2Z2JA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural Plasticity and Enzyme Action: Crystal Structures of Mycobacterium tuberculosis Peptidyl-tRNA Hydrolase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2z2jA00
2NAFA 4QD3A 4DJJA 4ERXA 4YLYA 5B6JA 1RYMA 4Z86A 5IVPA 3V2IA 2LGJA 4OLJA 2Z2JA 2JRCA 1RYNA 3KK0A 3TCNA 2Z2IA 3OFVA 4HOYA 4IKOA 4DHWA 4FOPA 4QBKA 5EKTA 3P2JA 4QAJA 3TCKA 4FYJA 4LWQA 3TD6A 2MJLA 4JWKA 3VJRA 4FNOA 4FOTA 4JC4A 4P7BA 3NEAA 2Z2KA 2PTHA 4JY7A 3TD2A 4ZXPA 4QT4A 5IKEA 3KJZA 1RYBA 5IMBA 4JX9A
chains in the Genus database with same CATH superfamily
3O1JC 4GZMA 5CAEA 4LNUB 2W6IA 3D59A 4Y7CA 4POOA 4QXMA 1YDGA 4NJEB 1U7UA 4LHSA 2FEPA 3PE4A 3NR2A 3U61B 4F4HA 2N75A 1K8ZB 5F5NA 3QLJA 3IAXA 3STWA 3WDLA 2WLSA 3I2HA 1B0ZA 4Q1FA 2V6JA 4CEJB 3TLEA 5C18A 4C1BA 1AGXA 2ZDQA 4FZ5A 5A06A 2WINI 4Z0TA 1CDZA 1N1EA 3N2KA 1YFLA 3ZJVA 4LRQA 1ISJA 1A0OA 4HLCA 2CXXA 2PJRA 2AC4A 1UFRA 3C3CA 2J6BA 5LYJA 1WCV1 2Q1WA 4G09A 3O0DA 4BEBA 4Z0NA 2EDAA 5DM4A 4W5TA 5AO9A 1NSFA 2IXGA 5I8ZA 2BHTA 4KPUB 3T9CA 4PNEA 4EP1A 5GV8A 2OZLB 2OFOA 3AFHA 2GCNA 4GPD1 2VLIA 2ODAA 3BWDD 4GLOA 3W8NA 1AKUA 3WK8A 5LB2A 3NRCA 3V8NA 3SXPA 6REQA 5JIBA 2Z0MA 4D82A 4YJ3F 1AK1A 4BECA 1QZZA 4WZBA 4ZT4A 3UICA 1AZSC 5BY2A 4AB1A 1O7JA 1UBJS 3C3KA 4QYXA 1M0WA 5JRZA 4C08A 2EJBA 2AEJA 2WFMA 2HQOA 2AFVA 1C1XA 4XIIA 3NH9A 4CI9A 1YR6A 3OLZA 5ES4B 2WWYA 2XW6A 5K3SA 2HZBA 5IULC 1WRBA 3MYYA 1JYEA 2ZRGA 2DPGA 4OAOA 4EZEA 1GAXA 2DULA 4MKRA 1Q2UA 2XZLA 4OSOA 6CHYA 3PFCA 1BJRE 3R4CA 4FW8A 1DJQA 3C1OA 4HVCA 1RQRA 3JWIA 1BS2A 4OG2A 1CE8A 4BNGA 4D9CA 1JX6A 2PXHA 2W9XA 2FN8A 1E94E 1G21E 2MSCB 4GI2A 4N12A 3L9XA 5EUQB 3CURA 4CJXA 3H2YA 5ER9A 4YACA 5C46F 3IUSA 4A6EA 3U7EB 4FGWA 1EB8A 4JY7A 1T5IA 2NNWB 4GSKA 3FYCA 4M0UA 4NMMA 4ZOLF 2C2HA 2ZTMA 3DKPA 3FYSA 3F6SA 4YY3B 3BMXA 3JZFA 1N0WA 4HAOA 1M9NA 1PBNA 3PCRB 3FI9A 1KE1A 4BGVA 2EW1A 3RU3A 3P9CA 2ZIUB 3LFHA 4AKEA 4B3TB 3D8SA 2HIGA 2QXTA 5C53B 1ZIYA 3FCUB 3OMLA 2YZNA 3ZDFA 4JASB 1XU9A 4F92B 5I7RA 4WFKA 5IYZB 1II8A 4Q4CA 2BEVB 1DKQA 1ZD5A 3FDXA 2RHRA 1NN1A 4JLAA 4QQFA 5EE1A 3UW3A 3TUZC 5JQGF 4WGGA 5CGQB 3UANA 4PTLA 1R8QA 3CQ9A 1GSIA 1TQ8A 2K2WA 1PRYA 3VZPA 1A9YA 4RZQA 3QJ5A 1EK1A 3O9MA 3QKSB 1L9XA 5T4BA 4CCWA 1TYBE 1YKSA 1XJ0A 4RJLA 1EVJA 4BO0A 5IKEA 1JR3E 4EKDA 2GAJA 1EIZA 1WCYA 2XGGA 3UMJA 4BDSA 4KIJA 2C84A 2Z2YA 4H16A 4U7TB 1PFVA 2H1FA 4OMFG 3PNOA 3HC7A 1IG0A 4NH4A 5HQJA 1G8YA 3I8XA 4GP6A 2WNHA 3BMNA 4X7MA 3WIVA 4JSRA 4UTPA 4B3RB 1T3ZA 2H7XA 4QNRA 3C24A 5AM3A 2FSFA 1CX9B 4DNOA 5AVOA 3NYIA 4DLZA 5B3KA 2ASEA 2FX5A 1FNBA 1UPAA 2HSDA 1QHNA 2REQB 3A6JA 3AXSA 3K0KA 3DBLB 1RQLA 4RKYA 4MQMA 3DL0A 3E9NA 4RSRA 4HYQA 5J2UA 2H29A 3DF9A 3VPHA 3WO1A 5KTTA 1A1VA 3BXHA 3L05A 2BZ0A 2RGXA 2VIIA 2HFKA 3SF8B 4EDHA 1L8XA 3K0EA 2ARKA 4B4VA 3IUEA 5AM4A 4C78A 2N0SA 2VC2B 4KX3A 1Z8HA 1OU0A 4YMHA 2G76A 1D4AA 2Z9DA 1E99A 1F6DA 3GJZA 3H87A 1XTPA 1JG7A 2ZROA 2FSGA 2E2WA 3A1CA 3AFIA 3I6QA 2POCA 3E23A 5F1YA 3CX8A 1P1HA 1BN6A 4EBBA 1W49A 1ESZA 1G17A 1SY7A 2ZDGA 1KPIA 1B1CA 3NJ4A 5HF5A 4RZIA 2JGRA 2BKAA 2QI9F 4MDYA 4YRRA 5K0LA 4KG7A 4E1BA 5K0BA 1E8DA 1TI7A 1XROA 2MR5A 3VNBA 1KQGA 3HUTA 1I7NA 1LWNA 3HE3A 3GGOA 1Z15A 3FMGA 4MGZR 4ZARA 4CQLA 1W6UA 2QROA 5I4CA 2EQAA 4QODA 5DLPA 2LV8A 3ZV4A 3TK1A 2P1RA 4BX0A 1M2GA 1D8AA 1GTMA 3FNFA 4KU4A 4BV2A 4C4RA 4E08A 4CIAA 1HMPA 1XZAA 4F3NA 5G4KB 1P33A 1OZ0A 4TXLA 2GRAA 3P5BA 4LBWA 1XKLA 3MLBA 4FCVA 5E9JA 4YAFA 4CW7A 4H18A 4ENSA 2N3ZA 3DBIA 4CMIB 4HX9A 3K9LA 4XIFA 1XVUA 2HMSA 2ZIWB 1ZI9A 3W2IA 3RTGA 1NUAA 3FZEA 1HZJA 3LC1O 3RUEA 3I2GA 3PXEA 4J0GA 3U60B 3FPAA 4LY6A 1DBQA 3TH5A 4L4ZA 2J1LA 5FPQA 4R3NA 3RVJA 3G1UA 4AUNA 1OZHA 3TM4A 2A9PA 4Q3CA 4F71A 4RIGA 1L5KA 1X87A 2DE0X 1W75A 4MUIA 2DY1A 5FPYA 4C4YA 3CTMA 3GARA 5LQUA 1TE2A 4M0KA 4Q9KA 1XPRA 2A59A 5D01A 5B2EA 3P0HA 2E4YA 4DN6A 4E14A 4ZYYA 1X1TA 1FP4B 2QTAA 1JALA 2GLXA 3UJBA 4BUZA 4D8WA 3G8YA 3T95A 2G1KA 4G56A 3FCYA 3M0EA 1L7QA 1Q3HA 3QX7A 4RE5A 2O0HA 4FB5A 4DA4A 1LDMA 3AP2A 1MJGM 3GHYA 2IH4A 2EW8A 5JSQA 5CG2A 2PQ6A 1ZAYA 4BQNA 2N42A 2HJRA 4HBGA 2OKCA 1W8DA 2XUOA 3OO1A 4CKBA 3QEBZ 4MV8A 2JJMA 1V47A 1A9XB 2QXUA 1IH8A 1GL7A 4JUAA 5CFPA 1RVV1 4RYLA 1O95A 5INTA 2NLOA 4WJKB 1C4KA 1AG9A 2COEA 2YQ4A 3VV3A 1PR4A 4GD3Q 4PSAA 2OHOA 1XWWA 2FA9A 2VKQA 3T3IA 4AYXA 3REQB 3STXA 1FZQA 3RS7A 5BUCA 5L3SB 3HXOA 1G18A 5EIHA 2VT2A 2VBIA 5A05A 5DMHA 4OMDA 1JB9A 1W19A 3AR8A 1WOMA 3M34A 3MBIA 4O2AF 4MYRA 1ECFA 4DMMA 2Y2VA 3G85A 3R0QA 1X1EA 2ALJA 4X54A 3W2FA 4FX5A 2JCGA 4BFLA 1NYRA 5IJ0B 5JVDA 1CEQA 1KDOA 3BEDA 2QQGA 2V7WA 4XX0A 4XAQA 1N5MA 3RUCA 4UHHA 4L78A 4B0PA 1WEHA 4WQMA 2HWUA 2IEYA 3B9PA 4B17A 4B74A 4ZIRB 5A0VA 2P5YA 4G1FA 2AI3A 4UEWA 2RHDA 1L1FA 4D9IA 2C61A 4YRNA 1YVDA 2NV0A 4LS3A 1VGQA 1G21A 1M66A 4GVXA 1TEXA 2PBLA 3H2SA 4A92A 2Y6VA 1PJLA 4DCTA 3TKAA 2QNBA 2E5WA 1B0UA 3NTOA 1Q1NA 4LRWA 3L8CA 5AVJA 1I3NA 4LHYA 2J3IA 3GPCA 4MULA 2J3JA 2YXLA 2QTCA 3OCWA 2WWWA 1J39A 3QU7A 4FGJA 1RJFA 4DF3A 1KTIA 3K0BA 4HAXA 1RRFA 4XD7A 5CCXA 2DTEA 3KV3O 5L3QB 4M22A 1DQZA 1X15A 2ODPA 3CUVA 1M2WA 1Q1ZA 1HG1A 2JCXA 1BVUA 1QBGA 3FGPA 3SDZA 3VOSA 1JP7A 1LB1B 1NXSA 2Q8PA 5KTYA 4QPNA 1BCSA 4YRGA 1X92A 3AUYA 3OT4A 1TA9A 2OG1A 4B8WA 3NRBA 4B8ZA 4DW8A 1X13A 4LZNA 1G8FA 4Q9JA 3WLIA 3R20A 4JU8A 1FTNA 4JL6A 1Y1KE 2GBPA 1U90A 1YCGA 3J7TA 3GPDG 3DMYA 1NBMD 5E8RA 1C3XA 1LF5A 2NU6B 4EA6A 2A3RA 1XAJA 4NV1A 4C3ZA 3FPFA 1KIFA 1JR3A 2BP7A 3EAQA 1FP6A 3EC7A 3K9HA 4I08A 5SZKB 3EWIA 1UIMA 1H66A 3NKVA 4UBMA 5CBKA 1DG3A 3L1JA 3RWMB 1C7QA 2XR1A 2R7KA 2IPNA 3HKDA 4KIGA 1ESDA 1UBTS 1UKEA 4HXFB 4OQQA 2HXGA 4V2UA 3E18A 3KB6A 3OJOA 1E4EA 1UWKA 3E5MA 1HM5A 3QJGA 3CONA 3SBOA 5CVTA 1PHRA 2W6PA 2F8TA 3PC4A 4LHZA 1RWQA 1PFQA 1YRLA 1ZL2A 1J0CA 2ID9A 3ZLJA 3QELB 4FYMA 4N7RA 3MXTA 2Q6IA 3PD7A 3M8KA 3DAGA 3ZK9A 2JIRA 3TR5A 3MCUA 3MUEA 1QVRA 3FDIA 3H84A 5EESA 1DMSA 4Q7QA 5IUJC 4WXHA 1VKNA 2YCLA 3JYOA 1NQ5A 2C1ZA 1R9NA 4PLPA 3QP9A 3E3AA 5KS2A 3DYVA 1R74A 1TA0A 2XNJA 5B1HA 2AV6A 3WFZA 3S2YA 4JNKA 3K8QA 4X60A 4IDFA 4MV3A 4J2OA 3EFHA 3HMQA 4EARA 1QHYA 4RPHA 1E2EA 1GL3A 2ILVA 4HUTA 5FUWA 2WY2D 5BRJA 4JOQA 3QI7A 1NU8A 5ICSA 3AF6A 4WKOA 2BY4A 2DPMA 3L9WA 4HF7A 3ZNQA 2E5FA 4Y18A 5K3OA 2H3EA 3N2NA 3S55A 3DDWA 3HL0A 2G1UA 1HT3A 3LCVB 3ZC3A 3SWWA 5AVVA 2OVFA 3DQPA 3N70A 2C42A 3M33A 1TYCA 4LRYA 4N18A 4ZPJA 4JI6B 2XCQA 1IQPA 2IOFK 5FEUA 3UAXA 1IIRA 3FSJX 3C85A 5J23A 1EGVB 1WLSA 1QFMA 1IEWA 2RBKA 3DNFA 2MYNA 5M3BA 1A5ZA 2NZ8A 3DNMA 1JHPA 4L08A 1CYDA 4IDGA 3AEXA 4K0RA 3KQHA 2JIZD 3B3GA 3D6NB 4LYFA 5LOVF 2NPFA 2C3MA 4QT4A 5C1DA 5G1OA 3A3KA 2ZFUA 4MS1B 3TDNA 4KEAA 3ZIAA 4HEJA 2IEDA 3PTZA 3T3HA 4E5MA 3I9FA 2WSSA 2IYZA 4FMCB 3BGWA 5M2QA 3MA0A 1XZQA 1GZ6A 1PSWA 2XDAA 4O3MA 3PWSA 1R2QA 2E4AA 5LC1A 3K1JA 5JSFA 3RYFA 3DZJA 1BZYA 2C7QA 1KVQA 4GBGA 2WWFA 4IDHA 1P1CA 1RXIA 2PQ0A 2ZR9A 1BKDR 2VWHA 3OF2A 4FR5A 5LZ5A 2BRUC 2AZXA 3N2ZB 1M7HA 4DIUA 2O8EA 3EF0A 4TROA 2ZBDA 3CNBA 1NC1A 4C7KA 3D6AA 3GFQA 3LY8A 2QK4A 3PJGA 2EERA 5F98A 3FDZA 1MU0A 2I4TA 3COPA 4P98A 2CXPA 2DLNA 3HYNA 1J8VA 3I4CA 2CDBA 1YKGA 3PIDA 3QU5A 5FOTA 3DTNA 5DTRA 3UHJA 1BRMA 1LTHR 5ESWA 1YVPA 1T8TA 3QUTA 4ARSA 4AYTA 3UQYS 2J32A 4BO9A 3SLGA 3E9QA 1RM5A 1P2BA 3EZ9A 1MO2A 3WHKA 1W1UA 2WKSA 4JB0A 4IIGA 1ZOPA 3FPHA 3GRKA 1KDVA 2ZPTX 3S3TA 4EPRA 1UH5A 1PBTA 2O2GA 1OFHA 4BMSA 1KOJA 4H17A 2DXIA 4P4LA 1TQ6A 1MRNA 1N2OA 1FLDA 1EPUA 3NBAA 1QKJA 2GJ8A 2Z4RA 3TVDA 3V7WA 2FPOA 3G5LA 4F2GA 2O3SA 1XMOB 1THMA 2P2GA 4G8BA 2WAMA 3ILSA 1Z2AA 4HWSA 3S1AB 1UOOA 9MHTA 3PX7A 1UJMA 5JS7A 2GZ3A 3H5VA 4IZIA 4D41A 1YFJA 3AF2A 2H63A 1UBHS 3P71T 3MT0A 3GOQA 3VO9A 1GRNA 3OD5A 1A9TA 1T6ZA 4KNWA 1N4AA 4QYMA 4EL0A 3FGZA 3CJTA 3L0IB 3BJMA 1SK9A 1X8JA 4M60A 4AKSA 4F0JA 5JALA 2QBYB 2ZRAA 1I3LA 3H3FA 4X64B 3GVIA 4JIMA 4Q16A 4TXNA 1XA3A 5CB4B 4YPOA 5JZMA 1D9ZA 2X8LA 3PQEA 3QTTA 4H2DA 3FUCA 4EFKA 4MWCA 4P53A 1Q92A 1QG6A 5B64A 5I6DA 3I9V1 5EA2A 5BSWA 4DV4B 3IAS6 4RVOA 2JC3A 1YZGA 2HSJA 4ITVA 4BO6A 1QH0A 4E1AA 1BDJA 3OSUA 5FL7A 2ZRIA 4D6YA 5CDTA 2H9IA 3DDOA 3O4JA 4WEQA 2R87A 2VT3A 3ORRA 3DGFC 1A5SB 4I4TF 2V54A 2C5BA 4D9BA 4R5MA 2XSZA 2YIVX 3SHVA 3H6GA 2RGGA 4JC0A 3WADA 5BW4A 4GE3A 1HT0A 3GMIA 1I2ZA 4L8VA 3L4EA 2Z83A 1PDOA 1V16A 2VQ3A 3K9GA 4TWAA 5HG0A 4KLRA 1FP1D 1UOPA 1JE1A 3X1YA 1KYTA 1KA9H 3F7OA 3R7LA 2HADA 3GJ7A 5E38A 1GNRA 2QM0A 3HCOA 5FD8A 2JBHA 2H65A 4IDEA 4AQDA 2XT0A 3BZBA 2NQTA 3T9EA 5G1PA 1S4QA 3T5BA 1ZW1A 4QBKA 2D13A 3CLTC 2RHGB 4V2IA 6PFKA 3B20A 1O8BA 1BS9A 5TEWA 3VJRA 4UREA 1OLUA 1XXHE 1AHNA 1E9SA 2UVQA 3WIUA 3GDGA 3H1PA 2IODA 4HLUA 2ZSDA 4XSGA 4JJZA 121PA 2NO7A 1X14A 2F1OA 1ZD9A 4IFEA 2FUG1 3R3YA 1GPJA 4U2KA 2CFTA 3ZKAA 4B3SB 4Y9UA 4G26A 2WPDD 1YI1A 1SUDA 2BR3A 4K3VA 4QRIA 4M8NE 1NW9B 3LKVA 1M3SA 3C14C 1GAEO 4G5QA 1NXXA 3AEZA 5F5LA 3ZUGA 1HKHA 5ELMA 5C8DA 3KL4A 2NSJA 4PC2A 3S2UA 1P39A 2ZPAA 2X0IA 2DQSA 4Q37A 1DI0A 2P65A 1MIOB 4K1XA 1NASA 3OAAA 4G6ZA 5J2TF 5TPWA 1G41A 4WLUA 3UWSA 2CXSA 1EDOA 4DLLA 3Q72A 2CCKA 2R7MA 4MPTA 3N2GA 1P5RA 2JFUA 3UV7A 4N3AA 4BGIA 3HK2A 1R0ZA 5DGDA 1AIPA 5KOHB 2YV3A 1BC5A 2AH5A 4PR3A 1AZTA 3WGLA 4H6WA 3BIXA 1E2MA 2AX3A 1I1OA 3W4IA 3ET5A 1AB6A 4H15A 3TEMA 4QARA 5DRTA 5EWMB 4BP9A 1QAMA 1R6TA 5ALPA 3IAFA 2W6JD 2HY7A 4OJYA 4F60A 4DY4A 2ZI5A 4NSNA 5E2IA 3U4CA 4BNUA 4D1YA 5KOIA 4GP7A 1DJPA 1AB5A 5H80A 3CW2A 5GM2A 4BO7A 2RB4A 3O82A 1JAYA 1RAGA 4I4NA 2EJVA 1O03A 1XMPA 2QE7A 2R6DA 4Y6QA 1RZ3A 1A71A 3LQRA 5EINA 4DBZA 2AIRA 1A7JA 5JSZB 1MH1A 4CBVA 1FYDA 5FLEX 2YC2C 2ECQA 3E15A 1TIKA 4Z4HA 5J4VA 1OY1A 1Y33E 3PXCX 4FD2A 4P2GA 4BVFA 5AVUA 2YZ7A 5HZKA 2X4GA 4XLZA 1Z6AA 4I1PA 1SM4A 2G6BA 3FNHA 2EW2A 4KO3S 4S12A 1N7GA 4O0LA 2LGJA 3BOSA 1ZVVA 1DZ3A 1W581 3M5CA 4TGLA 1J2TA 4RD3A 1USGA 1QRRA 2FFAA 2H4XA 1R4NB 1MA3A 1T2EA 2IUYA 2VA9A 3I6ZA 3PYXA 2JCBA 3N3AC 1TAQA 1W0JA 4PLVA 3RS4A 1LQUA 4Q9HA 1E1NA 3SCZA 3BE4A 3IUQA 3ESAA 4IIUA 2P90A 3VKUA 2VS1A 3V1NA 2WUGA 5LFAA 3C7DB 1M1YE 3T0FA 3ZWKA 1YT5A 2CK3A 3P2OA 2ZIGA 4BN5A 2OXEA 1RZRD 1OYYA 3S1LA 1B3BA 3BQ9A 1V8OA 4XQEA 3GJRA 2GR9A 3E7PA 4URVR 1XNRB 1WBJB 1F8XA 3Q9NA 2MSNA 2G1JA 1I6WA 2J5RA 2NACA 2I3ZA 3L3BA 3DCJA 1YZQA 3SOZA 4Z7NB 5I9IA 5HF8A 1FDWA 1TMOA 4FOOA 3LFTA 2AKEA 3ESZA 1U2TA 4HDOB 2YUTA 4QUKA 2HN9A 4RL6A 1DQYA 5JXHA 3PQDA 2GN1A 2OORA 1AY0A 2V7BA 2HCJB 3PHLA 3ZHCA 4B9EA 2MJLA 2C96A 2QGFA 4DMLA 2JCYA 4KE8A 1MO5A 1T1SA 1QHFA 1P4HA 1F7VA 2YVKA 3S81A 3PICA 5BUSA 4LSWA 2GF2A 3EDRA 4D9EA 1DWPA 4H08A 4MGYR 4L6IA 1RWXA 2Y92A 1ZCAA 2PKQP 1JAHA 2OZPA 1BCRA 1ZK2A 1H0RA 1MORA 4WK2B 1L5LA 3SQNA 1IEQA 3WK7A 1ZNYA 2WWIA 3ES9A 4M1YA 4IEEA 5AXCA 3KPWA 2VSXA 4JHLA 1B43A 3WGMA 2Y8EA 3EG5A 1N2CB 2ACWA 2EKZA 2WICA 2A30A 2R4QA 3UMFA 4A6XA 1C0KA 1K88A 4BNFA 4HNAB 5DTEA 3K0CA 2XNCA 2Y68A 1D2RA 3PKIA 4XQ0A 3S5UA 1VI2A 2H1CA 4XVQA 1VGRA 2HRCA 3DFUA 3IQWA 1GXSA 2I5PO 3DFIA 2ZUCA 1LDBA 4QNMA 2E6UX 3L1UA 3R6LA 2EAUA 2BGNA 3TBFA 1IZ0A 1NGSA 4E21A 4R2XA 4L16A 4EMUA 2IYEA 1G1AA 1SOUA 1ZRMA 4HRAA 4PE5B 1DEAA 1VSQA 4NK4A 2CE2X 2IWHA 1DJOA 5U4QA 3UPTA 1VHQA 1D2HA 1BJTA 2GNPA 2WKRA 3T3PB 4ZI7A 3ZGVA 1QS0B 4WERA 2RHTA 1NQTA 2GZMA 1EWVA 2CLLB 1GRCA 4MVJG 3U17A 1AXGA 3MTAA 2VAXA 4LXYA 3K2QA 1BW9B 5K8JB 3AHEA 2IOYA 3HWRA 1JTEA 3PWKA 5CFQA 4TYQA 3FPSA 1E79D 1BXRB 1OXUA 1W8IA 2VP0A 3FZQA 3MEQA 1QGZA 2O05A 4RABA 1L6IA 2GD6A 1DUSA 4IX1A 4CG2A 4F96A 1O6GA 2H0RA 3VNVA 1T4BA 1L0BA 2WILA 1HDYA 5T6MA 2YASA 3WTCA 3V1TC 4MUAA 1WSAA 2PKQO 4A4DA 4Q6BA 5E3JA 3HV2A 1U9CA 4EUKA 4KVGA 2PXAA 3M2TA 4MW9A 2AI2A 2IZ7A 1WMSA 2RGRA 4DYVA 3TRFA 2R65A 1XXHA 3OICA 4CDGA 1ID8A 2ZRJA 1ZD3A 1KDPA 3L0ZA 3PFBA 2E55A 1P1KA 5EWJB 2OYRA 2EZTA 3OZ7A 3BXZA 4XEHA 3TFWA 2QMHA 4DA0A 3THOA 3MJHA 1Y4UA 3GEMA 4OGKA 4Q05A 3NJ8A 1QCCA 4JROA 1EK6A 2Y1DA 4OX9B 1F3OA 4F4DA 5KWJA 1QG2A 4CKEA 5D1HA 3HVUA 2B99A 5BR1A 1FDRA 2D7CA 3HYSA 3IIMA 3LGXA 4TLLB 3RSOA 1F9AA 3K70C 1KO1A 4TPKA 2R9VA 4TTQA 2Q1TA 2QUHA 2BGLA 1I2CA 3K4QA 3T54A 2AXEA 2QMUA 2R6ZA 3EDYA 1WSDA 3FAKA 4BO5A 2C99A 3QKUA 3ZDQA 2O2ZA 3PDIB 2A0XA 4IF6A 1XV5A 4MWTA 1EHYA 4R3UC 3NIWA 4B4OA 2DEUA 2Z3VA 2YJNA 1R5NA 2PD3A 2Q1SA 2G9UA 2UUCB 4E7OA 4DLYA 2CMGA 1DAGA 1JI0A 1JIQA 3CBQA 2O7QA 4H1HA 3RRBA 4YXWD 1ZGGA 1NV8A 1XVTA 2L69A 2P69A 4ONEA 3K05A 2IEBA 4PLFA 3QE2A 2CWDA 3RJTA 4G0OA 4OATA 3WJAA 2JJ2A 1T1EA 3HZOA 4W8OA 2XNKA 3LYHA 4X6XA 3ZE6A 4HDNA 3AXTA 5DHPA 1GGFA 4BJ1A 4JUIA 2Q7OE 3HYRA 1IY0A 3Q85A 2ZJYA 4OP3A 1VJGA 7REQB 3TDMA 3QX3A 2REOA 3BZUA 3GH1A 4ZAXA 2WOOA 1REQB 2XEDA 4FFPA 2DHEA 1RQPA 2R6R1 1JHQA 1J5EB 3TPZA 2QD4A 1VB5A 2O1SA 2VJMA 5L3ZA 1GA6A 2VSQA 4PX9A 2KI5A 1WVMA 1PJQA 4N1AA 3S7TA 3UJPA 4U5QA 1IK6A 2G83A 1J99A 3VBCA 3M3DA 3WZLA 3ZU5A 4ZDKA 2H4YA 3BPSA 1XOIA 2Q8QA 4QGAA 3CV3A 2GBCA 4MVJP 1QAOA 1KMNA 3X2FA 5EJGA 3FKSD 5I8PA 1V8PA 5COBA 5E2AA 3P94A 1TO2E 3A6FA 3RQSA 4RIHA 3C8UA 3OMWA 1ZD4A 4GI1A 3KU4A 4P34A 5AXDA 1SHUX 2VJCA 4HGNA 5H8WA 2CSUA 3RTBA 1SCUB 4AF8A 3TMYA 4C7MA 2O8CA 3K2BA 5ILGA 2C2KA 3QQPA 1DT5A 1P4JA 4OVKA 4CQJA 2QB5A 1ZQ1A 3CVVA 2I54A 3H1BA 1L1EA 4GR5A 4YRSA 1M1YA 1H4QA 2C57A 2WJAA 2F8LA 2SKDA 4ER5A 3EGDB 2DH6A 4RESA 3SEQA 3WC4A 3IIEA 1T9GS 1P1BA 1GFZA 2X1MA 3EVEA 4FWBA 4IIJF 4Q18A 3PJDA 1WHSB 2HA3A 1ZYUA 1ZINA 2VZEA 5F7JA 3AEYA 5DGIA 3JPYA 1ST2A 2WVGA 3MCZA 4RD0A 4EY6A 2C9BA 3KOXA 2GKOA 1E60A 2GZAA 5HQ3B 1AKNA 2JW5A 3SEZA 2D06A 1E1MA 1ZGZA 2AR7A 2VPZA 4DJJA 5FPSA 4XWYA 4HTFB 4TQ9A 4B48A 2IHBA 2IU3A 2V0CA 3BCHA 3W1VA 1GD1O 1V6CA 4ZVOA 1IZ8A 1FDUA 1GV1A 4LQDA 5FV4A 1F8YA 2FWMX 1K0UA 1E77A 3AQIA 3IQDB 4MQFB 1FF9A 4RPLA 4NARA 2OGZA 4RACA 2R48A 2QL9A 4OXKA 4G5RA 3LZDA 1V5WA 3ENNA 4AQYB 3R7WA 5KSWB 1DKPA 2WEKA 4V1CA 2EBHX 5E6UB 1B8OA 2WA1A 4WZZA 2DCUA 3MELA 2K7ZA 3GN1A 3OJCA 4R8KA 2GBGA 1ZMBA 4FE4A 5CNIA 1KQNA 3DUWA 1IEXA 4R8SA 2GJ9A 2WSBA 1EDZA 1VMDA 1YQWA 4UM8B 3F74A 4TV9A 1ZUNB 4O2BF 1YJQA 4NU0A 4OAQA 1M6EX 1H3FA 1S3IA 5K8CA 4EYSA 2D2FA 4LI3X 4MUEA 3H9JA 3F0TA 3G68A 1IZZA 4MPPA 1JLRA 2DWQA 2XYRA 3M5DA 4KQWA 1F0PA 5JWHA 3KKOA 4NBSA 4CODB 5DI3A 3R7SA 1NZFA 3SAJA 4CL2A 4W9NA 1JJVA 1G38A 4RK7A 3CLRD 1RWPA 1XU4A 2RGAA 1HSOA 1FU7A 1RMTA 3MPOA 2Q45A 1M72A 2CB0A 2W5UA 1YL5A 3G82C 3GLHE 3IOMA 4IDBA 2IYOA 2R3SA 2OO5C 3F1KA 2I8LA 5G0WA 3E9RA 4DMKA 2JGEA 1JWLA 4DLUA 4D9HA 3DOHA 4MUHA 1T2AA 3TRKA 3QYJA 4ZVMA 1Z6TA 1JTFA 3WV4A 4W82A 3MIIA 5CITA 5CBPB 4WZAB 5JRDS 7YASA 1OH7A 1DKUA 1WF6A 1H2EA 3QPBA 2FF7A 2VHZA 3C3DA 2ZJAA 3OWOA 4HAIA 4XIYA 2GN6A 3ZJ4A 3W8FA 1EA5A 4QBFA 2YV1A 2V7XA 4Z3KA 4WT7A 3ZXUB 2XDQB 4AJKA 1ZAKA 2FUCA 3WLTA 4TYPA 4DABA 2NYRA 3IOEA 3LUKA 1VHJA 3DEIA 1ESEA 4RVNA 1RADA 1ZZGA 1Q7TA 3KXPA 2HDOA 5AR1A 1NW3A 3R7BA 2RBEA 2PA3A 1Q57A 2OGWA 3ID6C 3QKTA 4JJEA 4IG4A 2NU9A 4OFXA 1DIAA 4F3KA 3Q7IA 4R1UA 3DUFA 3BE5A 1L4BA 3G5MA 1EVLA 1I1HA 3K9QO 4KK4A 3TW4A 1X3SA 2BM0A 1P6UA 1POWA 2DYKA 3NKLA 3WNCA 5EJFA 1QO7A 5EHQA 4YRLA 4J29A 4ZO8A 3T5TA 3UG6A 5ISMA 1T13A 2ZUBA 1S2DA 3R3ZA 4NNJA 2PZMA 1I8TA 4QQ8A 3T99A 4ESEA 5E4JA 4TYWA 2UYGA 2D0PB 5CH8A 5GONF 2Q5QA 1PGNA 3H2HA 2H9AA 4PX2A 4R68A 3R3SA 1RYNA 3A70A 3KOUA 2VP2A 2E48A 3TCNA 4JOBA 2A5YB 5J2TA 3NMUF 2Y1XA 2WQZA 2HWWA 3FSEA 2D5BA 1KOGA 1QQ5A 3C5VA 3D0QA 5BQOA 4TWBA 1Y4AE 3S2SA 3EWNA 3HTXA 2WD7B 4FYJA 5DK4A 4MR7B 3MGAA 4V0ME 4ENVA 4JJKA 2FH5B 2OCAA 4LKOA 2O2CA 1NX6A 3EXEB 4G4JA 4X1KA 1CRZA 1F3LA 1N2SA 3C87A 3PQCA 3VDQA 1BEUB 1ISFA 4KDRA 5FUYA 2VDPB 4UAUA 3MLEA 4BU1A 1EX9A 5JXWA 3C6ZA 4TRNA 2PX3A 4IIVA 4A26A 5BSEA 1XD8A 2Z6VA 2QKYA 5HS4A 5KVAA 1FYEA 2BC9A 2QE6A 3B7GA 3Q11A 2OKGA 4OP2A 3TLKA 2XMQA 4GGPA 4ZOEA 2ONCA 3VR5A 4LFCB 4DY6A 3CH6A 3A4YA 3P2KA 2WMDA 3TLGB 1RRKA 1M73E 4EX7A 4CFZA 4GZ5A 2YWFA 3FOCA 4OBWA 2JLZA 3CZ5A 3Q41A 1W4BA 4NE7A 1K8XB 3TZKA 1Z12A 1Z2CA 3HB9A 2QGZA 5KAMA 3PFWO 4PO9A 2WJ3A 1OROA 3ROQA 3GJTA 4AG3A 4EPWA 4S24A 4X94A 3A1UA 5H3LA 2F55A 4CF6A 1EMDA 1A96A 1X7YA 1Y1LA 1XZBA 1P80A 1QZTA 2R1TA 2XQKA 3A6ZA 5FBKA 4S1NA 4DE5A 2AOUB 2EX0A 4UDNA 1UFKA 2VSYA 3D1VA 1WV0A 5EOVA 5KKNB 2C2MA 4ARVA 4BLUA 3I73A 5SZHB 1FNMA 1L4FA 2E85A 2NYUA 2O4CA 3RRZA 1VECA 4KWTA 3UOAB 4RK5A 1Z7GA 5FBVB 2OCLA 3EUWA 4HDKB 4INJA 1JR6A 4H3KB 3HG7A 1XRSB 2IP2A 1P9WA 4FC6A 3OTIA 4Q1EA 4C20A 3W5CA 3HN7A 4UMEA 2FY8A 3MWDB 1SVNA 3DXFA 1VBMA 1M5RA 2JFYA 2SNIE 4FOTA 4NEGA 1D6NA 2Z8ZA 4WY2A 3NIBA 3R3UA 2FZGA 3L0PA 3K2IA 3FPBA 2P75A 3PLNA 3PP8A 4TQAA 4U2CA 2E4XA 4AJPA 1UC9A 2XVMA 2ATEA 4LJ6A 3LGSA 5B1YA 2V7EA 1B23P 2AYXA 3G49A 4NAHA 1W94A 2VJQA 3A11A 3B1ZA 1MGOA 3RBZA 4PG8A 1JEAA 1Z6ZA 3EQ7A 4MYCA 1BKYA 1MH9A 1P17A 3JQBA 4KMRA 3T9FA 4GU5A 2F48A 1JJIA 5EPOA 4DJ5X 1H1DA 5F9FA 3ZTWA 4EUFA 3ASUA 2FN9A 4HO1X 4GSYA 3U2QA 1L4MA 1XK6A 1SCJA 5I4BA 2W8BA 4XR9A 1ECGA 2ZRQA 4L8YA 4BTLA 1DIBA 5FWYA 4BNYA 4F85A 4FJ1A 1IUPA 1N7HA 1W93A 2ZRKA 3LGAA 3T15A 3EDOA 3H8WA 4NFLA 3CVXA 9ATCA 4YK7A 3GN2A 3ZJ5A 3PCTA 3KLNA 2D1SA 1PGQA 3IT0A 2XIJA 4X1IA 5IYZF 3WMWA 4INPA 2C98A 4M9CA 4QGBA 2VPTA 4G0NA 2ZUUA 3E2PA 4DDUA 3A05A 3BGSA 1CUBA 3DVAA 3AY0A 3ROZA 1JLMA 1QH8A 3O90A 3SHFA 4UW9A 3X1ZA 4B47A 3UJ9A 1YOBA 4D96A 1QQBA 1YVEI 4MRMB 4X63A 2ZE8A 3C8MA 3LCCA 4ESHA 5BWLA 1K1EA 1V1RB 2ACKA 1Y9JA 2FFQA 3PXUA 4TTVA 4TVBA 4H3HB 4YRDA 4B3FX 1CEYA 3HFGA 3TAHA 2QU8A 4L7QA 5BN4A 3O8QA 4CE6A 2P2NA 2OWEA 1GTZA 2R00A 1AGNA 3N0RA 9LDTA 3THXB 3AUXA 2P5TB 4IHJA 1KYQA 3ZGLA 3UWMA 4QG7A 4XI9A 1XLWA 4RY8A 1XD9A 1GT91 2B78A 3D9QX 1T2DA 4FEAA 4HADA 5DFAA 5FUBA 4MW6A 2IHVA 1TECE 4IJWA 3K5WA 1RW4A 4GPZA 4PYOA 2G4VA 3R9KA 1NVVQ 1EH5A 3BF7A 1EXWA 2CVHA 2ZYVX 1NFRA 5KTOA 1NPTO 2VP6A 3HCCA 2FN7A 2XRZA 4IS2A 1SXJE 2BHRA 3QLVA 4XDYA 1GPNA 3T9AA 5JD6A 1K8QA 3GLHA 1N1MA 5TV2A 3RVQA 3L8GA 1EEXB 1G8HA 2WUFA 5KYXB 3U3MA 4HNQA 3WO0A 2RGBA 5DF1A 1EXVA 3FWYA 5ADHA 1NBWB 2HC9A 3AOGA 1AK2A 1XZLA 3HPQA 3JASB 3VR4A 3V46A 3HV0A 4C0SA 1IY8A 1M34A 1UDCA 2O54A 3SJUA 1NVDA 3RG8A 4BVKA 1I2BA 1BGVA 1E9BA 1IAVA 1UK7A 2C2XA 3EXFB 3DZIA 4R2KA 4UM9D 5FIUA 1ZVJA 5H0IA 2QD1A 1UFVA 4HB2A 5K3CA 4BOYA 5HJ5A 3N1UA 5IANA 2XZOA 1YTUA 1AOXA 4J4HA 4OLHA 5LP6B 1NONA 1JXMA 5IZCA 2IPXA 3ILHA 4M0LA 1WMAA 1EHCA 1GZUA 3JXEA 3NGXA 4I6GA 2PLNA 3QRWA 1VLQA 2Q5FA 3ZCXA 4CTNA 5D3QA 1GCOA 3TNLA 3RSFA 4IQ8A 2CNLA 1P18A 3UWOA 4JB2A 5L6MB 3ETGA 1ORDA 3CEMA 1QTIA 4MCHA 4Z4QA 4EI9A 3WGHA 3E8SA 1Z8DA 2QM3A 3K9WA 4IHAA 3FZGA 4RH0A 5ESXA 3FSGD 1Z7YA 2BBWA 2IW1A 2JGFA 4M6WA 4JI4B 5K20A 1UBRS 5H9VA 1CYEA 4XD2A 3MUNA 5FPHA 3RVBA 1AD2A 4E2YA 3QWFA 1J09A 4JDPA 3VU8A 3W6OA 3GAZA 3VMMA 3S1SA 5I7FA 4HDCA 2JHPA 3B1FA 1IOZA 1H23A 4PZLA 1D9XA 1KQOA 1TZKA 3BWBA 4OBEA 4BX2A 3Q3JB 3GRUA 5A3SA 4EPVA 1JDNA 1UBKS 2AGVA 2WABA 4MGEA 5EZSA 2PV7A 2LW7A 4QXOA 2FPMA 3IE1A 3EYAA 3UCFA 1RWBA 3HP7A 4V0MA 4ZT7A 2JJ1D 2ZI7A 1BXGA 1CUEA 1RLTA 4U1RA 5JVDB 3FVTA 4KRGA 3PIIA 3THWB 1FEZA 1XE3A 2VQ6A 3B9BA 3M6FA 2AL7A 4XCQA 4XM2A 1QUEA 1W6RA 1JHVA 1B74A 2G17A 2YOFA 3F7MA 3OPYB 4LOIA 1SCDA 5CURA 3WQSB 3ZH9B 1U1EA 1T2UA 1N6KA 5ANRB 1EUCA 1KVTA 4EENA 3VR6H 3UB2A 2DWOA 1C8LA 3LJKA 4OHWA 5FL3A 1O97C 3R8CA 1G2IA 1MT3A 4FDUA 4JOSA 3OTGA 4CF3A 4OFWA 5LBTA 3V7FA 5CW2A 4EG3A 2I34A 1OC2A 1QRAA 1II0A 2BFDA 3O47A 4GFDA 4R6XA 3TJZA 5KJCA 3QSYA 2JCVA 5AJZA 5TMDA 3WL6A 4GYWA 1YVRA 3QMWA 4YB8A 3WWYA 4M55A 2IGBA 1UOEA 3DBVO 4QOIA 4AY5A 4YYZA 5B7GA 2HT1A 4IVRA 4B1FA 3QG5A 2RK6A 1MFZA 2RAFA 4WOKA 3L8ZA 2H4WA 2YVLA 3HGTA 4IP0A 5HKAA 4EB6A 1DBWA 1X39A 2ZS7A 2WTUA 3W5IA 1FXUA 1GUZA 4P82A 4F1KA 2YIJA 3QJYA 1UDXA 2CLOB 4J4BA 3ACCA 4JL8A 3H9UA 3RUIA 1A77A 5ARDA 3VRHA 4RTJA 1HBJA 1SOWA 4CNBA 1SWWA 2O5EA 5E7JA 3HBJA 2AWNA 4KRYA 3RVNA 5ITWA 2OLKA 4MYUA 4MV4A 3FOEC 2JGJA 1PG5A 2AG1A 5CNMA 1QGDA 2WMYA 1CY6A 1KI2A 1TVKB 4BO4A 1YHZA 4GOOD 4PAWA 4F1JA 2QTVB 3QEJA 4Y1RA 1S2IA 3BYZA 2I7CA 4U9UA 1NNSA 3G6KA 5IVHA 5A5EA 5JSHA 4OQPA 1SA0B 2PWYA 4R2HA 3AINA 4QOSA 2A1TS 3LK6A 1VSUA 4ZJUA 1RWKA 4QDXA 3L0DA 2YW9A 4LFBB 1EVEA 1E5LA 1TCVA 1R8SA 4U02A 1YCHA 3TOVA 2G04A 5LBIA 3BTUA 4CEIB 5CVJA 3V7YA 2GPJA 1L7VC 1O94D 1VYVA 4HDRB 4ZVRA 2JLYA 3RU7A 4K9QA 8LDHA 2AF3C 5IBPA 2ZXFA 2CMKA 3VH1A 4CEHB 1PSDA 2ZXEA 1M2OA 2KE5A 2VYVD 4HNVA 1IE3A 1A72A 4A3SA 1E59A 4OD0A 3P19A 3AI3A 3D7MA 3ZDDA 4YT8A 3RC3A 1ZY2A 4OHXA 3ZOKA 2DECA 1PF7E 2WV7A 1RBYA 4NPHA 4WBXC 3IODA 1C4WA 2WDZA 4UMDA 1IPEA 2VATA 3GZ4A 4N9WA 5DYIA 3ZE8A 2BFWA 4EL5A 1SPBS 2FWPA 1EXDA 2FVYA 3KFXA 1JQAA 3DH0A 3LT4A 4LWPA 3FHTA 4KV9A 4TLAA 4W1PA 1KRXA 4ZVKA 2OBNA 2E9SA 3LA6A 4CKWB 1AVTA 5GJWC 3ZEAA 5CT4A 3EDCA 4KWCA 1TB4A 2ASVA 3GJQA 3HDVA 2D5CA 5CEEA 1NL3A 4ND2A 3M2PA 2WV9A 5EPEA 3R7DA 2O8FA 1C9MA 3VVCA 2G4LA 2GNOA 2ZBPA 3DF7A 3NFRA 1P6QA 5EP4A 1KI6A 1L4EA 2R2GA 1LPSA 1ZNXA 3EARA 4B4UA 2V6IA 4M89A 2QTHA 5IK2A 4IGEA 5IKMA 2GXSA 1XWIA 3RC7A 2DBRA 4EY3A 2WIDA 2VO1A 4LDQA 4DJFC 5JSUA 1OPRA 4TZ6A 3DMTC 5JLJA 5E9QA 2P6MA 2JLWA 3CKKA 3OE7D 3FCXA 2DPYA 4NYIR 3RK0A 2XZTA 4BVGA 3FOZA 1VLHA 2WTEA 1M6VB 3SLRA 1QH1A 1YL7A 2RHCA 1G20E 1MX1A 5CLJA 3O3NB 1MJGA 5C80A 3DOEA 4AF7A 4QD3A 4ZI5A 3C5EA 1SXJA 4EVRA 4LGCA 1LLCA 2UUBB 1BVHA 2FOLA 2YOGA 2X23A 1OWLA 2H1IA 1YZNA 4WEOA 3L0OA 5J1TB 3EPPA 2O0KA 1FFXB 5CUQA 1X0XA 3R40A 4MO2A 1RPZA 3UHAA 1XJ5A 2VXYA 2PZLA 1KU6A 2WG0A 4ZDIA 4Q1CA 2C0CA 3RKRA 4I5FA 1G8SA 1JEQB 4CTKA 2VDOB 3FWHA 5ALEA 4HFNA 1KAEA 1P5JA 1H5NA 4F5YA 5IKOA 4RF5A 3RNOA 2OAGA 5B58C 4QATA 3F49S 3IAM6 3T38A 1PEYA 1DE0A 1QLHA 1U0GA 3ASVA 1A76A 1MIHA 2BOVA 4DCJA 3OG9A 3BK1A 1DEKA 3IAAA 4X91A 1N5IA 3FX2A 4IOKA 5AW3A 1CBUA 3G0BA 2NZWA 5LQNA 1G2OA 4G01B 4JC8A 1C1YA 4N8DA 5DOVA 1C0LA 4DC0A 4RNCA 5EJ8A 2NIPA 4ID3A 1AHIA 1I7SB 4LNUA 4YV7A 1VPWA 4NJEA 2YJ4A 1GRQA 4UUOA 2UZ4A 1Q14A 3H83A 4GLBA 2HIHA 4FCWA 1FU8A 1LSOA 2XPCA 3LVQE 3PGA1 3C41J 1PX2A 4OK6A 1MF7A 4D9MA 1H2HA 3NTVA 5EP3A 3R0ZA 1BE6A 3S29A 3BH0A 3DO5A 5LIPA 1XEWY 3OFNA 3EEOA 2WHEA 4JD5A 4G8JA 2XUFA 3MAAC 1CB7A 5ALZA 1A27A 3PJEA 3FFBA 1D7AA 3PUKA 4H35A 4MB2A 4PPNA 3UUWA 4WESB 1UANA 1EP3B 2F6RA 3QXSA 4JYZA 3G7UA 2IXAA 4LYDA 3GFTA 3S40A 3UFXA 3ZZNA 4CZ2A 3A6HA 3R9XB 5K6AC 2FZ5A 3MQFA 4ZKEA 3TIIA 3ESYA 4JB8A 3TZHA 1IM5A 3AF5A 1J7JA 1FBNA 4MYSA 3UYKA 3FUUA 4I1OA 4GOLD 4LMRA 3UPDA 5I8WA 1W85A 4MVCA 4MUMA 3Q0EA 1C9DB 2A94A 1N2JA 1EG2A 1AXEA 2PL5A 3PPIA 4U2BA 3DFFA 2QG9A 5H7XA 4KQCA 3TLAA 1Y8QB 1TADA 5HFNA 5GMOA 5EUBA 3OKPA 1ZM3A 1WCIB 2XWPA 3W1EA 1I80A 2HEIA 1J6UA 3KKZA 4EJ2A 5JTUA 5HRUA 1VG1A 3KLOA 1G60A 1E4YA 4L0MA 1GKUB 1D3AA 2OP0A 4XB1A 3DOCA 2HBQA 3T7SA 3WLAA 4MWOA 2Y99A 1S9DA 3H04A 4OHOA 3WDKA 1M83A 3A1TA 3RBVA 1P2DA 2QRNA 1EZ4A 2M1XA 4FNGA 2PUCA 3AZPA 2VDVE 1I7LA 1D4ZA 1O6BA 1SKUA 2LKCA 4L6AA 3SK0A 4C88A 5A9RA 3BMCB 5BOSA 1NVFA 3QPAA 2FFRA 3GVHA 4E31A 5A0TA 4Q9AA 1J2UA 2BBOA 5LNK6 1IBMB 1PUJA 3GO4A 3U4IA 2W2OA 2QTWB 1MPXA 1F8UA 1JFLA 3FHLA 4BDTA 3H8JA 1JT9A 4FYKA 3WIOA 2P2LA 1KJJA 1CJTC 2W2LA 3LXXA 1CUAA 2PSFA 3FLMA 4GXRA 4K05A 4C05A 1BEZA 3O8RA 2WTAA 4RS4A 1BYIA 4IYRA 4HTAA 2A0KA 4MWSA 5EMLA 5B55A 2CV1A 1NRIA 1JVBA 2BE9A 4IBOA 3A8TA 3ZBTA 2B4YA 3S2GA 1XA0A 4MWEA 4JUDX 1QZXA 3CH4B 1Q7GA 4BFWA 1K6MA 3GPIA 3G13A 1HL7A 4WUTA 2C58A 2IHTA 3QKRA 1CZRA 3VHRA 2NMVA 2YZGA 2JFBA 3FNIA 5DNWA 1FJXA 3A32A 2BEVA 3ZIDA 3RYTC 2O5RA 1JV2B 2AJLI 4OXQA 2QAGB 2ZRLA 2EG9A 3PUXA 3VR2A 4HGZA 3EJWA 5HOEA 3ZR4B 3G0HA 4XPZA 5E6SA 3WGVA 1EU1A 1Y9ZA 1O54A 2HRRA 5JWOA 1UP7A 4C89A 1C9EA 4JGIA 1Q0LA 4CV1A 4ZYLA 1IQRA 3DTTA 4KFCA 2Q5IA 1NT4A 1KC3A 3CVWA 1PJCA 5FHQA 1GQFA 3ZYCA 2QW1A 1JLLB 4JI3B 4D97A 3NYRA 3NBZC 4MI1A 4K9KA 4MV9A 3BJRA 1B26A 1HEIA 4N5IX 4R1TA 5IAGA 4C76A 1KMQA 4QSMA 3S5JA 1DRVA 2YRXA 3AFGA 5AI0A 4ES6A 4DR3B 2V7UA 2REQA 3CJQA 3P8ZA 4U8HA 3K1AB 5T5QA 5KNBA 2X14A 5AKHA 3DBLA 4UMFA 4OUDB 3FRHA 4FBGA 3BL8A 4DS3A 3BX1A 2JAOA 4RXTA 3ZQUA 3VQTA 5FI5A 3DD5A 3SF8A 4QPJC 4ZTUB 1J8FA 4F5WA 5K8VA 2HMTA 1M0EA 4X41A 4PRYA 4BFCA 3ONFA 1VPTA 4S0XA 1D1PA 3OZGA 4FFRA 1CC1S 1R15A 4TKVA 3NW9A 3B5EA 1TW3A 4QULA 4YC7A 5EMHA 2JBAA 2M2IA 3OCXA 3I05A 3O1IC 1CVLA 3PUZA 3FKQA 5CPFA 5CXXA 2BMJA 1G20A 1YZLA 3AFOA 3D4LA 1NC3A 5BN1A 4OK3A 4B45A 9GPBA 4YMTA 3JYQA 1HRDA 1DXQA 3VHXB 1M75A 2MIIA 3AW9A 3MMNA 3QVGA 4TRRA 4W7IA 2VKTA 3BXFA 3U09A 1DCFA 3JWJA 1CY1A 3PKJA 3FLAA 4XCXA 1ZA1A 4KPEC 1LA2A 1XZGA 2R751 3W90A 4QVGA 1CQZA 2RSLA 2CHEA 3DL7A 4XGNA 4OYHA 4IDAA 4OHRA 4EVQA 5IT5A 4S1VA 3NM5A 4JXKA 4IDDA 3FTQA 4B5LA 3DC7A 2QRMA 2Z5GA 2X40A 1FSGA 4N3CA 4R81A 3V3TA 5F3DA 3AHDA 1EQ2A 2X0FA 2JHGA 2BF4A 4J49A 4FGUA 5FBHA 3EUFA 3OWXA 4J0QA 1NI5A 4LJRA 4NXNB 1QOPB 3KZXA 1ODTC 2F9FA 2YNMA 3I2YX 3ZNNA 3QA3E 4ZXPA 3AHIA 3UMCA 4CMHA 3U19A 1QYXA 4D3YA 1O6ZA 2PRIA 4ODIA 1IRIA 1KC1A 2XHEA 1OYVA 3VYRB 2NO6A 1NE7A 4HDAA 4BO2A 5G3YA 5AD1A 3DJFA 1X1AA 2P30A 4UBIA 1N25A 4EY8A 5BP7A 4S1PA 4AUEA 2IL1A 1A5AB 1U8FO 4V03A 1Q1AA 3SHTA 1R50A 2F90A 3IQIX 1Q16A 2YMPA 1AGPA 3JQ6A 4MVJE 2AR0A 1N92A 1RHRA 1PFGA 2I87A 1M7BA 3CSUA 4KYIB 1ZJ4A 2O2XA 4REMA 1PK7A 4O4HB 3W6UA 4LVCA 1Y4ZA 4RETA 2NVWA 5JDCC 1ZWLA 3PC2A 4XWKA 2YY5A 2YHSA 2X2OA 3RSLA 4JFRA 4H1TA 1S5PA 1V6AA 1J2RA 1FP4A 4GWKA 5KHOC 1XQVA 1CKEA 3LQYA 4KQ1A 1I1QB 3EZ2A 3OQHA 4A2CA 1GZ3A 4NECA 4XSVA 5IDXA 3KE8A 1GUBA 6GPBA 4EPXA 1V5EA 4BLQA 2GO7A 4J1QA 5EQTA 4AMBA 1OXXK 1ULZA 2HQBA 3JALB 1U0FA 1GLNA 2OHHA 1V8DA 2VUSA 3OM8A 3IO5A 4PAOA 4G9BA 2ZRFA 1HT1E 3OF5A 1TOAA 4UTRA 3AM1A 3WYDA 2FKAA 3OFVA 1KXZA 4AY4A 3BXPA 2XTNA 3VR6D 1YAHA 3HCRA 3QW2A 5JJKA 3QMVA 4RZHA 4GC5A 1SRQA 3A27A 5DNDA 4CM4A 2C4WA 2JPDA 3VTKA 1FTQA 3O5AA 4M8KA 5L3SA 2GKSA 4MKHA 4KOAA 4MKGA 2NO4A 1XTBA 1Y5RA 2G8NA 1FMTA 3C1AA 3HZRA 5DCLA 3ZCUA 4IXDA 4X66B 1RBQA 2O3UA 3DR3A 4OIFA 5FA6A 1NLZA 1EHIA 2BKLA 3NHMA 2ZYHA 1VIDA 4IH4A 3FPGA 4E5DA 4IFTA 5C2JB 4ZIRA 2R1VA 1Z5GA 4GBMA 5L4SA 3KQYA 4I3GA 1KARA 1ADCA 2H18A 4JP1A 1CLUA 4UHBA 2B30A 1E3JA 3ZCVA 2ADOA 2JB9A 3QA9A 4CDRA 2VVTA 5E6RB 1UP6A 4PTZA 4TLEA 4M76B 1OH6A 3FHJA 3C16C 2R85A 3UJDA 2OUIA 3Q6NA 2C5HA 1H9CA 1YDEA 4G4IA 3W3AH 3NBXX 1E3LA 1K0FA 4CHGA 3E7WA 3ZI4A 3CF6R 1JQEA 3DO8A 5H82A 2WHPA 2IOFA 3SR3A 5L3QA 1SHJA 4KPYA 4EGQA 4EBFA 3GJXC 4W7SA 3I6MA 3RIYA 3DZGA 3JQEA 1Q91A 1A88A 2SBTA 5JBQA 1M76A 2YFYA 3ICQB 1KEEB 4EHNA 2OOSA 3VH4A 3A4IA 4B2LA 3LUFA 1E92A 3L01A 3ZWBA 1KERA 3ND6A 4JXJA 2XE6A 1ZO8A 2A1IA 3UHPA 2QA5A 2UU9B 1YRAA 1CF4A 2PGIA 4G07A 2V98A 2OCDA 5K6AA 3QF4A 1CS0A 4N8SA 1MHTA 2P6PA 4KX5A 4S1WA 4IIFA 6Q21A 3WGJA 2ES4A 4RWEA 4ZQFA 3U4GA 3WLEA 3TOSA 1L4HA 1U8CB 3BJIC 1DC8A 1NBAA 4QJBA 3P9RA 4C6SA 3U44A 1CP3A 4FWIB 1V11B 2QM8A 2C3YA 2JZNA 2TMYA 2WLTA 4FT4A 5BN5B 1FSSA 3F9RA 4V0LA 3CE6A 4V0QA 4EZIA 1DIRA 4JJ7A 2WNSA 1DSSG 2GBLC 5K51A 3MINA 4JI2B 1JEYA 1U8YA 1XZDA 2GHRA 1FIUA 3WLJA 1J2EA 2IYSA 3NBYC 4HN9A 2Q9AA 1PW5A 5EJ6A 5FYDA 1KYZA 4UMVA 3WLRA 2Q49A 2WWRA 4Z7JA 2EC5A 5IXJA 1F0KA 1YUNA 4OH1A 4MDEA 3Q9SA 5FFNA 2V7QA 4L85A 3ZI7A 2YWRA 3BRWA 4RA9B 1NULA 3AIKA 2AOWA 1IHDA 1FNDA 1VIYA 1RHKA 2VSFA 2XNDA 4GM0A 1TC1A 1C14A 3WA6A 4BATA 3GNSA 4HWRA 3BTVA 3I23A 5DXJA 2CNNA 2C4MA 2KYRA 2HMVA 2A9KA 3EY9A 1NRXA 2CCGA 2F62A 3EIOA 4IJKA 5JO0A 2BTQB 1OB5A 2RH4A 1DKLA 2DAPA 2P9GA 3KXIA 2FK7A 5F1KA 4NYMQ 4O1HA 4PANA 2AZTA 2C03A 4M1SA 2FJ0A 4OXXA 2C7PA 3B53X 3EEQA 3WG9A 2TYSB 3OM1A 4CETA 3FCOA 3KQTA 3MN1A 4ARZA 3TNJA 4TTTS 3GEIA 3NBFA 4CCAA 4JA2A 4BAZA 3O3OB 1G8PA 2FEWB 3LS2A 2I80A 4WY5A 2A5GA 1CXZA 3CWCA 3WWEA 3M83A 4G3XA 1VCHA 1P74A 1QHXA 2ZSAA 2O8BB 4RGBA 3PRYA 3PVZA 1DS6A 3KTAA 1RJ9A 3DOIA 5AKYA 5HF6A 1ISPA 4O3FA 2QJRA 3OZCA 4INAA 5BQFA 1HT2E 1SQ6A 1SVWA 4P7BA 4J9VA 4RUKA 4DRXB 4P4SA 3EG9B 4YIKA 3ONNA 2D74A 2ZRNA 5EEHA 5JS1A 3BFPA 1URPA 5G0SA 2H92A 4EG8A 1G5RA 4OXIA 4AP5A 1BQ4A 4A10A 5KNCH 3VU0A 2A8YA 1Z0SA 1E2PA 4MI3A 1OLXA 2BFCB 2F8SA 3WKBA 2PQ2A 2A9OA 2IYRA 1D6SA 1Y4SA 4IRXA 3HR8A 3GPBA 1GPLA 1OV6A 4KMSA 4D02A 3QKWA 5L7WA 3ZJTA 1T3LA 2GEJA 1WMFA 4GRIA 1JIXA 2OD9A 3QWHA 5BYJA 2AJCA 1FS6A 1JIKA 3I9OA 4F12A 4RHEA 3D7KA 4LMBA 5KDLA 5IJZA 4KC0A 2AJ8A 5MDHA 1NVKA 1QK5A 3G5TA 3JAKA 3E3MA 4OLFA 4TZ0A 2ZSFA 1O2DA 2F00A 1L1QA 2Q27A 1T0UA 4BQPA 2YJZA 1AMUA 2QY6A 4FPXA 2NN3C 2CD9A 3BIWA 2L0XA 2BH9A 3M6XA 3QEKA 5A3VA 5FJJA 3AIMA 4XASA 3NUZA 5A4AA 4EJMA 4B3BA 2VBFA 2D8MA 5JXJA 3C2QA 1T5BA 4MVJA 5BQXA 1P2SA 1YIAA 5GAJA 3ZX4A 5DX1A 5EP2A 1P3JA 2W2MA 2WW8A 5KYUB 5LQAA 4E3WA 3KQMA 1Z0ZA 4EG4A 1HWYA 3T7IA 1U5BB 3MERA 4CF5A 5LD2B 4LXHA 8AT1A 1WSBA 3FYUC 1N5LA 4LWQA 1RBMA 2OFFA 5JCOC 5JMWA 4UUBA 4GR4A 4TUYA 5D8DA 1EVKA 4FFVA 1DOZA 3DHVA 1XLTC 4YAGA 1YZFA 4BKUA 1UAGA 2H4JA 2F8MA 3STVA 4UULA 1L7MA 3VKVA 1KTVA 2Q3MA 4A27A 4K81B 4KPFC 4S05A 1MZVA 5KNLA 4BNKA 3GFBA 3BD8A 4QJ4A 2Z2XA 5LWQA 2PKCA 2PAFA 5JZSA 3KT8A 5KQSA 3RVKA 4QDKA 5CW1A 4OQZA 3MOIA 4CDMA 3QOFA 2AOTA 3IHLA 1T4MA 2Z09A 4RMIA 4DDWA 2OMKA 3BBPA 1TEVA 4YJDA 5CTAA 1TX4B 3INTA 1PYDA 5CB4A 4S1OA 1Z6YA 3JWEA 1GCUA 2VUIB 3LLVA 2FEAA 3MB5A 1CS4C 2QU7A 4MUGA 2XXBA 1Y1TA 2Q4BA 4QQKA 4E3ZA 4EEXA 1UBFA 1PD1A 5EIAA 3RW9A 3OTHA 4JLNA 2PD4A 1D4FA 2VRCA 3MJFA 4HLNA 4QIHA 2VRBA 2Z6UA 4P80A 1WO8A 1ZNQO 2YWEA 2NQ2C 2CBZA 3QSGA 5F9MA 4IF4A 3LW7A 2CV2A 3GT0A 4AN4A 1TT5B 3BSSA 2VK8A 3K5PA 3QFSA 1FQKA 4AROA 1ZVMA 5FTKA 1G9XA 4OH7A 3A4MA 3M5WA 1Z0IA 3I12A 1T1JA 1UBOS 3A0RB 5H68A 2EEPA 1JG6A 1UQUA 4MRSA 5AI5A 4A73A 4KAAA 4JBYA 3ROMA 4PSUA 3ZHZA 1WY7A 1GPH1 3LRPA 4KGDA 3VOAA 5DNCA 4CM7A 2OD2A 3SJCA 4BMYA 2VJLA 4PPYA 3AF0A 2OQVA 3FPKA 1HQYE 4ND5A 1QIEA 4JI0B 4Q3EA 1XBTA 1HLFA 1U3GA 3L8YA 3V8EA 3PX2A 4J2HA 4DQUA 1XAIA 1Z5VA 3I64A 1H9AA 1TKAA 5AUQA 5KNDA 3VPAA 2GJKA 2VF5X 4KSYA 4RVUA 4D44A 5DRYA 5C8YB 2YS6A 3TCXB 4M0DA 1WEKA 1RYFA 2F67A 3DZFA 1F5NA 3ECAA 1PL7A 2G1PA 1NF3A 3K0FA 4O25A 4NBUA 4HHEA 1EFTA 3QXHA 4RU1A 4ZAZA 3SZMA 4AJEA 2GPSA 2XA2A 3MJTA 5B37A 1VDZA 1DRWA 3IEXA 4PW0A 4UOQA 1ZC4A 1XCJA 3FZNA 5MN5A 2P77A 4TT8A 4WLVA 1ZGCA 4CV3A 3OQPA 1FLAA 3L8MA 4FCCA 1MIOA 2X6TA 4WSOA 2LCQA 1WKCA 3MT8A 5KDDA 4B2YA 4Z1OA 4LTNA 2DTXA 2BGGA 1KMHA 2ONKA 4Y2TA 3SZLA 5CA1B 5AW0A 4ZGWA 1GR0A 1V8FA 1YS9A 2GZRA 1MDBA 1S0UA 4FDVA 5IVPA 2SKCA 5JASA 5KOHA 3WGYA 2J3KA 3IQZA 3R23A 2ZYGA 2AS0A 4QEKA 1HE2A 1H0KA 5EJ2A 5BYBA 1UFQA 2YTZA 3CNLA 2AE1A 1FLVA 3ACBA 2YHIB 1NUPA 2R44A 3KQKA 1Q15A 2J3HA 3SBDA 4QE3A 3U9TA 2Z95A 1NZJA 2R8BA 3F5MA 3NORA 5FNVB 5H3HA 1F4VA 3GEBA 4HWPA 1YQXA 4JX8A 1Z35A 3CR8A 5DNYB 1A9QA 1E9RA 1BHQ1 2P4SA 2OFPA 5EHGA 3MW8A 5ILOA 3U1TA 3BA6A 1DC4A 2I22A 1EYZA 2VJOA 3G6WA 2Y1OA 1RKXA 1UPCA 4URYR 1PWXA 2BUAA 3Q7EA 5D51S 5CLFA 3OEHA 1KEWA 5JEEA 3ZZUA 2QUIA 2FEMA 2I4RA 3N8DA 5JSZA 4F06A 1CNMA 1Q1GA 3FOFC 2Q2WA 4Q12A 3F47A 3S7ZA 4F4FA 2CL5A 2NO0A 3PXGA 4BN4A 2JFXA 3OCCA 4BNWA 4YLGA 2WQ6A 3RRXA 4P35A 2WTMA 3BD7A 3KAPA 3MXOA 1Y1PA 3HCDA 4GMXA 4LJ7A 4RSMA 1ZI6A 4Z8YA 3U6KA 4XYGA 4C6HA 1TUBA 1GFIA 1KI4A 3ZVRA 3AVXA 4HAWA 1W36D 3JARA 2B8JA 4U7PB 5AI6A 2OMEA 5F7ZA 1YSCA 4U0JA 1Y7LA 5AVTA 3IRVA 1XPUA 3H2GA 3ZGNA 4CXMA 2HUNA 5ULLA 4UM9B 2ODQA 2ZU0C 3RFCA 4B6SA 5K8TA 3IS3A 1SELA 4N4AA 2GPAA 3W9BA 4H4CA 1DAPA 1WB9A 2YR0A 2NVBA 4K9LA 1EFCA 1EFRD 2W2PA 4JT4A 3ZWQA 4KI7A 3P9ZA 4LYAA 1JHMA 3IIKA 3KNZA 4I1UA 3CW8X 1Z6QA 2GBLA 4QYSA 5LPNA 3W2GA 1CERA 3SI7A 2FUNB 3ED5A 2VCYA 5JMPA 4G2NA 3U1VA 3W8DA 3ELBA 2HO4A 4OB7A 1IB6A 4B2PA 3EVAA 4UU7A 1KL7A 3HA5A 4TS4A 5FA8A 3R1IA 5SYNA 1Y8ZA 1NKSA 1PGJA 2R8OA 4AZWA 3JVIA 1OI7A 2J85A 4AURA 5CA0A 1UF9A 1AQYA 3K94A 4DJAA 4KFRA 4JCCA 1D4OA 2XMBA 3OQBA 1GWNA 3FCAA 3ENQA 3KLBA 1RJWA 1UPXA 2HBRA 4WY8A 4R9UC 2DY0A 3ZY5A 1E3IA 5NLLA 2GA8A 4QLOA 1VL8A 4MAAA 2QW8A 1QFJA 4R2MA 5FV7A 5AW9A 3GFRA 3UNXA 3PNMA 2PX2A 1C2YA 1USKA 3PV0A 1E6LA 4TV8F 1LS6A 3EDMA 4DDVA 2AN4A 2HA7A 3BXGA 2YN2A 1UMBB 1OHHA 1ORWA 2ZS8A 5E1BA 1UP4A 3UF0A 1CR6A 5JATA 4LQ4A 2BGUA 2GYYA 2R8XA 3E9ZA 4FMPA 4PCVA 1IJEA 1ZOOA 4X61A 1OFUA 2BGJA 2D1YA 2JZOA 1XZ8A 3VPXA 1FYFA 4EUSA 1BN7A 3AEUB 3RFVA 2FDXA 2H8GA 5KCMA 1K2VN 4QHTA 5C32A 3PI7A 3O4FA 4QUGA 2XUIA 4GDMA 5DM1A 4LF5B 2A1UA 2V97A 5TQ0B 2CL7X 2WSMA 4MLDA 1IHXA 1AUQA 3I6BA 3IB6A 5KU1A 4Q4JB 4PZZA 1USUA 5ECDA 5ETJA 2WTNA 2ECKA 1FTYA 1N5DA 3CEPB 4WZAE 3SFTA 5BPHA 2X3UA 3FYUB 4ZK6A 2UV8A 4XLLA 1YMUA 3DS8A 4BV3A 4YO8A 4S04A 1O1YA 1FFSA 2F1KA 1U7ZA 4C22A 4D4MA 4JYAB 4M88A 3KBBA 2QT0A 2C8LA 1BA2A 2XVZA 4ZD6A 1BXRA 2ZAOA 1U2GC 1CJMA 3GLRA 2Z6AA 1OWPA 2QYSA 1VB3A 2ID8A 2PBZA 1WW8A 2J5XA 3GFGA 2HO5A 4IDPA 3GL9A 1TM4E 5DTJA 3VUEA 5JR3A 3DV0B 3GLSA 3ICPA 5LSAA 1I36A 4QICA 5CH5A 2I91A 3QLEA 4LDJA 3W3AD 1E2NA 3UAWA 3WGGA 1I7PA 4CR6A 1IHYA 2VRWA 3E22B 3FYDA 1GG9A 4YCCA 2HF8A 4U7WA 2O59A 2IZ6A 2VNAA 3D54D 3D7LA 1A9SA 5A5DA 4RIIA 1Y3IA 1Y6ZA 4XVHA 4C4OA 4LXGA 1SG0A 3G9QA 5MGBA 1OFIA 4ENPA 1MXFA 2FP3A 2V1UA 2ECPA 2GXUA 4F56A 3EZYA 1Y3AA 5I7WA 1G64A 4I66A 5E2BA 3H7AA 4I0WB 4D99A 1LI7A 2OXIA 4F45A 1S1MA 1W4AA 1HFKA 2H1OA 2FQXA 3IKTA 3HWWA 1AMOA 1HQCA 1MDFA 4OEHA 4K3UA 1F6WA 1M8JA 5GOZA 4B84A 5WRFA 2HWKA 3TW8B 3HDYA 1PVVA 4EW1A 2XGJA 3CH7A 2E4VA 1P7ZA 4G1CA 4B4DA 1PZNA 3REOA 7ABPA 2QIOA 4KIUA 4GM4A 3ZWYA 5GTDA 3OQVA 1PV1A 4C2BA 1GVHA 2YJ3A 4DJTA 3S99A 3EHEA 5IT4A 4GL2A 2WUDA 4WWHA 1MB0A 1RMYA 2J0QA 2QRZA 3A1EA 3CLHA 1LPPA 5EMNA 2BI8A 3NAGA 1NATA 3MGGA 2VNJA 4P31A 2W8ZA 1Z0KA 2V59A 4UHDA 3T5DA 5JVDF 5SZJA 3T4XA 2IV3A 3TOZA 1TCCA 1YDWA 1MP0A 3MRTA 1DFHA 3MM4A 1OVGA 1OX4A 4Y2RA 2VAMA 5IC4A 3SJBA 3AG6A 2XAAA 1EFVB 3O26A 1XX6A 3MMXA 5AIAA 1X9IA 2BR4A 1HZZA 4K6OA 1FBTA 4YCMA 1UM9A 1REQA 2FG5A 5KYTA 1ZD8A 3S2ZA 3EZ7A 5A3JA 4BZXA 3OQ1A 3KKKA 2FSVC 2PMDA 4X7PA 3TOCA 4PWYA 3SICE 2P7IA 4QGHA 2DP4E 2XNSA 2W4MA 5IARA 3B2QA 4M4SA 1LPAB 2DB3A 1A9ZA 1NF9A 1UL1X 2QRVA 1NJFA 2L17A 3LKZA 5JCXA 3EXHA 3UJNA 5MN6A 2WJIA 1KZGB 1U04A 3BILA 4D8XA 5KX5A 2YHBA 3MTGA 4Y6SA 3I4LA 4OTZA 1Z2EA 4PRZA 3SYLA 2XF8A 5FWDA 2QTLA 1V35A 2ATCA 4W6QA 4QUBA 1SCUA 1SOVA 2CSXA 1PJTA 4HZIA 4K9RA 4ZDJA 5KBYA 2AFIE 4RWZA 1XO1A 2BM1A 2ZBVA 1R8XA 1YQ9A 5I47A 4X8MA 1YZYA 2GKGA 4KKVA 4A9AA 3CFYA 3ZLBA 1DC5A 1FMJA 1PAUA 1IY1A 2I2FA 4C43A 5IF9A 4G81A 4XTRA 1ZGBA 4YUYA 1II9A 4RTPA 2C59A 3C3BA 2A86A 3ZDBA 3GFOA 1GUDA 5ERYA 4ZQEA 3CWZA 3ND7A 3M7IA 1A50B 1GGNA 1R12A 2B37A 3ITKA 4G63A 2OQ2A 2ZE5A 4LFAB 4QELA 3LYLA 3D3WB 3SG0A 4HGOA 4PYMA 2ERYA 4Q9DA 3BC1A 1B3RA 2PLFA 2QOEA 3CY6A 4NG5A 2JKYA 4XGIA 5EEGA 3DDCA 2PMCA 2PM8A 4HTFA 5CM2Z 4C0LA 4BAUA 4EYOA 2EQ5A 5LU8A 2BTEA 4FZVA 3VOTA 1I9CA 4AN0A 3NHSA 4LBYA 3KSUA 3ZH2A 1J9EA 3QYFA 4Q21A 1W1IA 3NAZA 4YV0A 3M5PA 4X97A 3RUFA 5GQSA 3U26A 3WIBA 2F3QA 1UK9A 1OAAA 1C2TA 1ODLA 3GHHA 5EUMA 4EMSA 1J0EA 1OR8A 2PUTA 2BEUB 5D1NA 2RCYA 2G70A 1YF3A 2JDID 3X2EA 1VE6A 1YDFA 2ZSJA 5EGNA 1YBMA 4B3MB 1ZICA 2WDPA 3BZWA 4R7TA 2EZ9A 2RG7A 2Z8XA 2OD7A 2AQHA 2HD4A 4MCJA 3FOWA 3UZUA 3T5MA 2IZ0A 1ZUNA 4AZ3A 1YCDA 2QN2A 3F4LA 5CX4A 5DASA 1C1DA 1QGUB 1NMSA 1LX6A 1XUOA 2ADFA 3COZA 3D8NA 4HMQA 2FW8A 5EQDA 4UCFA 2C2YA 1XRPA 3NVMB 2PIDA 3TQFA 1J9GA 1KI7A 3KEMA 4H1VA 4KGZA 4WFJA 4KIFA 4IVQA 4NZYA 4CMAA 3L1KA 1I9GA 1XEXB 4A8TA 3TZCA 5K8UA 1WJGA 2CMDA 1FPQA 3UAZA 4XDGA 2DLDA 4ZEOA 5JW6A 3F3YA 3CRVA 4H7HA 1RHUA 3FXAA 3TUJC 2I1LA 2YUIA 4MW0A 2BSXA 2JIDA 3TLBA 1NVUQ 5CVCA 1GG5A 3QU2A 2VJBA 3MWEA 5GIPE 4WZAA 3SM9A 1M1XB 5F1OA 3ROEA 1TJ3A 3E3OA 4P81A 3PQ6A 1K7EB 3PYMA 2QZSA 4QEDA 5AI8A 4YV1A 2C07A 5JNRA 3T5PA 3MYRA 3C45A 4G0PA 4I1YA 4DLAA 5C7OO 4G1MB 3FB4A 4RTKA 4GM1A 3AIIA 2OPBA 3SC6A 1JDBB 1E0AA 4LOLA 3IBTA 2YWCA 3INNA 4B31A 4EATA 3ANNA 3ERCA 3CZ4A 2Z2KA 3IBYA 1C3EA 3D43A 2I2CA 2M98A 1YB6A 2FMXA 2FW7A 4RANA 2VR1A 4DLRA 4DL9A 4B6OA 5JAIA 5E0KB 4PG6A 3OMXA 2OQIA 2GHQA 2CLIB 1BROA 1WB6A 3FGOA 2JH3A 3PSHA 4GH5A 1S2LA 1UT5A 4I50B 4J7AA 1QWSA 2NU7B 2ZJ3A 4P2BA 4UJ5A 5EHZA 3HS3A 3HA2A 5AFSA 3I04M 3NIDB 1QP0A 2PSEA 1E1CB 5I9BA 3F5DA 1JGTA 1SXPA 2OHXA 1QV7A 2YINC 5DMXA 4BNDB 3LBAA 2NUAB 4KO4S 4HGQA 2X0DA 1M74A 4X44A 2AOVA 3Q1LA 1SKQA 3PWTA 2W4QA 1XWFA 4FU0A 4L02A 2XCSB 2A6PA 3KETA 4L6CA 1DBPA 4YALA 3TJRA 3CZPA 1Q7BA 4C0XA 3O94A 1GSHA 4FHZA 1XQ9A 2OSBA 4GMKA 3CGGA 3U7IA 2Q5JA 2R4UA 4C9BA 3BF8A 3OIGA 3F1LA 2C9MA 1S89A 1EX7A 3PDJA 1YQGA 2WP8J 1SNYA 5IDWA 2JG3A 3TXAA 1PJAA 1PWYE 1H0SA 3EGCA 4QJIA 3G2HA 3LHFA 1E1RD 1MTZA 2FR0A 2ZT5A 1LK0A 1P75A 4O8CA 4CT5A 5T7BA 1DELA 1NBME 1HH4A 1RI2A 2DPXA 1N57A 3N75A 1N9GB 5SYMA 3O8BA 1B8NA 2GNAA 2AN5A 5IJAA 4Y30A 1WNTA 1A2OA 3M82A 3EFOA 3QMPA 3PHJA 2CZCA 5ALIA 5HS6A 4NATA 3UUGA 5GM1A 3ZHXA 4BVHA 1SKYB 1ZRHA 1ELOA 3IOCA 4OB6A 4QAJA 1P44A 4REQA 3TLGA 3DFZA 4NMXB 5B4UA 1LX7A 4ZC1A 3FB1A 5GY7A 3TR6A 3M6WA 3WYEA 5D6OA 1OZGA 4PY2A 1JFFB 3CO5A 4GPEA 1GQRA 3JVVA 4KV7A 2VPWA 3ZCTA 3FUWA 2H31A 1YR2A 3BQMB 3JRXA 2PYDA 2BH2A 4ALKA 3L8FA 3DOFA 2BHNA 2ZI4A 2AQ8A 4XM1A 1J8MF 1Z36A 2X13A 2BVNA 2ZAYA 3DEAA 1N32B 3L4JA 3IERA 3MWLA 1T5TA 3T35A 5LKAA 3KZVA 5LZ9A 3B7WA 3FBWA 4KQ6A 1U2GA 2AOUA 4CMEC 3KHTA 3TSZA 1FDTA 3KSRA 3RF6A 5EJ7A 4UAGA 2IVZA 4WNAB 4YDHB 3TL2A 4F4CA 3IP5A 1KBOA 3V32A 4Y6GB 3T1NA 4P32A 5A4FS 2LR0A 5IW8A 3LHDA 4Y6PA 1AX9A 2VQSA 3IQHX 3PC8A 4HDKA 3LO8A 4LJAA 4PYQA 5B3JA 1TUGA 1IEVA 1BQEA 2ZJ6A 4FDTA 1PL0A 3L7OA 3ORSA 3ZS8A 1JPNA 5G1NA 3NTRA 2WIAA 4D98A 4QWWA 4L5JA 3MWDA 1Z73A 2FEKA 4J03A 2XODA 4II7A 4Q4LA 3PFNA 1WNFA 2HM7A 3O95A 4YT2A 1X7WA 2FE1A 2OCIA 3R5SA 4KFSA 1Q3TA 2AF4C 2OHFA 4TLDA 4HDMB 4D92A 5HBRA 2IQIA 2ZITA 3FMFA 4FFLA 3PPWA 2G9NA 2AFIA 5DHFA 1FU4A 1O58A 5A71A 4YQFA 2CWWA 3WHLA 4CGYA 5AJHA 1SXGA 2VHQA 2HNBA 4US0R 2Q41A 4GF5A 4JWTA 5CDHA 2ZUFA 3O84A 3FNGA 1L1RA 2HJ9A 3HLYA 4AZ0B 3NC4A 2NXEA 3V4PB 2E4UA 1I01A 1L7BA 1VHWA 1NP3A 2PKRA 1Y9DA 2HPVA 3PNSA 3BK2A 4KDFA 4OQFA 1ZR2A 1NR1A 2QHXA 2RH5A 1O6FA 2CVOA 1CQIB 4LJLA 2XAUA 1RQXA 3QVVA 2CNKA 2FSUA 4ZAWA 3BWCA 1FDOA 4AMGA 5CT9A 2NXNA 3AV3A 1AV7A 1T3TA 3PVSA 1I33A 1CJCA 1RWMA 1WHTA 1X9HA 2XGMA 3IEIA 1WPRA 4MQBA 1WXFA 4F72A 4TVSA 5I9NA 4M49A 4RVFA 1X19A 3BRSA 4GYJA 2C8KA 4L07A 4LBZA 3WJ1A 4TMKA 1OXVA 3K20A 5HEKA 2P9BA 2XCLA 3GMSA 1WDKA 4MARA 5AMXA 3NVKI 3JAWA 1KJQA 4B46A 1E6KA 5ELXA 4N7JA 3LWNA 3UJCA 4YP9A 4FBLA 2Y1CA 2JAHA 4EUNA 1FYVA 2PZKA 4BN0A 1TPYA 1EUDB 2HIMA 621PA 5HR5A 3HA7A 1GU0A 2IZ1A 4M53A 3TZBA 3FBGA 1UZLA 1FDSA 1V1RA 2E4WA 3R3XA 4GWLA 4PYJA 3TTUA 2G82A 4CF7A 4B3XA 1LLUA 4BIMA 1NY6A 1XCMA 3VYTB 4CQMD 5JEDA 4BQSA 2VTDA 3LP6A 3C3AA 3WIDA 3EVGA 1CR0A 4MIKA 1K7FB 3JAMA 3FSRA 3PFHA 3AQ4A 4KMOA 2R5FA 3OD1A 3RV4A 1T6XA 2C54A 2V8OA 3PF9A 2B1IA 2DTDA 3MTQA 2AEMA 3U7JA 3N8NA 1U7DA 2Q6LA 3IT1A 3L40A 2CHVA 2R6AA 1JWBB 3LW8A 1RKUA 1P31A 4TTIA 4B6PA 5KREA 2NZVG 1L7RA 1Q2XA 2QT9A 2I65A 1K5DA 2YWBA 5BWMA 4AZVA 1EE9A 2ILTA 5HCUA 2QS9A 3HKBA 1O57A 3PRJA 4LX8A 4RMNA 1WDWB 2ZE6A 3BIOA 3B6IA 1C7ZA 4FILA 1DT3A 1KXJA 5TIIA 1FS5A 2P1DA 3AETB 3JASA 2JGDA 3GDWA 4TZTA 3I1FA 3JW8A 5AKGA 3UTDA 2IZZA 4LZPA 4RMGA 5EE3A 1KAGA 1BHSA 3GA0A 1JHZA 5LZ8A 4GX0A 4PC7A 3RVMA 4EGAA 3BA1A 2HNKA 1XQYA 1SAYA 4RFSA 3O1HB 4UD6A 3N6XA 3NOVA 5LP6A 1LI4A 1E69A 4CLOA 2WAAA 1ZEMA 1MB9A 2PX6A 5IC6A 1MABB 1AQIA 2QN1A 3A7DA 3K92A 4I1SA 1BMTA 3S8EA 4D5GA 4N7MA 3JRNA 2B4KA 2H17A 4NIMA 2H57A 3U3RA 2DT5A 1BH2A 5SY9A 3ACDA 3BGDA 2X41A 2GN0A 3N8HA 4W1SA 3TAXA 5IWAB 5JD5A 3KUCA 2R8EA 2DERA 4O4LA 1O0SA 2Q4RA 3L8DA 2GI4A 4I19A 3BULA 2VK1A 5CLLA 5JQGB 4WCVA 4C2AA 3B48A 3RM3A 4PZAA 3HJBA 1ENYA 1PYOA 1VMIA 2C9OA 3IBCA 3CX3A 3JATB 3SS7X 3TIVA 1IXYA 1RRMA 2JCSA 2MU1A 4BVBA 2GETA 3QF7A 4JBXA 3DHYA 4DZTA 2YFQA 2QX4A 1J56A 5FKJA 3ZBQA 3EGXB 3RI3A 3RS5A 1QUFA 5CH3A 1GY8A 2ABWA 1Y5NA 2VZ0A 3TS1A 3EX7C 1DDIA 3B78A 2ADMA 2PKEA 3M49A 1JSLA 4XDHA 1HX7A 3HY6A 3AHJA 2BJVA 3PB3A 4LCBA 4UBOA 2VBCA 3HRHA 4XX1A 2Q0HA 4Z54A 1E64A 3CXRA 5CB0A 2E1PA 3N6RA 3ROFA 3LYUA 2DJIA 2J09A 4XYMA 4ZVNA 2YY6A 1I6MA 1RZRA 1NBMA 2CJYA 4TYYA 1IL0A 1Y7IA 1XB2A 1E1KA 4N65A 4RO0A 3SYMA 1TMKA 5JY6A 5KOJB 1FFYA 4HMOA 3V4ZA 1KF0A 4O4HF 4L72A 1ZSVA 1FL9A 1PFKA 2BTOA 3LY5A 5HFJA 1WMBA 3AX6A 3DBHB 1QU2A 4HEA1 2CJFA 3PTLA 1JKMA 4CFYA 4N76A 2VP5A 3NHYA 4KAFA 1ODCA 4Y6LA 5TRTA 3GCWA 3URKA 1QOZA 4DIKA 4KHPB 1N2EA 4MINA 3X1KA 2Y66A 4YCLA 1HPLA 6ADHA 2QY9A 1SU8A 2JAPA 4MS3A 1RBZA 5J58A 5KYWA 3VPDA 4HRXA 3S27A 2R6FA 4FMBB 4JJ8A 3HXKA 3I30X 4WTOA 2GF0A 2WJHA 1HNNA 1YONA 3OCYA 3V5NA 4FDMA 3RGGA 2CNOA 3VC3A 4E12A 2WU1A 1HTTA 1WMEA 3EC1A 5JFGA 2B21A 2OCXA 2JATA 4NCHA 4Q1VA 4XWGA 1YK0A 2ZWMA 1CU1A 2C5EA 2C9ZA 1GCGA 2SCUA 5P21A 2XB8A 2P3SA 3EZXA 3OEED 1QGED 2GEFA 2R62A 2VPYA 4P22A 2LCFA 1VPEA 3BG5A 3WSWA 2EOAA 2CN1A 3BWVA 2FPXA 1ZJWA 3HPRA 3E03A 5LBUA 1MQSA 5TLSA 2J67A 2WJPA 3G0GA 4JI1B 2DKFA 1NI4A 5F52A 1WUKS 3PUWA 4N6OA 4RD2A 4K9MA 1ZL0A 2WF5A 4TWZA 5A9SB 2RJ3A 3WLOA 5I4KA 1EDEA 3BSFA 1US8B 3C3MA 3R3JA 1XPOA 2EIHA 2PS1A 2GK3A 3N28A 2I55A 4GI5A 2NUPB 2QTVA 1ZLXA 3ZHUA 2IIPA 3Q7QA 5E4TA 1MAAA 1IPFA 1WUHS 5M34A 1KY5A 1NYQA 1QF6A 2AOXA 5B1DA 1SA0A 1IXSB 2HRQA 3MMPA 1BX0A 4URHA 3EOZA 4NDZA 1DWQA 3ORHA 1Q6YA 3OY7A 2HTFA 4UNPA 2QJOA 1IBKB 1CRQA 3ED1A 1B6SA 2C2ZA 1QG0A 2D62A 1DKRA 2DX7A 3EFBA 4ZKDA 4G41A 4CEIA 3ESRA 3GNQA 2PTGA 2JIZA 1NVVR 2HHCA 1P60A 1KK3A 3QU4A 3SZGA 2O0JA 3E7DA 4ZHQF 4M9XA 5H3CA 3KKNA 1SVOA 2UYOA 1NVAA 3LPCA 2IOHA 2YW2A 1BH6A 1C81A 1GR1A 1P1IA 1TGVA 1TJPB 1ZD1A 2IXFA 3Q2KA 4Q7MB 3IPRA 1KK0A 2YC4C 5EIOA 4LY9A 5KMGB 2GK4A 4IIBA 2PUFA 4NJOA 4JLDA