4Z0TA

Crystal structure of a putative oxoacyl-(acyl carrier protein) reductase from brucella ovis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
IDLTGRLALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAGILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCRAFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short-chain dehydrogenase/reductase family
publication title Crystal Structure of a putative oxoacyl-(acyl carrier protein) reductase from Brucella ovis.
rcsb
source organism Brucella ovis
molecule tags Oxidoreductase
total genus 89
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z0tA00
1XEAA 5BSFA 2JAHA 5J23A 1R66A 2X8LA 2LDXA 4BKPA 1B3BA 1I24A 3I83A 1FDUA 4O5OA 2H63A 3FNGA 2YJZA 4TKLA 3A28A 4ALJA 1PX0A 3AI1A 1CWUA 2PY6A 1ZJZA 5JXWA 2Q49A 3D3WA 1UAYA 3NKLA 4R69A 3W8DA 4BS9A 2ZIZA 4A73A 1NR7A 5CDGA 1G1AA 2EV9A 5IDXA 4BO8A 1YS4A 5G0TA 1Y9EA 3NT4A 4GKBA 3OA2A 3TZCA 5JNLA 4MVJG 4XDYA 3GUCA 3ZGYA 3NJ8A 4I9HA 1P77A 1FDVA 2XAAA 2QIOA 3DFZA 1KC1A 4AJOA 4MVJI 1H2HA 1HZJA 3PDUA 1CQIA 1E3SA 4OXNA 3RUAA 3TN7A 4CM4B 3WTBA 5B4VA 3H2SA 4KZPA 3V1YA 3ZHBA 1DO8A 2J3HA 3VKUA 4W82A 3MJ4A 4NK4A 2JD0A 1QLHA 2NM0A 4KQXA 1XIVA 4WCFC 3BXXA 4Q39A 3U0BA 3FRJA 1IL0A 1U28A 2NVBA 2PKQP 4BGUA 1C1XA 3GNSA 2B5VA 4MPDA 2HDHA 4YT8A 3T7CA 4RVGA 1H0KA 4ALKA 1PQUA 3UICA 1MXHA 3IKVA 5JW6A 1TT7A 1VPDA 3P2YA 3RASA 5F1OA 4R41A 5B12A 2OBNA 3WSWA 4GAEA 4IS3A 4WASA 1ZIDA 3NDJA 5IZCC 5HRUA 2AEMA 4RQUA 4CQLB 3CTMA 4QECA 3GGOA 4YA6A 3ITDA 3MJVA 4O0LA 3GHHA 3WWZA 2HU2A 4N5NA 4DQVA 4ESOA 3VHRA 1XWFA 4RJTA 1U7HA 3DONA 4XYBA 1QYXA 2OO5A 1IE3A 2DTEA 3D7LA 4KOAA 3RFVA 2PGLA 1BHSA 3AY6A 4G2NA 5JSFA 3MOGA 1JDJA 3TFQA 3DBLA 1Y5MA 2VWPA 2NU7A 4O63O 3VDRA 2NV6A 4B4VA 3ONEA 4GVXA 3A1NA 4MINA 1LRKA 4XKJA 3MZ0A 4DPLA 4JNKA 4UULA 1KY4A 3OHSX 1HT0A 4ZRNA 2FY8A 2EP5A 1JN0A 3DMTC 1HZZA 4CODB 1I01A 3RC2A 4ALNA 5KCZA 2DBZA 2VZ0A 5A9SA 4D0RA 1F8GA 4DIOA 4PLVA 2IRWA 4R54A 3JD4A 3KYDB 3CZMA 3W6ZA 4HADA 2EEZA 3H3JA 5HM8A 5A3VA 1EFKA 4O1MA 5DCUA 4EUHA 2BFAA 1PJ3A 4XA8A 2OFPA 4D44A 3VH3A 3IP1A 4HXYA 2BH9A 1KS9A 1IULA 4E21A 2ZTLA 3F6YA 1F06A 3BA1A 3FPLA 5EMHA 2BLLA 3D5TA 1PQWA 2X23A 4YTEA 3WLFA 4BNTA 3EAGA 1LRJA 2XF8A 4CLOA 1P44A 2DLDA 4F3YA 1HSZA 4QO7A 2VTDA 3DAGA 1NFFA 2Y68A 5IDWA 2NU9A 4D3SA 4GPD1 1D1SA 2TMDA 2ZYDA 5TIIA 3RUFA 1E6WA 1I36A 5KJCA 3GRPA 4WPGA 1H6CA 1C0IA 4BV8A 4K6FA 4IXTA 2HSDA 4Q3CA 2ZCUA 2V7PA 4J7UA 1LDBA 3NYWA 2C5AA 2F00A 3INGA 1NYTA 3OICA 4ND4A 4DMMA 1Y7TA 2DAPA 2VTEA 1DRVA 4YWJA 1HDXA 2DPGA 3WXBA 4AJNA 2X22A 4WLFA 3WMWA 2HO5A 4LVCA 3I9MA 1X0VA 2O48X 1BVRA 3AUAA 4XQ9A 4E4YA 2EP7A 2WE8A 3QP9A 5K6AC 3WOHA 3D64A 2DFVA 1F0YA 1JW9B 2E82A 1E6UA 3DZKA 3PWKA 3WYBA 4DQUA 4XEHA 2JHGA 3IJRA 2NTVA 4JJGA 4B7XA 4NK5A 2VZ8A 1EBUA 4NFHA 4J2OA 1H5QA 2GN4A 2ZB3A 1HDZA 1MUUA 1Z7BA 3ANNA 1RM0A 4YQYA 4ZHSA 5MDHA 5CHEA 1IYZA 2X86A 2O4CA 4RV9A 3S1LA 3INTA 3ZNPA 5T6BA 1BW9B 1EDOA 3ONDA 1DB3A 1EQ2A 5DP2A 4HP8A 1ZSYA 1YBAA 1PEDA 4CMHA 4E6PA 1TI7A 4NR0A 1ONPA 1XYGA 2W2LD 3RI3A 3AUTA 2R00C 3CINA 2JCYA 4IJWA 4XX0A 3W4IA 5IXSA 2UAGA 3TQHA 2E48A 4BNLA 3UCFA 2GUGA 2VOJA 2C7VA 4IY1A 5KWEA 3C7DB 1EFLA 3ZI0A 5DOZA 5JLAA 3QVWA 4IXWA 4ZQGA 2YQ5A 1N1EA 1W8DA 1B8PA 2UDPA 3R3JA 4WGGA 3NTQA 4LSMA 2HMVA 1A7AA 3DZBA 4Y6RA 5H81A 1X1EA 4NU5A 3BTSA 2FSVA 4NHEA 1S7CA 3W6UA 1DIHA 4BNHA 4ND1A 2YV3A 1FJHA 3GMSA 2NTNA 4YT4A 2JAPA 3P2OA 5G4KB 4ZQFA 3RUHA 1M2WA 2AQIA 4BKUA 2VQ3A 4FN4A 1OI7A 3L6OO 1C1DA 3T4XA 1IUKA 3NTRA 1OC4A 5KVCA 3C1OA 1VL8A 5I8ZA 3ZWAA 2ZJ1A 3ZU4A 4YR9A 2VRCA 4CQMA 3WS7A 3HFSA 1NXQA 4OH1A 3DHEA 4RPHA 5DULA 1K89A 3JYPA 3AI2A 3I4CA 1ZEJA 2DBRA 5DBIA 3U5TA 1P1JA 4UVGA 1DAOA 3KYCB 3S2EA 2AA3A 3W4JA 4IIUA 4TRNA 2SCUA 2BD0A 2G82A 1SOWA 3V1TC 1RYDA 3PGXA 5JO0A 3HQ4O 1ZVMA 1IZ9A 4GLLA 1NQTA 4CM9A 4TROA 3L77A 1LSOA 1LLQA 4BHTA 4AG3A 4XGNA 1DC3A 2X5OA 1EVYA 4IINA 1WPQA 1JVBA 2W2KB 2BFOA 4W7IA 4Z6KA 5I9MA 2EJVA 2GO1A 1GZ4A 4A03A 3I9JA 4AL4A 4YAGA 5G4LA 1HF3A 3BHIA 4MVJF 3ZN2A 2WYVA 5EIOA 3DFUA 2WWRA 1WVGA 2O7QA 4RVSA 2QHXA 1YJ8A 1Z75A 3JQ6A 1KEUA 1X0XA 1YOVB 2GR9A 1EVZA 3PLRA 4CLRB 1IY8A 3I9OA 2YHIA 3OM9A 4M87A 4LISA 2J3KA 1MLDA 2W98A 3DHYA 5H83A 1A9YA 3BZUA 4XQEA 2Q50A 4D45A 2JFHA 4Y8VA 2AQHA 3R1IA 1ISGA 3BMOB 4EITA 3VZPA 2DBQA 1DC6A 3OJLA 4Q3AA 3WNQA 4ZRMA 3I9KA 3R0IA 4AJ4A 1Y8RA 1B0AA 3JQDA 3EY4A 2Q45A 3RKUA 1ZK4A 2X0RA 5KVQA 1X15A 2DC1A 3I4FA 1ZJYA 3PZBA 4J1QA 4BVAA 3OEWA 4RZIA 4GGPA 3JD2A 3QY9A 3E9QA 1HETA 3GDOA 2C07A 1WZIA 4FFOA 1I3MA 3M1LA 4FJ2A 4GX1A 4XQCA 2VYVA 3DAPA 3LT4A 4OL9A 1B3RA 3PHIA 4MJLA 1WP4A 3JQAD 1XDWA 5GZ6A 2X6TA 4MOWA 5F1PA 2WM3A 2WDZA 3JV7A 1WDMA 1H9AA 2X7HA 3JQ9C 3VZQA 2A35A 4K1LA 3E5RA 3UH1A 4QT0A 2P9GA 1LU9A 1OBFO 3WX0A 4RPLA 4EJ6A 3UN1A 3HADA 4MP6A 3BMQB 4R51A 4RF5A 3PFWO 4A7PA 4IBOA 5EPOA 1E1NA 3ZWMA 1EE2A 3SLKA 1EUZA 4BV9A 2B4RO 2CY0A 2NQTA 1VM6A 4GKVA 2C20A 1SCUA 1HLPA 2Y1OA 1PWXA 4TRJA 5TLSA 5TT1A 3QWHA 3STHA 3I9LA 5ICSA 4R5HA 3RBXA 4WUVA 5DN9A 4KQWA 2CVOA 3DBHB 1TVEA 1P1IA 3NT5A 3VAZA 1E6EA 3WDSA 3LZ6A 3RVDA 2FR8A 2Q99A 2HMTA 1GR0A 5TSDA 3RBZA 4MKRA 4AJHA 1YQDA 2P9EA 4EBFA 4Z0TA 4BIIA 4G81A 3GVXA 4PG7A 4BGIA 4CMAA 5HTOA 2NSDA 4GX2A 3IDSA 1ADFA 4DGSA 2FOIA 2AE2A 4PLTA 3M2TA 3A14A 2NU6A 1A72A 1PJ2A 1QYVA 4L75A 5F5LA 1ZFNA 4B4OA 1AXGA 2C7GA 3ENNA 4CM4A 4DLBA 1YQXA 4YJGA 1EMDA 5HS4A 1K3TA 5JAIA 4IJKA 3PJEA 2P5YA 2E4AA 4YAKA 1XR3A 1RYEA 4NG5A 3HNPA 1LEHA 3NGLA 3NEPX 3PWZA 4NNJA 4JQCA 3K31A 3RWBA 4F45A 5K9ZA 1PS0A 4FJ1A 3PYXA 1LDGA 3JQGB 1IOLA 3ZV3A 1AXEA 1NX6A 5T64A 3Q6IA 3S2GA 2NADA 3JD0A 3JQ7B 5JYDA 1PL6A 1F17A 2Q4BA 1E3JA 1OFGA 3CE6A 3KV3O 4ZN6A 2H6EA 1N8KA 3GPIA 2YQ4A 1E7MA 2LDBA 2QG4A 1GUYA 3GA0A 4FD3A 4CQLA 5EERA 3QVOA 2PZJA 1HYGA 4IDEA 3B1KA 2P91A 4MKXA 2VRBA 3QVXA 4BNVA 3KZVA 1VSUA 1ZK0A 4RVUA 4BQPA 2UUOA 3LYLA 4W4TA 1YL5A 2DKNA 4BMNA 1GUFA 1RM4A 3WGYA 4CUJA 3B1JA 1GADO 3LC7O 4JIGA 1DIAA 4E3ZA 1KVTA 1MV8A 3AOGA 3HE3A 1WDLA 4UUNA 1T2EA 1V6AA 1O5IA 2VWGA 3GNQA 2QX7A 1JKFA 2O23A 4R01A 3QJ5A 4YAIA 4QFCA 4DTIA 1U2GA 2ZYGA 5LDHA 4A5OA 2HK8A 2G0TA 3SJ7A 5FWNA 4NIMA 3H8VA 3KYDA 3RUCA 3DMYA 2P4QA 1E3EA 2YZ7A 5IDQA 3C7CB 2Y0DA 1ZUD1 1H2BA 1NBOA 2IDZA 3GPDG 3PYMA 4NDNE 4YVFA 4CM8B 2X58A 4WLEA 1P1FA 4MIOA 1K2WA 4GMGA 4OOFA 4RO0A 4KWIA 5TRTA 1MG0A 4J1SA 5KKAA 1KEWA 2W4QA 5ENDA 2CZCA 3N58A 1LC3A 2XXJA 3HG7A 1BXKA 4LW8A 1WXDA 4J1TA 3GF4A 1I3KA 1WWKA 4WJZA 4YRAA 1GQ2A 5CDUA 2PH5A 4AICA 1U9JA 3WFIA 4MVJM 1UP4A 1IB6A 5TQVA 4W9NC 4DA9A 3PHJA 4RGBA 3JQFA 3QRWA 4CV1A 4JX8A 4B3HA 2O3SA 4BO4A 4DLLA 1ONOA 4OOEA 4XYMA 3OFSA 3RUDA 3GZ4A 1YQGA 1I2BA 4ZA2A 4R9SA 3PHGA 1AHHA 3L07A 3PJDA 1HXHA 4PLPA 4UAGA 1H94A 1C3VA 4J90A 4BNWA 2Q1TA 1O9BA 2A9FA 5KJ1A 4J4HA 5GMOA 4WNCA 3PWSA 4CM3A 4NPCA 4HFRA 1R12A 3EW7A 3AU9A 1EVJA 4R3NA 4YXFA 1PJTA 4P4LA 2WJPA 4WLNA 3PVZA 1YDEA 2DBVO 3AFMA 1U3TA 1ZBQA 4KDFA 4BO1A 3PHHA 1BW9A 1NHWA 4BO0A 4GL4A 1WAMA 2PD4A 4ZQBA 1JAYA 1CYDA 4WCFA 1RWBA 4WLUA 3AUSA 3TL3A 1NR1A 4NU6A 5EESA 4ITUA 4C4OA 3AY7A 3HN2A 2DPHA 3K2EA 2X1HA 4GLOA 4XB1A 3TJRA 2VYNA 3H65A 1NQ5A 1Q1NA 4S3MA 3WR5A 2GPTA 1F8FA 1T2AA 4RVFA 3O9ZA 4OQYA 4GX0A 5IN4A 1UDAA 4PLZA 1ADGA 3Q3CA 5JAMA 4TKMA 4EYEA 5C3MA 4E2XA 3SC6A 5L53A 2W8ZA 5A9TA 3DZHA 4LMPA 4YCAA 4OIMA 5G4KA 1LSJA 1U3WA 2YUTA 1R0SA 3WGZA 3K9QO 3FN4A 2PGJA 5L51A 3L4BA 1MG5A 1UZLA 2C29D 5FYDA 4F6CA 7MDHA 1ORRA 1BXGA 2Y1EA 3TF5A 3JQFC 5JFOA 3U9LA 1CIVA 2VWQA 2Y1DA 4ONEA 4CLDA 5U4QA 1LLCA 2Z1NA 1LI4A 3PRJA 4B79A 2GCGA 3SJUA 1HE3A 4BNFA 1UXIA 3JYLA 1ZSVA 4IDGA 4NBWA 3KYCA 3TOZA 5A3JA 3DMTA 3T4EA 2CF5A 3ZWCA 2HMWA 2HMSA 5GZ3A 4UEJA 4CMCA 5DF1A 1SO8A 2HK9A 2Y67A 3F47A 3BHJA 1GEEA 2H1SA 1MFPA 4H16A 4MP8A 4CV2A 3AU8A 1DC4A 4CMIA 2VUTA 3KXDA 4UUPA 3DC2A 1YB4A 4NMHA 4OGWA 3VDQA 1UXGA 3BIOA 5KVVA 2JL1A 2CD9A 4MVJP 5L7YA 2W2KA 4IMPA 1TEHA 2PZKA 4A26A 1LA2A 5L3ZA 2PFGA 4BQRA 1LUAA 1MC5A 2FRDA 4J9UE 2DTXA 3KBOA 4J9VA 1UH5A 3KEQA 4L4RA 4OSPA 5AXCA 3DO5A 3G1UA 3DTYA 2CVQA 5ER9A 1Q7CA 2VT3A 4H15A 3H9UA 4MKZA 1VKOA 4CLRA 1SEVA 1ZNQO 1DHRA 3D5QA 4CUKA 2Z5LA 5I7EA 2CSUA 1T1RA 3QIVA 4IJVA 4DQXA 2VN8A 3BMOA 3GFBA 4FW8A 4DREA 1TLTA 1VKNA 5FF9A 3EUWA 4U6SA 2GERA 3EGOA 5JCJA 4IDDA 2O50A 2Y0CA 3FR8A 3MTJA 4QTZA 1UR5A 5JYEA 2AG8A 4M49A 3HDYA 3DWFA 1P45A 5KJFA 2EWMA 3BMNB 1GY8A 5ILGA 3QA9A 4PLGA 1PWZA 4FDAA 1LDYA 2B36A 5K6AA 3HDHA 3D3EA 1KIFA 3LVFO 1LXCA 4GSKA 2Y1GA 4H3VA 3GNTA 3GGGA 1MA0A 3L4BC 3FF4A 1ISMA 5GZ1A 5KTKA 3PYLA 3DBVO 4D43A 1NWCA 3ANLA 3LSYA 1KVSA 3PQEA 3PZRA 3C8MA 4L0QA 5C37A 1VJ1A 4ZD6A 1PJLA 4IM7A 4YRBA 1E5QA 2EXXA 4CM1A 4WOKA 2C59A 2ZTMA 3RKRA 4A27A 3V5NA 1YJQA 4E13A 5JMWA 3W1VA 2OXIA 8ADHA 1JU9A 3TDKA 3GC6A 8LDHA 3BMQA 5DCWA 4B3IA 4Z3KA 4E2ZA 1DJNA 2R2GA 3KOUA 4KWHA 5F1KA 5IJZA 1R6DA 3LF2A 3UXYA 3GVCA 3TWOA 5KJ6A 3DOCA 1DJQA 1LRLA 5TJHA 1QV6A 3KSZO 1HTBA 4M89A 2FMUA 4YDRA 5DP1A 2HLPA 2NWQA 2R00A 3IQDB 4J3FA 1E1KA 5JPIA 3D1LA 1E3IA 3ZV6A 1NVTA 5C7OO 1HDYA 5BR7A 4FOSA 1WMBA 3QE3A 3GR6A 4FGWA 2AQKA 5EN4A 3UW3A 1UZNA 1SB8A 2RH4A 4PLWA 3P5SA 3JQBA 3KRTA 3OBBA 4GWGA 5L95A 4FC6A 4CLHA 3K30A 4R3WA 4A2CA 4KUHA 3TFOA 1GQQA 5T8KA 3IIEA 3ZNQA 4E5PA 3PFFA 3WG9A 4B8ZA 2GASA 4I1IA 3OEYA 3OQ6A 3L0DA 4Q3DA 2BGLA 4DC0A 3WBBA 2BKAA 4WLVA 3HB4X 1M76A 4FFPA 5L45A 3HJAA 5AXAA 3QW2A 4NFYA 1T26A 3I5MA 1MXFA 3DOJA 4J43A 4TQGA 3JQGA 3DZIA 4BOYA 1MC4A 4UREA 2P4HX 4RZHA 1BGVA 1NVGA 2OP1A 4P8RA 5COBA 2HQ1A 4E31A 3GRKA 3Q1LA 3JQ7A 2AEFA 3QSGA 3DOOA 1NHGA 4GH5A 5G0WA 5CAEA 2XOXA 3RU7A 3ZCXA 1M6WA 2O3TA 1DEHA 4O6VA 1LJ8A 3TZ6A 4DXHA 3I52A 4ZJUA 2YV1A 4IDFA 2YW9A 3ZWBA 1OAAA 2YFQA 3B6ZA 4J2HA 3KEOA 3MTGA 2PK3A 4JBHA 1KVRA 2A92A 3IC5A 2OBYA 4WE3A 3ICPA 3WLEA 4AJLA 1PJSA 1E77A 4K6CA 4FCCA 4YAJA 4D42A 3KLMX 4XGKA 4Z0HO 5FI3A 5KOIA 1GD1O 4NBTA 5BNIA 4IMRA 3HZZA 2PV7A 2O7SA 1CRWG 1XGKA 3GDGA 2VRCD 4MVJE 2QYSA 3TOXA 1IZ0A 3KVOA 1PZHA 1GYRA 4LSWA 3ZWOA 1RJWA 3MCVA 4CLXA 1YDWA 4XJSA 5G0VA 2P68A 1QSGA 4WKGA 3TZHA 5A9RA 5T67A 4IJUA 3W8FA 4KMSA 4TZTA 4UUOA 1NPDA 1U5AA 3GOHA 3GLQA 5JMPA 1B26A 3QQPA 1NFRA 5DT9A 4UEKA 4AJKA 4CV3A 2AHRA 1V8BA 4IPTA 1FXSA 2QYTA 4Z9YA 3F46A 1WNTA 1TT5B 2TMGA 4FFMA 4JJFA 3JQBC 1N5DA 4HFNA 4I9UA 2NVUB 4CM8A 1Y81A 4XYEA 2ZB7A 5CEEA 5T8KC 3WWYA 1SPXA 3E5MA 4C7KA 1DBVO 1LQTA 3AM3A 3DQPA 1PZGA 2VHXA 2VOEA 1R4NB 1GV0A 3PEFA 4E12A 1F12A 1FDSA 2Y1CA 4BNNA 4CM7A 1M75A 4U6QA 3MEQA 4W99A 1Z45A 4K28A 1JVSA 4BNZA 1SMKA 3VPGA 5TC4A 1Y1PA 1GDHA 5KIAA 3E9MA 1OOEA 4NBUA 1NPTO 4KDEA 4X54A 1E3LA 3ICCA 3UUWA 3JQ9A 1YL6A 4PLFA 3PI7A 3RQSA 5BSEA 5FI5A 2I5PO 4U0KA 1ULSA 4WLOA 1J6UA 3JD1A 1PR9A 4J0FA 2FP4A 2A4KA 4XYGA 1WMAA 2PH3A 4Z9XA 2DU8A 3C7AA 1UUFA 4U7WA 3VZRA 2JCXA 3ANMA 4XIJA 3Q9NA 5EQDA 3UGKA 1NNUA 1DPGA 2WSBA 4CM6A 4HFJA 1VC2A 3HDQA 3BTVA 2D4AA 3D3WB 4FFNA 3KM0A 4OYRA 2GN9A 5A5EA 2BGKA 3R3SA 2ILTA 2JFFA 1E0DA 5TX7A 3JQ8B 3BMCB 4JCOA 1X7GA 3DBRB 5ER6A 1XLTA 1B15A 2BMAA 1AUPA 3KUXA 4MVJA 1JWBB 1R4MB 3GVHA 4GWKA 4DC1A 3EZYA 1L7DA 2V6GA 3ASUA 3OIGA 5JDCA 1N9GB 3H5RA 1GL3A 3GG9A 5AXDA 2P9CA 3OMLA 1KBZA 5C7IO 1XA0A 2IZZA 2BI7A 2QZZA 1NP3A 3UFXA 1IPEA 3E48A 5JAZA 1YE3A 3KO8A 2WD7A 3K8ZA 4N5LA 4E32A 4U8GA 4Z0PA 2B4TO 3D4PA 4RPGA 1Z73A 1VE9A 3F4LA 1V0JA 1D7OA 1U2DA 2ZCVA 2BHLA 4I5FA 1B8VA 4JLWA 5B37A 4YJFB 1QLJA 3BTUA 1C1XB 1V3VA 2B69A 5EINA 5T57A 1QYDA 3PTZA 1O8CA 2I66A 1DFIA 4HFMA 5JY6A 2O2YA 4B7CA 4AVYA 1A71A 3ZWVA 3U62A 3NDRA 3HDJA 3RAJA 1DIBA 5DDIP 2X0NA 1HWYA 4L73A 3RUEA 3F1LA 1QYCA 2VUSA 4S1VA 1XHLA 1QORA 2EW2A 1PS8A 1ZCJA 3FHLA 3ITKA 3VPSA 5I9NA 1XQ1A 4XWYA 3FWZA 5TT0A 3G49A 3H5NA 2OUIA 3G1TA 1GTMA 3HHPA 3ZDFA 1KETA 1H6BA 2GZ1A 2IXAA 3H9QA 4ZVVA 1PQPA 5TS3A 1HE5A 1XG5A 2DTDA 3A06A 1C14A 2V6BA 2VHVA 2FR1A 2F1KA 1QMGA 3OQBA 2GDZA 3TZKA 5HBRA 5IN5A 4BGEA 3DBLB 3D4NA 4MIEA 4OAQA 1RM5A 2Q2QA 3AFNA 3ABIA 4FFRA 4OJNA 4ND5A 4CR6A 3PDJA 4FR5A 3ZWWA 1T24A 4PGFA 1DFGA 5L7TA 4DIBA 1ULUA 4HWKA 3VH2A 2DFDA 1KVQA 4Q3EA 3PJFA 4FPXA 1A4IA 2OZPA 3PHLA 2Y93A 1ZK1A 1N2SA 5LC1A 1W0CA 3SC4A 3Q11A 4GQAA 3AJRA 2X0IA 2HJSA 2CNBA 4L4SA 5FEUA 2PNFA 1IHXA 5JDCC 4B4WA 2IZ1A 1XU7A 1U7TA 1Z7EA 5L40A 2VHZA 2X0JA 1XKQA 3H4VA 2EIHA 1V3UA 2WMDA 2YYYA 5KJEA 1T4BA 1JKJA 4L8VA 3LT2A 3ULKA 4CJXA 3SVTA 1SBYA 4EUFA 3C24A 5DOVA 1X1TA 3W8EA 4ZQHA 4XDZA 3G3EA 4D3FA 2UVDA 4W9NA 2OL4A 2R6JA 3WFJA 2P2SA 2X9NA 3A9WA 3ZHYA 3WMXA 2D59A 1LLDA 1VI2A 4ZU3A 4YJHB 1UDBA 4CMBA 2IE0A 3ZWNA 2ZQZA 2BI8A 1LSSA 1H93A 1ISFA 3GQVA 3KLPX 4YB8A 3NX4A 1H6AA 1ZK2A 4UVHA 3BMNA 4AJPA 1DDOA 4B8WA 3AK4A 3OA0A 4CL8A 3F3SA 5CDSA 3H6KA 5U9CA 3I6IA 4AJ2A 1VJ0A 5KVSA 1N1GA 1EK6A 4FOOA 5BNTA 1E1LA 2Z1MA 4JXKA 5EJ2A 1YBVA 3DZGA 3JYNA 1PJBA 1L1FA 1I33A 1R37A 1U4OA 1YGYA 4K26A 3DDNA 4CR8A 1I2CA 3CIFA 1B14A 1PGPA 4DBZA 1U1IA 4YAEA 1HLDA 5CPBA 4E5MA 3H9EO 4BO2A 2B4QA 4PIVA 3PXXA 1YRLA 2C82A 1Y8QB 3PQDA 2UUPA 2PTGA 3NDIA 4HNHA 4ALLA 5CG2A 1WW8A 4B3JA 2NTJA 3NAQA 4N18A 5TJ9A 1LX6A 5CDTA 4BNUA 2D0IA 2EF1A 1YONA 2X5JO 1ISIA 1B2LA 3WGQA 4E2WA 1W73A 4FB5A 4IDBA 3WB9A 5BQFA 1DLJA 1LQUA 1SZJG 3FD8A 5HA5A 1PL7A 3E8XA 2PD3A 2GYYA 2Q1UA 3EC7A 3S2IA 3V1UA 3ZW8A 1BWSA 3UCXA 3ROPA 3QWAA 2HRBA 3ETDA 4HKTA 1F14A 3W4KA 3DAFA 2PKRA 3VTZA 3WYCA 3U49A 2D5CA 3T7EA 5AVOA 4EGFA 4PFJA 1G6KA 2GLXA 3JYOA 3FBTA 5LDGA 1NVMB 3WGGA 4DLAA 2CVZA 3NV9A 4RDHA 3VOSA 5IG2A 3ZV4A 2X9GA 3OP4A 4LGVA 4TVBA 3I3OA 5JDIC 2FHSA 4N5MA 5F21A 5I8WA 4RF4A 4URFA 3LLVA 3VC7A 2YV2A 3E82A 3E6AA 1MP0A 1D3AA 1HDRA 4RDIA 4BB5A 5L4NA 3OF2A 4AJIA 1LDNA 2CMDA 1PR3A 3JSAA 4JK3A 5CFZA 3FWNA 5F5NA 3TNLA 1BXZA 2BRUA 4WECA 3WIDA 1PL8A 5T5QA 1YKFA 5DBGA 3ROMA 2EKQA 3ONFA 1C0PA 2O2SA 2O3QA 2VUUA 3VPFA 3HB5X 1NFQA 1Y9AA 4GSLA 2Q2WA 4AJ1A 4FGSA 1T25A 1A4UA 3LU1A 4IUYA 1P33A 5CEJA 2GD1O 3EK2A 2EKLA 4R5MA 3PIIA 1U4SA 3FCOA 3L4SO 3QWBA 1JAXA 1ZW1A 7ADHA 2O3JA 2NACA 4AJJA 1GFSA 1A9ZA 9LDTA 1MFZA 4BMSA 5ITWA 3K92A 1HYEA 4BKQA 1Z74A 1MX3A 3JQEA 4KTTE 1U3VA 1QRRA 3EYWA 3UCEA 2DVMA 4I5DA 4CL3A 4D3DA 5KNLA 2WE7A 1QP8A 1R0LA 2PR2A 2FPPA 1OC2A 4BMVA 5JC1A 1BDBA 2CDAA 1TB4A 2GZ2A 3OH8A 1QYWA 1YXMA 4I8XA 2IEBA 3X2FA 1AGNA 1D8AA 3CKYA 6ADHA 3CSDA 3H7AA 3SLGA 1YB5A 2Y99A 3DR3A 4FIZA 4CM5A 2JFGA 5IDYA 4XZ3A 1B7GO 2GRAA 3F4BA 4J7CA 5A06A 3KTDA 3SX2A 1EUCA 1NPYA 4EEZA 1NQAO 1TT5A 2IXBA 2HRZA 2NVUA 3BYZA 2OHXA 3OJFA 4NBRA 1I10A 4BB6A 5AOVA 2HAEA 3F5QA 3FNFA 1GCOA 3QWFA 4RLHA 2I6TA 4JP3A 1KERA 2WTBA 4EW6A 3FTNA 4OO3A 3WQSB 1R4NA 2YDXA 2BFPA 4BO6A 4YQZA 1P31A 5DBFA 3O38A 4DPMA 3JCZA 3CUKA 1Q2XA 2PZLA 2YHUA 4PRLA 3P19A 2VNSA 1HYHA 1YBMA 3ETEA 1BSVA 2Y0EA 3AOEC 4PLYA 1DOHA 4ND3A 4RQTA 2J6IA 2DM6A 1GUZA 3IS3A 3WQQA 4RF2A 1I3NA 3HUDA 4RVHA 1GYQA 1MB4A 2Q4EA 4RPKA 3VVCA 2Z95A 5AYVA 4BNXA 3H3FA 1L7EA 5G0UA 5JE8A 3ADPA 5JCJD 4DBVO 1PJQA 4DYVA 1PGNA 1GZ6A 1PJ4A 4UVEA 4N7RA 2QRLA 2Y1FA 2I3AA 2DT5A 4CV0A 5IAAA 1KY5A 2RHRA 3AY3A 3GEDA 4YEDA 1I5RA 3FI9A 1AE1A 4Y67A 1EVIA 1X7HA 3WGTA 2RHCA 3ZZNA 2A94A 4QO8A 2ET6A 1GYPA 3GN1A 5DZSA 3RFTA 4II3A 2JJYA 3E03A 4Y98A 3JQ8A 2C2XA 1GEGA 3BMCA 2CUKA 3DBRA 4E2YA 5AQ1A 2ZQYA 3RROA 3WYEA 3O8QB 3RCBA 3ZW9A 4QSMA 4OXYA 3MWDB 1R4MA 5I7FA 4Z9FA 1N9GA 1YOVA 2HCTA 2IEDA 3FSRA 3A4VA 4GX5A 4J16A 1E3WB 1SEPA 5TF4A 2E37A 2EGHA 2QW8A 1B8UA 1SOVA 3U4HA 3UHAA 3ZV5A 4EDFA 1A5ZA 3JQAB 1R15A 4YJGB 4I08A 1J4AA 3ZHZA 4CMEA 1ID1A 1YB1A 3KSDO 1LLUA 4GBJA 1KOLA 3LC2O 1PTJA 2E6UX 2HJRA 1WDKA 4JROA 4NZ9A 4QFDA 4RORA 4YJFA 1HL3A 1JQBA 1JTVA 3X2EA 3C85A 2EW8A 4UVDA 2G17A 4DIFA 4R68A 4L76A 5DCYA 1HKUA 3KSUA 1UXJA 1PJCA 3OQ1A 3AWDA 3EZLA 2ZKLA 2HK7A 2X9VA 3BAZA 2B37A 4NI5A 3SEFA 1A7KA 3JD3A 4JJIA 2DQ4A 2PA3A 4HNGA 1UAGA 3K5PA 2PGDA 4TZKA 1I30A 3NUGA 4LMRA 3AUUA 4CR7A 1U8FO 4XRGA 3FTPA 1GZ3A 1UP6A 3EHEA 1TXGA 2D3TA 1ADBA 1C0KA 1JWAB 1U8XX 3CMCO 5EQFA 2J5QA 4K9DA 1X14A 2UV8A 3GVIA 3CH6A 2RAFA 2NLOA 5DNAA 3IL2A 2AG5A 1KYQA 3AM5A 1BVUA 3C1TA 4R9RA 5A4DA 3OJOA 1SB9A 2FSSA 1UP7A 1PZEA 3DBHA 4J4BA 2QRJA 4ILKA 2H5LA 4II2A 4A10A 4BGVA 3KYBA 2O3RA 5COQA 5I7SA 1PSDA 3E9NA 4FC7A 4PVCA 3N74A 3WGIA 3ZU2A 2J5RA 3ROQA 4L4XA 2RIRA 1HDCA 1O0SA 2CF6A 4WEOA 5BT9A 5IZ4A 4DYDA 3NGXA 4UUMA 4ALIA 3GZNB 2D8AA 5BSHA 1GQYA 3ENKA 3VH1A 3E1KA 2G76A 4BO3A 1UJMA 1QXSA 3H5AA 4RL6A 5F3RA 1I32A 3GAZA 3OECA 4GGOA 2G5CA 3EVNA 3K96A 4JBIA 2EJWA 3RJ9A 1ARZA 4ND2A 1D1TA 1U5CA 2JHFA 2FN7A 2VHYA 1GPJA 3C1AA 1V9LA 5JS6A 1DLIA 4BNKA 1O89A 1OMOA 1YL7A 3EDMA 5A05A 4OM8A 1R0KA 4TSKA 1H6DA 3R6DA 4CMEC 1DIGA 4O59O 3I6QA 5A1TA 2CDCA 3K6JA 2C54A 2C5EA 5IXYA 3ZNNA 5CDYA 4F6LA 1Z82A 3DB2A 4CMKA 1CETA 4IDCA 4P4GA 4LRTB 4HBGA 4YRDA 3D4OA 4IQ0A 1EQUA 5A02A 4YJHA 2ZB4A 1NAHA 1O95A 3TZQA 3NT2A 4E5YA 1UXHA 2VHWA 2VZ9A 3GH3A 3ZH2A 3E18A 4NJMB 9LDBA 1Q7GA 4FJ0A 4BNGA 2DUWA 4TRRA 4TVOA 1CQJA 3GHYA 3LQFA 3PK0A 1VL0A 5TGDA 1SC6A 4HV4A 1FDTA 1ZXBA 5FFFA 2B35A 1A27A 4CMGA 4QQRA 5I9LA 1E7YA 1M67A 2GF2A 4FBGA 3WGOA 4P22A 1NQOA 2V65A 1T4DA 3I9NA 4CQMD 2XXBA 4PN3A 4B4UA 2J3IA 4PG5A 4B7UA 1DAPA 4D46A 1M6HA 5ITVA 3TSCA 1Y8QA 1NTOA 1HSOA 3DZJA 4J0EA 4LN1A 4P4NA 5C5IA 1K6XA 5B1YA 1NWHA 1ZEMA 3QV1A 4XJTA 1UZMA 3HN7A 1HEUA 4PVDA 5G2OA 1I2ZA 3RUIA 3OJ0A 4RF3A 5CP8A 4P38A 5H82A 4EZBA 4F46A 4PG6A 2O3UA 3F5SA 3N7UA 4CM9D 4XB2A 1O94A 4D41A 4WCFB 6LDHA 4NFSA 4CPDA 2PWZA 3ADOA 2GZ3A 1KEPA 2V6FA 4IQ8A 2Q2VA 2GN8A 1T1SA 5A03A 5JY1A 5JAQA 2FPIA 3CMMA 1ONNA 3ZHXA 1AN9A 3WJAA 1QG6A 3QVTA 4FQ8A 4BNJA 3OJEA 4R1SA 1ISHA 3OSUA 1QV7A 1QR6A 4MVJD 4Y9DA 3DZFA 3KHUA 1Q7BA 3GT0A 1J49A 3DEYX 4QX6A 4Y6PA 3PQFA 2HMUA 3V8BA 2RCYA 4MP3A 1LSUA 2OOSA 1LC0A 2C2YA 1T2CA 3C3XA 3L6EA 4PG4A 3NJ4A 5HS6A 2UYYA 1BDMA 3HSKA 1BXGB 2FZWA 3JTMA 1ISJA 1ZZEA 1RKXA 1V3TA 5B4TA 1ZXLA 4E0BA 2RH8A 4OKIA 4EEXA 1ZMTA 4MO2A 3EMKA 4NQZA 1JA9A 4BO9A 4W7HA 4YACA 4M86A 2Y05A 3B1FA 3VPHA 5JC8A 2GNAA 2W2LA 2ZJ0A 4TRMA 4GI2A 1X7DA 1C0LA 2B0JA 4RCVA 3GGPA 5IF3A 3MJSA 4ROSA 4NJOA 4PG8A 3MWEB 3VVBA 1EZ4A 5C7LO 4I5EA 3HWRA 1KEVA 3RSHA 2VYVD 3SBOA 4GVLA 3CZRA 3LLSA 4E33A 1NAIA 4CMIB 1Q0LA 4U0JA 4C7JA 1VJTA 1RPNA 4R1TA 3B70A 2QRKA 1JLLA 2WEKA 2Q1WA 4GMFA 3H9GA 2PLAA 3GAFA 2QZ9A 1PZFA 2D2IA 3TRIA 4LRSB 4JN6B 4Q3BA 4BNIA 3P7MA 5BSGA 4E30A 2EHDA 4E5KA 3OIDA 4G5HA 1GPDG 1Z6ZA 1G0OA 2BGMA 4QUKA 1N92A 2YFHA 2OMEA 4J7XA 3ZU3A 2V6MA 3TPCA 3CXRA 4WEQA 1CDOA 4M1QA 1Y6JA 2VT2A 3RD5A 4BO5A 5ES3A 1AHIA 3ZWXA 3OETA 1LDEA 5L4SA 3GEMA 3LF1A 3MOIA 1GU7A 1XELA 5A04A 4IIVA 4IGFA 1S6YA 2EKPA 1PGQA 1G0NA 3I1JA 2VWHA 4XR9A 1JKIA 4RLSA 2NNLD 1HDGO 1E1MA 1DSSG 1KVUA 1R16A 3MJTA 1GCUA 4DPKA 1NASA 1P1RA 3GG2A 3M2PA 4PZDA 2Y66A 1WLYA 3UVEA 4YBZA 3RFXA 2J3JA 1LNQA 2DUUA 2E49A 1ZMOA 3IJPA 4M55A 4JP2A 2EG9A 3L6DA 5ICMA 5ADHA 3IP3A 3CEAA 3L9XA 4D79A 3PPIA 4TMFA 1K6IA 4M54A 4XRRA 2GSDA 2AE1A 4IDAA 4MDHA 3F1KA 2AXQA 3QHAA 3U4DA 1BTOA 2ZB8A 4Y6SA 1P74A 2W90A 2O4UX 4KUGA 2FWMX 3BTOA 5CEFA 4IS2A 1DIRA 1P0FA 5MGBA 1YO6A 1HE4A 2P5UA 3M6IA 2NVWA 1D4FA 3RIHA 3V2UA 1T2DA 2NUAA 5LCXA 5L7WA 3PLNA 3U4IA 3U09A 4XQGA 3FNHA 3Q2IA 3FBGA 3JQCA 3DL2A 1ENYA 2BF7A 5A9SB 1GV1A 1GAEO 1T2FA 2B83A 3INRA 4H7PA 4D7AA 2X5KO 3L9WA 4J49A 2FR0A 2B5WA 4TWRA 3IOYA 5THQA 1LBEA 4EI2A 5I7VA 1HE2A 4M8SA 4PRKA 3GMDA 1ADCA 4RVDA 4DRYA 4UVIA 4OHUA 4W6ZA 4BKRA 4J1NA 3O8QA 3LT0A 4WK6A 4LK3A 3K2BA 4KUEA 2Q1SA 1UXKA 1FDWA 4G65A 4NH4A 3QVSA 5K0ZA 1M66A 1VRWA 4DUPA 1E7WA 1K0UA 3LT1A 4BUCA 4CLOB 5JO9A 4DWVA 5JDIA 1I8TA 1E3WA 2IYOA 3FPCA 4ZICA 3DHNA 3VZSA 3LDHA 3KETA 3JQAA 3ST7A 1YH3A 1YVEI 4PZEA 3ZNOA 2C0CA 4BNYA 2XPCA 4EJMA 2H9IA 4MVJH 3MJEA 3F9IA 3WTCA 1BRMA 3NTOA 2JCVA 3MJCA 2FZEA 3WQRA 1W4ZA 3RC7A 1RM3A 1CERA 4XIYA 3K73O 1ML3A 2OORA 3Q9UA 2POQX 2I65A 3ROKA 1U3UA 1XQ6A 2I76A 1N7GA 4WCDA 1FK8A 1X13A 3S55A 4YJDA 5A5FA 3UOGA 3VKVA 4IZHA 1P1HA 4AFNA 2RBEA 2D1YA 2AEJA 1VLLA 3IUPA 1Q0QA 1SAYA 4YT2A 3VH4A 3O26A 2J5KA 1VSVA 2ZK7A 3Q0EA 3WIEA 3KB6A 1K6JA 2FPGA 4ZQEA 1XU9A 1E7SA 1Y5RA 3UAGA 5ENVA 3IMFA 4PLCA 1K5HA 2IYPA 2Q3EA 3PGJA 4OSOA 1LTHR 2D5AA 3GEGA 2AW5A 1V35A 4MIYA 2AQ8A 4J91A 1EDZA 1P0CA 3GFGA 1P9LA 1ZSNA 4JBGA 3B20A 4HX5A 2JD2A 1PGOA 3BHMA 3ORFA 3V2HA 2JD1A 1I3LA 4BKOA 4OKNA 5AXBA 2OGUA 2PKQO 4EUEA 4IGEA 4KTVE 3S8MA 2BFMA 5ILOA 4AJEA 4KP7A 1VL6A 3ETGA 4D0SA 4CUZA 4XCVA 2I67A 1BMDA 4I5GA 2JKVA 1E7QA 2PD6A 3IAHA 3UF0A 1E5LA 1WZEA 3GZNA 3JYQA 3O03A 4R16A 5THKA 4CLEA 4ZGWA 4LCJA 4N54A 3IKTA 4ALMA 4PZCA 3FNEA 3G0OA 3PJGA 1EE9A 2EGGA 1ENPA 3O4RA 3WNVA 1ZO8A 4INAA 4PCVA 2I9PA 1DFHA 2IODA 4DVJA 3H2ZA 4BO7A 4E5NA 2GN6A 5JBIA 1BG6A 4FS3A 1ZKMA 5L9AA 2Q46A 4U5QA 3WICA 4I9NA 5CG1A 3LC1O 1E92A 3AI3A 1HDOA 4Q3NA 3AOEA 4QEDA 2YY7A 1C1DB 1P1KA 4J6FA 1EK5A 4FSHA 4BL5A 4PLHA 2VYND 3GDFA 3QWIA 4NBVA 4CQMB 4XYLA 5U1PA 1FF9A 3RU9A 1EBFA 1I0ZA 1E7RA 3GY0A 3ON5A 4R1UA 4YPOA 1EEHA 4WNIA 2OP0A 1SNYA 1UDCA 1CJCA 5GY7A 5HWSA 1W6UA 2GGSA 2I99A 2PZMA 1MGOA 2WD8A 2NQ8A 4NJMA 4XGIA 2BELA 4IQGA 1B16A 1PGJA 4L9RA 4A0SA 2ZATA 3VTFA 2J8ZA 3G79A 2VNAA 2VCYA 4HUJA 4XR4A 1ZK3A 4HY3A 4J4TA 4LVUA 4YYZA 1J5PA 5IFLA 1PU2A 5KKCA 2ZTVA 3IUSA 2G1UA 3I23A 4DMLA 1QKIA 2HUNA 1HRDA 3TL2A 3WGHA 3PP8A 3U3XA 2IZ0A 3VPXA 3FR7A 3GVPA 4QXMA 3DXFA 3G17A 5TNXA 1ENZA 3ASVA 4OMUA 3UKOA 3RC1A 2NU8A 1DXYA 2HKIA 4LCEA 4OXKA 2WYUA 3ZU5A 3RJ5A 3HFGA 5BNFA 4IZIA 5B4UA 4JGBA 1PIWA 3ZWPA 3SXPA 3ZWYA 1J0XO 1OZAA 1CEQA 3RBVA 4FFLA 2I3GA 3Q2KA 1DHTA 2YHIB 1FMCA 1ENOA 1P3DA 4R1NA 3WJ7A 4RPJA 3GN2A 1NM5A 1EUDA 1YWGO 3D0OA 2X4GA 1O6ZA 4DL9A 4R4JA 1CF2O 2WD7B 2QQ5A 3RC9A 5CPFA 2YDYA 3NRCA 1KC3A 3H9JA 1Q0HA 4OQZA 1LDMA 1Y8RB 4UEOA 2AMFA 1DRWA 2WYWA 4Z3DA 4CMJA 3WBFA 4L74A 2CFCA 3OIFA 4BNMA 3DTTA 3V2GA 1TA4A 4WOJA 1DC5A 5G0SA 2CDBA 5JCXA 3M1AA 3QLJA 5COAA 1ZH8A 3PIDA 1IHYA 4ID9A 3AM4A 2ZTUA 5IZCA 1XCBA 1DRUA 3GK3A 3CPSA 3GUYA 4YT5A 1H9BA 4Q9NA 3COSA 3S2FA 1IPFA 5EL0A 1PS9A 2ZYAA 4XD2A 5L4LA 2EERA 3LK7A 3WSVA 1N7HA 3EVTA 3U4CA 4EJ0A 3AW9A 1XSEA
chains in the Genus database with same CATH superfamily
4Z49A 1XKXA 5J23A 3LW8A 4FDMA 1ZGCA 4ZREA 2P4SA 3WAKA 4BKPA 1R0XA 1ORTA 4L6AA 1DAHA 2UKDA 4GF5A 4O5OA 3KCQA 4MWTA 4P80A 4RZ3A 5EZYA 1CY2A 1E4VA 1POWA 4NBKA 3A28A 2BHTA 4X41A 1J39A 1PX0A 1W85B 2UU9B 1CWUA 4YP6A 1GGNA 2ACWA 3AEKB 3IUBA 1G60A 2X76A 2KHZA 3NKLA 3U7HB 2IOHA 4DSOA 3P4UA 3PIRA 4R69A 1AQYA 1L5LA 3W8DA 2PT5A 1J09A 3EJ6A 3SS9X 2ZIZA 3SIPA 5IH7A 2HCJB 4LBWA 3T9FA 1SKQA 5IDXA 1AV6A 2ORWA 2HTEA 1Z6YA 5G0TA 2NUPB 4GKBA 1H3FA 3CM0A 4Y2TA 5F9MA 1JDBC 3SYTA 1JFVA 1LPOA 2R48A 3NJ8A 4I9HA 4UUQA 3BD7A 5GONA 2Z43A 1QKKA 3DFZA 3NTUA 5KTOA 3MUNA 4MVJI 3T5AA 2QTCA 1N77A 3KR9A 5AK6A 2NU6B 3AB8A 3RUAA 5AW7A 1MH1A 4UJ5A 1ZNYA 4QE3A 3KTAB 4KZPA 4MUXA 1I9CA 1KMQA 4MQBA 2ZJ6A 1DO8A 4NH0A 5SY4A 2CNKA 3RC8A 5CA0B 4Z1OA 4MAAA 3BWEA 4W82A 3MJ4A 2XSZD 2YIJA 4GZMA 4HF7A 4FBLA 1JKJB 4TTQA 3TTTA 2BFNA 3SZGA 5J3JA 2O8FB 1EJ0A 3OCUA 4KPGA 3U0BA 1NMXA 3QFRA 4P98A 3KUUA 1IL0A 4RPIA 2NVBA 2PKQP 5IM4F 2WP8J 4BGUA 1Z0FA 1UKCA 5T6MA 3BQ9A 4AK9A 5B3LA 5JSYA 4TM7A 3CRNA 2XVAA 4ALKA 1H0KA 3UMGA 4HT3B 4UHHA 3ANTA 3D0RA 1GLNA 3FFXA 2PL3A 4KCGA 1CUFA 1FL9A 1TZ2A 3BWVA 2BAGA 3G8BA 5EMNA 1C4OA 1VJCA 3RASA 4NESA 5JD4A 1DCFA 4YFVA 1WZNA 2XT6A 5CK4A 2WA2A 4C4PA 4NPAA 4PZUA 1FSPA 2HBQA 4O4LF 4Q03A 3WK6A 1FP4A 3GL9A 1I4DD 3TBKA 3K6KA 2AEMA 1K86A 1P72A 4JDUA 3CTMA 3ROZA 1RAAA 4ES6A 1IQ0A 3O8LA 3EMBA 2O1XA 2QENA 2O2GA 4BX3A 2FKNA 5BW4A 1K7CA 4G8JA 4CKEA 4N5IX 3GHHA 4HLQB 3WWZA 4KRXA 3F6PA 4N5NA 2GETA 3KQNA 1Z4KA 2XEDA 3UMRA 1N34B 3PNVA 2HGSA 1JJIA 1IE3A 4HGRA 3M83A 3GROA 1WXHA 3RFVA 4B76A 4ZOQI 3AY6A 2FPWA 5A3QA 5BYKA 5LYJB 2HRCA 2HZ7A 5EVCA 4XM0A 3ROXA 3W1EA 1DT3A 5JSFA 3DBLA 1SZPA 1Y5MA 2VWPA 4U9HS 4AZWA 4A6DA 4O63O 4DFDA 4L0DA 4Y9UA 4WY2A 4YS6A 1F3LA 3A1NA 4MINA 3PF8A 4PZ0A 4UNRA 2MR5A 4XKJA 3DGFC 4P3NA 4DPLA 4UULA 1KY4A 1HT0A 3RK0A 1UXOA 2J4CA 2QA5A 3DZDA 4IHQA 3DP7A 1I01A 1PEKE 1YR1A 1KFEB 2C9YA 1BFDA 1U9IC 1UKBA 4LAFA 3STUA 4IGIA 5A9SA 4BE4A 1YFKA 4DIOA 3LI2A 3PG5A 1HQCA 1XZQA 4ND8B 4R54A 4WWHA 5JSHA 2ZIXA 3CZMA 3OCVA 2I8LA 2R62A 5CMLA 4YRRA 3W6ZA 4Q4CA 3H3JA 3ZY3A 5KDOA 5A3VA 2P6UA 5B7NA 1P39A 5DCUA 5D7BA 2YWBA 2YQZA 3R20A 2OFPA 4XA8A 2R9VA 1QQAA 1NVVR 2GZAA 3VH3A 2JGLA 5HQJA 1L7MA 2FUG1 1Y3HA 1FTGA 1MEEA 2NPFA 1D6MA 4E21A 4C03A 2V7XA 3CUWA 5FRDA 3BA1A 4BMPB 3DGEC 2P8JA 4Q9DA 4LC1A 3NZEA 2JFBA 2Q6KA 3OOYA 2EATA 4PO9A 5CTJA 4CYMA 3VAYA 4TT3D 2PT6A 3ELWA 2FRDC 4F3YA 3GCGA 3VKGA 4H60A 4X8OA 4UZSA 4LNUA 1W87A 1NFFA 4EENA 3SOPA 4H59A 5HPYB 1MPXA 1QC5A 2JIOA 1QHYA 3H9BA 3ADDA 1EESA 4FM9A 1XXHE 4CFYA 1I36A 1GG5A 2O6LA 2OAEA 6YASA 3H4IA 4K6FA 2GPSA 2GK3A 2ZCUA 1H42A 5FWXB 5LB2A 4ND4A 5E9AA 1OYYA 2C5AA 1TF7A 2MT9A 1Y7TA 3AVWA 2VTEA 1MEJA 5ICFA 2HA7A 4HXGA 3QU9A 4RVOA 3SX0A 4PPQA 2X8WA 1MEOA 2QDKA 2DPLA 2R8ZA 3FMIA 5DJ5A 3VU9B 4LVCA 3PFCA 5DISB 1N5MA 1OAOC 2W43A 5EE9A 3CGWA 3RC3A 3MPOA 2WE8A 4E4YA 1GXSA 1R0BA 2DFNA 2V1XA 5EHIA 3WOHA 3OX3A 1F0YA 1A76A 3IOCA 1E2IA 3GB9A 5FR2A 1RWPA 3QMWA 1NV8A 2P79A 3V1MA 1H0SA 1FP2A 4ID3A 3RRXA 1Y3DE 3IJRA 2NTVA 3QEOA 4JJGA 5TQ2B 5LMUB 3TI7A 2VZ8A 3IB3A 4KRGA 2GZMA 5HR5A 3M5DA 3T3NA 3EIHA 1WKCA 2A5FA 2JGRA 3ETHA 2YBDA 4HNTA 1VPTA 1H5QA 3ZDEA 3UPUA 3D4BA 1RM0A 2R6HA 1JHVA 2FN4A 5CM9C 1PR4A 3GJ5A 1IYZA 4P36A 2A5DA 1ZLYA 2SKCA 3NIGB 3E5HA 2VHUA 4RV9A 4X1OA 5CB6A 4W5JA 3L5KA 5CBPB 4YRCA 4KO1S 5BSUA 2ZTHA 4F9TA 2FG6C 2NIPA 2NSLA 4QVGA 1FB5A 4YH1A 4FB4A 3RRYA 4E6PA 2DWUA 3VPCA 5JHHB 5JCOA 1JNXX 1T0JB 1ZU4A 1ONPA 1XYGA 2I4NA 3QXCA 4GUAA 3TH5A 3SQOA 1ZH0A 2W2LD 1UK8A 2HI0A 2XCTB 4OXRA 3U4QB 3CINA 1HMPA 3W7VA 5IXSA 1ZD3A 1CUIA 2RJ3A 2RH9B 4X64B 2E48A 1LJLA 1RVV1 3BQNB 2FUEA 2R8PA 4HUTA 4OQPA 1T3GA 2VOJA 1OKKA 4GBGA 1UANA 3KFXA 1RVDA 5DOZA 4CNQA 1P17A 1Z25A 2GJSA 3ZE9A 1JYEA 1N1EA 3R3JA 1HNZB 5HZGA 2N1MA 5GVSA 1R0WA 4DVGA 2GVNA 3H5VA 1X1EA 3P97A 1XRMA 4ZZ3A 1QOZA 4NHEA 1S7CA 5EJ5A 1DIHA 2ADMA 3BE5A 2A6PA 2I4TA 3DR5A 2RCNA 1FJHA 1S96A 1W52X 2J5XA 2KLHA 3R7WA 2RI0A 3S28A 1P0IA 4D4LA 4EY6A 1DINA 3JX9A 4RLFA 3ZKAA 2DSTA 4C6TB 3IDZA 4ZIRA 5FHQA 2VC2B 2AQIA 2ZI6A 1EGVB 2HEGA 3B60A 3NOOA 1W2GA 1OI7A 3L6OO 3NHSA 1C1DA 4GI7A 1IUKA 3LD9A 4H77A 4JJ4A 5LA6F 2O2CA 1N0VC 4P81A 1N1MA 5I8ZA 5FUWA 3HUFA 5JQGF 4FHZA 3DZCA 4IWNA 5HGXA 3NHPA 4CQMA 5JZ9A 3TKYA 2QK4A 1XJ0A 3HFSA 3WS7A 4R40A 5CBKA 2FZLA 1R9NA 4JOCA 2PN1A 2O0HA 3HKBA 3DHEA 4M1TA 2FE4A 4A0FA 3AI2A 1H4TA 2Q0XA 2DBRA 3G89A 4RD0A 1XC7A 1K66A 2XWQA 1Y3BE 1DAOA 5CCDA 3U5TA 5C5EA 3PRHA 1L5ZA 4ESEA 4RAOA 2SCUA 2BD0A 3B8HA 3AF0A 2G82A 4ZJPA 5B6PA 1O7JA 3U60B 5K3EA 1ZVMA 2YNMD 4GLLA 4JELA 4H7FA 3RABA 1WU7A 3HBFA 4KO8A 1RBYA 1UL1X 2IKQA 1NQTA 2JGKA 3LCUA 2XYVA 3OX1A 1O8BA 4X63A 4TV8F 2NV0A 3WK7A 6CHYA 1VHQA 1SK8A 3MS4A 3QY0A 3RVQA 1EVYA 4OU5A 1FLAA 4LGMA 4A0QA 3CLSD 4UAUA 1JVBA 4C7BA 4MITA 3B3QA 2BFOA 3PDIA 2VDWB 3TVYA 4ROTA 1A2QA 2EJVA 5I9MA 1UBOS 2GO1A 4Q3OA 4GS5A 4A03A 4AL4A 4YAGA 5HKKD 3T1HB 4OLHA 5G4LA 1A4XA 2HT6A 3E0QA 3HUUA 1QTIA 4DV0B 5CIYA 3KZNA 3W3ZB 5HSGA 5KX5A 1P91A 4MV5A 1WPXA 2IVZA 4JUDX 1Z5UA 3D1JA 4HEQA 1KDTA 5EPEA 5JH7B 1E2PA 2GR9A 3T95A 3PLRA 4H27A 1IY8A 3DFMA 2DP4E 2QE7A 3KPWA 4LISA 2W98A 3G2NA 5LJLA 2XB6A 4YDSA 1A9YA 5CDSA 2X5XA 1QCDA 4L3OA 2JFHA 3HACA 3N3BC 1MOZA 1T5DX 4EITA 1YHNA 2I4MA 5JBQA 5EJEA 3L40A 4Q1EA 4IDNA 4G4GA 3I9KA 4ZRMA 5HIKA 2GEKA 4CEJB 4EYSA 1B0AA 1QB8A 2GF0A 5PNTA 2J45A 3BFKA 3KTFA 2W2NA 2X0FA 1ZK4A 5IT4A 5JZVA 4QOGA 3U0VA 1VIAA 1CUAA 1QO0D 3K8QA 4WN9A 2YL2A 2ZYRA 1T4CA 3I4FA 3MIZA 1V45E 4KKXB 5DWDA 4EHAA 4BVAA 3NEJA 2JLYA 5DSXA 4RZIA 3H99A 4X1KA 1L4GA 7REQA 3GZTB 3IIIA 2C58A 3JD2A 1Y34E 1ZI8A 3GLTA 4ZEXA 3DA8A 1S8OA 1ZNWA 5EWJB 4F71A 2C07A 1I0IA 2NO0A 4FFOA 1R2QA 4YUAA 1I3MA 2QRMA 4RJ2A 5IW8A 1W5EA 4GX1A 1IMOA 2VYVA 3LRXA 2NX2A 1B3RA 4P3PA 1XO1A 3LBHA 3I04A 2Q5IA 1QZXA 5DBHX 5DSZA 5GZ6A 2G28A 4HOYA 4QGAA 3EIOA 1VB5A 2WDZA 2WM3A 1WDMA 5F1PA 1MA3A 4AURA 3OKFA 4N5DA 2LTAA 4QT0A 4HVTA 3GWZA 4OHRA 4TN1A 4O29A 1OBFO 3UH1A 4BFXA 4MV9A 4W5RA 4MP6A 1G4HA 3BMQB 4R51A 4NXNB 1YK1A 4RCZA 1IRIA 5EPOA 4ZO8A 1CZLA 2NXNA 3L1IA 1DQNA 1EE2A 4CIXA 2GKSA 1EUZA 2I1LA 4GKVA 2CY0A 2IQIA 4UDNA 1W85A 2C98A 3I32A 3R0VA 4BWFB 9ATCA 1HLPA 4KDCA 4WY5A 4YMVA 4HPJB 4XFDA 5TLSA 1PNTA 2F9MA 2QU7A 3QJYA 4A8HA 1EJ2A 1GUDA 3AZQA 2WHEA 4BQFA 1JEAA 2QAJA 4WUVA 5DN9A 5CX1B 4JI1B 1TVEA 3KR1A 5EEGA 3NT5A 3VSBA 5DM70 1RKUA 3NFRA 2QZSA 3F67A 3VR6D 1QAQA 2QS9A 1EAYA 2ODTX 2NUPA 3LH5A 4J0GA 2Q99A 3OZTA 3LIIA 4MW0A 5JWHA 1GR0A 3VYVA 1H2RS 1OWLA 4ZU1X 4AJHA 1BXRB 3KP1A 2JH8A 3DVRX 2CJYA 2C5HA 4BIIA 4G81A 5HTOA 3E22B 1YZFA 3R2JA 4RGYA 3TGWA 4GX2A 4AMUA 1ECFA 1WZ2A 1ADFA 1BHO1 1X9GA 5L3RA 1LF5A 1DMRA 2CMGA 2NU6A 1A72A 3GFSA 4B4OA 1VLMA 3DMDA 4NTZA 3ENNA 3PL1A 4R1OA 1U1EA 1YQXA 1J8QA 3KTAA 3PC8A 2YRFA 3KLOA 4GBED 4YJGA 3PQCA 4R2IA 3SZRA 5JWOA 3W5DA 4YUYA 3SK0A 2ZUVA 2BGGA 4EHIA 1JDUA 3OVMA 3PJEA 5CA0A 2WR8A 2XNCA 1TTTA 2DY0A 3K0CC 3TE7A 2DJIA 1IBCA 1RHQA 3HVIA 1G5RA 2R6CA 4BEBA 1XR3A 2O8FA 3VU0A 1PUJA 1FMJA 2NN3C 3HNPA 3VNAA 3SJZA 4NNJA 3PWZA 5JJKA 1T10A 4MJ7A 2ZRNA 4EJ2A 2BFEB 3PYXA 5G40A 4G0PA 2TYSB 3JQGB 1AXEA 1OZ0A 5T64A 2ODWA 3TW0A 1H2XA 1KDPA 3JD0A 2B25A 4QM7A 2UUCB 4OB6A 1L7PA 3GUHA 5BN5B 5PGMA 4E6EA 1XPJA 4ZVQA 2XYQA 1BDJA 1GITA 2H6EA 2JATA 4HNSA 3O0DA 4Q19A 1PD1A 3GGDA 5FUYA 2QG4A 1GUYA 3PGLA 1NJGA 4GI5A 2XY4A 5EERA 3P20A 3QVOA 1N6OA 5JI2E 3MF4A 3KDSE 3ZHCA 3B1KA 4FFVA 4JJKA 2VDJA 1KEZA 3NRJA 1FJ2A 3NB0A 2VRBA 3QVXA 4MV1A 2Z2IA 1VSUA 3OEED 1L6RA 1ZK0A 4PPYA 5ARBA 1L8OA 4EP1A 2UUOA 3BRQA 1JE1A 3LYLA 2OXRA 3HDGA 4W4TA 5GTDA 4BMNA 1T6ZA 1Y3FE 1GG2A 2QI9F 1FXWF 1WUKS 4NMWA 3UA4A 1D0IA 3B1JA 3EXFB 4FYVA 3OJCA 1F3OA 4AIIA 3RAFC 2M6SA 3MS2A 1Y6GA 1Z33A 5HCIA 4FQ7A 3A58B 1N6RA 1Z8FA 3HE3A 3HN6A 2M6RA 2ZRJA 4UUNA 1O6FA 1GA1A 4I4CA 4D9FA 4IFIA 3LECA 3GCWA 4LQDA 3UTDA 2O23A 2IL1A 5TPZD 1HORA 1DAEA 4AMGA 1VSQA 5DB4A 1TA9A 5FOSA 3BCSA 4I14A 3V2IA 2DR2A 4XTCS 2ZYGA 3S68A 5LDHA 1TCUA 4P08A 2I7CA 2Q7OE 2HK8A 4Y6OA 3SCZA 2FR8C 4A92A 5KNBH 4HDCA 4ND8A 1P7WA 5FWNA 4NIMA 3RUCA 1AKVA 4TTAA 4YMLA 1BHJA 1E3DA 2XMQA 3HWX1 4CIDA 2H4WA 3NEAA 2JLRA 1U31A 3C7CB 1FYEA 5HCNA 2FVYA 8AT1A 2Y0DA 1ZUD1 3LLCA 4G2TA 2N47A 2P41A 5LLSA 4GZ5A 3CLVA 1CB0A 4K6GA 1XB2A 4TWBA 1Z7YA 2X58A 3KIPA 3D0QA 5DM60 3KSBC 4JB0A 4CQNA 1WQ1R 4GMGA 1KK0A 4KWIA 1STOA 2E7ZA 1PF7E 4FDTA 2R65A 4J1SA 4BP1A 4EHDA 4ZCIA 4MWOA 5IJWA 3OPVA 5JTTA 3IPYA 3GFRA 2YKGA 4BN4A 1W36B 1LC3A 1AUOA 1TQHA 2W2TA 2CL5A 1W76A 1WLSA 1WXDA 4TXHA 2VXCA 2ZVPX 5LL6P 1VBFA 1M2JA 2M98A 3ZJVA 2YV5A 2JIQA 1I3KA 4I0WB 1CZNA 2R3SA 2BMJA 1GQ2A 1JR2A 3KQPA 2RK4A 3IDOA 5CDUA 2NTEA 3CY6A 2HDOA 3WFIA 2FDRA 3WWCA 1UP4A 3ZOKA 1IB6A 5TQVA 1OWOA 2WSMA 4DA9A 1JLMA 3GMIA 5AVXA 5AM5A 3LGXA 2ZDGA 3QX9A 4LJ7A 3D5EA 3JQFA 5K0EA 2PMKA 5FWXA 4CV1A 1ZP6A 1ZVJA 3LXRA 5D7NA 5E0KB 1E8NA 3T34A 3TLEA 3RF7A 1XCJA 4MGEA 5IFKA 3FCUB 2OOKA 3OFSA 5A7HA 3ZGXA 3MNFA 5EKSA 3D6MA 1YR3A 1T2NA 2XF2A 3L84A 2AZMA 1NBME 1ILEA 1YOBA 3PD7A 1Z13A 2AUTA 4R9SA 1AHHA 1DBPA 3L07A 3VMMA 1HOTA 1RBQA 1DX9A 2C8VA 3I2JA 4LZLA 5DK4A 2WTEA 2YUIA 3QITA 1Q0TA 1J21A 1E64A 1W94A 4F6RB 3AR2A 4NYJR 5K8IA 4WADA 1QDEA 3EUEA 2AXNA 1QF7A 2OFOA 2YN4A 5KJ1A 2C92A 3LA6A 2OWDA 3DOUA 4J4HA 2EFJA 5KS2A 3PWSA 3IB6A 3SG0A 4DDTA 1FUIA 4LBVA 5HUQA 1O0BA 5TQ2A 2ACKA 3VRHA 3EW7A 4JSYA 4LZOA 3BJRA 1G19A 3HV0A 3JQPA 4Q37A 4YREA 3AUXA 1T0BA 1XRNA 3CN7A 4FEGA 3RPEA 1K7YA 4R3NA 4LPKA 1R4AA 3P2KA 1N0WA 5C0OE 3UWSA 4CIBA 5KYUB 3AVOA 1G21B 3C70A 4UU1A 2K7ZA 2CCJA 3AG6A 1IEXA 2GJAA 3AFMA 3DL0A 3N59A 4X92A 3TSOA 4BO1A 5KEIA 2JFUA 3PHHA 5G3ZA 4DLVA 2BKVA 2Y0PA 1NHWA 4BO0A 2SNIE 2XUQA 2Z5FA 3FROA 5CBPA 2GXAA 3ZCTA 4ZQBA 2ZI4A 4N5HX 5IM5A 4GBMA 4JJAA 3FSEA 4AKSA 2YWJA 2ZR9A 4WCFA 2W2XA 3HGQA 3V4VB 1XTJA 1NLMA 1E59A 3JAKB 2HYDA 1BJTA 3O2SB 1GAJA 4OD0A 4TTIA 1EXVA 4QU9A 1Y5NA 3JVUA 1OBVA 4C4OA 5TDHA 2XWPA 1S8FA 2XKBA 3MSCA 2UZ1B 4GLOA 5EUMA 3U4QA 2VYNA 1PR0A 2DHEA 4M9XA 4QU0A 5KQGA 1DJMA 1P2SA 5EHXA 3UWKA 3O9ZA 2VTKA 4WZZA 5IN4A 1VJDA 4OCZA 4C4XA 5B58C 3T5MA 1TF5A 5F73A 1ADGA 2EKDA 5D5HA 4CHGA 3H2BA 2PO5A 4TS4A 5C3MA 1FFCA 4X3PA 4K03A 4JVNA 1CW2B 3PCXA 4MZDA 1FMTA 4F2DA 1RT9A 3T1TA 4DDUA 4E33A 4LOHA 1GPLA 1I2AA 1T5BA 1Z6PA 1A3CA 4JKYA 4C6TA 4OIMA 2WYIA 2J67A 4JYBA 5AICA 1R0SA 3K9QO 1TCVA 2XNJA 5AOAA 4D98A 3L4BA 7MDHA 1UZLA 2R0QC 1YHZA 1ORRA 2XGOA 4AUNA 3GLFE 3CT4A 4FCVA 2Y1EA 4HYYA 3OD1A 4CE6A 1CR2A 2DULA 3O8NA 3C3PA 4DLZA 1PG0A 3TF5A 2VWQA 2Y1DA 1ICEA 4Q1AA 4AY2A 4I2NA 5U4QA 3S81A 2ROQA 3BREA 4PANA 2Z1NA 1LI4A 1YJAA 2FWIA 3PRJA 2K4MA 3QXSA 1SUPA 4A23A 4UM9B 3VR2A 3KXKA 3CRRA 3N3AC 4I4TF 5CH5A 4HAVA 4Q9JA 4BNFA 1TQ6A 2JIRA 4TYWA 4NBWA 4XEUA 1FNCA 5A3JA 2Q0HA 4UJ3A 4PO8A 2CF5A 3D8RA 1ZJWA 5BPHA 3EXHC 3IE2A 1XZLA 2ZM5A 3BVPA 4G1FA 5H7XA 3F47A 5BXQC 3ZD7A 1VG0B 1YMQA 3LHDA 4LZPA 1MFPA 1UC4B 2VKQA 1EDBA 1JKMA 4QAJA 3VOBA 3TTWA 2F43B 2WQ6A 3DC2A 2EW1A 1JEQB 1SXJB 3ZHOA 4DT1B 3OLYA 4YUVA 4R0MA 2B0CA 1PLJA 5EIAA 1U04A 3LMKA 3TIIA 1QZUA 3K70B 5CFNA 1SCNE 3EMDA 1A5BB 2XMSA 4XVHA 3VNUA 4FIDA 4DV3B 3UJ9A 3FGPA 4RSHA 1A5AB 1W1UA 1AUQA 4YHHB 2IBSA 1LA2A 4YASA 1E9FA 5JNVA 3BJIC 3AL0C 2VCEA 5L3ZA 3FZYA 1TPZA 2QVBA 2VG8A 2W00A 3E3NA 4Y1RA 2K6GA 3A3YA 5JS7A 4QOSA 4LXYA 5AXCA 1T1JA 3DO5A 5BMVB 1DXOA 3W3AD 5JH7A 2QVLA 1WBBA 1F9AA 1NDHA 1YDGA 3S6JA 5IUNC 4MLPA 1Q7CA 1VKOA 2IE8A 2IHZA 3WV5A 1NXVA 4ZODA 1SEVA 3CNQS 5FLYA 3V33A 2O0MA 2PX4A 3D5QA 2Z5LA 2CXHA 1X1DA 5A5VA 4IJVA 2EYQA 5KYKA 2L17A 3PUJA 2OGTA 3FYCA 4B44A 5I9SA 4DREA 4OA5A 1TLTA 2I1QA 4JMLA 1SVOA 3V1LA 3WLRA 2A0WA 4KYTA 2BHSA 3EUWA 2QD4A 3P8ZA 2V4UA 4U6SA 4AU1A 4BPRA 3EGOA 3G8AA 3L4EA 2X8BA 1ZD4A 4CEJA 4IDDA 2O50A 1MT0A 2F3QA 5MHTA 1UPFA 2CXSA 3AHFA 4BFSA 1UR5A 2Q6OA 2VHJA 1NW9B 1M1UA 4KK3A 3HDYA 3A4LA 4IX1A 1T1EA 1GY8A 2RB4A 3OF5A 3QA9A 5ILGA 4FDAA 4R9NA 2B36A 2FZKA 3FUTA 4EYQA 2FETA 3ZEAA 3FJYA 4GSKA 2YMPA 2X5NA 5EWJA 3WGKA 3GGGA 4WL0A 4LJ5A 3EEYA 1WUJS 1JJAA 2WA1A 1T5LA 4YIHA 3CRQA 2ZJZA 4WZBB 2OCXA 5FBZA 5KTKA 1Y6ZA 3PYLA 4DCVA 4DQLA 2KB0A 3CPJB 1Y33E 3PZRA 5KVAA 3CG0A 3JU3A 2ZI7A 3A6DA 3ML1A 1E5QA 3X1YA 4FKZA 4YRBA 4IOMA 1X9IA 2ZR7A 2ZTMA 4LXXA 1FFXB 3VJLA 3VPBA 4ZCRA 1H8HA 4BX2A 4G5SA 4E13A 1GCGA 2CXRA 4L51A 3W1VA 2P9HA 2PUVA 2VBIA 4YALA 1YVDA 4JUBA 3BMQA 5JSKA 4AUKA 4B3IA 2BMFA 1KBOA 1DJNA 3SQWA 3FYUC 1NXTA 3USZA 5IJZA 3HTXA 5IYZF 1Q1QA 5DHFA 5KJ6A 1XRPA 2JBWA 3D9QX 1RWNA 1DJQA 3O4HA 1H0RA 4HLDA 4C4RA 4M89A 1KNXA 4R2MA 1PYGA 4MWSA 4E1BA 5DP1A 3D7KA 2W83A 2HLPA 1NLZA 5CX1A 5JPIA 2DYKA 3VC2A 3D1LA 5F7OA 1E3IA 5G1OA 2QN8A 3I2GA 4YRIA 2ASEA 1FRZA 4G56A 2PKXA 1KYVA 1N57A 2BFBB 3EZGA 2KLBA 3EMVA 4GYJA 3LX8A 3T9AA 1MW8X 4AI6A 5ITZB 4PLWA 3VO2A 3E22A 1KORA 3NPMA 3A11A 3P5SA 3KRTA 2WQ7A 2M1XA 2ZIUB 1F38A 1M73E 3DV9A 4QHTA 3I2HA 2B92A 2GWRA 4QXRA 1KMIY 2ZAYA 1O1YA 3THXB 3IIEA 1TDJA 5E4TA 3ZNQA 4DABA 1CVIA 3PFFA 4TTSA 4B47A 2PX0A 4B8ZA 4TMXA 4FUTA 3SDZA 1D0VA 2QN3A 3F78A 5FQOA 3KQKA 3OEYA 3OQ6A 3WY9A 1FVHA 2BGLA 1Q7EA 4DC0A 1FS6A 4Z1MD 2A0UA 4WLVA 5B55A 1K8XB 5ECGC 2ZUCA 3WZMA 4X97A 1ZIXA 4BECA 1EK1A 2CUTA 3O8CA 4EHNA 1TKBA 4CTKA 2HWYA 4MB0A 2ALJA 2EZTA 3R44A 3ZE7A 3I5MA 4QJ5A 4D8VA 4HLUC 1K5PA 2BFEA 2IEYA 4HRAA 1A5TA 1KO1A 1PTJC 3JQGA 4PTZA 2C5FA 3KKKA 4Z4IA 2XCIA 5BW6B 4HQLA 3LCCA 4PYQA 2P4HX 3BD8A 4OM7A 4RZHA 2OP1A 2C42A 5E2IA 3W34A 4D0GA 4E31A 5HZKA 4ZPXA 1SIOA 4UC0A 3GRKA 1Z4JA 3QSGA 3DT9A 1NHGA 4HAZA 1YASA 1YQ9A 1G98A 4Q1VA 3RU7A 5AKLA 3WL5A 5F23A 2AVNA 5J2UF 3COZA 5BOSB 2OEPA 3AMVA 4JBXA 5ISMA 1X1CA 3NETA 3LPNA 3TZ6A 1LJ8A 4DXHA 2B9EA 3L8HA 3CGGA 2YV1A 5DNVA 2YWEA 2V74B 1OAAA 1FVFA 1TQ2A 2YFQA 3F5MA 2XYRA 4L1KA 2AG1A 2PK3A 3KZMA 1NT2A 4IYRA 4WX2B 4QUIA 4WE3A 3JASB 2RHMA 1Z6TA 2OBYA 3WLEA 5J4VA 4OAOA 5AHXA 1WETA 2JI4A 3I01A 4YAJA 3TQSA 2FFRA 3ONNA 5IJ0B 4EPRA 5KOIA 4ATNA 4LWQA 3EXFA 1EZZA 1UBEA 3FNQA 3HZZA 4IMRA 5H5JA 3O83A 2EFCB 2O7SA 4MUYA 3U16A 1GHTA 2LRHA 2IK8A 4YJ3B 3CCBA 1CHNA 2PV0A 2CHVA 3DFKA 1OBCA 1Q17A 3F5DA 3OF3A 4FDVA 4K3VA 3VKWA 2PQ0A 5GINE 1ZVVA 1AS2A 3MXOA 2A7XA 2IPOA 3ZWOA 3FZGA 3GJ8A 4DUGD 3N07A 4ZDIA 2AN4A 1YDWA 1QS0B 4XJSA 1JB9A 2B99A 2DWOA 3DNPA 5G0VA 4B85A 2A5YB 4WKGA 3HR4A 5DLQC 4BVJA 3PEVA 1C3JA 4KMSA 4UUOA 3GOHA 4IVPA 1YCHA 2J0QA 3QNWA 2LIPA 3OZGA 4HNAB 4OFZA 1V8BA 3FDXA 4WFKA 3AHHA 2WY2D 1ZVQA 4Z9YA 1IHUA 5ALIA 3KJEA 2FUNB 2HO4A 1WNTA 2NZ8A 5AI6A 4ZVPA 1TT5B 2TMGA 3EGVA 4HGZA 4QDUA 2AFIE 3JQBC 2A0FA 4H1WA 3QPCA 5EYPB 4M0DA 1G8KA 2JAQA 2HCBA 1QFJA 2ZB7A 3BF7A 3IVXA 1HQDA 4G0ZA 5D5PA 3RLFA 2Z3ZA 3NNSA 4IWYA 3TLAA 4C7KA 3F49S 1Z2NX 4PZLA 4GPZA 1PZGA 3BK1A 4BEJA 1R4NB 3HCAA 2XIQA 2V03A 2WINI 2ECKA 3PUHA 4CM7A 2FUCA 2OKGA 2PXHA 2IIVA 3OIVA 2WPNA 2ZJOA 2CMKA 3M7IA 4BMCA 1A8PA 4BMDA 1F5NA 1BCSB 1U0JA 3QSYA 1EGQA 1SMKA 1I94B 4IHJB 3DM9B 3STTA 1GDHA 1QH8B 1Z8DA 3FUCA 1GUAA 2FSGA 4KDEA 2XD9A 2H51A 1Q6ZA 2PBFA 3WA7A 4CF3A 2J7KA 3JQ9A 1NSFA 4IX9A 4P4UA 1Q77A 5IMSA 3RQSA 2RHOA 3DB1A 4PZYA 3IAAA 5J59A 4EX7A 1OJ7A 2ZSAA 2ORYA 3OURA 5THXA 3NBMA 1FFSA 4QT4A 1X3SA 3AFOA 3CEJA 4RH0A 4C78A 3DOFA 2LR0A 4JSTA 2D3WA 4XYGA 2PH3A 2H2WA 3LXUX 3C7AA 3FYTA 1UUFA 1NRXA 4UATA 5FNZA 4G1UC 2OA0A 1RJEA 3WB2A 1WUIS 3ANMA 2SKDA 4XIJA 4IP0A 5EQDA 5D00A 3TX6A 3GFVA 3BL6A 1SY7A 4Z51A 4B3RB 4CM6A 4OJQA 3RO7A 4BVHA 5JZMA 4RD4A 4YV0A 1N5JA 2DPMA 2XRFA 2RC5A 2M6KA 4FFNA 4F6RA 1EFRA 2ZWPA 2G8LA 3KM0A 2ZCJA 4GOLD 2J09A 2BGKA 2JJMA 2P4UA 4JNCA 4H35A 2R11A 1AXRA 1PVOA 3EVEA 3DD5A 2B1JA 3M5PA 2XQIA 4H1VA 4G4SP 3DBRB 3SVLA 1M2NA 2BMAA 1SWWA 3WWOA 1KJQA 1R4MB 2JCSA 4GWKA 3HXQA 1Y7PA 5CH8A 3BXOA 1Z7GA 3SM3A 2WPDD 3EFOB 3OIGA 5GQSA 4JB2A 5ARCA 5KYUA 1G21A 3W5CA 1N5LA 3KLNA 1WUTA 5C8YB 2XITA 2P9CA 4L16A 5A4JA 2GM4A 4RTSA 3OMLA 1Y3CE 2IHYA 3FCCA 2BI7A 2FMIA 2O06A 4J0KA 1NP3A 3LDUA 4MYRA 4D9HA 3E48A 3R74A 1CQIB 3LBNA 4F4HA 1M1ZA 4TL9A 1I7LA 4E32A 3SMQA 4U8GA 1YRWA 2B4TO 4ICIA 2C78A 2QX8A 1XRQA 3JAKA 1M6YA 4ZEWA 1KHHA 1SH7A 4LVOA 4QQ8A 2D1QA 4B35A 3H6GA 4C3UA 1VE9A 3TAXA 4DR1B 5BXYA 1XDDA 1D7OA 3ZX5A 2UZ1A 3QE9Y 3BGVA 1NC1A 3BGSA 3CUUA 3UAXA 3W5VA 1VLQA 5J4LA 1WCYA 1UJ5A 2W4IA 2HXYA 4H4DA 4RTQA 4YJFB 1V3VA 3DO6A 4DEYA 3P32A 3B2QA 5T57A 2BMVA 1VI6A 2AR0A 3PFHA 1QX4A 2I66A 3CISA 4HFMA 4KV7A 3L0CA 4KL8S 4MX8A 4DCTA 4B7CA 3QIAA 5JY6A 1A71A 1Z08A 3ZCSA 2QD1A 1XMVA 3EIXA 3RAJA 1NNEA 3P0HA 4P53A 1DADA 4L73A 1AJEA 2Q21A 3OZUA 1G16A 4P6VF 5LUAA 1QORA 1RHJA 1J56A 1ZCJA 2HMAA 4OQ4A 5D3QA 3S1SA 3VPSA 1EFAA 1E99A 3N6VA 3B8EA 4P3OA 2H3EA 4XWYA 1WM1A 5LU8A 2OUIA 3G1TA 2QN6A 3SIWA 3SIRA 2P75A 2II6A 3EX7C 1CNEA 2FXVA 3FFBA 3W5HA 1NR5A 1PQPA 2FUKA 3OPMA 4C2UA 1K5DA 1HE5A 2W6MA 4JI5B 3HVUA 3AVUA 2DTDA 4YRFA 5IDVA 2V6BA 1USIA 4S0ZA 1CYEA 2F1KA 2AH5A 4FYJA 1QMGA 1F7VA 4O25A 3AIIA 4BGEA 1EXNA 1FQJA 1O97D 4ND6A 3T94A 3X0DA 4MIEA 3NVKI 1RI4A 3AFNA 4FFRA 5EZQA 3HA2A 3RS0A 2FEOA 3OQIB 4D9NA 2GLUA 3WXMA 7YASA 2J0EA 3PDJA 4AZ3A 3RK1A 3QU4A 2IX3A 2KSQA 3H0CA 5L7TA 2F43A 4UM5A 5JZSA 3UTCA 3MAAC 4Q3EA 1JEQA 1SXJA 2RKOA 4TS3A 1QIKA 1KIMA 4LOJA 5DM0A 4AC9A 3CX7A 4DT1A 3PHLA 5J4YA 5AQEA 5K8LA 3PUYA 1N2SA 1JHOA 3EHDA 3SC4A 4GQAA 5A0TA 2CNBA 4L4SA 5I7OA 2CXQA 2XR1A 5CIWA 2GQ0A 2WJZB 2VNJA 5K4GA 1JDSA 1P2FA 4YFYA 1I7DA 4RYDA 2FPXA 1XKQA 4HB2A 5C3UA 1V3UA 1LNZA 4ZDKA 1COWA 2R8OA 4ESHA 2ZP1A 1NSTA 1I4LD 5LP6C 5CFMA 1EIZA 3DPSA 4LZZA 1XTTA 1Y0BA 3IAFA 4O8ZA 5BMVA 1QFXA 2H29A 2IV3A 1NSYA 1X1TA 3WNDA 3OQNA 2FTKE 2QPOA 2ZVQX 3NR2A 4LNHA 2UVDA 3KB1A 4W9NA 5CGZA 4Q9LA 3TO5A 4O2AF 2ZYUX 5ELMA 3MMNA 3P45A 4I3GA 4MAMA 4NV3A 3DYIA 1KJZA 3ESRA 4AS1A 3LXXA 1VYVA 4DMUB 4MCIA 3UGQA 5I01A 2FPUA 4KKVA 2CDNA 1TZBA 2JFZA 2YMQA 3O93A 4YQEA 4HD8A 1LSSA 4P33A 4QNRA 1YKSA 3VM6A 3FMFA 1H1TA 3AVTA 3I1FA 3KLPX 3I92A 1KAGA 3FPJA 4KQGA 4YP7A 1AQ6A 3WISA 1WPGA 1CQJB 4Q4JB 4N82A 3H6KA 4GQIA 3S7ZA 5IC4A 2D1TA 2YNMC 4OI2A 4AJ2A 1VJ0A 4FOOA 1TEXA 1JSXA 4K40A 1EX9A 1YBVA 3DZGA 5EJ2A 1UBJS 3BB3A 3CVXA 1I33A 1YGYA 3CLSC 1H3NA 4LV5B 3DDNA 2ECFA 3FYDA 1S2DA 1IXKA 2H7CA 1NVEA 2BONA 3VZCA 1PGPA 1FUEA 3H9EO 3TCKA 3LHSA 2WUVA 4PIVA 1FFXA 1WL8A 1YRLA 2F3RA 3HNRA 4ZVSA 4Z2YA 1B42A 2QL9A 1XROA 4US1R 1YZ3A 1CUSA 3DMGA 4DRZA 3V4RA 3THWB 3DEKA 5IK2A 3WFZA 3GLGB 3OEHA 2PYZA 3KT0A 5BRNA 4D8WA 3DMHA 3GAMA 1ST2A 4CCAA 5EHQA 4IDHA 1MHTA 1Z0ZA 4BE7B 2P9TA 1QDLB 3CZ9A 3OHMA 1SVIA 1SXIA 1V5WA 3GEEA 2WSYB 5BUQA 5HUHA 3DKVA 1T2UA 3WRYC 4RZUA 4LJRA 3ANXA 4FB5A 3L7OA 3FY4A 1XP8A 2V9ZA 4MS4B 1NN1A 1WRBA 1GNTA 2WT4A 3EC7A 4OLBA 4C07A 1N9ZA 4EHFA 3GXBA 3DMPA 2BFBA 3KT3A 3P26A 5KDDA 2HRBA 2AI2A 3MTBA 4KBFA 3FUUA 3QPWA 2SECE 4C29A 5ITZA 4HKTA 3FMPB 5ALSA 2Q5EA 3LNCA 1T1GA 1YZTA 3VTZA 3WYCA 1Z5NA 3T7EA 1XAIA 1SRRA 1CS4C 4LZNA 4PCLA 5AVOA 1SULA 5MFZA 3U6BA 2I7VA 4MAFA 3QX7A 3SJAA 4NOLA 2OENG 3WNBA 2GLXA 4QD3A 3WGGA 2WTUA 1DC7A 1CS0B 3VOSA 3VYRB 1V1RB 5IG2A 2EP8A 2X9GA 4UTXA 4TVBA 3NHFA 5JDIC 5I8WA 4N5MA 5F21A 2REOA 5FORA 3L7LA 2BGUA 2ZRAA 2JLCA 4RF4A 5CT8A 3VC7A 1TTQB 3KFLA 1YB7A 3A6EA 2JJ2A 5BR1A 2XCQA 3I05A 2GD0A 4ZWNA 4RDIA 2OFXA 4FMDB 3EIWA 3SSNA 5AI9A 4UEQA 1LDNA 5EG5A 3FH0A 2H06A 1PR3A 1WB4A 2HV9A 1G5IA 4JK3A 3FWNA 5F5NA 1OGJA 5E3JA 2BRUA 4WECA 3DMNA 3WZLA 3OMWA 3WIDA 2REXB 4OXQA 5T5QA 3ROMA 2EDAA 3RSCA 1XTIA 5K0GA 2PHZA 2VUUA 2ASVA 4FGSA 1K88A 5KPDA 4LYEA 5AW8A 1GFWA 3HLKA 1GLGA 1DEOA 4IV0A 3ET4A 4MWDA 4RA6B 3SF8B 5BOSA 1P33A 4DM7A 1GILA 5EJ6A 2LIVA 2GD1O 4OATA 4V0MA 2A9OA 4BJ1A 1A98A 3VU8A 1MH9A 4ENWA 1FUUA 5CVCA 1RW4A 1XFDA 3EXAA 2OR3A 4O2BB 4KQHA 3RSGA 2NACA 5CNIA 1VB3A 1A9ZA 4JQYA 4IIDA 4R83A 1MFZA 3R8XA 4B6PA 4BMSA 1DTWB 1L9XA 1Z3IX 3JASA 2D1RA 4QDXA 3L7JA 3AFGA 4ISBA