4Z0TA

Crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
IDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis.
rcsb
source organism Brucella ovis
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short-chain dehydrogenase/reductase family
total genus 89
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z0tA00
5ER9A 2FOIA 4PLGA 4CM9A 4JP2A 4AG3A 2NM0A 4L9RA 3U4CA 3OMLA 4WOKA 3GY0A 2IXBA 4IS3A 3WGQA 2PKQO 4ALKA 3GC6A 1KC3A 3ENKA 2B37A 2NUAA 4P4NA 1DC3A 4XQGA 4JN6B 3PQFA 5JAIA 4OGWA 1K6IA 4YXFA 1U2DA 5AOVA 4MP8A 3ZWPA 2OHXA 3IUPA 4EYEA 4QFDA 1A72A 4F46A 2NLOA 5IFLA 3HDYA 3TZCA 4KTVE 3SJ7A 1YJ8A 4Z9FA 4R5MA 5A04A 2WD7A 1NFQA 4R68A 1DXYA 1U3VA 3MJTA 1AN9A 4Y67A 1WXDA 3K5PA 2JFHA 4A26A 3GDFA 5GY7A 3GHYA 1DHRA 3AUTA 1IZ9A 4BKOA 2CVQA 2ZJ1A 1C1DA 3NJ8A 5JBIA 2V6FA 3PHHA 1OOEA 1LUAA 4FC6A 1ULSA 4IDEA 3RASA 4R16A 2C5AA 5CG1A 4RPLA 4DRYA 3DFUA 2VHVA 3JQFA 1HSZA 2GUGA 4IXTA 5HWSA 3ONFA 4FW8A 4HFJA 4YBZA 1E6WA 4E3ZA 1Y81A 4WCDA 4BNHA 1CQJA 1HE5A 1VL8A 3O26A 1JDJA 9LDBA 2UAGA 4D44A 4FS3A 2FR0A 3GLQA 3LC7O 5BNIA 1V3UA 4H16A 1Y8RB 1N7HA 2UDPA 3B1KA 3PDJA 3QWHA 4XGIA 1K6XA 3S2EA 3DBRB 4XCVA 3WNVA 1NQAO 3WX0A 5L9AA 4TRMA 1MLDA 3CINA 2WMDA 4J7XA 4WEQA 2JFFA 3WYBA 3ZWNA 1QYWA 2BMAA 3TZQA 2PY6A 2X0NA 3WMXA 5AYVA 3VKUA 2XXBA 4J90A 3G3EA 3MZ0A 3PI7A 4FBGA 1SNYA 4FN4A 4RF5A 4B3IA 3GVXA 2HMTA 5FI5A 4A2CA 1KVUA 3S55A 3JQGB 2XXJA 4UUNA 3FF4A 2VWQA 4RLSA 2B0JA 1WMBA 5AXAA 4DYVA 2X5OA 3LZ6A 2B4QA 2DLDA 2BI8A 2J8ZA 4ROSA 1HZJA 4K6FA 2FP4A 1NWCA 4ITUA 4Y6PA 1Q1NA 1P0FA 1ZH8A 3FTNA 2VTDA 1RM4A 1UZNA 3TNLA 4TZKA 2FZWA 3BHMA 1LTHR 4IMPA 3ZWAA 4ZN6A 3T7EA 4WJZA 5F21A 1FMCA 3WGHA 1GCOA 1M75A 1J0XO 4XZ3A 3FNHA 3AWDA 1I2ZA 2P9EA 5B12A 3MEQA 4NBVA 5IXSA 5JE8A 4GLLA 2NACA 2HDHA 2W90A 3KHUA 3ROMA 1GYPA 1BRMA 3RU7A 1XQ1A 1WDMA 2HJSA 2NTVA 3M2TA 5I8WA 1UP6A 4M89A 4J49A 4ND2A 3STHA 4ALMA 1SO8A 5DULA 3RUIA 2NQ8A 4BNLA 3D5TA 1ARZA 8LDHA 1VKOA 5DOZA 1ADCA 4UUPA 4YJGA 2RBEA 3VPGA 4BGIA 1XLTA 1GUZA 1O5IA 4Q3CA 1P45A 4CMGA 4FOOA 4HWKA 3G0OA 3TZHA 1UP7A 3FNGA 4PFJA 4ALIA 2HK8A 2AE1A 4A27A 1ZMTA 3HJAA 3E5RA 3RU9A 3ZCXA 1MC5A 1ZEMA 4EDFA 4ZU3A 2FMUA 4DIBA 2CDAA 4XJSA 1E6UA 3RUCA 4IUYA 4J91A 4BO9A 4E2XA 4Y6SA 3E6AA 2JFGA 4N5LA 4Y8VA 1QP8A 2X23A 4YT8A 3O8QA 3KB6A 4BO8A 4RZHA 2VCYA 1B3RA 2ZQZA 2YFQA 3A4VA 4RF2A 1FDSA 2XPCA 3CZMA 4MJLA 3F47A 4N54A 3Q9NA 2Q4BA 4BNIA 1KEPA 3VH1A 4BO5A 1OFGA 2OORA 2TMGA 4L75A 4J2OA 1K2WA 5AQ1A 1ADBA 2VUUA 1Y6JA 3QV1A 4Z6KA 1HYEA 3H3FA 4RVDA 4R1SA 3ZV3A 4R4JA 5I7FA 5HS4A 2X9VA 4J1SA 1LRKA 4BNXA 3G79A 1E6EA 1DIAA 5F5LA 3W6ZA 3CTMA 3QLJA 3QVOA 5JY1A 1GYQA 4KQXA 5ILOA 1C3VA 1M6HA 2FR8A 5F1PA 4DXHA 3ETEA 3PWSA 3QVTA 1JU9A 1NPYA 1HL3A 4CMEC 1PL6A 3UCFA 1E3LA 5LCXA 1T2CA 5KCZA 1A9YA 4DQXA 1I01A 1PJCA 2FN7A 4S3MA 4YPOA 5JNLA 4QT0A 4CJXA 1E0DA 2DU8A 4CLHA 1YL6A 1LDGA 2Y93A 3H5RA 4OL9A 4NK4A 1BVRA 4Y9DA 2PD4A 3WQSB 3V1TC 1IZ0A 3KYDB 2NV6A 4CMIA 3RJ9A 4Q3BA 4E21A 2HRZA 2ZTVA 3MOIA 3OETA 5H83A 2YJZA 5AXBA 1XR3A 4QTZA 1PR9A 1PGJA 1YBVA 2HJRA 4JP3A 2V7PA 5G4LA 4YAIA 3ADOA 1NX6A 2AA3A 5DCUA 1NFRA 5L4NA 4KWHA 3WWZA 1E7SA 1X0VA 1Q0HA 4E0BA 3JD3A 3O38A 1XWFA 1C0PA 2AEMA 3TOZA 5TC4A 3KEOA 3WWYA 3G1UA 4ND3A 1PWXA 4CODB 3E18A 2BFMA 1DC5A 3EC7A 5I9LA 3JQ7A 4YJFB 1E3WA 1PS8A 1Y5MA 3DBVO 1H9BA 1P44A 3VPXA 1MP0A 4MVJP 4PLTA 1D7OA 3DOJA 3G1TA 3BMQB 3RQSA 1Y9EA 1AGNA 5A9TA 2GR9A 2AMFA 3ZU5A 3NEPX 4NBUA 4M8SA 2JD0A 2ZQYA 4U5QA 1LLCA 4PIVA 3ZV4A 4RPKA 4ALLA 4BKPA 2F1KA 3O03A 1QLJA 3VZQA 3SVTA 3OICA 1FJHA 5GZ1A 1C14A 2FZEA 2DC1A 2NNLD 1LXCA 4OKIA 3VPSA 2ZATA 5JPIA 3LVFO 1TT5B 1H2BA 2UV8A 3Q2KA 4J4HA 1HDOA 4IMRA 4NBWA 1HZZA 3B20A 4OSPA 4XYMA 4FJ1A 2VNAA 4BO2A 4N5NA 2Y1GA 4XKJA 3H4VA 3JYNA 1JAYA 4BS9A 4YRBA 1A27A 5CDSA 5I7EA 3RFTA 2O7SA 3Q11A 4B4OA 4CV2A 4YJHA 1LDBA 1FXSA 4MVJA 4ZGWA 4UVGA 1E3WB 1R0SA 2I6TA 3JCZA 3OHSX 4DLLA 4B4VA 3WGOA 1YWGO 1ENZA 4E5YA 2J6IA 1PJBA 4BHTA 3ROQA 2FHSA 1A7AA 2Y0EA 4OIMA 4YACA 4BNNA 2WDZA 1PSDA 4D46A 3GDGA 1DLJA 1N92A 3HNPA 4RF3A 3LT2A 1KBZA 4J9VA 4O5OA 1T4DA 3PYLA 4WKGA 1V9LA 1IPFA 1MXFA 4MIYA 4IIVA 3DMTC 1E77A 3TFQA 4DIFA 3ZWYA 3JD0A 2VHYA 1IHYA 4IDFA 5T57A 2D2IA 5IJZA 1GL3A 4PG6A 2QZZA 2OFPA 3AUUA 1HXHA 1EE2A 1H9AA 3WLEA 4WECA 4NDNE 1QYXA 3JQ9A 3WFJA 2Q1WA 1Z82A 5JO0A 4KQWA 4II3A 1MB4A 3ZU2A 1Z73A 3D4OA 1HYGA 1O8CA 4TRRA 4WPGA 2HLPA 4FIZA 1DDOA 1E7RA 1ZK2A 3AFNA 4I5GA 1O95A 4RGBA 5HBRA 3I9LA 4JK3A 3WTCA 5LC1A 2DTXA 3UAGA 4CV1A 3GVPA 3RFXA 1LJ8A 1H2HA 4BNGA 3GUCA 1NNUA 2PFGA 4TSKA 3ZWVA 4CPDA 1U5CA 4AJ2A 2AE2A 4NU5A 1LC3A 3QVXA 1WAMA 4NBTA 3HDQA 2DBVO 5JDIC 3X2EA 1LC0A 1UXJA 4WLVA 2NSDA 4E6PA 5KJ1A 3H5NA 3I1JA 3JQGA 4WLFA 2GGSA 4D3FA 5JDCA 3E48A 2Q45A 1FDVA 1EUZA 1RM5A 1M66A 3L6DA 3ZHYA 2CF5A 5BSHA 2BH9A 1HKUA 1PGOA 4IM7A 2WEKA 2WJPA 7MDHA 5B37A 5JY6A 4Q39A 4BKRA 5JCXA 1UH5A 2DFVA 3L6OO 1FF9A 1UZLA 3P2YA 4J0EA 3DC2A 4OAQA 1I2CA 4LMPA 1YO6A 4GX2A 1EFLA 4LSMA 4CM7A 1GDHA 4XX0A 1N1GA 3WSVA 4PZCA 3HQ4O 4U7WA 4NJMA 1YE3A 1P1KA 3DBRA 4K28A 3L9XA 2C5EA 2YDYA 1NR7A 4J2HA 4MOWA 2BFPA 3HFGA 3KEQA 4GWKA 1W0CA 2UYYA 1A71A 4FGWA 1R12A 2ZCUA 4IPTA 1LLDA 2O3UA 1I30A 3FI9A 1X14A 3JQEA 3QP9A 1HWYA 2FPIA 2E37A 5DBIA 3ZHBA 2FSVA 1Q0QA 3EYWA 4UEKA 1F14A 3ZW9A 1I10A 1EK5A 2J3JA 4ILKA 5KOIA 2VWGA 3PVZA 4GVLA 3BAZA 1BXGB 2YHIB 1ZK3A 1OZAA 3BMCA 4TVOA 4A73A 3SJUA 2QX7A 3ZDFA 4BNJA 4PLYA 1GQ2A 3JQDA 3S2GA 2CFCA 1HE3A 2EWMA 4KP7A 3ZU3A 3BIOA 4AICA 3WGTA 1U28A 3BMNB 2NWQA 4CQLB 2Q2QA 3LYLA 4XQEA 2I66A 3JD1A 1HEUA 1EE9A 1OAAA 3U9LA 4HV4A 2X9NA 1DC4A 4DBVO 3VDQA 4OSOA 1X15A 4I1IA 2AQHA 2Y0CA 3U62A 3LF1A 1IHXA 4PZDA 5KJFA 3B1FA 1MGOA 2DBZA 3FNEA 3LC1O 5FF9A 1E1NA 5L7WA 4TMFA 5I7SA 1Y5RA 3MTJA 3UN1A 3PHJA 5I7VA 1ZSYA 1DJQA 2WYUA 3UGKA 3PFWO 2F00A 5HTOA 1Q0LA 3IJRA 1JLLA 4CQMA 2VT3A 4E2WA 4IXWA 2VZ8A 4GSKA 1R37A 2FPPA 4INAA 3NGXA 3DO5A 4O63O 3HUDA 1P31A 3UKOA 1PS0A 1LLUA 4BO3A 1PS9A 5KIAA 4RV9A 8ADHA 1PJ3A 1UXGA 3JQCA 3ZWCA 4R69A 3PWKA 3JD4A 1E1MA 3DTTA 4WLEA 4CM9D 5MDHA 4LMRA 1JKIA 1QORA 2O48X 2C2YA 3HN2A 4IINA 4R5HA 1PU2A 3ITKA 4WLUA 5IN5A 7ADHA 2OXIA 1MG5A 4I5EA 3ABIA 3ETGA 2V65A 3H8VA 4LSWA 3FTPA 3RC1A 3SC4A 3WXBA 5JYEA 1XELA 1K3TA 1IYZA 3Q0EA 4G5HA 1R0KA 4QUKA 3RCBA 2VYVD 4DREA 1VJ0A 2VOEA 4GLOA 2VWPA 4U8GA 3AY3A 3CIFA 4B8ZA 1Z74A 5THKA 2PGLA 3MWDB 4U0KA 4ZRMA 2OBNA 1VSUA 3FWZA 1E7YA 1KYQA 3KVOA 4CV0A 3GEDA 1R4MA 4TROA 1IULA 2VHWA 2X5JO 5JAQA 1H6CA 1OMOA 1U4SA 3F3SA 5G2OA 3OH8A 3TWOA 1PZHA 3V1UA 4A10A 4GH5A 3QWFA 2HK7A 1IUKA 1WZIA 4I8XA 1JKFA 1SOWA 1ADGA 2WWRA 6ADHA 3LK7A 4GMFA 4U6SA 3GR6A 2C54A 3WBBA 1KIFA 4TZTA 2B4TO 1KY4A 2Y1EA 1YB5A 5U1PA 2JD1A 3R1IA 5B4TA 5A5FA 4KMSA 2FPGA 2DTEA 4CMCA 1OC4A 1PIWA 3PZBA 2G1UA 5L4LA 3SLKA 3OEWA 4LK3A 5JC8A 4CLXA 3SLGA 3VVCA 3NAQA 2PGDA 2YV2A 5AXCA 4CMIB 1QYCA 1I36A 4RL6A 3SBOA 4P4GA 1IY8A 1FK8A 1IB6A 2GRAA 3M6IA 2I9PA 2CVOA 2DBRA 3D4PA 3NT4A 3PK0A 4J7UA 1ENPA 5CPFA 1NPTO 3RUFA 1XIVA 3HDHA 4RPHA 4BNZA 3N58A 1BTOA 3DZBA 1I5RA 3U4DA 1QV6A 2ZJ0A 1X7DA 2ZYDA 1YKFA 3L0DA 4IY1A 1VLLA 3FBTA 3LLSA 1Y8RA 4G65A 4KOAA 3ZNQA 4CM5A 1JWBB 4R54A 2X9GA 1N9GB 5JLAA 4DLAA 3H2ZA 3NT2A 3AFMA 3RBVA 1ZK1A 4RORA 1Q7BA 1BDMA 2YFHA 3GGOA 4WLOA 2C20A 1R6DA 3VTZA 2CF6A 5L4SA 5JXWA 3BMNA 2WSBA 3MOGA 4G2NA 1KVTA 1MFPA 2AEFA 4Z0TA 5I9MA 3A14A 3DZKA 4W99A 4ID9A 3E8XA 2VHZA 3GNQA 3RKUA 1YXMA 3H9JA 2GLXA 3AUAA 4EITA 5T6BA 5COAA 2G82A 2X6TA 3UVEA 1Q7CA 4M1QA 1YQDA 1BXGA 2D5AA 1GUFA 3O8QB 3EGOA 1GAEO 2PZJA 2DFDA 3JQ9C 4ONEA 4PVDA 1L7EA 3EY4A 4LN1A 5EINA 1RM3A 3FSRA 4ND4A 1DPGA 4WGGA 1KERA 3B1JA 1LDYA 3RIHA 1T2DA 2EERA 1EDOA 3VPHA 2VOJA 4G81A 3W4JA 4JJIA 3K31A 4CL8A 2I67A 3E9MA 2Y99A 2OUIA 3NTRA 4Z9YA 4R1TA 3GN1A 4D79A 5EN4A 3RD5A 3WGGA 1P1IA 2OGUA 2NU9A 5ITWA 2R00C 2B83A 1GY8A 2VRCA 4DWVA 1KETA 3S8MA 3V2UA 1TT7A 1EEHA 3KSUA 4M87A 2Q49A 3C1AA 3L4SO 4MKXA 1LDMA 5A3JA 3ANNA 4BNKA 2ET6A 1MUUA 3U4IA 2VYND 4BNMA 5EQFA 4AJEA 3F1KA 4W6ZA 2Y68A 4YRAA 2O3RA 2X4GA 1X13A 2IODA 3OA0A 3QWIA 5AXDA 1PZGA 1P1HA 1SPXA 4LGVA 1HRDA 1RPNA 1TT5A 2P5YA 2E4AA 3FD8A 3WYEA 4PZEA 3ORFA 2YZ7A 4BUCA 3AUSA 4GMGA 3ROKA 1EVYA 1Y8QA 3Q1LA 1ZSVA 3QWAA 4QSMA 4D41A 4FFLA 3D3EA 4AJHA 4CUZA 3ZWOA 4PN3A 5TIIA 3MJCA 5G0TA 3TZ6A 1DLIA 2EJWA 1R66A 1S6YA 1K5HA 5TGDA 4Y98A 3RC9A 2X22A 5TRTA 2I76A 3OJLA 3Q6IA 4J4TA 4BIIA 2C7VA 1HLPA 1XGKA 1RKXA 2CNBA 2HRBA 2Z1MA 1VKNA 1WPQA 2Q99A 2D1YA 3EW7A 2VT2A 3JQAA 3U4HA 1HDCA 2HCTA 1A7KA 1LI4A 2ZTLA 4J16A 4TVBA 3OQ1A 5EPOA 2PV7A 4OJNA 1PQUA 3DWFA 2GN9A 4ZJUA 4DLBA 1NHGA 3C3XA 2C0CA 1B14A 5CDTA 4XWYA 1L1FA 3V1YA 2BRUA 1GEGA 3RBXA 2AXQA 1XQ6A 5L40A 1Y7TA 4YDRA 3KM0A 5G0WA 1ZSNA 3BMOA 3GH3A 3KRTA 4M49A 3BMQA 3UCXA 2HQ1A 4R51A 5TJ9A 5TS3A 4BKUA 1XYGA 4DA9A 2P5UA 3OIGA 1T25A 1RWBA 3TQHA 4XEHA 1SB9A 3EDMA 1DRWA 4EI2A 1EK6A 3F46A 1XU7A 3NTOA 1PR3A 3IOYA 2ZKLA 3GK3A 3KLPX 5ADHA 5GZ6A 5BNFA 3UFXA 1IOLA 4NI5A 3K2BA 3TDKA 2GZ3A 4I08A 3I5MA 3JQ8B 1VJTA 3W8FA 2QIOA 4ALNA 2R6JA 2V6MA 1V35A 2P68A 4R9RA 1LSUA 4CQMB 3ZWMA 4B7CA 2YHUA 4AJOA 3IS3A 5BSEA 3JYQA 4XYBA 3CXRA 5FEUA 1J6UA 3DDNA 3BTOA 4GGOA 5F1OA 4EUFA 4F45A 1N8KA 4C4OA 1ZIDA 3Q9UA 4KDFA 4XR4A 2EKPA 2VZ0A 1CYDA 4XDZA 1PJ2A 1YH3A 4DTIA 4PGFA 3ON5A 2H1SA 3DBHA 4ND1A 4JJFA 3AU9A 1CWUA 2Y1FA 3E82A 4LRTB 5BT9A 4YAEA 5JCJA 4ZQHA 1I3NA 1XU9A 2W2KB 1LX6A 2YDXA 3JQFC 2AQ8A 3OA2A 5HM8A 1MA0A 1HDYA 4EUEA 1GZ3A 4PG7A 1MFZA 4D0SA 5L53A 1BWSA 3AOGA 2OP1A 3ULKA 2PWZA 4MIOA 1SBYA 3RC7A 4IJVA 4BVAA 4YA6A 4IQGA 1G0OA 2O3TA 1VM6A 1NFFA 5ILGA 1D8AA 1LU9A 1Y8QB 4FSHA 3P2OA 5KVQA 4H7PA 4E30A 5IN4A 1FDWA 1XSEA 1YQGA 4GI2A 2JCXA 3I9KA 4JNKA 2P4HX 4Z9XA 3FWNA 3AY7A 1UXKA 4BO0A 1BW9B 2HU2A 3VOSA 2W8ZA 2C7GA 3AK4A 3RVDA 3CE6A 1CQIA 1DBVO 2D59A 1HE2A 5IDYA 3VKVA 1RYDA 1A4UA 1KEUA 2NU7A 4FPXA 1YJQA 2B36A 4CM6A 1K89A 1QLHA 4DYDA 4OHUA 3L6EA 1GEEA 4CLRA 1ISFA 1BGVA 2PZMA 1H94A 4KDEA 4D7AA 2Q1SA 3DZIA 2IRWA 1NYTA 2WE8A 1E3EA 2YY7A 3INGA 1QMGA 1YL5A 2PLAA 3RUDA 3F4LA 4ZQEA 3Q3CA 3I23A 1TEHA 2YQ4A 3H9QA 4IGEA 5JC1A 4GBJA 1GUYA 1SCUA 4ALJA 4GSLA 5IF3A 1E7WA 3ZV5A 4JJGA 3CPSA 3PYXA 1NVGA 4XIJA 3D4NA 4NFSA 1RJWA 1TXGA 1YGYA 1ULUA 2J5RA 1EVIA 4EW6A 5CG2A 4HBGA 4BKQA 1AHHA 3UICA 3FPLA 4H15A 4A5OA 3RI3A 5C7OO 4MDHA 1TA4A 1DHTA 3JQ8A 2X1HA 4IZHA 4IDCA 2BFAA 2E48A 3RC2A 3FR8A 1DIBA 4Q3AA 5HA5A 4JQCA 4PLWA 4XGKA 2TMDA 1PEDA 2D3TA 4C7KA 3SXPA 1Q7GA 2O3SA 3JV7A 3D3WA 4JBGA 3PRJA 1AUPA 3F9IA 3OJOA 4MVJI 3U0BA 4NIMA 1V8BA 5EMHA 1PL7A 4XB2A 3VVBA 3K73O 3GOHA 4XIYA 2P9CA 1PL8A 4JBIA 4AJ4A 5MGBA 4E5NA 2GN8A 4X54A 3CKYA 3N7UA 2EKQA 1XA0A 3PJDA 1BDBA 1KY5A 4QXMA 5C5IA 1NQTA 1GFSA 2SCUA 2GERA 4FD3A 3RSHA 2CDBA 4XYGA 4P22A 4BGEA 1HYHA 4AJIA 5DBFA 2ZIZA 3JQ7B 2Z5LA 3C85A 4P38A 2IZ0A 5KVVA 1ORRA 4FDAA 1R16A 2IXAA 1C1XA 4L0QA 1UZMA 3H9UA 2P4QA 2C29D 4TRJA 1ZK0A 3QY9A 4IBOA 4PVCA 4RO0A 5ENDA 3WSWA 3DB2A 1EUCA 3I4CA 2GZ1A 4URFA 4AJKA 3ZI0A 5DT9A 3ADPA 5IDQA 1PQWA 2Z95A 3GVCA 3JYOA 1N9GA 2C2XA 3OFSA 4I5FA 3OJ0A 1YOVB 2OP0A 3F5SA 4PG8A 2OOSA 4CR6A 2GNAA 2GZ2A 3DR3A 3QVSA 4W4TA 3JYPA 4LCJA 3ZWBA 4E13A 3K96A 2JJYA 4MVJD 1ISGA 4BNYA 4DMMA 2RCYA 3ZGYA 2DUWA 3JQAB 5KVSA 3WNQA 1GTMA 3UW3A 3ANMA 4GKBA 3C8MA 3DZFA 4HP8A 4W82A 1JKJA 2CDCA 1ENYA 2V6BA 4R1NA 1JVBA 3DL2A 2BGMA 4O0LA 5TT1A 1I3LA 1V0JA 4Q9NA 2P2SA 3GGGA 5H82A 4E5KA 3H9GA 3RKRA 3ZNOA 1NP3A 1YRLA 3GZNB 5U9CA 3D3WB 3K8ZA 3WFIA 5CP8A 4BNVA 2VUTA 5I9NA 1DRUA 5H81A 5DF1A 4W9NC 3KYBA 3MWEB 5A3VA 2AQKA 3GZ4A 4L8VA 1S7CA 3RUEA 5L7TA 3K92A 1V3VA 1OC2A 1U3WA 1E7MA 3MJ4A 1OBFO 4CLDA 3WMWA 4B3JA 3PPIA 2B35A 3AI1A 5B4UA 1HT0A 3A06A 2HMVA 1PGNA 2JCYA 3PIIA 2JKVA 1PWZA 1LBEA 3R3JA 1DIHA 2FR1A 3GNSA 5T64A 4UVIA 3ST7A 3TSCA 1KVRA 1YOVA 3PGJA 1ZVMA 3JQBC 1LQTA 3AOEA 4P8RA 2EGHA 1A4IA 3M1AA 3OJFA 3KXDA 3GPIA 2RIRA 2VQ3A 4YT5A 3ANLA 4LRSB 2X8LA 1QYDA 3C7AA 4GPD1 1D4FA 4Z3DA 3P19A 2Q1TA 1NVMB 3CSDA 1DFIA 1SMKA 3I9MA 1CRWG 1P3DA 2E49A 3WGYA 4XRRA 4Q3EA 4RCVA 4UVEA 4B4WA 1VE9A 3PDUA 3ZV6A 3WICA 1PJQA 5K9ZA 2POQX 3EUWA 2BD0A 4R41A 4CLRB 4CMHA 3INTA 3E9QA 2PGJA 4EBFA 4XD2A 1C0IA 5JDCC 4TKMA 5LDGA 3WTBA 1DJNA 4L76A 2UVDA 1B3BA 1KEWA 5A1TA 2ZYGA 4BMVA 1SEPA 2NU8A 1PJSA 3LSYA 2B4RO 1JWAB 4OM8A 3I52A 4PLVA 1EFKA 3W4KA 1RM0A 4F6CA 4DPLA 3DHEA 5CEJA 1HLDA 1NASA 2R2GA 3NGLA 4UEJA 2O4UX 2PZLA 3L4BA 4RVUA 3I83A 1GR0A 5IXYA 1X7HA 5ICMA 1UJMA 2AQIA 1B7GO 1E5QA 1AHIA 2C59A 2BGLA 3EAGA 4ZHSA 4QO8A 2YW9A 2VHXA 2JHFA 1M76A 5KWEA 4R3NA 5L95A 1QKIA 4XA8A 3PJGA 4CM3A 4EJMA 4WNIA 4AFNA 4CLEA 4UVHA 2WE7A 4I9HA 4WUVA 3UOGA 2IEBA 1YBMA 1IE3A 3GN2A 3EHEA 1E5LA 1IL0A 3R3SA 5CDYA 2G5CA 5KTKA 3HHPA 1MC4A 4RVFA 1Z75A 4E32A 5FFFA 3H3JA 1E3IA 4YAKA 1VL0A 4EZBA 3WLFA 1U1IA 4KUGA 4O1MA 3WQQA 5JS6A 4EEXA 4RJTA 4CM8A 5KNLA 1LSOA 3TRIA 3WOHA 2DAPA 1BXKA 2B5VA 3A9WA 3OECA 3WIEA 1OI7A 2D4AA 3PIDA 4A0SA 4BV8A 4K26A 5G0VA 3IC5A 1HDZA 1YBAA 3TN7A 1U7HA 2HAEA 4CL3A 4EGFA 4NK5A 4H3VA 4ZQGA 2DVMA 4A03A 3QSGA 4FFNA 1DSSG 1AXGA 4CUKA 1GQYA 2R00A 4RDHA 4CMAA 3FHLA 3GAFA 3HZZA 4FR5A 4HNGA 1PGQA 3C24A 4IDAA 1NAIA 2XOXA 1DC6A 3U5TA 3L07A 3GRPA 1ZFNA 5TJHA 1I3KA 2DPGA 2ILTA 2YV1A 2DKNA 1XHLA 2DTDA 4JCOA 3UH1A 1E7QA 4F3YA 4Z3KA 1WMAA 3RBZA 5A9RA 5THQA 3RUHA 3LT0A 3PYMA 4YJHB 5IZCC 4HXYA 5DOVA 2BI7A 4CM4A 4XYEA 4CQMD 3FPCA 1UDBA 1GU7A 3G49A 5JCJD 1A9ZA 1WW8A 4F6LA 5COQA 3UUWA 2PKQP 3GDOA 4II2A 4D45A 1LRLA 1Y9AA 4R3WA 1ISMA 4IDBA 2EIHA 3OIFA 2GYYA 1U7TA 4RZIA 3WGZA 3R6DA 1LDEA 4AJLA 5A03A 1E92A 4YTEA 1WVGA 2PD3A 1H0KA 1H6AA 1JQBA 3KO8A 4FFRA 4GVXA 4OOFA 4CUJA 5IZ4A 1GADO 4PG4A 1T24A 4OXYA 4ZQFA 1GYRA 1ZZEA 1I24A 2RHRA 4AJNA 1B8VA 3DFZA 4I9UA 4FB5A 2QRKA 4KZPA 2IDZA 2OZPA 3QVWA 4NFYA 4IDGA 3WS7A 3GEMA 4MKZA 1ZUD1 3VDRA 1AE1A 2H6EA 2Q50A 2JD2A 4GWGA 1XEAA 3PZRA 4NZ9A 3KYCB 5DCYA 1UUFA 5CFZA 1ZJYA 4J0FA 1Z45A 3PGXA 4HFMA 1E3SA 4DC0A 4PRLA 4CMBA 2EV9A 2WM3A 2VNSA 2PNFA 3DQPA 4NMHA 4NR0A 4PLPA 5C37A 1P77A 3IKVA 3JQBA 5G4KA 1ML3A 1W73A 4IJWA 4KUHA 1NM5A 2WYWA 2H63A 5DP1A 3RAJA 2O23A 1CIVA 2JAPA 3KUXA 5DP2A 1PZEA 3BZUA 4E5MA 5JFOA 1UDCA 4CLOA 1K0UA 5CEFA 1EZ4A 5BR7A 1PJ4A 3JYLA 4FCCA 1E1LA 3ZWWA 4B8WA 1DRVA 2O3JA 5T5QA 4YJGB 4WEOA 4W7IA 1GQQA 4Y6RA 1BG6A 3EK2A 4XB1A 3V2HA 3GF4A 3TF5A 5J23A 1D3AA 3RUAA 2AW5A 2P91A 2HMWA 1C1DB 2BLLA 3GFBA 3TJRA 3GAZA 5COBA 1JAXA 1LEHA 3FRJA 1KOLA 2J3HA 2NU6A 3F4BA 4OXNA 3HG7A 4PLCA 3AM4A 4HKTA 3WJAA 1ZCJA 4RLHA 4AJJA 4N7RA 3I9NA 2ZB3A 3FN4A 4YQYA 4MP3A 3H65A 2PR2A 2YUTA 3QWBA 4OYRA 2OBYA 4QEDA 5IDXA 3JSAA 3K30A 1BMDA 1D1SA 1UAGA 4O6VA 1GCUA 2P9GA 4FJ2A 5FWNA 2IE0A 3M1LA 3NYWA 2C82A 4FOSA 3V8BA 5DBGA 3FCOA 3GG2A 2IYOA 1SB8A 4BO7A 2JCVA 2AG5A 3C7CB 3LQFA 4NJMB 2HMSA 2QHXA 4E31A 3OF2A 4IIUA 5TF4A 5K0ZA 2QYSA 5CEEA 3N74A 4CR8A 1ZW1A 3IKTA 1N1EA 1AXEA 1WP4A 1GZ6A 4Z0HO 3JD2A 3NDRA 4BNWA 2B69A 4HADA 2Q3EA 3JQ6A 1H6DA 3ICCA 4NG5A 1P1FA 1T1SA 2Q46A 3BTVA 3CEAA 4B79A 4XQCA 2J3IA 1FDTA 4A7PA 2Y1OA 3GG9A 4R9SA 3QQPA 1E3JA 1YL7A 1GV0A 2X0JA 1CETA 4UVDA 4FGSA 2A92A 1LLQA 1MV8A 1P1JA 3JTMA 3QJ5A 2PA3A 2GF2A 2BKAA 2DPHA 2Y1CA 3W4IA 5A06A 2PKRA 2RAFA 2E82A 3TOXA 1YS4A 3UCEA 1TVEA 2OMEA 3RROA 5EQDA 3GQVA 2HK9A 1WDLA 3PP8A 4NQZA 3ZNNA 2EHDA 5CPBA 2EP7A 4CV3A 5JAZA 3GA0A 2DM6A 4J4BA 4N18A 1ZK4A 1P0CA 2CSUA 3C1OA 2V6GA 3ENNA 4XR9A 3LT4A 3KV3O 4PLHA 4QECA 1A5ZA 4OO3A 5LDHA 3BMOB 3DAGA 3EVTA 2O7QA 2CUKA 3GT0A 2D5CA 2HUNA 2GASA 4HNHA 1I32A 3KLMX 1VPDA 3PJFA 5B1YA 2X7HA 5T67A 4JIGA 4DUPA 1HDXA 4PG5A 5DN9A 4TQGA 3ZHZA 4AJPA 2BHLA 3IUSA 2ZCVA 4P4LA 2PK3A 3DXFA 2A4KA 4JROA 4ZRNA 3ZWXA 4ESOA 3K6JA 3NJ4A 1DB3A 3DZHA 1N7GA 3GFGA 4TRNA 4WCFC 3T4EA 1ZMOA 4XRGA 1NAHA 1T4BA 5BQFA 1D1TA 4WASA 1F8FA 3HADA 4NFHA 5CDUA 2ZB4A 3C1TA 4UREA 3KSZO 1ADFA 2BF7A 2XF8A 4WCFA 1ONNA 2NVUB 4L4RA 3LU1A 3D64A 1JTVA 2H9IA 2VWHA 3FBGA 5CDGA 1K6JA 3WB9A 1CEQA 1HSOA 1N5DA 2YV3A 1J49A 2ZB8A 3IP3A 4PLZA 2VZ9A 1C0LA 2I5PO 4WK6A 2LDXA 4MP6A 2YYYA 5A05A 5KJEA 3ZZNA 4DGSA 5F1KA 4CR7A 3NKLA 1EDZA 3BXXA 2ZYAA 2AHRA 1B26A 3R0IA 3A28A 4QX6A 4RVGA 5JDIA 1YB4A 5TT0A 1KVSA 4YCAA 4NJOA 4GGPA 4J1QA 4U6QA 2GN6A 1I2BA 2O3QA 4MVJE 1UAYA 5EIOA 5IAAA 2DUUA 4YAGA 5JMPA 5F3RA 3TPCA 3IAHA 4L4XA 5JW6A 1EVZA 3DHYA 2HO5A 3LC2O 5ER6A 1U5AA 1GV1A 2AG8A 4J3FA 2Y0DA 3WYCA 1ZKMA 4FFMA 3U3XA 1C0KA 4MIEA 3BTSA 1B8UA 4ZICA 3DZJA 3OM9A 3W1VA 3PLNA 2Q1UA 4J9UE 2IZZA 3S2IA 1QRRA 1LDNA 1NQ5A 2C07A 3ASVA 5JYDA 1ID1A 3RWBA 2B5WA 1H6BA 4DVJA 5A9SB 2VN8A 5TX7A 3GGPA 3PEFA 2EW8A 3AY6A 4UULA 4GKVA 3PLRA 1PJTA 1ZEJA 4LVUA 4OQZA 2G76A 3CMCO 4GX0A 1WZEA 1DAPA 4MINA 3ZHXA 5TNXA 3NTQA 4Q3NA 3EZLA 2PTGA 1NWHA 3PHLA 3V5NA 1SOVA 2X86A 2CMDA 5KJ6A 1HETA 3H6KA 5A9SA 1M67A 3TL2A 4OH1A 3GPDG 4J1NA 3ASUA 1PZFA 2NTNA 2O2SA 2BFOA 1KEVA 3E03A 4Z0PA 1O0SA 1TLTA 4CMKA 4NHEA 1MXHA 3HFSA 3NDIA 3WGIA 1UXHA 2Q4EA 4RF4A 5EJ2A 3E5MA 4L74A 3W8DA 2VTEA 3GUYA 5A4DA 1T2FA 1QYVA 4XDYA 4J6FA 4DPKA 3AI2A 3PHGA 3D5QA 3NDJA 2EGGA 5ITVA 2X0RA 4YAJA 4U0JA 4K1LA 4BNFA 4GAEA 4FFPA 2NVUA 3AM5A 1QXSA 1NVTA 4E2ZA 4XQ9A 3O9ZA 2GD1O 1PX0A 3NX4A 1EMDA 5DDIP 1W6UA 4LISA 2Y66A 1T26A 1ONPA 1B2LA 1WDKA 3QHAA 1JN0A 2O4CA 4HFNA 3VHRA 1H5QA 4BO6A 1BXZA 3QA9A 2AEJA 5U4QA 2FSSA 2VRBA 3GMSA 3GVIA 3VH2A 3L77A 4M55A 1R15A 3MJEA 2YQ5A 2RH8A 4B4UA 3KSDO 3WG9A 3KYCA 4E5PA 2E6UX 5EERA 1W8DA 3A1NA 3IJPA 3CMMA 1U9JA 4BGVA 4IDDA 3T7CA 2I99A 1J5PA 2A35A 2ZB7A 5KJCA 4M86A 1EQ2A 4FFOA 5G0SA 1R4NB 5T8KA 5JSFA 1EBFA 3CZRA 3KTDA 1B16A 1F8GA 4CQLA 4D0RA 3M2PA 1QR6A 3TL3A 1MX3A 3E9NA 2UUOA 3AJRA 3GMDA 1LRJA 1YB1A 1LSJA 2WTBA 3GHHA 3OBBA 4DPMA 4B7XA 1NQOA 3SC6A 3BMCB 3KBOA 1NXQA 5F5NA 2QW8A 4W7HA 1DIRA 2I3GA 1TI7A 3G17A 2EJVA 4RPGA 1MG0A 2XAAA 1O6ZA 1X7GA 1Y1PA 1P1RA 4JLWA 3OIDA 3RFVA 3B6ZA 4J43A 5FI3A 1UXIA 2DT5A 1ISJA 1GD1O 4RQTA 3OP4A 4BL5A 3H2SA 3AM3A 1U4OA 3IQDB 3ZU4A 1KS9A 2QRLA 2QYTA 4UAGA 4WNCA 4XGNA 4E2YA 1F17A 4OXKA 3VH3A 1ZJZA 5L51A 1YONA 2WD7B 3NV9A 4FC7A 4RDIA 3S1LA 3GNTA 3L4BC 3O4RA 1NPDA 2D0IA 3DEYX 1XDWA 2CZCA 2GCGA 3F6YA 2GPTA 1G0NA 1R4NA 2QQ5A 1U3UA 1JVSA 5CAEA 1JW9B 1WNTA 2W2LA 1WWKA 1I8TA 4GX1A 4WE3A 3IP1A 1X1TA 4JBHA 4K9DA 5BNTA 1U3TA 1GZ4A 3DMTA 2I3AA 3COSA 3DBHB 1F12A 1Z6ZA 4KUEA 1V3TA 2UUPA 3C7DB 4YRDA 4RQUA 4BGUA 3KYDA 2BGKA 3SEFA 4D3SA 4L4SA 3CUKA 3PWZA 1YDEA 3ONEA 1F06A 3VZRA 1VL6A 1KVQA 1XCBA 2PZKA 2A94A 4IJKA 4KWIA 3NRCA 3DZGA 5EL0A 1O89A 3I6QA 3UXYA 3QRWA 3MJVA 3PXXA 9LDTA 1L7DA 3T4XA 1I33A 1N2SA 2I65A 1ZO8A 2X0IA 4IS2A 2DQ4A 1EQUA 1B15A 2Q2WA 3AI3A 4S1VA 2CVZA 3VAZA 3P5SA 1V6AA 3BYZA 3CH6A 3GEGA 3SX2A 1UDAA 1ZXLA 4WOJA 4NNJA 3TZKA 3MJSA 3RJ5A 4ZVVA 2EP5A 1P33A 4HUJA 3MCVA 1U2GA 2A9FA 1DEHA 2CY0A 4QFCA 4D43A 5HS6A 4WCFB 5G4KB 3BA1A 3NUGA 3EVNA 3X2FA 4QQRA 5DNAA 4Q3DA 3INRA 1UP4A 3HDJA 2RHCA 4B7UA 4UUMA 4CM1A 4YVFA 3I3OA 2FWMX 4XYLA 1QSGA 3EMKA 4I9NA 4L73A 2G17A 1M2WA 3PFFA 2NVBA 3WR5A 1G1AA 3P7MA 4MVJG 4YQZA 1LA2A 4OQYA 5KKAA 1YVEI 3NT5A 5C7LO 3HN7A 3DTYA 4BQPA 3OSUA 1LSSA 2LDBA 5CHEA 5A02A 1PQPA 4J1TA 3WQRA 2VYNA 3ZH2A 1QG6A 5JAMA 5KVCA 1VSVA 2W2KA 5B4VA 4D42A 3U09A 1UR5A 3KZVA 1EUDA 3HSKA 3H9EO 4DBZA 3VC7A 2VRCD 1W4ZA 4BV9A 4EJ0A 2EXXA 4YEDA 4KTTE 4IQ0A 4ZD6A 3VZPA 1HTBA 4AL4A 1VJ1A 4YJDA 1SAYA 1I0ZA 4R01A 1JA9A 2JAHA 1EBUA 3VTFA 2O50A 3ZNPA 1PTJA 1U8XX 4RPJA 3GVHA 5KKCA 4E12A 2EKLA 5C7IO 1GPDG 3D7LA 3HE3A 1ISIA 1KC1A 2GDZA 4NU6A 1YDWA 3JQAD 3K9QO 2EF1A 1I3MA 2EEZA 4UUOA 4BMNA 4MVJH 2JL1A 2X5KO 4BMSA 3PQDA 3IIEA 3I9OA 4JX8A 3VZSA 3W8EA 5FYDA 2Q2VA 4BB6A 3DAFA 1X0XA 1RYEA 1HE4A 3EZYA 1DFGA 4OKNA 2Y1DA 2EG9A 3UF0A 5AVOA 1DIGA 3K2EA 3OQ6A 1QV7A 4MKRA 5DZSA 4ND5A 2O2YA 4LCEA 1O9BA 4TWRA 2PD6A 1NTOA 5C3MA 5L45A 1BSVA 3DAPA 1LQUA 1ENOA 3QW2A 1SEVA 4RVSA 4DQVA 2YHIA 4PCVA 3BTUA 2FRDA 5DCWA 2NADA 1YQXA 1CERA 4W9NA 1B0AA 4NH4A 3DONA 4C7JA 1NHWA 1CDOA 5GMOA 2J3KA 4CM8B 3VPFA 4BOYA 4EUHA 1C1XB 4LVCA 3OEYA 3F5QA 4R1UA 2D8AA 1P74A 1SC6A 2BELA 4YJFA 4BNUA 4IJUA 5ICSA 1DFHA 4QO7A 3W6UA 3D0OA 5L3ZA 2QZ9A 5HRUA 1XG5A 3GRKA 2IZ1A 2OO5A 4K6CA 4BO4A 3LDHA 4FJ0A 4UEOA 1VRWA 2WD8A 3FNFA 3OQBA 3PHIA 4BNTA 4CM4B 4EJ6A 1SZJG 2RH4A 6LDHA 2NTJA 4JXKA 3TFOA 4AJ1A 3QIVA 2Z1NA 2J5QA 3PTZA 2ZTMA 4DIOA 4YYZA 2NQTA 3AW9A 3D1LA 1M6WA 5A5EA 1DO8A 2ZK7A 1T2EA 3L9WA 3PJEA 2W4QA 5TSDA 4YT2A 1NBOA 2QRJA 1BHSA 1H93A 3ITDA 1CF2O 4OMUA 3U49A 4DL9A 4TKLA 5K6AC 1TB4A 4J7CA 1J4AA 3WBFA 2GO1A 3IDSA 1Q2XA 1Z7EA 3DOOA 2G0TA 3DBLA 1Z7BA 4GL4A 4E33A 2W98A 3HWRA 5BSFA 1VC2A 4IZIA 4MVJF 4ZA2A 3WIDA 4ZQBA 4YT4A 1PJLA 4E4YA 5I8ZA 2PH5A 4MVJM 3DBLB 2IEDA 5TQVA 4YR9A 5GZ3A 1CJCA 2Y67A 3I9JA 1BW9A 3ZW8A 1FDUA 1WLYA 5ENVA 5IDWA 2HKIA 3H5AA 2HMUA 3MTGA 1T2AA 3AOEC 4YWJA 2GN4A 2HSDA 3HB4X 4CMJA 4MO2A 2DBQA 1ONOA 1ZBQA 4RVHA 3FR7A 3AU8A 3B70A 3ETDA 2ZTUA 2NVWA 3VH4A 3WDSA 1G6KA 1T1RA 5ES3A 1IPEA 3I6IA 1X1EA 2VYVA 2W2LD 5T8KC 3WJ7A 4LW8A 2QG4A 3IMFA 3S2FA 3H7AA 2Y05A 1ZXBA 4AVYA 3Q2IA 1LNQA 5JMWA 1O94A 1XKQA 4OOEA 3QE3A 4GQAA 5G0UA 2H5LA 4EEZA 3LT1A 3LF2A 3LLVA 1GPJA 1E1KA 1NR1A 1R0LA 1BVUA 3I4FA 5K6AA 5L7YA 3ZN2A 4FQ8A 4MPDA 4NBRA 3IL2A 2FY8A 3DHNA 4O59O 1R4MB 2VUSA 2JHGA 4I5DA 4IGFA 3ROPA 2OL4A 4DMLA 3BHIA 1HDRA 1DOHA 3V2GA 2J5KA 4PLFA 1U8FO 1ZNQO 4WLNA 2GSDA 4NPCA 4M54A 4BQRA 3HB5X 1F0YA 5BSGA 3KOUA 1P9LA 3BHJA 1HF3A 4YB8A 2EW2A 2X58A 1ISHA 5JO9A 1PGPA 4N5MA 3OJEA 4BB5A 4GX5A 4JGBA 2WYVA 2PH3A 3GZNA 5TLSA 1EVJA 3DOCA 3ONDA 4HY3A 3F1LA 4CLOB 3UHAA 4DQUA 4XJTA 4B3HA 4BO1A 4CMEA 4DC1A 3ICPA 1DAOA 4HFRA 5IG2A 1HDGO 3KETA 4IQ8A 1VI2A 3DMYA 5IZCA 3PQEA 2CD9A 3E1KA 4PRKA 5EESA 2IYPA 4D3DA 1B8PA 4HX5A
chains in the Genus database with same CATH superfamily
4I3HA 4PLGA 1P4SA 1XXLA 2NM0A 3F8WA 2P8SA 1MJGA 1Z62A 3OMLA 3MCAA 3GY0A 1T91A 2QQEA 2BISA 4KQFA 3MN1A 1RYNA 4MV8A 4U8HA 4QM7A 2M6LA 1L7AA 2AR7A 3D0RA 3GC6A 3HP7A 3V97A 2C31A 2XIQA 4G0PA 1HMYA 4P4NA 4YUAA 1DC3A 4B2YA 4JN6B 5JAIA 3PCTA 3UK2A 1U2DA 4QA9A 3HJBA 3VR3D 1W5EA 4UKDA 2PUGA 1TAQA 5LOVB 4GHWA 3VV2A 4F4UA 4WNYA 4UOZA 1T8RA 1S2LA 5ICCA 4BZPA 4IMIB 4KTVE 5KUTA 1PAUA 1FYFA 5DXFA 3PU6A 2R11A 3R3WA 2B3TA 5I7AA 4RY9A 1Y6GA 5D5HA 2J3QA 1BJTA 1PNTA 1WXDA 3AVOA 2QN1A 4QC2A 4PF1A 2JFHA 3R9WA 5F23A 1Z68A 1JKJB 3T5MA 2RGCA 1JFFB 3M6WA 4FLFA 5DXAA 4MZXA 4MW1A 1PSZA 3TTUA 2C4VA 4EVQA 5EEHA 1C1DA 4AP9A 2Q6TA 3F8SA 2V6FA 3E7XA 1GARA 2P30A 3KXPA 3NJ8A 3PHHA 4FC6A 3WQHA 1NUPA 4HVTA 3FWHA 1G2IA 4H77A 2ZS7A 1QCYA 4KYIB 4R16A 2C5AA 4ZK2A 3BSSA 3DB1A 2WTEA 3DFUA 3A6JA 3Q5GA 8OHMA 1HSZA 4N65A 3STVA 1LWOA 4IXTA 5HWSA 4KREA 4E3ZA 2ZI5A 3OF3A 4K6HA 4WCDA 1WP9A 1F4VA 1RWOA 2WWXA 1PWEA 2JJ2A 9LDBA 3WZLA 3GLQA 1GTRA 3U31A 3K0KA 2VDOB 1TC2A 1XWWA 4K88A 2A7XA 1SG9A 4PNZA 3GL9A 4XGIA 4BTLA 1Q16A 1U1DA 4NSNA 3WX0A 1MCZA 2C7BA 5AQEA 5IJ9B 2WMDA 2WUGA 2ZE7A 4J7XA 4OFXA 3TNYA 3ZWNA 3OHMA 1QYWA 1XZCA 2W42A 4YRPA 1G7RA 3QZUA 1CEEA 2FEMA 3WMXA 4XIGS 2GD6A 3DE4X 3QLEA 1NIJA 4QPDA 3G3EA 3MZ0A 1P0PA 3I62A 3QPUA 1JI3A 3CX6A 5EJ4A 4JI3B 4JHXA 3JQQA 3PI7A 4FBGA 1SNYA 1JPVA 3AUFA 3Q6MA 1UCFA 3E2IA 1Y33E 4G25A 1OROA 3I04A 4UEQA 5FI5A 3S40A 2Q2OA 5JFGA 2HR1A 1T2VA 1J07A 2I6SA 3DMDA 5F9FA 3BQ9A 3IV6A 4F4FA 3FE2A 4B48A 5B6IA 2XXJA 1DRJA 1SBNE 2VWQA 4RPCA 3FGZA 1BE8A 1QHYA 4QYTA 2LXNA 3CZPA 1T8SA 4D5EA 2GETA 4ROSA 4BMOB 3FWKA 4YO7A 1HZJA 2O9JA 4C3OB 3E9CA 3KT0A 3T94A 1KI9A 4Y6PA 3C3EA 1R0ZA 1H4VB 1DPFA 4COKA 1Z38A 1GDTA 2H1WA 5F35A 2O1XA 4CN8A 3WWEA 3HBFA 3QNWA 2A1IA 1L8LA 4WJZA 5F21A 2OKCA 1FMCA 2D3WA 4C2AA 3RYHA 3SIPA 1GCOA 4M8IA 4R2IA 4XOIA 3QM1A 1IUNA 2AR9A 3HFRA 4FINA 4AO6A 3AWDA 1T4CA 1FXWF 1KQFA 2BFEA 3E7FA 5CURA 5IM4A 1NA5A 3N07A 1W34A 3ASYA 3GJ6A 4Z7OB 4CTKA 3ESQA 5IXSA 1EFAA 4ZHQB 2L0XA 2NACA 2REOA 1CE8B 2WV9A 3BWYA 1VJCA 3AEKA 3QG5A 4C0SA 1GYPA 1CU1A 1E2BA 2NTVA 2XCLA 4DQ0A 4KQKA 4LWZA 3KJIA 5JDIC 5I8WA 1UP6A 3RV3A 2ZIXA 3FCSB 3L0SA 1SO8A 1Z34A 1V4BA 1NZJA 4MUGA 1WUYA 2LE0A 4PZZA 1WXHA 4C22A 5B6PA 4IHJB 4DV6B 4H1UA 3T3PB 1V4NA 4XUEA 1MO6A 1AGXA 1XC7A 2OESA 3ETLA 2H51A 2PT6A 3VPGA 3C8HA 1M5TA 3ZGLA 2ZBPA 3M8KA 4FOOA 2QI9C 5EFZA 1L7VC 4PFJA 2A9RA 3D0KA 3D2CA 4ML3A 3RRZA 4ALIA 1ECFA 5JNTA 3RK0A 1MF7A 3DEZA 4A27A 1X80B 2C4WA 2XBUA 3ZY3A 2O5EA 2C5LA 4V1CI 4HWOA 3ONNA 1XEXA 2VT7A 2XCUA 3TR6A 1E6UA 1E2DA 4IUYA 2P9ZA 4UHHA 1T15A 1VL2A 5D8DA 1QB8A 3OHPA 1KBQA 4BO9A 4E2XA 3UH0A 5K20A 3NM6B 4MA5A 4N5LA 2Y2UA 2GJ4A 1OH8A 2X23A 3ZGZA 5ESRA 1JEQA 1JV2B 2IP4A 2ZQZA 5EHIA 2OK8A 3E3NA 4QRDA 3O82A 3ROGA 1A88A 2QMOA 3A4VA 3QBVA 3V7WA 2X9LA 4AMZA 2O8DB 2ACEA 2CW5A 4BEBA 5JZVA 2P9TA 4MJLA 2HIAA 3F47A 4PY2A 1LBQA 2P78A 4R7TA 5HF9A 3VH1A 3IMCA 5IX8A 5LWQA 4WZAE 2H7VA 2IWRA 2X8JB 4RW0A 5HNKA 2WK1A 4YV0A 1U2QA 1VIVA 3L0PA 2VUUA 1QTNA 3MFQA 3QV1A 1P4GA 1HYEA 3DT8A 2CK3A 2CGEA 4JDUA 4RVDA 4RD2A 3GD5A 4R1SA 2C9MA 3OPXA 3PC4A 1TTQB 2AXNA 4L8WB 5BRNA 2PANA 3BIFA 1E6EA 4KIJA 5LWHA 5F5LA 3QVOA 3JWEA 1PNVA 1GYQA 4R1QA 1NXOA 3CX4A 4IRMA 5DRTA 3WGNA 5ED0A 1KEKA 4JGGA 2FR8A 4QELA 3RVRA 2YXBA 5EZYF 1L8OA 3WK9A 1XUOA 3GPBA 1H85A 2H9AA 1SK9A 5DSXA 2DFNA 2OSBA 2PM8A 2FN4A 5LCXA 2BGJA 4ZPJA 3ZVKA 1G20B 1V1RA 5ISMA 4S3MA 2V7EA 1XAGA 1XL0A 3CUWA 2RONA 1E62A 1TO6A 1DGQA 4DT1A 4MVCA 1WCYA 1EIZA 1RQGA 1LDGA 1Z4NA 2OFWA 1DTSA 2RBKA 3CEJA 4RA9B 1KMHA 1SC4A 3ZOZA 4Q66C 1H2ZA 1TADA 4OL9A 3L46A 1BVRA 1J2EA 2OVFA 4PX2A 5DNWA 3EPHA 3KYDB 2NV6A 2QG9A 4X6XA 4ZZ3A 1HUQA 4FE7A 1MC8A 4Q3BA 2ZTVA 3IIIA 3LH5A 3MOIA 3OETA 2BUCA 5ESWA 4ITRC 4YI5A 4YPFA 3A1UA 3MW8A 5TQ2B 5AXBA 1CK4A 3RNLA 3UT5B 5AJZA 3G2NA 1J9ZA 4QTZA 2C04A 1EQAA 5EJ9A 1PR9A 4JP3A 4RA6A 1H22A 2R6FA 4DCOA 4YAIA 2AA3A 5L4NA 5BMVF 1AA9A 1GT6A 3AL2A 1ZESA 3WWZA 1HBJA 4IGAA 1E7SA 2Q9BA 3C6QA 2OO3A 3JZDA 4G5YA 2CLOB 3B8HA 4QHSA 1KTIA 1JJVA 5JWRA 2YWXA 1XWFA 1C0PA 3K15A 2AEMA 3TOZA 3GLFE 4HGZA 1ECCA 4PS0A 2WJVA 3VA7A 2VJYA 2ZJ4A 3SHWA 2GHQA 3UV7A 3CKKA 4KVZA 1NXXA 4NOJA 4NMLA 1ZCFA 4JDPA 1P8JA 1PWXA 3WNBA 3VU9B 5HDBB 2BFMA 3EC7A 3VDNB 2XHZA 3VSAA 5I9LA 3AXSA 3JQ7A 2Z2IA 4YJFB 4XASA 4B3SB 2IY7A 5EUQB 3NEAA 3ZPXA 2Q4RA 4KLAA 4EPXA 3RIXA 3BSWA 3HNOA 5ICFA 5JI3E 4TTJA 4ZOCA 2SCUB 3OOJA 3UHPA 4FEGA 4BLTA 5CM9C 4C5AA 4D98A 3WK7A 4DNFA 2HI0A 1HFKA 1TTTA 1AGNA 2JHPA 5A9TA 4BX3A 5IABA 3G5AA 5I7UA 1YHNA 2UUBB 5LLDA 5E0OA 1ANKA 4GRIA 3NEPX 3C5CA 5HHTA 4M8SA 3ZV4A 5E3IA 3TLZA 4ALLA 4JAVC 5JD4A 2F1KA 3JASB 2I1LA 1G66A 3O03A 2AS0A 4R0VA 2OXTA 1BS1A 3KHSA 3EDQA 1FJHA 4EMBA 1P2FA 2FZEA 1DKNA 3O8NA 5FNVB 2HH9A 2DC1A 3P4UA 4TKZA 1V5EA 1LXCA 4AW9A 4OKIA 2KS6A 3P0RA 1M54A 2IYQA 3PFIA 3BHNA 1MJHA 3VPSA 1Z28A 5HMLA 2JPDA 4M1EA 2YJ3A 5E6RA 1H2BA 2WIDA 2HJHA 3W5SA 4BWYA 1K1EA 1HDOA 2P6MA 2ZRMA 4IMRA 3B20A 4OGLA 1EHCA 1QB7A 2WWWA 2CUZA 2HCJB 3K0BA 4LWQA 4B81A 3S68A 3TGLA 1YF3A 4FHCA 4YRBA 4XKJA 1XAJA 3H4VA 4WKNA 2WMYA 5CDSA 2CLHB 2VO1A 1W4CA 4KX5A 4HWRA 4CV2A 3UKDA 4DJTA 4I3FA 1KRHA 2B1GA 4F2GA 5AVUA 3K70C 2C7QA 1PT5A 1E3WB 3AUJB 1R0SA 3VKFA 1Z2EA 2H16A 3IAM6 3RS3A 4J75A 4KMMA 1BX1A 3RYFA 2G9QA 2GPBA 3MLEA 2WIAA 4BCDA 1NE2A 4PC3A 1NC1A 1PJBA 1X9IA 3HJCA 4HS9A 1P5FA 1P9RA 2A9KA 3HDVA 3MGBA 1A7AA 2YW2A 1AO3A 1K7SN 2W2QA 3R7WB 3S0JA 3SE7A 1NTRA 1DLJA 2IEYA 3EULA 2BFCB 2QYHA 3P20A 3N39C 1BA2A 2C8KA 5CJPA 3ZDZB 1JSCA 4REQA 1FA9A 1XZAA 1Y5NA 2V1UA 3LT2A 3M5CA 1JNXX 4NAVA 1KBZA 2BFWA 5SYAA 1H66A 4GZLA 1RYYA 3ETHA 4HNAA 1ODLA 4P7BA 5KMGB 5IBPA 5C0OE 2BEKA 3W05A 4ZVPA 3NWOA 4MIYA 4LWPA 4QT4A 1ST2A 1UBHS 1KQPA 2XMSA 5DW3A 2RHLA 1RADA 2OT3B 3JD0A 5JZMA 3K70D 1IHYA 1MQ9A 2DJ5A 3QE4A 5KC9A 1H3FA 1R8XA 2WY2D 2R1ZA 4O0MA 4PG6A 2QZZA 1V11A 2OFPA 4NE7A 5JS6A 1H9AA 5HPYB 2OBFA 3FHOA 3GGSA 4WECA 4V1CA 1QYXA 3K1AB 1RDFA 3QOWA 1JQ5A 2ZSUA 4CCAA 1EFRA 5IXJA 5JO0A 2X7XA 4KQWA 1MB4A 5CFQA 3LXXA 3D4OA 3FAKA 4EI7A 1HYGA 3RS9A 1DDOA 1E79A 1U31A 1XZBA 2IYFA 4I5GA 1GPLA 2E5WA 3I9LA 1EWRA 1X6VA 3N9IA 4WKBA 3WTCA 4AC9A 2B1QA 5AD1A 2PMCA 2ZW9A 2C2WA 4N5IX 4HEA6 4NEHB 3C97A 5AESA 5DI3B 5TQJA 4TSKA 4W8GA 5ULLA 4P7FA 1U5CA 2AE2A 1LC3A 1Z4MA 4LKOA 3CRNA 3N2KB 3IV9A 2PPVA 3RC3A 2G07A 2IYZA 1U1CA 3X2EA 1UXJA 3K3PA 3KL2A 3MTBA 4J0HA 4LXGA 3ZHOA 2W83A 3CT4A 3VJRA 3M82A 4RC9A 2FG6C 3AWIA 4XFDA 3V00A 2GFQA 4S2UA 4E6PA 3FTFA 3I1JA 3B2EA 3PGA1 5HZMA 5IJ9A 2C58A 1MPXA 2HREA 1I51A 1RZUA 2KE5A 4JEMA 4DLUA 3QVLA 2WG1A 1EUZA 3ZHYA 5C52B 4YRIA 2CF5A 1VJRA 3Q0IA 2HB6A 3RRNA 1AZWA 1PGOA 3TMKA 2YN2A 4CKBB 7MDHA 4HB2A 5LSAA 4BKRA 5JCXA 2JLZA 1UH5A 3M89A 3P2YA 3KAQA 4OAQA 5ILQA 4NCNA 2CKMA 4MGEA 4LSMA 1GDHA 2FETA 3FTQA 4XX0A 1SQ5A 2YVKA 3FLMA 4L7QA 3B3AA 4NJMA 4U7WA 5J43A 1P1KA 2FZ4A 3DBRA 3U3DA 3U6BA 2HWYA 2XITA 1M0EA 1SVOA 3FMPB 3AC0A 1EFUA 2I33A 2R79A 2CLSA 4IILA 1QV9A 1TQDA 3WP0A 2J9YB 4F8EA 5IT5A 1SIWA 1BCRB 4YR7A 2XKJE 4GWKA 2WNHA 5DWQA 2QNIA 3TCXB 5I51A 3U3JA 2YHSA 1RYFA 2HV9A 2V98A 4FGWA 2N75A 2WG0A 3GLFB 1H1LB 3H1TA 2O3UA 4KIWA 6PFKA 4TYQA 2FSVC 2A1UB 2ZUEA 1LS6A 3MJRA 3N2NA 2OOKA 3QLTA 4N01A 5D3KA 2AWNA 4EB3A 2A8YA 2BCJQ 2H0QA 1QWOA 4AMBA 4AROA 4HH0A 2DFPA 3U2QA 4D1YA 1TQ6A 3M33A 1XI2A 1GUDA 2YVLA 1F14A 4Q4HB 5BYKA 1Z0UA 4RKFA 4KO1S 4BP3A 4ILKA 2BSAA 2QTTA 4EGJA 2IX9A 2ZS9A 1J0AA 2YX1A 3BSFA 4GVLA 4MUMA 2QJFA 3BAFA 1BXGB 4HTFA 4UUBA 1GAXA 4EMSA 2JARA 3BMCA 1PW7A 4TVOA 4A73A 5HQTA 5LLTA 2RGRA 2X1MA 1LF0A 4ZV4A 3G0GA 4PLYA 5LZ2A 1RXEA 2VHCA 2I2AA 1NI4B 2VYCA 4ZAVA 3BIOA 3R6GA 1R1DA 4MW0A 4AICA 1U28A 2O1SA 5KOJA 3BMNB 3EXG2 2VJBA 5A4AA 3JZMA 4QBIA 4FYKA 1R00A 3ZQ4A 3LYLA 1V37A 3U56A 1PZXA 1EE9A 2A9QA 4G67A 5C4IA 2V03A 2V6JA 2X9NA 3H1BA 4CYMA 4ZT3A 4CEJB 3VDQA 5JRDS 3Q0TA 1KEEA 1AXRA 4PNPA 3UENA 2OM2A 4I1IA 3W04A 3WK6A 2BONA 2PVSA 1UL1X 2AQHA 4XJVA 2DR3A 2DULA 3U62A 5DT2A 3LF1A 5K6RA 3B1FA 1W1IA 1P4JA 4IFIA 4XTRA 5EXTA 3ZX4A 3KU4A 3AEZA 1HFWA 5B30A 1ZPDA 1IY1A 4UU7A 4MVYA 1KHTA 3CEHA 3HXKA 2WYUA 1C8VB 5JJ5A 1MOPA 5LNK1 3IP5A 3MVEA 4X0EA 4F1KA 4BQEA 2R96A 2EJTA 2XNKA 4ZO6A 2GFIA 3HO6A 2G0AA 4DLXA 4E2WA 1Q0UA 1VHJA 2NSLA 2XMCA 3I2IA 2VVTA 2VZ8A 3LK6A 1KXJA 1C8BA 1U7OA 3MC1A 3RS7A 3TNJA 2Z6UA 5BNZA 5FBQB 3NGXA 5LQDA 1QCCA 2PX0A 1PS0A 2FEOA 3NIGB 1PZNA 1OLXB 3WNCA 4BO3A 5KIAA 8ADHA 3DOIA 5AI0A 5E4TA 4YV1A 1PN3A 3UANA 3MQFA 3RVNA 2XYVA 1U7DA 4KK3A 1YMQA 2QR2A 3PWKA 5J5VA 3DTTA 3OPYB 4MDYA 1S3SA 4LMRA 1QORA 2O48X 4R5HA 3TFQA 3ZS8A 3UJNA 1YACA 3ZR4B 3ABIA 1X1QA 4YP7A 3RC1A 3WXBA 5BSTA 2BEJA 3CRW1 1XELA 1K3TA 2E87A 5SZHB 5DN6A 2FUG6 1ZZGA 3RCBA 2CMGA 5ABPA 3PX7A 4DQDA 1FXWA 2VWPA 1W0JA 5AKYA 4CWAA 2GA8A 5IT0A 3M7IA 1Z74A 2BE7A 2PQ0A 1D9ZA 5T4BA 1VSUA 3N5CA 1MO5A 1KYQA 3G9ZA 1QPZA 4TROA 3O2JA 4TV8B 5BYBA 1IULA 5B57C 2P6RA 3NFRA 1OR8A 3GCWA 1RW4A 3IJ5A 2YOHA 3PUHA 3WKCA 4BIMA 3OH8A 1H1TA 1SD2A 4LHVA 1PZHA 2PXXA 4R40A 4WFKA 2Y9PB 1VB5A 4A10A 1YULA 3QWFA 4QICA 3WJ1A 1MENA 2IXGA 2OC4A 1IUKA 1WZIA 1X1DA 1LFDB 1JKFA 2G3YA 4UATA 4C0XA 1ADGA 3G2IA 1XDBA 4LYAA 1OX5A 2BJWA 1C3XA 1H0SA 1WMFA 3IBYA 4OMCA 1C4XA 1KIFA 2VDWB 2DETA 5J3JA 1WVIA 3ACCA 1Y4UA 3ZIDA 2UZ4A 4YJKA 5U1PA 2CV2A 5K8VA 2CYCA 2OG2A 4YHBA 1MIHA 1NU8A 5K8IA 2WU1A 4KMSA 3U7RA 3QYFA 4Q9KA 2QR5A 5DIFA 3TBFA 1PIWA 3Q10A 4OEHA 2QRPA 4GZ5A 4X91A 5FUMA 3OEWA 3VVCA 1YCDA 4L4UA 3W5HA 2YV2A 2J7PA 2J67A 1JMYA 3MGGA 1SBZA 2FEWB 3MPOA 4I4LA 2JGKA 3W2EA 4P4GA 1EAYA 2OC9A 5D84A 3QEMA 1IB6A 2W5UA 3FZQA 4QDOA 2GEUA 4OHXA 1S2MA 1SHUX 1Q3KA 2DBRA 2L19A 3NT4A 4J7UA 1ENPA 2DWOA 2ZJBA 4CT4B 3FPAA 1EXNA 3C70A 3RUFA 2X42A 2WFZA 3I5AA 2ECQA 4RPHA 4RK0A 4G4IA 2YC2C 4BNZA 4BUJA 1CC1S 2WZBA 3HM9A 1I5RA 3UAOA 1AMUA 2ZJ0A 3ZY6A 4Q1CA 3DA8A 4GLBA 3EEFA 1NOIA 4IY1A 1A1VA 2JANA 3LLSA 3P32A 1Y8RA 4RTQA 3ZNQA 3IP9A 5CB4F 2P1DA 1M7BA 2NP7A 2W0SA 1A8SA 3DPIA 1NSFA 3DDWA 4QOIA 4MW7A 1T8YA 4KPYA 5CYOA 2Z56A 3G85A 4B6JA 1P73A 2YYSA 3MWGA 1F7VA 1JWBB 1WHSB 4YMLA 4AQ7A 2UVPB 3G6KA 3LQYA 5JLAA 4OXRA 3T35A 4D82A 4DLAA 3THWB 4QUIA 4DMRA 3AFMA 2ATVA 2VDPB 4LTDA 4Y2TA 5D1NA 2V9PA 2AUNA 4BRWA 4EMUA 5AW0A 1Q7BA 1VG8A 1Y8ZA 1WW2A 4V2IA 4Y2RA 3C5HA 3Q9LA 3H2HA 3GLSA 5EZYA 1AQJA 5AI8A 2C20A 2BFCA 3F49S 1SXJC 2HJ9A 4HQOA 2VP5A 4B3MB 1MEOA 2PX8A 3RJZA 5IT4A 5JXWA 5F7ZA 2WMNB 1FYVA 3FWYA 3RAGA 4G2NA 1L1RA 5F64A 2AEFA 4NZOA 2R8XA 1D03A 4JJ4A 4V0ME 2JS7A 4Q1AA 5BY2A 1MQ8B 3OX1A 3DZKA 1NX9A 3NBXX 4AUNA 1QIMA 3E8XA 1PJAA 2DJIA 3GNQA 3RKUA 2BSQA 3EXIA 1AHNA 3REOA 1NBWB 1QCDA 4JSTA 1SR8A 3W2FA 2Q3BA 3GCDA 3GRRA 4M1QA 4PC7A 5CIQA 1GUFA 1Y34E 3EGOA 1JT9A 3GPCA 2PZJA 5ES4B 1THZA 2IZ6A 5M2QA 3PLAE 3FOEC 2JGDA 4GPBA 1K06A 1L7EA 3B78A 1XCLA 4GMXA 1RM3A 3L7KA 3LQKA 4LN1A 1DXHA 1GO2A 3KUDA 3ZY4A 3P52A 1KY3A 4ND4A 3PNLA 4JLUA 4WK2B 1KERA 3RIHA 3ILHA 3BD6A 2X19A 4P3KA 3W4JA 4G81A 5BOSB 4JJIA 1EI9A 3X1WA 4MEAA 1RPTA 1TQ2A 3E84A 3FMGA 3M6AA 3PC3A 4OHCA 2I67A 2BTOA 2OUIA 3K0AB 2G1KA 2JA2A 2WIFA 2V7QA 1J70A 3KZOA 3F7TA 2JFWA 3OC0A 2O0LA 3GN1A 4UM5A 2H4JA 5AJUA 5EN4A 3RD5A 5CM8B 2OGUA 2PGAA 3WYGA 2X0DA 2B83A 3O0TA 1GY8A 1XZJA 1JDNA 2VRCA 4J16C 3O4VA 4QGGA 3V2UA 4F2DA 5LP6C 1TT7A 1WD7A 4TKUB 1JLHA 1XWIA 2DKOA 2XIJA 3T3HA 3GU3A 1TRHA 3OCXA 3QVMA 4MKXA 4NECA 4REQB 4CCSA 3ANNA 2PXAA 5DNVA 3VXKA 1GQSA 1MUUA 1M0SA 2VYND 3NHJA 1UJCA 3CTPA 5ESXA 4F91B 1RU3A 1XNJA 3AYXB 4KDCA 2E55A 2O3RA 2X4GA 1X13A 4LX8A 3OA0A 4J3NA 1JFSA 4EGCB 3WGUA 4HJXA 3HLKA 1KP3A 4TXMA 5AXDA 3PWTA 1P1HA 4DV1B 1H42A 4RXUA 4P84A 3MM4A 1QHEA 3TOSA 4JWKA 1OIVA 1SOUA 3FD8A 5FBWB 3SEAA 1L5FA 3W2TA 3WYEA 3ZZUA 4PZEA 1HURA 3AUSA 2H4XA 3EJ6A 2XUDA 4GMGA 4C4ZA 1O97D 1ZSVA 5CFOA 2XQKA 1RCFA 1CKEA 3FYTA 1SA0A 3A4IA 3D3EA 2PCJA 3AQIA 1KQ3A 4CUZA 1E6CA 4NATA 4RS3A 4QBFA 4EFLA 3CM0A 3OZXA 1DLIA 5FL3A 2BGGA 1DI0A 3GLIE 1S6YA 1JEYA 3SFVA 3OIVA 4UEWA 5D3ZA 2IHKA 2X22A 2OD2A 2D1QA 1AY0A 1JA0A 9ATCA 1NDUA 4Z7NB 3QVVA 1ZHOA 1E58A 4IV5A 1K7FB 1YBFA 2QJRA 4KQHA 2V97A 3HRIA 3OKCA 4EM6A 2Q99A 4Q9IA 4RDCA 3V7UA 1SC9A 1A7KA 2ZTLA 4YCCA 2Z83A 5HZKA 3G2LA 4XAQA 3AG5A 2AXPA 3OQ1A 1I9CA 4QQKA 3FGOA 4ZVQA 2X76A 4HDMB 4OJNA 3PHBE 2GN9A 4EHAA 5C34B 5GJCA 3OZWA 3FA2A 4EG3A 1QVRA 2RAUA 4IFBA 3DE6X 5KSYA 4A23A 5LMZA 1AK9A 1YZFA 4XXHA 2VI5A 3E0QA 1PBTA 5DHSA 4A2WA 3AVVA 4OPMA 2BRUA 1QLWA 3TR0A 2VSNA 1SWWA 2AXQA 3QXSA 4WZ6A 3GFSA 1ZGJA 3IDFA 3JZIA 1TM5E 3QLVC 4YDRA 5G0WA 1SN7A 3ZCQA 3UCXA 4X1OA 3UWMA 3HEAA 1VZ2A 1C9NA 1JAHA 4DA9A 2P5UA 1NNI1 3G8AA 3KJHA 1T25A 3SDSA 3HXOA 1RIFA 3V8PA 1OFUA 3ELUA 4XEHA 5TF0A 4HB3A 2WJIA 3LMKA 3TMAA 3U26A 5FJJA 1DRWA 4IIBA 3KXLA 3PDWA 1U2PA 3R09A 4FSDA 1EX1A 1EJ6A 1YAJA 5DW0A 3IOYA 5LU9A 2BOVA 1PK8A 3UFXA 3MCTA 1TCBA 2KW5A 4QSHA 5T3UA 1VJTA 4ALNA 5DM4A 1N0IA 3L7JA 1GNLA 4G1FA 4CKEB 5I5EA 5AVQA 2JIQA 1BQ3A 1J8MF 1L5ZA 2GBGA 4JI1B 4XLZA 1LSUA 3AR6A 3INNA 1XTKA 2IC5A 2V4ZA 3VV3A 4DG5A 3M9WA 2PRSA 1QFYA 4J0DA 4UMDA 5BSEA 4OQMA 2ENWA 3JYQA 5EYPA 4C7OB 2HLDA 2WF6A 3FNBA 5E2BA 1PTJC 5EZSA 4LE0A 5FEUA 3HP1A 4US1R 1GTL1 3BTOA 4U2EA 2P9QA 3H9BA 4YASA 4F45A 1W49A 2YY6A 1ZIDA 4KDFA 4XR4A 2IGBA 3TB6A 3FZNA 1PJ2A 1SVKA 3PNQA 3F73A 2ZXFA 5EP3A 5DGDA 1V25A 2BIFA 2GJKA 1DG1G 3FFTA 3CHYA 3O8OA 3RHSA 3SMVA 3T9EA 1V8DA 3SZRA 1C3JA 3QXXA 4YAEA 5JCJA 4AF7A 2G06A 1KAMA 1NQVA 1SIBE 1A8IA 1XU9A 3A3KA 3D1JA 2VKTA 1GCIA 1UOQA 4HZUA 4CKEA 4UDYX 1GZ3A 5LQNA 3D8RA 1W0KD 3BFPA 3AOGA 2AXEA 2PH7A 3JU3A 2G7ZA 3SZMA 1K6MA 5DK6A 3ULKA 1Z4LA 3QX9A 3CX3A 3RC7A 3MERA 4BVAA 3GJ7A 1FDOA 1NUQA 1NZFA 1Z2PX 5I9IA 1D8AA 2MMGA 2AOVA 2QVCA 4KV9A 1KO4A 5KVQA 3P2OA 4K8OA 4H7PA 4D9CA 4Q1DA 5DTMA 2ZDGA 3G0BA 4OMFG 3NATA 1EUQA 1JFLA 4WNAB 5BVGA 2P4HX 5IUJC 1OI4A 3AY7A 3ZK7A 4BO0A 2D5IA 2HU2A 2I2BA 5LB2A 5E38A 4P0QB 4FYXA 2R8RA 4UTNA 3CE6A 1CQIA 1X19A 3U48A 1D4AA 1HE2A 1ZH0A 3HABA 3FFBA 3DLTA 2C0QA 2VTVA 5H3HA 3SJZA 1ABEA 1A4UA 1KEUA 1PWHA 3D8NA 2NU7A 1J21A 3DF7A 3RG2A 2AMJA 1JHQA 1ZAYA 5DWDA 4HYTA 3VTKA 4DYDA 5FLXA 2A14A 4OHUA 3L6EA 3RT1A 2PFKA 1Z4JA 3L7IA 3P2EA 5J9FA 4D57A 5A7HA 2CE2X 4P54A 2OECA 1FP4B 4M9QA 2HA0A 4KDEA 4O2BA 4TUYA 5E4JA 3DZIA 1NVBA 3CLRC 3F78A 3ND8A 1WUIS 2GJAA 2NX2A 2WE8A 1QP7A 4RJJA 1R7RA 5FBHA 1VFPA 1JEJA 1U9CA 1E3EA 1BWRA 1QIIA 2ZR8A 3OE4A 721PA 3EZFA 5F5XA 5AJVB 1NVKA 4Q9JA 2PLAA 1YI0A 1NI3A 2XE8A 4ZQEA 4BNMA 2Q3LA 4UNRA 1UBUS 3EMBA 2D00A 2YQ4A 5JC1A 1UKAA 2O8NA 4UAUA 4GSLA 4UBLA 3PEYA 4Q9AA 4F5YA 1WU8A 1E7WA 5IF3A 2WU4A 3BWBA 1YRWA 3ZV5A 3CPSA 3D7NA 5ED4A 3PYXA 4XIJA 1AURA 2UUAB 4RIFA 4U2CA 3AR9A 1VLZA 2QLMA 4ARAA 2VP3A 2RHBA 1YGYA 3QKUA 1P2BA 1ULUA 1EVIA 2J5RA 2H1HA 3FYHA 4HBGA 3R3XA 3ZZ1A 4R2KA 4BKQA 5AVXA 5IYZA 4G0WA 4ER5A 1U1GA 4H15A 2HLDD 3MCWA 1YNOA 5E1BA 3L06A 1WBJB 3CRVA 3BX1A 3OAAD 4A5OA 5C7OO 1TIBA 4I50B 4O4LB 5FLEX 2IQIA 4MDHA 3ABZA 4QXPA 3VDMA 1PNOA 1XOIA 1U0HC 2XD4A 3HKDB 3MIIA 4PTYA 1XKTA 3HCDA 1NSTA 2VJOA 5KYXB 4KNYA 3NMUF 3LCUA 1JR3A 2G9ZA 1P5ZB 1VLVA 3EXFB 3LAWA 3GJ5A 1VCOA 2W2MA 4GPTA 2PIDA 3SIXA 3PC8C 1DIBA 4EB8A 1CHDA 2FPLA 4FX2A 4OGKA 3OIYA 2Q5EA 3WZMA 4Y0NA 1OE0A 1Q7GA 1X7ZA 3SBXA 3JV7A 3D3WA 3PRJA 2JATA 3FUUA 4JX9A 5DHTA 2XWPA 1R9GA 2QY6A 3F9IA 4KXQA 3HCEA 4M0EA 1M8KA 2XKAA 4RWZA 2Y1KA 1TM4E 4NIMA 3U0BA 3NVKI 2JLAA 4MPRA 5IAOA 4ZV7A 3TEFA 4Z4GA 3DFMA 4FYJA 2BMJA 2QMEA 3KZXA 4GC9A 3VVBA 2C3UA 4AK9A 3A6KA 3K73O 2OAEA 3N8DA 1L5MA 2BEWB 2FMFA 2XQIA 4K9RA 3QKTA 1PKXA 3B53X 3TSYA 4X54A 3N7UA 2FU5C 4RM3A 5GM1A 3TXYA 4RFSB 4PO3X 3WXMA 1BDBA 3NHYA 1GFSA 3EVAA 4URHA 1CDDA 3T5BA 4P22A 1T8WA 4BGEA 3I53A 5KX5F 1E4EB 1WXFA 3QEOA 2ZIZA 3P97A 3CWZA 3JQ7B 3CKMA 4GE0A 1RXWA 4E08A 1ORRA 4LE1A 1E2IA 3L4KA 3H5OA 3DM5A 4M2LA 4MW4A 1X92A 4L0QA 4NE9A 1WA5A 2P4QA 3WLOA 2IDJA 3RRJA 1CRLA 1ZCZA 3ZJYA 3MS2A 3FI0A 3A9TA 4A6EA 5ENDA 3ILXA 3KWLA 3PR1A 5FHRA 2QNBA 4NS1A 3WSWA 3I4CA 3MMNA 3R6LA 3F2IA 3T15A 3ZC3A 1KRWA 2IYVA 2O8VA 2XNDD 3ADPA 5DT9A 5IDQA 1IEVA 3ZVLA 2OV4A 1J8FA 2C2XA 3G02A 4RZUA 3EZGA 2Q7OE 1J90A 4LE2A 2F1HA 2X0KA 2GZ2A 5J2TA 1AQUA 1Y7IA 3FLBA 4LCJA 5AJTA 2ES4A 3QKSA 5A1JA 1I94B 1MB2A 2RC6A 3KQWA 5CLHA 5EMMA 1T8UA 4RETA 1AUVA 2R1TB 3KQYA 4JLVA 1X1BA 1C3EA 1VA4A 2NSHA 4O2BF 4TUYF 1GTMA 5EJAA 5DWVA 4TZ6A 4GKBA 2RBGA 4WXMA 1O3YA 4KWEA 1U0GA 5H4GA 1ZM7A 4NYMR 5BWBA 3G2HA 2NPOA 3BUSA 3CURA 3H1GA 4JFRA 1E6MA 1JKJA 2GK6A 1Z6AA 2V6BA 1G21B 1OGYA 4HG2A 1DO2A 5TT1A 3H5TA 1I3LA 4Q9NA 5HKOA 1UBOS 2NUTB 2P2SA 3GGGA 3V3KA 3RKRA 4IWYA 1IN8A 1QTIA 3ZNOA 2C4UA 1NW9B 4UW9A 4EHHA 4TKVA 1RVV1 4A1OA 3IV7A 5U9CA 3D3WB 1GQFA 1ICEA 3EXEA 2MSLA 3D3NA 5TQ0B 4L51A 4CIXA 1SD1A 3A1TA 5H81A 2XNDA 1UINA 3WWCA 4JA0A 2IHYA 1UEJA 3VVMA 2QYOA 4L8VA 1S7CA 2E4VA 4ZI3A 2OYSA 5ALHA 1U3WA 5G3YA 2YZGA 4U2GA 4YP1A 5KU7A 3PPIA 2QU8A 1XDZA 2E1RA 4GZ6A 3OUUA 5FA6A 2QP9X 4H27A 1GOTA 4O1HA 1UQUA 2DFTA 1G3QA 2FE4A 3T7RA 3TD9A 1IHOA 5K0EA 1ZIXA 1CFJA 1KDOA 1NN3A 2HMVA 1F5NA 1SC3A 1KSHA 1CJTC 1OXVA 2G5GX 3LPMA 3R4CA 4HUQB 3QKRB 5H80A 3PIIA 1T2NA 4YRJA 4C05A 3A05A 5ARBA 3K7EA 2VRNA 5AKZA 3ST7A 2FZCA 3GNSA 3TSCA 2WA1A 3WK8A 2EJUA 1FBTA 4MMXB 1GGKA 3PQ3A 3R7FA 4IEEA 1LQTA 4P8RA 3AM1A 4N5DA 5DKFA 4DLYA 3M1AA 1P1BA 1WDWB 3OJFA 4HWTA 3GPIA 5CB4A 3A1EA 3ANLA 4GPEA 3BRWD 4LJ8A 1QOQB 4J76A 4YMIA 3RRYA 3VU0A 3H6GA 4J94A 3PD7A 4PYOA 1VKHA 4TXNA 1D4FA 1X86B 4FMBB 4ADSG 5JXGA 5DHAA 3T5GA 1NVMB 1UWLA 2FPOA 3GFTA 1DFIA 3CXUA 3I9MA 3K2IA 3PG5A 5ALNA 1N0UA 5HJ7A 1E0KA 4I1YA 4Z4QA 4XRRA 1Z83A 2HTFA 4CTMA 3WWOA 1DINA 2Q4DA 3VGJA 1EDEA 3PDUA 4NCHA 3ZV6A 1HQYE 4M22A 1FS4A 3A32A 3R5KA 1VDZA 3E9QA 4IIFA 4QDTA 2YRWA 5REQA 4KQMA 2PMEA 2V96A 1Y3DE 1OW3B 2PRJA 4Y6LA 1D5WA 2H8KA 2XUGA 2UVDA 4HVCA 2HBZA 3THYA 1AQIA 3IAFA 1D4OA 1ZU4A 4LBZA 3URKA 5BWMA 5IJXA 2Z8XA 2CL6X 3LYHA 2G0NA 1GPH1 4N49A 1J0BA 1CE8A 1XT6A 5EIAA 3ND5A 1BHJA 3W4KA 4DV7B 1RQ7A 4DPLA 4L5YA 1NASA 1WW3A 2R2GA 1IXZA 3JY6A 4UEJA 5LA6A 5JBNA 5KTOA 3NM5A 3IILA 4RVUA 3OZRA 4D2IA 5IXYA 5JJCA 1JH8A 4G0MA 4O2AA 1UJMA 3D6FA 4RVCA 5FTJA 3SICE 3ZHQA 4IP0A 4D9HA 1E5QA 1WCIA 4TMWA 3EXFA 3MTAA 3TLGA 1AA6A 3ZDAA 1OV4A 1DUVG 2VBGA 2C59A 3QELA 3EAGA 3P9CA 3Q7TA 4MV3A 3MHTA 4D6YA 2JHFA 3ZVNA 4F3TA 4EKGA 2PWBA 1QKIA 1QOPB 4XA8A 4EJMA 2AKYA 4TV9A 3OEED 3Q5EA 1FRFS 1V1JA 3PD1A 1QQBA 3M4NA 4JQYA 4LQ4A 2ZITA 5JCZA 5ALZA 1E5LA 3FYCA 4J0KA 4ENWA 3NHMA 2I2WA 1U2SA 4JUAA 2AZMA 1YAHA 4RVFA 4E32A 4A82A 3C8DA 1VL0A 2QRVA 3WRYC 5IKEA 3WQQA 5KQPA 3R6WA 4HAYA 1P0MA 1E89A 3DHVA 1LSOA 4XD7D 1PP4A 1U80A 3ECSA 5LJIA 2NUPA 1OI7A 2WHPA 4X1KA 5MN4A 1CZOA 1TVKB 2QN8A 2PWAA 3AIKA 4XM0A 1BKSB 4YBRA 1SUBA 2D1RA 3I37X 2RMKA 3OQVA 4ND8A 4ZVNA 2FQ1A 4W1SA 4NX2A 4OHRA 1JQAA 2XECA 3WLPA 1H2AS 2DVMA 1F60A 3EQ6A 1W5AA 2H2GA 6YASA 3JALA 1YE8A 5EY5B 5FLKA 4QU9A 2OZKA 4MAFA 1EVLA 8ABPA 5I3ZA 2AZTA 2KM1A 3L0BA 4LMBA 4R1LA 1C5KA 2GVDC 3AJAA 3B3QA 3JVUA 4FR5A 4IDAA 2IYNA 4IO0A 1NNEA 2FWRA 1DC6A 3L07A 4N8EA 4RJ2A 1CY0A 2NN3C 2VIIA 5IFKA 2DPGA 1UBNA 3O0DA 2BH2A 1XD8A 1QIFA 2IY8A 1WMAA 2QVLA 3AV3A 3C98A 3NHSA 3KPYA 4IHQA 5THQA 3RUHA 1U81A 2UXBB 2C57A 4MWBA 5IM4F 3KQUA 3LFTA 5FL7D 3AEXA 2IA5A 3CB4A 1UDBA 3NIDB 4RZ3A 4UCFA 2HDOA 2QUJA 2BUBA 3UMVA 5FNVF 5JCJD 1FX0B 3RTBA 3TNFA 4B5LA 3DEHA 1Z18A 1KWKA 1Y9AA 4R3WA 2WOJA 1DBWA 1PVOA 5H16A 2VH1A 4AJLA 4EO7A 4PQEA 3AIMA 4IR7A 3I2KA 3MK31 2QSYA 1H0KA 2V5AA 2R5FA 3KO8A 4FFRA 4OOFA 4CKCB 1GADO 1JQLB 2V58A 1JDVA 1E98A 2G88A 3DAHA 2PAAA 4KMOA 4X1IB 5K3EA 4HDOB 1T24A 3OJXA 4OXYA 2PUWA 3S70A 1JJAA 3LV8A 4G85A 4MUBA 1KAQA 4L4YA 4P4TA 5DJ5A 1I24A 2RHRA 4Q19A 4US0R 5FD8A 4U7GA 4AJNA 2GAOA 1VGVA 1NNSA 1MDFA 4I9UA 1MV5A 2VXCA 4MR8A 3K0CA 3OZGA 2XUJA 3RHZA 2VZLA