4Z0TA

Crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
IDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis.
rcsb
source organism Brucella ovis
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short-chain dehydrogenase/reductase family
total genus 89
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z0tA00
3DAFA 3K8ZA 1FDUA 3PRJA 4YRAA 2IDZA 1SZJG 5DP2A 5G4KA 2DPGA 5CHEA 3A9WA 3OA0A 4ESOA 2DTXA 5LCXA 3ZH2A 2Y1GA 5CDSA 4BKQA 3GRKA 1E6WA 5JY6A 3HDYA 1EBFA 2BMAA 3ETEA 1HZZA 4R1UA 5JDIC 1C1XB 4RJTA 1JVSA 3VOSA 4B8WA 1H2HA 4XYLA 1HDZA 2DC1A 1FDWA 1WLYA 2OORA 3HWRA 3LLSA 4R54A 1Y8QB 4Q3BA 4BNJA 1DIHA 2Z1NA 4CLRB 3IQDB 4OXYA 3H65A 3OIDA 2HRZA 4L75A 1UJMA 4DL9A 1PJTA 2JJYA 3OFSA 1B26A 1YDEA 2CNBA 1YB4A 2PZLA 3LT1A 1S7CA 3JYOA 1NWCA 2NVUA 4DLBA 4BNWA 1UP6A 1XDWA 3WGZA 4I9NA 4WK6A 2FHSA 3DHNA 3G49A 4GX1A 1F12A 5J23A 2IEDA 4O6VA 2H9IA 3VPSA 4AJ1A 4GMGA 3MJCA 4EBFA 2NVWA 3OMLA 4MKRA 3SC6A 7ADHA 3X2EA 1R4NB 4N5NA 3O26A 2GSDA 3RC7A 5BT9A 3PK0A 1U1IA 2IZ1A 2P4HX 3B1FA 1BG6A 2QZZA 1E0DA 3JD1A 4BV8A 2I3GA 3UFXA 4UEOA 3L4SO 3LT2A 4LSMA 4FR5A 2ZTVA 3STHA 4MPDA 1TT5A 1MV8A 2X8LA 1MX3A 1MP0A 1XEAA 2Q2QA 3E9MA 1RM5A 3D5TA 4CR6A 3OIFA 4LRSB 1V35A 3K2EA 3WYBA 4ZICA 3PJFA 3EVTA 1YS4A 3A1NA 3IKVA 4BNVA 1UP7A 1PGJA 4IS2A 1ORRA 3WWZA 3F46A 1VM6A 4L74A 2G17A 1YQXA 3ADOA 3ZN2A 4CMEA 4ALLA 3NT2A 3OQ6A 5FF9A 3M2PA 3H7AA 3ETDA 1DRVA 4LSWA 3ROMA 1GQ2A 4TMFA 2J5RA 5JFOA 2VWQA 3N58A 1QV6A 2RCYA 3OHSX 4KWIA 3FN4A 4J49A 1BTOA 5ILGA 2W8ZA 1JQBA 3BMOA 2VT3A 2ZB3A 3GLQA 4LCJA 4ALIA 1HE4A 4IS3A 4XQGA 2A35A 3PIIA 1XHLA 2D1YA 3NAQA 1CJCA 4OH1A 4OL9A 4FCCA 4RV9A 3AI3A 3AI2A 1WDLA 4FGSA 1ZW1A 4IXWA 3V2UA 4IGEA 3QV1A 2NTNA 3WS7A 5KNLA 4BGEA 4CM9D 2D8AA 4W7IA 2ZTLA 3IJPA 1VJTA 3AUAA 2IXBA 1JLLA 1QLHA 3JD0A 4NQZA 3G1TA 3MJVA 1A4IA 4MVJF 3TZ6A 1DAPA 3KO8A 1XGKA 1R0KA 1X7GA 2HJRA 3NDIA 1IY8A 5TQVA 1RM3A 4G81A 4PLYA 3ST7A 1F0YA 1P3DA 3AUUA 1NHWA 1VSVA 2VNSA 3KYDB 3VPFA 1Z7EA 4EJ6A 4Q3EA 4IDEA 4BNZA 3MWEB 2PNFA 2YDYA 1M66A 4IMRA 5U1PA 3SLKA 3ZV6A 2V6MA 3OECA 4RF2A 2GZ3A 1KERA 4KMSA 4QFCA 1YOVB 2OXIA 4PN3A 5CEFA 4FOOA 3LT0A 2EG9A 4XJSA 3KLPX 1DO8A 5I7FA 4XYBA 3FWNA 5CG2A 3KSUA 2DPHA 1ISMA 1CRWG 3RBXA 1R4MA 3HN2A 2WMDA 1UUFA 4WCFB 1MLDA 4GSKA 4OGWA 3ASUA 3P2YA 5DP1A 1PIWA 1W0CA 1L1FA 1Y7TA 4HFJA 3DWFA 3F9IA 4RDHA 5DBGA 4TRMA 3VAZA 1XR3A 2J3JA 3JQGB 3NX4A 3WTCA 2V6GA 4O5OA 4WOJA 4NBVA 1GY8A 2DAPA 2FPPA 3UCEA 1X14A 3C7CB 2EW8A 4LMRA 4TZTA 5DCYA 2Q49A 3CE6A 1EBUA 3IKTA 4EYEA 5DT9A 3RUDA 4XR4A 1CQJA 2DQ4A 3TFQA 4UEJA 3H9GA 4FJ0A 3CINA 2JCVA 5CDYA 1W8DA 4QSMA 1B14A 1IPEA 1BXGA 2X0JA 4NU6A 3P2OA 4TVOA 3JQAA 4YYZA 4YJDA 2BGKA 2O50A 3RIHA 1D4FA 5EN4A 2NTVA 1TLTA 5JE8A 1DLIA 1WPQA 4Q3AA 2YHUA 1JW9B 1N9GB 3LQFA 4R16A 3GVHA 3JCZA 3OH8A 1E3EA 3R6DA 1Y9AA 3CZRA 4BB5A 4DLAA 4ZVVA 1ZIDA 4CL3A 1WZIA 3BTSA 4NFYA 4PGFA 1YDWA 2GF2A 5JMPA 1EVJA 4BNIA 3OJOA 2VHWA 5K6AA 1KC3A 1IZ9A 1MXHA 3E5MA 3E48A 4WLFA 2O4UX 4HV4A 1EMDA 4DBVO 4BNLA 3GRPA 4YTEA 4E12A 3GN2A 3RAJA 4PVCA 1V3TA 4RPJA 4FFNA 5C3MA 2X6TA 2P9EA 2D0IA 4DLLA 1LSUA 3JQ9A 2GN4A 2WWRA 3O8QB 4H15A 3RC9A 1E6UA 4BO3A 1Q0QA 2WSBA 3LC1O 2IXAA 4ALJA 1WDMA 5DOZA 2I9PA 4IQ8A 3TWOA 4EITA 5CDGA 1GR0A 2Y0EA 3GFGA 4MIYA 5LC1A 3UF0A 2PWZA 4P8RA 3F5SA 2PZJA 1YBVA 1I10A 3WQSB 9LDBA 5T5QA 3HUDA 1ZMTA 5CP8A 3W6UA 1P1RA 3C85A 3KSZO 3DMYA 4XIJA 1R4NA 1UDBA 2VN8A 1YL6A 5EPOA 5ITVA 4OIMA 4IJVA 4WE3A 5CEEA 3OSUA 1AXEA 3AUSA 4UUNA 2HMSA 4YJHA 3T4XA 1IHXA 4KWHA 1CERA 2ZYGA 3QWAA 4J43A 3WGOA 1T2EA 5EJ2A 4EEZA 2VWPA 1YB5A 3RFTA 1LLCA 1YKFA 1ZH8A 3DZHA 4OXKA 4Z0PA 3EK2A 1U7HA 3GN1A 3JQEA 1M67A 4AVYA 4CLEA 1PZEA 1Z6ZA 1X15A 4CM4B 1ZKMA 5BSFA 2WD8A 4YRBA 2UVDA 4L9RA 4LVCA 2NQTA 4N5LA 3OM9A 1A9YA 1U9JA 4E5NA 1JA9A 3D4NA 2G5CA 4PLZA 5CFZA 4I1IA 3V1TC 3PHLA 3ONFA 1V8BA 3Q2KA 1NFFA 3JQFA 3Q9UA 4L8VA 4M86A 5ILOA 4IDBA 4U8GA 3WIEA 1EVZA 4XB2A 1T4BA 1PL6A 5DDIP 2VZ0A 4EDFA 1Z82A 2NWQA 1GPJA 5T57A 5C7OO 1N9GA 5F1OA 3GMSA 1EVIA 2RHCA 3EW7A 4NR0A 1NXQA 2W2LD 4QO7A 4KZPA 2YFQA 3RJ5A 1U5CA 3FI9A 5JXWA 4QT0A 1I2ZA 4ZQGA 4NIMA 3TRIA 5DNAA 5IZCA 2QRLA 3GGOA 1R6DA 5I9MA 3ZWXA 3NTOA 3ZNOA 3DMTA 5ER9A 2D5CA 3DMTC 1ISGA 5IDQA 3TJRA 1NQTA 2BD0A 5K0ZA 3O03A 3VTFA 3DBRA 1HF3A 4BNXA 4FFLA 1TT5B 5EINA 5IXYA 4CUJA 4Z0TA 4R68A 4AJIA 4YAJA 1XSEA 3H9UA 1EDZA 2XXBA 3TPCA 2P5UA 3AOGA 3ZWNA 3NEPX 1P77A 1I32A 2BGMA 1ZCJA 4BGVA 4W9NA 4WASA 3ONEA 4WNIA 3RFVA 5KVQA 5EERA 5A02A 2EF1A 1NPDA 5THKA 4DQVA 3L0DA 1PJ4A 5HRUA 1E77A 1NWHA 2ZB4A 3M1LA 4WUVA 2NU8A 1CEQA 3D3WA 3RFXA 1NVTA 1P1JA 1M75A 2IYPA 3HDJA 4CL8A 1EFKA 1PS8A 3ZCXA 3JQ7B 3GEMA 1D3AA 2J3IA 3HQ4O 5F1PA 2ILTA 4CLRA 4BO0A 3IJRA 2QYSA 1YOVA 1Y8QA 3BTOA 1WWKA 1F14A 1YL5A 3FBTA 1QYVA 4KTTE 4GX5A 1E3JA 4NBRA 5U9CA 1UZLA 5JCXA 4ZN6A 4MP6A 2GUGA 3GVCA 2I65A 4YXFA 4CR8A 4B3IA 5IN5A 1WXDA 3H5RA 1E1MA 4H7PA 4AJHA 3JQ6A 4BUCA 4JIGA 4IJUA 1E3WA 5JCJA 3KVOA 3FRJA 4JBGA 5H82A 1IYZA 5A3VA 4BNUA 1B2LA 4XA8A 3ONDA 1Q1NA 2FY8A 1NFRA 4KDEA 3D64A 4OSOA 5DBIA 4WCFA 4A7PA 3C1TA 3WQQA 3PJDA 3MTJA 3GHYA 1D1SA 2O7QA 4OYRA 3W4IA 3ZW8A 1VI2A 3G17A 5JCJD 4C7JA 1JDJA 4CMGA 4CM9A 1VPDA 3IS3A 4N18A 5F1KA 5BR7A 3QJ5A 4PRLA 2WE8A 3C8MA 2X9NA 2VTDA 1ENYA 1P1KA 4RVGA 4PRKA 1KVSA 1YRLA 4NFHA 2ZJ1A 4UVGA 1F17A 5B4VA 1GFSA 5H83A 1PL7A 1DLJA 1RKXA 5DF1A 5BSGA 3L6OO 1N2SA 4DIOA 2PK3A 3TQHA 1M6HA 3JD2A 5F21A 3HB4X 3JD4A 3PHIA 4XRRA 3UVEA 3IMFA 3BMNA 1JKJA 2EIHA 1E3SA 1SNYA 1XCBA 3R1IA 4TKMA 1I3MA 3NTRA 5KTKA 1AN9A 3AI1A 1SOVA 2CSUA 4TWRA 4GVLA 1PS0A 3L6DA 5L4LA 3ZI0A 3NJ8A 1X7HA 2FPIA 3CMCO 4K9DA 2WYVA 3K30A 4JBIA 3QVSA 4ZU3A 2BKAA 5HM8A 7MDHA 1W73A 4M54A 1LC0A 3M6IA 4IQ0A 1DC3A 1KVQA 4XR9A 2ZATA 1N92A 4KP7A 3DTYA 1N7HA 3G79A 4Z9FA 3D5QA 4QECA 1E7RA 3QRWA 2WD7A 3NKLA 2FMUA 5GZ1A 4E21A 4AJ2A 2CDAA 3PHHA 3VH2A 3KSDO 4CMCA 2JCYA 3CPSA 4B7XA 3NUGA 1A5ZA 4OKNA 3L4BC 3T7CA 1PGNA 4U0JA 1SEVA 1OZAA 3OJFA 4J9UE 4OQYA 2WEKA 3C24A 4FOSA 3ITKA 1HYEA 4PG7A 4XEHA 4BKOA 3U4DA 4E5YA 1ENOA 4AICA 4YR9A 1PGOA 4PVDA 3BHIA 2FZEA 4K1LA 4P22A 1V3VA 4YBZA 4WPGA 3TDKA 3FF4A 1LDNA 4UUOA 1Y5MA 2V6FA 1C1DA 4ZJUA 3KYBA 3DBHB 3B20A 1I2CA 5G4KB 5BSEA 4R9RA 2UV8A 1YJ8A 5L53A 3V1UA 3NYWA 3I5MA 4AJOA 2YYYA 2PZKA 3U0BA 4TRJA 2CDCA 2FP4A 3I23A 3UHAA 5KIAA 1JTVA 3HADA 3PGXA 3QHAA 4HFRA 1LQTA 3VPXA 2CD9A 4QEDA 3U09A 2F1KA 3L6EA 4D41A 4UVHA 1E7WA 4PLPA 3FNFA 1BRMA 1KY5A 3VPHA 2DTDA 2G82A 2YFHA 2X5OA 2G1UA 3BZUA 4NMHA 1KYQA 3BMNB 2Y66A 5JBIA 4AL4A 1UDAA 4UVEA 5HS4A 1PR9A 2PGLA 1X7DA 2CVQA 2E48A 3RCBA 3LLVA 4XYEA 2NV6A 5KJCA 1IULA 1PX0A 1TT7A 3PJGA 3MJEA 4J1TA 3I9KA 4FSHA 4HP8A 2DU8A 3WLEA 4CR7A 3PLRA 4RGBA 5IG2A 4ZA2A 1L7EA 3PYMA 2IEBA 1TI7A 4PLTA 1EUCA 3VZQA 1PJCA 2R00C 4JGBA 3F4BA 5AXBA 1NR1A 4O1MA 4YAKA 4LMPA 4G2NA 4E5KA 2OGUA 4MVJA 4MDHA 1IHYA 1KEUA 4WLNA 1JKIA 2YUTA 4UEKA 1GQYA 3ON5A 1U8FO 4G65A 3C7AA 1DRUA 4UREA 1ZSYA 3IP3A 1E3LA 3PTZA 1J6UA 1XA0A 4J1SA 1O5IA 1YVEI 3PLNA 4NU5A 3W4KA 4WKGA 1KEPA 4WEOA 2TMDA 4PCVA 3GMDA 3SEFA 3BA1A 3VHRA 3GGPA 2IRWA 3BMQB 4R3WA 2VNAA 3GNTA 4EZBA 1HSOA 2J5QA 4GVXA 5C5IA 1AGNA 1C0KA 1U2DA 4I5DA 3H5AA 5JC1A 2HCTA 1OBFO 2TMGA 3BHJA 1HL3A 4D44A 4IIVA 3N74A 4IJKA 3D3EA 1XQ6A 3E03A 3PHJA 4GH5A 2I6TA 4G5HA 2BI8A 4CODB 1VLLA 1MFZA 1ZSVA 3WGYA 3DZGA 2WTBA 3JQCA 3B1JA 5L51A 1I5RA 3W4JA 1LDEA 1CF2O 3HDQA 5A4DA 1K6XA 2Q1TA 4BGIA 2GLXA 4ONEA 3DAPA 2IZZA 3EC7A 4DPKA 3GZ4A 3JQDA 3PI7A 2HK7A 1J5PA 4WLEA 4BMVA 4YT2A 3AM5A 4YAGA 3DR3A 3AUTA 3HE3A 2C54A 4PG8A 3A4VA 2BELA 1B3RA 4NH4A 1OFGA 3GT0A 1E92A 1H94A 3HFGA 1HT0A 3TL3A 3WJ7A 1HE3A 3M2TA 4CMJA 4I9HA 1Q7GA 2DTEA 4I5EA 2NTJA 1JAXA 1ULSA 4ZRNA 4CLOB 5A9TA 2Q2VA 1EDOA 1QP8A 4YQYA 4CM7A 2BRUA 4XGIA 2JKVA 1B8PA 4RVUA 1HYHA 3I9MA 4U6SA 1NASA 3AFMA 3PQDA 4F3YA 3FBGA 3GR6A 1H6DA 1B7GO 2AEFA 4O59O 1ZK3A 1UP4A 5EQDA 2VTEA 1N1GA 1J0XO 1UH5A 1ARZA 2LDXA 4RL6A 3GVIA 3HB5X 1GUFA 2C2YA 3MOGA 2HMTA 4EJMA 4CUKA 4EW6A 1YQGA 3JQAB 2AA3A 4XD2A 4MVJD 3PWZA 4HNHA 1PWZA 2RH4A 5JAMA 1JWAB 1O89A 2GERA 3WX0A 2NM0A 1ZXLA 3OJ0A 2GCGA 5ENDA 4BKPA 2ZB8A 2AG8A 2HO5A 4B3JA 2ZQYA 1YB1A 2XOXA 3AJRA 4K26A 3D0OA 2Q45A 4BO9A 1UZMA 4YJHB 1LNQA 1E1KA 3DXFA 4NI5A 2WD7B 4I8XA 2Y1OA 1AE1A 2A4KA 3OBBA 2YV3A 5EIOA 4F46A 4CMIB 3NT5A 3FNHA 5KJ6A 3PWKA 4BNNA 3BYZA 2B36A 2EJWA 3IDSA 3ZU4A 3QLJA 2WM3A 4IY1A 4L73A 1GYQA 5TT0A 3KHUA 1FK8A 4NPCA 4RF3A 4D3FA 5FWNA 1R37A 5FI3A 5G0UA 1ZBQA 3E18A 3E6AA 3K2BA 4BNTA 3FNGA 4IIUA 1N1EA 1PQUA 4DMLA 1OMOA 1KY4A 2CFCA 2PTGA 4NDNE 4IZHA 1T26A 3L4BA 5KWEA 2DBRA 4IDAA 1ZK0A 1GUZA 1GCUA 5JS6A 4PZCA 1MXFA 4MVJI 4IUYA 2AE2A 3BIOA 2VHZA 4ND2A 3DZJA 2UUOA 4GQAA 4WLVA 3AK4A 1P0FA 1LJ8A 2C5AA 3ABIA 3ZU2A 3RU7A 2GYYA 1EE2A 3JQ8A 1LEHA 1IPFA 5TJHA 4Z6KA 5GZ3A 4FBGA 1KBZA 2GO1A 3UKOA 5A5FA 3VVBA 4XQEA 4Q3NA 4F45A 4Q39A 5AQ1A 2CMDA 3P5SA 4NJOA 4ZRMA 3CKYA 4HFNA 4CV3A 3G1UA 4F6CA 2X1HA 3DBVO 2FSVA 3U49A 3PHGA 3ZW9A 1I36A 4RLSA 5KJFA 5ADHA 4E4YA 3V2GA 2VUUA 3UH1A 3COSA 1A71A 2O23A 1GADO 3ETGA 1P45A 3MJTA 4DPMA 2V65A 3WBFA 4XWYA 1TA4A 2HQ1A 3PYXA 3EZYA 2Q99A 1K6JA 5IJZA 2O3QA 3K96A 4A10A 3P7MA 3WMXA 3V1YA 1YBAA 4MVJE 4D46A 1H93A 3DFZA 3ZWWA 2Y93A 1SB8A 4E0BA 4Y9DA 2B83A 1CDOA 2O48X 5JC8A 1C3VA 1FF9A 3ZGYA 3EHEA 3ENNA 2AW5A 2JCXA 1BXKA 3JTMA 4UUMA 1UAGA 1BMDA 1Q2XA 4ALMA 4A2CA 4CM4A 4CV1A 4PZDA 4OJNA 3JQBC 1AHHA 3WR5A 2CF6A 4IZIA 1U3UA 3Q2IA 2P4QA 1EE9A 1UDCA 4CMAA 1IE3A 3KXDA 1GDHA 3FNEA 4JLWA 3H9QA 4RQUA 3NGLA 1LA2A 4GKVA 1I01A 1YH3A 2CY0A 4DYDA 4MO2A 1DC6A 3C1AA 3ZNQA 2VYNA 4NZ9A 4DGSA 3GZNA 1EFLA 2YJZA 1A72A 4BO6A 3GFBA 6ADHA 4JP2A 4J6FA 5JDIA 1E1LA 2X22A 1QKIA 3TL2A 1FDSA 1XELA 5K9ZA 4O63O 5T6BA 2AEMA 4MP8A 4RPGA 4L4XA 2PFGA 4PZEA 4KQXA 4L4RA 2A92A 1LSJA 2DKNA 4JNKA 2JFHA 4Y6PA 4OHUA 4GPD1 1O6ZA 2EKLA 4J7XA 3KBOA 3ZWAA 1KEVA 3RROA 4FPXA 2C2XA 4JCOA 3TF5A 2DBVO 2ZTMA 2QRJA 1SOWA 2HRBA 3PIDA 2HU2A 3GDOA 3H9EO 1H5QA 3MTGA 3RUAA 5COQA 4YWJA 3WDSA 1EZ4A 3INRA 3WJAA 2AQHA 3OA2A 3WYCA 4DIFA 1HRDA 3UCFA 4BQPA 5FFFA 3CMMA 3WNQA 1UAYA 2R00A 1AUPA 3CZMA 3ICCA 3PGJA 1Q0HA 1WMBA 3K6JA 3RUFA 3TSCA 5JNLA 1V3UA 1NQOA 1WP4A 2PGJA 4R41A 4ZQEA 1PGPA 3PYLA 3RWBA 5IF3A 4J9VA 5ES3A 3RSHA 4JN6B 1E6EA 2EERA 1K6IA 1EK5A 2NQ8A 4J7UA 5DOVA 1T25A 5I7VA 1MB4A 4L76A 3WSVA 2GPTA 5L95A 2PGDA 2IZ0A 4OO3A 1G1AA 2BF7A 1LX6A 2OHXA 5T64A 5B4TA 2BI7A 2LDBA 5JAIA 5I8ZA 1WZEA 1SPXA 2B5WA 3Q3CA 1O95A 2PR2A 3UAGA 4B4WA 2VT2A 3EAGA 4U6QA 2I5PO 1BW9A 5C7IO 1AHIA 1YWGO 4YAIA 4M89A 2VWGA 4I5GA 4ALKA 1R12A 2VUSA 3I9LA 3AU9A 3R0IA 2DBQA 1XLTA 2X4GA 1QORA 2Q4BA 2Y1EA 2Y99A 3OEWA 4FJ2A 1LRKA 3L77A 3QQPA 1E5LA 5KJEA 3UGKA 3NGXA 4W4TA 4JXKA 1DFHA 3GZNB 1ZK1A 1O94A 2EP7A 5IXSA 3DQPA 5H81A 1NAIA 3GH3A 3GOHA 3VH3A 1V9LA 1JVBA 1PU2A 3TOZA 2V6BA 2D4AA 3GEDA 4MKXA 3ZNNA 1XU7A 1PJ3A 2Q1SA 3DTTA 3RC1A 1RWBA 4B79A 4IMPA 3H8VA 4BO8A 1H6AA 4UULA 3LC7O 1GEEA 4KOAA 4Q9NA 1NX6A 3S2IA 2Y68A 4ZGWA 4D43A 2Y0CA 2FN7A 1VL0A 3RKRA 5JPIA 4NFSA 2VCYA 1YL7A 2ET6A 2O3TA 3DO5A 1LC3A 4CQMD 3EMKA 4Z9XA 1GTMA 2GRAA 2ZK7A 2GN9A 2O3JA 4K6CA 2WE7A 4E2XA 4OOFA 4GBJA 4D3DA 3LF1A 5T8KA 3KEOA 2GASA 4DBZA 1VL8A 2XF8A 4S3MA 1S6YA 3NDJA 3WLFA 1Q7CA 5JLAA 1VRWA 4DUPA 4IDFA 4JJFA 3WOHA 4IDDA 1AXGA 3VZSA 1MUUA 2Q1WA 4FN4A 2PY6A 5JSFA 4M55A 1C1XA 4CM6A 3S2FA 1XKQA 4HADA 2E37A 1CQIA 5I7SA 4BO1A 3PEFA 5IDYA 4GWKA 3JD3A 2J6IA 4WLOA 4CV2A 2POQX 3ROKA 1HZJA 3I9OA 3TZCA 1TB4A 1ZUD1 3ANMA 4AJLA 3WB9A 4DIBA 3EZLA 4TRNA 1DJNA 2Q1UA 1BVUA 2WDZA 5JDCA 4XX0A 1GV0A 5ITWA 2AXQA 5TT1A 4CV0A 3CTMA 1C0PA 3D4PA 4YT5A 4GWGA 3VVCA 2Q50A 2IODA 1ENZA 3LDHA 1XU9A 4R1NA 3LSYA 2ZCUA 5T8KC 1NTOA 2I76A 4QFDA 4L0QA 2J5KA 5G0TA 2HAEA 1BWSA 4FD3A 3KETA 1NQAO 1SAYA 4CMIA 2H63A 4E32A 4J4BA 2ZIZA 3ITDA 2FWMX 1U3VA 3GQVA 1QG6A 1D7OA 1LRJA 1V0JA 4KUHA 5G2OA 1RM4A 4LISA 1PJLA 1HDGO 1SEPA 4NK4A 3MJ4A 5B1YA 3S8MA 3IOYA 1UXIA 1PZHA 3PVZA 2EGHA 5THQA 3I9JA 3GF4A 1F06A 4O0LA 1R66A 1GPDG 4NBWA 3ZWCA 1BDMA 5B12A 4EUEA 1GYRA 2AHRA 3ZHXA 4H3VA 4FC7A 2Q3EA 8LDHA 4FFOA 3QP9A 3R3JA 5KOIA 3FD8A 3LC2O 1BXGB 4E5PA 1WMAA 4MKZA 4E5MA 3DOJA 1MC5A 3ZHYA 1GZ4A 4DQXA 4PLCA 3GDFA 1ML3A 3H2ZA 4QX6A 3WQRA 1ISFA 4DA9A 3WIDA 2EHDA 3U9LA 2D5AA 3EVNA 1ONPA 2P9GA 2XAAA 3DBLB 4IINA 2G0TA 3S2GA 4CQLB 4KUGA 1ZK2A 3HJAA 3DAGA 1NVGA 2H1SA 5GZ6A 2PKQO 3CEAA 2EWMA 2G76A 3QWIA 3QVOA 2B5VA 2F00A 5A06A 3JQGA 4BNHA 2H5LA 1BGVA 2JFFA 2P68A 2RAFA 4II2A 4J2HA 3ZV4A 4E3ZA 3M1AA 3GY0A 1PZFA 3DEYX 2CF5A 2R2GA 5TS3A 3AY6A 4QXMA 1T2AA 2ZB7A 4IGFA 5G4LA 3PFWO 1MGOA 2AQKA 2VRBA 2J3KA 5AVOA 3T7EA 1Z74A 2VZ9A 2PA3A 1WDKA 3ORFA 1NM5A 1DIBA 4ZQHA 4PLHA 5TSDA 4DXHA 1HLDA 3DDNA 4R4JA 4E2ZA 1FXSA 3WFJA 5JAZA 3F5QA 2X9VA 1JAYA 4MVJM 1QR6A 3TZQA 3WICA 2X7HA 4BIIA 1IOLA 4ZD6A 4YA6A 4B4UA 4GLLA 2RBEA 4MP3A 2EV9A 1HDCA 3O9ZA 2JAHA 1U5AA 1U2GA 1QYXA 2EP5A 3WSWA 1OAAA 2HSDA 4RVSA 1CYDA 4ZQBA 4BB6A 4BGUA 2D59A 1GD1O 1U4SA 2O3SA 1ADCA 4OMUA 4A0SA 1LXCA 3NJ4A 5AXDA 4URFA 2HK8A 4B4OA 1C1DB 3FSRA 3ZWMA 4R3NA 1LLQA 2WYUA 1DFIA 2GDZA 2R6JA 5A1TA 3VH4A 3PFFA 5A04A 1BVRA 1E5QA 1ZEMA 1HDXA 2BLLA 5COBA 2CUKA 3WG9A 1O8CA 3LF2A 2JFGA 3AOEA 1DFGA 2DBZA 4GX0A 3PQEA 1K0UA 1E7YA 2FRDA 4WGGA 5G0VA 2IYOA 2NACA 3QVTA 3LVFO 4OOEA 3AM4A 1E3IA 3HN7A 1U3TA 4GGOA 1DSSG 4DWVA 4W9NC 3KV3O 5DZSA 5TF4A 2Q2WA 4RZIA 4WJZA 5TGDA 1DPGA 4BS9A 1YONA 3AWDA 3ZHBA 3Q0EA 3GHHA 4RORA 4LCEA 2C20A 3UCXA 3PDUA 3Q9NA 2AG5A 1ZEJA 2X9GA 3ZU3A 2ZTUA 4WCFC 3DZIA 3FWZA 1M6WA 4YQZA 3WFIA 2GZ1A 3E5RA 4YB8A 4TRRA 1V6AA 4TQGA 1Z7BA 4NBUA 1UXJA 2Z5LA 3I4FA 3WGIA 3OETA 4OSPA 5A03A 3GAFA 3CSDA 3VDRA 1OC2A 2HDHA 4FQ8A 5TX7A 3FR8A 4B3HA 4RF4A 3TN7A 3E8XA 3I52A 8ADHA 3FTPA 1HDOA 4J2OA 2I99A 1UR5A 4HFMA 3QW2A 4TROA 2PLAA 2W2KA 1IZ0A 4EUFA 4CMKA 3A14A 4OM8A 6LDHA 3BTUA 1CETA 2QW8A 4W82A 3C7DB 2JD2A 4ND4A 4Z3KA 2X0IA 1EK6A 3E9NA 4CMBA 1I3LA 3BMQA 1Y8RA 3QIVA 4AJPA 5A3JA 4S1VA 4N7RA 2FSSA 3JV7A 4FDAA 3IC5A 4WNCA 3ZHZA 2X5JO 1ZXBA 4HXYA 2O4CA 3H9JA 3H5NA 3O8QA 5JYDA 2NVUB 2Y0DA 3WGGA 4RQTA 3AY3A 2PD3A 4PLWA 3LZ6A 1NP3A 4RO0A 2ZQZA 1IB6A 1UXKA 4ITUA 4M49A 3O38A 1G6KA 4BO5A 3QVWA 4F6LA 3AOEC 1K3TA 4HY3A 3DZKA 1NVMB 3WBBA 1MC4A 2XXJA 5JW6A 4XYMA 2W98A 3AW9A 4PLFA 4MIEA 2JL1A 4BQRA 4YJFA 4CM5A 3GDGA 2Y1FA 3LU1A 3K73O 2E6UX 1B15A 4P4GA 2Q46A 1DC5A 3V8BA 4BKRA 5B37A 2OFPA 5HS6A 2OBYA 2NLOA 4XDYA 4XQ9A 4CUZA 1EEHA 4E13A 4RCVA 1D8AA 4YCAA 3VZPA 4MIOA 1J4AA 4LW8A 1Y9EA 2DVMA 3GVPA 4CLXA 5AXAA 4HNGA 1KVUA 4N54A 3ROPA 3RUCA 1NNUA 4D42A 1R0SA 4EGFA 1R0LA 3UW3A 4JJIA 1PZGA 1H6CA 1ADGA 1T2FA 1Z75A 4BNFA 4D0SA 3VTZA 3B70A 2BH9A 4DC1A 3MZ0A 4OAQA 3KRTA 2PKQP 4XCVA 5F5LA 1P44A 1I24A 1LSSA 5A9RA 2JD1A 3GAZA 4MVJH 1P1FA 1DIGA 3G3EA 4DPLA 3K9QO 3DHEA 4J1QA 1I33A 4K6FA 3I4CA 3DB2A 4UAGA 4AJKA 3UXYA 4Y8VA 1GL3A 1T4DA 3Q1LA 4AJNA 1RYDA 5AOVA 2YY7A 2BFPA 1RPNA 3GEGA 1N8KA 1SO8A 1KIFA 4OXNA 2OZPA 3DL2A 4RVFA 1NYTA 3NTQA 1Y81A 3GPDG 4R9SA 4IQGA 2DFVA 1H0KA 1EUZA 4BNYA 3ZWOA 1VJ1A 4NK5A 1ZNQO 5KVSA 1P33A 4IJWA 1L7DA 3RJ9A 3OEYA 1QRRA 3N7UA 3UOGA 4TVBA 3L9XA 1N5DA 5FYDA 1ZVMA 3JYPA 1H9BA 1PWXA 1PJQA 2VQ3A 1MFPA 3U4CA 2BFAA 2NADA 1P74A 4WEQA 2E4AA 4R69A 2QX7A 4J90A 1A4UA 4OQZA 4GSLA 5A9SB 1E7SA 1U3WA 4H16A 1HYGA 3E9QA 1PEDA 4PIVA 3UUWA 3JQAD 1GAEO 4R01A 2CVOA 3RI3A 3RUIA 1FJHA 1VKNA 4W99A 4NNJA 2W4QA 3F6YA 1JWBB 3BXXA 2EKPA 2X58A 4GX2A 2AQ8A 1GUYA 4E31A 1HLPA 5A05A 4DRYA 1LRLA 5JAQA 2QYTA 2OP1A 2B4RO 2YV1A 3PXXA 3RUHA 3W8FA 3JYLA 3HHPA 4UVIA 1DHRA 5BNFA 4ND3A 1Y8RB 2QHXA 5JDCC 3AY7A 3DONA 3ZWVA 3OQ1A 5T67A 2YDXA 3LYLA 1A9ZA 1ONNA 2EEZA 3DBHA 3LK7A 1H2BA 3MEQA 3RQSA 1DC4A 4XGNA 3I3OA 2O2SA 3ZZNA 4W7HA 4BOYA 2W2KB 3D4OA 1HKUA 4KTVE 3F47A 1I3KA 3JYNA 3S1LA 2NUAA 4CM1A 1HWYA 2UDPA 3A06A 2QQ5A 3SVTA 4JQCA 2VOEA 3CXRA 2PKRA 2C7VA 1DEHA 1HE5A 2NU6A 5AXCA 1YE3A 1PQPA 4BL5A 4YJGB 4IPTA 1IL0A 3HFSA 2OOSA 2Z95A 4RPKA 2OO5A 1Y1PA 3LT4A 1NHGA 1Z73A 2O3RA 2X23A 2VUTA 2HMUA 4TKLA 1CIVA 2BHLA 5EQFA 1B8UA 2DM6A 3B6ZA 2B37A 3E82A 2BGLA 1J49A 2YQ4A 4D7AA 5L40A 3NV9A 1ZK4A 4YJFB 5KCZA 1ZMOA 4CM8A 3PDJA 4J3FA 2C29D 3H4VA 4YJGA 5HBRA 2O7SA 4FJ1A 1T24A 1DOHA 3WXBA 1ZFNA 4EEXA 4P38A 2X86A 4ZHSA 1X13A 1ISIA 3ANNA 4JX8A 2P9CA 4R5MA 3FTNA 1PJ2A 4CM3A 4NBTA 3ZNPA 1ADFA 2I67A 4RZHA 4XYGA 2O3UA 4U0KA 5L9AA 3R3SA 2OP0A 4CPDA 1I2BA 4YRDA 1ZJZA 3KLMX 1H9AA 3BTVA 2VZ8A 4KUEA 1G0OA 5MDHA 4BV9A 3JQ8B 5TIIA 5HTOA 3QA9A 1HDRA 4CMHA 4PLGA 1RYEA 1VSUA 1QSGA 2UAGA 4UUPA 3BMOB 2J3HA 1QMGA 3GNSA 2YZ7A 1DDOA 2V7PA 4LN1A 5GMOA 3RBZA 5HA5A 3V5NA 5JO0A 4CLDA 1G0NA 2QZ9A 1JN0A 1PJBA 1MG0A 3K31A 1QYDA 3MJSA 4JP3A 4CQMA 3BMCA 4DVJA 4HX5A 2FR0A 3CIFA 3IL2A 5IDWA 4XZ3A 2JHGA 1T1RA 3DZFA 4ZQFA 3TNLA 3ENKA 1W6UA 1LTHR 2HMVA 3FHLA 4GI2A 4PLVA 3KTDA 5CDUA 3ANLA 1KC1A 3DC2A 4YPOA 4YVFA 3P19A 1YJQA 1DRWA 4J16A 1QV7A 1FDVA 1DJQA 1ZSNA 4J4HA 4MJLA 4PG4A 1LDYA 1PQWA 4FFRA 1TEHA 1RM0A 3AFNA 5DN9A 3SLGA 3OQBA 1B3BA 4AFNA 2AE1A 1OOEA 1DHTA 3RBVA 2ZYDA 3U4IA 1HE2A 2QRKA 2PD6A 3ZV5A 4DREA 2O2YA 1BHSA 4ID9A 5BSHA 1EQ2A 4E2YA 2C82A 3RU9A 4QO8A 1GEGA 3INGA 1GZ3A 1ZJYA 1YQDA 2Y05A 4XB1A 4BO7A 1DB3A 3HZZA 4MVJG 4CM8B 4Q3DA 4E30A 2P5YA 2FR1A 4K28A 1ISHA 4P4NA 5IZCC 3BAZA 2NVBA 2GZ2A 4BHTA 1OC4A 2DUWA 1VL6A 3C3XA 1X0XA 2QG4A 2CDBA 3OF2A 1LSOA 4ND1A 5EL0A 3F3SA 4HUJA 3L9WA 3SJ7A 5LDGA 3DBLA 4FFPA 4GGPA 2NNLD 1EUDA 4R51A 4BKUA 2WYWA 1ULUA 3ZV3A 1NPYA 3T4EA 4A26A 1ENPA 5KKCA 1OI7A 1Z45A 2YHIA 4NJMB 3ADPA 4Z3DA 3AM3A 3TFOA 2HUNA 4A5OA 4M87A 5ICMA 3OP4A 4YAEA 3KYCA 4KQWA 4TZKA 4PG6A 4BO2A 4CMEC 4ILKA 4RDIA 3DOCA 3ULKA 1KEWA 4B7CA 3OICA 2VRCA 3NDRA 1YGYA 4WECA 2C7GA 5G0SA 4N5MA 1DIAA 4J0EA 3GGGA 4U5QA 3V2HA 1R16A 1U4OA 5DBFA 5I9NA 2A9FA 3WGTA 1SMKA 1WW8A 1E7MA 4RPLA 3GG2A 1X1TA 5I7EA 5A5EA 2NU7A 2RH8A 3GUCA 5BNTA 4CLOA 3PZRA 1DXYA 5G0WA 1Y5RA 2PD4A 2VYVD 5CG1A 1Q7BA 1X0VA 1ISJA 2B4QA 2BFOA 3I6QA 4YDRA 4FS3A 2AMFA 4I9UA 5IZ4A 4Y6RA 3FR7A 5TRTA 2B69A 3D3WB 3S55A 3KEQA 3PWSA 3TZHA 4WOKA 1MG5A 4B8ZA 2YV2A 3EDMA 3ZWYA 2VYVA 1DIRA 1ZO8A 3MCVA 1I30A 3VZRA 4FGWA 1A7KA 3KUXA 4INAA 1NR7A 3UICA 1E3WB 2HMWA 3FPLA 3DFUA 4CQMB 3U5TA 3C1OA 4WCDA 2I66A 4HKTA 5FEUA 4J4TA 2BFMA 1A27A 1PJSA 4C4OA 3IP1A 4JROA 2VHXA 3GVXA 2YHIB 4CQLA 3GPIA 3PPIA 1BSVA 4UVDA 5JYEA 1WNTA 1P1HA 2QIOA 3I1JA 3EUWA 1RJWA 4NJMA 3VKVA 3QWBA 1UXHA 1LQUA 3I83A 1K89A 2FOIA 3JSAA 1GQQA 2GGSA 4LGVA 1P0CA 1P31A 2ZYAA 5F3RA 3W6ZA 3ROQA 4C7KA 3H6KA 2DLDA 3F1LA 3WTBA 1FDTA 4JJGA 5A9SA 5DCWA 3KZVA 4AG3A 3SXPA 5JY1A 2JD0A 1ID1A 1GYPA 2VOJA 3H3FA 3KOUA 4EJ0A 3D7LA 4Y67A 5TNXA 2FR8A 4II3A 4Z0HO 3FPCA 1F8FA 2XPCA 5F5NA 5B4UA 1T2DA 1SBYA 1E7QA 3PP8A 4FW8A 1GZ6A 1XYGA 3ASVA 4LK3A 3QY9A 3F1KA 5DULA 3KB6A 3K5PA 2GR9A 2CVZA 4P4LA 3PQFA 1XG5A 5TJ9A 2VWHA 5CAEA 5IDXA 1FMCA 3QSGA 3TOXA 3U62A 3O4RA 2OBNA 3RUEA 4A03A 4NHEA 1ZZEA 2Y67A 4YACA 4BO4A 3INTA 1PGQA 1NQ5A 1PL8A 2PH5A 4R5HA 1PSDA 3K92A 2VHYA 4DQUA 4EUHA 4IBOA 2Z1MA 3PJEA 2HLPA 4U7WA 3WGHA 5TLSA 1BXZA 1LUAA 5ICSA 5COAA 1E1NA 1LLUA 4DYVA 2D3TA 4Y6SA 4BNMA 2E49A 1I8TA 3GG9A 2P2SA 1M76A 5I9LA 3DOOA 3WYEA 1XQ1A 3IAHA 3B1KA 1VE9A 2GN6A 4PG5A 5BNIA 2VYND 3VPGA 2DFDA 3ZU5A 5ER6A 3SBOA 1LDGA 4YT8A 2HKIA 2JAPA 5JMWA 4R1SA 5IN4A 3DBRB 2A94A 2DT5A 5U4QA 2B4TO 4RF5A 3WMWA 3IIEA 3QE3A 1KOLA 3OIGA 3W1VA 1KVTA 3SX2A 1KETA 1U7TA 2OUIA 5KVVA 3VDQA 2FZWA 5IFLA 5L4NA 4XKJA 2DUUA 3CH6A 4GKBA 3WNVA 1Q0LA 3QWHA 4FFMA 2EJVA 1X1EA 4MINA 1W4ZA 4CJXA 2WJPA 1A7AA 4M1QA 4J1NA 1IUKA 2CZCA 2PH3A 4QTZA 3WGQA 1TXGA 3GC6A 3FCOA 3E1KA 4HBGA 4J91A 5ENVA 4GLOA 3I9NA 1GCOA 1TVEA 1GU7A 1HEUA 3JQFC 3MOIA 4PFJA 5L7TA 1WAMA 2P91A 3ICPA 4FIZA 1VJ0A 3HSKA 5L7WA 4HWKA 4BVAA 1B16A 4XRGA 1T1SA 4MVJP 4WLUA 4BMNA 1LU9A 4QUKA 3A28A 3CUKA 4A27A 2HJSA 2X0NA 2IE0A 2C07A 3X2FA 4BNGA 2EGGA 3GA0A 3TZKA 4DMMA 3NT4A 2FPGA 1HXHA 1P1IA 3HNPA 2UUPA 4B7UA 1K2WA 5HWSA 4J7CA 2VRCD 4DC0A 1H6BA 3JQ9C 4L4SA 2UYYA 2ZJ0A 4IDGA 3WWYA 5EMHA 4I5FA 3ZDFA 5KVCA 1DBVO 2PZMA 2ZCVA 4E33A 4FC6A 3ZWBA 3HG7A 3QVXA 4AJJA 2GNAA 1XWFA 1LBEA 3RASA 3G0OA 1HSZA 4E2WA 4D79A 2HK9A 2OMEA 1C0IA 4X54A 1JKFA 3NRCA 3DZBA 3KM0A 4OKIA 1NAHA 3H2SA 4B4VA 1I0ZA 1O0SA 2C0CA 3U4HA 3W8EA 3KYCB 3PZBA 2I3AA 4IXTA 3RD5A 1NBOA 1BDBA 3JYQA 1QYCA 4MOWA 4A73A 1U28A 1HDYA 2E82A 1O9BA 5DCUA 4GMFA 5I8WA 3HDHA 1GV1A 3OJEA 4JBHA 9LDTA 1LDMA 1C14A 3Q6IA 5C7LO 4XDZA 3H3JA 4J0FA 2X0RA 3RVDA 4KDFA 5K6AC 5EESA 1I3NA 2GN8A 4BMSA 3IUSA 2YW9A 4RVHA 5L4SA 5GY7A 5TC4A 2AEJA 3SC4A 4XJTA 1P9LA 2EXXA 1EVYA 3SJUA 3UN1A 1YO6A 4LRTB 4YT4A 1NPTO 5C37A 1PS9A 5LDHA 1DAOA 3MWDB 4ALNA 4BNKA 4W6ZA 1LI4A 1LLDA 1SC6A 1M2WA 2Y1DA 4NG5A 5L3ZA 4ND5A 3L07A 1U8XX 2B0JA 3EGOA 4D45A 3EY4A 3QWFA 1B0AA 4Y98A 1KVRA 2W90A 5L7YA 4FB5A 5JO9A 2OL4A 2D2IA 4AJ4A 1CWUA 3IUPA 4D0RA 1YBMA 1VKOA 5MGBA 2RHRA 3RC2A 1NFQA 4R1TA 2SCUA 2B35A 3VC7A 4D3SA 1ADBA 4RPHA 1B8VA 1SB9A 3JQBA 5KKAA 4QQRA 3BHMA 2VHVA 1UXGA 4ROSA 1KS9A 3EYWA 3AU8A 4AJEA 4TSKA 5CPBA 2NSDA 2H6EA 3JQ7A 3RKUA 4GAEA 5CEJA 3OJLA 4E6PA 2Y1CA 2EKQA 3Q11A 3ZWPA 5FI5A 3DHYA 3F4LA 5KJ1A 1PR3A 2C5EA 5AYVA 4IM7A 5L45A 2EW2A 4I08A 3W8DA 2RIRA 3U3XA 3I6IA 4JK3A 1XIVA 1N7GA 3BMCB 4RVDA 1D1TA 3VKUA 1PTJA 1Y6JA 1C0LA 3S2EA 2AQIA 1EQUA 4IDCA 4Q3CA 5CDTA 4XGKA 1BW9B 2J8ZA 4CLHA 5BQFA 3KYDA 4RLHA 1SCUA 1F8GA 1T2CA 2NU9A 4EI2A 1QXSA 1YXMA 4DTIA 2X5KO 1R4MB 5CPFA 4M8SA 3D1LA 1R15A 2JHFA 1MA0A 3GNQA 2C59A 4YEDA 1WVGA 3GUYA 4Z9YA 1QYWA 1VC2A 1QLJA 2YQ5A 3GK3A 3VH1A 2Q4EA 1HTBA 1LDBA 1ONOA 1UZNA 4GL4A 4XIYA 4XQCA 1K5HA 2W2LA 2ZKLA 2PV7A 5IAAA 2GD1O 1JU9A 1HETA 4LVUA
chains in the Genus database with same CATH superfamily
5LP6B 2KBEA 2HA4A 2MINA 1E1CA 2BGNA 2VRWA 1NJ5A 1GZ5A 2EZ9A 2FZKA 3PQ5A 5G4KA 4L5JA 5J4HA 5AI0A 1EM8A 2Q7XA 3K0AA 3OA0A 2WKSA 4ESOA 2OZVA 3ZH2A 5DASA 4B81A 1DWOA 1Z4PX 4EKYA 1LJLA 3VV3A 1I9CA 1E1RA 1NXWA 2G77B 4I1UA 4MB0A 4MPTA 5EHZA 3KWLA 1GZSA 2M6LA 2H0RA 1H2HA 1FSGA 4FCTA 1QJCA 1EVKA 1EIZA 2OORA 1ZLXA 3GUZA 3LLSA 2EQBA 4R54A 3RADC 2CT8A 3NHKA 1CIPA 5AKKA 1W46A 1EFTA 1KAMA 4Q3BA 1E79A 4H7EA 1KO8A 3I04A 3OFJA 3RJMA 4BNJA 1HDIA 3NLLA 4OXYA 2JZNA 2FYTA 1OLUB 4L75A 1OYWA 1FMTA 1PJTA 3OFSA 3RSCA 1B26A 1JH9A 3F78A 3F5MA 4FGKA 3J80A 5BN3A 3SMVA 1Z4IA 1UADA 4H0FA 4LNUA 3N2KA 4DLBA 3AZPA 1QQ6A 3DPSA 4WK6A 3ZW7A 3DHNA 4X45A 4BQIA 1F12A 4O6VA 1XA4A 3GLGB 2I4OA 3QY0A 1QCDA 4HZGA 4C89A 3R4CA 1B8OA 7ADHA 4JIMA 3T54A 3UHFA 4MCHA 1V1RB 1M1YA 3RC7A 1I6LA 1U1IA 2EBFX 1IN7A 3T3GA 4DF3A 1E0DA 1I7PA 2ZJOA 4XVUA 1WXQA 2G9RA 4WNAA 4LSMA 1WOYA 3RS5A 1Q0RA 4R2XA 1OIXA 1WUJS 1BCRA 3KJEA 2LIVA 4MPDA 4MRVA 1TT5A 3RF6A 1MV8A 4CTJA 4KQGA 2X8LA 1MX3A 3HA7A 2EYUA 2DX7A 3OIFA 1GCGA 3ZE0B 1FSFA 1XC7A 4HWPA 1PT5A 1NUQA 3Q15C 4RKRA 2P2LA 5ED4A 1YS4A 3A1NA 5E4TA 3RLFA 1UP7A 1XDUA 3GCWA 2C7OA 2ZJ6A 2ODAA 4FIDA 3F46A 3WWZA 5F3WB 2OAP1 4DZZA 3ADOA 4DLUA 5ALSA 1PFUA 3FW1A 3FTEA 4CMEA 1MV5A 3NT2A 1UMKA 2K5UA 1U65A 4D2IA 1QM5A 1USKA 2Q8NA 5FF9A 3ZV7A 4R6XA 5C4IA 4AQ7A 2DUMA 3LKZA 1GKLA 3HC7A 4A23A 3HKEB 4EYGA 2XCTB 1HGXA 5JFOA 2CL5A 1P4SA 3OLVA 3N58A 5LZ9A 3OU6A 4KWIA 1BTOA 3LA8A 3LPMA 1W48A 1OTXA 2W8ZA 1EG7A 1JQBA 3K2IA 4IIYA 3UNXA 3G8AA 2ZB3A 2ZPUA 4D6XA 2R6ZA 1R9GA 3WNBA 3WGNA 3HNRA 3LO8A 4D4MA 1IWOA 1UBLS 4IS3A 5C4MA 3TS1A 3NYRA 2P41A 4MGZR 3PIIA 3VOAA 1XHLA 2FF7A 4G8BA 3NAQA 4GZLA 3SPXA 3PHCA 3WRWA 2NZJA 2XHEA 1CT9A 4WKOA 4EKDA 3AI3A 3AI2A 1ZW1A 1GIAA 2EARA 3B38A 3Q0TA 4CVNA 5KYNA 1RSZA 2PMKA 3JATB 5AH0A 3G9ZA 5FBQB 2X0DA 1E4YA 3T5MA 3C3WA 5AHOA 3A9SA 1VJTA 4LDAA 2Y4OA 16PKA 1XJ5A 1EX9A 3JD0A 1L4EA 4J75A 4MW0A 1A4IA 3IUMA 5F12A 3EXHA 1BQEA 1R0KA 2RHHA 2PRKA 5C81A 3IEIA 4LTDA 1RM3A 2CXRA 4G81A 4MUIA 3JZDA 5TQVA 3F5DA 1P3DA 1VLZA 3P9QA 4IZOA 4EF5A 2OXTA 1E1DA 1G20B 4TYPA 4ZT3A 3DKVA 1TUIA 1ZZGA 1JHPA 1GO2A 2BGIA 2JLBA 1Z7EA 2ORED 3FH0A 4HUQA 2JGRA 4FDLA 1CEEA 4GS5A 3G59A 1GQRA 1YJAA 1YRBA 4BNZA 5A4IS 2YDYA 4CKBA 2IC5A 2RJ3A 3ND9A 1YR3A 3OZWA 4EY5A 2IP4A 1XEXA 3WQHA 5B6JA 5EE0A 5KTPA 3IEUA 1QPGA 3CR7A 4A8JB 1LJUA 1PFYA 3EVFA 1KERA 1OAOC 3JS5A 1JDSA 2JC3A 3GP5A 4UCWA 5IUNC 3GD5A 1YZUA 2JATA 4IH9A 4QFCA 1ZVQA 2VDUE 3OOYA 2EG9A 3TI9A 4J0KA 3V97A 1XZMA 1DXHA 1XO1A 5KDOA 3N59A 1JEJA 3EX7C 2A9RA 5I7FA 3U61B 4LF9B 1CUFA 5CG2A 1EFUA 3EDRA 2EDCA 4I50F 2IH5A 2O7RA 2GXAA 1GNPA 2HF8A 4MYSA 4DMFA 4PZ9A 1PVDA 4UD6A 1F8YA 1S2GA 2MMGA 3I01A 2FW1A 1PUIA 2XEDA 4K1XA 2NU8B 2DHEA 4LF6B 1CZLA 4GSKA 4G1EB 4AWAA 5DP1A 3P2YA 1PIWA 1W0CA 2Z8YA 4OQXA 4QPNA 1P5FA 4DV6B 2VATA 3LUDA 4RDHA 2DLNA 3VAZA 2JIQA 3NX4A 4MQ5A 4UHDA 4IIJB 3LQRA 2WFAA 1RPJA 4NBVA 1GY8A 1AHPA 1ZYUA 3WGUA 1FRFS 2ZRLA 2IYWA 5ALQA 1D6MA 1X14A 3HCRA 4LMRA 3N6RA 4EFMA 1YFLA 3ESBA 3PU6A 5DCYA 4HH3C 4EG4A 1EP9A 2F43A 2PBLA 1SRQA 3QVVA 5I4IA 3O92A 4CHGA 4ZAXA 1Q1QA 5KTRA 1BA2A 1H65A 3DH0A 3QGMA 4XR4A 1ZN9A 2I7DA 3C1UA 3PPXA 1C8LA 3EXHB 4MV4A 4FJ0A 1QF9A 3HCPA 2JCVA 4BJ3A 4DXDA 1KMCA 5FUXA 1WHTA 2XYPA 3MUEA 3GA7A 2X0JA 3TMAA 1F6BA 4TVOA 4K87A 2VHTA 3YASA 1N36B 2JFVA 3L8HA 2JBAB 2XDQB 1D4FA 5IBQA 3BWVA 1DBIA 1UKVY 2NTVA 3F5FA 2JGFA 3JQPA 3THWA 3I4LA 4DHWA 5FR2A 5AUPB 1C2YA 4JUDX 4EJSC 4LMAA 3L82B 3NBMA 1BO6A 3JWGA 4OIFA 3OH8A 1E3EA 1RLTA 3J81k 2QL7A 3H8SA 2C9CA 3FSGD 4HS4A 3WHPA 1JXAA 4BB5A 1KZYC 4UZFA 1ZIDA 3TVDA 4S1OA 4D1YA 5JXJA 4NFYA 3LBFA 4PGFA 3SMQA 2HF7A 2G4CA 1XF9A 3Q41A 4BNIA 4G5YA 4BRWA 3BSFA 5K6AA 3OCYA 3SYTA 2Y76A 4E14A 4F71A 3E5MA 3E48A 3DP9A 4R1QA 3K4PA 4WLFA 2O4UX 2BPOA 4W8HA 5E6SB 1DWUA 4JUBA 4DBVO 2B78A 2RGRA 3ZCVA 4E12A 1BEZA 2EBHX 5HP4A 1ZUNB 1TUGA 4RPJA 4ZVUA 4BBZA 1Z0IA 5C3MA 2HA5A 2X6TA 2D0IA 4UASA 1WEHA 3FSEA 5KX5A 2AMLA 3OURA 4C7OA 3D59A 1RQ7A 2W6CX 3RRMA 1E6UA 2QTZA 1OSNA 1MAVA 4RC9A 4BO3A 4ZYVA 5CD1A 3KVNA 4F4JA 3DO6A 5SZJA 3I64A 4PAQA 1SVSA 3TQQA 5DOZA 3T15A 1N77A 3TWOA 2MSDB 4EITA 1OX6A 2DUJA 2AIRA 1GR0A 2IX9A 2XE4A 2WT8A 5EPUA 2PWZA 3ZGZA 1OIWA 3F5SA 3JVDA 3QELA 4K0KB 2IS6A 4QRHA 3A4YA 3S5JA 5LU8A 1X7YA 3C8UA 3UA4A 1P1RA 3WWDA 3ZCRA 3PUHA 3AHJA 1M34A 1R4NA 2GEFA 4V03A 2YWHA 1UDBA 4D8XA 4EKNB 1YL6A 4P7BA 1VP3A 1T13A 1VJRA 3KVVA 5CEEA 4EDHA 1HT2E 4M36A 4DLYA 4MVCA 1IHXA 1ILEA 4E6EA 2PS1A 4MJ7A 3V1MA 3OEHD 1N4AA 4F21A 1N57A 4YPFA 4EEZA 2VWPA 1T3GA 3WGIA 2FW9A 3THSA 3BSYA 4PPQA 4QGBA 3IPLA 1XWIA 3AETA 2G8LA 2R8OA 1KMIY 2HBYA 5C5CA 3EK2A 1W35A 4OU4A 2ECOA 1M67A 2YXDA 4BVEA 1PZEA 3GAAA 2BTEA 1XZLA 3QUSA 3RT1A 2UVDA 3U2QA 2QR5A 1A9YA 1U9JA 3E1SA 3KXIA 5E6SA 3VUEA 1JA9A 5GTDA 4NBSA 2RI0A 1M9NA 1MVOA 5TQ2A 1SH7A 3HU5A 3K0FB 3TB4A 2FG5A 1NI4A 3NXSA 5PGMA 1ZISA 1NFFA 1E94E 2MSEB 3T9EA 4P81A 121PA 2PQMA 4QEKA 3VX3A 3GPBA 1B74A 1EWTA 2GMWA 1Z82A 3HB9A 1VI6A 4L07A 2NWQA 1D2CA 5T57A 4H0NA 1UMBA 2WFLA 1N9GA 1EK0A 1E1CB 1XMXA 1URPA 3GMSA 3K09C 1NXQA 3TLAA 3KSBC 3ZLUA 4ZU1X 1Y8ZA 4MDYA 3WMGA 2D5IA 1TZBA 1U5CA 4I8IA 5ALKA 4R40A 1NW4A 4UMDA 2FPXA 2G0AA 3GUUA 1HNNA 2HSJA 5DYGA 3WLPA 4NIMA 4MWTA 2BGWA 1OE0A 4IVPA 1R6DA 2QRNA 4KW7A 1DQNA 2I54A 4HXFB 3RARA 2FETA 2VJQA 3SHTA 4D9EA 3KEFA 4HGOA 2O8DB 3DMTA 1LNZA 1YCFA 3ZDAA 4II7A 2BD0A 2BFBA 1XLUA 2HBRA 2E1PA 4R2WA 4BNXA 1CR4A 4Y2RA 5K3CA 1GP2A 3K0CC 3GJ7A 5AVWA 3A8TA 3B51X 3PX7A 2PX2A 4H2DA 4Z0TA 4D8YA 3OPMA 4AJIA 1YHYA 3H9UA 1EDZA 1JG7A 1RR6A 2P5UA 3LPNA 4L4UA 3OLYA 4OHWA 3ZWNA 3COPA 1GU1A 1R18A 3NEPX 4MUFA 1P77A 4C2TA 3HY6A 1SHZA 2YYSA 5EERA 1KL7A 5A02A 3B1WA 2V0CA 1O9GA 3F6RA 1TO2E 2JDID 1EHIA 1Q0SA 2O0HA 5CA0F 1E77A 2HZ7A 2HSZA 3SZ3A 1H1DA 5H4GA 1A2QA 3EGDB 1O96B 5A5FA 1Z5ZA 3LS2A 3STTA 3E3OA 2IYPA 4CL8A 4H3HB 4P08A 4F38A 3PNMA 3TINA 5CFLA 2H07A 1D3AA 2FSUA 2J3IA 3HQ4O 4RZUA 5F1PA 5EMJA 3ACDA 3CGWA 2Z8ZA 3IJRA 5FT9A 2WWVD 4BX8A 4ZMBA 3V4OA 3IP7A 3E9RA 4PYIA 2OQIA 4MO9A 5IU6A 4DUGA 4WADA 1FEZA 2VEDA 2W2QA 5DWDA 2A0FA 2C3MA 1H5NA 3IQIX 4G4JA 4GX5A 4NBRA 1UZLA 3G9XA 1M1NB 3TLZA 3KHTA 4MP6A 4ZN6A 3OP1A 1IBRA 2ZVPX 4UFOA 4D6PA 2YJ3A 1SIWA 3NBFA 4H59A 1ABEA 5TVGA 1DAHA 3T7AA 3N8NA 1ONBA 1WHSB 1XTQA 4BC0A 2W8BA 4QDXA 1C2TA 1D2MA 1KNQA 5CYGA 1BXRB 4ZT7A 4NATA 4Q4HB 1TAGA 3RAPR 1TM2A 1GNQA 1L5SA 5KNDD 3RYCA 4JIGA 4IG4A 2JGDB 3B6JA 3LPDA 4ZYLA 5BUSA 5JCJA 3FRJA 1XE3A 2RGBA 1MHPA 1AQIA 3B7WA 3FETA 3LCUA 1OV6A 1XPOA 1FQWA 2AH5A 4K9QA 1UBHS 3BWBA 1O77A 2FGKA 2I2WA 1L7PA 1Z2CA 2RI1A 3QVJA 4G0WA 4WW0A 3PJDA 3U39A 5LU9A 4JOQA 4LTMA 4DADA 4OYRA 2CB0A 2J9FA 1IG3A 2K4MA 3E53A 1O08A 1VI2A 5HCNA 3GP3A 4FE3A 4YWHA 4QXOA 5D6NA 1W36B 1JDJA 3R3WA 4IEEA 2J3MA 2QA5A 4KSBA 5EIXA 2NUPA 2WTUA 3IS3A 5F1KA 5BR7A 3QJ5A 4FU0A 1R6AA 3VR6A 2WE8A 2FH5B 3C8MA 8AT1A 4QQFA 2BUCA 2VTDA 4BTEA 1ENYA 5KTYA 3GEBA 2V7TA 1P1KA 4PFQA 4PRKA 3PPWA 1P9NA 1U31A 5B4VA 3EZFA 1GFSA 1ZH2A 1PL7A 2A0UA 2BAGA 3K1TA 3CISA 1P8AA 4UE6A 1SUFA 1XEWY 4BRSA 2MT9A 4H77A 3T5AA 1QFYA 3BAFA 1E69A 4TM8A 3KJXA 1C80A 3M3PA 3HB4X 3PHIA 4ZK2A 1KSJA 1NBMD 3UVEA 3OD5A 4V0RA 4KPUB 5FL7A 2ZE5A 4F86A 1W4AA 1L6IA 3GWZA 2YIVX 4JJ4A 1E3SA 3O91A 1J09A 2FQYA 1TYDE 1SNYA 2JI4A 2YRWA 1G6Q1 3OCCA 2ZBRA 2R1ZA 5DI3A 1LPOA 5ISMA 4TWRA 4GVLA 2AGVA 3IFSA 1CBUA 3ZI0A 3BVPA 3GEEA 2FPIA 2L17A 3QPWA 4PR3A 4MYCA 1KDRA 3OFND 2Z09A 3GFPA 5C8DA 1N6HA 2BSQA 4F5EA 4R7ZA 4ZU3A 4FLFA 1NF9A 1C7QA 1RQRA 1W73A 4OJMX 3U3DA 3M6IA 4I0WB 3R0XA 1H5UA 1UCFA 3W1WA 2XGOA 1YFZA 3HXOA 1PBTA 1TADA 2I4NA 2ZATA 3LW7A 5LWHA 3DTYA 4PFKA 1RAEA 2FG7C 3O74A 1L7NA 3OHPA 3D5QA 5G1NA 4QECA 3Q7SA 1O94D 2WD7A 1T2UA 2FWJA 1NSFA 1Q1AA 5ALNA 3TLGA 2FMUA 1W87A 2XR1A 3B9QA 3HYCA 3PT5A 4S12A 5GV8A 1IN6A 4XUDA 4AJ2A 4DJFC 4ERXA 3FPGA 1S3GA 5FNZA 1CVRA 4MQFA 5D84A 3KSDO 3VH2A 4CMCA 2JCYA 4C3OB 3CPSA 5BURA 1M5UA 2BEKA 3NUGA 4D74A 3SC3A 3D6JA 8ATCA 3C8ZA 3T7CA 5JEDA 3DUFA 4U0JA 4RXUA 4PS0A 4EY7A 1RP1A 4FOLA 1OZAA 1NUSA 1YC2A 4OQYA 3OY2A 2WEKA 3C24A 4MV6A 3U3RA 4BKOA 4EG0A 2B21A 3U4DA 4KB5A 3NOQA 3ZLTA 3B6EA 2HJGA 2CLMB 4MV1A 4MUAA 1KRWA 1TK9A 2LPMA 1NJSA 1JHDA 2O6LA 5NLLA 4C4RA 3WLIA 4OBWA 2DOKA 4G8CA 1G4UR 4RESA 2D1SA 1T5LA 4KPUA 3FF4A 1LDNA 3L43A 3A1SA 4NE7A 3URMA 4JI4B 3ESYA 1LCIA 2Z57A 4MCAA 1U0OC 2ZU6A 2CNWD 5JNTA 1HR0B 4UMEA 4ZO4A 5CM9C 5BSEA 1GZ7A 2X1VA 1FU4A 2GRUA 3IHWA 4RAQA 4CTMA 5JYCA 5KWIA 3AVUA 1YRHA 3KYIB 3V1UA 1Z47A 2QTHA 1XRRA 1T8WA 1V1RA 2WAMA 1AQ6A 1NJ2A 1IEWA 2JH3A 2WWTA 4Q4CA 3AC0A 1N2IA 1WBJB 1JTVA 3PGXA 1QOQB 4K2HA 3T7DA 4HFRA 2FPIB 1LQTA 3UJ9A 4TZ0A 2ZWMA 3VU0A 1U0FA 3S8YA 1TF2A 1Z6XA 3AHHA 1VYUA 3HGMA 5LBIA 3T38A 4D41A 3U7HB 1FZTA 4UVHA 3U7EB 3RBAA 5KNBA 1Y1TA 4Y0NA 5MFPA 2UZ4A 1E7WA 1S7GA 1V7PC 1WXXA 3AMVA 3FZEA 2G82A 2YFHA 3H6HA 1DUIA 1CUVA 3G0GA 4QVKA 4NMHA 5DSXA 3IEVA 1Z7YA 3E84A 3OIYA 2ZUVA 1W1IA 5JBIA 5TDHA 1KZ6A 3K09A 1K8RA 1OA1A 2I8AA 5EHNA 3GT4A 1D6SA 2PGLA 2R6AA 4QDZA 4D96A 4W5OA 1P8JA 2QE7D 4X1KB 5KJCA 3M4YA 2H5JA 1JB1A 4ZHQB 5IKPA 4YMSA 4ZXFA 4DCSA 4OTZA 3DBOB 3ILSA 3PUIA 1X3SA 4FSHA 2VSOA 4LV6A 3T9BA 4AUEA 4QD3A 1Z06A 1H3FA 2J9YB 2GXUA 3FWPA 2DU8A 3OLQA 5GGXA 3WLEA 4YECA 3PLRA 4M8KA 1EJBA 1WP9A 2AFHB 3PUXA 2HRQA 2JIBA 1TI7A 4PSAA 1EUCA 4PLTA 4ZA2A 4YCNA 2I71A 3VZQA 3FF1A 2NTYC 4HX2A 1EB8A 1M8FA 1TNDA 1KF0A 2X8BA 3NJRA 2ZI5A 1YB6A 3FPHA 4YAKA 2JJMA 5JNSA 3Q8WA 1I1NA 4B6PA 3OZIA 4MMXB 2QORA 3GLTA 3ZS8A 3FHCB 2IXTA 4DCVA 5SZHB 4FNOA 1Z6QA 4R2HA 3S3TA 1KEUA 2JFUA 5L3QA 2PUFA 2R1VB 1ZGBA 3QJGA 4DA0A 2BBTA 5JANA 3MUOA 4LYYA 4MV9A 4AMGA 1F9EA 1UKZA 3ODGA 3F3KA 2XW6A 3U37A 3S29A 4UREA 1GLNA 3PTZA 5BNZA 1J6UA 1VOTA 3QKWA 1VDZA 1XA0A 2R84A 2XNDA 4DMGA 3IJ5A 3KXPA 3KVYA 1O5IA 2H3HA 2WA1A 3O75A 5CFMA 3PLNA 1PI3A 1GZDA 2WM2A 2R44A 3LD9A 3DNMA 2JG3A 1MO5A 2GWRA 3BA1A 3CZ9A 3OKCA 3BMQB 1CE8B 2VNAA 3GNTA 1HSOA 5IKMA 4X6UA 2A0KA 1FLAA 3C3JA 2HYIC 4I5DA 3MT0A 5JAHA 4E94A 5JC1A 2GVZC 2PIDA 1OBFO 4LRUA 4REQB 4LXHA 2M1ZA 4DLRA 3O7MA 1CUDA 2H2IA 2OFOA 3E03A 2QTCA 3K7EA 3N74A 3PHJA 4G5HA 2BI8A 4IJKA 5A6SA 3DZGA 5AKGA 3LDUA 2WTBA 3JQCA 1CNFA 1Q12A 5C4GB 5L51A 3M5WA 4XAQA 2NYAA 2VBGA 2ZBUA 3HDQA 1K6XA 4YJ3B 4ONEA 3DAPA 3ND7A 3PNOA 4QBHA 3ZE2B 4RHFA 3VJMA 1M73E 2HK7A 3PI7A 4WLEA 3V8VA 4YT2A 1HLFA 4O4HF 3K6SA 1MRZA 2XEXA 3DR3A 1S2LA 2C54A 1KAOA 1YI1A 3ODPA 3R0VA 1VKZA 1XRJA 2Q3JA 1OFGA 3WLNA 4DLNA 3C4QA 5I4KA 3C15C 3IULA 2QRPA 3NHUA 4OL0A 2IWHA 4A8HA 5EJ8A 5IZ4A 2NTJA 1JAXA 2F3SA 3DE1X 5CT4A 1N6KA 1V7CA 3VR2A 4E88A 2KWIA 3NATA 2V3VA 5TQ0B 2JKVA 1QH9A 1JHOA 1HYHA 3I9MA 4E11A 2VQ6A 2AN1A 1JYSA 3RIYA 1KEEA 3M6WA 4AKTA 2IU3A 4IX1A 4KBYA 1T0PA 3GRYA 3KPJA 3WISA 1XTRA 2GI4A 2O1WA 3PVCA 1PFQA 1UP4A 1EWQA 2KSQA 2VTEA 2ABWA 3GLGA 4C7VA 5MN6A 2L69A 1X87A 3HU2A 3UMVA 2O8BA 4G24A 4KX3A 3GVIA 2XE7A 3HB5X 2VTKA 2IIQA 5IWCA 3SK0A 4KGXA 1NV9A 2C2YA 4PW0A 3OC6A 2RK3A 4MVJD 4CU2A 1IDN1 2VHCA 1PR2A 1PWZA 3FA2A 2BDEA 5JAMA 3D2CA 2JASA 5ITZA 1TAQA 2ODQA 1U0BB 1I6MA 2ZREA 2HN9A 2GLUA 2GERA 1XVTA 3DEIA 3I6BA 3OJ0A 1U3DA 1FP2A 3C97A 1MHTA 1N7IA 2HO5A 4B3JA 4PM4A 1YB1A 1GT6A 1QRAA 2XOXA 4K26A 2Q7DA 1X1DA 1Y3DE 3E4DA 4IHJB 4MAFA 3OPYA 5SYNA 4G41A 4AK9A 1D5CA 2ZXFA 1HV8A 3DXFA 5BNWA 3OT5A 3KDPA 4PYJA 1MO6A 1MJFA 2VDWB 3KR0A 1YS6A 2YV3A 2PUBA 4CBVA 1A9QA 3LNTA 2BKLA 1KH2A 4HWSA 4CEHA 3NC0C 1P2SA 1NBME 2CBXA 4PZLA 3VSBA 4BQOA 1T3ZA 4WZAB 1T9ZA 1LBTA 3RW9A 4AN0A 3QLJA 2ZS9A 2JBHA 4NZYA 1JFVA 1GYQA 1JR3D 1TF7A 1SD1A 3B5JA 4KN8A 4ZI5A 3UIEA 3QK7A 2JFNA 4Z4FA 2P78A 4B2IA 2ATXA 2PNJA 1ZU5A 1ZBQA 2OCYC 2R7MA 2YJTD 3K2BA 4KZKA 3U13A 3ZHCA 5JR3A 4ZV4A 3QITA 1AU9A 5G02A 5DRYA 4AMYA 4LKOA 3OWXA 4OK6A 2UVPB 5JADA 1GITA 2IGTA 3ORYA 2DR3A 1J2RA 3LXXA 4R9NA 3DFFA 1Z6GA 2ASEA 3R6GA 3CVWA 1ZK0A 2FDRA 2J31A 5I01A 1ZN7A 2VYCA 1US8B 1GUZA 3WL5A 1O97C 5ERYA 1UK8A 5JS6A 1OXSC 4B6FA 1JFFB 3PD7A 5BW8A 2X42A 1TIBA 4IUYA 1T6YA 4FEYA 1Z17A 4HUQB 2AE2A 2M32A 3BIOA 4RFVA 2UZ1A 4V0OA 4GMKA 4S2EA 5D85A 4ZC8A 4NXNB 2Q8QA 4EG7A 4U39A 1LJ8A 5L6LB 3IUNA 3QV2A 1T5TA 3DULA 3RU7A 1LEHA 1IPFA 1I3OA 2Q5IA 4R83A 4Z6KA 5IK2D 3BDIA 2JLXA 5JNVA 3LXMA 3ER6A 3A6ZA 3O31A 4ZRMA 4B6SA 1OWNA 3H2IA 4R3UC 4CV3A 1Z22A 3G1UA 4F6CA 4Y2HA 2FSVA 3ZW9A 1I36A 2XQFA 3OKAA 1A7UA 5ADHA 1JR2A 3AKEA 4CF4A 3X2SA 3NAZA 1JIKA 1ZU4A 2O5VA 4P3KA 4HDQB 4MROA 3C6KA 4XCXA 1LV7A 2PSEA 1GADO 3ETGA 1P45A 3BM5A 2V65A 1DTWB 1WCWA 2KHZA 2AR9A 2ZT6A 1JRLA 3L2OB 1RJGA 3H99A 1PJ8A 3MUNA 2HQ1A 3O0TA 4M6WA 3EZYA 2FUCA 4QTTB 1DXQA 3EIUA 4WK0B 1K4MA 1C4XA 1LF0A 1Y3AA 2C2ZA 3RRZA 1YT5A 3QKIA 2G40A 3QI2A 4A10A 4S0ZA 2PIAA 3A2LA 1Z29A 4IHJA 2FJUA 2C77A 1B42A 2A59A 5HFJA 2CXXA 5AKJA 1VL1A 3G8DA 1OKKD 1FRNA 2AJDA 2Y93A 3P71T 4Y9DA 2IYRA 2O48X 4DZRA 4N6GA 1V8ZA 4ZCMA 3HPRA 4N01A 3B3FA 3DYIA 4LOIA 2QW1A 1HYBA 3WK4A 4YV0A 1J8DA 3FFWA 4HGRA 4CV1A 1PTKA 3CCBA 1T5SA 3A37A 3L01A 3O4IA 1ACMA 1AKNA 1BQ3A 1I4EB 4OJNA 1IXYA 4IZIA 4XWKA 1M0SA 2NPOA 4XPIA 1VIMA 3EH1A 4UXHA 4WFQA 3ENWA 3I45A 4CMAA 4Q16A 1KS2A 1Z37A 2R79A 2XB9A 4G4GA 4RQUA 3H9QA 3C6ZA 3WLOA 3NGLA 2ZUSA 1I01A 2IPOA 7AT1A 2ONYA 4LZNA 4MO2A 3ZX4A 3ZNQA 1I4WA 5H68A 3KR9A 2YJZA 3KT8A 3OJXA 4BO6A 2ARKA 1KFKB 3GFBA 4JP2A 2CXOA 3CR8A 1E1LA 5NULA 2GPBA 2VK8A 5EEGA 4NBLA 3WXBA 5K3SA 3FHTA 4KLAA 3AVVA 3L84A 2HXSA 4FX2A 2HRDA 4IYRA 4RPGA 3PX2A 1RXVA 2VP5A 3AF4A 4QPPA 3UK2A 2PFGA 4KQXA 3WGMA 4AIIA 4DCGA 1EDEA 1U0GA 4RJKA 5FPKA 1ZI9A 1DG9A 3DDUA 4NSNA 4ZI2A 3OIWA 2P9YA 3RANA 2J3DA 3I8OA 4R8VA 5B1EA 1T36A 3I04M 3IO3A 1TTPB 3P5BA 3WFZA 3EXFA 1P7ZA 6GPBA 2O2ZA 3ZWAA 5LQUA 4X65B 1YS2X 2D1TA 1OJLA 5EFZA 2C2XA 2AC4A 2HADA 1T3TA 2SCUB 1XYYA 2DBVO 1IVSA 2DXIA 2QRJA 1B93A 1V96A 2VRNA 3PIDA 2GEDA 5D7NA 3RUAA 1RQXA 4DCPA 1P39A 3MTGA 2X15A 1GAQA 1QZZA 4YWJA 1OWPA 1VGQA 1EZ4A 3MS7A 1WUIS 1WXEA 1T1IA 1Y3IA 3MA0A 3EZ2A 3EXG2 3MSCA 1BOFA 2O8VA 5DXJA 1G2PA 4DIFA 1U1FA 1V4NA 3CB2A 4LJKA 2C61A 3WNQA 5EVCA 3IT3A 1W7AA 4JR0A 1S9HA 1TLLA 3K0AB 1NBWB 1CPYA 1WMBA 1NVAA 1TCUA 2P0EA 2ZJ2A 3OHMA 3S28A 2WB4A 3ZDYB 4AF7A 1FXUA 2G9ZA 2JLSA 3IYLW 4HH1A 1ZVVA 3AF2A 5CA1A 4P3PA 1U2EA 4Q4DA 1WP4A 3MC1A 1MH1A 2XUFA 1IUOA 3IDAA 4RV4A 1V2HE 3K6KA 5HE8A 1KSGA 3RSHA 3TLBA 3WBKA 3NPAA 1T25A 1ZIYA 2IYSA 1MB4A 1MB3A 3SZLA 2GPTA 3DFMA 3EOAI 3TAHA 5B3AA 3T3HA 4QULA 2YTZA 1G1AA 3I1YA 4OO3A 1JIXA 2R8EA 5B4TA 1PNOA 2ZUWA 4LC9A 3UUGA 3C14C 1WZEA 2WJIA 4JJ7A 4EOGA 4BEVA 3EB9A 1IEXA 3NAGA 2PR2A 3HI4A 1Y33E 4GD3Q 4K03A 4UNRA 4WBNF 2AD1A 3B2QA 1RZUA 1BH2A 2FZCA 3GWGA 2OY0A 3M81A 3K0SA 4ZMSA 2XH8A 3MWYW 3PNPA 1BKDR 2RJOA 2VNKA 4XQ0A 3U44B 2QYHA 1BS9A 3BJEA 3FYHA 4IDHA 2R11A 1JIUA 4BMYA 3ZY4A 1YWGO 1T10A 1X74A 1YSCA 2VWGA 1T8RA 1UPFA 2GS9A 2Z2JA 4KVGA 4Z0NA 5JXHA 3X1WA 3PNLA 1N0UA 3KLNA 1XLTA 3U3KA 4JLPA 5FNVA 1WXIA 2ZU0C 5B3JA 3L1HA 2FPLA 4M1KA 4GZ5A 4M8LA 1UIRA 3EIQA 3L77A 1RLUA 2QN6A 3KNZA 4X44A 1JTFA 1KK1A 3C6YA 1OFVA 1E5LA 2E4VA 5KJEA 3MD9A 2A0YA 5DHPA 3WBJA 4HUTA 2WHEA 1JIJA 4URHA 3UGKA 4FHEA 2D8MA 1GFIA 5CNIA 2OPHA 4KR6A 1DFHA 1TKBA 2NPIA 3GZNB 5CCDA 1IMJA 1FDOA 4DR6B 3DQPA 2R86A 3GH3A 4ZP1A 5BY2A 5LYJB 4F9GA 1TCAA 3BB1A 1K3FA 1PEAA 2V6BA 5EMKA 1V7ZA 2E3JA 4MKXA 4XSGA 3ZNNA 4UBLA 1PJ3A 2Q1SA 3DTTA 2YQZA 1QH0A 3FPSA 4ML3A 1RE1A 3DVLA 1E96A 3OOSA 3OTGA 4MR8A 5LBTA 4BLUA 4YJ2F 4PXSA 1QBGA 3S44A 2H2FA 3ZCTA 4UULA 3LC7O 2JFXA 4C08A 1K9SA 1HTWA 3W7AA 4D43A 4O4HB 4TKUA 1Q1EA 3ACCA 4GRAA 4JNCA 3G5MA 3RKRA 3OZVA 4N8SA 3CEHA 3KAJA 1QZ3A 2ET6A 4HDMA 2O3TA 3KJZA 4RMGA 4RSGA 3DO5A 1C41A 9ATCA 4FZRA 1JIIA 3WK5A 1JSXA 4Z9XA 5HEKA 4Y6QA 2VG8A 1NLFA 2QMUA 3FYTA 4XM2A 1D0VA 1T5BA 1G5PA 1W2GA 2GN9A 2EFGA 2O3JA 3NU1A 1S0UA 4PQFA 5ERXA 4E2XA 1DDGA 1NBMA 4OQNA 1ZOLA 3KEOA 3IV9A 1YNSA 3KJFA 1X9HA 1J7JA 1VL8A 4GP7A 1LPAB 4DYHA 3N1UA 3FDJA 4X91A 3TQIA 3K72B 1Q7CA 1T9AA 1VRWA 4QBFA 4JJFA 1UMCB 3IAAA 3O2JA 4IUCS 3A1VA 3F7TA 2A9JA 4RL4A 2R2AA 3H1BA 3S70A 3V8RA 3VZSA 1UOQA 1QCCA 1R27A 1T4CA 1VJGA 3T1NA 2IOHA 1K2VN 3KIPA 2J0QA 5JSFA 4M55A 5DISB 1D2GA 4CM6A 3WLAA 3ZBTA 3U6BA 4GBGA 1XKQA 1P29A 1GLGA 2E37A 3D43A 4BX9A 1DCTA 2R6GA 4XGRA 3TLEA 1J1IA 2VT7A 3CBGA 1M2OB 4GWKA 1J20A 3JD3A 1I6WA 4WLOA 2POQX 2QD4A 4HLNA 3ROKA 4AY5A 1ND5A 3I9OA 1D9ZA 2VAVA 1CJBA 3ANMA 4PFSA 5TMPA 2AJTA 4ARCA 1E2EA 1GT91 3EZLA 1RWKA 4C06A 4JT8A 4EQ6B 2Z0MA 3LDAA 3UA3A 1N6IA 3ICVA 1NN5A 5ITWA 5E6RB 2QMEA 3QPCA 3A58B 3E2PA 3I8SA 3NBZC 1F3LA 5TT1A 1YCHA 3VO2A 1XVIA 1U0TA 4BZPA 1HM5A 3BMXA 3CTMA 2NO9A 1FSPA 3D3KA 3I6MA 2AN4A 3TSZA 1G7RA 3PQ3A 4BAZA 3FY4A 2PUEA 2B1GA 5JZOA 2PSJA 3VVCA 2FEXA 4QUIA 1FXWA 5H7XA 1AGRA 1WDTA 2GM9A 3AI7A 3HLTA 4QFDA 1T9GR 4L0QA 4RHTA 5G0TA 4EG8A 5CW2A 3TOSA 3GD7A 4FNAA 1S2DA 3BGOS 2FSPA 5IVIA 4RTKA 2ZRIA 1W0KD 3LT5A 4LV8B 3FOCA 2H63A 1WY5A 2X8JB 5EJ5A 1U7OA 1WUYA 4EY3A 4BEBA 1T43A 4O29A 2GJSA 3MAAC 5DGCA 1ZQ1A 1PNRA 2YV4A 3GCZA 2JFBA 5E3HA 1QHNA 3GZJA 1GRRA 2WI8A 1KP3A 2H59A 2QROA 4I50A 1GPNA 3HFJA 1W0KA 3NVKI 1MORA 4JI8B 4U2KA 3BRWA 4X60A 2EGHA 5F5XA 3DP7A 3ZOZA 4E7PA 4ZEOA 3GF4A 1F06A 4O0LA 2YRXA 4HR7A 4O33A 3DKKA 1LQ2A 4AZWA 1GTL1 2J3LA 2PCJA 3DM5A 4HXGA 2Z58A 1R8SA 4IJMA 1M7HA 1XRPA 4TYMA 2DFKB 5K0LA 1OI2A 4OSEA 3ZWCA 1KI6B 1T6BY 4GECA 4EUEA 1SCJA 2AHRA 1BYUA 1QFMA 2AYYA 3D1VA 4H3VA 1QG2A 3V1NA 4DEVA 1ZAKA 4FKBA 4TPKA 5DM1A 3KWJA 4PN7A 5FOUA 1A9SA 3WRYC 3RG8A 1WMAA 4E5PA 4E5MA 2UXDB 3E9EA 1MC5A 1LZLA 1GZ4A 4DQXA 4PLCA 3U5TA 3GDFA 1G38A 1B76A 4JLJA 4QX6A 3E22B 4MR9B 1XRSB 3WIDA 3ZD9A 5CVTA 4BFSA 1T36B 4YRLA 2DSTA 3EVNA 1SZCA 5EP4A 2P9GA 1YZVA 4TSRA 2QAGA 1JHYA 3NHMA 4KUGA 4WY5A 3LZDA 1W4BA 1QIMA 3FDZB 4B35A 1T0JB 5HM6A 2JLUA 1NVGA 2GXQA 3R0JA 3T3EA 2WPDD 2QLBA 4IEFB 4RD3A 5GZ6A 5EUCA 3EASA 4PR0A 4K46A 5A06A 2IXFA 3JQGA 4DV3B 2C98A 2H5LA 3RV3A 1C3XA 2R5NA 2RAFA 2I6UA 3K94A 4II2A 5SV2A 2BZ0A 5T4EA 4EHBA 5B55A 1OLSA 1NW5A 1PSZA 2R2GA 3AY6A 4YJ2A 4B7AA 3UMJA 4WFJA 4QXMA 4X93A 4IGFA 4BBPA 4EVSA 4F12A 2Y71A 4J3JA 4X97A 4TUYF 3PFWO 7REQA 2AQKA 1DXOA 2VRBA 5AVOA 5K01A 4DXHA 2OAGA 3JTEA 1Q44A 3ORFA 4ZQHA 2EX4A 1E2UA 4JUIA 1FXSA 4ZEVA 1UPBA 3FKSD 3RU2A 4CTKA 2O52A 4RTLA 2X9VA 1JAYA 2JH8A 3BCSA 3UTCA 2XYHA 3W9UA 4Y6GB 1X1SA 4YA6A 3FE2A 5KO2A 1Q16A 4MP3A 2EV9A 4B34A 5K4HA 2FP4B 2JAHA 5DYTA 1RC0A 4CKCA 3W2GA 4N39A 5KYUB 2HSDA 3D0QA 5JSYA 1AUQA 3UPDA 1F4LA 2A4MA 1ADCA 4TMTA 5JFGA 4XUCA 1VE1A 1LXCA 1AQJA 2ZBGA 1KK2A 5IEJA 4F2PA 2QNBA 3JALA 3Q72A 1S8NA 1T9HA 2HPAA 3FSRA 3GLIA 3VC1A 2CL6X 3U7IA 3E3MA 2VP2A 4HAIA 3UGQA 3AR8A 2WYUA 3JQRA 1DFIA 2ZSJA 5EJIA 4DKXA 2A1TR 1TW2A 4O25A 4UDYX 2CMFA 3E22A 2EL9A 2LBPA 5EAIA 4OXXA 2XMBA 2BLLA 5L6MB 4KH0A 1OH5A 2CCGA 4BMXA 1O8CA 1CNEA 2JFGA 4GX0A 1DFGA 1NUHA 4P1ZA 3PQEA 5G0VA 1G5TA 1PG0A 1T0BA 1YKGA 2AK3A 3LIIA 4KI7A 1GNTA 3LVFO 4OOEA 4V0KA 4D9MA 4HDKA 4UDNA 4KQCA 4MRRA 1E3IA 2GSWA 4KXWA 4BU1A 5HJ7A 4MEAA 3W2HA 4G8DA 4HJXA 4DWVA 1JQAA 1O96A 5DZSA 1Z0KA 4ZI7B 3HZOA 2OO7A 3L8MA 4IUBS 5TGDA 3EXEB 1XCPA 3PPYA 4LE1A 3SF8B 4KQ2A 4JDPA 4DSOA 1DPGA 4QPCA 1NMXA 3UJAA 3SG0A 5A5VA 2Y2VA 1YONA 1GPYA 1IEVA 4Y6LA 3AWDA 3CKMA 4FMCF 1FTNA 4NCBA 1WHSA 1RBMA 4RORA 3RT9A 4TL7A 5AKEA 1ZOPA 1PV2A 1WABA 2FQXA 5HVNA 3G13A 4JLUA 5FOQA 5LM3A 2AG5A 3UV7A 3A3OA 3DZIA 2F3RA 1MJNA 3HKCA 4ZOBA 1M6WA 4YQZA 3VDXA 3UC5A 1V6AA 3PFNA 4G0YA 1Z7BA 4V0QA 1V16A 1ZN2A 3UJPA 1AKMA 3OETA 3SM9A 1Q74A 2GQ0A 2WHXA 3GAFA 4O4LA 5A03A 3CSDA 1CSEE 3KZKA 2H8KA 3TNFA 4NEGA 2KMLA 4YDSA 4IF4A 3VVLA 3REQA 3ROMA 1OC2A 1Z4KA 1TU0A 2YH2A 4B3HA 1K5GA 3NONA 4DIDA 3E8XA 3HLYA 2I2AA 4LJYA 1AT1A 2G08A 2IHZA 4LRYA 3FTPA 1HDOA 3JPYA 3PC8A 4TROA 4WD3A 4E4TA 5LZ5A 5EJ9A 5FTMA 2W2KA 4OQFA 3PXGA