4Z0TA

Crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
IDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis.
rcsb
source organism Brucella ovis
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short-chain dehydrogenase/reductase family
total genus 89
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z0tA00
4ZQFA 2C5EA 1HDXA 3E6AA 5IZCC 2HRZA 1O8CA 3MOIA 4WECA 4J2OA 1DRUA 4MIOA 3KSDO 5AXCA 4L0QA 4ALIA 4BNZA 3OJOA 4BVAA 4A03A 3WJAA 1SNYA 2HQ1A 3RQSA 5JS6A 5JCJD 4XKJA 3JQAB 8ADHA 2DQ4A 2AA3A 1WW8A 3BMQB 4ZVVA 5CHEA 1NTOA 4Y6RA 1JKJA 3Q1LA 3K73O 2GZ2A 1T25A 5L7TA 4PLVA 3WWYA 3FD8A 2G5CA 3QWBA 5EPOA 2FMUA 5ILOA 1XCBA 3LT4A 4DIOA 3GEGA 1HLPA 2Z1MA 4HWKA 3IJRA 2HMWA 2J3HA 3GN1A 1VKOA 4KQXA 4DREA 4DIFA 2BGMA 4MVJE 1AGNA 4R9RA 3DBLB 3PQFA 1Q7BA 3ZHYA 3KYCA 3RFVA 4E5PA 2Y0DA 3DOCA 3OICA 1AXGA 2CMDA 1TVEA 2D0IA 4II3A 4E33A 1U8FO 5KVVA 3A14A 1SCUA 3GAZA 3WGZA 2Q2QA 4RPJA 2D8AA 3GGGA 1NFRA 4YB8A 4CV2A 2NVWA 5LCXA 3KETA 4FJ1A 1WMAA 5COBA 2NU6A 3I5MA 5JFOA 3LYLA 4DUPA 1E3SA 4D42A 3DBHA 3ZWNA 1K0UA 2YQ5A 1DHRA 3NDJA 4IDEA 4RGBA 1MGOA 4WCDA 1V9LA 4D3DA 1LRJA 1O95A 4CQLA 4M8SA 5JYDA 4MVJH 3ZWOA 2PKQO 3D4NA 4QO7A 1UDBA 3AWDA 1PL6A 4WLVA 3RWBA 3TZKA 4GH5A 3ZHXA 5JAMA 4F3YA 1PGQA 1MA0A 1UXJA 2E4AA 3G49A 2EEZA 4TMFA 3KEQA 1EFKA 1MC5A 2YDXA 1R66A 1HRDA 5AOVA 5DZSA 1YWGO 1P1KA 1ZK4A 1UXHA 1BDMA 3U4IA 3D3WB 3JQBA 2Q99A 1K6IA 3H5NA 4OH1A 1U3WA 4WEQA 3KYBA 5JO0A 1DDOA 4MKXA 4ALMA 5I7SA 3E82A 2NM0A 1BW9B 1KS9A 4YQZA 4WLUA 3GVXA 1B16A 4FC6A 5DNAA 4GQAA 3I6IA 4E2WA 3KLPX 1CERA 3QP9A 4GX5A 4Z3KA 5CEJA 2FHSA 3VOSA 4BNVA 1G0NA 5H82A 3DZIA 3PJGA 1D1TA 4NFSA 3KXDA 3W4JA 4D7AA 3OJLA 3TNLA 3DFUA 1KYQA 4MVJM 1K6XA 4A7PA 1T24A 1U8XX 1ZK2A 1M6HA 4XQCA 4F6LA 3GEDA 2Y67A 4OM8A 5T8KA 1DB3A 3IKTA 2DLDA 3LZ6A 4INAA 1VL0A 3AI2A 1GU7A 4BMNA 4TRNA 4GGOA 3GVPA 5EN4A 4N5NA 1HWYA 2I3GA 2Q50A 1NWHA 2ZTLA 3SEFA 1VL6A 1NX6A 4NNJA 2NU7A 1KOLA 3B6ZA 1PGPA 5HS4A 4XRRA 3RSHA 4ZU3A 2DC1A 5THKA 1XEAA 4A26A 4FJ2A 3B1JA 3FR8A 4OKIA 4D0SA 1PJSA 4TRJA 1HE3A 1GZ3A 1YS4A 4YAGA 2GNAA 3F47A 4U0JA 5HTOA 4L8VA 1E6WA 4W4TA 3ZW8A 4IDDA 1IB6A 5I7FA 2HO5A 4AJHA 4CJXA 1A7KA 3JTMA 1J6UA 2DUWA 1ZZEA 1WP4A 3GFGA 3UOGA 4Q3EA 1DC3A 4I9NA 3SJUA 1AE1A 1HLDA 1NWCA 2B83A 4MIEA 4DQXA 5L7YA 5HBRA 4C7JA 5DOZA 4JJGA 4HBGA 1A9ZA 3IJPA 1FDUA 1H6CA 3GEMA 5L4LA 4RVSA 1I5RA 3E9QA 4OIMA 1PEDA 3FTPA 1CEQA 3T4XA 4HKTA 5T8KC 1XELA 1T2FA 4FFLA 5BSHA 1AHIA 2ZJ0A 1ADFA 5BNIA 5EJ2A 5JAQA 2C2YA 3RBVA 4CMEA 1P74A 1Q0HA 4J9UE 4CM4B 1DLIA 1CDOA 4IS3A 2JL1A 1R0SA 3QSGA 2DVMA 3ZU5A 1P77A 1KY4A 4IJVA 1KIFA 1VJ1A 2A4KA 1G0OA 4PLHA 1NR7A 3HADA 4DC1A 4DXHA 2BELA 2VTEA 1Z75A 4E5KA 1ONNA 1R0KA 5F1OA 2YUTA 2VT3A 2ZATA 3VPSA 5C5IA 4ND5A 1EUZA 3D3WA 3NTRA 2V6GA 5CP8A 2BI7A 3L4SO 4JQCA 4BNIA 1J49A 3ZI0A 3LU1A 3JD0A 3PWZA 1PR3A 2RHCA 3ST7A 2ZTUA 2O23A 1YL6A 3RC1A 4KP7A 5LDHA 1RKXA 3W4IA 1DIAA 1XWFA 1A71A 5K6AC 1AXEA 3EYWA 1H6BA 1QYWA 5CG1A 3V2GA 3H9EO 3KLMX 5K0ZA 4IJUA 4DBZA 3EZYA 1T2CA 1VE9A 3PDJA 3A1NA 1EEHA 2IXAA 4PLWA 2GO1A 3QVSA 4NZ9A 1Y9EA 2H9IA 3NT2A 4BKQA 3NDRA 3COSA 3I6QA 1H93A 4D46A 1YL7A 3H5RA 5KKCA 3WGQA 2JAPA 1YE3A 3PHLA 4XD2A 5T64A 4BO6A 4GMFA 3KRTA 1J5PA 4YAEA 4FD3A 1OC4A 4UVIA 2P5UA 1PX0A 1VJTA 2I66A 2GLXA 1BXZA 1GYRA 4OQZA 4Q3BA 4M86A 1Y8RA 1NFFA 2X5KO 3AM5A 5B1YA 4M1QA 4OXYA 1SOWA 2X0IA 2I99A 4IIVA 3H9QA 1T26A 2GD1O 4ZD6A 5KCZA 2O50A 4L4XA 4DPLA 4IIUA 3BA1A 2CY0A 3T7EA 1LLQA 1PZGA 2FZEA 3FHLA 2VZ8A 1T2EA 3QRWA 4WNIA 5TX7A 2PK3A 4YWJA 1MV8A 1O0SA 4UVHA 4GI2A 3I4CA 3V2UA 5I7EA 3ENNA 5JO9A 1NYTA 4PZEA 2NSDA 2I3AA 3PPIA 1ZNQO 1RM4A 1FMCA 3MTJA 2HK8A 5GZ6A 1KEWA 4LGVA 5JPIA 4PLTA 1PQWA 1DC5A 4IZIA 2HMUA 2P4QA 3U4CA 1NQ5A 1D1SA 1DC6A 1TT7A 4FJ0A 4RPHA 4JX8A 4UEJA 1OI7A 1ADGA 1BG6A 2BGLA 2J5RA 4R69A 4KUEA 2RCYA 4HNGA 2VHYA 4WLFA 4AJ1A 1H6DA 1GFSA 1BXKA 4BS9A 4IDBA 1QP8A 4WOJA 3IMFA 3O8QB 2HJSA 2QIOA 4U5QA 3GMSA 4RPGA 2EP7A 4K6CA 3M1LA 3GPDG 3QVWA 1EBUA 3DHYA 3IOYA 3RFTA 3PGXA 1U7HA 1VRWA 1HF3A 4E4YA 3KV3O 3K8ZA 3PQEA 4ZJUA 5TC4A 4IQ0A 5TNXA 1W4ZA 3KHUA 3EGOA 3MJEA 4IXTA 2EF1A 4J1SA 1PWXA 3W8FA 4YR9A 3ZNNA 3GVIA 1SO8A 2I67A 1F8FA 4RF3A 4Q9NA 4CQMD 2AEJA 1PJTA 2JD2A 3PHGA 1OOEA 2X1HA 1KC3A 5IF3A 2J3IA 5DCWA 1EVJA 1LLDA 2H1SA 2V6MA 2AQHA 1E7MA 4BO4A 4CUJA 1EVZA 1CRWG 1GYQA 5C7LO 3VZSA 4UVGA 2WM3A 1VM6A 1L1FA 3WS7A 3JQ7A 4MKZA 3WTBA 2I76A 5B4TA 1W73A 2BLLA 5K9ZA 3TDKA 3W1VA 3NTQA 1UP6A 3QIVA 2X58A 5I9NA 1AUPA 4MVJP 2CDBA 2NTVA 3RBXA 4MP6A 4WLOA 3Q11A 3DMTA 4YJFA 3R3JA 2VUSA 3WXBA 2PFGA 5IG2A 4P8RA 2PD4A 4XB1A 4CQMA 4RF5A 1LDGA 2BHLA 1B26A 1PJLA 2PKQP 4EW6A 3DXFA 1EMDA 4J43A 4A10A 3VKUA 5AYVA 3PLRA 4KTVE 1DJQA 1LDMA 4X54A 1JWBB 2P9CA 3B20A 4J16A 4FCCA 3UXYA 1PGOA 3M2TA 4II2A 1DC4A 1MLDA 3TZCA 4DYDA 5A3JA 3CZMA 1LDBA 4KTTE 5JCXA 4Y98A 4FGWA 2CNBA 1GAEO 3WSVA 4BO7A 4DQUA 4E5YA 3PXXA 2AQIA 2DFVA 2I5PO 4NG5A 3DMTC 4CL8A 5A03A 5EMHA 3WGIA 4B7CA 4EUFA 5DOVA 3WWZA 2HMSA 3JQ7B 3G0OA 4I5DA 1E1KA 2Y66A 2QRKA 3NYWA 4GPD1 1K89A 1HYGA 3IS3A 1RM3A 3DTTA 1DO8A 3LT1A 2X0JA 3QWAA 4G5HA 2Y1DA 1GY8A 2P9GA 4YJHB 3FWZA 1E3EA 2WSBA 3CEAA 4NHEA 1LDEA 3NEPX 3WQQA 3ZV3A 4BO5A 5JDIA 3JD3A 1Q7GA 4GVLA 3GRPA 3RU9A 4BMSA 1GV1A 2D59A 4FOSA 2H6EA 1YL5A 2FR0A 4YRAA 1HDCA 2X5OA 4ITUA 5G0WA 4L73A 2O3SA 2CDCA 4J6FA 2IZZA 2AHRA 2YW9A 4OXNA 3GK3A 4DLBA 3JQCA 1TA4A 4HX5A 4N18A 2DAPA 3ZU3A 3Q3CA 4GKVA 4QFCA 2V7PA 5JMWA 3HFSA 1Q7CA 2Z5LA 3RROA 3VC7A 1N8KA 1GADO 3C24A 1ZJYA 4JP3A 1ZH8A 1IL0A 3AUSA 3O8QA 1DLJA 2CFCA 4M89A 1JVBA 3WGYA 4EZBA 1N9GB 1IPFA 2UYYA 5DBIA 4EUHA 3LT0A 4A73A 2VWQA 1EUDA 2IDZA 5KTKA 1R16A 4DIBA 1C0LA 1TI7A 1PJBA 2R6JA 4IJWA 4AJ4A 1HEUA 1E7QA 3CE6A 5F1KA 4AL4A 4BNNA 1C1XA 3KSZO 1U3UA 2WYVA 3EK2A 3K31A 4K6FA 1UZMA 1M2WA 4OOFA 4BV8A 4BNMA 4PLPA 1GZ4A 3GGOA 4XQEA 3WG9A 4I5GA 4ONEA 1JDJA 1C3VA 1LLUA 2ZK7A 5IDXA 4FFNA 3LLSA 3ETEA 4YXFA 1R4NB 4GX1A 1N9GA 2AMFA 2I9PA 1YQGA 3RAJA 3ZWVA 4AJLA 1L7EA 1A7AA 4E2YA 2FP4A 3QWFA 3EY4A 3I4FA 3PLNA 3PYXA 3DO5A 1MFZA 1NPYA 4Z9XA 1U3VA 4R54A 1DPGA 1WZIA 3GG2A 1E5LA 5JDCC 5IXYA 3B1KA 4AJEA 1N1GA 4K1LA 5IDQA 5KWEA 3DZBA 4ND4A 1I01A 1JU9A 4WOKA 3S2GA 4IY1A 3SVTA 4CM8B 1XQ1A 2GN4A 4BNYA 2X6TA 1H2HA 4NU5A 4R4JA 4ILKA 3AK4A 4YJGB 3WGOA 4J2HA 1CETA 3BTUA 3N58A 3H6KA 1EK5A 3E48A 1C0PA 4PRLA 1OBFO 1X0VA 1X0XA 1IZ9A 1D8AA 1ZEJA 2GGSA 4OAQA 4IZHA 3RBZA 5L40A 1EBFA 4G2NA 4CLHA 4PIVA 3X2EA 3AW9A 2AG8A 4AJNA 2CVQA 2PKRA 4IQ8A 4OYRA 3IC5A 2WD7B 5A9SB 1E3JA 1L7DA 1WAMA 2B4TO 2HDHA 1QXSA 4QUKA 3Q2IA 4U0KA 1BSVA 3HZZA 3RD5A 5DT9A 1X7GA 3VH1A 4TKLA 1U7TA 3FPLA 4BNHA 4CM8A 3MCVA 4CLDA 4B4OA 3C1TA 1UDAA 3E9NA 4K28A 4YTEA 4Y6SA 1M75A 3DONA 3MWEB 2BMAA 3EZLA 4PG5A 4Y9DA 5EQFA 4TZKA 5JDCA 4Y6PA 2UV8A 3VH4A 4EJ0A 4QX6A 4CUZA 3ZWWA 4BKPA 3L9XA 2X22A 3MJVA 4MVJI 5I9LA 5T67A 3MTGA 2YQ4A 1R4MB 3O38A 1BTOA 1B8VA 4RQTA 1DSSG 5JE8A 1SC6A 5LC1A 4QECA 4IS2A 1DIRA 3CPSA 4OSPA 2J6IA 2TMGA 4MKRA 2AXQA 5U9CA 4M54A 4RPLA 2QW8A 4JBGA 2HMVA 4UUNA 3DQPA 4CLXA 1LDYA 4E5MA 1PSDA 5C7IO 4JJIA 1GQYA 2NVBA 4IDGA 2OO5A 1XQ6A 4K26A 5CPFA 4U8GA 4W9NA 3U4HA 2RHRA 4IMPA 4PLYA 3BMNA 3E9MA 4QQRA 4QSMA 4JN6B 4S1VA 3C7DB 5I8WA 3WICA 2JKVA 3L07A 1N92A 1AHHA 3L6OO 1EVIA 3GA0A 3GUCA 4R1UA 3U0BA 3C1OA 3ZGYA 2PZJA 4JK3A 1U2GA 4NJMB 1V3TA 5B4UA 2XOXA 3OIFA 4NBVA 1SPXA 1TT5A 3I9LA 4WCFB 3TPCA 2EKLA 3JYQA 3VTFA 1C0KA 1E1LA 4WASA 4BB6A 3ZDFA 1HDGO 5ER6A 1KERA 3GC6A 4Q3CA 5T5QA 1CQJA 1I24A 1ZK0A 2NU9A 4MVJD 3PYMA 3S2FA 2GASA 3ASUA 2OP1A 3WMWA 1OAAA 4L75A 2X86A 2W4QA 4CMCA 3CTMA 1NAHA 3MJSA 3GMDA 4IGFA 3RASA 4BO1A 5G0TA 2VRCA 4MO2A 3ANMA 3INRA 2DTDA 4L76A 1XA0A 1P1FA 4NMHA 3IQDB 5ITVA 2VUTA 2C7VA 2JD0A 2VNAA 5L51A 1JW9B 3K30A 4PG8A 1A27A 3D4PA 1QKIA 1ADCA 2GPTA 3ETDA 3H2ZA 5FEUA 1VJ0A 2W2KB 3FNFA 3ZWPA 1I8TA 2OZPA 1PGJA 4MDHA 3WGHA 1IUKA 2Z1NA 3K6JA 3QLJA 3OM9A 2LDBA 2UAGA 1K5HA 3L6DA 2YDYA 3CZRA 5U1PA 2I6TA 4TVBA 3ZV5A 2O3JA 3L6EA 3JD2A 4K9DA 4LRTB 3IP3A 4YJDA 1B14A 4EEZA 4B3IA 3VTZA 5A3VA 1QYXA 1RM0A 1BGVA 2QRJA 4U7WA 3W8EA 4YA6A 5ENDA 4JJFA 3VAZA 3DFZA 4JBIA 1PZEA 2VQ3A 2XF8A 3OH8A 4P22A 3A4VA 4BGVA 4CM9A 1B3BA 5TRTA 2Y99A 1BXGB 4U6SA 1I36A 3H65A 3F6YA 1OC2A 3GUYA 1PQPA 3LT2A 4RVUA 1YB4A 1WMBA 5TQVA 3PTZA 3BHMA 4DPKA 4YPOA 5KIAA 2VUUA 1F06A 3MEQA 3STHA 3ZWAA 3DBHB 1PJ4A 1ZUD1 4ZHSA 5CDUA 1V0JA 5AXBA 3U49A 3QVTA 4CMAA 2E49A 3TFOA 4NBWA 5CDYA 4RJTA 3UH1A 1BMDA 1BXGA 3PP8A 4EGFA 5JY1A 3A9WA 4UULA 4ZGWA 4PLZA 2XXJA 2IODA 4N7RA 4YT5A 2IZ0A 2G1UA 4IMRA 5TJHA 3PGJA 1S7CA 2Y1OA 3UHAA 5KNLA 1HE2A 1MX3A 2VN8A 2Y1EA 1EZ4A 4BO2A 1XSEA 3FF4A 5JDIC 1YBAA 3SC4A 4D3SA 1LQTA 1YJQA 2VYND 1KBZA 1TXGA 3BMQA 3P19A 3WQSB 1GL3A 2EXXA 2OHXA 4RQUA 5L9AA 4RVDA 3JQBC 5GZ3A 4LCEA 4R5MA 2GZ1A 5G4KB 4J0FA 2Q1SA 4CM4A 1M66A 2CSUA 3AI1A 1C14A 2GN8A 4QTZA 1CF2O 3ROKA 3NTOA 5HWSA 1QORA 4QFDA 2VOJA 3BAZA 4JGBA 4YRDA 4OXKA 3WLFA 4J49A 1PTJA 4YCAA 2IZ1A 6ADHA 6LDHA 1DAOA 4D79A 2OMEA 3PWSA 4BL5A 4R51A 2V65A 3TZ6A 3K5PA 1ONOA 7ADHA 3KYDB 5TS3A 2B0JA 3HG7A 4I9UA 1WWKA 5HS6A 1SEPA 2JFGA 4XYLA 2NACA 3VZQA 1UH5A 5CAEA 2CUKA 2VZ0A 3A28A 3RC9A 3JQAD 4R3WA 2RBEA 5HRUA 4Z0TA 4HFJA 4B3HA 3JD1A 1CJCA 3UF0A 2BD0A 1N7GA 4RDHA 1LSJA 4D41A 3C7AA 1YONA 4NJMA 5L3ZA 5GZ1A 5FI3A 3EVNA 4XQ9A 1RJWA 1LSUA 2VHVA 4WCFC 5TIIA 1HDRA 3T7CA 2GYYA 3VPXA 1LC0A 3U62A 5EIOA 4GMGA 3D0OA 3AI3A 2Q46A 1IHYA 1P45A 2DT5A 3RIHA 5CEEA 4FOOA 1HSOA 1HL3A 4H7PA 5BNFA 3AM3A 1PS8A 1PQUA 3NGLA 5KVQA 3ASVA 4PLGA 1X1EA 2G17A 2AEFA 2VYVD 1CQIA 1N7HA 2O2SA 2UUPA 4CM5A 1R15A 5AQ1A 1TLTA 2YV1A 1GUYA 2YFHA 3JQEA 4JXKA 1LJ8A 4TKMA 2HK9A 3LVFO 2ZTMA 3PHJA 4BNLA 3L9WA 1H9BA 4NPCA 2B36A 1VLLA 2X9NA 3KEOA 4O5OA 4AVYA 1E3WB 2G82A 4W82A 2CD9A 1EVYA 1YJ8A 2WE8A 2EV9A 3OBBA 4LMPA 4ROSA 4J90A 5A06A 1EDOA 1BRMA 3OHSX 4OHUA 4NFYA 1JN0A 3PJFA 1XR3A 3RUEA 3K2EA 5TT1A 3H9GA 3GT0A 3VKVA 4NR0A 4ZRMA 4JCOA 4L9RA 2Q4EA 1O89A 2A35A 4RO0A 1EUCA 2IYOA 4GKBA 2D2IA 4B4WA 4P38A 4OO3A 5IAAA 3HFGA 4CMIA 3G17A 1ID1A 4DLAA 3GZ4A 4YDRA 3DAGA 4DPMA 3NJ8A 4R1TA 3IUPA 2JCVA 2DBZA 5H81A 3PJEA 3CINA 2FSSA 2BF7A 3SLKA 3KOUA 3GZNA 4NQZA 4QXMA 4EITA 2Q1WA 4BV9A 1NHGA 3I1JA 4CMEC 5CPBA 1R0LA 5BSFA 3ZWMA 1KVSA 4YBZA 5BNTA 1T4DA 4F45A 1FDWA 3G79A 3ENKA 2RAFA 1E3WA 3VVCA 2NUAA 3DOJA 3OQ6A 1ISIA 3CUKA 3PI7A 3U09A 4IINA 4A27A 3O9ZA 4CL3A 1ZEMA 5JAIA 1Z7BA 3TZQA 3TOXA 3H3JA 5JC1A 2J3JA 3JYLA 3ICCA 3K9QO 2FPIA 5BSGA 4AJJA 1DFIA 2X7HA 4FFPA 5F5NA 3VPHA 1LUAA 3WTCA 1I0ZA 2Q3EA 3DZHA 4XDYA 3MOGA 2TMDA 4PCVA 4H16A 4CM9D 4XZ3A 5EL0A 2GN6A 3KYCB 2J8ZA 3LK7A 4M49A 1ZKMA 5DBGA 1ZK3A 3TL3A 1UP4A 3NJ4A 1EE9A 3GN2A 5JMPA 2FWMX 2JFHA 3CMMA 2JFFA 4FPXA 4O0LA 4Q3AA 3WFIA 3TZHA 3TWOA 3GHYA 3E8XA 1LNQA 3GOHA 3HDJA 2D4AA 1CYDA 5A5FA 3DR3A 4ZQHA 1NPDA 1FDSA 2ZJ1A 4LVCA 1GV0A 3NT5A 4HFNA 3OIDA 3V8BA 3I23A 3I9OA 1T4BA 4J9VA 3UCFA 4IXWA 3AY3A 3BXXA 2PA3A 3DL2A 3ANNA 4GX2A 1QYVA 4CMBA 3F5QA 4R9SA 3JQ8B 3RU7A 1PJQA 4CM1A 1T2DA 2WJPA 1HZJA 4N5MA 3HDYA 2HLPA 4R68A 4RORA 3PYLA 2VWGA 3M2PA 3S1LA 4YT4A 2QYTA 2ZTVA 5G0SA 3UGKA 1RYDA 1XG5A 1YBVA 4BKOA 2CF6A 4QT0A 4KQWA 3ZNOA 3WJ7A 1QG6A 2GCGA 4UREA 3NKLA 2W90A 1XDWA 3KM0A 4XB2A 3IL2A 4WEOA 4YACA 3C1AA 3CMCO 4J3FA 3HQ4O 4S3MA 4BHTA 3D5TA 3VZPA 4B4VA 2POQX 3FI9A 3DB2A 4D0RA 2YYYA 3GVCA 1OMOA 2V6FA 2X8LA 3M1AA 1S6YA 1O94A 3WYEA 5IDWA 1CWUA 4J0EA 4ID9A 4R5HA 3D4OA 1UAGA 3ULKA 4DYVA 1ULUA 4R3NA 4MVJF 2EWMA 3K2BA 4W6ZA 3GLQA 4XR4A 3RUCA 3S2EA 4KOAA 2PZMA 1YQDA 2DPHA 3B1FA 3G3EA 1Z73A 2VHZA 1WXDA 2NWQA 2QZZA 4WLNA 4FR5A 4WUVA 2WD7A 1U5CA 4XYEA 3SC6A 2JJYA 5C3MA 3HWRA 3R0IA 1DAPA 3O4RA 4BNWA 4FFRA 4CLOA 3D64A 1YDEA 3OJEA 4W9NC 3PJDA 4J91A 4IBOA 3AY6A 1V3UA 3Q0EA 5A4DA 3EDMA 4CM6A 3IDSA 1IHXA 1YQXA 2FSVA 3FCOA 3WR5A 2ET6A 2HK7A 4WPGA 1HXHA 1RM5A 4YJGA 4FGSA 5KJEA 4I9HA 2OUIA 2B69A 1IULA 3Q9UA 2V6BA 3JSAA 5FWNA 1BDBA 1K6JA 3HJAA 1XIVA 1HKUA 4XEHA 1G6KA 2AG5A 3W4KA 5GY7A 3GVHA 3U5TA 4NFHA 1LI4A 1KVUA 1SB9A 2QRLA 3GFBA 4MPDA 3UCEA 2PY6A 2C07A 2JCYA 3D1LA 3LC7O 1SMKA 4WLEA 2D5CA 5IN4A 4GSKA 1V6AA 2DTEA 2ZB8A 4YAIA 3WQRA 1KEUA 4DWVA 2HMTA 3JQAA 4JIGA 1DEHA 1PJCA 4CR8A 1ZSYA 1NQOA 2IYPA 2O3QA 4P4GA 5GMOA 4WNCA 1NR1A 2X9GA 3DOOA 3E18A 5DN9A 1J4AA 1C1DB 1GUFA 2Y1FA 1B0AA 2NQTA 3D3EA 3PZBA 4PZCA 1C1XB 3JYNA 2P2SA 1YRLA 4J7UA 4NBTA 3AUAA 3RUDA 1YOVB 1ZBQA 3ZNQA 2X5JO 1ENOA 4RDIA 4JROA 4NK4A 1I3KA 2VYVA 1SAYA 1LBEA 3JV7A 4EDFA 4H3VA 1EK6A 5MGBA 1V8BA 4LCJA 5U4QA 1I3MA 2A9FA 3JQ6A 5DP2A 3HSKA 1A72A 1ZXBA 2O4UX 2QG4A 1UZLA 1QR6A 2X0NA 4RVHA 1JQBA 5JW6A 4Q39A 3ROPA 2C29D 5L53A 4XJSA 4HY3A 1YKFA 3ADOA 4AJIA 2WYWA 2J3KA 4RF4A 4CV1A 1OZAA 2VT2A 2Y1CA 3GR6A 4DC0A 2ZYGA 1E1MA 2G76A 1PR9A 4PZDA 1N2SA 2HU2A 3U9LA 5L4SA 1H0KA 3V1YA 1NNUA 4OL9A 4F6CA 4JNKA 3QA9A 5HM8A 3TSCA 3BMNB 2IRWA 5CDTA 4GWKA 4AFNA 3H4VA 1VL8A 3W6UA 4YJHA 2Q1TA 4Z0HO 2DUUA 1I2CA 1E92A 2P91A 2DBQA 4OQYA 3ROMA 3TOZA 1GEGA 1X13A 4UAGA 4BQPA 3LF2A 3A06A 2PZLA 1U4OA 3DEYX 1M76A 2EIHA 2O4CA 2YZ7A 4GLOA 1YH3A 4FB5A 4O59O 2VHXA 3PIDA 1C1DA 1W0CA 4BGIA 3CSDA 4I5FA 2PH5A 4IDFA 3DZJA 3G1UA 2HSDA 5CDSA 1HETA 1EE2A 4PRKA 2C54A 2B4QA 3HDHA 5L4NA 3Q6IA 4GWGA 2IXBA 4N54A 4HNHA 3I9NA 4FBGA 1KEVA 4CMJA 4OKNA 3FRJA 1NXQA 3PFWO 5EINA 2X23A 1R4MA 1PL8A 9LDTA 3BHIA 4EBFA 7MDHA 3V2HA 4E21A 1GPJA 1SBYA 3GNTA 2VRCD 2EKPA 4FDAA 1WVGA 4ND3A 5G2OA 2AE1A 2OP0A 5ER9A 2FOIA 3V1UA 2ZQYA 3DAFA 3QVXA 1ENZA 3OMLA 3F9IA 2YV2A 3S8MA 4Z0PA 1HZZA 2RH8A 3FR7A 1ARZA 3LC1O 2YHIA 3TFQA 4CMGA 4CPDA 4YYZA 4CLRA 2HAEA 1U1IA 2EHDA 4EUEA 2CF5A 3AM4A 2Y0CA 1T2AA 1QYDA 1YB1A 5I8ZA 2Y05A 3AUUA 3UW3A 4BQRA 2VNSA 2VYNA 4IPTA 2OL4A 2IEBA 4LN1A 3BMCB 4RZIA 4D3FA 3RCBA 1ORRA 5BR7A 3OF2A 1R37A 3FTNA 4TRRA 1Q1NA 1HYHA 3WYBA 4RV9A 4E31A 2E48A 2GN9A 2YHIB 1PGNA 4R41A 5EQDA 3DBRB 1HTBA 1UXGA 4UUPA 5A02A 1KVTA 1I10A 4HADA 1XHLA 4BGEA 4NIMA 5DF1A 5EERA 2W2LA 2PH3A 3HB4X 4BMVA 3EUWA 4I5EA 4AJ2A 2O3UA 1D4FA 1E7RA 4DBVO 5COAA 1GYPA 3WYCA 4ZRNA 3ZH2A 1PU2A 5ICSA 5KJ6A 5TLSA 1ZSNA 2VZ9A 2CDAA 4KZPA 1KETA 2BI8A 4RPKA 3O26A 4XQGA 3V1TC 4XIYA 2PGLA 3MWDB 1FK8A 5DDIP 3DBVO 3K96A 1ZCJA 2UUOA 3DZGA 1RYEA 3QWIA 2F00A 3OECA 1HE5A 1IYZA 2X0RA 4MINA 1R4NA 1X7DA 3OIGA 2VWPA 1PIWA 1H9AA 1P44A 3HN2A 4RVFA 1MXHA 1E7WA 1ZFNA 2ZIZA 3WNQA 4DGSA 4FFMA 5G0UA 1MG0A 5IN5A 4G81A 1PZFA 3VDQA 1MUUA 4Z9FA 1P1IA 1FDVA 2GR9A 4BNTA 5JYEA 1NPTO 1GCUA 2PZKA 5TT0A 4PG4A 3PWKA 1MB4A 1Y5RA 1NASA 2A92A 3GG9A 1UXKA 1W6UA 1NVTA 1ZIDA 4Q3DA 2VTDA 4GL4A 4XA8A 2OGUA 3NRCA 3R1IA 1VSUA 4KDFA 1PJ3A 3NDIA 2CVZA 1ZJZA 4IDAA 3GAFA 3IAHA 4L4RA 4BB5A 4UEOA 3E5MA 4BO8A 2IE0A 3KVOA 4Y8VA 5KKAA 3AOGA 3QWHA 1HE4A 3HUDA 5L7WA 4ZICA 5FFFA 2AEMA 3QQPA 4GLLA 3OP4A 3I3OA 1Y8RB 3JD4A 4XCVA 1Y9AA 5A1TA 3UKOA 1LRKA 3DBRA 1D7OA 1KVQA 1YGYA 4TWRA 3C8MA 1ISGA 1D3AA 3WDSA 3OA2A 4AJKA 1HT0A 4RLHA 3WBBA 3AOEC 2JHFA 1GQQA 3VZRA 5DP1A 3WX0A 1R12A 3ON5A 1ISJA 4YEDA 4FS3A 2SCUA 2R00A 4O6VA 1OFGA 3ICPA 4WKGA 4ZQGA 2P9EA 3TF5A 3LLVA 2JCXA 2NU8A 4A5OA 3MJTA 2O7QA 4WJZA 1LX6A 1M67A 1Y7TA 1DIBA 4MVJG 4RVGA 1GCOA 2ZYAA 4R1NA 1QV6A 2NVUA 3GHHA 1UUFA 4PG6A 4HV4A 4ALJA 2UDPA 2XXBA 1B2LA 3K92A 1ENYA 1H2BA 3WOHA 4A0SA 4M87A 3ZU4A 3VPFA 1TEHA 4XIJA 3LF1A 2D3TA 2B5VA 2WMDA 3CIFA 5ENVA 2ZCUA 2HUNA 2BFOA 5TF4A 1BW9A 3TJRA 4J7CA 2EGGA 5BQFA 3BIOA 4B79A 2BFMA 2BFPA 5FF9A 3RKRA 3HN7A 2O48X 2VOEA 1EDZA 3FNGA 1YDWA 3I9KA 3QV1A 3IKVA 4YVFA 1LU9A 3P7MA 4CQMB 1MG5A 4FN4A 3UCXA 1WDLA 2WTBA 4DMLA 2BFAA 1I3LA 1ML3A 3DHNA 3PDUA 1P33A 4YJFB 4B4UA 1B8UA 3RJ5A 4KDEA 1EQUA 3SLGA 1ONPA 4UVEA 3KB6A 4R16A 2GUGA 1LTHR 4CR6A 4IDCA 4BKRA 1E3LA 4ND2A 3DZFA 4FIZA 1CIVA 1P1HA 3W8DA 3WFJA 1T1SA 1GDHA 4XGIA 3JQ9A 1Y6JA 1G1AA 3KTDA 4CV3A 3ONDA 3UN1A 5CG2A 4ZA2A 2O7SA 1DXYA 2EG9A 2GDZA 4NBUA 3OEWA 4I08A 3VVBA 3QVOA 4WGGA 1DFGA 3DZKA 1FXSA 4J4BA 4E5NA 4EYEA 3ADPA 1TT5B 3QE3A 4MOWA 4WCFA 1FDTA 2VHWA 4KWIA 2GZ3A 3RFXA 3R3SA 3WIEA 5KVCA 3NX4A 1KC1A 2YV3A 4N5LA 4XJTA 3BMOB 1JTVA 4IUYA 1PWZA 4PVCA 4WK6A 1NVGA 2A94A 1I2BA 2BRUA 5ICMA 3HNPA 2EKQA 3CXRA 4B3JA 1B15A 3E5RA 4C7KA 3KYDA 1DIGA 5H83A 1W8DA 5JC8A 2JD1A 3OJ0A 3NT4A 3VH3A 2OBYA 3OFSA 4J7XA 3N7UA 4TVOA 3P2OA 5KJFA 3AU9A 4FSHA 5A9TA 5A9RA 1VPDA 3PFFA 4XWYA 3ZWCA 1IE3A 4Z9YA 1NFQA 3F5SA 2Q1UA 3VHRA 2W2LD 5IZ4A 5G4KA 3V5NA 4XRGA 4YT2A 2Y0EA 2NNLD 3H9UA 5L45A 1YB5A 5IZCA 1F0YA 2FPPA 3KBOA 5LDGA 5TSDA 4GBJA 4LISA 5A05A 3TRIA 1H5QA 4ALNA 4D44A 5ITWA 3U3XA 5IDYA 4ZQBA 2BH9A 1RWBA 1IPEA 3QY9A 1YXMA 3FN4A 3X2FA 4HFMA 3F4BA 3TQHA 1BVRA 1QYCA 3BTVA 3KZVA 3MJ4A 3WIDA 1E6EA 4E32A 1PJ2A 4BO0A 4DMMA 2W8ZA 1QV7A 2NTJA 4JBHA 2F1KA 3OSUA 2QHXA 4M55A 4ZQEA 4LW8A 4RF2A 4RZHA 1YBMA 5J23A 2ZKLA 1P31A 1Z6ZA 3H9JA 1GTMA 3ZV4A 3F1LA 4Z6KA 1H94A 5L95A 1O5IA 4UUOA 2QQ5A 3GRKA 4BO9A 1P0FA 5AVOA 3EMKA 2FZWA 4XYBA 4LRSB 5B12A 2R00C 4MIYA 4AG3A 5F1PA 1UP7A 5ADHA 3ZCXA 1WZEA 4MJLA 2DTXA 4FC7A 3JYOA 4I1IA 3R6DA 4PN3A 1JAXA 4CODB 2NTNA 1U2DA 3UAGA 2B37A 5TJ9A 3GQVA 1DFHA 4B8ZA 1YVEI 1A4IA 3IIEA 4BUCA 3LQFA 4PVDA 4AJOA 3ZV6A 4NK5A 1U4SA 3BYZA 1HDZA 2ZQZA 4LSWA 3ZZNA 4ESOA 1DRVA 1NQAO 3H3FA 2ZCVA 1QLHA 4NJOA 1LA2A 3QHAA 4RL6A 2BGKA 3GZNB 4BNKA 1ZMOA 4CMKA 3LDHA 1NAIA 5FI5A 2Q2VA 1XU9A 2HJRA 2QX7A 2RH4A 1MC4A 4TQGA 4OSOA 5KOIA 4YAKA 3AUTA 4J1TA 3S2IA 1ISFA 4D43A 1XKQA 2C0CA 1BHSA 2OFPA 2AQ8A 4NH4A 2VRBA 2PNFA 4GX0A 3ZNPA 1P9LA 4FW8A 3WMXA 1JLLA 3TN7A 1PZHA 1F8GA 3PK0A 4L4SA 5JCJA 4RLSA 1P1RA 2H63A 3GY0A 3WBFA 3GGPA 4BNXA 1JKFA 4GSLA 2P4HX 3ZWYA 3C3XA 3GNSA 4YT8A 4ZN6A 2DBVO 2BKAA 2NV6A 1BVUA 5TGDA 3WLEA 2DBRA 2WD8A 1LEHA 3BHJA 3NUGA 2FN7A 2FR1A 1MXFA 1A4UA 5IJZA 1O9BA 3AFMA 4J1NA 4BO3A 1ISHA 3O03A 2O3RA 5F5LA 5FYDA 1X7HA 2ZYDA 3CKYA 4HXYA 4LVUA 5F3RA 4E13A 4HFRA 3F46A 1BWSA 4W7HA 5EESA 3DDNA 2PD6A 2I65A 3FNEA 4RCVA 1UXIA 3NGXA 3JQDA 1A5ZA 1Y8QA 3INGA 4XYGA 1HDYA 3WGTA 2Q45A 2W98A 4F46A 1XGKA 3PEFA 4QO8A 3JCZA 3T4EA 2J5KA 4LMRA 3HDQA 3QW2A 1PL7A 1I32A 1B3RA 1X1TA 4CR7A 1SOVA 1UR5A 4P4NA 3ZW9A 1UJMA 2EW8A 1XU7A 2GF2A 2E82A 2Y1GA 4P4LA 4U6QA 2PR2A 3IP1A 5DCUA 4Y67A 4KUHA 4YAJA 1Y8QB 3F1KA 4J4HA 2DFDA 2LDXA 1AN9A 1XLTA 3C7CB 5CFZA 3VH2A 1DJNA 1MP0A 4OJNA 4DVJA 4TZTA 4IQGA 1LLCA 2DU8A 1WLYA 4URFA 3P5SA 4IJKA 3FBTA 1UDCA 1TB4A 1PS9A 5T57A 1F14A 2GSDA 4R01A 1E6UA 3E1KA 3ORFA 1T1RA 4DRYA 1ZO8A 3VDRA 2AQKA 1GUZA 1N1EA 4BNUA 5JXWA 1E3IA 3HE3A 3ABIA 1ZSVA 4TSKA 1KVRA 2E6UX 4YQYA 3VPGA 3JQGA 2HCTA 4CV0A 2HKIA 2EJVA 3LC2O 4B8WA 2WDZA 4UVDA 1HYEA 3N74A 4XX0A 1GZ6A 4CMIB 3NAQA 3ZHBA 3DMYA 3G1TA 4A2CA 4WE3A 2O3TA 1FJHA 2RIRA 2E37A 1I30A 3GDFA 4DLLA 3RVDA 2CZCA 4AICA 3OA0A 1E77A 1ZK1A 1LC3A 1LDNA 3GH3A 3RJ9A 1UAYA 1E1NA 2D5AA 3MZ0A 3ZU2A 2WEKA 3GNQA 2NVUB 4CM3A 5JSFA 1FF9A 1XYGA 2WE7A 2VWHA 3ZN2A 3W6ZA 5MDHA 3KO8A 4MP8A 1F12A 1WNTA 3ZHZA 2GERA 4BNJA 2C82A 5A9SA 2Q2WA 5AXDA 4DL9A 1NBOA 5AXAA 4E6PA 1GR0A 2WWRA 2XAAA 3UVEA 1Z74A 2PLAA 2Q4BA 2JHGA 3E03A 1NHWA 5JAZA 3L0DA 5F21A 3BMCA 4CLOB 2C20A 3PRJA 1H6AA 5CDGA 3AJRA 4E2ZA 3AOEA 2NLOA 3IUSA 3RUIA 3DWFA 4KUGA 1QRRA 4BNGA 5A04A 2ZB3A 2CVOA 5C7OO 2OBNA 4XYMA 5K6AA 2EERA 2ILTA 4LK3A 4PLFA 1LXCA 3GDOA 4QEDA 4O1MA 2PWZA 1KEPA 2GRAA 3Q9NA 1EQ2A 1B8PA 3DBLA 4PFJA 1GEEA 4BGUA 1ISMA 3CH6A 4W99A 3H2SA 1ZVMA 3WB9A 3HHPA 1GPDG 3OEYA 1R6DA 3OJFA 4XGKA 1SZJG 4NBRA 4OOEA 4PLCA 2FRDA 1K3TA 4CMHA 3AFNA 2Y93A 1X15A 4KWHA 4J1QA 1VKNA 1Z82A 1WDMA 1DHTA 9LDBA 4UEKA 5B37A 4ND1A 2DPGA 1NVMB 2Y68A 1F17A 3PIIA 3AY7A 3HB5X 1M6WA 4PGFA 4R1SA 1QLJA 2PGJA 4XDZA 2W2KA 3UFXA 2YHUA 4PG7A 4XGNA 3D7LA 3C85A 4JP2A 2EP5A 3ZWXA 5DBFA 2UVDA 4E0BA 2YJZA 3BTSA 3RC7A 3EAGA 3DC2A 1E7SA 2IEDA 1WDKA 1UZNA 3ITDA 4EJMA 2AE2A 4W7IA 4GGPA 1ADBA 3JQ8A 5THQA 1A9YA 2EJWA 1VC2A 2ZB7A 2R2GA 3PHIA 4I8XA 5CEFA 3EC7A 1NM5A 4Q3NA 4C4OA 5COQA 3I9JA 5JY6A 1DOHA 2PTGA 1I2ZA 1Y81A 1ULSA 4FFOA 4EJ6A 1NQTA 1P0CA 5IXSA 4GVXA 5G0VA 3FPCA 4OMUA 3DTYA 3I83A 2PGDA 3BMOA 1PS0A 3L4BA 3KSUA 3JQFA 2EW2A 3FSRA 3SX2A 1WPQA 1RPNA 5JNLA 3OQ1A 3BTOA 4LSMA 3PZRA 4TRMA 3JYPA 4KMSA 4B7UA 4NU6A 2PV7A 1E7YA 1X14A 1U28A 2YFQA 1SB8A 3ETGA 3UICA 4D45A 2ZB4A 1QMGA 1K2WA 3F4LA 3MJCA 3SJ7A 2AW5A 2HRBA 1U9JA 3NV9A 3M6IA 4HUJA 4E12A 1B7GO 3EHEA 4L74A 1MFPA 3OQBA 4JLWA 1YOVA 3WGGA 4EEXA 3L77A 2YY7A 3I52A 4G65A 5A5EA 3GF4A 3QJ5A 1ZW1A 1U3TA 4J4TA 3WNVA 3ROQA 5G4LA 2B35A 5KJCA 4HP8A 3ANLA 2B5WA 4BNFA 1DRWA 4CLRB 1LSOA 2OXIA 3LSYA 2NADA 3P2YA 2FR8A 4NI5A 1GD1O 1Q2XA 2DKNA 2Q49A 4DQVA 1EFLA 4BIIA 2QYSA 3H7AA 3FWNA 3L4BC 5I9MA 4BOYA 5I7VA 4IM7A 2H5LA 2P5YA 3U4DA 1HDOA 3EW7A 4O63O 4XR9A 1Y1PA 1KY5A 4TROA 3H8VA 4AJPA 5IFLA 5B4VA 3KUXA 1QSGA 2OORA 2X4GA 3UUWA 1DIHA 1VI2A 5JBIA 5DCYA 1U5AA 2D1YA 3PVZA 3DAPA 2FPGA 4DA9A 1LRLA 3GDGA 1N5DA 3I9MA 1Q0LA 1ZMTA 2C5AA 3SBOA 5BSEA 3JQGB 1DBVO 1LQUA 1SEVA 3D5QA 2DM6A 4Z3DA 5BT9A 1IY8A 1HSZA 3EVTA 3ZWBA 1NP3A 1JAYA 2Z95A 3RKUA 2C59A 4IGEA 4MP3A 5C37A 5KVSA 1ZXLA 1E5QA 1GQ2A 4CLEA 1JWAB 1VSVA 2QZ9A 3BZUA 2OOSA 3PHHA 1I3NA 4OGWA 4ALLA 4CQLB 1C0IA 2NQ8A 1I33A 2VCYA 2B4RO 3ONFA 1P1JA 4E2XA 3AU8A 3B70A 4YRBA 1IOLA 1V3VA 2G0TA 4H15A 4MVJA 3RI3A 1JKIA 3FBGA 5ES3A 4BKUA 4EI2A 4UUMA 1V35A 3INTA 2PD3A 3DHEA 3RUFA 1YO6A 3Q2KA 1J0XO 4FQ8A 4B7XA 1JVSA 4CM7A 2WYUA 3H5AA 2P68A 1P3DA 1Y5MA 3JQFC 5DULA 3RUAA 2C7GA 3FNHA 4CUKA 4E3ZA 3RC2A 4GAEA 2FY8A 3OETA 5JLAA 8LDHA 5T6BA 1Z45A 1JA9A 1O6ZA 5HA5A 1Q0QA 1ENPA 3TL2A 2O2YA 2XPCA 3GPIA 4DTIA 3WSWA 3ITKA 3S55A 4ALKA 1E0DA 3SXPA 2JAHA 5ILGA 1LSSA 2EGHA 2J5QA 3ONEA 3PQDA 1IZ0A 3RUHA 5KJ1A 3JQ9C 3F3SA 1Z7EA 2C2XA 2X9VA 4NDNE 4E30A
chains in the Genus database with same CATH superfamily
4HDMA 4M9QA 5FWDA 3HO1A 2PEYA 3WK6A 1HDXA 3E6AA 1RHRA 5IZCC 2WR8A 1JUDA 2IU3A 4WECA 1HFKA 4BBAA 3QPCA 1DRUA 2IUEA 3KSDO 3RYIB 1RWMA 4Q7JB 3VGJA 4C9BA 5KYUB 3U7JA 5ALEA 1TM3E 1I51A 2M6LA 6CHYA 1CE8A 2RHHA 1NMXA 3G6WA 3PSAA 1JEJA 1NF2A 4D9MA 4A03A 2B8WA 4WSOA 5DGTA 3TK1A 3ZZMA 1FTGA 3PC3A 5AKYA 3C6ZA 3V8RA 5AW0A 5BVGB 3OLCX 4RGQA 3CRNA 2NMVA 2AA3A 4LJ4A 4GPEA 4TSFA 5JD6A 3AVTA 1NTOA 1XL0A 5BN4B 3TQRA 4D8YA 2XVAA 4NECA 1JKJA 4MKIA 4F3TA 2P11A 3VU3A 2W2VA 4UU0A 4FEAA 5JRJA 4AF8A 4BLRA 4UEQA 4DNPA 4PW0A 3QLVC 4HXEB 2FMUA 5EPOA 3B2EA 1Z8FA 1OJLA 1DQRA 1HA3A 1Z25A 4HWKA 2AFIE 3ZDAA 1OIXA 2J3HA 4TUYB 3MUNA 4KR7A 1KHTA 2BGMA 4D5EA 4MVJE 5FPPA 1JE1A 3G02A 4UD6A 5AI8A 1M1NA 3R7LA 3SBDA 3ZHYA 4ALLA 1FW6A 2GK4A 1QFYA 4E5PA 5I7AA 2LV8A 4II3A 9GPBA 4JT8A 3ZTTA 4E33A 1U8FO 1DX9A 5B58T 3HU5A 1RAHA 3ORSA 1NQXA 1FFEA 4BYGA 1IWBB 1G60A 3O1HB 4IZOA 3ZJYA 2PL3A 1SR8A 3QLTA 2CXOA 3HL4A 5COBA 3I5MA 4POAA 3N2LA 1UC4B 4MJXA 3OUTA 1YQ9A 2YIDA 4D42A 2XHZA 4XVQA 3T3IA 4CQLA 1WG8A 4B74A 2YQ5A 4QNRA 3NDJA 4RGBA 1UBKS 4WZ6A 4US0R 2VH2A 1N2BA 4WCDA 2VSFA 1Y9DA 1O95A 4P4UA 1JTFA 5JYDA 4LY0A 3GP8A 2G83A 2OCLA 1OTHA 1UDBA 3MLAA 1PL6A 4HGNA 1MJHA 1NJGA 2EWWA 2ZT5A 4HNAA 3HI4A 4K3VA 3WA7A 4XWTA 1MA0A 4TMFA 2A86A 2EEZA 1P81A 3DLIA 3KEQA 4TTRA 1MC5A 2IXEA 4LXGA 2YDXA 1XF1A 1PFUA 1UBHS 1CUUA 1T4MA 2GK6A 1YWGO 4AWBA 5I01A 3EF3A 1G4AE 1P1KA 1ZK4A 2C8LA 5TPZD 1TMOA 4F2WA 5EYPB 3OCZA 2MWMA 4M1MA 4DCOA 1G59A 1QHXA 2CHFA 2C83A 1IAVA 3IVXA 1JJIA 1AJEA 3KYBA 3W8RA 2W11A 1DDOA 4MKXA 4EOGA 1FNNA 1F5SA 1RHMA 4B0PA 4KR2A 1BW9B 3F7MA 1N25A 1EDEA 3ISTA 5ETJA 1OKKD 1M2GA 4C6HA 1IM5A 2ORWA 3M89A 1B16A 2DH6A 5DNAA 5BYKA 3OZWA 4RE5A 4Z3KA 4BX8A 1J99A 4M1ZA 2FHSA 3AC0A 4H4DA 1G0NA 5AI9A 5ALDA 3DZIA 5IFKA 4QOSA 4OHMA 1TO6A 2PKCA 3OJLA 3NUZA 4HMPA 4QUHA 5JSYA 5I45A 3V2IA 1KYQA 1XFDA 4LXQA 1QH8B 1S89A 4MVJM 4KPUB 1KTIA 1K6XA 4B7AA 2GYUA 4I2VA 4F5DA 4F71A 3ER6A 4QD3A 5I8PA 2QTLA 1DB3A 4UNPA 1O03A 2DLDA 3DO6A 4INAA 1WVIA 3MHPA 16PKA 4JENA 3AI2A 5CFLA 3CH5A 1JHAA 4TRNA 1COWA 3ZX5A 4XI9A 1EVQA 5CVTA 3R44A 4IEEA 3KOMA 4R2MA 2FKAA 1T5IA 2Q50A 1HLGA 2GJ4A 3F3YA 5K0SA 1TMGE 1XLTC 4NNJA 1KOLA 4HNVA 4HDKB 1ZD2P 2P1ZA 2WWWA 3N8NA 1Y42X 3PV0A 5THKA 5BR1A 1FZTA 4C0AC 4DOMA 5JMOA 3DJYA 4YV7A 4CKWB 1OGJA 3P8ZA 4EHKA 2JFOA 4C6SA 1BH6A 4M37A 5AI5A 3IDZA 4PTLA 3BX1A 3EBLA 2WU4A 4YAGA 3AL0C 4MHSA 5TPWA 5HTOA 1FYDA 4IDDA 3UEOA 2HO5A 1NXSA 1D0SA 5HNKA 2R7AA 4AJHA 4CJXA 4KLAA 3WIVA 5T41A 1OFIA 1WSAA 2P2DA 1UBCA 2ODBA 3HP4A 4Q3EA 1OREA 3FZYA 3CNHA 5LMUB 3R09A 1HLDA 2B83A 1SKYE 4MIEA 3IJ5A 1Y3DE 5L7YA 5UKDA 1OYWA 1U04A 3JTEA 3T5TA 2OFWA 4LEIA 5KNDH 2H31A 1VI6A 1H6CA 1RXVA 1HNXB 4BBZA 1XCPA 2OR3A 5LP6A 3E70C 1W47A 3KJFA 3CUTA 1CEQA 3E53A 4FVTA 5CIQA 5K3AA 3BK1A 3BRCA 1AHIA 4GXNA 2APJA 1BDIA 4MQFA 3L1HA 4PICA 5EJ2A 3NYQA 1N1MA 1FMJA 3WSTA 1YIAA 2RJ3A 2WAAA 3B6EA 4MMYB 1ZIPA 2JL1A 2VT7A 4NDAA 3ZD7A 1N6IA 2PO7A 4IJVA 4YUZA 2ZUSA 2R25B 4S1TA 4AJ9A 1G0OA 1JEQA 1QE5A 1URPA 3CT4A 4GMDA 1FCJA 4LJKA 5E1MA 1CDDA 4DC1A 2QQGA 4A0HA 1FLDA 2VTEA 3EPPA 3QMMA 2VJDA 4A6DA 2QTBA 3W8NA 5ALGA 2CK3A 4M60A 5EVJA 2VKQA 2A8YA 2NO7A 1TJNA 3W2TA 1SD5A 5DCLA 3NTRA 2VA9A 3U17A 2FMXA 3KZKA 1X77A 2V6GA 2B4YA 1NMEA 4PGHA 5DM1A 5F12A 4DFDA 2BI7A 4QULA 3AVWA 2CJPA 3KZOA 3ZI0A 3LU1A 2WZQA 2XR1A 3E15A 3DHVA 1PR3A 4BIMA 3VO1A 3C3EA 4DKXA 2O23A 4LXIA 5TVKA 1A9XB 1AM4D 4C0SA 1DIAA 1W34A 2H1HA 2AXNA 5AHRA 1DC8A 3A27A 1T9ZA 2HADA 2PRSA 5ALKA 3EYWA 5K09A 5KC8A 1WSBA 1X7YA 2VDPB 3H2BA 3V2GA 3Q0TA 3C1UA 3KLMX 5DNDA 2QJFA 4PSVA 3QE2A 4KX3A 4WDQA 3I5AA 2VZLA 3II6X 5CJ2A 5BY2A 3FMPB 1JB1A 2GO1A 4FYYA 4HNQA 4OHOA 5D86A 1II8A 2BM0A 1IXKA 2VJKA 3CRZA 4KXQA 1L3BA 3QW4B 4QXRA 1Y9JA 3KKPA 2TMKA 3COSA 3SGLA 3I6QA 3GXBA 4MMXB 2JKYA 1IWPB 1E1RA 4WZZA 5FNZA 3ETCA 1TGVA 4OLFA 3WZ2A 3FGNA 4JLKA 2YICA 5F2EA 4BO6A 1YE3A 4C78A 2HA7A 4EGQA 4C2AA 4C2TA 4N49A 3KRTA 2V59A 4QOJA 1YE5A 1J5PA 4N5DA 4YAEA 1Z83A 3IKMB 4UVIA 3TZEA 2UUAB 3I72A 1NBEA 4BJHB 2V4MA 2GLXA 4NFLA 3WKCA 4HH3C 3BH7A 2H1VA 1Q7TA 1XZGA 4KI0A 4HRVA 2JFXA 2XYVA 4PFKA 5CXUA 4AS1A 1KRXA 1LWNA 1IEXA 2G08A 1KYZA 2ZROA 3B1WA 1ZP6A 2X5KO 3AM5A 2PQ0A 4MDYA 2DY0A 4LF4B 4D5GA 1T26A 2GD1O 2CB0A 3FTCA 2HREA 4L4XA 3VSDA 3Q8LA 1HFEL 2VJQA 4IIUA 4Y2RA 2QXTA 2I3BA 4ISBA 3EXHA 1JSZA 3C15C 3E27A 3VBCA 2FQWA 4O2AB 4UARA 3BSFA 3CWCA 3C8DA 3IBFA 1UFQA 1G18A 2PK3A 4RKQA 1V4BA 4EW3A 4QQNA 1ODTC 1SZPA 1KZYC 1Z34A 2Y2VA 5ENZA 1GNQA 1O0SA 4HDSB 5DHSA 1VBFA 3SHOA 4A6PA 4Z5XA 3V2UA 4B6SA 4ZALA 5I7EA 1UPCA 3R5XA 3SDBA 1J97A 3A6KA 4BFZA 4HB2A 1NBWB 1FLNA 1UFRA 4PZEA 3FDJA 3L7OA 2Q3LA 3HYCA 5EIEA 4MGHA 4C4PA 3NHSA 1FX1A 4YAWA 1T6XA 4N01A 1X9GA 1K7CA 5GZ6A 3OIYA 4LGVA 1NLYA 4BN4A 2OV2A 4TL9A 4U1RA 2IP1A 4PLTA 1PQWA 3ZBQA 4YWHA 1DC5A 3OQHA 4IZIA 2P4QA 4JLUA 3U4CA 1YI1A 3U80A 1DC6A 1TT7A 2P27A 1AUVA 3ENZA 1OI7A 2OKCA 2Q3HA 4G86A 1BG6A 2RGBA 4MI9A 2V03A 4OU5A 1Y6FA 1T9HA 2QT1A 1C9DB 2IELA 2MSNA 2VHYA 3L8HA 1H6DA 2GO7A 3LQQA 3HXQA 3K05A 3CS3A 1QP8A 4WOJA 1OWOA 3O8QB 1C30B 2K4MA 4RPGA 3FLMA 4AY2A 1A9RA 1GZUA 2ORYA 3GPDG 3M1LA 1E66A 3DHYA 3FCYA 3W3AH 1U7HA 1VRWA 1HF3A 3MJHA 4LNHA 2H4HA 2ODEA 4YRCA 2JI7A 1K97A 5EQTA 3UWKA 2BLNA 3UHJA 1N8TA 4NVRA 4ZJUA 1RPZA 3PR3A 3DAOA 1EP1B 4Y1GA 1P8JA 4RHFA 4ES6A 3FOCA 4RKFA 2A14A 2ZUCA 5CMLA 1N9ZA 3G5AA 3MJEA 4J0IA 5ALHA 3ZCUA 5FUMA 4J1SA 1PWXA 4YR9A 1KDZA 5HMLA 2ACVA 5AD1A 2VJPA 5CA1F 3PB3A 4MI6A 1EXVA 5IK2D 2K5UA 2XNDA 4R81A 1XTRA 2F1HA 4FYMA 2VPWA 2B9EA 2IGTA 2JD2A 1W87A 4FEYA 3PHGA 1LWOA 4B35A 4DMKA 2QRUA 4M9RA 3FOWA 2ZXFA 2VVTA 3K9WA 3SNHA 1LLDA 2H1SA 3A6EA 3IBYA 2V6MA 4H7EA 3KFXA 3SFZA 3ZCRA 3W9SA 1E7MA 5CGZA 2EG5A 2JRLA 4BO4A 1YF3A 3PQ2A 2YIMA 2YUIA 1EVZA 1DDGA 5A5GA 2I4LA 1XMIA 1OI3A 2C4HA 3PNSA 1TKBA 5C7LO 1PVOA 3PEUA 4PC2A 1AMUA 2XUGA 2ZIEA 4R1QA 3PC4A 3WS7A 1XDZA 3JQ7A 4MKZA 5EKXA 4HVLA 4XGQA 5DK6A 2R6ZA 5K9ZA 2OD2A 2I6UA 3TDKA 4OTZA 1TC2A 1T2NA 2WFLB 2ZIUB 1JPJA 1UP6A 1Z9BA 1VGQA 3NC1C 2D5LA 4U3JB 2CDBA 1QAMA 2NTVA 4TLAA 1QIGA 3RBXA 4WLOA 1FYWA 5AW9A 4C4TA 3E81A 3OOHA 3BORA 5IG2A 2UXDB 1UBEA 3V8QA 3CT6A 2TRSB 3U44B 3IJEB 1Q3KA 2I1LA 3K71B 4BPBA 3MSXA 3GLRA 3AZOA 3OD1A 3GLIA 4EW6A 2VDRB 3DXFA 1EMDA 2IDKA 3IX7A 4J43A 4EAAA 4F5EA 1T5OA 1A5AB 4NBKA 1YT5A 3L8EA 1OHHA 1J06A 4KQGA 1JMKC 1Z6TA 5ED0A 4JBNA 3EH2A 1EZ1A 5JBNA 2DT8A 2FRXA 4YP7A 1PGOA 1Y33E 2GBFA 4XX0B 3E7WA 3E9YA 1M33A 5IDXA 1ZWKA 1Z2CA 1BX0A 1GAEO 2CNBA 3KJIA 1BZYA 3WY9A 4DCNA 3KEFA 1KMHA 3A4MA 3WHIA 4E5YA 3ICQB 4OUDA 4U8HA 4CGZA 2ZM5A 1J21A 1C50A 4QBIA 4C08A 3DMTC 3N5CA 1Z35A 3MVEA 1QTNA 1XMOB 4HWPA 4MB2A 4M8NE 3SBEA 3HJFA 4F92B 5JBQA 4DM7A 3P9IA 1IJFA 4H08A 4W8HA 3BQ9A 3IELA 2H4YA 2Z3ZA 3JQ7B 4M9UA 5CH8A 4MAFA 2BOVA 1O57A 2Y1XA 1FMFA 5EEGA 2Q5QA 3DTTA 1DTSA 4EUSA 1F3LA 1Z68A 4G5HA 3GRZA 3CLVA 3H6HA 5KYYA 1I2AA 3R5KA 4EYSA 3J81k 1MO3A 1E3EA 1XZPA 4QE3A 5AK0A 1OHHD 3WQQA 4NHEA 4XAQA 3SC3A 2VZEA 2FNAA 2VYQA 2EL7A 4ZZ0A 3R20A 1D6SA 1OFUX 2O1WA 4GVLA 1GV1A 4OI2A 4I1RA 2D59A 5F78A 3RU9A 3S3TA 4EL0A 2XWJI 2FEKA 4FOSA 2SKEA 4CF5A 2R4TA 2BH2A 4J6FA 2DWOA 3UYKA 2IZZA 3UGQA 2AHRA 2IVZA 2YW9A 4OXNA 2HRCA 3B5EA 2NZUG 5ALFA 4B9AA 2RSLA 5B64A 1B6GA 4CKYA 1RZRD 1PI3A 2JA2A 1KEZA 1UF9A 4I4TF 2ZJ6A 4BWFB 4F9GA 1L5LA 4GKVA 4JGIA 2RH9B 3SJZA 1FOEB 4JITA 4MUFA 5DLEA 3VX3A 5LOVA 3B8EA 3W2GA 3ZE8A 2PS9A 4KC0A 3RROA 1F8UA 5HJ5A 3FCUB 2PVSA 4QGAA 1FUKA 1AGRA 1MAVA 2IF0A 3O8QA 2CFCA 3WHKA 4EZBA 5A5EA 5GM1A 4HLQB 5BXYA 5JCZA 1DUIA 3WL3A 1PFVA 2VWQA 1POWA 2F4NA 1RJDA 1SRRA 3QI7A 1EUDA 1F1JA 1WW3A 2WSMA 5BV7A 5MN5A 4EJ2A 5BYJA 4DIBA 2QN6A 4CFYA 1C0LA 1TI7A 2POCA 4ZO9A 3CE6A 4JBLA 5A5DA 3TSAA 1JF8A 3KSZO 3MQFA 5A3QA 1NOJA 1S96A 1ZESA 2X9LA 5IK2A 3KG2A 1GJRA 2P9HA 3IXLA 4PLPA 1GZ4A 3EC2A 3WG9A 1SUAA 2FU5C 4ONEA 1W1IA 2ZK7A 3CJTA 1EWYA 2BFDA 2JAUA 4LJYA 4CEIB 4K87A 1OE0A 3D43A 4KN9S 3ETEA 5J9FA 2B5OA 4PQEA 2JIBA 3OPMA 1D7AA 1N9GA 2B34A 1PJ8A 3NOQA 3PXEA 4HYYA 4LRYA 4XW2A 3WWPA 1L7EA 3HGQA 4E2YA 5AW6A 5DNEA 3GLFB 3PYXA 1VCOA 3LTNC 1G21A 2QP9X 3DO5A 1MFZA 3BDVA 3LW7A 2OA0A 3FUWA 3LL4A 4Z7NB 5DHUA 1WZIA 2FN9A 2Q3JA 4LJ8A 1OH8A 2OZEA 2R84A 2H0AA 1HNWB 4AZTA 5JDCC 4DDHA 5J4VA 4XM2A 2VQEB 1N1GA 1HX7A 4RK7A 2GFQA 3L4JA 3U7FB 3ZGZA 3EXHB 4L3VA 2QZJA 4M1EA 4TMKA 5IDQA 3WGKA 3PHBE 1IMOA 4ND4A 1KP9A 4UDYX 4FHDA 1FIUA 2FAXA 3O2NA 1W6RA 2RHJA 3IR5A 1JU9A 1YR8A 3V4FA 5C8VA 4CM8B 3KKKA 4OP2A 1DAFA 2IP2A 5F1YA 5KMGB 3IOCA 4OHBA 5ILQA 3TOCA 5HZGA 2NZXA 5B3AA 2GPSA 2PLNA 2Q62A 3AK4A 3WGOA 3OCWA 4LGYA 5IJXA 1QUEA 3U56A 4WINA 3V4LA 5KB3A 3CKLA 3Q7RA 2AKYA 1CG6A 1KAEA 1U2SA 4I5IA 4MLCA 1QH1B 1X0VA 3JXEA 4DARA 3I6MA 1OA0A 1GNPA 2GCIA 3O92A 5IRCD 3EGCA 1VHTA 3LX8A 4HEA1 3N86A 4IZHA 5ALTA 4QYXA 5ALOA 4OA8A 5EHGA 2CXSA 3RBZA 5KVAA 1RBZA 4RTPA 2NPFA 1TYEB 3JVIA 4PIVA 3NBZC 3OPNA 3AW9A 1FYVA 2IYYA 4AJNA 2CVQA 2HNAA 2HLDA 3AH8A 3KJNA 4L4YA 3S70A 5A9SB 2B4TO 1CR4A 1WAMA 4GZMA 5JCXA 3Q2IA 3DCIA 1BSVA 1X7YB 1U65A 2DKOA 3NHJA 4U0KA 5FTWA 5TS2A 4ENUA 2VS1A 3L0OA 1RYZA 3GP3A 3KPVA 3L7LA 3G59A 4L8YA 4YAFA 5DT9A 3BJZA 5FI0B 2JLUA 4A8JC 4TKLA 5AJXA 3VR2D 1A9XA 3U39A 5EMNA 4Y6OA 2X3UA 4CM8A 5KOHB 1UM9B 2XWPA 1HE8B 3DGFC 4RACA 3ZJVA 4F56A 1I7LA 4K28A 3F71A 1IRIA 2WZDA 4MI1A 4YRQA 4B9EA 4BQEA 4PG5A 1HYQA 3EZLA 3TLJA 4CN8A 4TZKA 4MYUA 1CC1S 4TTIA 2E55A 5EJAA 4QUDA 4QZVA 3G9ZA 3L9XA 1ZJ4A 2X22A 5EZYA 2OO5C 3IP9A 4H7KA 3SZUA 4P58A 1G21B 2EP8A 2OXTA 1R4MB 3DV0B 3R75A 3HEMA 1M5UA 2XA2A 2XGJA 4RQTA 4FDLA 3RR2A 1SC6A 5LC1A 3AV0B 2I8AA 4LDQA 4B3MB 1ST2A 2GTIA 2VRWA 3N2NA 4IS2A 1P4GA 2ZJ3A 5KBYA 2ZCJA 2N47A 2XQGA 1X3LA 2GAFA 3CXUA 3UATA 1HFWA 1WHSA 4N41A 1K68A 2CKMA 3CG0A 5BUSA 3TM5A 3PPVA 2AVNA 3RIGA 4NJEA 3BWBA 4HDNA 1E63A 3FDZB 3DQPA 1JJAA 4CLXA 4MGEA 4UM9D 1NSTA 3GFRA 2DCMA 4OI0A 4E5MA 3ZLVA 3GDWA 3BKWA 1JDBB 2C9ZA 5LBTA 4JJIA 4PE5B 1GQYA 3ENWA 1L7OA 1AHPA 4K26A 3IAAA 4AS3A 3BXHA 4B8YA 4WESB 2V7GA 3K8OE 4YGYA 3QE4A 2OTCA 3AVQA 3ETNA 5IP5A 1ZCZA 2XKBA 1MIHA 4QQRA 4R2HA 3Q7TA 1ZOPA 1W85B 2I1QA 5HJ2A 4G9BA 2Z9BA 2XITA 4LY6A 3ITNA 5DLPA 3AZPA 1G9SA 1EVIA 1IXRC 5BRNA 3GUCA 4KV7A 3F6RA 2I7XA 4K8RB 2PZJA 3EVDA 3ZGYA 2I4NA 2H1FA 3ND7A 4QTYA 1XZHA 1UOEA 1R8SA 1LCIA 2JI9A 1J39A 1ODSA 5HF5A 4NBVA 1SPXA 2O8BA 4WCFB 4E1AA 3JYQA 2R8XA 3MGKA 3H1AA 5C1IA 1U7WA 2JJ2D 3C3YA 3U16A 4RK5A 1N2HA 1G20B 1U8CB 2PYZA 3I28A 3AKEA 3PYMA 3IDOA 3S2FA 1WKBA 2ECPA 2XQVA 3ASUA 4HF7A 2B9VA 2FN3A 5KYYB 1Z0FA 1L5YA 2YJNA 3JATA 4L75A 2X86A 2WHPA 2ZUDA 2PRKA 4BEWA 3SQLA 3MJSA 3EQ9A 3GMDA 3RASA 3LHKA 4WHMA 3RQIA 5I3CA 4OVKA 3X1XA 4V1CB 3I1FA 5CIYA 3WNZA 2KWIA 1KSHA 2Y92A 3S7TA 4I55A 3SAJA 3ORRA 2DTDA 1Q91A 2YW2A 4M0FA 2V7VA 3AIKA 2PZ8A 1ISRA 2C5FA 3HP1A 3COJA 3TLKA 2IEYA 4DR2B 1X80B 4YTEA 5ALQA 1FL9A 1WPRA 2Z2KA 4QJ3A 1CVIA 2BHNA 1UMKA 2A3NA 2VJCA 5E1BA 1M74A 1YUMA 3UNXA 4RTOA 3QEMA 2P6RA 1JW9B 2RI6A 3K30A 3H2ZA 4XSVA 5FEUA 5FL7D 2LCQA 2GAJA 1I8TA 4W5TA 2OZPA 1GDTA 3W5AA 1ONBA 5DHQA 1PRYA 2CBZA 1IUKA 3V6LA 1TCUA 2Q41A 3EEQA 1K0FA 2VP0A 10MHA 1HE1C 1K5HA 4OUKX 2DCUA 3WMRA 3RNLA 2QU7A 1OLSA 3F90A 2G40A 1WD7A 4FCVA 1CX9B 2XXAA 1FFXB 2B1RA 2P8JA 1QFXA 2BEJA 4TYPA 4NYMR 4K9DA 4MUBA 3IP3A 4OGLA 1B14A 4EEZA 1C5KA 3GJRA 5A7FA 4J29A 2HZ7A 5A3VA 3W8EA 5DYYA 1BIFA 3STXA 3WKAA 4AIIA 5J4YA 1W9MA 2ZI9A 1QC5B 4MLZA 1Y7LA 3DFZA 2JH8A 3FFWA 2JI6A 2HPVA 2ONYA 3A4VA 4A92A 1B3BA 4MS3A 4P3XA 4CE6A 4CM9A 4F3KA 1JZTA 1C8LA 1Y1SA 4TLCA 3Q7PA 3IH5A 3H65A 4URYR 2ZWPA 3E22A 2PLFA 3LUKA 3O8LA 1WMBA 2I2XB 4B6EA 1Y1RA 3PTZA 5ISMA 3BHMA 4P34A 4L9SA 5TQ0B 4YPOA 3V1KA 3MEQA 3STHA 1AB6A 5DEOA 2SKDA 3EFEA 1PJ4A 1ZUD1 4KGDA 2FG5A 2QX8A 3MF4A 4FGLA 5FO1A 4C4XA 1O1YA 2NU6B 2AUNA 5AXBA 2YMMA 2YZ2A 3KJZA 1ZI6A 3QVTA 5GV7A 4CMAA 3D0RA 4LV5B 4ZZIA 3Q3IA 2W6ID 1L8XA 4S05A 2E5FA 4EGFA 5B7PA 4RWZA 3ZHVA 4CFZA 5AKLA 1RLUA 1T8YA 1TOAA 2IODA 3B3QA 4BECA 2C1EA 4WD3A 1H9CA 1ML4A 4UEWA 1FJGB 4LNAA 1N4DA 3VV3A 5MGNA 5KNLA 4MDEA 2Y1EA 3BD6A 5FBLB 3CUYA 4ZT2A 3K1YA 4PINA 2WWFA 3FJOA 3HO8A 3DWGA 1XEXB 1ONSA 1CUYA 5K3DA 1YBAA 3JQPA 4MQUA 3EEFA 3RIYA 3BK2A 2Z08A 1IOWA 4PPGA 1Q84A 5IUJC 2FK8A 2ZWMA 4GLJA 1F3OA 5HFNA 1BROA 3BPSA 3O21A 2W48A 1NLZA 4ZI3A 1J0EA 5E6UA 3MGGA 5EGSA 3FPHA 3DXZA 1T6NA 4TM8A 3WRXC 4V2IA 5F2NA 1Q20A 2OHXA 2XA9A 1N0IA 4B0OA 1Q5PA 4N3CA 1XRLA 3N76A 3KQPA 2CLMB 3MWYW 4HOYA 4OQLA 4B34A 4BP9A 4F7DA 3V8PA 1JR6A 5G4KB 4J0FA 4I2NA 3VZBA 5JCPA 2CSUA 5CXQA 1J24A 1H42A 3C3PA 5KOYA 4UOEA 1CE8B 5HWSA 3RKSA 5CNJA 1O5TA 2VOJA 4QFDA 5JD5A 1F2DA 2H0RA 2ZJ2A 3CRRA 4R1OA 3C3AA 4YRDA 2C2OA 1PTJA 3WLFA 3X44A 1Q0RA 1UWCA 4PS1A 3VAAA 1L7NA 2DQSA 2G9NA 4DR6B 5K8LA 2OMEA 1HOTA 1NGSA 2ORED 1NOKA 3MQ4A 4GM4A 4R51A 4MUEA 4WW0A 1W5EA 4C21A 2B3TA 1TZJA 4A0GA 1FU7A 4D98A 5CFMA 7ADHA 4GOXA 3HG7A 1QCZA 2F8MA 1VKHA 3H1PA 3K8QA 5KPJA 1SEPA 1O96B 1WETA 3BJMA 1Z3IX 4QUIA 4CNBA 3RC9A 5CAEA 2DHQA 5LLSA 1E0AA 2MMGA 1XEXA 3T4UA 1EI9A 1S4QA 2RBEA 4GECA 5HRUA 4AY5A 3DDCA 3MRSA 3EEBA 1IOVA 4NU0A 4EKDA 3C7AA 2IPOA 1YONA 3GEHA 4NJMA 5GZ1A 2I2AA 2AZXA 5E7JA 3ZW7A 3EVNA 4OLBA 2O1SA 7REQB 3DYIA 4L85A 4F96A 1EP2B 2PV0A 3Q40A 3W9YA 1D2GA 3FXAA 1LQ2A 3VPXA 5FBHA 1TE2A 2C3MA 4GMGA 2D00A 4ZOEA 1C7JA 1P45A 2DT5A 5C3UA 5CEEA 4N82A 5FUYA 4JYPA 1QQ5A 3BH0A 1HL3A 4MW7A 4P7GA 1PS8A 3NGLA 4PLGA 2RAPA 5JAHA 3PDIB 5J5AA 4CM5A 2F9FA 2A3RA 2BP7A 3AJDA 3PDCA 1BHQ1 4L15A 4EMSA 5EWJB 2YFHA 4N7MA 1T2UA 2JK0A 2Z6UA 3ONVA 1LJ8A 4Q9DA 5CCXA 3N87A 4TKMA 4KW7A 3LVFO 3PHJA 4BNLA 2ZDGA 1H9BA 4D6PA 1B42A 2H3EA 1L8OA 3KEOA 4YV1A 3MWFA 3IB3A 1NTRA 4W82A 1YJ8A 2GPNA 4IDHA 4WMLA 1YJAA 1KMIY 2HCRA 2PWPA 4P3NA 2Z2IA 1EYZA 3OBBA 3WOVA 2PXAA 3WMGA 4LZPA 2BR4A 2J9FA 1R50A 1CJTC 1H85A 3K35A 3OHSX 1RPJA 2A0KA 2V8OA 3TAUA 4M38A 1XR3A 4KU4A 5FLXA 5EIHA 3D8RA 2GJKA 1KP3A 3H9GA 3GT0A 2VNIA 4J3JA 4DYHA 1O89A 2X7JA 4FSDA 2DFLA 2A35A 4MYDA 1EUCA 1PR0A 4RO0A 4YPFA 2HDNB 5AFSA 1TIPA 4KWTA 4OO3A 2IQ5A 5FI1B 1L5FA 1Z0SA 4XFKA 3UZUA 1Z5WA 2DFNA 1P9RA 2BJHA 2W00A 3COPA 2JLSA 1S8OA 2I3DA 1P39A 3HFGA 5PNTA 2ZWIA 3OI7A 2VDWB 4DLAA 1XJ0A 3AWIA 2PUWA 4G0UA 3W5CA 4R1TA 1BFDA 1IN7A 1HQDA 2DBZA 3SQDA 4DLYA 2RD2A 3UJCA 2CNNA 2FSSA 2IW1A 3KEGA 4OYHA 5IARA 3KOUA 3GZNA 4NQZA 2CSXA 3HUUA 4EITA 4TV9B 4BV9A 1U31A 1OJ7A 3I1JA 1H65A 3UWPA 4FZ3A 4PZZA 2Q5EA 5BSFA 3AMVA 4WNAA 1XJ5A 3ZWMA 4YBZA 1U8UA 1GN9A 4Q7MB 5KTNA 2QTVA 2KPOA 3L8CA 1BS2A 2M32A 4BX3A 4LYHA 4B46A 3VBEA 3U09A 2R6AA 4A27A 4GRAA 3OE1A 1TTPB 1Y3CE 4MV5A 5A71A 4CL3A 3EUFA 2Q5IA 4AURA 4MV1A 2FQQA 3HMKA 2XTAA 5ADVA 1QH9A 4YMWA 3TOXA 3HR7A 1X94A 2AUMA 1QQTA 1S8FA 3IT3A 3EEYA 3K9QO 2CLOB 4OCZA 4CU5A 1IXYA 2Y6VA 1GA4A 3WTCA 3UMRA 5TGTA 3DZHA 4YRKA 3BDAA 2EX4A 3MOGA 4QEKA 2PUFA 3ERCA 4CM9D 5EL0A 3FRHA 2BISA 2PFKA 5SZJA 5K8TA 3WJ2A 5CCBA 4M4SA 3OVMA 5JCOA 4D81A 2IPNA 1JBKA 2ZWAA 3QPAA 3ROEA 4XVUA 1RJGA 1DINA 3ZBTA 3DG9A 4EX7A 5BMVB 1ZJ6A 3CF0A 1A98A 5H59A 4RADA 5JMPA 4H7JA 2FFRA 1ZQ9A 2QPAA 5F52A 2JIOA 2IWRA 3THXA 4BE7B 1DC7A 1W4AA 1WA5A 1UINA 1A82A 3ESQA 1Q3HA 3LWBA 4QHTA 1OH6A 4C6TA 3K1JA 4HDKA 4OFWA 3HU2A 2B98A 4A9AA 1OZ0A 2ZJ1A 1RCFA 1FSPA 3HKBB 2XVMA 1JR3A 1JH8A 1Z47A 1XC7A 1SJ9A 5AKZA 1QGED 2PH7A 1BKYA 3GH1A 4BRZA 4ETWA 3CF4G 3ANNA 2ZW9A 3GLFE 2MYPA 2XRZA 4R9SA 3JQ8B 3BULA 3RU7A 1FC0A 1T2DA 5BSRA 4C5CA 3RLIA 4ZYLA 4Y18A 2FFQA 3HDYA 4YMTA 2H7VA 5KYKA 2HLPA 4S2EA 3KVRA 1NDQA 3S1LA 4YT4A 3WLRA 1R5NA 1CRQA 2X19A 2AFHE 4ZI7F 2Q9AA 5IAOA 2QAJA 4B83A 3UGKA 2RGYA 1FNMA 3IXMA 5EMMA 1UMCB 5FBKA 4QT0A 4BJ5A 1ODFA 2PSDA 4HCJA 4G0NA 2UZ3A 2GCGA 5DK4A 2V58A 4CN9A 4O4JF 2IBTA 3PE4A 1LNZA 2PRYA 3KM0A 2JF0A 1P2TA 3H0CA 4XB2A 3ET5A 5LXTB 1K75A 3GYGA 2P3SA 3AR2A 3CN7A 2AI2A 2PYDA 2B82A 4LJLA 2O8DA 4QG3A 4CI9A 4L07A 3KQUA 3THXB 2BYTA 2OV3A 3FI9A 3IRUA 3H1EA 4OHKA 1JSCA 4EG4A 1U3DA 2X9QA 2X8JA 3AKYA 1KK1A 1G291 5CB6A 2GAAA 1M1UA 2Q2NA 4YRRA 2I0FA 4R5HA 1TCAA 4YP5A 1VLQA 3NNDA 4JY7A 2OYSA 3C41J 4YC7A 5CVCA 1M83A 4MVJF 5IANA 3K2BA 2R3SA 4UBJA 4YDSA 2RBKA 3IUQA 5THXA 4KOAA 4IMIB 3CISA 3B1FA 4NL4H 3BWXA 1Z73A 4H59A 3WJ1A 3BVPA 4WBNF 5EXTA 3TLXA 4PHHA 4FYVA 1XP8A 3SR3A 3W78A 1DKOA 2HA5A 2JJYA 3K09A 3HWRA 1PR1A 4X61A 3R7WA 4HRYA 1E2NA 4FFRA 4BNWA 3TTTA 4DLVA 3D64A 2I7TA 4LZJA 4CLOA 4A15A 1WKVA 4W9NC 1GU0A 1S8AA 4E5SA 3AY6A 1V3UA 3DKIA 1AURA 3OT5A 1YQXA 3Q9LA 1KSJA 4IICA 4RJKA 3WR5A 1IOZA 3GELA 1SG6A 2VC2B 2ZE8A 1WXGA 5IJWA 4JOSA 2Q28A 1QNLA 3MFQA 1HZZC 3FKJA 3IMEA 1VYUA 5DSZA 1H22A 1JILA 4DMRA 5BVHA 1Y37A 4UXJA 3E0QA 4BDSA 1K6JA 3I2JA 2HH9A 5FRDA 5IMSA 1JDNA 4QKQA 4B71A 4LDRA 1G6KA 1KMQA 1KZ6A 1QG0A 2BKUA 2JCGA 3GVHA 4H7DA 4B44A 4QA9A 2A6PA 3IOBA 4JVOA 1I7QB 3FNQA 1Q0UA 3GFBA 4IH4A 3LXUX 4P3OA 2NXWA 4B47A 1SMKA 1EUCB 1U63A 1ZD1A 5D5PA 1PBNA 1BWRA 1P3Y1 3ESZA 3UUGA 3OLQA 5IN4A 2DTEA 1NI3A 3GLFA 3QE9Y 5AJUA 4DWVA 1THTA 2A9KA 4N48A 5IT4A 4ZCLA 3PS9A 3JQAA 3ECSA 2HIGA 2QZSA 5GMOA 3A58B 4WNCA 5FUWA 4MLDA 3TINA 3E18A 2FDCA 4L78A 2IV7A 1C1DB 1U7XA 3EWAA 3T9BA 1ULTA 1MEOA 1VPVA 1EFPB 4ZEWA 2AK3A 1U94A 2V8BA 4WZAA 2P2SA 3GIWA 3PEEA 1NDUA 3PC2A 3EH1A 4WXEA 2YNMC 3FYUA 3ECCA 4NBTA 1ZVQA 2HNKA 3UA3A 1IUPA 2QMOA 2G9ZA 3O7WA 5LYYA 1E2GA 3RUDA 1PF7E 4DMFA 2X5JO 1Z4NA 1ENOA 3TEFA 3ORYA 4JROA 3AESB 3NPAA 1E0JA 5FTMA 2Q9UA 2NO6A 3I39X 3QF7A 1GPWB 4DJTA 2D0DA 5JZSA 3H16A 3JV7A 3FJYA 1JEAA 1T0PA 4Q6WA 4PRYA 1TK3A 1V8BA 3DFMA 5U4QA 1R0WA 4RY0A 5IF9A 1YA4A 5JWHA 1BWPA 1XZAA 2O4UX 3VM6A 4CDNA 3TGPA 5EI5A 1T13A 2JFBA 1GCAA 1GNLA 1OH5A 3L05A 4HY3A 2RGNA 3VVLA 1Z2AA 4P3YA 5IS2A 5EIWA 1OB2A 1ZXXA 3RVBA 4DC0A 1YA8A 4LJAA 2RGNC 1IM2A 4G5QA 1N2SA 5DMXA 4KL8S 3V1YA 4ZVPA 5HCIA 4EYGA 4O2AF 3HLKA 3TNYA 4F6CA 4INJA 2XCIA 1Y7IA 5K6RA 3MMZA 1U5BB 2IRWA 1O95C 5HKLA 4GWKA 4AFNA 3PUKA 2HW8A 3I12A 3E84A 5HRCA 1L8LA 2QZ4A 3P9NA 3RK1A 3DULA 3O2SB 4H7HA 4LV6A 4X3PA 1X6VA 4CIXA 3QPBA 4FK8A 3IUMA 2PKXA 2Q1TA 4WOCA 4Z0HO 1RWPA 1SD2A 1F7UA 4YIHA 1QPGA 2DBQA 3RSGA 3RU3A 1X13A 2CMKA 2WZBA 3IPXA 4UAGA 4RIHA 3FRIA 4F72A 3LF2A 1U4OA 1XZKA 3RSOA 2O4CA 2QV7A 2KB0A 1HT1E 1SU8A 2ASEA 5EFZA 4TMZA 5C1OA 3K1TA 2IUYA 4O59O 2W42A 2VHXA 4TQUS 4MRAA 4BGIA 1X1CA 3VISA 1TYZA 4I5FA 1XZCA 2YINC 3RTEA 1I7SB 5JR3A 1B0UA 1CUVA 1EE2A 2HA6A 1E62A 1FP2A 4DG5A 4LYFA 1P8AA 3HDHA 4OG2A 4U9UA 1G9TA 5L4NA 3RSQA 4X63A 1J23A 3OCCA 1M6VB 1V5IA 3QXHA 3HY3A 2O5EA 2AJBA 4YXWD 3OZRA 2IC5A 4GBED 1WL8A 1ZU4A 3QEJA 1GPJA 4BAZA 1YDFA 2VJOA 1JU4A 1WOYA 3WC4A 2WC1A 3F9RA 7ABPA 3GNTA 4QEZA 1VBMA 1CUJA 2EKPA 2ZI5A 4IZ6A 4PGGA 3DFIA 4RJJA 5K3CA 5G2OA 5ER9A 3Q6MA 1Q11A 3CNBA 3CZ9A 3MUOA 3DL0A 1ENZA 1SKBA 4IIDA 4A8JA 3TRKA 4IOLA 2J85A 1XQWA 2NO9A 1GZ7A 4EMTA 2R4QA 4JNCA 4G3XA 3S8MA 4OIFA 4WACA 4Z0PA 4QYMA 5BVHB 1HZZA 3FR7A 3LC1O 9MHTA 1QHSA 2CLFB 2GSWA 1OUMA 4D8VA 5E4JA 2X2EA 4H35A 1Q6YA 1X9HA 1U1IA 3AM4A 4U39A 1T2AA 1SXPA 1XLWA 3FUCA 1E6CA 2FMHA 5C4MA 1YB1A 4D92A 2XUDA 3B7WA 3RFFA 2CCJA 1ETUA 1IHPA 1DXHA 1YDGA 2VNSA 2Q4OA 1QNFA 4HDOB 3RSSA 1YZ3A 2OCYC 4LN1A 4MA5A 2VJAA 3U7HB 2A88A 3RCBA 4GYWA 2FKNA 1CQIB 3PXAA 4F38A 1Y6GA 5SZKB 1BHJA 1R37A 1RMYA 2BJWA 3LUAA 3QFFA 4NPAA 2HEGA 3VR6H 5LOVF 1Q1NA 1BNCA 2XF2A 1LZKA 4RV9A 3PCRB 4GXTA 3H4MA 2E48A 2GN9A 2XNDD 4LZLA 2V3VA 3EASA 1SCJA 3I01A 2PGAA 1RHKA 4G0PA 4UUPA 1O4WA 1QO9A 3A7DA 1NUHA 3DEIA 1M5TA 3G7SA 4MRRA 5EERA 5DF1A 4BGEA 1ZIOA 2W2LA 4C1NA 1BD3A 1S2MA 5CFRA 2CNWA 3QYPA 4OK6A 3LX4A 4IDQA 1Y34E 2UYCA 2I6FA 4WBXC 5COAA 3WYCA 2F62A 5JWOA 3CLUC 4LS3A 3ZH2A 4Z7OB 4GUDA 1C9NA 5TPWB 1HO3A 5TLSA 4NCBA 4Z4EA 2Z2ZA 4KZPA 1KETA 3PX2A 4QNMA 2IW3A 4XIYA 5I9TA 1W48A 1E2DA 1IK4A 1FK8A 2WILA 3MWDB 3R4CA 4KQ2A 4AX8A 4GZ5A 5JWRA