2C83A

Crystal structure of the sialyltransferase pm0188
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
391
structure length
391
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDIILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKELGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism Pasteurella multocida
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN PM0188
total genus 125
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c83A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c83A01
2ZWIA 3S44A 2EX0A 2Z4TA 2IHKA 2IY8A 4R9VA 2C83A 2ILVA 4V2UA 2II6A 2IIBA 4R84A 2IIQA 4V3BA 2C84A 4R83A 2EX1A 4V39A 4V3CA 2IHJA 2IHZA 2IY7A 4V38A
chains in the Genus database with same CATH superfamily
5JJIA 2G9VA 3DEFA 4CR7A 3FKQA 4M0PA 2QRZA 1XRMA 3QF4B 4WNYA 4ZI5A 5HZHA 2BDEA 4ZEXA 4ZOLA 2C4UA 1RT9A 4Q7EA 4BO9A 1ODTC 2QMHA 4QFBA 3MFYA 2VP5A 4X7RA 4NBSA 4MWDA 1M34E 3IPCA 5H82A 4BQIA 1JEYB 3BGSA 3CWZA 1A9TA 1HLDA 1D9ZA 3LJKA 1LPPA 3ZV6A 4BVGA 4XTRA 3W8RA 1VBFA 2AW5A 5CEJA 3N2KB 2YWFA 1L1RA 3BB3A 2AI1A 2EGHA 2ZTUA 5I7FA 3BD7A 3K1AA 3QU2A 4UMEA 5J59A 4L5JA 4UM8B 1FFXB 1MTZA 3RSSA 1G18A 3RYCA 2AMJA 3IEIA 2IU6A 3O8OA 5C7LO 4OJKA 2C2OA 4WUVA 5U1PA 4ER3A 1Z2DA 1ZXBA 5DEIA 3WGVA 2FUNB 3KQLA 5CB4A 1B15A 2ONKA 4G25A 3RUFA 5FUQA 2NAFA 2FPLA 4X95A 2YMQA 2VZ0A 4K9OA 1NR7A 2WAAA 4LHVA 5LD2C 5LU8A 3GUZA 3CVYA 2JGKA 1HG0A 5H70A 4YMVA 1UZNA 2CDRA 5EESA 2BSQA 1NUAA 1FMCA 3BB1A 4V3CA 3ZX4A 4BLRA 4LQLA 2O4CA 5KWJA 2C7OA 5AVQA 4PF1A 3KKLA 2TECE 5FKJA 3V00A 3FTNA 4CKCA 5LQMA 3JQ6A 4JYMA 4NPHA 2Z6QA 3WL8A 2BI8A 2C4VA 3WJ1A 1H1DA 1SCIA 3NONA 3QVOA 4HAVA 5HBGA 2PY6A 1EXVA 2PE5A 4PZCA 3V6LA 2FJ0A 1RLIA 2VSFA 3MA0A 3T4XA 3M3DA 2RJ3A 3ZE0B 4U2DA 2OD2A 2CXTA 4RULA 2C42A 5LNK6 3MTBA 2CJWB 2QZJA 4Q82A 3AL2A 2QJRA 3NWBA 4WCFA 1U1GA 1KBZA 1VCOA 4PGGA 4CG1A 1J0DA 1UOEA 1T5DX 4X7MA 5E6RB 2DRIA 4G5HA 2C0QA 1KO8A 1TTPB 1RRKA 1JEEA 1X1RA 5EERA 5C8YF 4KR3A 1YR1A 2XGJA 3CW2A 2BPOA 2GOYA 1R27A 4EY7A 2CXRA 3C74A 1JHMA 2NUBA 1PS9A 3RGGA 3B48A 3HRKA 5EXSA 3WDKA 5C3MA 4LF7B 4FEAA 5FPPA 2Y2VA 2AFHA 3P0JA 1LPNA 3OOSA 1T3LA 4HFRA 4MMXB 3W5HA 1AQJA 3A0UA 3C1OA 5FADA 4EPRA 2R6JA 1OX4A 2HSZA 4RMJA 4AJJA 3NDBB 1ECGA 1KP3A 4HCJA 4TVBA 3JRXA 4N18A 3IR6A 4WESA 1A4IA 5K3FB 1U6IA 5K4HA 3A1VA 2PD6A 3IAHA 1SNYA 1XD2B 5HWSA 1IEWA 1R37A 1TM1E 3C7KA 5ES3A 2J07A 3IKJA 1Q0LA 4PYJA 1BKYA 1PZNA 2VJBA 1DCMA 2ZJ5A 5CX1A 3UK2A 3VR6D 3ZZTA 1T4GA 4ETIA 5AWFC 4BRWA 3D1VA 4WXMA 2LUOA 1IXRC 4DPKA 2JIRA 5F2KA 5JAQA 3QYPA 4K6GA 3N1UA 2WJ4A 5K3DA 3WC4A 3D3JA 4LFBB 5HGJA 5JCJD 1XELA 1UBHS 3DPIA 5THQA 3R75A 2WWXA 4TUYA 3BK2A 3UFXA 1CF4A 1NWCA 3U4IA 1AHPA 4D9JA 4QU0A 1DQNA 1C0KA 2ADMA 1Y4UA 2IHYA 3FETA 4HGRA 3RU2A 3VX3A 2R11A 1NIJA 4QKQA 3TBKA 3QUBA 4AMBA 2OZKA 1LPAB 4DC9A 4YUZA 2RKOA 5GOTA 3THYA 1PX2A 2YFYA 1AS0A 1XP8A 1U2TA 1Y8QA 4QO8A 4J7CA 2SCUB 3JTEA 3VO8A 2XUAA 3PFNA 5LQNA 1K6JA 2XQVA 2YJ5A 4D56A 1LY1A 1R8SA 2Q0XA 5FYDA 3BHIA 3PCRB 1PCXA 1D1QA 3MT7A 5BW8A 5FL7A 2CCKA 2W5UA 4MW9A 1AX9A 4HFJA 3OOEA 1DQYA 3QYAA 4KLCA 4NICA 4C5AA 4XIFA 3K4HA 4DSOA 6REQA 3DLBA 1DI0A 2V7BA 1DCFA 1WW3A 5I5GA 2D0OB 2IC5A 3NBYC 3E03A 3AR9A 4GIBA 1UAYA 3T3OA 3NBMA 1P31A 2F64A 2GCGA 1XVUA 1Z0ZA 2B4TO 2BM1A 5A5EA 3R3SA 5GP1A 1GNLA 3S81A 1YCFA 4QHSA 1F4PA 2ASEA 4YRAA 5HKKD 4P08A 1TD1A 1O6BA 2ZTVA 1HYBA 5G02A 3N74A 3WJAA 4ZI2A 4PZDA 1SOVA 2ZRPA 4KN5A 2OD9A 3ZXIA 1YC5A 3L7OA 1HE5A 2XADA 2N1MA 3N7AA 3TK1A 2YWJA 2VEOA 3H6KA 3RRYA 3B6ZA 4EFDA 5KDOA 3TBHA 4E14A 2REQA 2R5WA 4TTIA 1IPFA 4PO9A 3W7BA 1PT6A 1OVGA 1WVGA 1Z33A 2GETA 1UBTS 1R0YA 1TVKA 3GOHA 3OX2A 5CDYA 3DW1X 3NUZA 2VJQA 3P27A 4K86A 3VRHA 1JFRA 1XAJA 5MN6A 1DOHA 3WGYA 5I4IA 2VT6A 3QKSB 5CYPA 2JI9A 4FM9A 1BROA 1QYCA 1TFUA 2CWDA 2HV8A 4YQFA 1OQAA 2C95A 1CTQA 1E6KA 1JDVA 2C4MA 2ZANA 5JFTA 1Y1QA 4TMZA 4ZN6A 3WWPA 1JBKA 1E9DA 5HSGA 3JVVA 1T34A 3AYZB 3P32A 1D4ZA 4KXNA 4GXQA 4YC7A 3DFZA 2ZTMA 3MSXA 3RBVA 3UPUA 2PRSA 2AEMA 1OFIA 1BRMA 4QOEA 1K0FA 2P90A 2PGXA 3ETGA 3HN2A 1EWYA 1X94A 3OHSX 3Q9UA 4YAJA 3SQDA 5JYEA 2C82A 2OXEA 4W5TA 3DFUA 3ORHA 1YR7A 3MTIA 1XZQA 2AFIA 4Z9XA 2GB4A 2YJNA 3C97A 4O5AA 2GS9A 3AVWA 1C5KA 1XR3A 3IEXA 3C7TA 1SULA 2CXUA 3AHCA 4DSUA 2WJYA 3GQBB 3DHEA 5AHRA 4JI0B 2NPOA 1RABA 1WCV1 4IF4A 3QLUC 4NOLA 1ODCA 1NQWA 2H54A 4UZFA 1TQDA 3WR5A 3JSAA 1XVAA 4RIEA 5MDHA 1ZITA 5ADUS 3V2HA 5M2QA 4RPIA 3MINB 2TS1A 2WSLA 3RJ9A 2CNWD 5KTSA 2O54A 2GF2A 1JFTA 2DBZA 3LX4A 4M1OA 5B2ZA 2JJ1D 1U81A 1BQ3A 1JP7A 3AERB 3CLUC 4EHAA 5K8TA 5CFMA 3AWIA 4HV4A 5TPZA 1CUCA 1FSZA 3GFVA 1ILWA 4JLJA 1CDEA 3HXMA 1M1NB 2A6PA 2E4WA 1VJ5A 3BS4A 1XQ1A 3AQ4A 3AJEA 4JBNA 1JZSA 1KAOA 4XUDA 3Q8MA 2GLXA 1QYXA 2YY5A 3IHWA 4JEIA 5AI5A 2Y1DA 3W3AD 5HIKA 3ZDBA 3V55A 3PWZA 1B2LA 1CRZA 1Z7YA 2EYQA 3EWNA 5DMXA 4EKDA 2W4IA 4M98A 3LP5A 3EBPA 3LBFA 1U2ZA 4HJXA 1EFRD 5BSGA 4E7OA 4G0OA 5SYNA 4FC6A 4ZJZA 4A8JB 2R79A 1T2DA 3A2LA 3U9TA 1I1OA 1Y8QB 5EJ9A 3NVDA 3JWIA 3IP1A 1LDGA 4QASA 3HBLA 4C14A 2N47A 4B7ZA 3PA8A 1Q84A 3HYCA 2NSYA 4BO8A 2HA5A 3HJNA 4MTLA 3U7GA 3LUFA 3UTCA 2E5WA 3PQDA 5EHIA 1E2BA 2W2KA 3OPVA 3K5PA 2OCBA 3H2YA 3AEZA 3JQ8B 4EF6A 3AUAA 4FGZA 4KKXB 4GX1A 2HKIA 4JP1A 3GJ5A 3QYJA 4OB7A 5F2EA 3UJ9A 1OWNA 1Z26A 4MPJA 5JBIA 3UGJA 4CMEA 4UOQA 3EPPA 1UZAA 2WICA 3DT8A 3FGZA 3LYHA 3RS9A 2E87A 2IEDA 4HYQA 4DUGD 4F45A 4G5GA 4WEOA 2FMFA 2AA3A 4HATA 3SZGA 3GB9A 3V1LA 4MB0A 4PLTA 2Q6TA 2XMPA 1IHYA 4JJGA 4S0ZA 2ZBPA 3KCQA 4UTRA 1CDZA 2BZGA 3VR6A 3RKSA 2Y05A 3SC3A 5CBPA 4R0NA 3CISA 3FFXA 2IYQA 5REQB 2EQAA 1WUYA 4XUCA 2FMHA 3VZSA 5TJHA 4DJTA 5KCZA 1KQFA 5LOVA 4RY8A 4EQ6B 1BCSB 4FHZA 1G21A 2YC2C 4NHEA 4HXYA 4MCIA 4BP1A 2FFJA 2HMUA 13PKA 3DR3A 5H7XA 3U7RA 1G1AA 2PBZA 3BMCB 2W2LD 1JYEA 1VZ2A 4M0LA 1L5RA 5FUWA 4E46A 5IM5A 3WE7A 2XB9A 2I87A 4C2BA 5JMOA 3JQAA 2RGEA 3GEHA 2FGJA 3EXIB 3IEKA 5EOVA 3OPQA 3VH4A 4DCTA 5KVCA 1EFCA 1IWPB 4TL9A 5FBKA 2TMKA 3DAFA 3O26A 5JMWA 2Y0PA 3D8HA 3MWDA 2VA8A 1EINA 5K3BA 3SHWA 4DG5A 4A36A 3TF5A 2QF7A 4CUJA 3JYHA 3UMBA 1QAQA 1UDCA 3OG9A 1WBDA 3NHMA 1NIPA 2H2GA 4MARA 5LKAA 1UAGA 2AF4C 4C05A 4QUHA 3VSEA 1RPAA 721PA 1HDCA 4DJEC 2NADA 5JSZA 1OXMA 3SIPA 2Y1GA 2K2WA 4ND6A 1HKUA 2HPVA 4BVJA 3U1TA 3SICE 2R3SA 4LDQA 3UANA 1EHYA 2FEPA 4LDRA 2QV0A 4WA8A 2PD4A 3IDAA 3AVTA 1D1SA 4FILA 4FZ5A 5K7SA 4JU9A 5AJYA 2BSXA 3STTA 1QZTA 5KQRA 1MVNA 1ULAA 3HBFA 3BXZA 5J5VA 1OIWA 1WXWA 4Y9SA 3RHSA 4BWVA 1YI1A 2CB9A 3ZVNA 1VE3A 3ITEA 2J3IA 4OI2A 1VPDA 3ROPA 2JASA 3GPDG 4L15A 4MQ5A 4M0UA 3GX1A 2PRIA 1ZUNA 3H5OA 3JWJA 3JZDA 4HB0A 1CUVA 4NMMA 1GIAA 2O7SA 2XE7A 3BKXA 4KFRA 2ZWOA 4GZMA 1Z13A 4O8CA 4WZ6A 1YS4A 4AY4A 2VXOA 2ZXUA 1WEHA 2O8DB 1ZFNA 4Q4HA 1UEJA 4YCJA 4NBTA 4TL7A 2G5PA 4IDDA 1T4CA 4MCJA 1TDJA 1DHRA 1U4OA 4IIFA 4YP7A 1GOTA 3SP1A 4BCCA 4QZVA 1ZGHA 2I2CA 3LPLA 4Y9RA 2N3ZA 2IT1A 1VE9A 2YHUA 3L1HA 2W0SA 2H4HA 1D5CA 2CLIB 1OI3A 5DXFA 1RIFA 4Z8XA 2ZCJA 4KIJA 4L28A 4TKUB 3GD5A 3OC6A 4FBMA 3GCWA 4H4DA 3WRWA 2JARA 3TPFA 1YA8A 4BJ1A 3CNBA 1JHPA 1Q22A 3P5SA 4BL5A 3ESDA 5T4BA 3NKFA 3KDSE 2EBFX 3ZE9A 5BPFA 2IDJA 2WWWA 3I72A 2HRQA 3KE9A 4M8LA 4D9KA 1LJLA 3HXOA 4F7WA 4B5KA 4RD0A 1EIWA 1GV1A 3L1IA 2JFPA 1JHXA 3T5MA 1XQ9A 4NU0A 1GITA 4D4LA 2EWWA 2QAGB 5G0VA 2VFAA 2NXCA 1M6YA 1QH1B 3COVA 5CA0F 1K08A 4GEGA 4C07A 2J0VA 2CJPA 2IZOA 5CD9A 2HSJA 2H1IA 4ISCA 4R2XA 2BSAA 4YMGA 5L3SB 1IB0A 2AK3A 3ZCXA 2VTBA 3AT1A 1NFRA 3EWIA 1P1RA 3G5TA 3DOUA 1XP5A 4FN4A 4J0CA 3V33A 1A76A 2C4HA 4WK4B 4EK9A 1Q1ZA 1Z56C 2RCNA 2Z6VA 4U7TB 3H1TA 4EITA 3IAAA 2X0DA 4W82A 4P4SA 2R00A 2EP5A 4GMDA 3V8EA 4YQYA 2KLHA 2Q1TA 1NY6A 4MW7A 4HZUA 3EGEA 2WUWE 4R2HA 5CNMA 1FFYA 2HWYA 3C24A 2YINC 1M2GA 2H2DA 1MB4A 2ZSBA 1E8MA 4PNZA 4ZVVA 1GZVA 1NATA 1RXYA 5TGDA 1II0A 3G9XA 4L4ZA 3VZRA 2J30A 4U1RA 3VDMA 2ZWPA 3PGKA 4EYGA 5DBHX 4M99A 4M8NE 4PX9A 2WB2A 1DC4A 3IB3A 4NU6A 4LF9B 4IW3B 3U4QA 1LU9A 2ZRAA 3X1MA 2LD4A 3I12A 4PG4A 5IAJA 4OY3A 1LBSA 2H4FA 1WCXA 4QGBA 3HS3A 3AO0B 1XDZA 5FTJA 3BMXA 4ROTA 4CM7A 3LQ2A 2HWXA 3GL9A 4E94A 2WWIA 3O8CA 3L3BA 2WUGA 3K5IA 4LCBA 3TSOA 4CM5A 1IQPA 3CTPA 3WYNA 1IY2A 2X8BA 2RH9B 3UFXB 2AC4A 2VP4A 1IAVA 3E7FA 2BFCB 3S2ZA 1W88A 2JW5A 2WF6A 4XLTA 3FYUC 4P93A 2R7AA 2RAVA 2J4FA 4WOCA 5DT9A 1BVYF 1N0VC 1UWKA 2IGTA 3HM9A 1HNWB 1DBSA 3ONWA 2ZPTX 3TB6A 3HU1A 3H1BA 1KE2A 1SMKA 3G5UA 3RS2A 3WYGA 1DAGA 1Q17A 1UQRA 4HEA6 1PGJA 4RQUA 1MGOA 2OGUA 2ZYWX 2VH2A 3V7YA 4MDEA 3AL0C 3KB1A 4R1TA 4BFTA 1FDSA 2WLTA 5KNLA 5LYJB 1R8QA 2EFEB 2GZRA 1MX9A 4IS2A 1ZAKA 1YB1A 3AKCA 3L6BA 1M6EX 1P2SA 3L8CA 3MJ4A 1Z7WA 5A02A 1DO2A 3I83A 4O2BB 2DERA 4G5RA 4HDRB 4BUJA 2UYCA 1WP9A 1UADA 2VP0A 5K0TA 3U4AA 2BT4A 4ZZIA 4TQAA 4JLPA 3X1KA 4QUBA 1RXIA 3DW3X 1NJ8A 4DJAA 4KIUA 5BXYA 1WLYA 1CF2O 4FFSA 1FFHA 3LDGA 1YFLA 3WWEA 4KQ2A 5K45A 5LBUA 1GZSA 4L9RA 2B5OA 2WM3A 1KMHA 3TCNA 2HMYB 4I46A 1CJMA 3K0HA 2RKWA 3K8OE 4RNDB 4URUR 1JGTA 1XSEA 5FPSA 4EEXA 3OY7A 3IILA 4MQFA 4D44A 2RHGB 3GLIB 2FW6A 2V3CC 2IV2X 3MHTA 5CW2A 5EJEA 4HMQA 3I62A 5ICEA 3SFVA 3WGIA 3B6JA 1JIJA 4FHCA 1HYQA 1HL3A 1M2NA 1U0TA 3GY0A 4JITA 5AKHA 1VDMA 2FHPA 3TQSA 3WKEA 2XVZA 3TAXA 5KSWB 2Q28A 1YBHA 2PUFA 3A06A 3ZZ1A 5DXJA 2F3PA 5HKBA 1C7QA 2R86A 4HDNA 1XEXA 1E2PA 2E4AA 3EZNA 3K35A 4XOUA 4ZT4A 3U31A 3KR1A 5DOVA 1V16A 5TXGA 3RTBA 3W9BA 3WJ7A 1MQAA 2R48A 2FPGB 4L07A 4OQ4A 2OK8A 2XA9A 5DLDA 3CN7A 4DCSA 4IH1A 2B92A 1YFJA 4EKEA 3D4BA 3BH0A 2XUJA 1Y4SA 3D1JA 3HPQA 3Q4GA 2Z30A 3JATA 5MGNA 1CZRA 1B8PA 2P4HX 2Q7DA 2R2GA 3RH0A 2AQ8A 4OA5A 1E0AA 1LD3A 2KSQA 3OT4A 3SX4A 1GRRA 2H18A 2ECOA 1NBWB 3UJCA 3I3SR 3UICA 4YRNA 1K7FB 4MDFA 1Y0BA 2R5FA 4HDNB 4PZUA 1Y9EA 3PE3A 3IRUA 1K6MA 2QS9A 5CVJA 2PZEA 2RG7A 1HYGA 3I2KA 3BIXA 3EQ6A 3O8BA 4PFSA 5DLEA 1Z5UA 4QL3A 4TKMA 2G71A 3H3FA 2IXFA 1TYDE 2MOKA 2QAIA 4MQ6A 1PL0A 2B1GA 2NUTB 2IUFA 3QEOA 1EJ0A 3N2IA 2JZNA 4J03A 3RIXA 5JWHA 3FKSA 4BFVA 1FYDA 5AM1A 2RHBA 4RTJA 2PT5A 3RQIA 3P71T 2V4ZA 4DMCA 2PRZA 4QYIB 3PNMA 2QTNA 1K89A 2QTRA 3WA6A 1DX6A 4R2WA 2ZB3A 3H0KA 3JQAD 2TSYB 1A27A 1OPXA 3QU9A 3FOWA 1NY5A 3P20A 4X1YB 3VUFA 4TYWA 4NU5A 4G36A 4AF7A 3LPAA 1PYDA 4RNCA 3UA3A 2DLDA 5K3OA 2AR0A 2WP8J 1YNOA 2HV9A 2ZETA 2EG5A 3QPWA 3LLCA 1EA7A 1QLWA 1RSZA 2HF2A 3ZC3A 3OAAA 5BNTA 1BFUA 5KNDH 1RKUA 4NBWA 1GUAA 3UPDA 3CNLA 5AOBA 2H29A 4G07A 4GBJA 1FMLA 3RRMA 3F90A 5LXTA 5TX7A 3M34A 3DPSA 1H85A 1ZM7A 5KSZA 3ERCA 3G89A 3PHIA 3Q72A 4GZ3A 1LDYA 1SVUA 2XA2A 4TLMB 2AXQA 4QYTA 4AQYB 3H5NA 3ZDDA 4WJKB 1IEQA 2ZTLA 5HIIA 3QWBA 4DCVA 3MMXA 4AJOA 4E1BA 1L5HA 1XO1A 3O2QB 1Q1EA 1LH0A 1LWOA 1GRQA 2JAHA 1QGED 2QA5A 1FDWA 3KTAA 4X65B 4GC9A 4YLEA 1DJMA 2WM9B 3ABIA 4AXXA 1VE1A 3BXPA 4IV0A 1UKVY 2YWHA 3IQZA 3IAM1 1D2AA 4IZOA 5CJJA 2QTTA 1ZA2A 4ES6A 3Q10A 1AUVA 3USCS 1DAFA 4U0JA 3KD2A 1N1DA 1O8BA 1Q5PA 3L0PA 1JS1X 2VWHA 1Y81A 4HH4A 5AR1A 3W05A 2AB0A 2FPRA 4TLEA 1IZ8A 4YR9A 3GP3A 4YP1A 2BFFA 5CB8A 2J6BA 5LQUA 3JZAA 1KSGA 3R24A 3BRWD 4XWAA 1GQ2A 3V1NA 3G8AA 1FZQA 2GN4A 3M49A 2XIJA 4BV3A 4ENTA 1KBOA 4IRXA 1B8OA 2OFWA 1L5QA 2VF8A 3ZE7A 3K70B 1GTMA 3TW8B 2Y1LA 4Z1OA 2UXDB 4BP8A 3RABA 2VPZA 2ZE5A 4NC9A 3WADA 2IE8A 5HS4A 5K3SA 1U65A 1QQTA 3NBZC 4DTIA 2FJPA 1DBPA 3K1YA 4LVUA 3BKWA 3IDZA 2DVMA 4MUYA 1S2NA 2Z6AA 4XASA 3R41A 1XA3A 4LZOA 2QORA 3WAJA 2ID9A 1U8FO 3QMVA 3KK0A 4OJTA 1I94B 2RK4A 2X4LA 5L3ZA 2XUOA 1CHDA 2PTGA 3B53X 3TINA 2WG2A 3PFKA 4UD6A 3NGXA 4KYUA 3U2QA 5B55A 2VQSA 2W0MA 5FOVA 2YVQA 1U99A 1G8HA 1Y3HA 4G85A 2B2XA 3FDXA 5D3MB 4FIDA 3ZW8A 3PEEA 4FGWA 2O3TA 1Z0JA 2Y1WA 4N0EA 3E4CA 2ECPA 2CMGA 1W5BA 3GNQA 2JI4A 4LZZA 3INGA 1XNJA 2RCYA 2P3QA 3I2GA 5I9BA 1AF4A 3NDJA 2B8WA 4TTJA 1DLIA 1VOTA 4LWPA 1S1MA 3LLVA 1Q2XA 1XZGA 1VPWA 4MWTA 1DXHA 2AUNA 2DSNA 5DPMA 5IVKA 2AG5A 2E1RA 1QBGA 2APJA 2Q21A 4LRUA 4BATA 2BGNA 2CXHA 1IOLA 2IYNA 3BA6A 3I8SA 5CJPA 5BV0A 2SECE 2CL7X 5CLJA 1FS5A 3HKCA 3ED1A 3WYAA 1W8IA 2UKDA 3NEAA 5ILGA 3SU8A 1R0WA 4ZFNA 1RAFA 3A2KA 2OD7A 4B9AA 3RC1A 4O2RA 2OBMA 2C54A 1E9AA 3S2UA 1NWHA 2QN1A 3KLOA 5LIRA 1LTKA 1N92A 4P3PA 5JOQA 2GCOB 1XZFA 3KWLA 1PFVA 3GAFA 1T15A 3DZDA 4JH0A 4OBWA 5DLQC 5LQSA 1TQHA 2AXEA 4TV8F 2K87A 1FFEA 2YIMA 5C5CA 2EKQA 5FUYA 3IVXA 3SIWA 1L4UA 4D8TA 2E21A 1DKRA 4G2NA 3MJRA 4P2BA 4KSCA 4YECA 1JH8A 2PLAA 5AK3A 3RC2A 1E1YA 4CM8B 2CUKA 2UDPA 2PMWB 1D6SA 1S01A 1Z4OA 2JRLA 1K7SN 3K9WA 3QW4B 5IJ0B 5EQFA 3RKUA 1MAUA 2I3BA 2Z5FA 3W2FA 1AK2A 4FGLA 4MRAA 1EHIA 3JQ7A 3ZZMA 1IBMB 2QRVA 3JVUA 2ATIA 1UC5B 2FSVA 1WZNA 2I6TA 3ROQA 1ENPA 4LCEA 1ZLYA 5KYYB 1XT6A 4IR7A 3AB3A 3P9QA 4M86A 4OYHA 5F3DA 2ONJA 3W4KA 4BJ3A 5A3QA 3ETCA 1EWTA 3K31A 1E5LA 2VNJA 3ICVA 3LP8A 3M3HA 3ZI0A 3WQHA 4J3FA 5A4MS 4Y1RA 2JFGA 1NG9A 2AZXA 1TF2A 3B52X 2QUIA 2EIXA 4JGBA 5JNUA 3OU2A 5EJGA 3WYCA 1N7GA 2I99A 5AJVB 4NJMB 4DS3A 2UUCB 3N2KA 2QRQA 2QTZA 4KW7A 5G0UA 4CMKA 2B20A 5FFMA 3COWA 3F5SA 2TMYA 3NOOA 3IQXA 5ECDA 3CVOA 1PQWA 4D02A 2HSGA 1RQGA 3HL0A 3U4HA 2JIPA 2CVHA 5D1NA 5B57C 3G7SA 5HZMA 3JYNA 3BIFA 3P9CA 2OLKA 1J09A 2FCRA 1K8ZB 2YVUA 3S99A 5E3HA 3TIIA 1LI7A 1X7YB 2NAPA 1AZSC 3L02A 4FINA 3RR2A 3HC7A 1WOYA 4HGYA 3H1AA 3IV6A 4CKWB 1SD2A 1EQUA 5ICGA 4DYHA 3VA7A 4D3ZA 1UPFA 1X74A 2GAOA 3ODGA 5AW0A 4I4TB 4ZVLA 1DBQA 2D00A 4MMYB 3UK0A 4BZZA 4LZLA 1RBQA 2ZQYA 4WIAA 1OFGA 2FMTA 2IS2A 2F3RA 1Q14A 1W88B 5EIOA 1M8GA 1V35A 2B7CA 4QYIA 3EIXA 4NMLA 5I4BA 3CJQA 4L6CA 4EMBA 2FEMA 3GFSA 1G60A 3FMVA 4AS1A 3GLSA 2A9JA 1UBCA 3KPJA 1T5SA 3ZE1B 4GDMA 5LQJA 1M3SA 5KOJA 2BTQA 2Y0CA 3DV2A 3I2JA 4MZDA 5D5HA 4OVKA 4X8HA 2AXNA 3U6BA 1VE7A 3UMGA 1KJNA 3BTVA 3QTBA 2QLLA 2B37A 4OAQA 4WN9B 2R84A 4B9EA 1AV6A 1N0UA 4QULA 3IIMA 3WQSB 3NRCA 5TSDA 4Q3OA 1U2RA 2IIVA 2XGOA 5AK0A 1TZBA 3LWNA 5F76A 2VYQA 3LP6A 2Z56A 3ONFA 5AI4A 5D86A 2EFJA 3LPNA 4NH4A 1GTJ1 4FFPA 4ZGGA 3BZUA 2N1BA 2PSFA 3AEKB 3ON5A 2BKVA 3L7MA 2B5WA 4N5IX 1FS6A 4I1VA 4A6DA 1HDEA 4EVRA 3MRTA 2B7BA 1J5EB 1UPUA 2OYSA 1WABA 3AQIA 4YAUA 4B35A 1QKJA 1Y1RA 2D2VA 4Y9UA 5ITWA 4B3MB 5IUNC 5KNCH 1OLUA 2CE7A 3AONB 5FTWA 1XQYA 4JOBA 4BLSA 4PO3X 3HYLA 2CNNA 3H9GA 3L4SO 5EI5A 1ZH4A 1XEXB 3CUTA 1JDUA 1YH3A 4CKBA 1SKAA 3SCZA 1MOPA 4PRKA 1ECJA 1OYWA 3TAUA 4QATA 3MLBA 1Q0QA 5KSOA 3HY4A 1EKXA 2IS4A 1U4SA 5CXQA 1YMVA 3C8UA 3CZRA 1O6ZA 2DPXA 3W4IA 5HKAA 1ZHOA 1N5RA 2CLMB 1W0KD 4GXNA 4E08A 4ZV4A 2A7QA 2QQFA 1SFRA 4IJWA 2A4MA 2I4LA 3MCZA 4CF3A 1IPHA 4HH1A 3PXUA 4BN4A 4BNLA 4UTPA 3LQFA 5GVSA 2EW2A 3G49A 4KI0A 5K01A 2ZIUB 1K88A 4B81A 4RLQA 1ADJA 1KMHB 1SUFA 1P4GA 1SR8A 2FSHA 3IIKA 1X7YA 2P69A 3U62A 4F3YA 3P7MA 4Q6WA 1P72A 5DNAA 2VUTA 2VA9A 3ZWPA 3O8NA 1CX9B 3LX8A 2OHOA 5TPZD 4N76A 1L3IA 2RFLA 3BRCA 3AXSA 3GPBA 3OUUA 4QSHA 2HWKA 4E5VA 2GXAA 1QJ4A 1SO8A 3SX2A 1CDOA 2JHFA 5A4DA 1INLA 1NE2A 3VTFA 1GDTA 2IEZA 4S3MA 3LSTA 3RTGA 5BMVF 1OB2A 3KELA 3UXMA 1NF8A 1J8VA 4TX1A 4NZYA 1T8YA 3GELA 3LCJA 4MQBA 1V5WA 3L46A 3G02A 4IIYA 2VTVA 1JSLA 1VHDA 2GN0A 1H8ED 2NNLD 4MITA 4NIMA 4E2XA 4MULA 3SQOA 2EW1A 3BXFA 3U37A 2NU9B 5BN4A 4UARA 4UASA 1ZSVA 3QLEA 3FX2A 5H3LA 4P33A 4CXMA 4L4YA 1M74A 2QTGA 3GRFA 3U1VA 4WSOA 2I29A 1LSSA 2F1KA 2XJ4A 1YIDA 2WIDA 4QYWA 1VYTA 3ESRA 2P2YA 3VVMA 3F4BA 4BLWA 1W0JA 1C3OB 1JLRA 1G0OA 1W34A 1WJGA 4OJYA 4TQGA 2PQ0A 2HDWA 4IDFA 4KEAA 1YU9A 3ZN2A 1U3WA 2DEUA 3AOEC 1RLTA 1YIOA 2P9CA 2R8ZA 3LMKA 3AIOA 4M6WA 5CVCA 3GK3A 1VJ1A 5SYAA 3TW4A 4AWAA 3NHLA 1M8KA 4TTAA 5B1SA 1PLKA 3B8EA 3S40A 2HYIC 2P2DA 2NSLA 4P98A 5A0VA 2ONYA 4Q6BA 1AGPA 1WMBA 3F5MA 4RFLA 2XTMA 2Q5IA 3WP1B 5KJ6A 3CKMA 1EM6A 3QX8A 3MCVA 5L3QA 1QGDA 1R4MB 2P4SA 3ANYB 4Q19A 1QH0A 3PC6A 4O6VA 4EW3A 1CIVA 5KEIA 5FBWB 1FP4B 1NJ2A 4QDKA 5ECWA 4EFNA 2O2CA 3KFLA 3F8WA 3PHBE 3D7NA 1EUZA 4YI5A 2ZWVA 3C3WA 1HC7A 2C3YA 2FPKA 2FX5A 2QR5A 4K6OA 4KPUA 4PTZA 4EPVA 1NGSA 1ZS9A 1QYRA 1Y1KE 1JG6A 3EIUA 3OLXA 1U5CA 4L8FA 3S7TA 5FR2A 2GJAA 2V03A 2XZPA 3AOGA 3OCCA 4M0KA 5CIYA 2JBWA 2FN3A 4S2EA 4A2WA 4WXYB 7MHTA 3RS3A 3GWGA 4G41A 4EUKA 2OUKA 2B0CA 1PLLA 5C31A 1GPJA 2ZBRA 1EK1A 2WHXA 4MK4A 2JL1A 5TARA 3ZHVA 5E3IA 2OV6A 2QB5A 1L5YA 1KIAA 1MFPA 4PSAA 5D85A 1OH8A 3H1EA 3NKVA 4P4SB 1MJGA 4KLRA 1P44A 4ZP1A 3I4LA 3NRBA 1YS6A 2JLWA 2YASA 2FR8A 3ZTTA 4R8SA 5COBA 2QVCA 3UJ8A 2H9AA 1RYHA 2HSEA 3JU3A 4AL4A 2ZI7A 4KJZA 1EM8B 4AMVA 3VR3A 2HPHA 3NP7A 4QQKA 1D0IA 2W2KB 3CLHA 3FYTA 2GF9A 2VDOB 2N46A 3B89A 1H93A 3O0TA 5ALSA 1AUXA 3UCFA 2COKA 2VXBA 1KXZA 3PDUA 1LLFA 5AW2A 4UVGA 1I30A 3PNSA 3HR7A 3FE2A 3WL6A 4EJ6A 1X87A 3I45A 4RJJA 1TM3E 4Q3DA 4RCVA 2V9PA 3TECE 4GYWA 3OHPA 4PC6A 4XD7D 3VYWA 4MUMA 5BR4A 4Z7OB 4JLBA 4LK3A 1B76A 5AHKA 1WMDA 4AKSA 4DQKA 4A73A 3K9CA 4R2MA 1BX3A 3FRHA 1M1XB 1L7QA 1OTHA 1QRDA 1TLFA 2CVOA 4MKIA 1Z0FA 4RH0A 4PGAA 1BQ4A 4HSGA 5JJKA 1S2LA 3GJ3A 2WWFA 4HEA1 1ZNXA 5JDCC 2IK8A 2PUDA 1A9QA 5UKDA 1JJIA 2HRZA 1K92A 4Y7DA 3VGPA 4GOND 3GFTA 2X42A 3PT9A 2WUVA 3RWBA 1ETUA 2RHCA 2WMOB 1G5QA 2LKDA 4DR5B 3ENNA 2HK7A 3F67A 2E37A 3SZLA 3VSAA 1U80A 2UZ3A 3TMKA 1T8WA 2PCLA 1MC1A 1NASA 1Z2PX 3PIDA 4PFKA 4WOKA 4UNNA 4B73A 1H2EA 1BN7A 2B4AA 3FF4A 4G81A 4D5GA 3F8SA 3QF4A 1V43A 2PU7A 2PYDA 4CW7A 3AFMA 3RLFA 1B3BA 1OWLA 1ZA1A 1UDXA 4KHZA 4N3GA 3SJZA 5CX4A 2XAUA 4DM4A 4N5NA 3CVJA 4BASA 2D6FA 2O8EA 2FW9A 2XH8A 2EP7A 2OXRA 2QL7A 4X64B 4C0JA 3EHEA 2QZSA 3P9RA 2XI4A 1SXPA 2X7XA 1YKGA 1UR5A 1JIVA 2XB6A 2ZRNA 2CL5A 1AS2A 2ANBA 3TTUA 2V9ZA 3WGMA 2PZGA 3JAMA 3RVNA 2H5IA 3U3JA 4C3OB 4TM7A 2VDWB 1ZMBA 3B70A 2XNCA 3WO1A 2VJLA 3CRVA 1XJQA 2QPTA 1RXCA 2B83A 3C7AA 4QFMA 5FBHA 2V5UA 2OXTA 4Z1MD 4HNRA 4YTEA 5IP5A 2I7XA 3GGGA 5E4YA 4A5OA 1O2DA 1XZEA 4J3JA 4YRKA 3CE9A 1PT7A 4LZAA 5ALWA 3A36A 5I47A 3O03A 1O95C 3ZBPA 1L4FA 2ZBUA 4AJLA 5ICMA 3FWYA 4U5XA 3HXKA 4D45A 4BQEA 1VLVA 1H2BA 3RK0A 5SZJA 1M67A 2JFVA 3HDHA 3WGLA 4E5PA 1QHIA 3VBCA 1UJ2A 4AU1A 1H1TA 2FTKE 1KOFA 1OA1A 3L43A 5C5IA 5CA1B 2FUG6 4KI7A 4H7IA 1VLZA 2JFYA 3JALA 4X1IB 1DJQA 2FG5A 4X66B 3TVDA 4MW6A 1EU1A 1ZLXA 1CRWG 3ZJTA 1RJGA 4MW2A 4BV8A 1KJIA 3K0CA 5BYBA 3AL3A 2VCEA 1OLXA 4PCAA 4LDJA 1DOAA 2W6IA 3RYFB 2WU0A 1YJ5A 3EMBA 3GJ4A 4ON9A 5FI0B 1GA4A 1PZEA 3H4MA 1YUMA 3R8XA 3SSNA 2QYHA 4G5FA 1XTTA 4D0LB 2P4QA 4F9EA 2OGSA 2ZTSA 3NTXA 4L9AA 4R81A 1SVKA 4QDTA 3NEJA 2O07A 4G5SA 2OHFA 3L1UA 4I55F 1QP8A 3DD1A 1ZC3A 1XZLA 1TUBA 3VSBA 4YLGA 2Y0BA 3VC7A 4E31A 2OBFA 3RF7A 1F0PA 1N75A 5A5FA 3KXIA 4LEIA 5C34B 4FU0A 4CMIB 1ML4A 4BMOB 4Z5XA 3L4JA 1GKIA 1YJXA 4OHWA 4QU9A 4H1HA 4YJGB 4J0QA 1AN9A 4AZSA 4A15A 1EXMA 5IM4A 4LK2A 2FZGA 4N7MA 3RK1A 4NNJA 3GNTA 2VYCA 2XTZA 4AAYA 2IUSA 3MBIA 4H4CA 4RESA 1NXQA 2JDID 2OZEA 5FTKA 2OA0A 2HMWA 4CLOA 4A0RA 4D25A 1DV1A 2BHSA 1T26A 2IFTA 2OGWA 2XUDA 4KIGA 5CDGA 3GJ8A 1I1HA 1KC1A 1ENZA 4ERXA 1ZSYA 1KWKA 1Z5WA 6Q21A 2FQ1A 4FDAA 4IDNA 5DW3A 3W6OA 3ITNA 3U3OA 2CUNA 1CJBA 2WFAA 4X63A 1JAXA 2CY0A 4BBAA 5BV1A 1IQ0A 3KXPA 1Y34E 2R5NA 4QEZA 1C7EA 1JZTA 1ZK3A 5DO9A 5BWOA 4REOA 5KBYA 2C7RA 2M6RA 4K81B 4CIAA 5IT0A 3SG0A 3KPYA 4WZBE 5D3QA 1UDBA 1WZUA 5G0TA 2O4UX 1KI7A 2C5BA 4Z9AA 3BE6A 2NO5A 3PPIA 4LWZA 4F96A 3VH1A 3MAGA 1RQRA 1TMKA 3ETDA 3ZWQA 4WKNA 3ZNNA 1K68A 1QJCA 5BVHA 2VKTA 4U7FA 4QHYA 1OWMA 4DXHA 3E2MA 5B7QA 4UCQA 3VISA 2CCGA 4MWZA 2IPOA 5DGCA 5EPOA 4PWZA 1YVEI 2VBCA 3FI9A 4D3FA 1KY4A 3KLNA 4I3HA 4XWYA 5EUMA 1JEJA 1TIKA 1F3LA 4INOA 3QNUA 1RMYA 4JR1A 4K9DA 4UUMA 2D7CA 3FNQA 4UHJA 2V7QA 2GN8A 5FPHA 2WU1A 2H1CA 1ZIPA 2Q5OA 2P1DA 1XQWA 3LZ6A 4H3SA 1HDYA 4X7BA 1XZJA 2WWHA 3M7IA 5CW1A 3THSA 3IQWA 4PTLA 8ADHA 5JAIA 4WACA 3T5BA 3IBGA 5EKXA 1MT3A 5EWMA 1TEZA 5KDDA 3T41A 3BULA 3QBEA 3TIVA 1JKIA 1PWYE 1RRCA 4CODB 1XZCA 2VPIA 1VGVA 2HK6A 1PJBA 3HLKA 1QYVA 4L8WB 4E13A 3DOCA 4JEUA 1ZD1A 2ODBA 3RS5A 3FPSA 4JNKA 2XWQA 3G9UA 4JXKA 2CDBA 4QQ8A 4AK9A 1H9CA 1DFGA 3N53A 4LRTB 4P3YA 4YJ3A 3NPMA 2YWDA 3SHVA 3VPSA 2Q50A 1PL6A 2VJKA 1E1CB 5CLIA 4JWTA 4XGQA 1PLJA 2QUHA 3DQZA 5TS2A 5FIUA 1MRSA 2R751 4BNDB 1IY9A 4YMTA 5TQ2B 5E0KB 4LTMA 4L2IB 3DOOA 1NDHA 3DEIA 1TF5A 3SD7A 1RTTA 1Y6ZA 1RXSA 3ESCA 4I9NA 4MUBA 4DLTA 1R74A 4B8YA 1DQZA 3G5LA 3JZMA 4XX0A 1S9HA 3M6AA 3U39A 2G3YA 2ZSFA 4AB1A 1Y8CA 1GL9B 4GWLA 5T7BA 1WXIA 3OBBA 4OQFA 1U9YA 1OZGA 5K0JA 3O4FA 1L7XA 3GCZA 1SUSA 5EUQB 1IMOA 4OQPA 2DT8A 1G291 3W1EA 4L08A 4QC2A 3K2QA 2B1QA 2H00A 1F6WA 1OD6A 2VDNB 1USUA 2PM8A 3A3NA 1QZUA 3A9VA 5DX0A 3KSMA 4Y30A 4AZ0B 4NYIQ 4RTKA 5SY6A 1JV2B 1V6SA 4N0QA 4ZREA 1T4DA 1USWA 1NMYA 2OCGA 3AY7A 2VJMA 5EUBA 4LJSA 2MINA 4CKYA 4ARCA 1A9XB 1CNFA 1EWKA 2EKZA 3QMWA 1O0CA 1XI2A 2VUUA 4K8RB 3RB8A 2YJTD 3UJHA 2XDYA 4EYOA 2Q4DA 2DM6A 4XVRA 3EPKA 1NQXA 2QMOA 2XOXA 1UBEA 2A0YA 3VVLA 4IGFA 5HOQA 1R8JA 1E62A 5TPWB 4BP9A 5LYJA 3NS7A 1E1LA 1MDBA 1NZJA 4JCOA 1R0XA 1QR6A 1JDSA 1V8ZA 2VJAA 3M6UA 1NUHA 2Q46A 3M9XA 4LC1A 4RY2A 3TJMA 2AHRA 4MIYA 4Y2UA 3KHSA 3S3TA 1ISIA 3QVGA 1BJKA 3UBMA 1QR2A 4CEHB 2FW1A 2H8KA 2J5RA 3PR2B 1K3TA 3GNLA 1P9WA 1YTLA 2D2FA 3CSDA 3T5CA 2QRPA 1ZGJA 5E1BA 4CIDA 5J4KA 2O8DA 1XXLA 3QM1A 4TWBA 4NG4A 1THGA 1WU8A 3H1GA 1BH6A 3HFJA 5EIFA 5IXSA 2IYVA 3C5EA 5CEFA 5CFQA 2FR8C 1OXTA 1I2ZA 4MGKR 3O8QA 3ZDXB 2O5CA 3K0AB 5KYNA 2AEFA 4IJQA 4JYAB 2C9CA 4MWEA 1PR6A 2YN4A 4FMCB 2EU8A 3DS8A 2JAOA 4HPXB 5EL0A 4BB9A 1JDBB 3VU9B 5HJEA 2H5EA 2G4VA 3HGQA 3CXUA 1BQEA 2JK0A 2HM7A 3GBPA 2P7IA 5LIPA 1RM0A 1AK1A 1APBA 1I6MA 1BXKA 3KT0A 4UPVA 3UMRA 1KFKB 4AJNA 1MPXA 2YWEA 3P9SA 1JAIA 2ZYHA 4MUIA 4MQ4A 3L84A 4N5HX 4DJFC 5I3CA 4WINA 3GLIE 1RI4A 5GMOA 3B85A 3C5HA 3OQVA 3U16A 4HQRA 2YYSA 2JBAB 3VSCA 4I6EA 4OJMX 3TZHA 2AOTA 4E15A 4FLFA 4QFCA 3L92A 2AHOA 3IIIA 5ALTA 1NSYA 5TS3A 3ICPA 4DADA 2PUCA 1OZHA 2QZZA 2AT1A 3OA2A 2G88A 4L9WA 4Z2AA 1ZM4A 4XQCA 1JMKC 1YUNA 2IJGX 4DDTA 2G17A 1P3JA 1XA0A 5FA6A 1N0WA 1N78A 1YDWA 4RUKA 1O03A 4MUHA 2NQTA 4OGLA 3KOOA 3MYRA 4IRMA 2X8WA 3DKKA 2RHMA 4I08A 4P38A 5HR5A 1E2UA 3OZDA 3AEQA 1UKEA 2Y1XA 3ZY3A 4DW8A 5BR1A 1UKAA 2VYVD 3F5FA 3OEED 2H2IA 3CX8A 2BE7A 3U48A 4OKNA 4KQHA 4EI2A 3SEZA 1JQBA 4S2UA 1EH5A 3RVJA 4QTYA 3TR0A 1N57A 1EFPB 2N0SA 3DBLA 3UG6A 1C7ZA 1GCOA 1W2WB 2Q8NA 1DEAA 1FVXA 1O54A 2OFOA 3KJFA 4KQEA 4OQDA 5THXA 2FEKA 4OO3A 2R8EA 3ZJUA 4B31A 3INYA 5E2AA 1E1MA 1T1GA 4NEHB 3KEFA 5HFJA 5IKEA 3EK2A 3O4JA 4FEYA 1T13A 4FN5A 2G1UA 4MVJA 4OHUA 4XJVA 1QIEA 2Q3LA 4B7CA 4A10A 1Z75A 3B6KA 3QVGB 4JP8A 2H1HA 4U2CA 2C4TA 2F48A 4BMPB 1MIOA 4NJEA 3THXA 1NE7A 4ND8B 4OK3A 1OR8A 5KYTA 3BXGA 4JLVA 4ZAFA 1ZOOA 4GDFA 4BVKA 1AA9A 3RS0A 4M9XA 2ECFA 3CM0A 2WD7B 5GPBA 3STWA 1KJZA 3GO4A 3WNBA 4DYDA 3IVRA 2IDZA 1DKMA 3IS3A 4ZRNA 1PJ2A 3VC3A 1JHQA 2I62A 5JNTA 1RWQA 1OZFA 2G0AA 2JIDA 4O59O 4RHFA 1CC1S 1DC3A 1F8UA 1M1YE 1VL1A 2E49A 2R97A 3N70A 1CF9A 4RSMA 4XQ0A 1XEWY 1J99A 1VL5A 3PFFA 4HDRA 1EFRA 3QE4A 4TT3A 3UW1A 5KOHB 2P9EA 1L9XA 4UEWA 2FKAA 1HZZA 1T0HB 1VKHA 2VJCA 1OU0A 3KL4A 1SKMA 1JEAA 1U7OA 5JS8A 3DL0A 5HQJA 2HK9A 3DV0B 1SIWA 3LRTA 3PUXA 4JDPA 1Q3HA 1LK0A 2I78A 4Q02A 3WFIA 4NZNA 2GD1O 2ZVPX 4DRYA 4ZYTA 4BEWA 4K40A 4R8MA 3H19A 1G3MA 3PFWO 1GSAA 4NPCA 4IDQA 4CIXA 4PYNA 2Y1FA 3S29A 1L6IA 5KNDA 4FFMA 4EHFA 1DE0A 3WK9A 4GUAA 5A4IS 4JMPA 1EFUA 5I7AA 1AKMA 2YJ6A 3AETA 1DBWA 2D5BA 2X0RA 3M8KA 1KBQA 3H5IA 5A9SA 3I28A 8LDHA 4FXOA 3ZQ6A 3UT5A 1A8IA 4X20B 2NU6B 4PLPA 5CUQA 5J3JA 2ZVJA 3IP7A 1JVSA 3IOMA 3BFPA 2IBTA 4RZUA 3KV1A 1COWD 1J49A 1YOVB 4UHEA 1RC0A 2AGVA 3D4LA 4TMTA 5FLXA 4ZO4A 3PGVA 2VF2A 3LOPA 4AMGA 5KTOA 4DCJA 3QG1A 1EDZA 3ZJ4A 2GN9A 2GZ2A 3U9LA 4YFYA 2QU7A 2CHFA 3NIDB 1URPA 4I3GA 2J4DA 5AJZA 1R3UA 2MU1A 5KYGA 4QNRA 1F2DA 4OQQA 5EG5A 1PK9A 3TIGA 4DANA 4F5YA 5DHRA 1QFXA 4PV7A 3ZD7A 1DIHA 3AVOA 4WASA 2OG1A 4XWOA 2RHWA 1NXSA 4LC9A 3KQYA 3ZHZA 4RD3A 3MS7A 2JFUA 3PNOA 4NDZA 4P7JA 4BX8A 3V9AA 2CKMA 3QOXA 4WN3A 2ZWMA 1GGFA 3CWCA 5HGXA 2A7XA 3NV7A 2ZYTX 4QREA 3LECA 3E3NA 3HN7A 3FCAA 2C83A 5BQPA 2VSOA 3DCYA 3TLGA 4YCNA 3UAXA 4CHTA 3A05A 1FNSA 1MC4A 2C5EA 3W0LB 4DTCA 2K7ZA 1T2EA 4CKZA 4OV6B 2VI5A 5FPYA 5FB3A 3O73A 3ZHYA 2XOKA 2IEGA 4R01A 4N41A 1U31A 1VSBA 2QM7A 3C8ZA 3R6GA 4Q7JB 5JAOA 1GY8A 4HLCA 3MEQA 5CURA 4AX8A 4D98A 2AOWA 2QRGA 1C3OA 3D8BA 1TZJA 2Z43A 4I4NA 3ORRA 1VMIA 1ZNQO 2XNHA 3OBIA 4FYYA 5JY6A 1QO0A 1HQCA 2C03A 1PDWA 1YHNA 3U3XA 4DBLC 1P0CA 2BI4A 1JR3D 4HVAA 4ALMA 4Z9YA 5E9WA 4ZC1A 4YAIA 1T1RA 2IHKA 2NZWA 2VHYA 1YRBA 4K1LA 1TRHA 3UYLA 2ZBVA 3ZY6A 4RTPA 3WSWA 5JECA 1G2QA 3BUSA 4GLFA 2GFHA 1S8OA 2GGSA 3JASA 1O4VA 4PSCA 3VHXA 3QEBZ 1J4AA 3G6KA 5IJAA 2HJHA 4J16A 3FCXA 3KSRA 3R1IA 5JSQA 2I76A 4M1KA 1Z6PA 2SKCA 3MT9A 4BB5A 1C81A 3O1LA 3O75A 1PGOA 2LCQA 1LK5A 3VYVA 3PX7A 1O6GA 3IBTA 4ZOEA 5G4KB 4Z2YA 3VNVA 5CDFE 2PLWA 1RJEA 1AO3A 2J9RA 4PRZA 3HH8A 4F6RA 1W4AA 4MW0A 1KQNA 1LKZA 4MV5A 1DUIA 2IGBA 4X41A 1GZ3A 1F20A 1CZKA 4AIIA 4UBOA 1GXSA 2AVNA 3WMGA 3IR5A 1W46A 3L0OA 1O5IA 1E6CA 3H9CA 1NA5A 4L5CA 2BJVA 3STUA 4AN0A 1SVLA 2YDXA 2KM1A 1KL7A 1E59A 3FDJA 4K6MA 1QQBA 1JQLB 4WNAA 1ABFA 3D31A 1Q77A 3OFND 3SYLA 4F56A 4KKVA 1FRQA 3ABRB 3BDAA 3HJBA 1AY0A 3IEPA 1YR2A 1YSCA 2ID7A 2A1IA 3PDCA 3HJGA 1NHGA 5HYVA 2Q62A 1NW8A 1LV7A 2WEKA 2GH1A 1DRVA 4XYGA 2DJIA 1PWHA 1Q11A 4F91B 2GM5A 1BDJA 2NXEA 2XF8A 2Z2ZA 3WGTA 3T4EA 3BHNA 2Z95A 1ESZA 3BMQB 2W83A 2ZWIA 5L7WA 5I48A 3A6LA 1TUGA 3IUSA 1EDDA 1K63A 1D04A 3HBAA 4H9GA 3QFHA 4PX2A 1YIAA 1H05A 1V7PC 1ZD9A 1VI5A 2X8AA 3ANMA 4NMWA 4ZEWA 5C37A 3PUKA 4JB3A 3W90A 1LDNA 3RV4A 3URKA 1FTWA 1ESEA 1ONOA 2HSWA 1JI0A 3DT9A 1PEYA 3H2KA 4QYXA 5FCDA 3WLLA 3AR3A 1D2MA 1ONPA 4OL9A 2JFXA 1NYQA 1TA9A 5B7PA 1QSGA 4G8DA 3BQMB 3RFTA 1P45A 1XZNA 2RSLA 4XDYA 3VKWA 3VR5A 1CERA 4IUYA 4QGHA 5JDIA 1OPRA 4CM4B 1YBAA 1A2BA 2EW8A 2PMFA 4QG3A 3V4PB 3D3KA 1U5BA 3UM9A 2PKXA 3I1YA 5AK5A 2DPLA 2D2IA 3CUEF 4CMBA 1T2AA 1UT8A 4YRZA 1V9LA 5JHGB 1WZEA 3FGOA 5KOJB 2AWNA 4WDRA 1QWOA 3KU4A 3OE4A 5IEBA 4D80A 3PD7A 4WUTA 5JO9A 2V98A 2DHEA 2IHUA 3JQAB 1BSVA 1GJRA 5CCXA 1BHJA 3A6ZA 2QW1A 4LWOA 1X7DA 5B58C 1IIRA 2WUEA 5ED4A 2J9XB 1UMDA 5T57A 4DNOA 4NYMQ 5DRYA 2UU9B 3BGVA 3V7WA 3MELA 3RJ5A 3I9MA 3MGGA 1T5OA 4U2EA 2I66A 3K9BA 4LI0A 1RVV1 2OQVA 2A30A 2JVKA 2VWPA 3N0RA 4JQYA 2DE0X 4LWQA 5LM3A 4ACBA 1T9KA 1H2HA 1M2WA 3Q8XB 1ZU5A 4MI3A 1SXGA 2YZGA 3H2JA 5HF6A 1U3VA 4MHTA 1GAQA 2WF9A 2WHQA 1H1LA 2DKNA 2I6SA 3IT3A 4R5HA 5HZGA 3I5XA 3DLTA 1UBKS 4M1TA 3VQTA 1R0ZA 8AT1A 1UZLA 4EHJA 2OMEA 3WIVA 1J0XO 4DJDC 5F5XA 4PLGA 5KSPA 1D03A 4TYPA 4OF4A 3T0FA 3V48A 3IMEA 3WKAA 4GM1A 1LPOA 1WY7A 5KQGA 2DF8A 3V4SA 1US8B 4FKZA 4NKRA 3ABSB 2OILA 2C00A 3TM5A 2XB2A 2ZM5A 4G1UC 2D5CA 2XPCA 3NWOA 4IOLA 4JT9A 1CQXA 4DUZB 3U4MA 2D06A 3TLXA 4UBKA 3ZHBA 4QBTA 4NULA 4QRDA 2H3EA 2DUMA 2Z1DA 3MT8A 2CDAA 5C2JB 5JS7A 1QIGA 1F4LA 5K8VA 1V71A 1RZRD 4UEJA 5ALHA 3T5GA 3C3KA 4AKTA 1V8PA 4RKWA 2KYRA 3NH9A 3ES9A 2JH3A 3PQ8A 5BQOA 1S5PA 4RPLA 1IATA 10MHA 5DYNA 5BXQC 1J7JA 2OUIA 2QN6A 1L5NA 1V1MB 2IHNA 4LYDA 1TYAE 4ZQGA 2WMDA 5TMEA 2ZCUA 2IX9A 4CKEA 3A6EA 2ORWA 3C6ZA 3WBJA 1I7DA 4BO7A 5HILA 1KC3A 1AZLA 3CBGA 2R6HA 4HDCA 3SLRA 1YHYA 4JASB 2F4VB 1KP2A 1IHOA 4UXHA 3SYNA 5AM3A 4LDAA 2O59A 1QZXA 1EVIA 3LC7O 4E03A 1YL5A 2NVUA 2MWMA 3J81A 1YT5A 4XEUA 1MX3A 3CSSA 4QLOA 1DPFA 3FLEA 3I32A 5CXSA 4D4KA 3Q87B 5J2UF 1KGSA 3NALA 3OZUA 1I6WA 4MB2A 4C88A 4JX8A 1TEXA 4G26A 1SU8A 3IPYA 4UNSA 4J7UA 3WSTA 4CDGA 4EHNA 2BE9A 2XMSA 1EQAA 1TUBB 2HCRA 2PD3A 3HVUA 3NBXX 3BZWA 4Z49A 4QOIA 3ZVMA 1CQIA 1OBCA 3L4BA 2CLOB 3LZDA 3OVMA 2WDPA 3UWDA 1EFPA 1I1NA 1P33A 1FZTA 3DBHA 3EZFA 4OUKX 1L8QA 1OHHD 4HN4B 2ZT8A 4ZMRA 2Z3WA 3D0OA 2IHJA 1QHXA 1KZ1A 1NC1A 3G23A 3Q7RA 5MN5A 2M9MA 1N9ZA 5GADl 1X86B 2WWRA 5D7NA 7REQA 1E9BA 1TW3A 3AFGA 3E0QA 4I8XA 4LY0A 4KTVE 1ZAYA 2DG2A 2RBKA 3IBSA 4K1XA 4EG0A 5C8DA 1XMOB 1JXMA 1IOZA 1GZUA 2CXPA 1DIBA 3BVPA 3N7TA 3NWPA 1LXCA 4PGFA 2NUAB 3VKVA 3ZWXA 2B3TA 1FNMA 3FPGA 2A0XA 1NUPA 3E2PA 2FFAA 3CH4B 3CVUA 1C8VB 1EUDA 1G8JA 3E3LA 1X15A 3PPXA 1NW7A 1JHVA 1T9GS 1TKCA 2V7PA 4H59A 2O48X 3FHCB 4Q1AA 4EY3A 3ZCPA 3CWQA 4AUNA 5JH7A 1BX0A 2YRFA 3U0VA 3EEBA 4FS3A 5DISB 3HCNA 4LJAA 4Q05A 5CDSA 3NHWA 4DG8A 3B2NA 1IZ7A 2DBRA 2IZ1A 3UFBA 2VUSA 3ZTWA 2QENA 2OVBA 2Q5EA 4NY1A 5I5EA 2REOA 4H3VA 3OQHA 4EG5A 4QSMA 1XRQA 5I9MA 4GMXA 4P84A 1SH7A 1KGDA 4HEJA 1ZOLA 3DVAB 4I14A 4FOLA 5AW3A 1NJ5A 1U0JA 2XKBA 3EA0A 5AW8A 5FP0A 4ZCIA 3OCZA 2MR5A 4KREA 2H51A 2A33A 4HBZA 2NW6A 1FW6A 4WFKA 3R44A 1RJFA 1Z06A 3TRHA 2DR3A 5JD6A 3LKDA 1ZGAA 1KMMA 1ZN7A 3H5LA 1E32A 3KKMA 2XB4A 4MIKA 5JG7A 2PKEA 3V8BA 4PAGA 5BVHB 3O94A 4LTDA 5LB4A 3FZEA 5JMPA 4LGYA 3MC1A 5EKUA 3QKWA 5IYZF 3BK1A 4BVFA 4BO6A 2ILTA 5A6VA 2AE1A 2Y99A 2OM6A 3EZ6A 3H11B 3KSUA 4X1OA 5FLYA 3VOAA 5B1HA 1ISGA 1ZC4A 4B79A 1DVRA 4R9RA 3OZ7A 5FV4A 2PVCA 2VXYA 2NTYC 4LNUA 4V2UA 4FP9A 1FFSA 3PIRA 1VLLA 4MOWA 2QRNA 3BCRA 2XUQA 2GILA 2Y9PB 3R6LA 4IUDS 3ZCTA 1HE1C 1LRKA 2Y0EA 1N33B 4JCCA 2DR2A 1G38A 2OB2A 3W3ZB 3ZGNA 2GNPA 2XYHA 2WDZA 4LJ8A 1YE3A 5EIXA 2AOXA 5F4BA 3KRTA 3RSLA 2NU8B 1GLVA 4NCBA 2BMAA 4QBFA 2IITA 1G19A 1XEWX 3ZVLA 1S8AA 3WLSA 1EX1A 3S2YA 3WB0A 5FQOA 3NUQA 4DMRA 2VJMB 5F7OA 2CLSA 5IBRA 5IRCD 1AQIA 1OGIA 3FYUA 4KGZA 1ITZA 2GXQA 3PRHA 4Q16A 1TMYA 3L7JA 3FSGD 4Y2JA 4BIMA 2YHAA 1ONNA 3A3KA 3CA8A 2I2FA 2HNAA 2YNMC 2X9QA 3C6YA 1EI9A 4Y1GA 2INGX 4D8WA 4UZEA 4RD4A 1W47A 3EJWA 4WECA 3S8EA 3Q6IA 4FWBA 4PYLA 2JAQA 4BHTA 2AKYA 3ZGOA 3GG9A 4R8KA 1US8A 1RYNA 2VN8A 4E7PA 1PSZA 4EUNA 1TL7C 4GKBA 1RCUA 3OFNA 3CGGA 4BO1A 3RRZA 1EFVB 2XCIA 4DREA 1XN1A 2HJWA 3QEMA 4XX0B 1GQYA 1VMDA 2ZSUA 3RK4A 1IZ9A 1H1LB 1JWBB 3G7UA 1M2JA 5KYVA 5ESDA 3MJHA 2JLBA 1I0ZA 3BSYA 4FGUA 4XVHA 2JKVA 2LCIA 3EBOA 2G9NA 1O95D 2MCFA 1XD2A 4QUGA 4HX5A 2P5SA 3SJUA 1SELA 5DN6A 4DA6A 5JVDB 4KYIB 3RUIA 1YQTA 1DRJA 2E3JA 3GZNA 1FA9A 2JF0A 4UAUA 3ZIUA 4D9MA 5KAPA 3MVEA 3GJYA 1JILA 1P7CA 3VU0A 2QW8A 4F7DA 4DB4A 2LP4Y 2G0TA 4ZQHA 1P9OA 4LIPD 1V5FA 3C6QA 1VG0B 2X6RA 2ZRIA 1JZQA 2WF7A 3N0WA 3RDPA 3S2GA 2CHQA 4LZPA 1THZA 4GWGA 5EWMB 4Q37A 1K27A 4TN5A 5ICFA 1ZRNA 3SS8A 4FT2A 3T5TA 3TCXB 5JBQA 2FVYA 1HORA 2X9LA 5CM9C 4HS9A 5JXWA 1GAWA 3BAZA 3HI4A 2BKXA 1ZMTA 4FHGA 1VMKA 4H7JA 4P31A 3QSGA 1N2ZA 4B09A 3AR4A 4YMSA 5EP4A 2YHIA 4CETA 1KS2A 1QVAA 2FZLA 3GEPA 3PL5A 1B8NA 1FP4A 1VYVA 2FZKA 2HHAA 4FUTA 5MN4A 4QEKA 3RAFC 2CXOA 1DXQA 2ILVA 4J2OA 4YR7A 2FFRA 3ECSA 4LF4B 1W4RA 1H4SA 3W2TA 4M88A 4CUKA 4ZOLF 3QZUA 4JSRA 2SHKA 1KZ4A 3FNHA 4KRGA 1LQTA 4KRYA 1PWEA 3JAKA 2M6LA 3GFPA 3DKPA 2XQFA 3IOBA 2IQ5A 3JQ9A 2I2XB 3CZQA 2P9FA 1JHUA 2OK7A 2VDWA 2J5BA 1JU3A 3W5UA 4DMFA 2HU2A 3ZWYA 1P75A 1N34B 4BAUA 5KREA 5B7NA 4NDAA 2I4TA 4R8LA 1HDGO 1XF1A 4W1PA 5FNVA 1QUFA 1J20A 1V5IA 5B64A 3BFXA 2WQZA 2C61A 3DFIA 4D26A 5KYUA 3TRIA 2XR1A 4GPAA 3LQYA 2W90A 5JVDF 3E5HA 3UK6A 1SCDA 1XUOA 5GJBA 3UV7A 4BJ5A 4KR0A 4MR7B 1FL9A 2YYAA 2ZRGA 2ASVA 3PUYA 5CNKA 4RA6A 4I7EA 1PJRA 5DWDA 3GLHB 3U4DA 1JECA 2QK4A 3R7DA 3UNXA 2QD1A 3RIMA 1U3CA 3PKIA 4OBBA 3NX4A 1SG9A 3Q3CA 4EHKA 5AH0A 1FSPA 3HXPA 1E2LA 4IQFA 3F6EX 5P8WA 3W77A 1YB2A 3QLVA 5D1HA 5D6OA 2HJVA 3WMWA 1RM5A 1DMRA 1UFVA 1XCOA 2DH5A 4RIFA 1TCCA 1SXJC 3B1ZA 1T9DA 1T4CB 4ZYXA 3IKVA 3PQ4A 1Q7TA 1DOZA 2DU8A 3IUJA 3OLVA 1GQOA 2VAWA 4DILA 2QMZA 3SOPA 5BT8A 4O0LA 3GDFA 1C9NA 1Y89A 1ECLA 4HQ6A 5C46F 3G85A 2MSLA 3F1KA 3KZNA 1U3GA 2O20A 4N3NA 1XVTA 3KKOA 4RA6B 4N6GA 2YXLA 3MNFA 4JJ7A 4DDWA 3P94A 1MG5A 3AHHA 1IMJA 2OE2A 1E3DA 3GJXC 3H4VA 4EG4A 4N54A 4EWLA 4Z9BA 4TT3D 4RTNA 1J9EA 1W9MA 5JADA 3E6AA 4DQ0A 3HA7A 2PZFA 1SVOA 2Q1UA 3ESBA 3IRVA 3LU1A 5JQGF 5LFAA 1M34A 1C7JA 3PE4A 1EIZA 2Y4NA 3H2GA 3M4XA 3L6OO 2W2OA 2VHVA 4KZKA 4PM4A 4QTUB 4U8HA 4YAOA 1STOA 2W2XA 4CTOA 1J07A 3JD2A 2ZJ2A 2C94A 2X9GA 4IIUA 4EELA 2B1IA 2L2QA 1C9MA 3PC8A 2FUCA 2PMDA 2B7LA 4ETNA 4MPTA 5K4GA 3ZDEA 1AKVA 1Q12A 1NVVR 1MB0A 3EHDA 3FDZB 4K87A 1L5KA 3U7QB 1KKLA 2PLRA 1SUDA 1BOOA 2GWHA 5FBLB 5JLAA 3RUAA 1WPQA 3UMFA 2F6RA 5K0EA 4ESVA 2H2HA 2HADA 3AGQA 2W6ZA 1EK2A 3KYDB 2IVFA 1HQDA 2DH6A 5EYPB 4HK4A 1BW9A 3AINA 3ZXYA 3L1VA 3NC1C 4G67A 2EG9A 3EWSA 1RP7A 1YZFA 3V3TA 4O1MA 4TYNA 1SXIA 3UHPA 3R2JA 1KK1A 1JW9B 5HM8A 4CLXA 3JSXA 2DTXA 4I5IA 3RYIA 4YX9A 3KWMA 5T3YA 3HKBB 1T10A 3A14A 2P6OA 1KI6B 2IYPA 2JGDA 3E9EA 3KCNA 5WRFA 3WLQA 3ER9A 1SHUX 2JEOA 2OCXA 4D57A 2ZAYA 3V1UA 4D97A 1TPZA 5JRJA 1G6Q1 1R8XA 1LA2A 4DEYA 2Q9AA 3WIOA 2BMWA 1VJ0A 2GD2A 1QHGA 2CF5A 1BE0A 4EF4A 4EKNB 1F4VA 3MTQA 2Y2UA 7YASA 1AK9A 1E2IA 4I0WB 1NU6A 4QUEA 5CLLA 5ANRB 3WY9A 5C1DA 5BWBA 2PGAA 3RC8A 2OOSA 1NKSA 2ZJ4A 1QU3A 3FVTA 1PT8A 4E1VA 5BURA 1CS0A 1GUFA 2PZMA 5HX7A 4D3YA 3T54A 2O8EB 4FOOA 4HX2A 1F1BA 4HAWA 4ZZ2A 2BN4A 3BGWA 3CPHA 1IXSB 3ETHA 4P36A 2GBIA 2IYEA 3LC1O 4HAIA 5CTJA 5JCJA 2IV3A 1QF6A 2VNHA 3EC2A 3WV5A 5JAZA 5F7XA 1K5HA 3N58A 3T7KA 1WO8A 1UT6A 3BICA 1HM5A 2VO1A 3QVVA 1I7LA 4URVR 1GPWB 1WP4A 2CYBA 1OH7A 5T5QA 3NEYA 2WI8A 1R2QA 1R6BX 3DTVA 1CY2A 2FW0A 3QBJA 4ZANA 1QFZA 2GFQA 2E5FA 1PN3A 4HRXA 5CT8A 3INRA 2I33A 2WZCA 4Y2GA 5BSTA 1E64A 1QXSA 1ZXXA 1HEIA 2C84A 3M1LA 2XBUA 3IP3A 3WI7A 3F78A 3KLPX 3S55A 4O2LA 4US1R 4EVIA 1QGZA 2BGUA 4A8TA 1CKEA 5EFZA 3OP1A 4LBVA 2GZDA 3EAFA 4C3VA 1ENOA 3LL7A 4CBVA 4TSFD 5AHWA 3H5TA 2NG1A 3UCXA 5EHNA 3I64A 1YJ8A 1WXHA 1XDUA 1IHPA 2RBEA 4ZARA 2CMHA 3LQRA 5CCDA 5JJCA 2GAJA 1DGQA 5I6DA 3IMKA 5ED0A 2BGTA 1D9XA 1P4SA 2OO5C 3SFTA 4Q0MA 4QJIA 4WQMA 1JN0A 5JYDA 1DPGA 2HLDD 2Y1EA 3GGJA 2PU5A 5JMTA 1YB4A 3HUFA 3JAWA 4G1VA 4KZPA 4DY6A 4YO8A 1V8OA 4I5DA 4AYTA 4N4AA 1TM7E 1Q15A 3FLBA 2IOYA 1CNMA 3L82B 5HF8A 2FQWA 1SU4A 3RTAA 1WULS 2DCUA 2RAFA 3I37X 1GV0A 4WK2B 4YPFA 4EHDA 1II8A 4GOLD 1VL2A 2JVJA 4RA9B 3OPNA 3ABOB 1M83A 1Y8RA 4V0MA 3W06A 4EGAA 1IB6A 1WD7A 4R1MA 1EK6A 1H2FA 1VHTA 5E95A 2X4IA 4P0TA 3U3MA 4FI3C 1SOWA 2HF9A 3EVNA 4QNMA 1ULTA 3FUWA 1VKNA 2GTIA 2V6IA 2SKDA 4C0KA 3AF1A 3B13B 1NJ1A 1NUUA 2OEPA 3PCXA 3AZOA 2EGUA 3EGDB 3ML1A 1U1IA 2H5JA 2E48A 4BEBA 4OFZA 3TMYA 3C3BA 2VHWA 1YRQA 2QMQA 5BOVA 1JAYA 1SUPA 3C16C 1SBCA 4WFIA 2PGNA 4EOGA 4HI0E 3BX1A 4LJ6A 4ASUA 1FMJA 2Y1OA 3Q8LA 3HB1A 4F3RA 5LLSA 1WMFA 3V9PA 4CF7A 3PI6A 3M9LA 4YHHB 3L7DA 2R8BA 3UENA 1IU9A 1AHHA 4JD5A 4IG9A 5A4AA 3UJDA 3A6PC 4EY8A 2PL1A 1SKYB 1PVOA 2PGJA 2ZU6A 3R76A 3HU3A 3GZ4A 2DETA 4BS9A 1W5AA 3TSYA 5CVEA 4KACA 3SDZA 3VO1A 3NUGA 2QVXX 3VR4D 5DJ5A 5EJIA 1AGYA 1FYFA 3KJIA 1G21B 2Z1MA 1WSWA 3EOZA 4HB4A 1N9GA 3U7QA 4D82A 3BE4A 4PG7A 2M6KA 3IQIX 4KG7A 2D13A 3DHWC 3C8MA 4GMKA 2C5HA 1IVYA 1JIIA 3AU8A 3FA2A 5FI1B 4CIYA 2G36A 4WJLA 1QRSA 2OFPA 1OXXK 1M73E 4INPA 3NBKA 4NCHA 4TWJA 5EINA 7REQB 3KXLA 4RU1A 1H3FA 4W9NA 4KE9A 3L0DA 2GBLA 3AP2A 1EFVA 5B4UA 1BWQA 2ZU0C 4YRJA 1ZY2A 3PEVA 1KI2A 3ZS9A 4ZMSA 3NOQA 3Q6NA 4A0HA 4ZAXA 5KPDA 2C20A 1KYZA 3NHJA 4NQRA 2J08A 1F5SA 1M0TA 3B6IA 2O8BB 4F4HA 4JJIA 3T3HA 5IZCC 3MGAA 2J9FA 3MIZA 5KWEA 3R3YA 3C6XA 2ARKA 2CVZA 4R69A 3T1QA 1T8SA 2HOQA 3EJ6A 3AF2A 1GD1O 2D7DA 3MCWA 1XBTA 3KU1A 4UHBA 4JIGA 4FX5A 4R0MA 4PAWA 1AURA 2ZUCA 5KOIA 1NVAA 2P9ZA 2AL7A 2PQ2A 3B1XA 2P9QA 2V7GA 1EVZA 2OKGA 4V0KA 1SY7A 4ZVPA 4ARUA 2NXWA 3D3WB 5BO5A 4BBJA 3A58B 3RSZA 3PD0A 4P2GA 3KJGA 4PPYA 4NFSA 2Q49A 1E96A 3SVZA 4B6SA 2I4RA 2NWQA 4RH3A 1QHHA 3VI4B 2R6AA 1QTIA 2Z5GA 3CH7A 1GNRA 4PZZA 4WLEA 5EZ5A 1W581 4A7PA 5K0FA 2HREA 2XUFA 2CW5A 3CEHA 3QA3E 3I1FA 4KQ6A 3OTGA 4X6XA 2WWTA 5HCIA 1QB8A 3PGMA 4N12A 2EZUA 4F11A 4CEJA 4OU5A 5E6SB 5I9IA 1Z28A 2B98A 2GHIA 4DNQA 3VJRA 1XC7A 1WR8A 3CUSA 1QKKA 3TZLA 2AS0A 4XGKA 3WMXA 2UZ1B 1XL0A 3QQPA 5EMHA 3VNSA 2ATCA 1JKFA 1VC2A 4HNGA 1C3LA 1VSTA 1O1YA 4I1OA 3C39A 1MR3F 5JT1A 4TGLA 3G2OA 1N6RA 1DTEA 1NVGA 3HYSA 5A7HA 4N9QA 4G9BA 4IHAA 3H8SA 4WJZA 3TO5A 4U8GA 1BGVA 4QD3A 1V1RA 2GZ3A 2JI7A 4MGHA 1U98A 4CM8A 2IHZA 1O6FA 2I22A 4EY4A 3DBLB 3O4HA 1OZAA 3KQKA 3QE9Y 3S44A 3UB3A 2BCGY 3G5MA 4GF5A 2A14A 4PN3A 4PIVA 5GZ1A 3CNHA 4DV3B 3QKRB 1K7YA 4JUDX 4ARBA 4OHPA 4E2YA 3DZGA 2WD8A 3UA4A 3IAS1 1HF3A 1MJNA 2NZYA 3CQ9A 3OEHA 4RYLA 1NI5A 4LMBA 4IWNA 1XEAA 5ALLA 3ZDRA 4L7VA 1XXHE 3NHSA 3ABZA 1U7ZA 5TV2A 3G1WA 1SOMA 3RUPA 2Y71A 3USES 1CEYA 2FRXA 4KAXA 5J63A 1UXKA 3IQFA 3QOWA 1OXKB 4I50F 2Z2YA 3UEOA 2D4HA 4DSAA 4MYDA 2YY7A 5KU1A 2WA1A 4MRMA 1PU2A 2Q1SA 1BXRB 3ANXA 2F3UA 4FWTA 1W76A 5HXAA 4KVFA 1M7HA 3H2HA 3SJ7A 4DIUA 1QQ7A 1OGYA 4PYIA 3SR0A 5HP4A 5KWVA 2QGZA 2OAP1 1LZKA 1SRRA 2FPOA 4L4RA 3NTVA 3LE8A 2A3NA 2AOUA 5IW8A 2VHUA 4XVQA 4YRTA 4PX3A 5B4VA 4MO2A 1W30A 3DSRA 1YZ3A 2JJ2D 3WZLA 5CYFA 4Q7QA 1MD9A 3QKSA 3T3NA 4B8ZA 4I50B 5REQA 2ZCVA 3SBOA 3ZG6A 2Q3BA 2ETXA 4A92A 2PA3A 3U26A 1M34B 2A9OA 3G17A 3P2EA 2L42A 2VQ3A 1NT4A 3L7IA 4KL8S 4KN9S 4RIGA 3KQHA 3DO8A 1KFEB 1SU7A 2ZJ6A 3AU9A 4RF4A 1VJCA 4IGAA 1JFVA 3PXDA 2C92A 2E4YA 1NQVA 1KDOA 4TXNA 3UXHA 2AH5A 4ITRC 4L4XA 4ECEA 3LY7A 5EGNA 1Z5OA 4JOSA 4MUXA 5D84A 4F8EA 3DJYA 1BIFA 2C2MA 2LRHA 3CMMA 1X3SA 4XI9A 4X93A 2DQ4A 3B1JA 4GKVA 2NV6A 3VTAA 4ILEA 4IQ0A 3BEOA 1AQUA 2G25A 1T25A 3TRDA 1C0EA 1P80A 1CUJA 2R47A 2W2MA 1COZA 4MPDA 5SZIA 4L6AA 3HB0A 3VR4A 1KPGA 4BRUA 8MHTA 1JPUA 2ADFA 1L1EA 1NAIA 1U0HC 2PXHA 3F98A 3IP9A 1UOPA 1R00A 1AZTA 3DJFA 2G82A 3SYMA 1A1VA 2X15A 1E6EA 2JLRA 1N4DA 3N76A 4IXTA 3EIOA 2V6JA 5ALVA 3GVPA 4B3FX 5CG2A 4E2ZA 3B3AA 2AYYA 1NMXA 1NX6A 4BMXA 1EWRA 2Q0HA 1UBUS 2R60A 3BJMA 3O3OB 2OBXA 4J0IA 3KNZA 3FZNA 1J8FA 2J8ZA 4QICA 2A2ZA 4AURA 4QU5A 1ZH8A 1FUKA 2PGDA 3QKUA 2BFEA 4I9GA 1VRWA 4QJ5A 5FV7A 4FD3A 4IDBA 4EKYA 4RXUA 1MVOA 2CJFA 2GEJA 2WAMA 2MSNA 3CUWA 3KJZA 1D07A 4S1NA 4Q39A 4FDTA 2I0FA 4LXIA 3VAZA 3H11A 1ODLA 4PC2A 3J80A 5AVYA 5F1OA 4LHSA 1YHZA 1X7GA 1ENYA 4OM7A 1AGNA 1BE8A 1U02A 1ZVQA 3HCFA 4U7HA 4RACA 5JI3E 2CLDX 1C4OA 5E6UA 4ZU6X 2YRWA 3K53A 4LKOA 3OE7D 3QFFA 3WRXC 3PU6A 4R3WA 1E5DA 3UWSA 2PPVA 5EQDA 2NP6A 4Y6GB 5HTOA 4O4JF 4WPGA 1LJ8A 3IVAA 2KPOA 2UYOA 4M2LA 4H7HA 4K28A 3LLUA 4I81A 5FAKA 1ISRA 4JLAA 3MFQA 4YPVA 1KFJB 1LS1A 2UVDA 3DNMA 2OZPA 4NYIR 4HF7A 1QTNA 1XRNA 3G0DA 2RG1A 4Q3CA 3ETJA 5EXPA 3B1FA 1V26A 1Z07A 3LA8A 1C1DA 3S7ZA 4I50A 3RFCA 1K4KA 2XD4A 4EL5A 3E18A 4FE4A 3R9XA 1A4RA 1OUMA 4EM6A 1JHDA 5IWAB 2X3YA 2Q9CA 3L40A 1L5VA 2JFOA 4B2PA 2D0DA 2ZIVB 4XD7A 5JALA 2IV7A 1VPVA 1OX4B 3PNPA 4L76A 4P58A 1FJXA 3AHJA 3E8SA 2HRRA 1Z9BA 1GTVA 1LV8A 1ND5A 3HM2A 1RLOA 1XWFA 4B3JA 4W9MC 2R7KA 3GRZA 3I01M 4DVGA 2O5EA 3IR7A 5E1MA 2O2HA 2JB9A 4EIWA 2H52A 4Q4CA 1PEAA 4HN9A 1N2EA 4J4HA 5G40A 1I3KA 1NBIA 1W8DA 4UNQA 3CONA 5AKLA 4W5HA 2RARA 3KZVA 4NZOA 5L4LA 4N40A 1C9EA 4WFJA 3TIXB 2BGLA 1X7WB 1JWLA 3WG9A 4M7PA 4L75A 2CLCX 4R7GA 3AF6A 3D6TB 2A88A 4DLNA 2C5AA 3GU3A 1F2TB 1ACMA 5JTTA 2JKYA 4C4TA 4DG9A 1MN6A 3NWJA 1N0IA 5IAOA 4Y2VA 2JGEA 2GZHA 4O0MA 1QF9A 3NORA 4UUAA 4AX4A 4PG8A 1PHPA 2W6JA 1TO6A 2W2TA 5LD2B 3EGCA 1PDOA 1XG5A 4GP7A 2H1SA 3PCTA 4M1MA 4Y2YA 3O7WA 3JY6A 3RQSA 1HFEL 7ABPA 4N6OA 1IUNA 4F85A 4KMMA 4TSRA 4X8OA 3FYUB 1XNQB 2CD7A 1Z0UA 3HXLA 3JD3A 2ORVA 1RQNA 1JB9A 2FLVA 3F6RA 1ZHHA 2QY9A 3AM3A 4X90A 4W5JA 3RUCA 1I0IA 4KAAA 4TTTS 3MWJA 4WDQA 4LMAA 3KUCA 1Z36A 4GL2A 2A5DA 3TW6A 1ISFA 1M7BA 2WG1A 3PHJA 3PEFA 2F55A 4RANA 2B9EA 4MYTA 3I58A 1B0UA 2Q99A 4S12A 4DMMA 1TJPB 3O2JA 4TKUA 2EERA 4BVHA 5AVVA 3YASA 1K6EA 2DHCA 4QBHA 4XCQA 1ZXLA 1L5HB 1XL1A 1OV6A 3OEHD 4XFDA 4C20A 4ZJPA 1IJBA 1DAOA 2J48A 1I2BA 2VDQB 3SKXA 1RWNA 1Y9AA 3CX7A 1DAHA 3IQHX 2HPAA 1VB3A 1FQJA 3UMVA 1UOOA 2FV8A 1IHDA 2COEA 5IH7A 1ABBA 1TO2E 3F7NA 5BYJA 4RLHA 5ALZA 5KQSA 4HH3C 3KT8A 3K0SA 3R77A 2P1ZA 4ZOLB 1CWUA 4BJ6A 3PR1A 3L9XA 1ZWKA 1BU8A 4NCNA 3SZ3A 1QGAA 5TF0A 3T1HB 4Z4GA 1YACA 5CTAA 4BTEA 1VRVA 3F97A 1NT2A 5EJ8A 4FTWA 2CB0A 1K06A 2AV6A 2ZDGA 4RJIA 5LNK1 3GH3A 1X3LA 1OROA 4I66A 5DNYB 3GAZA 2V5VA 4H35A 5FBQB 5JSYA 2HPZA 3AF4A 3WKBA 1EGVB 1YFKA 1K2WA 3DZCA 3IT1A 2H2AA 3ORFA 3UJPA 5AW6A 2DLCX 2JLCA 4LFCB 2ZUVA 1ZX1A 1C0LA 1GG8A 4NOJA 3WVNA 5HW0A 4I4TF 1L5MA 1KTIA 5ALRA 1J2UA 3MQFA 5LZ7A 4BEVA 1JG1A 3F3KA 1N9GB 3KR9A 2K7FA 4RVGA 1RHQA 1I4OA 2VPPA 3CR3C 4BPRA 4G84A 5LMNB 1YDHA 2P9TA 2FSUA 2GLUA 3C3YA 2OZLA 3VR0A 1Q44A 1I0LA 2HIMA 4NDNE 5K8LA 2DHDA 3OKCA 4K05A 3L5OA 4O33A 1A0OA 1SQFA 3KB6A 1ATIA 1VRCA 4ZAZA 4AY2A 3LL4A 3TZKA 4AG5A 5CT4A 2W6PA 3R5HA 5BN5A 5CAEA 5JZVA 1NW5A 4ZT5A 3VM6A 1CJKC 3GUUA 2FWBA 1ZP6A 1XOIA 1GYQA 3QXXA 2WHRA 4QM6A 4BLOA 2W6NA 4OP2A 3H05A 1CUXA 1O57A 1YQXA 4AKGA 5HM6A 2QAJA 2RBGA 1V7QA 3HCDA 5JJLA 3C5WP 3GLUA 4CM4A 1PS8A 2A78A 2A84A 5GVRA 1RI5A 1XTIA 3L7NA 5TB5A 3ED5A 3OPYB 4HJRA 5GINE 2BGGA 5KNCD 4QODA 3SMQA 3GPIA 4FOSA 1HV8A 3ZUPA 1W52X 5LQCA 2PZJA 3WA7A 2QBYB 3KLBA 3KTDA 4QJ3A 4MUGA 4YUXA 3QE0A 1DQSA 4DQVA 4Y8VA 5EY5B 1JR6A 3DVRX 2QAGC 2J7KA 4Z9FA 4BCBA 3EXEB 2GKSA 3OTOB 2VJOA 5EWLB 1SK8A 3I3OA 1G17A 4RPHA 1V3VA 4HQNA 1GKUB 4J1TC 2WQ6A 4H31A 3TDNA 2ZBFA 5G2OA 2FF7A 3ADDA 4ND5A 4OLAA 4UQLA 4HZGA 4UM5A 5CGQB 5F35A 2G9QA 3F6SA 4BRSA 3OQNA 1U8AA 5AJTA 3SHFA 3U5TA 1XHFA 2PX2A 3M3PA 3OEEA 1H9BA 1RPTA 1RJWA 2UZ4A 1C9YA 5IJXA 4ER5A 1R4NB 5LSAA 2YXDA 1J2EA 1NJFA 3LBYA 3PXBA 4CL2A 1OA0A 3K2EA 4FZRA 5DP1A 1H6CA 3LI2A 2OXFA 4DMUB 1SWWA 4P0PB 2VK2A 3GJRA 5KQMA 3V3KA 4AUMA 3O8LA 5LP6F 2RMKA 1GEEA 2YFHA 3QSYA 4FCCA 3SX0A 4JSYA 1PF7E 3UB2A 2EWMA 3LT1A 4N7JA 5ITZA 1H4QA 3X1DA 1N7HA 3DE5X 2BR3A 3A6DA 1X7XB 2B4RO 1LQ2A 4UVDA 1NU8A 1A2QA 1G3IA 3ESQA 2QXUA 1RZUA 2M1ZA 4B46A 2ZUEA 1EE9A 5DTIA 4RDIA 4P3OA 5DHSA 4EYEA 4C6SA 1MW9X 1ZQ1A 2PXAA 4UEOA 3HWSA 2AQIA 3MQ2A 4X92A 3BJEA 1FDTA 4AJEA 3TW0A 3DXZA 4PYKA 4KV9A 4B71A 2YWXA 2BCJQ 3CRRA 2IHVA 1S3SA 2XUHA 2HWUA 3BDVA 1NVFA 3EH1A 4NYJR 1IUKA 2Z1NA 1KYIA 2R4TA 1KXJA 1PX0A 3U44B 4A9AA 1G9XA 2BVNA 2D62A 1RAHA 3BCUA 4K0RA 3ZE8A 4DBVO 1P2TA 1CQJA 1R4AA 3BBLA 1Q7GA 3DH0A 2MDTA 3GEDA 1WMEA