2C83A

Crystal structure of the sialyltransferase pm0188
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
391
structure length
391
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDIILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKELGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PM0188
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 125
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c83A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c83A01
4V3CA 2C83A 3S44A 2IHKA 2IIQA 4V3BA 4V2UA 2EX1A 4R9VA 4R83A 2C84A 4V38A 2EX0A 2Z4TA 2ILVA 4V39A 2IY7A 2IIBA 4R84A 2IHJA 2IHZA 2IY8A 2II6A 2ZWIA
chains in the Genus database with same CATH superfamily
4B3JA 2BGNA 3DTYA 1RM0A 1QORA 3GQBB 4FFPA 3O8QA 4TMVA 2H9AA 1T1SA 4DADA 4JYZA 4JVSB 3OQPA 4DV2B 2C2BA 4PX5A 1JR3A 3WZLA 3H3XA 2WJWA 3PXBA 4RTNA 1MB3A 5FHQA 4Z0NA 2Z2YA 3L7CA 2V3WA 3TE6A 1KEVA 1MCZA 6AT1A 1Q1NA 5HMMA 3WYEA 4O3FA 3LP8A 5ESWA 5INTA 3CN9A 4J9UE 2D6FA 4ZZ0A 3CVJA 1EFRD 1Z4JA 5BNIA 5FWNA 5A0FA 2FTKE 2GZMA 2XEDA 4MGKR 3REQB 4OP3A 3D1LA 5EXSA 1HDRA 1UQUA 2CVHA 1JHPA 2Z83A 3IUNA 1XD2A 3TIXB 3UY4A 4F12A 4NCAA 4BTLA 4D26A 4K7JA 1CD5A 2RJOA 3C98A 1DC8A 5F35A 3ECCA 2WTMA 3A6HA 3EZLA 4LWZA 4PFJA 3ZDYB 2ZM5A 2JFNA 2A5LA 4B2PA 1NVGA 4IO1A 4YR7A 1FDTA 3CZCA 4WOJA 3R77A 3KZXA 1LPMA 4BJHB 1UK6A 5EMNA 5L7TA 1SUDA 2HXGA 4TXLA 1QGED 2OG1A 3DC7A 3EIUA 3DXYA 3TTSA 3VNBA 3C4VA 3OU7A 4IHQA 3CLTC 3W7AA 1OU4A 2W11A 4H7IA 2GNPA 3KKKA 4AJOA 1UMBA 1T36A 5LNK6 2HZBA 1M1NA 3L5KA 4JXKA 2WBLC 2X4GA 5FPTA 1GTZA 1OXBB 3VISA 5BV7A 1XKTA 2HSJA 2OVFA 2NO1A 1QK4A 3B6EA 3EW7A 2Y3IA 3KELA 3MJCA 4NIMA 2NP7A 2HNBA 2C77A 1XE3A 3I2JA 4JGBA 1J99A 3L3BA 4JX9A 3N76A 4WK4B 1IAVA 1OC2A 3GFTA 3HBMA 4UQPA 2CDNA 2O2YA 2IUYA 4ER7A 5CCEA 2OKCA 1B8PA 1W0KD 3PA6A 3CNHA 4NTZA 5JYCA 3ROPA 4N0MA 1ZKMA 2P4SA 2PL1A 1DV1A 1JSZA 1U0TA 3ZNPA 4J3JA 5JDIA 4X94A 2CJPA 4RGBA 3R8XA 2J3DA 1X80B 2EKLA 2AOVA 3QVGB 4HF7A 1KDVA 3PIRA 4FX5A 2PKYX 3QPDA 3IUBA 3LQKA 5IYZF 4EPVA 3T7AA 4P31A 4EITA 1FMFA 2W2NA 2EL7A 3LO8A 3OJ0A 1U5CA 3IAM6 5ENVA 4KTTE 1NUUA 4A5SA 4EPTA 2XBMA 4JUAA 1IK4A 3TNFA 2IXAA 3UFXB 3D2AA 2DTEA 4NR0A 3Q40A 5C52B 2CNLA 3CRRA 4O2RA 1XRPA 1V1MB 3BAZA 1PSWA 2QJOA 1RTTA 3W5UA 1LLFA 3E18A 1JT9A 2ZETA 3G17A 4F9TA 4ZHQF 3S0JA 3WWYA 5F9HA 4JVOA 1J2EA 1MQSA 2NUPA 1DX9A 1G0NA 4ETWA 1DVRA 4TTPA 3UKDA 2IXFA 2ONKA 1MC8A 10MHA 2FJUA 4DDHA 5ALDA 4JK3A 1AXRA 3FZEA 3VR4H 2UYYA 3GL9A 1JZSA 3QMWA 3BRCA 4BU0A 2ATXA 4QYMA 121PA 4BQIA 1NQVA 2NWQA 5JMPA 3V8BA 3KWLA 2PVSA 4RELA 5EG5A 1R00A 4RS4A 1QF9A 2WLTA 1D4ZA 3M89A 2GQ0A 3P1JA 3T4UA 3AZOA 3BA6A 1OHHA 1YS9A 2V03A 5HQ3B 5A7GA 4BLRA 1FYFA 3OCZA 1YCGA 2QYHA 4DR2B 3ZWKA 4KWEA 5CVTA 3OX1A 4TUYA 3S2EA 3UUGA 2W2QA 1JBQA 3IERA 5ITZA 1RM4A 3FTNA 3H99A 3QK7A 3QKSB 4DIBA 2RGXA 2A1UB 3T3OA 1Q0UA 3H2ZA 1E4OA 1OY1A 2WVAA 4FLEA 4QBHA 1ORIA 1TU4A 1VQ1A 2CFTA 2R6JA 4P81A 1T6BY 3AP2A 1SEVA 1CQWA 1O9BA 2CMKA 5EYPA 4ZYLA 3GJ3A 4L27A 4X60A 4ZCLA 4CETA 1HETA 5KKCA 3QEBZ 1C4OA 1GNPA 2O9JA 1G5IA 4L0QA 1IOWA 1GKIA 1QFMA 1OH8A 2IH5A 2ZYSA 1IUOA 1Y5IA 3Q87B 4NMMA 1R5BA 4Q3LA 2F00A 4NBSA 2B20A 3R0JA 4G97A 3LO5A 2QUHA 4X8LA 3VZRA 1E32A 5JO9A 2REBA 1QANA 3ZDBA 4B8ZA 1OX6A 3HYCA 4PVDA 5IJXA 3ML1A 4LMPA 1YKSA 3KPWA 4GPEA 4LY9A 1G8HA 3H11A 2IL1A 2J41A 3MTJA 3RG2A 3QWBA 2I03A 1GQRA 1QVVA 3ZDFA 1OKKD 4AQ7A 3ASYA 5BMVF 5TS2A 3GRCA 5JARA 1RLOA 3GJTA 4JNKA 1EFTA 4ZTBA 2GPYA 4YUAA 4RF4A 1N3IA 3HYSA 2G9RA 4PM4A 4CEIA 1ZN2A 1G8MA 2HL6A 1YZKA 1P19A 1S9HA 1YV9A 2E18A 2EIXA 4PSAA 2FW1A 5ERXA 1CUBA 2QT9A 4EY4A 3CVWA 5BQPA 3O8CA 3NP9A 2FFHA 2ZE8A 4OBEA 2NNWB 4N5DA 2Y4NA 4E5MA 4B3GA 1P6XA 3X1ZA 1N9GB 5DHSA 2I4OA 2QLNA 3AEUA 2BZ1A 1FFXB 2R7AA 1NXVA 3NEPX 3KOMA 4X3PA 5JWRA 4AZSA 3K15A 2QJTA 3L04A 2ZSEA 1NN5A 1QR6A 2GZ2A 3AKCA 3SS8A 4JEMA 2GASA 4G5XA 1UIMA 4X20B 2GXQA 3DYBA 3KHUA 3U7IA 1B7GO 1THTA 1RABA 3WMWA 2PJRA 3VKGA 1GYPA 3OTIA 2EZ4A 4UU7A 4XCVA 2ET6A 2WWGA 2CCGA 4MSUA 1N6OA 4LZLA 1FU4A 2CLSA 2W37A 4L22A 5IVPA 4II2A 1CZRA 3R6WA 3K05A 3ERCA 2C83A 3RU9A 2RI0A 3EFHA 3WYFA 1P9RA 2EZ8A 2JFWA 4IV5A 4R2MA 2ADOA 2HCFA 1L8LA 3HDVA 4MQBA 3BIXA 4X8HA 5F9MA 1RHRA 1ZAYA 2C5BA 1XN1A 1J1IA 2BELA 2WSSD 2LTAA 1FS4A 1XVVA 1KP2A 1P45A 1PI3A 1TUIA 1RI5A 4HQRA 4I1OA 4DANA 2W2PA 2XVYA 4H1TA 5LQCA 4JI7B 1QSGA 1XLTA 1GGHA 3GRAA 5DASA 2RGUA 4IGIA 2HGSA 2Q5JA 1NQUA 2WF5A 2LVBA 3EXFA 5KYGA 3Q10A 4BOYA 1M8FA 2QX9A 3H4IA 4GRIA 4JT9A 5AQEA 2P67A 3TSWA 3FSEA 2DQSA 4P2GA 4M4SA 5KIAA 3DHWC 5L4SA 4QYTA 1GPUA 3WC4A 1RXCA 1P62B 3AK4A 4CCSA 1KMNA 3WJ1A 1ZK4A 2FW9A 2UUPA 1EUDA 2PUTA 2VT7A 3UWMA 1REQB 1U3FA 1E1MA 2QM8A 1E2IA 2Y1LA 3E9ZA 5BWBA 4AN4A 2Q29A 4YAIA 2SHKA 1CYDA 2W2VA 3QX8A 3LBAA 3CLTD 4MO2A 4I1PA 1AS0A 5FYDA 4OAOA 3W3AD 1ZQ1A 1JDTA 3EXEB 4BNGA 1A1SA 1U2RA 1NVWQ 2MSEB 2LPMA 2GWHA 3IV7A 4LEIA 4UUBA 2CLLB 1JAYA 3TR0A 4OHWA 2G77B 2HEGA 5PGMA 1FUYB 4XQ0A 4JOSA 4NU8X 5EJMA 3EK2A 4ITRC 3X44A 3CH7A 5FR1A 3PCRB 2X5JO 3M1LA 2BSAA 4GW3A 1T8SA 4RMGA 5K2MA 1LU9A 4EZBA 1DPFA 1KO5A 4KFCA 2ZFUA 4K3UA 4LGYA 1TT7A 4HOYA 1SBYA 3RFXA 3SMVA 3TQRA 3DPUA 1II8B 5DGHA 4MQ5A 4OJKA 3ZV5A 1CR0A 3ZLVA 2GBFA 4OEHA 1QNLA 2FPIB 3PXCX 3FAKA 1IG0A 1LK0A 2E4VA 3I64A 4LPKA 4Q3DA 4BNTA 5AXAA 3RC3A 4R0MA 1J07A 2XZPA 2YMMA 3LYHA 2GDZA 2IX9A 1SQSA 4MHSA 3SC6A 2Y1WA 3CG0A 3X43A 2HWWA 1PJZA 3JQRA 4L16A 1UJNA 4R2JA 2F1HA 5JPCA 5CX1A 2IPAB 1YA8A 3ENKA 3EDOA 3ER6A 2W4QA 1JH9A 2G28A 3CFYA 5HM8A 1LLQA 4OXNA 3H5OA 4CT0A 1IQRA 3DXXA 4UBKA 2E5FA 3N2KA 4RNDB 1TK9A 3HP7A 4Q9NA 1YA6A 3ANLA 3P0HA 3KQHA 2JIDA 2F3SA 3GEHA 1I8TA 1QFJA 3BXOA 4IGKA 4C06A 4MCIA 5AI4A 4CU2A 4AJHA 4URUR 3LKVA 3HCOA 2Q5FA 3MMSA 1WB5A 1O94A 1MX5A 3C87A 4B4KA 1FDUA 1I3OA 1NXPA 5J4YA 1Y8CA 5KJEA 2BEKA 2O2JA 2OR3A 4P82A 1FDRA 4PC2A 2V0CA 4ECAA 1SFRA 3NOVA 1I0ZA 4Q93A 4YJ2F 3U19A 3G6KA 1KI2A 2JI7A 2XX3A 3TZLA 2QN6A 1EP1B 2QTLA 3MCWA 4JNCA 8ABPA 4BXOA 3ZV3A 3MGGA 1E4EA 1WUHS 1BRMA 4FIDA 3GIWA 4PZDA 3FVTA 4JBGA 1DKNA 1DKRA 2VPQA 2NU9A 3FUXA 4XSHA 5DULA 3ZLJA 3DW1X 2G08A 3LDAA 1HZJA 2WJJA 2EX4A 4LVCA 2CXPA 5LDHA 3T7TA 1H93A 3BZWA 3HI4A 3JTMA 4J16C 1AHPA 1U1GA 3NQ41 2O3UA 1I5OA 1CX9B 2D5BA 2DG2A 1ZOSA 5DHQA 5H16A 4ALNA 4DIKA 1JQ3A 3KG2A 3QITA 1U0RA 2HI0A 4KLAA 2GPAA 4N3AA 4QTXA 2ZXEA 3K9FC 3DBHB 4RHUA 1N0WA 3EZ9A 4M54A 2CL0X 3S2ZA 5FWAA 5JRDS 5LMUB 2YNMD 4AZWA 1JFTA 5LQDA 4C89A 3FE2A 4G5RA 1HNWB 4JLBA 1YZYA 5LZ8A 4YQZA 4INZA 1IEXA 2ZRAA 1DBVO 3G2QA 5FLKA 1XJ5A 1QP7A 2GKOA 3TG8A 1QU2A 5GVSA 4HAVA 1CUFA 2GCOB 4CKEB 1SKUA 3DZFA 4RVUA 3CHYA 3DKPA 3NHBA 1MX3A 2GN1A 2GAOA 2H48A 4JLJA 4UATA 1UKYA 3V9PA 1PEAA 3NDPA 1ZZGA 2X8LA 1EVYA 3GGDA 4RVDA 5DK4A 3GLIB 4EZEA 4ITVA 4YR9A 5I5EA 3DE7X 3BQMB 1SEPA 5DX1A 3SZUA 3GOHA 3P19A 5JNVA 2FDRA 3GJYA 1FIUA 2J3KA 4NBWA 1I7PA 1T2UA 3P9NA 4JI0B 2XNKA 3IUYA 4JR1A 2ZSIA 1QHHB 1NW9B 2B61A 3DLIA 4JXZA 2XXAA 2I78A 4GO1A 4W4TA 3ZV6A 2P62A 2QHXA 3QP9A 4S2UA 3VYSB 4ZMRA 2PUEA 1RVV1 5JXHA 5IJAA 3HCBA 2FUEA 5CVUA 5FI0B 4MDHA 4OFBA 1JLKA 1TQDA 1ZISA 4M49A 1O1YA 3H5VA 1DQNA 5BVHB 3ZQ4A 5BN3A 1XJQA 2ENWA 3LOPA 2G83A 3BHNA 2CLFB 1QZUA 4BKPA 5BWLA 4D0NA 1KQNA 1FJGB 2R8XA 3VX3A 2EP7A 3KEFA 3U6KA 2HA4A 3KXKA 4R69A 4Q3BA 1U7DA 4RZIA 4YK7A 5B6IA 2EARA 5K8TA 2C20A 4N7JA 3WMEA 4NC9A 1M10A 4MI6A 5EL0A 5EQDA 3W90A 4HB0A 4MZXA 1TZMA 4BV9A 1E7SA 2NUTB 3M4YA 2GESA 3FWYA 4Z4QA 2F8MA 4Z4CA 3HXOA 1KZ6A 4XVHA 1XVTA 2WT9A 4ZCIA 1E5LA 4ZVOA 1DIBA 2OCDA 3HXKA 4FE4A 3M7IA 4Y9TA 4Z4GA 2WNHA 3OHSX 2I1LA 1X38A 4UCFA 5E6RB 3BH7A 3SZRA 5REQB 1P74A 3GFRA 1FNCA 3KUDA 3LT2A 1H0KA 2G71A 3NEYA 4NG4A 1BXGB 3MWDB 4KV7A 3SBOA 4F0JA 2ZPTX 2X9NA 4E2ZA 2ZI7A 5J2UF 3PEWA 3JYPA 2ZG6A 4EHDA 4KXVA 1CFZA 1O0SA 2O5VA 3JD0A 4RTJA 3FOAA 1ZNQO 1TW2A 2XCQA 4I8IA 4B87A 2YW2A 2RGNA 3CW9A 2DR0A 4QEDA 5FL3A 1SVMA 3OQOA 1XEFA 1DS6A 3OJEA 4MYDA 1WQ1R 4WRRA 3E03A 1ZYUA 1PNRA 2OUIA 4JU9A 2UYQA 3GFPA 3A6PC 2X5OA 1GHTA 3PDJA 4NZOA 1XRMA 1C29B 2DKNA 1J25A 1WCIB 2FW6A 3JWHA 5ALSA 2HBYA 3V1UA 2O7SA 3FFBA 4MZDA 4G1UC 2R5FA 1JDBB 1VG1A 2FPXA 3AUKA 2YC2C 1NOJA 4LHYA 3RD5A 3AFGA 4M0CA 1ZW1A 5B53A 3GGCA 3N8GA 4O63O 3TAHA 1ZNXA 3QVVA 3VHLB 1JFVA 3L8YA 2HRQA 2YN0A 3LUDA 1GCOA 3UJAA 1GLVA 4ARAA 4KWTA 2A86A 1CBUA 2JASA 1LLUA 1OWNA 3OX3A 5TQ0B 5EZSA 4BDTA 4CF4A 5I7RA 4YFVA 2IFTA 1XDSA 2C07A 1KDRA 2ETVA 5DOZA 4DRXB 1N2GA 4YXWA 4EUEA 5JCJD 2CNWD 1YR7A 4AJIA 4YRAA 3OEEA 2KE5A 2ZWIA 4Q9JA 4JBWA 4G37A 2RHGB 4M0PA 3K8QA 1U3UA 4WKBA 4PZAA 5M04A 5JQGB 3CB2A 1XMPA 2HDWA 4FEYA 3V46A 2Q5IA 3MRVA 4Y98A 3SIPA 4D9JA 3E84A 3ESXA 1FF9A 1P9NA 2EJTA 2ES4A 3ELYA 4HUQB 2OSVA 5IUKC 3V33A 3BHIA 4PRZA 1PYOA 1HKUA 4GHWA 4QDUA 1C0PA 3G8AA 3IDSA 3ZGNA 2ZJFA 2BEVA 1YZFA 3VPGA 3JXEA 5I8ZA 5IJ0A 3TK1A 3E35A 3TLEA 4OQFA 3K2EA 4D96A 2XTZA 3FUUA 4WNYA 4BX8A 1KWGA 5ICFA 2YR0A 3D02A 3LKZA 1LS6A 1SGWA 3JQEA 4MR9B 3LRTA 4WFJA 4XUGB 1ULSA 2GK3A 3CPHA 4NECA 3SYRA 4RDIA 3BWCA 4LHSA 4HNAB 1BDIA 1IC6A 1YOVB 3CT4A 1Q6ZA 1PJRA 1GGMA 2QN9A 2PUFA 1RXUA 1YK1A 3GT4A 1GPH1 2G6BA 4N5MA 1G8FA 1NU8A 3GZNB 4R3UC 4YH1A 4ZVVA 1P2FA 1R0SA 1K06A 3C8ZA 1O5TA 2WAYA 4G2NA 2VHTA 2IGTA 1R12A 3I6BA 4DDMA 2AFVA 2KWIA 4KQMA 3X0DA 4ESOA 3NIGB 4JZYA 2X41A 4O4HF 1PT5A 4ARCA 1HURA 4RFSA 1YHNA 5LA6A 3VR4A 1K92A 2IOHA 4Z7OB 2PNFA 4NFYA 4TVSA 2NO9A 2PMEA 1NQWA 3AR6A 1ZGBA 2JFZA 4DGSA 3S29A 4CM6A 3OY7A 1MTZA 4QFDA 2GRUA 4B31A 3PC3A 4Q03A 1KJNA 1X42A 4HAYA 4FYJA 1UIRA 4Y2HA 4UAGA 1USGA 3DAHA 5DTMA 3ZH9B 4ZQBA 2G5GX 1IHXA 4A6EA 3NTRA 1T26A 3DR3A 2JFVA 3H75A 4G2TA 4TMZA 4BKMA 4B6QA 2VP5A 3GEGA 4ALLA 2O5CA 2ZYWX 2EV9A 3QPVA 5IBCA 3DD1A 3MQFA 1I3NA 3WBFA 1GV1A 2E6UX 4KE6A 3LHDA 4Z53A 3GT0A 1U2DC 4XFDA 2PA0A 3P9RA 3VTZA 4CDRA 2GSDA 2R3SA 3NRCA 1F4LA 3PPIA 3V4SA 1P9OA 4DV3B 4U3JB 1GPAA 1Z18A 4H18A 4NMHA 3F3YA 2FY8A 2XUKA 1Q7GA 3OIDA 3T5PA 4MDFA 4CLHA 4FGLA 2HRRA 4U8HA 5D51S 3AM3A 3B52X 3HNOA 4KODA 4ABYA 1KL7A 4LRYA 4C7KA 1WY7A 3NOOA 3G2IA 4PO3X 3QHQA 5CDGA 3E58A 5F7ZA 4FHDA 4WOPA 3DZJA 5EZYF 1BCRB 3DDNA 1T2NA 3G23A 4QECA 4ZT4A 4UZEA 4F5ZA 4ZQHA 4EARA 1BE0A 4NZPA 4BFYA 4DIFA 5BY2A 1XQWA 5ALEA 4CDMA 2A2ZA 1WTAA 2I6GA 1K2VN 4H16A 1YKGA 1XYVA 1PT9A 3OOWA 4JQZA 2A5JA 1NBMA 4G56A 4MKIA 2B1IA 1TJPB 4UHKA 1JIIA 3VHQA 4EECA 3A3KA 4JYCA 3TLYA 2PSDA 3QU4A 3IPXA 3UV7A 1EK1A 5KDOA 1VXOA 2AG5A 2R00C 3EA4A 4LZWA 2VSOA 4MCAA 4DCSA 4RZQA 3ZZ0A 1I7QB 5L95A 4NONA 4V0OA 5CFZA 3KQWA 1N5DA 3GXBA 5ES4B 4MCJA 2CHQA 4KE9A 3LAWA 3OE4A 4IHJA 2JFBA 2Q3HA 5HBRA 3RFUA 2NAPA 2OV2A 5FOTA 3G0BA 2CNBA 2WP0A 1OYYA 4L4SA 4BKQA 4BLQA 4DA0A 2ID8A 2R97A 3FCYA 5DDIP 4EUFA 4ZU1X 1NJ2A 1W2HA 2HCBA 3U48A 1KZGB 1WQ3A 2CNDA 2W22A 1J0EA 3CU5A 3TRFA 4H4CA 5I01A 5ANRB 1ZL2A 2OZPA 1CUDA 2VJKA 2Y1OA 4OBBA 5F4BA 3OFKA 4DZZA 1N1DA 4LOIA 1QXSA 1XEXB 4FI3C 4ZDWA 3UANA 4O02B 3B6ZA 2QN7A 3R40A 4WPGA 2BE7A 3AJDA 4XE5A 3SF8B 1YVRA 4RTRA 3CUKA 2FWNA 1U3TA 1HFWA 2QTHA 4M0FA 4XYGA 3TZQA 4B6GA 3F5QA 3KL2A 1XDGA 2HHCA 1R4AA 3PDIB 3VDRA 1M76A 3KU1A 4CV3A 5CPBA 3QHPA 1WMSA 4Y8VA 4B8WA 1O97D 1SQGA 3AIMA 4C4PA 3FPKA 2G72A 4D9MA 3IIMA 4F8JA 3K6KA 5AVYA 2FMIA 3AF0A 5IP5A 1X92A 1WETA 4QDXA 3SS9X 2PWAA 2X5KO 4C0BA 1B8OA 1PWXA 5JUWA 4AKHA 3OQNA 2CVOA 3BWXA 1EVLA 3CR7A 2XBLA 3HRHA 1A7KA 2FF7A 3ONVA 4JI3B 1VLVA 2WJ6A 1VIDA 2F1OA 2A4MA 5BORA 1EBUA 1G6HA 5F2EA 1ECJA 4MS3B 5JCXA 2QI9C 1X3LA 3N2IA 1EX1A 4N4AA 1JMYA 4OIFA 4L57A 1FUEA 3VYVA 1NRIA 1NQAO 2OZLA 1K9VF 1XKLA 1QIGA 3OICA 4K6KA 1R10A 4WECA 3TPZA 2C97A 4BLUA 3KR2A 1K66A 1SULA 2XITA 1RPNA 2PXAA 2HGZA 1JKIA 2XNDA 4PYMA 2I7XA 5JBIA 5JW6A 1TGVA 1J2TA 4A27A 3G7NA 3NOXA 4B6PA 3SBXA 2J4CA 1KJQA 4L9AA 3RVNA 3VKUA 4JELA 3GP5A 4B33A 4KXMA 5EQJB 4COOA 4LOLA 1M0TA 4IIJF 5K9ZA 2XQGA 1OC4A 3TLGA 5D8DA 1CQZA 1Z45A 2C9OA 4PZZA 1G2OA 2AG0A 2AN5A 2BHTA 1GV0A 1KVQA 1UBJS 2XSZA 3WA6A 1I80A 3LXXA 1VHJA 1HX7A 2NXJA 5H82A 3JRNA 5FBZA 2LW7A 3UPDA 3N70A 4ZZIA 1E2PA 1UPAA 3QVJA 1NF9A 2X9GA 4JBYA 4HMOA 1Q0PA 1FFEA 3TPFA 3AX6A 2PD4A 4CNBA 1XMVA 1ZIPA 4KMRA 4DUGD 5H0IA 2BFEA 1CZNA 3H1BA 4QDZA 5B6PA 2BI7A 1Z7EA 3P94A 4AO7A 2XJ4A 5F51A 2Q4EA 3EN0A 3RVDA 4BP8A 4BFXA 2WKSA 1N8SA 2XKJE 1FDSA 1GGEA 2C00A 4OL0A 2DHDA 1QLHA 2P3SA 1T5TA 4TKUB 1EK2A 4REQB 2VPYA 4IHKA 5HRAA 1Q0QA 2JIPA 2BFDA 3ECAA 4I3FA 3ZHBA 4EVQA 3PNMA 5A5DA 4IFIA 4C88A 4F96A 5A04A 3L9XA 5D86A 3EXG2 4B5LA 2J3MA 1HDOA 4RV9A 3MJHA 1SPBS 4UD2A 3LL4A 1QDEA 2Q1SA 3KXIA 1KEWA 2WR8A 3JALB 3DCNA 4JJ6A 3AETA 2WVGA 3AH8A 4E46A 3DEIA 4K9NA 2PUHA 1ZD3A 3KETA 3CNLA 4IX9A 3PPVA 4RDHA 1U1DA 3ZEAA 5C7OO 1UBSB 2TMYA 3LQRA 1KPHA 2OILA 3NP7A 1UM8A 4RKEA 5J5CA 5SYMA 2XDQB 1EZZA 4DCVA 2I1WA 3N74A 2XMCA 3KAQA 2X23A 2ZRDA 3LUKA 1CIPA 1ECPA 1K75A 5DIZA 4HXFB 2FKAA 4Z51A 1WDKA 1MIOA 3V48A 1CJMA 1WDTA 3L8FA 4REMA 4LKOA 3KZCA 1IJBA 1Z5NA 2PX6A 1U7XA 4YJHA 4UUAA 2JGDB 3MF4A 2IHVA 1JDUA 4RPJA 4CVNA 3S6JA 2RKOA 3U7QB 1YDWA 2XT9A 3H5RA 1GPYA 1QRUA 4DC1A 1JA1A 2P0AA 3ND8A 3I04M 1L7OA 2VOEA 4MUJA 1T0BA 2IWRA 4R9RA 2MTBA 3BT7A 1IG3A 2X8AA 3AF1A 3T5AA 1MJHA 3MINA 4FSHA 2QAGB 4AZ3A 4DMFA 3ROQA 4M1MA 1KMIY 1EDDA 4RPGA 3ZGYA 1CZUA 1SUWA 1B2RA 1JDZA 1K1EA 3QF4B 5CEJA 1N8KA 1G5TA 1XC7A 2PQ6A 4FGSA 4NFLA 3O4VA 3RC7A 3ZWQA 2AKAB 1UM9A 2BMWA 2JBHA 3KEGA 4MKRA 3T61A 1H1LA 1I7DA 1T9HA 2RG7A 4FYHA 4E7PA 3WIDA 1SXJE 1NY6A 1TB4A 3I2HA 4F1WA 2AWOA 3BMQB 3S44A 5B7NA 4JJ8A 1JYSA 1X2BA 4MIOA 4B09A 5HKOA 3F73A 4O4IB 5HK9A 4B6SA 2COKA 5ICSA 4P53A 4ZQFA 4GVLA 3OE1A 3WYAA 3LVFO 1UH5A 1Z82A 3U2QA 4GSKA 1NG9A 1WXEA 1YU6A 2HEIA 3ROEA 1AMUA 1Y1TA 1AUXA 2C57A 3KKQA 3OHMA 3LPDA 4RQAA 3G9QA 4A6XA 3FNRA 5IZCA 8GPBA 3RYCB 1B4DA 1O6GA 3PPYA 2ZZMA 1U90A 5SY9A 3T1NA 2OCBA 2UZ4A 1K7SN 2Q3FA 3O2QB 4K5QA 3BICA 3K70C 3Q7QA 5TXGA 1DX6A 3FYSA 4L2IA 3WWCA 4EDFA 2XQVA 1GWNA 1AO3A 3UMVA 2J0UA 2GLXA 1F8GA 3DDOA 4I14A 4K3VA 3V42A 1T29A 4O4JB 3CR3C 4QX6A 4CYMA 1AM4D 2P9BA 4NYMQ 4OL9A 4C6SA 3I9OA 4RAOA 4EZIA 2KS6A 4FMCB 5B2FA 5KYNA 5LIPA 4U2KA 4Q4JA 1AHIA 5AK5A 5HQTA 3Q9NA 4F72A 1UDCA 2DOKA 3ZKWB 2ID4A 4PFQA 4HTFB 4D74A 1XMIA 3AFOA 1SZPA 2WICA 4HPWA 4Y2UA 3SEFA 3H8SA 4F6RA 5CYFA 4F3NA 2DY0A 2JVJA 4HYYA 4OF4A 4R1MA 2OC4A 4MNTA 5CX4A 3KLBA 3GRVA 4MPDA 3VO9A 4KPFC 1MHPA 1SOWA 2IODA 3T3HA 1SUFA 3T4XA 3JQ9A 4MV4A 4BBJA 5IN4A 3EXHC 3VAYA 5TQ2B 4AP6A 3ED5A 4Z4HA 1HE3A 2A14A 4AD8A 4AMZA 4WFKA 5L3VA 2C96A 3OMLA 4NJOA 5FFNA 1N6RA 2NX2A 5A3RA 2A35A 5HKKD 1JEQB 1NI3A 4EKGA 3NO4A 2FSHA 5IC5A 3UMYA 3MCZA 1V11B 1EMDA 1UZMA 1QDUA 1P5JA 1G4UR 4I2VA 3CJTA 4M21A 3D2CA 3TLJA 5A6VA 3IR5A 2OSBA 3NTQA 5A06A 2OQIA 2I2FA 3BMOB 3HUUA 4HZUA 4MRSA 4NK5A 2VKQA 4ZYZA 1GPJA 2CDRA 1VJ0A 3O82A 4MVWA 1JYEA 2BR5A 3HR7A 3G2LA 3M6AA 4FK8A 4BWYA 3C1TA 5DGCA 1PTJC 2ID7A 4I8DA 3Q15C 4MPPA 1H1TA 4FYYA 4YT5A 3B5IA 3K1YA 1JMKC 2G8NA 1GCUA 4IJWA 1OLUA 1BQEA 1T8WA 3WYCA 1J7JA 4X71A 2WD7B 4KQHA 1P7CA 1XTVA 2I55A 3BKWA 2ZJ4A 3K30A 1N2CE 1GP2A 4UVGA 1LTHR 5CJ2A 4ZALA 2QM0A 4BMSA 4E1AA 3L6EA 2H5IA 4KXLA 2P6UA 1YBMA 3M33A 3A3PA 1VCOA 5FWYA 3DVSX 2IXDA 3EDQA 3TSAA 1SKYE 4F4FA 1L4YA 1TECE 2VRCA 4E32A 3CRVA 2PRKA 1A82A 3R7WB 1YR8A 3OY2A 1TMKA 4HBGA 4TRNA 1KU0A 2AFHB 2WIFA 2A67A 2XUFA 3QKWA 1Y34E 4A9AA 4AMVA 1TVMA 3HYTA 4KGXA 3IBYA 2AFIE 4KO1S 4TPKA 1G8GA 1YL5A 3GT3A 2GK7A 2WJYA 3NH6A 1DBQA 3CA8A 3RYFA 2OHVA 4OCZA 4B83A 2NZ2A 5C46F 4RX1A 3FOZA 1MQAA 1D2MA 2G4CA 4X6XA 2HA3A 2ANBA 3EZGA 3A6LA 5JCOA 4C4SA 1EG7A 5TVGA 5J63A 4CFZA 3RUPA 2H1FA 3WG9A 2J5BA 1KKUA 4X7PA 5K8VA 1U2TA 4LY0A 2AX4A 4G89A 4J7CA 2C5LA 2XEXA 4D97A 4H7FA 1KR2A 4E70A 3UHFA 1T43A 1I13A 4OAPA 2FMHA 1R74A 2I54A 3ZHCA 3ENZA 4CV2A 1T1RA 2ZT7A 3QLUA 3DEJA 3QLVC 3TE7A 3U80A 3W0LB 4B45A 1RIIA 2ZYUX 3M9LA 5BR8B 3QUAA 3FCUB 1DO2A 3GLFA 4GZMA 1CY7A 4B2YA 4I9FA 3E1SA 2X6TA 3TAXA 3WRXA 4I4TA 3MWFA 4UEKA 3NHZA 5AUNB 3FB4A 3LWZA 5J2TF 2DFLA 1IM8A 1YS2X 1WD7A 3FYHA 4B81A 5EVJA 5AVSA 1KOLA 4DNFA 3D7MA 3F6YA 1XDWA 1VGRA 4P3XA 1JNXX 2OLJA 1HQKA 4M1WA 2LIPA 3ITNA 2G7ZA 4QU9A 4I3HA 5G4KA 1K3TA 2ID9A 3B36A 3ON5A 4HY3A 4E03A 3R3YA 2JAQA 4RJTA 4YMWA 1ADFA 4BLVA 3DYVA 4D4KA 5K4GA 2YY6A 1M7BA 4PYJA 5C81A 1C4XA 1JQAA 3S1AA 1T2CA 1W59A 3IMCA 4Q4DA 1C4KA 4IPTA 3FOBA 3AF2A 1G19A 1N2SA 2ODNA 4L8WB 1PL7A 3SQDA 4I81A 1H4SA 5KPDA 1QJ4A 2CCJA 1K0FA 2HSGA 1NP7A 4QUHA 2P77A 4FYWA 2FPGB 4NKRA 4O0MA 3IT0A 4F9GA 3ZDDA 2RGYA 3A3OA 2AKEA 1LX6A 3OPMA 1V47A 2HZ7A 1SBHA 2PGDA 4XYMA 5EQTA 1NMSA 5KJ6A 1LC0A 2VHQA 3M6FA 2HPHA 4DGQA 5DBGA 1VLJA 5B7PA 4RE5A 4NDNE 1ZMRA 3EC1A 5H59A 2AS0A 4GMFA 1UXOA 3U39A 2AEMA 2FUCA 5A7FA 1IBLB 1C0KA 1CUEA 1CUUA 1DC7A 1MU0A 2DUUA 3SYKA 3UGTA 1U0JA 5KTKA 5C8DA 4KO3S 4U2GA 4WZZA 1Y48E 1ES9A 1VIYA 4W82A 4N48A 1XG5A 2VT3A 4V24A 2IEZA 2P9TA 3OEWA 4FZ5A 4GWGA 4W63A 1KPIA 2KJQA 5DXJA 2I91A 1ISMA 5DW3A 5FFFA 4FB4A 2QX8A 2OFFA 4RTOA 2UVPA 1R0BA 3WV4A 1EA7A 2VS1A 2AGVA 2GBGA 3L4KA 2XMDA 2X4IA 2GTPA 1FRVA 3VR1A 5L3QA 1OXTA 4YJ3B 1FQKA 5JSFA 4JSTA 1M2WA 3PTAA 3VDNB 3GDHA 4TV8F 4MUEA 5JAMA 2IBTA 4QHYA 3K70D 5LP6A 4OXQA 1BOOA 1AY0A 3QYFA 3EQZA 2HRCA 4GIBA 2F9MA 5LDDC 2FDCA 1BWQA 4MW0A 1Y42X 1GZ3A 1QZTA 1IOVA 3O75A 2Q9AA 3F6BX 3PGXA 5DWVA 3TEMA 3FBGA 3W3AH 4CXMA 2E4WA 2XB4A 4ILKA 4RM3A 1YI8A 3MMPA 2N75A 1GEEA 3EF3A 4QJ5A 4MV0A 2ZJ6A 1TCUA 1WUTA 3E8XA 1BHSA 1Y4UA 4OY3A 3VAAA 2PA3A 3F1LA 1E3EA 1VI6A 3GG2A 3GK3A 2HDOA 3C5EA 4WBNA 4H17A 2MYTA 3Q12A 1SOMA 2ZJ7A 5KAPA 3W6NA 5EIAA 3QEMB 1RJ9A 2WJIA 3K5WA 4XVUA 3NONA 1WW8A 2FG7C 2JKZA 4QQ8A 4FR5A 1TLLA 4S1PA 2HREA 3KJNA 1IZ0A 3AT1A 3Q7SA 4GZ3A 4QTUB 4UAJA 4XGNA 1OIVA 2WZQA 5L3SA 5E3IA 3IMEA 5B55A 2GJ9A 2JDID 2GNOA 4LX0A 1CS0A 1FOEB 1M2OA 4G4SP 4PG5A 3LCCA 1Q1QA 2QENA 1AIPA 2OK7A 3EVGA 3OZGA 4HPJB 3IE0A 3EPLA 1Y82A 2OXFA 2O48X 4EUKA 4AURA 1PKXA 3K09A 3OF2A 2OZVA 1TF7A 1VE7A 3IUQA 5AW6A 1U3DA 4DQLA 1PJQA 2DUMA 1AKTA 2BGIA 3PC4A 3QSGA 2WEKA 1HXHA 1NNSA 3WISA 3ZDAA 4EQ6A 1KEUA 1LTKA 2NNLD 2F90A 2M6RA 4HDOB 4FEAA 4RPLA 1TEVA 1CUHA 5F2NA 4L5AA 4COKA 4WWHA 4PX9A 3WB2A 5D2CA 3F8TA 2GBIA 5FNVB 1C7ZA 4MAAA 4FKBA 5DSXA 1QBKC 2CBZA 4KGVA 3RNLA 2XCIA 3GRKA 5A2GA 4TRMA 3D4LA 1UFKA 1K5DA 1M8KA 4UBNA 3TKYA 4G65A 2BONA 1EU1A 1JKMA 2YWDA 1DIOB 3AQIA 1O6ZA 3FTPA 2R8OA 4C03A 3FCEA 4J7XA 2W8BA 3FNFA 3LGAA 1Y1KE 5G02A 5GIPE 5KX5A 4HGRA 4OI1A 3WVNA 1GSHA 1U28A 1XCOA 3SE7A 4NATA 1N7IA 2CFOA 1VLLA 2JATA 3WB1A 4LJYA 2Y76A 2O8DB 4UHJA 1DSSG 3WJ7A 4G5FA 1ZN9A 2BW0A 3EIQA 1EK5A 4IV8A 4NX2A 2NTNA 2W6CX 2ZK7A 3W5HA 3L1HA 1MQ9A 1X13A 3MS2A 3VYWA 1HTBA 1R5JA 1P31A 2A5DA 1B42A 3QE0A 3TQQA 1KI1A 3GBSA 3GLSA 1UZUA 2B2CA 1FLVA 4IL5A 2Y66A 1YB4A 4AB1A 1S96A 1XA3A 3L82B 3F6RA 1KFBB 5AOVA 3I3SR 2XYHA 3PQCA 4CU5A 3K73O 4FZJA 3ZBPA 3A1NA 3PE4A 3RYHA 4IV0A 4QXRA 5AVVA 2GSWA 1ESNA 1RMYA 3P97A 2PZLA 1W35A 3MTDA 4Y1FA 5AOBA 1QK3A 3IAFA 2V5UA 2C8VA 1JIQA 2WIDA 6ADHA 1WCV1 4ROSA 2XCSB 1RWPA 1UXKA 4U5XA 3EYWA 2JLXA 3U60B 1XHEA 4DLTA 1L4EA 3KVYA 2ORYA 4N1AA 1NW3A 2W0SA 1BVHA 4I6JA 1L7EA 2D7DA 1XMQB 2OCKA 3CVOA 4DQ0A 5CFOA 3LPCA 2AG6A 3ZDCA 4XOUA 2EF0A 4M76B 5FO0A 4QOFA 1X7WB 2CKMA 1NV9A 3GAAA 5U9CA 3T7SA 3FYCA 1PFGA 5ICEA 1XL1A 3RGGA 4B17A 1XDBA 5AKYA 1QC5A 3K5HA 3I5YA 1PSZA 2IU0A 3VNRA 1TT5A 3UT5A 4J0IA 3L8CA 4CIAA 1NBIA 1K6XA 5C0OE 3K4QA 1E3IA 3OZRA 4JY7A 1Z5ZA 2ZUEA 1YZUA 1Z7GA 2VFAA 3FH0A 4FS3A 4F84A 1OUMA 1NKSA 3CONA 4FZ3A 4KE8A 1M1YA 5CVCA 4BMXA 1BDJA 4CT4B 4X00A 2RGWA 1ZIOA 2VZ0A 3N39C 3RIGA 3NV9A 4MUHA 4GXTA 5IAKA 4BQOA 2OYCA 4J0DA 3CW8X 4BVGA 3LTNC 4JBHA 3P0RA 4CQLB 5C31A 2OB2A 3M8KA 2PLRA 3C0KA 1C7RA 4MP3A 5C7IO 1X7DA 1XD9A 3D4OA 4U2FA 3KYBA 2ZGVA 2QRQA 4FBLA 3KLPX 4DM3A 1KXJA 2B0JA 2ACKA 2PLWA 4DCJA 1D4FA 3R7FA 3TOVA 4G1VA 5C8YF 3SSOA 4DMHA 4DLNA 1DI0A 1IOZA 1T2VA 2B78A 4JWKA 4L7QA 4D5GA 4EPYA 2BOVA 4B34A 2P9EA 1DINA 1JSRA 2I8CA 1EWKA 4RK5A 1A95A 4RIHA 1ZJ5A 5FA5A 3M4ZA 3ZY3A 4PLVA 3RU7A 3THXA 3V8EA 1EFRA 1CTQA 4QRIA 4KYUA 1DELA 2IDMA 4IEEA 1OX4A 4BGUA 1IHUA 3Q7PA 3IQDB 5BPHA 4D4HA 3GOQA 2CXUA 2G9VA 1YQ9A 3KP1A 1US8B 1ZUWA 4ZVPA 5KCMA 4S1OA 4ENQA 5IS2A 2P6PA 1R0RE 3C74A 4D81A 3BFJA 2GLUA 1INLA 1SVOA 1AKNA 1OASA 1YGYA 4JP5A 2NU6A 1VG8A 1H5QA 4RDXA 4MIKA 2CLCX 1YZVA 4UDOA 4BX0A 2HNKA 4W7IA 4XVRA 4Z4FA 3EIXA 2X13A 3KSDO 3E5HA 2I7VA 3LFUA 3DWIA 5EINA 3MTEA 1IXYA 4AJJA 2AOTB 2I2DA 2FMXA 5FCDA 3F67A 2WWRA 3VO8A 1X0XA 3D7NA 2ZBVA 4ME6A 4IIGA 3FCSB 2ZIXA 1SCJA 5ICCA 4C14A 4B2IA 3LHFA 4EI8A 3RAPR 3RH0A 1HMYA 1MHTA 1DAHA 5J5VA 1CV2A 3N2NA 2WSIA 1D03A 4IO0A 3VV2A 3CNBA 3COSA 4MRMA 1ZGCA 2XGOA 2QU7A 3BGIA 3DFIA 3JAKB 4KWHA 2D2IA 1LV7A 1DOAA 3D3WA 2QZ9A 1IAQA 5KWEA 1GR0A 4ZMSA 4J0FA 1F0KA 4CQMB 5EESA 1KSFX 1W0KA 2MYNA 3LQ2A 4TV9A 3U4AA 1XEWY 2HIAA 1T1GA 2V7UA 2ZJ0A 4AX4A 3LT5A 3GMTA 2WQ6A 5IMSA 2WSBA 3D1VA 2G9UA 1DTSA 2ROQA 1IEWA 1JEOA 1SB9A 1JEDA 2IOFK 3C7CB 3KOXA 4TMTA 2BEWA 1SIOA 2K7FA 3SQWA 3K1ZA 4RD3A 4ARZA 3B53X 4L6CA 3ZGZA 2QXTA 3FRJA 3V8PA 4KRFA 1CQJA 5EIFA 3OFVA 4S1NA 4DG8A 2DERA 3TOSA 2WNIA 2YN2A 3G9XA 1FTQA 3BJEA 4B6RA 2HHHB 1ODKA 2ACEA 2ZU0C 3U0VA 3PHCA 4I7EA 1MXFA 1C5KA 2QNBA 4L8FA 1JEEA 1GAJA 3HFSA 3MUEA 5DNEA 4GC5A 1N9KA 3T3EA 5KTOA 2C3MA 2OORC 5EJ4A 2EBWA 2TMDA 4UE2A 3W04A 1RZ3A 1K27A 1TFRA 4HEJA 1LTQA 5FOVA 3KLOA 2QYOA 3CRQA 2GHIA 4W99A 8AT1A 1SCUB 1WBDA 3B9QA 2FA9A 5LQNA 1F06A 2I6TA 5CXSA 4EKYA 1UP4A 1ARZA 3CTPA 4KGZA 2J9FA 1DTWB 1U1CA 2VHVA 4B9AA 1H05A 3MOIA 4C7MA 2I6UA 1M1UA 3FKJA 4C87A 2DBZA 5JBNA 3I32A 3PNYA 3D0OA 3E9QA 4DXAA 2WAOA 3HBLA 1WUYA 2ZJOA 4EG5A 1X7XA 2DU8A 2Z1DA 5JVDF 4UAUA 3VTAA 4X1IA 5I7FA 1MB4A 1EVZA 4EYSA 4R71A 3G9ZA 3P0EA 3I2KA 2XLBA 3WLIA 2ZRHA 4LJSA 2A88A 3H19A 2Q9CA 3K9WA 4YCLA 2JVKA 2PXXA 3LVQE 1EM8A 2WM9B 5FLYA 5CA1B 4IVQA 1E2DA 4PHHA 2FLKA 3VH4A 1W96A 2BKVA 3U3DA 1TCCA 3DAFA 3NNNA 4AM8A 4FWTA 1EWYA 1W75A 3H13A 4GR9A 3RKRA 1ISRA 3Q0IA 3R3ZA 4BLWA 3DQQA 2DTDA 1DZ3A 2H2WA 3LC1O 5IPFA 3EXIA 1QRDA 1IRXA 4HAIA 1KO4A 4DV1B 2PX3A 3O4JA 1BFKA 1HTWA 1QJCA 2CHFA 3FVQA 4I5DA 4OGWA 5GJCA 4XD7D 5KNCA 1XEWX 1YI1A 5FV7A 3W3ZB 1QMGA 4DUPA 3PDWA 5AHOA 2I76A 1PDVA 2VPZA 4QPCA 1RAAA 2FXIA 2VSYA 3RWMB 2WNSA 3X1YA 3AHGA 3I73A 4MLZA 1OKKA 4NBKA 1C14A 4OXYA 4MEBA 1YWGO 3SDZA 4M9XA 1MOQA 3BB3A 5HCNA 3WSTA 1XK7A 4FCTA 3ELWA 4A15A 3F7OA 3HS3A 1NP6A 3AFIA 4LE0A 3W8EA 4R98A 1JQ5A 4E5SA 3KTAA 2CL6X 2DT5A 1NUQA 3QLEA 1U7WA 2IUSA 2MHCA 2A0FA 3F4LA 1D07A 4R01A 1B0PA 3STVA 3W2EA 1CY2A 2XYQA 3BB4A 4L78A 3HEBA 1UP6A 3FYDA 2M2IA 3G8DA 2PEYA 3IDOA 3ZOZA 4QT4A 4C3UA 1WUIS 2R6FA 2XXBA 4RBNA 4UPDA 3M6MD 3DUWA 7REQA 5KTMA 2CEKA 1Q92A 1K7EB 3VBEA 2J7PD 4GPBA 4R51A 4XR4A 5LU9A 1T2AA 1RQXA 4OBWA 2Z8ZA 4OOFA 3ZWOA 3UXMA 1XKQA 1J8QA 3AHFA 3SFZA 4EG4A 2PJUA 3JQCA 2IXBA 3SX4A 3A31A 2WTUA 4MARA 4L95C 1QLWA 3NT2A 4AUNA 4CF3A 1ADYA 2JFGA 1LC3A 1QH9A 1VL5A 3G2HA 4NNJA 3WIOA 4EO4A 4LHEA 5JH7B 5ALWA 1W5SA 3LE8A 4OHXA 3RJ5A 3JD3A 3UUFA 2HN9A 1E8DA 1GN9A 4US1R 4YT2A 3L7LA 3MWJA 5ALGA 4BO6A 1ZJJA 4ESEA 1T5DX 4QDTA 3VOAA 2D1YA 3LCJA 5E9AA 5M2QA 1DWOA 2WI8A 3AM5A 5ER9A 3T41A 1DBSA 2C5EA 4RA9B 5JAIA 3C3DA 3P9CA 1YD7A 2WSSA 3L46A 3T7KA 5BW4A 5LD2C 3HZZA 1XVAA 3Q8XB 4JU8A 4IQ8A 4JB3A 4UTOA 5MFZA 2VTBA 1IXSB 3HV2A 4R2IA 3L1KA 1OTXA 4HWGA 4U0KA 3JVUA 2E6KA 2B83A 4ND8A 4PGGA 1P44A 3MAJA 3O38A 3LUFA 3QVTA 4Q9KA 3F9RA 2WKPA 3UM9A 1JHOA 2PG3A 2Z8YA 2HMVA 1LBSA 1LDEA 1KZ9A 4G41A 1LSJA 3N8HA 1V43A 1UBOS 2P6MA 3EC7A 3HO8A 2YWBA 3AB3A 4HH0A 4P7KA 3BXZA 5G53C 1A27A 1PIWA 1MC1A 5FL7A 1NXWA 3UUWA 5MGNA 4YAWA 4UZFA 4LC9A 3GROA 4B44A 3OT1B 1ZUNA 1VP9A 5GOTA 4L28A 4DT1B 3KU4A 4DR4B 4RPKA 4H1HA 2CHUA 3PXXA 2Z9CA 4PHTA 4EY7A 2ZSFA 2C3YA 3W8DA 1P72A 2I4MA 1QHYA 3ZCVA 4RETA 1ZNZA 2V3CC 2AQKA 1VM6A 4UTZA 3BRWD 3R0XA 3COVA 1HT3A 1KVSA 2QRLA 3VR5A 2UKDA 3EUFA 4F5WA 1EGHA 4U2EA 1E2GA 2WZBA 3NNDA 3W6ZA 1U1EA 3Q9LA 2Q07A 4JVMA 4PLTA 2AOUA 4FWBA 4CKBB 4P84A 4RVNA 4FCVA 4XVQA 2K5UA 4XM0A 1PAUA 2C9ZA 3R6DA 1IY0A 2C7BA 3BYZA 3MLAA 5G2OA 3VSCA 1A97A 1Q19A 4Z49A 3W2HA 5KBYA 2F43A 4ZXFA 4GF5A 3HJFA 3K32A 1L5OA 5K09A 3MVEA 1QKJA 3O8QB 3L4SO 2QTCA 4I2NA 2GJKA 1NR1A 2GKGA 2QPAA 4CG3A 3TQSA 3DGEC 1F9EA 3VR6D 2G06A 2CJWA 1RT9A 4EL0A 1Y80A 3O1JC 1IHDA 5HCIA 5HVNA 2DPGA 2QMUA 1CUWA 2VUUA 4RLFA 3KSAC 1C3VA 3VJRA 1JSXA 4P5PA 1G63A 5FX2A 1XZEA 2NQ2C 3NORA 1E3SA 2Z95A 2I4LA 3G82C 1RWBA 3RASA 2WIBA 3PDHA 1R0CA 4CQNA 4D57A 3QMPA 5IN5A 1J7KA 1QWSA 2V4UA 4I4LA 1U2GC 2RH9B 3ASUA 3CCBA 3VO1A 1L5FA 3IFSA 3RAJA 3UHAA 5C2JB 3O6VA 4ZPXA 1XD2B 4ZCRA 3QKTA 3TEJA 4OI0A 4MVXA 1R9GA 1GZDA 4GM0A 221PA 1WVIA 1CJUC 3RO7A 1YQQA 3OLWA 4YRPA 3T54A 4CNQA 721PA 3I1YA 2ONJA 1FUIA 1OYOA 1PNVA 3RVBA 1Q21A 5IT5A 2G1PA 1ISHA 1WMEA 2NT3A 2V3VA 3PFKA 3C1OA 3H2KA 4MCHA 4ZOBA 5EJ2A 4B5KA 4EW2A 9GPBA 4D8TA 1BH6A 4J76A 4OMCA 4QULA 3A4IA 2J0QA 1K68A 1RWKA 1Y8QA 2V7XA 4WZBE 5JFTA 2JFFA 4A3SA 3PDUA 1DT5A 1P8JA 3F5DA 4CUJA 2Y68A 4XWOA 1G7CA 1TEHA 2V6JA 3RREA 2GD1O 2VHZA 5IUNC 1NDQA 2GRJA 2VYQA 5K0FA 2YXLA 3FPSA 4BO9A 2IS4A 3E8SA 3UGQA 1UMBB 2QORA 1KJJA 1T36B 3K8ZA 4ZJUA 2HQSA 4DLYA 5HNKA 3W5JA 4BV3A 5JT1A 1M1NB 2POCA 3AYXB 2Q9UA 3C3AA 4R1SA 4S1WA 1JHRA 4IKEA 4WN3A 3ABOB 3E1GA 4X44A 2OYRA 1SMKA 1D09A 1ZC3A 2HBRA 3HVUA 1T6YA 2DJIA 2UZ3A 5ECDA 1I2AA 3LFHA 3JVVA 2C0PA 3PRJA 2OM6A 2XCOA 3HLYA 3KQTA 1GUBA 4OG2A 2FEKA 3GNTA 1TVEA 3LK7A 3JQ7A 4XX1A 1UDWA 2DRIA 2PUGA 1AQ6A 2WIJA 1LLCA 4WINA 4CJXA 2X3YA 2YNMA 5CIYA 2XQJA 1S4QA 2I6SA 5DBHX 4N5HX 3BSSA 2CEAA 5MN5A 4MHTA 2VNIA 3OCXA 4RWZA 5F78A 1QZ3A 1XJCA 1YVDA 1WE2A 2OAQ1 3RYHB 2ZANA 5H1YA 1E66A 2VNAA 3NHUA 1R9JA 1E98A 2H6EA 1SBTA 4P5DA 1AN0A 5CM8B 4XWYA 3RHZA 2WF7A 2XMRA 4URFA 4XEUA 1CU1A 3OKAA 4WMLA 4KNWA 3BTOA 2FMTA 4MMYB 3H1PA 1NI5A 1YQEA 3NAZA 3B5JA 2NYUA 4E33A 3HKCA 4PX3A 5B3JA 4JEIA 2BKUA 1ZK1A 3VUFA 4B32A 3VA7A 3DH0A 2EBUA 5BMVA 1FSZA 4YRMA 1D8TA 2NUPB 1IBRA 2WMNB 3UJHA 2PT9A 1VP3A 1SOAA 2W00A 1GAXA 1JSCA 2H3EA 3BE5A 1V5GA 2QVLA 5FB3A 4PCUA 3AZPA 5LM3A 2DPYA 1PGQA 1TA4A 2G1JA 3ROGA 4LDNA 3B1YA 3I4LA 3DD5A 2CMHA 1HSZA 1SH7A 4DR7B 2GZ3A 1OJLA 1GL7A 3B8HA 2IY7A 3SBDA 2Z56A 1XZHA 1NOKA 1IY1A 4EENA 4ZEVA 1CWUA 4IG9A 2VYND 1KYXA 1JV2B 2AYXA 2FW7A 4CDGA 5KNBD 4IIXA 4MYRA 2CL5A 1M73E 4TUYB 1P5RA 2E49A 4DN6A 3ZEIA 5ITZB 3THOA 4F1JA 2CE7A 1Z5VA 4I55F 4P7FA 1ICEA 1QO0D 3DT9A 5LLDA 4IQFA 3UUEA 2H11A 2WHQA 3I6ZA 2Q5QA 3ECSA 4Q4CA 2ORED 1ZIYA 2CWWA 2Y1EA 3H9GA 4NFHA 4DBLE 3AI2A 5EYPB 3B5EA 2FWRA 3LX6A 2YQ4A 2PLAA 1C9JA 4IQ0A 3LXMA 3EC2A 5HBGA 3PEEA 3KOZA 4KVAA 3CH4B 3H3JA 2ZRCA 4DAEA 3ZZTA 2ZWOA 4JWTA 5T8KC 2R6HA 4JFRA 1ZGZA 1RKBA 1J0XO 3E7PA 3I2IA 3WKCA 3ZGLA 1NW7A 2ZWVA 1H42A 3A32A 2A9OA 2CXHA 3EG5A 3E7FA 3WO1A 3NPMA 1S6YA 1WZNA 4ZOCA 4KG7A 5KOIA 5KTYA 3SOPA 5CVDA 1L7RA 4DJJA 3DHYA 4LV6A 1EXDA 2IU4A 2ZBUA 5JSHA 3OLQA 5LZ5A 3WAGA 1L4UA 1BGWA 1ZH2A 4LSGA 4CEIB 3JWEA 1KSGA 4FJ0A 3ICQB 2HXSA 4L4RA 4ZAVA 3ED1A 1Y9AA 4JQYA 3FPFA 2C1ZA 1ZD1A 4I8XA 4K6GA 3UMCA 4JIMA 1Y3CE 4PYIA 1WKCA 1QGAA 1E4YA 2XUGA 3CH6A 4WK0B 2IYZA 2YJNA 5LXTA 1Y0BA 2EF1A 1D1SA 1KY5A 2BMDA 3GLUA 3LCRA 3LYAA 2KB0A 4FN5A 4KQGA 1UF9A 1Q50A 3AEUB 1ZMBA 4Y9RA 5D6NA 3BUSA 1TAQA 1S3SA 2FPLA 3NBQA 2JIZD 1PQ4A 4PANA 1QFXA 2BUBA 2ZT6A 1S3FA 5HKLA 4DV0B 1XD8A 1DADA 4LAFA 1UXJA 2VBGA 1WDWB 3H2SA 2VF7A 4Y1EA 3RRBA 3VZCA 1J8FA 2QM3A 2PQ2A 3KB2A 5KQRA 5BNZA 3DMHA 2F3RA 1Y6FA 3H5IA 1YBVA 1ACMA 2DGDA 1CUGA 2WA2A 3MGCA 4MGIR 1N0HA 2WMDA 3AR8A 3BWBA 4RHFA 5K0BA 4BUJA 3KQNA 3QA3E 3BTUA 1WPXA 1KZ1A 4QPPA 3O0TA 3REOA 2P90A 2RKBA 2GEJA 1GVNB 1V8FA 1E3JA 4QLAA 3UW3A 4NENA 1QGYA 2CUKA 3DMNA 3GGOA 3ICPA 2UZ0A 2ZWMA 4GL4A 4IXMA 4RSHA 1DARA 3RF7A 3TOZA 4BQNA 1Z0DA 4FQ7A 5CM9C 3GN2A 2A8YA 3HBJA 3WIVA 4RAQA 2CFSA 4IDDA 1OSNA 2DFPA 4BP9A 1P39A 2E87A 3JQDA 4UDXX 3ONNA 3W7VA 4L76A 1O58A 5I6DA 1GSOA 2Z6AA 1LY1A 1RBMA 4OGLA 2X76A 2PN1A 2XZTA 4DLAA 5LJLA 1L7MA 3O1IC 1YJCA 2OBLA 3N86A 4QO8A 2AZXA 2O8CA 1SNYA 3EXFB 1S2GA 4FJ2A 4KTVE 3DL7A 4O33A 1KJ9A 3K6JA 1HDIA 3USZA 3W4IA 5G4LA 4C6RA 3KPYA 3RWOA 3WYDA 1IXKA 1NMEA 3CZPA 1JIVA 2ZAMA 2EJBA 2CB0A 3PNBA 5JTUA 4N5LA 2QVGA 1QTRA 3ZDEA 4RD2A 4NL4H 2REOA 3TO5A 1EUDB 1A8QA 5KYYA 1NRWA 3VQTA 1VE5A 4DQUA 3V55A 2G5PA 2K87A 2DJ5A 1Y3DE 3IJEB 4YP6A 5E4YA 3UT6A 5JAPA 4JC5A 1FX1A 4GXNA 2X5XA 3IOEA 4AWAA 1PR1A 2X1VA 3AI7A 2Q4OA 1FY2A 3L41A 3OU2A 4PIPA 4LZZA 3O95A 1XQXA 1EIWA 1KKLA 1RWQA 3U56A 1AN9A 2Z6QA 3GEEA 1RKVA 2IP2A 2MR5A 4RQBA 4LRQA 4R83A 4YRDA 2V7PA 1QHXA 4EKIA 3LKBA 3H87A 2QIOA 5GGYA 4Q1VA 3IL2A 2ZBDA 1A4RA 1J0DA 3PF8A 4OQQA 4S1VA 5K5EA 1R8YA 2B8TA 2IHYA 3MWLA 1Q2XA 4YYZA 3HEAA 2GN0A 4QU0A 1UBTS 3K0HA 3KZOA 4M0UA 4HQLA 4HEA1 2RGAA 3C3MA 1DMRA 1L1QA 3CKKA 4TXJA 1N75A 4K1XA 3GLHE 3A4MA 1QKKA 5CX1B 3EWIA 2O2ZA 2QD1A 5IJZA 5I7VA 2VQDA 3I9MA 4AZVA 1N7GA 1RHQA 4D3YA 3NHLA 4CMEC 5IM4A 4RH3A 4YJDA 2XE7A 3N2KB 3A0RB 3BJRA 4NCIA 4Q66C 1S2NA 2RBEA 3TG2A 1QH1A 5ERYA 1XVLA 4KK3A 4G63A 1FTWA 1MA0A 2PMBA 4XDYA 1NASA 1RQGA 1H22A 4IDOA 5M34A 2IE0A 1GPDG 2OGSA 3OCVA 4HTAA 1B6GA 3I9LA 4J2OA 3RIXA 3KE8A 3TIVA 5GTDA 3GI1A 2I4TA 2OFPA 2QLJA 3O7MA 1G291 3P0IA 1EUCA 3QX3A 3OE5A 2O57A 5HE8A 2GVZC 4NCBA 2A78A 2F64A 3O5AA 4NOKA 3FWKA 1ZZEA 5EIEA 4QOHA 4BXOB 1GQ2A 3D8BA 4LGCA 1E4EB 3OKPA 4XAQA 1X8LA 2EWMA 4S3MA 5E6SA 5E4JA 1XBTA 3M6VA 5AESA 4DDTA 2NU9B 1VPEA 3AKZA 2RK6A 4L5JA 4DJDC 3BZUA 1MG0A 4GGOA 4M86A 3FNIA 4KLCA 1GKLA 3DOUA 3NFYA 2ZRJA 2HMTA 1G21E 4XSGA 1Z13A 3KFXA 3ZHRA 2C9DA 2WHEA 2D0OB 3S2UA 5ITWA 4NHEA 5CXXA 4LHWA 3BJIC 5SZIA 2G4VA 4LFCB 1EDOA 1K4KA 4MPTA 3UENA 2MT9A 2WJ3A 4KQFA 4NVRA 4WXMA 4AC9A 3HB4X 4YRTA 3IKTA 1KYIA 4Z0PA 1R6BX 1JS1X 1LQTA 4LQCA 1CFJA 1E2BA 4QA9A 1YJBA 4W5NA 3V5NA 1W2GA 1TFUA 3C4QA 4NYJQ 5EE1A 4GI3A 3TRIA 5LQRA 4JJFA 4A6DA 1Y3HA 5CHYA 2NGRA 1JN0A 1ZUIA 4J1QA 4DS3A 1UFVA 3EOBI 3ETEA 1QTQA 5CLFA 1FVXA 1GSIA 2WZCA 3HHEA 5IABA 4Y6SA 4AECA 3HB5X 4MRAA 1SXJA 4JQCA 4Q12A 4BO0A 5KJCA 4LXTA 4YACA 3VPHA 3WDSA 3GJ0A 1GRCA 4RCZA 4NOLA 2PUBA 1MRSA 3ANNA 4EO7A 2NVUA 2QLBA 3T3PB 1QU3A 3M9WA 1GZUA 1U0FA 1UEJA 3OTHA 5EXDA 2IGBA 4MW2A 5L3ZA 2HWYA 3GGPA 5BXQC 1UINA 3BEDA 3N7UA 2ONCA 4MR7A 5IVDA 3BGWA 1DJLA 4EA7A 1SC6A 2XXAB 1NLMA 3R1IA 3ZKWA 4PWYA 4Y6LA 4BKOA 3BXEA 2ERYA 2F67A 3H83A 2ADFA 3OKFA 1EWQA 2P3QA 1DAIA 1UT5A 2C8KA 1JG2A 3AHHA 3W4JA 2O0LA 1FNBA 1H8ED 1PZFA 2BFMA 3AP1A 4G4GA 5FTNA 3SEQA 4C0SA 4CMEA 2Y9PB 5BN3B 4HDRA 1JHQA 1ZWLA 5HF5A 2ZAGA 3UKOA 3CSDA 4ZT3A 4EKNB 2K2QB 3O3CA 3AU8A 1WR8A 3GPCA 4IZHA 3ZHOA 4M6WA 4AKSA 1RSZA 5CLIA 1B74A 4FSDA 3MGAA 2L82A 3OIVA 4IOKA 4KDEA 4CMIA 3PS9A 3PYMA 4N5NA 4AQDA 3JQAA 5I8PA 3BCRA 2V7BA 2YMQA 2JZCA 4M98A 4QJIA 5G1OA 5K6RA 1ADBA 2P30A 1L4NA 3BK7A 4LHXA 3HLKA 4RIGA 4DUGA 2PL5A 1WDLA 4KUHA 4OHRA 1BD4A 3R3SA 4MS1A 3R7SA 1E2LA 3PNLA 1BN6A 1GUYA 3EJWA 4DLVA 3GGGA 3TTXA 1PFUA 3TJRA 3CRNA 4BJ1A 4XCQA 3Q3IA 3KZNA 2BKEA 2Z2KA 5B7GA 2IV7A 1H1DA 4EBBA 4RANA 5GADl 1MUUA 3UW1A 5JDCC 2BFFB 3MSCA 3OLYA 2OHJA 4CMJA 2IYFA 4PZ9A 2A9QA 3KJQA 1TOAA 3JRWA 2Z8YM 4DARA 4Z6KA 2P2LA 4MUNA 1PBTA 3A6DA 2BC9A 4E4RA 5K0CA 1JVSA 4G0MA 4DVJA 5ALKA 4ARBA 1COZA 1HYGA 1NJSA 1HBJA 1GCIA 3ZQUA 1R8XA 2G5CA 5AVWA 1U3VA 1GADO 4W6QA 3KS9A 1JEAA 4LJAA 4RA6A 4BMNA 1E7MA 4ID9A 4KAXA 5FJIA 5CP8A 3ILVA 3K0BA 1ZXLA 3FFXA 1DAPA 1XROA 2TRSB 2B21A 1MX1A 2FPKA 3J80A 3FHTA 3T94A 1CEXA 1XZMA 4J4BA 1QGOA 3RSHA 3D3KA 4AYWA 3OE7D 3L8DA 4EUHA 1MOPA 4GOMD 1CT9A 1M7GA 2P11A 2AMFA 3KVNA 4D0RA 3U09A 3AI1A 2NSJA 2O8FA 2PBZA 1DBRA 3PGVA 4TTQA 1VSVA 3TXAA 3MHTA 1N2CA 2QZJA 2BHRA 4IJ5A 1O03A 2REXB 1NPYA 3ZNOA 5IAAA 3QNUA 4OKSA 5AVUA 3PSAA 4B6FA 5JOQA 4FFLA 1KVRA 1YQWA 3OQBA 3HCRA 5ELLA 3LX8A 3DVQX 5KDLA 3D3QA 4CG1A 3AL2A 4MI3A 4NRDA 4DV5B 1OQAA 3NVKI 4MV6A 4RJKA 2Q6TA 2AFIA 2BEVB 2PD3A 3M6LA 1FRQA 4RYLA 5IJ0B 4OX9B 3CF0A 4TVKA 2I7CA 1RRPA 3FB1A 2NO5A 1ULZA 3COJA 4WK6A 1F2UA 1L7AA 2FP3A 3H7IA 2FOLA 1PK9A 4REOA 2PKQO 1UC5B 2IPLA 3A58B 3F9CA 2LIVA 5HJ2A 3UNXA 1DBPA 3W2GA 2Z3VA 2PXHA 1QZZA 4E6EA 3ZHZA 3U7HB 3QE3A 3QEJA 4BNDB 1EK6A 2UUOA 1U11A 4F2GA 2GERA 3MNFA 2DVMA 5I4CA 2ZI6A 4I5IA 5CVJA 3WGJA 1XTZA 3BDVA 1PN3A 3F46A 3ROZA 2V45A 4RFSB 2LNDA 3WICA 4QZVA 3RABA 2C2XA 2FZVA 4QODA 4S04A 2VRWA 2XB2A 3WGHA 3A9TA 3WHPA 2QQFA 3LP6A 3R5KA 2KSQA 4I1IA 3UXHA 1VYVA 5JV5A 1GZ4A 3EIWA 1U7TA 4IR7A 3G9TA 5BSEA 3A7EA 1RI1A 1D2NA 1P73A 2A6PA 4IUBS 2QPLA 4NESA 3RI3A 5IC4A 2PGOA 2H4YA 4Q18A 1K08A 3OJXA 2HRZA 1ZINA 3PFBA 2WWHA 4BNUA 4NYIQ 1U0OC 1M2VA 3LT0A 3DFMA 4GP7A 4NU5A 5IF9A 1YVPA 2PV0A 2C58A 4JT4A 3NRBA 3MG9A 5E8RA 5EN4A 1B1AA 4PGMA 2PCLA 5F73A 3PRYA 3BB1A 1MRNA 3HSYA 5T57A 3U1VA 2AEFA 4RH0A 3WIBA 2X2OA 3NWJA 4IS3A 1YXMA 1PLLA 4JENA 1HZZC 4IHAA 3C3XA 1RXWA 1AV7A 4XDGA 1N78A 4KV9A 4M9CA 1N2XA 3QFRA 4FFSA 2ZAYA 4HDSA 1V9SA 2BLNA 1AUOA 3KLNA 4TLMB 5BQ3A 2C7VA 5HKKA 4WOBA 2BGMA 5AI9A 4AN1A 3GFQA 4XIIA 1IM5A 2QRPA 4ZGGA 2WWIA 5LKRA 4KH1A 2Q0SA 1FFSA 1T4CA 2FEXA 1MO4A 3TZEA 3SLGA 2LR0A 3ANMA 5JROA 1BWRA 4IVNA 3UMGA 5K8CA 4DJTA 1GNQA 3UQZA 2XGJA 2QSZA 4L85A 2PUJA 1FNDA 1U04A 5KCZA 1ZFNA 4LOHA 1Z2OX 5DNDA 1KQPA 5FUYA 4EGJA 1DRKA 4XTCS 3L7NA 3C16C 3N0XA 5EJ9A 3KSBC 3JWIA 4TLCA 4F9EA 2KBFA 5F12A 4OI2A 4FPXA 4DLKA 4AXXA 5B1HA 1QZXA 3GQVA 3OLZA 3ESRA 5KWJA 1JHZA 4B35A 2V7EA 3M70A 3C3YA 5H5JA 4D9EA 4G5QA 5FRDA 3GMDA 4WASA 3SY8A 1SY7A 1ZD4A 4K9QA 3TUJC 1F0PA 2V7TA 2G40A 1ZR2A 5A9SA 2QX6A 3X1WA 2Z2ZA 4QU5A 5HS6A 3E7DA 1M8PA 2FPSA 3EGDA 1CIVA 4YV0A 5KSWB 2HSDA 3OLXA 4YO7A 1Q3HA 2EAUA 4IHJB 2OC9A 3BKXA 4WW0A 4Y6GB 1X7GA 3UFBA 3KHTA 3V7UA 1W19A 4DWWA 2ZUTA 3DFKA 1E6LA 1U9CA 1PGNA 4G81A 3CLUC 1HDCA 3GD7A 3EGWA 4AJPA 4LV5B 3EUEA 4BNIA 4R31A 2OPBA 3EMVA 3PVSA 2B4KA 1X86B 1H6BA 2WG0A 5ALIA 3OIYA 2BEJA 1IWBB 1HE8B 1W2WB 4LK3A 4ZOLF 4WZAE 3WADA 1L6RA 3PQ8A 2Z04A 2GX6A 1X15A 1LRJA 4PZ0A 4RF3A 1A4IA 2DBQA 3P4YA 4JT2A 4C9BA 1GUDA 2ZTMA 4GE3A 5JS8A 1DEAA 5JZSA 3EZFA 5IBPA 3VU9A 9LDTA 1EGQA 2ZPAA 2I3AA 1BD3A 3R76A 4TVOA 3S5UA 1JDBC 4QLOA 1X0VA 5FQOA 3W6UA 1JB1A 3IIJA 1U8TA 1F38A 1U2QA 3S99A 1DRVA 3UGKA 1LRKA 4DLWA 3FPEA 3L0YA 3EEQA 4F2PA 2FX3A 4HKTA 3OX2A 4FU0A 3N0TA 2IOQA 3VR3A 4ZIRA 5CFRA 3U7FB 4AMUA 4GSYA 1PR6A 4XJVA 4Z3KA 3Q9SA 4JA0A 1TIPA 4BTEA 5HTKA 1Z6TA 3ZWNA 1VGVA 2ODQA 3SHQA 1Y7PA 4BL5A 3EDRA 4Z3OA 4LWQA 4CMKA 5JSZA 2OZLB 2RIRA 4J4HA 3QV1A 4YAFA 5E2AA 2O06A 2DWPA 3FRIA 1RPJA 3U81A 3CUUA 2C7OA 4GYYA 4TYYA 4P83A 4HPXB 1XXLA 3EXG1 2AYZA 1V8ZA 2I5PO 3CEHA 3E3MA 4H3SA 3U13A 2VWPA 4TSFD 3L0DA 4X66B 4PF1A 5FTJA 3MWKA 2RHOA 3NHWA 3C7DB 4RLHA 3VC3A 1SRRA 5DX0A 1YC2A 2X9VA 1T5HX 3DZ8A 3QVKA 3OCWA 1ZM3A 1NSTA 5CVEA 3T7IA 4ENUA 1KEEA 2DR3A 4B47A 3TQCA 4EABA 4EDHA 3EWNA 3GRZA 4OTZA 3TLGB 1RBZA 4ZYWA 1AKUA 1WUJS 2EGGA 2Z5FA 4L50A 4WN9A 5CPFA 4PY2A 3OFND 1Z4KA 4ZT2A 5K0EA 2WFZA 2Q0QA 4PAQA 1L5LA 3RVJA 2IS2A 1N5KA 1N92A 4UXHA 1YMUA 3P7MA 2DPXA 3L7OA 1QPZA 1G55A 1HG0A 2GZDA 1NLZA 4WFIA 3KNZA 2YW9A 4C2AA 4C3VA 1AZLA 1UBUS 3DC2A 3DZKA 1IBSA 1RWWA 1AZWA 4PQGA 3HA2A 4TKMA 3TVYA 3DJFA 1CERA 2BRUA 2JA2A 1JF8A 1UODA 2BFEB 2V1UA 2DBRA 1QNFA 3NBKA 4CV1A 1AGRA 3PJGA 5DGDA 4BCBA 5BSWA 2DQKA 3UHJA 3GY0A 4HQNA 1LF0A 2J32A 3HU5A 3PUZA 2OO5C 3BORA 4FNGA 2NSHA 1VGQA 1E61A 1N5IA 3IHWA 1WABA 2BFDB 1T3ZA 3NUGA 1F8FA 4XWAA 4ZQIA 5DM4A 5FO1A 2WPDD 5DFAA 3HN6A 4RL4A 1FSPA 1ZRMA 5EKSA 1I1NA 2Q2NA 3HVIA 2RONA 3AETB 1E3WA 4KQ1A 1YDGA 3P9PA 3W2TA 3R3WA 4P93A 1AT1A 1UBMS 3AWIA 3EEYA 4HEQA 2N1BA 5DM1A 5D1NA 5FLEX 2NSDA 3A28A 3C41J 4GE0A 4PZPA 5BQXA 4JLWA 4N47A 3T1VA 3T15A 5JC8A 1E3TA 5KOJA 3ABQB 2ZDGA 5LA6F 3UH1A 2ZR7A 4MPRA 2ZS9A 4YRFA 3HM9A 2PSSA 1W85A 3WMFA 4KPEC 3WK8A 5H81A 1GARA 2ANCA 2PTGA 2EX1A 1SHLA 1HDZA 1MIOB 2FR8C 2HADA 3IOYA 1OA0A 1GQQA 1YDMA 1E1CA 4PYOA 4YUVA 4X90A 2MCFA 4MI1A 5GIOE 3RAFC 2EXXA 4YJHB 5GJVC 4CIWA 3NWBA 4W7HA 2PYIA 4MO9A 4HATA 3I1FA 2R7LA 2AW5A 4RDCA 3WQSB 4DL9A 3B2EA 3WQBA 4ETMA 1KORA 1I1OA 4IOMA 1Z0FA 2ATEA 1DC4A 3GAMA 1TPYA 1AO0A 1J56A 4GAEA 1Y3AA 1YI0A 3PHGA 3ONEA 1JTVA 1FFWA 3O3NB 5E9JA 3ILHA 5C53B 5A4FS 3MINB 2PRSA 4AZ3B 3DV9A 2EYUA 4GLFA 4BY9E 3IEPA 4G8JA 3MA0A 3VR6H 5LQAA 1EK0A 2PSEA 5KI6A 3T52A 1LI7A 1X94A 4RXMA 1UM9B 1NULA 3EHEA 4FZRA 3TIFA 4ERNA 1H1LB 2QX4A 5A9TA 3VNVA 4RPIA 1W4CA 2ZYDA 3OJFA 2AJ8A 4B3FX 2XUPA 1Q12A 5DNUA 3H16A 4P7BA 4V39A 4CMCA 1Y3FE 2IYSA 3GFVA 4ML3A 1SVLA 1HT2E 1KAGA 2DFKB 4MA4A 2C8JA 2CZQA 3OFSA 4PVCA 4HYTA 5CD9A 4R8KA 1KI9A 2XHZA 1T8PA 4TYMA 2GYUA 4WXEA 1BXZA 1KK2A 4XLTA 1QQBA 3O73A 2B8WA 2WVJA 2ZKLA 5DYIA 1J5XA 5BYJA 3ETCA 4BN0A 4CL3A 5C32A 2I2BA 4O2AA 4LRXA 1JQJC 1WJGA 5KVSA 4O29A 3DLBA 1YT5A 1LNQA 1RTKA 2FN3A 4ZVUA 4CIVA 3ANXA 2HHJA 1SELA 3A36A 4KSCA 3ORFA 4HVTA 2GO1A 1AQJA 5FUXA 7YASA 6NULA 3WK4A 3HVHA 2C4MA 4GKVA 4H15A 4DIUA 1NSFA 4HDQB 4L2IB 5EMJA 1RMTA 4QDOA 3U3MA 5DSTA 2XE4A 1R0KA 2FHSA 2J0UB 1VKRA 3FPCA 3ES9A 4WUVA 5DKFA 4BZWA 2CKDA 2VHXA 3AFMA 1MB0A 3LIIA 4HDAA 2XCUA 4IDQA 4KAAA 5J1SB 5BOSA 2Q1YA 3UBTA 2O59A 4DWOA 1TUGA 3KT0A 4UCWA 1C4WA 1N2ZA 3IVMA 4KUGA 1NBOA 1KDTA 1T15A 3DM5A 4Q4JB 5BSMA 3COWA 4PO9A 4TMFA 4D0SA 1VOTA 1J8VA 5IH3A 1NVAA 2FFRA 4G24A 2WUVA 2RC5A 2XR1A 3I9KA 1OZ0A 2MWMA 4PE5B 4AP9A 4F6RB 1BTOA 4GL2A 1DKLA 7GPBA 1N2IA 2V74B 3E2MA 2HUNA 2X0KA 2Q3JA 3UJDA 3HG7A 4MEJA 4DR6B 4LA4A 2G88A 4KOEC 4LVOA 4ZO7A 4BC0A 3DXFA 3P0FA 3L6DA 3VFDA 4KQXA 1MN6A 4EA6A 3G0HA 3M5CA 4HWSA 1GN8A 1JKXA 1Z83A 1JB9A 3NXSA 5CLJA 2CL7X 3N8KA 4PC3A 4QXMA 4BP1A 3AMVA 3DHEA 2JD0A 1QKIA 1YGPA 4PYKA 3KEQA 3SYLA 2X9QA 4HZUB 1H4QA 1JR6A 5LU8A 1UJ5A 2CK3A 4LZPA 5ETJA 2X19A 4RKRA 1L5KA 1YR1A 3A0UA 1ML3A 1NVVQ 1QUEA 1A2BA 5DN9A 3VUEA 3EIOA 3CKMA 3FPGA 3CEMA 4RZ2A 4XOIA 4K81B 1J1UA 2JF0A 1QR2A 4EW6A 4PSUA 4CGZA 3T7CA 4X8MA 1CUYA 3LI2A 1E6CA 5E1MA 4FFBA 1OLUB 3RRFA 3UVEA 3PFNA 5AKIA 3BD8A 4XR9A 4YAOA 1E1QD 3E61A 5SYNA 4X6LA 1D1PA 5ULLA 2CSXA 1BYIA 1EFHA 4FIZA 1ZH6A 3UK7A 1HRKA 1DL5A 1I2MA 2Q8PA 3OOHA 3KDSE 1XRJA 4UU1A 3EVTA 3BMCA 3QPWA 4HMQA 5FWYB 4D41A 5AW1A 3PLAE 2IC5A 2O54A 4KO8A 5A4MS 3JWGA 3ADBA 2L17A 4Q3EA 2RMKA 4OMUA 1YRQA 5KNBH 2GUWA 2NO4A 5EPEA 4X1OA 5A1TA 1CF4A 1ILEA 3IHLA 2FEPA 3S2YA 2FMKA 4D8WA 4GI7A 4CTKA 1NXXA 1EJ6A 1Z06A 4TS4A 4XB1A 2D1SA 2IHUA 5D87A 3NHFA 3RYFB 3VSEA 4EHAA 4LF4B 4YASA 1H9CA 3WSVA 3WRVA 4ZANA 3DE2X 1QG0A 3KQVA 3TXXA 2WU8A 1ECFA 2WOJA 3K0CA 4N6OA 1MAHA 3AUJB 3BIOA 2ICAA 2WDZA 3JVEA 3QEAZ 2PZBA 1NVBA 3W8RA 2WG1A 2W9XA 1A9SA 2PO7A 3G0GA 3WB9A 1IZZA 3LY5A 3MOSA 3GDWA 3A14A 5J40A 1PGPA 4FMBB 4A5OA 4YRIA 1KAQA 1Z2NX 1C3XA 4BV8A 1Z38A 2ZCVA 3PUKA 3QUCA 1ESMA 3QWAA 2HBQA 2YCBA 1JVBA 2A9JA 2IUTA 3ZU2A 5CFQA 5DEIA 1SVWA 1Y4AE 2JJ2A 3HFJA 2XWQA 2NADA 4XPIA 3GLFB 1YNOA 4Q19A 4I4TB 4RY0A 4PGHA 3NVDA 2KPOA 1P1RA 4RNCA 2QTVA 5M29A 2ACVA 3V3KA 5CA0F 2FOXA 2WF6A 2RH5A 2VQ6A 4EB8A 4AI6A 3CEAA 4TV8A 4RHXA 3DTVD 5E0OA 5KAMA 3WP0A 5G4KB 5AVTA 1A4UA 5K3SA 2E4UA 4PTYA 4ZYYA 4TT8A 2R6AA 5CJJA 3S1AB 5KYTA 3K6RA 4HWTA 5BW6B 3E82A 3GDGA 4B4UA 5ESDA 2QAGC 4C1BA 4OJTA 4JITA 4FQ5A 4CGYA 4ZVLA 5PNTA 1LBQA 3DNFA 3DVAA 4ZD6A 1M0SA 4M1QA 4O8CA 1XZPA 4FYIA 1E9FA 2NSYA 5F3RA 5F5XA 1JUDA 2IK8A 5FPPA 4DLZA 1U8AA 5DHPA 3FUWA 4MWBA 1VSUA 2X5NA 1TNDA 5CITA 3O4GA 3AF5A 1O6BA 4MYTA 1I94B 4ZYVA 5DLYA 3WNZA 2F8LA 1D2AA 1IIBA 4W8GA 5DGXA 2IP1A 1PX2A 3GARA 5H83A 2C8LA 5HZKA 3AIOA 2WYIA 1DIGA 4YFYA 4GC9A 1CEQA 1SJ9A 3EISA 3D7RA 1QG4A 2IYEA 3PXGA 1Z15A 1KH3A 1MVOA 1NI4A 3QXJA 4KHZA 4A8JA 1JJFA 1RD4A 3MGKA 4A36A 4EFDA 1B23P 4E4TA 4Z1OA 1Z62A 1Z2DA 2FLVA 4O4JF 1JA9A 1EBBA 1R16A 1F6DA 4RL6A 1HORA 2QUJA 5HZGA 3R8FA 4G09A 3KZVA 2Y67A 2QVYX 4FMCF 1VG9B 2O3JA 4IS2A 3PXAA 2RH4A 2E89A 3OLCX 3RS2A 2P7HA 3QQPA 1LPBB 3STTA 2UVPB 1NUSA 3TNYA 4AZ0A 4KXWA 3N0RA 1OBOA 5KMGA 1E1RA 3AUYA 3JD2A 4ZXPA 4UFOA 5AIBA 4RABA 4PBTA 2WK1A 2XVMA 4MRNA 4R1PA 1XNGA 1I4DD 3UQYS 2XECA 4NYJR 3U4GA 5L3QB 5CH8A 1F5NA 4QT0A 4H4EA 3RVPA 1BE6A 3Q2OA 4TX1A 2NO6A 3WQRA 1E5QA 3H8JA 2QL9A 3IB3A 4ETIA 3L7KA 3MAGA 2OPHA 1K5GA 1P7WA 2WPNA 2FHPA 1Y8RA 1R0XA 3A06A 3CF6R 1PW5A 2XZDA 3L6OO 5CT9A 5DHUA 1APBA 2UYHA 3KKLA 1ZM2A 4NV1A 3PXDA 1LPSA 1H0SA 2EW1A 4M7RA 2LDBA 1XHLA 2IT1A 2SKCA 1SHTX 2TECE 3W9SA 2ZZNA 1CEEA 2IW1A 3OKCA 4BO5A 5C5CA 1KQ3A 2VDLB 1GNTA 2A4KA 2VPIA 3O8LA 4LYGA 1K5PA 4N54A 1HH4A 2IZ5A 3II6X 5TRTA 3NOQA 4WL0A 1KTIA 1QP0A 2DX7A 2EJCA 4H77A 4WBNB 3KJHA 1YFZA 4OREX 1UKZA 3VSBA 3B9RA 5G40A 2BBWA 2A58A 1RJ9B 3EG9A 4TS9A 2V5AA 1Z4PX 2C59A 4ERXA 1URPA 2IY9A 1UZLA 3R0QA 4JI5B 1HYQA 2BGTA 2JJMA 3RDPA 2PX4A 2FPUA 2X9LA 4Z86A 3SEAA 4BNWA 2WYWA 4J49A 4OM7A 1HWYA 4D99A 5L3SB 2C5GA 3C8HA 3DF7A 4E09A 5FPSA 3KQMA 1CS0B 4MUMA 4AYXA 3SEZA 1UJ6A 1M2OB 4CLRA 5J4LA 1XZNA 4G1EB 2VDQB 3PQ6A 1WO8A 2VF8A 4GG1A 4M0MA 3EAFA 3H2IA 4JYMA 4NNOA 5JANA 4LXGA 2H4ZA 4XD7A 4DAOA 3Q2KA 4LYAA 2ZE6A 2OAGA 5BQ5A 2VQEB 3PENA 1TC2A 5KWIA 4KX5A 2ZS8A 4NABA 1D2EA 5DB4A 1JLLA 2I1QA 5DM0A 3ILSA 3MK31 1OFUA 4B4VA 2FQXA 4MWEA 4B3TB 3FM9A 3TDNA 1N7HA 2Q8NA 1P4JA 1E6UA 1D04A 1EHYA 1KSJA 3KQUA 4YGXB 5JD3A 3Q6MA 4EQ6B 2YJGA 1U3WA 2Q28A 3GCWA 2ZJZA 3KLMX 1SAYA 2GO7A 3FIUA 4L3VA 1FW6A 1E8MA 3HFGA 3ISVA 4ND3A 5B1EA 1LW6E 4GXRA 5DOVA 3EJ6A 3MTBA 4J75A 3HJAA 4WXHA 5THKA 5LZ2A 5IJ9A 3WLOA 1BZYA 1WM1A 1Z4OA 4N8SA 5BQOA 2B1JA 1W4AA 1T35A 2W2TA 4EGCB 1PQUA 3NETA 3LOQA 2H9IA 3RRZA 1ZVMA 2QGNA 3CQ9A 1U31A 3S40A 1P6QA 3DLTA 3AOEA 4CL0A 1ZCJA 1ODSA 4UE6A 1FE8A 3SZ3A 1G20E 3KQSA 3GEMA 1IHYA 2W8BB 3ZHQA 3UK6A 3ND6A 1XF9A 3AEYA 2WLSA 2Y77A 4YV7A 3LOUA 1QRSA 3DCIA 3CJQA 5A1JA 3V8MA 1L7DA 1OAKA 2AWNA 3VAZA 3VU0A 5MN6A 1GTG1 4KQ9A 1FTSA 1TU3A 4G0WA 2B25A