5IBQA

Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
287
structure length
287
Chain Sequence
MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal structure of an ABC solute binding protein from Rhizobium etli CFN 42 (RHE_PF00037,TARGET EFI-511357) in complex with alpha-D-apiose
rcsb
source organism Rhizobium etli
molecule tags Solute-binding protein
total genus 122
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA01
4RZSA 3NHZA 3O2JA 4TN5A 4XAQA 1RZRD 1YTUA 1KRWA 1C4WA 3D8UA 4YGXB 5JNRA 4MGEA 3HJFA 1ISRA 5HM6A 2VK2A 1PHRA 4YV7A 3CNBA 3O1JC 5JS2A 3DLHA 4XLTA 3SQNA 1ZH2A 2OENG 4KRFA 1L5ZA 3JPYA 3TX6A 1Z15A 3HV2A 4RK0A 2HQOA 4RU1A 1UDRA 3KTOA 1U04A 1J56A 3I5AA 4L4UA 3H5TA 4RY0A 1MB3A 1PNTA 4P98A 2NT3A 4F8JA 3OLZA 1NXSA 2YHBA 1P8AA 3A3KA 3QX8A 2LUOA 2VUIB 4Q6BA 3CU5A 2X7XA 2NT4A 3KHTA 3M6MD 3MQ4A 3N0RA 3Q7TA 3DGFC 3SAJA 5IULC 4WUTA 1R8JA 2RJNA 2QXYA 3N0XA 4KMRA 3QLTA 2FEWB 1D4ZA 3EDCA 2A9QA 2FN8A 6ABPA 2PKXA 3BILA 4B09A 5ABPA 1JF8A 1QP4A 1IIBA 2IDMA 4D74A 3IPCA 4O5AA 3URMA 1GUBA 1JL3A 1RZRA 5PNTA 2P9HA 4DADA 4MR7A 4LX8A 4PYRA 7ABPA 3A0RB 4Z4EA 1QP0A 1Z13A 1RXEA 1FFGA 1DBPA 1Z12A 4WWHA 2ZAYA 1JWLA 1MB0A 4EGSA 3SG0A 2JRLA 4EVQA 3OLVA 3EQZA 3TMYA 2QR3A 3A0UA 5GQSA 2QVCA 3G85A 3GYBA 4G0QA 3EAFA 2A9RA 3L49A 2IOYA 1TLFA 2L17A 2M1ZA 5FWXB 3UUGA 2AYXA 1JHZA 2PL9A 4G0MA 1GCGA 3QEMA 2MYTA 2NUBA 3G1WA 2XDYA 3EULA 2HQBA 2MYUA 3B2NA 3GRCA 4RY9A 3NHMA 2JBAB 5F64A 3DBIA 2WB4A 3MF4A 2E4XA 3CLKA 4MR8B 3O21A 4MS3B 1KRXA 1NXTA 3LKBA 5EWLA 2JB9A 3LFTA 1YS7A 4RWEA 2PLNA 4N76A 3IP7A 1Z17A 4ZMRA 3GBVA 3MM4A 2R4QA 2L2QA 2E4WA 1DBWA 3DGEC 4RXMA 4FB4A 5TPZD 3LUCA 3KLOA 1TVMA 2ID9A 1BDHA 5KQGA 4G86A 3KYJB 1Z2EA 4TLMB 1PUXA 4Z4IA 3L6UA 4Z4GA 1NTRA 3QLVC 1E2BA 2QV0A 4MS1A 5DKFA 2QW1A 2RGYA 3E3MA 5GOTA 2DRIA 2MSKA 3C3WA 4RKQA 1YK0A 4KPYA 2ZWMA 3QELB 1NXXA 3ROFA 1FSPA 4G0XA 4MR9A 3RVSA 4WXMA 3Q9SA 2FMFA 1JDPA 1DZ3A 4FE7A 1DCMA 3N8IA 1PNRA 2FEPA 4M88A 3RVJA 1EHCA 3CG0A 4YWHA 2M98A 3CKMA 3F6CA 8ABPA 4EYGA 2H3HA 4RK4A 3TO5A 3KLNA 4ETMA 4RKRA 1ISSA 1D5WA 2FQXA 4Z4HA 5C5CA 4NQRA 3O75A 3D02A 3IP6A 1GLGA 1QNLA 1VLZA 3N75A 5IC5A 4F12A 2FMIA 4IGAA 5C5EA 1JBEA 2JVJA 3LUGA 5HSGA 1YMUA 4MQEA 1JFVA 2FQYA 1ZN2A 4RY8A 1ZHHA 5TPZA 4XASA 1NXWA 5BQ3A 4LDAA 2B1JA 5TPWB 5KQMA 1NXOA 3OO0A 4YLEA 2V0NA 5TQ0A 5JNSA 4HNRA 5KC8A 1TJYA 2N9UA 1MVOA 2F8SA 1JYFA 1ABFA 3T6KA 1QP7A 4YP9A 4KFCA 3VNAA 1NATA 1U0SY 3BRSA 4MPTA 4PICA 5IBQA 2OQRA 3F7NA 3GA5A 4H3KB 1DCKA 3H6GA 3HEBA 3LUDA 4G0YA 2PAFA 4IILA 1H9CA 1BVHA 4O1IA 2W42A 1M2FA 4PZ0A 5DGCA 1USGA 4MS4B 2TMYA 2GBPA 3BBLA 3I42A 2IPMA 3EODA 2FLWA 4FE4A 4QYWA 4Z9AA 4N03A 1BDJA 3O1HB 1USIA 1GCAA 3CRNA 2CHFA 1EWKA 1SRRA 1P2FA 3C3KA 4RSMA 1D1QA 3VNBA 4EYKA 5EWMA 3FFXA 2ID7A 4RV5A 1GUDA 3HVRA 3S99A 1LBIA 3JPWA 3KG2A 3LUHA 4IMIB 2E4YA 1LBHA 2JCGA 1D1PA 2NZVG 3IP9A 4MRMA 4F11A 4OG2A 3H75A 1TM2A 1SD5A 5CNMA 2QVGA 3W9SA 3H5LA 2LBPA 3OLXA 2A9PA 4ZMSA 1SXIA 3IPAA 4E7PA 1HEYA 1SXGA 2JVKA 4EY3A 5BRAA 1ZVVA 4W5RA 2WWVD 2VUHB 5EWJB 4KK3A 3TD9A 3NNDA 1NXPA 2FXIA 3ROTA 1A2OA 1EWTA 2MSWA 1BA2A 3C6QA 3QK7A 4MAAA 1S8NA 1YMVA 2MSLA 3Q15C 2IPLA 3EQ2A 3HUUA 4LE1A 4NCAA 4EUKA 9ABPA 3UKJA 4F3TA 1APBA 3N53A 4G0ZA 4EVRA 4ZYLA 1NY5A 2WY2D 4F06A 2GI4A 5B3JC 3FFTA 1U2PA 3OMXA 4YR7A 3Q7SA 1DRJA 1EAYA 3FMVA 3FFWA 2AYZA 2LP4Y 4ZPJA 5FBKA 1YIOA 3OO1A 3IDOA 4LZLA 2E4VA 4Z4FA 2HQRA 1C0EA 1USKA 4YO7A 2NZUG 2WJAA 2HJ9A 3H1GA 5KC9A 3HS3A 4Q6WA 1DCFA 5FWYA 2FLKA 2FSPA 4LDZA 3K4HA 1U8TA 4KREA 1YVUA 4KQ9A 1Z2DA 4ETNA 4MQFA 3C97A 4GPAA 3RVPA 4RDCA 1DG9A 1KMIY 2JK1A 4NCBA 4WZZA 4W5NA 3H5VA 1LJLA 5DLEA 1Z26A 1QO0D 3MA0A 5T3YA 3T95A 1ZDMA 1ZAYA 2H0AA 3Q41A 4ML3A 2CWDA 4OBBA 4RK6A 4DN6A 1EFAA 1VPWA 4YRZA 5JNWA 4OATA 4H3HB 5T7BA 3OQNA 2BGGA 2IPAB 1PEYA 3HSYA 5JNUA 1K68A 1URPA 3HDGA 3N6VA 2FKAA 1DP4A 2MYNA 2FVYA 1LJUA 2R48A 3MYYA 4MR7B 3EJWA 4KK4A 2FQWA 2CHEA 1XHFA 3OM0A 3TB6A 3CHYA 4EYQA 4W5OA 5BRJA 1DC7A 5CNJA 3CS3A 1BDIA 3BRQA 2WMYA 3HUTA 2PUBA 1W25A 2A9OA 2PMCA 1RNLA 1YS6A 1Y1LA 1MIHA 3GWGA 3HCWA 1PEAA 4TLLB 1QKKA 2IYNA 4W5QA 3LUJA 3QEMB 4EYOA 3T38A 2E4ZA 4QICA 3RVLA 4E7OA 2IPNA 3RVKA 2PUCA 2PL1A 2PUAA 1QO0A 4EVSA 3H6HA 3Q7RA 3JS5A 5FBHA 3KYIB 4QPJC 3QX9A 3I45A 4PEVA 4Y9TA 4W5TA 3KSMA 5EWLB 5FWYB 1DJMA 5CNKA 3RVRA 1CEYA 3OLWA 1OXBB 2B4AA 2MYPA 2R25B 4HYEA 4UHKA 3HM9A 1JH9A 3H1FA 3MMNA 4KV7A 1ZY2A 3H5OA 2LPMA 3I09A 2J48A 4JB0A 3OM1A 4LE0A 3KJXA 4N0PA 3RQIA 5JS1A 1QQBA 1RPJA 3FGZA 1JDNA 3QLUA 3GBPA 1QPZA 4TMYA 5FWXA 1DBQA 3GT7A 3HXMA 1JFSA 1TMYA 4MS1B 3FDFA 4OLAA 2PUEA 5IX8A 1E6KA 1ZITA 3GV0A 3ILHA 4NICA 3RVOA 5KQLA 4S04A 1MAVA 4H60A 5TQ2A 1M5TA 2JBAA 4RK5A 4HNQA 1CHNA 3SM9A 4MR9B 4RS3A 3HK2A 2YHAA 4MR8A 4MS3A 3DZDA 3JTEA 1F51E 1ZGGA 4XXHA 5HQJA 5I4CA 4JB2A 2PUDA 3OLYA 1QMPA 2PUFA 3LUFA 3OQOA 4XFKA 4GNRA 4RXTA 2GWRA 3F73A 1YK1A 2Q5CA 3H5IA 3OMWA 2PUGA 2KYRA 3NNSA 2JVIA 3KKEA 4NV3A 2HPHA 3RVQA 2IKSA 3ILYA 1EWVA 4KZKA 4N41A 1FFSA 3H5WA 4IF4A 5IEBA 3RVNA 3A10A 4YCSA 5IEJA 4MQEB 5DCLA 5IUKC 3P9YA 4D6XA 5JNTA 3QELA 2R47A 4JP1A 3LUKA 3JY6A 2GKGA 5TQJA 1ZGZA 5DTEA 4Z4CA 5TQ0B 3M9WA 1F4VA 1P6QA 2PJUA 1SXHA 4G97A 1LK0A 4Z0NA 1A04A 3SNKA 5KWSA 2FMKA 3KS9A 4LRQA 1DRKA 2WJWA 4OTZA 1JYEA 2PE5A 3E61A 4PE5B 3SY8A 4JA2A 1BAPA 2FN9A 6CHYA 2GX6A 4IMJB 3O2QB 2LIVA 3CZCA 3NNNA 3CG4A 3K9CA 3LOPA 3BREA 4KVFA 1VRVA 4S05A 3F6PA 1XWWA 1B00A 3C3MA 1ZESA 3OQMA 4Z9BA 1Z16A 3LUAA 3CFYA 3RVMA 5IUJC 1D2AA 4CBVA 3EGCA 5TQ2B 5TPWA 4UHJA 3RH0A 3O74A 1CYEA 4KQCA 5ED4A 1FQWA 3R0JA 1ABEA 2RDMA 4ZJPA 2FW0A 2QSJA 2QU7A 5EWMB 1I3CA 3M9XA 1VKRA 4QYMA 1E6LA 1RXIA 1WETA 3JVDA 4LE2A 4DQDA 4MRMB 4ETIA 3GL9A 3O2SB 1XHEA 4N0QA 4RK1A 2HSGA 1U2QA 4Q7EA 5JNVA 3KCNA 4KNYA 5CNIA 4MYRA 4OLBA 4G0PA 1M2EA 2L19A 4XARA 5IUNC 4MS4A 4IRXA 3LKVA 5D2CA 2P4UA 4P1ZA 3HDVA 3QEKA 4RXUA 3NBMA 1JFTA 4WXEA 4JASB 1QQAA 3DLBA 1W9HA 1ZH4A 4N47A 3JVIA 1DC8A 4L85A 5B3JA 3IP5A 1OXKB 3QLUC 2CD7A 1K66A 2QZJA 3H1EA 1AB6A 1FFWA 2FEKA 3HO1A 4MLDA 1L5YA 3LMKA 3T8YA 1JLKA 1P6UA 3UK0A 5HKOA 5BR1A 4RK7A 1A0OA 3MIZA 3N0WA 1AB5A 2VYCA 1Z18A 4JAVC 5TE9A 4G0OA 5KQPA 1M5UA 2FTKE 3LTEA 4Z99A 2O20A 5CHYA 2WRZA 4YS6A 2RJOA 3O1IC 1T34A 2F8TA 4JOQA 1E6MA 4MLCA 2FMHA 4HNSA 4MQFB 4WT7A 1JX6A 3CTPA 1NXVA 3QLVA 5EWJA 4D6YA 1Z25A 5KI6A 2L18A 2I6FA 2E4UA 3HZHA 5E3JA 4O1HA 1KGSA 3CZ5A
chains in the Genus database with same CATH superfamily
3UMMA 2ZSFA 5AVWA 2REQB 3ZGYA 1AD2A 5HRUA 4I1RA 1PKEA 1WZNA 3BXEA 2PRYA 1GPWB 1P9WA 3LPAA 3SXPA 2JEZA 4ZOCA 1GM5A 2JGRA 3C41J 1IZYA 5E1OA 2JFYA 5SYNA 1JQBA 2W0MA 1T3SA 1T5HX 1Y9ZA 2OHXA 4WKOA 4AU1A 2IYEA 3IA7A 4DLPA 1KZYC 2GHIA 4MI1A 5LKAA 3DM5A 2II6A 4EGQA 3JV7A 4EEXA 3PGA1 4KX3A 4BVHA 1EAMA 3FZYA 3H5TA 3OZWA 1NIJA 3W6UA 1P29A 3E7FA 2W9XA 4TN1A 3VO8A 3K6KA 1ARZA 1SEVA 4HLQB 2JAWA 4KDFA 2C7QA 2QZ9A 3WY9A 1FL9A 1FNCA 8MHTA 5I6DA 4ZDWA 4KUEA 1S2GA 3ND9A 2J9GA 3DR5A 2JIBA 1Z2PX 1CUZA 1DIGA 1PZHA 1W0KA 4H7DA 3VH4A 2NSHA 1X7DA 3H4TA 4C04A 4DDWA 1R8JA 5FBVB 3AP3A 2C9OA 2GKOA 4BFUA 2QR2A 3RTAA 5JTUA 1NVMB 3BFJA 1U3UA 2ZXEA 4BO6A 3UT0A 4C1BA 4YXWA 4C29A 1XZDA 3MPOA 4ZCQA 5TXGA 3W5JA 5TR9A 2C3OA 1ID1A 5DNDA 3IH5A 1KYZA 3MUEA 4DADA 3ZY6A 3OJFA 4MR7A 1OGJA 5HWSA 4WE3A 2D59A 1Z13A 1NJ8A 2HYIC 4UTXA 4LK3A 4WWHA 3JQRA 1Z8DA 4OQMA 2A9FA 1VL6A 4EVQA 3HB1A 1QV6A 4FZ5A 5J3JA 1L5QA 3L82B 3SYNA 5A9TA 1OWMA 5GQSA 3TQHA 1EM8A 2EIHA 2JGMA 1KVQA 1CFJA 1P4SA 5JH7A 2W6MA 4WX2B 1G6KA 1MDFA 1UIRA 3QKRA 3GJ5A 3S2UA 1GAXA 4I46A 3OZAA 4HAZA 2A92A 4JWTA 4TYWA 4QE3A 2OSVA 5JLAA 1U8CB 3OZEA 2EIXA 3T8YA 1CRLA 2YRWA 2F64A 1G7RA 5JC8A 1AA6A 4EG7A 4JUAA 1XRRA 2JBAB 3HPRA 3FOFC 4PYJA 1D2NA 5GZ6A 1MJNA 4MWOA 3X1DA 1L8LA 1KRXA 4OJNA 2QLNA 3GN1A 5K3SA 1JIKA 1PJCA 1P2BA 2Z5LA 2HYDA 3LKBA 2AS0A 2VAXA 5JOQA 1MTOA 3H86A 5JYBA 3R7LA 3QF4A 1U99A 3I2KA 2ZAGA 4N9WA 4R51A 1KO8A 2ZIZA 3OZ7A 1H8ED 1WY5A 2C5LA 4PO1A 1L5HB 2W2VA 3SJZA 4YK7A 5ALZA 1A2KC 1ATIA 2L2QA 1E6WA 3DF9A 3WP1B 4C4SA 2DSTA 1RXYA 2LW7A 2GD1O 2DR3A 3AR6A 4CLEA 1FFEA 3PFGA 4DR6B 1KZGB 1G20A 4FYIA 4R1OA 4MUBA 3N59A 3E2IA 5FPYA 2CT8A 4P5EA 1TC2A 1M2KA 2IY8A 3B3JA 4P4UA 4Q9AA 4XB6B 4RKQA 3S2IA 4PLGA 4V0KA 3EGXA 2A9KA 1KS2A 3A2NA 5H8WA 3WRWA 3ROFA 1FSPA 1W87A 5HZGA 1CUAA 4RUKA 1NKSA 3Q9SA 5U1PA 2F62A 5F7ZA 3OPYA 1DCMA 2BFBA 3DLIA 1SIUA 2FEPA 2ZB3A 3N8IA 4L0CA 3S2ZA 2GASA 3ODGA 1DMRA 5KTPA 1OH7A 2YHIA 3MTIA 4KQFA 2M98A 1UODA 2HWWA 4K1LA 4V0QA 3WGTA 3W5BA 1LVUA 3FPGA 4IH4A 1JXAA 2ZBVA 1OY1A 1QCCA 3LQQA 4OB6A 4FFPA 1AKWA 4QUGA 1VTKA 2ZYDA 3G0CA 3WB0A 1Q0ZA 1DIHA 1TFRA 4TV8F 4CG2A 5C8XA 3TSOA 1DOHA 1BTOA 1HDXA 2QXTA 3OJOA 4YJ3B 2R6FA 2YWJA 4MCHA 3NAZA 3OU7A 4P82A 4BFVA 1U7HA 1KZHA 3GLFE 2PX3A 1TAUA 1OWPA 1V1RA 2ZI6A 4FD2A 5AXAA 1CJMA 2ZTMA 1H8EA 2ZYWX 3OURA 1Q6YA 1GZ4A 1M54A 3AC0A 1X2BA 1YQUA 2UAGA 2ZK7A 4Q1FA 4QGGA 5JYEA 3Q3EA 4KMMA 3AVTA 1U3FA 1ESEA 2XUOA 2GHQA 1V8BA 4G8JA 4LDAA 5GVRA 4TV9A 1X8JA 3UJ7A 2NU9B 5J2UF 5MDHA 1NASA 3E81A 4EB3A 4JJAA 1SHTX 2FSSA 3E23A 3K0AA 2H1SA 5CAEB 3A1EA 3C5HA 1QP7A 1T35A 2B4YA 4HO1X 1M7GA 1I2BA 2AVDA 3CZAA 4N54A 3G0BA 3THSA 4YCDA 1XKLA 5JS8A 4MPTA 2Z3WA 3D8TA 1DIOB 3Q7QA 5LUBA 1GT91 3DOUA 1DFGA 1II8B 3E1SA 4H3KB 3SMVA 3T99A 4ACBA 5KX5A 5L9AA 4BPBA 4W9RA 4IILA 1DQPA 2HQSA 4QOGA 3R0XA 1X3SA 1R7RA 3QWBA 3L8DA 4IL5A 4LSMA 3VKUA 2IZ6A 3EQ9A 3FM9A 1HTTA 5GV7A 1GITA 1QYDA 2WNSA 1W581 2ASEA 3VSEA 4N7MA 2J3KA 4YTEA 3RVBA 5CA0F 1EJ0A 2P35A 1ULHA 2I29A 2YC2C 3NFYA 4IDCA 1JTVA 1NPTO 1T3ZA 1YCHA 2B4RO 2FFHA 5EQFA 2K2QB 1T0BA 1ZR2A 4X92A 4B3XA 4H0FA 1R5NA 2VF8A 2JIZD 2PRIA 3G2LA 1L8QA 3K9BA 4NAVA 4Y30A 3UJDA 2HR1A 2AJCA 1P2FA 2F1KA 2V55B 2XRFA 4IH9A 3FCUB 1HRDA 2WU8A 3LPMA 2WOJA 4PLVA 2WG2A 4XPIA 4U00A 1F0YA 3COVA 4MRMA 2Q2QA 4Y8VA 1OBCA 5GIPE 1KOLA 4YP0A 3AVPA 4H16A 1ACJA 2FW9A 3JYQA 4IHJB 4QEDA 3DE2X 1RM5A 3U7EB 4F2DA 3EVFA 1R0LA 3U4IA 3RJMA 3CA8A 1TJPB 1TKRA 2DUWA 2C7GA 1E3EA 4E13A 3L4JA 5JZMA 1SCUA 4R84A 1T26A 1CY6A 1VJ5A 3KDAA 1VL0A 3BGSA 4ND3A 1Z4PX 3PEYA 2FWJA 2EX0A 2FXIA 4FXOA 4CT4B 3E48A 3KZVA 4PPGA 1QQAA 3M3HA 1LLQA 3RW9A 1RD4A 2QZSA 3HUUA 3RIGA 5IABA 2R65A 5EZQA 4DLRA 2X8BA 1FE8A 2YOGA 1L7QA 3IKLA 4Z2AA 3F5DA 1C7FA 4LW8A 4F06A 4U2GA 3WTBA 4DCVA 3ZCQA 1G7CA 4ZDIA 2IV3A 3Q8WA 5FLYA 5AW0A 3W7AA 3LWZA 3PHCA 2JS7A 3WLJA 3MK31 3IB6A 4TKUA 4B7UA 4UTNA 5HDQA 4CKCA 2JIZA 3L0IB 3MIIA 1MNAA 2FY8A 4I8XA 4TROA 5D6NA 1ATZA 3TLZA 1RRFA 2NZUG 3UZUA 3HS3A 3V6MA 1XZNA 4AMZA 1IZ9A 3R3UA 3K4HA 2ZYRA 3GGCA 3JQ6A 5P8WA 2FJ0A 1AC5A 4J16A 4M0DA 4BNTA 3LQFA 1B0AA 3N6RA 4MQFA 4OOEA 2XCRB 1Y81A 3DZGA 1REQB 3PCTA 2EDAA 2OXRA 3LXUX 1KMIY 2A59A 2YICA 3FR8A 3CNOA 3EZ7A 2O4CA 5T64A 1OBOA 4MROA 421PA 2PEZA 2QYSA 4M54A 2I34A 1ZAYA 2DFPA 3VZBA 1MTZA 4C06A 4G41A 1RE0A 2CE7A 4FK8A 2R8EA 1KE2A 4LHYA 2DPXA 3IJ5A 5LJLA 4NJMB 2JLCA 5ECWA 3EA4A 4OM7A 2RIPA 1BXGB 3WKBA 5F1KA 3HJAA 3BEDA 3PENA 1BG6A 2R1TB 2CUZA 2W37A 5EIBC 3FMOB 1BX0A 4JN6B 4RDHA 4EPRA 2DKOA 1J8QA 1U2SA 1YB2A 3EZ2A 2Y1OA 2YJGA 3NBQA 2CHEA 4EL5A 8LDHA 3RT9A 1FC0A 3R3JA 3QFTA 4DANA 1PLKA 4W5OA 2XODA 2HK6A 1DC7A 4EQ6A 2XGJA 2X8WA 4FUTA 4XA8A 1IXZA 1GNTA 1KRHA 3HBMA 3DCNA 3LZ6A 2H0RA 1XZKA 4RHTA 4D3ZA 5C46F 1Z4OA 1J8YF 5ECDA 4BVAA 3FD8A 2PUBA 2HRCA 3TCKA 1KVTA 4H7FA 1PWXA 1U2TA 2FG5A 1PR0A 2ZTLA 1WULS 3DTNA 2WNIA 1ZH8A 5I51A 3I5UA 2ACEA 3V4ZA 1M1YA 1Y89A 3BA1A 5KSZA 4MB2A 4DLLA 1XZFA 4GMGA 4P36A 4EGCB 3RASA 1E2PA 3QEBZ 3DE7X 3DZBA 3OCWA 3ZKAA 3OFND 4NX2A 3H1BA 3V9AA 3GLFA 3NTUA 3Q6IA 2C57A 1W5EA 1CTQA 2OXFA 3H83A 4EKEA 5FXMA 3N6XA 5HQTA 4DV7B 1GU1A 2QW0X 1AK1A 3KSMA 4YIKA 5C31A 1C9DB 1C0PA 1J21A 1W4RA 1BQ4A 2CB0A 3MB8A 4WCFC 4A9AA 1SKQA 3FAZA 3FPJA 4KUHA 5HNKA 1O03A 3LWNA 1XF9A 3TZCA 4DLYA 3TGPA 2YCBA 1DB3A 1ZG3A 3K2IA 1CY7A 1KMCA 3JQAD 4L9WA 5A5VA 4H7EA 2R0QC 2BI4A 3D0RA 4BNYA 7YASA 1XHLA 3HB0A 1XPJA 3H65A 4EHLA 3NT4A 3DV0A 4RPGA 1ZXLA 3IJPA 2Q7OE 1QPZA 1JA9A 1WZUA 3LGXA 5FI0B 1O89A 1V3UA 4F71A 4S2UA 1W2WB 3TTXA 4R2HA 4BQSA 1MKYA 3F2IA 4ZA2A 4EHKA 2UZ0A 3AOGA 4NBKA 3DKPA 5BP7A 1DQRA 2EEPA 3H4IA 3WLQA 5CFOA 1RU3A 3D7LA 4YDQA 1A9SA 4M8NE 4DDHA 2ZRDA 1YBAA 3DZDA 4HQNA 4XEUA 2GM4A 4GKJB 3S7TA 3NGMA 1S5PA 4R68A 2ZYUX 2XQIA 3L40A 1A5BB 4KXMA 1V26A 2BDTA 2WKRA 3FNEA 1LDNA 1EGVB 2PSSA 3OFNA 3V7YA 4ZT2A 3QHAA 4YV1A 4B3RB 1HE2A 2NQ2C 3UK2A 1NNI1 3QG5A 4UBJA 1EFHA 4B6EA 1WUTA 2AXPA 4UM8B 1Y33E 2DPHA 2HADA 2ORYA 4LZPA 4UNIA 1K5PA 3R9XA 1UJ2A 4JHXA 2PMBA 1K3FA 3LUBA 3GB9A 1M6YA 3CLRD 3LDAA 4EKIA 4IUDS 1G2IA 2ZIEA 2XAAA 4YCSA 3JQAA 4MPJA 4CEJA 3WBFA 1ULUA 1JTEA 1PG2A 4Q9JA 1J0DA 1RJGA 3PKJA 3ZDZB 4D9IA 3PWTA 5EJ8A 1EK2A 2IZ5A 1RQXA 1T9GR 2XTMA 4CR7A 5TQ0B 3LQ2A 3L7KA 3PFHA 3W8EA 5JSQA 5KWSA 4UULA 4QOFA 2IYWA 1MPTA 4BGDA 2PWAA 4N12A 1GGFA 1CX9B 1M76A 1QFJA 2WJWA 3E15A 3PS9A 2IUYA 1M2NA 2WM8A 5H16A 4AO8A 3G7SA 1N78A 1AKYA 5DV9A 4AJEA 1TZJA 2JGJA 4KLAA 3KWJA 5FNZA 3FUWA 4E2WA 3F6EX 1BMDA 4ND4A 4Z7OB 4UDNA 1YZHA 4Q34A 3TW8B 3F90A 1H0KA 1E8MA 4RVFA 5J59A 2L69A 4P35A 1XWWA 5JSZA 3ICPA 3OPQA 3NALA 3RE1A 5LMNB 5TMEA 2PSHA 2D54A 1M8JA 4BFZA 1N0UA 1HGXA 1RRPA 4EMUA 4QYSA 4AJIA 1JQ5A 5GINE 1Z5PA 2PRSA 5J5VA 2V0GA 5C34B 3AWIA 1DBIA 2Z43A 1W75A 1L4BA 1VLQA 2I4RA 2NVUA 4U2FA 4AP5A 1E92A 1PSWA 2WFLB 3WFZA 4BMPB 2RGNA 4O4IA 3W3AA 5IT4A 3USCS 1ZM9A 5ILGA 1KEZA 4HT3B 1W85B 4FGKA 1P2DA 1EZ4A 2V58A 4RABA 3ASYA 3FG9A 3BUSA 4MUHA 3NYQA 521PA 3S55A 1NVVR 3BDAA 4NCNA 2PNFA 4KODA 3JR3A 4OU5A 3ZV5A 1WMFA 4JLSA 5TX7A 5AXDA 1M1XB 3RC9A 3R5FA 4HYQA 5K3EA 5ALGA 3KFLA 2IGTA 1M66A 1TQ6A 1ZIDA 2Q3DA 3QEKA 4KN6A 3KQYA 2H8GA 3K9GA 2V7QD 4KPUB 4O2BB 4AS3A 2P91A 3OZTA 4WEQA 4AS2A 2JFHA 3NTRA 4WKCA 4KPFC 2C59A 4Z54A 1FFWA 4YJHB 5MFZA 1QHIA 3NXSA 5I7HA 1P1IA 3R7AA 2TSYB 2Z3VA 3DWFA 4RMGA 3QMVA 3UK0A 2AKAB 1QXSA 4I4LA 4KQ2A 5KDOA 4K05A 4XVUA 5HIMA 2R00A 2FRDC 2GS9A 1F6BA 4FDAA 1TAGA 4JI7B 1H2BA 2QM8A 2WKQA 4U7GA 3VH2A 2FK8A 5GONF 4OFWA 1D1TA 1SVWA 4FHDA 4GI3A 4HUJA 4LC0A 5LXTF 4N48A 5AVRA 1VM6A 3QWAA 5H1YA 4DMGA 2D1SA 3ANXA 4PZYA 4LGVA 1JSZA 5CHYA 2PXCA 5CK4A 3H2JA 5I4KA 1BWSA 4EHAA 2QMYA 1ZIPA 2ASVA 2XYHA 3GOQA 3O1IC 4JZKA 1YRWA 5LZ5A 2UVDA 3IDAA 1MIOB 3LGSA 1JX6A 1ZJZA 1EBBA 3DBHB 2LCQA 2FRXA 3DO8A 3E22B 4PBTA 2Q7XA 2W4IA 3F3KA 4LKRA 4F38A 2TS1A 3VYTB 2WYWA 2NYUA 4J0IA 4P8RA 2V7QA 5AO9A 5EQDA 4IZIA 3CF4A 3OIWA 5KSWB 3MC1A 2HT1A 4E1BA 3ROZA 4PYQA 1XZAA 5AOBA 3GG2A 3U7GA 2IF0A 2XZDA 3IRUA 3Q3GE 2D4AA 2E4AA 1UFOA 3H19A 2XNHA 1PQWA 4OI2A 4PO9A 4UXIA 5T4BA 4M1MA 4U3JA 4FR0A 1XEWX 3TF5A 3EXHA 4E31A 5T6BA 2NPOA 4NBNA 1A4IA 2ZKLA 3KYCA 1UC4B 5KYUA 1RC0A 4J0JA 4E4YA 5MN4A 4YCLA 5ALNA 4UFNA 3ICWA 1QX3A 1M8GA 3QOXA 4KJXA 1I4WA 1KZ6A 1PO7A 3QX8A 4MARA 4PCAA 1JG6A 2H18A 2ISSD 3EIQA 2NV2B 3EMKA 2IU3A 3CN7A 1AZTA 5BW8A 1M0EA 4HC4A 1Y3DE 3EARA 1RWKA 2RJNA 2H1LA 3KEMA 4A0FA 1V8PA 3EDCA 1KE1A 3S8YA 3HWSA 4GDMA 4BMOB 1SHZA 4M7OA 5A2QA 4RJLA 3MWEA 2Z1NA 3P2OA 4HUTA 3QMWA 2YHUA 4PS0A 1XCOA 1N5RA 3TQOA 3UAGA 1GUBA 4XJVA 3IBSA 2YFYA 2FJUA 3DDOA 4KXNA 3JQ9A 3TXYA 1V47A 4UTZA 2ATXA 3E8XA 1MB0A 4FFVA 3VU9A 4EGSA 3SXUA 2DERA 2DB3A 1I5EA 3CY6A 4PO8A 2GAJA 1H1LB 2OAEA 5HBRA 2JD2A 3KZKA 4YV2A 2C99A 4QUAA 1FVOA 1UFVA 2VN8A 4F9FA 4BNZA 1U7PA 2JLXA 1UZUA 1I36A 5LA6A 1ZSVA 3ZVLA 2XKJE 2WUEA 3JZFA 3CPSA 5TVGA 1NJ6A 2BEVA 1XNHA 1YS4A 2O7QA 3G1WA 2XDYA 3FYDA 3GD7A 4LFBB 3IP1A 3GRCA 1E3WA 4B8YA 3GRVA 2BW0A 1YV9A 3W4IA 4Q3CA 4MULA 4LXGA 3KD3A 4DBLE 2ZSAA 3VUEA 4DREA 4ZKDA 4C7OB 1L5VA 2P2NA 5EWLA 4DR1B 1RAEA 4PNEA 4JVNA 4LMPA 5EJ7A 1XVLA 5BW5A 3NOQA 4G09A 4HZGA 4RPKA 2QRJA 4L3OA 3IP7A 3H11A 5EJ2A 1GTG1 1E5DA 3MM4A 4WESB 3HMQA 4WOBA 1DBWA 1LDMA 1QHEA 5C18A 1GPDG 1GTVA 4EG1A 1EVQA 5TPZD 5T41A 1N2IA 1KDOA 1SBCA 4DA7A 1HEIA 3I32A 1NUSA 1T1JA 1YDFA 3RAFC 5SZHB 3L7YA 4BC0A 4J0HA 3CNEA 4RLSA 1T8WA 5DKFA 3B89A 3C3WA 3FHCB 3PHBE 4E08A 3L8GA 1YJQA 4DA4A 4YUWA 3KJHA 1WHTB 4P3OA 1C4OA 2O2HA 4WXMA 2FMFA 1CZKA 2BBWA 1WMDA 3E2MA 3I9NA 4OXIA 4ARZB 4E5SA 1JECA 3ETLA 5A0TA 1ZJJA 3HQ4O 4W5HA 3A1WA 3Q9LA 2ACVA 1LDBA 1M6VB 3DVQX 2EF0A 4FDVA 4WLUA 3NV7A 3U62A 5GJCA 1SU6A 1XI2A 2B69A 3M33A 1VHLA 1PGQA 2P9EA 3OU6A 3OOJA 4B40A 3B9BA 4B83A 1P7CA 1QNLA 1TB4A 2VEOA 1ZWLA 3Q3VA 1D2CA 4MYCA 5CFZA 3IMFA 3IB3A 2C4UA 1M6WA 2GZHA 4EA6A 5HPYB 2JCBA 1UKVY 4CQLB 5ALTA 4EJ6A 4ZYXA 2BN4A 5FA5A 4PGHA 3A4LA 3P97A 1HFEL 1TZCA 8ADHA 4MXDA 1U0RA 2XZTA 3L1JA 5TPZA 1ENZA 1BKDR 3TNFA 2O8CB 4KKVA 1GPLA 1ZHFA 1CUVA 3OBIA 2K5UA 3BD9A 3JQCA 2ODTX 1SQGA 5BQ5A 2HM7A 2YWFA 3C8ZA 3KCQA 4NV1A 4P0TA 5DEIA 3RTCA 4Q9NA 4QPZA 3THXA 1DQSA 3WIUA 2H4YA 1HNXB 4OM8A 4ARUA 4G9EA 3V7WA 2PH7A 3HB7A 3PNLA 5IBQA 1NF8A 1QDUA 3K5PA 4BASA 4BNUA 4XWTA 2OT3B 3AL3A 2VUUA 5M29A 5EHXA 2E18A 5CDHA 2G9VA 4I8DA 4CL8A 3OUTA 5DGCA 1QZZA 1TCVA 1NLYA 1P1HA 3PRYA 2IW3A 4EYSA 4AB1A 1K9VF 1XSEA 2XOKD 1OYVA 2NP6A 2IS2A 3AI2A 1QH8B 1U7UA 2DQZA 2PBZA 1OU0A 1FW8A 5ALDA 2PGOA 4ZZIA 3EE6A 3D64A 3ZV6A 4DB4A 4I1PA 1SURA 4NS4A 2E5FA 4PC7A 3G8CA 3TFWA 1HDGO 3H0CA 1GPAA 3HVJA 3H3FA 4M87A 4RZIA 4YMIA 2Q8PA 1G9TA 3O5AA 4M60A 3CISA 3DE5X 3M8KA 1L4HA 4DGSA 1FQOA 3RSSA 3LT0A 1E5QA 5HK9A 3MD0A 2I2AA 3D4PA 5L6MB 4DOMA 1BD4A 1A7UA 2E4YA 4EHBA 1B8PA 2IUEA 3RSQA 2F55A 3CR7A 5BW6B 4PZAA 3JZAA 2OCXA 2QRZA 5EIEA 2A67A 2X5OA 1M2VA 1M34E 3UC5A 1LPOA 1RI2A 3I9KA 2QROA 2Z8XA 1DL5A 4IW3B 2IP4A 2XUAA 3HB4X 4CU2A 4F60A 5KUTA 2NMVA 1SXGA 2GRAA 3FYHA 2D3WA 2OXCA 1AKQA 2QL6A 3GPIA 4MEBA 4BX2A 3E9YA 2PD4A 3IHLA 4CG1A 2L82A 1BDBA 3KDSE 3RBVA 2VHWA 3E2PA 1JMVA 2ZQYA 5KYVA 1WUIS 2DWUA 5K0SA 1FX0A 5BN3B 3GGOA 4IZ6A 1ZVQA 3P7MA 3UOAB 4Z49A 4LMRA 4GZ6A 3O2NA 3ET4A 4NCAA 2M9MA 5AUQA 4UAGA 4K03A 4F3TA 2QN6A 3W3AD 2XOKA 5YASA 4B34A 3WNDA 4D9GA 5SZJA 1OOEA 1FDUA 4ESVA 1L7DA 3BWDD 1MV8A 2QTWB 1G60A 3OMXA 3PYMA 3WB9A 4JLMA 4YV0A 5K09A 3FMVA 4QGHA 2OZVA 4KU4A 3GDHA 2OCIA 3AESB 2MR5A 3E8MA 1NVEA 1RMQA 2VPPA 2RGCA 4OKSA 3LHKA 1PVVA 3VU0A 3MJTA 4HAOA 5AR1A 1MW9X 1NQXA 2XIJA 2R7NA 4TPKA 5DM70 2XUPA 4OQZA 2JGAA 3C45A 3B6EA 3PICA 4KREA 2H5IA 3RIYA 1H2WA 1N1GA 3EXFB 3AYXB 2ID8A 4N7RA 2BHLA 1QCYA 1N6OA 2GUWA 1KHTA 3A6HA 1FTWA 1BFUA 1EUCA 4E70A 4NCBA 4GZ3A 1XCJA 1A9TA 3TS1A 4DARA 2A33A 1Q84A 2ZTSA 3R5XA 3VU1A 1QO0D 2AWNA 3DVLA 5T3YA 4F3KA 5J23A 2IHTA 3GWZA 4ML3A 1ODFA 3K7EA 2CWDA 5K2MA 5EA2A 3W9BA 4B79A 3A9CA 4FSHA 2CLKB 4XYGA 2HLDD 1YB7A 4K9SA 2QGNA 4JL8A 2HDOA 1P2TA 1A8SA 2H1FA 2OVBA 1LVHA 2V5AA 1UWKA 2AQHA 1UIMA 2V7GA 3HDJA 3JVUA 4YAGA 3KEGA 3MYYA 1B1CA 3KAPA 3PFBA 2JLVA 3I2IA 4X8HA 4R98A 2PKQO 5IC6A 3G13A 4WACA 1ZO8A 3BCUA 4A6EA 3PE3A 1TVKA 3NHBA 4XGIA 2P4EA 1GZHB 1LPBB 4PZUA 2FW7A 2X5JO 3TXXA 4EJSB 3GMSA 2R6CA 4OHFA 4CDRA 1NVDA 4JV5B 1UR5A 5KOHB 1PL6A 3TSWA 4BNFA 1QKKA 1SOVA 1XZJA 2QJWA 1Q95A 3CLTD 3PL1A 5C2JB 1QHXA 1Q3HA 3PXAA 5AVXA 3UNXA 3I28A 3VSAA 2DEUA 4HVAA 5CH8A 3RHZA 3IUJA 2VQEB 1JSCA 3RVKA 5K6AC 5AJUA 2VZLA 2HIAA 3TUIC 3MINB 1TNDA 1QO0A 3NM6B 1LJ8A 2OO7A 5A05A 2IU0A 1F7UA 4KACA 5D00A 3ZWOA 4HPXB 3BHIA 3I45A 2Q3FA 4EW3A 3A6PC 3PUWA 5LD2B 3G6WA 3FNBA 3E5HA 1WTAA 3U0BA 2HLDA 1MHTA 5JTTA 1Q14A 5DWDA 4PHHA 5HUJA 4NXMB 5INTA 1LX6A 1MT3A 3HM9A 1AZSC 1XU9A 2AMFA 3PK0A 3MMNA 5DMHA 1KKUA 3LVQE 3MCVA 5JT1A 2CJWB 4NVRA 5SY9A 4LQDA 4PC6A 2O06A 2RARA 4LAFA 4TMKA 3LL7A 1G8FA 4HD8A 2O8DA 2XXJA 3W4JA 5FWXA 5HW0A 1A50B 4AZ3A 4JEMA 4B3DA 1JAHA 4CF4A 2QTZA 1D5CA 1JWBB 3DYIA 2J3MA 2O1XA 2OWDA 2R6ZA 4M1YA 4A91A 5KQLA 3TVYA 1D09A 3SX2A 4M7WA 4YB8A 3BAZA 1Y8ZA 2JZOA 1HDZA 3P1JA 2ZYGA 4NY1A 4NBWA 3U60B 1QJ4A 1SC3A 2J5BA 4R0MA 1N36B 1ZCZA 4MUXA 3DKKA 4MW0A 4LGMA 4OQQA 7REQA 2WVGA 5L3SB 4LDNA 4N7JA 1CC1S 2OV6A 3F73A 1TAHA 3PTAA 3IP8A 2A0UA 3A6JA 1CZRA 2FUCA 1IJBA 3QNWA 4CTMA 5JJKA 1S1MA 4CM7A 3B60A 1GSAA 1R4NA 4NNPA 5JXGA 5ELXA 2PZBA 4DV0B 4GO1A 1AKMA 3GEHA 4KP7A 4QUJA 1V39A 4WOPA 4BAUA 2C7VA 1I32A 5K0NA 4DM3A 2QX4A 4PSKA 2GERA 5E4JA 1GUAA 3ZDEA 4YCMA 2IT1A 2KS6A 3JCZA 4IV8A 2I33A 4WK6A 5J4LA 2A1IA 3U9SA 2JD1A 2VLBA 4C76A 2I99A 3L8ZA 3N3BC 1U6JA 1DX4A 1H9AA 4JODA 4NONA 4X8MA 3PXGA 3KS9A 2I2BA 4TQ9A 3SNKA 1J5XA 2H06A 1I6LA 3ZJYA 3E9QA 1U90A 5JQGF 1KOFA 4F6RA 1ZBQA 3DT8A 3IS3A 4OTZA 4MGZR 2Z6VA 3ZV4A 2XNCA 4MQ5A 4ZVQA 4OHUA 5IAJA 4DCSA 2WTNA 4CHTA 5DFAA 4FNAA 1OFTA 1B8UA 2XE8A 3NM4A 1RMTA 4DIKA 2P9TA 3NNNA 3PC8C 5DTJA 4J7XA 1HWYA 1MGPA 2QRHA 4EUSA 4A1FA 2PMKA 3PP8A 2EF1A 1FP6A 3ABZA 2HHJA 4Q5IA 2O8EB 2VAWA 1WV1A 2QQGA 2C54A 1C29B 3D3NA 3HRHA 5TJHA 3I39X 5ER9A 4GR9A 1NBIA 2RDMA 3B6JA 4XYMA 3MLEA 4PWZA 1N33B 2ABWA 3U4QA 1KIMA 5AW5A 2COKA 2IC5A 1M8KA 1UDBA 2B4KA 3A28A 3CVXA 2QE7A 1SUCA 3W5UA 3N07A 1K08A 3ZU6A 4MQBA 1NULA 1DPGA 3G5AA 1E99A 1GWNA 4C5CA 3WO1A 2YZKA 4J8PA 4L8GA 4GM0A 5KKAA 4R1NA 1SKMA 1YBHA 1KYQA 4IRXA 3WQQA 3AI3A 5JZOA 2NADA 3DDZX 3T1QA 4Q7QA 4B2PA 2JLWA 4YRCA 4R2XA 4EG5A 4JASB 3UT6A 1SWWA 2E55A 5JROA 2WIBA 1W9HA 5JZSA 4QDJA 5D6OA 2P7HA 3VOSA 4FQ8A 5D51S 3W9YA 2XT9A 5H7XA 1Y80A 3IBGA 3OECA 4D5GA 4D8XA 1XTZA 5COAA 1G8JA 4NZZA 4ZQGA 1V1JA 4ZEMA 1WW8A 5I4BA 1S96A 2HRDA 4JKIA 5AM2A 2C8LA 4FGWA 4LV6A 2MU1A 2F3TA 2CNKA 1BHJA 4QU5A 4RCZA 2J6BA 1FB5A 1PFUA 1A0OA 1FZQA 4GYWA 2RG1A 3RABA 3RS4A 4QUKA 5H82A 2ZCVA 1Y6JA 4OU4A 2XR1A 5K45A 4NYIR 2A5LA 2PMWB 5HIAA 3VHLB 3TLAA 5CBKA 3G1TA 1Q7EA 2GT1A 2Q6LA 4X7PA 3KYDA 3I01M 2J0UB 2O8NA 2IV7A 1O8BA 2C9MA 5BSRA 4TXLA 5TS2A 1N0IA 4C5BA 1IZ8A 1E64A 2C97A 1THGA 4PZEA 3UBMA 4JUCA 1QLHA 1TYCA 3QUTA 1NQTA 2FMHA 4E22A 1C8KA 4L5CA 1ZJYA 1ZK3A 3CTPA 4UDYX 4DV2B 2RGWA 2NO0A 4WECA 1AS3A 3F4KA 3T9DA 4DRXB 2W6PA 3B53X 3G89A 2KW5A 5DHPA 1XCGB 1YXMA 3OZSA 3KE9A 1JPUA 5LWQA 4LVUA 3TECE 3ITDA 3EZFA 5AK3A 4RJKA 3ZS9A 1RZRD 2I7XA 4R4JA 4YGXB 5ALXA 3FPBA 3VR3D 5BSMA 4OREX 5AI9A 3I52A 4CL2A 1Y8RA 2G1JA 3M7IA 2XUGA 3AVUA 3AERA 5JS2A 4BXOA 5EGSA 4F21A 2Q6IA 1VLHA 2NUPB 1OIWA 2QDKA 4C2AA 3W6ZA 3AHDA 5DASA 1XAGA 2EL9A 3VHRA 3INRA 4RK0A 5CJPA 5I8WA 3DQPA 2ZPUA 2ADMA 3F0TA 3Q12A 1L7BA 4ZEVA 1L4FA 5DWVA 2AZ4A 1BMFD 5AVKA 1ZN9A 2NXCA 1TU3A 2VWHA 3DONA 3WJ2A 4TSKA 2ZJ7A 1PSDA 3FCXA 4Y2SA 3AJDA 2NT3A 3ILSA 5ALUA 1LLFA 3BHMA 4EKNB 5DRTA 3U7QA 1Y4SA 4OYLA 3HNOA 3IXQA 2QVLA 3R5KA 2NT4A 4CV1A 4KKXB 4MLZA 1C7RA 5IULC 4NG5A 2I1VB 1XD2B 5LYJB 4N9QA 4WUTA 4V39A 3T15A 2JJ2D 2K7ZA 4KMRA 3AFIA 3QLTA 1HT3A 2FEWB 1R6TA 2H2HA 3L8MA 5KYYA 2QP4A 1DRUA 2HMSA 4F86A 1KC3A 3HI4A 3GDWA 3GZJA 4QLBA 2QIOA 1W35A 2QVXX 2ZGVA 3PC6A 4XVRA 4G63A 1U3VA 2PNJA 1ZVJA 5LQSA 3W8FA 5B6PA 3TNYA 1X38A 1FTGA 3KUCA 4KQJA 4DDVA 1RZRA 2QORA 1M6HA 4JL6A 2WUFA 2XXBA 3EGWA 1TUIA 2QD3A 4N6OA 4NAUA 1L9KA 3DLBA 5TRTA 4X64B 4A5OA 4HDRB 3UGTA 3VJRA 2ZJYA 4HVTA 3V4OA 4DBZA 3OQVA 3C8HA 3U39A 3QKSA 3THYA 3GGGA 4G0QA 2XQJA 1BMFA 1UMDA 1Y9DA 3T3IA 3BSYA 2PY6A 5EIHA 2PFSA 4RVHA 5DLDA 2I22A 2WHQA 3BQ9A 3NEYA 3NTQA 2QTFA 2X4LA 4NJOA 4NV0A 4X1KA 3ROMA 4G0MA 3DFKA 4TQGA 5EZYB 2ZDGA 5THXA 4D3FA 4UE6A 2OHIA 2QLBA 5B4TA 4UXHA 1PEKE 1GQOA 4AF7A 3MOGA 4UQLA 1DDOA 5B3KA 3DBIA 1QAQA 4JLDA 4FFNA 1YUNA 3KT8A 3H8VA 3LCJA 3O21A 4Y1RA 4HGNA 5AKEA 1TXGA 1TM5E 1LC0A 3S8EA 1OYWA 5CCDA 3NHFA 3T4EA 1KAOA 1E2DA 1MJGM 5HP4A 4EY8A 2GTHA 2W2QA 3P5BA 4JBYA 4O2AF 3F78A 3DZHA 3ZCSA 3ZK8A 4AI6A 4O4JF 1FMCA 3MSCA 2ZIXB 5ICMA 2GEDA 5JS7A 3THWA 1TEVA 5C8YF 5JDCA 3MBOA 3QJYA 4L73A 4MKHA 4F2GA 1TVMA 3FCYA 1JB1A 4J7CA 3SKXA 1X7YB 4Z4GA 2HU8A 2NVOA 2PO7A 1LY1A 3QITA 2HIMA 1GXSB 2A9JA 4QQFA 1E2BA 4RZ2A 5CDYA 4G8BA 3RSGA 1OTYA 1TQ8A 1KO4A 1NM5C 2MSKA 3IUYA 4UKDA 3RYFB 4M1SA 5JJIA 1NXXA 4PX9A 4H1TA 3OIUA 4OQYA 3UMVA 1PNRA 4HWPA 4KFRA 3F8TA 3ROPA 4KSYA 3TUJC 1EFTA 3AEQA 3MUOA 1VPVA 2AL7A 1RS0A 2VHCA 1G3QA 2X8LA 1UXHA 2A5DA 3O9MA 4IKOA 5EMHA 4AJ1A 1Q0SA 5KS2A 3QBJA 3B51X 5FCDA 3TPFA 2BMFA 2Q4RA 1E4VA 2FCRA 5AJTA 1K89A 1Z35A 4AJJA 1G66A 1Y8CA 3W8DA 3A27A 3CZPA 2NU7B 2BM9A 2YXNA 4JR0A 4NU8X 4P4LA 2FPLA 3CRZA 4F12A 2PQ0A 3G0IA 2PZGA 3MRSA 3F5QA 4Y7CA 3ND5A 3PUXA 1QHHB 5CK5A 4TMVA 1JG4A 2QAGC 3LY5A 4GM4A 1A71A 3ZLUA 3R0QA 3R44A 3I1YA 3QWHA 1F06A 1MABA 2YV1A 1Y8AA 2R1VA 4YLEA 1V4VA 4U2KA 1BN7A 2V0NA 4BNLA 3PFFA 1VGRA 3CLSC 3CPHA 4M86A 1ZOLA 3GOHA 1MVOA 5B4VA 3VNVA 1GKLA 1YDGA 4KTVE 5AHRA 2HSDA 2XCOA 5FF9A 1OROA 2AHRA 3VNAA 2HTEA 3EZXA 1U0SY 3HUDA 1T9CA 2D2FA 1KFCB 1TO2E 3QVGB 1YJAA 4IJMA 5BN4A 1HDIA 1DCKA 2IUSA 3G3EA 4GPD1 1N5OX 1SZJG 2PAFA 3VR1A 2BTOA 1IIRA 1E60A 3QV1A 4PSCA 4YT8A 3KJEA 3GFPA 4JYZA 3SR4A 4CKWB 4O2LA 1OFUX 1Q19A 5AWFC 4B4UA 4BMNA 2GBPA 1RHMA 3DMDA 4V0SA 5CLGA 4JT4A 4L8LA 1BHSA 1T8SA 2CNLA 3KTAB 2WZBA 2ZI5A 3C8UA 2DHRA 3IEPA 4OGKA 3SQLA 2EARA 1G5QA 2FFBA 4CNQA 4ZICA 5IMSA 2WVHA 4O33A 1MC1A 3H18A 1UWLA 4TWRA 4Z3KA 3N8NA 5CVCA 2XAUA 2RH9B 2Z5VA 3GJ7A 2H3EA 4D4LA 1K6IA 1GGJA 3OVMA 4MB0A 3CNLA 1U2DC 1UJ5A 3QVWA 3BMQB 3FFXA 1UC8A 3QFCA 2WHPA 1GUDA 1MH1A 1XQYA 1ZQ1A 3BIXA 2AA3A 2GJ9A 2X2FA 4IMIB 1JLLA 1WXQA 1YBVA 2O1WA 2ZSBA 2ZWAA 3BQMB 3HU2A 3UPDA 4AYTA 3QENA 1B43A 4XEHA 1KA9H 4IIJF 5I7WA 5KMGA 2IYYA 4DLBA 4FDTA 5F9MA 2A9PA 4KR7A 1ZH0A 4IWNA 3TZQA 3KWLA 2ZJ3A 5FI5A 1C5KA 5PGMA 3MT9A 2GBCA 1VL8A 1E1YA 3AB8A 4FX2A 5JMOA 2D2EA 2WWVD 5JE8A 1J8DA 4JC5A 3NHRA 1QYXA 4HAIA 4RVUA 2CBZA 1UPTA 4Z0TA 1YMVA 2I2XB 1AHNA 1WDKA 4J3FA 1I4EB 4MMYB 3UKJA 2XOEA 2C8JA 2IODA 1NW3A 5IG2A 2NXWA 1KQGA 1ZLXA 3DULA 1O7JA 5DULA 1YQTA 4KPGA 4QAJA 3ELBA 3JYPA 3O90A 1LD3A 3Q40A 2IRWA 2O0HA 4RZXA 5IBRA 1XTIA 3FFWA 3CZRA 1QR6A 4HFMA 4TWZA 2XGSA 1R6VA 1HKUA 1KEUA 2PSFA 4I9GA 2DLCX 4DIDA 2IHNA 2AX3A 1NMYA 1KPIA 4P4SA 2WV7A 4R8SA 1CRQA 3WL6A 1M73E 4A23A 1E2GA 3ODPA 1B6RA 1NU6A 4MUMA 1JSLA 5AKHA 4QAQA 5FWYA 3GNQA 1M7BA 1TEXA 1RACA 4MTLA 1CJCA 4NK4A 1SAYA 3BFPA 3O4FA 4DSNA 3ZVNA 4E09A 3OF2A 3EDMA 3KXIA 1GGMA 3LLMA 1ST2A 3C97A 4GPAA 4EHFA 5COBA 1FUKA 2R44A 2IYSA 2B92A 2ARKA 3PA8A 3QWFA 1XC7A 3M0EA 3KNZA 2Q99A 1H2RS 1LPAB 3SNHA 3A6GA 4CKZA 3MA0A 2AI2A 3PDIB 1U0FA 5T4FA 3T95A 2WIJA 2WILA 4M9RA 4UZFA 4Q19A 4RK6A 3UA3A 1ML4A 4XVHA 4U2BA 1C7ZA 2J87A 2P5TB 1IQRA 3CLUC 1YCFA 5BYKA 5LOVA 8AT1A 5LP6B 2BGGA 5JNUA 1C7IA 1SHJA 3R3WA 4WCFB 3PJRA 1NF3A 1G8HA 1TYAE 1VJGA 2BMAA 1RWNA 3ED1A 1E3IA 4ZGBA 1Y63A 1WP4A 2XITA 5TMBA 4Q66C 2EFHB 5J40A 3KUDA 1IQUA 3WP0A 3AM5A 4CL3A 1L7OA 1IH8A 3LF2A 4GRDA 2JL1A 4ZK6A 1USUA 3EBLA 3Q6MA 4JQOA 3HMKA 3PE6A 5KAPA 4BDTA 2Y1GA 1E2IA 2OHOA 3QXSA 4NL4H 2REOA 5EOVA 1FSSA 3RBXA 4DA9A 2BKXA 3DAHA 3FWPA 4RVSA 1PK7A 5GTDA 2QX6A 2R6R1 2BYTA 2GEVA 3LPLA 2P1ZA 1I4OA 2Z1MA 3HCWA 3O4VA 3MCAA 9LDTA 2NPIA 1CETA 4HQOA 2XYVA 3VPCA 1JALA 4LK2A 4HTAA 4U9UA 4DQ0A 4YCAA 3RVLA 4WL0A 4E7OA 5JXIA 1G8GA 3HCCA 4TUYB 5CXSA 3WDSA 4C2TA 2G5PA 5EFZA 1PK8A 2CXXA 2EU8A 2H2WA 1U80A 5L51A 3O7WA 4FHEA 2H2DA 1ZRSA 3TUZC 2G07A 4Z1MD 3DDNA 3MWDB 4ND5A 1VKNA 2CMHA 2O9JA 3VO2A 5ADVA 1ZC3A 1U2GA 1CEYA 2WT9A 5KTKA 1DJMA 5FR2A 1VSTA 1Z47A 3GEGA 3TW0A 1U1FA 2B4AA 3O3MB 3LYAA 4L4YA 3CUKA 2QL9A 3FCSB 4RD6A 3C24A 3HV0A 4X20B 4XH9B 4EWLA 4RAOA 2C8KA 3H5OA 5MGBA 4NCKA 1I4LD 3KIPA 2QLTA 3NC1C 3QVVA 1Z2OX 4X90A 4WJZA 2YS7A 4IPTA 2CXNA 3FGZA 3FUXA 1U4SA 3GBPA 1TX4B 2Q28A 4KRXA 1EMDA 2CJPA 1YKSA 4DS3A 5K8VA 4MCIA 4ERNA 2XA9A 2ZJ1A 3ELYA 3LUPA 4XUGB 3WJAA 1EXNA 4BB5A 1VSQA 3PNYA 3F8SA 4D4GA 1IU9A 2OZLA 1BO6A 4AIRA 2ZWIA 3HK2A 4FFWA 4PPQA 3JTEA 5AH0A 5D7NA 1XLVA 3ZWAA 3OFJA 1HQYE 3MTQA 4G4JA 3PHHA 4K88A 5NULA 5TEVA 5AIBA 2Y68A 3DB2A 3KPYA 1QTQA 1UZMA 3LUFA 2QPAA 2CMFA 4FOTA 4WFJA 1OX5A 1KNQA 4Q4DA 4XFKA 3UMSA 4CODB 2QYOA 3CVUA 1E3DA 1PGNA 4CYMA 2PUGA 2CLHB 2WWRA 2POCA 1GQYA 3FXAA 1G42A 3I23A 4NZPA 4WXRA 1SY7A 5B58T 4C14A 1ULSA 5CBPA 4Z1MA 1T4CB 4DQUA 2I3BA 1KJJA 3G8YA 1W29A 2D7JA 8OHMA 5IYZA 1JZTA 2C83A 4J1NA 4DZTA 2IE8A 4ZI7F 2VPTA 2H92A 4YYEA 4Z5XA 1P0QA 1Z6AA 3OCVA 4HXYA 4MV1A 3QPVA 2NSDA 2PEYA 4CMJA 4REQA 4BZPA 3OSUA 2WYUA 2WQ7A 3AR4A 1CQIB 3F74A 1HX7A 4DJJA 1F4VA 1BC5A 5F5NA 2VA8A 1U98A 1C9YA 3G17A 5G0TA 2VTEA 5HMMA 3TAUA 3GLUA 5CYPA 1HSOA 1XZQA 2BFDA 3M6FA 2P40A 3HLKA 2V9PA 4IIUA 3RTGA 1SBIA 4KN5A 3I6IA 4RVDA 4RA6B 1TK3A 2ZWPA 2PS3A 3H6KA 4Y2JA 1G8KA 3MBKA 1H2ZA 3ZIDA 2B34A 4JA2A 1X7HA 4N4AA 4O25A 4ZU3A 6CHYA 2I6SA 1NVTA 2H07A 1OXVA 3E18A 3HI6A 4M0LA 4UE3S 2NP7A 3L0DA 2VYVD 5KYGA 3K92A 2J3DA 3CG4A 3IALA 3CF0A 4A4DA 1KDRA 4MO9A 1TUEA 1FXWA 3PX3A 4M89A 1WHSB 1BYUA 2O52A 4OAPA 1B00A 1KMHA 3B82A 4OYYA 1CP3A 4LIPD 4RCYA 5E0OA 4WZBB 5IJZA 1A4UA 2YXLA 2QLFA 3KFVA 1OFVA 1P5RA 2EOAA 1TT5B 4RH0A 3T7RA 4A2CA 4DMHA 5BVGA 2GYVA 2PPVA 5E4TA 3NOXA 3UAYA 3NEAA 3R0JA 2V7BA 3LT5A 1G8SA 1ND6A 3AEUA 5EMLA 2FG7C 1S7GA 3GAFA 4TKMA 1VKRA 3PGMA 1WETA 5F4BA 2HGZA 3BT7A 1R0BA 3NORA 3BIFA 4EGJA 1ZUHA 2BUBA 4BGIA 2FDCA 3RYIB 1K92A 4RD4A 4XFJA 3TRFA 2PQ6A 3FCCA 4XGNA 1K7FB 1PBTA 2Q1UA 2IYOA 4MWZA 1E58A 3IE1A 4TTJA 5D2CA 1KSGA 1VCMA 4B3FX 2D5AA 3VR0A 1UKBA 3IQFA 5EUBA 1QNFA 4I50B 4RZ3A 4QTXA 1K0UA 1Q20A 1E2NA 4PAMA 4KOEC 3UEOA 2ZM6B 2PA3A 2NU6A 1NY6A 3U0VA 1S2DA 3GRUA 2GILA 3QLUC 2Q1WA 2IS4A 2PKEA 1R9JA 2VYVA 4CIAA 1KZ1A 2DUNA 1B16A 3LMKA 3S29A 4EX6A 3ZWYA 3E5MA 3GJYA 4XX0A 2OQVA 3U37A 2JKYA 4AWXA 3QW2A 2QUKA 1M9NA 4W8OA 1PP4A 2XZOA 5ADHA 3Q3CA 2RGXA 4PXAA 5LLSA 2JGLA 1EBFA 3CSSA 3WAKA 2BONA 1X39A 2CXUA 2YH2A 1F48A 2Z30A 3R4CA 3W7VA 4XYLA 5KQPA 3V6LA 4MCJA 1W52X 2GPWA 1UK7A 2HA2A 3PNVA 3L77A 3RO7A 4HG2A 2X9LA 2DZDA 4ID9A 4URZR 5J58A 4LJ7A 2XKAA 2E5WA 2J9FB 3D7MA 1ZSNA 3COYA 4L15A 2JC3A 4GOLD 2QQEA 4RS4A 5JD4A 1PUJA 3ELWA 4XTCS 5J5CA 2J3EA 2C9BA 2HK7A 2GN8A 4KK4A 2I91A 2A5JA 4M21A 2EL7A 3BTVA 3L4KA 1FQJA 4ZAGA 4QBKA 3Q4GA 3UHPA 5KSYA 5ITVA 2FPKA 1N2CB 2CUNA 4X1YB 5KYNA 2H4HA 2IZ1A 1S89A 3JTMA 5JPIA 1ODCA 1P5ZB 1U1DA 3IQGX 3O1JC 3RS2A 1O1YA 3NHKA 3JSXA 4WFKA 2OV8A 3B1ZA 3WNZA 4Y2PA 1G3MA 1B8VA 3IPYA 1QIMA 3DEZA 1AGYA 1J56A 1ZD2P 1T0IA 2VRBA 2BGTA 5ELMA 3R7SA 2CJXA 2UUOA 5KOIA 1LNSA 2CVFA 4BV8A 3SDSA 3VVLA 4FFLA 4CLDA 1P8AA 3P8ZA 5C8DA 1XPRA 2CV1A 1S2MA 1OTHA 3CEMA 1JS1X 3M6MD 4NJEA 3T5PA 1C14A 2WAXA 1EA5A 2ZATA 3EGIA 2Q1YA 5JSHA 3SBXA 1EA7A 4X60A 1MR3F 1D4ZA 1IHYA 3P19A 4LZJA 2FN8A 1QORA 1U3TA 3ZGOA 2EZ8A 3RU9A 3KSUA 4EKGA 5BWMA 5E7IA 2FKNA 2VBGA 5KTNA 5HR5A 1SELA 5M04A 5T3UA 4FWBA 2OAQ1 1UP4A 3L6BA 1N2GA 2EV9A 4YJ2F 1JEQA 1FSFA 2P3OA 2UZ1A 2AG1A 1TJ3A 4Q7LA 3K53A 2JBWA 3E27A 4PHCA 1DBPA 5LYYA 1KDVA 4F4JA 5AVYA 2RB4A 3OZRA 3PZBA 1TCCA 3CUUA 3ZNNA 1OZ0A 2MR6A 5EP3A 4R9VA 5FTLA 5LDDC 4DGQA 3F6RA 4W7HA 2DULA 1HURA 3H9QA 3NHUA 4TV8A 5FNVF 1FTSA 4D0SA 1IDN1 2CFIA 1KU0A 1BHQ1 4WXHA 2QTGA 2PG3A 1QANA 1JAYA 1JFRA 4V1CB 1MCZA 2QRVA 5CUQA 1EX1A 2JLRA 2PIDA 4GSLA 4BFLA 1PHPA 2WOOA 2NYVA 4UQPA 4WNIA 4RQAA 4HQLA 4L0DA 1J22A 4PCVA 1AV7A 3GQVA 1CS0A 4UEJA 4PONA 2EWVA 5JFGA 3GFSA 4FDLA 4DQLA 4C6TB 5IXJA 2ON6A 5LQKA 1GUZA 4QYIA 4C05A 4Q4LA 5BNIA 2YYSA 3HCRA 4K5QA 3RS3A 1L3IA 3RRZA 3GUZA 1TD9A 2P0YA 2ZS9A 1LQUA 4R2JA 1SCDA 3UPTA 2BKEA 5J2UA 2QZZA 1OH6A 2HA3A 1UOEA 4OUDB 2R66A 1VE5A 5D01A 1XMVA 3FCOA 4ZVMA 1F7VA 3V80A 3Q8LA 1HKHA 1TKAA 2VHZA 3DHYA 3LP6A 1JKIA 3PFNA 4L5IA 2HA4A 4CLRB 5BPFA 1BDHA 1F8GA 5KJFA 4B5KA 4BB0A 3B7PA 3L6UA 1Z9BA 1H3FA 4WZAB 4L8VA 4IJUA 3L0PA 4D97A 5JATA 1LWNA 1F1JA 1LSOA 1RKUA 1YULA 2DBYA 1SBHA 5I45A 2QZ4A 3UW3A 5CA0A 4LQCA 4G5XA 2VQFB 1LDEA 2JFZA 4F4FA 3HABA 3O8OB 3AEKA 1S0UA 3AJRA 4PY2A 4US1R 2CF5A 2XMBA 7ADHA 4BCBA 4NXNB 4BKOA 4RJTA 2Y77A 3ZHOA 3IXLA 4N0EA 1R9GA 4UU1A 2X40A 1NVBA 1FNSA 2NVWA 3VR4H 1KL7A 1G2PA 1P7VA 5DHTA 1BEEA 1I30A 1GTMA 3A8TA 1D5WA 2H6EA 3CMCO 3ESRA 1YS9A 3HU5A 4PYKA 1NVWQ 2A58A 1K27A 4JR1A 5H80A 4NQRA 1NNUA 3T5AA 3ASVA 2V7UA 3C3DA 3G7NA 3IEIA 3ORRA 4MV0A 5DN9A 2E6KA 2GWHA 1GLGA 3ZC3A 4ARAA 4EENA 5AW6A 1KIAA 3SHVA 1UWCA 2J30A 4KI0A 3JWGA 4JP2A 4WV3A 3QUBA 1JZQA 3FDJA 3ER6A 5JQWA 5CEEA 2G0AA 1VB3A 3QLJA 1YQGA 4OX9B 4J2TA 1Q1EA 4PV7A 3DHVA 1LRKA 3M49A 3U09A 2QHXA 3BXZA 2VT7A 2CVPA 5KQMA 1LSUA 1NXOA 3H2GA 4IMPA 2Z2KA 3UCXA 3CKKA 1R0XA 5K3CA 2C92A 2N9UA 1PLJA 4DIBA 3RFCA 3PITA 3ZVMA 2EZUA 2R60A 3K15A 4H27A 1DEOA 3VNRA 2GQ0A 1XXHA 3N8HA 3PI7A 2D0PB 4KFCA 1RQPA 3PDCA 5D3QA 1PFVA 3K9FC 4CMEC 3CVYA 1D8TA 3BRSA 2DY1A 4A8JC 4C87A 2PUWA 1DXYA 1QHYA 1ZD1A 2MWMA 3GEMA 4PLYA 1VJ0A 2GBGA 2PGXA 1VDMA 1WM1A 1N5DA 2YWHA 1OAAA 1V7ZA 2B82A 4MCAA 3QPAA 3AQ4A 4QXOA 4NFHA 2V4MA 1NVVQ 2WLTA 1OLXB 1Q3TA 1RAAA 1TRKA 3AEXA 3DBVO 4KVGA 1JUDA 4Q4CA 4B4WA 4HAXA 4WOJA 1F5SA 4Q39A 1BHO1 2AJBA 3JWPA 4FDUA 5FFFA 3ITNA 2B99A 2ZAMA 4YAKA 1Y7TA 3WMXA 3RAJA 1F5NA 2ZBDA 3EXEB 3ESAA 3VC7A 4JD5A 5A5GA 4FM9A 1FNBA 3OP1A 3X1YA 4G25A 1UBOS 1BCRB 1V9CA 3VNBA 4KBGA 1MEEA 1XKXA 2HK9A 3I53A 1IN5A 5IH7A 1SUEA 1Y8QB 4JROA 1WP9A 1C9KA 2ESRA 2EJWA 2IV2X 2B98A 1S4MA 4Y67A 1F9AA 1TM2A 3BAFA 5DBIA 3CX4A 4N49A 3H1AA 1ZNQO 2CEAA 1E9RA 2JFGA 2ZITA 4OAQA 1FFAA 3R4VA 1QRUA 3OLXA 5GJBA 2GDJA 2HREA 4D98A 2CGEA 2X3YA 1TF5A 1BOOA 1HEYA 4G26A 4WTOA 1PJLA 3I83A 4L2IB 3NIWA 3ZU3A 1PL0A 1Z6GA 2RHDA 2XDWA 3NC4A 3PNOA 5CXXA 3E70C 2HBRA 1T36A 4BTVA 3OU2A 3SGLA 3GJQA 4IEEA 1FJHA 4KK3A 3NNDA 1PJ3A 1H2YA 2QOEA 1OU4A 2MSWA 3EDQA 1F20A 4N82A 3PIRA 4PWYA 1SUIA 3BH7A 5FAXA 5H3LA 1YTLA 1SJ9A 4HMQA 2PL3A 5DYYA 5DN6D 2PX4A 1F2UA 1APBA 1W4BA 1ZGJA 2V03A 3HB5X 3P96A 3VM6A 3T3GA 4D42A 4JJGA 1BQEA 5COQA 4IO1A 4WGFA 4BRWA 1O95D 5DNCA 1RAHA 1CEQA 1OT3A 2ZBGA 5CB4F 2B37A 3WGGA 4QGFA 2QTHA 1T8UA 3A6FA 4LS3A 4RA9B 3RRXA 5U9CA 1KQFA 2RHHA 4Z9XA 3HVIA 4H1WA 3DEYX 2JFPA 2HHCA 3DKVA 3H1GA 4BU1A 4E1AA 1DCFA 2P30A 2FLKA 5AOCA 5HE8A 1RWWA 1K5DA 2GCEA 1ADGA 3GMTA 1DKLA 1DWQA 3PC7A 4GLLA 3V4LA 1FFXA 1XK6A 2B1QA 1TQHA 2Y1DA 2C03A 1NT2A 1ISIA 1LV8A 2P79A 4RHEA 3RVPA 1EYZA 1R3DA 1KWKA 2WQ6A 1CEEA 2H1IA 4O0LA 5A0VA 1FQKA 1VRWA 4I4NA 4LVCA 2N3ZA 1NUPA 3KSBC 2VO1A 4HTFB 5A4IS 1U9IA 3G2OA 3STUA 5JBQA 1IZZA 2UZ4A 5JAIA 2QA5A 1UUFA 5JNWA 2DFDA 3LX8A 4I4IA 4H3HB 5KWEA 1JQDA 3LT1A 3R20A 4OB8A 2FPPA 2ICAA 4WXYB 3CUWA 5DN6A 2O48X 2YIMA 5ALKA 1LJUA 1V5FA 3UHJA 2VRNA 3HADA 2DFVA 4GYYA 4BE9A 2DLDA 3LPNA 3GGPA 2PU5A 1E5XA 1Z07A 1ZUD1 2BMVA 1S3FA 3AHCA 3ECAA 3N87A 4EJ2A 3PXXA 4ZK2A 3IEXA 3GG9A 1TMKA 2J46A 2QP3A 4XYEA 5CNJA 1QU3A 5AKKA 4C9BA 2WMYA 5HKLA 5IC4A 4HDQB 3UO8B 3PJGA 4EFKA 4QJ5A 5EE1A 1RYZA 4GPTA 1W5BA 3QX3A 1RNLA 2Y0EA 1WU7A 1AUXA 1T3GA 3GWGA 3GPBA 4QPNA 1JHMA 2X86A 4UEOA 2I3ZA 1O08A 1E9SA 1EFPB 3KKPA 3PVSA 4CMCA 3QEMB 4EYOA 3T38A 5B6IA 4HJRA 1XXLA 3RSZA 1L7AA 1ENYA 3FJOA 1JTFA 2NTEA 1B76A 1T8TA 1PZFA 2QUAA 4NF2A 1U02A 4BUZA 4QOEA 2YOHA 1KI3A 1UM9B 3JARB 4P54A 1R15A 2TRSB 4B3CA 3SJUA 4DMRA 1E0KA 3MRTA 3A1DA 3L02A 4RL4A 1HF3A 1GGNA 5KPJA 3RVRA 3GDFA 4X7MA 1H22A 2AT1A 4KO2S 2NXNA 2JARA 3A1FA 4CR8A 3O26A 5GADl 2CUKA 2AEEA 2E85A 2X0IA 3CZ9A 1ESMA 1X80B 2ZEJA 4LJSA 2NXJA 2FWIA 2GM3A 6AT1A 5E6RB 5FP0A 2ZUCA 4AG5A 3KB6A 3RQIA 3P2KA 2N1MA 1O9BA 4B0PA 3TOCA 1CXZA 4R8LA 1UDCA 1GHTA 2DBZA 3KKMA 1GDTA 4OLAA 2OAGA 5C51B 3PCXA 3MMZA 5IXSA 2HV9A 4E5YA 1ORWA 1VE9A 2IYLD 3ZY5A 2IDJA 5JFOA 3T94A 5A04A 1VXRA 3RS0A 3G9ZA 1NLMA 4H31A 4Z9FA 1QHFA 4DTCA 4PHTA 4X0EA 3H5NA 5DHAA 3VOAA 3R3SA 5F78A 3WYNA 2VPYA 2QBYA 3H3JA 2O2JA 3W5HA 1AGPA 2VR1A 3O8DA 4U7HA 3DW3X 3ONWA 4LBVA 5HCNA 4D44A 1DWPA 3LE8A 3TOXA 3CWQA 1X2EA 2WU4A 1RR6A 2B30A 3AI7A 3OMWA 3NNSA 3Q7PA 4HYTA 1HFWA 1Y6QA 2JVIA 4QA9A 1CUHA 5BQPA 1ID8A 3PVZA 1UBCA 3KOYA 3Q88A 4LHXA 3C3XA 2C4NA 1QKIA 1VPTA 3W5VA 5CT5A 5IEBA 4DA8A 3SWWA 1TADA 3NWEA 3OCXA 3UJ3X 5BSEA 5J2TB 4ENWA 3BEOA 5DCLA 3SK0A 2Q1TA 4AJ9A 3ACDA 1R4MB 4QXMA 4EIWA 1T1GA 4QU9A 4RIFA 3U44B 4BX9A 2G77B 5EKUA 1JLRA 4ZOLF 3F97A 2E48A 3JY6A 4HDNA 4WY8A 5TQJA 4L78A 4U2CA 3P9PA 4RETA 2BFNA 1SKYE 2KE5A 1Z7BA 1C9NA 1KHHA 1I1OA 1JKJA 2XE6A 5ESXA 1FVXA 1YONA 2VUTA 4MDFA 3G9TA 1L8XA 4MPDA 3CC8A 4IOLA 1YDWA 4E5NA 4LWPA 3C14C 4NECA 1B6TA 4Q9IA 5CJ2A 2E0IA 4DXHA 2PX0A 2CZCA 4Z7NB 3N2GA 4I5FA 4F9GA 4OHMA 5DM60 4PZZA 2XTNA 2CLFB 1XP8A 2Q3BA 1G64A 5LXTA 1YQWA 4K46A 1Z0KA 4ZKEA 1OH5A 2JAUA 2HLNA 5BURA 3NS7A 4I2VA 3K9CA 1VC2A 1U7DA 1NTOA 3ISJA 2BCEA 2I80A 4GWGA 2XRZA 4H3VA 1IM8A 3S6JA 3T5DA 2Q4EA 3TH5A 4UHJA 1ZK1A 3PGLA 1ZGBA 5FAKA 1SVKA 4GXNA 5CDFE 3FDZB 2A86A 3HBNA 2CDCA 2JATA 3L0OA 1RPZA 1DUVG 4KR2A 4YLYA 4QYMA 1E6LA 5EKSA 3QIVA 5FV4A 4ETIA 2A4KA 3RUCA 1P1JA 2VDUE 3NIBA 3JQEA 4IV5A 4RIIA 5F12A 5JY1A 3USES 3MD9A 4RK1A 4WNAA 2C82A 2DFTA 4UHFA 4A0HA 5CNIA 4AC9A 1SVIA 5A02A 5KOYA 1KEEA 3JQPA 2J41A 4RYLA 2UZIR 4O63O 4IXWA 4O4HF 4UHBA 4CW7A 2I4TA 2WKPA 3ZK9A 3R23A 4XKJA 1HDRA 4MHSA 3QSYA 2QN7A 5C1PA 2XF2A 4M9SA 2BFEA 3MT8A 2CKDA 4JT2A 4N47A 1YWGO 5F7JA 1UJ4A 2BGKA 1GUYA 5FO0A 3IDZA 3LX5A 1YHZA 3ZWCA 2H1HA 5JY6A 2ILTA 4HH3C 3RNLA 5E6UA 2Q8QA 4H08A 3TQRA 1JLKA 2ZDQA 2C4VA 5ARBA 5KNBH 2WZDA 1JPJA 1Q0PA 4FOOA 2BFCA 4FGUA 1R0WA 3LRTA 1TIKA 1KVUA 4K2HA 5E1MA 3I30X 3BICA 2B5WA 1NBHA 1MXFA 1G63A 4Y7DA 4URYR 2RB5A 1FYXA 3B85A 4JAVC 5TE9A 3RRMA 3HR7A 3DC2A 1M2OB 2PLFA 5KTYA 3HHEA 4O2RA 4QJ4A 5I7OA 5IK2D 2B3DA 4L95C 1OFGA 2C4HA 3I4CA 3HUEA 2HFJA 1WD7A 1D7OA 1FF9A 3KPJA 4RW0A 4MVJE 1Y3HA 4H1VA 2R3SA 3O8BA 1E18A 4DCUA 1JG2A 3OPYI 1KFEB 3R6DA 3WK4A 3R5TA 1TW2A 2Z8YA 1PQ4A 2WE7A 1QGOA 3Q1KA 4M1WA 4U2EA 5I3ZA 3AILA 3DVAB 5FIUA 1F4PA 4ZC1A 2C9ZA 3GBSA 3TL2A 2XUZA 1NR1A 4OH7A 1VMKA 1TYBE 2NZYA 4ENTA 1E2KA 1OLUB 4MVYA 5HM6A 2VK2A 4PAOA 4F2PA 4B45A 2ZRHA 1ZRMA 3Q87B 3WMWA 4ND1A 3TZEA 4KRFA 1L5ZA 3TDMA 1IB6A 1JNYA 3I1FA 3HO8A 1G5PA 1YGPA 4UE2A 1KKLA 3N39C 4CTJA 2R6AA 3UT5A 3G8DA 4C7OA 3KTOA 2AMLA 2DUMA 2V1XA 1E9CA 4YNBA 1N75A 3DLCA 4GYKA 2FPSA 4U6SA 3ZXIA 2BR5A 1BNCA 2G4LA 3S40A 4WESA 4OUKX 3GFFA 4ES6A 2X9QA 3RRFA 2JH9A 4RM2A 3QEAZ 4QEZA 2J4DA 1VKJA 1V8ZA 1GSHA 2NTVA 3DDSA 4BMSA 5IK2A 2DU8A 1P80A 2ZIWB 4D80A 1IMJA 1IMOA 1E94E 2QIPA 3IR5A 4RGQA 4QWMA 4G65A 4LSWA 4IIGA 3JAKB 1T4DA 2JJ8A 3GHHA 3K05A 4QULA 4FBMA 3K09A 1GCUA 4EMBA 1Z06A 2WVJA 5MHTA 4QDOA 1MJFA 2AF3C 4AO7A 2IOQA 2WYVA 2CN1A 5ALVA 3L4EA 3S28A 5KJ6A 3EAGA 3HP7A 2FZ5A 3PWZA 3R76A 1NV9A 1QIIA 2P9HA 2W6QA 3QPDA 2PX6A 2RONA 2NW6A 1TO6A 2VPWA 4M38A 2FYTA 2Z57A 3VSBA 4CTKA 1TECE 1YBMA 1YRYE 3SG0A 1Y1RA 2JRLA 5JANA 4CFSA 3OLVA 2Z6AA 1XZBA 4JH0A 2NPFA 3TMYA 4UMDA 2QR3A 1VI6A 1L8AA 2AH5A 3HVUA 5F1PA 3GYBA 1K4MA 1T1RA 4Q24A 4QIHA 3DYBA 4EAQA 2KBFA 3WLSA 1BW9A 1N2JA 2HO5A 2L17A 2NXEA 2YY5A 4AJ2A 1CJKC 3TD6A 4D3SA 1AXEA 3W04A 2YQZA 2OORA 5G1OA 2QE6A 3EW9A 4KXLA 3W7BA 3O8RA 1ZIOA 4JC0A 1GPH1 1TQDA 3IUBA 7AT1A 3AZOA 5JDIC 5JCOC 1BD3A 3KETA 2Q0SA 4NAHA 4FMCB 4NCIA 3ZVKA 4B3IA 2AEMA 3AJAA 3AIOA 3N2EA 2X77A 4MS3B 3FNQA 1P33A 1SUBA 1JI3A 2VFAA 1G2QA 4KQXA 5DWQA 1KEKA 3KOMA 1YQEA 3PDHA 4W82A 4I14A 5TMDA 4J75A 4RCVA 1SU7A 3DDHA 4PYIA 3AONB 5EQJB 1SUFA 3SYKA 3T41A 2G5TA 5CDFA 4QOSA 4A0SA 1UT8A 2DBVO 3RROA 1HYHA 4F3NA 3J81A 3TW6A 4ZANA 3H0EA 3CCCA 3OTWA 4HP8A 4IINA 5EYPB 1QGYA 1SWVA 1O87A 4WBNF 4Q4JA 4Z4IA 3D2AA 3IFSA 4H1HA 2XNSA 4IDDA 1VJCA 1XMIA 2FOIA 1K98A 1UPAA 4QUEA 3HDTA 5L4SA 1YI0A 4QDKA 5EUQB 1EVIA 1KQ3A 4TYQA 4V0OA 1QIKA 2FW6A 2A88A 3LBHA 4CLOB 1AG9A 2W2MA 1T1SA 5IVDA 2VTBA 3GCDA 1NFFA 2PBLA 4G0XA 2Y9MB 5AOAA 1F14A 1X8XA 1JDPA 3IIKA 5CVDA 5KAMA 3WGNA 4CT5A 1N6NA 4MKZA 3V4FA 5LU8A 4JR2A 4D1YA 1EVLA 2OYRA 3SF8B 2GLUA 1SHKA 2C88A 3FX2A 1OASA 3MJRA 1JE1A 1L4EA 4I9UA 4LDJA 3R9KA 5BN5A 3E3NA 1ZYUA 2W8BA 4KN8A 4Q1BA 4MV5A 1I0ZA 5C5CA 4CQMD 4DBVO 1ODJA 3EIXA 2RK6A 2W6ID 4JP8A 1VLZA 2PIAA 2WYHA 3N75A 2ZT5A 3IBFA 4JB3A 2YVAA 1GVHA 1JEOA 1G6OA 1L7RA 1VDZA 1YE3A 5AHXA 1OWNA 1PN3A 1N9GB 4GX1A 1EDDA 4PG5A 3VPDA 2FQYA 3L3BA 1ZN2A 4Q3OA 4R2KA 4E88A 3I8SA 3P0JA 3AUFA 3WWYA 3REQA 4BNDB 1UDAA 4A0QA 3FVQA 2WIGA 2YRXA 3GLTA 1P2GA 1Y3FE 2OAP1 1FFHA 4BQIA 3VDMA 1BH2A 3WZMA 5JNSA 3AKEA 4RLQA 1NWCA 3PXDA 4B31A 1NYTA 3MJHA 3RBZA 2NYAA 3UHAA 4WKBA 2AOTA 3QH4A 3WQSB 4E3ZA 4IWXA 3B1JA 3P71T 3H6GA 4X00A 3OHSX 1N8TA 2IZ7A 4EF5A 3KV3O 4WXPA 2UUAB 1U63A 3NDRA 4HEJA 3FPFA 4MW9A 4I4TF 4TVOA 1A5AB 2I3GA 4UUAA 4MS4B 3VSDA 2YV3A 4TKLA 5TT0A 4CUJA 2R68A 2IPMA 1CUGA 1R0KA 4DR3B 2P90A 4MIKA 2OILA 3UENA 3UK7A 3VUFA 4BZQA 1KR2A 3WGLA 1T0JB 4R69A 3STTA 5CURA 1M7HA 4CQMA 4AMBA 1W88A 2XD4A 5HCUA 4N03A 4PGFA 1UZAA 4LA4A 1CVRA 2VAVA 2CHFA 1EE9A 2X58A 4B4OA 3F7MA 5DXAA 3LLSA 5HJ5A 4W1PA 4PW0A 2QRPA 1ZCJA 2NQ8A 3M6AA 4PYMA 2HJVA 3M6XA 2OPHA 2V6BA 3S99A 1LBIA 2EJCA 4OHVA 4J49A 1JI0A 1E1MA 3PG5A 2GO1A 4E46A 4BKUA 5FUQA 2ENUA 2QD4A 3PWSA 2B2CA 3B48A 2HY7A 4DMCA 5AESA 4BBPA 3FMIA 4TMXA 2VKQA 1XU7A 1THTA 2A30A 1N4DA 2GO7A 2HPZA 3HSSA 3NC0C 4CGYA 1FPQA 1PUIA 3IGFA 4LF7B 2G6TA 3HR8A 3TTSA 3JQBC 3A4MA 3HDQA 4NEHB 5EWJB 4IX9A 4COOA 1QRSA 3NJ4A 4ZTBA 2QTVB 1BCSA 2GVDC 4Z51A 2SECE 2IP1A 2QLMA 4QUDA 2ZRIA 4UNNA 4MJ3A 2YZGA 1GTSA 2VIIA 2OCAA 4MINA 3JWEA 4GPZA 2OFPA 4IVRA 3U49A 4AY4A 2D7DA 3Q7SA 4JXXA 2X9GA 1U3WA 2J7KA 5EKTA 3KR1A 2IS1A 4DXAA 1L1QA 2J45A 2P3SA 2AFHA 1CKEA 4ND8A 2O8FA 4FYJA 4NU6A 3SFVA 4G0NA 3T1VA 3JYNA 5KC9A 2V45A 3WVNA 2FCAA 1HE3A 3WGUA 2N75A 3SYTA 5B4UA 4EUNA 3WWZA 2WSIA 2F3UA 1JAZA 2DX7A 1ZAKA 2B21A 3TSAA 2HRBA 4KR0A 3V2UA 5CT9A 4AMVA 3ZNQA 2BLNA 4QPPA 5MN5A 2OA0A 4ZD6A 1CQJA 4O4LA 1IHXA 2JI9A 3BMNB 3X1JA 2Q0QA 4IDHA 1Z26A 2AG8A 4JOCA 3T3NA 1SZPA 5EHIA 1Q5PA 3EIOA 1H4TA 2QI9F 5CVUA 2SCUB 4WDQA 3IJEB 3WJ7A 3FFBA 4QVKA 5LIRA 3D6FA 3VHQA 3ZY3A 2C2MA 3C6ZA 3NEPX 3T7AA 5KOJA 3UFBA 4BBZA 2AN5A 3CT6A 1CDZA 3L41A 3PR3A 3D4BA 2XVZA 2MYNA 1V16B 1WQ3A 5IVIA 4ALMA 5AUNB 2O7NA 2A7XA 3IQHX 4S24A 5DBEX 1M3SA 1GR1A 4F0JA 4ZP1A 3OM0A 3WLAA 3VDXA 5B58C 3UPUA 2VDRB 1KVSA 4EYQA 2HMUA 4RACA 4LRXA 1EE2A 2CUTA 4Q18A 1T2AA