2FW9A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAFRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw9A00
5CLIA 1O4VA 2NSLA 4YCDA 4ZJYA 4AY3A 4ZC8A 2NSJA 5BOSB 5BOSA 1QCZA 4GRDA 4B4KA 4ZMBA 5CLFA 1D7AA 3OOWA 3RGGA 5CLJA 3OPQA 4JA0A 4ZK2A 2FWPA 2FW1A 3LP6A 2YWXA 3RG8A 2NSHA 3ORSA 4YCBA 3KUUA 4YCJA 4YCCA 2FWAA 2FW6A 5CLHA 5CVTA 1XMPA 2FW8A 3TRHA 5C5DA 4Z7JA 2FWJA 2ATEA 1U11A 2FWIA 2FW7A 2H31A 5CLGA 2FWBA 5BORA 2FW9A 4AY4A 5CTJA
chains in the Genus database with same CATH superfamily
4M1OA 2Q9AA 4PZAA 1NF8A 2LP4Y 4KQMA 4FW8A 2PYZA 5CA0F 3P94A 2PJZA 1QFMA 5IDVA 3WL4A 1X1QA 2CSUA 3ZXUB 3C45A 1P1HA 4RMNA 3K0HA 1NP7A 4Z6KA 1HMPA 4C4YA 1CV2A 1RRPA 4YHBA 1DMRA 3I1JA 1ZITA 4TWZA 2HNBA 3OG9A 3FZGA 3UAXA 1KO4A 3N76A 4M86A 1X1SA 4WH0A 3U3ZA 3WMEA 5ESXA 1PEYA 3BMQA 4FUQA 3ELWA 1JUDA 1DEHA 2QVCA 4MYCA 3FNIA 1YIAA 4ALKA 4O0LA 4FT2A 2Z2XA 1AURA 1D2CA 1F2TB 1F3OA 1JAHA 1TC1A 1N2BA 3TG2A 1B8PA 1EINA 1JHYA 5CU7A 2FUG1 3HG7A 2O4CA 5AKGA 2JI8A 3REQB 1DBSA 3KSBC 1VP9A 2BHLA 3V80A 3LF1A 2BP7B 3CLUD 3WGMA 4CDNA 3GCZA 4QYSA 4WVFA 4H7HA 4BLQA 1AKWA 2ZWVA 4CTJA 3E7PA 1AZLA 3U40A 1MB2A 3LH5A 4X84A 2QTVA 4D44A 1FUUA 4M0UA 1NMZA 2X2OA 4RGVA 3NEYA 2AH5A 4LZZA 3PL1A 4MR8A 4V02A 4RCZA 1RMTA 3EMDA 2CNBA 3N5KA 4MNTA 2Q50A 5I9IA 4HNAA 1CQZA 1YKFA 2VNIA 2YYYA 1T8UA 1PJ8A 4XEHA 3NT4A 4PRYA 2WFAA 2REQB 1NLZA 5AM5A 2CXRA 3EWNA 3OQPA 4NU0A 5TX7A 4WT7A 1MV8A 1K5HA 2ZAYA 2OZEA 1D6JA 4CF6A 5U4XA 3W9SA 1L8XA 5CR9A 5L95A 1XL0A 2XWPA 1HOTA 2GKGA 2YJ6A 4GRDA 4MWEA 3WLEA 3S1SA 2HR1A 3MT8A 4UVIA 3C4JA 3DBIA 1WZNA 2Z09A 4BZZA 4L5IA 3CEJA 3CGWA 3IERA 3HXKA 1ZNYA 3RIEA 3WKBA 1WKCA 1UDXA 4G8CA 4EUHA 5CFRA 5FUMA 1IB0A 2E4ZA 2JL1A 2CL0X 1GUYA 2RDMA 1E20A 4PGGA 1HEUA 3HYCA 1FFSA 3HXTA 5CUQA 2R47A 1M1YA 4NNOA 3RYFB 4CG2A 1CP2A 3I5XA 3CVVA 3ICEA 2GDJA 1TK2A 1ITZA 1YBVA 2ZULA 2D0IA 3HUTA 1SCDA 5J2TB 1AC5A 3BJEA 1P6XA 4CRWB 1AQUA 1HSZA 2J5BA 4GDMA 1E2PA 4R1PA 3AEYA 3D7RA 1YRWA 4FDAA 4Q3LA 3B9QA 4QUJA 2BFOA 5K3CA 4G4IA 1AK2A 4C6SA 3SEFA 4A6DA 1C4KA 4C3VA 1W93A 2ENWA 4XLZA 2HMSA 1XTIA 3B9RA 5J63A 4HO1X 2FOXA 4PV7A 1ZQ1A 1HYHA 1LA2A 2CUTA 2Y1CA 3EEIA 3GDFA 3KQQA 4Q4LA 3UAWA 3WGTA 2BGMA 1J1ZA 5TPWA 1FSPA 2SICE 4BKPA 4FGKA 4UXHA 2YYSA 2QRGA 3FJOA 4JVLA 4KU4A 1WXWA 4B3GA 1XP8A 1F8UA 2W00A 4QBKA 2H1WA 2V6JA 3L4EA 1UQRA 2GNPA 3FYTA 5C1BA 1AV7A 3C87A 4RZ3A 2AR9A 4MQBA 4FFLA 1XEAA 2QPOA 1J21A 3I9V6 3HM2A 2QYOA 4LS3A 3N2EA 3O82A 3KX2A 3E1KA 1JIKA 4W1RA 1VL5A 3OWXA 3C6BA 1E1RA 1IIBA 2QRZA 5K0NA 3NP7A 1QZZA 5LFAA 4AY4A 2CCKA 3WLSA 4WUVA 5ALDA 1LC3A 3F49S 3PV0A 4DRXA 1MX9A 5IYZF 4ZOEA 2C2ZA 2IYEA 4OP3A 4E1VA 4MR7B 1AKYA 4H4DA 1ND5A 4Y1GA 3H5OA 1N5RA 5IH7A 4A8TA 1AF4A 4N65A 1OB5A 2QW1A 1RACA 2NO7A 1PZFA 5DKFA 9LDBA 3H13A 3F74A 1JXMA 3BJZA 4M8LA 5BQPA 3ZY6A 4GS5A 5DK4A 3NAZA 3BIXA 2CLEB 4YRAA 5AOBA 3CN9A 1XRNA 2V3CC 1P0MA 3FZYA 1DQZA 2MINA 4MB2A 4EB0A 4F4FA 1JT2A 1IUKA 1ZQ9A 2EP8A 4Y2TA 1G63A 1KC3A 1KZ4A 1NQ5A 3TIIA 5JJKA 4KZPA 1WCIB 3MFQA 2RKBA 3SBEA 4AZ0A 1Y9DA 4M7WA 1ZA2A 3GJ4A 4Q1FA 4D0GA 4D3DA 1HX7A 2BZ1A 3HCRA 5LM3A 3HY4A 2YC2C 2J4FA 3WL6A 3KTAB 1QANA 2J31A 4R8KA 5DTRA 5HQJA 1LZKA 1EX1A 4JJ7A 5EZSA 3O1IC 4DMKA 5BQFA 3HYTA 1T8WA 4JXXA 1T6ZA 2RAVA 4CDGA 3DXFA 1Q7CA 4AWBA 3F5QA 5ERYA 4HYYA 5BMVF 2I8CA 1D6SA 5GZ1A 2YOHA 3LBAA 3LUJA 4I2VA 3N0TA 3KYCA 2VXCA 2HC9A 2GXUA 3DW1X 5KDOA 3GDWA 1XMSA 1DAIA 5LL6P 3T7KA 3ZWQA 3KJNA 1B8OA 1NATA 3CG0A 1JDVA 2Y77A 4P4GA 1SZDA 4F0JA 4RM2A 1SXQA 3KB1A 4F46A 4NEQA 4RORA 2C00A 1NLYA 3TL6A 1C1DB 3WL8A 3CVWA 4KSYA 3U0BA 4GOOD 3Q7TA 5IU6A 1RAHA 3MK31 3JZIA 1A9TA 1KP2A 2FFBA 1MA0A 1WP9A 3PKJA 4V3CA 1QCZA 4WZBA 5TF0A 5LA6F 1P80A 3ITEA 4I1SA 4P7JA 2GJSA 1KJZA 3NBUA 1Y8RA 1KI7A 2XKAA 5AHKA 5KYWA 4DSOA 1KTIA 3EGEA 1KQPA 1YJ8A 3LBFA 5SY9A 3LDHA 4DOMA 5E2IA 3R8XA 3IAAA 4AMGA 4AO6A 1X1TA 3M81A 1GM5A 3F73A 1KWKA 1AV6A 1RU3A 1YCDA 3UUFA 3IO3A 3KNZA 4D9MA 5A3RA 2BFWA 1G2OA 4I1IA 1OZAA 4KUGA 2BF4A 2ONKA 1KHTA 3A3KA 3BF8A 1TCVA 3KAPA 1TB4A 5FT9A 1T2AA 2MSWA 3RJ9A 1VKZA 5K8VA 4FONA 1VM6A 2HNAA 2IZ6A 2FRXA 1JR2A 4NV1A 4B4DA 2R7NA 1T9DA 2OV4A 1XXHB 4FVTA 4FFVA 4HMOA 3AERB 3IIKA 3RC1A 4ZQGA 1IN7A 4OQEA 3SYLA 3CZCA 3UM9A 4L1KA 4C4XA 4RTQA 1MT0A 3KJXA 4OSPA 3NTXA 4HAYA 5DGIA 2PZMA 2W6IA 3G7UA 4RKFA 2CFTA 3GY0A 5J5CA 2WOJA 2ZS7A 3DHWC 5BRNA 4ASUD 4WLFA 3Q9LA 2J6BA 3KSAC 2QUAA 1A77A 4G5YA 2PSFA 4JLJA 3PHBE 1C7EA 4REMA 1PR9A 4MVJH 3F2VA 1UQTA 2WJAA 3KVYA 3PGA1 4XIYA 3AFHA 2WHXA 2B1RA 1MNAA 3QG5A 3QUSA 1VHWA 1P29A 4YJ3A 3D4LA 1LDMA 1K6MA 2HV8A 4UZSA 4N03A 2V6FA 1EJ0A 1WIWA 1R0LA 1RYEA 4RULA 3AVVA 3GELA 3BREA 1E77A 1KEVA 2I62A 2I2WA 1RAIA 2OEPA 1XD8A 2XVMA 1LKZA 2CDRA 2ZYRA 3JZMA 1ORWA 2QTFA 2RMKA 5BV2P 1JA0A 2BEUA 5EIBD 4CXMA 4XR4A 1OBHA 2C07A 4MVJM 3RS0A 2QZSA 5AT1A 2HA5A 3Q3CA 3OZDA 4KK3A 2Q49A 1KDPA 4P5PA 3C14C 1DEOA 2IYZA 4PZCA 2QF7A 4YO8A 2PGNA 4TS9A 3RFTA 4XIIA 3L7KA 3QE0A 4E5UA 3HGTA 5FCDA 4B34A 5B12A 3DE6X 4JU8A 3ZU2A 4RZUA 3VKUA 1RWWA 1XPOA 4WQMA 4L95C 4RO0A 4U8HA 5IFLA 2YZNA 4MPTA 3OCCA 3KB8A 4PR3A 3HCDA 4H6XA 4M0KA 3FE2A 1YFZA 4M8KA 4TM7A 1C1XB 3OU7A 2WSLA 5I7FA 3K16A 4EJMA 1T6BY 1R0XA 1I1OA 3I2KA 1II8B 2AWNA 2AMFA 3KJGA 2AFRA 1B2RA 1UBSB 2V9ZA 3PNPA 3QKSA 1BJRE 4B09A 1HT1E 4B2PA 5J3JA 1KRWA 5H59A 4R0MA 4HX9A 3KHKA 3LO5A 1PKXA 2Y4NA 3VJRA 5FA8A 1VJ0A 1F6DA 3OZ7A 3EW7A 4EYKA 2PBZA 1D7OA 2O2CA 3CO0S 3IQHX 3K0KA 1S8FA 4PBRA 4CM9A 3B12A 1J5EB 1XVUA 2CHQA 2J5KA 3CTMA 3F5MA 4PC6A 5DLYA 4AF8A 1QQ7A 4IFTA 4F7DA 3R76A 1MRZA 4ZZ2A 2DFPA 1BE6A 4LG1A 3PSAA 1G5TA 5TPZA 3G23A 2Q6VA 1IVNA 2CLOB 5ALEA 1NXTA 2WFMA 2YN2A 1OI4A 3P0JA 1VMAA 2YVQA 4K6HA 4BZXA 4DLXA 3DPUA 4G9BA 4OOFA 3UATA 2JGFA 2ZWIA 4ND8B 4BP9A 3DZDA 4CF5A 3GVPA 4OHZA 2ZYHA 2PZFA 2HRCA 4N39A 3VI4B 4ZTUB 4CIWA 3H0KA 1N6IA 3PNQA 2NVOA 3UXHA 3SLGA 3DR5A 1PJBA 2WTEA 2GZ2A 2OYRA 1ISIA 4B83A 5C5IA 8AT1A 2M2IA 5HTOA 3F6RA 4WHMA 4BV2A 1G291 1P8AA 2DUMA 4UFOA 1A97A 2C7GA 4GR5A 3RGWS 4D74A 2JH9A 3DP7A 4MVJA 1O57A 4MQEB 3GVCA 4B3MB 2B0JA 3FJYA 2QMYA 1KETA 1FFBA 2FG7C 1MLDA 5F98A 1ND6A 1PFGA 2VP0A 1M8GA 3DKRA 3DUWA 4XFKA 3OJOA 4K9MA 1UJ2A 1FZTA 1UMDA 2NZVG 1NVVR 2W2PA 2JIPA 2BHRA 2PMFA 2ZBFA 3PX3A 1KEZA 3R6DA 4GWLA 4P3YA 4Y2QA 2OQ2A 2AUTA 2VP6A 4ZVMA 1XD2B 2FG5A 4ZYUA 1P19A 3FOEC 2OM2A 4PQFA 2PTHA 3ZV3A 2DLCX 1IYZA 5T41A 4ZGGA 2IPAB 4DYVA 1V8FA 2OFXA 3BWDD 1KZGB 1O96A 4H1TA 5CLQA 4QT0A 5HZMA 1KBQA 1KZ7B 1GQ2A 1L1QA 3COYA 4NFLA 1D3AA 4OXIA 5BUCA 2QT0A 4IDFA 4QUAA 5G53C 5CVJA 1NVXQ 4ALLA 4EI8A 4OCZA 3NB0A 3OCWA 4FZ3A 4NL4H 2FWIA 3CZ4A 4KPUB 2NZWA 4LFBB 1Y8CA 4C4OA 4F9TA 4K0KB 3KZNA 1GPNA 3PICA 4RK6A 3QXCA 4C7OB 5ALVA 5AXAA 1E6KA 4NEHB 1XLUA 1OGIA 3HFGA 4PC7A 3CN7A 3NPMA 2AR0A 4DGQA 1Z22A 2PH7A 5AW9A 4F4IA 4A6EA 2VP5A 2ODNA 4RFVA 2RARA 3WRYC 1EEXB 2KQUA 3IQGX 4DNXA 1V4BA 1O6ZA 2BFFA 1X8JA 1FF9A 1C0PA 1CUUA 1F5NA 2DUJA 1MH9A 3INTA 4P53A 2FY8A 1VIMA 5F12A 5F1OA 4DYDA 1KKUA 2IK8A 2X13A 4XWGA 5IAAA 2BMWA 1H2EA 3EGVA 2WJ3A 4WK4B 5IC5A 2VC2B 5AVRA 1QPZA 1SFRA 4EYGA 3HP7A 3OFNA 4IHKA 5JLJA 1ZMOA 3JQPA 1KGSA 4YUZA 5KNCH 1EVZA 3ON5A 4B82A 4DLAA 1U0OC 5A4DA 1OHHA 1G21B 5JQGB 3EISA 4D02A 4IMPA 5E6SA 3W3AD 1HKUA 3MTBA 3GB9A 1UPUA 1ZONA 4MRAA 4ENRA 3JQEA 2H7VA 3CZRA 3D3NA 1T1GA 2EBFX 1R4ZA 2QRVB 3CPSA 1CQIB 3ML1A 4EECA 3IV7A 1EVEA 1NXSA 5HX7A 2GFIA 1XZIA 2NT4A 2BM9A 4RUKA 3FTFA 1UBFA 2G1UA 2O19A 4KQ1A 4NBKA 1IDN1 5ALYA 3RS4A 3IAM1 2AK2A 5K8JB 4R41A 4EG3A 2PSJA 1E6EA 2CJFA 4TYQA 2H06A 2TRSB 3MPOA 2YMLA 3M6MD 3HVKA 1ZVQA 1RBQA 5JDCA 2IH4A 1BU8A 1XCOA 4UE6A 4Y2VA 5EMNA 5IAJA 1KK0A 4PYQA 3F7TA 4PG7A 4MAFA 3WIDA 3G2OA 2W6JA 4K5QA 4P22A 3DVAA 4PCUA 4RNDB 1C4XA 1RHMA 4YECA 3HI6A 4L0QA 2VBGA 4KYVA 2OZLB 2OD7A 1UWLA 2XBLA 1ULTA 2X3UA 1Q0RA 1GPKA 3H84A 1PHPA 2O1EA 3I0MA 3KYBA 1HEIA 2ZREA 4U6NA 4TVKA 1M7BA 2EDAA 1JDJA 3DTNA 1NQVA 4EGJA 1ZGHA 4LRYA 1NG9A 3ZGNA 3FLAA 1J8QA 3GVHA 2JGKA 2JI4A 4PFJA 4RL4A 3BH6A 4NYJQ 3LCCA 1DKPA 3QHQA 3OPMA 1E6LA 1TU4A 4NS1A 3CWZA 1UJNA 2NTJA 3GZNB 4LGMA 4NZYA 4H0CA 4RNCA 4BX0A 5KTTA 5L53A 4LZWA 5B3JA 1RLIA 3F7MA 1TT5B 3FNFA 3F6BX 4UFNA 1QUEA 3X1XA 2A4MA 4JB8A 1UPCA 5EWMB 1L7VC 2OV6A 3K1TA 3JPYA 3OMLA 4PLTA 2WIKA 1OAOA 1AKNA 1XSEA 1SVMA 5JCPA 5A04A 2QAIA 3AP1A 4MQFB 3HKBB 3GBSA 3H2SA 4YPOA 3AF0A 2II6A 3FPLA 2AZ4A 3NHPA 2P9ZA 2HA6A 1C9MA 3O8QA 1DPFA 2GK6A 2OZPA 2X86A 3AINA 1H2ZA 3C15C 3E5RA 1O5IA 1MU0A 3FSEA 1Z5OA 4ITUA 2RBEA 4U02A 1G64A 4C4PA 3LX5A 4MR9B 4AULA 4UOZA 3ADBA 2GJAA 4TZTA 4F3NA 1SC9A 1SBHA 2EKLA 3B7PA 3EZ9A 4TN1A 4EARA 5GIPE 2OECA 3L7DA 3UT5A 1CLUA 1CVIA 1T24A 3VKFA 3TLJA 2IZOA 2IU0A 2B9VA 4Y8VA 5AKEA 1EB8A 3A58B 1PS8A 4PLYA 3RARA 2PZGA 4AY5A 1B74A 1UC9A 4TSRA 1FDVA 2B0CA 3RUEA 2EYUA 2A9RA 5HRCA 1QH8B 2PQMA 3WRVA 1Y1RA 5EZ5A 5KNCA 5JCJD 2QY6A 2ZE6A 3FGOA 1T5IA 1QLHA 2I6XA 4B8ZA 4WZAB 1PT9A 1EFRA 3I2HA 2YHBA 3QIVA 1CQXA 3K1YA 3LX8A 3CEHA 2Q1XA 3AUFA 4RSMA 4OH1A 3X1WA 1RIIA 4JJIA 4ZIRA 1F5SA 1RLUA 3KLNA 3QEMB 5LSAA 3IAHA 1E9VA 1KU0A 2P6RA 4UAUA 5FBQB 5KTRA 2R8PA 1PW7A 1QHFA 3NX4A 2JJYA 5AI8A 1WKBA 1CZUA 1WDTA 3WNBA 2OY0A 3RVKA 2IIPA 2GWHA 3C70A 5AHWA 3LL7A 3OPYI 3DBRB 4UM5A 1KYVA 4DJ5X 1GUAA 3DBHA 3UY4A 1XTTA 3B3GA 3GH3A 5CHYA 5DN6A 3KT8A 3NGXA 1NA5A 4ETMA 1GN8A 3W5DA 1NUAA 1AUXA 1O77A 1DC5A 3ZDYB 1SD2A 1BG6A 4LGVA 5LN1A 1RZRA 2DTXA 3GFQA 5DYIA 4FDTA 3RE1A 3QFFA 4UUOA 3UPDA 4L4RA 4BB0A 2CXPA 4LY3A 1QIIA 1JEYA 3VC1A 4G2TA 1JN0A 1Z7EA 2Q3JA 1BAPA 5BURA 1IJFA 3CF0A 2GR9A 4BQPA 4CM8A 4KLCA 3FFAA 1V5WA 1ONPA 3JQFA 2AEMA 2EGHA 2JANA 3BICA 1S2DA 4OX9Y 2WTNA 2EJWA 6YASA 3AB3A 1RXSA 4PHCA 3KFXA 1CNFA 3IPCA 4DNQA 4G2NA 5AVQA 5K4GA 4LVNA 1DUVG 4OB6A 5HQ3A 2DH5A 2QORA 1ODIA 3H4IA 3VZDA 4NS4A 3EB9A 4DHWA 2IUYA 2RGNA 1Z8HA 3HB7A 5ALIA 3MGBA 2KI5A 1Y1PA 3IVAA 5GJWC 4XIGS 5EJGA 1LPSA 2Q5HA 4PX5A 1PWHA 5H16A 1G5HA 3QOWA 1ZMRA 3EZNA 2AMYA 5K3FA 5JNLA 4XLLA 2C4UA 4NOJA 1YWGO 4OMUA 5ARDA 2H9YA 4O02B 2NU9B 4CFYA 1BWPA 3L7LA 3B1ZA 4NF2A 5FUYA 1N3LA 1ZI6A 1K5DA 3D8NA 3O4FA 1C80A 2QD1A 3OHSX 5BT9A 3U80A 1E89A 3MBOA 5K6AA 3HVHA 5EHGA 3HN2A 3N2KB 3UWSA 5DCUA 2WWIA 3N3BC 2YHUA 1VLMA 1GG5A 1ZVJA 4CV2A 1C7QA 3FMFA 5ENDA 5T5QA 2FXIA 1BCRA 1N2CB 3VU9B 2UXBB 1S96A 3LOQA 4Y2HA 1P5HA 3N70A 1RXWA 1W8DA 3ZE2B 4EYEA 4LRTB 5FNVF 3FWPA 2RIPA 1H2WA 1DFIA 1FX0A 3DVLA 4HGRA 4OK5A 5ALSA 1JF8A 5JSYA 1K75A 1GTVA 2PR2A 1CY7A 4DAEA 1NW6A 1Z45A 3HDHA 1YB4A 1UODA 4IUCS 2I2AA 1YJBA 3UH1A 1WXGA 1M75A 4DPMA 2OT3B 3KTOA 4ZXFA 4CMEA 1HKHA 5C37A 1JKJA 1RQXA 4QGFA 2Y9PB 5AJXA 5LP6B 2PX5A 5F2KA 5LXTA 1DTEA 4WLOA 1U2PA 3GAZA 1I2BA 1Y5RA 1PDOA 1K27A 5FLKA 4AJKA 1WQ4A 2EFEB 4EHDA 2BRUC 1XMOB 1PI3A 3P0HA 3ZN2A 2DU8A 3UMMA 2ZRIA 4KREA 3G2NA 3BWVA 2WFZA 3HU1A 1GZ3A 4B44A 5DM70 5IUNC 3DVQX 2HWXA 3OU2A 5CK5A 1UC4B 2P35A 3ESXA 3PYXA 4N12A 5H70A 1J22A 1MAHA 4QJIA 5F2OA 3NIBA 1UBEA 2MSNA 1TOAA 4BLPA 1RC0A 3T3HA 1OA0A 3QNUA 3LY8A 2HQRA 2IEBA 3S1AA 3V4OA 2XF8A 1JXAA 3AR6A 1CR4A 2C1EA 1E9CA 1N0HA 3WWDA 1XX6A 3C8HA 1NTRA 4Q9DA 3H9CA 4FN4A 1N6KA 1E6UA 1JQKA 1LK7A 1L5LA 4EX6A 1Q84A 5YASA 3QXGA 5BWOA 2QTVB 1EXDA 2PCJA 2EBUA 2NZ2A 1SG6A 4MR8B 2EEZA 2R8YA 4YCJA 2OGUA 5CVUA 3AR7A 3UB4A 2V7VA 1KP3A 2XHZA 3U9TA 3IMKA 4GZMA 4CTKA 1R18A 2P3OA 2RHGB 1GNLA 4IGKA 4HNAB 1QYDA 1IK4A 2AF3C 3LWNA 1U8YA 4OKSA 4EVQA 4NJMA 1VCNA 1RCUA 3PUVA 1U7OA 4WLNA 4DNPA 5DX8A 4ALJA 3A27A 3EC2A 4C2BA 2H7YA 1KZ9A 1K2VN 1LFAA 5IF9A 2LCFA 3HUDA 3VYWA 5CDGA 1KQOA 4YP6A 2B1GA 1NRIA 5AHRA 3DB1A 3NJRA 1FDIA 1TMKA 1WVIA 4NOKA 5FUVA 5UKDA 5CB4A 2VZ0A 5D5PA 1Z29A 1PW5A 5A02A 1PTKA 3TR0A 2BMAA 4I50F 1DINA 1CNEA 1M1YB 2BHSA 2JCBA 2V7BA 3ABIA 4YMSA 2ZWPA 1CDOA 1GR0A 1RQPA 1ONSA 1TCCA 2D06A 3CXRA 3EF1A 5H7XA 5CAEA 1TUEA 1DX9A 4RPLA 3DQZA 3G0IA 3O3CA 3V8PA 2IHJA 2GJ4A 1FYEA 4P84A 3CGGA 4YCSA 2O8BA 4G37A 1X7XA 2XE4A 2I6FA 4PLVA 1AUQA 2AEFA 1FVOA 4N7MA 2Q1WA 4MW2A 2RSLA 2OFOA 3ESZA 2FVYA 3U7HB 4LJ7A 2DH6A 1R0SA 1O5OA 2R7LA 3R41A 3DEYX 1Q1NA 5KHAA 2ZVPX 5TPWB 2C7OA 1GPJA 4JP2A 5BSHA 4OD0A 3M3PA 5CK4A 1AT1A 4R2HA 1GV0A 2C54A 2E1PA 3CZ9A 1OH8A 3WP1B 3JRXA 2C0QA 2HJVA 4Y2GA 3JXEA 2VR1A 1K7FB 3GG9A 3JQ9A 4RMHA 1Z6QA 5GM1A 4YBZA 3QYAA 4G0UA 3DTYA 3KKEA 2XQIA 1RJEA 3D6TB 4YVFA 4AZSA 5LZ8A 4AS1A 2ZBGA 2BF7A 1HFKA 5G3ZA 5IWAB 3BA1A 2PWBA 3PCXA 1PFUA 4XFJA 2WICA 5C32A 1YQDA 1RWVA 2XXJA 4J7XA 4PYLA 221PA 4DRXB 1I4WA 3QPBA 4QUGA 1ZHHA 5BSRA 4QWWA 5K6TA 5IM4A 5AW8A 4H3KB 1AKVA 1ZM4A 3L1VA 4E2YA 5TVKA 1AUPA 1H5QA 5DNDA 5FR2A 3I92A 2PT6A 2F59A 3QKIA 3O03A 5DH9A 1UK9A 1QQBA 1NE2A 2BVNA 1W4ZA 3QEAZ 4KHPB 3HCFA 2ZRKA 3IUPA 1VL2A 4MQ4A 2QN2A 3R23A 1W0JA 4Q1CA 4DJTA 5EWLB 3CUUA 3MTGA 5F7OA 4KGZA 3OURA 4L51A 4H3VA 1HE8B 4FSDA 5I5GA 2MINB 4ZVKA 1FS6A 3TBKA 4CF3A 1J09A 1O8BA 2RB4A 1VECA 3A6FA 3KFLA 3FYHA 2W2TA 3GFFA 3U9LA 2FPXA 3GLIE 5WRFA 4AZ0B 3AXTA 3QV1A 4GO1A 1TF2A 3NC1C 3QLVA 5HMLA 1OVGA 3JPWA 3LUFA 2O8FA 1VYVA 1RXVA 1NT2A 1ZNXA 4HP8A 3DMTC 2FKNA 4ETWA 1ELOA 1ATZA 5D5QA 3T15A 5G2OA 1M6YA 2Y1LA 4ZQBA 4D4IA 3OPQA 1ULHA 1YB5A 3FOWA 1SCBA 4PSVA 4PZ9A 3UV3A 2IELA 5SV2A 1J0CA 4I4IA 3VOAA 2WUFA 1H3NA 4GM1A 3FPHA 3KYCB 3OLWA 3EPPA 2I1LA 4HHEA 4L27A 5FJIA 5IN5A 2BOVA 2WHYA 1XZKA 1U2DC 4KIGA 4QREA 3GK3A 3BWXA 2A6PA 1RJDA 3F5DA 2H4JA 3VKHA 4V1CI 1W5TA 2I7DA 1DIHA 4O8CA 2KB0A 4YA6A 5IANA 1GTSA 4PGFA 2Y1FA 1Z5WA 1HYBA 1W75A 2F00A 4D9JA 5BXQC 1JRLA 1K63A 1CR6A 1YFKA 3MD9A 4DXAA 4WZBB 4P86A 3IQXA 1HM5A 4GPZA 4YC7A 5KYWB 1Y8RB 2AG6A 4COOA 5G4KA 3BWCA 4MV9A 2C9YA 1LK5A 5F1YA 4BQOA 3DBVO 3DB2A 2YVAA 1NI3A 1W87A 1TL7C 5DCLA 3ZQUA 4WCDA 4YUAA 4LWOA 1YQTA 2X41A 3CG4A 3H2ZA 5CDTA 4DUYB 1UWCA 2NGRA 3AMVA 4IHJF 2JF0A 3LDGA 1Z37A 4WI1A 5CM2Z 4JENA 4PO9A 4V39A 1DC6A 5KWSA 5MDHA 1TW2A 1IWPB 2PZBA 4LX8A 1OH5A 2XVYA 1ZS9A 3NHLA 3FYUA 4MWOA 2XYPA 3KE8A 2VTEA 2ZCUA 1XTBA 5TJHA 2FNAA 4EJ6A 2QKYA 1YA6A 3TZKA 1P9NA 3I42A 1D8TA 1RRMA 3KDSE 1OX4B 4HNSA 2HQSA 5A62A 3D7MA 1VMIA 1SOVA 2ADOA 3RPEA 3EIEA 5ALMA 2WB4A 2VJCA 2X0IA 3VTZA 4B3HA 5C7IO 1QTIA 2H57A 1D2HA 2GOYA 1IOVA 3GGGA 3FPCA 4ZARA 2R8ZA 4S2UA 2AUNA 5T6BA 1U7PA 4BMDA 4CLXA 4DSZA 3LCJA 1K3TA 3QXSA 1CUCA 1JFSA 2JVJA 4FYYA 1SKMA 1XA0A 4UTNA 2VJLA 2KYRA 4ROSA 4XFDA 2W83A 4GMHA 4IKPA 4YJ3B 4COKA 4K6OA 4E32A 2O2IA 3KR0A 5ELLA 4EYSA 1KFCB 5KVAA 3UT0A 2FWBA 3LBHA 2X9VA 2C2KA 4HLUA 3SWWA 2C57A 2VTBA 3V5NA 2Q29A 2E5WA 1CF9A 5JO0A 3NV9A 3FCEA 3SMQA 1CZNA 4Y30A 2XQJA 2BEUB 2A88A 3CX3A 3BE6A 4FQ7A 4XDZA 5L9AA 3NWJA 3ORRA 5KKAA 1N6OA 4HDNB 4E33A 1JSXA 1REQA 1BHSA 3TW4A 4QL3A 3WMRA 1K9SA 4ZK2A 2CFIA 1DXQA 1GKUB 2PZ8A 5K8IA 1YZVA 1ISMA 1MEJA 1YQGA 4LDZA 4IOLA 1JWAB 3ZZTA 3OOSA 2ZIUB 3GJRA 3L9WA 4IZIA 3WL5A 5J4LA 2BUBA 3K73O 2JJ2A 3A8TA 1ACLA 1XG5A 2HGSA 2BIFA 5KNLA 4LDNA 3UT5B 1NU8A 1Z5UA 2J7KA 1VJDA 2PO7A 1T0PA 2Q8NA 3GRVA 3LT1A 4HR7A 5IBRA 3QMPA 5TQ2A 3E7DA 2E87A 1YU6A 4WY2A 1GG8A 1NU6A 3KZOA 4IXTA 2ZQYA 1P5JA 3I5UA 4TTJA 3B20A 1U7XA 1CZHA 1QHGA 2G17A 3O91A 1NW4A 2ZYVX 3QKSB 3FF4A 5DTJA 4OFXA 4CV3A 1C9JA 3EMVA 2CMHA 3AJ8A 4UUQA 2QR5A 3D5EA 3DEFA 3DMHA 3M1AA 5I9BA 1E4YA 4GLOA 4BNMA 5F5XA 5EJEA 1PK8A 3KM0A 1G7RA 1HOXA 1PSZA 3K4HA 1JXOA 4ARZA 5JQWA 3WYFA 4MWDA 2FP3A 2KJQA 1LNZA 2IHUA 1IBCA 1HLPA 3NYIA 3KKZA 1K92A 4OHWA 4U7FA 4MINA 4QXOA 4FILA 2BBWA 2XQGA 3GQBA 3DAGA 4A6XA 1KJ8A 4NG5A 1PGPA 1ZK2A 4JYCA 2OPHA 2ZRQA 3QKRB 4D9CA 3OCVA 3TQTA 3ZKWA 1P44A 3PEYA 2WMYA 1OXXK 2OENG 3LPMA 2FSVC 2HQ1A 1LBTA 2Q45A 1WPQA 5BN3A 5HUQA 3WX0A 1YE5A 5CB0A 4EW3A 3HBFA 2DQKA 4OQXA 3FCSB 4JBXA 1UJCA 1XLTC 2IOFA 2O1SA 3PD7A 3VTKA 3WLOA 5D84A 3BMCA 3UV7A 4AU1A 3I5YA 1VB5A 3AIIA 1LI4A 3F9CA 5CDUA 7GPBA 5A3VA 4M0PA 4HT3B 4R8RA 4F2DA 4L8FA 1GPYA 1WUKS 2C59A 1CJTC 2Q3DA 3Q7QA 4JELA 4UMDA 3CUYA 5I7AA 1UMDB 5EG5A 5JATA 2GASA 1D1SA 2PMEA 2HUNA 1RQGA 2O3SA 4HWSA 1OYVA 1SVKA 3OFSA 4P7KA 2J0EA 3EPHA 3T99A 2VHEA 5T57A 3KEGA 2XNJA 3FKSD 2I2CA 8ABPA 1OFGA 2RH4A 1RP7A 2LDXA 4P4SA 5TMPA 1VJRA 1EK5A 1XMQB 3MMNA 1ZKDA 2PWPA 1U0TA 4DZRA 5DOZA 1NWCA 1ZINA 3BMOA 5I3ZA 1SQGA 1UZMA 5J43A 5EP4A 3R2JA 3D6JA 1LPMA 3PR1A 3Q6IA 4R1QA 3Q6NA 2GX6A 4RZXA 3KEOA 3C7TA 5MN6A 3U13A 5CG1A 5H9WA 2HHCA 1Z63A 3L6CA 4OHUA 3B5JA 1ZSYA 4HSGA 1R5NA 1GTJ1 4L3OA 5KU1A 2FE1A 3CCFA 1VPTA 1Z0JA 2VUUA 5HRAA 2PT7A 3DT9A 5A5VA 8ADHA 1XDSA 4JQCA 4LW8A 1PD0A 3MA0A 2XBUA 1LVGA 1GCIA 1EP1B 5IWCA 3KR2A 4ND7A 3GCWA 5FWAA 3BIJA 2P3LA 2BMJA 1A8PA 2QSUA 3OZSA 5EQFA 3W1VA 2GYUA 3HJUA 5GADl 2JD0A 4K2HA 1LPBB 5K5EA 1TC2A 3TYXA 4R1OA 4JUBA 3KOMA 1O08A 2BFFB 4XX0A 5C3MA 2H8KA 4FSHA 5DNEA 5LDGA 3JQ6A 1GNVA 3T06B 2PSHA 4EEKA 4EUNA 4QX6A 4R05A 4YGYA 3DEJA 3E18A 4RTOA 4UPDA 2MSLA 1HDGO 2B6HA 3ZTWA 4HH0A 5LQMA 3K70C 3NHUA 4D5EA 1KGDA 1Y1TA 2MSKA 1QE5A 4CM3A 4D9KA 1DU4A 4IH4A 2XY4A 2XIQA 3QE4A 2FA9A 1VE3A 5JJLA 1YHZA 1GZDA 1RXUA 4RTKA 4BN5A 5M3BA 3L46A 4HAWA 4F5DA 3T3DA 4CNBA 2CK3A 1XP5A 2D1RA 2W4QA 1IATA 3K6JA 3CTPA 4WX2B 3MGGA 1TAUA 5E6SB 1UP4A 2AX4A 4WPGA 5J59A 1JQLB 1NNUA 2IIBA 1Q0PA 1ZESA 3F3SA 3AU9A 3G0CA 4KKVA 1GN9A 4DYHA 3CWCA 2J59A 3W5CA 3ZJVA 1VGQA 2ZR7A 3BXHA 5AJHA 3UQZA 2DQYA 3MOSA 5BNIA 1SRQA 5EE0A 1NQUA 1PJQA 3AEKA 1YS2X 4DPKA 4AFNA 4Q7MB 1FJHA 3UA4A 1OWOA 1GIAA 3RC8A 2GLXA 2QPLA 4G5RA 3WFIA 4I2NA 2JG3A 5D2CA 3OPNA 1A8SA 5AXCA 5HIIA 1XTZA 4DM4A 2BZSA 4G67A 1JBKA 4Y6PA 1NLFA 4KH1A 4CKCB 5CD1A 2AKAB 5HE8A 1SBIA 1ZCFA 5C1PA 3DVAB 3GFRA 3SIPA 1D2MA 1HDIA 2HRDA 5IW8A 3AYZB 1OGJA 3N5CA 4TKUA 3ZV7A 1GV1A 3ADDA 4K9KA 2JK0A 3OQHA 2EOAA 2C2BA 3BCUA 1J8DA 2D0DA 3BULA 4FC7A 3SDZA 4A2PA 2NN3C 1RCFA 3SLRA 4PLFA 2AG1A 3QQ5A 5F23A 1QYCA 3CB4A 3VR1A 3A1NA 3FWKA 1VL6A 3BIWA 4OPMA 4FFWA 1PX0A 3AF2A 3KUDA 3QY9A 4NZPA 2GPSA 3FSGD 1E4VA 3QZUA 3LRXA 1W581 4LC0A 4E88A 4OHYA 3QY0A 2XLCA 1RJWA 5G0UA 1H2BA 4TMTA 3S6JA 3K2BA 3RAFC 1YDWA 1GSAA 2B98A 2X0KA 3NOQA 4HWKA 7ADHA 4NAUA 3O31A 3TE7A 3M9LA 3C3WA 4RETA 1KNQA 4BMXA 2YXDA 5CGQB 2G3YA 4TKMA 3DHVA 3H4VA 3ZLJA 3VR6D 5BW8A 4MQLA 1OFUX 4OVKA 3LY9A 4XGRA 3HR8A 5D7BA 3LXXA 2AB0A 4HFRA 3T1TA 1TJ5A 3ZVKA 2B2CA 1KFEB 5FLEX 4PIPA 3UJ9A 1Z28A 3PNSA 3Q9SA 3GAAA 3LXRA 2W6ZA 2RKOA 4R40A 4B4UA 1E0DA 3L0DA 3F8SA 4IDQA 5DYGA 3WY9A 2VPXA 3TLEA 2OHIA 2O0JA 3OX1A 3V3KA 3DZJA 2HNKA 1I01A 4OXKA 3OD5A 1IY1A 2JCGA 1L1FA 1E9SA 3UF0A 1L3CA 2B61A 1XDGA 2P77A 2P2SA 1FSZA 2RI6A 3EIFA 4HPXB 2Y8EA 4GI1A 1A2QA 4P4UA 1WJGA 4JXZA 1DUSA 1FUEA 1E98A 2AC2A 3BILA 1N5MA 1Q1EA 2XOXA 5HIMA 3EYAA 3NS7A 3K9CA 3PKIA 4QXRA 3SZOA 1DTSA 4KRFA 1VBNA 3NM5A 3ZOZA 1DO0A 3LPAA 3N6VA 5A7GA 2HWUA 3IDSA 3RLFA 3M8KA 5BR7A 4RJLA 3QKWA 3KQMA 1WDMA 3A31A 3I6BA 4TTVA 3Q10A 4ZHQF 1R1DA 2OSVA 3KB2A 2QQ0A 1GUBA 3PCTA 3PIIA 4BNVA 4L8YA 1BE1A 2DTEA 2G4LA 3SPXA 1Z7WA 4N6NA 2XUGA 2V97A 4R0VA 4HQLA 3A4NA 2L18A 4L5JA 2V0NA 4R1TA 2WYIA 2DX7A 3M2PA 4QT4A 4ZIRB 4BN0A 4PINA 1ZGAA 1AS0A 2DY0A 3MUFA 4GMFA 1NQWA 5DCYA 5AOAA 2PH1A 3SC3A 1ISSA 4QTZA 4BQIA 1XIVA 1DV1A 1SH7A 3I58A 5FL7D 4MUKA 2OBBA 3OJ0A 4JR0A 4CL8A 3ZTTA 4WFQA 1KEKA 2JBHA 1RYFA 4Z49A 1LQ2A 3Q2OA 3H0EA 3GLRA 4YT4A 3NHBA 1UKAA 4IV0A 4YWJA 1BHQ1 3CF2A 2ZBUA 3DBHB 4XAQA 3JRNA 3O8BA 2FN3A 3KKOA 1YI8A 2XJ4A 2I78A 5HSGA 2XOKD 1G8KA 3CNNA 2R86A 1JEOA 4AMBA 1P2UA 4MITA 2PXXA 1I24A 3ME5A 1EWQA 1RDFA 1FFEA 4HL6A 4XD7D 5DTIA 5J5AA 4ZFNA 1N8NA 3MTAA 1M8JA 3M4JA 1QIMA 2EFHB 2NXNA 4KVFA 1KYQA 3NFRA 1P75A 4QRHA 2IUUA 3U1VA 1ECCA 1PT6A 4JI4B 3QGMA 2FUG6 4I3FA 1YNSA 1H2XA 3H6HA 3ZDEA 1JEYB 4OLBA 1EP2B 3TFOA 4YX9A 3D0RA 1VI6A 3UHPA 1JLMA 1I33A 2FPOA 2OCIA 4CM8B 1UZNA 4BRWA 2F3QA 1KORA 2HXSA 3ED5A 4XUGB 1T2VA 1MO3A 1QMGA 2LDBA 3EVZA 5AKJA 3WLMA 4CCWA 4DA7A 5ESWA 3LPDA 3QM1A 2Z95A 5K45A 4TXLA 2OKCA 2H1HA 3LXMA 5HQ3B 4LZAA 2FTKE 2JB9A 3UHFA 2V4UA 4F3YA 3RV3A 2C7RA 2CD9A 1QAMA 1T4MA 1ZD9A 3PJRA 3X1DA 5M34A 1U2EA 1CRQA 1V26A 1GU0A 2YY5A 3NC0C 1WEKA 1C0KA 3W05A 5K3FB 2PANA 2QRJA 3A6KA 1PEAA 2L19A 3EDQA 4NYJR 2H2IA 3E4CA 1IZYA 4A9AA 1GLNA 3HN6A 5FPTA 2JZNA 5ETJA 2EJUA 3AR9A 4KH0A 1J1UA 3DFMA 3C41J 4I6GA 2HSZA 3R9WA 3B8EA 4YMVA 1HQKA 4JEHA 1ZW6A 2ZPTX 5ICGA 3AEQA 5I7HA 3KAQA 2F8LA 1QKJA 3P32A 1UBRS 4Q3AA 1KMHA 3F8TA 4A0QA 1DBRA 5L4NA 2JFNA 3PX2A 4L6IA 4DQDA 3NU1A 4CBVA 4KUEA 1BCRB 1I3LA 2KLHA 2D62A 1XCLA 2PLAA 3E27A 3H2IA 3I8SA 2QX8A 4IR7A 1FX0B 3DOFA 2FEKA 5AKZA 4RTLA 4W82A 5LQJA 3GHHA 4PTLA 1UKBA 4C0JA 4JR1A 3U61B 2IEGA 4BNGA 2B5OA 2W0SA 3AHGA 3BBLA 2DBRA 3DA8A 3KTDA 3MT7A 4MP6A 4P7BA 5JCOA 3RO7A 1Q15A 4KB5A 4EH1A 1G98A 2B1QA 2G9UA 2QRQA 1AQ6A 3IMEA 4P33A 2Y0CA 4R6WA 5EMHA 1ZM9A 3ZYCA 3OQNA 3NORA 3IH5A 4MGIR 1T25A 1VCHA 5JNWA 4A4DA 3WGGA 1RXYA 3NYQA 3WYDA 4MGEA 1G8PA 1O6BA 2VUSA 5LXTB 2JAHA 3OP1A 5KVCA 3OOJA 2VSYA 1UPBA 1M8KA 1XB2A 3LUPA 1FFAA 3GT7A 3DWEX 4MGYR 1SHKA 4XDHA 3WGJA 2B1JA 2SKEA 4FKBA 2AJBA 5K01A 5JG7A 3O8CA 3NEAA 2PTGA 1QGUA 4I8IA 1CQJA 1M3SA 2CJWA 3ESYA 5I51A 4LV5B 3OKFA 4XB2A 1EZ4A 2CW5A 3ZHSA 3C6MA 4I36A 3C4QA 5E1OA 3NDPA 4OHOA 4DC1A 4YGXB 1L5QA 3GA5A 3R5SA 3T9BA 5G1OA 1GARA 4W8HA 4DB4A 4F1JA 4Y0VA 3LLUA 5ARCA 3GMSA 2H6EA 3TIVA 1CQWA 2TSYB 4EK9A 2XX3A 3OSZA 4HEJA 1TVEA 1JJIA 2YQ4A 2PYDA 1R9NA 3GXOA 1P5RA 2HY7A 4YV0A 3T61A 1MO5A 1N9ZA 1JJVA 2O0LA 3G9XA 4RZIA 4L6CA 2ZRMA 4P0PB 2NNWB 4CPDA 2CLMB 3LHDA 1E2UA 1LQTA 1X1EA 4LXQA 3IPLA 5LZ5A 1G20E 3RHZA 1KJYA 1X7ZB 1NBME 1WOMA 4IUDS 2FPRA 5AW6A 1V25A 1UOOA 3MVEA 5H4HA 2J9FA 4X85A 4D99A 4NJMB 3VC2A 3JATA 3T7RA 1EFVA 4FZRA 4KHZA 4P1ZA 1MAAA 4LZLA 4IIJF 3KL2A 3HP4A 2WTBA 1KXZA 1U3WA 2GRAA 1I0IA 4MB0A 3QOFA 1E9BA 3AR4A 2YY6A 5U9CA 3RIHA 1AKEA 3K4PA 4KQ6A 4YI3A 5KTNA 5CB4B 4J8PA 5DLDA 2G1KA 5G41A 3VR2D 4DJAA 4X7PA 5JISA 3INRA 3OLQA 3KC2A 4S2EA 1W7AA 5JYBA 1CJMA 4ALMA 3ONVA 1E6MA 2IHKA 1Z6GA 4C78A 4WDRA 1UBTS 1LJUA 4L5YA 5CAEB 2EERA 4DMFA 5A9SA 3TVYA 5AH0A 5AM2A 3E81A 1DIOB 4OUKX 2PX2A 2FW7A 2B20A 4KI0A 3U7EB 1Z38A 4HN4B 3A10A 1Q91A 3SBOA 1CXZA 1Z4IA 4O1IA 2F67A 4FNMA 5K0GA 2ISCA 2P9FA 5KDDA 4MVJF 4Z4IA 3ENNA 3UUWA 3RAEC 1D6MA 1EM8A 4UMVA 4PIMA 3LKDA 3EPRA 1ZC3A 1W96A 1Q7EA 1P9RA 2ID7A 2OMKA 2VZLA 2IJGX 4HY3A 2VWHA 5F7JA 1BMQA 3IGFA 2XSZA 4B17A 3T94A 1CJCA 1GZSA 3ZUGA 3EXHC 3L0IB 2GRUA 1DE0A 5TDHA 1BVHA 2P9QA 5HFJA 1JZTA 4LV6A 1QTQA 1KOJA 2WF9A 3HFSA 3QVJA 4JLBA 3VR4A 4G0WA 4B9AA 4QJ4A 5C5DA 1V7ZA 1R0YA 4YDHB 4AMUA 2HF8A 5ULLA 1DIRA 5JMOA 2Q5LA 1IUOA 1QIGA 2V7QA 1R8QA 3G0DA 5FPYA 1Q0TA 1J24A 4R5HA 1LLCA 5KS2A 1X7HA 1XKXA 4D98A 4M1KA 4FXOA 4D4KA 4GYWA 2JAQA 2A5YB 4Z1MA 5DPMA 3KLBA 4KQGA 4WXEA 5JE8A 3ZIAD 3UTCA 1XZDA 3K2QA 1CZRA 3BRWA 1KVRA 4F04A 5L6LB 2J5QA 5EESA 4ZEXA 5CLFA 2ODPA 2XI4A 3NONA 1CTQA 4EB6A 5K8UA 2J8ZA 3LGAA 2VRCA 3K1JA 3SAJA 2JIOA 3V97A 4AS2A 4PZEA 1VRCA 4DWVA 1VPVA 3TIGA 3JY6A 4EG1A 3EVGA 4DIEA 1AK9A 3Q0EA 4RLHA 4K9OA 3QJYA 1FTSA 3T7TA 4MW7A 1Z13A 2ZIAA 3AUSA 1AO0A 2R8XA 5LWHA 4B2IA 4MEAA 3N8NA 2J0VA 5J2UF 2JIBA 2R7AA 3OTOB 3LUAA 3CBGA 1EG2A 4C4AA 1JI3A 3DF7A 1YIDA 3DLCA 3F7OA 4ZKEA 2O8FB 1A8HA 4NHOA 4ER6A 2FZCA 3DF9A 3MWYW 1C5KA 2YW9A 5D01A 3KK0A 1PGQA 2QD4A 2P2ZA 3RIYA 1JYSA 2DXIA 4Z4EA 4DLWA 2Z43A 1KH2A 2QN1A 5D3QA 2C8JA 4UREA 1AB5A 1MO4A 1GT6A 2G8NA 3MB5A 2R5FA 1YOBA 3JV7A 4J03A 4NWIA 4BECA 5FRDA 1PT5A 1PBTA 1QPGA 4ZYWA 4JOQA 4M9QA 5D6OA 1XAGA 3ERCA 4LISA 2IXAA 2DKNA 2WT9A 4GM4A 2VJDA 2AYZA 3A32A 2YVUA 5B1SA 2QLBA 1JFVA 1MIHA 3FOAA 4UM9B 2BH9A 2UVPA 3WWOA 1MENA 3OLYA 1EXMA 2QYHA 5HOQA 2GT1A 4YRTA 1IAQA 5DULA 1I2DA 3BD7A 1PJ2A 3CV3A 4D81A 1QHYA 2MR6A 4LDPA 2Q07A 1JNXX 3TGLA 1EFPA 5GMOA 4RHFA 4LAFA 4YI5A 5G4KB 3CZQA 1FMJA 3STUA 4EQZA 2WQ6A 2O7VA 1VC2A 2V03A 2ZRFA 3MCZA 5I47A 2JKYA 1RKBA 3GZJA 1AQIA 2HM7A 1ETHA 4LRUA 4BJ5A 4FR0A 3SXJA 4DMGA 1D4AA 1LTQA 1UM9A 3FVTA 2H08A 4M49A 1DADA 1JWLA 1KY2A 1PR3A 4GX0A 4IIDA 1AQNA 1JIXA 4G1CA 5EIFA 2W6OA 3FYUB 1PJAA 1LEHA 3IX7A 4YJFA 5EIHA 5D3MA 4I5FA 1YVDA 1FMCA 1OD6A 4PN3A 3HO1A 5DI3A 2BJHA 1D03A 1I5OA 3EBLA 3LUBA 1P2GA 3G9ZA 1H2YA 3PC3A 5EUMA 1VCOA 1T10A 1DNPA 4G81A 1S3GA 1N1MA 3GJ5A 2ASVA 1MX1A 1IM8A 2HDWA 3B2EA 1N78A 3OPYB 1ISGA 2WSSD 5HFAA 1M73E 1OH7A 3PDHA 2QZ9A 3PUJA 2HBQA 4RF2A 3AVQA 1EGHA 4AF6A 3PUHA 4U7WA 4J7AA 1YJXA 3DNMA 4DJFC 2AS0A 5HYVA 2WWVD 1N5LA 4F85A 4O0MA 5HKKA 6ABPA 1Y48E 4Y18A 5TMBA 1V8PA 2VSQA 3MTDA 1P1JA 3ZXXA 1X92A 2AF4C 2E48A 2OAGA 1X7DA 2VTBB 2TMGA 3L6DA 4IP0A 4D5GA 1XNHA 2QT1A 2Y67A 1FE8A 1PL6A 1JMVA 1YUBA 2O2EA 2CXXA 4Z3DA 1Z6TA 3HM9A 1R6BX 3NG1A 3TLBA 4DF3A 4QTUB 2Q27A 2XMRA 2IIQA 4NTZA 2OZVA 4JLNA 1N9GA 3N8IA 4TROA 2PVSA 1K0UA 1RXEA 3AZOA 2DR2A 1REQB 5LQRA 2O3UA 1Q17A 1S2LA 4C7KA 2W0MA 4KIFA 2XB9A 4EM6A 4F4UA 5BW6B 2DTDA 1R15A 3CRQA 2G83A 1BWRA 1E2IA 4H2DA 4LHXA 2YXLA 3PXGA 4AYWA 2QSYA 4MUFA 1P4AA 5G3YA 1YR2A 3JCZA 1GNRA 3WBKA 4HMQA 2DFVA 4K9SA 4LHWA 3P9XA 1DIBA 4ER3A 2H1CA 3ABRB 1NVAA 3SJAA 4ARSA 5TQ2B 1L4FA 3VZSA 1FUIA 3DOUA 2VAMA 2D1FA 1X8KA 2EIXA 2OCXA 3A70A 3GBVA 2WYVA 3EYWA 4OGWA 3GLHE 3LWZA 3VMFA 1FFHA 2VZEA 5AW2A 3HGMA 1Z6AA 3EG9A 1DGQA 2F9LA 2VSOA 3MJVA 2DLDA 1Z4OA 4RQBA 2GQ0A 2ZJOA 3V8BA 4FTWA 1K8YB 2P9HA 2XKJE 3PC2A 4YDSA 1B7GO 4DM3A 1GZVA 5EZYA 1SVNA 1SBZA 2OHHA 2PPLA 2WKPA 1SKBA 4PAGA 3TXYA 3DAYA 4ARZB 4E5YA 1OZ0A 5DHFA 3RROA 1O9HA 3DWGA 3HSSA 2M32A 1BW9A 4URUR 1KPHA 3GQBB 1WUJS 2YS6A 1V47A 3PFGA 4F92B 2OVBA 4KIUA 1NUTA 5HIAA 2VLIA 1HG1A 3PEWA 1BH2A 3NDIA 1JB9A 3HABA 4XGNA 3PFBA 4ZZ0A 4NMMA 3GF4A 1QFSA 4JH0A 1C29B 4EJSC 2CLHB 4KDFA 4ZEVA 5BN3B 5INTA 3GFTA 5K3BA 1PLLA 5G4LA 3UMBA 4D96A 3DTVA 1F2UA 4R8LA 2YV3A 1PX2A 5FUQA 3GP3A 4BJ1A 3V2GA 2R4QA 2OBMA 3BMCB 2FSIA 2GBLC 4DLRA 2APJA 3JYHA 3IAM6 2WYHA 2ZEJA 4QXQA 3Q98A 5COAA 1HDXA 1DKLA 4LBWA 3EFEA 1SIBE 2Q3MA 3ID6C 4OG2A 5DLQC 3B8HA 3AG6A 2GD0A 2PH3A 1OXVA 4YONB 5DBEX 1CVRA 2ID4A 3FWZA 4ZYTA 5BSUA 2PO5A 1ADJA 5HPYB 2YMPA 4XDGA 5AJTA 1KPGA 3Q87B 5DOVA 4YCDA 1ZIOA 2GBFA 4NICA 4X7BA 2E1RA 4WFJA 3IRVA 4BL5A 5BY2A 1WMDA 1YRBA 4P4SB 4BCBA 3GLKA 1SCUA 4KAJA 4LRXA 2R68A 4MLDA 1AXGA 4UEWA 1ST2A 3WDLA 5LD2B 3BMOB 1U94A 2ZYIA 2QT9A 5LZ7A 4TWIA 2WHQA 1VIVA 3HA2A 1OAAA 2X0JA 4ZQFA 3JYNA 1M54A 3H5IA 4OP1A 4YNBA 4D41A 1BQEA 4A16A 4L2IB 1UKVY 3G5TA 3IBFA 3IVCA 3TTTA 4KV9A 4ERXA 1NDUA 3FDFA 1PK7A 4BTEA 2WV7A 3KWJA 4FMCB 4K28A 1P81A 1TNDA 2XB8A 3EARA 4WCVA 4LVUA 3TO5A 1B4DA 2NO6A 4TVSA 3G3EA 5TMDA 3UMJA 5C52B 1VYTA 5DHTA 3OEHA 3CPHA 2HLNA 2NYAA 3N39C 5TQJA 3GUUA 4JJ6A 2M6KA 2OV2A 2JGNA 3AH8A 5KHLB 2C4MA 1Z2AA 1KEEA 4L4YA 5JJIA 1KC1A 1VMKA 3F6CA 3SIRA 4OHFA 1H2AS 5E7IA 2R4UA 4C2UA 4QGAA 2CFCA 2PIAA 1E2EA 4HQOA 3TUJC 4XX0B 5JMTA 1DIAA 1U9JA 1VXOA 1YL7A 2FFRA 2WSMA 3RK4A 5EVJA 2YXPX 3N6RA 1V7QA 2K7ZA 4JIMA 1ZI8A 3QKTA 3O1HB 4BE7B 3HPRA 3R7SA 5B36A 4LNUA 2D8AA 2C1ZA 4QULA 4CGYA 4CLOA 1NJSA 1ZIXA 4ZQCB 2JFOA 2QTNA 3I05A 4Y6QA 4D2IA 4D56A 2QAGC 4UM8B 1MB4A 3GRKA 4C7VA 3JASA 5HUJA 4AKIA 2LKDA 4G4SO 5A4KA 3F90A 3SX4A 2F55A 3LT4A 2O6LA 4RVSA 2YOFA 3SG0A 2A1TR 4W5RA 2ZTSA 3CLVA 1KS9A 3B1VA 2WE7A 1LK0A 3D5QA 2PRYA 4HX5A 1PYDA 3U5ZB 1D6NA 4LMBA 4KE8A 1MW8X 4S0ZA 4D0SA 2XUKA 1K06A 1EB9A 3A6LA 4Q7KA 2GGSA 2I7TA 2OUIA 2VCYA 3O2NA 2JFVA 3PWKA 4YV7A 1PGJA 4P3XA 3KYIB 3S5JA 3WLRA 4AMVA 2NO9A 4D3ZA 5K6RA 2R6DA 1CX9B 1T15A 3WR5A 1PQYA 1RBZA 3N05A 3U4IA 3V1YA 1TI7A 3ADCA 1RE0A 2DZDA 3ROTA 4JP1A 2HHAA 3MLEA 2JW5A 4EF6A 3ZPXA 1JDPA 4J2HA 1H0RA 1ZA1A 3RRYA 1LUAA 4TKUB 1ZWKA 1XCMA 2EWVA 3ONWA 2Y0DA 4TYPA 8ATCA 3EVEA 4J7UA 3FLMA 2FJ0A 1UINA 2OL4A 2G76A 1PWEA 3JALA 1XEXA 1JBEA 3R5KA 1KI8A 2BR3A 2C9BA 3LKZA 1L4GA 4AUEA 2J45A 2PLWA 1TJ4A 2H29A 2J85A 4IIVA 2M6RA 4RAOA 1DKOA 4IOMA 1G6KA 3KVVA 3EPJA 1W8IA 1MMFB 1E0JA 2I7CA 1CSEE 5FKJA 2Y1WA 3S5UA 1TJ3A 4GT1A 3S70A 2FWNA 2V59A 2GKOA 3M83A 3IXQA 3IP8A 3N2GA 4IF6A 3FPEA 5BNFA 3ZOKA 4C08A 4BKUA 3WGYA 1ZWLA 4JASB 1HDYA 3WTBA 3DMRA 3PNYA 5B58C 5HF8A 4AMZA 3FIUA 3SYTA 1P77A 2QX9A 3AGQA 3GD7A 3L5KA 3NOOA 3FMGA 1PF7E 1AQLA 4INJA 3PNOA 3D6NB 2QVXX 1JQ3A 5AP9A 4UAGA 2G4CA 5KVSA 4UBIA 3TDKA 3G2HA 3BB4A 4PO1A 5HJEA 1NVFA 3WLFA 1PNTA 1X38A 3WLKX 5KPJA 4C3OB 3D8TA 4HVCA 2NZXA 2WSBA 4NNPA 1W1WA 2I3BA 3LQYA 4MUMA 5KWEA 2YXNA 1KFBB 2AVDA 4PYRA 2F1IA 3AIOA 3F71A 4ZREA 4RKYA 3HXLA 4UJ5A 2F9FA 2R79A 2XYQA 4JWTA 4IFEA 1FQWA 4YP1A 3CBQA 1HR0B 2GM3A 1HLFA 1Z15A 3LU1A 2ON6A 4EWLA 2NV0A 3M5CA 4XGIA 2FHSA 4AB1A 1YBAA 3GEPA 3HK2A 4S1TA 2QZJA 3RBVA 3A4MA 4Z4CA 2AFIE 2X8WA 5KYYA 4B2LA 2YHAA 4P9NA 4DKJA 1T1JA 1OAOC 1UDCA 4RVFA 4BBAA 4LOJA 5CFZA 5KQLA 1GT91 3ZJ5A 4CKBA 2Q4TA 1BTOA 1G0OA 1L8QA 5JJCA 3I9NA 2ZQ5A 1E4OA 2OZKA 1RP1A 1K97A 1D2NA 4H7PA 2B37A 5K3EA 3FKQA 3LPLA 4L85A 1LDGA 1ESNA 3E2PA 2WAMA 3KJQA 3B48A 3O83A 4B7XA 4YXWD 1XN1A 4N7RA 3VPHA 3V2HA 4WCFC 4DIOA 1M34E 1Q1AA 2RHWA 1U4NA 1T8PA 1G6Q1 3L7MA 4A8JA 5ECYA 4ZJYA 3AR2A 3NHWA 4RD6A 3RAPR 2INGX 2BJVA 1DBIA 1X94A 3L8GA 3OOWA 3WRXC 2ZTUA 2F64A 1TZMA 4JOCA 1N8SA 4PFKA 3MCUA 4QHTA 4UEJA 2PKWA 4YACA 4LV8B 3U3OA 2FQYA 4CDRA 3IIEA 3BK7A 4KXXA 1QG4A 1UDRA 2PGLA 1FMTA 4MKFA 2BC9A 2ZT8A 2PD4A 1EFLA 5BXYA 3NHZA 4PX2A 1VE1A 5CEEA 5HTKA 3U3KA 2WUWE 4HNUA 3GAMA 3KQLA 2BGUA 3MFYA 2C2OA 2NXCA 4FR2A 5LDHA 4YHHB 2HGZA 3OZTA 4ZGWA 5EE9A 2G8LA 2CKMA 2XTMA 2P62A 2HWKA 4EMUA 3RS2A 5ESRA 1ZR4A 3COJA 4WMLA 3W9YA 1QB8A 1PTJA 3UHOA 4P92A 5JRJA 4JB0A 4MMZB 4IHQA 1KJJA 3LYAA 2GNOA 4DCTA 3VNAA 3UANA 2A3NA 2HH9A 2WJYA 3MTEA 2XCIA 4FDMA 1S2OA 2A9JA 1MJFA 4ND1A 4RK5A 4WGGA 3CIFA 4XRRA 2X14A 1XI2A 3WQBA 5IEJA 2C3OA 4RPKA 4HB0A 4B0OA 1LJ8A 3R8FA 1BGXT 3SBXA 3CYFA 1J20A 5AHXA 1MVLA 2YIVX 1M2OA 4MS4A 1M66A 5L4SA 4TL7A 4ZK6A 6LDHA 1RRKA 3KLMX 3ZXIA 4R6XA 4CNQA 1VLHA 2PV0A 5B1EA 1FUKA 1GU1A 2CHEA 1MHPA 1VXRA 1I9GA 1PS0A 3C3CA 3MWLA 4PPQA 4UZFA 4BUCA 5AOVA 1QFJA 2Q5JA 1FLVA 4G3XA 1LU9A 3ETGA 4MWBA 3SEZA 4FEGA 3ZWXA 4PNEA 5EGNA 2QDXA 2FRDA 2N42A 1H65A 3WB0A 1CJSA 1EVQA 2ZB3A 2Y05A 3V7YA 3EULA 4QNNA 3ZGYA 1CIJA 4MV7A 3LI2A 3T1VA 3AEQB 4WXPA 1SCNE 5KNBA 4V38A 1CU1A 1NVGA 2VO1A 4NI5A 4OATA 1T8SA 2K6GA 1KMHB 3FB1A 4REQA 3V55A 4GBJA 4E3WA 1NQOA 1XNGA 5B57C 1OAKA 4RA9A 5DHQA 3G0HA 5SYNA 1PKEA 1S3SA 1U6JA 3B85A 3BL8A 3CJQA 2GEBA 4MQUA 5FWDA 1TYAE 2P2GA 4YCCA 5KX5B 4KQIA 2K4MA 4JKOA 2X6TA 1XQXA 2PSDA 2RGNC 1AF7A 4W5TA 4DR7B 4K3VA 1X77A 2H31A 2WU0A 2OAQ1 3QOXA 1OTYA 3MJRA 4P98A 4RIIA 3AQ4A 5EERA 3CUVA 2Z6AA 3SNHA 5I7VA 2QLNA 4XARA 3KJHA 1Y4AE 3LUDA 3QPUA 4LOKA 4G84A 4MDYA 2G40A 2HIAA 4MHSA 4RD0A 4F2WA 2PUDA 3H9EO 1E79A 1CIVA 2R1TA 2E4WA 3DGEC 5E1MA 1QXSA 5A6SA 4BO5A 1JHRA 4QPZA 5CLJA 3KVNA 1AXEA 2JPDA 4C0BA 4DC0A 4YRIA 2ZP1A 1GGEA 1AY0A 4UUPA 4X20A 3ESQA 5FFNA 2PRKA 1P2VA 1PJSA 4QBHA 4ER7A 2X0NA 2ZIEA 2YS7A 4PLPA 1TZBA 1LWNA 1XWWA 1PVVA 4PM4A 1G2IA 1QGUB 4F4HA 1CQJB 2CJWB 3R40A 5JEEA 4U7DA 4PAMA 1DAGA 1UXJA 1IK6A 3VR3D 1YI1A 2ENUA 3UC9A 3WZMA 1LLQA 1DFHA 4CLHA 1U8AA 3PXUA 4KMMA 3WQQA 3X0DA 1CIPA 4QOJA 3SYMA 2WAAA 4ILKA 2XTNA 1I3KA 4F1KA 3HEMA 4RJIA 3UK2A 4INZA 1A0OA 1QVVA 1Z26A 2BGTA 2V0CA 2JEOA 4X92A 1G1MA 5JS6A 2PGDA 4XM0A 4RD1A 3E9DA 1IEQA 2HRZA 3PK0A 4FZJA 2DERA 2AOWA 3PGXA 3T12A 2OM6A 5IK2A 5IJWA 3CCBA 1KOFA 1VKRA 4QEKA 2DFDA 4MGKR 5CVEA 4DGSA 1BEZA 2FUEA 2WD7A 3EVAA 1C8VB 3Q3IA 3ZR4B 5KCZA 2K2WA 4KR9A 4WN9A 5FTKA 4JDUA 4OUDA 4EMSA 2CYBA 2NZYA 4YRJA 3OQOA 1DARA 3TN7A 3JATB 1EFVB 1E1RD 1GPUA 1HT0A 4YRQA 3K2EA 3ANLA 4RF5A 3TX6A 3T9CA 2C9CA 2A8YA 3PG5A 3L4JA 3HFJA 4TTQA 4B3TB 3X1YA 4MMYB 4W7SA 1BS1A 4B1FA 5C2JB 2ZR0A 4YRSA 4KI7A 3NRBA 1VE5A 4IW3B 1RRGA 2CB0A 1ILEA 1WNTA 3RQIA 3HRIA 5LU8A 2QN8A 4DA6A 4G4GA 3IFSA 2C77A 3Q6MA 4K6MA 2G82A 1I3MA 3T4UA 5FYDA 3VDRA 4PW0A 2PZAA 4YIKA 5A9SB 3WXBA 3TEMA 3G5MA 4DSNA 2NXEA 4HF7A 4ZPXA 5C51B 2QJWA 1USGA 3OWOA 4YJDA 3T3EA 2VHYA 1Q1GA 3VH1A 4NZNA 2YRXA 3ZWOA 4TS3A 3LX6A 3PQFA 5KO2A 2BI4A 2PWAA 5JADA 2ZZMA 2R25B 1PL7A 2OO5A 1EM8B 3U1TA 1A2BA 3K53A 1XR3A 3BRQA 1YB7A 1HZZA 1ZGGA 4IM7A 3MW8A 4G9GA 1WXIA 3WKEA 4EMBA 4BO4A 4HG2A 1VCMA 1RPTA 2IUSA 3PWSA 3RJZA 5BSKA 3A1DA 5FTLA 5ELMA 1C3OB 2QQ5A 3HDTA 4ZOQI 1SUFA 1OTHA 1RLTA 4OYHA 3JYPA 5E6RB 4TTPA 3KELA 4ROTA 2CHGA 3G2KA 4A2WA 3OCZA 4WY8A 1M1XB 1H9BA 1IEXA 4NJEA 2WWWA 1JBQA 1GZ7A 4RPJA 1L3BA 5EKXA 5HJ5A 3PTAA 5ED4A 2CD7A 1FRZA 4XIFA 1A69A 1YZFA 4OB7A 4YREA 5IC6A 3U4MA 4NFYA 1P9WA 1CS4C 3KCQA 3T7CA 3TRKA 2JI6A 3A6PC 3OAAA 1AQYA 5ICCA 1PJ3A 1Q22A 1V3UA 1S5PA 2SNIE 1HA3A 1WD5A 2ILVA 4CHTA 1QE3A 1A7UA 2PX0A 1KAEA 4MROA 3GFGA 5CURA 2AGVA 4TLBA 3ELDA 3SX0A 2BFNA 4BVKA 2GN9A 1U3VA 1XU4A 3KU1A 4P35A 4B71A 5A4FS 1G42A 1GKIA 3IILA 4EB6B 1WHTA 1CE8A 5PNTA 3OM8A 1M8FA 3WWEA 4GLJA 4IF4A 1ULUA 4KXFB 4Q4DA 2OORA 3T5GA 4DJEC 3IULA 2FUCA 3A9SA 4TZ0A 3K6SA 1J2EA 4A2QA 2COUA 3OX4A 4Z2YA 2VF5X 4YP9A 1FPQA 3JWPA 3VAZA 1EFCA 3KHTA 4B35A 1P60A 4B8YA 1DBPA 1M6EX 4ESOA 4NXNB 1ZJYA 4KXNA 4LJRA 1GQYA 5JEDA 4HDRA 3FDZA 3JSXA 2HHJA 3D8BA 3OEWA 2ZAGA 3FPJA 4ALNA 4MEBA 3ZHTA 3LIPA 3IQZA 3NASA 2PRZA 4R2XA 4IIUA 3L4BA 2AEEA 3NDRA 3EMKA 3QBEA 3M9XA 1QHIA 2PRJA 4FYXA 2JATA 2JHAA 4DQ0A 2AMLA 5I4IA 3E58A 3M6IA 1JL3A 3PGJA 3PYLA 3MUOA 4KACA 3A04A 4UDNA 2W70A 1RHRA 1UR5A 4J16A 1HDOA 4HFJA 1JHZA 4TWBA 4US1R 4A7PA 3LBIA 4ZO7A 1E1LA 4MRSA 3S44A 3A3OA 2QBYB 1B42A 1HURA 2X4GA 3C1UA 4MW5A 4R1MA 1ZW1A 3A6JA 1JHQA 2YIJA 5FUWA 3I9FA 4W5QA 3N0VA 1G1AA 1SCJA 2UVPB 4G01B 1E5QA 4RDCA 4OL9A 2R11A 2AX3A 2CDNA 5LYJF 1V71A 4CLRA 3L0CA 2H54A 4ESEA 1Q83A 2J0UA 3QLVC 4ZCPA 4A0FA 1EFPB 4YRMA 1G4AE 4OSEA 5LJIA 1RMQA 2JJ8A 2WIFA 4RE5A 2OCLA 4LJKA 2C5FA 2W2LD 5SYMA 1Q95A 1BIFA 4U2DA 2JLYA 2ZB2A 3FN4A 1GLVA 2WRZA 3DMDA 2VP4A 2YZ7A 3O2QB 4L08A 3REGA 4ZOBA 3ONDA 3NXKA 4GVXA 2DWPA 3EFBA 2IXTA 2QBYA 3CURA 3DDSA 1B6RA 1UM9B 2OO3A 4MJXA 4DBVO 1WU7A 3OM0A 4MDEA 4CDMA 2O2ZA 4IH1A 2KE5A 4B8WA 1E3LA 2QDKA 1UADA 4NPCA 3UJBA 2GEDA 1JHPA 3UK7A 3CM0A 5L3SA 1VPDA 5TJ9A 2QUHA 4DM7A 5D3MB 4QUEA 4G0PA 4XQEA 4EGAA 3TTYA 5J4HA 1ZOPA 5FWYA 3G2PA 5IN4A 5B2ZA 1B43A 3H5VA 5FBZA 3T5PA 3OT1A 1RD4A 3QFTA 5H3HA 3B1KA 3ZHQA 2CLCX 3A1EA 3TKYA 1A3CA 2WJHA 4K6CA 3ZNQA 2ZSAA 2I4LA 2PS1A 1MFZA 1YRQA 2D3WA 2QIOA 2ZIGA 3CEPB 5CH5A 4OBBA 4UD6A 1SBNE 3CR8A 4MPPA 4X8HA 4EUEA 5IXJA 2I9KA 1DC8A 5AI4A 1I94B 4CM4B 3VSDA 5CFLA 1NPDA 4LI3X 1CEXA 1RE1A 4CM9D 5IDQA 3ZCVA 1TXGA 4I55F 2IZ7A 3OCJA 1YF3A 2OESA 4B6PA 2QTLA 2VNJA 4D92A 4GC5A 1W25A 2FRVA 2HWYA 3GEEA 2K7FA 3W6OA 3CH6A 3ZC3A 2IWHA 2EFCB 2NPIA 2OFFA 3KE9A 4R7ZA 1O3YA 1YCFA 1WY5A 1MW9X 3EEFA 4HDKA 2GPBA 1IQ0A 1TECE 3EE6A 3L7NA 2FFJA 4MARA 4RC9A 4CQJA 2ZU6A 5AUNB 2X22A 1E9EA 1LBIA 1N9GB 2VNSA 1ZIDA 3QVWA 1T29A 3HCWA 1S3FA 4Y9DA 5FPSA 4F3CA 4UATA 3ANNA 1YFLA 1J7KA 1IXSB 4LN1A 4B5KA 3IAEA 4I5EA 3LNCA 4PFSA 4EPVA 5HBGA 2X1MA 2OXEA 3LAWA 3OKAA 3EZLA 4GE3A 4MW6A 1QGAA 4MVJD 3HH8A 3OIVA 1EKXA 5EOVA 2VK8A 5I45A 1QQAA 3R5XA 4BVBA 2H7XA 4EKYA 4FK8A 4BN4A 2X9GA 3OOEA 1L7BA 1G7CA 1WS6A 1P2FA 2WHPA 4HLUC 1JNYA 2Y1OA 1XO1A 3PQ2A 4K05A 1ZN7A 5JZMA 3NTVA 3EG9B 3TAHA 4BWFB 2WZQA 3D4IA 3P1JA 4X1YA 4DG9A 3H2HA 4N0EA 1YK1A 4QDUA 4EBBA 1HTBA 3AC0A 4RU1A 3I53A 4ZXPA 1PHRA 2VVTA 1HLDA 3KO8A 4O4HF 2AYYA 4OHKA 3O26A 4M89A 2A4KA 3IBSA 5EZYB 1I3OA 1NW8A 4M46A 1DQSA 5SZIA 4O08A 5JUWA 2CNWD 1E2HA 3E7XA 4EF4A 2GD2A 4IXMA 4Q3DA 3D0KA 3G1WA 5CGZA 1FRFS 1MOSA 4GIBA 5FB3A 4R9UC 1DJPA 5KJ6A 2Z1NA 4YFVA 5ENZA 4FYMA 3WZLA 1BW9B 1R6VA 3JQBC 1IEVA 2Y4OA 1ZPDA 2PUVA 1KRXA 4GVLA 4W6QA 2ALJA 2X1HA 2ZRJA 1BGWA 3H05A 4RS3A 1KQGA 1KI6A 3JQ7A 1SXJA 1WMEA 2AN9A 4A03A 4BO6A 3AOEA 1H3EA 4BYMA 3H8JA 2AZDA 1EK1A 4DIFA 2BMVA 2P0EA 2BBSA 1L4NA 1J90A 1ZGBA 2O4UX 4L4SA 4ATNA 4RK7A 2QMZA 1WD7A 4ZAFA 4CKCA 5KC8A 3WDSA 1E1QD 1W5FA 3KETA 3GPLA 3DTVB 1F2UB 3TWOA 3R3UA 1BXRA 2C8VA 2P2CA 3NHSA 2VJOA 1PRYA 3MRXA 4I08A 4C7XA 4PYNA 1RM5A 1QG6A 5FH9A 1TMOA 4X1KB 4FOSA 1XMPA 2HEIA 1N7IA 1NMXA 2V65A 4M6WA 1CBUA 3ONNA 1XPRA 1N9KA 3KDAA 2YTZA 4EY5A 3O9VA 4AQ7A 3BYZA 3I4LA 4XQ0A 5I8PA 2FMKA 2JBAA 3II6X 2GBIA 3OZAA 3OFND 1X86B 4CKXA 5I01A 3OT5A 4MRRA 1JPJA 4CJXA 3NHYA 4OQPA 2ECOA 3T9DA 1EGQA 1QLWA 1USIA 4MCJA 4OFZA 1G8SA 2A78A 1L7NA 3NNNA 3DS8A 1SELA 1SCUB 2IY9A 2B4KA 1OHHD 2VDPB 3QLEA 5DM0A 1DXHA 1G8HA 1GPH1 1UDAA 3ZH2A 5C35A 2FSHA 1V3TA 4MQMA 5I7WA 2V55B 1LI5A 2GCOB 4Q3CA 2RGWA 4RZHA 3G6WA 4IMIB 3UWDA 1W34A 3RSZA 2O0MA 3AUYA 5JBNA 1M7HA 3I61A 1XYGA 2ADMA 3WVNA 4TMZA 2DF8A 4ZWNA 1XVVA 4ZVRA 3TLKA 3NC4A 3V7NA 3E22A 4PBTA 2FETA 5FR1A 1TEZA 2A5GA 2V7XA 5DSTA 3T9FA 5K1ZA 5A7FA 1ZJJA 1T8RA 5CM8B 5EIWA 1IBLB 1C9YA 5KKCA 3MJTA 2W6JD 2VN8A 1Z0UA 5KAMA 3ZU4A 5KQRA 4YUXA 3FD8A 3TLAA 1KJ9A 1KEEB 1LPAB 3PE3A 3KCNA 4HWGA 4WKPA 2X4IA 3S2FA 1NF3A 2J3DA 3BT7A 4JA0A 3PDCA 3R3HA 1CYDA 4PHHA 5ICSA 3PI6A 4MLCA 4INAA 4MV6A 3NIWA 4PF1A 2ODEA 4TLCA 3ADKA 4PLHA 3NFYA 3UXMA 5DNYB 1NMYA 1EHYA 2ASEA 3D3EA 3LMKA 3IKTA 4KO8A 2JAUA 1KDZA 5F9HA 1LDBA 3IR6A 2QYTA 3NJ4A 4LNUB 4YLEA 1P2BA 5JHGB 3R0QA 1P0CA 4CLOB 3AESA 2JAXA 4FGLA 2NQ8A 3QEOA 4P54A 4Q34A 4WNIA 2B7BA 4LGCA 2GNAA 3JASB 4L4XA 5ALTA 1GCAA 2DLNA 2HSDA 3KOZA 4EW1A 1OB2A 3H1PA 4URVR 1N0VC 4YJ2F 1RAFA 1L5NA 1ECGA 2WE8A 3KQOA 4O4LF 5ALXA 4DMMA 4NDAA 4J07A 3VXKA 5KSWB 2J3QA 2A2ZA 1GL7A 1R66A 3PXEA 4P4LA 4PZYA 7REQA 3UIEA 4FFOA 3BD9A 1Y5NA 4FCWA 4M8IA 1PEDA 3ZU5A 3EHDA 3R6GA 2RK6A 1QV9A 2QW0X 4Z53A 4NC9A 5EJMA 1VG9B 1K4YA 2JC3A 1ICEA 3DULA 4MUEA 5P21A 3RVPA 5FOQA 1CF4A 1QP0A 2BLLA 5KYXA 3NBZC 2H3EA 5JSHA 4L0CA 3HWSA 1FRVA 2JBWA 3VBCA 1XV5A 4U1RA 4LUCA 4ODIA 4ZDJA 1GAXA 1WMFA 2C9MA 2WF6A 4Q4HA 4FYJA 1K0FA 1T9CA 1XEXB 3AF1A 3JALB 4UARA 4J0HA 3CINA 3DLBA 2HFJA 5KNCD 5LBTA 2Q3FA 1IONA 3FMVA 5EXSA 3W5JA 5K8TA 1I2CA 5KEIA 5IT5A 3ZJYA 1E3MA 4XYMA 2N3ZA 1AH2A 2XDQA 1KEWA 2EP7A 2AD1A 3QPCA 4IWYA 2HXYA 4NDZA 4RD4A 1A1VA 4Z0PA 3FGZA 3W1EA 4DCSA 3UG6A 2L42A 2HCTA 1GKKA 2X1LA 3DDZX 3QEJA 1T8TA 2A0KA 2WJ4A 3N2GB 2ORYA 4ZRMA 4CCSA 2QHXA 3BMNA 2VPYA 4ARBA 1YBMA 3ND8A 4AJ9A 2H18A 4C30A 4CI9A 1FLDA 4JLOA 3SOPA 5AJUA 1PNQA 3FLBA 1Z4MA 2UKDA 4YCNA 1I1NA 3OOYA 1AKMA 1T26A 4Q3NA 4WNYA 4WBNA 5CIYA 4LJ9A 3TLZA 3TIFA 4GZ6A 1FJXA 3MS4A 4D8TA 4PS1A 1GUDA 4J2OA 2R2GA 3WGQA 4NBWA 3RBXA 3P9IA 5DN6D 1FFXA 3MAJA 5F21A 4AP5A 1XJCA 1Y7HA 4FOPA 2O7SA 2PZJA 1MR3F 2W11A 2Z2YA 3O1JC 4I14A 3T52A 2J1LA 5JJ5A 5EJ6A 2YWRA 5THXA 3CEAA 4J0FA 5JS1A 4INPA 4BFCA 3WLIA 4DRYA 2I22A 1XA4A 4I3GA 4NU6A 3NP9A 4D26A 5EHNA 5EQDA 3ANXA 3K0AA 4JXJA 5H8WA 3Q7IA 2BTEA 1CR0A 1ZSNA 5B37A 4HBGA 4XYLA 4C4RA 2IU6A 2A7QA 1FTYA 1AHHA 1V41E 1BN7A 1WTCA 3BJMA 3G0BA 4PAOA 2OXRA 3UA3A 2I3AA 4BWGA 5EMLA 1C4OA 2O2YA 1C9DB 1L4YA 3U60B 2ZSKA 4BTVA 4WNAA 2P27A 3HJRA 2IX3A 2QG4A 2QUKA 4NENA 1PJZA 3OIGA 1V4VA 4CKBB 2ZWOA 1KO8A 2X3YA 3A2NA 4O4IA 2J9RA 2JLVA 4NBSA 5DEIA 3EGOA 3GJ3A 4XOIA 1VZ3A 4OI2A 3EG5A 2DB3A 5A9TA 2J46A 4XM1A 2RC5A 3DOEA 4KXWA 4B87A 4BNFA 4C06A 2B83A 4D79A 1G5FA 1V11B 3FFTA 3G2IA 1PIWA 4OJTA 4A8JB 5CXUA 1VE6A 4CEJA 3PSHA 1V8BA 1XTJA 3QX7A 4R68A 4DMCA 1OH6A 9LDTA 1G60A 3JZDA 1YR1A 3REFA 3ILHA 3ITKA 3PHLA 2YJGA 2CUNA 4JKIA 4CIAA 2ZUTA 4CIBA 3TS1A 2HUPA 4EA7A 4E6EA 1PS9A 4WJZA 1OQAA 4B3JA 3O5AA 1N7GA 1UK7A 4PSAA 4JYZA 1BHJA 3NR2A 1YQWA 4BIMA 2B92A 3UWPA 1MB3A 1RM4A 3B6JA 2B2XA 3LQ4A 2X58A 4HADA 4YUVA 4LF4B 1K8QA 4OSOA 4AT1A 3LYUA 5FV7A 4ED9A 2FMHA 2J9ZB 4E22A 3DZKA 3R20A 1R5OA 5CT4A 1Q16A 1TTTA 2YWJA 4BKQA 3FCOA 3UAGA 3S68A 4KDEA 3WMXA 5ILGA 5IJ0A 1MTZA 1U6IA 1F4LA 1GUFA 4JT2A 4U63A 3C8DA 3DM5A 4Q24A 2GZ3A 1FYWA 2ZSDA 1KQFA 2WWRA 2CN1A 5B4UA 4H7EA 1E1CA 2W2NA 3UH0A 4BQFA 2I6UA 3BX1A 3WNVA 1OKKA 2NU6A 5JW6A 1U9CA 2ZT6A 3TPCA 1UXHA 4IQ0A 2FE4A 5A5DA 1M2OB 4MS4B 1C3EA 2I4MA 3VRHA 1M76A 2R00A 2AI3A 2CXHA 5JPDA 1VKOA 3Q85A 1NW3A 1OI7A 2QLLA 1LLFA 2C9DA 3RJ5A 3V32A 4DE5A 2Q9BA 1M34B 5FI5A 3Q5EA 4E2ZA 3IBGA 3KT0A 1YXMA 1CZLA 4WIAA 5CJJA 1LSSA 3PITA 3QU5A 4B4WA 5A4MS 5B64A 1B76A 3EC1A 1SU6A 3H1GA 1TK3A 1P7ZA 2AYXA 3DVRX 4QBFA 1E9RA 4QD3A 2NAPA 1T9GR 3C97A 4UE3S 2I6QA 4XLTA 4XWTA 2WVJA 5ALLA 2A35A 4BFLA 2MMCA 1E8DA 1SC1A 4UU7A 1D04A 2YWGA 4IO0A 4Y2UA 4REQB 3IP3A 3LKBA 4GYKA 3RYTC 3QTBA 2DBYA 4RA9B 4N3BA 3HY3A 4BKRA 5ADWA 1GQQA 3EWSA 3COWA 4TVBA 3DHYA 4YB8A 3ZCTA 1XDBA 2XZPA 2GESA 3FUXA 4FJ1A 4DDMA 1M6HA 4C0AC 2QRNA 4I46A 3G5AA 3P2OA 3HCPA 4ES6A 1XMJA 2DT5A 2DCMA 4OHPA 1WR8A 1PR0A 4OLJA 2W71A 4MULA 3NM4A 1T5TA 2R1TB 2UZ3A 1KY4A 4JVOA 2IU3A 4YASA 1L6RA 1OTXA 3H97A 4KBYA 5A6SB 3S2SA 1LRJA 2IITA 3I2GA 4X20B 2V7EA 3VU1A 1ULBA 5A4AA 1S9HA 3NWBA 1IOWA 2B5VA 2Z4TA 4LHZA 3PHJA 1H0HA 1UBGA 4YRGA 4R2KA 2Z98A 3LE8A 3VZRA 3DZ8A 2BMFA 4RQUA 1DJMA 3DL4A 5KQPA 1XT6A 2AOVA 1HRDA 1VSTA 4GMDA 5ER6A 1O0BA 3DYBA 4PS0A 4WXMA 1J2JA 3IOEA 1YA4A 3T8YA 2JK1A 4HEA1 4PPNA 5AK5A 3SFZA 5ITSA 1U5AA 1EVKA 5JCOC 2Q2VA 3KR9A 2BAGA 1DPGA 2XE6A 4NYIQ 5JS2A 4CW7A 1XZMA 5KNDH 1Q74A 4XUEA 2G5CA 3HCCA 2AIRA 2IPOA 1TPYA 1IY0A 1VJCA 1A88A 2PA3A 3VDQA 5F7XA 3OE5A 3TR5A 4HGZA 4FYWA 3AF3A 3ZYZA 1XDWA 3WYNA 1UOQA 2E4UA 4URHA 3T95A 2P7IA 4RSHA 1W48A 3CH4B 4LXYA 4LY6A 3DMFA 4JLVA 2P0AA 5T8KA 3SF0A 4KQKA 3TXAA 3D4BA 4CMIA 2V6BA 3C3YA 4I4TA 4WN9B 1I6LA 1E7WA 1SCIA 1U1DA 2PKQO 4OUDB 4YPFA 5G0WA 6CHYA 3SQWA 2QM7A 2EXXA 1G5QA 1JLKA 1NHGA 2OVFA 4RANA 4B3CA 2F17A 2XTJA 3C3DA 4GE0A 1HK7A 4L50A 3CLHA 2JA1A 3I6YA 3R4VA 5CTJA 3T5DA 3GLFA 2Q7XA 4DR6B 3BUSA 3ZD9A 2HJWA 4FB4A