5IBQA

Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
287
structure length
287
Chain Sequence
b'MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal structure of an ABC solute binding protein from Rhizobium etli CFN 42 (RHE_PF00037,TARGET EFI-511357) in complex with alpha-D-apiose
rcsb
source organism Rhizobium etli
molecule tags Solute-binding protein
total genus 122
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ibqA01
1JDNA 3N0RA 3F6PA 5EWMA 2FW0A 4Z9BA 4EYKA 3DGEC 4H3KB 3IP6A 3I42A 3KG2A 2YHAA 3RH0A 5CNJA 3HUUA 1E6KA 3RVPA 3G1WA 3CRNA 4QPJC 3O21A 5TPWB 4Z4HA 4OTZA 4MQFB 2E4UA 4MS4B 1NY5A 3H1FA 3GA5A 3LUKA 4N76A 4H3HB 5TE9A 4JASB 1YMUA 3H5WA 3EAFA 2JVIA 2LBPA 1MB3A 2JRLA 5EWLA 3HDVA 5TPZA 3CLKA 1YIOA 2CWDA 4MQEA 9ABPA 2ID9A 2PUFA 3CFYA 4G0XA 4S05A 1DC8A 1EAYA 5IUNC 4PZ0A 3L49A 1JYFA 3Q7RA 1ABFA 4LRQA 2M98A 4KK4A 3OLXA 1ZH2A 3NNNA 1SXHA 4FB4A 1AB6A 3G85A 4MRMA 1GUBA 5JNWA 3RVOA 3NHZA 1DCKA 3QK7A 5KC9A 3OQOA 4W5RA 3D8UA 2QXYA 5IBQA 5C5CA 1KGSA 3RVJA 3KKEA 2GWRA 3RQIA 3N0WA 5KC8A 2NUBA 2ID7A 1D5WA 3M9WA 5BQ3A 4D6YA 3SQNA 3EDCA 3MQ4A 4ZJPA 1Z12A 2CHEA 3CTPA 2PUGA 2A9RA 1PUXA 4XAQA 1D1QA 4LE0A 2R47A 5DGCA 4MQFA 3H5VA 4MS4A 8ABPA 2WB4A 4RSMA 4Z4CA 5JNSA 4WZZA 2FEWB 1HEYA 3QLVC 2ZWMA 5FBHA 4G0PA 3A10A 2FMKA 3A0UA 5JNRA 1NXTA 3QEMB 2PUDA 4RV5A 3GRCA 5C5EA 5CNMA 4Q7EA 3KYIB 1Z25A 4ETIA 3N75A 1KRWA 5IX8A 1PNRA 4Z99A 1ZH4A 4G0MA 4NV3A 1A2OA 5ABPA 5TPZD 3F73A 1E6MA 5GQSA 2JBAB 4TMYA 5CNIA 7ABPA 2I6FA 1NXXA 3MA0A 2FMHA 2IPNA 1TMYA 3QX8A 5FWXA 3LOPA 5T7BA 4WUTA 2J48A 4EY3A 1OXKB 5PNTA 3QEKA 1XWWA 2Q5CA 3HV2A 5T3YA 4Y9TA 2HQRA 3C3MA 3TMYA 5EWMB 3LMKA 2F8TA 2MSLA 1T34A 1WETA 2HPHA 5EWJA 2PL1A 4Z4FA 2FLKA 1ZHHA 2A9PA 2HQOA 5DLEA 3T38A 4D6XA 1M2FA 2NZVG 5IULC 2BGGA 1U8TA 3TD9A 2B4AA 3IPCA 1SXIA 2FEKA 5BRJA 1GLGA 5FWYA 4YS6A 1LBHA 1PHRA 3OQNA 3DLHA 4W5NA 1E2BA 4MLCA 2IPAB 2V0NA 3FFTA 4RK5A 3LUDA 3RVLA 3HCWA 4HYEA 5B3JC 1RNLA 1U2PA 3H6GA 3OMWA 2QZJA 2L17A 1XHFA 3O2QB 3GWGA 1LK0A 1NXSA 1GCGA 1JLKA 4N47A 1Z26A 2GI4A 3ILHA 2KYRA 1DRKA 2JBAA 2QW1A 3L6UA 4E7PA 2A9OA 2PUCA 5BRAA 4Z0NA 3HSYA 3OQMA 4FE4A 3HS3A 3SAJA 2X7XA 1NXOA 3IP9A 3RVSA 4Q6BA 3NNDA 3QLUC 3HJFA 4EYGA 4MLDA 1MIHA 3LUHA 3H1GA 5TQ2B 1NXWA 1EWTA 3FMVA 2W42A 1JH9A 2VUHB 3ILYA 3VNAA 1ZN2A 2FTKE 1RXEA 4OBBA 4ZPJA 3A0RB 3O1JC 3RVNA 4EVSA 4S04A 1QP0A 2L18A 4RK6A 4JB0A 4MGEA 1ZVVA 1ZAYA 1CEYA 4EYQA 3JPWA 4UHJA 1NTRA 1YK1A 3CG4A 1QQBA 2B1JA 2FQYA 3SG0A 3UKJA 1PEYA 4D74A 3OLWA 3RVQA 3JTEA 1APBA 3EQ2A 1QNLA 3DGFC 3N8IA 1JL3A 4JOQA 3H5OA 3E3MA 2A9QA 1Z2EA 3FFXA 3GBVA 4YO7A 5HKOA 3UUGA 1M2EA 4P1ZA 1JF8A 2PLNA 2PMCA 1E6LA 5GOTA 1DJMA 2LIVA 4JB2A 4W5OA 2QR3A 3KTOA 2JK1A 5JNTA 3IP5A 2IDMA 3OO1A 4HNQA 3NBMA 1Z18A 4N0PA 4RXMA 4TN5A 5IUJC 5FWXB 2P9HA 1BVHA 4KVFA 5DCLA 3H5LA 1Z15A 5KWSA 1L5ZA 2VYCA 1A04A 2P4UA 3KYJB 2E4YA 2IOYA 2FQXA 4F12A 1KMIY 4MR9B 3HXMA 5TQ2A 3T95A 4L4UA 3M6MD 5EWJB 3TX6A 4LE2A 4OATA 5ED4A 3CNBA 2QVGA 4YR7A 1D1PA 1CYEA 4KMRA 1PEAA 1M5TA 2HJ9A 2RJOA 2VK2A 1VKRA 1TM2A 3CS3A 3H6HA 3OMXA 3TB6A 4LDAA 1M5UA 4XLTA 5FWYB 3CHYA 4ZYLA 2AYXA 3OLZA 4L85A 4Z4IA 4RY8A 1RZRA 4UHKA 4YCSA 1BA2A 1UDRA 1VRVA 4NQRA 3LTEA 4EUKA 1YK0A 2FVYA 2PJUA 3Q7TA 4RKQA 4WWHA 1RPJA 2QVCA 2OQRA 3JVIA 1YTUA 4YRZA 2IYNA 2M1ZA 1ZGGA 1ZESA 2RJNA 3EQZA 4KPYA 3OM0A 3RVMA 1ABEA 2RGYA 2AYZA 3NNSA 1VPWA 4B09A 4OG2A 1DBPA 4Z4EA 4QYWA 5JS2A 3CU5A 1YMVA 3BILA 2E4VA 4TLMB 3DBIA 2PAFA 2FEPA 4KZKA 5IEBA 2GBPA 4DN6A 2WJWA 4MR9A 3F6CA 2O20A 3ROTA 3EGCA 4JA2A 2H0AA 2JVJA 3GL9A 3JY6A 1FFWA 4N03A 2FKAA 1JX6A 1SRRA 3UK0A 1EWKA 1ZY2A 2HQBA 2MYNA 3F7NA 3CKMA 4LE1A 2LUOA 3KS9A 2JVKA 1NATA 4JP1A 1Z13A 4IMJB 3GT7A 2PE5A 1F51E 4MS1B 5KQPA 2FN8A 4YGXB 3CZCA 2MSKA 1DBQA 3S99A 1ZDMA 4RK7A 1R8JA 1F4VA 1USGA 1DZ3A 3K9CA 4M88A 5D2CA 1GCAA 3HVRA 2L2QA 4GPAA 3KHTA 3O74A 1JFTA 2NZUG 3HUTA 4RK0A 4KK3A 3M9XA 1MB0A 2TMYA 3JVDA 2WY2D 5JS1A 2FSPA 1U04A 2IPLA 1USIA 4F11A 1RZRD 2OENG 2H3HA 1JHZA 4G0OA 1W25A 3B2NA 4RXUA 4IGAA 1W9HA 1AB5A 1FQWA 1JDPA 4MPTA 2MSWA 1PNTA 1EWVA 3LUCA 1QP7A 3HEBA 5TQ0A 1P8AA 3BREA 4LZLA 4ML3A 5CNKA 1IIBA 2E4ZA 1TLFA 4ZMSA 1I3CA 1TVMA 1VLZA 3JS5A 2DRIA 2YHBA 1ISSA 4FE7A 4RKRA 4YP9A 4F06A 1QPZA 5JNUA 3BRQA 4KRFA 3RVRA 4NCBA 3FDFA 4PYRA 1P6UA 4DQDA 1NXVA 4F8JA 2PUBA 4LDZA 4MAAA 2F8SA 1TJYA 4MS1A 3KJXA 2GKGA 2N9UA 4TLLB 1K68A 4MS3B 1LJUA 3O75A 4XARA 4RY0A 2PUAA 3K4HA 3O2JA 5KQMA 1BDHA 1K66A 5JNVA 1BDJA 4KREA 3C97A 3T6KA 4ETNA 2XDYA 3Q7SA 1Z17A 2FLWA 2FXIA 4KQCA 5IC5A 3KLOA 2MYUA 4P98A 4Q6WA 1DG9A 4IF4A 4WT7A 4EVRA 2E4XA 2WWVD 5DTEA 3MIZA 1FSPA 3LKVA 5B3JA 5BR1A 3QELB 4MYRA 1S8NA 1DCMA 3MYYA 4PE5B 3SM9A 3ROFA 3MF4A 4JAVC 1BDIA 3SY8A 3LUAA 4HNRA 4XXHA 3URMA 4H60A 3MMNA 1ISRA 2VUIB 4RK4A 6ABPA 6CHYA 4RU1A 3MM4A 4PICA 5DKFA 3I09A 5KI6A 1FFGA 3HM9A 4MR7B 3Q15C 4O5AA 3OO0A 4O1IA 4G86A 4YV7A 3LUFA 4E7OA 1QO0A 3Q9SA 3QX9A 4RK1A 4EYOA 3N0XA 3EODA 3QLUA 3BRSA 4HNSA 2MYPA 2QU7A 4WXEA 4OLBA 2L19A 1BAPA 1C4WA 2R4QA 3FGZA 2IPMA 2JB9A 4MS3A 3LKBA 1USKA 4YWHA 1YVUA 1LBIA 2E4WA 4KNYA 4G97A 2FN9A 3VNBA 1KRXA 1XHEA 2ZAYA 3CG0A 3GV0A 2IKSA 4PEVA 3C3WA 4MR8B 4IILA 1QQAA 1D4ZA 1A0OA 3LUJA 5HQJA 4DADA 4ZMRA 1CHNA 4F3TA 2LP4Y 2FMIA 5TPWA 3QELA 4KV7A 3CZ5A 4OLAA 3T8YA 1GUDA 2R25B 3D02A 1ZGZA 3N6VA 1D2AA 3H75A 3O1HB 1DCFA 3H1EA 1DC7A 3I45A 2WRZA 4G0QA 4NICA 4RWEA 2FQWA 3GYBA 5I4CA 2NT3A 5TQ0B 5TQJA 3IPAA 4IMIB 4Z9AA 2NT4A 4XASA 1EHCA 3QLTA 4YLEA 4G0YA 4N0QA 1QKKA 2QV0A 4MR7A 4N41A 3P9YA 5E3JA 3BBLA 2PL9A 4WXMA 1DRJA 5HM6A 4LX8A 2R48A 2WJAA 2QSJA 1QMPA 3HZHA 1DP4A 3KCNA 3W9SA 4NCAA 5KQGA 5CHYA 1J56A 1YS6A 3H5TA 2PKXA 4XFKA 3RVKA 3R0JA 4RDCA 1B00A 3GBPA 3KLNA 4KQ9A 2MYTA 4QYMA 1JBEA 4CBVA 3KSMA 5KQLA 1QO0D 2FMFA 3EULA 5FBKA 1Z2DA 3IDOA 3IP7A 2PUEA 3LFTA 4W5QA 1JFSA 1OXBB 1Z16A 5HSGA 3HO1A 4IRXA 4MR8A 3QLVA 1YS7A 4ETMA 4QICA 4EGSA 2LPMA 3DLBA 1URPA 1RXIA 1DBWA 4RS3A 3E61A 1U2QA 3C6QA 4RXTA 1MVOA 3HDGA 3O1IC 4EVQA 3I5AA 4RY9A 1QP4A 1LJLA 3H5IA 3C3KA 3TO5A 3QEMA 4G0ZA 5EWLB 4W5TA 1P6QA 4Z4GA 1Y1LA 2JCGA 3Q41A 5IEJA 3FFWA 4KFCA 4MQEB 2CHFA 5F64A 1C0EA 2HSGA 1SXGA 1U0SY 3JPYA 3SNKA 1FFSA 1L5YA 1JWLA 4GNRA 1JFVA 3A3KA 1SD5A 1JYEA 1MAVA 3LUGA 4O1HA 4MRMB 4RZSA 1EFAA 3DZDA 2WMYA 5IUKC 1H9CA 1NXPA 1ZITA 2GX6A 3OLVA 3OLYA 3N53A 3NHMA 3HK2A 1P2FA 3EJWA 3O2SB 2CD7A 2RDMA 3OM1A
chains in the Genus database with same CATH superfamily
1Z2PX 4BP3A 1C7RA 1C3LA 4GDMA 1B8NA 1IJFA 2W98A 3AETB 3D3WB 3NLLA 2XT9A 3VDMA 1BHQ1 4Q3LA 5CVCA 2M6LA 2OXRA 1KMMA 3AFGA 4C6TB 5JSZA 3NHRA 4EHKA 3DNMA 1SBHA 4H08A 3C1TA 1UZMA 4QPJC 3SZRA 2GDZA 3LO8A 3WG9A 1CQXA 4BNIA 4BN5A 5TGTA 4EMUA 3UC9A 3TBHA 4E22A 1FFYA 1MABA 1X94A 4L2IA 3U5ZB 3EEYA 1Z2CA 1LTQA 1C4KA 3LUKA 4YFYA 5J5CA 4DCGA 1YMUA 4Z2AA 3F6EX 3RF6A 1H2HA 3BK1A 4KN5A 5IVKA 1K0FA 5DVZA 5JC8A 3TBKA 5I7HA 4Y6PA 2H1SA 3KJHA 3A4NA 3CLKA 4GGOA 3MD9A 4RGVA 1N8NA 5ISMA 2ID9A 3L4BC 2PUFA 3CFYA 4NBNA 3O7MA 4LJ4A 5KSPA 3R44A 1JYFA 3RG8A 2CLMB 1RIIA 1BJTA 2DPLA 4YJ2F 1M2KA 1OZGA 5CVUA 4E33A 1YF3A 3P96A 3KWJA 2CHUA 2JFUA 5EY5B 4IIHA 4F45A 5B58C 4IGIA 3VR4H 5FX2A 2WP8J 1NNUA 4GM0A 4QOFA 4RVOA 4W9NA 3V7YA 4CG1A 3C1OA 3RAJA 3UYKA 1RYBA 4TXNA 1L5LA 4IDQA 2Y1FA 2Z8YA 3K0FB 3ETGA 3DAFA 1BQ3A 4MVYA 3RUCA 3TMKA 2PUGA 1GU7A 1NZJA 3DQQA 2A9VA 4LXHA 3AT1A 4QATA 4R7GA 4CM9D 5KNCA 1M83A 1I7NA 4LE0A 3UT5A 3AWIA 5BSGA 2BTEA 3AEYA 5FOUA 1E2LA 2ZWPA 2C4UA 3NDRA 1S2IA 3L8ZA 5BUCA 3A3NA 2DX7A 2BLLA 2J3LA 3H11B 1PQPA 1IUOA 1NASA 3LJKA 3IPLA 3EXFB 4Z4CA 3TDMA 3TOZA 1E92A 4N3GA 1YUMA 2J3IA 3FUWA 3O8NA 3DZBA 5HZHA 5HFAA 3DWIA 5K0SA 4YPOA 3M89A 3ADDA 1NXTA 2A0YA 1TE2A 3QEMB 3FLMA 1FDUA 3GHYA 4ZT3A 2IXEA 1CR6A 3ZQ4A 1P1HA 1L4BA 3T3OA 1S8FA 5TSDA 3M6IA 4PWYA 5CFQA 4TSRA 2FAXA 1T9KA 2ZBFA 1HQKA 3ON5A 1J90A 3R5JA 5D7BA 3UICA 1ZNQO 4AS3A 1DT5A 3BWVA 1SWVA 1VLVA 4M9XA 1FFXB 4NBKA 4TMYA 2QAGB 4WXRA 4I66A 4ZALA 4F1KA 3QX8A 1FA9A 1SIWA 1NPYA 1TMYA 2Z4TA 2OPHA 2CK3A 4W1SA 2B35A 4HP8A 4EY3A 1F60A 4AY2A 4EJFA 3KLPX 4DPLA 4BKUA 1DHTA 3HP4A 4PQFA 5EWMB 1G38A 3WYGA 3DOFA 2GFQA 4XIIA 3CO0S 2HPHA 1QRUA 3RFCA 2ZTLA 3HCPA 2X0KA 1II0A 2V7WA 2XW6A 1TJ4A 3ORSA 2ZJ7A 4FNOA 4IDPA 4NC9A 3T38A 3M9LA 3A2KA 3AZOA 4ER0A 3TD6A 1UKBA 2I3GA 1M2FA 2XT0A 3U44A 2LRHA 4ND7A 3UWOA 1YZGA 4M0CA 3N8GA 3BA1A 2I4LA 1LBHA 5F21A 1AURA 2YQ4A 3I04A 1G7TA 1PWZA 3NAGA 4W9MC 1C0PA 1AUVA 1CV2A 3KYCA 3B1VA 1N1DA 2Q99A 1PNQA 2Z58A 4MW7A 2PUWA 1R4NB 4IWNA 4QXAA 1EUQA 3NJ8A 1CR2A 1OTHA 3GJ8A 1GSHA 2IIPA 1UMCA 1Z0FA 2ADMA 3NGMA 3OT1A 3W2GA 4D0NA 2VLIA 4PR0A 5DASA 5CVDA 5JSKA 1J49A 3LT0A 1KAHA 2KYRA 1QF6A 4AY6A 2EBWA 4QECA 1U0EA 1JWAB 3TPFA 4H17A 2NZWA 5EIHA 2VSYA 1YFLA 4E5DA 2X6QA 2J9RA 4ZAWA 2ZPTX 4D0GA 1EGMB 2I33A 4KLRA 2DJ5A 3C6YA 5ALRA 4BE7B 1FP4A 2XRZA 3RJ5A 2WG2A 2I34A 5SYAA 5EMMA 4DBZA 1V3VA 4WKGA 4KQJA 1KDTA 1BKYA 1PS0A 2R8YA 5DX1A 3CEJA 3TI9A 1P2UA 2JHFA 4MUNA 4KE9A 4LRSB 621PA 1XDSA 2AC2A 2C2OA 2YWRA 5JLJA 4B81A 1N3IA 5J4KA 1IRXA 3KVOA 1MQ8B 4W8OA 3SHVA 5GMOA 4BRWA 2DYKA 5JH7B 5LSAA 3PV0A 4R6XA 4YAFA 4LJLA 5EUBA 1FU8A 2CL7X 4JL8A 4MA0A 3THYB 3PFIA 3RABA 2GLUA 2LE0A 4ZKDA 4PLVA 2CCJA 5JOQA 1XMOB 1JL3A 1W75A 1Q7GA 3ZWYA 4EUNA 4CT0A 4R3WA 2W8BA 3FKSA 1NP7A 4P1ZA 1TZBA 3AUAA 4X0EA 4DJTA 1XCGB 2QRVA 1YRAA 3FHJA 2VXCA 3I9LA 3YASA 4HB0A 4C2AA 3ZKAA 3H2ZA 2F3RA 1T6YA 4L8WB 3AM5A 3Q9UA 3K31A 4G5XA 4GR5A 2P90A 2OR3A 1RAIA 2OXCA 3CTMA 4XIJA 2AXNA 4HFJA 1AN0A 1SULA 5KDOA 3E58A 1QMGA 1ESZA 1E64A 1T26A 2BV3A 1IDOA 3MD0A 4AJIA 4CIDA 3TLZA 2VEOA 2R8ZA 5CAEA 3PQFA 1MB2A 4KFUA 3KT8A 1ZIPA 3JARA 2I2XB 3LHIA 2Z6VA 1SN7A 2ECKA 1OBOA 4HSGA 5CXSA 5B7PA 1CUSA 1VM6A 4GI7A 5JQGA 1GUYA 2JIQA 3LYHA 1XCPA 1LEHA 4R9NA 4WA8A 3M0EA 4WLOA 1R18A 3NATA 1ADCA 2QVGA 3AM3A 4U9UA 5LA6F 2W2KA 3C8DA 3OC0A 5FEMA 1H4SA 2E21A 2AR7A 1JDBC 2F00A 2K6GA 3I83A 3IYLW 3QVGB 4IX9A 3PCTA 1OZAA 4QWMA 4RZHA 2GVNA 3CT4A 5ALKA 4C4XA 2UYGA 3LPNA 4OQFA 2N46A 2GTIA 4AKHA 2OCXA 1ADGA 1HURA 4ES6A 4UHKA 4X91A 2XB9A 3UAYA 2WB2A 2F4VB 1II8A 1F5NA 4O25A 2I1QA 2ZCJA 5E0OA 1H3EA 1X2EA 1E0AA 3DCYA 4TV9F 2Z4RA 3EIFA 2V7EA 4N8EA 3BGIA 4J1SA 3ZCRA 4RHEA 1MIOB 1GTG1 3GA0A 3DBLA 5DM4A 3LVRE 4W6QA 3B82A 3WTCA 3ECCA 1GR0A 2VP5A 3EQZA 2ZAIA 1UKZA 1I3OA 1DAOA 4FEGA 5C5IA 5FO1A 2PGOA 4AECA 2WE7A 2PSSA 4ZKEA 1ABEA 4F7DA 3JWJA 3NNSA 4KVAA 3M6LA 3NHYA 4EZEA 4B33A 1Z8NA 4QYWA 2LR0A 3AY3A 1HMYA 1M34E 2IGTA 2VK4A 3DE5X 3M4ZA 1MHPA 5EE3A 3TAUA 5ICFA 4JGBA 1GL3A 2ZDQA 2IXFA 4FGJA 1Y3CE 4Y2RA 2VH1A 1CJVC 4U2DA 2GXSA 2QTZA 3T54A 2YOFA 4FYXA 1QCDA 2H0AA 3BFVA 1NVVR 3LD9A 4N03A 1F0KA 3UWMA 2XYVA 1ZU4A 4IR7A 3MWFA 5B58T 3TOXA 5BR8B 1LU9A 2HCBA 4KX3A 4OXYA 3MPOA 4R4JA 1QHEA 5JVDB 3FPGA 3N6RA 4F1JA 2D1QA 3CR3C 1TLLA 1M6EX 3GEEA 3WLOA 1L7RA 7YASA 1HE3A 1CEEA 4CODB 5B57C 4PC2A 1G9XA 1OYVA 3NT4A 1A9TA 5U1PA 2XDWA 1V16B 3CZ9A 4DDWA 5B4UA 2G1JA 4B82A 4LF4B 2WD9A 1VJDA 2RGEA 3KCQA 1BQEA 2BWJA 2P9CA 3QQ5A 4W9RA 4EHFA 2OZPA 3UAOA 4DWOA 3NT5A 3DYVA 3EBOA 5AH0A 2VP9A 4UAUA 1OGYA 4NDZA 5K8CA 1SUWA 2I9KA 5TIIA 1W36C 3W6ZA 4PVCA 2OB1A 2R0QC 2IS6A 2RMKA 1MVLA 1M2NA 3CNNA 4LZJA 1FYDA 4HZUB 1GPLA 4G0OA 3BICA 4WCVA 3RSGA 4XQ0A 4E4TA 1AB5A 1Y5MA 4BWYA 2B2CA 2W2TA 4IDFA 4G8BA 2CSXA 3DUWA 3KEFA 1EMDA 1EUDA 3DLTA 2ZSKA 4J16C 1QYCA 2JLBA 3WNDA 3WV4A 1P8AA 3FVVA 3ZHTA 1JFLA 5JI2E 3K9HA 1GPNA 4C0QC 3MRSA 4JWTA 1GTSA 1J5PA 1CRLA 1I3CA 1SKMA 1TYBE 2ORYA 2ZG6A 3OUZA 4KAAA 3PGMA 5TGZA 1FYVA 1PBNA 1W5AA 1VJ0A 3GJ4A 4PX2A 1AKQA 3RVRA 2C7OA 4RMNA 1K88A 1LUAA 1Y3FE 3GFGA 3HCNA 1X77A 2H4HA 4WNIA 1DUVG 3AYZB 4LBVA 3ZGOA 4A2PA 2QRKA 1W34A 1KJQA 4O5OA 2FPIB 2CLCX 4OBWA 3D0OA 4XTRA 5K8IA 2H9AA 3ZJVA 4EG8A 1M0TA 4JLKA 1YNOA 1Y9JA 2BKAA 4L0QA 2QE7A 4O2BF 5JNVA 2A5GA 2UYYA 4RKYA 2QRNA 4BWVA 2BUAA 2XDYA 1ZKDA 4RE5A 1R8SA 3UZUA 3IXQA 9MHTA 1H3NA 1BXGA 1MEJA 1GGVA 2K7FA 2X7HA 4AC9A 5B3JC 3K1YA 1V1RB 3DDUA 3OJ0A 3OPVA 1JJAA 1DKMA 3EOBI 5AJHA 1TJPB 3GFVA 1R37A 3ITNA 3LPAA 1BYIA 2X3UA 3FKQA 4EB6A 3TVTA 1NRJB 4BMZA 1GPDG 2RGBA 2WU0A 5THQA 3EZGA 1NJGA 4P7JA 3DVRX 1DIRA 2I3DA 1IFXA 1TKCA 2IPOA 4M7RA 1UAGA 1XJ0A 5AVWA 3DCNA 1WPRA 2FUEA 4CHGA 2BFCA 1SCUA 2EX1A 2WU1A 1XLTA 1N6RA 3E2IA 2JI6A 3MM4A 4IDHA 1WDKA 2G8NA 3GG9A 2KW5A 4NG5A 1LH0A 1B26A 4AG5A 4O5AA 3IDFA 5HKBA 3HPRA 1LK5A 4X5OA 1XDZA 3R3HA 5CCXA 1IEWA 3KVRA 4JT2A 1J20A 5KINB 1QF9A 3JRNA 5IPFA 2JLZA 3N5CA 3IR5A 1WB9A 2FR1A 1YVDA 3K6SA 1V9CA 2ZK7A 1KAGA 3QLEA 5FTJA 3ZR4B 4C76A 3TOVA 3LY5A 4CTOA 3KUUA 4KYUA 2BHRA 5F4BA 3ND7A 5FA6A 3NBKA 2I4TA 1JKJB 1Y82A 2BBWA 2Q3FA 1FDTA 3LPLA 4UBIA 5LD2C 1UXHA 1K7XB 2IKSA 4M60A 5DBFA 4UE6A 2V9PA 2BR5A 1D4ZA 4RA6A 3H2IA 2FZEA 4UNPA 1ZAKA 2CJYA 4U2CA 2EJVA 5CDSA 2QBYB 3I8XA 1JHXA 4M87A 2ZS9A 3KEGA 4XDYA 5EPUA 1JVBA 1VJCA 1XL1A 2XVMA 4M38A 4MTCA 1YRLA 2VP4A 4NTZA 1I1NA 1M1XB 1PYGA 4FKZA 3FR8A 4BN0A 1B41A 3VRHA 4K3UA 3VOBA 3HI4A 1T6NA 1WDWB 2BUCA 4NCXA 4RJKA 4C04A 3CR7A 3NAZA 4G26A 4QL3A 3QEOA 4BMNA 1RYYA 3EWNA 3IVAA 2HLNA 3M83A 3BAZA 3F49S 1HA3A 2F48A 2C00A 4G2TA 4ZYWA 3ED1A 1OVMA 1NYRA 2ZRGA 3UK2A 4DQKA 2VZLA 3S2IA 3P2JA 1Q44A 2FQQA 3RYFA 5C51B 3SLKA 3PD7A 1A9XB 3BL5A 3LT4A 5AW6A 2P8JA 2V59A 3PUIA 1MN6A 4GLLA 4X24A 5D1HA 4ZOCA 4K9SA 2IW1A 3HU5A 3ZK7A 1E1QD 1ONPA 5DHPA 2ORED 1BJRE 3X3HA 2I03A 4EATA 3K0HA 1WXIA 3I2YX 5KSOA 3DVAB 1LZLA 2MU1A 4H0NA 1C9DB 3SZGA 5AHWA 1M10A 1XD2B 1O2DA 3IAAA 4R2HA 3D7KA 4KQ9A 1YRBA 3LL7A 4CBVA 2ZI9A 4QD3A 2AE2A 2DFPA 1P45A 2BMFA 1TOAA 5EXPA 3BE5A 2YMMA 2DSNA 4DANA 1F8GA 5B3KA 5K5EA 1E9AA 1L4NA 1WZ2A 3EF0A 1NN1A 1GXSA 1RJEA 2FR8C 5I7AA 4MI6A 2FZ4A 4V0NA 3FMOB 5H81A 2OAEA 1DMRA 3KHSA 2PFGA 5FIUA 4MIYA 3E61A 4ZZ1A 4YCDA 2WJ3A 3KXDA 5HCUA 1MVOA 2GSWA 1BU5A 1WPXA 3JWPA 4QARA 1LQTA 4XOIA 1MABB 1T0JB 2BGJA 3S1SA 1G63A 1HX7A 4YRMA 2BEVA 3KZ1E 3UFBA 3ULKA 1ID8A 4YMIA 4PYNA 3HRKA 1JDUA 4Z9FA 1Z47A 1OH6A 1U3CA 1UKYA 1QRTA 3HACA 3FRJA 2OA0A 2FF5A 4GD3Q 1C0EA 2PSHA 2OFXA 3Q88A 3T9AA 4I9FA 1IPHA 2UVDA 1KVQA 4OGWA 2UUBB 4MRRA 2VAWA 3HKBA 3N76A 2Q1XA 3F8SA 3IA7A 3CEHA 5CIQA 4B6GA 3MWLA 3B1XA 5JEEA 1H2WA 1SUSA 3CH4B 3L18A 1ZOIA 2HKIA 1M2GA 3QJYA 2PPVA 3C5WP 4N01A 1JR3D 3MS7A 5EGSA 2WMYA 3U37A 2CLEB 4TTTS 3HWX1 4EGCB 3DD1A 3I3SR 4QSHA 3PPWA 4V2IA 3LFHA 4Z9BA 2O8EA 4LHWA 3ZBQA 2AE1A 2FEMA 2OFOA 2YXLA 2OAQ1 1OAOC 1PNVA 2YV4A 1U0LA 3ZV6A 2QX9A 4BQSA 1Q1ZA 2K2QB 4OHUA 3MRTA 3T1VA 3W2FA 4AMUA 3U7FB 4C4YA 2CWWA 4WKCA 1KYTA 1XA3A 1UM8A 3CRNA 3ZDCA 1JDVA 4PFJA 4LI3X 3RWMB 5CB8A 1ES9A 2C9ZA 3IEIA 4D4KA 4QYIA 1Z62A 3EH1A 4FFLA 1F9AA 3CVYA 5ECYA 1XQXA 2J08A 3CLTD 1SVSA 2NSJA 2P9JA 3LF1A 5AVZA 4LYYA 3B9BA 2JRLA 4KEAA 4HD8A 5DMHA 2BT4A 4NHOA 1B15A 1K86A 3VYWA 3CSDA 4DC0A 4O2RA 1I94B 1FBTA 3VZBA 4S05A 2WIKA 3OIVA 4F9FA 2ZJYA 1SOAA 1KJZA 3R3JA 3TLXA 3NFYA 2TYSB 5KTTA 4RD0A 8ADHA 1EUCA 3G2MA 1RVV1 3FTDA 4Q3KA 3BGWA 1SQFA 3MYRA 2I1VB 3ZWAA 4GI1A 1K7SN 2Q3CA 2C1EA 1ZIYA 2QXYA 1XZGA 2B1IA 3GPDG 1ADYA 5K3CA 4OBEA 2BP7A 5K6TA 1MG0A 1I1OA 1XTUA 5FFMA 1DC4A 1I6LA 5C35A 1YL6A 2AV6A 2CNLA 2H16A 5T4BA 3PUJA 3SQNA 3WKDA 4E1BA 3EIUA 5A62A 1T8TA 4ER3A 4DEXA 4HUJA 3IQHX 2JLVA 1X39A 5JZMA 4ZT6A 4AQ7A 4GVLA 2AJTA 3FE2A 1JKIA 3U44B 3AJ8A 3TJMA 4EPWA 4B3DA 4U6NA 1BRTA 3SQDA 2GTPA 3S6JA 1KU6A 3P9IA 2ODWA 2JI4A 2IHTA 4KU4A 3NMUF 4N3BA 2CDCA 1FTQA 1SVLA 2XVZA 3KYCB 3V2UA 1X8KA 4EX7A 1MDFA 1YS1X 1U0GA 5FTNA 3V5NA 3VHRA 4BKMA 4HXGA 2Q5EA 3CCFA 3KKPA 1KYZA 4M0EA 3SFVA 2W2OA 3CLUD 3SKXA 2A5DA 3U1VA 1RRVA 5BURA 1JI3A 1WKCA 4YQYA 1UMCB 1G20E 3OT1B 3AVYA 4ZA2A 3HYCA 2JFVA 3P97A 1YFJA 3AHGA 3USCS 3S40A 4NV3A 4XIGS 4C1BA 4PN7A 3F73A 5TVKA 1XCLA 2YHSA 2G5GX 7ADHA 3BJEA 5J40A 1R0BA 1CZHA 2ID8A 4LWPA 3MCZA 3QEKA 2VDVE 3HGTA 4A2QA 1J1ZA 5AKGA 5KX5F 1UDXA 1PL0A 2AZMA 3E6AA 2ZAOA 3FUTA 1FP4B 2AZTA 3BC1A 3N8NA 4ZVUA 2ALJA 4LSZA 2I2DA 3DZHA 4CHTA 1BWSA 2V98A 4JKYA 5I9LA 1KBQA 5C7OO 3GLTA 3AF4A 3VAAA 4N0DA 1R0CA 1NZDA 1OI7A 1IZYA 4JI6B 1O1YA 1RWKA 1WWKA 3A1SA 3MAJA 1ORRA 2JI8A 3FCAA 4HJRA 3N1UA 1IHOA 4YS6A 4HTFA 5FF9A 2V0NA 2HXGA 3CJQA 3FFTA 3RVLA 1PKXA 4LI0A 1TKAA 1E9VA 1KXZA 2QUAA 3DMHA 1G1MA 1T5IA 2QM7A 3PXEA 2ZYWX 4MYDA 1W5SA 2W8BB 3G0GA 5LU9A 4DLNA 3FA2A 3B5IA 4LMAA 1XHFA 3WJ1A 5CFMA 3IFSA 1QQTA 1DC3A 4IXMA 2QRVB 4JJAA 1F7VA 2YIMA 2ZJBA 2FFRA 1PVOA 1JLKA 2XF2A 2RGDA 3GJ3A 1BMQA 1VL5A 4YRFA 2R85A 3FCSB 1VMEA 3LY8A 1RJDA 2ODPA 1DRKA 1IXKA 4QVGA 5L4NA 2VUUA 5I7VA 1YH3A 4Z0NA 1GAEO 5CAEB 3VNVA 1XD9A 4GPEA 4NZNA 2JLAA 1JLRA 3OQ6A 2RONA 3JARB 3OCCA 1I1QB 1U2EA 2Z2JA 1QWOA 4YASA 5JQGB 2E37A 3WQRA 4Z3OA 1HLPA 2YWJA 2WKRA 3FMVA 3QG5A 4HATA 2WPDA 5A9RA 4OXIA 4UNRA 1JHYA 3W1WA 4GP6A 1KF0A 4JLNA 5ALSA 1X1EA 3KKLA 3RVNA 1YSCA 5LYJA 3IQFA 1OIVA 4ZAVA 5K45A 5I8PA 1JB1A 2W2KB 4LV6A 3T4EA 4I5FA 3S1AA 2GZ2A 4FHEA 1SZPA 4HFRA 4EITA 4YUAA 3AU8A 1EKXA 5I7OA 4P6VF 2NAPA 3Q6IA 4IG9A 3T7KA 4Q18A 4WY5A 1APBA 2B2XA 4QRHA 1NUPA 4FCTA 3DGFC 1SXPA 1II8B 4BVKA 5KYWB 3LHDA 3EIQA 4PPFA 4QG3A 1KI9A 3WLKX 2VJKA 1NKVA 1C81A 1TKBA 1U98A 2PMCA 4LGCA 4M8LA 1W7AA 1FMFA 3UB3A 3QBVA 3AI7A 3DBLB 4RHXA 3OZTA 3EC1A 3BVPA 3UTCA 1GFWA 2BIFA 4B87A 1G4HA 4YRTA 5GIPE 2YRFA 2I7XA 1BVHA 3BJIC 4YIKA 5DCLA 1PJLA 4QRIA 1Z15A 1GG9A 3GFQA 3F96A 3BDIA 1GTJ1 1R16A 3HJHA 4GVPA 2E4YA 4J4TA 4LISA 3UAGA 4BNTA 2YN0A 4OMCA 3Q6MA 4CV2A 2XCQA 4OJQA 3WQHA 4UFPA 4UFOA 5DBHX 3GF4A 1OHHA 1NMQA 3BK2A 4OATA 5JAHA 2K4MA 4W8GA 5KAPA 4EI2A 1SCNE 2IUSA 2X5XA 2YS7A 4BDTA 4YCMA 4KMRA 1IY9A 3DE4X 4QUIA 1QHNA 1PIWA 4M2LA 4AIIA 1AQNA 2FUKA 3FD8A 4UHDA 3DPUA 4DB4A 3PEEA 1XN1A 1H23A 2B20A 4U3JA 4B80A 5FPKA 4WW0A 1XBTA 4J3FA 3SE0A 3WAKA 1CUGA 3GVXA 2AN1A 4QU5A 4C21A 3GGJA 2GNPA 1O57A 1Y6ZA 4AWBA 1GM5A 4BX0A 4Z6KA 1ESDA 1VC2A 2FVYA 1LC0A 3RWOA 5K6RA 4C08A 5AMXA 2OCPA 2NGRA 4UE3S 5EZYB 3ME5A 4IVRA 3PFWO 4K3VA 3OKAA 3DDOA 1OWNA 3CUWA 1L5MA 1YTUA 3PF8A 4WZAA 4A6DA 2IYNA 2ZAMA 2PX3A 1DC5A 4ABYA 1VHDA 1LPOA 3LH5A 1RHJA 3L0YA 1UXKA 2B7LA 5IK2D 2ATEA 4BZXA 3P1JA 4QOEA 4EJ2A 2QQFA 4DCPA 3AVWA 2ES4A 5B37A 1UXOA 2WLSA 2ON6A 4TTSA 1L5OA 4I9HA 4D44A 3QUQA 1EUDB 1NU8A 1PFYA 1AN9A 1VJ1A 1XAHA 2BEJA 2PAFA 2W43A 1DJLA 2BYTA 2GBPA 4UAVA 3IT1A 1YCGA 4WXPA 3RWBA 5K3OA 2LKCA 4M99A 2C2YA 2ZYTX 3C41J 3Q8LA 1M33A 2YVUA 2EZ4A 3WSWA 1GPUA 4BKPA 3ZE8A 2ODBA 4EI9A 2LCFA 1JEQA 3II6X 3NBZC 3SVZA 4G0VA 2JH8A 4AW9A 2QN9A 3Q4GA 1V5GA 4M7OA 2VKQA 1LA2A 4GPTA 4QPZA 3ROZA 3W3AD 3PJDA 4ENSA 3OM8A 4M88A 2F3QA 1D3AA 4HNVA 1MT0A 4BGVA 5GM2A 2WWYA 2G1AA 1X7HA 3R6DA 1L4EA 5JWHA 1DJPA 2IY9A 1QKIA 1U63A 3RS0A 3VSAA 1BXGB 1ETHA 3U3OA 2RJ3A 4OP2A 2OHVA 1FNDA 2OBYA 1RZRD 2PVCA 3KDSE 2WZDA 3WDMA 3RTBA 4BB6A 1RQ2A 4EUEA 1JT9A 1JS1X 2QB5A 2WYVA 3K70B 3IEUA 4RXUA 1VSVA 4FW9A 3TRIA 4EB6B 1XA0A 3M82A 3ZH2A 2HADA 2R6R1 2ZYUX 3KZXA 4WEQA 1G5PA 2K87A 4N39A 5EKTA 5DJ5A 3P9KA 4A2WA 1TK9A 5EE5B 5BSTA 5IFLA 4ML3A 1OJLA 3RSOA 3VZCA 3QPBA 4E5PA 5JUWA 5CNKA 2BFCB 4C87A 5BRJA 1TVMA 2CL0X 3X1DA 3D5TA 2V03A 4YJ3F 2Q27A 1X74A 3HZZA 1BKDR 2E4AA 3O4FA 4R3UC 4TRNA 4JI8B 1R8XA 1AA9A 2HO4A 1JEEA 1S4MA 2QI9C 2OYCA 3R8FA 3F4BA 2ZDGA 1P61B 3C7AA 3TAXA 3SIPA 2H0RA 1TJYA 2PNJA 4RIEA 3TAHA 3WJ2A 3K6SB 1LQUA 4FR2A 3K6KA 1ZN7A 2AWNA 2CBGA 2YJNA 4MJLA 1XV5A 4U7HA 5J2UA 1R0SA 1EVYA 1ZM3A 1FS5A 3BTOA 4GI3A 3U3KA 3OSZA 5J4LA 2WZCA 3NWPA 2DQSA 2FSGA 4UVDA 2RKWA 4TKMA 1ATZA 4MVJM 1YDHA 1FU7A 3Q7SA 4DF3A 5ICGA 4KQCA 2FLWA 3LV8A 4XSHA 2C83A 3QKRA 4DMKA 4WT7A 3WMXA 1DU4A 1YT5A 4DC1A 5I47A 2WWVD 2QRPA 2C99A 4YMVA 1I4OA 2HRQA 2FEOA 3LKVA 4J6EA 4JQCA 4AN1A 2VXBA 3P4UA 4CRWB 3KAKA 5HBGA 3GRVA 1FUYB 4L0MA 3EDRA 2PRJA 3OM9A 4DDUA 1QH8B 1MGOA 1RYMA 3OY7A 3V46A 1ZUWA 1CNMA 1GKKA 2B92A 4HNRA 1ENPA 1HFJA 4R8MA 1TC2A 1ISRA 5L9AA 2VUIB 2OYSA 3OF3A 1NJ5A 1PTJA 1RKQA 2WYUA 4WUVA 4DMGA 1QWSA 4EHJA 4ND2A 3AIOA 3JX9A 1ORHA 4TM8A 2V4UA 2ZXEA 421PA 3I09A 5IW8A 4AF8A 1BWQA 3HM9A 3RYFB 1SZDA 3PLAE 1WCYA 2OD7A 1KOLA 5A1TA 4Z3KA 1TCAA 4TS3A 3HVUA 4CG2A 4OJNA 2AW5A 2IEZA 5KOJA 1DPFA 1XMVA 4D5EA 1VDZA 3HKEB 2G83A 1UBLS 3LC1O 4RLHA 1FDRA 5LP6C 1SH7A 2IFTA 3N2GA 1CU1A 1RD4A 3H17A 5IARA 3HYNA 4WN9A 1EFPB 3AI2A 4OHFA 4MVJE 1A8PA 3MMPA 1IOVA 3PGA1 4HWKA 2ZIFA 3GDOA 3C1AA 1XHEA 1RRPA 3ODGA 4N40A 4ZHSA 3D1VA 4PEVA 2AG1A 2XMDA 4ZCQA 3RODA 1GXSB 4EHBA 2R8OA 4BLRA 1C80A 1O95D 3QPVA 4DADA 2CFTA 2H1RA 2Q9CA 1G8KA 5KU7A 1Y9ZA 1OZFA 3HB7A 1ILWA 1ECJA 3KWFA 3HCDA 1RIFA 4MARA 4CDMA 1RC0A 4CR7A 4KIUA 3CZ5A 5CDUA 3ICEA 1DTSA 4YMWA 1XTVA 2FW9A 5FL7D 3JWIA 4GMDA 3T8YA 3EG5A 3UJPA 1OV4A 1JHOA 2BELA 2XV1A 5AKLA 3O1HB 3UWKA 2DBRA 1IG0A 1JSXA 1J97A 3JSAA 4QGAA 4WACA 2V6MA 5FQOA 4FB5A 1ULSA 1XCOA 2D6FA 3FJ1A 1C9NA 2QSZA 5CU7A 4J7UA 2XI4A 3C6ZA 5BT8A 3HRHA 3UW1A 1JAHA 3D2LA 4N41A 2RGGA 4PS1A 3H5RA 4YAJA 2P68A 2ABWA 4PGMA 2ZJ4A 3PGKA 1UCFA 3HKBB 4S2UA 5CEFA 1FE8A 1ULHA 2DCUA 2FG5A 4HMOA 4NYJQ 3GLRA 4MWSA 3SSMA 4RTQA 3J80A 5AHRA 2LTAA 3I2JA 3TQIA 1ISHA 2DMRA 3ZCSA 3N7TA 2IX9A 5AVSA 3IAXA 4A16A 1T5SA 5CHYA 2AEEA 3O6VA 4IQ0A 5F51A 5IAJA 3C8ZA 1N77A 4OA8A 3OWXA 3SE7A 1UKEA 3BB1A 5G2OA 3HWRA 1T3HA 1V3UA 2EATA 4HAUA 3QYFA 3RQSA 1NF2A 3KPJA 2XEDA 5A02A 1RS0A 1NNSA 3FF4A 2V3CC 3WYAA 1YB1A 5C80A 2R5FA 4Q47A 2H8GA 2BBTA 3V7UA 4C2UA 3A1CA 1G7RA 3IUSA 3QMVA 4LRWA 1F6BA 3DH0A 3T9DA 3PGJA 3PE6A 2W4QA 2V54A 4QYIB 4F4CA 5A04A 4PHFA 2VPQA 4YB8A 3GDHA 4NFLA 3BRWA 4MV6A 2DH6A 2V4ZA 1OBCA 3LC2O 4UHEA 2X0FA 4P7FA 1EX1A 3AXTA 3KDAA 3TXYA 1P6QA 1RM4A 3QU5A 1VE5A 3MT0A 5TS3A 1PR4A 2HA7A 4IEFB 3H8WA 3I9V6 2RI6A 2W2XA 3L7IA 3HBNA 5F2NA 3FPKA 4D0LB 1P1KA 2GHRA 2AS0A 3A3KA 1TMOA 3KIPA 1I0LA 4C88A 1GPKA 2FOXA 3UXEA 2ZVQX 3H2GA 1I5OA 1NJ8A 3HZOA 1LI7A 2Y1KA 5ICSA 1Y3IA 1ZITA 1OYYA 1Z56C 2D0DA 3N53A 3O2SB 5ILQA 1TM5E 3OCWA 4CCYA 3HK2A 4O08A 1LPSA 1GGHA 2RGWA 1OYOA 2OYRA 2BP7B 1IXRC 1NVTA 3IKTA 3DGEC 1TI7A 3I42A 3TGPA 1MJNA 3K2BA 1OLOA 4JL5A 2CDNA 2MMGA 4Y2HA 3O3MB 2QQ0A 2JIRA 4F2PA 3AB3A 1DOZA 4TXJA 3DTVB 3L43A 3NWOA 2EJUA 1FDOA 1PBTA 3DMTA 1RPAA 5E4TA 4QDKA 1E3JA 4LZNA 2ZEJA 4XIYA 2O6LA 3V4LA 4HXYA 4BX2A 2JFNA 1ENOA 4D2IA 2WD7A 3VU3A 1MW8X 3AFOA 4B44A 4UCXA 4E51A 5JROA 4MQEA 4G5QA 4TMVA 4D8VA 4DIFA 4MYTA 3O94A 4U0KA 3FHCB 1WE2A 1QOZA 1TB4A 5I7UA 3UMJA 1QU3A 2VPPA 1UJNA 3JTMA 4R68A 1LLFA 4QQNA 2RHHA 4YQEA 3H05A 3LQRA 1FYEA 4HLCA 2WSIA 3ABIA 4ZTUB 1HDGO 3PF9A 1ZJJA 5AI6A 5C37A 1SVMA 4BO7A 4G01B 1LDEA 1AGNA 1TF7A 4W5RA 2VAPA 4X65B 5L95A 1GRRA 4MQLA 2HJWA 1BGWA 3BMNA 1GVHA 1E66A 1FFDA 1YA8A 3FCYA 1EQUA 3GRAA 2EJCA 3ZU6A 2VOJA 1R6BX 1SPXA 4H7KA 2OCIA 1ZRSA 2Q5IA 2V97A 4HGRA 5D6OA 3ZV5A 1AKTA 4BQQA 2B6NA 3HA5A 5HIIA 3ZDAA 2EWWA 4EHLA 2CHEA 2YL2A 3HY6A 3HCBA 1MCZA 5FYQA 4Y2TA 3DAHA 1YBAA 2QLNA 3IAFA 4YP5A 5C8VA 2HSJA 1WW2A 4LTMA 2OWDA 2B37A 2R4TA 1L4GA 5JY1A 4I7EA 3TJZA 2QZZA 2WB4A 5IYZF 1L5FA 2WIDA 3VSCA 5FBHA 3JQAA 1SIOA 4HTFB 3TCKA 4PHHA 2AG5A 4AYWA 2CXPA 4HGZA 2CVQA 3GLUA 4MXDA 3GRCA 4MVJH 2W6ID 2O1SA 2C4MA 2VWQA 4O2AF 4RELA 1WQ4A 1LNQA 2ZIVB 3QBDA 2H5JA 5F3RA 3UK6A 4B9AA 2ZYVX 4ZAGA 4LY9A 1IC6A 2VDQB 1T8WA 2XMGA 1X7XB 3O03A 5IX8A 2BZ1A 4Z99A 2QZSA 1ZH4A 5CT6A 2BBOA 2GAIA 3CKYA 3VSDA 4BO2A 2BEKA 5IAAA 4FINA 1FJ2A 3OZSA 3AXSA 1VCMA 3ZY2A 2NYRA 3GGSA 1KKLA 2P1DA 3ZD8A 3IOMA 2C2ZA 2YYAA 3LW7A 5ALJA 1P62B 2PLWA 4BQFA 4EW1A 3W2HA 2W37A 3CF6R 5KHOC 4JEHA 2BH2A 2JNWA 1PJRA 1A2QA 4MKXA 3GT0A 2VF4X 4K88A 5BQPA 2NPFA 4H1TA 1SXJD 3QE3A 4Q1CA 3R24A 4FI3C 4CVNA 4WECA 5FTMA 1M8KA 1G8YA 2EG9A 3HDHA 3QUAA 5LYJB 1IM8A 3V8BA 2P65A 3IUEA 3S1AB 4BUZA 2ZUVA 3G7UA 4I81A 3IPCA 3AHCA 1YOVA 1R6XA 2EF0A 4QG7A 1Y5NA 3U3JA 1E7WA 2EKBA 4RWZA 1P33A 5MGBA 4M1WA 3UKDA 2YDXA 3RGGA 1XPOA 3AYXB 3IMKA 2XRFA 2XODA 1B2LA 1VXOA 4FOSA 1DE0A 1P2VA 2RIRA 1RRCA 4JI7B 2AWOA 2HDWA 4BNDA 3FTFA 2PS0A 2F62A 1M54A 1LK0A 4JHLA 1BVUA 3DVSX 3T1YB 2VPXA 3MAGA 1ZRNA 4Q66C 1C50A 1QRDA 4HGNA 4R2LA 5LXTF 1PL6A 3T3DA 3UAZA 5BOSA 1OH5A 4C0KA 2E5WA 5CGZA 4J76A 4Q1DA 1PL8A 4QO7A 4P0QB 3JW8A 3D31A 1KZ7B 3D8TA 4CTKA 4CJXA 5AHXA 3EMDA 4AWAA 1K7CA 3T3EA 5KYTA 2O1WA 3N5KA 4WEOA 1XOIA 4EOGA 2XTMA 3H83A 1MIHA 4HWSA 1B6TA 3WC4A 2H9IA 1NXWA 2NO0A 1CZNA 3KOYA 3NTVA 2RARA 1R4AA 4UOEA 2AJCA 1E3LA 4DV3B 2CK3D 1ZN2A 3D6UA 2PKEA 1T2FA 4ZEVA 3PQ5A 1GILA 2P79A 3BXFA 4MGEA 4W5WA 5TJ9A 2UZAA 3TLGA 5HZGA 3W6UA 1G98A 3C3XA 4UHJA 4ZQGA 1KK3A 3K71B 2WP0A 1YK1A 2WYWA 5DLPA 3F7OA 1BYUA 3X0DA 3D8HA 1E1RA 2EIXA 2GUGA 2G6BA 4U3JB 3WYBA 1K8XB 4KUHA 3X1MA 4BZZA 4WJZA 4AQDA 5HTOA 1DQNA 2XLCA 1COWA 1GTMA 4UQPA 2W9XA 1IRIA 2YNMA 4H1WA 1G21A 1M76A 1QR6A 3TFWA 4AJOA 3DOIA 2ZQZA 4KIFA 1N33B 4A4DA 1OYWA 1Q15A 4EX6A 5D3QA 1KI6A 2Z09A 4WZAB 5BVGB 1NLYA 1QV7A 1KFKB 4ZXPA 1HYBA 2VJOA 4DR3B 5JNTA 1WD5A 2C82A 3KKQA 3VKUA 2VSOA 1E4EA 1V1MA 2JCBA 3F8TA 3INNA 1KFBB 3MCTA 3QENA 4IV5A 3VDXA 5FWXB 1XRQA 1GZ6A 1G3IA 4R1PA 2BGUA 2PD3A 4EENA 1C8BA 2CVZA 2PX2A 1JA9A 4FYPA 4XB2A 2KI5A 1P5RA 1XMXA 1TQ8A 1G8JA 4HB4A 3R4CA 3UOGA 3FYTA 4Q3BA 4NQZA 2I67A 4HN2A 3RS2A 3B1ZA 3EH2A 4PBTA 1P73A 3ZD9A 1PYOA 5CFRA 2NP7A 3IKVA 1E2IA 2WVHA 3QIVA 3WMRA 2Z5GA 5CB0A 4KFSA 2DPHA 1JEQB 3AGQA 4PCLA 1Q2UA 4RMGA 3VH3A 3ZD7A 4C4PA 3WI7A 3OMXA 1AK2A 1M5UA 1TYAE 1G6KA 2BJWA 2C77A 4M36A 3NQ41 1C5KA 1CUHA 2JD2A 3BD6A 1BA2A 1LCIA 1FFEA 5ULLA 4F3KA 4CPDA 4ITUA 2QTGA 2JFBA 3DXZA 4K6OA 1RMYA 2DPMA 4UEQA 4GHWA 2ICAA 4D1YA 1L4MA 4DW8A 3ZDFA 1ZCFA 2X9QA 2RHJA 4FJ1A 4L0DA 2ZBVA 3MWGA 1ZGGA 1A88A 1L5GB 4IFTA 4RX1A 4BFLA 5JZVA 4XDGA 3IX7A 4TRRA 5K8LA 2VHEA 4KXMA 5C46F 2XWJI 1WPQA 2EYUA 2RH5A 3FKSD 4QGGA 4QBTA 2D4HA 1ZD4A 1GZSA 5EIXA 5JZSA 1HSZA 4WLEA 5DIFA 3WYEA 3MBKA 2BFNA 3RHSA 3V1NA 1V6AA 4JUAA 4QTYA 2GTHA 4FHZA 4FC6A 4GIBA 2FHSA 1A8UA 3TRJA 4JA2A 4O2BA 3GL9A 2HQBA 3LQKA 1P2BA 3JQGA 3BSFA 4JP2A 2IQ5A 3B52X 4W63A 1VBFA 2QUBA 2ERYA 3PG5A 4HEQA 3RIGA 4MTLA 4MV3A 1XDGA 4BFWA 4DSAA 1ZVJA 2FH5B 2Z2XA 3CH7A 3LY9A 2XB8A 5HGXA 1U2RA 2MSKA 2QIPA 2WLTA 2OV3A 4FEYA 2XKBA 4DQ0A 2OOSA 1DZ3A 2XTJA 5EEHA 5J2UB 3CBQA 2XE4A 3AUSA 3OT5A 3N6XA 2IGBA 2NZUG 4F38A 4ESVA 1HTTA 1NYQA 4GPD1 5HIKA 5GADl 1NPTO 2Z2YA 1XLUA 3KUXA 3P9NA 4OQQA 4ZT4A 3H8JA 2FSPA 4O4IF 1IVYA 4DBLE 5B2EA 1K4KA 3WLAA 3MT9A 4ZHQB 1VCOA 3V1LA 2NXNA 2VATA 5CX1B 5BW6B 4QVIA 2HUNA 3F8WA 1BMTA 2O0KA 4RGQA 1EAMA 2HF8A 4KH1A 1V1JA 3OEWA 1PI3A 4IUBS 2IZOA 4L9AA 4B83A 4KE6A 1W96A 4NX2A 5F7OA 4J43A 1K9SA 3LWDA 2XUAA 1A7KA 4RZ3A 4EAQA 1MAHA 2BF4A 1CVRA 2DQ4A 3SEAA 1SKUA 3EF1A 4CLEA 2YXNA 1J23A 3PGLA 1IPFA 1N2BA 5AKYA 5DNDA 1UPFA 3QXCA 3VHLB 3QG1A 2YQ5A 2V7GA 4LJYA 2DU8A 1VHJA 4QPCA 4E5VA 1JG6A 3NP7A 5CLGA 3TE6A 2IEBA 3H7IA 1EFVA 1NFFA 4YJKA 4LAFA 2PUBA 4YAGA 1Z22A 5ALOA 4EPYA 1IJEA 1ZMRA 2PO5A 2FR8A 2VJPA 1U7PA 4FE3A 4WN9B 3P0HA 4LYFA 4IOMA 2WTAA 3K4HA 3WIUA 5JS7A 3GN2A 3QY0A 4NCKA 2VDJA 3V8VA 4EF4A 5DPMA 4CTMA 1Z73A 2DE0X 4QPDA 2C4HA 3SR0A 3PNQA 1JJFA 2A9KA 3AIKA 3FRIA 3OU7A 4G5GA 5JT1A 2FXIA 3I9KA 5IC5A 5NLLA 4B17A 2PBLA 2MYUA 4P98A 3RREA 2FPOA 2ZPUA 1DX4A 2H57A 1MJFA 3AHJA 1E2EA 2ZSEA 2A9FA 4G24A 5GV7A 1KU0A 5JCXA 2X23A 5FQNA 3JQPA 3KBBA 1BHSA 1WBBA 2J9GA 4FZVA 5BV8A 1Q1NA 5LC1A 1DV1A 4ZN6A 3BD7A 4ZD6A 3TSAA 3I8SA 5CM8B 4FLFA 2OBXA 3O1LA 4NAVA 2AN3A 3IDQA 3QPAA 3PRKE 4FDMA 2D1FA 4TRMA 1JA1A 2HK9A 4R2WA 1OXUA 5JAPA 5FT9A 1A77A 4PIVA 1G0OA 1JTVA 5DKFA 1Z4QA 4ZK2A 3MSCA 5BN5A 4IHAA 3KOXA 4BB5A 2CF5A 3W79A 3QFSA 5DISB 4MWOA 1C3OA 4M1SA 1SOMA 4XM2A 4YLGA 3B60A 1DJQA 2QMQA 2O06A 4H1UA 1E2NA 5D85A 2XD4A 2ZWIA 3ELUA 3P5SA 2I4IA 1Q7CA 3AJ9A 3EW7A 2V7QA 3N0XA 1XRMA 4WXEA 1G9SA 1A7JA 1T6XA 1VP9A 1C4WA 4L08A 5HFNA 1J0XO 3K94A 2JB9A 4C7VA 2M6KA 4UVEA 1L8LA 1OF1A 2OOKA 4HDSA 3GEPA 4AYTA 3E0QA 5GOZA 1LFDB 1YVUA 3HDQA 3IKJA 3JZIA 3U56A 2BTOA 4ZZIA 2I2CA 4JLJA 2I6UA 4EO4A 3VNRA 1OB2A 1DKRA 3M3HA 1E9EA 3CNOA 3EA0A 1AGXA 3JWGA 3LUJA 1HXHA 5H4HA 3JYOA 4F60A 2XITA 3BAFA 1AMUA 1NZFA 4HPWA 3W3AH 4RH0A 1P74A 2MDTA 1SC9A 3D8RA 3FPHA 3NORA 4XYMA 3UOWA 4AZWA 3NTQA 4U2EA 4BNJA 2C5SA 3MFQA 2C4KA 2VH5R 4Q7KA 1Q1AA 1E20A 1LV7A 2ZVDA 3A36A 2DTDA 4ROTA 3DE1X 3JVVA 1BN6A 1UC8A 4GT1A 2PCJA 4FYHA 1DC7A 1XXLA 3I45A 4HLUA 4YA6A 3G3EA 1KYYA 3UV3A 3AVVA 3AL0C 4DCNA 2ACEA 5BYAA 3QBEA 4RGBA 5JANA 3RU3A 2C03A 2NZJA 3CF4G 5A2GA 3VYSB 3B53X 1QKKA 3K70D 1RJGA 5A0TA 4ENRA 5AVRA 1TTQB 1B6GA 5CG2A 2IEAA 2OB2A 2R1VA 1DRJA 1U2DC 5FORA 3C45A 3OY2A 2DJIA 4E15A 2I6XA 4ZAYA 5BRNA 3IEXA 1JIJA 1EX7A 1EB9A 4OREX 5DU2A 3KZCA 1W49A 3AC0A 3HCOA 4Y1FA 4FXPA 1YS6A 4JJ7A 2AJLI 5CIWA 1DO8A 3N59A 1UPCA 4BVHA 3HN7A 4C03A 1LVUA 1B00A 3WFJA 4CMCA 4CCYB 1ZR4A 3OWOA 2G77B 3RYCA 4DA9A 1A4RA 2IY8A 4M37A 3ECAA 1HV8A 3IP7A 4NS1A 4O4HF 4W5QA 1W44A 4X61A 1IBCA 3M2TA 2QRGA 3ROMA 1PFKA 1Q6YA 2ZKLA 1VHLA 1EFKA 1S3SA 3IKLA 4I1YA 1MXHA 2AN9A 1KDOA 3E05A 4RNCA 5T4HA 1V41E 3UMVA 1WU7A 5JV5A 2OO3A 3C3EA 3DVLA 5EG5A 2JLSA 1T6BY 2R84A 3X1ZA 1K98A 1WXGA 2CEKA 2KLBA 3USZA 1O8CA 1XRSB 3O84A 3K35A 4NEGA 4PZUA 1S2NA 3CUVA 4Y0VA 3IV7A 5HK8A 2I4MA 4P5DA 3LXXA 2X58A 1N7GA 2BJHA 1HR0B 2IODA 3BE6A 4K28A 2KB0A 3E53A 2DUUA 2ILTA 4MQEB 1JG7A 3VJRA 3LA8A 2J0UB 1BH2A 1DRWA 3NJRA 3DLPX 1L3BA 3NTLA 3GRYA 4RTLA 2W2MA 4FONA 5KCZA 4TQGA 4IIJF 4BXOA 5A6VA 1EXWA 3EZYA 3OP1A 1KP9A 1FMLA 4IKEA 4QDZA 3GMTA 4BEVA 5CPBA 2XAUA 1CUEA 3K8QA 1V4BA 4YDHB 3DZDA 1U4NA 3GUHA 5JZOA 5KVSA 3TOCA 1FYFA 3GRUA 1T4CA 2IV3A 5GJBA 1AM4D 3BMNB 3OM1A 3VMMA 1ZOLA 3FF1A 4P38A 4ON9A 1E61A 2R6CA 1OSNA 2X9LA 4CG0A 2QTNA 5SY4A 1HDIA 1CBUA 1QH9A 4JBHA 4RM2A 4AO8A 3KSDO 2RB5A 1L7XA 4N5HX 2Y2UA 4FKMA 2COEA 5A3RA 1Q77A 1JGTA 3A05A 4DZZA 3P19A 1Q0SA 3VXKA 1RZ3A 2HDHA 3DULA 3FIJA 2ZRQA 4M49A 4EEKA 5KMGA 3GPBA 3MCUA 3UMFA 3I5YA 1YDFA 1GL7A 3D6NB 3LM8A 5EJAA 3JQAB 4JP5A 1JQKA 4DABA 3AF5A 3AVQA 4O29A 3AZQA 2QJTA 3AONB 1PR0A 2NZ8A 3RRXA 3TTVA 4C4SA 4EG5A 3X1WA 3FDZA 1BE1A 1FTYA 3AJAA 2QS9A 4JLMA 4TMKA 1IU9A 1OJ7A 2R86A 4L6AA 3NHFA 3UHFA 1J5XA 3AFIA 3BTVA 4GI2A 1EAYA 1NN5A 1OTXA 5H1YA 3L49A 3Q8MA 3FPAA 4Q4JB 3TB4A 3Q7RA 1SJ9A 3N70A 2Q8PA 2LGJA 2YKGA 2IEYA 3NUZA 1ZH2A 4P08A 4XVUA 3IT0A 3M6WA 3B7WA 1BMFD 1KPGA 5KC9A 3U31A 4YY3B 4Q9NA 4ENUA 4NNJA 3IEVA 1XFDA 3LLMA 2Z08A 4HB2A 2CUTA 2R1ZA 1OAKA 1ONOA 4H0FA 2WYOA 4O1MA 5DI3A 1E1KA 4ZO8A 4B6SA 5KC8A 2CVOA 1Z12A 3KJFA 4MV4A 5IVPA 4GX0A 5KNBA 4PZZA 4X1OA 3RU2A 4ZCIA 3I9MA 3R6GA 4KP7A 3F1LA 1BU8A 3NEYA 4DRXA 3CUYA 4M46A 5I8WA 3M70A 4BTVA 2ONZA 4OSOA 5L4LA 2H08A 2WJYA 1E89A 3LZ6A 2QDKA 4JLAA 5AHOA 3TPCA 2WTMA 5AIBA 3PVCA 5LOVF 2CB9A 1VJGA 3TRDA 2FZKA 3E0XA 1HOXA 4Y9DA 3PX7A 4HDKA 1LSOA 4DIOA 3SZOA 2P30A 1KZ4A 3E7PA 1CY8A 2VOEA 1E6CA 3QFTA 1XNRB 2Q07A 4KWIA 2PKWA 4R7TA 2VR1A 3DL2A 1JG1A 1UBKS 2E55A 1SB8A 3VJLA 2UZIR 3ZGVA 4FS8A 2FWRA 5C1IA 1GGMA 3NTOA 3HBFA 2CZQA 4ITRC 5DW3A 5IU6A 4OLHA 1S96A 1YTLA 3D81A 5BOSB 1EP9A 2FN3A 2WG0A 4XJXA 4X6XA 3HA2A 3GN1A 1AE1A 1MW9X 1B6RA 2Q2NA 1HYGA 1G0NA 1JMKC 1T9CA 3BOSA 2H8KA 1FVFA 1NVBA 3HV2A 3KJQA 1BHJA 1W4AA 2UXBB 3TMYA 1GNSA 4CNBA 1XI2A 5EN4A 3IPXA 1AGRA 1WW3A 2HYIC 4TZKA 3ZWBA 5TV2A 4FGKA 1RLIA 5J4YA 2G1PA 3TUIC 1IN5A 2QZPA 3DE3X 3DHVA 1DXQA 1RAHA 2NW6A 1VLHA 4DCJA 5H5JA 2OP0A 3TLGB 4BFTA 5JWOA 1O94A 4N6GA 3ZU5A 3KR0A 3P52A 1PJBA 4JEUA 2BHSA 1PJZA 3G1UA 3P9QA 4X1YA 1EDOA 4CEHA 3OQNA 1PNOA 1JQLB 4JB3A 3GPLA 1YJCA 1WP9A 3P2YA 2PCLA 4TTPA 3LUDA 3C3JA 4QOSA 4NENB 1V8OA 3R3UA 3ID6C 4BFCA 1G21B 4Y2SA 2JHGA 3VR5A 3TQCA 1A9SA 1QAQA 1LDBA 1X1BA 2QW0X 3DQPA 1KI6B 3MWYW 4A73A 3VSEA 3L4JA 1ZC3A 1ACLA 2HIHA 3IO3A 1RRMA 4ME6A 1UT5A 4P22A 4X41A 1YE8A 3DE0X 3KU1A 3ZJ4A 5TEWA 1E4EB 3IAS6 1V1MB 2JBAA 3A6LA 3HFGA 4G25A 4FMDB 5G0UA 3V4PB 1W4BA 4AG3A 2LNDA 3FNBA 4KX5A 4RHCA 2PNFA 1F8YA 5HXAA 1NXOA 1ZHOA 4LYJA 3SU8A 2P27A 3ZHBA 4TV8F 2W6OA 3RJMA 4KW7A 5AWFC 4OYHA 4K26A 5BQFA 2AOUA 3GCDA 1VPVA 2YIJA 2RHCA 2C96A 4ZPXA 1WQ1R 5IASA 1A9ZA 3T7AA 1XXHE 2X0RA 3DMYA 3ONNA 2Y6UA 4EB0A 2PD6A 1RXEA 4UTRA 3QUBA 4F3CA 1MLDA 5BNFA 3L40A 4R0NA 4YO8A 3EVCA 4CMIA 2BI8A 4PHTA 2ZWAA 5J58A 3CISA 1PK9A 3GUVA 1DWOA 5C8YF 1J0AA 1MDBA 1D4AA 4XJVA 1HZZC 4BB0A 2ZSAA 2R7LA 3TX6A 3DYBA 5EJ7A 2XQJA 2A9QA 2ZUDA 1WZCA 2ZS7A 1F8UA 2C78A 1B3BA 2YWGA 4UVHA 3EUEA 3T3IA 1NVFA 2DB3A 3PHIA 1GZ3A 1NX9A 2CLFB 3ZN2A 1KJYA 1P9WA 3PC8C 2FWNA 3ZZTA 4QGSA 3ADPA 2QLFA 4LSMA 1R5JA 5DXJA 1RPZA 5ITVA 4CT5A 2R2GA 3K6JA 3WQQA 1GZUA 1BVRA 3IP5A 1L4HA 1GCUA 2QUJA 3K9GA 1KQ3A 3M6AA 1IXZA 3QTTA 3G9TA 3CW2A 4Q82A 2X6TA 1AT1A 2X2FA 3QRWA 2YFQA 1W48A 3FSJX 4IIBA 4OGKA 2JI7A 3PNBA 1GRVA 3KQQA 5AOAA 2BGRA 3B70A 3NHWA 5IJAA 1YV9A 4NZOA 5HMLA 1Y9AA 5FAKA 4A0HA 4RIGA 1XZKA 1KI7A 2BM8A 4M1KA 5EQDA 1G16A 1U8CB 4EQ6A 1XMIA 1EIZA 3JQGB 1RP7A 4L57A 5DHUA 1BRMA 2PZEA 1QPBA 5I51A 2ZUFA 1N2ZA 2AC4A 3H3JA 1E9BA 4KQFA 4MKZA 4OFBA 5CR9A 4ADSG 5LD2B 3RIXA 3E1GA 4R1SA 3CHYA 2ONKA 2WPDD 3EB9A 5KJ6A 4QELA 1PQUA 3JAKA 4JQZA 5TR9A 4TTIA 3DDNA 1NUHA 1QVZA 3OFSA 2RHGB 2QHXA 3W6OA 1UDRA 2RK6A 3LRXA 4UNIA 5EGNA 4KNVA 1QK4A 3MXTA 2JIZD 5J9FA 3WLTA 5A5DA 2QU8A 5LQCA 4OH1A 2A58A 1L7QA 1NOIA 2Q21A 4XIFA 2QD1A 1QGYA 4XFJA 4N9QA 5FFNA 4DAEA 4JBLA 5K4GA 1NSYA 1FCJA 2O2DA 2WIJA 3IOCA 4B7UA 5LYYA 3RAEC 3KXKA 3NASA 2TRSB 4LOAA 3TI7A 3ZWWA 4AB1A 5L40A 3C5VA 4J6FA 1FX0A 4B09A 5KNCH 2GPAA 1Q14A 3R7AA 3G23A 2ZZNA 1VE3A 2XB4A 2COUA 3QFFA 3T5PA 3LDHA 2P2CA 3A28A 4HH4A 4OX9B 2PGLA 4KB5A 2FPRA 4PPYA 5AUOB 2Z2KA 5KCMA 3R76A 1J2RA 2RAUA 2FCAA 3NBQA 2Y0PA 3JY6A 3L7DA 3SQOA 4CEJB 4N8DA 1CQPA 2J67A 4YPVA 2RGXA 2EX4A 2VZ0A 2EQAA 3KXPA 4E6PA 1QE0A 2ZREA 3T7EA 4FIZA 2HDOA 4NNOA 4JXZA 3HQ4O 5HNKA 1EFVB 1TW3A 1G8GA 1Z13A 5KBYA 1F51E 1EDDA 4ILEA 1UKVY 4NATA 5KQPA 3TIXB 5D84A 1Z63A 1OHHD 1R8JA 1FP1D 3HGMA 1IVNA 3OZCA 1MO2A 1OH7A 2P78A 1GHTA 3Q1LA 4EPRA 3O9ZA 1VSUA 5F9MA 3R3ZA 4NBLA 1UMDA 4RK0A 4ZGGA 2GYVA 2R5NA 2JJQA 3N58A 4KK3A 2DWQA 3VYTB 1VL1A 2HK8A 2TMYA 4G81A 1GRNA 3AFNA 1T36A 4K87A 4CMGA 3JAWA 3QVTA 3AJRA 4IMRA 5C52B 2GPBA 4FLEA 3SHOA 3SZLA 2GZHA 2R6JA 2GN9A 1C8VB 1SCIA 2BDUA 2HPAA 2YCLA 3UHAA 5KOJB 1N78A 4MVJF 1NQAO 1THTA 2QGFA 1G8PA 4LCJA 2XGGA 3CV3A 1M6VA 1U4SA 5MN6A 2UYQA 2MSWA 2WQZA 4MPJA 4B2YA 4YECA 3WGTA 1M2VA 5K05A 3ITEA 2V7UA 3LUCA 5JCOA 2A8YA 2EC5A 4ZREA 1KKUA 3AHIA 3FYSA 1ESEA 2EJWA 2O14A 3HKDB 5CFZA 5BN5B 5T6BA 3KP1A 3RBXA 3IV6A 3GVCA 4KAJA 4KVZA 5F4ZA 3R7DA 1CB0A 3WNCA 3V8RA 2I1LA 4FZRA 4N54A 1C3OB 2ZYDA 1I2AA 4CF6A 4RLQA 1E7QA 3HG7A 1WF6A 2C5LA 4K9MA 3D6HA 3MHPA 4O4LF 1R64A 3TTXA 4E2WA 1CYEA 3AEKB 3PFNA 3HBMA 2NX2A 4F5YA 2C5GA 3U9TA 821PA 3PNLA 4J1TA 2FW1A 4RIFA 2IE0A 3DF9A 1Z5WA 1NR7A 3WXBA 1U02A 1U3GA 3ER9A 4WFKA 3DQZA 2HHCA 3LF2A 4ZYVA 3KLMX 5DNUA 2JANA 4KE7A 1P9NA 3IALA 2OHIA 3HTXA 1JXOA 1DG9A 4W7SA 4OL0A 5D01A 3LRPA 4G5RA 5DTEA 1P4JA 2XJ9A 1ZOPA 4NRDA 4YCCA 4DTIA 3V7NA 1IWBB 3R77A 1G42A 3QKWA 3T9CA 5A9SA 4MUGA 3M1AA 3FBGA 2W2NA 2FNAA 3KXIA 2J8ZA 2HU5A 4GSYA 3B9RA 4JAVC 3K8ZA 4S24A 2YJZA 4P54A 4MVJG 3URMA 5BWBA 4R98A 2HMSA 5K3EA 4K0RA 1ISGA 3F6SA 2GERA 4UAGA 1NKTA 1M2HA 4KYIB 2PRIA 1UH5A 3GVPA 13PKA 1IATA 3EIWA 4UDOA 3FPFA 1N0WA 5A4IS 2J5QA 3Q15C 2XBMA 4R1NA 4WK0B 4K1LA 2JI9A 1E9CA 4ZZ2A 5A5EA 2R1VB 4OQDA 2J5BA 4OVKA 3ZHVA 5FPHA 3ZHXA 3EY4A 1UIRA 1LTHR 3DMNA 2VDUE 3SOPA 4EA9A 1YC2A 1ZW6A 4RHUA 1Z6GA 2OO5C 3T52A 4KXXA 4AS1A 2OVFA 1U8XX 5F1PA 3RS3A 1V25A 1XQWA 1YR6A 3IHWA 2FSIA 3QE0A 4PNEA 5B12A 1ZD8A 1O77A 2POQX 4US1R 3RYCB 3HABA 2PVSA 4PG8A 2QRJA 3PQ6A 5D87A 4BFZA 5JYBA 1QO9A 3B6KA 1G60A 3K0EA 3OEEA 2QM0A 1RRKA 2IUUA 1G5RA 2AVDA 1N7IA 5H9VA 4JFRA 4DDKA 2A57A 1T0HB 5DM60 2BGMA 3UMMA 1ML3A 5KAMA 1WVIA 1VIAA 2XY4A 5AJVB 5TPWA 2OWEA 5KYNA 2J3QA 1P17A 3ZE1B 3IHTA 1GUDA 4DLWA 3RSFA 2CXXA 1Z4PX 1X0XA 3A9UA 2VDWA 3D02A 4J2TA 4UDXX 1X1AA 3HUFA 4LXIA 3LE8A 4NICA 1R10A 2ZVJA 2NM0A 3ECSA 4ZQCB 5TQ0B 4PLTA 5CM9C 5FPYA 3X2FA 3TLAA 4LS3A 4ND5A 3RS5A 4E5NA 2YWHA 2TMGA 4N0QA 3MCAA 3TL3A 1QDEA 1HH4A 3AUYA 1RMQA 1SMKA 1UMKA 3P9YA 3QVOA 1UDBA 4MR7A 2J59A 3BBLA 2PL9A 3L9XA 5AW2A 2JK0A 4MCHA 1W5FA 4C4ZA 4BXOB 3DUFA 2AMLA 1AKRA 2PWZA 3ELDA 3RFUA 4E2YA 2C1ZA 3D9QX 1WV0A 3H5TA 5BUQA 1S9DA 3RTAA 4FBMA 1KNQA 1T4CB 1BJKA 3HBLA 4IZOA 2FUCA 4BL5A 1TU3A 3DO5A 4O0LA 1OZHA 2RSLA 5ALFA 4GAEA 2OKCA 2B83A 3EULA 3L0CA 1KMQA 1XDUA 3BZWA 3TLYA 4TSKA 2A0XA 3TKAA 4BUCA 1JDZA 5HSGA 4LV5B 4IJVA 5TARA 3FAKA 4JI1B 4JSRA 2DBZA 1WSBA 1VBMA 4MEJA 2RE8A 4ZQBA 4NE7A 2E18A 1O9BA 1Z5UA 5JSYA 3IILA 2Q9AA 1R9MA 4PS0A 5B2FA 5ITWA 5KMGB 5A4JA 5F78A 5J5AA 1BEUB 1SG6A 1T4DA 3LP6A 4QBIA 4W99A 1LJLA 2JASA 4B6OA 1UBOS 4NBTA 2XMCA 4A6XA 1HDXA 1XZQA 3HRIA 4NMXB 3GRZA 1PWXA 2W2VA 1F7UA 5ITZB 2HA4A 3BKWA 3Q41A 1WB6A 1SC4A 3GCGA 2OAGA 5LPNA 2PEZA 3JASB 4HQRA 3VYUB 2DERA 4HQFA 3QVJA 3UPUA 1L5YA 1T0BA 3NBAA 2VDNB 1JWLA 4DR7B 1YC5A 1EFCA 4R2KA 1XJ5A 3BERA 3AKZA 3HBAA 3GY0A 2AEFA 2A84A 2F6RA 5CB4A 2EBHX 1R0ZA 4QLBA 2GT1A 2ZU6A 3I5MA 3NALA 1N5KA 2EFCB 3OD5A 3PUXA 4GOXA 4ZAFA 2WE8A 4ZC1A 3SEFA 5AK3A 1OLUA 3OLYA 2DGDA 3SBEA 4CKBA 3RD5A 1RKBA 2XZTA 1T43A 4DY4A 2BJVA 1MJHA 3EVGA 4XE5A 1V7CA 2OCKA 1HG0A 3BXHA 3IP6A 1GR1A 3NBFA 4GE3A 5DI3B 2VHVA 3C7DB 5F73A 5ARBA 2Q2OA 3U13A 2EFEB 1W4LA 3D0RA 5H16A 5LM3A 2GD6A 2H92A 4AS2A 4O2AA 4TVKA 2JAOA 4H59A 3D3NA 4YP6A 3RVPA 4XGQA 3H0KA 3LPCA 2O0HA 3UV7A 2J0SA 5AKZA 2GESA 2DY0A 1G8SA 1DAPA 3X1YA 3PQ2A 3H1FA 4LBWA 4Q5IA 2AG8A 3ZXYA 5K20A 4QUHA 3R74A 1KTVA 1SB9A 1YQWA 1TCCA 2BRUC 4D79A 1DAGA 3DE2X 1EA5A 2JVIA 3LBHA 1KO5A 1ECLA 1R1DA 2WSMA 1KR5A 2VAVA 3VVBA 1MF7A 1WHSA 1YASA 2P6RA 1JKFA 1PQYA 3VFDA 5AESA 3D7LA 1YQUA 4JBGA 1D2GA 2OQIA 4L28A 2GYUA 3EDOA 4G0XA 2VZEA 1EVKA 3LIPA 3MB8A 1F38A 4BV9A 4GO1A 3BRWD 5TC4A 3QE2A 3EFHA 4LRQA 2Z3WA 1T6ZA 2P8SA 4G07A 1L8XA 4D82A 1X86B 1GFIA 1T4MA 2ZIGA 4IDOA 2XPCA 2IYLD 2I4OA 1DJNA 3FBTA 4PRLA 1DAKA 4MRSA 4NDAA 4CMEC 3I5UA 5LQNA 4YJDA 3QK7A 4CEIA 4LF8B 1TYEB 2H7VA 2WVJA 4ETWA 3K1TA 3AIIA 3A11A 3FSGA 4N7RA 4IRUB 2ZT8A 3TKYA 2I80A 4OPMA 2Q3JA 1G2QA 2P91A 4NBWA 3RUEA 1XTSA 3GRRA 1EPUA 3WFIA 4D56A 3EGEA 1Q7BA 1XALA 4GZ6A 1K3TA 4CLDA 5C4GB 2WF9A 4IIFA 4JUIA 4HRVA 1FFHA 1QHSA 3BE4A 3NZEA 4CF7A 4NI5A 3LS2A 5ELXA 2FWPA 2AFIE 5LQKA 5AI8A 3G5MA 4K6HA 2R47A 2CW5A 3PZRA 3QBTA 4ALMA 4E08A 5DHAA 1NW8A 3GRPA 1Y63A 3FPLA 5JNSA 4YYZA 4X1YB 1OB5A 4CEHB 4RLSA 3DZJA 4NJOA 4ZVQA 1DMSA 3IUYA 3I2KA 1PV4A 3COPA 1UMBA 2GEJA 3DBVO 4UPVA 5FTLA 4R2XA 3QITA 2O1XA 4KMMA 1JFFB 1YZTA 3O95A 3ZCTA 2A9JA 3ASVA 3AF2A 4WDRA 3REFA 3I76A 5AQ1A 2Q6VA 1KQPA 4GWKA 2VDKB 4UZFA 4BQIA 3UXHA 2WQ6A 3EYAA 1GSAA 2ATVA 2G9QA 2YV3A 2ZRMA 3CZMA 1Z34A 3D5EA 3CUUA 3ZUGA 4A8JC 4JENA 3IXMA 4QXPA 4BUJA 5F7XA 3O83A 3QH4A 1E6MA 4OQMA 1M34A 2JBAB 4QU0A 4J0DA 1J39A 1XC7A 7ABPA 3AI1A 2G07A 4BZPA 3H2KA 3MELA 2EL9A 5D3KA 5A2QA 1VKNA 4LJSA 1Z8DA 4LA4A 1XWWA 3G7NA 4B84A 2DWPA 3QMPA 2RGUA 3LMKA 1FFCA 2MSLA 1OGIA 2AOUB 1QHFA 2AR9A 1H1LB 2J09A 3ONWA 3RU7A 1PV2A 1CR1A 3AY7A 4MP6A 4RC9A 4WIAA 2IE8A 4D4LA 3F2IA 2ZRKA 1UZNA 3OE1A 5HE8A 4ENWA 1PZNA 1N5RA 1RZUA 4LCBA 1Q0RA 4Y1RA 4ASUA 3A1UA 4ZFNA 3REQA 4D6XA 3R9XA 2BKEA 2WF5A 3ENNA 1V2HE 2HO5A 4CMIB 1ZCAA 5H59A 5JQWA 2V5UA 4S1TA 1GLGA 5AR1A 3A37A 2WT8A 4RPCA 2JFQA 1NONA 1PZXA 1XZPA 3GAAA 4EGAA 1XJCA 3G49A 4H7EA 5JG7A 3WICA 5EIBD 1FSFA 3CZAA 4P4NA 8LDHA 1H2RS 1ADFA 1XFAA 3IB6A 3QUTA 4UD2A 1RWMA 5AOBA 3R7BA 4CXMA 1AV7A 5DN6A 1TVEA 1YJ5A 3FETA 2FPMA 4V0QA 4E11A 3JQAD 1PEKE 4YCLA 5JH7F 4AFNA 1EFRA 1GCGA 3DP7A 3DA8A 4N47A 1CLUA 4BNKA 3ILHA 3NBXX 3NOVA 3AEUA 2I54A 2VKTA 2QW1A 3RRBA 1UUFA 1M2JA 5L6MB 4OFXA 5LB2A 1CEQA 1IK4A 2BOVA 2X3FA 4ARBA 2ZOSA 2RBEA 1ZLYA 1THGA 2EGHA 2GEDA 1B74A 3I53A 3PD0A 1L7DA 1GQSA 4LK3A 5SY6A 4LF5B 4QFCA 1CUWA 4R2JA 1MC1A 3UHPA 1VLMA 3PE3A 1E5DA 1JLLA 4KZPA 1WU8A 3FTCA 4YP7A 2Y99A 2PY6A 2JA1A 3OLCX 3WDKA 4EQ6B 4HWTA 1JPVA 5GVRA 2HIGA 3ZI0A 4AN0A 2JIPA 3F7MA 6LDHA 4FSHA 5TMBA 1YU9A 1EZZA 3W6PA 1TUIA 3TDKA 4BB9A 1ZAYA 1G5QA 4BNWA 3K5IA 2UYCA 4NZ9A 4X7MA 1P0QA 1VL2A 3CG4A 4YCJA 1QQBA 3UKJA 2XE7A 5A7HA 3NB0A 3ORFA 1FNBA 1XA4A 3PEFA 1R0KA 5BWCA 3E7WA 1ITZA 2NSHA 3JAKB 3OQHA 3BGVA 2IWRA 4ACBA 4ZODA 4YO7A 3EVEA 1M2EA 1FBNA 2UVPA 4E1VA 1TEHA 2OK8A 4HX2A 3VR2A 3QOXA 2XNKA 3R3YA 1UJMA 5B53A 1Z0AA 4R2IA 1PO7A 3MTEA 1O6GA 2GK4A 1HQYE 2H18A 1LWNA 3ZDYB 5IAEA 2IZ1A 1S2DA 2P9EA 1IY0A 4XX0A 3JVEA 4R8RA 1Y42X 3P32A 1FX0B 4PLHA 4W6ZA 1US8B 1O6CA 4AIRA 2P9HA 2B94A 5DNWA 4YAKA 1G8MA 4M53A 4Q0MA 2YMLA 4HH3C 5K4AA 2WZQA 2ZU0C 3DHEA 1A04A 4C01A 4F9EA 5CITA 4B46A 1FLDA 3AEZA 5LKAA 1SD1A 2GK3A 2PMFA 3OTWA 4UUBA 4P93A 8AT1A 4B3MB 4RQBA 2IYFA 3MJHA 1P77A 4MO2A 1PQ4A 1UOOA 5DH9A 2BR4A 3DNPA 5DHFA 1RQLA 3HWWA 3U6BA 3GNSA 3VH4A 4GKJB 2EFDB 4RDIA 3NBYC 2B8WA 3VOSA 4JU8A 4HV4A 3H6HA 3OQ1A 1ISJA 1JHAA 4I2NA 5J2TF 4ZYLA 4BVAA 5JJ5A 1LDYA 1FNSA 2FSVC 3KPYA 3KOUA 4KXQA 3M7IA 1L3CA 3U3MA 1WSAA 4NQRA 1UMDB 4E31A 4OM8A 4P3PA 3HDJA 1GPYA 3ABRB 5JVDF 4RKQA 1ULUA 1T36B 4IOLA 4MA5A 1XD8A 4NWIA 5EUMA 1BXRA 1E1RD 2OP1A 1P7VA 1W19A 2F8LA 4PBRA 1ISFA 4PYIA 1YBMA 4DCCA 4A36A 5A0VA 3M6FA 2IIVA 2RJNA 1EBFA 2YICA 1V37A 3IR7A 3TW4A 4DBLC 4Z8YA 1G8FA 3ISTA 4QDJA 2YNMD 3NYQA 3OZUA 1M6VB 2FDXA 4PG6A 5CHEA 4B6QA 3C8UA 2JCYA 1KK1A 5H83A 5CLJA 1TYDE 2OE2A 4I99A 5AOVA 4BBJA 4TLMB 5K0JA 4HYTA 3IO5A 1AUQA 3Q40A 4AKGA 3RBVA 4OEHA 3CX6A 2XIJA 4UZEA 5DTQA 2PRZA 1L7VC 1G291 1K4MA 1U99A 5HOEA 4NK4A 1NOKA 3EPHA 1MD9A 2HYDA 1R27A 1NNI1 3D54D 4IOKA 2LCQA 1STOA 4U8HA 2O19A 3GLHE 1J70A 3CKMA 2W6QA 3EXIB 1IM5A 1VQ1A 4ND3A 1KC1A 4WKOA 3IVRA 3OA0A 3WGZA 2EYQA 2VI5A 1EDBA 1C1XA 3QXGA 3W4JA 3R0IA 1KNXA