2FW9A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAFRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw9A00
2FW6A 4YCCA 5CLFA 5BOSB 2FW8A 2ATEA 4GRDA 4YCDA 1D7AA 4Z7JA 4YCBA 5CLHA 2FW1A 2NSJA 5BOSA 2H31A 2FW9A 3RG8A 2FW7A 4AY4A 1U11A 3LP6A 3KUUA 3OPQA 5CLIA 5CLJA 2NSLA 4ZJYA 4ZK2A 2YWXA 3OOWA 4ZMBA 1QCZA 1XMPA 4JA0A 1O4VA 4ZC8A 2FWAA 5CVTA 2FWIA 4AY3A 3RGGA 5C5DA 2FWPA 3ORSA 2FWJA 5CTJA 4YCJA 2FWBA 4B4KA 5BORA 3TRHA 5CLGA 2NSHA
chains in the Genus database with same CATH superfamily
3ZVLA 4BFUA 3G5LA 5I9MA 4AJJA 3LP8A 4ESOA 1IZ8A 2NXJA 3DLIA 3UJAA 1RMTA 3QK7A 4BZQA 5F98A 1Y8AA 1BFKA 3AC0A 3RK1A 3NLLA 4ZAZA 5JXHA 5M04A 4FZRA 4JGIA 4ZAGA 1OZFA 2W6NA 3RHTA 1ICIA 2VDPB 4IS2A 4L74A 1UKYA 1UC9A 2GM9A 1PT7A 3DBHA 2FCRA 5MDHA 4BKUA 4HD8A 1BAPA 3U7EB 2AOXA 4B7XA 2I66A 4PHCA 1R6XA 2Z9BA 1V39A 2PYZA 3JX9A 4Q34A 2LCIA 1PS0A 2QL5A 1ZN8A 3BHNA 4EHFA 4AZVA 1MOZA 4WK4B 4DY6A 1KP2A 1B73A 5U4QA 1SH7A 2XKKA 2RGWA 3VC7A 4HWSA 3MC1A 1MUUA 1FMCA 4ERXA 4FVTA 3MIIA 4L72A 4YRMA 1BOOA 1H2BA 3NXKA 2TMKA 1NLYA 3I9KA 3MILA 1AKRA 3NOVA 3E27A 3G3EA 4RL4A 1BQEA 1XR3A 3D0RA 4XVUA 5K8CA 3AR8A 4BPBA 4MNTA 3KXPA 1PNQA 1SD5A 4CG0A 4FKZA 2IWRA 3FZNA 4GX0A 4CRWB 1NMQA 2G17A 5BQXA 3LFTA 3WLKX 2EZ4A 3ZZ1A 1C1DA 2VP2A 4BZPA 3T3MB 3GCDA 5I7OA 4C4YA 5CB0A 2OFXA 2HSWA 2O7RA 2RGEA 3OPYI 2WKQA 3G1TA 5CDGA 1P18A 5BN4A 1HDGO 1U2DC 4X8MA 5FV4A 4Q24A 3N2LA 2IGBA 3OMLA 1H2XA 4XM2A 1E1MA 3T52A 3R0QA 4Y9UA 3B51X 4J3NA 1SJ9A 3NHBA 3A4LA 3HI4A 2AI1A 3AR6A 1B2LA 1FP1D 4JVOA 2C1ZA 5CDYA 1KEEA 3F4BA 2BHNA 1K5HA 4RTSA 3KEQA 2CZQA 3IRVA 2JAWA 4PYLA 1A72A 5M3BA 2AN5A 1IPFA 2LDXA 4IIJA 4E09A 4BP1A 1IY9A 2VT7A 2QN6A 1NX9A 2JIZD 3AW9A 4AWXA 4E03A 4D56A 4PHTA 2NP6A 4RU1A 4M0DA 4WMLA 5LPNA 1XTIA 3V4ZA 2YOHA 3OQNA 3MJ4A 3HCNA 1C29B 5DW0A 3V8NA 1VLHA 1NPYA 2Y1XA 5DTMA 1UXKA 3ENVA 3R76A 2IS1A 5A02A 3DMTC 3Q7PA 3Q98A 4FFPA 4P08A 4JP3A 2D5CA 1ZNZA 3PGKA 2HMYB 3HDHA 3RBAA 2ZYIA 3C16C 4DJJA 4G41A 3E9EA 3D7RA 1P4AA 4KX3A 4D4LA 2AI3A 2W2TA 1JHPA 5HE8A 3TOXA 1F6BA 1KFCB 2PTHA 4PX3A 4YLYA 1AKYA 4JFAA 4BO2A 2GPYA 3R23A 4ZT7A 1VSBA 3SOZA 4LBYA 1G4UR 3LUHA 3D8BA 5K4HA 3GV0A 1FQKA 2QN1A 4WFQA 3UGJA 2XF8A 1DLIA 1A9OA 1PVDA 5IDYA 4ABTA 3IJPA 1TT5A 4NS1A 4N5HX 1P9RA 3OT5A 3C0KA 1YAJA 3B5IA 4XJVA 2GEJA 4N6OA 3Q7SA 5LBUA 3RTAA 5JNVA 4ZOLA 1KH1A 1KYYA 2EARA 4R9SA 1A7KA 2VH5R 4EQ6A 2IOQA 4PTLA 3ZCUA 1XB2A 1YVEI 2B83A 2VCEA 3CKLA 2FSIA 2RHCA 4LJ5A 3FNRA 1MPTA 4L8VA 1ISSA 3I52A 3BB1A 3Q2KA 3FR8A 4ARSA 5FQNA 3P2OA 4BNXA 3CZ4A 2QZPA 3MFYA 4MVJM 3DV2A 4F1WA 1E79D 2J87A 3SM9A 5EPUA 3E7XA 5SY6A 5EKXA 4GU5A 5JDCA 1MU0A 5FOSA 3F3KA 4QECA 1H22A 1BH2A 2OILA 2IPLA 2PHZA 1BXRA 3G2LA 1W36D 1W5TA 4BNTA 2FPRA 3OU7A 3FMFA 2B8JA 4WA7A 5EHNA 3I8XA 1KEVA 4IF6A 4UREA 1YR7A 2PGIA 2PMFA 4BNYA 3J81k 1RMYA 2O7SA 5H4HA 3T1OA 2ATEA 3CKKA 4GLFA 4UVIA 1FX1A 2CHUA 3I6YA 3EVFA 5I3CA 1K6JA 5KQPA 1BFDA 3ENQA 3QI2A 2LWIA 3BH0A 4ZVOA 2G40A 4B6EA 2Q2NA 3O8QA 4L6AA 2ZYUX 2R1TA 4ZEWA 3KEFA 3IAXA 3FPFA 3B53X 4H15A 1I6LA 1XHFA 1UOOA 4U6SA 3DE0X 2VDJA 4R2KA 3T5DA 4DZRA 5BN5B 2G88A 3D0OA 4BO5A 1UBUS 4PLVA 4CMHA 2JAUA 3L8FA 1T1SA 3NU1A 4Z9AA 3TB6A 3HJFA 2H1HA 1CJTC 1CUGA 2Z1NA 4BJ5A 3VMMA 2EAUA 1S3FA 2NZJA 5H02A 3WK9A 4C2AA 1GNSA 3CKYA 2O2ZA 2F43A 4I1SA 2C7GA 3LQYA 4QYTA 5JCOC 5KDDA 4G63A 1Z7GA 1L5YA 1OGJA 4Q4CA 2H65A 5FKJA 3V4PB 1I4WA 3OP4A 2H4HA 1BVRA 1VECA 4P7BA 1WRBA 5F5LA 3DB1A 4GFDA 4YH1A 3ECCA 3F5QA 2IXGA 1FJGB 1O9GA 5G02A 1KDTA 3KZVA 1G1MA 4Q02A 4TLMB 1WB4A 1CR1A 3ID6C 3ZV6A 4B43A 2NUBA 4ZCLA 1KIMA 3R5FA 4RADA 4JELA 2DECA 3GELA 5C4GB 4B6RA 2XEXA 4JU8A 4L8YA 1PTKA 4GZMA 4HGNA 1DX4A 4YRZA 1K66A 2FHSA 2CVOA 4UM9B 1Q1ZA 3K6JA 4AJEA 4I9UA 5D5QA 1E3IA 4Q4AA 1CYDA 3K9NA 1FRVA 2VNSA 4H6XA 3VU0A 4BV8A 1EB8A 4M0UA 4TKUB 2PFGA 4J1QA 1B23P 3IXMA 4HATA 2HZBA 3T5BA 2DVMA 1YFLA 3NX4A 1Z82A 5BOVA 3E2MA 4EDFA 3O84A 1YBMA 1LB1B 2WDPA 2XGMA 4L4XA 3GFOA 4OUDB 2CLLB 4PINA 4AKGA 1OXVA 4UVHA 3WAGA 3H4VA 1UWLA 3IBSA 3BEOA 3AM1A 4OJNA 1DQYA 3H6GA 2ZE5A 2HJRA 2BFAA 2R84A 3D6FA 3P9YA 5EIFA 3GWZA 4L8FA 3MXTA 5H7XA 1N7IA 5E9WA 3JVVA 1KI1A 1GWNA 3NDPA 3EVNA 4BKQA 4BNLA 3QHQA 1U5BB 2Q9AA 3QW4B 4OQ4A 2GWRA 5HHTA 3OOEA 1SVMA 3G0BA 4ZJYA 4RTRA 1DQPA 3WYNA 1Q1AA 1KQFA 1FP6A 1BN6A 4JJAA 2CLSA 1XA0A 2I6TA 2JFZA 1XTQA 2JHCA 4HB2A 3CEJA 2RK6A 4V0RA 3BQNB 1TO2E 1MB9A 5FOVA 5IT9A 1F4LA 2E5LB 2AT1A 4C21A 4D4JA 3Q11A 4PAMA 5CA0F 4H7EA 3BERA 2M9MA 1RYZA 3C3BA 3CM0A 5F9MA 3Q88A 4KOEC 4KU4A 1TGYA 4Q93A 5EKUA 2JIBA 1LI4A 2A94A 3OP1A 1CJMA 5BWBA 4Q4HB 4AMBA 3VAZA 5JAUA 2VNHA 3O9VA 4LVUA 1RQRA 3ULKA 1RWKA 3GA7A 1X42A 1ZOSA 2YXDA 3I5AA 4CMGA 3N5CA 5JS1A 1K7XB 4MQ6A 4AI6A 4YV2A 4XIGS 2HHHB 2P0YA 5J1TB 1AK2A 3ZJ4A 2W2MA 1ZI6A 5I9NA 5A9RA 1V6CA 1SZDA 1XDDA 3Q3VA 5JH7A 5JRJA 3UCEA 5M5BA 2O8CA 2R1VB 1YCGA 2C9MA 4KVGA 2V7EA 3HLTA 3QMMA 1MABA 2VF7A 5BQOA 3FY4A 3IUQA 1F7VA 3UK7A 3CX8A 1KIAA 2YYZA 4YGXB 1T2DA 2WHYA 3PVCA 2QBYA 1P2DA 4OBEA 1OVMA 4QATA 5CXUA 3OEYA 4E0BA 2M1ZA 1M10A 1N6KA 3W5CA 5JJIA 3WP1B 4QHSA 4URWR 3S68A 3NWEA 3ZLJA 1XE3A 1G6Q1 4PC6A 3PE6A 3HTXA 1ZIPA 2IHUA 4ALIA 3QPCA 1GRCA 2ZWVA 4KPUB 5K8LA 2CMDA 3H2HA 2JAOA 4P83A 1BW9B 1QMGA 3AERA 5TGZA 2I7DA 2BM9A 4QOIA 1OI2A 3OI7A 4C5CA 2SHKA 3KPUA 3AOEA 1ESCA 1SN7A 4K03A 4O1MA 3LGAA 3JD2A 1PZXA 2BKUA 3DFKA 3I9OA 4YCJA 3TTYA 2H7XA 1HI9A 3THYA 1RLIA 3PXUA 4P3XA 2ECFA 3KO8A 5BNFA 2RKWA 2JLVA 1YVDA 3SN6A 2FPLA 1TQ8A 5FR1A 4RGYA 3WKEA 1K68A 2H3HA 3NIFB 4JC5A 4B9AA 1T0IA 1RAGA 1JIKA 3TEFA 2CL5A 3BC1A 3IDZA 2OQRA 4LHYA 5CLIA 3VYRB 4EPRA 1FP2A 4QYXA 2MWMA 4YONB 5LQDA 4IWNA 5JXJA 5LQMA 3ETDA 2GN8A 4JQZA 5BWNA 5IASA 3S7ZA 1GPWB 2OM2A 5LIRA 3ADOA 2QW8A 3EHEA 1EFHA 2OO7A 3DPIA 1JLRA 3IT2A 4X0EA 1PFYA 4ZC8A 5IKPA 4R0MA 3ZZMA 2ZRKA 4G65A 1W87A 1AKVA 2NG1A 2Y9PB 1BRMA 3EMVA 3G49A 3M4XA 3U0BA 5CD9A 5K7SA 2XMQA 5L3QA 2RK3A 5L95A 2FNAA 1F5SA 1ODCA 1RAIA 1Z5VA 3U49A 1HE5A 4DLWA 4F8EA 3O1LA 5JZ9A 4N41A 1X1DA 4NYJQ 5F2EA 3A1UA 3WMRA 2BUCA 4C6RA 4YI3A 3JWIA 2X2FA 3KQSA 4PZUA 4ZU6X 2JK1A 3EUAA 3SHTA 2B4QA 4JI7B 1RWXA 4AB1A 3RE1A 4OHVA 2C92A 2X5XA 5AYVA 3N76A 5KWIA 2LRHA 3F4LA 1Q7CA 3RI3A 1OASA 4QHYA 4TYQA 3JYPA 1PD1A 3E9ZA 2WP8J 1DQNA 3IMEA 1TU4A 4GOJA 1I0IA 1CEXA 1SKQA 1WJGA 2O14A 3L9WA 4GKBA 3HACA 3O3NB 4HLNA 4RCYA 3HDQA 2BDUA 2XA1A 1JJIA 2QTWB 4I1YA 1P72A 4M1YA 3X2FA 4DVGA 4MHTA 4KFUA 4Q3EA 4YX9A 4X7RA 2WSSA 1HTTA 2D1TA 2JS7A 3L79A 4DSAA 5K99A 2YZ2A 2IOYA 3KZNA 1WZIA 1C3JA 4TS4A 2X5NA 2ZJFA 1TCBA 3BD6A 3PC6A 3K73O 8ADHA 1YVPA 3NVKI 3UC5A 1HKUA 5LBIA 4M9ZA 2Z2IA 1ODTC 3ZXYA 2WWRA 3N05A 1Z13A 2OXRA 4I55B 1UMDA 2P6NA 1MJFA 4C78A 3IAFA 5KQLA 4NPAA 1D07A 1SKYE 2EBFX 2YV5A 2WIAA 2V7UA 4EAAA 2UV8A 2VL7A 3MCTA 5ALOA 2JFHA 3E9RA 4RVOA 4G5RA 4NOMA 2D1FA 2W98A 2GZHA 1QCDA 1Z17A 2XA9A 3LYUA 3JQ7A 4R98A 3RDPA 3ZNNA 4P81A 3QVMA 4OJMX 3SJ7A 4DNPA 4RSRA 1Z88A 3H99A 2SKEA 4LMPA 4BJ6A 3B1VA 3NPAA 4BASA 1P2SA 2VKTA 5JXWA 4I1OA 3P27A 4S35A 1JAZA 1Q1EA 3M1AA 3L0BA 4G8BA 4PG8A 1QHSA 2M1XA 2FUNB 1DC8A 3WJAA 4AZWA 5JCZA 1GFZA 2O2DA 3BSYA 4QEZA 1PNTA 4RK1A 1WR8A 4XR4A 4ZQFA 5A5EA 1DC5A 5ADVA 1Z68A 1YB2A 2G5CA 2JCVA 3NTQA 3T9CA 3NDJA 3TOVA 3UGTA 1K8QA 3WQHA 4BX0A 3VR5D 3VKWA 3T9AA 1TKRA 2GA9A 3VAYA 4YCNA 5AXDA 4CUZA 1U0FA 1VDZA 1AQNA 3L7CA 1RYEA 2G07A 1Z2NX 2VG8A 3OQIB 3HJRA 4U8HA 1KOLA 1V43A 4IIUA 3IIIA 4X1KB 2WV7A 3UK6A 5HYVA 3BAZA 3N2IA 4FWTA 2H54A 4DUGD 3DZIA 1MTZA 3KKZA 5FPTA 1II9A 1JTEA 4REQA 2C96A 3OX3A 5YASA 1T2EA 4LJLA 1QPBA 3A4IA 1JXMA 1PF7E 3LPCA 4WD3A 5G1OA 3KV3O 1N25A 3AUKA 3LW7A 2H1SA 3B52X 1EVJA 3LVBA 2VDKB 4WCFA 1TM3E 3OCYA 3ICEA 5LA6F 1X8JA 4BRZA 1V26A 1CP3A 2VQ3A 5J5AA 5CLJA 1DG3A 4WOJA 3EAQA 5IYZB 4QUKA 4DW8A 4EKIA 3MRTA 3PNBA 1TKBA 1EHYA 1G21A 3LZCA 1NJFA 1V3UA 3OZBA 5JD4A 2FRXA 1NW6A 4MV1A 4WHMA 7ADHA 1IOWA 2IU3A 3ZD7A 1O94A 4B09A 5E6RA 4ZO7A 2NWQA 2R11A 3KOYA 3QG5A 3GGOA 4CHTA 1THZA 1LI7A 2V74B 3N8NA 4WKOA 1EB9A 4XGQA 3T7DA 4PRYA 3KU1A 1M5TA 1H2ZA 3I09A 1J21A 3OFKA 4MIOA 1QV6A 3S2ZA 3RC1A 1JHMA 1E7MA 2IYQA 1X8LA 4H7FA 4UM8B 2BH9A 3O21A 1XZGA 1D2HA 1VHQA 3UJCA 3OUUA 1G8PA 1U1DA 2B36A 3QF4A 1RWWA 4PONA 2QRQA 3W2EA 1CEYA 4Z8YA 2IHZA 2W2OA 2ETVA 3ZWXA 3KHSA 4BLUA 5L3VA 3T3OA 5CXSA 3B13B 2EFYA 3DL4A 1OAOA 2VK4A 4P34A 3TBKA 5DP2A 5BP7A 2UUAB 4QPCA 4UEOA 1R9MA 1Y3AA 1BCRB 1JZTA 3FRHA 4KBYA 3AR3A 5AJZA 3GUHA 1I24A 4WGFA 3S0JA 4L85A 1UAAA 2FDCA 1H2RS 2C82A 4HQOA 4MV9A 4BQEA 4H17A 3TM5A 2CXRA 3SHFA 1N2CA 4R2IA 4PCVA 4D96A 5BPHA 3P4YA 3NNNA 4S1OA 1WOMA 3C4JA 4RBNA 2PGLA 3CRZA 5KSPA 3TSOA 1N7GA 1M76A 1HRDA 3R44A 1QPGA 4H1VA 1QVWA 4UFNA 3SQDA 3ZIUA 3SK0A 4X7BA 3CBGA 2QGNA 1NATA 3EGOA 4QICA 2IFTA 1U80A 2QMYA 4JV5B 2GERA 5HK8A 1RJFA 3RT7A 5HJ2A 1X7ZB 4Y9TA 1DAKA 2V3WA 5B1YA 4RFVA 5CRIA 2R2GA 2ZGVA 3ANTA 3AUYA 4KQGA 3E03A 2EJWA 1XQ6A 3BVPA 3UK0A 5DHQA 3RTBA 1E89A 4XD2A 1VL8A 4I4IA 5DBOA 3AEKA 1X0XA 3R5TA 4MTLA 4DADA 3AVTA 4B17A 1RQ7A 4GR5A 2Z43A 1QHYA 3D8HA 2A1TR 1OC2A 2ZM5A 2AXNA 2G7MC 3ZX5A 4CQMA 1UKZA 4JODA 1NVVQ 1YB7A 4LY0A 4NFLA 4TVOA 6GPBA 4MRMB 2YYAA 2QVGA 3DWGA 1LNSA 4D6YA 4LF7B 1N2HA 2JW5A 1ZD1A 3LC7O 5EERA 1MOPA 4BWFB 1RZ3A 1I80A 3AUAA 3KVYA 3ACBA 1A82A 3QG1A 2VHUA 4LV8B 3WSWA 5IFLA 2CD9A 2GSDA 5ALPA 5LFAA 4JJZA 3DLAA 4FSXA 4W6QA 4J4BA 1BKYA 4Z9YA 1L1FA 5K0BA 3CGGA 3CPEA 5K0LA 3ABRB 1UBGA 2NU6B 3IRUA 1XLUA 3BSSA 4HFJA 1P73A 1NJSA 1ODJA 3OAAA 4DRXA 5TPZD 1ZPDA 3IUYA 1BMTA 5KNDH 5KPJA 3GLIE 7GPBA 3U60B 2UZ1A 3UICA 3G02A 3PRKE 4KSYA 4JUDX 1AY0A 4MB2A 7ABPA 5T67A 3HJHA 2QR5A 4YUAA 3KC2A 5C80A 2PRIA 3LUKA 3FUCA 3OPVA 4MKIA 2ZWIA 3RCBA 4OHXA 3WGIA 3AY6A 3BIXA 2VYCA 3QE0A 1X13A 1DIHA 3ZDRA 4EFKA 4EGFA 4RKQA 1YR8A 4OU5A 1S2NA 5ULLA 1WSDA 2AX3A 4EPXA 1U2GC 1FJHA 2RAFA 1BIFA 3H9CA 1W1UA 4ZCMA 3PR3A 5BQ5A 5C8YF 4V03A 3BE6A 4NENB 2OAEA 5TMDA 5T6BA 5DNWA 2YWJA 3QEJA 3DZBA 4BGIA 5BNIA 1Z18A 5TARA 2IDJA 1ORTA 2Q62A 4RXMA 2FZCA 5JBQA 4R2XA 2WAYA 5EP4A 3DOFA 3RRXA 4C3UA 1UJNA 4QVIA 3WK6A 3QE9Y 1WXWA 3CNHA 3AB7A 3WKCA 4OMCA 4NCIA 4Y2QA 2W83A 3PEYA 3DTVD 3HUEA 4HADA 4DRYA 4DCTA 2OQ2A 3EVZA 3K9CA 5T4EA 1YR2A 3GLIB 4IH9A 1ZXLA 3AY7A 3VDMA 2VSYA 2JAQA 2VP4A 2XEDA 2CDRA 2XVAA 1I9GA 2OLJA 4Z9FA 2J07A 1G8YA 1LZLA 5FL7D 2WPDD 1HT3A 2RHWA 2OTCA 5L3RA 2HXYA 1EP9A 2FFJA 4YUXA 1E7SA 2FR8C 5AI4A 4UCFA 2BH2A 2D2XA 3P9RA 3L7LA 4EW1A 4A0FA 1UP7A 1DDGA 4ROSA 1YUMA 4E3ZA 2JGDB 5DGIA 1CQJA 3A4NA 5JFOA 1G6HA 1K4KA 2QP3A 1U0NA 3LD9A 1VBKA 5DGCA 1C3EA 3DUWA 1BA2A 4G8CA 1PJRA 2VUUA 1IAQA 3SKYA 3UAVA 4CL0A 4C7OA 4URHA 3K1ZA 2YJGA 3RG8A 3N6XA 2J41A 5D1NA 4JI3B 3T7KA 2RJOA 1JTFA 1XEWX 4J9UE 1XPJA 4HQ6A 3PCTA 1OC4A 1MXHA 3QPDA 2C5AA 1DRUA 1EUDA 4PS1A 2GTIA 3UIEA 1T2CA 4U3JB 4WKNA 5CYPA 1U1CA 1FX0A 2SBTA 3EIEA 5AKHA 1Y4UA 5ALRA 3UKDA 3OM8A 1TKCA 1T36A 5ERXA 2J7PD 1W9HA 4IMJB 4RAOA 1YS1X 2GM5A 3UWSA 1JAXA 5FJIA 4RIHA 4ARIA 4E15A 3BM5A 4XEUA 1W48A 2I7CA 1LPMA 1NXWA 2WB2A 5IZCA 4E88A 1UL1X 1DFGA 5AUOB 3AVXA 3DT6A 2C2KA 4HAYA 1A7UA 4DMHA 3DHEA 1IJFA 3FFAA 3TVTA 5KX5B 1HX7A 4K9OA 3KFVA 3NV9A 5JQWA 1Z4OA 3JAWB 2FB9A 4U2EA 1LPPA 2XJ4A 5FYQA 4KE8A 1T6NA 4CM9A 1V1MA 1KI8A 4GPZA 1G0NA 2PT6A 3L7AA 3CUTA 4PC1A 1P2UA 1XYYA 5G0SA 4ZI2A 2YFHA 2GZ2A 4K26A 2GNOA 3C45A 3KLOA 2NUTB 4YJKA 4OI0A 2QT1A 2WNHA 3KZXA 4FCCA 2EKDA 1XF9A 4A5SA 5KREA 2RHGB 2TMGA 3JZFA 4NTZA 4S0XA 5BYKA 5IANA 1CUSA 4V0SA 2A9VA 5FBQB 3EASA 1HV8A 2YVLA 3AL2A 3LCCA 4G89A 1B0UA 3WLRA 1XKLA 2QZZA 5HNKA 1DX6A 1W75A 1Z8HA 1C0LA 3BK2A 4DNXA 2Y99A 5EJEA 4XPIA 2CT8A 3DL2A 2IYTA 4MPJA 5AVJA 3HNRA 4LE1A 3QOYA 4YJGB 3W4JA 5BSWA 1GV1A 2POQX 2B0JA 1IM5A 3QU2A 1VC2A 5DI9A 1JSLA 2AD5A 2VQDA 2BEUB 4HG2A 3ZIAD 1REQA 3E9CA 4YO7A 1MLDA 2BGNA 5ALIA 1MQAA 2Q3EA 1JKFA 4OB6A 4Q15A 1GSAA 3WQQA 2HBRA 2QA5A 5KTRA 3GLGE 5CFOA 3ZE1B 5BR8B 3MJSA 1UOQA 3ZKWB 1DV2A 1H4SA 1NYRA 3P9ZA 1M1YA 3UT5A 2ZSDA 2EBHX 5BV7A 5IKMA 3PJDA 4RLQA 1X80B 2PD6A 4NCHA 1YMQA 1TQDA 5ELLA 2HCRA 2JG3A 1CJCA 1M2OA 2P9HA 2Q0SA 4IUCS 1DKRA 4BQOA 3IUEA 4GC9A 4MR9A 5DLYA 1FW6A 4BL5A 5KNCD 4QXPA 3G8CA 5I01A 3K6RA 4EEZA 1GKUB 2RFLA 4ZD6A 3M49A 1QIJA 1WUKS 2PKYX 3OLZA 5GVRA 3VDXA 1I7DA 1GUAA 2WWXA 3N5KA 4K7JA 4OHBA 5BSFA 2C2WA 2QLLA 1V7QA 4GVPA 4G1EB 1UINA 1CB0A 2G76A 4XARA 1U0BB 1MKYA 3EGIA 2QZ9A 1G5FA 1RM0A 3LQ2A 3L6OO 5LQCA 3M83A 2BBTA 1O5OA 1T13A 1E4OA 1ZGCA 2Z9CA 3OPYB 3R40A 4HY3A 4QPZA 1G20A 1OV4A 1U98A 4IF4A 4O1IA 4W9RA 2BD0A 1NWCA 5IK2A 3ROKA 3O3MB 4V2IA 4HSGA 3RS2A 3YASA 4TZKA 1QRTA 1PUIA 2CD7A 2G9NA 4UNPA 3QUTA 4NBRA 4WLVA 1IHPA 1OI3A 5LL6P 4MO2A 5ESWA 3PEFA 5KMGA 3Q7RA 2WNIA 4MCAA 2YZMA 3VH4A 1EA7A 3Q8LA 3F5DA 3WHLA 1R66A 2Q5IA 2GAFA 2W4QA 2P6OA 4JVSB 1J8DA 1D09A 5IYZF 3L7KA 4CR6A 4I9FA 3GHYA 1VGQA 4FX2A 4C7BA 3BREA 3BXPA 2QVYX 2C99A 3QEKA 2OWEA 4FMCF 2V7QA 3DKVA 3IIMA 4DDTA 5KQGA 4LNHA 3VKHA 4FCTA 5HMLA 4FDMA 4KYUA 1JR3A 2GCIA 2PZMA 3MVEA 1S01A 5ECWA 3RAFC 2J3DA 4ALJA 2W43A 3F9RA 2AXQA 5DJ5A 2R751 5ALMA 1ZEJA 4LA4A 3WGMA 1HT2E 1M2VA 1VYHA 3B1WA 4CEHB 3GNQA 4YLGA 2EX0A 2MIIA 1P2VA 2WMYA 2GVZC 4ITRC 1F6WA 1QOZA 5J5CA 4DKXA 2RGRA 1DG9A 5A0VA 1GGHA 4BLQA 4IDPA 1Z26A 1OZGA 2BM1A 2QQ0A 2YVQA 1HFWA 4P9NA 4ENVA 2BGMA 1D2CA 1WHSB 1V9CA 2G5TA 4GYJA 4JCCA 5DGXA 5B1HA 5TB5A 4DM4A 4F4DA 4XLZA 2XCSB 4L0QA 1L4FA 3OA2A 2FW9A 3AUJB 3GDHA 2VHXA 2FSHA 2O0MA 1MT3A 1GEGA 4MUNA 3VKVA 4Z51A 4M1OA 1ISMA 3HV2A 4KIGA 5AFSA 3U3MA 4BUZA 5J43A 4ENPA 1QO9A 3HBLA 1CLUA 2FQWA 5LKRA 3EPLA 3NT5A 3OCZA 1CZKA 2ZVJA 1ILWA 1NQWA 2J0VA 2VPWA 3IP5A 4HVTA 4KGXA 2OV1A 4QUDA 4CEJB 4IO1A 1XTVA 2JGMA 3B3FA 2I2FA 2X58A 4LE2A 5E7QA 2XB8A 2HNAA 5GV8A 4DCNA 2C2GA 4KR6A 4IH1A 4CCAA 4GC5A 1R6UA 3OEHA 1Y7IA 5ALQA 3W3AD 2P5YA 4RXUA 2JZNA 3OHMA 3IE1A 2GX6A 1NU8A 2W6IA 5JZBA 1BU8A 4FDAA 4DB2A 3FPGA 2AJDA 1C3VA 3NW9A 3HUTA 1V5EA 4JDUA 2XNCA 5DYTA 3FCXA 3EFBA 3O1HB 4HXGA 3NIDB 3OZAA 2ZYWX 2CFRA 3TOSA 3ZCTA 3BGVA 3K0HA 4L08A 2O8FA 1CF4A 3ZJUA 3FNHA 1G42A 2UZIR 4K9KA 4H1HA 2AVDA 2CNNA 2YV2A 4LI0A 5AK5A 3OIYA 3PYLA 2HF7A 3SDZA 5K51A 3HI6A 3SQMA 1RP1A 1JKXA 1YRYE 3HB4X 5H16A 4CNQA 2VYFA 3D0QA 4ZKEA 3IYLW 3OE7A 4GG1A 4R9UC 3SZUA 1G4AE 2ZI6A 3IALA 2IHTA 3T7CA 4BNMA 4ZI7F 1SG6A 5IJ9B 1XNRB 4N48A 4ECEA 1M1UA 2IP2A 2O5CA 2GPJA 2VYND 4HAIA 2R8BA 3MT9A 1VKHA 2AOUB 1QO0D 2FXIA 2Y76A 4UZSA 5MGNA 1H93A 1UODA 1TVMA 4RHEA 2WMDA 3FTCA 3P9CA 3ZWPA 1OKKA 5KYWB 4QASA 1IN7A 2X42A 2ODEA 4WQMA 4A2QA 1EVLA 1BZYA 4JR1A 3WGVA 4Z7QB 2C7OA 2ZZNA 3CZ9A 4N7RA 1ZM3A 2DYKA 5M2QA 2OHJA 3A4YA 1FVOA 3UCXA 2W4IA 3TVDA 3ZOKA 3A4TA 4ZRMA 4Y2UA 3TQTA 4PR0A 1WQ3A 4BP3A 3DT8A 1JPNA 2AE1A 4W8HA 3U19A 3NBFA 1S5PA 1YA8A 3NAQA 2AZ4A 4D3DA 1PDVA 1J42A 2PVCA 1KI9A 4KR7A 3R7LA 4HK4A 4AJ2A 4MSUA 4NABA 5DN6A 1TIKA 2JHAA 3Q6NA 3HFJA 1WZ2A 3HZHA 2XB2A 2F90A 2VTVA 4BXOB 2XSZA 1X8KA 1VTKA 1T29A 5ADUS 5HF5A 4AJLA 1ZFNA 3FYTA 5H0IA 2I4IA 3DZCA 4PC2A 2PCLA 2YNMD 3PNVA 4N9QA 3EIQA 4RPLA 4NESA 1E9EA 1YMUA 5BYJA 4PYOA 3ROFA 5JANA 1HZZC 1VSUA 4PHHA 2D5BA 1HRKA 1ZP6A 1XLTA 1HT0A 2FSVA 2CYBA 4Y6SA 3ABQB 4NJEB 2NPOA 4F6LA 2BOVA 5L4SA 1E3QA 2INGX 3PYXA 4HN2A 3CLRD 1NW8A 1OXTA 4WSOA 3GJ5A 1KJIA 3BYZA 2FEOA 3LLMA 4GE0A 1AS3A 4FMDB 4LJRA 2QM7A 4HNRA 4ZZ0A 1IM8A 4Y2TA 5TS3A 4QLBA 1UK8A 2JB9A 3NRBA 2WEKA 2H11A 2NPIA 3GVPA 4HQNA 3HJGA 4OJYA 1YL5A 1ISGA 2JBWA 1FUEA 2C9CA 3EPPA 4WEOA 2WY2D 2IXAA 2R4QA 1NC3A 4AF8A 4J16A 2MOKA 3JWJA 3ZX4A 3LDFA 3UATA 4BFZA 1NMSA 3I92A 5DO9A 4KO8A 3C6MA 1HNWB 1FLNA 1Q6YA 3L4BA 1T9HA 4NAHA 3LCUA 4CDRA 3QWAA 4N7BA 3UW3A 4JH0A 1CVLA 1WMEA 1O96B 2DCMA 4UVGA 5TT1A 2QX8A 5ALYA 3OU2A 4Y0NA 5WRFA 1NR7A 2FEPA 4IDNA 2OENG 3H42B 4FHFA 3R0ZA 4UHFA 1IATA 4OQPA 1MC4A 3WHKA 3ZPXA 1XIVA 2VT2A 3QFFA 2WZQA 3BMNB 4L1KA 1SG0A 3GMTA 4EFMA 3UW1A 1TQHA 1NE7A 1HDIA 2I80A 3TG8A 4BVEA 3ETCA 1RADA 5EFZA 2OLKA 1ADYA 3GFQA 3LUAA 1XXLA 4HB3A 4DPMA 4BIIA 3CF4A 3AR2A 3EQZA 1A95A 2EXXA 3UMCA 3TLJA 4AZSA 2A5DA 4JNKA 3AUTA 4INAA 3K9LA 4A92A 2P35A 2Y1GA 3TFOA 5CVTA 2PJRA 2CJWB 1ZJJA 5JZVA 1L5HB 3CVUA 2Z4RA 4E5PA 5C2JB 5JUWA 3AF6A 2Q5JA 4C0KA 4ZI3A 1Y6JA 2VCHA 4URFA 5BN5A 3WYDA 5IG2A 121PA 4JX8A 2IBMA 1T4GA 4UE3S 4LRXA 4P36A 1CR4A 1AZTA 1L7EA 1QZUA 2PO5A 3AH8A 1M66A 3HR8A 2XUZA 5CJ2A 4D9HA 3T7IA 3UJPA 1B7GO 1A1SA 1XN4A 1UKVY 3GJZA 3CVVA 3MTDA 5HQ3B 5A4KA 4KQEA 5ITZB 2VJMB 1SK8A 2QG6A 3HCCA 4CM8B 1HO3A 1V9LA 1D4OA 4BC0A 3KDPA 1Y8QB 2ZTHA 3ED5A 1Z2CA 3FNGA 1AJEA 1EG2A 2FCAA 4FE3A 2OP0A 3WR5A 4F86A 5JSUA 3HY4A 5GM2A 2ZAGA 4QZVA 1KYIA 2HHJA 2OYCA 1QG0A 3T41A 3NBUA 3EMDA 2TMYA 2X13A 3E3OA 5DCWA 3IQWA 4NNOA 5LZ9A 3WV4A 2QN3A 4Q00A 5KOIA 2DR3A 1T9CA 3QNUA 1CB7A 3AJRA 4GZ6A 3ND5A 4WAUA 4FOLA 1QRDA 4TGLA 4GMHA 3V34A 3F4KA 1SXJC 5EJ6A 2G6TA 2GN4A 2ISSD 2P65A 1KC3A 4IG4A 2EFJA 5FWYB 3NOOA 3MZ0A 5CJJA 4ZGBA 3FZGA 1TEHA 3A3PA 3SNKA 1JKJB 3BA6A 4WLUA 5DXJA 4AKEA 1LPAB 4JHLA 4RD1A 2PSDA 2XD4A 2WYOA 3O0DA 4CM1A 5BSRA 3UWKA 2XBMA 1DFIA 2VEOA 1YRLA 2C1XA 4Y3UA 4E5NA 2GN1A 4ACAA 2NYVA 3W04A 1LKZA 1WVIA 2WQZA 2CCGA 2DY0A 4OUDA 4AKTA 4D8XA 3IIJA 3G8DA 2WTMA 3Q9UA 5EJ4A 3E5NA 3MJEA 1Y5NA 2YQ5A 3KVNA 3Q3IA 5KOYA 1PT6A 1Q0HA 4LGMA 5H8WA 5M34A 4W5JA 3WJ7A 3E1KA 1JU4A 4B4OA 2JKVA 2WF6A 2Q5QA 1OR8A 3CJRA 2VAMA 4CZ2A 4F71A 3IXLA 3NBQA 4MVCA 1FYWA 1LNZA 4Y2VA 4Y2JA 3R9XB 5G4KB 2P5TB 1U5BA 4NEQA 4F3RA 1SQSA 5BUZA 4WJKB 3N1UA 1KQPA 2P6MA 3ESAA 2EFDB 3NOXA 4I3FA 3QVUA 4P58A 4YUVA 1YIOA 2FMFA 3VO8A 3IBCA 1G4HA 3CR3C 5DHAA 5CFZA 1M34B 2CHGA 3PXEA 4JXKA 5T6MA 1EUQA 2JIRA 4J1TC 1QFJA 3R6WA 3A0UA 5E4JA 1CK4A 4Q12A 2FX2A 1O4WA 4M8LA 3VR5H 8ABPA 5FBLB 1AV6A 2OHOA 1YVRA 3K9QO 3KR1A 1L3IA 2GXSA 5JY6A 4DSTA 1ZYUA 2QSUA 4AW9A 3ROPA 5LR6A 5KAMA 5IVKA 3IPRA 4QLAA 4J03A 4Q4HA 4BMCA 4QAJA 3EPKA 1RHMA 4EQ6B 2AOTA 1Z37A 2ODBA 2WYHA 3ZY6A 1UDBA 2D1RA 4RY9A 1TAGA 3AV0B 1QRRA 3L0ZA 5LDGA 3FN4A 5CM8B 3TAHA 3A4VA 1UEXC 1KJNA 3MT0A 4JK3A 5IXSA 1TK2A 1K86A 1KFBB 3LA8A 4TWIA 5T4HA 4QG3A 1DHRA 2XUIA 5K0SA 4LGCA 4NYIR 4JOCA 1K5GA 1E7QA 4GXQA 2Y1DA 4CI0B 2HPAA 4ZQEA 3LOQA 4R1LA 1U28A 2GA8A 4J7AA 1KKLA 3F6CA 4G4SO 4IVQA 4M0LA 4G0VA 2PO7A 4R1SA 2ODQA 4DR6B 2R85A 3Q9NA 1SBHA 4GBED 1TTPB 5ITSA 1T15A 3GJ6A 2HRDA 1NG1A 2V3CC 3QPVA 1Z4PX 1ZUHA 2A1IA 3FWPA 4AFNA 1T9ZA 4I14A 4IBOA 5IZ4A 3NHZA 1YI1A 3IR6A 5LXTF 3TSYA 3TZLA 4OQDA 3KIPA 4RC9A 3FJYA 4KPUA 3I2YX 2I4NA 2WG1A 1BW9A 4KYTA 1TGVA 1G6KA 1MB0A 1ZGBA 2WJAA 2C2YA 4H35A 4HFMA 4NPCA 5B4TA 1RWBA 1S7GA 3HPRA 3GA0A 821PA 5B5SA 3IMCA 4S05A 3K92A 3DE4X 4IIEA 4KQHA 2DFPA 2M6KA 3WMXA 4WESB 4F97A 2PK3A 4UARA 5FUWA 3R0VA 3UHOA 1F2DA 2ZM6B 1QOPB 1DCTA 2YH2A 2Q49A 3BZUA 3R2JA 5E4FA 4E5VA 4KFCA 1QE3A 2I54A 5J4KA 4JLWA 3AB8A 3EGXB 2ACWA 1XALA 1Y9AA 3H2SA 4OGWA 3ZBTA 3ZW8A 1X15A 1NPTO 3NZEA 5I45A 3BB4A 1TT7A 2EQAA 1CY4A 1MENA 2WF7A 3M89A 2ATCA 3O95A 1U3CA 1ZK4A 1ANKA 3OIVA 5GONB 4W5TA 3SEQA 3GLTA 5JRDS 1KBOA 3DH0A 4J49A 2Z4TA 5AKEA 3WK8A 3GLKA 4YQZA 2WWFA 5C0OE 4RIIA 2I9PA 1T35A 2XJ9A 4PAQA 3SZOA 1KSHA 1NZDA 2DTXA 2HYIC 4F5WA 2HO4A 5GMOA 2NVOA 4MJ3A 3O03A 2MSWA 1OLUB 4E2ZA 8LDHA 7MDHA 5LWHA 5CTAA 1XPRA 3CH5A 1WUHS 3TRKA 1HORA 1RXYA 4AUMA 1D9ZA 1RQPA 1UWKA 1KO8A 1ENOA 3OCUA 2AZTA 2O19A 3D4LA 3EX7C 1ODFA 1Z5GA 4DIBA 1CZNA 4HLDA 2O54A 4MUGA 1CPYA 4MP8A 4RDHA 4UTRA 2ECPA 3UNXA 3JQ6A 4DYVA 4JIMA 2RH8A 3I6QA 4Y1RB 3PFNA 3PQEA 4ALKA 2GDJA 1MB2A 2ZJ1A 4G0UA 4MZDA 1RXIA 5EQDA 2R1UA 4WK6A 3A6ZA 4BWVA 2XQJA 3KEGA 1T8YA 3QVVA 3AXTA 4LRWA 1YCDA 3HGMA 2Y2UA 1W0JD 5JYBA 3PGVA 4P35A 3EVTA 3FVTA 4PYKA 2OXIA 2WOOA 4F21A 1FY2A 1B1CA 1Q6ZA 3GGSA 4YP9A 3RRBA 3B1JA 3BBPA 4HNHA 4TN5A 4I55A 5FFFA 3ICWA 4YRIA 1CIVA 2A5JA 5HF9A 4G9GA 1ZD3A 4JXJA 3R0JA 1HDZA 3MTEA 2J9FB 1O8BA 3FZYA 4JC0A 4IUDS 3DUFB 2CDCA 4FTWA 1QR6A 5AHWA 5AI8A 4G1UC 5ANRB 2HRQA 2Q5CA 4ALNA 1MV8A 3W9SA 1GLGA 3EZXA 3ZDCA 2A0XA 1L5SA 1VB3A 2X6QA 4GDFA 4KLCA 3RSSA 3DAPA 3C6BA 4NBTA 2JPDA 2MU1A 5FLYA 1IRXA 4E22A 1JMYA 2FZKA 4RVFA 6ADHA 3RANA 3PEUA 3PWTA 5FUMA 2XODA 4R2MA 1ZWLA 1ZW1A 3V2UA 3VC1A 4I1IA 4DOMA 5KOHB 1EFRD 4PGGA 3QENA 5E2BA 4BFCA 4WY5A 4FOPA 4PCLA 3PQ3A 2H17A 1AZWA 2VAPA 3PKIA 2LZ0A 3T3IA 4CTKA 3ECSA 3JS5A 1WMDA 4QQFA 3QYPA 9LDBA 1QHHB 3OEEA 3DNFA 4QQ8A 3LG2A 1YBAA 4AAYA 5FH9A 4IHJF 3OQIA 4BCDA 4Q4LA 1NTRA 1F9EA 1P0CA 4X1KA 1CZUA 4WKGA 5DNCA 4D4MA 5INTA 4S1TA 4OL9A 4KGZA 1WV0A 1JDSA 3E8SA 4F4HA 3QXJA 1FRZA 4PANA 3DXZA 3O1JC 4LRYA 4N8DA 1CERA 1MW9X 4AYTA 2XUFA 4OSPA 3WLMA 2Y71A 1AS0A 1RC0A 2NSHA 3A05A 4K6GA 3OF2A 2CE7A 3NBAA 3WLIA 1GUBA 1W4LA 4UUOA 1LS1A 3RHZA 1K7EB 4A27A 2FQYA 2YQZA 1MRZA 2HUNA 4HP8A 4DLTA 4JWKA 1QU3A 3VOSA 1E4VA 2EGGA 1RCTE 1XMXA 3HVJA 3FH0A 1QQAA 1MA3A 1PBNA 4BLOA 4NBLA 4F38A 5IYZA 1HETA 4LXQA 4N5DA 2P41A 2RGUA 1XRSB 1NZJA 5J4HA 2O5EA 1YFKA 3WIBA 2AFIE 2ZW9A 3RSZA 3GP3A 4WKBA 3BMOB 4XLLA 7YASA 3LO5A 1GN8A 4RQTA 1DUVG 4DY4A 3R8CA 2OGSA 2PV0A 5FOXA 1IZ9A 3H9EO 1HLFA 2CSUA 4C30A 1S8FA 2R1ZA 2XKAA 4XWGA 2QR2A 4CIAA 3UG6A 4W5HA 3GJTA 2JCXA 1WP9A 2XUDA 4Y1FA 5LQRA 5HCNA 3WMEA 4BZXA 1KI6B 2DBVO 3G9TA 4ES6A 5BVGB 1H4TA 1SOVA 2OOKA 4EATA 1HQYE 1JXAA 3G2QA 1RZUA 4XRRA 1AKQA 3BJEA 4RF2A 4LF5B 3L40A 3EFEA 4DQ0A 3NHYA 4L3WA 2OFOA 1MRSA 2JHFA 4LXYA 4AJ4A 1KBQA 3KOWA 4IIYA 3S5UA 1WDTA 1UQTA 5JADA 5EVJA 1UBHS 2C4TA 2ALJA 5B7QA 4H59A 5CK4A 2F00A 1BCRA 2XMGA 1AGNA 4ZTUB 4KQ1A 1K0UA 4RK4A 3S1LA 3NJ8A 4D9JA 2FMHA 1BE1A 1Z7BA 2BZ1A 2E5FA 2HLDA 3H5RA 4HQ0A 1QH8B 3K20A 1U8FO 5BORA 4JZYA 1R4NB 2IUUA 1I1NA 1STOA 1AB6A 1V6AA 2AFVA 2XRFA 1QFMA 4NEHB 2Q1YA 3HSKA 3ZQKA 3A37A 3GZNA 3IURA 3LX6A 3ORQA 1N6HA 5D5HA 1USWA 4MPPA 2HDWA 2JLQA 2P90A 4FFDA 3FHCB 4J7UA 3TNLA 1EAYA 3DE1X 2ZYGA 4UJ3A 2BFPA 1VJ5A 3EZ7A 3NUQA 3FF1A 1E1LA 1GPYA 3H9BA 4HKTA 3RC7A 1X7ZA 2XTZA 1FDWA 2V97A 2O2JA 2WFMA 2OO5A 4IAOA 4YAGA 2YN0A 2QSYA 3HKEB 2GSWA 1XVTA 2DULA 3FE2A 3LRTA 4X7PA 1KJJA 3U7QB 2GHTA 2BM8A 2H0QA 1YDWA 4UE6A 5A03A 5BNZA 3KUKA 1EGHA 4ABYA 2VF8A 3ZI0A 2VS1A 4HNQA 4NK4A 3E84A 2VI5A 1AA9A 2XHEA 1XOIA 3A9VA 2VUHB 1E0DA 4GRIA 1L7MA 1QK3A 2OD7A 2FXVA 3PC3A 2Q0QA 4QUAA 2BEVB 3AF5A 4BAZA 1DIOB 3C3WA 3MGBA 1ZGGA 2ID9A 1GA6A 2DGDA 1Q44A 3QBEA 1K6MA 2GBGA 2GCOB 4GNKA 4MRMA 1RBQA 2GAAA 2J4DA 4EB8A 2Y92A 3AFGA 2OB2A 2B9VA 1D2EA 1QWOA 4LK3A 2ASEA 1R3UA 1E59A 4MVJD 3LF1A 2JKYA 2RSLA 3INNA 4C6SA 1BO6A 5A0TA 4HDMB 1GIAA 4NONA 1CDDA 5FWDA 4AK9A 3VJRA 2BGWA 2V3VA 5JECA 2NU6A 3KQMA 3GB9A 3VJLA 4A6PA 1UMBB 4URUR 1SVLA 2X9VA 4EL5A 1FNDA 5LP1A 1P4RA 4X84A 2OCXA 1GNPA 3JQ9A 2G1AA 1RYDA 2GPNA 3T3PB 1CR2A 1TVCA 2HFJA 5KNCH 4P4SB 4PV7A 3UAXA 2DQZA 2RHTA 3EMBA 2K5UA 2X7HA 4ND6A 4BO1A 1DOZA 3U7RA 2BONA 4YPVA 4YJ3F 4ZT2A 1SIWA 2FLKA 5L7TA 2DUNA 4OMFG 1ZMOA 5F52A 1M74A 4MW2A 3SIRA 3ZZ0A 4F85A 3R5SA 1YI0A 5CDFA 3BJRA 4FNOA 3SC3A 2CXSA 4ZQCB 4KUEA 3R6GA 1HK7A 2ZXFA 2B7BA 4BJ1A 5C81A 1QV9A 4NENA 5K45A 1CNMA 3EQ7A 4ZOAA 1JDVA 5CLQA 1UC8A 3O26A 4QQNA 4PW0A 5EZ6B 1I6WA 1JTVA 4Q9AA 1O6FA 2RI0A 3LRPA 2BBWA 4KE9A 2JIPA 4N3CA 1Q3TA 3UEOA 2XMPA 4RJJA 1FRFS 5ENDA 2EKQA 4UPEA 1P81A 3KZ1E 5AVUA 3RBVA 2RIPA 2QZ4A 2J85A 3STVA 4PTZA 5FNVF 4MWSA 2DWOA 4H31A 3K0AB 3GLIA 1WY7A 4PBRA 4QU5A 4Z99A 3PUHA 2W8ZA 1TW3A 2QI9F 4MEJA 3F73A 2GD6A 2E55A 2GZSA 3VZCA 2H1OA 4M46A 3TTXA 3BQ9A 2WM2A 4W8GA 2ZCJA 1KZYC 1A8PA 2FHPA 1YK0A 1QYCA 1YASA 3IAM6 1T9AA 2JLSA 2VYQA 1E4EB 4BEVA 1F7UA 5D01A 1RQXA 2J3MA 2R7AA 2Z1DA 3CLTD 3MTJA 3OOSA 3TLZA 3ROXA 4Z3KA 2JGDA 1DIBA 4QYSA 4H16A 1KSGA 2UVQA 4RF4A 1EWKA 1YK1A 5FOUA 1N2XA 2X0EA 1KY2A 3BXOA 4NX2A 1G2QA 2H5LA 3MJRA 1PJBA 1EX7A 1UAYA 4R40A 5EQFA 4RTLA 5KVCA 1BHQ1 2GK4A 2FRVA 4WUVA 3R9IA 3QUBA 2XOEA 2ZXEA 2BE7A 4IVNA 1CUEA 4GMXA 1T0PA 4E14A 3WIOA 4US2R 1NHWA 3NHKA 1OF1A 1FU8A 2QTBA 1ISPA 1L7RA 2RG1A 4U3JA 5HKLA 5HK9A 3K0KA 3VYVA 4B4UA 4KW7A 3ZI4A 4QNNA 3L4KA 4CCWA 4G85A 1EI9A 4RMHA 3DVAB 2ZSIA 1L7PA 4BFLA 3IB3A 3KU4A 3RFFA 2QUIA 5EKTA 1J00A 4FEEA 3ZHXA 4ISBA 1PV2A 2FKNA 1QAQA 4HEJA 4AYWA 1GV0A 1OGYA 3P7MA 4DTCA 3Q41A 1I7LA 4P0TA 3DBRB 3DE3X 3B38A 4BTEA 4QX6A 2OFFA 4UNNA 4YJFB 3BD8A 1U3TA 4V0OA 3UANA 5EGNA 5KX5A 4PU0A 3PICA 1NNSA 1EUYA 3ETEA 2SECE 2BEWB 3UGKA 1N5OX 3JAWA 1J1UA 1FSSA 5JALA 4J94A 1NMXA 2HN9A 3HGTA 4MULA 4ZODA 1CVIA 1SK9A 5IVPA 3W3AH 3E48A 4WFJA 3NBXX 1T2AA 2GAIA 4BYMA 3AJ9A 3CTMA 3E5HA 3GLHE 2NUTA 3JSAA 2W70A 3QX9A 2AZDA 1RJEA 4S0ZA 3QPAA 4DLBA 4QTYA 5CFNA 5LOVB 1TCCA 3W5UA 3EEYA 3WGNA 2EYUA 2VPIA 5L3SB 5I7EA 3EHDA 5DHPA 2HU8A 3RWBA 1APBA 1KVSA 1UZLA 3FWKA 4OV6B 2C2BA 2QTCA 1T9KA 3OTIA 1QDLB 1P3Y1 2RGXA 2EKBA 3MWDB 4I5GA 4INJA 4BC1A 4CLRB 2YUTA 1M6EX 2PUJA 3S2UA 3U48A 4YJGA 4PM4A 2A4MA 3B82A 5CIYA 4WK0B 2IOFK 4X00A 3OX1A 2XUAA 3RREA 2A2ZA 2G4VA 2X0RA 4Q1FA 4AKSA 3ICQB 2V03A 5JDCC 4ADSG 1A2KC 1AGXA 2C94A 3PBKA 4G56A 4X64B 1HG0A 3EOBI 5EJMA 5DEOA 3CNEA 1D0VA 1P29A 3DP7A 2RJNA 4K9DA 3HC7A 3FSGD 4EY5A 1DJPA 1NLUA 1Z63A 3HGQA 1OA0A 1CIPA 3B9BA 3F5SA 3FDZB 4OP2A 2AWNA 1QHNA 1YS4A 1BMFD 1ZOOA 2IYSA 1PBTA 2ZT5A 4G1CA 5DSXA 3WBFA 3ZV3A 1AQLA 1FDVA 4NF2A 4BZWA 1QGDA 1E9CA 4MVJG 3WWZA 1O0CA 5EXSA 4LKRA 4YROA 4QA9A 5JPIA 4NCKA 4L9RA 5TRTA 2QLMA 4MWBA 3ZU3A 3A1NA 2FPOA 1GJRA 1LRKA 1ODSA 1F4VA 4CTOA 1SHJA 3BXEA 1GPBA 1MORA 3FCAA 1K3TA 2D3WA 3ZK7A 5EFOA 3GJ7A 5KYTA 1ECPA 1A9ZA 1JLHA 1O95A 3L4JA 3ZWDA 2PMWB 5F3RA 2RAPA 3ZY3A 4BNKA 4CKEB 2GJ9A 2EVWX 1CBUA 1Q11A 3NASA 4M49A 3JQ8B 5CP8A 5D2CA 1X38A 1VI2A 3D6HA 1B6TA 4Y0VA 4Q18A 5AO9A 3ZBPA 4E12A 3P9KA 2X6TA 2BT4A 2ZDHA 2D2EA 2CNKA 3KAQA 4L5JA 3ND6A 2FSGA 5CJPA 3OPYA 2CMGA 3V1YA 3KYIB 4DBLE 4Q4JB 2JCBA 3VR2A 1Q1NA 1YB1A 1ULHA 1BC5A 2IYWA 2NIPA 4NL4H 4O3FA 2J3QA 4C88A 4QG7A 5JMTA 3SVLA 5CDHA 1D0SA 1ZAYA 1LS6A 2ZANA 2I67A 2DQKA 3C7KA 3AR5A 4LSGA 5HGXA 3DTVB 2AN4A 5A9TA 3BDAA 3GLFB 1JFTA 3FGPA 4LFCB 4HH1A 3MOIA 2WG0A 1ID1A 2A5GA 4HAZA 4DLPA 3DDHA 3K15A 4KLRA 5D7BA 1CG6A 2QX4A 4LOKA 4HVLA 4DV2B 4UFOA 3AVWA 4ZEMA 4HF7A 2H29A 4Y2HA 1NDUA 1B0PA 3I2KA 3KQHA 1YR9A 4HDRB 4JBXA 4DLUA 1TO6A 2CSXA 3OPNA 5BW5A 1P33A 3PLNA 3WGLA 2I4RA 4RENA 2ZJ6A 2AEJA 1LBHA 1ENYA 2HBYA 2PZFA 3CUEF 4LOIA 1BEZA 4QDJA 5ARBA 3ADBA 4N9WA 4I9GA 4QUIA 4U2CA 1E69A 3JZDA 3QMWA 5AJVB 1DJLA 1WLYA 3D6UA 1NMZA 4LIPD 4ZDKA 1AO3A 3DVLA 4GGPA 1WDLA 4NAVA 1GTRA 3ASYA 1MDBA 5JLJA 2DPLA 3HO6A 3UGQA 1JSCA 4UTOA 5ER6A 1DBSA 1ZKDA 1A4XA 5K2OA 1AA6A 2ZTLA 4ZVUA 1A76A 1V4NA 2PUEA 1QWSA 3GJSA 1NI4B 2G5GX 3OZDA 5GV7A 4EHBA 3GEEA 2FH5B 4ZO9A 2OV2A 3I53A 1K1EA 3DV9A 3RKUA 1NUAA 1SCKA 2Y1LA 2B7LA 3L92A 3V9PA 3IPAA 3MFQA 4I4TF 2DHDA 2PZKA 4QJBA 5DE3A 5AESA 4UBKA 4O6VA 5EJGA 2OD9A 3W8RA 2OMEA 4HH3C 4R0NA 4P3KA 4BGEA 4UNSA 4HT3B 1E3EA 1RWQA 2VWGA 2VDWA 1E9AA 1EDZA 1F51E 2W6PA 3AB3A 2JFVA 3R24A 1E8NA 4GXRA 5G1NA 1EFTA 2QMUA 4MVJI 4DIUA 4JP1A 2Q5HA 5LKAA 2JJQA 4FILA 3UJNA 4CEJA 3KR2A 4HUQB 3T5MA 1CQZA 1JB1A 1X77A 3FDJA 3K1JA 4HPJB 4A16A 5K0JA 2LXNA 5CB6A 1NVEA 4LVCA 4GYWA 4AZTA 2OBLA 3K70B 3Q9SA 2VSFA 3PUXA 4RVCA 2C00A 5K09A 4K1XA 2OA0A 2UXBB 3ORRA 5JD3A 3UXHA 5E2AA 4YUZA 4KIJA 2CMFA 1T5BA 4F06A 5FUYA 5C7LO 4MGHA 2DFTA 3ETHA 4F72A 4L5AA 4RPHA 4IG9A 2FW7A 1AN0A 3DULA 1BQ3A 2VEDA 3F71A 4JLMA 3SFZA 5HJEA 4BMZA 2CVQA 1CFJA 1ZUD1 3SS7X 1BHO1 4QYMA 2H1VA 5LVAA 4ZK2A 1R0XA 2C9BA 3W8EA 2A8YA 1EX6A 4QJ3A 3ICCA 4MAFA 4IKOA 3LWNA 1V2GA 2J09A 4D4GA 4NH4A 3UHFA 2ZRQA 3HA7A 5E38A 4G5FA 5DZSA 3I0MA 5AVVA 2H6EA 2KM1A 2HA6A 1D7OA 5FXMA 2E7ZA 3N2EA 1KPIA 3S70A 3NUZA 3L6RA 2PPLA 2H52A 5DBIA 4LPKA 3C3MA 3GAZA 4DNFA 1W25A 1L1QA 1N6OA 1V48A 4R51A 1WNTA 1YFJA 2EP7A 2GYWA 4OKNA 1GGKA 3H9JA 4PPQA 2BFDB 2XIJA 3EDCA 3H1TA 1YS9A 2AG1A 5B2ZA 3OCVA 1N3YA 1W96A 3ZDZB 4FYJA 2ZBFA 1PGQA 2V96A 3P9IA 2QTTA 4IXTA 3ZDXB 1RRCA 4RVHA 4IJUA 5KYWA 3DEHA 5KVQA 2BCGY 4TTSA 3AOEC 1ZOLA 2QRHA 2J59A 2XB4A 1TZCA 3P2MA 3ZGYA 2Q3LA 5FNZA 4YMGA 4A0GA 4INOA 1EQAA 1H42A 1RI5A 1DTEA 1U0TA 2ZIEA 4X8HA 5TS2A 4N8EA 2A5YB 1NVXQ 5EKSA 3EPHA 3LVQE 1G3MA 1CIJA 3BRWD 3P52A 4O33A 5KTOA 4A0QA 4A1OA 1EXMA 4RTMA 1JHVA 1Y8RB 1VKRA 3L2OB 3GRPA 3WKAA 4M8SA 4ZQHA 1AUXA 3HFSA 4GLLA 4B87A 1NJ5A 4WCDA 1L4LA 1DC7A 1GRQA 5EXEA 5ALVA 5L6LB 2ZE6A 3R41A 1N8KA 3HYCA 3KJNA 2AJ8A 2X8JB 5EUMA 2GCPA 2G3YA 3EOZA 1D6JA 4YIKA 4BB0A 3Q8MA 4BXOA 3G7SA 1Q5PA 4HC4A 3JTEA 2OCIA 1P91A 5EE9A 4CU2A 2MTBA 5EJ2A 4D8YA 2CLFB 3UJ8A 2F17A 4FD3A 3VZBA 2GPWA 1KI2A 3PVSA 4D9FA 1IHYA 4GDMA 4YQEA 3PGXA 4QNRA 5I7RA 2QMZA 1IJBA 4DUPA 4E7PA 2HEGA 3CMMA 3QLEA 4GLBA 4NJEA 5BXQC 3MWEA 5F7XA 1DL5A 2CNWA 1E3MA 4MDHA 3MD0A 4KR9A 3RF6A 1X1SA 4BV2A 4DCJA 2N46A 4WZBB 1M0EA 2F8MA 1ZIDA 2QLBA 3X1DA 1JR2A 1KZGB 4DG5A 1B3BA 1ABFA 4OMDA 1CUYA 1QX3A 4WBNB 2IU4A 3A7DA 4R2LA 3DR3A 5JLAA 2FLWA 1HXHA 1K8RA 4BB5A 1M2GA 2E82A 4J90A 4P92A 2A9RA 1L5GB 1EJ0A 3X1WA 5A0FA 1TFUA 5L4LA 4C05A 4JEMA 4FFVA 2F62A 2ADMA 3W79A 1K8ZB 2A3RA 2CUZA 1V1RB 3ZS9A 3H8VA 1IY8A 1CJBA 3GEDA 5LC1A 3KX2A 1QFZA 2ZTVA 5H83A 2Z04A 1A69A 2X0FA 4XX0A 4A4DA 4RULA 2OGWA 1O96A 5JQGF 3SCZA 4B2IA 1SB9A 3K2QA 3AEUA 1KEUA 1ZRNA 3V00A 4GVXA 2R3SA 1KHHA 4ITVA 1UJ6A 3W7BA 2ATIA 3OJCA 2APJA 2AYYA 1Y33E 1D8AA 4BVJA 1CTQA 1PS8A 3DMHA 3EOAI 2HQBA 3KJEA 3BMNA 2Q1WA 3TQIA 1O87A 1HLDA 1UPXA 1QE0A 4GSYA 1CUUA 1EZZA 5EWLB 4IDCA 2PQ0A 1O5IA 3GQBB 5KTMA 1GY8A 2WFZA 4JROA 1WF6A 1M7BA 1G5TA 1WMAA 3V8RA 4XB6B 1TK9A 1AGPA 2ERYA 3FKQA 4IEIA 3R74A 5DYNA 2CJWA 4Y1EA 4ETWA 4WNCA 1DQSA 2YDYA 3JQFA 2NOAA 1MJGA 3I9NA 4QU9A 5J1SB 4MMXB 2OCGA 3C43A 5EJFA 4MKFA 5K4GA 2A14A 4MGYR 2OGUA 3HUUA 4NBUA 4E5YA 2FUG6 3GPIA 3TZQA 2C54A 2Q3HA 4MGKR 2JD1A 2BDTA 2GVNA 3FVWA 3VU9A 4CMJA 5AKLA 1W5EA 3PNMA 4G0OA 3U31A 1D2MA 1NIPA 1QQ5A 1JECA 1L8AA 3IQFA 5EJ7A 1Y3DE 3TOCA 5HQ3A 5ITZA 3BTVA 4IQ4A 2VJMA 1SUCA 1WCWA 5BMVB 2C5LA 4CM8A 5CDUA 1XZ8A 3BAFA 1KTIA 5LOVF 3PJEA 1Y8QA 2O23A 3UV3A 3ELBA 1KGSA 1RSZA 2E37A 4XQCA 5A3JA 4KH0A 2FWBA 3D3KA 1LVUA 5AIAA 3HE3A 5IC5A 5LCXA 3BRQA 1TPZA 2VT3A 3HRIA 4XWOA 2A0UA 5CCBA 1QHGA 4WCFC 2VHZA 2HRCA 3RFVA 3RNOA 1SULA 3H18A 3H2JA 3R77A 4KLZA 4JI0B 4PZEA 1IY1A 1XP8A 2JI9A 4OSOA 4B74A 4BYGA 2ASVA 5KJCA 3U6BA 1N77A 4RJKA 4LXGA 4TXLA 2R6JA 1PZFA 3W90A 5FWYA 1CDOA 2CCKA 4WXEA 3AI3A 3C3XA 1O94C 1LSSA 1QVAA 1KMNA 1YZKA 1JKJA 3F47A 3LPMA 4WX2B 3WNDA 4ED9A 1K92A 1DCMA 4RPJA 3K5HA 4JI1B 2Q9BA 2QNRA 3COVA 3UM9A 1A4RA 1V95A 1BX0A 2QM8A 2QD5A 3S6JA 5HUHA 2QXYA 3M6VA 4DCUA 4OP1A 3EE6A 4QGSA 1ZN7A 3HXOA 2XT0A 3HSYA 5DH9A 4NCAA 1Y1SA 4RTPA 4NU5A 1JHDA 2R7KA 4OF4A 1JWLA 4Q3CA 1L7OA 1ZA1A 2QTRA 1H66A 3ASVA 3GUUA 3PDIA 4YJHB 1ZHOA 4HJXA 4X1YB 5EIHA 6Q21A 3P1JA 1OAOC 4ND1A 4WW0A 5E9JA 3N0RA 1QNLA 3C1TA 5GGXA 4CL3A 1QVZA 1Y48E 3J80A 5G4KA 2Q6IA 2FFRA 1R9GA 1QP8A 3U4QB 3FHJA 4JR0A 1WWKA 2O0JA 1NVDA 1U1FA 3RGGA 2R68A 3RVMA 1KYTA 5JEEA 1J20A 1Z39A 3DMPA 3NTVA 3U7HB 2C0PA 2JH3A 2NO1A 2VUTA 3A8TA 1E1YA 2XCIA 3ABSB 2YV4A 3NFYA 1HDRA 4LOJA 1A27A 3UBMA 1SIOA 3Q0EA 1ZJ6A 4YJ3A 1CT9A 2KS6A 4C0HA 2X0JA 4B2YA 3EEOA 5JISA 2RK4A 1T8UA 5AIBA 2IQIA 3WL5A 3C87A 3LC2O 3Q87B 2B21A 3O0TA 2R60A 2ZPUA 3O93A 4QLOA 3QU7A 2ZI4A 2GAJA 1DELA 1WDWB 4IOMA 3QVWA 1WUYA 3ANMA 3L5OA 4UXJA 3UMYA 1FL9A 4OA8A 2UZ3A 2VPTA 3KR9A 3NHSA 2H4ZA 5SZHB 1NDHA 3SLGA 4C2BA 4RVGA 4Q4DA 5C51B 4CNBA 4V0ME 3PXXA 2JCGA 4QGAA 3GIWA 5DBHX 3VZRA 4DR4B 4MUBA 1R0KA 2DETA 1ADBA 2I3DA 2PJUA 4ZO6A 1Z8NA 4TTAA 3G88A 2K7ZA 4OI2A 4WNYA 5AK0A 2VJYA 1W47A 1UQUA 3R3SA 1J2JA 2VCYA 3KOUA 3OIGA 4NDZA 4N03A 5FBHA 1ZNQO 3OLWA 2EJVA 4X8OA 3I8OA 3EFHA 1EXVA 1H2YA 1YA4A 2CNOA 4ASUA 2ILTA 5CURA 3VO9A 2Q6LA 1GNRA 2WNSA 3MAGA 4N3NA 1UMKA 2GJSA 1WPXA 2QWXA 2H2WA 3FZQA 5LLSA 4KPYA 1FMLA 3T15A 3T7JA 4XWWA 5L6MB 1N5RA 1NONA 1PYGA 4F46A 3C4QA 5ALDA 4YRKA 3W6OA 1DCKA 2Y1OA 3CJQA 3IL2A 2CMKA 3QVSA 3F96A 3RLIA 3DFZA 4EB3A 1YDGA 1NL3A 2DR2A 2F6RA 3IOCA 4RKEA 3CF2A 3LLSA 1JKMA 1XTSA 5JFGA 5IHPA 2ACKA 5JZOA 5EE3A 2JGLA 3NWPA 4QE3A 2GRJA 1R3DA 2AR0A 4OIMA 4HX2A 1KZ7B 3B3AA 4O2AF 3TSWA 1S2IA 4JVNA 3GXBA 1A9RA 4W5RA 1WBBA 1OROA 4LOLA 2XYHA 3AOGA 1KERA 2BMAA 4IMIB 1A98A 1WVGA 2VK8A 1GPH1 1R6BX 3EGXA 3NHFA 5KKAA 3SF8B 3GUVA 4MXDA 1R6DA 3E4DA 2F1KA 3K7EA 1BG6A 4GQAA 4Q16A 5HEKA 5IUNC 2R7MA 3D59A 3DKIA 4M9XA 1SBNE 2VSNA 1KJZA 4FGKA 4QPJC 5JAZA 4Z4EA 3RHFA 2O0HA 2QPOA 4I3HA 5HCUA 4OU4A 1JHZA 3MTBA 1L8QA 2OYRA 4BLVA 4DJDC 4IDQA 3OKCA 621PA 4OAQA 5JXIA 1RPAA 1QRUA 3PHHA 3ELYA 4B3JA 1OLUA 4QPNA 2I4MA 1L4NA 2C7BA 2DKOA 3KTAB 3H0CA 2WVAA 5BSUA 3H87A 3P9QA 2WKRA 4BNFA 3EEIA 4EO4A 2XWQA 5LWQA 2ID7A 4MQLA 3V8VA 4KXYA 3OQOA 1POWA 1KU6A 3A36A 3EWSA 5EQJB 3ZWCA 3Q7EA 3NTRA 4FHCA 3BT7A 3VZDA 1A7AA 5AQ1A 5ETJA 4LEIA 1LY1A 2HXSA 4BO3A 4YRTA 1H2EA 1VMEA 3ZHUA 3NORA 4Y1RA 2XE4A 3HUDA 1OQAA 4XIJA 1JXQA 2WHPB 1IY0A 4DJ5X 1VBNA 4DV5B 1KPGA 3F2VA 3IDSA 4GX1A 4RZXA 5GIOE 4ZXFA 1VZ3A 2ZI5A 4LG1A 1B4DA 1P7YA 1OUMA 4I5IA 1K27A 1X7HA 4B32A 4BRWA 3OZXA 4MYTA 4BZZA 3LIPA 2VTEA 4MVJH 1JLKA 1UMCB 1J22A 5A04A 1GG9A 3RC2A 3B1FA 4MQ4A 4RLHA 1SZPA 1ZIYA 1BS2A 1OXKB 1RXSA 2G09A 3D3JA 3D8UA 3PJFA 3R5HA 5FPHA 1C1XA 1XCGB 3NIGB 3CMCO 4AURA 5AM1A 2JAXA 4LZJA 2PAFA 2QNBA 3U3DA 4KREA 4BQRA 1W35A 2YJ3A 3G0IA 4WINA 3ZCXA 1IULA 4YDRA 1D2NA 2C77A 3BTSA 4H7DA 3PXCX 3DUFA 4DV3B 1GP2A 3P4XA 1U94A 3AM4A 1BDIA 1J8FA 1X2BA 3QWFA 1VLJA 3RUHA 2KHZA 2XT6A 3ADPA 3JQGA 2WAXA 4U9IS 1E1QA 4YAOA 4YWJA 1Z47A 5CEJA 2FG6C 5FA8A 3E9YA 5EUQB 4AMYA 4FIDA 5IZCC 1W93A 1RLOA 1YSCA 1KYWA 2IELA 2YIJA 5DHFA 5TMBA 4QKQA 1PT8A 2QDXA 1WM1A 4JSTA 1DO2A 5FBWB 3WGJA 2A7QA 4MWTA 3LP6A 4OHCA 3NHAA 2WA2A 1ZS9A 2VP9A 2X0NA 5HE9A 4BCBA 1GARA 3S2FA 4AZ0B 5KTNA 4KIWA 4EZEA 1B3RA 3U3ZA 1QHHA 4B3IA 4EYEA 4W6ZA 5ABPA 1UXJA 5LB4A 3CVYA 2GPTA 3IP6A 2ZIFA 3CSSA 4FZ3A 3REQB 4BE4A 2C8JA 4I5FA 2JIDA 2EATA 1NQOA 2ODTX 4TTRA 4UDYX 4YV0A 3KLBA 2RHRA 3QEMB 3ZXXA 3CLKA 3AMVA 3JPYA 1XZNA 1VIMA 4DV4B 1GZ7A 4ZJUA 2Q2VA 1E2LA 5AI0A 3TR0A 3V1NA 1F1BA 4QDOA 4QGHA 1FMFA 3H9QA 2CHFA 3B89A 5HOQA 4W5QA 1Z3IX 1GLVA 1BS1A 3SZMA 1E2DA 2P4UA 2H1LA 1Z0JA 1JV2B 2AHRA 4D41A 1UZNA 2ZB8A 4FCVA 3OH8A 4IIBA 1LRLA 4U1RA 3WZ2A 4EPTA 1KEKA 1SMKA 2DBQA 1FP4B 2RCNA 1V4BA 3MMSA 4INZA 4S1NA 3FR7A 3VR3D 4LF4B 2JA2A 2LPMA 3BMQB 5KU1A 2H92A 2BDEA 4EVQA 4RY0A 4ZJZA 3BMOA 4A0SA 2X1MA 2EWVA 2X9NA 3MT8A 4Z0TA 3RAJA 2DUWA 3D2LA 1DX9A 4ZC1A 3V4SA 5IN4A 3JCZA 3K1YA 4PQRA 4GI3A 3MBIA 2VWQA 3RVOA 2N1MA 4B7UA 2DT8A 3PDWA 1CWUA 4NQZA 3JALB 5JCPA 2R25B 1KI6A 3Q15C 1H9AA 3LP5A 4IIFA 4HNUA 5BVGA 4BPRA 1T91A 5JJLA 3WSTA 3HA2A 2O3QA 4AJKA 1VKJA 3Q2IA 3QPBA 4TT3D 4PNZA 1O1YA 3SIXA 2WZBA 1EDOA 4HDSB 4IEFB 3QYAA 3H75A 4V02A 4G3XA 4GOLD 2B4KA 2N3ZA 4AP9A 3FMOB 3S2GA 3DMDA 4I4TA 1HKHA 3CUUA 1QIHA 3V4OA 4CM4B 1BXKA 1E62A 3E3NA 4EHJA 2PUBA 2NN3C 1ZD2P 4R8SA 5DHTA 3X0DA 3W3ZB 1QH8A 3ABZA 5JDIA 1R4NA 3GPBA 1V8DA 2H4XA 1FOEB 4TV8B 1M2HA 2ET6A 3C3AA 4OPMA 1G63A 1PT5A 2O0LA 2OKGA 3E7FA 4HLCA 1XAIA 2AFIA 1VKZA 3SG0A 4B3DA 5EP1A 1Z0ZA 1UEJA 4DUZB 2FVYA 2ZRGA 4AUKA 1R5NA 3TZBA 3EBOA 4K8OA 5GZ3A 3CRQA 1PL8A 1PW5A 3VQTA 2BHRA 2QT0A 1OGIA 1QTRA 3TL3A 4E4TA 3HKEA 3U7QA 3D02A 3REOA 3UZUA 4CI9A 3FKSA 4RIGA 5B58T 2E4XA 2CMHA 3NGMA 2VSOA 5CIWA 2XIQA 2PKEA 3OFVA 2UYHA 3O90A 1RYHA 2C88A 1SBIA 3WGGA 4E21A 1NVWQ 2WSLA 1OFTA 3O73A 4UBLA 4BEWA 3L6BA 2BEVA 1WZNA 1K06A 1X7GA 2J67A 3FVVA 2GCOA 4X6YA 2I4TA 2OY0A 1FVXA 3O38A 1HPLA 1S9DA 1Y9JA 1E2FA 4V1CI 2DH6A 2Q1TA 3R6LA 4TZTA 1ESDA 4L5IA 1WB6A 1U8UA 5KYUA 5DTRA 3TEJA 4U0JA 3COYA 2J5XA 3ILVA 3TSAA 2QJFA 4ANFA 1PVOA 3E3AA 5B3JA 4HDMA 2A4KA 1Q0ZA 2FG7C 1SUEA 4NC9A 3O91A 3G2NA 1XJQA 1N2ZA 2JFFA 3FRIA 1NQTA 2FWRA 4MV5A 3S44A 4EGAA 3OUZA 2BSXA 4GWGA 1OH5A 4UATA 1UMBA 1B1AA 3GVHA 1P1HA 1LBTA 1GGNA 1P0FA 1KMMA 4ME6A 4EA9A 1DMRA 3CNBA 3HY3A 4OK3A 3R7BA 4B46A 3G7UA 4EGJA 5JAOA 2W11A 3KP1A 1RNLA 3CLVA 2LD4A 4Q7JB 4P4SA 2IYYA 3NHUA 4BVLA 4RKWA 4A8HA 1G8SA 2HA0A 1KAGA 2EP8A 4TRJA 2DPXA 4L22A 5KAPA 1TAHA 1IQPA 1DQRA 4MW9A 4ZAXA 4JB3A 3ZWMA 3F1KA 3FYUB 2VQEB 3K4QA 3DVRX 5ALEA 1NVVR 2FPIA 4TMYA 3RO7A 3VR5A 4ICIA 3GP5A 1E1RD 4NJMB 4P5DA 4XQGA 3RVBA 3HCOA 1UPBA 1YGPA 2VPXA 4RXTA 2BZ0A 3EZLA 1SKMA 4FNGA 4B44A 1KQ3A 5IH3A 4X1IB 5KCMA 2AMVA 2B2NA 3G68A 2W6CX 3EY9A 2PT9A 3UWPA 4AUEA 5M29A 2Q4TA 5DWDA 1RZRD 3OOHA 2D6FA 3A6JA 3KM0A 3CZMA 5AM5A 1SHZA 4LJSA 4D46A 5AW8A 5JAIA 1OIVA 3RYFB 2B4TO 1F1JA 1T1GA 4AF6A 1J1IA 2I87A 1YB4A 1EJ2A 3K0AA 2X1HA 2Y9MB 4FIZA 4G37A 1MAWA 4B48A 2ZVQX 2IYPA 3CNQS 4EYKA 2ZATA 2JD0A 4KLAA 5B3LA 1PV4A 2VPZA 1ORWA 1L4MA 3GCWA 2WK1A 2C31A 3HU5A 4IFEA 2E89A 1KO1A 1VFNA 3CIFA 1IVYA 4RVNA 4AF7A 4CIWA 1EP1B 3M81A 3RRZA 5CFQA 4YUWA 1GTMA 3CEMA 1E2PA 1XVIA 2IYRA 5DFAA 3VU1A 1YZGA 3SSAA 4Z1OA 4ZVMA 1EX9A 3RJMA 2F4NA 3N74A 3LU1A 2ISCA 3DQZA 3W5AA 1ZOPA 5TMEA 1U7UA 1Q95A 1A77A 1IJEA 3QSGA 2QP4A 4Q9DA 5FWAA 5EYPB 3TX2A 4Q1BA 7AT1A 1XTZA 3BFJA 1SOAA 1XJWA 4ZCRA 1GILA 3OZTA 2LR0A 5A71A 1IBKB 3H1FA 4FYIA 4DPLA 3QPWA 2ZB7A 4EEKA 3W4IA 5AW4A 3ZWNA 2OCPA 3QUSA 5P21A 3MRVA 2WM9B 1E9BA 3OCXA 3O82A 1IG0A 2QPAA 1RYNA 2Z2ZA 1LVHA 4FHDA 4PFSA 4OLBA 2JRCA 3DVAA 2CJFA 1ODKA 1ZHFA 2A5FA 3TJRA 3TRHA 5A6VA 5B7NA 1IU9A 2ZOSA 2OLEA 1JHXA 3KZCA 4QOFA 3ZW7A 5KC9A 1EIWA 3E3MA 3G9XA 4W4TA 1A50B 4GPBA 1HYGA 3HBNA 2R8PA 3SR0A 4Q7EA 4RV4A 2XTMA 1UWCA 3B1XA 3Q72A 3WLJA 2JD2A 2K87A 2P69A 2PMCA 4J3JA 4XM0A 2NZUG 4MI6A 4OJKA 2UUOA 1HNNA 2WUWE 2AIRA 1SBZA 1FJXA 4KRGA 4LE0A 4DR5B 3PF8A 1E92A 2BEWA 1XLTC 1DLJA 2FSVC 1H0KA 1A3CA 5F7JA 2G9ZA 2FFBA 2CY0A 1NNEA 2CV0A 5FUQA 5GJCA 1C1YA 2ORED 3MG9A 1KI4A 4L78A 2R5FA 2Q99A 4CDGA 2G8LA 5JI3E 3ER9A 4HNVA 1WF3A 3T5CA 1KMCA 4RMGA 3WMGA 2ECQA 3PT5A 2JGAA 2H00A 5LOVA 2PX3A 1E6WA 3IIEA 4DWVA 1ATIA 1OHHD 2SNIE 5E3IA 1G3RA 5IJ0B 1WU8A 5L3SA 1P9OA 3OQVA 4XOIA 1W88B 1S8OA 1Z2OX 2OZEA 2PNJA 5IABA 3CRMA 1JB9A 3C5CA 5CPFA 4EKEA 2AUNA 3MWDA 4M21A 4J16C 4CLRA 3KYDB 1I01A 1U2TA 3OO1A 4ZPXA 1NJ2A 3FPKA 2IP4A 4PYNA 2N1BA 5AM3A 1LLFA 1QIIA 1ORDA 2H4FA 1EX1A 3GLSA 3JAKB 3L4BC 4KR0A 2HU5A 1YIAA 1NKSA 1S3IA 4NMLA 3AM3A 4AN1A 1ZWKA 5EJAA 3TRFA 5CB8A 1Z83A 3EJWA 1FCJA 1SXJD 1H2FA 4CM5A 2CVFA 3SKXA 3QSYA 4E32A 5E6UB 2NW6A 4NP6A 3OESA 4L73A 3UXEA 1FNMA 3C8ZA 5DP1A 5AW2A 2Y2VA 1TQ6A 4KXWA 5A4IS 3DHYA 2BFEB 2ETXA 2MSNA 4FFLA 3FDZA 3V1UA 4XVCA 4B0OA 5HM8A 4MWZA 4FPXA 4ZYXA 3PL5A 2SCUB 3P20A 4S2EA 3TIIA 1W7AA 1BJKA 1AUPA 5JYEA 2OG2A 5BWLA 1JFFB 2QX7A 4U9UA 3ZE6A 1KDOA 1FUIA 2Q2WA 1RLTA 2B92A 2YZNA 1XTPA 3D6MA 3K2EA 2BI4A 3R7FA 1CY6A 3INGA 3VPDA 1NLFA 2FWPA 3WWDA 1Z06A 2OHHA 3OSZA 4IPTA 1IJKA 4HHEA 4G2TA 2PV7A 2QY6A 3PFCA 5IKOA 4UC0A 5LUBA 3NUGA 3B2EA 1OYVA 4J0GA 4CKEA 1KDRA 1S6YA 1Y42X 3EBPA 3URMA 1E18A 4F4IA 2PX4A 3AHHA 3TZEA 4C4AA 4KXMA 1O9BA 3ONVA 4LWQA 3IKJA 4WXPA 4CLXA 5C4IA 1XHLA 1HSOA 3S1AB 1LW7A 2ZBGA 4KDEA 4YP0A 5EI5A 1C8KA 1OY1A 1SELA 3COPA 3SIWA 1KQNA 1AB5A 2A84A 3HN2A 4TV9B 1K0FA 1SWVA 3IXQA 3VM6A 4PG7A 5IPFA 4IV8A 3HYNA 3KXDA 1Y98A 1R5OA 1SB8A 1X94A 3KYCB 2OECA 3CZRA 3IQHX 3HJAA 4FGJA 4EX6A 1E63A 3N75A 4MA5A 4Z49A 3DTVA 2JJ2A 4B83A 3UFXB 2ZYTX 4TLDA 3D7SA 3GLFA 3S28A 1SC1A 4ROTA 2ZSKA 3MYYA 1L5LA 1QHEA 2VJLA 4E51A 2A9FA 4FB4A 3P4UA 1ZSYA 1HG1A 4OAPA 3BICA 4BMNA 1NZFA 3E5MA 1V4VA 3AINA 4AWAA 1S3GA 4JT4A 1UAGA 4FR5A 4JIGA 2OG1A 5D3MA 3WGYA 5BT8A 4JT8A 3O4VA 3WIUA 1U7ZA 1AHHA 1E3JA 2H5JA 4MQFA 1YAHA 5DULA 1B16A 3MGKA 5B36A 4CQNA 1C7JA 1U4NA 3L82B 1Y5LA 1LTQA 3DOHA 1FSZA 4YV1A 1Y9DA 4E13A 4RX1A 4IZIA 1Q1GA 2YJZA 3OZSA 3Q40A 4PIPA 1J0AA 2XECA 3L8HA 3T1NA 1CV2A 1YUBA 4IMRA 4MPTA 4XAQA 3B9QA 3UK2A 1KJ9A 3V3TA 1NI4A 3AZOA 4H08A 5DGTA 1E7RA 2ZSAA 1M54A 3HR4A 4BVFA 4C7KA 2G77B 3I30X 5DOVA 1M2WA 1F14A 1F60A 3V8BA 1JJFA 4XUEA 3WIVA 1KK3A 4D8UA 1R15A 3E0XA 1TAUA 2PH1A 3S1SA 3SEFA 1EFLA 4QOEA 1Y6GA 1URPA 2B0CA 3JVUA 2ZUVA 4IZHA 3RS4A 4BLTA 4WA8A 1NOKA 1A88A 2AUMA 2J0UB 3O74A 2G6BA 3G59A 4L57A 2YC4C 1AO0A 2VDOB 3ORSA 3CISA 4Q21A 2GPSA 4RM2A 1QDUA 1KVQA 3AUUA 3L0PA 1JI0A 3OZEA 1RBMA 3GC6A 4HUQA 2VZLA 3FCCA 2E0IA 5D8DA 1DEAA 2ZB4A 5IDWA 1FQOA 2X9LA 1LNQA 1NXTA 2CUKA 3VOTA 2PG3A 4BNJA 1YDFA 4L4ZA 3LLUA 4NULA 3OZCA 1G7RA 5E3HA 2EERA 2XUOA 1ILEA 3GJ0A 3HKBB 3CZ5A 5HW0A 4IDDA 1MOSA 1U11A 2B8WA 3TECE 1G16A 3H83A 1ZHHA 5FIUA 3KBOA 4DMGA 2V7WA 3BWCA 3U39A 5EE1A 3OOWA 1P5FA 2EW8A 3RSLA 5A5VA 3EZ6A 1NUSA 1YZLA 2OZVA 1IWBB 2XXBA 2WVHA 1IQRA 2IDZA 3MTAA 1MJNA 1S8AA 3K0FA 1Y6QA 4CCSA 1K75A 2JASA 4OJQA 4GHWA 4EBFA 1ZBQA 1U28C 2LNDA 3IP9A 1SQFA 3KT0A 2XYRA 1NUTA 4ENSA 4PGAA 2JLYA 5FBVB 3L6UA 1U8AA 4MV4A 3OJLA 3K35A 1BDJA 3U7FB 3GN1A 3ZWWA 1G60A 1T10A 1WMFA 3KNZA 3A1FA 2NADA 5FDFA 2JJ1A 3JAMA 1OYOA 4L3OA 4IDOA 1JNYA 3TDKA 3WZLA 4F92B 2BFDA 4FEYA 1FTQA 4V0KA 2JDIA 4X65B 3R3WA 3E82A 4GKVA 3RAGA 3A7EA 1ISRA 5FCDA 1B6GA 4DWWA 2PMBA 3M4YA 2QU8A 3RPEA 5ISMA 4AVYA 3UVEA 4F2GA 3AVPA 2CHVA 3Q6MA 1N1GA 1ODLA 1I2ZA 2ADFA 1WD7A 1T2UA 4XJSA 3GRKA 2ZZMA 4W5NA 1N0WA 3UAYA 1XTJA 5CEFA 3MJHA 3QFSA 2G28A 1V45E 1FJ2A 4UHEA 1XNGA 2HCJB 1JEAA 5KNCA 1SCDA 2XUPA 3J81A 4TX1A 2R8XA 4Q47A 3KWMA 5T8KA 1FVHA 2R96A 4HAUA 5BV1A 1JA1A 3QQ5A 1PD0A 1XU4A 2QY9A 3DZ8A 2CDNA 3CR7A 3ITKA 3K5WA 3WDLA 1A9PA 4GBMA 5K0FA 2NGRA 1E2KA 4PGFA 2WTEA 5FUBA 3OC6A 3M2TA 4MAMA 4C4ZA 2I71A 1Q0QA 2WD8A 2BTOA 1LWOA 2X8JA 4KFSA 1YOVA 3F2IA 3CRNA 3HN7A 1IHOA 5BMOA