2Z2JA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
180
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural Plasticity and Enzyme Action: Crystal Structures of Mycobacterium tuberculosis Peptidyl-tRNA Hydrolase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 57
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2z2jA00
5B6JA 4HOYA 2PTHA 5IMBA 3V2IA 4DJJA 2NAFA 5IKEA 2Z2JA 4DHWA 3KK0A 3OFVA 1RYNA 2LGJA 3TD6A 4FYJA 4Z86A 3TD2A 4JX9A 2Z2KA 4JC4A 4JY7A 5IVPA 1RYMA 3P2JA 2JRCA 3VJRA 2Z2IA 4FNOA 4ERXA 1RYBA 4LWQA 3NEAA 4OLJA 4FOTA 5EKTA 4ZXPA 3TCKA 4IKOA 4JWKA 4YLYA 3TCNA 4QAJA 2MJLA 4P7BA 4FOPA 3KJZA 4QT4A 4QBKA 4QD3A
chains in the Genus database with same CATH superfamily
3DLAA 4WT7A 2G9VA 1M6HA 2H0AA 4NCXA 5D5HA 4F5ZA 3FF1A 3O1HB 5EKSA 1AO0A 1T9GR 2FHPA 2NUAA 5D87A 1SKYE 5IXSA 1CSEE 4QOEA 3GPLA 1B7GO 3F3KA 2WNHA 4FP9A 4F91B 1UWLA 1DJOA 2BCJQ 1UEXC 3EGWA 4O2BA 3K5IA 5IXJA 1CUAA 2QJWA 4EKDA 5DBGA 5JD5A 4E5KA 1C7ZA 1FUIA 1JR4A 1Q16A 2I99A 2EJUA 3BWMA 1JT9A 2HDHA 2J41A 4FEYA 5AHKA 5ABPA 1SOWA 4HEJA 5IAGA 4CXMA 2FGKA 3TBFA 3CX8A 2IL1A 4XUDA 5BYKA 4WI1A 1WMBA 1G8JA 2CXOA 3AIIA 1RRGA 3CIFA 4H08A 5I8PA 1TDJA 2XNKA 3CW2A 3E7FA 4QOIA 3LUCA 4D3SA 1LBIA 3LL4A 4KQ1A 5LUAA 4TZTA 4XA8A 4XKJA 5HFNA 1L7XA 4WLVA 1EXVA 1X1RA 4WACA 1A2OA 2YRXA 3H4IA 3CRQA 3RGGA 3CX3A 4E1AA 1NVTA 4RM3A 1QOZA 3P1JA 4K86A 4O4LF 5F3RA 5BVGA 2HJVA 3OAAA 3S68A 4IHKA 3ZV6A 1E2BA 4QOSA 1LW7A 2Q07A 3CF4G 4C7JA 4DB2A 4HH1A 4WH0A 5C4GB 2ZSFA 4CF4A 1N4DA 2IV7A 3FOBA 3EZFA 1GUZA 4H16A 3AEUB 3OPMA 3HNOA 2XB8A 4DA7A 3LTNC 4FUQA 4FOOA 3MCWA 3F96A 5KBYA 5HTOA 1X0VA 4H3KB 5CLJA 4HYYA 1CJTC 2PS1A 3O38A 3CJTA 4L6IA 1D2EA 4H6WA 3R09A 4NF2A 1GAEO 3CN7A 4CQJA 3GJ8A 4C4TA 4PHTA 3AVUA 1JKIA 1HO3A 2I9KA 4JJ8A 1CUCA 5JZMA 2XX3A 5LCXA 2QJFA 3DOJA 1C1HA 5ALHA 1WMSA 2R8OA 3QLEA 5GONB 5BWMA 1P7YA 3TAHA 2VI5A 2ZRCA 3OU6A 3UJ9A 1M5RA 2C59A 3TRIA 3SJCA 3GQBB 3QWFA 1RTKA 2XMGA 2CDRA 2V98A 4AN1A 3OZXA 1FEZA 3OIDA 4TLAA 4HVLA 5IEJA 2HHHB 1TJPB 1YBAA 2AK3A 2H65A 2VDLB 2WFAA 3LA8A 4Q05A 2QTMA 4ARZB 5CT6A 1JMYA 2TRSB 4D4KA 1Y5IA 4UNRA 3GLIE 4BBPA 1JEYA 1P19A 1EE2A 2IQ5A 3NWOA 2PUCA 2H63A 4PFKA 4UBNA 2VHUA 2P6OA 5J63A 1EJBA 2G0NA 4GPIB 3OEHD 2YHIA 4K6CA 1AV6A 5DASA 3AB3A 1NUAA 2GZ2A 3HSYA 3QENA 1UFVA 2QMEA 2ZWVA 3ZYZA 3AKZA 3R41A 1EDOA 2XB4A 5KTTA 1Y6FA 1EM8B 4CR6A 4RO0A 3GH1A 3MJSA 3PFGA 3QUBA 4IIJA 5EWMB 1LV8A 2GM5A 3PQ6A 3F6BX 1KZ4A 1QQ5A 4JHLA 3VPDA 4MI9A 2PLFA 4D41A 3WRXA 4N82A 3SG0A 1E3LA 5CCDA 4BX0A 1L7BA 3FNEA 1C9DB 2Q7DA 2JGDA 4OKSA 1XYGA 4KXWA 2IY7A 3H9UA 5ESXA 3ZIAD 4JLSA 2GCPA 4TZ0A 1ZZGA 2XUAA 3T9CA 2HLPA 3FPCA 5B6JA 1PWYE 1IFXA 721PA 3VR4D 4CM7A 2I2AA 3ICWA 2A9RA 1P2FA 3AL2A 1VE1A 5EZYA 2ZBUA 4QWMA 5C9ZA 3I62A 1U7UA 5I9IA 2RBKA 2VEOA 1ODLA 1N5IA 5JTTA 3T5BA 3PXUA 2QRQA 1R3DA 1CU1A 1U2DC 4TZKA 1U0EA 2PA0A 3KALA 5CLQA 3RWBA 4D02A 5EHXA 3TOSA 5JCZA 4G41A 2AD1A 1WXQA 1Z3CA 2WVJA 3ICQB 1NZFA 5HRCA 1NX6A 1G7TA 1JVNA 4A23A 2JH3A 1E62A 2IHUA 5LQCA 2HREA 4NDZA 4KSBA 4KREA 2JFXA 3ZWYA 1WQ3A 4WNCA 3BWBA 3IUMA 5EIBC 4EKGA 2X1HA 1W48A 3DSRA 1RC8A 2DY1A 5J3JA 3CR7A 4JS0A 3AEKA 2FDXA 1UBCA 3RS4A 4HL6A 5E1DA 3ZHBA 1YI1A 3IRVA 3ESZA 3JPWA 3EEOA 4OFZA 5EIEA 2OXCA 4RS4A 2VJCA 2HI0A 3E7PA 1TAGA 3FKQA 1EWYA 3A37A 5HQ3B 1M76A 4KO8A 4MPTA 5BUQA 5JJCA 2YWHA 4LY6A 5J1TB 4KR6A 1P72A 1E1NA 2OMEA 2O1EA 1E20A 1Y4SA 5DV9A 1K98A 3F67A 5LOVA 2PRSA 5EMJA 2OENG 1ULHA 2IY8A 4X64B 3UPUA 1MENA 4KMOA 3C39A 4U3JB 3OKCA 3V2HA 4K2AA 3U3RA 2OV4A 3AHDA 3S27A 1DC6A 4COOA 3THSA 1ZGBA 2FF5A 1XX6A 3K05A 1KQFA 3H2ZA 3PQFA 3ROQA 3PL1A 2BEWA 3ZBQA 3NP9A 2HSWA 3BWYA 2Y99A 3FN4A 3KSRA 2UUBB 4MO2A 5FL7A 1S4QA 2PSDA 2I7CA 1E5TA 4OQNA 4RPHA 2BFDB 3ZHYA 3BXGA 4QUKA 5FUVA 3O0DA 5FFMA 4ASUD 1YXMA 1P0MA 2P65A 2QIOA 3HNRA 1SZCA 3SZ3A 4Z1MD 2P5UA 5H83A 5D1HA 2NZXA 2AI3A 2EZ8A 2EARA 1YR3A 1KQNA 4B3CA 1LLFA 3UOAB 2ON6A 1UJBA 2C5HA 4MEJA 4CFZA 3E3MA 3TQCA 2JIPA 1OFTA 2N0SA 1Z25A 1FK8A 2PZMA 3C5HA 2VJAA 4MGIR 3FDIA 3UCXA 3L7MA 4RJJA 1ZU5A 1GKIA 1AGNA 1KOLA 1DTSA 2O1XA 2QPOA 2YZ7A 3RKRA 1GXSA 2CZQA 3JD2A 2ZUDA 1RXEA 1YS6A 1BWSA 5AKXA 4K9NA 1HKUA 1YZQA 3STUA 1L3IA 1X3SA 2EFJA 4JJAA 4FU0A 3QVJA 3TBKA 3VFDA 1YQWA 1II9A 1N2BA 2BGRA 2CE7A 3CBGA 3I6ZA 3RC1A 3ZLBA 4BASA 1QDEA 3QEMA 4IICA 4QEDA 3ZWOA 2PQ0A 4G1VA 4X3PA 2FZWA 2IHJA 2VWQA 1P5JA 3RU7A 5DCLA 3DF9A 3AEUA 1XNQB 3JQ9A 4XFJA 1OTXA 1G18A 1NYRA 2LDXA 2ZCVA 4Q1BA 5JIBA 1XTBA 3GAAA 3HFJA 4BX3A 1OKKA 1U3CA 1R6VA 1XEAA 2FTKE 5EINA 1W75A 3LKDA 3ULKA 2CBGA 4JUBA 3RUDA 3KEQA 1Z4LA 5JQGB 1OB2A 5IBCA 1P2BA 1QH8B 4O2BF 3FRHA 2A14A 4F71A 1HWYA 4BO0A 1TO2E 4US2R 3GJ0A 2C2YA 2LV8A 1QFMA 1CE8B 4I9NA 2HDNB 2H3HA 2IJGX 4KNWA 4RF3A 2CHQA 3D8UA 3KB8A 1XYVA 4JLAA 1SVNA 2YUIA 2N42A 1UK8A 2XRZA 1LQ2A 1FX1A 3FOEC 1GL9B 3VNUA 3MJTA 3GQBA 3GD7A 5JWHA 4B17A 3DJYA 1YRQA 1HYGA 3SOPA 1L5SA 4BGDA 5C46F 1JS1X 4LJKA 2BGLA 3QBDA 2WYVA 3HLKA 3HG7A 4OM8A 4BKRA 1ODSA 1R4AA 1VPDA 2CNWD 4ARZA 2BOVA 2PMFA 3QEJA 4DKXA 3IEIA 4Y6LA 4KUHA 4YAEA 1L4MA 1TVEA 4IRMA 2K2QB 3W4JA 2ECOA 1GU1A 2B1QA 2A88A 4S35A 4DMUB 5DH9A 3AFIA 2WPNA 1HNZB 1NUTA 2VPQA 1CQXA 4LHXA 1NF3A 3GLHE 3TE6A 4CLRB 1GITA 1A9SA 1U8TA 4AY3A 3TGLA 5AR1A 1OASA 3MLAA 2H18A 2ZVJA 3RBXA 2YS7A 5BR4A 2QVZX 2YXEA 4ROSA 2IOYA 2UVQA 4N3CA 2RB4A 3PU6A 2I78A 4IIGA 3WL8A 4YAFA 2ZRFA 1AVTA 4W99A 3PEEA 4QVGA 4NMLA 2P4QA 5CJ2A 2H1OA 4ARSA 1VRVA 3UT6A 1G291 5ICEA 1MB9A 1QYXA 4F4DA 2G1PA 1BRTA 4L28A 5BPFA 4BZPA 1KAQA 1HT2E 2HLDA 2NLOA 3CGGA 3R4VA 5C7LO 4IDBA 4QJ4A 1OVMA 5L3SB 2N1BA 1SCIA 2IYVA 2Q28A 2AJLI 1T1SA 4AP9A 2J5QA 1SHJA 2V74B 4LI0A 3VMFA 2Q1TA 2GTPA 4L3WA 4DTIA 3WOVA 1EP3B 3KOOA 3EX7C 5L3QB 3WR5A 4JBIA 1OA0A 4CQNA 5E1MA 5B2ZA 1A5TA 4GI3A 4WJLA 2Q8PA 5LLSA 1ADFA 2QVCA 3FNRA 5AM1A 1SXJC 2ZR9A 1B43A 1G8FA 1RWQA 2C5SA 3NAQA 5ADWA 2BDUA 3UJ8A 4RORA 3P9YA 4YCMA 4QGGA 5EXTA 4LAFA 1FSFA 5EXEA 1IJEA 5HKAA 2P1DA 4QT4A 3G2IA 4LJSA 3TW4A 4DCTA 5D51S 4UHFA 3I9KA 3RU3A 3WRYA 4AY2A 1OB5A 1M7BA 4R16A 4B7ZA 1S1CA 1J2UA 4GMDA 4Q7JB 1OXBB 1WUIS 1L8QA 2P9QA 1AXGA 4RVSA 1K1EA 2PVCA 3NDIA 5A9TA 2R47A 1SUWA 3UUEA 5HQ3A 3B8HA 3U4MA 3HWRA 4DT1A 1PVDA 3M6FA 2F48A 1R15A 1Z3IX 3IV9A 3QUCA 1R0LA 4DF3A 4JKYA 2B34A 4PG4A 3B9BA 3TLXA 3VZSA 3UHAA 4ZEMA 2AQ8A 4W1SA 3OO0A 3E1GA 5EXSA 4XD2A 2VK1A 5CM8B 1H8ED 4U3JA 1V7QA 5JZOA 2XUGA 3FH0A 3N07A 4RJIA 1HYEA 5C1IA 4M0EA 2PNFA 3ZWAA 4RA6B 4RD4A 3AKDA 4BVHA 1YOBA 3I2FA 3I9MA 4MARA 4Z0HO 4LZJA 5AJUA 4MV5A 4AQDA 2C2WA 2NZUG 1XRSB 4EJSC 1BVYF 2GD2A 3HVJA 4MVJH 1ECBA 3LP6A 2G70A 1MNAA 4KWEA 2UV8A 5HJ2A 1EZ4A 2BFDA 2F1IA 2KQUA 4C0WA 2IS6A 3NMUF 1A04A 4KB5A 4FZRA 3U9TA 3U6BA 1XJWA 4LJ7A 3QBTA 3U44A 3PA6A 4RDIA 1GKUB 1DQRA 2PUHA 3D6VA 4CMEC 2GN0A 4MQ6A 5BN3B 3V1NA 2IQIA 3AWDA 3SJZA 1MV5A 4XSGA 3A4LA 2OO5A 4KIFA 4M0DA 4YT2A 2R4TA 1CDEA 1XZLA 2GBLA 4JJ4A 3G8YA 5T57A 5I9LA 1KIAA 3UT5A 4BVJA 5D2CA 3HLTA 5CCXA 4DLNA 3MWDA 1O97C 3VHXB 1Y3DE 4KXLA 1DMSA 3UWDA 3ZJ4A 3V2IA 1Y8AA 2XYRA 2QVXX 3BH6A 1RVDA 1DHTA 3I1FA 3VOAA 1YS1X 3JU3A 4IX9A 2E4ZA 3VNRA 4MCIA 2ZT6A 4JR2A 2XD9A 4PX2A 1JXMA 4AG3A 3L84A 2YN2A 2Z2ZA 3OF2A 4QBIA 1V8ZA 2OHVA 3CKKA 3PHCA 3W8NA 3A70A 4LBWA 4U2CA 4GG1A 1QFSA 4JCOA 3RVNA 3JAMA 4ATNA 1LPNA 5DGCA 1JN0A 4F5EA 1ABEA 4GWKA 1B8UA 1JV2B 1KA9H 1G7RA 4Q37A 3B85A 4JSRA 5IBPA 4XRGA 2BH2A 4L8LA 4I3HA 1YJBA 1S3IA 4DLAA 1CQIA 1ZH2A 4IHQA 3DL4A 3JATB 1E9VA 1EK1A 4BOYA 2H1FA 1JJAA 3SHQA 3UJCA 1M6YA 1RXCA 2FUNB 2Q0XA 2RI0A 2UUOA 2VP2A 3BICA 4RPLA 3H8WA 5EQJB 1CZHA 4YROA 1IH8A 3H5IA 3E9YA 3CZAA 3R9KA 4DB4A 1PLLA 1I4TD 2G71A 2IIVA 1A5ZA 4K46A 1QRTA 1C7JA 4QXPA 5AJTA 1TMKA 2WE7A 2Y2VA 3GARA 5CP8A 1AKRA 3F4KA 1ZK2A 1T3SA 2Q9AA 4ID3A 5SV2A 2UXBB 3TMYA 3UXEA 3KDAA 1EVQA 3BH7A 2XOKD 3QIVA 4WOCA 2PL1A 3M1LA 1Q1GA 2C2BA 3PUKA 3U3XA 1RI1A 5DIZA 5KTKA 3QTBA 1GA1A 1YR7A 2NZWA 4XYEA 1LLCA 4L78A 1R8SA 2SNIE 4BZZA 4D8WA 2C9OA 4XEHA 3M2TA 5IAEA 1KVSA 2VK4A 2XHEA 1XKXA 2YBDA 3GA5A 3L8YA 5GM1A 5KJ6A 1G38A 4QD3A 2P5YA 3AVPA 1HEYA 4FC7A 1LSJA 4PQEA 4CTNA 1C4KA 4IIFA 4Q3LA 3TXYA 4UPDA 5DNVA 3NJ8A 3FNHA 5I8WA 2JZOA 1LKZA 2PGOA 2QRZA 4NKRA 3FYSA 4LJAA 4C87A 3C1AA 4PG8A 5K6AC 3U7IA 2JBWA 2M98A 3QVWA 4MICA 5JCOA 3RUHA 4CLRA 5H8WA 1E9AA 5CVCA 4DMKA 1A9XB 3AFHA 3SGLA 5JFGA 4QTXA 2CVQA 2C99A 1KK1A 5AKHA 1RXUA 2BH9A 4LPSA 1A8UA 3A6HA 4N12A 2HRRA 1REQB 2SECE 3OZFA 3RYHA 4D3DA 3Q12A 2G5GX 1CQZA 2XT6A 1Q2XA 3ZWBA 3EPLA 1O58A 1L5NA 2AVNA 2XMBA 2ET6A 1DJPA 3OZVA 3SF8B 1DDOA 1D0IA 4B35A 4YMIA 5JALA 5DGIA 5KJCA 3NTRA 3OPYB 3ZWWA 4PNEA 3AUJB 3D9QX 4N0QA 5GONF 3SX4A 2ZIEA 4HAZA 1JH9A 1QH9A 2X4GA 4BVKA 1O6CA 3BYZA 3FWZA 3FD8A 3FRIA 5JJIA 3LC1O 1VBNA 2VTEA 5CPBA 3RWOA 1XF9A 4U6SA 2JI4A 3DAGA 3RG2A 1IOVA 1WM1A 1T8PA 4EVQA 2Q8QA 1DAOA 1LI5A 2AG8A 3FMVA 1DBIA 1L8LA 5DTEA 1GARA 2Q6VA 3HABA 4TLLB 3RT7A 3UJPA 3ZU4A 1XTQA 1Y63A 5T5QA 4PO3X 4DAEA 2RHDA 1N34B 1HUQA 2J8ZA 3IAM6 2FG6C 1FLDA 2O5VA 4Q7EA 1O3YA 5JD4A 4GH5A 5KYVA 2EL7A 1X1QA 1GJRA 1I6MA 1PGPA 4GWGA 1D6JA 1JXAA 4KH1A 4HADA 1MVOA 4KPUB 4LRUA 3RQSA 3JWHA 3DT8A 4RHEA 2BW0A 2DWQA 4OQZA 2Q6OA 4BECA 2DHRA 1XTTA 4DV1B 1XCGB 2V7BA 4NAVA 4Q4JA 621PA 4LTNA 3ESYA 2VS1A 1EWVA 3EWAA 4DXHA 2GYYA 4Q6BA 2C78A 4R1QA 1L9KA 2BJWA 3UJ3X 1HM5A 4JLPA 4UPEA 2YTZA 2TMYA 2ZJ5A 1SOMA 2JRCA 1J24A 2OUKA 3HDGA 4DABA 1B76A 4D82A 1HRDA 4US0R 1C3EA 4C78A 1NVFA 2GJSA 2I2DA 2OO3A 1E3SA 3CUUA 3ONNA 2QTTA 3EE6A 5GOZA 3LBYA 1L5RA 3RARA 1RI4A 4J16A 2AWNA 3LOUA 3JTMA 1CR2A 5LBIA 4F1KA 4A0SA 1X7DA 2RIRA 5MGBA 2DBZA 4U7PB 1HLDA 1MJGM 3T3EA 4EQ6B 2J3KA 4GGPA 4V0QA 3NCTA 2ZPUA 2XMRA 3G2QA 3HJNA 1NMZA 3MS2A 1A4IA 4QXRA 4TMFA 1IULA 2FSGA 2F3QA 3SOZA 1X6VA 3I05A 2HCRA 1YGYA 4JROA 5BMVB 3ICEA 1QMPA 4KO1S 4L27A 1L4BA 3UVEA 1XMVA 1K89A 3GJYA 4ZYTA 2VUSA 3ZI4A 1JZSA 1K3TA 4FOLA 1QOPB 1XK6A 1YFLA 1CJCA 3ENKA 3QXHA 4N4AA 3VVCA 1UXIA 1PL6A 5JFOA 2D13A 1BX0A 3SQNA 2QLMA 3SQLA 2RGWA 1T5OA 1J99A 1U4SA 3BTUA 2ZP1A 3GLTA 5ER9A 5JE8A 4QQNA 3W3ZB 1SVIA 3WSTA 5F2KA 3B3JA 4ZXFA 2PO5A 1X8LA 2ZZKA 1K5PA 3FUCA 5TDHA 3VR2A 2HPZA 1O4VA 4EY4A 4DHEA 1T9GS 3BA6A 5CDSA 5FPSA 2VAVA 1J0EA 4MLCA 2CT8A 2B4YA 5DXJA 1MPXA 4ENRA 3SIRA 1CT9A 2VDVE 1VB5A 3SZMA 4LV6A 4ALIA 1QIKA 4BWYA 5CX1B 4EABA 3OZIA 3P4UA 1KZ7B 1ZGHA 2GXUA 1EFLA 4M83A 3NUGA 5AVRA 4DUGD 5J5CA 4GXTA 2QRPA 5EVCA 2FWAA 4DJAA 1KWKA 1B8PA 2ZRJA 3VH3A 1TQ4A 1YZKA 3JVDA 4D4JA 2CDNA 4YRMA 5L4SA 4U63A 1BHO1 2WEKA 4O4IB 5C52B 4J94A 4V2UA 2FX5A 1ZIXA 2VKTA 2IIBA 1ZD4A 4EDHA 1G4UR 1EA5A 3AMVA 1G9TA 2QZ4A 1CEXA 3LYLA 3OFVA 4MGYR 4MW6A 1WVGA 3IP3A 3MJVA 4CT5A 3RYCB 3UAGA 5KINB 4HCJA 5CJPA 3LHFA 3UW3A 2ZRBA 1BZYA 4KE9A 4TN5A 2AYYA 2QDKA 1ZH6A 3DYVA 1JWAB 3M5PA 3OBBA 1P9NA 3ORHA 3WK8A 2NUPB 3JYOA 1S2MA 3TOVA 4IHJB 5A3SA 4AMZA 5DPMA 2ZSEA 4F6CA 4QPCA 4UEJA 5H4GA 4OU4A 5L3ZA 1K8QA 1VRCA 2GASA 4HDOB 1XNRB 2CUNA 4FYXA 4JI7B 2BR5A 3M6IA 1V71A 2P0EA 3QV2A 4F3CA 3SXPA 1UIRA 2F3TA 1N2SA 5FO0A 4MUKA 4ZJPA 5FRDA 5ALWA 1VKJA 1IG3A 2V97A 1YONA 2JASA 1USGA 2BFEA 4M7PA 3IT0A 2NTJA 1JLHA 4QU5A 3CLRC 3O95A 4Z9AA 4AZSA 1PVOA 3SD7A 1RAIA 2GSWA 5JQGF 2P8SA 1ORWA 3GO4A 4N6NA 3ZV3A 1N6IA 2MR5A 4PSCA 4JI5B 2IIPA 2OLEA 3QFRA 5IU6A 4W8OA 5D85A 3SF8A 4E2WA 1I30A 1L1RA 1HEIA 2AOUB 1E98A 3QJ5A 4QM7A 4S0XA 1SU6A 1TW3A 2BBTA 3GPIA 1KQOA 1YE5A 3OJ0A 5DSZA 2C7VA 4XDGA 3T7AA 3KBOA 5DCUA 1JR3E 1KF0A 1Z5WA 1KSGA 3DVSX 2I0FA 3MHPA 5EMMA 3EBPA 1U0TA 4FKZA 4MWEA 3RK4A 1LNSA 2I9PA 3L6OO 9GPBA 2RC6A 3LF1A 3M2PA 4W8HA 1YFJA 3GCZA 4XQGA 4AJHA 10MHA 1ECFA 2M9MA 1JDBC 4L75A 3PB3A 4B6QA 5MGNA 2YV3A 4KO3S 3SMQA 2PV7A 4EY5A 3M0EA 2F8TA 2TSYB 1P3DA 3L6DA 3LDFA 4HS9A 3KXPA 4NBWA 3SEZA 4W9MC 2EFYA 3FNGA 4WW0A 2OQRA 1QVAA 4B9EA 3DMTC 4KPUA 4D43A 3G89A 4WEOA 4F3RA 1PUJA 1F0KA 2X14A 4M9SA 2OUIA 4TV9B 5D3QA 4YS6A 3E3OA 5AK0A 3LXUX 3ZCUA 4BVGA 3JQGB 2FMUA 3GWZA 1YJ5A 1BQ4A 3GL9A 2CLDX 4B4WA 2J48A 1GTG1 1GQFA 5FUYA 3X1XA 1I1OA 4Z4IA 2VNJA 2HLHA 3L07A 3O9MA 3AYXB 4CF6A 5JNRA 1ZW6A 3AVWA 3KUCA 4ZCPA 1QG4A 1WPRA 3FKSA 3LLSA 1EBFA 1RWNA 4MB0A 4I1RA 4B6SA 4A6PA 2R96A 1CP2A 2DWCA 2INGX 2HDWA 2LIVA 4B87A 3QKRA 5ALDA 5EIBD 4UOQA 3HCBA 1ONSA 1FU7A 2MSCB 3L7BA 4KQHA 3JYLA 1A3CA 4PZDA 1B14A 3QF4B 4FI3F 2RGAA 2VH5R 3HCWA 2ZRHA 1QG2A 3AILA 1DP4A 1ZA1A 2QW0X 3EVDA 5D7BA 4P4LA 5CIYA 3NU1A 2YYSA 4J6EA 4BP3A 1DVRA 1HY3A 3TINA 5KOIA 1WUKS 4CTOA 3RRJA 1TYDE 1CNMA 5EUBA 3AV0B 1EAYA 4ZVNA 1KQ3A 2OLKA 1LLQA 4KZPA 4JFAA 3VH1A 3TQFA 5BMVA 3DCYA 4RADA 3ZD8A 4PC6A 2Q3CA 4OGWA 3GAFA 1ND5A 5KREA 3FROA 3IX7A 3DFUA 3HA2A 5EKTA 3TQQA 4GZLA 3EVBA 5DWQA 1P5RA 3OQ6A 4CCAA 3TL3A 3BMNB 4MYDA 4J0HA 2XECA 4C4YA 1YBMA 5TMBA 4KDEA 3GMSA 1UC9A 1OT5A 5H0IA 2A84A 1ZNQO 3OP1A 1G8YA 2I1WA 4OP2A 2CGEA 3FZYA 1BS2A 1UBKS 3HWWA 3W9BA 3DTVD 3KHTA 1PE0A 2UAGA 3FHOA 1BMDA 1BS1A 2H2AA 4MVJA 3L8FA 3MWEA 5ALOA 4F7DA 5ALYA 2CXPA 1H9AA 1XUOA 4RY0A 4XQEA 4N5MA 3WNQA 3GVIA 2PUAA 4XIJA 2GDZA 3HCDA 1FZTA 5EFZA 3A7EA 4GI5A 4TTQA 3I9FA 2PA3A 3K0AA 1JW9B 4LISA 1CVLA 1P1KA 5THKA 5CX1A 2EBWA 3A7DA 3W3AH 5KOJA 2ZBRA 3V32A 1LBSA 1C1DB 4AS2A 1MQAA 2G09A 2O0LA 5KU7A 3PNVA 4LY3A 4REMA 4YRAA 4IS2A 1YDFA 3DHNA 1GPNA 3HPQA 3G9UA 3NIFB 4UNPA 7MDHA 2ZUEA 1C9EA 3LVQE 4NBKA 4ZV4A 4WINA 2EQBA 5TPZA 4KH0A 1A1SA 3KZKA 4HH3C 4ZRNA 2R1TA 2XEDA 4GX0A 1A7AA 3B51X 3ZE8A 2KMLA 1M1NA 4HP8A 1B2RA 3HRKA 5DLQC 3HDJA 4X91A 2W2VA 5JXIA 1ZH8A 1W5FA 3NO4A 3PR2B 3PXXA 1L7OA 3ZHCA 2I1VB 4NWIA 3ZW8A 5C7YA 1U5BA 3K1TA 3A9RA 4I8IA 3TTYA 2FR0A 2VC2B 4K6OA 1AN0A 4QFCA 2AFVA 4WKCA 5DNUA 4BJ1A 3FPKA 3WQQA 3W2HA 3HUFA 4IHJA 4XOIA 4K6MA 1UANA 2QXUA 2YVAA 1E0KA 1VHTA 3IDAA 8OHMA 3DO8A 5KWJA 3AR3A 2BCGY 2IU3A 3KEFA 4GQIA 3ZCRA 5D6OA 1ZVVA 3ONDA 3WLMA 2WUWE 4N6OA 3U9LA 3Q3CA 4L1KA 5AW4A 1MGOA 5KNBH 1ECLA 5I5GA 3LECA 3O3CA 1EX6A 3GY0A 3CVVA 3HJCA 3WZLA 2O2YA 1ODIA 1TK2A 2MSWA 2ZYVX 2XSZA 1UMDB 3N0WA 4Q9DA 1DNPA 4OO3A 4XWGA 4DR4B 5J2TB 3VKGA 4FNOA 1FF9A 1MMFB 1NC3A 4WZZA 3AV3A 1RZVA 2OHXA 4NOMA 3R5FA 4NU0A 2WAYA 1S2NA 3HXLA 4WX2B 1U1EA 3FRJA 5AWFC 5BT9A 3D43A 1N4AA 4ZQGA 4HI0E 4L4ZA 3DV2A 5L4NA 2ZE7A 1N2CB 1J25A 3AC0A 3DPUA 3GT7A 1LC3A 3O2JA 3CX7A 4Y9SA 2R6DA 2VF7A 4J1TA 4RZXA 2BKEA 3SXUB 5LM3A 4X1YA 3CINA 4IGAA 3EQ7A 3VH2A 2YJ3A 2RHRA 1X15A 2AR9A 3SYKA 5B7NA 1NF9A 4RY8A 1T9AA 3RJ9A 3IPLA 1ML4A 2G82A 3KWJA 1BE0A 4PZPA 3ZZMA 1XTJA 1O8CA 2FN7A 2P3SA 3PGMA 4EZIA 4YN3A 1GTL1 1BEUB 2NIPA 2XGOA 4O3FA 3EISA 5HIJA 3V8PA 3ZXXA 3HS3A 1BHSA 3W5HA 2L2QA 4WE3A 2ZAYA 4ZCLA 4JI1B 3K70D 2Q41A 3RC8A 3QH4A 1XXHB 3NVDA 1L8XA 4NV3A 3KKKA 5DYIA 2GFIA 5ALXA 2XXBA 3Q15C 3QFCA 4DC1A 1QO0D 1JX6A 1KXJA 2JAUA 5KZMB 4UD2A 1GWNA 2OV3A 5D3KA 4MR8B 2ZS9A 3COVA 2ZDGA 4TV9A 4LECA 2G9RA 2WDZA 4MVWA 5DLYA 4AL4A 4EL5A 4R1TA 2F59A 2FW7A 3AL3A 4X6LA 3ZCXA 1H0RA 3K32A 2O3SA 1Q83A 2VP4A 4FYJA 1BYIA 2FZEA 2O14A 5DM1A 3MCZA 1THZA 4XWAA 2BTEA 2GN2A 5DSXA 5J4KA 3JAWB 5KTMA 4CEIB 4AD8A 4WKNA 1SXJD 5F9MA 4EELA 3QWIA 1YAJA 3VI3B 1VI2A 3IKVA 3IAM1 2WJ3A 3KKNA 4OJYA 1A1VA 4TQAA 3TJZA 2X0FA 4JEHA 2FFJA 3HR8A 1MABB 4DDUA 5K8VA 3TI7A 1GGEA 3LCRA 1KEEB 1GSAA 1T9HA 3ESQA 4CLDA 5INTA 1JPNA 4UAGA 5J2UB 5FUXA 2PD6A 4FGWA 5JAOA 2BC9A 1Q0SA 3U16A 4L95C 3GMTA 1S2IA 3OHMA 1UBRS 3H6HA 4WY5A 1IN7A 5FTJA 1VLQA 3GZ4A 3RHZA 4F4IA 1KDOA 5LP1A 4Q3NA 1H3EA 1X8KA 3GBVA 5EIHA 1P91A 1JPJA 3G9QA 2IS2A 4QHYA 5ELLA 3ZCVA 4EB0A 2HSJA 1T43A 2YICA 2NM0A 3O31A 5J58A 2C88A 3GGCA 4PZAA 2G9QA 5AKZA 3BGDA 3KIPA 3X1DA 2C2MA 3W5AA 5JI3E 1YJAA 5I01A 3BMNA 4KAAA 2COKA 1NMQA 4IF4A 4RIGA 1S8AA 5JS6A 2CW5A 3LP5A 2VPYA 1GYPA 2R6HA 1V6CA 3NG1A 1NA5A 1KYWA 1SG6A 4Y9UA 1CRPA 2ZB4A 4R2XA 2XMCA 2PKCA 1IHDA 1M75A 1QTIA 2X58A 3KQOA 3TAUA 1HE1C 2WLTA 3SHTA 2FI1A 1XSEA 3AERA 4KNYA 3H5AA 1A4RA 2AN5A 1NE2A 2Z56A 1FDWA 1G8HA 3KJIA 4FMBB 4KQ9A 4OGLA 4UTOA 1IBMB 4PZCA 1T8RA 2ODBA 2WQZA 3SJ7A 5EA2A 1NBMA 3AI2A 3PP8A 4JUFA 5FPHA 2LVBA 1U9IA 1E2PA 1K7XB 2R87A 4Q01A 2DFNA 1NF2A 5EOVA 1E9BA 3E9NA 4M1ZA 3UAXA 4KK4A 1Q7CA 1Y8RA 1U65A 4QREA 1OLXB 5DGXA 2DOKA 3JCZA 1C1DA 2X13A 4G86A 1Z62A 2KLBA 3GI1A 4GKKB 1E5QA 4DM7A 4LRQA 4BNYA 2Z5FA 3L41A 2ZI5A 1UPFA 3K9LA 3HWX1 3E2PA 1UDAA 4L5JA 1FQWA 2BEJA 1RE0A 4NRDA 5KS2A 3RS0A 2W6CX 3KETA 3EVNA 3KZVA 1U11A 1AHPA 3LQFA 1ULUA 4PSUA 2IZOA 1W94A 2QXTA 5DN9A 4HMOA 2FR8C 2ESRA 1F4VA 2FUCA 1RMYA 1T5TA 1ZNXA 4K8RB 4KXMA 5BSVA 5BURA 2GBFA 3KQUA 2GPBA 4IWXA 4AX4A 2F1RA 3OZSA 5HOEA 2CVPA 2ZREA 3LX6A 1U2QA 4W1RA 3KQNA 4K1LA 9MHTA 5K3FB 2AJBA 2QQFA 4ZO7A 4J03A 3RJ5A 1ID8A 2V6MA 4QEZA 4DBVO 5HF6A 1XZ8A 4Q1CA 3PPIA 4BE4A 1WCIA 4LOIA 3P9RA 5CIWA 5K3CA 5L4LA 1X94A 4O8CA 1JPUA 1U1DA 1KAMA 3WYAA 3I5XA 4LKRA 2F7SA 4I19A 2WILA 4C0SA 1PD1A 5H68A 1ABFA 4AP6A 1M6WA 3EMVA 3VISA 1JKMA 1GZUA 4JVSB 2CNOA 4FYKA 4ZO9A 4B81A 4ZAFA 1B26A 4J75A 1UMDA 2AR0A 2XHZA 4C5AA 5T6MA 3ZXUB 8ATCA 2QTZA 3BMQB 1QS0A 3G1WA 3LBIA 1LY1A 3MILA 4KPFC 4BGVA 3ZE2B 3Q3VA 4W4TA 1NWCA 1R0RE 1DG1G 4O4IF 1S8NA 3F1KA 4TXHA 1C7QA 3NV9A 4UXJA 1IN4A 1FU8A 1N2CA 3PS9A 2GEKA 1NXTA 2XUKA 3NOOA 4IFTA 4IV0A 4ZV9A 3V2UA 2CF6A 4EY8A 2QN3A 5L51A 2LPMA 2WAOA 1I4LD 3ONVA 4GUAA 4S24A 4WJZA 5CFRA 4HQNA 3UAYA 3FSRA 2QGFA 1SCKA 3RIXA 2C9YA 1MX5A 1WKBA 3FFTA 2FRDA 3LHSA 3BWEA 4RFSA 3TQRA 4XUGB 2B8JA 1T2CA 3PQ3A 4Q3DA 1GQOA 2V45A 2FGJA 2YS6A 1M6VB 3B38A 5EIFA 5H9VA 1BD4A 3TZCA 3UK2A 4YPOA 3NTOA 5GV8A 1JRLA 4U2BA 3BXZA 1L1QA 3F7TA 3NR2A 4H4CA 5KDLA 4LWOA 5C8YB 5TT1A 2VFAA 5HUQA 3BWVA 3F3MA 1V6SA 4UU1A 1WV0A 1P60A 4GKJB 2IPAB 4MR8A 4B79A 2PGXA 3T7SA 1X86B 2QI9C 3AR7A 3D2AA 4JBLA 4XOUA 1AF7A 4MQFB 4F5WA 1LRLA 2BKXA 1Y9JA 2AC7A 1RXIA 2Q2QA 4J7UA 3JQ6A 5F7OA 4N48A 1NW5A 1DX9A 3AO0B 1I5OA 1Y7PA 4L3OA 3EY4A 4JK3A 1OH7A 2VJOA 3WMWA 3HV2A 1FNCA 3JQEA 1RYZA 3R3YA 2BGUA 3VGPA 4DWVA 2FPWA 3G8DA 4MWZA 3Q98A 2ONCA 4C4PA 2HA3A 5FOQA 4X45A 1PEAA 5KVCA 4XWWA 5AP9A 5GPBA 1MABA 1L7AA 4OI4A 3PEFA 1PNVA 3MGCA 5EUMA 1KEEA 1E5LA 1UIMA 1IVNA 4QDOA 5NLLA 3RB8A 1ZVQA 4E7OA 4EYOA 5ECDA 3PSHA 3NGXA 2W6OA 4JOBA 1XQ6A 1IHXA 1O9BA 2NO7A 2O2JA 4GNKA 4QDJA 1E60A 3EPRA 1GPLA 4FTWA 4KFUA 1CK4A 3PXEA 3S8MA 5L40A 2W37A 3A25A 4RSGA 2AJCA 4A2QA 4GEKA 1CUEA 1NRJB 4DUYB 1WMEA 3E84A 3LHKA 3UAVA 1IEWA 1D1TA 2ZSJA 3VC2A 3K1JA 4RKFA 4F60A 1ISFA 1Z0FA 2Q27A 5G4KB 4JI6B 4BL5A 1S2LA 4E2ZA 5EJEA 1PV4A 4L07A 4IY1A 4QQRA 1PF7E 2YDXA 3KG2A 3FW1A 4G07A 2O6HA 1GG2A 1YZLA 3VZDA 4FSXA 3R4CA 4FZ5A 4DMMA 2WI8A 1HLFA 4H6XA 3ET5A 5IK2A 3VX4A 2CXXA 1BDMA 1LWNA 4QA9A 3PNMA 3DDUA 4K9MA 4DCPA 4PBTA 4EBFA 1J07A 2AN9A 5IKPA 4AT1A 1CDZA 1SBCA 3IKMB 4C1BA 3D7SA 3PCXA 4UAJA 2ZTMA 4D9KA 4BQOA 5KQMA 3INRA 4J76A 4B74A 1MB0A 2VRWA 3G2LA 3WL4A 4PZUA 1N0HA 4C6TA 4UHEA 5HFJA 1QB8A 1WHSB 3IB6A 3IUYA 4RLFA 2P62A 5D3MB 2CHGA 4KAJA 2UKDA 3V4LA 4LFAB 5JARA 1AKQA 1HMYA 1BW9B 1C9KA 1N8SA 1H6CA 3KT0A 2PUGA 1VCNA 3W06A 3UFXB 5JBQA 1ZSNA 1OJ7A 2BEVB 1UDXA 1P31A 3OQ1A 3QU7A 1D4AA 4UTNA 4MUFA 4TS9A 1PL8A 3D5QA 3PTAA 4DRZA 1VDZA 2OCBA 1OD6A 2I62A 1P7WA 2QM3A 1DAEA 1B0PA 2GS9A 2JFOA 221PA 2GDJA 2MMCA 3ESDA 4MQ5A 2XADA 4Q82A 4ZP1A 4X6XA 1Z2DA 4QATA 3CFYA 3LDGA 3OEEA 3LWNA 2EWMA 3JZAA 3VOTA 3VR5D 1H2RS 1J8VA 1YTLA 2YCBA 3KUUA 1I2ZA 1DFGA 3NIWA 3EXHA 3W3AA 2YNMC 3AUUA 1G6OA 3AR2A 3IXLA 3N6VA 4RF4A 3RE1A 4DSZA 3IP5A 3AJ8A 5A5VA 2BGGA 1L5QA 5GGXA 1VJ0A 4JT4A 2VNKA 2GHTA 2C3MA 4FOPA 4MHSA 4A73A 2GPTA 1GFIA 2IUFA 4GPEA 2HCBA 2CVHA 1BGWA 2IPMA 1KFCB 3DE2X 4MA5A 4MS4B 4QLOA 1E0JA 1T2EA 3DDWA 3OKFA 4GPTA 2A9QA 3IXQA 1A9YA 4PX9A 2F3SA 3CXUA 4ED9A 1ZM9A 3DD5A 1T24A 5IH3A 1PV1A 2BM1A 2BTQA 4EH1A 4RSHA 3IT1A 1KMQA 3EDMA 4WL0A 2NU6B 4JLNA 1DCMA 1TCBA 2R6JA 3F6YA 3WLNA 2HU5A 1PZEA 3CSUA 3DYBA 3GFBA 5DNCA 4R3UC 3V4FA 1EESA 1MAUA 1QIMA 2ZWMA 4MZXA 5DYWA 5KSOA 2CCGA 3OURA 2XCIA 4XFKA 1EVZA 3H99A 1DAFA 4OP3A 4Z4HA 2WD8A 1W52X 3OIFA 1N2IA 3ZH9B 4CN9A 3T1QA 4ZK2A 3CN9A 2P9CA 1FVHA 4MRAA 5KNBA 2ZAGA 3S5JA 3T34A 3LLUA 4JZYA 2QZ9A 4EIWA 2Y67A 5CVUA 2FKNA 2DMRA 1EXDA 3U19A 1OYWA 2VUUA 2XWBF 1A8QA 3FBWA 1BH2A 4MWOA 3YASA 2BM8A 4AQYB 3EYAA 1RM4A 1P17A 2CJWB 1FMTA 4PAQA 5KDOA 2FW0A 1M6VA 1JDNA 3GLQA 1DWPA 2ZUUA 4TMZA 5ED0A 1IEQA 1Z83A 4BQQA 1AGYA 2E4VA 4XM2A 4YRNA 2OGUA 4XD7D 4MIEA 4ARBA 1USVA 1M2WA 4NBTA 2ZBDA 3DLIA 3FMOB 1NOJA 3DVRX 3H1GA 4IIXA 4KJXA 3M6UA 5FAXA 3IODA 4EF6A 3U5ZB 4D44A 4O4JA 3OWOA 4I6JA 1HDIA 2GM3A 1CVIA 4IBOA 5J2TF 2WVGA 4DREA 3C7TA 5ESDA 4LDPA 5IXYA 3HY3A 5DLDA 4IKPA 4F3TA 1Q5PA 4Z9YA 3G2NA 2RBEA 3IP1A 4C14A 4IYJA 3PDCA 2NYAA 1DXHA 1NOKA 5AW0A 3LPDA 5B3JA 4F6RB 4DARA 1OAOA 4L9AA 1CULC 2JFWA 3U3OA 5C0OE 1FVFA 3UJHA 4MKGA 2OWEA 4AW9A 4CEJA 2PT7A 3TNDA 4Q3EA 2FSFA 4DLLA 1EX9A 1QU3A 2W2MA 4U2KA 4B45A 1YMUA 3TOZA 1KU6A 4JP1A 1USWA 4ZAZA 2HQSA 4MR9B 4KIJA 1QYIA 1XK7A 4PGMA 2GA9A 4GPD1 4A0RA 1TMOA 3SSAA 1ZM4A 1J8MF 1GNLA 1Z8HA 1OGIA 3IQXA 5JS1A 4X94A 2NO1A 4RK7A 2NXEA 3SIXA 1G20B 3RAJA 4E0BA 1V7CA 1XLVA 3G23A 3MAAC 3A05A 3OJXA 1Y4AE 4UM7A 5EAIA 3DT6A 1IN6A 1D2AA 2V7PA 3DE5X 3TLJA 3FCYA 3V7FA 3KDSE 1E4YA 1NQAO 1XCLA 4ZOLF 1L7DA 1L7EA 3PHGA 5G4KA 1Z2CA 2DBQA 2FMTA 3R9WA 1GD1O 3OM0A 2YZNA 3UYKA 2I76A 1BDIA 1T1EA 2QIPA 2A30A 4TMTA 4AF8A 5F3WB 3G9ZA 5AVXA 4JB0A 2KB0A 3JASB 4TM7A 1FP4B 1ZD5A 1HC7A 2EBFX 1IRIA 5B58C 2O59A 1WS6A 2BFBA 3PF8A 2DPHA 4AUNA 1UK9A 4QOJA 1BN7A 5E3IA 4JJ6A 3A1UA 3A9VA 2AI2A 3W79A 4HQOA 4AWAA 9ABPA 2X22A 3TD2A 4B76A 1QV6A 3OETA 2DHDA 3VVBA 1FQKA 4D8UA 2QTWB 5B55A 1A69A 3LT0A 1HDXA 4HGYA 3HRIA 4FMCB 2QLBA 3MFQA 4BNDA 3TL2A 2P1RA 1JKXA 4DLYA 1WHSA 3GMDA 3K6JA 2CVOA 4RABA 2FZ5A 3DMRA 5D3MA 3UJBA 5J2UF 4ADSG 3T7TA 4MB2A 3U0BA 2RH8A 1LPBB 4I0WB 2C00A 2I67A 1WZCA 1X14A 2VJBA 1UPXA 3I2HA 2W0MA 1GT6A 4KLRA 1VMKA 1F7VA 3WJAA 3KT6A 3UFXA 1IXKA 5EJIA 5TVKA 2G80A 2RHHA 3IALA 1HT1E 4FGLA 4BMXA 4EP1A 2OCPA 2FPIB 1SQGA 2C3OA 2I8AA 3E4CA 1PZMA 3JD3A 5EP2A 5F33A 3WB1A 4BC1A 3VNVA 2J0UA 4DA8A 1NQVA 4UBOA 3RVJA 3FOCA 1NUPA 3TN7A 3MLBA 4E21A 4PE5B 1RADA 2UZAA 3A36A 1IMOA 4Q03A 5CXUA 4D9EA 4C7OB 1DKRA 3RYIB 3ZU5A 1P1BA 3TKLA 2QP3A 4IRUB 4OQPA 5EUCA 2AE2A 3GG9A 1GZ4A 5IM4A 4KOEC 4X71A 4AXXA 1U3GA 1ZXXA 3LW8A 4JSTA 3KB1A 1KOGA 3GHYA 4YGYA 5L6LB 4RLHA 1Q0RA 2H07A 4FDAA 3V7NA 1G64A 3CF4A 4JL6A 4G84A 1W1UA 4UTXA 1K7YA 1YB2A 3AXSA 1KP9A 2CXNA 3OCYA 5J4LA 3ZDYB 3T95A 2IE8A 4MS4A 5IMBA 1A2BA 1ICIA 3FSGA 4ZVSA 4YMWA 3RCBA 4M0UA 2WPDD 1PBTA 3LUHA 3PHLA 5FTWA 5J9FA 4BFZA 4C3UA 1E2KA 4Y2PA 4YJ2A 1TW2A 2XUOA 4CM5A 4RD6A 2CYAA 1AQYA 1PHPA 4S05A 3RIYA 1OUMA 1CDOA 3FVVA 2YASA 3HRHA 5JMTA 3H7AA 1IHUA 1JYSA 2O2DA 2ZIVB 1DB3A 3HBAA 4MDYA 2Y05A 1EGVB 1WSDA 1X7ZB 3C7AA 3R76A 4GP9A 3ZPXA 1WULS 1GLNA 1A2KC 3ELBA 4OMDA 1Z0DA 2C2KA 2CLOB 1A9OA 3OIVA 4BTVA 4MLDA 5EJAA 4E5SA 2ZZNA 3N2ZB 3DZIA 1MGPA 1QIJA 1PK9A 5E7IA 3K71B 3NT2A 4NE9A 4IDOA 1E9SA 1NRIA 2G4LA 2PEZA 1Z8DA 5G3YA 1IJBA 1AM4D 1PD0A 1E2MA 3WRXC 3RUIA 4TYPA 3LTEA 5U4QA 2G36A 2IPLA 5IC6A 3FI0A 3GVHA 1MCZA 1IY1A 2OC4A 1QVZA 2QRNA 3CNNA 1CNEA 4MV0A 4NH4A 3K3PA 3NHKA 4LOHA 1KMHA 4OSOA 1DV1A 2CJWA 3IIMA 4NX2A 3BL8A 2DSNA 3D31A 3L6CA 4N7RA 4NR0A 4RZSA 4UTRA 9LDTA 1W46A 2V1XA 4AUEA 3OTGA 2EF1A 4NS1A 3SJBA 1YS2X 4L8GA 2OLJA 1X8XA 1A50B 1FNBA 3ZNNA 2YN4A 3KTOA 5M2QA 2C2ZA 4UCXA 4BFVA 4XX0B 1IRXA 4PV7A 4RZUA 1YBFA 4BO8A 2Q6IA 4QTZA 1TI7A 3W1WA 1T4CB 4NV0A 3LC0A 3ODPA 3THRA 3MT9A 5GINE 4P5PA 1GSHA 2CEKA 1SZPA 1PG5A 2P30A 4YJKA 2ZTHA 1JDTA 1QGDA 2JKVA 3FDZA 3RC7A 1U8CB 2J5BA 1A9ZA 1R9GA 2GXSA 4I50A 2F43B 3FXAA 3GJZA 2IS4A 5FI3A 1VG0B 4XWTA 4X8LA 1GR1A 4V03A 1XA3A 4YPVA 1D03A 3CJRA 1GKKA 2GCOB 2NUTA 5A06A 2D0DA 3CW9A 1QQ6A 2V6IA 1H69A 1TB4A 3TYXA 3LPLA 3OF5A 2SKEA 1V16B 4XVHA 5CK4A 4C88A 1TZKA 2IU6A 1RWPA 5A4KA 2G6BA 5FV4A 4NBSA 1YA6A 3DO5A 4FDMA 3N6RA 5EESA 4X54A 3OEHA 1G20A 1ORHA 3EAFA 3IXMA 1H0SA 1PFWA 3WMFA 2D1QA 5C8YF 3OOYA 1LDEA 2TMKA 3LKZA 5KC9A 1NBEA 1FFAA 2HLNA 4GM0A 4JYPA 3DBOB 1FBTA 3TW8B 1XMOB 1Y4DE 3A14A 1XGKA 2DWPA 4JYAB 2JLWA 5G41A 1NL3A 1YC2A 2JCGA 1YB1A 3KTAA 4YMGA 4AYTA 4KQGA 4US1R 4A82A 3RO7A 3STYA 4EG3A 1UINA 3P0JA 4ZVOA 5TC4A 3GIDA 5BSMA 4GBMA 2I6SA 5EEGA 4A27A 3HVKA 4A16A 1PVVA 2VH2A 4LQCA 4RH0A 3UHFA 1BVHA 2CHUA 4I55B 3VR4A 1PV2A 1WPQA 1SIOA 1WCYA 1TAQA 4PPQA 3SKXA 3TUZC 3OQMA 4JUDX 1SBZA 4TLDA 3BRQA 2CJXA 5A4FS 3THXA 1PSDA 3FOWA 3EEIA 1HQKA 2FKAA 1KY5A 5A0VA 3L1JA 4PFQA 1PZXA 4HVTA 3T99A 3I0NA 3B7PA 4CW7A 1S7CA 3EFBA 4B3DA 3URKA 3OIGA 1A9PA 3VDXA 1V6AA 1KGSA 3A1SA 3ITNA 3M81A 1D2NA 3BKXA 4G89A 4IDQA 2G25A 2O6LA 1UFRA 4BFCA 4ETIA 3WGUA 1PSWA 1B74A 4EG5A 1T0BA 4B46A 4JLBA 1XC7A 3JQ9C 1HEUA 3QVGB 4PRKA 3GFPA 3KEMA 3W90A 3C3CA 2D2VA 3OEYA 3W7BA 1VHJA 2GSDA 3NBYC 2V1UA 1NAIA 4JQSA 4RQAA 4MAMA 4ZOEA 3X1MA 2D5IA 1YHNA 1QRUA 1ZCFA 1LPPA 1SHZA 4A8JA 1UBNA 3OEWA 4WCFB 2IV2X 4Y9TA 4ZPJA 3TD9A 3ZU2A 1KFEB 5JRJA 3RYIA 1IU9A 3OIWA 4C7OA 1M7GA 1VJ1A 3FTEA 1NAHA 5ULLA 1O6BA 5ALJA 1ONOA 2P79A 2REBA 3PENA 3TQIA 2FPGA 4I1SA 4N39A 4XZ3A 1Z2PX 3T3IA 2HJWA 4NCKA 4B5KA 4Q4LA 3BD9A 4WRRA 4DRXB 4F7WA 4D26A 2I1LA 5LDGA 1E79D 1E3QA 1RM3A 2VL7A 3L5OA 3R75A 2C20A 4XRRA 1Z4NA 2FSSA 3EH2A 2WM8A 3C7DB 4XI9A 1XDSA 1CQWA 4Y2HA 5F1YA 5JW6A 3GR6A 4ND4A 3RSSA 2B9VA 4J3JA 4RTQA 2RHLA 4C30A 3FI9A 4YUZA 3H0CA 4IKEA 3RVBA 2YWRA 1XQYA 1BQEA 4IJQA 1THGA 3LWDA 3RRNA 2ICAA 2PXAA 4OJQA 5B4VA 2AMJA 3H13A 3GLSA 4NXNB 4KRXA 4ABYA 5LWHA 1NOIA 2JK0A 4PAGA 4AO7A 3OCXA 2VBFA 3O3MB 4LG1A 5B4UA 3TIGA 2QL9A 4ASUA 1U0FA 3E05A 3PRKE 3OBIA 3UA4A 1PT9A 5MDHA 5IJXA 2MSDB 3WGVA 1K7SN 2TS1A 5IUNC 1KNQA 2PGNA 2XCUA 4MKFA 2XCSB 1K3UB 3LD9A 4I1IA 4BB9A 2BGWA 1DEXA 3SDSA 2JHFA 4K1XA 4PG7A 2DZDA 3DAPA 3GDFA 3IOCA 1RQ7A 5BYBA 2GCGA 4E51A 2ATXA 2PD4A 3HB0A 4ROTA 4IIYA 3T7JA 2ZXFA 2A4KA 2AN1A 3I5AA 5LLDA 1CC1S 3SICE 4H3HB 1KH2A 1PZFA 4RKYA 4BCBA 3S8YA 5IM4F 4FYPA 3P27A 5CGQB 1T15A 1YC5A 4N7JA 2Q46A 3DLTA 5I3CA 5JV5A 2WKPA 3U6KA 1GDHA 4RQUA 5C1OA 2CV2A 2PAFA 1UKVY 5TX7A 2DFVA 3K0KA 4GICA 3FPSA 1C0LA 3MSXA 3J81k 2PT5A 3A6JA 3VKFA 1WMDA 4AMVA 3S3TA 4FB4A 4P4TA 5A1JA 5K20A 3COJA 5IZ4A 1D4FA 2VQ3A 3NONA 4BRZA 3PI6A 2V4UA 1YZGA 3BRCA 4KR0A 3LWZA 4OCZA 3RNLA 4TROA 2QBYA 5CFLA 1UZNA 2RHJA 4DV2B 4G1BA 4AZ0A 2FP4A 1N8NA 1POXA 1T4CA 2IHKA 2QD2A 1DEOA 2X9LA 4JXJA 4M49A 3JV7A 5CT5A 1LFAA 1DCFA 1T1JA 2JCYA 3RUFA 2ODNA 5DSTA 4LDQA 4MW9A 8LDHA 1ZJZA 2VSNA 4TKVB 5D8DA 2YMLA 3C74A 5DULA 2NAPA 4O33A 1XTRA 4MVJI 2DULA 1K6XA 1PNTA 1KDYA 1A96A 2F43A 3CUWA 3MWYW 4EZBA 2WSLA 1YFKA 2Z4RA 2CFRA 1C80A 3PHJA 3EDRA 2PKWA 2XE7A 5K0ZA 4CNBA 2GCOA 2YIVX 2AZ4A 1KVRA 3AR6A 3HKEA 4XDYA 5EUQB 2P0YA 3VSDA 3X44A 2AL7A 2CNWA 3EA4A 4AMUA 4CM6A 2J0SA 1V16A 5AVJA 1JR6A 1NQTA 3FMGA 3M4NA 2F9MA 4YP9A 2YYYA 4YIHA 2JLXA 3DEZA 5FBKA 3LPAA 2B7LA 3OT5A 4XUEA 5KHAA 4CMJA 2XYGA 5CCBA 4UHKA 4QUGA 1Q0TA 1C1XB 3LKBA 1Q3TA 4ZOAA 3VV2A 1U6IA 2PL5A 4X00A 2VYCA 3IAAA 3AY0A 4XVUA 4CT0A 3LHDA 4W63A 4Y0NA 4DYHA 4HGQA 3NVKI 4OQQA 1ZXLA 3TW8A 4R1SA 2C29D 4WVLA 4YRIA 3W6UA 2VTKA 3UBTA 2VPPA 3EARA 4B6RA 2FWNA 4DDKA 1Y34E 3N75A 3ZCSA 1EUYA 4XJTA 3ECCA 2PRIA 4MS3A 3SBOA 1ZUWA 4MI3A 2PUVA 2B4TO 4TMVA 4HVCA 3P96A 4UUPA 3ERCA 2OP0A 4RXTA 2Z6UA 4REOA 3GFGA 4CTKA 3IDZA 4CLEA 5ISMA 3KOXA 4HHEA 3HYLA 4Q3BA 1RYFA 5IYZA 4IAOA 5BWBA 3TLGB 3WSVA 4JITA 1RCTE 2W98A 4LZLA 5DP2A 1KOFA 1AZSC 3BOSA 3QM1A 4DLPA 1NRWA 4LGYA 2RK3A 2A3RA 1LEHA 1V9SA 4FZ3A 3QX9A 4L7QA 1OWMA 1OPRA 1W8DA 1AUQA 4NCIA 3KYDB 1JECA 2A7QA 4U8HA 3LCJA 3TNFA 5LIRA 5J23A 2G83A 3K0CA 3A1VA 3D6FA 1VE6A 4C3VA 3GUZA 3KJQA 4R9NA 4X0EA 4Q6WA 1GA4A 1DUIA 2I65A 3RREA 3AETB 2WJIA 2CKMA 3PICA 3WWYA 5LKRA 1YS7A 4A5OA 1P81A 1ZK3A 4ML3A 1JTFA 4R81A 3D5TA 2LUOA 4A0GA 3IUBA 1UT5A 3B60A 2FSPA 5L7TA 4JC5A 1TD1A 2AHRA 4PZZA 3TRFA 3AY6A 2WOJA 1OWNA 5BUZA 1YKFA 2IV3A 4GQAA 3D4PA 2Z08A 4MGHA 5LP6A 2ALJA 4WCFA 3W05A 1DLJA 4PEVA 1VKZA 4E6EA 3N8DA 1L5HA 4ZMRA 2IZ5A 2UZ3A 1XB2A 2VTBB 4RW0A 1SBNE 5HW0A 1P33A 2GWHA 1ZPDA 3OJEA 1XEXB 2IEYA 4ZAYA 3U3JA 3RIGA 1W4RA 4Z3DA 2W71A 5BQFA 5FD8A 3RABA 2X7XA 4Q9NA 5JOQA 4D6PA 2H1RA 2ZJ3A 2NXJA 4LWPA 1UT6A 3AR4A 4G4GA 3IBTA 4X6UA 1EUZA 1H8EA 5GM2A 4N3AA 2PKXA 2EHJA 3O21A 4FMCF 2V5AA 4BNXA 1UDRA 4Q9AA 3EIFA 3QPBA 2MYPA 1IZ8A 3EXG1 4Y1FA 4HN9A 1P6XA 2Q3MA 4M7WA 1I5RA 3PUIA 2NO4A 4XTRA 2P7IA 2FOLA 1UKEA 2ZG6A 1V39A 2BFAA 4OLJA 4OAOA 5KNDH 1G21B 1UBSB 2ORYA 3NT5A 3D6TB 1YCFA 2JS7A 1LBQA 3IEUA 1Y81A 3DBIA 1KYVA 2ZATA 3H1EA 4XTCS 3M7IA 4GOND 2WWTA 1J0AA 3OY2A 2UVPA 1NKVA 3L9XA 3D1VA 5JCOC 2Q5EA 3ZZ0A 2WQ7A 1EGAA 1RWBA 1EFAA 5LQSA 3N8NA 3WO1A 2HK6A 4YRLA 2DBRA 1G41A 4FQ5A 2NYVA 1J97A 2IZZA 4GLOA 3TO5A 1Y1TA 2AKEA 4JFRA 1LDBA 1YU6A 1I7NA 2A9PA 4C06A 1H5UA 3FYTA 3SC2A 2W70A 3TUJC 3NATA 4DQ0A 3C14C 3GD5A 3D3QA 2XYVA 3UMGA 2NU7A 2PM8A 1BXGA 3K4PA 2ZB2A 3H19A 2IYOA 4RF5A 1Z17A 2V8OA 1YGPA 3DCIA 4JXXA 4DLTA 2H7XA 4DNQA 1DRVA 3FMFA 4DBZA 4X24A 1TM5E 3IILA 4UHCA 3G7UA 4LC1A 3U3ZA 3A32A 1MO3A 3KV1A 4KE7A 4LZWA 3N0VA 4F3NA 5K6AA 2WU0A 2O2EA 4BNHA 3BJMA 3QJGA 4C1NA 2REOA 2WNIA 5AJYA 5CB4B 1Z47A 4DZZA 4RDCA 3T9EA 2Z6QA 3WQBA 1U1IA 5IM5A 2JPDA 4NFYA 4H60A 5J5AA 3WV4A 4AY6A 1MO2A 1U3WA 2Z3ZA 1LD3A 1GPUA 2J33A 3NM4A 3OA2A 3UJDA 4EMTA 1FRVA 3GJ7A 1YOVB 1TEHA 1Y3IA 2H8GA 1EFCA 1W0JD 2VOEA 1PK7A 4PG5A 1J9EA 1VLMA 3OZAA 2KSQA 1LLDA 3QBVA 1R10A 3Q11A 1RJDA 1VPLA 1W59A 3THWB 2PJZA 2XOKA 3AOEA 1I8TA 1ZU4A 3EC2A 4Y1EA 4KR9A 3NI2A 2C0QA 1BSVA 3P2MA 4IV8A 3LPNA 1TD9A 3IT3A 2ZYIA 4KAXA 1KY2A 1UAAA 1HF3A 3EVCA 2ZYUX 1MX9A 5DNYB 4LMPA 5IJ0A 1BU5A 2YZKA 5T8KC 3D8NA 1GN9A 4DQDA 2ZPTX 3IBFA 4QASA 1XCMA 2OBBA 1JG4A 4W5JA 4QOHA 4J16C 4NNJA 2Q3HA 4DE5A 1H0KA 3MUEA 3JZDA 5HRAA 3EAGA 4PLFA 1FS5A 1VOTA 2O3UA 2R8RA 5BO5A 1NSFA 2WF6A 2IITA 2XB9A 1X38A 2II6A 4UNSA 2XE8A 2V55B 1UDBA 3ENQA 1QSGA 2XR1A 2VUIB 2MIIA 3OF3A 4M38A 5K0NA 5SY4A 4AAYA 1U1GA 5IJWA 1SKYB 1DO8A 3H2KA 3CE6A 1JE1A 4TV8F 3WLTA 2QN6A 3MRSA 4I08A 4XDZA 3DWEX 4PONA 3P4YA 4MP6A 1P9LA 3GRVA 3WIDA 2E82A 4X63A 3TLKA 1Z0AA 4YPFA 2Q9BA 1W76A 1MT0A 3U40A 3ROGA 2AE1A 1KFBB 2BVNA 3FF4A 4BO6A 2W4QA 1IQ0A 3TAXA 3U4AA 5B7QA 1K63A 5JVDF 3GEIA 1KTIA 4YAKA 4DM3A 4G0ZA 3L1HA 3TLGA 3NPAA 3DBHB 4WFJA 4HWRA 1AKEA 2IC5A 3EXIA 2YWFA 1U0BB 1ZAYA 1CPYA 1GHTA 3D59A 2EEPA 5HF8A 3ISJA 4ND6A 5CNKA 3UAWA 1KDPA 4HS4A 3KYDA 3TDKA 1RRFA 3ZHQA 2VH1A 4M7OA 4MP3A 4R68A 1L4EA 2KWIA 3ZGYA 1T26A 3GEMA 1RLOA 2R86A 4MCHA 2JB9A 4CE6A 5IJ9A 4LC9A 5ECGC 3AETA 3AZQA 1M2NA 5BWCA 3TB6A 1SA0B 3NHJA 4M89A 1ZJ6A 4B2PA 3B6EA 2XCRB 4R8KA 5JSZB 3IPRA 4IFBA 4QUHA 3T3OA 1A5AB 3OP4A 4NC9A 4U2GA 1XLTC 3M6WA 3WNCA 4CV1A 3DXYA 1PEDA 1W2HA 4D7AA 2UUCB 5C34B 4KEAA 5SZHB 1GILA 2RAFA 1BA2A 5K4AA 5ADVA 3DMYA 5BN5A 1EVIA 5LYJF 1Z4KA 4NTZA 1JB1A 1U94A 2ZJOA 1WEKA 5ALIA 3PIDA 2BFFB 3L0CA 3OAAD 4LDAA 4EHLA 2VTBA 3LG2A 1ZQ9A 4YJFB 2OHIA 1VMAA 5BNIA 3DAFA 2DFKB 5F2EA 3G8AA 2BZ1A 3J7AC 2Q7XA 1X92A 5F2OA 1E2JA 2WUEA 4I55F 4QFMA 3QE9Y 5FUWA 2Y4OA 3BXPA 4ND3A 4OSEA 4WXRA 2FMXA 1GVHA 3IUQA 4B44A 4L5CA 4KFTA 3GLRA 1YO6A 1G8MA 1J22A 2EL9A 4GIBA 1GSOA 2WYHA 1LWOA 1J21A 1M8KA 4RLSA 2WZBA 1TLLA 2DERA 1OFGA 2YWJA 4BJ6A 4D0GA 4S1WA 4KMSA 1Z34A 3FG9A 4K9LA 4OEHA 1FFBA 5AVQA 4K0KB 3FAKA 3V34A 1Q95A 4NNOA 5DGHA 2P6MA 3L06A 2VDRB 3S2IA 1G21A 4WUVA 5BT8A 1IPFA 1ORVA 4WADA 4CM8B 3IUNA 5A04A 1OMOA 1SCNE 5A6VA 2OB1A 4RIIA 4HR7A 1I2CA 1Z9BA 2F1KA 2FSVC 2HU7A 2O2XA 4PZYA 5ELXA 1JQ5A 1CWUA 3OT4A 3WK5A 2YKGA 1TTHA 1TFUA 1UBGA 3EIEA 2FK8A 1LK7A 4BTEA 2Q5HA 1PS9A 1Y1PA 2PUFA 4OHYA 1XZHA 4Y1RB 3OPXA 3SU8A 3ZGZA 3C8HA 1M34A 1L1FA 3F8WA 3DTVB 3EZYA 4BNVA 1NNSA 1T2UA 5BXYA 4R8LA 3VU8A 3PJEA 2KW5A 1RFLA 2OYSA 2F00A 2P2SA 4L4UA 4E4RA 1LU9A 1VBKA 3LX4A 3VO8A 1MJNA 5HHTA 3O92A 4OYHA 3BJZA 1KEKA 5C8DA 1AUPA 1FMFA 4MJLA 1U6KA 2DTXA 4M86A 4HQ6A 4HAOA 1O89A 1MIHA 5BV8A 2A92A 1IONA 5DE3A 3DCNA 4AWBA 3WGTA 1ZMTA 4ON9A 1CRWG 3NHFA 2FWMX 3AEZA 4DUGA 5ICMA 4J91A 4PW0A 1LQUA 1U6JA 5JPDA 2ZBQA 5ETJA 4EG4A 4TSFD 4ZVKA 5DYGA 4J9VA 3TJRA 5FXMA 5JSHA 1ZUNB 1R2QA 2WT8A 1IM2A 2CFSA 2XTMA 3HDQA 3HCPA 3O4VA 1XZPA 1KI8A 2OB2A 4QBTA 4PX3A 1ZJ5A 2BBOA 1LSSA 1ZITA 4LNUB 4DEVA 4QG3A 2JHAA 5MN5A 3PYXA 4M0LA 4P0TA 3OTWA 3R7WB 2I71A 1KDRA 4CTMA 4QKQA 3THWA 2PDAA 1QQ7A 1K66A 3EY9A 3WTBA 4GRAA 1A0OA 2JLSA 1WCXA 2C0PA 1ORTA 5TXGA 4UUOA 2BIFA 3D2BA 3IUJA 5DIFA 3DVAA 3Q8XB 4IR7A 4YHBA 3LYHA 1GFWA 1R00A 6ADHA 1VHLA 5CG2A 1U3FA 2FEPA 5E2AA 5A9RA 3DQPA 4FYMA 4C7XA 1NR7A 4DIOA 1HORA 2WTAA 2PU5A 4MRRA 4CEHB 1Z38A 2FFRA 2IX9A 2NVUB 2E2WA 3LGAA 1UKYA 3JALB 1IZ7A 1R8JA 2H54A 2JJMA 1C4WA 4YRCA 5JSQA 3AVTA 3MGKA 1V3TA 2CZCA 3M5DA 4HQRA 5AKIA 1CETA 1EIZA 1UPCA 4JAVC 2GI4A 2G7ZA 4QHTA 4RXMA 1EQAA 4WA8A 4OJNA 5FADA 1HYQA 4YRPA 4U9IS 3L49A 2I3AA 4MUMA 1JE0A 4R5HA 2FUEA 2WA2A 1US8B 2ISQA 5HTKA 2HD4A 1USUA 4D1YA 5KJFA 3KEGA 2Z8YM 5FYDA 1TTPB 1WXHA 4HNAB 2CEAA 1KEUA 4LTMA 1CUDA 5HDQA 2ZSKA 2PTGA 4ERXA 1C3LA 1JJ7A 1D2RA 4DGQA 4PYLA 4WZBA 3HKDB 4AO8A 3B1JA 2JLUA 3M9WA 3ESBA 5JS8A 1WWKA 1ZMRA 4LHWA 2R3SA 4MA0A 4OU5A 4OLHA 5FL7D 2PFGA 1NI4B 4MA4A 1VPEA 1XMSA 4FDUA 4JLKA 2IYXA 4WBXC 3WNZA 4BNNA 5GVSA 2ZRIA 1RZUA 5B6IA 5LZ9A 1BEZA 5D5QA 4BHTA 1QGAA 1S96A 3PD0A 4E33A 2R00C 3DUFB 5EHQA 5BPHA 2C2OA 2CLFB 2PUWA 1VP3A 1RRVA 2V0CA 1SA0A 3OD1A 4FMPA 4WCDA 5DN6A 3AOGA 3GHHA 5JSZA 2YJNA 4TXNA 3A1WA 4DQKA 3N86A 5CDUA 3WWCA 4G9GA 2CHEA 5B64A 1VGQA 1L5ZA 2G63A 4LBVA 5A4DA 1XZEA 1NI5A 3ABZA 5AM3A 4BATA 1VL5A 2IOQA 3RBZA 2NUBA 4J7XA 1WDLA 4KAFA 5HGJA 3GJ4A 2BFFA 3ZDCA 1NBOA 3WIEA 4C0BA 2G1AA 1SXJB 2FV8A 3KAKA 1XU7A 4QC2A 4TLCA 2J9XB 1P7VA 1SWVA 2YR0A 1EB8A 1SHKA 1UC8A 1QF9A 4ND7A 4D8TA 1AQJA 4FR5A 3HN6A 4EO9A 2C54A 2ZM6B 1GZSA 2BZSA 3NT4A 2Y8EA 2IW1A 1CIJA 4OL9A 5KOHA 2RH5A 3RRYA 3WYFA 4CL3A 1DCTA 1UBLS 3K1ZA 4UNNA 1J2EA 2QPLA 1OKKD 3IJEB 5KWEA 3BGOS 3CRW1 2A8YA 4IO1A 2SBTA 2LR0A 3J7TA 1TF5A 3AHGA 1U9JA 4J4TA 1MIOB 3MLEA 1YQ9A 3G0HA 3EFHA 4L73A 4QWWA 1OFVA 1NQ5A 1YB5A 1BE8A 4B3RB 3NBKA 3BE6A 1X77A 3Q41A 3EZ7A 1T2VA 1QWSA 2O2GA 4QE3A 3ZGNA 2F3UA 4CUJA 1F2UB 3VZPA 3TW6A 2QYTA 1W5SA 3NAGA 2O2ZA 3SQOA 5HM8A 3EMDA 4Y1RA 3DBRA 3BFXA 1MOZA 5H4HA 1HI9A 4MUYA 5IMSA 2IKSA 2YYZA 1OX5A 3WLJA 1ADCA 1PGNA 2IEZA 5EQFA 4UCWA 3ZTYA 5C53B 5EP1A 2JGRA 1SEPA 3DTVA 3KVYA 3TTTA 5CDGA 3ZHXA 4C5CA 4DYDA 5KNDA 1F6WA 3R23A 4FDLA 1FYVA 2CB0A 2LKDA 4H7DA 1YS9A 1KKUA 1IQRA 3DW1X 1R66A 2ZGVA 3R7FA 3CO0S 3VPCA 1T2DA 3F73A 3ASUA 1CNFA 1A4UA 1T5LA 3AL0C 3AVYA 2C5LA 4RTMA 3EFEA 1GZVA 4GZ3A 4ZQHA 3VYWA 3W5BA 3UOGA 5EKXA 3DT9A 2C9ZA 4J43A 4PR3A 4RACA 2OAP1 2HU2A 3GG2A 2NPIA 4GPBA 5DHQA 5TB5A 1JDPA 3M82A 1RKQA 4IDAA 2EW2A 1Q21A 2FPLA 4F86A 4ZAXA 4TTRA 4CKZA 2Q2OA 3E35A 1VBFA 2ETXA 1WLSA 2EG9A 5DX8A 3L04A 3LUAA 1MB4A 1E96A 2AQKA 1N2HA 1SBQA 4LMAA 4NAUA 5HUJA 3FYCA 4IHAA 2BZGA 1WW2A 1SBIA 2WTNA 5K8CA 3ISVA 3W5CA 3AP1A 4Y18A 1AH2A 5CA1F 3IKTA 1QO7A 2WSYB 4F6LA 1R88A 4WD3A 1QZTA 3VRHA 1UEIA 3HBMA 2LDBA 3KJXA 3HVRA 3WHPA 1N1EA 1CUHA 1BO6A 4RK6A 2EQ5A 2C07A 5EFOA 5TV2A 3WP1B 4LNUA 4JJGA 3WDLA 5T6BA 1FTSA 3NYQA 4YCLA 3BJIC 2W8ZA 4FYYA 3R7WA 3TS1A 2EFEB 1NDUA 1UH5A 2EYQA 1FMLA 3K1AB 4ZDIA 4FFPA 3MT7A 3ZLJA 3N8IA 4HGNA 1LUAA 1ZKMA 3H5TA 4NZMA 1HG0A 1GVNB 1R0WA 3IV7A 1F6BA 4H1HA 1FTYA 1JEEA 1BWRA 3GJSA 1WSWA 2XVAA 3G0BA 4YA6A 2EXXA 1QXSA 3ROTA 1PYDA 2G1KA 4BQNA 6GPBA 5JNUA 2F17A 4FKBA 5KNBD 1QDUA 4PRLA 1ESMA 5EP3A 3DO6A 2NPFA 2ZT5A 3IHKA 1IBLB 3QW2A 4FHEA 4KGDA 4W7IA 4G36A 3BZWA 4FDVA 2GESA 1Y9ZA 1W30A 3UQYS 3WYEA 3QUTA 2NVUA 4CKWB 5BVHB 1JSZA 3P8ZA 2J3IA 1NJGA 3JALA 5DI3A 5CB4F 4IIUA 4QBKA 4NJEB 3CNOA 4Y8VA 3O4JA 4CM9D 2OGTA 4UREA 3O90A 4DR6B 2XUFA 1CY7A 4PLPA 2WDPA 3K09A 4LOKA 1QYWA 1T4BA 1X7WB 5DF1A 1V8PA 3RTAA 3U7QB 1KMIY 3BEDA 3LIPA 1BXKA 4UHJA 4UHDA 3L6UA 3MUNA 3UMFA 4U6NA 1QYVA 4FM9A 1UM9B 4FQ7A 2VT2A 5A7FA 5HJEA 1GUBA 4MP8A 1JSCA 1FDRA 1VPTA 1D5WA 4LDZA 5YASA 1PX0A 4OQLA 4OYRA 1NJ5A 4JL8A 2FQYA 4PRZA 4HXEB 2OD7A 4PLGA 1QV7A 2BI4A 1XL0A 4E5VA 2V0GA 2Z3WA 5DT9A 3PGLA 3I2IA 4OHRA 4WESB 3Q8KA 2CVFA 2JI8A 3NJ4A 1L7NA 1NI4A 3Q5DA 2CD9A 4K9PA 2IP4A 3ZDXB 4YBRA 1YUNA 4OY3A 1CRQA 1GUDA 1ZI8A 3H5RA 1TLTA 3HJAA 1LS6A 2QQEA 1ENOA 3DUFA 2YL2A 5CURA 1FY2A 4EKYA 1N2CE 2NVWA 3DFIA 1U9IC 1R18A 2RIPA 3L1KA 4K7JA 1XD9A 1MKYA 4YCSA 4S1PA 2Y1WA 3C3YA 3ILYA 3SN6A 1GLGA 1QO0A 1Z8NA 4UVHA 5THQA 5H7XA 3FSEA 4U7TB 4TVOA 2WC1A 3WLEA 2E1PA 2ZYDA 2D1YA 3K5PA 5DNAA 1COZA 3JR3A 4PYQA 5IRCD 2P75A 2JHPA 2EIXA 3DHVA 1VLLA 1FL9A 3UMRA 4MWDA 2BEKA 1PDOA 3W8EA 5CNIA 2OFWA 2HA6A 3DOCA 4KYTA 4WXYB 1P5ZB 5HCUA 4WCVA 2FPMA 3Q40A 4JT9A 4JU8A 1SXJA 2G4CA 5E0OA 1Q15A 4QUAA 1BJRE 3FTFA 2JGMA 3REOA 3HCFA 3M6AA 1XPUA 1GR0A 2I2XB 5CLLA 4DPKA 4L6AA 4TKLA 1X7HA 1M10A 1B1CA 1W4ZA 3CHYA 1U0OC 3N2EA 1RM0A 2ADFA 1RW4A 2XDYA 2HWUA 2VXBA 2YH2A 4MYRA 1K88A 1KFKB 3ESAA 5DHSA 3OQVA 1XRPA 2VN8A 5ARCA 1Z4PX 4NQZA 1X1CA 3PXGA 4F4UA 3QA9A 1P4HA 3K8ZA 5LR6A 2ZUVA 5AMXA 1MIOA 5B36A 5FBRB 4II2A 4BMDA 4KFSA 5ED4A 2R7MA 4W6QA 2R62A 5F1PA 2ZZMA 2OHJA 1R5JA 1ZGAA 2QYOA 3K9NA 3AEXA 4LRTB 3V9AA 1UF9A 2BF7A 2H16A 2WV9A 3ASVA 5KWVA 1XKQA 1BFUA 4IWNA 5TT0A 3C8ZA 1KO8A 1KOJA 4B09A 3E70C 5AVZA 1TL7C 4NBRA 3LZ6A 2CL6X 4NK5A 3VKUA 2CUTA 1YK1A 2WJPA 4BJHB 1KI1A 1S9DA 1GTMA 1HDZA 3BFKA 3GA7A 4KI7A 5CFZA 3HM2A 2ZXEA 3IGFA 2OVBA 5HZHA 1UK6A 2CFCA 2EP8A 2FP3A 1IUKA 1LPOA 4I9UA 4EPRA 1V1RB 4EJSA 4ER5A 5TF4A 3UCEA 3PLNA 1XZDA 2FJPA 4AJEA 5DX0A 2BGTA 4U39A 4ZVRA 4HAIA 2VJMB 5L3VA 4TMKA 5ALEA 2C4VA 4R3NA 2K2WA 1R0ZA 2FW6A 2W8BA 3IVCA 2Q1XA 1AC5A 1UBMS 3EGDB 3N53A 3PEVA 4X1IA 4L16A 3O2QB 2FRDC 2O1SA 4PQGA 3QE0A 1HDEA 3BK1A 2P9JA 1M2KA 2RBGA 3TF5A 1U2TA 1XL1A 2ZYSA 3ISTA 4KG7A 3O4RA 2H4ZA 3RVLA 1QPBA 2RJNA 3THOA 5KIAA 3N76A 4HN2A 2QRHA 4HZGA 4MJ3A 4X44A 5I9MA 3RS7A 4F8JA 2CUKA 2VXOA 3ZQKA 5FOTA 3MFYA 4E2FA 2AUTA 3QYJA 2D54A 1Y8QB 5F12A 5LB2A 3TTSA 3ZGVA 3USZA 3AINA 4TL9A 3FWKA 4R5MA 3GBSA 1QBGA 2Q45A 1HDGO 1NP7A 1X7XB 3CBQA 2Q4EA 1U3UA 4RKRA 1JJVA 1MDFA 4X8HA 4ZVPA 3A4MA 2AX4A 4WLFA 4ZI7B 4D74A 3ZGLA 4CWAA 5DTIA 1SKBA 3EPJA 1I33A 3UWOA 1XDGA 3S1SA 3K1AA 5JSFA 1L7VC 2FPSA 4M0PA 2XEXA 2ZYRA 4YDSA 4Q4HA 2EJTA 4XB2A 2WABA 1YIDA 1ZK1A 3FM9A 3L7CA 2WFLB 4OI1A 3UW1A 5IKMA 1W8IA 2GCIA 1YRHA 1DC4A 1JFFB 4LCBA 4DWOA 3B52X 3ENNA 1M2FA 3TUIC 5EZQA 3C16C 4ZVUA 4ZTZB 3GPDG 5T7BA 3KYCA 3VJRA 2DFPA 2OYCA 1J0XO 1GPJA 2AF3C 3EDYA 3GJ3A 3JTEA 2QZPA 3OFKA 1DV2A 5CH5A 4YFYA 2NZYA 4M2LA 1DIRA 4NPAA 4C4OA 4E07A 1UOEA 2EYUA 4LUCA 5HQJA 1I3OA 4KSCA 4EDFA 2XNCA 4JB2A 4ZD6A 2QE6A 5KQGA 1HG1A 4RKQA 1IZYA 1G17A 2IHVA 3AIKA 2QTVA 3D4NA 3LFUA 3N0TA 2MINB 3R44A 4P53A 1MX3A 4U7WA 4CDMA 5JCPA 1K6JA 3ELWA 3W34A 3I6MA 1VL2A 2FEKA 7REQB 3DKIA 3N0RA 3QLUC 5FTMA 3Q87B 3KSAC 2PO7A 4PO9A 5CFOA 1WPXA 3NAZA 3LBAA 2YZGA 2Y76A 3SMVA 1WXXA 3V8VA 4RTLA 2PSHA 1JIQA 1UM9A 2CLEB 3NVAA 4DVJA 4ENTA 3E5RA 5K0SA 4LF9B 3FNQA 3LAWA 5KU1A 3F2IA 2ISSD 3O91A 4FFNA 4G8CA 2HRCA 2C7PA 3T35A 1Q6ZA 4TRNA 4U2DA 2JIQA 2VJNA 1IDN1 3ENZA 2BFCA 4YDRA 2FZ4A 3VPAA 4WESA 2WHXA 4TVBA 5ICSA 1KZ9A 3KU1A 1Y5NA 1PEKE 2Q1UA 2PGJA 5DJ5A 3RF7A 4J0FA 4BN0A 4DMCA 4E11A 4X7RA 3OIYA 1QTQA 3B89A 1UBEA 2FA9A 2VPXA 3EN0A 4F5DA 1UXHA 3SQDA 4LTDA 2LBPA 4XIIA 5A6SB 5J4VA 1MG5A 2Z9CA 1R4MB 3PC8A 2BMFA 4F8EA 3VZQA 4OGKA 1FRNA 1IUNA 2C5AA 4FGJA 1T5HX 4YJHA 5I7SA 4FEEA 2HMAA 4BKMA 4RMGA 2YYAA 1JLRA 4ILKA 4M99A 4B6JA 5FQOA 4UTPA 2A5DA 3L8CA 4AZ3A 1WB6A 4D6XA 1WUYA 4E2YA 3D3EA 1IY8A 1UJ2A 2PJDA 4NU6A 3V4PB 1JDBB 1V4NA 3N9IA 4IMRA 5FLYA 4UHBA 3PXDA 3CUKA 4HZUB 1VGVA 1BROA 2ZULA 2WM9B 1I0IA 1OXUA 1Z5UA 1RKUA 3PNPA 4FW9A 5B1DA 1DADA 2GO1A 5F21A 2ATCA 2IHTA 4QGSA 3E0XA 1QRRA 1EKXA 2NQ8A 1H85A 3ED1A 5AIAA 3EXHC 1BD3A 1MAHA 4KGZA 1G19A 4A91A 2OK7A 1I2BA 3OG9A 3HXQA 4YYZA 2NO9A 1FDOA 2HQBA 3IEXA 4R0NA 5LLTA 5JNTA 2WB4A 4PZLA 1KC1A 2HKIA 2YINC 4MXDA 1ADBA 4BXOB 5EJFA 3FA2A 4F46A 2OM6A 1O87A 1A5SB 3QZUA 3S7ZA 2D59A 5C32A 1VMIA 1RQNA 1QIFA 4D5EA 1DRJA 1M73E 2IX3A 1UP4A 2ILVA 3H42B 2WG2A 4DDVA 3UB4A 1C0PA 1VIYA 1Y7HA 4TS4A 3LUFA 4OXRA 2HGZA 1GG9A 2ASEA 2L69A 4BMPB 1SURA 4RCVA 2PANA 3SFZA 3WGNA 5IANA 4G8DA 3IVAA 1MQSA 2LNDA 3HWSA 2FPRA 4HKTA 3OKPA 1O0BA 1NUHA 1B6GA 1SOVA 2C9CA 4G09A 4U5QA 3WLHA 2NSDA 2PS0A 4OV6B 2ZROA 4QLBA 3HR4A 3QOFA 3CXRA 1VECA 1WR8A 2XT0A 3TRKA 1T8SA 5E0KB 1KO4A 1RPTA 1SU4A 1V1RA 2GEBA 4PLWA 5JNLA 3EEFA 4CZ2A 2OAGA 1WOYA 2JI6A 1BJTA 3C45A 1ULBA 1RABA 3DLBA 2JFBA 3ZQJA 4Q02A 4B3SB 5LOVB 4B48A 2ZJ8A 4OQ4A 3H2BA 4KWCA 3FPHA 2HMSA 5FI0B 1N0WA 1P3Y1 1U4OA 2NO6A 3IMKA 1QQTA 3U4HA 5E1BA 4R2MA 2ONKA 1OY1A 1CJKC 2H59A 1DQZA 3OOSA 2B35A 5DBHX 5EHIA 3HB1A 1DIAA 1QO9A 1G59A 4IZ6A 1NI3A 1SCQA 3BJEA 4JJEA 2GHIA 4A1FA 3CH6A 1EA7A 1X2EA 2HC9A 2J45A 4K9OA 4S1TA 4DUPA 2X0NA 1Q7RA 3H4TA 1Y1SA 1ZXBA 3PR3A 4EMBA 2A33A 5AJWA 5REQA 2G07A 3PNLA 4RIEA 1E7MA 4LHZA 3P32A 4BAUA 1FFXB 3HDTA 3VR5A 1DFHA 4F85A 4JL5A 2QMQA 2QSJA 3UGKA 4D9MA 1ZONA 3TG8A 3WA7A 4ZT2A 3W78A 1PR3A 2HNAA 1OLSB 2P2GA 3R3XA 5AI4A 5LQNA 5AYVA 121PA 1FFCA 3QBEA 1TU4A 3RS3A 5B3JC 1HNXB 1XZFA 4PYRA 1XV5A 1Z2OX 4ND8B 2WFLA 4BLSA 2BLNA 2P3OA 4ZO8A 2WSBA 5B3AA 2E4WA 1KY4A 4RD0A 5IBRA 1VL6A 3E7DA 1NV8A 3DXFA 1VKHA 1V25A 1W0CA 4RVGA 1PR2A 1WTCA 2NPOA 4YMLA 4F56A 3EQ6A 4ZZ0A 2XYPA 3ZLUA 1KYIA 3RR2A 4KQKA 5KYKA 1XTKA 1QG0A 4G0PA 1U02A 3EGVA 2G88A 1Z2NX 2Q5JA 2ZJ6A 3QHPA 2GTHA 4UM5A 1OW3B 4I81A 2DPXA 3H4VA 2BMDA 1XEWX 2MINA