4Z0TA

Crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
IDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short-chain dehydrogenase/reductase family
publication title Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis.
rcsb
source organism Brucella ovis
total genus 89
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z0tA00
2IZ0A 3V8BA 3LF2A 5LC1A 4UULA 3RSHA 4ZGWA 4B3IA 4ZQBA 3RJ9A 3JQFC 5JXWA 3L07A 1N8KA 1MB4A 2V65A 4OSOA 3FPCA 1JAYA 3DAGA 1LJ8A 1VE9A 5TT1A 1UR5A 4TROA 1PJSA 1NPDA 2C0CA 3AUUA 3CMCO 3CZMA 4Z9YA 5JAMA 3PYLA 3H9QA 1XHLA 1ADBA 2J3HA 1PJTA 3I6IA 5L9AA 3HADA 3KV3O 5TJHA 3IJPA 4DIOA 5HBRA 3VHRA 2GZ2A 3ZWYA 3LLSA 3PQFA 3TRIA 4M87A 4W7IA 4WASA 3GH3A 2EKLA 3H9GA 4IXTA 4CV2A 3SXPA 4GLOA 1ENOA 1T26A 1D1SA 2X0IA 5GY7A 5B4TA 4A5OA 3KM0A 3OJLA 5DULA 4AJ2A 2TMGA 3V1TC 1DC6A 5ER9A 3PJEA 4MP6A 4ZU3A 1HLPA 3BMOA 1VJTA 2X6TA 2NTJA 3IUSA 4LVUA 4MVJE 1X0XA 1F0YA 1QG6A 2EP7A 2PZMA 2EERA 5DN9A 2YQ4A 2Y66A 1PGJA 2GNAA 2J3JA 1RM0A 4MVJP 5ITWA 2Y67A 4EUHA 3VTFA 4RPHA 3TPCA 1UDCA 4A27A 4ZQFA 1PS0A 3QVWA 3ZWOA 2RAFA 4H3VA 1BWSA 1O9BA 2P5UA 4JNKA 4RORA 4A26A 5I9MA 4XGIA 2OGUA 1XSEA 2VUTA 1QRRA 4AG3A 1OMOA 4MVJD 1BDMA 1CRWG 3GN2A 4M49A 3WGIA 3JQ8B 3O26A 3LQFA 1I10A 1EVYA 1NWHA 2EG9A 2Y05A 2ZYGA 3NUGA 2IZZA 4GWGA 5L7YA 4Z6KA 1ADGA 2D4AA 2E48A 3E82A 4FFPA 3VC7A 4XB2A 1X14A 3GVIA 4Y6PA 1BW9A 2FOIA 4L9RA 4GX5A 4NJMB 2GN9A 2Q46A 3NAQA 4BO9A 4D41A 2PKQO 2FMUA 3DTYA 3JQBA 4AJNA 5BSEA 2W4QA 1Q0QA 5LDHA 1ZO8A 4FFMA 4MP8A 1LBEA 4MVJM 5DCUA 2O4CA 2FWMX 3I23A 2D5CA 3P2OA 3UCEA 1LUAA 1KEUA 3MJTA 2Q1UA 4OAQA 4FGSA 3QHAA 4I5DA 1GUZA 1WAMA 2O48X 3FNFA 3KSDO 4YQZA 2B4TO 3L9XA 3JTMA 4RO0A 3GVCA 2EV9A 3OETA 3PQDA 3JYLA 4BO6A 1WMAA 3V2UA 2VHYA 2D0IA 4FQ8A 1R16A 2FZWA 3DZHA 2G0TA 4JJIA 4AJKA 3G49A 4WLFA 4J7CA 1CQJA 1BTOA 3W6ZA 4E5KA 4DIBA 4PLYA 4I1IA 3FF4A 1NFQA 1H9BA 4OL9A 4F46A 2YHUA 5IDYA 4ZHSA 4YPOA 3DZGA 2CD9A 1MLDA 3HG7A 2JCVA 4CMIA 3PHIA 3WGOA 5C7LO 3JSAA 1I0ZA 3PFFA 2Y93A 1PJ2A 3X2FA 8LDHA 4CM4B 3P2YA 5JBIA 4CQMB 3JQGB 1JDJA 1FDTA 4KQWA 1E3JA 1DAPA 3JYOA 5KCZA 4I9UA 4MVJA 5COQA 1HL3A 4E0BA 1YB4A 2EEZA 4ZQGA 2W90A 1YL6A 5KVSA 3DOCA 4PVCA 1PL7A 4URFA 4XRRA 3UKOA 1EDOA 4G65A 2YHIB 2WE7A 2Q4EA 1X7GA 1ZEMA 3OJEA 5IZCC 3HJAA 4M8SA 1QSGA 1IUKA 4GBJA 5KVQA 1KIFA 1OC4A 4GPD1 1P33A 4IDGA 1N7HA 3JQAB 3WOHA 1E3WA 2FR0A 1GCUA 1YO6A 1QR6A 3D4NA 4R1SA 3U09A 4I08A 1KERA 3RCBA 3WIDA 4DYDA 2VOEA 2JFFA 4FCCA 4PLVA 4U6SA 5CPBA 3GRPA 5A4DA 2D8AA 3PPIA 4MVJH 4NBTA 1ADFA 3S2EA 5BQFA 1X0VA 1LDEA 3RUEA 4ILKA 3MJCA 4M55A 5T64A 4E31A 1HDCA 2VYVA 3U3XA 1X15A 1I33A 2VHWA 1YDEA 4G81A 4U0KA 1LNQA 1N5DA 1D3AA 4FJ1A 3WS7A 4CLEA 5F5NA 5JO9A 4TKMA 2GERA 3DMYA 4GX1A 5DP2A 1GFSA 1VC2A 1PL6A 4R1UA 2A92A 2P68A 3DHNA 5LDGA 1NNUA 3SJUA 1GL3A 1M6WA 1B26A 1M66A 3KB6A 1RM5A 3KOUA 2ZB8A 3W4KA 1HE2A 2BFPA 3NJ8A 3ZW8A 3IQDB 4DQUA 4DVJA 1E6EA 3DZJA 3F3SA 3H8VA 2EKQA 4FBGA 1JA9A 4GSLA 4K1LA 4YAEA 2BKAA 4RDIA 4BHTA 1Q7CA 4ZRNA 4DXHA 5B4VA 3G0OA 3RIHA 1K6IA 4DC1A 3G1TA 4R1TA 1I8TA 2JL1A 3KYCA 4R16A 2I99A 4RLHA 4J1QA 1H2HA 4J1SA 4NFHA 2UYYA 4RVGA 4FFRA 5AQ1A 4TZTA 3UN1A 4OKIA 2PR2A 1WVGA 3OHSX 3LT1A 2DPGA 2P9EA 2D2IA 4XZ3A 3D7LA 5F5LA 2QHXA 3ZWWA 3WWYA 4H16A 1E7RA 2Q99A 4MINA 1C1XA 2NNLD 4Z9XA 1NM5A 1GV0A 4NR0A 1PZFA 4PZCA 5L4LA 1WNTA 3CINA 5TC4A 1V3TA 1SCUA 3KHUA 4ROSA 2IYPA 4E13A 3GEDA 2NU6A 4NDNE 4PGFA 4ND4A 1LSJA 3QWFA 3H5AA 1TT5B 3BIOA 1VI2A 4LN1A 4EUFA 1B16A 3WGQA 3RC7A 2FY8A 4XDZA 4Y6RA 2Y1OA 3RUFA 4JXKA 4DLLA 5CHEA 3FNGA 2Z1NA 5L40A 1K2WA 2CDBA 5IDXA 4UREA 1G6KA 3TDKA 4CUZA 5IJZA 1IPFA 2QIOA 1ZH8A 5K6AC 5TIIA 2DTEA 3DBHB 3ETGA 3Q11A 5T6BA 4WK6A 2QX7A 1NHGA 3UGKA 4BNKA 3NT2A 2XAAA 1GYPA 4GAEA 2G1UA 3D3WA 1UZLA 2X9GA 3CEAA 4N54A 5ENDA 2OL4A 2CSUA 2CVOA 2P91A 3RC9A 2P9GA 1U7TA 4BO5A 1ZUD1 4O6VA 2JD1A 4CMJA 4ONEA 4CQLA 1SOVA 4JCOA 5H81A 1O0SA 2FN7A 5F21A 4GVXA 3DHEA 3SLKA 4FFOA 4IDDA 4Q39A 3ASUA 3H5RA 1VJ0A 1FDUA 5HWSA 5EN4A 1ONOA 4N18A 1HZZA 1MC4A 1DPGA 2VHVA 1U1IA 2IZ1A 2C2XA 4FC7A 3U4HA 2IODA 3INTA 2O7QA 4YTEA 4HNHA 5JC8A 5A9RA 4D79A 5FYDA 1T25A 1Z6ZA 4QTZA 1DIGA 2IRWA 3BMOB 3GHHA 4A10A 3EGOA 2GYYA 2PH5A 4IGFA 2PLAA 3I9MA 5ER6A 4R51A 2X58A 3MTJA 4ZVVA 3SBOA 3ZZNA 3JYQA 2CVZA 4OMUA 3ZWAA 3ZWNA 3ZGYA 1Z7BA 2EGHA 4BGVA 2OO5A 4HADA 4J0FA 1O95A 2PD4A 4JGBA 3INRA 4R5HA 1X7DA 3AY6A 1DOHA 1KYQA 3NX4A 3V2HA 2IEBA 3F5QA 4M54A 3ETDA 4BO7A 3IC5A 3W8EA 4KDFA 3B1JA 4OQYA 2QYSA 2EGGA 3D0OA 3DZBA 4R68A 3ZH2A 2HMWA 3A1NA 4EDFA 4IXWA 2X23A 2X22A 3QQPA 5IDQA 1OFGA 3BHJA 2WTBA 4YJGA 3NDIA 3RUDA 1XLTA 1P45A 5JCJD 4YYZA 3LT2A 1ZK2A 4E5NA 4QQRA 1BW9B 4BO0A 4DA9A 3VTZA 1B14A 4AVYA 4PLWA 2O3QA 3DHYA 3JQ7A 4BNVA 2UUPA 1EE9A 2O23A 3DBRA 5FI3A 3DC2A 4PFJA 1Y1PA 2O3RA 4E5YA 2PKQP 3WFJA 4CV0A 3PXXA 1DDOA 3OJFA 4Q3EA 4BNMA 1E1LA 4GKBA 3WBBA 2JFGA 4XYMA 4KWIA 2GN8A 2PY6A 3QVOA 1ML3A 4ALJA 3BMCB 2JD0A 3E6AA 1LDNA 2GPTA 1GY8A 2TMDA 1HYEA 1Y5MA 3M1AA 5CEJA 1C0KA 3I4FA 4BB5A 5ICMA 1NFFA 4OXKA 3S55A 1EBFA 4JBHA 1N1GA 4PN3A 3E8XA 4E6PA 4RGBA 1XKQA 3ZV5A 3F4BA 3K8ZA 3PJFA 4QUKA 2QRLA 4AJ4A 5JMWA 5DT9A 1HDGO 4F6CA 3Q1LA 3UCFA 4MP3A 5A03A 5IZCA 1H6BA 2C5AA 2C29D 2Q4BA 4L8VA 4X54A 4CMIB 3C24A 2J8ZA 2WYWA 3BZUA 1VPDA 3IKTA 1H2BA 1PGQA 5HS6A 1ENZA 3PP8A 2PK3A 3PWZA 2I3GA 2J3IA 3W4IA 4BKQA 4E2XA 3EUWA 3V2GA 4TVBA 3LC1O 5B12A 3PHLA 2IE0A 4BGIA 2AA3A 4N5NA 3KEOA 3V1UA 4NIMA 5LCXA 5J23A 1PWZA 1K6JA 3EZYA 4UEKA 5JDIC 3PZBA 3MJVA 4XR9A 5G0UA 3PLNA 1T2CA 2V6GA 5THKA 3IAHA 4BKOA 2C07A 4MVJI 2Q1WA 5L53A 3S1LA 4OXNA 1WDLA 3HDJA 3GGGA 1E3WB 4KTVE 1E0DA 1XWFA 5C5IA 3BMQA 2PV7A 3DWFA 3ZV6A 3B20A 3GLQA 4NFSA 2YZ7A 4E21A 1CJCA 1PJQA 1UUFA 3AK4A 4K26A 1T2AA 3TFQA 4E12A 5F1OA 4XQGA 3FTPA 3RUAA 2F1KA 5EIOA 4LMPA 4W7HA 5IZ4A 2GZ1A 3PJGA 2YV3A 5L95A 2Z1MA 1U3VA 4AJOA 1NQTA 1GQ2A 1R15A 1YB5A 4ZN6A 4XA8A 2GRAA 3M6IA 3O4RA 4CM3A 1BHSA 4IMRA 4MPDA 3GUYA 3ZU3A 4O5OA 1SC6A 4QXMA 2FP4A 2R00A 2Q2QA 3UVEA 5A9SA 2RCYA 3GG9A 4E5PA 4BIIA 4HV4A 3K2EA 4E4YA 4RVDA 4KUEA 4NJOA 2Y99A 1EUZA 3U4DA 5G4KA 3UF0A 3B1FA 4FIZA 1PR9A 3PZRA 3JYPA 4PVDA 1AGNA 3OICA 3SC4A 2J5QA 1PQWA 3TWOA 4J90A 4PG7A 3DR3A 3WGTA 2DFVA 4DLAA 2QZ9A 4J1NA 3PI7A 4F45A 1E5QA 3HFGA 4EUEA 3CTMA 4FJ0A 5A5FA 2WE8A 1NR7A 4J6FA 2HMUA 3STHA 1BXKA 4EI2A 2YDYA 3H2ZA 1SNYA 3EC7A 3I52A 4CR6A 2GSDA 4IJVA 4R3WA 5DCWA 4ITUA 3RC1A 1ZKMA 1NBOA 1U5CA 3GPIA 4RCVA 3JQDA 4I5EA 2VCYA 3LSYA 5EQDA 1C1XB 4BO3A 3TSCA 4FR5A 1JKJA 2DBRA 5EMHA 1RPNA 2HU2A 5K6AA 4D0SA 5EPOA 3F4LA 3G17A 4NMHA 1L1FA 3DOJA 5TT0A 4LISA 2VRCA 4UVEA 3F46A 2HSDA 3JV7A 4P4LA 2HJSA 3GA0A 5A3VA 1GZ4A 1UDBA 1ISHA 4JN6B 5L45A 4HX5A 3W1VA 4II3A 1Y81A 2GN6A 2ZTMA 4YJHB 1DIAA 3L6EA 1YQDA 3JQ6A 1SB8A 3CZRA 3KYDB 4GMGA 2YY7A 2PA3A 3IKVA 3ZWXA 2D3TA 4EJMA 3HB5X 4XJTA 1NP3A 1SOWA 1ID1A 1V3VA 1DIRA 4BMNA 4BL5A 3ANNA 2GGSA 2H6EA 3O8QA 4R01A 4FN4A 3R6DA 1W73A 1PZEA 5F1KA 1R0LA 2A4KA 3D3WB 4PIVA 1MC5A 3I9JA 4U5QA 3RJ5A 1QKIA 4QECA 1UZMA 2HQ1A 1T4DA 5F1PA 3AJRA 1HWYA 4GGPA 4XB1A 2AE2A 1E1MA 3CSDA 1IL0A 2Q45A 4D3FA 1VL0A 4LSWA 3DZFA 4K28A 4BNWA 1BGVA 3JD3A 1U8FO 2P2SA 3GNQA 2NQ8A 9LDTA 3N74A 4BKUA 2VUUA 5A06A 4CL8A 3D5QA 4IIUA 1O8CA 3WTBA 3WYCA 1LDMA 1IY8A 2BFAA 3T4EA 1P1HA 3MTGA 3GZNA 5TQVA 4ALLA 2VYND 3W4JA 3PFWO 1PIWA 2UDPA 1Q7GA 5KJEA 3TZQA 3Q3CA 1GV1A 2RH4A 3ZHZA 4ALNA 4CPDA 1DFGA 1DJNA 1B3BA 4HBGA 3DAFA 4CUKA 4DTIA 4FPXA 1YBMA 1KY4A 5A9TA 4IQGA 3ZNQA 4MVJG 4BGEA 4BS9A 3CH6A 3AI1A 4BNXA 4M86A 1ISIA 2OOSA 3H9EO 1GYQA 3H9UA 1ZFNA 3WQQA 4E2ZA 1CF2O 1HRDA 2BGLA 2HRZA 2NVWA 3JD1A 3PQEA 1OAAA 1PS8A 3B70A 1GQQA 1JLLA 2C7GA 1UXJA 3E9NA 1BVUA 3BHIA 2AQKA 3ZU5A 1WZEA 2Y1GA 3E5MA 3B6ZA 4PLGA 2QG4A 2QRKA 3P19A 1PJLA 5IN5A 3BAZA 2F00A 1GEGA 1UP6A 1KBZA 3DAPA 1ONNA 2AG5A 3UH1A 4BNIA 4DYVA 3QLJA 1QP8A 1DAOA 3ORFA 5DF1A 3RU7A 5TLSA 3A9WA 3U5TA 1YONA 3L77A 5I9NA 3GGPA 4BUCA 4XCVA 1DLIA 4BNNA 3Q9NA 1ISGA 5DCYA 5I9LA 3L4BC 1VM6A 4U7WA 5AVOA 2Y1DA 1LI4A 3UAGA 2O2SA 5JY1A 4ESOA 2Y68A 1ZMTA 1Q0LA 2E82A 1C14A 2YUTA 1LC3A 5HA5A 4B8ZA 3I83A 3RKRA 2CFCA 2OFPA 4J49A 4CLRA 4Q9NA 1XU7A 3T4XA 1JQBA 2WEKA 4RF5A 3WGHA 4HY3A 1GZ6A 1FMCA 1FDWA 2HUNA 2EF1A 3DOOA 3RQSA 5L51A 3GK3A 1B7GO 2B37A 1GCOA 1SBYA 2Z5LA 2IDZA 3C1AA 5JE8A 4QSMA 5JDIA 1Z45A 1PR3A 2VWQA 1N2SA 2X0JA 3U4CA 5C7OO 3FD8A 5GZ3A 5A5EA 3C7AA 1N92A 3NEPX 2O4UX 5AXAA 1H94A 3GQVA 2EXXA 2NVBA 4DGSA 1F12A 1P0FA 1CWUA 1PZHA 4RDHA 3GUCA 2X5JO 1HF3A 1V35A 1A7KA 2QZZA 3DFZA 2JKVA 3PGXA 4LMRA 2WJPA 3VZRA 3WYBA 3GZ4A 3PJDA 4HFJA 4Z0TA 1B3RA 1PTJA 3AY7A 2GF2A 5KKCA 1UXGA 1U3TA 4G5HA 1V6AA 3LK7A 4WGGA 1E7WA 3WJ7A 1IULA 4OIMA 1MXFA 4W99A 4P4GA 2C5EA 3FPLA 5DOZA 1I3LA 2AW5A 5KWEA 2X5KO 1R4MB 3LLVA 3SX2A 4R5MA 5ILOA 1PWXA 4BNLA 1XELA 4RF2A 4NBVA 3EYWA 2Q1SA 2EP5A 1NVTA 1DIBA 3PVZA 4ND5A 1LTHR 4PLZA 2B35A 4TMFA 2NQTA 1E6UA 1GUYA 3MWDB 4QFDA 3TFOA 1TEHA 4AL4A 2LDBA 4NU6A 4M1QA 3QJ5A 3ZI0A 4TZKA 4D0RA 3HN7A 5G0SA 4AJLA 4D7AA 4CMEC 3RBXA 4BGUA 1JTVA 4IPTA 4U8GA 3ZN2A 4BNUA 5I7FA 3QP9A 1RYEA 4PLHA 4DWVA 3WWZA 4TRJA 2CDCA 3WXBA 4BKPA 3BHMA 4KZPA 2AEFA 3I6QA 1C0LA 1EK5A 1F8FA 3IDSA 2PZJA 4J0EA 2QW8A 1JKFA 4P4NA 1E77A 4FB5A 4YAIA 3O38A 5MGBA 1QORA 4CV1A 1NYTA 5DOVA 3OSUA 3ROQA 3M2TA 2BRUA 4Z0HO 4ID9A 3DTTA 1LRJA 1NVMB 5A9SB 1W6UA 4MOWA 5GZ6A 3AU8A 2BLLA 3AY3A 1JAXA 3E9MA 5HS4A 5G4KB 3AM5A 2PKRA 3LT4A 1ADCA 1KC1A 2W2LD 4TQGA 5L7TA 1EQ2A 1P44A 4UVIA 5KIAA 1WLYA 1EMDA 1C1DA 4DIFA 4NG5A 4RZHA 4AFNA 2H9IA 5CDGA 2UAGA 4TRNA 2X86A 1LDGA 2O3UA 3PLRA 3QW2A 3ZHBA 4NU5A 3WDSA 2GLXA 2OUIA 2JHGA 4R9SA 1GUFA 3GAFA 2ZTLA 3NYWA 2ZYDA 2D1YA 1HZJA 4IM7A 1KVQA 1PQPA 4NPCA 1GPJA 5I8ZA 3W8DA 3WIEA 1K89A 1KVTA 1A9ZA 4NHEA 1KC3A 3FBTA 1HSOA 1YXMA 2E49A 1LQTA 5COBA 3RKUA 2R00C 1EK6A 1LEHA 3GEMA 2JAHA 2ET6A 3FI9A 1DC3A 3E18A 3L6OO 4J3FA 3OH8A 4IS3A 4EEZA 5KOIA 4IY1A 3GVPA 2ZJ0A 5IDWA 2YFQA 3SEFA 1Q1NA 1AN9A 4KOAA 1MUUA 1GZ3A 3C1TA 5A3JA 2GD1O 3CXRA 1X7HA 1HDXA 6LDHA 5COAA 4DPMA 4MDHA 5B1YA 3LF1A 3QWHA 3ENKA 4WCFC 1VL8A 2ZB7A 3P5SA 5IF3A 4XX0A 5CP8A 5T8KC 3OIGA 4JROA 3WR5A 2WD7A 5AYVA 1UXIA 1CQIA 1JN0A 4WLUA 5BNFA 1EZ4A 1ZNQO 4JJGA 3TZKA 3I1JA 3AOGA 1NHWA 3ZCXA 1D8AA 2ZJ1A 3L6DA 3V5NA 1B8VA 4Z3KA 2ZCUA 1P1KA 1PJ4A 3HHPA 2ZTUA 5FWNA 3GDOA 1NX6A 2O3JA 4Y67A 1T1RA 3NGLA 2AHRA 2W98A 3O8QB 1T2EA 4GX0A 3IJRA 4IJWA 3HQ4O 4TRRA 4JQCA 4I9NA 2VOJA 3N7UA 4EW6A 5CDYA 2W2LA 3AFNA 2YDXA 1LC0A 4D44A 1ULUA 4EBFA 2X9NA 1NPYA 1VRWA 4OKNA 3OQ1A 1PGPA 2BI8A 4S3MA 2O3SA 3RFXA 4UVHA 2FZEA 3ZV3A 1NR1A 3TL3A 4WEQA 4FOOA 1LSUA 4WE3A 4L4XA 2AE1A 5GZ1A 1YB1A 5JMPA 3E5RA 3FCOA 3IMFA 1RM3A 4BNGA 3GZNB 2OZPA 2NU7A 2X1HA 5BSGA 1I32A 1O94A 2Y1CA 4CLOA 1Y8RA 4Z3DA 3ASVA 3ROPA 2J5RA 3LZ6A 4ALIA 4XQCA 3NV9A 3ZWCA 2B36A 3I9NA 1H6AA 5U1PA 1E3SA 4BQRA 4N5MA 1ZXLA 4GI2A 1NAIA 3GHYA 3IUPA 3LC7O 4TKLA 4HXYA 2VT3A 4GH5A 1YJ8A 4B4UA 4YRAA 1RWBA 3TOZA 1JKIA 2FPPA 3VKUA 1JWAB 1GAEO 2G5CA 2YFHA 4CR7A 1PQUA 5A05A 2Q49A 1M76A 3PHGA 2Q3EA 3WLFA 1BMDA 5CEEA 3MOIA 1KY5A 3VZQA 3KBOA 4IDAA 1LLCA 3WMXA 2GASA 1MFPA 3L4BA 4RVSA 3VAZA 4WOJA 4H15A 2HLPA 3A28A 2GO1A 3ETEA 3ST7A 4D3SA 4L75A 1O5IA 4YT8A 4RJTA 3VH2A 4PG6A 3U0BA 4YR9A 1EVZA 4Y6SA 1VLLA 4YWJA 4ZQHA 3WNQA 4C7KA 3GMSA 2OBNA 4RVHA 3EHEA 4A03A 5KVVA 4DREA 4B7CA 4CLDA 4EYEA 1B15A 2VT2A 4CM8A 1U3UA 2RIRA 2W2KA 2Y0EA 4UAGA 4YQYA 3K30A 3VDQA 3I3OA 3QVTA 4IQ8A 1Y5RA 1HDRA 3PK0A 1YDWA 3GN1A 4R3NA 3WSVA 2DUWA 5A04A 1XGKA 2Y0DA 1HE5A 4E5MA 2VTDA 4J2OA 4CQMD 2B5WA 4P8RA 3WX0A 1KVUA 5ICSA 3ROKA 3EVNA 3F5SA 2HKIA 2ZTVA 2PD6A 3ENNA 5AXCA 4WNCA 3JQ8A 3H6KA 1BRMA 3VVBA 4S1VA 1IE3A 2PGJA 1DB3A 4YT2A 2NU8A 4WKGA 4XIYA 3LYLA 4YT5A 5JAZA 4HUJA 3VDRA 4A7PA 4AJJA 5KTKA 4IDEA 3FWZA 4W9NC 1EEHA 4HKTA 2Q50A 3OECA 4IBOA 4PRKA 3BMNA 3RFTA 5JYEA 4EITA 3JQAD 3NDJA 2VWPA 4XYBA 3S8MA 3WB9A 1A4IA 2HJRA 3AW9A 1PZGA 1H0KA 1PS9A 4JP3A 1X1EA 3KZVA 1DO8A 4ALMA 2EKPA 4AJPA 2FPIA 3ONEA 2BGMA 2G82A 5CG1A 4XQEA 3VPFA 3WGGA 4FFLA 3RROA 4LK3A 1SEVA 2J6IA 3PYMA 2D5AA 1PL8A 4G2NA 4LCJA 4MKXA 4GMFA 1T2DA 4CMEA 2YYYA 2XPCA 3WSWA 3X2EA 1ZJYA 5DBFA 3OFSA 1R6DA 3DEYX 3K6JA 1U2GA 1PGOA 4DC0A 4DLBA 3JQCA 1B8PA 1UJMA 3WFIA 1EUDA 2EWMA 5TS3A 4B7UA 2PGDA 3L0DA 1Z75A 4O1MA 2AQHA 4QX6A 5AXBA 5ITVA 1U8XX 1UH5A 3D3EA 2IYOA 3KTDA 1P0CA 1A71A 1PSDA 3GNTA 2VZ9A 5TF4A 4XJSA 3ZU4A 1ISJA 1U4OA 5JCJA 3H9JA 3ADOA 3M1LA 3ZU2A 1EVIA 1BXZA 2VWHA 5TNXA 2BD0A 3BTOA 1LA2A 1HLDA 1ZIDA 4LVCA 3VPSA 1DC4A 1HDYA 4OM8A 2BELA 5JAIA 1RYDA 4I8XA 4K6CA 3NGXA 3PIDA 4CM4A 1NTOA 1H5QA 1ZK1A 2A94A 3F6YA 3JD2A 1EFKA 4IDBA 5JY6A 5JSFA 1YQXA 3VPHA 1IYZA 1LLUA 3EAGA 3GT0A 2ZIZA 3AI3A 4M89A 1H93A 2R2GA 2B83A 1MG5A 3DMTC 3PEFA 4MJLA 3WQRA 3D64A 3RU9A 4CR8A 3ZNNA 2HK7A 2WD8A 6ADHA 4D46A 5CAEA 4IUYA 3Q9UA 1U28A 2CY0A 2R6JA 3Q2KA 3MJ4A 4UEJA 1JWBB 3QRWA 4UUNA 1A27A 4YAKA 5FF9A 4BQPA 4IJKA 3VPGA 1I30A 4IJUA 1VJ1A 1S6YA 3WBFA 3WNVA 1FXSA 2LDXA 4PLCA 2I6TA 1LSSA 1AUPA 1AHHA 3EK2A 2V6BA 4A73A 5CDTA 2C7VA 5U4QA 1SMKA 4O63O 2HMTA 2O50A 4J9UE 2C82A 1LDBA 2I9PA 2VZ0A 2I3AA 1QLHA 3F1LA 2FRDA 3W8FA 4BOYA 1LLQA 3ONFA 1HDOA 4D3DA 1ZK0A 1RKXA 2B4QA 3R0IA 7ADHA 1WXDA 1ZZEA 1E3EA 3R3SA 1PJCA 1C0IA 3IP1A 2YV2A 4WCFA 3E03A 2VHXA 1MP0A 2ZK7A 3U9LA 1ZSVA 1T1SA 4RL6A 5T8KA 3ON5A 3KYCB 4EJ6A 5A02A 1M6HA 4B4VA 1AE1A 3HN2A 1CDOA 1ZCJA 3FBGA 1P31A 3VZSA 4KUGA 1DHRA 3RBVA 1E7YA 3H5NA 1Y6JA 3GY0A 4UEOA 4DL9A 3AWDA 3RUIA 3HDQA 2DM6A 4UVDA 1GQYA 4E33A 1OI7A 1YBVA 2YQ5A 3KRTA 3TOXA 3K5PA 1CERA 1ZSNA 3GF4A 3GDGA 3M2PA 5EESA 2PGLA 1A9YA 3V1YA 1XIVA 4XRGA 4YRBA 1YWGO 2NADA 4C7JA 4BO2A 3ANMA 2IXBA 2EJWA 1MG0A 3ROMA 4Z9FA 1Y7TA 2DBZA 3LVFO 3O9ZA 4NK5A 1QYCA 1XR3A 2E4AA 2JCYA 3GFBA 3OIDA 5IN4A 3I5MA 2WD7B 3K92A 4NNJA 4YACA 4YJDA 1OC2A 3G3EA 4P22A 2RBEA 4L0QA 3EMKA 3WG9A 4W82A 2G17A 2WDZA 4FSHA 4B3HA 4J16A 3ZW9A 2PTGA 1G1AA 1YJQA 4NK4A 1IZ0A 1HE3A 2CMDA 4IZHA 5I8WA 4BO1A 4JIGA 4BMSA 1LX6A 2P4HX 4WOKA 4YAGA 1I2BA 3MJSA 5TX7A 1NXQA 2VTEA 3C7DB 5H83A 2PH3A 4WECA 2O2YA 3GAZA 4NFYA 1FF9A 5B37A 3AUTA 5BSHA 3D4PA 5JS6A 4NBWA 4OO3A 1P1JA 2DC1A 1HE4A 4NBUA 5T67A 5L3ZA 3ITDA 5T5QA 3QVSA 1F06A 2D59A 4CQLB 2BGKA 5L7WA 3GNSA 4YVFA 4FFNA 5JLAA 2GR9A 4YJFA 3T7CA 1M2WA 2NSDA 5G0WA 4PRLA 2ZATA 5TSDA 4L76A 1IHXA 4AJIA 1ZBQA 2VNSA 2DVMA 4FS3A 3WJAA 4Y8VA 2CDAA 1G0OA 3IP3A 5FI5A 4B8WA 2YW9A 3ADPA 3D1LA 4XDYA 3OEYA 5DDIP 4CLOB 1HSZA 1Y8RB 1T4BA 2GUGA 4OOFA 2FSVA 1YE3A 2AEJA 2Q2VA 3F1KA 2VUSA 3ZNPA 3LT0A 2WYVA 1E7MA 1K0UA 1NQOA 1T24A 4YDRA 5JDCC 4BKRA 1I3NA 1KEPA 4MVJF 4XYLA 4PLFA 3BTUA 1UXKA 1VKOA 2NV6A 4MKRA 2DBVO 4B7XA 5JC1A 5JO0A 2CF5A 5K0ZA 1TXGA 4Y98A 3BXXA 5KJ1A 1DFHA 3ZWVA 1DFIA 1R0KA 4XKJA 2HAEA 5TJ9A 3COSA 5CDUA 5IXYA 3EW7A 2I5PO 3GFGA 1EBUA 1P1RA 3QWAA 2OXIA 2GCGA 1WMBA 3TNLA 1B0AA 2ZKLA 4GX2A 5CDSA 2B69A 3RUCA 3D5TA 3GEGA 1I3MA 3NTOA 1DRVA 1ENYA 1N1EA 4FDAA 2PD3A 4XGNA 3AM3A 2WSBA 4MKZA 5EQFA 3W6UA 4RVFA 2CUKA 3ULKA 3U4IA 4KDEA 1Y8QA 5JPIA 4HFMA 1LRLA 1QYXA 3LC2O 4ZJUA 3QE3A 1JVBA 1NQAO 2ZB3A 1H6DA 3OQBA 4L74A 4CM8B 2W2KB 2BFMA 4D42A 3U49A 3ITKA 4YJGB 4RPGA 5JNLA 4W9NA 1S7CA 4CM6A 2BFOA 4GKVA 4FJ2A 3PIIA 2OHXA 2G76A 3JQ7B 5C37A 1T2FA 4J2HA 1LU9A 1HYGA 3OM9A 2GZ3A 1CIVA 2PNFA 5K9ZA 3DBRB 3GR6A 3HSKA 5KNLA 2FR8A 3AM4A 1QLJA 5I7SA 3ZHXA 1SO8A 4H7PA 4EEXA 1EVJA 5TRTA 4CJXA 1ISMA 4W4TA 5B4UA 2X8LA 2AEMA 5DP1A 3JYNA 1F17A 2ZYAA 3AUSA 2H5LA 1GD1O 1SB9A 1P1IA 1V8BA 3C7CB 5CG2A 2DFDA 4IDFA 1AXEA 2VYNA 4E2WA 1R37A 3HNPA 3GVXA 2NUAA 3Q2IA 4LRSB 2FHSA 3P7MA 3BMNB 5ILGA 1F14A 3WICA 4BV8A 4IINA 2JJYA 4E3ZA 4F6LA 1DXYA 3E1KA 3C3XA 2HK8A 4B4WA 4OGWA 4LCEA 1QV7A 4UUMA 3JD4A 4KQXA 3MOGA 4AJ1A 1PX0A 3KLMX 4B79A 1JU9A 4RPJA 4R4JA 1E1KA 5KJFA 1Y9AA 4A0SA 1Q0HA 2BI7A 3OJOA 3FTNA 3BTSA 5KJCA 1M75A 2VYVD 3A06A 1WDKA 3E9QA 4L4SA 3TN7A 4YEDA 1QYDA 4RPKA 3DL2A 3BMCA 3BYZA 4PZDA 2X7HA 2J3KA 1MA0A 1GR0A 4TRMA 4ND1A 3VOSA 1YL7A 4DPLA 2V6FA 3S2GA 1NQ5A 4UUPA 3RAJA 3TZ6A 5BNTA 3HUDA 1U3WA 4RF3A 4ZA2A 3GOHA 3WLEA 1BXGA 4CMBA 4II2A 1LRKA 3DMTA 2BH9A 1XQ1A 1WZIA 2FSSA 2W8ZA 4RF4A 2WWRA 3HFSA 1MXHA 2DTXA 1KVSA 2QQ5A 4EJ0A 5DNAA 2HRBA 2QRJA 3DBHA 3Q6IA 4D45A 1V9LA 1E7QA 4CMHA 4P38A 1SAYA 3BMQB 5HTOA 3ICPA 1LQUA 3F9IA 5CPFA 4RLSA 4OJNA 4QEDA 1YL5A 2OP1A 1D1TA 2VN8A 5BNIA 2FR1A 4KWHA 3QIVA 5AOVA 3GGOA 3ICCA 3QA9A 4GL4A 1KEWA 5DZSA 2DU8A 4HWKA 4I5FA 2HMVA 3PRJA 4K9DA 4BB6A 2JCXA 4CMGA 3HDHA 5GMOA 4CMCA 5BT9A 4B3JA 2FPGA 2NTVA 2VRBA 1YOVA 1DC5A 4ND3A 3DZKA 4DQXA 5I7EA 3C8MA 1QYVA 4AICA 1FK8A 2HK9A 1HTBA 2RH8A 1MX3A 2NACA 3T7EA 5MDHA 4INAA 5C7IO 3ZWMA 1YBAA 3DBLA 3K96A 3WQSB 3Q0EA 3QWIA 3GVHA 4U6QA 4FW8A 3FR7A 3OF2A 3H7AA 3OMLA 2XOXA 1WW8A 3BA1A 2V6MA 4NI5A 4C4OA 1MFZA 3UW3A 4WJZA 1NVGA 2PZKA 4PZEA 4MIOA 2OORA 3MZ0A 5JYDA 1HYHA 1N7GA 3IL2A 1P77A 1NAHA 2RHRA 5CEFA 4XEHA 1YS4A 1V3UA 3PWSA 4JLWA 3EY4A 2Y0CA 4DUPA 1NFRA 4WCFB 5G2OA 3KYBA 2BMAA 3GPDG 1TLTA 3IS3A 4CM7A 1UAYA 4CM9D 5EINA 4J4TA 3NKLA 4PLPA 3WMWA 4BNFA 2Y1EA 1U7HA 1P3DA 4OYRA 3ZDFA 1XCBA 4BO4A 2NVUA 1U5AA 3ABIA 1LLDA 2C2YA 4KP7A 3H2SA 4KMSA 1GTMA 1UP7A 3RASA 1N9GA 2PFGA 4DBZA 3I9LA 3PYXA 1E1NA 1E92A 1P9LA 3DQPA 2AMFA 1XYGA 3K9QO 4NQZA 1EDZA 1IHYA 1U9JA 4TSKA 4BNZA 4K6FA 1XQ6A 1PJ3A 3OJ0A 1R0SA 1D4FA 4Z0PA 1HDZA 1A72A 4RV9A 3H3FA 3DFUA 2Y1FA 1R4NA 3ZWPA 5ENVA 3UXYA 3SVTA 2DPHA 3PTZA 1Z74A 3FNHA 3FN4A 2DUUA 2VWGA 4YAJA 3RD5A 1IPEA 2X0RA 3QSGA 3EZLA 4BV9A 4R9RA 2QYTA 3WTCA 4WPGA 1J6UA 3PDJA 4ZRMA 4L73A 4O59O 4QO7A 4R54A 1VSVA 2H63A 2VZ8A 2ZB4A 3PWKA 3INGA 8ADHA 5G4LA 2B5VA 4DRYA 3G79A 4EZBA 3KSUA 1HEUA 3O03A 3QWBA 3JQEA 5T57A 4D43A 4IMPA 1ZK3A 3MJEA 2UV8A 2ZQZA 1DEHA 3NDRA 3VVCA 4EGFA 2PZLA 3FNEA 2GDZA 4IGEA 3KLPX 4ZICA 4GGOA 2NU9A 1PU2A 1VSUA 3L4SO 5JDCA 3RC2A 4RQUA 3UOGA 1CYDA 3QVXA 3JQFA 3SJ7A 1PEDA 1PGNA 1E3LA 1TA4A 3VH1A 3I9KA 3S2FA 5KVCA 1DJQA 1MV8A 3ZHYA 3JQ9C 3OA0A 4QO8A 3DBVO 4HNGA 4YJHA 4YJFB 1BVRA 1U4SA 3C85A 2C54A 1BDBA 2Z95A 4CM9A 3FSRA 3KYDA 4Y9DA 4DQVA 1HETA 2X9VA 3DONA 3F47A 3R3JA 3OA2A 2B4RO 1KS9A 3AI2A 4XQ9A 3RWBA 1CETA 3OBBA 1WDMA 3QY9A 1E6WA 1QYWA 1NASA 4OOEA 1ORRA 4B4OA 4I9HA 3NTRA 3L9WA 2P4QA 1E7SA 4JP2A 4L4RA 4XYGA 1OOEA 2O3TA 1WWKA 1GYRA 2UVDA 1AXGA 3AOEC 1HXHA 1LXCA 3B1KA 5I7VA 1GADO 1X1TA 4Q3CA 4PG4A 2CZCA 3VH4A 3ZV4A 4BNYA 3WGZA 4YXFA 1XEAA 2AXQA 4HFRA 1UDAA 3RUHA 3LU1A 2C20A 4WCDA 1E3IA 5C3MA 2NLOA 2B0JA 3KEQA 3PHHA 2DLDA 3HE3A 3H65A 2A35A 3FHLA 4AJEA 4XR4A 1I5RA 3VKVA 4BO8A 5U9CA 2ZQYA 4OHUA 1YH3A 1UZNA 3C1OA 3UCXA 1PJBA 2YV1A 4YBZA 4XWYA 1C3VA 1QXSA 4BNTA 5BR7A 1L7DA 2E37A 4ZQEA 2Q1TA 1Y8QB 1XDWA 4GWKA 4N5LA 2A9FA 2UUOA 1ZEJA 3S2IA 4YA6A 2HCTA 1ZSYA 3MEQA 1KOLA 1K6XA 1TB4A 1GPDG 3DO5A 1TI7A 4GSKA 4N7RA 1MGOA 4RVUA 4ALKA 4DBVO 2VHZA 1W8DA 3NTQA 4W6ZA 1A7AA 1FDSA 2DKNA 2JHFA 5G0TA 4E30A 4U0JA 5BSFA 4PLTA 3MCVA 4J91A 3LDHA 4KUHA 3PDUA 3NJ4A 3IOYA 3GRKA 1DBVO 1NPTO 5JW6A 1CEQA 1QMGA 1EQUA 5A1TA 5ADHA 4MO2A 1LSOA 3PGJA 4CLRB 3CMMA 5KKAA 4E2YA 2OBYA 3N58A 3AU9A 1NWCA 4A2CA 1O89A 1A4UA 1J49A 1YKFA 2I76A 4ZD6A 1J4AA 4OXYA 4UUOA 3CIFA 4CM5A 4J7XA 4JBGA 1O6ZA 5IFLA 1KEVA 5TGDA 4DPKA 2EW2A 3A14A 3JCZA 2E6UX 4BVAA 3RBZA 1EUCA 2WMDA 4NJMA 1U2DA 3I9OA 1IZ9A 3JD0A 4HP8A 4OQZA 2EHDA 2BF7A 3HZZA 2H1SA 3RI3A 3GG2A 4E32A 1M67A 3TQHA 2WYUA 4IS2A 1I2ZA 1L7EA 5HM8A 2NM0A 4JX8A 2O7SA 2DTDA 5H82A 1J5PA 1I3KA 3OP4A 4MIEA 4AJHA 5L4SA 5HRUA 1H9AA 1DSSG 4HFNA 2EW8A 4YCAA 4DMLA 3MWEB 2HO5A 1EFLA 2EIHA 4GQAA 1BXGB 3UFXA 4CLHA 1B8UA 5IXSA 2HDHA 1Z7EA 3K31A 4GLLA 1Q7BA 4NBRA 4FD3A 4GVLA 2CF6A 3KETA 3FWNA 4NH4A 3CPSA 4J4BA 4CL3A 2VNAA 3U62A 2NTNA 3NT4A 2CVQA 5CFZA 4F3YA 3R1IA 2JD2A 1P74A 1LDYA 3JQBC 3KVOA 1W4ZA 2I66A 4RQTA 3NT5A 1Q2XA 3HDYA 4WUVA 5EJ2A 2DQ4A 2P5YA 4QT0A 3EVTA 1GEEA 1G0NA 3GDFA 3IIEA 4LSMA 5FFFA 4J9VA 2XF8A 2C59A 4KTTE 4YB8A 1DRWA 5F3RA 1ZXBA 3A4VA 3HB4X 3OIFA 4J1TA 2DAPA 4CODB 4LW8A 1OBFO 1IB6A 4CQMA 3JQGA 2SCUA 1YQGA 4WLNA 5DBIA 1SZJG 1ULSA 3KXDA 1B2LA 1YOVB 3RFVA 5L4NA 3BTVA 3CKYA 5EL0A 1R4MA 2X5OA 1EE2A 2OP0A 3AUAA 3TF5A 3E48A 4Q3AA 1ZMOA 1A5ZA 2YHIA 3DZIA 5DBGA 2VQ3A 1UAGA 2PWZA 3FR8A 3DBLB 1XG5A 2NWQA 4PCVA 1DIHA 5THQA 3ZNOA 2AQIA 2IEDA 4PG5A 3I4CA 4QFCA 1RM4A 2J5KA 1ISFA 2I65A 4XYEA 3AFMA 1HKUA 4PG8A 4J43A 4WNIA 3JQAA 3WGYA 3DXFA 1UP4A 1ZVMA 4CLXA 3ONDA 2VRCD 1V0JA 3H4VA 7MDHA 3CUKA 4XD2A 1C1DB 4WLVA 1TVEA 2ILTA 1E5LA 1ARZA 4JJFA 1H6CA 4CMAA 2X0NA 1SPXA 1W0CA 3D4OA 1RJWA 1R12A 2X4GA 3PHJA 4CMKA 3EDMA 5ES3A 5AXDA 3TZHA 3SLGA 1BG6A 5JAQA 1YRLA 2NVUB 4IQ0A 3VPXA 1N9GB 1ZW1A 4R41A 3K2BA 1C0PA 2ZCVA 4XIJA 5G0VA 1DLJA 1QV6A 1FJHA 4CM1A 1ZJZA 2OMEA 4R69A 3VZPA 4RPLA 4OSPA 2P9CA 3OEWA 3SC6A 3DDNA 4Q3BA 1XU9A 1I2CA 1I24A 1WPQA 2JFHA 3OQ6A 1R4NB 4Q3NA 3NRCA 3H3JA 2I67A 1IOLA 4OH1A 2Q2WA 4LRTB 3GC6A 3VH3A 5JCXA 2V7PA 2DT5A 4WLEA 3GMDA 3TJRA 4BMVA 2YJZA 1JW9B 4J7UA 3TL2A 4BNHA 2BHLA 1ENPA 3JQ9A 4UVGA 4NZ9A 2JAPA 1R66A 4IDCA 3KO8A 4Q3DA 1UXHA 3ZWBA 1DHTA 1ZK4A 3DB2A 1HT0A 4BNJA 4FOSA 2DBQA 3ANLA 4RZIA 9LDBA 1YGYA 1TT7A 1KETA 4MIYA 1I36A 2WM3A 4YRDA 2IXAA 4FGWA 1I01A 1K3TA 3KSZO 4J4HA 2CNBA 2POQX 5FEUA 5IAAA 4FC6A 1VKNA 2AG8A 3UICA 1VL6A 4O0LA 4DMMA 5EERA 4XGKA 1X13A 3QV1A 1K5HA 2AQ8A 4R1NA 1F8GA 3AOEA 4IZIA 4JBIA 1TT5A 3G1UA 1Z82A 1KVRA 2XXJA 2EJVA 3WYEA 1SEPA 1YVEI 3TZCA 3UUWA 1P1FA 3KUXA 1BSVA 3RVDA 1DRUA 3CE6A 1Y9EA 5KJ6A 3K73O 4TVOA 4WLOA 4ND2A 1JVSA 1ONPA 4YT4A 1J0XO 1AHIA 1GDHA 3FRJA 2RHCA 4CV3A 1XA0A 1OZAA 3UHAA 4CUJA 4I5GA 1D7OA 2GN4A 4WEOA 1WP4A 3HWRA 4JK3A 5IG2A 5JFOA 1FDVA 1GU7A 4LGVA 1Z73A 4TWRA 2HMSA 4IIVA 2XXBA
chains in the Genus database with same CATH superfamily
3WLHA 5JFGA 2Y0PA 1Q0PA 4YHBA 3LF2A 3U60B 5YASA 5AI5A 3RSHA 1RJ9B 2GO7A 4ARZA 1V37A 3E5HA 3OZGA 2UXBB 1MB3A 1N8KA 3QEJA 4G8BA 4B0OA 1RYMA 1DG3A 2F62A 1T2NA 4I50A 4WN9B 5IEBA 2B6HA 3RK0A 4Q9AA 1REQB 3RC3A 1G38A 4LRWA 4NYMR 3SS7X 5TT1A 1GU0A 1NN3A 2YXPX 1JEQA 3ZWKA 1PR0A 4W6QA 3HMQA 1ECPA 3GFQA 4Z9YA 5LJIA 1LVUA 2J9ZB 3CMCO 1H85A 3V9PA 2W00A 4A8JB 3H9QA 4M4SA 4A36A 1FDIA 1PJTA 1E66A 5E1DA 5L9AA 1C29B 3NCTA 3PR1A 2WVHA 1TJYA 3VHRA 3MS2A 3U39A 2O2CA 3RSLA 1A4XA 3NYRA 4W7IA 4OREX 3QF7A 3ZUGA 1AKVA 4HDKA 4IXTA 1IN8A 1VGRA 1HY3A 2ZYHA 1PV2A 2H2IA 3H9GA 4ZPXA 4CV2A 4F1JA 3B7WA 5KMGA 4A5OA 4Q34A 4QDZA 3BRQA 1X92A 1UC4B 2ATIA 2V7GA 1P19A 1GNQA 2TMGA 1XZQA 4B48A 1XUOA 3CVOA 1DC6A 1LBTA 1LGYA 3L8DA 3I8SA 3PJEA 4MP6A 3PD1A 4JH0A 3BJZA 5JAHA 4KGDA 4MVJE 5LB4A 2HC9A 3BWEA 4C3OB 4RH1A 4UARA 4L2IA 4N3GA 3TIIA 2YW2A 1H4TA 3KQHA 4XW2A 4KC0A 4ZKEA 4RV5A 2YQ4A 1RJGA 1ZH0A 3JQQA 5JSHA 1PGJA 1ELOA 1JIIA 2X42A 3HBLA 3M9WA 4FINA 3RVKA 2GNAA 1JYSA 1IHOA 4LDAA 3V7NA 5ITWA 5LOVB 2LGJA 5F9FA 5E2BA 4INZA 4RA9B 2DT8A 2HSWA 3LWDA 4IFIA 4C0QC 1NXWA 1UDCA 4FGKA 4A27A 2QPLA 2WKWA 4JB3A 1W6RA 2RAFA 1B23P 1BWSA 4JNKA 4Q19A 2JI8A 5I9MA 1U5BB 4XPIA 2OGUA 1LI7A 3DXXA 5K8UA 5IVHA 1QRRA 3HI6A 3SICE 4YCJA 3G2NA 1L9KA 1CG6A 1OMOA 4AG3A 1BDMA 3GT4A 4M1MA 4RVOA 3M3DA 2JLUA 5DLYA 3P27A 3GRUA 1YCDA 1BFKA 2XWPA 1G18A 3LX8A 3E22B 3JQ8B 5FD8A 4AC9A 3ZTTA 1I10A 1XCLA 3CCFA 2Y05A 2ZYGA 4NSNA 2A0XA 3LUFA 4Z6KA 2I2DA 1TO2E 2D4AA 2E48A 3BERA 3ND9A 2YIJA 1Q3HA 3BH6A 1ZPDA 1X14A 2YN4A 3EGXB 4JP8A 5F33A 5FL7D 3W6OA 2XCQA 4KIFA 4MHOA 2HB6A 4PBTA 3WL5A 3AFGA 2J6BA 2OV4A 1BW9A 2FOIA 1E4YA 4KW7A 2WHPB 3ESQA 3R0QA 1IG0A 2BWJA 5KYVA 4PIMA 1SUBA 2FFAA 3MAJA 4NMMA 5CJPA 4G0NA 1SXIA 4X8OA 3USZA 4YYEA 4KV9A 2A9PA 2BKUA 5BSEA 1B42A 1T0PA 1XMXA 1JP7A 3EIOA 5JTTA 1XNGA 2PHZA 4FFMA 4ZV9A 3DE2X 1LBEA 5DCUA 4N8DA 2O8CB 2VRWA 4AK9A 3P2OA 1LUAA 1KEUA 1DPFA 1OI2A 2Q1UA 3BIXA 4C0XA 3LUJA 1AG9A 1OU4A 2GZRA 3RGWS 4MQMA 3H2GA 1TZMA 4QC2A 3UMRA 4MROA 1OE0A 1BAPA 5FUBA 1JPNA 2L82A 3FPAA 2PXHA 3SYKA 4C87A 4Z4QA 2JIOA 3IRVA 3UM9A 1TAUA 5LD2B 2ECPA 3FOCA 3JYLA 3O9MA 3G6KA 3RK1A 1WMAA 1UMDA 2ONZA 2XBUA 4BO6A 3PRYA 4WK0B 4E14A 2AMLA 4XJVA 4CDMA 5KSOA 1LJLA 4AJKA 3DT9A 4W5NA 5AHWA 3B5IA 4MUBA 3NHYA 2PQ0A 2BSXA 1QVZA 2RHJA 3I30X 2O8NA 5HFJA 3TLCA 4AROA 4QKQA 1XZBA 4MQ5A 4ARAA 4BAUA 1T5BA 2VVTA 2VZEA 1CEEA 4OL9A 3SQLA 5SZIA 1RYZA 4U39A 1E0SA 5AI6A 3KS9A 1BYUA 2O6HA 1GPWB 5IDYA 4C5BA 4D80A 2CFIA 1L0BA 1ZD1A 2P90A 4JQZA 4MJ3A 4YJ3A 2Q21A 4MTLA 2JCVA 3WGOA 1D8TA 2PYDA 4FLFA 3NPAA 4DMRA 2OG2A 3DLIA 3PSHA 4X20A 5H0IA 5GOTA 4Q1DA 3R9KA 3UJ8A 2VT6A 4CQMB 2AJTA 3JQGB 1JDJA 4W9RA 1SOUA 4XIIA 1E3JA 1BXRA 4X61A 1E8NA 5JWHA 1WU8A 3VO1A 5KCZA 4GRDA 5COQA 2BP7A 1IXSB 2ZRQA 2QQGA 3FXAA 1UBUS 4PWYA 2PJZA 1L5QA 2BT4A 2GJAA 2LCFA 1QGOA 3LYAA 4K81B 3SSNA 4R1PA 3DOCA 4XRRA 2Q5LA 3UKOA 4V2IA 1XQWA 2IOFA 2OXRA 5D7BA 5EGSA 2Q4EA 5EPEA 1QHGA 4KMRA 1C7ZA 4X1YA 1QVAA 3MMPA 1I3OA 4JJZA 1TGVA 1WG8A 4M8SA 1QSGA 4O2AB 4AB1A 4YUXA 4QYMA 3LVBA 2NV2B 5AM5A 5EYPA 2MDTA 1JSRA 3UH0A 1O54A 4BFTA 2VJBA 1DBRA 1P33A 1OB2A 5L3SA 3UMFA 2QJTA 4IDGA 4ZXFA 2UVPA 3IV7A 4REQB 2FR0A 2C7OA 2Q5IA 1GCUA 2VJQA 1JA1A 1H3NA 1SHTX 3D4NA 4OJQA 4R1SA 1EP1B 1MX1A 1G7SA 1AKMA 2XSZA 3RCBA 1T5OA 3WIDA 2NZUG 4EPRA 3SYNA 4PLVA 1XJ0A 1PCXA 4U6SA 4EIWA 3A4YA 3VYRB 5A4DA 5AVUA 1P0MA 2ZUUA 1P29A 4FOLA 1ADFA 1IN5A 1S2DA 3S2EA 2ZUBA 5BWCA 5FTJA 4EUKA 3GROA 1DUVG 1FX0B 3FLBA 4KXYA 2GHIA 4E31A 2VYVA 3TQCA 1BH6A 5JXIA 3U3XA 3OCCA 1X15A 1GDDA 4WNAA 4AMBA 2JLQA 5K0BA 4G81A 4U0KA 2P2DA 1F0NA 1LNQA 2E5FA 4DDUA 4YMTA 1M2FA 2ZYIA 4EY7A 5F5NA 4PCAA 5JO9A 3FPBA 2GERA 3F5MA 2YZMA 3AVPA 1EG2A 4E4RA 4X92A 3SP1A 4EYKA 5KDOA 2B34A 1VG0B 1SQSA 2J33A 3GOQA 2ZYSA 1GFSA 5DP2A 2KMLA 4HS9A 1PL6A 4KX3A 2XCRB 2NTEA 1NNUA 1PK8A 3IDFA 1T0HB 3SJUA 1GL3A 5KX5A 3U7RA 4P0QB 4YCSA 3FDFA 3LP6A 4H7DA 3OOHA 5HKOA 1E99A 2FZ5A 4OGLA 2GYWA 1WV1A 5D3QA 1E2BA 1F60A 1KDVA 4DG5A 3ZGVA 3LHIA 1E1CA 2YWBA 3CO5A 1VDZA 4J0DA 1MN6A 3O8OA 1UBCA 4LHYA 1QRDA 3VJMA 4D8TA 4DQUA 2FRVA 2R8RA 4QGAA 1S5PA 1NOIA 1MT0A 5JH7B 2DFPA 1NNEA 2LXNA 2Q7DA 4IFEA 4P86A 1JA9A 4AMYA 2BKAA 4RDIA 1FYXA 3S2UA 5C81A 1H8ED 3WP0A 4DYHA 1K6IA 3GMTA 4RHTA 3G1TA 1DKNA 3CKMA 4R1TA 2ZBEA 1TFRA 3ILXA 2I99A 2FWBA 2VJCA 3A6ZA 4HX9A 3TX6A 4LYYA 4U3JB 4RELA 4YN3A 4PC3A 5FBLB 4Y18A 3DNPA 3GELA 2G9UA 4WOBA 3MBIA 3OBIA 2YJ5A 2WFAA 3W06A 4F97A 4W5WA 3UPUA 1R8YA 2PR2A 3EGEA 3B7PA 3K09A 3LT1A 4GZ3A 4XZ3A 3D7LA 4PEVA 5AQEA 2H0RA 2JAUA 1NJFA 1E7RA 1Y6RA 16PKA 4WDRA 4PAOA 1FUKA 3IPAA 2BCGY 5DIFA 3SF0A 1NM5A 2JFXA 2HX1A 4AW9A 1E20A 3L7LA 2F67A 4FP9A 4E13A 1SU4A 3D7MA 4H7HA 5BT8A 2NU6A 2II6A 3FE2A 2ZSAA 5F9MA 3TOVA 4MUHA 4QLBA 2XMDA 3IE0A 2FMIA 1TYAE 3N7TA 1AQ6A 1YACA 4K05A 4W8HA 2QNBA 3H5AA 5DGDA 3T38A 1TT5B 3C16C 1CUCA 5EP2A 1VI2A 4LN1A 4MW4A 1B16A 1RCTE 3WGQA 2IHTA 2N3ZA 4HOYA 3H5WA 4XDZA 1U0FA 4Y6RA 5IUJC 1S9HA 1Q6YA 3C43A 3EWAA 3M0EA 4DLLA 4F9FA 1DDIA 5KWJA 1GRRA 5JSUA 2A78A 3DZCA 2OXEA 1K2WA 3QK7A 2JHPA 2CDBA 2HBRA 5EC8A 2MU1A 3T0IA 2RIPA 3PVSA 5FADA 3UWSA 5IDXA 1MX9A 1NW9B 2ZIAA 3IEXA 4HYQA 4PPQA 5CYGA 2Z8YM 3LUCA 4KO4S 4I4TF 4CG2A 2IPAB 1EI9A 2H4JA 3SF8A 3PPXA 4WW0A 1ZD5A 5KQSA 4BNKA 1P5ZB 4UDXX 3KV1A 1NUUA 2O8BB 1GYPA 2OKCA 2GN2A 4KO3S 3H2KA 3VNUA 5B3AA 4N54A 2X9GA 4IIJF 4AULA 2NXCA 5HIJA 4UQOA 1EX1A 4AY4A 2OL4A 1Q1EA 2CSUA 2CVOA 2P91A 2PL9A 3QQ5A 2DWPA 5KZMB 3X0DA 1FLVA 2A84A 1U7TA 2P9GA 5K3FA 2X1VA 2GHTA 4G85A 1QVWA 3P32A 5DGCA 4G1MB 3QA3E 2WHRA 4B6SA 3I39X 4AQ7A 2RHOA 5F21A 3SLKA 3DHEA 3GLIE 4FFOA 3FW1A 1QGYA 4U8HA 5LIPA 1ZLXA 4KO1S 5HWSA 1ONOA 4MWBA 4GPBA 3P9IA 3VR1A 4G63A 1RCUA 2YXLA 2FSGA 3IVXA 5J9FA 2XUOA 3ENQA 2VHVA 2Q6VA 5FIUA 2MINA 3OD5A 2VXYA 1FPMA 1FS4A 3LQYA 1QHHA 3P2EA 4KQIA 3ZK9A 3ZS8A 2IODA 1Y1KE 4Z7JA 4P4SA 3H1PA 5IS2A 1J7JA 2QX8A 5EQTA 2IRWA 1W4CA 4FEEA 1QZTA 3T3NA 3GHHA 2JBHA 4RENA 4S05A 4ZT7A 2FN3A 1K9SA 1RIFA 3G0DA 1UBEA 2PH5A 2ZRAA 3FZYA 2G4CA 3I5UA 3ECSA 4PC6A 4B45A 4EB8A 4F3NA 2GI4A 4X6YA 1LPBB 1JWLA 5I47A 4AKHA 1DADA 2R84A 3FDZB 1SCJA 4ICIA 4ZYUA 1GU1A 3REQA 1UK9A 1KH3A 1NUHA 4P2GA 2BTEA 1GTL1 1N0HA 2PZEA 4ZRDA 1L7NA 5FQNA 2GS9A 1GKYA 3F5DA 4LXXA 4QRIA 1CZNA 3SYRA 3O8CA 2R8XA 3KTOA 4DIMA 5EXXA 3NX4A 4OY3A 1Y4SA 2JHAA 3L8CA 2IEBA 2G1PA 4YXWD 1AK2A 4X85A 1PJZA 2QK4A 4LZAA 3RG8A 3CNBA 4B8YA 4BWFB 1N2GA 2NVOA 2OQRA 1JQKA 4UCWA 3VAYA 2XA1A 2V8BA 1QFMA 3DS8A 4Y2QA 4M99A 5CD1A 1KDRA 2X22A 3QQPA 4WZZA 1XQVA 2L69A 1TKBA 4YJGA 4ESHA 2R68A 1OXMA 1ZGHA 1W5EA 2QU8A 3E9YA 3RRYA 4EF5A 1JR4A 3G8CA 5AICA 1II9A 3AHGA 3CWQA 1R0XA 3LT2A 5CB4A 3CZQA 5CGZA 4DA9A 2Z6UA 1B14A 3T9CA 4LOAA 1L4UA 1T8UA 3A3KA 3AV3A 3IPLA 3Q5DA 5HMLA 4BNVA 5LDDC 2UUPA 2O23A 3M5WA 4DQ0A 3RIMA 4CNBA 3DC2A 4D8WA 1H0SA 2XOEA 3D2BA 5DGTA 1Z06A 4E5YA 2DETA 4BPBA 1VJRA 2JFZA 1T5TA 1TTHA 1DDOA 3JZIA 2P8SA 5K03A 5LQDA 3BQNB 2BGRA 1E1LA 4XTCS 3T5GA 3VQTA 3N2EA 1ZHHA 3I37X 2QD4A 3BMCB 4MUNA 3UJ9A 3NB0A 4JFRA 1FXUA 1WLSA 2YXBA 3K1YA 1Z0IA 4O2RA 4Q00A 1R8SA 4G26A 3LUBA 4UPVA 2TMDA 3FWHA 1YC5A 1HYEA 1LBSA 3I4LA 4BV2A 1FYEA 1NFFA 1EBFA 4WBSA 1XAJA 2HBYA 5DMXA 1N1GA 2C78A 1SPBS 3HYCA 3FCYA 2XDQA 3CLUD 2BZ1A 4QUKA 2W8BB 4RS4A 3FIJA 4B34A 2LIVA 4JQSA 2GXUA 4KQ1A 1H6BA 2QN6A 1UQRA 2HRQA 1CUAA 5T7BA 4CL0A 2W71A 5DNYB 3QYFA 4DM3A 1SVNA 5C51B 3I09A 3QVVA 1NI4A 3C24A 4TT3A 2J8ZA 3MUOA 4L9WA 3OKAA 4QU5A 4UFPA 2YN0A 2ZIGA 2V1UA 2PMEA 3NC1C 1DG1G 1ENZA 2DHCA 3GFOA 3PP8A 3Q7EA 2P1ZA 3KAQA 4R1OA 4BKQA 3W4IA 5HKKD 3HFRA 4HDOB 3BGWA 3FVVA 3P0EA 4GP9A 4M38A 3V2GA 4E2XA 5B12A 5J4LA 2V0GA 1F8YA 2A2ZA 2FQWA 3V1UA 2D5LA 3R0ZA 5LCXA 1ZMXA 4C14A 3UXMA 1JH9A 4D57A 2PO7A 4UEKA 3FM9A 1FQKA 4QFMA 3Q7PA 3WMEA 3ELUA 4PZPA 3GX1A 2V6GA 1I0IA 4DLVA 1CZLA 1E64A 2VP5A 1VPTA 2WIFA 2ZJ7A 2PKWA 4WBNB 4EENA 4QHYA 4XWTA 5EZQA 3WC4A 5A5VA 3LUHA 3R3WA 3ONVA 3K70D 3OZSA 3MOSA 2UUAB 3WA7A 3T9FA 1D6MA 5EIFA 3HSYA 4AUMA 1EVKA 2ZVJA 3AG5A 1Q17A 3CU5A 4K9OA 1WHSB 4KTVE 5EUMA 2VDWB 1XWFA 3PD7A 4MA0A 4X1IB 3NMUF 2CLSA 1PTJC 4YIHA 1OB5A 3C8DA 1O87A 2V1XA 4NCNA 2HV8A 1DBQA 3ZV6A 1OI4A 4DQLA 2BF4A 4OJMX 5FTMA 4E4TA 2CE2X 4YLEA 3U7FB 1KYYA 2JVJA 3TLBA 3AK4A 1D0VA 2C3OA 4I50F 1QZZA 5F1OA 4TUYA 2PL1A 3VR4H 5A0VA 1KZYC 1Q2UA 1BX3A 3TSWA 1DEAA 1QUFA 2YOGA 1YA4A 3OM8A 1U8ZA 4NEHB 2WJYA 4P7BA 3WLIA 1RQPA 3K9CA 2GZ1A 3ESCA 3PJGA 1BVHA 1XB2A 2CHFA 4TLEA 1XZAA 2P1DA 4JUDX 1GQ2A 1YB5A 3OLXA 5C9ZA 1GOTA 2GRAA 2JGLA 4PNEA 2CT8A 4ZI7F 4CM3A 4IMRA 4MPDA 2A0KA 3HVRA 3HU2A 2DUJA 4YLGA 2R00A 4V39A 2D62A 4LVNA 2FUCA 3KFVA 2HLHA 2V4MA 1I4EB 4KB5A 4TXMA 4EP1A 3PLAE 5FBQB 3BA6A 3AJAA 4BIIA 1U2EA 4E4YA 4HV4A 4ZO7A 4KUEA 1GGEA 1DQNA 1F6DA 2BMVA 2JVIA 3K1ZA 3UF0A 4BX9A 4FIZA 3SY8A 1PR9A 3TTXA 1TIPA 1TM1E 2ZVDA 3FNRA 4PZ0A 5B30A 3PZRA 3U40A 1JSCA 4AU1A 3RR2A 5ITZA 4PVDA 1FYWA 1OVMA 3ET4A 3KCQA 4HT3B 3OICA 1KZ9A 5EE1A 3GCZA 3TE7A 4J90A 1J90A 1J39A 1YZVA 1GFZA 3WGTA 1DKOA 2AWNA 4MGEA 3ICVA 3I01A 4MLDA 4J1NA 3LO8A 3ZR4B 1CRQA 4F4HA 5HXAA 4EUEA 2GCEA 1UQUA 3CTMA 3H6HA 3QXSA 4FJ0A 3EIXA 3THYB 1Q20A 3KSMA 2BBTA 5DVZA 1BXKA 2W9XA 4EI2A 2IS4A 3JALA 1PEKE 2GK4A 3H2ZA 1J0EA 3EC7A 1DC7A 1POXA 3LZCA 5DCWA 3SQXA 3B8HA 3A31A 1I4DD 1XDZA 4YP7A 1NUTA 1EDBA 1NBOA 3GPIA 1OROA 2AKAB 2MR6A 1CNMA 3JQDA 4I5EA 4Z2AA 2R8OA 1XWIA 5MN6A 1NX9A 2YV5A 2FPUA 2H2AA 3LFHA 4LZWA 4G8DA 5EQDA 5H9WA 2IXGA 1A9RA 3E84A 3LMKA 3NXKA 1UBKS 1D2RA 2E21A 5IM5A 1W4AA 1RPNA 4Y30A 2O5CA 2EYUA 2IYNA 1SHUX 4I1SA 4RFSA 3C45A 4D0SA 5EPOA 2EZ4A 2HXYA 4MPJA 5KQRA 3IODA 4IWXA 1YGPA 1NKTA 4LISA 2HSZA 2HNAA 3F46A 1V9SA 4P4LA 1KZ4A 4ARVA 6ABPA 3GA0A 4JGGA 4R9VA 2HT6A 2QR5A 4JN6B 5L45A 1WF6A 1QJ4A 5HFAA 1SHZA 4II3A 3W1VA 1TTPB 2ZXFA 2PUBA 1XX6A 2ZTMA 1PFVA 4YJHB 2X0EA 2HF8A 5C31A 1DJLA 3ZE0B 2BFDB 1H69A 1QZXA 1YQDA 3F8WA 1YS6A 3BE8A 1VJ5A 3GLTA 1RI3A 4FHFA 3EG9B 4LPSA 1WMFA 4NECA 2IXFA 4KFUA 3HP4A 4XOIA 1S3SA 4XJTA 4EJMA 1SRRA 1KSFX 1Z36A 3RT9A 2UUCB 1CZRA 4LZJA 1MX5A 4DRZA 2XXAB 2VCHA 2ZVQX 4H7JA 4QULA 3W9UA 1TVKA 4OFXA 3PEWA 2CB9A 1B43A 1FDOA 2CVPA 5BN5A 1OJ7A 3HYTA 5CLHA 3D3WB 1NF9A 4IIFA 4NE2A 4UBIA 3RJ5A 1AMOA 4NZMA 4HSEA 1UZMA 1RBYA 3AJRA 3T7RA 4L72A 4XB1A 1PBTA 1VJCA 2ZJBA 3EHDA 2DCMA 1CFZA 3U37A 5SZJA 3VYTB 4ANFA 5JJBA 1EFRD 1QS0B 3I5XA 4D6XA 5KOJA 3RRZA 1IL0A 1JYEA 5GP1A 2Z2JA 4D3FA 1G8MA 1VL0A 1YR3A 1KZGB 1BMFA 1NGSA 2PS0A 4K28A 4LSWA 1KQNA 4JVMA 1KKMA 1XZ8A 2WFLA 4OUDB 1CVIA 3N53A 9LDTA 1EFTA 1T4MA 3SDZA 1E5DA 1GZVA 3MXOA 3CUSA 2VUUA 4C29A 5A06A 2JK0A 4CL8A 1EXNA 1OGJA 3E23A 4Q4DA 3UJHA 3WYCA 3PWTA 3T4EA 4KVAA 3OT4A 1Q5PA 5EG5A 4RTMA 2PS1A 2B8JA 3V1MA 3IJ5A 2D06A 3PCRB 3GPBA 2ZT5A 3G6WA 4XPIB 5HJ2A 1X94A 2IHVA 2V7WA 1Q7GA 3N07A 2RH4A 4GMHA 3RUPA 3IP8A 1WDTA 3PV0A 4AXXA 4MI9A 4N7BA 1RD4A 2KSQA 4P34A 4X8LA 4W5TA 1H3FA 3DAFA 3UK0A 1V2GA 1YFJA 2IEIA 5LXTF 4HZIA 5FOWA 2OD7A 4Y1FA 1PG2A 3HCNA 3GL9A 4MYCA 1KY4A 2IQ5A 3KELA 3KL2A 3ZNQA 4AY3A 2XYPA 4KPGA 5REQA 4BS9A 1E69A 2P9ZA 2ZR7A 2A0YA 1PUXA 3KAKA 3RPEA 4S1NA 1M6EX 1LPNA 2Q8QA 4GOLD 1HOTA 2OOSA 3DDSA 3T1YB 3B1VA 5CH5A 3BSWA 3H9UA 1TJ5A 3OX4A 5ESRA 1CF2O 1HRDA 2N42A 1CQWA 2I1VB 1HT3A 2NVWA 2Q2OA 3DCJA 3JD1A 4I6JA 5C2JB 5IYZF 5CNIA 2Q0QA 5GV8A 2L42A 1JLLA 3HCAA 1UXJA 2EG5A 1BWQA 3SYLA 5JATA 3ZU5A 4TWBA 2Y1GA 3FGOA 2F8LA 3B6ZA 3E5MA 3NDPA 2OFWA 4B3SB 1UZAA 2JRCA 4MV7A 4GZLA 1K1EA 2VRNA 3AM1A 3DAPA 5CCEA 2AG5A 3BIWA 2JBWA 1TQ4A 1CQXA 1QP8A 4YO7A 3ROZA 3AH8A 2OCPA 1VKRA 4V0NA 3A9WA 1CY2A 1H8HA 5JEDA 3BK2A 1XT6A 1YONA 3L77A 2X9QA 5I9NA 1SQ5A 3GGPA 4P7JA 4X1KB 3HRHA 3DO8A 2H2FA 4JC8A 5KX5F 1CLEA 1VG8A 2QX4A 2FV8A 3Q7RA 3HUUA 1EZZA 2OGTA 3Q9NA 3JASB 3KB2A 3Q3HA 4HDMB 2F8SA 3L4BC 5JJLA 1W2HA 1GO2A 3BK7A 4U7WA 4OPMA 5AVOA 4R0NA 2HWWA 4IUCS 2E82A 1Q0LA 2D2XA 3DT6A 4DCPA 2I33A 2UYGA 2BCJQ 3AEKB 4Q7JB 4V3CA 4B8ZA 3GP8A 4JV5B 2H65A 3AETA 4LWOA 4J49A 3B89A 4GFDA 3PQ5A 4QSHA 5K20A 1P6XA 3W0LB 3DOOA 2EF1A 4TLCA 3RQSA 3B36A 1PG5A 4S1WA 4HS4A 3ZDDA 1MOPA 2IDZA 2CXPA 1NT4A 5JE8A 4N0QA 2J5XA 3GLIB 4M6WA 1PR3A 1AN0A 1E0KA 2C03A 2X0JA 2ZG6A 1YQTA 3U4CA 3QE4A 2PL5A 1O6GA 2Z3ZA 2PYZA 4WESA 1PTKA 5AXAA 3Q8MA 3OZIA 5U4XA 1H94A 3GQVA 2WUEA 4PTLA 3QOFA 4U9UA 1RXCA 3QELB 5DM2A 1F12A 4EG7A 1CEYA 1PZHA 2AYXA 1O1YA 3GUCA 3LKDA 1ECBA 1DRJA 1V35A 1YU6A 3V4ZA 1KMNA 1CUYA 3ESBA 4HQOA 5B3JC 3GRRA 2C4TA 1KK2A 2JKVA 4LJ8A 1K7XB 1QFJA 4IWNA 2HA3A 3IHWA 4Q82A 3PJDA 5JXJA 4Z0TA 3FUVA 1A97A 1PTJA 3AY7A 1U1DA 3R3YA 4MI3A 4BDTA 3PC7A 4NRDA 2HU8A 4ZDJA 3G5MA 5KTNA 1UWCA 6REQA 1JALA 2CXRA 4FWIB 1KFJB 3LK7A 4HZUB 4WGGA 4MCIA 2WA1A 2J0QA 3CW2A 3OKPA 2CSXA 4NENB 4P4GA 1VHLA 2QGZA 3QNUA 4JL5A 3KR9A 4ZEXA 4X41A 5DOZA 4Q66C 4NOLA 4FYHA 1WUIS 2X5KO 1MENA 2Y76A 4IIGA 1PWXA 2EBUA 3ZXIA 4M8LA 3TR0A 4CTMA 3EYWA 5EHZA 3PVZA 2JFBA 3RW9A 1QHYA 4EZEA 3SM9A 3PX7A 3K0AB 4S2EA 3PHBE 1LTHR 2I0FA 2XTAA 1NMZA 3B3AA 5A7HA 1DU4A 1GUYA 3TFOA 4JXXA 3SNHA 4OHWA 4TSRA 1MH9A 3HJTA 3O3OB 5LA6F 3NHZA 4ZOLB 4AL4A 4ER5A 2YJGA 5FL7A 4M1QA 3RC8A 1QH8B 1FY2A 1QNLA 4ITVA 1XTPA 4MWZA 2BKVA 5G0SA 4D0RA 5K2OA 1EM8B 4D7AA 5AVXA 4W5QA 4CT5A 1DKLA 5I01A 2JI7A 5IT5A 1Y1TA 1NZFA 1HQKA 3D3JA 3F97A 3JRXA 3KJFA 1GSAA 3M6LA 4UE2A 3HKCA 6CHYA 4BIMA 2IL1A 2XIQA 1ETHA 1N0VC 3T5PA 3HKEA 3G7UA 3JAKA 2UZ3A 4GBGA 2C4VA 4KZPA 4L8YA 4EKGA 2AEFA 5BWLA 2OOKA 1C0LA 2FPSA 2REOA 4CKWA 1KQPA 2PT7A 3PQ6A 1EB8A 4EHIA 2IBTA 2QW8A 1SKMA 1TW3A 1JKFA 4YAIA 1LVGA 1H65A 4KAJA 4CV1A 1DQZA 3H84A 4HDAA 4M1YA 4BU1A 5AW7A 5LMCA 4XIGS 2ZM6B 1WB9A 3ROQA 3M2TA 4OHVA 2G5TA 3DTTA 1ZS9A 3UOWA 1QVRA 5HZHA 3G2IA 1UF9A 2BLLA 2BZGA 2ORVA 2VPPA 3PGMA 4S12A 1O5OA 4BX2A 3OE5A 1M33A 3PDIA 5A4KA 2YMLA 2XZDA 2IH5A 3K1AA 5G4KB 1OAOC 3E27A 3I2HA 2YYZA 1KC1A 4DV7B 1FVOA 3CF4G 4P83A 4RYLA 1RJEA 3AR5A 4UD2A 3NFYA 1JPJA 2H9IA 1XE3A 2UAGA 1SN7A 3DUWA 3FMGA 4RABA 4TRNA 1E0JA 3OMXA 3ZLBA 3BMXA 2YNMD 1GPNA 3ZHBA 3D6HA 3IEUA 3PL5A 3WDSA 2GLXA 2Y3IA 3CV3A 1X3LA 2JHGA 3X2SA 1QLWA 3A1CA 3C48A 4H31A 3NYWA 4MUFA 4ZP1A 5EWJB 4B7AA 4LOKA 3WLLA 1ZVKA 1W35A 2HJVA 1NI3A 2E4WA 1HRKA 4IM7A 4NPCA 1LJUA 4CKCA 5I8ZA 2W5UA 5FV4A 3W8DA 3TSYA 1K89A 2EHJA 4MW0A 3WIEA 1KC3A 2O2IA 3A32A 4KXWA 4U2FA 4ZOCA 1YXMA 1VCOA 4L0MA 3VRHA 4QOSA 5EJMA 1IPHA 2CLDX 3WQBA 1R27A 3FLMA 1EK6A 3CLUC 4IQFA 1ZN9A 2WJHA 4DWJA 1W9MA 2R96A 3GEMA 2WUDA 3M1YA 3IHLA 3Q85A 4YJKA 4D9BA 3FI9A 1JKJB 2H2HA 2C4NA 3E18A 5HYVA 3EJ6A 1SHKA 2REQA 2I4NA 5JVDA 2NUPA 1JG1A 2QTZA 1X1DA 4EEZA 3PITA 3BB3A 2XCLA 4D96A 1GZ3A 1F2TA 1QHSA 2XHZA 3IQEA 3R5KA 1HDXA 1LTKA 1XNQB 5B1YA 4FCTA 4MDHA 2IEYA 4R2WA 1E4EA 2XNSA 3ENKA 5DX0A 2G08A 3OIGA 4JROA 3ZVMA 3OQVA 4J0QA 2WD7A 4AS3A 3IUMA 3OSZA 3MLBA 2AUNA 5AYVA 3D0QA 5IVIA 1FU7A 5M34A 1JN0A 2XUQA 4WLUA 2QT1A 1ZNQO 5BNFA 3CRNA 4DLPA 4EGCB 3GP3A 3I1JA 3AOGA 1NHWA 3AF5A 3C8ZA 3EBPA 2H4HA 3JSXA 4MWGA 4FFSA 2HZ7A 3TECE 3SWWA 1PJ4A 3VTAA 4KO2S 4Q4AB 1NX6A 5ESWA 2VDLB 2AHRA 2W98A 3NGLA 4I0WB 2RHDA 3A7EA 5IEJA 1NJ6A 1J33A 3K2IA 5EKSA 3I6ZA 4EW6A 3MMXA 2W2LA 3AFNA 1QHXA 1G6Q1 3NANA 4M36A 1EFPA 3EVBA 1EFVA 4JKYA 3NASA 1RSZA 1FNCA 4EY6A 3BKXA 5I7OA 1Z17A 2Y2VA 3HS3A 3OF3A 4JIMA 4K6HA 4CKEB 4DDTA 4PXAA 1K8RA 2I22A 4KXUA 1C9EA 1QCZA 1QUEA 1ODTC 2VSYA 4LOLA 3F71A 5DI3A 1NW6A 2JFWA 4U2EA 3VKHA 1NR1A 4FOOA 1LSUA 4WE3A 2X8JB 4OGGA 3U81A 5ALDA 5GZ1A 3O6VA 1MTOA 3OQJA 1N5MA 1H8EA 3KKOA 3F4KA 1AHPA 2WUGA 3BJEA 3FHCB 3GZNB 2OZPA 2X1HA 1UBMS 2Y1CA 3A9RA 3K9BA 4R0MA 5BXYA 3ASVA 3BBLA 3HL0A 3ZX5A 5EIEA 3FSEA 4ALIA 2WZCA 4XVHA 1KOJA 1SBNE 3WK9A 5U1PA 3O1HB 3PNLA 4BQRA 3W5CA 3EIEA 3I64A 3IEMA 2R1UA 3VNBA 2E3JA 2JEOA 2Y4OA 3GHYA 3ZD8A 3AL3A 3GBVA 1P7VA 1WJGA 2H59A 2PKYX 1YJ8A 2ZAMA 3M7IA 4B4UA 3MINB 1ZUWA 2FPPA 4AKSA 2YFHA 4QNMA 4CR7A 2OCDA 1TYZA 5A05A 2AD5A 3PHGA 1GPBA 1Z0JA 3HM2A 3LBHA 5BR4A 4HK4A 2IHYA 2IOQA 4R6XA 1PT9A 4P31A 1N0WA 3H5OA 4DCUA 2NAPA 4PSVA 4R81A 4ZJYA 2UYHA 3B60A 3L4BA 4RVSA 3T12A 1MZPA 2PJRA 1RC1A 3EIFA 4EELA 5K5EA 2IH4A 1YTUA 1URPA 2GO1A 1SCQA 2BAGA 4D3SA 2WYHA 1JEYB 3A36A 3WWEA 4BVHA 3QBDA 4TUYF 3R0VA 5DHQA 5C1BA 4LWZA 3DSRA 2QMUA 3IB3A 5AJVB 5E0OA 4P5PA 1B6RA 4P82A 5GONA 5IAKA 1ISRA 1ECFA 1VLLA 4YWJA 4Q3LA 1N2CE 3QKSB 4C7KA 2FFRA 2OBNA 1CDZA 1UT5A 3PBKA 4K9SA 4PNHA 3TOSA 4DREA 3AF4A 2R48A 1ACJA 4FZ5A 2PX5A 2RIRA 2Y0EA 5DGIA 3HSSA 5KCMA 3ZJTA 1C41A 2Q5JA 2XIJA 3K30A 3R5FA 5IASA 5ABPA 2VUIB 3QVTA 1U9IC 4OQ4A 3PK0A 3PFBA 1YDWA 5CT6A 3EZ6A 4UBJA 3RKSA 4K87A 5H4GA 1H1LB 2WAMA 4WXHA 1AZLA 1R6BX 2ZJ4A 3GRYA 5KWSA 3H97A 1CHNA 1HE5A 3NUZA 4DV6B 1E94E 1V1JA 2QMEA 2PCLA 3EZ7A 1WB6A 2VSFA 3DMFA 5B3JA 5GPBA 3PT5A 5SY9A 4CQMD 2WJ4A 1JR6A 1P7PA 1W5AA 2BPOA 3KDPA 1QX3A 4G4IA 2B5WA 3OOJA 4KLRA 1KVUA 1TZJA 5ICSA 1JA0A 2ZE6A 2R62A 3ROKA 1XNHA 4E1BA 3ENNA 3MTAA 4YROA 4F6RB 2X7JA 2VLIA 2QVYX 3HNOA 1BRMA 1IE3A 2EX1A 3STUA 2CV1A 3NQ41 4YT2A 2NU8A 3OIYA 2TSYB 1MU0A 4LOIA 4MKIA 5LBUA 4AMUA 1SUIA 1Q19A 5MF6A 3NC0C 1Y98A 4HUJA 3W90A 3IPCA 1XZFA 1EEHA 4HKTA 5EP3A 3OECA 3DF7A 4PRKA 2FF5A 4UTNA 2WLTA 1ZZGA 2F8TA 2ACKA 2QZSA 2XTZA 1PL0A 3V34A 3UAOA 4QIHA 4EITA 3WY9A 3KEMA 1WBJB 3KPYA 1I4LD 3ETCA 2XAUA 5AI8A 1N6HA 2XZPA 5JG7A 1GT91 1KBQA 4GZ6A 2SICE 1FC0A 4GW3A 3ZQKA 1DO8A 4K88A 4ALMA 2GOYA 2VNJA 1X38A 2G82A 4XQEA 2FE1A 3VPFA 1YR1A 3KIPA 1O9GA 4FFLA 3RROA 2J6IA 1YULA 2HRRA 2D5AA 1PL8A 2IA5A 2OM2A 3PYMA 1YZLA 2VL7A 2XMGA 5HM6A 5KREA 1G8GA 2YYYA 1ZJYA 5IULC 4D25A 3OFSA 3DEYX 3H0KA 3HO6A 1XDDA 4LZOA 4WBXC 3DLTA 2QSYA 3FMPB 3JQCA 3OFND 4HDRB 4DC0A 2XEXA 1G8YA 1QE5A 2C95A 2PEYA 3PA8A 1CCWA 2WICA 2PGDA 3H4IA 4ZODA 2FX2A 5B6JA 4C7BA 4OB7A 4WZAE 4UHFA 3EULA 4B2IA 1MKYA 1CUEA 4RXTA 1U8XX 3OPMA 3D3EA 2XF2A 2Q3JA 5AO9A 1P0CA 1OHHD 1PSDA 2RKWA 2VZ9A 4MS3B 4UNNA 4PAWA 4EHKA 3KQYA 3HK2A 1HMYA 2OGSA 1IRIA 5CLLA 3CYFA 4I1UA 5FOVA 1KS2A 3WB1A 3AHJA 1RYHA 4MAAA 5TNXA 4Z4FA 4B4KA 1HLDA 4LVCA 1OAOA 4EB3A 1HDYA 3BN3A 3WRYC 5INTA 3AHDA 2JH3A 4G4GA 2CL6X 4IEIA 1RLUA 1IG3A 2OECA 3RS7A 2Z2ZA 3F6YA 2DPMA 3OLVA 5DU2A 3K15A 4MQBA 1C5KA 3B78A 4C2BA 5TQ0A 1RZRD 4B3CA 1ZCFA 2R2GA 1S4MA 2BFCB 1RLIA 1UEIA 1KNQA 2B83A 3I6MA 1I1HA 3FCXA 3BAFA 3II6X 5J2TF 3SX4A 4EFLA 2BCEA 2J31A 2HL6A 1IOVA 3OI7A 3UANA 5FBHA 5TE9A 4IRUB 3D64A 4IVQA 4XM0A 3RU9A 4CR8A 2FPWA 5A3RA 6ADHA 2JGRA 5CAEA 4IUYA 1G7TA 1IHUA 3Q9UA 1KSJA 2TS1A 4M7RA 4RTOA 2CV0A 2R6JA 3Q2KA 2C7RA 1JWBB 3QRWA 1HA3A 1A27A 3HCFA 3PUKA 4L0DA 2I4MA 4KCGA 3NWJA 4F2DA 1TDJA 3VPGA 1E9VA 3EH2A 4RD1A 1TM3E 3WWOA 4HEHA 1PHRA 3MA0A 3OLQA 2ORIA 3ZGLA 1KOGA 1ZRNA 3EK2A 3KB1A 2V6BA 3ZHSA 5BSUA 5CDTA 3RVQA 5CFLA 5U4QA 2C04A 4PAMA 1SMKA 3C1UA 3E35A 4TLLB 4J9UE 3ZGXA 3I8OA 4MICA 4YS6A 2CJYA 1E2MA 1U0HC 3NEAA 3F1LA 4I4IA 5HF6A 1G59A 1LLQA 3HWX1 4QJ4A 1SC4A 1S96A 2HIMA 3WHLA 1RKXA 5IPFA 1J1ZA 3BDIA 1XCMA 1THZA 2FPXA 3RYHB 3TGWA 1PJCA 2DPXA 1Q95A 1EEXB 4UXHA 1SG9A 3UJ7A 3TNDA 4QWMA 5E3IA 3X3HA 2VHXA 1P2BA 3IX7A 1ZSVA 2VDJA 3HU5A 3ZJVA 5FOQA 3ON5A 5F77A 1AQJA 4LF6B 2I6UA 2XE6A 3KYCB 3EISA 3WHPA 4N0MA 1A5AB 1AE1A 1D2CA 3HN2A 1ZCJA 5JJCA 2BTQB 4MQ4A 2C61A 1DHRA 4TLDA 1E7YA 1UOPA 4LJ6A 1PV4A 3FFBA 3L4EA 3S99A 4UEOA 1JDUA 3RUIA 2W2VA 1EESA 3WP1B 2DM6A 1AXRA 3SJAA 1Z83A 2EFEB 1J97A 2YQ5A 3SKYA 3TOXA 2BSAA 2YASA 1FEZA 5EESA 4IEEA 4KFRA 1XZEA 3PR3A 5DXAA 4PR0A 1AKEA 1Q21A 2IYQA 2J4DA 3NONA 3ANMA 4LYHA 3TH5A 3W2TA 4MRSA 5JYBA 3V42A 2Z2IA 4V0MA 5AK3A 4Z9FA 3T7TA 3KQUA 1U9YA 3O9ZA 2JCYA 3GFBA 3BE6A 3QPAA 5BWBA 4A6PA 2F1IA 3GLGB 1PR1A 1OGYA 4KO8A 2XKAA 5EE0A 3OQPA 3MB5A 1QBGA 2JIDA 2VDPB 4XH9B 3G85A 5BQ5A 1L5GB 3G3EA 2PE5A 3HBJA 3PEYA 4FKBA 5E6RA 2BJVA 3OLYA 4IIYA 1BHO1 4W82A 2G17A 2FRXA 2H0AA