2FW9A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAFRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw9A00
4YCJA 5BORA 5C5DA 1QCZA 4GRDA 2FWPA 5CLIA 4B4KA 2ATEA 2FWJA 4Z7JA 4JA0A 3OOWA 3ORSA 3TRHA 4ZK2A 3KUUA 1U11A 3OPQA 1XMPA 5CTJA 5BOSB 4YCDA 5CVTA 4AY3A 2NSJA 2FW7A 2FW8A 1D7AA 2FW1A 2H31A 1O4VA 5CLJA 4YCCA 5BOSA 5CLHA 5CLFA 4ZMBA 4AY4A 3RGGA 2NSHA 2FW9A 2FWIA 2FW6A 2FWAA 4YCBA 4ZC8A 4ZJYA 2NSLA 2FWBA 3RG8A 2YWXA 3LP6A 5CLGA
chains in the Genus database with same CATH superfamily
2GI4A 3TAHA 5AKXA 4R1SA 2UZ0A 3R41A 1HSOA 3NTOA 4IIGA 4BN0A 1R0BA 1QRTA 3A0RB 1GN9A 1D8TA 3JTEA 4G9GA 5DYNA 3UJCA 2JJMA 2I87A 4QJ5A 1YOBA 5IC5A 1WB5A 3FCEA 3CW2A 3KCQA 3VFDA 4C0BA 4BJ3A 1TZKA 2FX3A 1GJRA 2IOYA 4JI3B 3OZVA 1ZUHA 1EFRD 2BHRA 3EVGA 3PE3A 3Q7IA 4Y6LA 5IYZB 5E6SB 2ZYIA 1W8DA 4KE7A 4UC0A 1BDBA 4QUBA 2PLRA 1VKJA 4ZEVA 1C9JA 2QRLA 4IMPA 5EIXA 4KK3A 1FFBA 1FRZA 1M6VA 3OIGA 2E4VA 1NW3A 3JCZA 1W0KA 5C7LO 4DV0B 4U3JB 3FNBA 4BB5A 2C07A 4MVJA 2ZUFA 3T5BA 1U0OC 1PLLA 3QKWA 2UKDA 4FOLA 2FE1A 2XMGA 5CP8A 3COZA 5D8DA 1USWA 1T2AA 1BE1A 4G1BA 3VU9B 1N0UA 1G20A 1RXVA 1ZR2A 3ILHA 3PHJA 4IO0A 4REOA 3FD8A 4R2IA 1AMUA 2O1XA 4WA8A 1XQYA 5ALGA 5AP9A 2JRCA 1V2GA 1T9DA 1OF1A 1VLMA 2XV1A 1AO3A 2XWQA 2VK1A 3E8XA 3ZJ5A 5CURA 3HQ4O 1W2WB 4RVUA 1NXOA 4HLDA 1C3EA 4GPEA 5E1OA 1PWHA 4UTPA 2COUA 1R66A 3KJHA 3MCUA 3WJ2A 3P0JA 1GDHA 1EM8B 1ONNA 3IPCA 2VHQA 4U8HA 4ZN6A 1J7KA 3VNSA 2VF7A 3NAGA 4GP7A 3DA8A 3GRFA 3IKTA 2IEDA 2JFHA 2I34A 2QN7A 1USGA 3WFIA 4JKYA 1AC5A 4Q3BA 5HIKA 1ZVKA 4DUYB 2C95A 4CCYA 3ROQA 2BEJA 1RJWA 1YVPA 3ZK8A 1XVUA 3P94A 4JU9A 2MJLA 1YU9A 2POQX 4ZD6A 1KDYA 2HJRA 4KP7A 2B7BA 4DRXB 4ENUA 1H2RS 4FQ8A 4U2BA 3ZCPA 5CD9A 2VNJA 4V0QA 2VHZA 2OA0A 3G13A 3INNA 4GWKA 1D2CA 1NNUA 4PSCA 3JTMA 1G21A 2OCIA 4IG4A 4IINA 4HYTA 3ZWVA 2AZTA 2C5LA 3T12A 2VDPB 1IWPB 1WCYA 4F3RA 3HDYA 2ZE7A 2Q50A 4GKAA 5GOTA 2WLSA 4FW8A 3FCCA 5FF9A 4EG1A 5F3RA 3U1BA 4IHJF 4W5JA 3DV0A 5K20A 1QAOA 2R6CA 1P6QA 3TNDA 1F2UB 4PYJA 4W1RA 4IH9A 1IZ7A 4F5ZA 3UB3A 1OA1A 4Q18A 2JLXA 4HB0A 3ANNA 3M3DA 1U3DA 1SXGA 4Y2HA 1IN6A 4K3VA 4EZIA 1T1EA 1YQGA 3HBFA 1E66A 3G68A 4MW9A 3ZV4A 1N34B 1QRRA 5CVCA 5JZ9A 3VNAA 1Q3KA 4JBWA 4UTOA 4YI5A 5EKXA 5GONA 3RS8A 1UT5A 4UNPA 4XYMA 2HA3A 3TX6A 4FTWA 4HQRA 4HQNA 2GZ1A 1UBCA 1R0YA 2V3CC 1GFSA 1MQAA 1QWSA 2VNKA 3Q15C 1Z2EA 4HO1X 4J1QA 1TCUA 3SI7A 5L6LB 6GPBA 3H75A 1Y3FE 1KIAA 5LA6B 1ESZA 1R6DA 5K0EA 2FPIB 2H85A 1BA2A 2E55A 2QSZA 1S2LA 4B31A 3V42A 1IY0A 4M89A 2VWQA 2WJ3A 2CJYA 1LBEA 3L6UA 4PX2A 5IC4A 1R5NA 2CVQA 2VN8A 1EUQA 3N0WA 3F7NA 2R1VB 3LT4A 4OH7A 4BZXA 5C46F 2RGEA 4I50F 1SOAA 4JXXA 4IFEA 3BEDA 3UJDA 2RAPA 1HT3A 4F7DA 1GGMA 2C83A 1Y7LA 2W6MA 4UBKA 1GAWA 2EATA 3ROTA 4RIHA 1U8EA 2J6CA 4D02A 3ADDA 1SXJD 2X15A 4TMKA 1IH8A 4O0MA 4ARIA 4HWOA 1ORDA 5BQXA 3W4KA 3CVJA 4LZLA 1K27A 4OJNA 2VHXA 5FA8A 1FYDA 2HBYA 4O1IA 2P9QA 2ZUSA 1ODCA 1ORRA 5JQGA 4PEVA 4B35A 3UPUA 1NF8A 1GPJA 3GUVA 3LYUA 2KBEA 3CBGA 4AVYA 4DL9A 1OZFA 1WMAA 2CGEA 2ZXEA 1PRYA 1Z38A 4PHTA 3NHSA 2IYWA 5ER6A 4N3AA 4JJFA 1KZ1A 1SVOA 4BQNA 1JDPA 2B8TA 1VBKA 2H4XA 2CDRA 5DCWA 1PI3A 4E6PA 3IP5A 4DLUA 1X7YB 1XALA 4MINA 5IFKA 2MDTA 3CZ4A 5ADUS 3AGPA 2YASA 3OCVA 1FVFA 1FYXA 2FSSA 4AL4A 3GPBA 2B20A 4AS3A 1Z4LA 4XPIB 4M1OA 2XE7A 1DAIA 3CZRA 5BXQC 3JPWA 3DVRX 5JZOA 4Q4JA 1IXZA 2O7RA 3QPAA 1XMXA 4WUTA 4P5DA 3KYCA 4JGGA 4EATA 1EVEA 1A82A 3U4AA 4Y6OA 1JB9A 3G9XA 3JASB 4RSGA 1E8MA 1UMDA 3AHDA 3W2HA 1MB0A 2F3QA 2GSDA 3SIPA 4CMJA 3DKKA 3EULA 1RRVA 1O5TA 2YOHA 3RK4A 1UKAA 2JFXA 1U6IA 2VI5A 3RRYA 3UQZA 3FTEA 5EHNA 3QVXA 1XELA 2V5AA 1CEEA 2HLHA 3M33A 4HRYA 3U48A 2J9RA 2AD1A 3ZEAA 1OAAA 4JQOA 1XNGA 4UHEA 3ZGZA 4UUQA 5A3SA 5FHRA 1XRNA 2DX7A 1DRVA 2D1YA 3MK31 2GCPA 3KQMA 5B2FA 2QRHA 4JP1A 5KNBA 2BR3A 1XTJA 4S1WA 3FZQA 4RJKA 4WNAA 4X20A 5CNKA 1AUOA 2OCGA 2R7NA 1G64A 2WSBA 1H5QA 5P8WA 4FKMA 3A0UA 1I2BA 4XYBA 4B6GA 3ZZNA 3JATA 2WM2A 4JR0A 1WMBA 5FOQA 2ZM5A 1EK2A 3PQ4A 1CDDA 4AKHA 2O4CA 2NXCA 3K20A 5BWBA 1FLAA 1YDMA 3HC7A 4JUCA 3MINA 4LKOA 1ZVJA 4N4AA 3V34A 4EAQA 1F17A 3V7WA 2IPMA 2KB0A 2ZANA 4FNAA 4QU9A 4KITB 2ZSIA 4OMCA 3SMVA 4E70A 1HDIA 4F92B 1H66A 1PG0A 3WGTA 2I4NA 1NKSA 1EXDA 5BWMA 2QX9A 4XDYA 3SHTA 2O59A 4NAUA 3FPEA 3RD5A 4I6GA 1KR2A 1LRLA 2HRBA 1T5LA 3PEVA 4LY0A 2CL5A 4HNQA 3SBEA 3UK7A 2PXAA 5AVYA 2QRMA 4FONA 4LVNA 1D0SA 1UIRA 4WCFA 3KLBA 1FUYB 3G59A 1J0XO 1U8XX 1PDWA 3IBSA 5EUCA 2Q6KA 5KX5B 1ATIA 3VSCA 3EH2A 3SAJA 2A5FA 1VKNA 5AWFC 4IUYA 5HRAA 1DTWB 4NRDA 1D2MA 2OLKA 2P9YA 3KDPA 2CFCA 3TOXA 1XPOA 1L7VC 2FWJA 4YUWA 5C1OA 4IQFA 2WF7A 4ZVLA 3RASA 3AI3A 1YC5A 1VE6A 1LX7A 1YAJA 4RPLA 5PGMA 4D8TA 1K89A 1E98A 5ITZB 4JGIA 4NNJA 1K97A 2PRKA 2G4LA 4W6ZA 1IY8A 1OZHA 2BUBA 4MA4A 4LJ9A 1KY3A 1A88A 1VGQA 1U0HC 2HU8A 2PZEA 4W5QA 2DXIA 1QHIA 2I3AA 3CVWA 3E22A 4O6VA 2JVJA 3NTVA 3I42A 4X92A 1QPBA 5MN4A 2NN3C 4TZ6A 3BYZA 4KC0A 3I4CA 1KDRA 4JMLA 1ZG3A 3KC2A 1ZOPA 2IPNA 1CUWA 2RJ3A 3MBKA 2XIJA 3EVZA 2I22A 3WGGA 2KHZA 2XTNA 1A98A 2FLKA 3E9EA 4UAGA 3URKA 3EPKA 3NAZA 1M6WA 5CXUA 3COPA 5ALRA 1EDDA 2PT6A 2IPOA 3KVYA 1FNDA 2FU5C 2H9YA 4XGKA 3ROZA 1DAPA 1UKBA 3ADPA 5AVKA 4QU0A 5KOJA 3AFIA 4YMGA 3U5ZB 1ORTA 1O58A 4R2LA 4JD5A 4GX5A 1II9A 2AKEA 4BVBA 2XCOA 1VJ5A 1CJVC 2PL3A 4FMCB 5HYVA 5AKZA 1JBKA 4EUKA 2BMVA 1S2GA 3T1TA 3PKJA 1ENOA 1QX4A 2OESA 3P2KA 4LS3A 3DZDA 4I4LA 4JBYA 1YB2A 4P81A 2DEUA 3IGFA 1J9ZA 3K4PA 2YWFA 2GZ3A 4Y9SA 2CLLB 3VO1A 2HRRA 3HYSA 1R8SA 1KE1A 4AJPA 4KJXA 1QO7A 1E2EA 1O97C 4B8YA 4IJWA 3H18A 4C6HA 1YBVA 2ZKIA 2P11A 1YWGO 1FTGA 3C70A 4N01A 4N49A 4Z9BA 4ZFNA 2G6TA 8GPBA 5KHLB 1H2ZA 2Z2KA 3ROFA 4E0BA 1AZWA 3U7QA 5C4GB 4HLUC 1U0BB 1EWQA 2UUAB 2VAWA 3PXXA 4NYMQ 1BXGA 2HCRA 5CEFA 1JTFA 2PSDA 1M8FA 2CT8A 1V5GA 3JD2A 3ICVA 2RBGA 4WKOA 2AUNA 2E87A 3X43A 3ZK9A 3O8DA 5H83A 2GUWA 3TD2A 4OX9Y 1Z2DA 1XCMA 2GBCA 3AUXA 4OL9A 1L7AA 1JWAB 1V1MB 5AI6A 1EX1A 3C8DA 4K9RA 5FB3A 5HCIA 3D0QA 3I73A 4DXAA 4DDTA 1ILWA 3AEQB 1RAEA 2A9QA 2PFKA 4PQFA 1RE0A 4UBJA 4CDNA 4ZZ0A 3DR5A 1VFPA 3BXEA 5BSRA 4BJ5A 2FW0A 3H83A 1K6JA 2BTQB 4RM3A 1XZJA 1JMKC 1GQSA 1R4MA 1XTRA 1JG6A 1W2HA 3PJEA 1YS6A 4YP1A 2NU6A 2D2XA 3AU9A 2CE7A 2JJYA 4EL5A 2BMAA 4K26A 2JGIA 3SF0A 3WZ2A 4NPHA 3PKIA 3UB2A 4ZXFA 2BUAA 2CBGA 4MYHA 1M2EA 4X41A 5EMKA 4FWIB 2ZDGA 3V4SA 4AG6A 3P9PA 4F56A 1PFGA 3DAFA 2O14A 2HHAA 1G18A 1KY2A 1D0VA 2R60A 1GUDA 2WEKA 2I29A 2HPAA 3A3OA 3IUJA 3E3NA 4MRVA 3D3WB 3LKBA 3LUDA 2VDWA 2C0PA 3UO8B 3S7TA 2ZITA 3EBPA 4C0JA 1L4NA 1SIWA 1RCTE 4G4JA 3U2QA 2YHBA 1SXQA 1OPXA 4GX0A 3DJFA 1MNQA 5DISB 1FSGA 3NKVA 1CF9A 4PG8A 3L6CA 3EQ2A 2V3VA 3VSAA 5A2QA 4PINA 4DJJA 2HU2A 5FH9A 4QDUA 2XKBA 1TCCA 3EDYA 1NSTA 2EKQA 4RYLA 4UREA 4AJ1A 1CCWA 3QX3A 5BSUA 3E53A 1MX1A 4XLTA 1TZCA 3AJ8A 4PO8A 1VKZA 1GAEO 1ZJ6A 4RCYA 2VCYA 2WFZA 4EGFA 1C0EA 2G1PA 4HH1A 1ZN2A 4E3WA 3C1OA 5C35A 3D5QA 2QZ4A 3A4VA 4O5OA 3S2FA 1GXSA 4TMXA 4XVUA 1F4VA 1KDOA 5LUAA 4R69A 3K5IA 3L8CA 2WF5A 5BYJA 1QGAA 2IRWA 1T1IA 3TQSA 3A6ZA 4E11A 3QU5A 4R1LA 1JYSA 1SVLA 2QMUA 3KRTA 1FNBA 2J0EA 4CEHA 3F9IA 2C5FA 2DBYA 4CM9D 5HKAA 1O96A 4Z7QB 5CFOA 1U3WA 4F84A 3HSKA 3G88A 4CIWA 2QY9A 4JL8A 2EX4A 2DR2A 1FXWF 4F5WA 3N28A 3PI6A 3CT4A 4Q12A 3S5JA 5K0JA 3CGGA 1HLFA 2ES4A 3NIGB 1X6VA 4ND8A 4MKZA 4XKJA 3P27A 1BG6A 1IN4A 1U1FA 2P6UA 4GYWA 1E1YA 4KODA 4WXMA 2BFPA 2HKIA 3ZE9A 3B13B 2AMYA 2GYUA 4M9UA 5F77A 5EKSA 1RWMA 2C7VA 3I30X 3WKEA 1FP2A 4GC5A 1AK9A 2GYYA 2M2IA 1RQPA 1VLJA 3B3JA 3W5JA 3T3DA 2NVWA 4CMIA 1YA4A 5ILQA 3H3JA 3QTTA 2EW1A 2FR8C 1L8AA 3RIYA 4YRGA 1W0KD 4TGLA 1LBQA 1E1DA 3H1AA 1GU1A 4HDOB 4ME6A 2GXUA 1FRVA 2R7AA 3R6WA 4OMDA 1X80A 3W2TA 1X86B 2CK3A 3CKLA 1Z06A 4ONEA 1LTHR 1LTKA 4HN9A 1MO2A 1V1JA 1SZPA 4TV8B 4B6QA 1UK6A 4YFVA 1F2UA 2ZBUA 5H5JA 4CIXA 4QDTA 4U0KA 1M2NA 2WIJA 1XA4A 1H9BA 5LCXA 4QJ3A 4L8LA 4RL4A 1KI9A 2IYYA 1L3BA 3WIOA 2VP2A 5I4KA 5HQ3B 1U3TA 1JHDA 4DSNA 4WKPA 3T15A 5F7XA 4JZKA 1VPTA 1AGYA 4NVRA 4R9VA 1R1DA 1ZGJA 4NOJA 3IOMA 4HS9A 4LFBB 1NVGA 1WUIS 1UMKA 1Q0QA 1YKGA 2G80A 1Z2OX 2WD9A 1AURA 5I9BA 4KR7A 3NHAA 4ARZB 1OXMA 4LHEA 2BJHA 2VXOA 4ZOAA 4OXKA 5J2UB 5HCUA 3IERA 2FPOA 4E30A 2AXEA 4DA0A 1Z22A 4FHGA 1ISJA 5IT4A 4E2ZA 3OFSA 4P7KA 2A92A 1D6SA 2R8RA 4QUEA 3H1EA 1M6YA 2Y67A 4FZ3A 3L07A 4Q7MB 5GJVC 3PQ6A 3X2EA 1GLGA 1C3OA 5GMOA 3WLPA 5BSWA 1D3AA 3C0KA 2FRXA 3DC2A 4MV3A 4DA4A 3LRTA 1G0NA 4OP3A 3ITEA 4AY3A 2C3OA 5LDHA 1UM9B 3A3KA 3QOWA 1DC3A 4PY2A 2R8ZA 3GJ4A 3HGMA 5ALOA 1IL0A 4EO4A 4IOKA 1ESEA 3LPCA 4KSYA 3RYHB 1KQOA 2I3BA 4J7XA 2VDKB 4PSVA 1WX1A 3BRSA 1T8UA 2VUIB 3RS4A 1YR7A 3E9RA 1MG5A 2OGTA 3R5HA 4WASA 1TXGA 5ARBA 5CJJA 3SJ7A 3AL3A 3DHEA 4K6FA 1UJ5A 4JJEA 2WD8A 4MAAA 3F4LA 2YWGA 4LAFA 3CUVA 3PE6A 4LX0A 4DGSA 4GKJB 3B7GA 3NGMA 5IWAB 2BP7B 2P2ZA 2VSFA 2WHEA 3NHMA 4X1KA 3ZHYA 4BQFA 3KJFA 3IAM1 1G8SA 4IVRA 2I4MA 2LP4Y 3PIIA 4ZCMA 3ZIAA 4ARVA 3PNLA 1L1EA 2ZVDA 1XZBA 1MQSA 2WT8A 3TGPA 3L05A 2IHKA 1EUDA 3F74A 5H70A 4MZXA 3U0BA 1KMHB 4W5WA 1XRQA 4ZQHA 4K9DA 3G7NA 4XJXA 1NBWB 3OCYA 1JEEA 3NUQA 4GLJA 1WLYA 1CDOA 2A33A 2GUGA 2VUHB 3JQGA 3TZLA 1U5CA 2NTYC 2IOFA 2BTQA 2O5CA 1SRQA 4XLLA 1T0IA 2X40A 1MO3A 2LPMA 3BXHA 3TL3A 4G9EA 2QTMA 4M60A 3CFYA 1PL7A 1EG2A 2VS1A 4NV1A 3JYPA 2EJTA 2FQQA 4KN9S 2QN9A 4N5MA 3B8HA 3HV0A 2ZRCA 4FMBB 3DV0B 1YE8A 1PFVA 3CIFA 3HYRA 5FLYA 1QRSA 4BWVA 4R2HA 4C4PA 2ORVA 4C3VA 1Z6GA 1OMOA 3NDIA 3T3OA 4RIEA 3HKDB 1AN0A 1NC1A 2JIZD 2G9UA 3R9XB 5CMLA 3FHJA 3FGZA 5E38A 5EZQA 5IAGA 1ECBA 4OMFG 4EHFA 4MQUA 1Q83A 3KT8A 4KUGA 5FBHA 4BRUA 4FILA 2BTEA 2G76A 2REQB 5GINE 1U3UA 3MZ0A 1L6RA 1N2IA 4H3VA 4RD4A 2FXVA 4UNIA 3EBLA 1IZ0A 5EJ4A 1FS6A 2WTMA 3O31A 3WDLA 3D6MA 3G7UA 4HVCA 1VL2A 4DR7B 3IDFA 2VZ9A 3PBKA 4RSRA 5DWDA 4B5KA 2R48A 3H8VA 1A96A 3H84A 4CIVA 4ZP1A 1VSQA 4HNGA 3GLFB 1DAKA 1VJTA 1GZVA 2GFHA 3AJEA 3H0KA 5HQ3A 1HG1A 2AE1A 3UJHA 4OI0A 4P36A 1NX6A 2H16A 1K3UB 4CT5A 1NP3A 2BAGA 2LRHA 2K87A 2W8ZA 4AO7A 5AI8A 1KO5A 4HADA 2P9HA 1YR1A 3VYUB 4PZ0A 1KEZA 3GB9A 1IQUA 4QFBA 2OAQ1 2JGMA 4E7PA 4HQFA 2AFIE 1C4OA 1GRNA 3G49A 3RFVA 3RYFA 4MWDA 4QBGB 4BNYA 3NBAA 1YDWA 1EJ6A 2YN4A 2FDRA 1OGIA 1VPEA 3WL8A 5JHGB 4W7HA 1ZHOA 5AOBA 4H7JA 4N7MA 2IIPA 1Z4QA 2VZEA 3MGKA 4K88A 3ID6C 1K8QA 3IMFA 4UCFA 3FOEC 1ZH2A 1T2FA 1EWRA 1JYEA 1TF2A 2EIHA 3BC1A 1IHPA 2WQ7A 2B1GA 4BGDA 4AN1A 1UJBA 3PSAA 4H27A 3W7VA 1OH7A 1P8AA 4EY5A 1FMFA 2UV8A 3L7AA 2DM6A 3RT9A 2H7XA 2UUBB 3WLQA 2O0LA 5EOVA 1Z73A 3GFGA 1JIXA 3IDOA 1KDVA 2DETA 1IY2A 1K88A 1JKMA 3A04A 2HF7A 3ZNNA 5ENVA 4CMKA 3AP1A 5DHRA 4DCMA 4G25A 5IEBA 7REQA 3IAEA 1VHTA 3G8DA 3PL5A 2QT0A 1N5DA 2WSSA 4AMUA 4CKZA 1AKEA 2L17A 3KKEA 5L4LA 4LTDA 1I3NA 5MFPA 1PZXA 2B98A 3OEED 4WJLA 5DV9A 4HAZA 5KNCD 1QONA 2EQ5A 2AR0A 4RW0A 1KHHA 3DPUA 5IJAA 3ZE8A 5HK9A 3TFOA 1YQ9A 1EVYA 4DZTA 1JI0A 1IONA 1SHKA 1DRWA 2D0OB 3LVRE 3NZEA 2Y1GA 4EYGA 3L06A 2YJGA 3TVTA 4DQXA 5BR1A 1DCKA 1TD1A 4TPKA 3F6YA 3VZRA 2HH9A 1UF9A 2MU1A 2WWHA 1H3NA 1KORA 4B45A 3GLGA 3SIRA 4YMTA 2E1PA 2XVZA 3K1YA 4S1OA 4PZZA 2XYHA 2GKOA 4IILA 4GSLA 4X61A 3CSUA 3VR1A 4AP6A 3COYA 5KOYA 2VJMA 4O8CA 5KO2A 3UGTA 5ICGA 3ORQA 4LXIA 3IE1A 3T7CA 1Z7BA 3WKDA 3F96A 2PD3A 4ZT2A 4I55F 3U9TA 4KFTA 4J0GA 4B32A 1R0XA 5ESWA 3MJHA 1WXWA 5A71A 1X70A 5LKAA 4TSFD 5FOXA 5EMNA 2RK4A 1LF5A 2VOEA 2NZJA 3C7DB 1KZ6A 4D82A 3GD7A 1PJTA 1V11A 4NIMA 4Y2GA 4XQCA 3O9VA 3R44A 4GC9A 4MRRA 1IJEA 1TJPB 2GBLA 2F62A 2CNBA 1G0OA 4LGYA 2CXRA 3BMCB 5ES4B 2X0EA 3E5HA 3K35A 2HXSA 4BU0A 1I33A 3GROA 3PL1A 4QNNA 3TMAA 1MT0A 3FIJA 1E1CB 1CS4C 4BMNA 2XUGA 1IHXA 1WXDA 2OKGA 3OPYA 3NHPA 3OPQA 4X62B 2EL9A 3UMYA 1E6MA 5BSFA 4UNQA 2IEGA 3GFRA 3KEOA 4DIBA 3DEYX 1M2GA 4BYMA 4N8SA 4U3JA 2OWDA 3HCOA 2HYIC 3EZYA 4TOIA 3KOZA 4DLKA 2WOJA 2ZBDA 4AO8A 4QM6A 4WZ6A 6REQB 1FQKA 1GAXA 4NENA 2Y8EA 3ESDA 4P4TA 4B85A 3SWWA 3CURA 4ZTBA 3OICA 4GPD1 4ND6A 1XRSB 1G6Q1 4BYGA 1AQYA 2UYYA 1PJAA 2VLIA 2O0KA 2NV6A 5EP1A 1R64A 1J0AA 4IDNA 5T67A 3DT8A 1PV2A 1VLLA 3DBHB 1H65A 5K0BA 3N1UA 4K9OA 1VIDA 1S89A 1SUCA 4OI2A 4CW7A 3ZWNA 2EQBA 2R85A 2Y1OA 1TM1E 2UYOA 1WCV1 1WULS 1MTOA 1SM4A 2JI9A 2Y1LA 5F98A 1FP4A 1O54A 3FFTA 3OOYA 3IEMA 5BPFA 3LX8A 1I51A 2B5WA 3ZXYA 4V0RA 5E2IA 4H7IA 4AECA 3QX7A 2FZGA 4IXWA 3H3FA 3TFWA 3AVUA 4I8DA 1BEEA 3BMQA 3WQRA 1B8VA 1Z68A 1Q0TA 3T35A 4OPMA 1W4CA 4YR7A 2P3LA 3F90A 1AGXA 3GMTA 4O4LA 1UK9A 1PHPA 4GRAA 3TUIC 3ZBUA 4IX1A 4J94A 3PCTA 2WE7A 1HKHA 4L57A 4KAXA 3KR2A 3CCCA 3N0TA 4F2PA 2A9KA 1E18A 3AR6A 1KDZA 1H4QA 2WBLC 1JA9A 4G26A 4R9RA 3RNLA 3TPFA 3V1MA 2C9OA 4G4SP 3BFKA 4KMRA 4Q3EA 1AY0A 4ZKEA 1SD5A 2VP6A 4TLCA 2G77B 3OA0A 2Z2JA 4V2UA 4M88A 2COEA 5FQNA 2EDAA 4YWJA 4BMDA 2JK1A 2Y77A 2P9CA 3URMA 1IN1A 1WQ3A 2R6DA 2OBMA 2O8BB 2AMFA 3PU6A 4LE2A 1D2RA 3K0KA 4J1SA 3ROMA 3WA6A 3VNUA 1ZWKA 3I9OA 5K6RA 1W5BA 2X5KO 1NLZA 3I6YA 5DTJA 1JG3A 5FNVB 5IBPA 3CLSC 2MSCB 5KQRA 3JYQA 4TLEA 4KREA 1DBVO 3EXFB 3SXUB 1TUEA 3QJGA 4EHBA 2IP2A 4FGLA 2P35A 4N9WA 4AP5A 4Q4CA 2KQUA 2CBZA 3FKQA 2Z8YA 4OHWA 4PPYA 3WBKA 4E4YA 3ZLJA 3ITDA 4E5PA 221PA 2OAGA 4TSRA 4EAAA 5C7OO 2QM0A 5EQTA 3SYNA 4HFMA 3IHLA 1GQOA 3DFUA 4JLDA 1E6UA 1M34E 2WLTA 5KYUA 4AKTA 1Q12A 4URXR 4YS6A 2EP7A 1ES9A 1YQXA 2OFOA 3GJZA 2O54A 2VF2A 2AXPA 4J16A 4MWOA 1UKZA 3NOOA 5IMSA 4A15A 2H2IA 1BXRB 4DMHA 4ZQGA 2OG2A 4QE3A 2UXDB 1DBPA 2D1FA 2GDZA 3ASVA 4J2HA 4L9WA 2I6SA 4CQMD 3PUYA 4BV2A 1DXOA 3D7SA 4TYPA 5T6BA 5D3MA 1QB8A 4G09A 4LDRA 2OO5A 1EDEA 4BO1A 1GQFA 3CSSA 3KXDA 3MCAA 2VJPA 3EUWA 3I64A 4PLWA 4RLFA 3M1YA 5AXAA 4TRNA 5FWXB 1C3JA 2YZ7A 2AS0A 2VJKA 2Z56A 4RTNA 3KXLA 1KI8A 3I62A 3DE4X 4B83A 1XD9A 1JU4A 1TD9A 2G7ZA 2GHIA 5C8XA 5IH7A 2ET6A 4YUZA 1RXCA 3DQZA 1P4HA 4ZOCA 3IA2A 3M70A 2PBRA 4L1KA 4AC9A 3HLYA 4OQNA 1CRQA 2ZK7A 5EUBA 1W5SA 1EFDN 4J3JA 2IW1A 3AIOA 3K9BA 2B6NA 3TLBA 2WTUA 4P33A 4CQNA 2OXTA 2BRUA 4FNMA 3QXGA 4Q39A 1Q20A 4M8IA 4KGZA 4O5AA 3BDAA 2P90A 1HNXB 4PYMA 5TPWA 4XJVA 1AV7A 2P9TA 3YASA 4CM4B 1FW6A 1L0BA 4D3XA 5B5SA 1DJMA 3NBXX 3PXDA 3GJSA 5CIWA 4MW1A 1ZD5A 5KJCA 1YQDA 2ERXA 3O8OB 4JUDX 5G0VA 3S0JA 2J31A 3FJOA 4EPXA 5KTRA 1YMUA 3ED5A 3V1YA 4MS3A 1F0NA 1BSVA 4DPMA 4WBNB 2P9FA 2O7SA 3DL2A 3NOQA 4M7WA 4LMAA 1BX3A 3UB4A 4CGYA 3T5TA 3LDHA 1FDOA 4TXLA 4ZDJA 2YV3A 4HGOA 2BGIA 2FX2A 4ZOEA 3CQ9A 2ZRAA 3EMKA 3KT6A 2GXQA 4TROA 3ZKAA 5AJWA 4TTTS 2WIAA 4RMGA 2QZPA 3HJCA 1PNVA 4CF7A 4Z7NB 1P74A 3X1XA 4JUAA 3W8DA 3ESYA 2YFKA 3HUFA 3G3EA 3IP6A 3RUAA 4WGGA 2L82A 1RXUA 2AIRA 3R9KA 3EGOA 3R24A 3RR2A 1QIMA 3E84A 1KYVA 5DHUA 4J1TA 3I0NA 1MFZA 2A9VA 2QV7A 5JXWA 3ZCVA 3CH4B 4X8LA 2VHWA 2VC2B 1PR2A 2AF3C 3OH8A 4LSWA 3T0FA 1Z6YA 4CCYB 2P3SA 3HA2A 1FY2A 1R4AA 1RI5A 3REGA 4FGWA 1FZQA 2Z0MA 1XAJA 2GNAA 4OSPA 3D8HA 1SOUA 2OCXA 1Q14A 5NLLA 1J23A 1AUXA 3PX3A 1RC8A 5EIEA 2Q8NA 4R9UC 4RHUA 2NNLD 3BB1A 1SBCA 5JQWA 3ZLUA 5KYYB 9MHTA 4IH4A 2AEFA 1OHHA 4FYHA 1T13A 1Z39A 1ESMA 1WEHA 3P5SA 4WXHA 3K30A 5GM2A 5CLJA 1Q50A 4JFAA 3DDSA 1HZZC 2FSVC 2QXYA 1SCUB 4D79A 1JR3E 5IRCD 3HJAA 3HEMA 1HRKA 4V03A 1GZ6A 4UOZA 3EG9A 2NG1A 2UUCB 3QWHA 1SUPA 4ZT7A 4ATNA 1V41E 1EWTA 4FBGA 4EY8A 5I9NA 4L76A 5J58A 2XUQA 4TMWA 5E9JA 4LFCB 1UODA 3ANSA 4OCZA 3KB1A 3BL5A 1EMDA 5K9ZA 2WJJA 3GNSA 4BNDB 2FB9A 2E89A 3ON5A 4QJIA 3UATA 3GO4A 1QGED 4E22A 1BDHA 1NYLA 3VM6A 2HSJA 4UHKA 2JFBA 2BCEA 2QNBA 5D2CA 3SS8A 3U1TA 4QGGA 4A82A 1NBAA 2R1ZA 4AWXA 3D3JA 4DSTA 2OECA 3A36A 1D03A 2II6A 2OP0A 5FWDA 4EG6A 5KTPA 1C8VB 3DMDA 5HM6A 4IUBS 4UHDA 3VPFA 1YJXA 4OI1A 3CY6A 1CYDA 5L7YA 1K66A 1Y48E 2A2ZA 1F3LA 1V43A 4M1QA 1NI5A 4RLSA 3KZVA 3UK2A 4WXRA 4JBXA 4XGIA 1G5TA 1QTIA 3MGBA 1RS0A 1W4LA 4KW7A 1VHWA 5F9MA 4GPAA 4RENA 5TQ0B 1YKSA 3B1KA 3PDWA 4NCXA 1FC0A 5HF5A 5KHOC 2EWVA 1M67A 1KDTA 1KKMA 1OI7A 3UAYA 4D9CA 5LP1A 1YB5A 1NYRA 5K8IA 2VTBB 1P0PA 4Q4LA 4TSFA 2P9GA 3GFVA 4HWKA 1UPFA 4NULA 4GKKB 2BGLA 2DBRA 1LA2A 2H11A 2QTVA 2FW1A 3DD1A 3X1YA 4HGZA 1P2FA 1QDLB 4DN6A 3PDHA 3NM6B 3GG9A 5IFLA 1W6RA 4FJ0A 2W2PA 1JHOA 1SQ6A 3DMTC 4P34A 1IXKA 1SFRA 4RK6A 2WFMA 4RIIA 4L9AA 1OVGA 3RTBA 1ZAYA 1QZXA 1CV2A 1PZMA 2QTFA 4NMWA 5GZ6A 5JECA 2OCLA 5B37A 3GAFA 3DZ8A 4P4SA 2H1VA 2J85A 3OP4A 1T8TA 1SC1A 2XA1A 4G23A 5EE0A 5EKTA 3TDNA 3V3KA 1A9RA 1DOZA 1RMTA 3R7NA 4A4DA 4EWLA 1FP1D 4NJOA 1P1RA 1JMYA 1LFDB 3K72B 3PRHA 3Q7RA 1TO1E 3CMMA 3D9QX 1SUBA 3NHUA 4H9GA 4ZO4A 2QB5A 4A3SA 3OPMA 2YRXA 2ZQ5A 1K5HA 1I4WA 1P75A 5KPJA 1ZBQA 2XVAA 1QVVA 4AJ9A 2J46A 4O2AB 2PXHA 2WU1A 3QLUA 3VDXA 3G2MA 3ECAA 3C3EA 3JZIA 4WERA 5CH5A 1AT1A 3TN7A 1QV7A 4ML3A 4OQMA 2YKGA 5AXBA 3E9YA 3N70A 3WAKA 4ZJPA 4HAWA 3AH8A 1NJ8A 2P67A 3VOBA 1DIBA 3HK2A 4LISA 4PPQA 2ZIFA 1OV6A 3SHFA 3ZHOA 5TLSA 2JFFA 5JLJA 4LUCA 2ZB4A 3STUA 1E2KA 3C48A 3NJ4A 5IDWA 3ET4A 1P7WA 1NJFA 1LQ2A 3ZCRA 3LUHA 1PVVA 3NWBA 1I13A 2KLBA 4DDVA 1L7PA 2FEKA 1FX1A 4QOGA 1AM4D 4D0LB 1QO9A 3AL0C 3R3XA 1UC8A 2CMDA 4DJTA 3SE7A 3R9XA 2ZQZA 2Y1KA 5HF6A 4URUR 2O1SA 1L5FA 5LWHA 5L7TA 4UDYX 4IKEA 4O63O 5GADl 1EK5A 3K2IA 2JBWA 2ZB3A 1UDCA 1X1TA 1GPAA 2FF7A 1ZXLA 2FN4A 4DCPA 2VSQA 1TTQB 4EG8A 7MHTA 1OI3A 2OSBA 1IIRA 5THQA 4I1SA 1UZNA 5EUMA 4AZTA 3MMNA 1KZGB 3O1HB 1LNZA 3IRVA 1QSGA 3ZGLA 2VJBA 3GA5A 1QUEA 4CYMA 1RE1A 2IYAA 3C15C 3MUNA 2PTHA 4MAFA 4MDHA 2OM2A 1NMXA 5K5EA 4CCWA 4C4XA 1SU7A 2ZB2A 4PCAA 3LZ6A 3K1AA 3MBIA 4XW2A 1SQ5A 4KPYA 4MLDA 4HVTA 3RF7A 1IDN1 2C97A 1PJ2A 3EDQA 4ZMBA 3TIIA 1MJ5A 3OBIA 1NBOA 2PSJA 2WSLA 1M8PA 3K1JA 4A26A 4Q4JB 6NULA 4MVJE 1K9VF 2J48A 3L0BA 1WRBA 3R6LA 4XQGA 4XIIA 5KYKA 1QGUB 1GGFA 2GJAA 2WFLA 1ZJWA 4MDEA 2FAXA 2XZOA 2DLNA 2A1UB 1ENYA 1KEKA 2Q1TA 3UHPA 3BICA 4QU5A 1GTJ1 5AFSA 1QZTA 5BRAA 1FNCA 4GM1A 1N6PA 1LJUA 1SULA 1E0JA 1X7XA 4N7BA 4B4WA 4JEUA 1NLUA 1SUAA 3UT0A 1M5RA 1URPA 3EF3A 4QUDA 3SQLA 1OIVA 2PS3A 1PJQA 3DOHA 4RSMA 2O52A 3HE3A 4MRNA 4EY7A 1C41A 1LVUA 1N7GA 2GKGA 4OLFA 4A1OA 3A1EA 4C0AC 4E32A 5LWQA 5K3CA 1UCFA 4LCEA 2GJ8A 2A0YA 4KI0A 3D0RA 2VPWA 3T7SA 1BH2A 2ZEJA 4URFA 2XXBA 2VHYA 1WBJB 1XEFA 3V6LA 2A30A 5G0SA 2GAJA 5F2NA 1GRQA 2HUPA 2RB5A 2ZYGA 4X93A 1MJHA 2I8LA 3QBJA 4KN8A 4LF9B 2ZJAA 4OB6A 3PDJA 1SHLA 3I6ZA 2IEIA 2V65A 4N9QA 2CNKA 5ECWA 2XMDA 5C5CA 3AFMA 4D0RA 4Q21A 4QSMA 3F6RA 1FFCA 2Z58A 4LDNA 5IM5A 3EHDA 4KBFA 4I36A 5BNIA 5LB4A 3PCRB 1Q92A 3TLGA 4TTQA 3A7DA 5TR9A 4B33A 4DJFC 5MHTA 2QMHA 2XX3A 4IQ8A 1BD4A 4MMYB 3NCTA 3S81A 4RTMA 4AKSA 4N5DA 2WHXA 2VDJA 2WY2D 2R00A 2XQFA 4G0ZA 3L8HA 9LDBA 4ZT4A 1VKHA 3SYKA 1QV9A 1US8A 4BNFA 2YWBA 1O03A 2YQZA 3BK1A 5K01A 4NECA 1USIA 1Y7TA 3N0RA 3O1IC 1VI2A 4PFSA 3DLTA 2X0JA 3QU4A 3SDSA 3WNQA 4DLVA 4NDNE 3MWGA 1KGSA 1IPHA 2XMSA 3NT5A 3SJBA 3O7MA 4KE9A 1RM0A 4GFDA 4L4XA 1GEEA 3GWGA 3FN4A 3GOQA 3LGAA 1FIUA 3HRHA 1Q1EA 3A4MA 3LT2A 2XAAA 4NF2A 5D3QA 5J9FA 3P0RA 3UCXA 4KQCA 2J5KA 1LPPA 1QQTA 1H05A 1U0JA 5G0TA 2H18A 4H2DA 1BXGB 3LXXA 1PUIA 1C1HA 2JH8A 3AR2A 3CLUD 4C4YA 4DA9A 1DBSA 3G82C 2QT9A 5ITZA 4XARA 1LVHA 5DH9A 2AW3A 1JJVA 3BXPA 1M2JA 1XMQB 4P0PB 2O48X 2WDPA 3GFBA 4P5EA 3LRPA 4HDCA 4OLHA 4RVCA 5REQB 2FMTA 1VSUA 5HTKA 1P9WA 1HC7A 4HXEB 4B7CA 4A2WA 2ZREA 3H1TA 1PX0A 2VKTA 4CHGA 4Q9HA 1AA9A 2DG2A 5COAA 5CA0B 3H4MA 4BNHA 2AVNA 1KH1A 2FSUA 1ECJA 4PONA 3RARA 3TLMA 2QS9A 2QJTA 2A1TR 4NZMA 3RYIB 3UXEA 2NYVA 1RLUA 2I8CA 5FL7D 4NEHB 1Y9AA 3RVPA 1L8QA 1NBMD 1I6MA 2HF8A 2VYFA 5SYAA 4EFKA 5LQDA 5L3SA 4TT3A 2JATA 1NFFA 3CIOA 3NTUA 1JJIA 1O97D 3ZY4A 4LZAA 4R1UA 5B64A 3ENKA 1U1IA 3DKIA 5LBUA 1OKKA 4Z54A 5DKFA 2VBIA 1A7AA 3FTNA 1MPXA 1TAGA 2Q4BA 4GMDA 1EUYA 4NY1A 4YAIA 1ZISA 4CLOB 2ISCA 3DWEX 1U7DA 3R3WA 1WDWB 2EFDB 2B5OA 2IT1A 5FWAA 5AIAA 2QF7A 1ODIA 3NOXA 3LNCA 2XT6A 4KNVA 3U4DA 1ULTA 4L7QA 3WWDA 4PX9A 3A7EA 3DBLA 3ZIUA 5AVRA 5BVHB 2J3LA 4BVGA 3EOZA 4D4KA 5A5FA 1PYOA 1CFJA 1ZWLA 2VJMB 3EA4A 3EODA 4HI0E 3JRWA 5HIJA 3U0VA 4F6RB 4HX5A 1U11A 3VKWA 4H4CA 4QVKA 4E12A 2RI6A 2ZLBA 1PKXA 4FFNA 1XZFA 5K3AA 2IHBA 2NO6A 3BGIA 3A14A 4P32A 4ZVKA 1M2WA 4HQ6A 3B3GA 4EENA 4HKTA 2I54A 5LDGA 3K8QA 3UJ8A 5C8DA 3H2SA 3SZGA 1WBDA 1QAQA 3TD6A 1JAXA 3MJSA 3LC2O 4B4OA 4QOFA 3LDAA 5K4HA 2GRUA 1WXXA 1D1QA 2ZR7A 3BMCA 3E1KA 4TXJA 2P30A 2JI6A 1RHMA 3E3OA 1QHFA 4O4JA 3U39A 5C37A 4QZVA 3HTXA 2IS6A 2HWWA 2VNAA 4HF7A 4WNCA 1KBQA 4IDEA 4JUBA 4O08A 4DF3A 1DDIA 3VNRA 4BKUA 1KFJB 3I9JA 4G0OA 4UU8A 1WMSA 1HE3A 1L7DA 1HLGA 3DCIA 1HDZA 4JX9A 1NJ1A 3KQHA 2NU9B 2X9LA 3GJ6A 1YS7A 4QT4A 1OLUA 1D6MA 3D4LA 1W34A 3JQPA 4ZQCB 2W2NA 3AETA 3RYCA 1U04A 3GLFE 3LBHA 1B6RA 3QJ5A 1TRHA 1E1RD 1VBNA 1JPNA 1E2LA 1MP0A 3QKSA 4FX2A 4WOKA 1HE2A 1THZA 2WZDA 4OA8A 3QEOA 4QYIB 1BMFD 2RAUA 4Q24A 3JQ9C 5FO1A 5G3ZA 4AMVA 1N0WA 4OJYA 4CR6A 1ZP6A 4D6PA 4S3MA 2XWBF 3E27A 1PEDA 2XB4A 1EK1A 4FR5A 2AN1A 2E4XA 1CE8A 3D7NA 4PPGA 4QBIA 4NK4A 2W2XA 3NHFA 1SBIA 3TTUA 1ZONA 3RCBA 1I80A 4ACBA 3TNLA 3KSRA 4B0OA 1WL8A 4GM4A 3LVBA 3IR7A 3V8BA 2A3NA 4BFCA 3TLAA 1CF4A 2YJ6A 1MMFB 3WFJA 2NOAA 3TH5A 4DBLE 1EJ2A 2KBFA 3OZIA 4LFAB 4J43A 4LDAA 1XE3A 5EIFA 4Z1OA 2X19A 4M6WA 5CX4A 4L02A 4OYHA 1NOKA 3DSRA 3LG2A 4TTAA 4ZAWA 3VTKA 1ZPDA 1MG0A 5ALMA 4KPFC 3O0TA 3ASZA 4YK7A 4BZWA 4RHFA 4HDNB 3H5NA 1CJUC 3HZOA 4J0HA 4YCAA 3UTCA 2PZBA 1DG1G 4WESA 3DXYA 1X8XA 2JL1A 1OV4A 4YP5A 3PHCA 2BVNA 1YONA 3FGNA 4C1BA 5B4VA 4XUCA 3IPRA 3ULKA 5CVTA 5GM1A 4I5EA 3G0OA 5GZ1A 5ABPA 3TG2A 3HCNA 4D43A 2ZZNA 4Y2UA 1DTSA 2FZ5A 2DSTA 4ND2A 4PZCA 5EIWA 2Q3BA 1DL5A 1YDGA 4L50A 5AICA 5AK6A 5B4UA 2WDZA 1SIBE 1QH1B 4F9GA 1NMEA 2L42A 1M2VA 1X7DA 2JDIA 2P27A 3GCZA 4FSXA 1MAWA 4FUQA 3TWOA 4E03A 2PUAA 4C2AA 4B9EA 4DMCA 5IN4A 3WB0A 1XXLA 2PEYA 4YA6A 2VJLA 4JN6B 1SGWA 4LMBA 3GGOA 1W46A 4OM7A 1AK2A 3S28A 1KOJA 2WIBA 3CX6A 1L4MA 1U0FA 1XZCA 3OZ7A 2EF0A 5JLAA 3MJEA 4ND3A 1T3GA 3BWCA 2JD0A 3CF0A 2JVKA 2BELA 3OTQA 3Q5DA 1EFKA 4LJ8A 4AKEA 4ON9A 1BX0A 1I36A 1YR2A 2WMOB 3SS9X 4QG7A 3TD9A 2DFNA 2OXFA 4GLBA 3RSCA 1FCJA 5DN6A 1KO8A 2V0NA 2IEBA 1CEXA 1NBHA 4H3SA 4HDKB 4MO9A 4EI8A 3W6PA 2CCJA 3WP0A 4LPSA 5EXXA 2ZIEA 3MJCA 2P2NA 2R7MA 4EA6A 3A4TA 1EH5A 2GJ9A 4QHYA 1I2AA 1ZS9A 2WFLB 4KUEA 2EYQA 3MXTA 3USZA 1ZRHA 1ZUNB 3OJFA 1ZGZA 1V35A 2CFIA 2OC9A 4K6OA 2QN2A 1UBMS 3H4VA 3DZHA 1NUAA 2AMVA 2C2XA 1E4YA 1JFVA 1QLWA 4I6EA 3GAAA 3K05A 4HV4A 5KEIA 1IEXA 3SICE 2QRVB 1YS9A 3IV7A 4MWBA 3AWDA 4TXHA 2BYTA 5IULC 2PX4A 3EIEA 3IV6A 4JSRA 4M37A 1IWBB 4OKSA 5EAIA 3PEWA 4FFOA 3L8MA 1D8AA 2KPOA 2FWAA 1Y8QB 1BDJA 2IXTA 2XLBA 4RELA 3STVA 2BZSA 2NMVA 4UCXA 2HA2A 2BGKA 3RYIA 1W36C 1X42A 1T91A 2Z8YM 2QBYA 3UG7A 2ZU6A 2P5SA 5JDIA 2BHLA 3ORFA 5L40A 1KAGA 1FMLA 3VAAA 3GJYA 2IWRA 3V2UA 3THYA 1IYZA 2FFAA 3RDPA 4POOA 3K73O 2GWRA 3AVYA 1Z4MA 3ZU4A 3MHPA 2R68A 4DQDA 3C5EA 3N8GA 3KO8A 3EEOA 2D5AA 2GFQA 4F3CA 3LLMA 1TB4A 3S99A 4WGFA 4L0MA 1XVAA 2P4UA 3Q8MA 4EM6A 1W29A 5IYZA 1E2BA 3KZXA 2M6RA 5JCZA 1T24A 2Z2XA 3CF6R 4AUKA 3DOCA 3IP7A 3EPHA 1RRGA 2BN4A 3ROEA 2EBHX 3PNMA 3CB2A 3HL0A 3LUAA 2PGOA 3O03A 2EZ4A 4TXNA 3TRIA 3V33A 1OE0A 1AB5A 1M1UA 4O25A 2ANCA 1WXQA 4OIMA 4GMXA 4LVOA 1VLHA 3HMKA 3IELA 3F3YA 2OCDA 1J0BA 5FI5A 2FPWA 2CKMA 2QM3A 2FSHA 3H8WA 2PO7A 4DXDA 4X45A 4DNOA 4ABTA 1D9XA 3LQRA 4CFSA 4KQWA 4XSGA 3SYRA 3ZIDA 2OXEA 3FSGA 4UM9D 2R79A 5TPWB 2VJYA 5K3FA 1JPVA 1XGKA 4UJ3A 3AVPA 2W4MA 3SVLA 4FXOA 2R6FA 2NZVG 1R27A 5J59A 1P9RA 3EC1A 3L8GA 4PBRA 2RHOA 4DB2A 3DEAA 1XQ9A 5K1ZA 4C0SA 1B2LA 2A0WA 1J42A 4KDFA 3MWDA 1X1SA 1XEXA 3A3PA 3R23A 4QRDA 2R4TA 2BL4A 1C1DB 1HQCA 2ECFA 1ZMOA 1ISIA 2HPHA 3R3JA 1HZJA 4K1LA 1QMGA 1O94C 2BEWB 3E5RA 5DO9A 3O9MA 3QVUA 4G0QA 3CLUC 3WMRA 8ADHA 1GDTA 3ER8A 4B0PA 1K3FA 4MRAA 4Z4HA 4XRGA 3DO5A 4GYKA 5ECYA 4N39A 4TUYF 2AKAB 1I2ZA 3AI1A 1M1NA 1L5RA 3RV4A 6PFKA 1W19A 2PSFA 2RHRA 2HRZA 2W7TA 3I1IA 2IV3A 3RIGA 2EU8A 1L5KA 4IJVA 2FQYA 1VJRA 5F2OA 4HT3B 4I9HA 1JKFA 5GQSA 4QX6A 3VV3A 5DTQA 5B55A 2BOVA 2PY6A 2AOVA 2O0HA 2P1DA 3RHFA 3CW9A 3IEUA 4PGAA 1VTKA 1X7WB 2N47A 2ONYA 2FEXA 3OQ6A 5P21A 3TIVA 3Q3JB 4ECAA 2CVZA 5KJ1A 2E5LB 2PUEA 4XI9A 3W9YA 4N5IX 4NH0A 5BW4A 4HYEA 4QNMA 1RZ3A 1BMTA 1Z7YA 1REQA 1C2TA 4GOND 3RK0A 5B3JA 2J7KA 3Q3GE 1YOVA 2DT5A 1PJZA 4XXHA 1O89A 2HGSA 2P91A 4U2KA 4B4UA 1IMOA 2WUFA 4KVZA 3L7OA 4CUKA 2V3WA 3OJLA 4H3HB 1NPTO 3WDKA 1GNVA 1JEQB 1DBQA 3LDGA 4B6SA 3VAZA 1XZGA 5F73A 4NE7A 4BBZA 4K1XA 1NR1A 2NV0A 3OUTA 2Q0XA 1L5WA 2OSVA 1LK7A 5DYIA 5CFMA 3JZDA 8AT1A 3KHSA 2XZDA 3R7SA 2AA3A 1A9YA 2XLCA 4CF3A 4YUYA 1A71A 5AW4A 2PYZA 3DYBA 3QNWA 5DJ5A 1LDBA 2R5NA 3F1LA 4OJMX 3V7UA 3PJRA 2CMGA 1Z8NA 3TMYA 4IMRA 2GBPA 2TMYA 3BFJA 2J8ZA 2RGDA 3C8MA 2L69A 3NHBA 4DCGA 1P2SA 3QY9A 1P1BA 4WN9A 3UHAA 4Z9XA 2DFTA 2IGTA 3F5SA 2OORA 4RANA 3SZMA 3DYIA 3NUZA 1TU0A 1Z5PA 1CRZA 3HYTA 4Q48A 4X97A 5C1DA 4PQRA 5CB0A 4Q4AA 1X19A 4M0EA 4OX9B 3HG7A 1PVOA 4Y2XA 3NAMA 2PZJA 3IVAA 2AYXA 3B1YA 1OU0A 5FR2A 2R8EA 1CUYA 4TLDA 4R05A 3WYNA 1YHYA 3O91A 1O7JA 1UDXA 1UFRA 4I5DA 1J0DA 1UXIA 3SFZA 3IURA 3ABQB 1QR6A 3C6XA 2K6GA 3HLKA 3RV3A 1UQTA 5GJCA 2ZSKA 4D99A 4OLBA 2RGBA 5BVGB 3LY7A 4RH3A 1MAAA 5MFZA 2GM3A 2Z8ZA 3HYCA 4WVFA 1AD2A 1VMDA 4R40A 4ZAFA 4L3VA 1BRMA 3FPFA 5I7SA 4JYMA 1B8NA 1JLLA 5GZ3A 1DJLA 4AWBA 1Y1TA 4ZYTA 3SIWA 5B7NA 2W00A 2QN3A 3NBMA 4MI3A 1LZKA 1VBFA 2ASEA 3HR7A 3KZ1E 2XXAA 2JB9A 5KVVA 2DJIA 4KMSA 4V0ME 4XLZA 2QLFA 3OX2A 1XEAA 4ER6A 2ODQA 1NONA 1XBTA 1JF8A 3LRXA 3OT1A 3Q4GA 4XOUA 3THWA 2XMCA 4N3BA 3OJEA 4DSZA 1MC4A 2RKOA 4QEKA 5AKGA 2ZI9A 3MF4A 1RLMA 3B9QA 4MVXA 2NP7A 4ETNA 3UAVA 4G0PA 4HDSA 1ZD9A 1ETUA 4R8LA 3N05A 4UEOA 2E21A 1IBCA 2IZ6A 2P4HX 3C8UA 3CRNA 4W9NA 3HWSA 5DWQA 3EN0A 5HFJA 1H23A 1AS0A 2MSKA 2ZIAA 3GRZA 3MTAA 5LVAA 3ET5A 3RUHA 1O6CA 2JIDA 1NRJB 1FPMA 3UXYA 1AF4A 2I76A 3GJ5A 3ODPA 4AU1A 1ZCBA 1Q0UA 2Z04A 1EE9A 1NQWA 3GLQA 2GD0A 3P0HA 4PZ9A 1AQJA 4MDFA 5L3QB 1ZINA 2ZPAA 4QQKA 3DF9A 4AF6A 1UBUS 2O3JA 4XJSA 4LJ6A 4XX0B 3ZLTA 2WWRA 2JLWA 2QR2A 4NZNA 2C8LA 1QFZA 3QWIA 1IULA 4XE5A 1M2HA 1KJ9A 3PFIA 3D81A 3PYLA 1QIGA 4IKPA 2ZS7A 4FEYA 3ISTA 4KXLA 4MWCA 4D4IA 4EB6A 3ZV6A 3AX6A 1L1RA 4YV0A 4P84A 4EYOA 2PJZA 3AW9A 2DHRA 3DDZX 4KOEC 2ARKA 1ZK0A 4OKIA 4TSKA 1M7HA 5KWSA 2Q1WA 2XBMA 1HT2E 1P7PA 2W5UA 3QV2A 2D2IA 3MLAA 5DASA 3G2IA 4QTZA 2FGKA 2Q3DA 4AZ3B 3K6KA 1WLSA 3V8VA 4W5HA 4YDSA 1RJDA 4AJHA 3OZAA 4FWBA 3RT1A 3I9LA 3O4HA 4GXQA 4EGQA 2BEVA 1XL0A 2VNHA 3BCUA 3VA7A 1T9CA 2OLJA 4DMLA 1MB2A 1EFPA 4UOQA 5H7XA 2PWYA 4L28A 4EKDA 3R09A 3EVCA 3OOWA 3TSYA 2N46A 4BXOB 3TPCA 2CFTA 1ZUNA 3V7YA 3H87A 3QEBZ 1DMRA 4Q3DA 4N0PA 4LI0A 4GLOA 1ZCAA 3ESCA 5GPBA 1Z18A 3JD3A 2CMHA 1YRYE 2IHUA 4MP6A 3EGXB 4ZCIA 1FXUA 4H31A 2FY8A 2J3HA 3DLPX 3I8XA 3OF3A 2HPVA 3L8DA 2AC4A 2ZSAA 4GRIA 1WG8A 1G5FA 4XD7D 1MZVA 4YMSA 3PHGA 3C74A 1I9GA 4MX8A 4FCCA 4K3UA 5L4SA 3GAZA 2R7KA 1ZZGA 4MR8A 1NVEA 3I37X 4C0LA 5KJFA 4PX3A 1R6UA 3FR8A 3P26A 4HFJA 4IMJB 1QFJA 5DFAA 2CLKB 2P2YA 3KZCA 1RQNA 3N2EA 4GVXA 2JGDA 4MS4A 3TQFA 2CE2X 4Z53A 1Y34E 3MQ4A 2IV7A 4B2IA 2FLWA 1F12A 3LT1A 3WKAA 3MT9A 4TL9A 3M6XA 1PEYA 1FJXA 1TK9A 3BULA 1U02A 2NYRA 3N2ZB 3RVMA 2WW8A 4Y18A 3CLSD 1YJQA 4CIDA 1O9BA 1GL9B 1YJ5A 7ABPA 3CXUA 4BNGA 2CYBA 1FFXA 1MJGM 1M6HA 1SPXA 3AIKA 4O2BF 4ZT3A 3WWPA 4EPVA 3LCUA 2J5BA 4YAUA 2FWNA 2GHRA 3S6JA 1Z63A 2JIPA 3FTFA 4GWGA 5EP2A 1U1DA 2PFGA 2PRJA 3C6QA 3QX9A 4J4BA 3S8MA 4FD2A 4DKJA 4G0MA 2NU8B 4DW8A 4JQYA 3WHIA 1J39A 2QPLA 5DIZA 3E1SA 4IDBA 1T5SA 1XPRA 1ZM4A 4LY6A 1GZ5A 1OBHA 3ACDA 4URYR 2YFHA 4YI3A 1JEQA 1GPBA 3MERA 4MGHA 3RUEA 1L9KA 1LZLA 4BNDA 4KNYA 2I2BA 3NTLA 3WNZA 4MROA 4E1VA 2JKZA 1Z2NX 2D3TA 1U1GA 2XUKA 3HUDA 2X8JA 1NE2A 2FRVA 3CC8A 3CNOA 3FMGA 3NDPA 5JDIC 1U2ZA 2BCGY 1P6XA 5BNZA 1O6GA 1GZ7A 3RJTA 4TN1A 3THXB 3ROKA 3TGWA 3E9QA 4PQGA 4N47A 1KJIA 3MWKA 4G1VA 1BTOA 4J75A 2VUUA 3BZUA 4F6LA 2PN1A 3IBTA 3HY4A 3GT7A 4KQFA 4BLPA 2YJ4A 1MHPA 5AW2A 3OOJA 1C1XB 1JKXA 1R12A 3QKSB 1YB1A 5LP6A 2Q5FA 1VIAA 1WPQA 1ND5A 1SCNE 3R3HA 4TQUS 3LHDA 4NBWA 3B2EA 4UAUA 1TQ4A 1UPAA 4Y1FA 4Y67A 5EA2A 5FBZA 3V1KA 2W71A 1SCBA 1P3Y1 3B3AA 1VRCA 4FE3A 1ULBA 2W8BA 1ABEA 2CHFA 4MEJA 3A1SA 1OB5A 1M33A 1E9FA 4TKUA 3W7BA 1U3CA 1W52X 3P0IA 2W2KA 2AR7A 1IEWA 3IOCA 5F9FA 1LNSA 4IGKA 3B85A 2NXWA 3KLPX 4PRYA 1GADO 1YZVA 4N3GA 4CZ2A 4I3GA 1AX9A 3GBPA 4KMMA 2WJPA 4QT0A 4UBOA 3KLNA 4BQRA 1IVYA 1VIVA 2PX8A 3FVWA 1FVXA 3MWJA 1CT9A 4A0QA 5BSHA 1ISMA 2HZBA 3U26A 1V6CA 3DTYA 4L22A 3WB9A 4ZYXA 3S8YA 2GOYA 2GF0A 3CN7A 5EJ8A 4Z49A 2RGAA 4K2AA 2Y4NA 2JLZA 4JEIA 1U7WA 3CUKA 4H18A 4HWPA 1HE1C 3G2KA 2HMSA 3P96A 1K6IA 2F64A 3GDGA 3GY0A 3JQ8B 4TTSA 5ALLA 4AIIA 4BC1A 3NBFA 2EJWA 3T7KA 4WBNA 1N2CE 1O0SA 1EM6A 1X8KA 1UOOA 3ELUA 4P6VF 4Q0MA 4UE6A 1QM5A 2YY7A 3OJWA 3L92A 1DBWA 3FVQA 3OO0A 4NCKA 1GPKA 3V1NA 1B15A 1QC5A 4CE6A 4U7DA 2DHEA 2YIVX 2CEKA 3A6HA 3PD7A 3X44A 3NFYA 4A8TA 2BY4A 4TL8A 5E8JA 1ZH4A 1EFTA 1SB9A 3AKYA 5EZSA 1R3DA 1SKAA 1WV1A 1K08A 1AKNA 1NYTA 2GQ0A 1Y7HA 3ZS8A 3QVWA 4LQLA 1KL7A 1BDIA 1W88A 2P1RA 3A26A 2YHUA 3V00A 4BUZA 3TXXA 4YB8A 3DL4A 4YEDA 1U5BA 2J9FA 3QYJA 4L72A 2DQYA 2R97A 2QTLA 3LY8A 4ZQBA 1ZR4A 3FWPA 3ZI4A 5DVZA 4I9NA 2OM6A 2OR3A 1TMYA 5C5IA 1A4IA 1A97A 4W4TA 1NXSA 2H2FA 4TWBA 1RPZA 5EIAA 5LBTA 1JEYB 3CEHA 2CWWA 2R6GA 1L5ZA 3DEJA 1Q2UA 3KHUA 1QYDA 5E9AA 4HNHA 1Y8ZA 4P08A 3REOA 5E6SA 4DGQA 5FWYA 4S2EA 4KPUA 1W1IA 5TPZA 5K0CA 1O94D 2IYVA 1EPUA 3A6LA 5K3DA 1U0TA 2ENWA 1QH0A 5GONB 1D1PA 3BDVA 3U81A 4CVNA 5AKEA 3IHKA 4RACA 2BJWA 3BF8A 4YJHA 3UMJA 4L5IA 4K6MA 2YICA 1C4XA 3CWCA 4P3OA 1IVSA 3KB2A 3T3EA 3OFND 5AVUA 4A0SA 2P65A 3L7DA 4HSEA 5DM4A 3VR4D 5E4TA 3OC0A 4UVDA 1BU8A 3WKCA 3NXKA 5C1IA 2H59A 5CB4F 5CDTA 1TAUA 2IDMA 4XCXA 2F3RA 3WHLA 3DNMA 1JJ7A 1IEQA 3C5VA 3KYJB 3PF9A 3SG0A 3VU9A 5JPDA 1CBUA 1KO1A 3DLIA 1WY7A 1FDVA 3LZDA 1JSZA 2C5BA 4GOOD 4HEA6 1E1KA 2PTGA 3KALA 4LG1A 1VI6A 1DAOA 1GYQA 7ADHA 4CV3A 1C29B 1M1YE 4TWZA 4HDSB 5B1HA 3S44A 3TLZA 3NYQA 1N2BA 2RC5A 1KO4A 3IXMA 4PYLA 3KYCB 2VQSA 2QJRA 1V4BA 3LGXA 4K2HA 4TT8A 5CT9A 2Q3HA 2FZKA 3RU9A 4L5AA 5AKKA 4NCNA 4V1CB 4DCOA 1QDUA 3DJYA 2GCNA 3W05A 4OFWA 5I3CA 2ZYAA 2OKCA 4MR8B 3EASA 1TYZA 1UJ4A 1G291 2RI0A 3GRUA 4IWYA 4KL8S 3M9WA 4NBSA 4YV1A 1F7UA 4XPZA 4TLBA 4NP6A 3WIUA 2CC2A 2O57A 3DZCA 3I5UA 1VRVA 3M5PA 3TVYA 3ZWCA 2G82A 2MR6A 5DK4A 5D85A 3LYAA 4RMNA 3BJIC 3A4IA 3LNTA 5A62A 2WWIA 3SQWA 3IXLA 1JIUA 1RKUA 1SK9A 4AJEA 1C7ZA 2IIVA 4D8WA 4D26A 4DTCA 2MSLA 1O4WA 1O6FA 3QWFA 5M7EA 1T5IA 4J3FA 1H4SA 2BHTA 2RH9B 3SY8A 2GEVA 4MR9B 1WCIB 5FBRB 2C4VA 1VCNA 1K7EB 1COZA 1A9PA 1YH3A 3MOGA 2P3OA 3R6TA 4X3OA 1ZU4A 1JG2A 2PQ2A 5D1NA 3UGKA 1SVIA 1YUBA 3V8RA 2BFAA 1QS0B 3GJ7A 1CNEA 1MO5A 3QM1A 3G9TA 4BMOB 1VG9B 3L02A 2XRMA 3H2KA 3W1VA 1B3BA 3E48A 3E7XA 1QRAA 5ANRB 1F0PA 5I7RA 4UUMA 3AR3A 4WK2B 5BN4B 5J1TB 5FORA 1Q7TA 2P0AA 4B40A 3AFHA 2Z5FA 4RVHA 5HQJA 3V8QA 1DQZA 1QJ4A 3PQ7A 1SC4A 1YR8A 2OUKA 2QDKA 2H7VA 4KB5A 1XHFA 2YY5A 5CBKA 4DCSA 3TXYA 3PNPA 4KQ1A 3L9XA 3NEPX 2O3UA 3SMQA 2IZ7A 4YRKA 3RS0A 3L49A 2OQVA 3TQOA 1UXHA 2B4KA 4LOIA 2WB4A 4D0SA 3QPUA 2FK7A 1DRUA 2I7DA 4MQ6A 5JAMA 1IN8A 2PRIA 3LP8A 1KWGA 2ZSDA 3ZD7A 3O0DA 3DEFA 2P75A 3FUVA 3UIEA 4DNFA 2WYIA 3L43A 1FQJA 1FUIA 4Y6RA 1Y82A 1RWQA 2M32A 3NT2A 5EJMA 8OHMA 1KOGA 2Q5HA 2IX3A 2XDAA 4XDGA 4DWWA 4ZYZA 2R6JA 3IESA 1JPUA 3QH4A 4XIYA 4S2UA 2WFAA 3QXHA 2HLDD 1NL3A 2VFAA 2I2DA 1NJ6A 4Z9FA 3SC3A 4U39A 4DQUA 1RXSA 3MN1A 4RKRA 2TSYB 1CQXA 3LAWA 4IIEA 4C01A 5FWNA 5I4CA 1SK8A 3AHFA 3A1VA 5A4KA 5AVQA 5I7WA 2ZWPA 1GZ4A 3UC5A 3A4LA 2Z5VA 3GZTB 3H0EA 5T4FA 4BLSA 4WACA 1SCDA 2R8YA 3H11B 4N5HX 4OBWA 5BNWA 2DUNA 1Z47A 4HPJB 3ZE0B 3RAEC 1UDBA 2FKAA 1IRXA 2O7VA 3PR3A 3TBHA 3K0BA 3SFVA 4Q05A 4AY6A 1SZDA 1C81A 2ODPA 1HRDA 1YJ8A 2CDCA 2WA2A 2ZW9A 1NRWA 4LTMA 1W5TA 3UMMA 1NVWQ 3MHTA 4L2IA 4UBIA 4MIEA 1JR3D 3ESRA 3PNVA 3RU7A 4RWEA 1QRUA 1FUKA 4JLMA 1HOXA 1N8SA 5HILA 3GOHA 3GRCA 3A8TA 3G0GA 1UXJA 4IRXA 2W2VA 1TIPA 2CCKA 4CLRB 5KKCA 2V6JA 1XEXB 3HJFA 3WMEA 3EVNA 3PGXA 2IIQA 4RZHA 4EMUA 2AFIA 3WS7A 4ZDKA 2Q5JA 5HE9A 1CUGA 3EVTA 2OHHA 4KLRA 1SQFA 4N6OA 1PR4A 3IE2A 4E2FA 3D6JA 6Q21A 2TS1A 1G7CA 1NOIA 1JHZA 3W3ZB 3H6HA 4LNAA 3AHHA 3ILXA 1JMVA 2WMDA 3OECA 4P5PA 3F71A 4EOGA 1X9GA 1QHEA 4Q3NA 4MUFA 1B2RA 5K3FB 4H7FA 5G41A 1IMJA 2FI1A 4O4HB 2W6JA 5KYXB 2N1BA 2Y76A 3L9WA 4E4TA 1N6LA 1KC3A 4PS0A 3DMFA 2PNJA 2QN1A 4NDAA 1U0GA 2VRCA 4M0PA 3AHJA 1P6UA 4MPDA 2XCSB 3JQAA 1MF7A 2JJ2D 2EJVA 2IY8A 4KXMA 4DIUA 2QZ9A 3L4BC 3OEHD 4MR7A 2I1LA 4WDRA 4QELA 1Z07A 3HKCB 4BFXA 4LF5B 2I65A 4RJTA 5FIUA 1AZSC 3BZWA 4K81B 2FNAA 3U1VA 4UAVA 4C07A 3GNLA 1P2VA 3PITA 2C82A 5IDVA 1ADCA 1OGYA 2IYNA 2WNHA 3RVJA 4ASUA 1J2YA 1TC1A 4XX0A 3NC1C 2CXXA 1K4YA 2H07A 3S2EA 5CB8A 4Z3OA 1M0TA 2JIQA 3EZ2A 3GGGA 2QE6A 2Y1EA 1PBNA 2O8DB 4BN5A 1D04A 4Q3CA 4NCBA 3ZDXB 5TVGA 4M7OA 5JZBA 4MI1A 3F6CA 3DFFA 1II8B 3QTBA 1YZGA 4R0VA 5C1PA 4HNTA 5F7OA 4WN3A 3ZEIA 5COQA 1A9XB 2GLUA 1BRTA 2VHUA 2D1RA 3KQQA 2JFPA 4LRXA 1P4JA 3BPSA 1MW9X 4MV6A 3S2GA 1HDGO 2BFBB 3UQYS 3KT3A 1XJWA 3WYFA 1WHTB 1CUHA 1H8HA 2D8AA 2Z1MA 1NBIA 2QY6A 3AXTA 3ORSA 4OU5A 5AK0A 3WNDA 3QXCA 4US2R 4MRMA 3GVPA 2BMFA 7YASA 1P39A 3SZ3A 1ACJA 1J8FA 3U56A 3NTQA 2HT1A 3U3JA 3F6PA 1B1AA 4CKWB 3ILYA 2H52A 3R5JA 3O26A 3LHFA 4N41A 3G79A 3PWZA 3QFHA 2BSAA 4EVQA 1ULAA 3H2JA 5BOSA 1ONOA 5KTNA 3KTOA 1KFEB 2YJNA 3OKCA 2D8MA 3OQBA 5CPFA 4Y9TA 2BHNA 3O5AA 3ZQJA 4OP2A 3KVRA 2ETVA 2QT1A 4BKRA 3RK1A 4MUMA 3VC3A 1U63A 2A14A 3HEBA 3EFOA 5TEVA 1F0KA 121PA 2CN1A 2P4EA 3KOYA 4DLBA 4ZU6X 4A36A 4KIGA 2IYUA 3EZFA 4YPVA 2B94A 5FPHA 4JR1A 5DBIA 1DPGA 3JATB 4QLOA 4EECA 5JS1A 2YJTD 2FZ4A 2IU4A 2GN4A 1TYEB 1SELA 3KKLA 3MAAC 5HS6A 2BEUA 2CKDA 2V96A 3UKDA 5IJWA 3K0CC 1IHUA 1YSCA 1IM2A 4Q9KA 5B7PA 1FFEA 3RPEA 1HT0A 1R9NA 2NZXA 2Z5LA 3ZWWA 1PCXA 5EJ9A 4MVJG 3AUFA 3FUTA 1HDOA 1JVSA 2L2QA 2YOFA 3V1UA 1Q22A 1NVTA 3HVRA 1NG1A 2QQEA 4M1ZA 2C2GA 5DTMA 4B3CA 4EO7A 4UOEA 5C5EA 4Y2PA 5BURA 5JXIA 3H1FA 1TU3A 4OO3A 1RZUA 1BH6A 2J9GA 2PR7A 1PL6A 1ZZEA 2GN2A 4EB6B 2W2LA 1RXIA 5D1HA 4WXPA 4IYRA 1ZNYA 1T4MA 3IUMA 4WZAE 5COBA 4UUAA 1PK8A 2HOQA 5HFNA 3VC7A 4WZBA 3ZD9A 1H4VB 4G24A 1OXSC 3DNPA 3IB3A 3SLRA 4DR5B 3D7LA 2BZ0A 1Q17A 2VYQA 2H06A 3KR0A 1G8KA 4YJDA 1RBYA 1QF6A 2Q28A 3LHKA 1JHVA 1UKCA 3LU1A 4NG4A 3S1AB 2NZYA 1MH1A 1Q5PA 3R3UA 3O3OB 4XB6B 2I80A 2OCAA 4ZI7A 3SCZA 5I51A 3KQLA 3ZWAA 1I0IA 4CEJB 2FW9A 1DMSA 2FVXA 3C41J 4UD2A 5FAKA 1FS4A 2ATXA 3JD0A 4WLNA 4RF4A 3BQ9A 1U6JA 1AKUA 4FBMA 2F43A 1NXVA 4HB4A 2C3MA 3TLKA 1EYZA 5EE3A 1BE0A 4L85A 4EFMA 2WG0A 3FHLA 5CLQA 3BB3A 4YHBA 4Q4AB 4F2WA 3LY5A 5DGXA 3NV9A 1ZCFA 5DHFA 1NJSA 4B6PA 5DP1A 3ZXUB 2BR5A 3T1YB 2HQ1A 3H99A 1XJQA 3IJEB 4WEQA 4OXIA 5LP6C 1M8JA 1A3CA 1V5WA 1QHHB 1ZVQA 3EVFA 3OZTA 3VMFA 3UC9A 4JP5A 2PS0A 1VJ1A 5DB4A 5T4EA 4KTTE 4KYUA 5EPEA 4CQLA 4D9KA 2Z5GA 2PGIA 4JKIA 4IJQA 4JHLA 3T9CA 5K8LA 4RK4A 2WWVD 1I3KA 4A6PA 1ZI6A 4EMTA 1RQ7A 5FJIA 4R1QA 5CXXA 4C5AA 4CMEA 1K8RA 4FOTA 1LKZA 1G21B 5FOUA 3BILA 3AYZB 4HYQA 1I7LA 5AHKA 1J22A 4GQAA 3IP9A 4L5YA 5FWYB 2YJZA 3NAQA 1KP2A 2A57A 3GEHA 1WUJS 3N0XA 2X2FA 5FBQB 1FMCA 4LDQA 4ARAA 5BXYA 4HH0A 3U44A 2QL9A 2XOKD 3R76A 3OIWA 2IBMA 3C16C 3M6MD 4X44A 3WLOA 3EXHA 2KJQA 3D3QA 1MD9A 1OLSA 1E96A 4KVAA 4U7PB 5FA5A 3C3DA 3QEAZ 5DRYA 1I1HA 5BWCA 1DJOA 3AHCA 3K96A 1NBEA 1ZJJA 2R6R1 1U98A 1C9NA 2H1RA 3EYAA 5G2OA 3ZXSA 4A0FA 1Z75A 3G5UA 2H92A 2PLNA 4YPFA 3E3LA 2O3TA 5IXSA 1Y6GA 2X7XA 1YF3A 3F5DA 2GPYA 5EQDA 4BX0A 5JADA 5SY9A 4O4IF 1MAVA 3NWJA 4MS1B 3WHPA 1KEVA 1JDBC 4E07A 1LBIA 1Z0SA 5CYGA 1CQZA 4I7EA 2HL6A 5HDQA 4C4TA 2I7VA 1N75A 5CLIA 4OXQA 4E09A 2DWPA 3HBAA 2WPDA 2OC4A 3MLBA 2R3SA 4PANA 3KOUA 3WHKA 3CNHA 4GX1A 1GKLA 3KS9A 4KXXA 3VPHA 1RWOA 4B6RA 3ZD6A 5JNRA 1GPUA 2OMEA 2OCPA 1WV0A 2V9PA 1LK0A 1UFKA 3GFTA 3O4VA 3KWFA 4JU8A 1KYTA 4F3YA 4ZDIA 1NBMA 1JSCA 1OUMA 1V26A 3KXKA 1UBNA 4MGKR 4XIFA 5D5PA 3B5IA 1HLDA 4INOA 1Y37A 2ACWA 4HFNA 1R4MB 1ULUA 3KM0A 3SBDA 4CUZA 4E5UA 5LBIA 4J49A 3VKVA 1GILA 1M72A 2C29D 2ILTA 2QYOA 4H0CA 3ENNA 3NANA 2FN7A 4PSAA 5J4YA 3MXOA 4EHLA 1EU1A 4G2NA 3RVLA 1RJFA 3JWPA 4LIPD 1K7XB 2XTZA 4MVJF 5B53A 1OFGA 3IHTA 2J30A 2V7QA 1YFKA 3W5HA 4BKOA 3ER6A 2ZAIA 3UJPA 2W98A 5AKLA 2CEAA 5GJBA 4OHRA 4PTLA 3QMVA 2PUFA 5EP4A 2ZAOA 3QVMA 5K6TA 1L4FA 3QUTA 5KJEA 4EJ2A 1BA3A 4HMOA 1FDWA 2OG1A 1A0OA 3WLNA 2H6EA 3DYVA 1KI3A 3L46A 4R7ZA 2GN0A 3DDWA 4Y6GB 4Y2QA 4G4SO 3T41A 6LDHA 1DFGA 1IJKA 1GFWA 5DF1A 4TT3D 4DMFA 4WLVA 3KPVA 1Q77A 2WKWA 1GVNB 2Q62A 1HXHA 1H1LB 2A9JA 2QGNA 4IL5A 2GK4A 3VYWA 4B4VA 2QNIA 3L8YA 3V46A 2MYNA 4G0YA 1RJGA 1B76A 2BCJQ 3DEKA 4GH5A 3PC3A 2OHXA 2WU8A 3QG1A 4E15A 1FRFS 2A9OA 3LC0A 3VX4A 5CM2Z 4YRMA 2O2ZA 3W2EA 4DQKA 5JALA 4FMDB 4YV7A 2YMQA 3PSHA 1RFLA 1XMPA 3B6KA 3GLRA 5DYGA 1S1CA 1QE5A 1N57A 1RIFA 4R6WA 3ZNPA 3LYLA 1UBGA 5K8TA 1EAYA 1OBCA 2O2YA 4K9NA 1VG1A 3ZH2A 3C4VA 2J4CA 3ZBPA 2VBGA 1PR0A 2JHGA 1H6CA 4QJ4A 1FFDA 4XJTA 1PE0A 3ZBTA 3MMXA 3P9ZA 1P62B 5DIFA 4D6YA 2D62A 4AMGA 5F12A 1L7BA 2PL1A 3NRCA 4YJKA 2W42A 1BC5A 2DBQA 3OZGA 1Q0SA 3BXGA 4ZRNA 3BJZA 3ZJYA 1AV6A 2X9QA 3QELB 1DX4A 3FRIA 1N2CB 3GGSA 4YV2A 1GKKA 3LE8A 1TIKA 2VQDA 2WICA 3D1LA 4KI7A 1XJCA 1OC2A 1GQQA 4WECA 3DLAA 5ESXA 5L3VA 1V8OA 5ICFA 2DULA 2EG9A 3II6X 4L08A 4ALLA 1JL3A 2EFCB 4KKVA 4S05A 4AZ0A 4QQRA 2PHZA 1AOXA 2XSZA 3AR7A 1BS2A 4L8VA 5AM0A 3ONFA 2AJDA 4CMAA 4EI7A 3FCOA 3SSNA 1KP3A 4ZAVA 3VZPA 4XTCS 1NIJA 4FGKA 1YZFA 2W4IA 4YASA 3TW8B 3L40A 4BEBA 5HJEA 5K03A 3CKKA 2DQKA 3GRVA 3Q8LA 3TOVA 1Q0PA 2BP7A 2G1AA 4LHWA 4X1KB 1OWOA 2QMZA 4YJGA 2PX6A 3U60B 3L7LA 3JQFC 2CK3D 5KCMA 3HBMA 3G2QA 2XGJA 1DE0A 1ORWA 1QFMA 2O6HA 3ZCQA 4C5CA 3J80A 3L0DA 3NV7A 4WMLA 1MVOA 1W5FA 3CVXA 3K8YA 1V8DA 4KXYA 2ZT6A 5IHPA 5J4LA 3P2OA 5AOVA 5A5DA 5IJ0A 1GV1A 2WMNB 2F8MA 5DYYA 1PNRA 4I1IA 3X1JA 4FDVA 1UAGA 4ARBA 3H9CA 1EESA 3W3AA 1Z5NA 4KPGA 1YR9A 3VUEA 2XQKA 3L7NA 1XMIA 1MTZA 4QTTB 4RIGA 3UUGA 2DKNA 3N5CA 2HHLA 4QD3A 2IS4A 3VH1A 3QENA 4ALNA 3OOHA 4PSDA 4DCUA 2P9JA 2X86A 3UJ6A 3IUYA 4UVEA 3ES9A 5JV5A 3EA0A 3E05A 1XVIA 3ADCA 1H1DA 1PJLA 2C78A 3UWDA 2W2TA 5EI5A 4J0DA 2C7PA 1O1YA 4MKXA 3S3TA 1OZAA 4XGRA 3LQ2A 5G1PA 5B1SA 3CUYA 3B70A 5CM9C 4RTPA 3DCNA 1T8PA 5JT1A 3ZWDA 4Z0TA 2IHVA 4RH1A 2BIFA 3D4BA 4DYDA 2I6QA 4MITA 3KSBC 1GUFA 3C7CB 1U0RA 2P68A 2XUOA 3CUSA 3OKAA 4WLEA 4AUMA 2BM1A 3I34X 3TLEA 4OB8A 1K8XB 2Y0PA 3OIFA 4HAUA 1ZJYA 2XWSA 3HKCA 4H3KB 4LE0A 3TZKA 2NW6A 4UZSA 5IU6A 4H6VA 5TT1A 3ZU5A 1K0UA 3ZHVA 4DR2B 2VVTA 4YCLA 8LDHA 1H8EA 3QHAA 4XCVA 1N5RA 4Y1RA 3AJRA 4X0EA 1HUQA 2IODA 5IVIA 4XFDA 4M1WA 2M6LA 3SHWA 1HORA 1SA0A 5DX0A 4BE9A 1K0FA 4IPTA 1XNJA 5TF4A 1NZJA 1Q1ZA 4J7AA 1HQDA 4JLBA 3W1EA 4D4LA 4PNEA 4PZAA 4YP0A 4Q3KA 4QOEA 4DTIA 1KMMA 1PT8A 1H2HA 3PUHA 4IH1A 2IF0A 3E8MA 3C3KA 5EP3A 3T5MA 3UMVA 1Z8DA 1GOTA 1X2BA 3WP1B 1GZSA 4ZEOA 1PEAA 2VDVE 3EXEA 2W6IA 3TQQA 4CLEA 4UTVA 3EIQA 1JAZA 3QW4B 3FYCA 2XB9A 4ENVA 2GBLC 1VP3A 2N75A 3CRMA 3ICWA 3K31A 3SNHA 1U2GA 3EMDA 1D6JA 1QOZA 3RE1A 1UZLA 2IUFA 3ETDA 1LUAA 3GUUA 2K2WA 4FC6A 4PVDA 4XYGA 5AT1A 3TCKA 3PYMA 1SIOA 1ZN7A 3TBFA 3UV7A 3KLOA 4MV1A 1NI4A 1WKBA 2QVCA 4YCSA 1AU9A 5E2BA 1Y5NA 4TYWA 3JPYA 4X90A 4IYJA 3C14C 4BIMA 5ILOA 1LH0A 5DM0A 4DJAA 2PUDA 1VC2A 3FSRA 3S70A 2O8BA 2Z30A 4O2BB 1QU3A 4WADA 4EB8A 1Q2XA 3PQDA 4XB2A 4YMVA 1AE1A 1JFRA 1LVGA 2ZJ8A 3KBOA 3IPAA 1J8YF 4G1FA 5JSKA 4MA5A 1C8BA 2QX8A 3QPCA 5BO5A 5JARA 3IKVA 3EZGA 2HWKA 3X0DA 2Q99A 5A2GA 4TVOA 5U9CA 2I2AA 3UKOA 2HJHA 2OPBA 3JX9A 3SLGA 4O3FA 1J9GA 2QAGA 2CY0A 3FNGA 3V8PA 3EJWA 1E9RA 4E31A 4EYEA 4YRFA 4CTJA 4DIEA 1H6DA 5BV7A 1DS6A 3Q2IA 1KQPA 3L0SA 2YH2A 3F6SA 2H57A 4XUEA 4U7WA 3CZ9A 2RIRA 1MOQA 1XJ5A 4DMKA 5KQMA 4TZKA 1IBKB 4QNRA 2XZLA 3MC1A 4X71A 1WTCA 3IEXA 1STOA 4AJLA 1IRIA 1N78A 3Q98A 3P9CA 4ZC8A 2I3DA 4DR1B 3VPCA 1E3EA 1U1EA 2WAYA 1FRNA 2ZSHA 2NZWA 5HF8A 4ZA2A 2W37A 5DX1A 1KVRA 4X00A 4G5FA 1SU6A 4ARCA 1X13A 2DFPA 1UMBB 3BREA 3PFFA 2JPDA 3MMPA 4OBXA 2D06A 2G5TA 3E4CA 4DANA 1AMNA 4O4LB 1RC1A 3M2TA 5E0KB 1MN6A 2G0AA 5FFNA 2M6KA 4BNKA 3GT4A 1JU3A 3QLEA 4QHSA 1JIQA 3PC7A 3ZKWA 3HXPA 1R3UA 1DC8A 4QAQA 4RFSA 5SY6A 2BSQA 4OHXA 3KAPA 3OTHA 5KTTA 2VLBA 1UWVA 2FZEA 1MPTA 3QXSA 2G9NA 3H5RA 2QI9F 3RHZA 1Z5GA 2HZ7A 2UZ3A 4PRKA 2I9PA 1M1ZA 3HZHA 2OXCA 2GXAA 1Z16A 3IUEA 2BEKA 1B7GO 3BDIA 5EFZA 3DZKA 3P2JA 3RIHA 3NH6A 1Z5ZA 1JEDA 2X1MA 1I1QB 2PZ8A 2ECOA 3EEYA 4YNBA 2OYSA 1QOPB 4GI5A 5LP6B 5AHOA 3L82B 5EGSA 5JCOA 3G0HA 1VA4A 5IT0A 2QGFA 3FPAA 3GHYA 5K8JB 3MT0A 1G4HA 1B73A 3FOWA 3UJAA 4MUXA 2ICAA 3RIXA 3TZ6A 5LMCA 2BFFB 5DDIP 2SKCA 3PNSA 3DE3X 3O8QA 3PXGA 3DBOB 1FDIA 2XT9A 3TMKA 4NC9A 4UTRA 2I4OA 1P2UA 2GMWA 3FNHA 4H77A 4QGFA 4C0QC 4CV0A 2DU8A 4D98A 4PC7A 1MFPA 3NB0A 4H6WA 4J16C 3ZQKA 5JBQA 3KKPA 4RY0A 4FS8A 5BOVA 3JAMA 4EABA 1DHTA 2V7UA 4AX4A 4MJLA 4Y1RB 2HU7A 5TF0A 1T3HA 3UKJA 3K94A 4HWTA 5KWEA 4YXWD 2K4MA 1KXJA 2YS7A 3I5AA 4HQKA 4CL2A 5LMUB 1DT3A 5BW5A 3M6WA 1CW2B 4X8MA 1PLJA 1DRKA 2QPAA 1PJBA 3NC0C 4DC0A 2IITA 1F6DA 3MB8A 3GEGA 5JNSA 2BONA 4NFYA 5IUKC 3E70C 4UU7A 4U1RA 3JASA 5J3JA 1E2PA 3IUSA 3IQGX 5C53B 3OQMA 1QQ5A 2HWYA 2UAGA 3QMWA 4Y9UA 3SX4A 4B84A 5JJKA 2QW8A 3S40A 3PUKA 4KLNA 4EUHA 4AO6A 2PH3A 1D4FA