA 3BIXA 1VG1A 3NT4A 1YVUA 2YRFA 4LBZA 3JPYA 3S7ZA 5JFOA 2QGNA 3KJHA 3KWJA 1P0CA 2I22A 5FL7A 2COKA 2QUJA 4BKPA 2X0NA 2W2NA 4A6XA 3O2SB 4OIMA 1KORA 4QOHA 3OECA 3H2HA 1UFVA 3EZGA 3ILHA 2E4YA 4HDKB 1V3QE 5EPOA 3HSKA 3ZLUA 2P2DA 4C0LA 2V9PA 2ZZMA 4BWVA 4EKIA 1P5RA 3I4FA 2VFAA 3O03A 1JR2A 2Y1DA 2YJZA 5AWFC 3HB9A 5A1TA 4ND2A 2NSLA 3MAAC 3CH5A 4A2QA 2Q5LA 3HXLA 5I47A 3N0VA 1ODTC 2XODA 3IIEA 4UNRA 3MA0A 1E7SA 5JSUA 3L9WA 1NOIA 3GEBA 3EEIA 1HE3A 1ZNXA 4L3VA 4LPKA 3WZMA 1GT6A 4FZ5A 1YS4A 2K5UA 3DE1X 1R4ZA 4L72A 1L5LA 4PLHA 3V55A 3U09A 3MJEA 3OF3A 2OZPA 5H16A 2LIVA 1Y8RB 2IQIA 2IITA 2QVZX 1AXRA 2KLBA 4G5RA 1Q57A 1WW2A 2I4TA 2OBMA 3QRWA 4CCAA 5KO2A 3C3BA 1G55A 2R6R1 1XZHA 4UM7A 5DTRA 4F3TA 5DBIA 1OAAA 4RZUA 5FI1B 4AG5A 4Z4EA 3W7AA 1LI7A 4EKDA 4DUPA 5DLEA 5IZ4A 1Z35A 1PJBA 1BXGA 1UKAA 2IGBA 4MQUA 5EWLA 4IH4A 2PUHA 3W34A 2PWYA 2BGKA 2OP0A 4JI5B 2ERXA 4HB3A 1CSEE 4NECA 1UQRA 3VYWA 1MX9A 3KU1A 4CGYA 2HF8A 1U2DA 3LD9A 2PK3A 4C22A 2DWPA 4WZZA 1D0IA 1SD1A 2ZRFA 4CM9D 1XTVA 3I5AA 4P6VF 3A1WA 1SHTX 2BISA 3IBCA 4JLUA 3B6KA 4RKQA 4B4OA 4RGYA 4JA2A 4TKMA 3RUFA 4M1KA 2JCXA 1RW4A 3QPCA 3FTFA 5ALRA 2HIMA 3PE4A 3TUIC 2WK1A 1HKUA 1XTBA 4KHPB 4HGOA 3UHJA 2C8LA 4EW2A 2EOAA 3OE7D 3HRIA 4RH0A 1F48A 1RYBA 4WERA 3IR5A 2E0IA 2VEDA 1FTSA 2X4GA 3PGMA 1NIPA 2QM3A 3TNJA 3ZD9A 4KDEA 2HF7A 5E4FA 2M6SA 5ILOA 4C29A 3LPDA 4U02A 4JQSA 4A5OA 4MEAA 4E11A 4XVRA 1ZZEA 1PW5A 1GA1A 4EG5A 1DEXA 2Q6VA 4F3YA 4Z7NB 3GIWA 3P32A 1I30A 2FZLA 1HK7A 3DSRA 1ZI9A 3GH1A 3N8HA 1DCTA 4Y6QA 1G5FA 1IHUA 1UBJS 1I2BA 1JHAA 1ORTA 2W6JA 3DEZA 5F4ZA 2XNKA 1QUEA 4I0WB 1RRFA 2BTOA 2FPGB 2E87A 1MJ5A 4HDRA 4L3OA 4YMVA 1D2MA 3GBSA 2UUOA 3ZWAA 1FTWA 1QRTA 1OWOA 3P4YA 3WNZA 4CTOA 2GO7A 5K0BA 2YMQA 4O6VA 2NSHA 1CZNA 2KSQA 1DCMA 3QU2A 3I2IA 4CKCA 2NYVA 2G1AA 4B32A 3GDHA 1QIJA 3KSRA 2G36A 4CEIB 1VCOA 1JHUA 1TA9A 5C7OO 1SQ0A 3A3OA 4DCTA 4UQLA 3HXQA 1EFHA 1NJGA 1IVNA 3CX3A 3DCIA 5C37A 2IKSA 4FS8A 5DLPA 3SE0A 5DJ5A 3HJAA 3WIDA 3QM1A 2H2WA 2B99A 2Q3FA 5DGXA 5AVKA 3AR6A 1L5GB 4W8HA 1VFPA 4EHKA 2IZZA 1L7EA 5AFSA 3PEWA 4OQDA 2BUAA 3AERA 4GI3A 1E62A 3K35A 5IKPA 5EESA 1ZM7A 2OP1A 1ISMA 3DDZX 4C04A 1ABBA 8OHMA 3HYLA 4GYWA 1ZEMA 3BD8A 2B98A 4GC9A 4ME6A 4YHBA 1Z0AA 3WBFA 5KNCH 2NVUA 1NHGA 3CVWA 2ZWPA 2GVDC 4AT1A 1DL5A 1G9SA 1U9ZA 2GH1A 3K1YA 3OJFA 2XVMA 1J1IA 1HT2E 3E58A 3KXPA 3WGGA 1V5EA 2O1WA 2G28A 4N65A 1RWQA 5KU1A 3IC5A 3U48A 4HSEA 1NOJA 5L45A 3I5XA 1OB5A 3MWEB 4HEQA 3BHNA 4B6FA 2Z58A 3BEOA 2V97A 4MWBA 3DTNA 3WLTA 1SXJB 1FDWA 1TL7C 2F2TA 1JFTA 2O0HA 1HDEA 2EFYA 3IIIA 5GONA 2FQXA 4N3BA 2ECOA 3X1ZA 1K86A 4YEDA 3AETA 1WEHA 1JLSA 4AMGA 3HM9A 2WTMA 1M2WA 3BORA 1U7ZA 4ZK6A 2INGX 3IIKA 1XA0A 1RYEA 2EKBA 5EWMA 3V2IA 2WDZA 2NO0A 2HJGA 4IGIA 4Q48A 5DM1A 3S81A 2EEPA 4M0KA 3CVXA 3IALA 2FPRA 4A91A 1FFXB 1Z4JA 5HM6A 4KPUA 4B7XA 1P75A 3BX1A 2VUSA 3SQLA 4LE2A 2R6JA 5ARDA 3ELYA 1Q0RA 5HPYB 3IAM6 5E3JA 5JPIA 3MD9A 2V7BA 5CD9A 4RE6A 2YCLA 4NZPA 3R6GA 1PJZA 4EA6A 1E2QA 3K9NA 3WNBA 1EFVB 1W4LA 1EH5A 4RD6A 1FX0A 2P7IA 4HY3A 4B7CA 5BMVB 4MVJE 1ZM3A 4A23A 1MO2A 1NJSA 3L4SO 1YS6A 5BQ3A 4EX7A 1SQGA 4PXYA 5IC6A 1ORIA 4ZVVA 4CMEA 5CYGA 1GTG1 4XZ3A 3JYOA 4Z9XA 5HGJA 1MLDA 1Q1QA 2FE1A 3KYDB 5AI0A 2BTQB 3WQBA 4JBLA 1WY5A 4G09A 4KVGA 2WP8J 4B3GA 2YJ4A 4EG6A 2JLSA 3EZXA 4LV8B 2H1RA 2V5VA 4RTJA 4DMMA 3GJQA 4V1CI 1U11A 3Q9NA 4WL0A 1EX7A 5GJWC 4LNAA 1O8CA 3I4LA 4FJ0A 2I6XA 4UUMA 3WZLA 1FP4B 1G3QA 3CRZA 1FSZA 1GR0A 4OJYA 3N05A 4BO5A 4RORA 1LX6A 1XTUA 4Y30A 2G1KA 4GBED 4M0FA 2Y6VA 4F4DA 5KINB 1BG6A 1H9AA 1E3WB 1SURA 1T3HA 2IYSA 1BRTA 4WK0B 1CY4A 4NCXA 3WKAA 2R6AA 3ZCQA 1NR1A 1S96A 1V8OA 2IYNA 5AW6A 4Q01A 4FM9A 3DO5A 1OIXA 3DVAB 4IDHA 4QHYA 3SS7X 7YASA 1W93A 1P6XA 3OCWA 2OYRA 1EK0A 4MI9A 3MT7A 2V7WA 5AJUA 2Q1UA 2RJ3A 3BMQB 3ZDDA 1JPJA 4NBKA 4Y2TA 3VKGA 3IOEA 4LBWA 2C2KA 3DEIA 4TS1A 5CM8B 3FJYA 2EHDA 4M7PA 1I6LA 2ZBVA 1K2VN 1E1QA 1T34A 1MHPA 1QB7A 2VYQA 2QRQA 3OJCA 5E1OA 5B2FA 5G53C 3DBOB 3HWWA 4QODA 4XAQA 1P5HA 1WSAA 4EA8A 3LA8A 4GOND 3TN7A 4XB2A 2CUKA 1V1RA 4QDUA 4BMZA 3DTVB 4PF1A 2QQ0A 1RJEA 4TMVA 1IU9A 4EQZA 3R9XB 2H0QA 4J0DA 4U8GA 3NOVA 1ZRSA 4KBYA 3S5UA 1PDWA 4M7RA 3ZNQA 1N25A 4EPRA 2IYAA 2ZBRA 3D5TA 1A5SB 3IQHX 5L3SA 4D0LB 4EDFA 1S3GA 3RM3A 4XGRA 3T0GA 3PQ6A 4CODB 5ICMA 4GE3A 4D9KA 1SHJA 1Y3BE 4N12A 1ENYA 4S12A 3SJCA 1E7QA 1U6KA 2GQ0A 4W4TA 3LK7A 4X60A 4S0ZA 3NTXA 3RRMA 2ZUDA 2EXXA 5AOVA 4KQIA 4S1VA 1F14A 1Z6TA 2GK3A 3FTCA 3IBTA 3R0IA 4XPIA 5C5EA 2DR2A 3HKEA 3ZWNA 2BGUA 3E9EA 3ZGLA 3TLXA 3T7KA 3WQRA 4DM7A 4IIJA 5CJJA 2C2WA 1NFQA 2FMIA 1ID1A 3F9CA 5FHQA 4A36A 2YICA 5TPZA 1A96A 1WZEA 2ZJ3A 3GUVA 4RZHA 2J6IA 1KI9A 2FVYA 5JWHA 3F5FA 1EVIA 4KV9A 5KYXB 3FUWA 3LC1O 2XMDA 4I55F 2DUWA 4P4TA 5J2TF 5KNCA 3QX3A 5COQA 2L42A 3JW8A 3TLAA 5A0VA 2AVNA 3MJRA 1JPVA 1MV5A 2GPJA 2WF6A 2YJNA 4K9KA 1KZYC 2WKQA 3O26A 2QZ4A 3A6KA 3QW2A 2EFDB 4GEGA 2DQKA 1QTIA 2EU8A 1ISPA 5HWSA 5K8UA 1ZR2A 1N33B 5THXA 1K8QA 1UIRA 4CM8A 2ZYSA 4JSTA 4YAIA 4D2IA 1XLTC 1FSPA 3QX8A 3T1NA 5KYWA 1TCCA 3ZGVA