3DLTA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
molecule keywords Esterase D
total genus 85
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dltA00
3YASA 2PKYX 4AQDA 1ETHA 1FSSA 2JGKA 1EB9A 3E1GA 5JD6A 3FYUA 5DNUA 1QZ3A 1DT5A 3WZLA 5AIAA 5E4TA 5LYYA 3D3NA 4ZV9A 5JADA 3A2LA 1VA5A 4CFSA 1QIMA 1YCDA 5AICA 2YXPX 2QKYA 4X3CA 4ZGBA 2QUBA 2XQJA 3V1MA 5A71A 2HRQA 2PPLA 1CLEA 4DTCA 3RM3A 4P93A 1MU0A 1JU4A 4C6HA 1IZ7A 5ALXA 5T4HA 4KEAA 5AH0A 1WOMA 4FDMA 4PO3X 5SYNA 3IB3A 1QIIA 1RWQA 5ALGA 3PDCA 3MGAA 4ARAA 1FFDA 4LXIA 2JBWA 4UBMA 1AZWA 1CUDA 1THGA 4GW3A 1K8QA 1HBJA 4MQLA 4K6KA 1MX5A 1OCEA 2IIVA 2HA7A 4NVRA 3DCNA 5ISMA 4Y2JA 3STYA 1TCBA 3VDXA 3BJMA 1XQXA 5ALUA 4B9EA 1SCIA 1UK8A 5BWBA 3R3YA 1LBTA 4MYDA 5LZ5A 4Q34A 4J7AA 4U2EA 1JFRA 5AI8A 3FNBA 3EF3A 3VVMA 4XJVA 5FLKA 3C70A 3VISA 1PFQA 4HXGA 2V97A 4G5XA 2BGNA 4DYHA 2VJDA 1R88A 2VT7A 4Y2TA 1GKLA 1MPXA 3WK6A 4Y9SA 1R9MA 5LZ7A 3G7NA 1UZAA 3FVTA 1CUAA 3ZLTA 4EA6A 2G4LA 1B6GA 2XT0A 3STXA 4OYYA 3C8DA 4UUQA 4G1FA 4ZRDA 3M3DA 4F60A 4BVJA 1E5TA 1WPXA 2ZJ6A 2AJDA 4BRSA 3FYUC 3GELA 2O7VA 5LZ9A 2ZVDA 1HPLA 5ALEA 3IDAA 2RONA 2G5PA 1W1IA 1QONA 4GEGA 2E3JA 5IVDA 2XUKA 3M83A 1VA4A 5CTAA 3WWEA 1QE3A 3QBJA 2VJAA 5EHZA 1IVYA 2ES4A 1Q0RA 3TRDA 3C45A 3QPCA 5CH3A 4Q3KA 4X7BA 4EB0A 4X94A 1JMKC 4N5HX 5I8PA 1O6FA 4HTAA 1TKRA 2QXUA 2B61A 5HZGA 4X92A 4BVKA 4X85A 2DHDA 2WIGA 2R8BA 5DWDA 2DQYA 5T4FA 4INZA 1C7IA 1JMYA 2WUDA 5CW2A 1XZMA 2PUJA 4B81A 2QUAA 4BDSA 1D07A 3S2ZA 5IH7A 1CPYA 4ROTA 2VEOA 2ECFA 5ALLA 1QIEA 3I2KA 2C4HA 2B20A 4X95A 4QDOA 5SYMA 4UHCA 2QM0A 4EBBA 2BKLA 1NU6A 5AM5A 2QR5A 1XRPA 2WFLA 2HFKA 1L7QA 4ARBA 1ZIYA 1YB7A 2J3QA 4MXDA 5ALYA 3IUMA 1CQZA 3HJUA 1N1MA 3QMWA 5AKKA 3A2MA 3V1NA 2OGSA 5BOVA 4OCZA 5A7FA 3CCBA 1P0PA 5CT5A 1GPKA 4I3FA 1XKTA 1CUCA 2QOEA 4RE5A 4BCBA 1UWCA 1ACLA 5JD4A 1S8OA 4AZ0A 1EDEA 3TEJA 2WTMA 1H2YA 3BIXA 5HQ3A 2XUAA 1K63A 2RHWA 1Y37A 3IBTA 4WFKA 4M0EA 3VJMA 3T52A 3F96A 4LXGA 4J0KA 2CEKA 4W1QA 3HYSA 2QT9A 4QNNA 3RLIA 7YASA 1T4MA 1EB8A 1O6GA 4MQMA 2X76A 1MNAA 1NX9A 5KREA 1A8UA 1TAHA 4HAIA 2OCIA 2OCLA 1YB6A 1LPBB 2Z8XA 2AJBA 1BN6A 1ZGCA 3KWJA 1L7AA 3ED1A 3AZPA 4FLEA 1CUWA 3BF7A 5DYWA 3A2NA 1AX9A 4J0JA 3E3AA 3WA6A 4OB8A 3WK9A 1Y7IA 5DNWA 1MNQA 3PF9A 4Y7DA 4FOLA 4Y2QA 2VSQA 3W06A 4RE6A 2ACKA 3G0DA 3WA7A 1ZD5A 4S0XA 1LGYA 4DMCA 5AKXA 2WIFA 2XE4A 2DHEA 3NOXA 1ZGBA 4BRZA 5HQ3B 5AJHA 5LZ4A 2ZSHA 4HVTA 4J0IA 4QWMA 5FUMA 2WUGA 5ALRA 1X2EA 1ZD2P 3ANSA 4LYDA 2BUBA 1Y7HA 2XUIA 3AILA 4IHAA 2FJPA 1XLUA 2PSHA 2VAXA 2WM2A 2XDWA 4IQ4A 4H7DA 4DM7A 4GWLA 1ZD3A 4QEKA 2VQ6A 1ZIXA 4U2GA 4X90A 1XRLA 3O4JA 1YR2A 4OB6A 2D0DA 4WFJA 3F97A 1CUUA 4OUKX 1UKCA 4WDRA 2AJ8A 4IH9A 5CMLA 4E15A 3G0CA 4CG2A 1XZLA 1VKHA 3AJAA 1EHYA 5DYTA 1QTRA 5AM4A 5IVKA 2Z3ZA 4AMYA 1QTIA 3VJLA 4BVLA 2ONCA 4W1PA 4AO8A 1KEZA 3EBLA 3D0KA 4A5SA 3D2AA 2HA6A 1DTEA 5AP9A 1M33A 1LPNA 1AQLA 4UFPA 5CRIA 5A6VA 2K2QB 1QFMA 1UFOA 1FFEA 2ROQA 5A62A 5IKXA 2PSDA 1LZKA 1CEXA 1SFRA 4CIBA 3ANTA 3HACA 3WJ2A 3HRHA 5ALPA 3SK0A 1CUFA 4BCDA 1P0IA 2CZQA 3V48A 3WK5A 4M0MA 2W22A 4F21A 2J4FA 1AURA 3L1JA 1X70A 4K5QA 2QMQA 1Q83A 3PI6A 3WKDA 3I2JA 1F0PA 2O2GA 1CUYA 2HIHA 1DINA 4HRYA 3B3QA 4LIPD 3HLKA 1LPSA 2JGIA 3LS2A 3IUJA 2XLBA 2B9VA 3QVMA 2GBCA 4MEAA 1ZJ4A 5HK9A 1JU3A 3PICA 1JJBA 3FYTA 4U2BA 3WK8A 2Z3WA 3D59A 2AXEA 5AM2A 3WZMA 4JEIA 2WUEA 3PF8A 4AZ3A 1QOZA 1CUIA 4OPMA 2YASA 3D5EA 4OSEA 4KRXA 3GBSA 2QVBA 2QS9A 2H7YA 3G0GA 4X6YA 4RNCA 3W2TA 5AKZA 3I2GA 5AO9A 2OGTA 2O2HA 4BATA 1W76A 1QJ4A 4EY8A 1K4YA 3E4DA 5CXUA 2PSEA 3O9MA 1TIBA 1MX9A 1PJAA 3K2IA 1XZJA 1YSCA 3BIWA 2HL6A 1ZI6A 5JARA 1E8DA 2ACEA 3C87A 2FJ0A 3O4GA 5JAUA 4QZVA 5CURA 4RGYA 4KE8A 5ALIA 4QA9A 3RARA 5C8ZA 3QYJA 1THTA 1VLQA 4M0FA 4AN1A 4N8SA 3GZJA 4TGLA 1CUVA 4BP9A 3V1KA 5E4JA 1IUNA 3LLCA 3SX4A 4C4XA 4YK7A 3VKFA 4FFWA 4J0GA 1R1DA 5IVHA 4J0DA 4CI9A 1LPOA 3WL6A 3C6ZA 3G02A 2WU4A 1ZJ5A 4UHDA 1EH5A 4UBKA 2DFPA 5T4BA 4ZV7A 3HSSA 5A7HA 3DD5A 3H0CA 4GDMA 4N5IX 2W6CX 3OOSA 2C5GA 4FBLA 4JYPA 5JAPA 1E8MA 1EDBA 5FKJA 4ZI5A 1W52X 2HU5A 3MUNA 3WK7A 1IMJA 3F67A 5LP1A 2D5LA 2RAUA 1MAHA 3MUOA 5AKIA 4B80A 1XZBA 4BBZA 3FAKA 2XMRA 1L7RA 2QXTA 1HKHA 1XLWA 3HI4A 2XB6A 1BU8A 1YAJA 4TVKA 5K5EA 2O7RA 1R9NA 2Y6UA 2VF2A 1ZI8A 5CT9A 3WL8A 5LZ2A 1VJ5A 2WG2A 2XMBA 4QDZA 3WK4A 1TCCA 3AINA 4EY5A 3O4IA 5A2GA 4B0PA 1YA4A 4KYVA 4B9AA 2G5TA 3KD2A 4BE4A 2UZ0A 1FFCA 3P2MA 4DNPA 2V9ZA 3FSGD 1CQWA 1GZ7A 4H7KA 5HFAA 3N2ZB 2AJCA 5DTIA 1Q84A 1AC5A 4WY5A 4DSZA 4JUIA 4A16A 3JYHA 2HU7A 4BTVA 2R11A 2VT6A 4JH0A 4C89A 4DNOA 5ALMA 2EDAA 2ZYIA 4B0OA 3IA2A 1BN7A 1P0QA 3MVEA 3WYDA 4MYSA 3M81A 5C81A 4G4IA 4BZWA 3OURA 3F98A 3HABA 4C88A 2OPHA 1E89A 2VAVA 4GI1A 5KWJA 1A8SA 2PU7A 3ESCA 2HU8A 5DYYA 3WMRA 2GZRA 3ZLUA 4X00A 2OQIA 3SC2A 4ITVA 2XMQA 1MAAA 2ZSIA 4C4YA 2HHAA 3STVA 4OB7A 3DQZA 5ALWA 3G9ZA 2O2IA 2QJWA 3O9VA 2DHCA 3AFIA 1ODSA 1X2BA 3H19A 4BDTA 2QZPA 1J1IA 2QJRA 2JIDA 4QDTA 1EA5A 4X97A 1QGED 4XIIA 3NUZA 5JZ9A 4X93A 1J2EA 4HRXA 2XLCA 3FLEA 1ZICA 4E14A 5FXMA 3D2CA 3BE8A 2XMZA 5YASA 4MWSA 4CCWA 1QIGA 1WPRA 3I28A 3DKRA 5JZSA 5D6OA 4G9GA 3PUHA 3DS8A 4Y2PA 1T2NA 3L1HA 4CIAA 3EIOA 1AMNA 5FPQA 3G9TA 1LPPA 3K6KA 3R3ZA 5AKHA 4UHEA 4DMHA 2BUAA 3KWFA 4LXHA 3AIMA 2OCKA 5ALVA 1ZI9A 3WJ1A 5ALDA 4OU5A 2WFLB 1W75A 5ALTA 4PV7A 3DL4A 1CIJA 5ALSA 4EZIA 2V96A 3FCYA 3ZV7A 1AKNA 2QTBA 1K5PA 3WYNA 4H7EA 4G8CA 5DNVA 4DGQA 4KRYA 2IITA 4EY7A 1U4NA 3DYIA 3Q0TA 3EQ9A 5E2IA 3D4LA 2RGUA 3LP5A 2CKMA 2GYVA 1JJFA 4HXEB 5DTJA 3ZLVA 5DLPA 1DT3A 3ESDA 2I03A 3C6YA 2DR0A 4G8BA 4BB0A 1GT6A 3FLBA 3H2KA 1YAHA 4J03A 1QO9A 1MTZA 3WKCA 1AUOA 1UKBA 5LKRA 2PX6A 1TQHA 1F6WA 5K3DA 1G5FA 5AKLA 1ODTC 1IZ8A 4W9RA 3C43A 3R40A 1FFBA 4KE7A 1C7JA 4J3JA 3G0BA 3PFBA 4L0CA 3WL5A 1KU0A 4TPKA 3T4UA 3GUUA 4Y2XA 4H7IA 2H9YA 5F4ZA 4RPCA 1XKLA 4BC0A 2XUFA 5AK6A 3UUEA 3I6MA 4Q82A 1XZHA 3D2BA 4FMPA 2FUKA 4J0HA 5LZ8A 1JKMA 1YA8A 5EI5A 1LLFA 2WLSA 3G9UA 3H2IA 4QLAA 1XZIA 5BV7A 2PU5A 3H17A 2BAGA 2BCEA 1EX9A 4BAUA 2JEZA 2I3DA 1IUOA 5ALHA 1UXOA 5D7BA 2OLEA 4BP8A 2PM8A 2I3ZA 3UUFA 3I2IA 1DQYA 2RHTA 4UBIA 4AX4A 2GBFA 1UK7A 5IVIA 5FPPA 2YYSA 3ESBA 4JYMA 2WIDA 5FRDA 3DEAA 3HXKA 2X8BA 1LNSA 2ZJFA 3RKSA 1A7UA 5EHXA 2DCMA 4Q05A 1G4HA 2NW6A 1TRHA 4EY6A 1GQRA 3IVMA 2ZYRA 3WWOA 2OAEA 4KAAA 3H18A 5HCUA 2QRUA 1EVEA 1QIHA 5AI4A 2OXEA 5D3KA 2OAGA 5HF8A 2BGRA 4KAJA 2G63A 1DWQA 1WM1A 1DWOA 4Z49A 2PL5A 3C5VA 1QIJA 1CUJA 4XVCA 3M82A 1U2EA 2J4CA 3WIBA 1HLGA 1F0NA 3N0TA 5HF5A 4PF1A 5CT8A 2WIJA 1UK9A 4GXNA 5D3ZA 5CT6A 2XMGA 2XUHA 4U2CA 5JALA 3GROA 4Q3OA 4L72A 5ALZA 3OM8A 1MJ5A 3OTQA 3PE6A 4Y2VA 6YASA 2PSFA 1DQZA 2CBGA 5DJ5A 3B5EA 3ILSA 2C0PA 3IUQA 3TGLA 3FYUB 3STWA 5I9IA 4H7FA 4B7ZA 3VVLA 3ESAA 3VXKA 2WIKA 3ICWA 4FTWA 4OD0A 1QFSA 4K6GA 2EEPA 5LKAA 5JAHA 2VJBA 1E8NA 5ALJA 1EI9A 2WILA 5ESRA 2ZYHA 2J3DA 5K3FB 3WWDA 5AIBA 4FBMA 1H23A 1VZ3A 3ZI7A 4KACA 2Y1KA 4C4ZA 1NU8A 4UHFA 4P92A 3GFFA 3I2HA 4F5ZA 5C7YA 1MT3A 1HDEA 1CFJA 3I6ZA 5AOAA 1YS2X 5K3FA 3H2GA 1BE0A 1XRNA 4GBGA 4UHHA 3WWPA 3DYVA 5AHXA 2FX5A 3BL8A 5ALOA 3IUNA 1EINA 4Q3LA 3WQHA 5AI0A 3DOHA 1ZD4A 3AUKA 4DMFA 1CUEA 4V2IA 1W6RA 2XMDA 1VXOA 3BWXA 4Y2YA 4GLBA 4G8DA 1VE6A 3STTA 4GHWA 4KE9A 1GGVA 4H77A 1WB5A 4N8DA 3AZOA 1XQYA 3C8HA 5AKJA 5LLSA 4NS4A 5J3JA 4PNZA 2C7BA 3FCXA 2PSJA 2Y2VA 5K3EA 1XRRA 4G4GA 1ZOIA 1KU6A 2ZYSA 1CUZA 2GYUA 4LYEA 2WUFA 4KAFA 5AK5A 2HM7A 5FOQA 4PSCA 3A70A 4QDUA 4BTLA 1FFAA 2WFZA 4H0CA 1SCKA 3R41A 2WJ4A 1QIFA 5AM3A 4U2FA 2WTNA 3FSGA 2XQIA 4ETWA 2WJ3A 1PV1A 3R3WA 2RI6A 3GA7A 5AM1A 2IX9A 1Z68A 1GPLA 1CRLA 4WCVA 3FOBA 5AKYA 5I7UA 4B6GA 4IH1A 1N5MA 3X3HA 4AMZA 4DMKA 3ICVA 3R3VA 3CN7A 5FV4A 3G0IA 2H7CA 4FNGA 4UBJA 1RYYA 2WHQA 5H3HA 3F9CA 3K9BA 3FLAA 4BZZA 4B83A 4UBNA 3PFCA 2C0QA 2BFNA 5AI5A 2WHPA 4XX1A 5EIHA 5T4EA 2WKWA 1QO7A 4W63A 3WKBA 3QM1A 2BJHA 4AO7A 4CCYB 4K6HA 4AO6A 2JGLA 5JIBA 1WCYA 4H7JA 1N8SA 2HA5A 1XZAA 2RIPA 1DX4A 1JT2A 2WU3A 4EY4A 5JYCA 3WLAA 3O95A 1E3QA 3TJMA 3JW8A 4CG1A 4H18A 4FNMA 4E11A 3KXPA 2DQZA 3FVRA 3G8YA 5ALFA 4MEBA 1XRQA 4BE9A 3I1YA 4L3WA 5FP0A 4B82A 3BF8A 1EK1A 5AKEA 2WFMA 3WIOA 1XRMA 4BCCA 2GBIA 4GECA 1CUBA 1SC9A 3BDVA 5EHNA 1UOPA 5CH5A 3OC0A 1GXSA 3Q8WA 4P9NA 3V1LA 1B41A 4X71A 4FHZA 1MX1A 5AK3A 2JGJA 4IO0A 5K3BA 5HK8A 1ORWA 2OG1A 4UHBA 3E0XA 3EQ8A 1P0MA 1CUXA 4LHEA 2CJPA 3WKAA 4AB1A 4G9EA 1UT6A 2WHRA 1LPMA 5HF9A 3G9XA 4DNFA 4B85A 4X6XA 3BXPA 1USWA 2XUPA 5A7GA 4ZREA 4H7HA 3KDAA 4QE3A 4W1RA 4C87A 1G66A 3DJYA 4J0CA 2CB9A 5JZBA 3LCRA 4PSUA 1ACJA 4K2AA 5ALKA 1U65A 2HA2A 5ALQA 1XZKA 1BCRA 3IULA 1VOTA 2Y2UA 3NWOA 5C8VA 1DU4A 2XUGA 5AM0A 3R3XA 1FJ2A 4UFOA 3R3UA 2HA4A 1W4LA 2GZSA 1A88A 4E46A 3QH4A 5K3AA 1R3DA 3HEAA 1CVLA 3QZUA 2VATA 3I2FA 3PUIA 1DX6A 1H2ZA 1OILA 4OU4A 4DNQA 4L9AA 4X6UA 4I4CA 1CR6A 4PSDA 4NZZA 1UOOA 1QIKA 1TK3A 4QWWA 5EFZA 4I19A 4EHBA 3LIPA 5E4YA 4DSAA 1H2WA 4PQEA 2JF0A 4WFIA 4Y2RA 4MJ3A 3QITA 2P8SA 1VZ2A 4OYLA 4QDXA 3LIIA 2CUTA 3HC7A 4WDQA 2VJCA 3KSRA 3ZPXA 4ZWNA 4YPVA 4HS9A 2OQVA 3S8YA 1XFDA 4WJLA 2EDCA 3C5WP 2Z5GA 2ORYA 1XZDA 4U2DA 2GYWA 4MWTA 1H22A 3F8SA 2WSLA 1XROA 4HXFB 3FWHA 4KJXA 1LBSA 3W04A 1A8QA 4CG3A 1WB4A 2C5FA 2HA3A 4JNCA 2HFJA 5CT4A 2B4KA 3R0VA 2WJ6A 4FLMA 3H2JA 3DNMA 1R50A 5AKGA 3UMJA 2XUDA 2OCGA 2XQFA 1ORVA 2XUOA 5CH8A 5EGNA 1K6EA 2HRRA 3FBWA 4Y2SA 3HZOA 2C58A 4G4JA 3DKKA 1ISPA 5HKAA 3C6BA 2JGMA 1CUHA 3RK4A 4O08A 4P08A 1EK2A 1YASA 4PW0A 3NGMA 4FLFA 2BUCA 4NMWA 1WHSA 2Y6VA 1JI3A 1XZFA 1MO2A 2XUJA 2OGZA 4D9JA 2WG1A 5EIAA 1ODCA 3D7RA 3STUA 4UBLA 5JANA 1CUGA 4UPDA 3AIOA 4B84A 5JASA 1HL7A 2PUHA 3O0DA 3U1TA 1LZLA 2DSNA 5AI6A 3I1IA 4FKBA 1BS9A 1AGYA 5AK4A 2HADA 3CXUA 4Q1VA 3KOOA 1E66A 4WY8A 4H35A 5JATA 5CXXA 2WHPB 3W9UA 3AIKA 3BJRA 4Y2UA 1J06A 5AI9A 1UK6A 3BDIA 1DWPA 3H04A 5AOCA 2HA0A 3A6ZA 1SCQA 3SWWA 2PVSA 4UFNA 2GBGA 4A23A 3VJKA 1XZCA 3H1AA 1VE7A 5BWCA 2H7XA 4AXBA 1GKKA 3IIIA 3WL7A 4YASA 3DLTA 2X5XA 3IURA 3OPMA 1MN6A 1C4XA 3B12A 5AOBA 5JAOA 3H2HA 3QPAA 1N5RA 1I6WA 3W05A 1BRTA 1UKAA 4F0JA 1RP1A 5FDFA 1SOMA 1LPAB 2JGFA 1XQWA 1HQDA 2Z8ZA 1XQVA 5KBYA 2XMCA 1WHTA 3WWCA 3WKEA 5EHQA 2ZJ7A 4XWGA 4BC1A 2VA9A 1JJIA 3CN9A 4FWBA 2LIPA 2PBLA 3DL7A 2XMSA 4BAGA 4DLNA 1TCAA 3QPDA 3WI7A 1QIDA 4ZXFA 2XI4A 3QMVA 1OXMA 5LIPA 1CV2A 5C8XA 2I78A 3O4HA 1R4ZA 5CBKA 5K3CA 1BCSA 1G42A 1BROA 1BEZA 3C6XA 3L1IA 4BAZA 4KR0A 4IH4A 3U0VA 5HFNA 5HKBA 2JGEA 4BYMA 4KE6A 3QMMA 1J07A 1XZEA 1EDDA 3W9BA 5KWIA 3EQ7A 5EIEA 5JD5A 3H1BA 5ALNA 2JEYA 1H2XA 2H1IA 1WB6A 3AZQA 4N8EA 4X91A 3JWEA 1EXWA 1F8UA 2XQGA 2CMFA 1QLWA 2VTVA 4CCYA 1GQSA 1U8EA 4YX9A 1XZGA 1YS1X 3DDUA 2WQZA 1IUPA 3OG9A 4QLOA 4LKOA 4W1SA 3V9AA 1VXRA 4EUSA 2AJLI 4HZGA 2WG0A 4FFVA 3CCCA 2HDWA 2Q0XA 2V98A 5HF6A 1XLVA 3I6YA 3DOIA 1Q0ZA 4C01A 2XQKA 1EVQA 1GPNA 1BEEA 2YH2A 4UBOA 4DIUA 3ZWQA 2XUQA 1UOQA 4AN0A 1CUSA
chains in the Genus database with same CATH superfamily
4AMBA 4M99A 4LMPA 3RGGA 4F04A 3T1YB 1JB9A 3CRVA 3ZQKA 2IXBA 3MWEA 4ID3A 1N6LA 4QUDA 4KMMA 1USVA 4X7MA 3YASA 4PX5A 1Y8QA 4RH1A 3LFHA 5FAXA 2CYCA 2PUEA 4MV4A 3PQ8A 2EKBA 1LFDB 3GV0A 4G89A 4XRRA 1C7ZA 2I4RA 2HJSA 3IV7A 2JGKA 1J20A 1E4EB 3HDHA 1RXWA 3AL0C 3E1GA 4X24A 3FYUA 1RFLA 1T8UA 4F45A 3I9MA 4GIBA 4FSDA 4TKLA 3H2SA 1XXHE 4UASA 3VO8A 2E49A 2I2XB 3CF4A 1DT5A 4RF5A 4U8HA 3WZLA 3ZHCA 1IHPA 1TVEA 5AIAA 4TMWA 4BYGA 4DMMA 4ENUA 2J9FA 3EXEB 1EP9A 4QXQA 4TV8A 5ED0A 1V95A 3C15C 4GI7A 4EW1A 4ZMBA 3VKVA 1R4NA 1E5QA 1KSJA 1N57A 1XTUA 3A2LA 4MV1A 2PZLA 4A0SA 1HZZA 2A6PA 1QIMA 2II6A 3TAHA 4DLVA 1RHQA 1Q20A 4OXYA 2PQ0A 3FPLA 1KP3A 5JXIA 1NW9B 2YXPX 2VLBA 4MV0A 1TKAA 4DWOA 3KKEA 3AKEA 5DXAA 4QDJA 4CWAA 3GJ6A 3V1MA 5A71A 2Q4EA 1JP7A 3Q6NA 1XX6A 3TW8A 3OOEA 3R0JA 1D03A 2DBQA 2PPLA 4Z0HO 4GX2A 4BVFA 4C78A 1GTRA 4LRUA 4WUVA 1I0IA 4YXWA 3ILXA 4YFVA 4JQCA 2H31A 1ZK4A 1CXZA 2QGFA 3ENQA 4HSGA 3RM3A 3RVNA 4ZDIA 2RK4A 1CDEA 3QVXA 1JU4A 4I9NA 2DWOA 3EGEA 4IGAA 1EM8A 1B0PA 3E5NA 3K1JA 3K4PA 4AF6A 5ALXA 1MKYA 3TW4A 5A3JA 5T4HA 1J5XA 4Q4CA 1PZMA 1IWOA 2W2NA 5I8WA 2EKPA 3M1IA 4M9ZA 1CZLA 2YC2C 5JS6A 3ETNA 1NRWA 3IQXA 4KEAA 1UDRA 3IJPA 3KLBA 3RWBA 2LDBA 2NTJA 3F0TA 4JCCA 4V2UA 4M0UA 4DQ0A 1R66A 3VDMA 1GCGA 2CVFA 1KJQA 4D3XA 3D0RA 4Q9JA 3HXTA 3IP5A 3VPBA 1IJBA 5HKOA 2WUWE 5DI3B 3PDCA 3MGAA 4JXJA 4D96A 1J56A 1PEAA 1SVWA 1GGNA 1TEHA 2JBWA 3CEPB 3CONA 3LXXA 4FT4A 2VK2A 3VZPA 1PE0A 4KR2A 1HE2A 1THGA 1N9GB 2QF7A 3TW0A 1H2FA 3BSFA 2AF4C 2QD1A 2G0NA 3B1WA 1T3ZA 4P7GA 2XTAA 3WNDA 1Z5WA 4MI9A 2BLLA 5JQWA 1ZD1A 2P0EA 2R7NA 4ZO4A 2I22A 2GN1A 2VPYA 4IIJA 2ZIVB 2XVAA 3VDXA 4ZALA 1IK6A 2J5XA 3VR3A 5AW9A 2O3JA 4B9EA 821PA 1WW8A 5DTRA 4D0SA 3UQYS 1XN1A 3A9UA 4XDZA 2P4SA 3HJGA 4HEHA 3R3HA 5BWBA 3EJ6A 1QVWA 4PCLA 5A3SA 2BEVB 4ES6A 4MP6A 2QMYA 3LD9A 4GLFA 5DTQA 4ZIRA 1O6ZA 4J7AA 4ZOLB 1G3RA 2AUMA 3EAFA 3OFVA 1IM2A 1WPQA 2JVIA 3UV6A 4AG5A 1AXEA 1PU2A 4FMDB 1RABA 2DFTA 3T5GA 3Q8XB 4RFLA 1YQUA 1AS2A 3AUSA 3FNBA 3KZVA 1QCCA 3LK7A 4CKXA 1JFTA 4B3RB 1ARZA 4RS4A 5JROA 1X80A 2JGNA 1Z0JA 4I4TA 4KXVA 3SY8A 3VISA 4A15A 4EUNA 2IYVA 3NHKA 1CY1A 2IYAA 5I9TA 3CKKA 3F6BX 2X8JB 3HO6A 3QFRA 4OH7A 1M2NA 1QFZA 1F2UA 2BGNA 2JL1A 2ZREA 4RF2A 3UAWA 1R88A 3WTCA 3ZWWA 2VJYA 2PZGA 1YJ8A 1D1PA 1GGHA 2IHJA 1GKLA 1K6MA 2QJFA 3IB6A 2SICE 1TVMA 2G1AA 1SUWA 2FHSA 2IU4A 4WZAE 2ZIFA 2J3KA 3U3KA 2JRCA 2ZM6B 4A0GA 5EKDA 3W9YA 1OXTA 2IE0A 1N3YA 1T10A 1C9JA 4MMXB 1HK7A 3U4AA 5JU6A 1PUXA 1YGYA 4IJVA 3QVLA 1CS0A 4QQFA 3PA8A 2MJLA 1V6SA 3PHCA 1UZAA 3SSAA 2AHRA 3GUHA 5B57C 2Y1CA 2R87A 1QLJA 2VOJA 3Q98A 3D1LA 2VNKA 3I9JA 2XB4A 3MINB 3T5CA 1B6GA 1PIWA 4CKBA 5JUWA 1IJKA 2HTFA 2JD2A 1P80A 4H4CA 4EK9A 3C8DA 4KYTA 3QXCA 1PS0A 1PGJA 1QKJA 2HF9A 1Z4JA 2PX2A 4QOEA 5FTKA 4F60A 1ZUNB 2GCNA 3G23A 2C8JA 3L7BA 4OM7A 4GP7A 4BVJA 3NTUA 4O4JF 5KQLA 4GL2A 3M1AA 4GM0A 4HWTA 1K3TA 3OIYA 5L3RA 3AG5A 4O0LA 3EIHA 1Z2CA 3NC1C 4G56A 1FLNA 5KAPA 2VHJA 3WFJA 2O7VA 4TN1A 1T4DA 2ZVDA 1SBIA 2HZBA 3DW1X 3DR3A 4PGGA 4M1SA 1CEYA 4EUHA 2QU8A 3VZQA 5TR9A 1KZ9A 1VCIA 2NG1A 3QW4B 4HNQA 3ROFA 5DN9A 5BP7A 4KLAA 4UXJA 3UT6A 1FVXA 2WSBA 2HTEA 1JYFA 1E69A 3K0AB 1WNFA 1W1IA 4E33A 5G4KA 2AG0A 3AVTA 1C7EA 3EEQA 4O02B 1YO6A 4EECA 5IVDA 3NNDA 3L46A 4OP2A 5B2EA 5KNBD 2YS7A 3WWEA 3RAFC 1T1EA 3FBTA 3T38A 4GE0A 2ZBEA 1IY9A 3OLQA 3ZVNA 3BFVA 1FP4B 1FXWA 2EQBA 2I87A 3GXBA 4YB8A 3K1AB 3HU3A 1Z33A 4P82A 3ZY5A 3N59A 2XZLA 5AVVA 4L22A 1KVQA 3TRDA 1N9ZA 2Q5HA 2GCGA 1FTQA 3C45A 3ET4A 1PQ4A 3QPCA 4Q3KA 3DUWA 4RDHA 3TS1A 4CHGA 5CDHA 5IZCC 5LVAA 5IHPA 4X94A 2HGZA 1KF0A 3MMZA 4WD3A 2PZMA 2PMEA 1I3LA 2JFGA 4YBRA 3RTCA 3ZD7A 4RTPA 1NVVQ 2AMYA 3E9MA 1J49A 3H8JA 5KTTA 2D5CA 3LL4A 1O6FA 4HTAA 4WCFC 1IWPB 2ZJYA 1G19A 4XASA 4BKQA 4CTJA 4KNVA 1FX0A 1NBWB 2J3JA 4B3FX 3GLQA 4PEVA 4TVBA 2EC5A 4X85A 4K46A 4Z4HA 1H1LA 1Q1GA 1Y5LA 4KI7A 2WIGA 2G80A 1PJ4A 1LJUA 3WNZA 5EKUA 4PO8A 3LMKA 3IP3A 3U48A 1TYAE 4LV8B 1LTQA 1HNNA 2PG3A 1FDRA 1X7HA 4ECEA 4IJMA 5FQNA 2OHHA 2ZT8A 1U8YA 1RQRA 3OECA 5FTNA 4ZCIA 1C7IA 2J9XB 3LT5A 2P2DA 1ZSYA 1PWYE 1QFYA 2I7XA 5CW2A 2RKBA 1DIOB 5FOTA 3A1TA 4ZI7A 4CEHA 1EIWA 1YZUA 2D0PB 2PUJA 4LHXA 3GJ4A 1YBVA 3DMTC 2ZIXB 5L3ZA 3G5LA 1D07A 3PIRA 3ABOB 3KOYA 3EEIA 3QYAA 4BIMA 3R8XA 2HPZA 3ND5A 4K0KB 1QIEA 2WJHA 4MZDA 2Q7OE 2FEOA 2ZJ4A 1LF5A 4MJ7A 5KQPA 3O73A 1CJMA 4M8SA 1E61A 4XWTA 3TSOA 2F3RA 2VRWA 1Z0DA 1ZLXA 2X3UA 2YQ4A 4PANA 5SYMA 3X44A 3BSYA 3IJEB 1EQAA 4BEBA 3BVPA 1XRPA 3IJRA 5FUYA 1B15A 1G3MA 3NZEA 4I0WB 1L7QA 3X2EA 5IT5A 3H8WA 4V38A 2J3QA 4TMTA 4P38A 1JIUA 5E6RA 5ALYA 2UZ4A 1T5HX 2OZKA 2QAGC 3IUMA 3PJFA 1BE6A 4P8RA 1IXSB 3S3TA 2G09A 1N1MA 2XTMA 1OFHA 2W98A 1R37A 3QMWA 2O19A 1W4BA 5AKKA 5BNWA 2Y27A 3GJZA 1I4DD 5J4KA 2VO1A 1RZVA 1S02A 4MVJP 3V1NA 3A6EA 1A71A 2Z4SA 1T36A 4HDRA 5KTOA 1I7QB 3OWOA 4TM8A 2Q0HA 2X3FA 1RJ9A 1I6MA 2P2ZA 2ZJ3A 1BCRB 3CCBA 4Z3DA 5ESXA 4DG8A 1FPQA 3N1UA 1P0PA 2DRIA 1I4LD 4WT7A 1ZRMA 3TVTA 4C5CA 5DCLA 2QPAA 3QEBZ 3OQJA 4WA8A 3VC7A 2QIPA 1XKTA 1YK0A 4DAOA 2FSVA 1RLIA 1P4RA 2OB1A 1SKMA 3SI7A 5IJ0B 1KOGA 2XXAA 1ZEMA 4G5SA 2GK4A 2AOWA 2I66A 4TT3D 1S8OA 4AG6A 5EUQB 3B6MA 3EXHB 4I2VA 1GKIA 2QL9A 5DM60 3T94A 1VYTA 5IXJA 1JR4A 1P6XA 4IXNA 3TFQA 4DRZA 3W2HA 3WLEA 4C3ZA 3DFUA 5HGXA 5JAIA 4GZLA 1Y37A 1DG3A 2F64A 3U1BA 4O8CA 2P4UA 4B3MB 4IQFA 3B38A 3WLJA 1Y9DA 3GLIB 2UZIR 4L08A 4KGDA 1BDHA 3GBPA 3T52A 1JWAB 1KY3A 1T6BY 1Y33E 3F3MA 3GRCA 1XEXA 2VPIA 3QWBA 2KBFA 4AYWA 4XUEA 2QTWB 5IMBA 1GPDG 2UXCB 3VR4D 4NYJQ 2CE7A 3UJBA 4QNNA 1AGPA 3RLIA 4E7OA 1U0JA 4TVSA 1T5SA 4LWQA 1CDZA 5EIWA 3VJRA 1EG7A 4W8OA 4KWCA 1KVTA 2X76A 2FR1A 1GN8A 1XTVA 3LY9A 5FL3A 3EAGA 2RH4A 1P75A 1M1NA 2GEVA 3ANYB 2Q07A 4ARVA 4D9EA 2KJQA 4HAIA 2OCIA 3WR5A 4RPKA 2OCLA 4G5GA 4KJZA 5F3RA 5TLSA 2QYHA 4LJRA 1W36C 4B2LA 1GPMA 1HM5A 4PZDA 2AJBA 2AR9A 2J5KA 1YA6A 1SPBS 4BFXA 2EW8A 3KJGA 3ML1A 1IBRA 1U02A 4HFJA 3AZPA 4MVJH 4WZBB 1OLUA 3LXRA 5BY2A 1CUWA 1SIBE 3A2NA 3GGOA 1AX9A 2QX4A 2YJ6A 2PUVA 4TSKA 1JHMA 1W44A 4BNHA 3GPLA 4HX9A 4KVAA 1LU9A 1T5LA 1UDBA 3ZGXA 2X19A 3GGSA 3SJUA 1A2KC 3BX1A 2BKXA 4MWCA 1MZPA 1BWSA 1G60A 3L05A 5HUJA 2N47A 2E6KA 1NBME 4LZZA 1U0OC 1EE2A 3IVGA 4OGLA 2AN9A 3QKRB 1KGSA 1V39A 3RU3A 1JBQA 1JAIA 1L3IA 2QHXA 3PF9A 4EA7A 3KQSA 3Q5GA 4Y2QA 2C99A 1E94E 1GZSA 4RE6A 3JZFA 3NH6A 3T0GA 4D9IA 2BFDA 4EVQA 1XVIA 4KXMA 2H4JA 3QLTA 1VIAA 3A4LA 4MYCA 5FL7D 4KWHA 4S0XA 2ADOA 1LGYA 4LPSA 1PAUA 2X23A 1IOVA 1HURA 1K4MA 4P80A 5CDFA 2PE5A 1ZGBA 2NXWA 2ZWPA 4BRZA 1CRWG 1YJQA 4R3WA 1UT8A 4G41A 2HBRA 2C2OA 2ZJ2A 2ZRQA 4C0HA 1WQ1R 1HYQA 4JLAA 2ZSHA 4WIAA 4EEKA 1E2PA 4K9LA 4J0IA 1PJLA 3D6NB 5EPUA 1ZN8A 1I7LA 1GNSA 3OTHA 3AP1A 1II9A 4UREA 2P0YA 1PFKA 1SNYA 4TX1A 3PFNA 4CEJA 4YVFA 5ALRA 4ZRNA 3H84A 2BW0A 2XNKA 5GJCA 4JP1A 4LYDA 5AMXA 1A95A 2BUBA 4IV5A 1F7UA 1CY8A 5JNLA 1E3TA 1U4OA 1DMSA 1GA1A 1ECPA 3LM8A 1Z5ZA 4TXLA 2OVBA 4DTIA 3OFKA 3EPHA 4TYPA 1IG0A 2OCDA 4HDMA 4BFCA 5KB3A 2GAAA 2WM2A 2XDWA 3HPQA 4HYQA 4QFCA 2C31A 4BLQA 3MFQA 2PBZA 1JVSA 1LF0A 3AR9A 4FP9A 1G0NA 1ZD3A 4GWLA 3N75A 2CHEA 3IERA 4QEKA 4RJ2A 3RTDA 3ZE6A 2Z58A 3BZUA 3ZVRA 2X6QA 1WCXA 4QHSA 4F4UA 5SZHB 2DVMA 3FUXA 4RV9A 5AW2A 1HTWA 2RHJA 3C4VA 3IEIA 4A8PA 4CGYA 4X90A 3SM3A 4UEQA 4YAIA 1NOJA 1XF9A 1H6DA 1YR2A 3GA0A 3O4JA 4P4SB 1OV4A 1Z6GA 2HJGA 1BDBA 1EGMB 2HT6A 2PH3A 1RWPA 2Q1XA 2WOJA 2I6XA 4OUKX 5BN5B 1CJSA 2WU8A 3EW9A 5KCMA 3TQFA 4WH0A 4DDMA 2HDOA 5KDDA 3ZDBA 3G0CA 3DAPA 2G7MC 2R1VB 4FZJA 4CKZA 3O6VA 3GLTA 4NQZA 1QZTA 1KK3A 2WQ7A 2V7UA 1EHYA 2ZUVA 4JJAA 2JIMA 3LRXA 1R16A 3UWPA 1HNWB 3VR4H 2Z3ZA 2WAYA 3D4PA 5L3SB 5J23A 1WQ3A 4Y1RA 2HJVA 4R69A 1CIPA 4AMYA 1Y81A 2GCIA 1GPJA 2UUOA 2ZQYA 4J75A 1AH2A 4YLGA 2I62A 1VPDA 1QYCA 1UXHA 2BDTA 2DJIA 2HQBA 3NXSA 4QPDA 5FCDA 5FPKA 3G79A 1AS3A 1E2JA 1DJPA 4ZGWA 4MB0A 3D2AA 2XNCA 3NWPA 1GDTA 3EA5A 4MCJA 4I66A 2IUUA 1CEQA 2ZBPA 4HX2A 4CN9A 3M33A 3VKUA 3QX3A 2H9AA 1LPNA 5B12A 2AA3A 1CVIA 4JVOA 3CR3C 2K2QB 1QFMA 3BXZA 2IXTA 4NK5A 2JLZA 4W6QA 1RYDA 2W4MA 3B3AA 1PWEA 3H16A 3CRW1 4XZ3A 1FFEA 1R6DA 4DSNA 1E0JA 1YR1A 1V26A 4D4KA 2VDUE 1OC4A 3PHIA 1AKEA 3ULKA 3K70C 2QN3A 3CJRA 4IRUB 2ECOA 3HKCB 2HWUA 2IYQA 2QEQA 1DBPA 2W43A 3EK2A 3O3CA 4DLUA 2VQDA 4XM1A 4NQRA 4KXNA 3WJ2A 3PNKA 2AF3C 3WFZA 3NBKA 4QPZA 2DX7A 1SVIA 4G97A 2YWFA 1OFUA 3GY0A 5DHQA 3RVJA 1IAVA 3T15A 2F1RA 5ALPA 3SK0A 2ZRHA 4D3SA 3M1YA 1WXIA 2REBA 3ONWA 3BE4A 3HUDA 3IUPA 3V2HA 1T0JB 2F59A 1Q6ZA 4ZKEA 3OIDA 4CIDA 3L4BA 4IFBA 3MAJA 3R5KA 3V7YA 2HHHB 2XBUA 3ZCVA 5MN6A 2CZQA 1SVKA 3V48A 1DAKA 3G2HA 4LZNA 3QPWA 2W42A 4MCHA 3UWOA 3OZCA 4P2BA 4F21A 2J4FA 2F1HA 3A10A 3S28A 1AURA 1IXRC 3DG9A 2NX2A 4PPFA 3U60B 3HBMA 1HG1A 2ZZKA 3EGIA 4GGMX 1TTHA 1A5ZA 3PI6A 3WKDA 3GEEA 4A03A 1VE3A 4ACBA 2AC4A 4BNUA 3G1WA 1F0PA 3NBYC 1AD2A 2O2GA 2HIHA 1DINA 3BXGA 3FSJX 2IVFA 2HSGA 3ETGA 4RQTA 1K98A 4OK6A 5KWSA 4D57A 3HLKA 5FTJA 2Q1WA 4LZOA 3IUJA 1LCIA 2BGLA 3D0QA 3ORYA 1I94B 4WPGA 1MW9X 2B9VA 2DH6A 3BERA 3AFNA 5BWOA 4L0QA 2D1SA 3V1UA 4M0LA 5BV1A 1ZUNA 1HFWA 1SG0A 4MEAA 4YAOA 1ZJ4A 2IUYA 4DLTA 5HK9A 4NCBA 4K9QA 2B8WA 2PUTA 3VR4A 3NOQA 1Q2XA 3HZRA 1F9AA 4IZ6A 1NBMD 2EU8A 1L0BA 2W0MA 3NDRA 4JLNA 3ANXA 5B7PA 3G6WA 1H5QA 5FA5A 1SQSA 4WOCA 1M9NA 3MCAA 3Q85A 4XW2A 2Q46A 3FF4A 4NOJA 4O4IF 5IJAA 2H2FA 1V35A 1YRLA 4M0PA 1G291 1V3TA 4MA4A 5AM2A 3RBXA 3PF8A 4G2TA 2DGDA 4RY2A 4FYHA 1OU4A 1ZCFA 1JQDA 2BZSA 4OPMA 3K0SA 2CFIA 3OETA 4CLEA 1EFVB 3OIVA 4N48A 4ALNA 2PUAA 2PJRA 5D5HA 3UCEA 3OKFA 4XVRA 4Y6RA 3RG2A 2F17A 4AG3A 1SC1A 2CYBA 4CZ2A 2OHVA 4E5KA 1Q91A 3AM3A 1EWVA 5AKZA 3GR6A 4HTFB 3AP3A 4O2AA 4P4LA 4EF5A 3QNUA 3CPEA 4MR7B 4PZ0A 1Z56C 4H3HB 4GBED 3WHIA 1ZHOA 2ETVA 3JPWA 1P74A 4MW1A 4B7CA 2O2HA 1F2UB 2Y67A 3GEMA 4RTOA 3KQNA 3LFUA 2FWJA 3ZD6A 4EY8A 3VC2A 1BOFA 2ZTMA 1XWIA 3C7CB 3QSGA 4FOTA 1XA3A 1V3UA 2DT8A 3DMPA 3HNPA 3OMLA 5K6AC 2FOXA 9LDBA 1I5EA 1T5IA 3AR8A 4JLSA 1PJAA 2A3RA 4LNAA 3DFIA 4PCUA 3GPDG 1QQTA 1D0IA 1U6KA 3JQDA 3EVEA 2FQQA 2C95A 1ORTA 3LHIA 3RIXA 2HL6A 3LI2A 3N2GB 3MWYW 5JEDA 5JARA 5C5CA 5L4SA 3O9ZA 3E15A 3ADDA 4CV3A 4X1OA 1ZD8A 4PZEA 3NHRA 1C0KA 3K9QO 3ZU6A 4R1MA 1YZGA 1P5HA 1PZHA 2LNDA 3JQ8A 3LDHA 3PDHA 4JBNA 5JAUA 2EQ5A 1SVNA 1FJHA 4EI2A 1XUOA 2CVPA 5GIPE 4MROA 3TLZA 1D2CA 2EZ9A 1X39A 4BO8A 2P68A 3JALA 1GNQA 1KZYC 1NKSA 4QA9A 1U0GA 1A0OA 2QAIA 2W2KB 5ILOA 1LQUA 2F9LA 3NTXA 1UXKA 2X0NA 1LV8A 2CLIB 1U3UA 1OBFO 2VTKA 3QYJA 4K88A 5HW0A 3ZHQA 3R8FA 1DAGA 1JKJB 2R00A 1THTA 3PC8A 1KS9A 3SZRA 3VRHA 4G85A 1YFJA 2MYNA 4RW0A 1JI0A 3BRWD 4BO1A 1OXBB 1YS4A 3B1FA 2JLAA 4M0FA 3V42A 4L9SA 2EGUA 3CRRA 3G88A 4UZEA 4QKQA 1SWWA 4FMCB 1JLRA 3OQVA 4JELA 3C7KA 1IQUA 4JLPA 1FQOA 4AN1A 5LIRA 1N7IA 3SG0A 4E4YA 4QPCA 1J23A 1AS0A 1ZYUA 2VTBA 1AKQA 3LLCA 1M2OA 2OSBA 3I1JA 3UJPA 3AYZB 3KXDA 4BMNA 2VYVA 1FUIA 2C1EA 2QD5A 1LK7A 3RYIA 1NATA 1OBCA 1VSQA 1T6NA 3JWJA 2KS6A 2QMZA 1FLDA 3A06A 4MI1A 1Q0TA 3K70B 2FB9A 2ZE5A 4CPDA 4RTRA 3WAJA 1FYDA 2OY0A 4CI9A 3CX4A 4YXWD 1M1NB 3FIJA 3MGBA 3ETEA 3PQ3A 4CQMB 2HD4A 3OLZA 5FWDA 1ZJ5A 4JBYA 4WSOA 3DOCA 4PNPA 3MIZA 4IMPA 4DPKA 5DHFA 3SSNA 4GZ5A 4ND5A 4MGKR 1QE0A 4ZU6X 3ZWMA 3N3AC 4LYGA 4RX1A 1EFDN 2X58A 3I5UA 3TMYA 5ILGA 2FWMX 2RGBA 4RQUA 2OA0A 3DYBA 4AS3A 2REXB 1KRXA 2NM0A 2X0RA 3WV4A 2W6CX 3VU9A 1KIAA 1RQPA 3WB9A 3FNHA 3NEPX 4JYPA 5JAPA 2TMYA 4WOPA 3L7DA 2R47A 4IMJB 2Q9AA 4TV8B 4KKXB 2J9FB 3EXEA 2Q3DA 2EQAA 3QQPA 4RWZA 1KJWA 4ZI5A 2FLVA 3RB8A 4DIMA 1LX6A 3MUNA 1Q3HA 1VG0B 5EVJA 2XWQA 1ZR2A 2O4CA 5AW6A 1JEJA 1Q7RA 3Q3VA 1TVKA 1JTEA 1IMJA 1DEXA 3UAGA 2A7QA 2JCVA 1U80A 2MYPA 3F67A 1UIRA 3COWA 4JGBA 5CYPA 3TSZA 5IH3A 5LP1A 2D5LA 2RAUA 5KQMA 2C57A 1X7GA 3MUOA 4WAUA 5KTNA 1CSEE 1OWOA 3NVDA 2QVZX 4V0QA 2Z98A 3ZV5A 4ZJYA 1GQOA 2PD4A 4NPAA 3TX2A 1YIOA 2NO7A 4BQQA 3MIIA 1YBHA 2YXBA 1JG2A 2HQSA 2W2KA 2XMRA 3QOFA 5TPWB 4MKFA 4KK3A 4NOKA 1QRTA 1GA6A 3NC4A 2DZDA 4JA2A 3OEED 3H9BA 3L8DA 5BV0A 1TNDA 1H3FA 1DC8A 1F8FA 1XLWA 3HI4A 3IT1A 1NXQA 2I4MA 2YWRA 3P9IA 4MCIA 4TVKA 3MD9A 2EJWA 3U3MA 3FY4A 1U2GC 3EZ2A 2O3TA 3ZCPA 1EVLA 1S96A 2Y6UA 5EA2A 3O2QB 1VG1A 1CKEA 1ZI8A 4BP3A 5CT9A 4N03A 2IYNA 4X20B 3QVVA 3WL8A 1FQWA 5BPFA 3DB1A 5EP4A 1SXJC 2Q3CA 3LOUA 3P9NA 2IYXA 1XZ8A 2VP5A 2CC2A 1MVOA 3VH1A 1GR0A 1XEWY 3RS4A 1V7PC 1REQB 3I6BA 4JP5A 4QGHA 2Y4OA 4WACA 5FOVA 3O4IA 1A9RA 4YAFA 5A2GA 4G5RA 4GE3A 4W5QA 1VYVA 1ISFA 1M0WA 4AF7A 4F2HA 2G5TA 4E2ZA 1XLTA 1LRKA 1KQOA 1PJ2A 4S3MA 1OAAA 4ZAZA 1WUHS 4ALMA 5JDIA 1TQ4A 4P98A 1FFCA 4OQNA 3RC8A 4CFYA 2XODA 3L92A 5BSEA 2V9ZA 1BAPA 2GLUA 3GCWA 2YXDA 1Y5IA 1CQWA 3PUXA 2L42A 1O03A 2HRCA 3PHHA 2H54A 4P4UA 3OTOB 4UEKA 5BQFA 4H7KA 3ZH2A 3HVIA 3U31A 4ZZ0A 2V7XA 3KSBC 2IT1A 4BQRA 3PD1A 1A5SB 4C4AA 2GJ4A 1C81A 2C4TA 3K0BA 4I55B 1QTNA 3O82A 1SHTX 1NVGA 4AC9A 4HGNA 4CU5A 4MVCA 3T9DA 1G8SA 1I24A 3FZEA 3UV7A 5TEVA 2PXHA 4C2TA 4JQYA 2Y1DA 1GG9A 1DHTA 2PH1A 1U1CA 4BLPA 4OHUA 1I2MA 1J2TA 2HWYA 2R11A 1W4ZA 2VT6A 4JH0A 3DDCA 3KVVA 3PQ6A 1MDFA 3DA8A 3HFJA 1ZC3A 4L6AA 4QBTA 5TC4A 3U09A 1D2HA 4Y6LA 2ISCA 5LNK6 4DNOA 1JQJC 4TL8A 2CDRA 5LP6A 2EDAA 5DNAA 1H3EA 2ZYIA 4H1UA 5F76A 2CB0A 2GPTA 3CFYA 3HWRA 3MVEA 2TSYB 3CY6A 4JN6B 4OQ4A 2A5YB 2QT1A 4OI1A 1RTKA 4KPYA 4V24A 2O3RA 1N4AA 3BH6A 5TMBA 1H9BA 2W2LA 1QHHB 3SD7A 2OD7A 2G70A 3LVFO 1GZUA 3HABA 3KIPA 3PENA 2G0TA 4KFSA 5CXSA 3T6KA 3PP8A 3OUZA 4AY2A 1PEDA 4RSRA 2W2TA 3EEFA 5ABPA 1FMFA 3HA2A 3GMDA 9LDTA 3WGKA 2AE2A 4PSKA 2O7NA 3ZU3A 4F8EA 4YAGA 5JTUA 2J67A 3B52X 3MBOA 1WOYA 2GZRA 3ZY2A 3HB9A 1FLAA 4X00A 2N46A 2NUTA 3K9GA 1YF3A 2XMQA 2B7LA 3FCSB 3OQPA 3A27A 4MKXA 4EJ6A 2CUZA 2CL0X 1SCJA 3R76A 2FMHA 2E1PA 5TVKA 4KUEA 3RC2A 2G4VA 2XWBF 4ZDKA 4OB7A 4CF5A 2NO9A 3PC2A 3AFOA 1GP2A 3HI6A 2NVBA 5K8LA 1BC5A 4R6XA 5BOSB 1IVSA 2GM3A 1Y4UA 4FI3C 2P5TB 2DHRA 5IYZF 2DHCA 2J9YB 3AO0B 4KN9S 5DU2A 1BRMA 1Z15A 4NCIA 4ZO9A 5LA6F 5IJZA 2X8AA 2IYZA 1ODSA 1PD0A 1X2BA 2CDNA 2ODTX 3A3NA 3AFIA 3DHWC 3HJRA 4FFBA 4I4NA 5EP2A 5GAJA 3K8OE 16PKA 1ZL0A 4G2NA 4CT5A 5K0CA 2V7WA 1Q16A 5JRZA 1FDWA 4IIJF 3DFZA 5ESWA 1NQUA 4CLOA 5KYXA 5DGHA 1R6TA 2Q6KA 1F8GA 4HB2A 3RIMA 2IHNA 4JGIA 1QGED 1S2DA 4NTZA 2QIOA 5HP4A 2F48A 1L7MA 2QVXX 3JVDA 3JU3A 5JZ9A 3ZLJA 3EOZA 4K03A 1V5EA 1H94A 1NL3A 1XEXB 2XLCA 4A6DA 3SXUA 3X2SA 2ZVPX 4G0NA 4J7UA 5CVTA 2FPOA 3MZ0A 3NMUF 4E14A 1FTWA 1VL1A 4BECA 3KKKA 2ZJ1A 4XCVA 3BE8A 2CFRA 4NZNA 2G1PA 1PV2A 3IMFA 4OX9Y 3WGYA 4HWSA 3FN4A 1DHRA 3DF9A 1QIGA 3E2PA 3RODA 3FTNA 1G8HA 2ACVA 1L1QA 3G2MA 1KPHA 3A31A 2CBXA 4R1PA 3ZE1B 4PC1A 4WBXC 3HBLA 2H2DA 3OJEA 2JFQA 1GYPA 2IK8A 2K7FA 4MJLA 4MPRA 4ZI2A 4WNAB 4BB5A 1T2AA 3IIMA 4N0MA 1RXYA 3NNNA 1LD3A 5IDQA 3UW1A 4RQBA 2ZJ0A 3TLGA 1GTZA 4G9GA 4TTTS 3VPFA 1X80B 4PX3A 3BIFA 4L6IA 1TO6A 2PMBA 5BQ3A 4OK3A 5K8UA 4ZQCB 5EN4A 3G5AA 3REOA 3VNVA 3G9TA 2W2MA 2D06A 5ICMA 3H5NA 3H4IA 4AZVA 3KLPX 2H0RA 1FUKA 2RIRA 4MR9A 5CLQA 2YOFA 5AKHA 5B58C 1DKQA 3VNAA 4DMHA 3MT0A 4I5EA 5IAAA 1VFNA 4I8XA 2BUAA 4IPTA 3ZCQA 1DRWA 2AJTA 2EJVA 2QRQA 2J6CA 2G71A 5IS2A 3EGXB 3AIMA 4LFAB 5E6RB 5ALVA 2RCYA 4WTOA 5JQGF 1MRSA 1PFYA 3KPVA 2FLWA 2V0CA 4ICIA 4Q7KA 4KWTA 5ALDA 3EEBA 3UUGA 4MWOA 1YB4A 1AKTA 1VTKA 1U9YA 1RRFA 2FDRA 4AZWA 2VSOA 1VLZA 2M98A 3MCUA 4M8IA 1W75A 1BJRE 2M32A 2VJQA 1AKUA 4H6WA 1DLJA 1N2CE 3RV3A 3T4PA 3WLQA 5ALTA 3SBXA 1J2YA 5BPHA 2JLVA 5LDDC 4RMIA 1PL8A 2J85A 2ZRKA 5G4LA 2WE7A 2YWXA 4JJFA 4UPEA 4GYWA 3N6VA 1X94A 2A5GA 1SKYB 2HN9A 2X9VA 3AMVA 4TWJA 3A9CA 4YO7A 1SHLA 3AERA 3CLKA 4CQLA 1UC9A 1YZTA 2QTMA 4HLCA 1RIFA 4Y18A 1EAYA 5EWJA 4HX5A 4FCTA 3ROTA 1FE8A 3FCYA 5F64A 3I5YA 3LBHA 2Y1OA 4MGYR 2QZ4A 5JCXA 1QRSA 4IDQA 2GTHA 5AJXA 1MRZA 1KMHA 1U7OA 4N47A 5EJ5A 3LC2O 1U9JA 4DGQA 4KRYA 2IITA 1PZXA 1RJWA 2QENA 3FF1A 3D3QA 1RZUA 4LJ5A 5GONF 1SR8A 1U4NA 3HDVA 3TM4A 4GOXA 5I7RA 4U8GA 5E2IA 4YMTA 4UMVA 4DWJA 2FSIA 2JLXA 3CX7A 4C7OB 1L5MA 4B6OA 1BGWA 2OOSA 3D6AA 3FGNA 3JVVA 5IKPA 1AKMA 1VSTA 3D7SA 3KKZA 3C6YA 1MG0A 3X1DA 2ZI5A 3T7JA 2Q50A 2A3NA 3SGLA 4YAWA 2HWKA 1YFKA 3FLBA 1VJ0A 3CLSC 4YJ3F 1D6MA 3QE9Y 5KJCA 2WNIA 1UZUA 3CUYA 3KDPA 5LBUA 1P1JA 1AMUA 3VHQA 3IQEA 3HCCA 1H1DA 1Z2NX 3HGQA 3M49A 2R8YA 3WKCA 1UKBA 2XNJA 3EDOA 4PYKA 1TQHA 5TQ2A 2VK8A 4D25A 1W0JD 4IXDA 2R86A 4HLDA 1E2MA 1QNLA 3PQCA 2CNBA 4M2LA 4M6WB 4Q21A 3C43A 3R40A 4RTNA 4FVTA 2GAFA 1HA3A 3RKRA 3WLNA 4GMDA 4KE7A 4ZCRA 3TJZA 1HL3A 4PAOA 4Y1GA 1M67A 1UM8A 4MCAA 3U56A 4NBVA 4Q9NA 4L0CA 2O1XA 2ZETA 4F06A 2JD0A 3Q8LA 1KU0A 4D43A 1T43A 2JVJA 3BRSA 5FJJA 2GTPA 1VG8A 2Z8YM 4POOA 2CHVA 4DJAA 5DNCA 2YHSA 2ERXA 1P60A 1GEEA 2BELA 1OREA 3PR1A 3RK1A 2J08A 4GL4A 2PZKA 5F4ZA 1IQPA 3GLIA 5L53A 1GITA 2FVYA 2ISSD 4NU6A 4KYIB 3LUKA 5BR1A 1NN1A 2EP8A 2VWGA 4RPCA 5DCWA 2YQ5A 5EOVA 1YVUA 3R4VA 5AVXA 2IVZA 2GVNA 3LX5A 2A1IA 4Q82A 1AN9A 1YE8A 2PR7A 2DUNA 3D2BA 4FMPA 4EA8A 1N0UA 5K0NA 3MRSA 2FUKA 2AK3A 3QF7A 4J0HA 5LZ8A 1JKMA 3NEJA 1TK9A 2HXGA 2R84A 3EZ9A 1CF9A 4ZVTA 5T57A 3FTQA 8ADHA 1MC5A 4JJEA 3KAPA 2UVPB 5DYNA 3H2IA 5BQ5A 3EVZA 4PBTA 1E9CA 5PGMA 2IF0A 5B37A 3RAJA 3AVXA 1XXHB 1ECJA 1HDYA 3OHMA 1GA4A 2G9ZA 3QVGB 2A1UA 4MIEA 4DLSA 4ZEWA 3ZX5A 5EZQA 5BV7A 5CVDA 1SEPA 2Z9DA 1EXNA 2C59A 4ZCMA 3EPJA 4Y8VA 2AXPA 3HCWA 3BK7A 2JEZA 2I3DA 1IUOA 2P6NA 5DGCA 2JPDA 2VDNB 4HJRA 4V0SA 4Q9HA 4AJ2A 1Y7TA 5E3IA 3CT4A 5C8YB 3ASZA 1R0XA 3PQFA 2IU3A 3K94A 4WCFB 3LPAA 5ADWA 5ES4B 4JUAA 3CEJA 5G02A 4P7KA 4YO8A 4PHCA 4ZEVA 1FC0A 3DAYA 1XTJA 1EM6A 3RJ5A 3W3AH 3ASYA 3IBCA 3W78A 1S2MA 3IHTA 5KTSA 1U04A 2ZR0A 4K8RB 4Q4JA 1ZUIA 2H1VA 2A8YA 2WHEA 3IKTA 2GBFA 4ZIRB 2B99A 1CK4A 1KI3A 1NBMA 4WJZA 1E9RA 3OVMA 1RHUA 2YNMD 1T9DA 2Y68A 3IKMB 5FI3A 3N2IA 4LPKA 3GCGA 5DHRA 4L85A 5FPPA 1WR8A 1WU7A 2XEXA 3GIDA 3QVKA 3P7MA 2VOEA 5FRDA 3AEXA 5J40A 2ZJBA 2CL5A 3HKEB 3BB4A 4NBRA 2CXSA 1K68A 5K6RA 2ZATA 5IC6A 2A2ZA 2FEWB 1Y9AA 2ALJA 2BM1A 4FR2A 4I81A 5EP3A 5D6NA 1WUYA 2WW8A 3UJ6A 2DBRA 3SHOA 2D59A 1HSZA 1T2DA 3R7LA 1E3DA 1EWKA 3OF3A 2DKFA 3A28A 1U5BA 3D1VA 3L6UA 4QBKA 4COOA 4Q12A 4F9EA 3WBKA 5H3LA 3PJGA 3UK0A 2G6TA 3CZRA 1N0HA 3QUAA 5A03A 5HX7A 3C3AA 3GUCA 5EVCA 3TM5A 3G89A 1RRGA 1OZ0A 4GC9A 4GPBA 4NZ9A 3CZCA 5GZ1A 2QSYA 4N9QA 3WWOA 2OAEA 2Z2YA 1N6IA 3ZU2A 1FX0B 1WZCA 3F8TA 3SVLA 4OHFA 2PKWA 6REQB 5KVQA 4X44A 2C7QA 4Q3DA 5JLAA 1IY0A 1OC2A 3MJCA 4JT4A 2PS1A 5C1OA 4CXMA 1EP3B 4GVPA 1I6KA 1SVSA 2OXEA 4GPEA 2NVUA 1A5AB 2PYDA 4KAJA 4B4UA 2G63A 2WA2A 1QB8A 2Q5QA 3JATA 3OPXA 4I1OA 3RC7A 4KNYA 3WYEA 4FQ7A 1RU3A 1QZUA 2YDYA 3HJCA 1EZ4A 3TRJA 4MHTA 3Q0EA 2A1TS 2WQ6A 1U2EA 3UANA 4YUZA 3WGNA 5LMZA 1GPAA 4C03A 3QI7A 3DTYA 3TLKA 2G17A 3WIBA 1A9PA 4IY1A 4J49A 4MOWA 1OIVA 1ISIA 5F4BA 1GNVA 4I2NA 2RAPA 1K7XB 1Z2AA 4PF1A 4YJGA 1OLXB 3DOOA 1LJ8A 2YFYA 4IHKA 1DDGA 3TUIC 3DLCA 1SA0A 5AVRA 3GZNA 2LR0A 4GXNA 3CC8A 3P4XA 4R31A 2OBFA 3ANLA 3BJIC 3N53A 1OASA 1PLLA 1UMDA 4N3AA 2XB9A 5CT6A 1FEZA 4D8UA 4U2CA 4CLRA 3PC7A 4BN0A 5ADHA 4ZJZA 3WMXA 2V4UA 5CJJA 3T3IA 2YXLA 3GROA 1CF2O 4PLYA 4ZOAA 1DAPA 3GJ0A 3JYNA 3NKFA 3P9PA 4L72A 4CM9D 5BOSA 2JJ1A 3F4BA 5FFFA 4PTLA 5BW4A 4Y6OA 1KK2A 2AFHB 2B98A 1GG8A 3BFPA 4JL5A 2PXCA 4XJSA 3UW3A 3WRWA 3A0RB 1SUDA 4M7RA 4G8JA 3RANA 5A04A 4CT4B 2D8MA 5H7XA 1VLHA 3VSEA 1OX6A 4MUKA 2A9QA 3IUQA 4JI0B 4Y9UA 1OB2A 2CN1A 3JASB 3VVLA 4B7ZA 2FW6A 1TEZA 2IKQA 2OHFA 2GN9A 2HIGA 3CNOA 3GDOA 2P0AA 2V58A 2QX6A 5CX1A 3VXKA 3B51X 1XPUA 4LXUA 2BBTA 1OW3B 1BFKA 1Q7TA 2XOXA 3FFAA 3H65A 3SR4A 4CKBB 3Q6IA 2NO4A 4K6GA 2BHSA 5LKAA 1QBGA 4EPVA 5J63A 1RPAA 2VJBA 1L7BA 2TMGA 3SOPA 5B53A 1SZCA 4CIXA 2AOUB 5EJIA 4DLKA 3RWMB 5IXYA 4UVEA 5DRYA 1KI2A 4MYRA 5HILA 1D0SA 1EI9A 2VH5R 5COQA 5AFSA 2C9BA 2WILA 5ESRA 5MF6A 4LY0A 1ZRHA 2ET6A 5AIBA 4OSOA 1PKEA 4KUHA 5K99A 2C7OA 1MQ8B 3LPNA 3EC7A 5A9SA 2RARA 1H23A 1VZ3A 4M88A 1YZYA 5A2QA 2QR2A 4HG2A 5EWMB 4HNGA 4W7SA 5CA0A 6CHYA 1O5OA 4AURA 4TYQA 3TO5A 4HUTA 1YONA 3DM5A 3EUWA 3U9LA 4HGZA 4UHFA 2GN2A 3IR6A 5EJ9A 4WXMA 4FHEA 5LJLA 1ECFA 2FPSA 2IP2A 4U5XA 3IMGA 1IONA 1Q74A 2F2TA 4ND7A 4YJ2B 2NO5A 3JWHA 4F5ZA 2Z9CA 4F1KA 1MT3A 1SBHA 4I55F 5H9VA 4TKVA 2R8OA 4YPFA 2XDYA 2YICA 1G6Q1 3IV6A 2BN4A 3T0FA 1BHSA 1WXXA 1S3SA 3TLYA 4XJXA 1PHPA 3BGSA 5JFOA 4AS1A 1X0XA 3E35A 3I6ZA 2DFKB 2PS3A 2JIZA 3VAAA 4R0MA 1MO6A 4QQ8A 4XQ0A 2ZB3A 3PWKA 4CU2A 1TMGE 5F1YA 1OAOA 1PS8A 1PR6A 1O08A 3W7AA 5E7MA 3NRCA 4YNBA 3D81A 1XRNA 2ZAGA 4LTNA 2YMMA 2WM9B 1GGFA 1TU3A 4UHHA 5E8JA 1Z6QA 2C4MA 2YFHA 2H2WA 3DYVA 1PFUA 4GUAA 4JD5A 5HDQA 7GPBA 1I9CA 3OJXA 1OAKA 1GU0A 3AYXB 4XYMA 3H83A 4FDUA 3BL8A 1EDOA 4RCYA 2GAOA 5FO1A 3ZZ1A 2YV1A 4C1BA 2ODPA 5AD1A 1VKZA 4RD2A 2PJZA 4OJMX 4MV3A 4MQUA 4XIFA 1WBDA 1VB5A 4OF4A 1TYEB 3GRKA 5DBEX 3DOHA 4LDPA 5E38A 3AJEA 4BWVA 1AB6A 1ZD4A 2JFOA 2YUTA 1P1KA 4GI3A 1BGXT 2ZIGA 4YMHA 4WADA 1JSCA 1NXOA 2UUCB 3HM2A 1XTKA 1YQQA 1CJCA 2G40A 3EPRA 1XDZA 3OEHD 4B8YA 4V2IA 2C97A 3GLHE 1W6RA 1E1RA 4KQCA 3F9IA 4S1NA 1PR3A 1E3IA 3KZMA 4R9SA 1RLTA 4AY4A 1Z12A 3ICEA 5T6MA 3K9NA 4GLBA 4FQ5A 4G8DA 2QSZA 1ZL2A 1NKVA 2JKZA 5LQDA 1MW8X 1FZQA 3ABZA 1FRZA 3AEQA 4GHWA 1I33A 2EFYA 3HJHA 5BNFA 1GGVA 2GJSA 2XKAA 2EFGA 2XXBA 4FFPA 2J6IA 4H77A 4ID9A 1ZVVA 2R751 3HY3A 1Q19A 3F78A 4FCVA 1FRQA 2XRMA 4I1SA 4N8DA 5BSTA 2W6PA 1YB2A 4DR3B 3X43A 2H59A 1L5WA 1FYWA 1X7YA 1Z5PA 3P26A 2NT4A 4I4LA 1JEQB 5AKJA 3HR7A 3BMXA 1BTOA 1M83A 2QUIA 4BVHA 2BTEA 2QQ0A 3FTEA 4GWGA 2VKQA 1OZAA 2JFBA 3FCXA 1SCNE 3DNPA 3OM0A 1BA3A 1FDOA 1R0KA 4LJYA 5IEBA 2XBMA 3KJIA 4G4GA 1G0OA 2C5LA 2D1QA 2QP3A 3J80A 2ZYSA 2AMJA 3HCDA 4LJAA 5DVZA 2BMAA 1JIQA 1ZEJA 1HE4A 2RBEA 3CV3A 5KC9A 1IZYA 2CWDA 2WYVA 2ZWOA 2HM7A 4D6PA 1H69A 1PNVA 3ISTA 3ORRA 1FFAA 1F06A 1SCKA 3GLVA 3OOHA 2B1QA 1JHPA 3FSGA 1K89A 1LW7A 1BA2A 2IPXA 5B4VA 1FDTA 1XRJA 4RESA 1WUIS 2ODQA 2OCAA 5CJ2A 3TCNA 3JAMA 1IJFA 1LLUA 4TXNA 1Q5PA 1Y1QA 4QVIA 4RCZA 2LCFA 3TZHA 1KMCA 1RT9A 4BZXA 4IAOA 4XUCA 4NFYA 1JFSA 4KQMA 3GA7A 1VJRA 2R5WA 3GGDA 1O2DA 4RHYA 2X9NA 1QYRA 5GV8A 2XF2A 3AXSA 3JAKA 5T64A 2GASA 5JAQA 3TRKA 2E37A 3KXLA 5HIAA 2IZ0A 5BSFA 4B6SA 1P72A 2HCJB 5DIFA 2BCJQ 1QAOA 1YMUA 3F6EX 3PXUA 1NF8A 4OLBA 3I32A 3OZEA 4W5RA 1M2OB 3C3WA 1VHDA 1NRJB 1ZO8A 4PIVA 5IAGA 2X5OA 4IH1A 4WXEA 1PR5A 1E2KA 1CWUA 2I7TA 4HK4A 4WBSA 2VPXA 3H4VA 3X3HA 3EUEA 3JQGB 5KEIA 2DUMA 1PNRA 3CN7A 5FV4A 2JNWA 3DDNA 2H7CA 4DCVA 1WEKA 4FNGA 2PGIA 3LUGA 3ZW8A 3MA0A 2W4QA 2C4NA 4O1MA 1W96A 3AEUB 1EFRA 1ISGA 2ZYWX 4J4BA 4YLYA 2XCTB 3IBFA 1DC3A 3Q9LA 4BZZA 5D7NA 4Z7QB 4NCXA 3ZWNA 4UBNA 4IINA 2C0QA 4RGQA 3OX4A 5HE8A 4DQVA 3K2BA 2JGDA 2OAP1 4XX1A 5EIHA 3SR3A 3OZXA 3AT1A 1MC1A 4Z8YA 2ZRAA 1Q0QA 3DEHA 2EZ4A 4W63A 2FSUA 1TM7E 1E1YA 3GVCA 1ISJA 4PQGA 3TRHA 2DERA 1YDHA 2A9FA 1VBMA 1IVNA 2G3YA 3N0RA 4JUCA 4XWYA 1TM5E 3FOAA 4AO6A 4EJMA 3BE6A 1KO8A 2ZTVA 3L9WA 1MHTA 1WCYA 2QTRA 2XE8A 2UUPA 3EISA 3AH8A 2PGOA 1FQJA 3EW7A 4LJKA 1MO5A 2CT8A 2GD1O 2O0MA 3AY6A 4WK4B 4EY4A 4ESVA 2HMTA 5FA6A 3SYNA 1RWWA 3PNVA 3S2IA 1PR0A 1WD7A 2K5UA 1E3QA 4ZQGA 5A5GA 4HGOA 2XVXA 4ZYTA 2X77A 1P3Y1 1KORA 1YZNA 2GAIA 4FYWA 2QBYA 2BEWA 2JZOA 5JCJD 3LCCA 3TCKA 4AJ4A 5GIOE 1LVHA 2O9JA 3TD2A 3AR4A 1U90A 1BVUA 2V59A 3G8YA 5ALFA 4GMHA 7REQA 2AFRA 3VOBA 1I1HA 5DGIA 3MJRA 5JE8A 3VU0A 3P9XA 3M6VA 4I1VA 4BE9A 3LBAA 5H82A 1NNUA 1VBNA 4C0JA 3URKA 1P0FA 5FP0A 4ED9A 5HVNA 2BGIA 3B9QA 1EWYA 1UDWA 5CBPA 1X8KA 2G1KA 3HUUA 3QUCA 3CUSA 1PGNA 2ODBA 3GLHA 1EK1A 2B3DA 1C8BA 2IBSA 1QRAA 3IDZA 1T4BA 5KYGA 1APBA 1MORA 4L75A 2EF1A 2EG9A 4XOIA 1Y6RA 4X60A 1TJNA 4UFOA 1Z07A 4TN5A 3DE6X 3JQPA 3NTVA 4H4DA 4GX1A 4EVRA 1CUBA 1OX4A 2LDXA 2ZUBA 4DG9A 3QE0A 5A06A 1UOPA 2FQYA 4QU0A 2H2AA 5JH7A 1A9XA 3FB4A 3PQEA 1L2TA 3PYMA 3Q1KA 3V1LA 4AECA 4QGSA 4E5MA 1NVWQ 1DC7A 4RIHA 3HKDA 1K06A 2JGJA 2JLCA 1XDUA 1ZKDA 1XMJA 5DMXA 2NAFA 5TQ2B 3V8QA 5LMUB 2VYCA 2QY6A 2OG1A 1LS1A 2F1IA 3Q2OA 4EJFA 1PZEA 3O93A 3E0XA 3UOAB 1FTSA 5EJMA 2WB4A 2PAAA 3ISVA 2WWRA 1QHGA 2HU2A 4IWXA 3REQB 4PQFA 4CQMD 2GPJA 3KAQA 3NAMA 3RYCA 2ZXEA 1IYZA 5HGJA 3RSHA 2NU6A 3NALA 5SV2A 1Z8FA 6AT1A 4EG0A 4B44A 2DJ5A 1B2LA 2B9EA 1ULAA 3T61A 3LBFA 3KO8A 1WSDA 3N6RA 3O8DA 5J2TB 4LNUB 1KDYA 2CJPA 3B78A 2FGJA 4G9EA 3RT1A 5ITZB 3EOBI 1MJGA 5H81A 3MSCA 4KDFA 2PR2A 1E1KA 2WHRA 3FWNA 3P9QA 2PRZA 3D3WA 2A9OA 3EG9A 5EUMA 2A4KA 4MPTA 4H2DA 4MGEA 1WV0A 2AMVA 3GH1A 3OU7A 1DBRA 1LWOA 1WJGA 2RG7A 2VCYA 3GB9A 2FPIB 4TLLB 3UG6A 3ZWPA 1NVFA 2AZ4A 2EAUA 1RJDA 2I99A 2XUPA 3DOEA 2GNAA 4MA0A 4Q3NA 5CPBA 3RABA 2QVYX 1FPMA 3V4RA 3ITDA 5BT8A 1PDOA 3L6BA 4QOSA 4PTYA 3OF5A 4H7HA 1P9NA 1ZNWA 3IAXA 1WBJB 5C31A 2IWHA 3E9EA 3T3OA 4W1RA 4OAQA 3EFOB 3HJAA 3P52A 3F5FA 3MYRA 2FRXA 4R1TA 1K5DA 5D00A 5TJHA 1W581 3L0CA 1IZZA 7REQB 3AF6A 3DXXA 2XRZA 1A1VA 1G3UA 1OZFA 1Z82A 4QTTB 1NLFA 1QQAA 4NJOA 2X41A 1GPH1 3JVEA 3IQWA 4LHZA 1ZUD1 3BEDA 4C0SA 2VXYA 1IUKA 1GPWB 1U98A 3I9FA 4FT2A 4LHYA 3TZKA 2B34A 2C9ZA 4R3UC 2NACA 4F3NA 1QAMA 2JAUA 2VSFA 5GJBA 4Z1OA 4J9UE 5FBHA 4Q9AA 4EFDA 4YEDA 3TPFA 2GHRA 4M98A 4KXFB 3NWOA 2PUBA 1DU4A 4C6RA 3RBAA 4YP1A 4MUMA 1DZ3A 1JSXA 5AM0A 1L4BA 4KDRA 1LEHA 3IKLA 2VDOB 4XX0A 3M3HA 1JA0A 2PRYA 3BUSA 3OLXA 1J4AA 3F3SA 1UP4A 4UM7A 4ZEOA 2WY2D 1NQ5A 2P3LA 4HP8A 4B6JA 4EEXA 5F23A 1R0YA 4PYJA 1OXSC 1PT8A 1ZBQA 3QH4A 1XLTC 1H2HA 2ANCA 3HSYA 3ZQ6A 1JKXA 5K3AA 3KLOA 2B94A 4OHYA 1YUNA 1ST2A 1TGVA 1R3DA 3L4EA 2JFFA 4K9NA 5BNZA 5L40A 1CVLA 4S1VA 1Q1ZA 2EHDA 1RWMA 3EVAA 3QZUA 2D6FA 5TPZD 3EGCA 5DE3A 3D5QA 4JX9A 4OFWA 4B73A 3IEVA 1PI3A 3ILYA 1H2ZA 3UY4A 1E2DA 4WKGA 4X6UA 4DNQA 1INLA 5HUQA 3C3PA 3VO2A 4Q6WA 1UP7A 4NZZA 2FR0A 2CEAA 3BYZA 2Q8PA 3KPUA 4V0OA 4IUYA 2NU7B 1Z47A 2BM8A 1C2YA 4UPVA 5B64A 4EHBA 4B71A 3LIPA 2C92A 1AK9A 4R9RA 5F1PA 3EZLA 4DSAA 1GFZA 3ESYA 5KPJA 1S2OA 2NZ8A 3A6GA 1XDGA 3LLSA 2VSNA 4MDYA 1ILEA 2RGNA 3FYHA 2GR9A 2VP6A 4EDHA 1ZMXA 1B6TA 4EY3A 3IUYA 4WUTA 1VZ2A 1YR8A 2UAGA 1YR7A 5F21A 3PKZA 2EATA 1T1RA 3LIIA 4IILA 2CUTA 3HC7A 5JXWA 4QC2A 3VAYA 1TUBA 3JYPA 1M6WA 1QGAA 5I5EA 3FD8A 1ZCAA 5DWVA 1XTTA 3RFTA 3DZDA 1ICIA 1TYBE 3IO5A 4D9HA 4A0RA 2ENWA 3FG9A 1KIMA 2FHPA 2OHJA 3MJFA 4IG4A 2OQVA 4YT4A 4GOLD 3CR7A 4B6FA 1J8VA 1XNQB 1M6HA 1ZOPA 1EUDB 3BFXA 3IPCA 4MP8A 4DMGA 3THXB 4URXR 1WY7A 2H8KA 4BY9E 2Z5GA 1M0EA 3PXBA 5DT9A 1J0DA 4LWOA 2GYWA 4MWTA 3PHBE 5EESA 2R4QA 1JNXX 2C83A 5KVCA 4PQYA 3DDHA 5THKA 3D2LA 4AIIA 1QF6A 3PGA1 3IYLW 1L1RA 1BCSB 3F6PA 3L43A 4KJXA 1NZFA 1P3DA 1U8XX 1XZPA 1Q0SA 2FN4A 4LYFA 1GSOA 1U9IC 1WB4A 2GJKA 1FYFA 1AF7A 1YOVA 4MWZA 4DIFA 4DHWA 1DJOA 1WKVA 4P0TA 2CLEB 1JHDA 4HEJA 4OUDB 4XYGA 3HV2A 2VHCA 1VGRA 4D82A 1L7OA 3U6BA 3IXLA 3UMJA 1BGVA 1GPYA 1Y8CA 1OGIA 2OCGA 3TPCA 2VSYA 1TJ5A 3N8DA 4QEZA 2XUOA 4U7WA 2BBSA 2ZIZA 3KE9A 5DEOA 1XELA 1O9HA 5H8WA 3PG5A 4K87A 2ZEJA 2HRRA 1YZHA 1XQ9A 3FBWA 4HFMA 3HZOA 3AEQB 3GNQA 4MW4A 3SX2A 3C4QA 4C4TA 2H4FA 1XU9A 3HO8A 4HN9A 4P86A 5JJKA 2WZQA 2ID4A 2C98A 3TOSA 1ISPA 1EUDA 2MYTA 4LI0A 1TM1E 1VPLA 4B2PA 4J0EA 1OH5A 3LQKA 3VZBA 1CUHA 3T9FA 1OI7A 3RK4A 3T7RA 3TBHA 2IV2X 1PNOA 4MICA 1IRXA 1YQDA 2OLJA 4GQAA 4LJ7A 4QYIA 3A9SA 4P08A 2I6UA 2ZRIA 1WDTA 1C4WA 4PW0A 3RSOA 3IFSA 3NGMA 4IKOA 1F38A 4X45A 2P3SA 2BSXA 2BUCA 2JGRA 2ZBRA 3MGCA 1KMHB 2ZYUX 4FJ1A 4REQB 1RDFA 1WHSA 2BONA 1MOQA 2B8NA 1D04A 1T1SA 2WF9A 1GARA 3SHFA 3UB4A 2WJJA 2VDQB 1XZFA 3LC0A 2XECA 2FPWA 3KXKA 5H83A 2XUJA 4ZO8A 2GZ2A 3KQTA 3NBQA 2PQ6A 1SG9A 5HPYB 1ZJWA 1IFXA 2GUWA 1E7MA 3MT9A 4INAA 1RWVA 3L0ZA 3T3GA 3UJCA 1BJKA 3BQNB 5A3QA 4DXAA 5JLJA 5TQ0B 3N5CA 5DBGA 4PAMA 3I0MA 1Q77A 4OFBA 2CCKA 3UMFA 1N2OA 1IY2A 1WDLA 2XWJI 4PNHA 4BNDB 9GPBA 4LJ9A 4R05A 4XIGS 3S2GA 4R2IA 2B5WA 2D5BA 2ZI6A 5HMLA 2O6LA 1M7BA 4RZQA 4RM3A 2PFGA 4L5AA 3GLRA 4OX9B 1BVHA 4FS8A 1Q21A 3RFFA 5KOJB 2P2LA 1HL7A 3PWZA 4CDMA 3ZCSA 1XA4A 2CGEA 3OY2A 4HAZA 2WM3A 4JT8A 2DF8A 4UCQA 2A30A 5D86A 2I6GA 2Q21A 1G8KA 3OHSX 2O8DB 1H2EA 4GVLA 4C30A 3RBVA 4H27A 3DMNA 4P3PA 4G3XA 1W5SA 3CXUA 3KOOA 3WXBA 1G4UR 2OYRA 1N36B 4FX5A 1V41E 4NFLA 5EJ6A 2CBZA 2G72A 1LH0A 3M9LA 4BQSA 1KSHA 1FP2A 2BHNA 4RH0A 2BGUA 2IIBA 3KUKA 3RO7A 3KZCA 3RVBA 3Q8KA 1JB1A 2WHPB 1X19A 3DEZA 3R75A 1WU8A 3FDJA 3BJRA 3TZEA 1TLFA 2FDXA 2E48A 4A27A 3IMCA 1GAJA 4BV3A 3N0VA 2M1ZA 3WBJA 1E1NA 1Z17A 1KHHA 3PC4A 2WSYB 5AOCA 2NNLD 2HA0A 3PEUA 3ZVLA 4E94A 3FNIA 1V6CA 2PVSA 1PZNA 1CRPA 4A23A 3VJKA 3H1AA 4MV9A 3X1MA 5BWCA 1IXKA 2YN0A 2CZCA 4U02A 2Q6TA 3GJ5A 3JQGA 5FLEX 5BRNA 4D9MA 3W5AA 1MT0A 2PMCA 2P11A 3ZHUA 1M73E 3OPMA 2I2DA 4D44A 2ZT6A 4OQMA 2PJUA 2Q2WA 1YI0A 1O89A 4R2MA 5LOVF 1QDEA 4R7GA 1BHJA 2LD4A 1JUDA 4G0PA 1LXCA 3THRA 1O6BA 4YRCA 4RSGA 4IJWA 5AOBA 1AQIA 2R85A 3QY0A 1Z2DA 4WNIA 1ADGA 2FPIA 4L7VA 3T9AA 2BE9A 5DBFA 3ZXIA 3I58A 1EAMA 3EXFA 1QHFA 4F0JA 2VNIA 4CR8A 3HDTA 1P17A 3V33A 3NQ41 1BZYA 5EZYA 3U6KA 1DGQA 1SOMA 3PQ2A 5FF9A 2G0AA 3EDQA 4KBFA 4MB6A 3DF7A 5DCUA 1GTSA 3AVUA 2ON6A 2ZIWB 4Z4EA 1XQWA 1QR2A 4OI4A 3TEFA 4QG7A 5B3LA 1E2LA 3ES9A 3WKEA 3U5ZB 1MAWA 4WOBA 5EHQA 2FV8A 1X1RA 2ZJ7A 4XWGA 3ZW7A 1G1MA 2VA9A 2G04A 1V5FA 3CUUA 1IE3A 1ZK2A 1M6YA 1JJIA 1YIDA 4NH4A 4CMCA 3V32A 1L5YA 2BMJA 2X0FA 2P6RA 3LW7A 2LIPA 1M8PA 1J9ZA 3W4KA 4HGPA 4O4JB 2JHAA 3DL7A 4KR6A 4F4DA 3KQHA 3AB8A 1EFHA 1ZRSA 4PICA 1TCAA 4LFBB 3GAMA 4GMFA 3QMVA 1AUVA 1NW6A 3AHFA 1V1RA 4PPGA 3DBIA 1GZ4A 3RSQA 1QP4A 4NDZA 3AWIA 4MX8A 1YZ3A 3LT1A 4RZIA 1C3XA 1P7ZA 2A1TR 5BSWA 2QRVA 1R4ZA 3EZNA 1YD7A 3LPMA 3QYPA 4YQZA 5DBOA 1YR6A 1NP6A 3BPSA 3OFJA 3Q2IA 2V7QD 2FYTA 1DQRA 3DVLA 4ZVRA 1G42A 1Q15A 1E58A 2X3YA 1BEZA 3MYYA 1KY4A 2FFJA 1AQ6A 1I3OA 1T9HA 2CF6A 3C6XA 3L8CA 4NAVA 1TD1A 1AZSC 4NU0A 5FNZA 1Q1EA 3ZEIA 3HADA 1G9SA 3HV0A 4AI6A 4BAZA 2PRJA 4DBVO 1WXWA 3PGLA 5BV2P 1J9GA 1OIXA 3BTUA 5HFNA 5A0FA 2VDVE 1OHHD 3OM1A 4COKA 1P8JA 1YQWA 4ZPJA 1E0SA 4BJHB 1YOBA 2PUWA 5LN1A 2ZUFA 2JDIA 3QMMA 3FPBA 1JZTA 1A4UA 3BOSA 3KKPA 3AM5A 1J07A 4TQ9A 3I45A 3J7TA 1COWD 4D8XA 3ESXA 3MJ4A 5DLYA 4B3HA 2UZ1A 3C24A 5KWIA 3ZE9A 1AHNA 2AYXA 4MIYA 2EJUA 3O38A 5SZIA 2XDQA 3FMGA 1P91A 1JDNA 1YUMA 3AJ9A 3MB5A 4EPRA 2HMVA 3BKXA 3UIEA 5ALNA 1SXQA 4Q01A 3EDYA 4PBRA 3QU5A 5CLFA 2COEA 4DV6B 4Z54A 1USUA 3AZQA 3PK0A 1JJVA 1W1UA 1T5OA 2Q99A 4N8EA 1HE1C 2CK3A 2GCOB 2GSDA 3HSKA 4