3DLTA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase D
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
total genus 85
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dltA00
1B6GA 4KRYA 4GEGA 5LLSA 5SYMA 2QR5A 1GGVA 1G4HA 2PM8A 3M83A 4W1SA 5ALEA 1MT3A 2PL5A 2J3QA 4IH1A 1NU8A 2X8BA 3P2MA 1MNAA 3PE6A 1UKAA 2V96A 4V2IA 5AKLA 1JU3A 2WTNA 5HFNA 4H7HA 5JAOA 1ZJ5A 3BF8A 1FFEA 2HA4A 5AKKA 2K2QB 2UZ0A 1EK1A 2B61A 1GZ7A 4FKBA 3EQ9A 5LZ4A 5AM3A 3GFFA 1CUDA 3FLBA 3C8DA 3OOSA 1RYYA 3N0TA 3WQHA 1JFRA 5D7BA 4NS4A 3G0DA 5AOBA 4X3CA 2RGUA 1WM1A 3DD5A 3FBWA 3CN9A 1MJ5A 2OLEA 3WL7A 1F8UA 3HJUA 1EB8A 2WHPA 5HK9A 2Z3WA 3IB3A 2XUFA 2VQ6A 3B12A 2P8SA 2HA6A 2XMQA 4X93A 4P92A 2OAGA 5A2GA 4B83A 3BJRA 4B81A 1OILA 1XZBA 2BKLA 4CIAA 3ZPXA 4GDMA 1Y7IA 5KREA 1H2ZA 5EHXA 2VSQA 4QDZA 5ALXA 4HRYA 3FLEA 1K63A 2JEYA 2X5XA 5JADA 4H7DA 3H0CA 1XZMA 4X94A 4BRZA 5H3HA 4G9EA 3TGLA 4F60A 1XQWA 3B3QA 3PICA 4HXEB 1EX9A 3GZJA 4F21A 5JZBA 4QNNA 4KR0A 4AX4A 1CFJA 4Y2SA 3O4GA 1FFDA 1PJAA 4Q1VA 4FBLA 5EIAA 4Y2UA 2WG0A 4DLNA 2Y6VA 4ZREA 3H2KA 2ZVDA 1EI9A 1ISPA 4Y2QA 1BCRA 4G4IA 3WK5A 5HF6A 3VXKA 1UK7A 1CUZA 1QO9A 2QXUA 2YYSA 4G9GA 1BE0A 2XMDA 2XUOA 1ZD5A 2PVSA 4PSCA 4C87A 1VKHA 3DLTA 2ZJ7A 3V1LA 1E3QA 2ZJ6A 3Q8WA 1L7QA 2QMQA 2O2IA 4XVCA 3HACA 3DKRA 1CUSA 2VATA 1VE6A 2AXEA 2WTMA 4H35A 3WL5A 3C6YA 3IUQA 3HI4A 3KOOA 1DT5A 3WK7A 4K6GA 1CPYA 4DGQA 4S0XA 4DIUA 5IH7A 1CQZA 3H2IA 4KACA 2OCLA 1D07A 1EK2A 4X90A 1ODTC 3FVRA 4Y2PA 5DNVA 4H18A 4U2BA 4L9AA 3PI6A 2EDAA 3CXUA 3O95A 1IZ7A 2OG1A 2XUPA 3FCYA 1LPPA 3ESDA 4KYVA 3VJLA 1XKTA 2WIJA 3R40A 1EDDA 3H1AA 4UBNA 2WHPB 4FTWA 4OPMA 4FLFA 1R4ZA 3WKAA 5FKJA 4RE6A 5AKHA 1IMJA 2V98A 4ROTA 5AM0A 1QJ4A 4IH9A 2GZSA 4B85A 4X6YA 2GBGA 2O2HA 3WYNA 2VT7A 5ALWA 5AKEA 3H1BA 1B41A 1N5RA 1R88A 3A70A 4BAZA 4FMPA 1PV1A 1XLWA 5C8XA 3ZLUA 2WUGA 1A8QA 1VZ2A 1YAHA 2OCGA 1QIDA 5D3ZA 4H7JA 4BB0A 3STTA 2XMZA 5JANA 4BVKA 5LKAA 4GECA 2XUGA 1CUIA 1YA8A 4H77A 5EGNA 1LPSA 1EA5A 4N8DA 3HSSA 4EUSA 4UHBA 2WIFA 2ACKA 1TCBA 5J3JA 4U2EA 1Y7HA 5CTAA 4AMYA 1FFBA 5D6OA 4A23A 2XQJA 4ZI5A 4Y2VA 4EB0A 3QYJA 3CN7A 2Y6UA 3WK6A 1E8DA 3FOBA 4FBMA 3FYUA 4PSDA 1SC9A 4UBIA 2WG2A 5HCUA 3E0XA 4DMCA 4EBBA 5HKBA 1YAJA 1LNSA 4I19A 1Q0ZA 2PU7A 1XZGA 3G0BA 5DJ5A 1ORWA 1SCQA 4YX9A 3X3HA 1UWCA 3VVMA 5LZ9A 1EH5A 1BEEA 4B7ZA 1ACLA 3C6XA 1USWA 3G0GA 2D0DA 3S8YA 4LYDA 4BZWA 3WL6A 2WFLB 1AC5A 4UFPA 1J07A 2XMCA 1SCIA 4LHEA 1FFAA 4C4XA 5ALSA 3FSGA 5ESRA 1TAHA 2PSEA 4OSEA 3O0DA 4C4ZA 3RK4A 3QMWA 5FRDA 3H2HA 3WK8A 4PF1A 5F4ZA 4P08A 4BATA 1A88A 5LZ5A 4J0GA 4UHCA 1P0QA 4WJLA 1HDEA 1TKRA 4IH4A 5CT8A 2B9VA 2PSJA 5AM2A 2H7CA 3U0VA 1XRRA 3R3XA 2ROQA 4G4GA 1EXWA 4EZIA 1UK8A 2PSFA 4Q3OA 4LKOA 4TPKA 1JU4A 2W6CX 4BCCA 3KSRA 2H1IA 3G8YA 1AUOA 4Y2RA 1W1IA 1SOMA 2BGNA 1F0NA 3YASA 1X2EA 5AK3A 1BRTA 1YS1X 2V97A 1UKCA 2Y2VA 3HZOA 1XRNA 2IX9A 2DR0A 2HHAA 2G5TA 4XIIA 1P0PA 2DHCA 3IVMA 2HU5A 4IQ4A 4MEAA 1E8NA 4B9AA 2AJLI 1QGED 4G8BA 4UBKA 1CQWA 1QLWA 1ZI8A 3WWPA 4G8CA 3AUKA 2ORYA 1Z68A 4GXNA 4UBJA 2WU4A 4BP8A 2GZRA 1C4XA 1UOQA 1CUFA 2WHRA 2FUKA 2RHTA 3LS2A 4HTAA 1DWOA 1EB9A 3WZMA 3HABA 1W4LA 3I2FA 3DOHA 1MPXA 3IA2A 4EY5A 1P0IA 2PUJA 2XUKA 2ONCA 2RONA 5A7FA 3G0IA 1CVLA 4C01A 4BTVA 3F98A 4PSUA 4X00A 2I3ZA 3LLCA 3G0CA 2XE4A 3A2MA 5AK5A 5JYCA 3RARA 3I6YA 2HL6A 3W2TA 2XQIA 2GYUA 2C0QA 1GPLA 2EEPA 2WILA 5AH0A 1TIBA 2WQZA 5AKJA 5DYTA 4UFNA 4B0PA 2VTVA 5AI9A 1QIMA 5JIBA 2WUFA 3QBJA 2HIHA 3O9MA 3PFBA 2QXTA 3G02A 3I28A 4BAGA 1J06A 4XWGA 4HZGA 4HXFB 4AO7A 3G7NA 1CUYA 5IVHA 1EVQA 4B84A 5FPQA 4ZV7A 1QIHA 1R3DA 3RM3A 5EFZA 4LXIA 1AZWA 2HADA 2DQZA 2WU3A 4OYLA 4AZ3A 1LPBB 4AO6A 2E3JA 4AMZA 3RLIA 4UUQA 2O7RA 1XRQA 2BCEA 2XMRA 2ZYSA 4AQDA 4AN1A 1LPOA 5HFAA 3WWEA 3WIOA 3UMJA 2DQYA 3F97A 4Q05A 2J4FA 1QOZA 4QDUA 4CI9A 2FJPA 1R9MA 4WFIA 4X7BA 3IUMA 3H18A 4JNCA 2LIPA 1WB6A 3WA6A 1IUPA 1U2EA 3IUNA 2BGRA 4XJVA 3MGAA 1N1MA 1ZI6A 4QDTA 2VEOA 5T4FA 3AZPA 4I3FA 5A7GA 4M0EA 1G42A 2H7YA 4FLEA 4AO8A 4CCWA 3KDAA 4J03A 4FFWA 4I4CA 1KU0A 1HKHA 4W1RA 4GLBA 4Q3LA 3ZI7A 4L72A 2QVBA 2XUJA 2B4KA 1OXMA 3V9AA 4CG2A 5IVDA 2OGSA 2ZJFA 5AM4A 3DJYA 3V1MA 5AM1A 1XFDA 5FDFA 4FNMA 5AO9A 2R11A 5IKXA 4MYSA 2QZPA 1JMYA 4PNZA 2IITA 3WWOA 3WJ1A 5AKGA 3ESCA 5AOAA 3ESBA 4WFKA 1UZAA 1YA4A 5KWIA 1W75A 2C5GA 4DMKA 5ALKA 4C6HA 4J3JA 1GKKA 2RIPA 1GQSA 1WHSA 3C70A 3EQ7A 3D4LA 3JWEA 5D3KA 1XZKA 2JF0A 5ALJA 1W76A 5E4TA 1QIEA 1TQHA 1Q84A 1XRMA 2B20A 5ALVA 5C81A 1CUXA 5E4YA 1G5FA 3NGMA 1U4NA 4EHBA 2CZQA 1WB4A 4OB8A 2XUQA 3BL8A 4H0CA 3WLAA 5BWBA 2OQVA 3I2HA 3IULA 1ORVA 4CFSA 2I03A 4KAAA 2ZYIA 2ECFA 1CR6A 1T4MA 5LKRA 4KJXA 4FWBA 3NUZA 4EY8A 4GWLA 1DT3A 5FV4A 5CBKA 4RNCA 5AI6A 1JT2A 2XDWA 5CXXA 2AJDA 5ISMA 3WKBA 2VT6A 2WIGA 3WMRA 1DX6A 1EINA 5FPPA 5A7HA 3STUA 2RI6A 5AI8A 1WHTA 3ZWQA 2XMSA 1LGYA 1EHYA 4X97A 1GPKA 3ICVA 4LXHA 3IBTA 1GQRA 4WCVA 1VA4A 2OAEA 1UXOA 3DS8A 1UK9A 2HA2A 5AI5A 1QIFA 4C89A 2PX6A 3WK4A 1I6WA 4K2AA 2XQFA 5EHZA 1VLQA 1HPLA 4BCDA 2J3DA 3QPDA 4J0IA 4CG3A 2JGIA 3E4DA 2WFLA 1HLGA 4FLMA 3H19A 1UK6A 2HFJA 3FVTA 5LZ8A 1C7IA 3DNMA 3WK9A 3R0VA 5FOQA 1K6EA 4KAFA 4H7IA 1DTEA 5HKAA 4B80A 1P0MA 1UOPA 3AZQA 1W52X 5DTIA 1CUVA 1MO2A 5AM5A 1CRLA 3DEAA 1XZHA 2G63A 5YASA 5I8PA 1XKLA 3FWHA 4WDQA 5LIPA 1CEXA 5ALPA 3WYDA 2BUBA 2GBIA 2QS9A 3PF8A 5ALTA 5CT5A 1QFSA 1MX5A 4WFJA 1GT6A 5AK4A 2HU8A 1U8EA 3BDIA 3ZV7A 4G1FA 3KD2A 4Y7DA 4MQMA 4MQLA 5DWDA 1O6FA 3W06A 3AZOA 2VJCA 1HQDA 3ICWA 2Z5GA 2CMFA 1L7RA 1AMNA 2Z3ZA 3EBLA 2C0PA 1QTIA 1XZFA 3WKCA 2H9YA 1BROA 1A8UA 2QOEA 1AURA 2X76A 4PQEA 4PV7A 4BE9A 2R8BA 3QPCA 2WUEA 3FAKA 1IUOA 2QKYA 4UHDA 4LXGA 2J4CA 4UHEA 3N2ZB 3OTQA 2YXPX 4BTLA 2BFNA 1XLUA 4K5QA 4C4YA 2HA5A 4E14A 5JD5A 1XQVA 5HK8A 2C58A 3VKFA 1QIKA 2OCIA 1JJFA 4L0CA 5A62A 3ESAA 3NWOA 2CEKA 4J7AA 3K9BA 2CB9A 3MVEA 4N8EA 4BYMA 2OPHA 1A8SA 1CV2A 2VJAA 1CUHA 1VZ3A 1GXSA 4OB7A 1MX9A 4DMHA 2XUIA 1HBJA 3I6MA 2QUAA 5T4EA 3I2KA 1CUAA 1NU6A 4G8DA 5AI0A 4B0OA 3TJMA 2QJWA 3QM1A 5DTJA 1BCSA 5JD6A 2JGLA 1CUGA 4P93A 3RKSA 4BC0A 4LYEA 1TRHA 5CH3A 3KWJA 5JZSA 5K3CA 1H2WA 1JKMA 4KRXA 2GBFA 1ZD3A 3F9CA 2CUTA 3AFIA 1F0PA 3A2LA 3OG9A 5A71A 4OB6A 4BE4A 4W1PA 5SYNA 4MYDA 2EDCA 1ZD4A 3DYVA 4OD0A 4FDMA 4N5IX 4QLAA 4UBOA 3STVA 1EVEA 3VJKA 1IZ8A 3G9UA 5JAPA 1XRPA 2WUDA 1M33A 1WPXA 2HM7A 2WHQA 1R9NA 2Z8XA 4WY5A 2XQKA 1CUEA 1TCCA 1YCDA 1WB5A 3A2NA 1VE7A 3OURA 4JEIA 2BUCA 4NMWA 3DL7A 5CXUA 1E66A 1QFMA 3BIXA 1KU6A 2OQIA 2PKYX 1LBSA 1XZCA 1C7JA 2ZSHA 4MXDA 4E11A 5BWCA 1J2EA 4UHFA 5CT6A 1VXRA 1MN6A 2Y2UA 4KAJA 5LZ7A 4C88A 5C8ZA 1QIGA 5IVKA 1MNQA 4BP9A 4PO3X 1ODCA 1R1DA 3I1YA 5EHNA 3WWDA 1AKNA 4BDSA 5AKZA 1THGA 4JYMA 4QA9A 4E15A 1ZD2P 5ALQA 4FNGA 1YB7A 2RHWA 4ITVA 5AICA 4TVKA 2RAUA 3K6KA 5I7UA 1R50A 1JJIA 4UBLA 3TEJA 3W9BA 1DX4A 1UFOA 1TCAA 4ZWNA 1X2BA 3F67A 3I1IA 3BIWA 2WJ6A 2WSLA 3PUHA 3R3VA 4U2DA 3MUOA 1BN6A 1QE3A 1Y37A 4L3WA 4QLOA 1QO7A 3E3AA 3ANTA 4IO0A 1ZIYA 5ALDA 1CUWA 4A5SA 5BV7A 3C87A 3H2JA 4X92A 1AGYA 2JIDA 1BU8A 3I2JA 3WL8A 4IHAA 4JYPA 3WWCA 1U65A 2HA3A 1H2YA 3O4IA 2VF2A 3C45A 4CG1A 2ES4A 4GHWA 3D3NA 2AJCA 5HF9A 1YASA 2PU5A 3ANSA 3JYHA 4TGLA 3IURA 3EIOA 1N5MA 2QRUA 7YASA 4OU5A 5FXMA 5DNUA 3C6BA 2BUAA 5LZ2A 1S8OA 5ALLA 3F8SA 4QE3A 5K3FA 2QT9A 1WCYA 3G9XA 5HF5A 2QJRA 2JGEA 2XUHA 2PBLA 2HU7A 3M81A 4Q82A 2QUBA 2G5PA 3MUNA 3OM8A 2OXEA 2O7VA 5EHQA 4AB1A 3PDCA 4P9NA 3LIIA 3H04A 5DYYA 3GROA 2FX5A 5ALYA 5HZGA 1L7AA 2ZSIA 3HLKA 4H7FA 5JD4A 2WLSA 1YSCA 5JAUA 1XZAA 3PFCA 4INZA 3HYSA 4HVTA 3OC0A 4EA6A 3R41A 4Q3KA 1BEZA 1FSSA 3C5VA 1DWPA 3C8HA 3V1KA 4BVJA 5FP0A 5K3AA 1GKLA 3R3WA 2W22A 5DNWA 3QVMA 1E89A 4ARBA 1DQZA 3ZLTA 1YB6A 4DNPA 3DKKA 4G4JA 2XQGA 2HA7A 1Q83A 4OU4A 4OUKX 1K8QA 3FNBA 3DYIA 5HF8A 2C7BA 4QDOA 3DCNA 5ALUA 5E4JA 3C6ZA 3VJMA 1LBTA 4UHHA 2DCMA 5K3EA 3GELA 4X85A 3PUIA 1RP1A 1LPMA 1JI3A 3I6ZA 4QEKA 4Y9SA 3DQZA 1EDEA 4O08A 1LLFA 5AKYA 5JALA 4NZZA 2HA0A 5BOVA 1QTRA 1XQYA 5CW2A 4W9RA 1UKBA 3O9VA 5AHXA 4X95A 1N8SA 3WIBA 1XROA 2WKWA 5CH8A 4M0FA 5HQ3A 5T4HA 1OCEA 4YK7A 3ED1A 4HXGA 4QWWA 1BS9A 3BJMA 4QDXA 3TRDA 1VA5A 2Q0XA 4J0KA 2GBCA 4CCYB 6YASA 1XQXA 4M0MA 3Q0TA 2WG1A 4H7KA 3OPMA 4W63A 5CT4A 4HRXA 3WZLA 4B9EA 1LPAB 3D2AA 2XUDA 4HS9A 4MWTA 1NX9A 5C7YA 3EQ8A 4B6GA 4MEBA 1K5PA 3T52A 1O6GA 5AOCA 5K3FB 2JEZA 2V9ZA 1TK3A 4Q34A 4YPVA 4FHZA 4J0DA 3H17A 1Q0RA 2DHDA 1CIJA 4QWMA 4RPCA 2O2GA 3IIIA 4W1QA 2IIVA 1ETHA 3DDUA 5K5EA 4U2GA 3BE8A 3I2IA 3VDXA 3L1JA 3B5EA 1GPNA 4A16A 1H23A 4E46A 4ETWA 4EY4A 2VAVA 1T2NA 4J0CA 2GYWA 2Z8ZA 4QZVA 4Y2XA 1XLVA 1CLEA 4X91A 4DM7A 3FYUC 1E5TA 4DTCA 5ALRA 3A6ZA 5JZ9A 1K4YA 1QONA 4WY8A 4N5HX 5LP1A 5KWJA 1BN7A 3PF9A 1MTZA 5AK6A 4DNFA 1ZI9A 4BBZA 3F96A 1H2XA 1XRLA 3WI7A 2VA9A 3BF7A 3HXKA 5K3BA 2C5FA 2QM0A 4MWSA 2PUHA 1DU4A 1CUBA 3GUUA 4LIPD 2XLCA 2JGMA 1E8MA 2VJBA 4BC1A 5FUMA 5AKIA 2WFZA 2PPLA 3D0KA 4BRSA 4X6XA 1LZKA 4KE9A 2QTBA 5DLPA 5ALMA 4F0JA 3LCRA 1W6RA 5ALNA 1XZEA 5HQ3B 5ALIA 4K6HA 4N8SA 4MJ3A 3UUEA 4BAUA 3FYTA 3C43A 2OGZA 1H22A 3M3DA 1MAHA 3WKEA 4JH0A 2XMBA 4OCZA 4ZXFA 4GBGA 3KWFA 3ZLVA 4UFOA 2Y1KA 3M82A 4AXBA 4K6KA 4Z49A 1VOTA 3U1TA 1FFCA 2C4HA 4KE8A 4YASA 3D7RA 2XMGA 4U2CA 3FSGD 1ZJ4A 1SFRA 1UOOA 2OCKA 5FLKA 2HRQA 1ZIXA 5AKXA 3R3ZA 2D5LA 2CKMA 4BDTA 4HAIA 3DL4A 2XB6A 4FOLA 1XZLA 1EDBA 3R3UA 2DFPA 3QH4A 4X6UA 3LIPA 4F5ZA 5AJHA 4WDRA 5CRIA 4B82A 1MAAA 3AILA 1XZDA 1ZOIA 4PW0A 4ZV9A 2XT0A 5ALGA 3D2CA 5CT9A 3HEAA 4NVRA 4UPDA 5CURA 1UT6A 2AJBA 4DYHA 4G5XA 1FJ2A 3GBSA 4DSZA 4ZGBA 1CUCA 2ACEA 1VJ5A 1PFQA 3QPAA 5EI5A 3UUFA 5JATA 3LP5A 4AN0A 3QITA 1JMKC 5JASA 4BVLA 4KEAA 3AIMA 4Y2JA 2I3DA 3HRHA 3NOXA 2JBWA 3KXPA 2VJDA 1MX1A 3SK0A 2YH2A 2HRRA 3G9TA 2JGJA 5AIBA 2HDWA 3JW8A 5LYYA 4EY6A 2JGKA 5C8VA 3T4UA 4RGYA 2HFKA 5K3DA 2WM2A 4FFVA 5DYWA 2XUAA 5A6VA 5JARA 2I78A 2FJ0A 1SCKA 5ALZA 1QIIA 2YASA 1G66A 4DNQA 2WFMA 2ZYRA 4BCBA 1LZLA 4AZ0A 1JJBA 3L1HA 3WA7A 3HC7A 4Y2YA 3IDAA 2WIKA 4XX1A 3EF3A 3AIKA 3I2GA 2BAGA 4DSAA 3SWWA 1AX9A 5ALHA 4J0HA 5AP9A 1X70A 5T4BA 3STXA 4GI1A 1CUUA 2WIDA 5EIHA 1CUJA 2CJPA 3G9ZA 1XZJA 1YR2A 1XZIA 1QIJA 1KEZA 4ARAA 1RWQA 1QZ3A 3QZUA 5AI4A 4KE6A 4JUIA 5ALOA 5JAHA 1A7UA 2DHEA 3WJ2A 4RE5A 2WJ3A 2AJ8A 2GYVA 1AQLA 2CBGA 1DINA 1MU0A 1ZICA 1LPNA 2OGTA 4U2FA 3W9UA 2PSHA 1WOMA 3QMVA 1THTA 1WPRA 1DQYA 2VAXA 3SC2A 3V48A 4CIBA 4D9JA 3SX4A 5AIAA 4OYYA 2XI4A 3CCBA 1VXOA 3FYUB 2G4LA 3O4HA 3AINA 5CMLA 4CCYA 3GA7A 3VISA 4H7EA 2XLBA 3STWA 4DNOA 1DWQA 4EY7A 3H2GA 3DOIA 2NW6A 3D5EA 3QMMA 1IVYA 5KBYA 2DSNA 3BXPA 5EIEA 3K2IA 1YS2X 2WJ4A 3VVLA 3L1IA 2ZYHA 1J1IA 4GW3A 3FLAA 3BWXA 5ALFA 1ZGBA 4BZZA 3R3YA 4Y2TA 1ACJA 3C5WP 2PSDA 3ILSA 1F6WA 4J0JA 5E2IA 3CCCA 3BDVA 2H7XA 3S2ZA 3W05A 2JGFA 3STYA 3W04A 4DMFA 5I9IA 1IUNA 1ODSA 3IUJA 3O4JA 1HL7A 3D59A 3AJAA 3WKDA 3D2BA 4UBMA 5IVIA 3AIOA 4ZRDA 3E1GA 4KE7A 3FCXA 3V1NA 5CH5A 4X71A 1ZGCA 2BJHA
chains in the Genus database with same CATH superfamily
1MG5A 2EP5A 3VTZA 3PFWO 2EYQA 1CVRA 1QV7A 2DY1A 2RJOA 2ZQZA 3FNRA 3L0IB 5LLSA 1BFDA 2IXFA 1YWGO 1XNQB 2QR5A 1RKVA 1XPOA 4QM6A 2PM8A 4GC5A 1U6JA 4RJKA 4U39A 2P6NA 4JC5A 4PR0A 1MLDA 1WSWA 2EBUA 2F3RA 4PM4A 4K9PA 4LQCA 1SKMA 1GAEO 2JGAA 1OY1A 1HDXA 2P3OA 2QY6A 3HJBA 1OXKB 4GWGA 3TJZA 5I7SA 5AW3A 4Y9RA 1EJ6A 2IVFA 3N8KA 4IH1A 2PMKA 3UJPA 5AW5A 2R68A 4KQXA 2P27A 3QJYA 3PZRA 5KOJB 1MNAA 1UMKA 1YRWA 2DBVO 3PE6A 4LF6B 1UKAA 2FV8A 4V2IA 4RVFA 3EPHA 3LYLA 1JU3A 2ZW9A 4UCQA 1FNBA 3EULA 3HKCA 1QRTA 4M55A 5JAOA 3PHLA 4GX1A 1NNEA 1ZJ5A 2EJWA 3B52X 4TUYB 3D1VA 4BFXA 4O25A 4K0KB 3AF0A 3QXJA 9MHTA 1WULS 3MYRA 5D00A 4XB2A 2HA4A 3H05A 5TIIA 4LDQA 1K0FA 1IIRA 5EHGA 3K6SA 3HDJA 2J85A 3NUGA 3WADA 2VNHA 4M1WA 2J1LA 3IUYA 4IVNA 1B8OA 1KJJA 3GDWA 3I9JA 1SOVA 3BG5A 2XBMA 1DTSA 2J6BA 1MJHA 4L28A 2R0QC 1NE2A 1JDJA 1P3DA 1PZEA 1XLTC 2YWJA 2WWXA 1MTOA 4QVKA 4EFMA 1CUDA 2NZUG 2Y0PA 1MOPA 4Q3NA 2WKQA 3FLBA 4W5HA 1CZOA 2B7CA 2RK3A 3GAZA 4IJ5A 1CE8A 4NRDA 5BO5A 3W78A 4JJIA 1RYYA 1R5BA 1RYEA 5E9JA 3R9IA 3RIYA 3ZV4A 5CNKA 3T9AA 1JFRA 5D7BA 3ZXYA 2PX5A 2TMKA 3MSCA 3R0QA 5K01A 2EWVA 4X3CA 4MTLA 4PXYA 5CYOA 2Q0HA 1R6DA 4PN7A 1WY7A 1A50B 4QO8A 2RGUA 3A7DA 3SIWA 2ATIA 4C29A 4LPSA 3T3NA 2NV6A 5HQJA 3DD5A 4ZI7F 1NXWA 1WW8A 4X44A 3CN9A 1EAMA 4LV6A 5F7JA 2ZYUX 3HCCA 1Z17A 4DTIA 3FUWA 4NPCA 2CYAA 4DBLC 1TMYA 1XJWA 5IF3A 3JVIA 2DVMA 3O93A 2EVWX 4LG1A 3SC2B 4DLKA 5HK9A 4OP2A 4M9ZA 3ZV3A 3R76A 1LDNA 1VDMA 5JDCA 1HL3A 1BJTA 3WO1A 5A1JA 5I8WA 1G6HA 1C9EA 3RUCA 2FDCA 4O59O 1MDFA 4X93A 4BNLA 3ZQJA 2GJ8A 1ORRA 3OJXA 4TRRA 1SD2A 1XMOB 4JSRA 1B8VA 3NRJA 1XZBA 3THYA 4R9NA 1WW2A 1GPWB 3NT2A 3PP8A 4MRRA 4CIAA 3GJRA 2NV2B 4YI3A 3V8RA 3ZPXA 4EPYA 4YRKA 2WVAA 2PQ0A 3LNTA 3EQ2A 4IIJB 4ZVUA 4RS3A 1NN3A 1Y7IA 2RHDA 5AR1A 4AKHA 3OCXA 4NS1A 5EHXA 2OFFA 3PQFA 4ZPJA 5ALXA 1EKXA 2QP4A 2REXB 3T1QA 1YRQA 4ALNA 1Q7BA 3ONEA 2GVNA 4CLEA 1FQKA 4YP9A 1SHLA 4KDCA 4ETNA 2QTLA 1Y3HA 3FLEA 3DEJA 2MYTA 1WV0A 2HBRA 4C7VA 3B7WA 1U28C 4HDKB 3ZS9A 2PRSA 2QBYB 1JVSA 3LCJA 3KQYA 1JLRA 1S4QA 2IZ0A 2F8MA 4DCJA 5JADA 1YKSA 1IDN1 1SU7A 1W4CA 2WBLC 3MTDA 4LDNA 2G4CA 3GR6A 3KVRA 4H7DA 4MRMB 4I4TB 5C18A 4GPTA 4PLHA 3HP1A 3IBFA 1YIDA 4Q7KA 1M2EA 4RA9A 1MORA 2H1VA 2HNAA 2ZI4A 3TGLA 3E7DA 4F60A 4XFDA 4DF3A 1RXWA 5JI3E 3PICA 2NADA 2P2LA 4CQMB 3GZJA 3D54D 4OFXA 3SP1A 4F21A 3UUWA 2D0PB 4KVGA 2O8FB 1AKQA 1NUUA 4Y2SA 3HJGA 3O4GA 3UWPA 2H29A 3FTDA 1FFDA 3WJAA 2OCPA 1S6YA 1VBFA 4CF6A 1AHPA 4MNTA 4LV8B 2FPSA 4DLAA 2CFTA 4UATA 4PVCA 1G3RA 3PT9A 4FBLA 2I2XB 2ZT6A 2WAMA 4CW7A 2IYTA 1P1IA 4IMRA 5DRYA 2HV9A 4UAUA 3ZDBA 1QHHB 3KKZA 4LVCA 5DM70 3IC5A 4WHMA 1XP8A 3ELYA 3W0LB 3CY6A 3AERA 5L6MB 5KYXB 4FGLA 2EARA 1YQWA 3ZHXA 1U1DA 3I09A 3GFQA 5L3QB 1UPBA 2ZVDA 1SHJA 4TTVA 1U3FA 3FGNA 1ISPA 1Z06A 2GPJA 2ZRMA 4MH0R 3TQFA 3EZGA 3K0CA 4KNYA 2HEIA 4YRGA 2B78A 1J0DA 2Q1SA 5AW8A 5C4IA 3TFWA 3VI4B 3PTAA 3NHBA 2NO4A 1H66A 4MMZB 3AEUA 1CUZA 3LDHA 3OQMA 2VH2A 4M99A 1X1SA 2WB4A 3IVXA 1HG1A 5IVPA 1YZLA 3DOUA 4NBKA 3HJFA 1C7EA 1ZLYA 2PVSA 1QO0D 4FQ5A 5CW1A 2SNIE 3P4UA 1AGNA 4EG6A 3DXXA 3W5BA 1I10A 5FJJA 3QVVA 1Z73A 4LZJA 4W7IA 1HQYE 1EUZA 3HFJA 3QHPA 4FR5A 4PSCA 3OPXA 4K88A 1JIVA 1TJ3A 3VU1A 4DFDA 3UATA 1VKHA 3EUWA 3DLTA 4BNJA 3S1SA 4OI4A 1LSSA 4YH1A 3AEKA 2FG5A 1OFHA 1WIWA 3Q8WA 3V1LA 3ZZ1A 1H0RA 1WQ3A 4ZQHA 4KC0A 3OUTA 3T94A 2AQIA 2G9VA 4EG7A 2WABA 5KNDD 5LDDC 4FYHA 4JJ7A 1NKTA 4AWAA 2VK2A 3GBPA 2EFDB 2IV3A 2WNSA 4IF4A 4A0SA 2QR2A 2AXEA 1WUJS 3CRVA 2W4QA 3LUAA 3W1VA 4Q3BA 5EJEA 1ADFA 1KJIA 2H17A 5B4UA 1JDUA 1YZHA 3E3NA 4NAUA 3WL5A 4DAEA 4BGDA 4FCWA 2C7OA 3KOOA 2PKCA 1BE6A 3HKCB 2Q29A 1P1KA 2JDID 2MSNA 1OYYA 4PHFA 3U9SA 1AB6A 1I3OA 2D4HA 2REQA 3CR8A 4B3MB 1H6BA 1TFUA 4BEJA 4PZZA 5ICGA 1TCUA 2WWIA 3N2GA 3KUDA 3T7RA 4E08A 3K6SB 1WDLA 4WK2B 4E2ZA 2OCLA 4J0QA 1RCFA 4K03A 5D01A 4BV2A 3OQ1A 3RLFA 1ODTC 2JL1A 3FVRA 4I55F 3PX7A 2UYGA 4IGIA 4ZOQI 4D9CA 1MG0A 2GK6A 1SBYA 2EIHA 4LGVA 3RIXA 3QOYA 1UL1X 4WOBA 2FLKA 4Y2PA 1W8DA 2W2VA 3OZVA 1MEOA 2J9XB 3OMLA 4H18A 4FILA 1TA4A 1EMDA 2YFQA 1CE8B 1BAPA 9ABPA 4WGFA 3KPYA 4QYWA 1SPBS 4D81A 5EWMA 2ADMA 4U2BA 5JECA 2ZM5A 1KZ6A 5EMKA 2HF7A 2J3HA 4RD0A 2ZK7A 4QTUB 2CJYA 3ORHA 1J56A 2AGVA 4X3PA 4I1YA 2R3SA 2XUPA 4CKXA 3QX8A 2ZBPA 5CEEA 3RBAA 1BHO1 2XDQA 5IAAA 2JIZD 1GAXA 2O8EA 1EDDA 1ZJ6A 3IILA 1H05A 2FDXA 4NULA 5GJVC 3I5XA 4Y9DA 4RYDA 3RSQA 2I2FA 4FTWA 4FYVA 3VX3A 4MYHA 3MMXA 3IQWA 3BD8A 4FX5A 3FHTA 2I9KA 4IIDA 4GZLA 4C7MA 4E5UA 1DIGA 2QV7A 1HSOA 2EC5A 5AKHA 4DZRA 1RPNA 2GPTA 1L5VA 2NVUA 5IXJA 4NCBA 1KY3A 2Q6OA 4EUEA 4HUQA 1UJ6A 2V98A 4R1NA 5BT9A 1HFKA 1A97A 4KH0A 2G71A 5EGSA 1PNVA 4YQEA 4X6YA 5AK0A 4B85A 2IHJA 5T57A 4D8YA 1IBLB 1O2DA 2ZJ2A 2C8LA 3T54A 2DTEA 4Q15A 5ALWA 5ITZA 1ADYA 2QX8A 4EHLA 4MS4A 2AG6A 1W87A 2W4MA 4J2OA 5I9LA 2F8LA 2WD9A 2FFJA 2NZ8A 3OKCA 4FMPA 4Z6KA 1PV1A 2OHGA 3KU4A 4WRRA 4OM7A 1SUDA 2GS9A 3EGXA 1A8QA 1WZEA 1VZ2A 1JR3E 4RXUA 5J2TF 3Q7QA 4Z7NB 2GGSA 1QVRA 3O1JC 4RTJA 1F2TA 1MB0A 1P60A 4N9WA 3W7VA 4EG0A 4XWOA 4I2NA 3QE9Y 1TUEA 4BB0A 4Z53A 2VYQA 2IEIA 2A84A 2XMZA 3X1XA 5JANA 1MEEA 4JUAA 3OJWA 4RPHA 4GECA 3OQ6A 4C20A 1SKAA 2VXBA 2RGNC 1IEWA 4RA9B 3Q12A 3EE6A 5CM9C 1E2FA 3EJ6A 5TMBA 2EX4A 3RHZA 1DC4A 4ENQA 4BX0A 3DW1X 1LPSA 4PG7A 2GN9A 1A5ZA 1EA5A 4N8DA 1WUYA 5P8WA 3F3YA 4QPNA 4W9NA 1NVFA 2WTXA 3NW9A 4QRIA 4RF5A 3T5DA 3ZK7A 1X6VA 3EFBA 4ZO6A 5KOIA 4Z8XA 2WIFA 3ROMA 3TQTA 1WDTA 2DP4E 2GQ0A 5JRZA 5BYJA 4AP9A 4IIVA 4GR4A 2XKJE 1W9HA 4GPD1 3G2IA 1TCBA 1WNFA 3DG9A 3CRNA 5TY0A 2DM6A 4RK6A 3ZGLA 4RZHA 4Y2GA 2ZUSA 4I1PA 2B0JA 2JVIA 3TR6A 3DOFA 5CTAA 1WY5A 2X3UA 4QQNA 1FFBA 1KY2A 1OLSA 3HB0A 3ME5A 4Y2VA 2Q3LA 5KNBH 3AERB 1E3TA 4YRFA 1U4OA 3LKVA 3F3SA 4TM8A 1XDBA 1DEAA 2EHDA 4KIWA 2JJQA 3QTBA 1M2VA 3CGGA 2G8NA 2DPLA 4UU0A 3GOHA 1XTIA 3QA9A 4FBMA 1OT5A 3N5KA 1FTNA 1N1GA 4IJKA 5FPYA 5B3KA 1BW9B 4CMBA 3AEUB 2NUBA 4CU2A 2NP7A 2Q2WA 1NQTA 2POCA 1VRWA 2HTEA 1T4GA 4U63A 1MB2A 3E0XA 3LDGA 4DMCA 2GETA 4EBBA 1KQOA 3V2GA 2V0NA 3ILXA 5LXTA 2OHJA 2PH5A 3OO1A 1BYUA 2PU7A 3VR4A 1N33B 5BSVA 3ICPA 3NHJA 2RBEA 3SF8A 3UMGA 1C7QA 1NXVA 4WV3A 3UPTA 1WHTB 1Y1LA 5EE1A 3PJEA 3JQ6A 1QKJA 3HCDA 4P7KA 3FF1A 3MINB 2HCRA 4UM7A 2GEVA 4TMZA 2OBYA 5JCPA 2W6JA 5G0VA 1JZSA 3DKVA 1BEEA 2CEAA 3ZLJA 1J99A 1VYTA 3OQVA 1ACLA 5ICEA 2UUBB 2A0YA 3UJAA 5TNXA 1USWA 1PJLA 2GWRA 4HX9A 1F4VA 2XEXA 3HDGA 4TRMA 2GRUA 1CY1A 2QGNA 2R6DA 4LFCB 4TSRA 1EHCA 2P2CA 4B87A 2FFAA 1BA2A 1NONA 2REQB 2GASA 5EVJA 3U19A 1ANKA 5T7BA 3WL6A 2B6HA 1F1JA 3K20A 5HSGA 3N2GB 1K5GA 2OL4A 3THRA 3JX9A 1TD1A 2P9GA 3QFRA 2DHRA 1Y81A 5BPFA 3EIQA 3D3EA 1NXTA 3NC0C 4EG5A 4YCDA 5JHHB 1P9WA 2W43A 5ALSA 1MO6A 1I6KA 4RWEA 2EJCA 2FKAA 2PRIA 4F91B 3V6LA 1MX3A 2JHFA 2TMGA 4XYLA 4NBLA 2DECA 3CF4A 1E1CA 1ZEMA 2PSEA 3JALA 3OZDA 4CV3A 4JI3B 1VL8A 3O0DA 4I46A 3OJLA 3TSOA 3KEOA 1JFLA 1NW3A 3LY5A 3L0PA 5EWMB 1C7FA 1QCYA 3DB1A 2AWOA 5KNCH 1C3JA 3ONDA 3ORFA 3D4PA 3RUIA 2JI6A 1EUQA 1P5JA 4BATA 1CY7A 2PGNA 1A88A 1TF2A 1UEIA 1Y6ZA 1SULA 2FSVA 5ELLA 3FFTA 4RLQA 5HGXA 4M2LA 1SCNE 2X0FA 1NXSA 2Y3IA 4HLDA 3BGIA 3R5HA 1NR1A 1DWUA 1RTKA 2PSJA 2H7CA 1NDQA 3DNFA 3MHPA 1UBCA 4KVAA 1T35A 4M8IA 3UXEA 2YX1A 5I7AA 3WNZA 1Q1GA 1JXAA 1EXWA 1WSDA 2HBZA 1YFZA 4M98A 1SEPA 3FJYA 2NVUB 2FLVA 4NP6A 3RSHA 3SHQA 3WBJA 4HUQB 1PFUA 3OIWA 5LBTA 3GUHA 1JSXA 3KAPA 1SVKA 4MQFB 4RPJA 1ITZA 1LJLA 4WWHA 3ZLBA 4ZJYA 5ADUS 1MRZA 1JU4A 3WAKA 4I6EA 4QBIA 4MS4B 3ZY6A 2Z1NA 4B4KA 3RAFC 1J25A 4G1MB 4RGQA 2EIXA 2X0EA 3Q1LA 1B1CA 5B30A 5JFGA 3UT5A 4EB8A 2Y71A 4FM9A 1BDIA 2AA3A 1JAIA 3G8YA 3T34A 4WOJA 4TS4A 4Y2RA 1W1IA 3ZK9A 3EGXB 3VPBA 3LC7O 1U1CA 4GBJA 3W5CA 5EZSA 4KUGA 4BQEA 1WTCA 1IU9A 2UZAA 5BY2A 1DJQA 2ICAA 5MHTA 1KOGA 1F2TB 1YS1X 4GX2A 3HZOA 3FA2A 3MN1A 3QU7A 5CFRA 2ZIEA 4WNYA 5EJ2A 2VIIA 4D8TA 1S2OA 2VNAA 3CCFA 1JDVA 2FFQA 3ASUA 4EH1A 2OGWA 2AVNA 2H1LA 2ZQ5A 1NBME 1A5AB 3UJBA 1P0PA 5L9AA 1SXPA 3BWDD 1KY5A 1CC1S 4KWEA 4O4HA 2DHCA 3UIEA 4B3DA 121PA 5B1DA 2GEUA 4ZO7A 5T5QA 2UVPA 3NASA 3V2HA 3ZE6A 2YIDA 3ELWA 4F93B 4EKGA 4OGKA 3T1NA 3PGKA 4G8BA 5ETJA 1Y8CA 3PX3A 3PR3A 4MP8A 4YP5A 1FYDA 1WVGA 1VMKA 4EIWA 3CZRA 2CDRA 3M6IA 2QM7A 1ZI8A 1RWMA 1KNQA 2G4VA 3NZEA 5ES3A 5FV7A 1FZQA 1QDUA 2FGKA 1XZ8A 2CCJA 3H1GA 3DTNA 1Q91A 3JWHA 3D6UA 4HAVA 3WWPA 5CA0F 4B3GA 2X8WA 4DIEA 5G4KA 3AVYA 2NLOA 3WL3A 1T4BA 2I4NA 2PKQP 2H2IA 4D8VA 4LF7B 1NYQA 3A3OA 4OLAA 5IYZF 4HN4B 3M4NA 4FFPA 3T1OA 1OLSB 2NU6A 3H42B 4KWTA 3QFTA 4BP8A 3R7FA 2GZRA 1C4XA 3I3SR 3R20A 1CUFA 1PQUA 1U7HA 2FUKA 3LKBA 1AV7A 3LS2A 3OFJA 4HTAA 4R1OA 1I7SB 5CCXA 1DWOA 3HLYA 3V1UA 3PDUA 2PBFA 1EB9A 1OSNA 3KFVA 2DBQA 3WZMA 2JI8A 2NUAA 5ESDA 4FDVA 2ZSBA 4OLFA 1NE7A 4M37A 1WDMA 1YJ5A 4M53A 4PIVA 4Z0PA 1F6DA 1GXSB 1SN7A 1VMAA 2JLSA 1FVOA 2Y76A 3BM5A 3NYRA 1P0IA 4ZQFA 5DN6D 1OLOA 3W90A 1JDTA 2ONCA 5BN4B 5LXTB 2XDYA 4MUXA 5A3QA 1T8RA 5EIOA 1KH3A 2IIQA 3QIVA 3MMNA 3BFVA 4P4LA 2IZ7A 3WOVA 1FRNA 2BSXA 2PXAA 1WMSA 2WZBA 2NZVG 4PSUA 4YV0A 1U7ZA 1R10A 3K9QO 4N4AA 4AG6A 3LLCA 2QVGA 2PZLA 4B76A 2XE4A 1KRWA 3D4NA 2C9ZA 3I9V1 2B34A 1JAXA 1Y9EA 2HJVA 3FSEA 3NI2A 3GW8A 3K2EA 4WW0A 3RARA 1C14A 1DQPA 1K92A 3TSAA 2HL6A 4HDNA 3SEQA 3UICA 2AOWA 4BP1A 2NQ2C 1Z45A 3FJ1A 3PQ8A 3HWRA 4QTTB 4RX1A 2N9UA 5AFSA 1DO8A 3VPDA 1ZW6A 4BO5A 4EWLA 1TIBA 1HYBA 1I33A 1IN5A 1V6SA 1I51A 4O6VA 3CZ4A 5FQOA 2IX3A 2J0UA 5TQ2B 1N1EA 1LBIA 4Q1BA 4GR9A 3QBJA 1I0IA 4LC0A 5IUJC 3O9MA 4C7BA 3HJTA 3BS4A 2ZJ3A 2JIQA 4GYJA 3GEMA 1O9BA 3VO8A 2Z09A 3QWBA 3NNSA 3U9TA 2I6QA 1V96A 1PHRA 5KQGA 1KYVA 3TGWA 4RTMA 4P53A 5K7SA 1NAIA 3ENZA 3J80A 5B7GA 1ZMTA 3O1HB 4QBGB 1OB2A 4MYTA 2CBZA 2R6FA 3E8MA 1W48A 1V1JA 4TM7A 1A96A 4DWWA 1TPZA 3RH0A 2PWZA 5TEWA 5JDIC 4C7OA 1E1CB 3ESRA 5MFPA 3UG7A 4LY3A 1M5TA 4JP8A 1X13A 1Y4SA 4K9QA 4ASUA 4HLNA 5K3SA 3ST7A 4B4VA 3ZD6A 4JIGA 2RH8A 1O87A 2FXVA 1K8ZB 2OCBA 3DUWA 3RGWS 3HCOA 1LKZA 3OLCX 1G55A 2BZGA 3N8NA 3ZHUA 2DUNA 1AQJA 3S81A 1FDVA 1UZUA 4O1MA 4KUEA 2QRJA 2I33A 4O4LA 3GNLA 1WMDA 5BV0A 3IAHA 4E09A 2WU3A 2FPPA 1UBFA 4ZODA 2YMQA 3OCCA 4KQFA 3AK4A 3PIIA 3COZA 3TD6A 1TGYA 2CLEB 3HXQA 2A30A 2B37A 2BMVA 4AO6A 1WO8A 2YN0A 4Q9AA 3AF1A 3VR5D 2QL7A 4HBZA 2ZIUB 1UPUA 3TOZA 3EVAA 3TB4A 4B3FX 4O2BA 2YUTA 4UUQA 4JYCA 2Z6VA 3CFYA 2QW0X 5DKFA 5KTSA 3EPPA 1XRQA 3PC8C 4IEIA 1NV9A 4EDHA 3EVNA 1ZN7A 4G41A 2O54A 5H80A 3VU0A 3WLEA 2J0EA 3ZVNA 1W8IA 2FETA 1ZA2A 3FGOA 5G0WA 3GYBA 3KALA 2OP0A 4I2VA 3KUKA 4AQ7A 4YGYA 3EOZA 3QG5A 4IGEA 5G2OA 4DARA 5B3JC 2QX7A 4NECA 3UOGA 5JUWA 1Y0BA 1AHIA 3WLLA 4KLAA 1OBVA 3Q0IA 3UT5B 2YZKA 4Q05A 1YUMA 2FJPA 2A33A 2PIDA 4V0RA 2G0AA 4D8UA 2R7MA 3H18A 2AB0A 1IUPA 2YTZA 4MW4A 3FNFA 4CKCB 2GXSA 4X41A 3SZRA 3C1TA 3SS9X 3AESB 3UW1A 1UZNA 3DQQA 3WLTA 1NVVQ 1M8FA 1TX4B 1C9NA 2VEOA 4KNVA 1J8FA 5C51B 2X0RA 3FYHA 5F73A 2Q0SA 3LUCA 2VDNB 3OC6A 3GLIB 2ZRCA 1RABA 2PUBA 4N7JA 2NAFA 3MNFA 3B70A 4O4HB 3A6GA 2HF9A 4AO8A 1WCIB 2AZ4A 2GAOA 3AC0A 3LT4A 5IN5A 4JLSA 4BFCA 2AMVA 4J03A 3U7GA 1A5BB 3PEWA 2YY7A 1LC0A 4CDRA 4Q3LA 2VJMB 4FZJA 2YN2A 4PYRA 5DYNA 4L72A 4P5DA 1BKDR 2I5PO 2Z9BA 1U8UA 5AVUA 3LK7A 3GEBA 5AVVA 1SCBA 1VIVA 4BB9A 2JAHA 1IVNA 1OXMA 2ZWIA 4H08A 5G4KB 1OHHD 3TDMA 3JZIA 2YNMA 5IVDA 2OGSA 3ZVRA 1XAJA 2ZJFA 4UVGA 4B35A 3OJEA 5AM4A 2NU6B 3DJYA 2XR1A 3O2QB 4QUKA 1RJDA 3SHFA 2J9ZB 3V1MA 3WP0A 4NYJQ 5AM1A 4OJKA 1UAAA 1KO1A 4HQ6A 4R9RA 2AQKA 2D1QA 5IH3A 5BN5A 4G56A 2V7TA 4GL2A 1W19A 3C7TA 5D8DA 2FJUA 4LYYA 2NUAB 1N2GA 1X8JA 3NJ8A 1P6XA 5DSZA 5FNVA 1O96A 1VLLA 2VQ3A 3ESBA 4M1YA 4WFKA 1FP2A 5DLDA 4GGOA 3RYHA 4D9EA 2OFWA 1UZAA 3KCQA 1JE1A 1YA4A 1MRSA 3DE4X 2OC4A 3ZH2A 5EJ7A 3NEJA 3DTYA 2YWBA 4M46A 1ULHA 4NESA 3V6MA 5B1YA 4MUNA 1SIWA 1DOZA 4GKJB 2NTJA 4CLHA 3EMVA 1NY5A 1Z6PA 3FKQA 3QX7A 1ESNA 5AXCA 4DDKA 3DBLA 3CH7A 4RH0A 4Z2AA 3EYAA 1GG5A 1DPFA 3R75A 2VZLA 1GQSA 1TU3A 2O1EA 4B4WA 5KINB 4S3MA 1Y4UA 4A03A 1Z5GA 5CDFE 2VL7A 3EQ7A 4D0RA 4D3YA 2BDTA 1XVAA 1JG6A 2BF7A 3F5QA 4ZEWA 1CQXA 1VIAA 1E9VA 4IDHA 2ZIZA 3TLJA 1GPDG 1ZVJA 3KD3A 2FMIA 4QG7A 3AT1A 5ALJA 4ZTBA 2WVJA 3KJGA 3M4XA 5E4TA 1R27A 2LGJA 1GCUA 2O06A 3I4FA 4XGKA 4I4LA 1C3EA 4IUYA 4KN8A 3ZCUA 2W6NA 5ALVA 1AHHA 2AI3A 2D2XA 3PXBA 4OI1A 2WZCA 1QHGA 3HGQA 3INGA 3K9WA 3FFXA 3NGMA 1U4NA 3PQ4A 5E3JA 4EHBA 1TADA 5EWJA 1L7EA 2NN3C 3C3AA 1GGKA 3G68A 4A0HA 3ZI4A 1ZOLA 2ODAA 3BL8A 4JI0B 2J9YB 3MCTA 3ROEA 5HX7A 2X9GA 1T9DA 1ZEJA 3GEEA 1UFKA 3MWEA 2ECQA 2QTTA 4FWIB 3WLIA 3VTKA 4C7OB 1U1GA 4AKEA 4QPDA 1M6NA 3P2YA 1NNI1 3EZNA 1QYRA 3IULA 5I6DA 3FCSB 3IA7A 3ZU3A 1C1YA 5CJPA 1GTG1 1WV1A 4D44A 1IN1A 2I03A 1PT6A 5T6BA 1DC5A 1QUEA 4GI7A 2V6BA 4QU8A 2C1EA 1KJ9A 3LNCA 4O4LB 4PZLA 1YCGA 1BDBA 5FBQB 4XWTA 3ZW8A 1D5CA 4LEIA 1B0UA 2FPPB 1FE8A 3T4PA 3RRMA 5EG5A 1JA0A 3RSCA 2WAYA 1A9PA 5AI6A 2XDWA 3H84A 3WKBA 2A35A 2VT6A 1SOWA 2WIGA 3K1AA 4CVNA 2C9DA 4NMXB 4XB1A 1S1MA 2H4ZA 3BSWA 1EINA 4MIKA 4O2BB 4Q4JB 5BSTA 4O3MA 1Z0UA 1M9NA 1R8QA 2Q5CA 1PL6A 2FW9A 2RI6A 4K8OA 4C5BA 3OM9A 1KJWA 3KPWA 4NK4A 1FVHA 2XMSA 1YI0A 4IXTA 5D85A 2PT7A 3I8OA 4MRAA 4F84A 3C3XA 5HHTA 2MHCA 4E22A 1E3EA 2FWMX 2OAEA 2Q1UA 4JASB 2CCKA 4WNCA 5FEMA 2HA2A 3JARA 4B75A 4ENPA 1SWWA 3R4CA 1X19A 3T9DA 1OPXA 1QWSA 3WGOA 3W5AA 1Q12A 10MHA 3ZE2B 1C81A 2CFRA 3ESXA 1OPRA 4MQ5A 2XQFA 4G81A 1ZRHA 4I8XA 3ROZA 4CEHB 2VPXA 1VLQA 5KTNA 1P62B 4BNNA 3QPDA 1KDTA 4G0QA 4J0IA 2WQ6A 1SCDA 1GRNA 4NCAA 2BGGA 1U6IA 1N2HA 3MWLA 2IEAA 1JB9A 4F3CA 2AFRA 2VDKB 2ODQA 3L4BC 2A14A 2IGTA 3QQ5A 4KITB 3DBRB 2A4MA 3T6KA 3B9PA 3DNMA 3WK9A 1XELA 3RHSA 1A9XA 4PN3A 1B6RA 3PUZA 2QUJA 1SRQA 4H7IA 2AVDA 5J47A 3D8SA 4D6PA 1X0XA 4IGAA 1I0LA 4UVHA 2I99A 3KL2A 4OJMX 3UMBA 3CE6A 5JSHA 3Q7RA 2R1ZA 3V4PB 1UOPA 1IOVA 3ZU6A 3ORQA 4MR7B 3WXBA 5L4NA 2PO7A 1NULA 1V8PA 1KI3A 4MB2A 4RHUA 1AVTA 2J33A 2ZI5A 1MDBA 3AZQA 4RLSA 1GFIA 1P7PA 4TV9A 3GP8A 3TNLA 4ZGGA 4DMUB 2QW1A 2OD2A 1RR6A 1XWWA 5E3IA 1E59A 1NHGA 1KA9H 1TK2A 5JD3A 5AESA 4EFNA 1NATA 4JQCA 1E79D 5P21A 5YASA 3W6ZA 2ZUEA 1TYDE 4HB3A 4TZTA 3RS7A 4QVGA 3JYOA 4ILEA 5G1PA 1FPQA 3BMCA 4LJ9A 4N0DA 2VRNA 3GFVA 1DJPA 3U17A 4D6YA 4IWXA 4JVMA 2V54A 3IQZA 1VRCA 4OGGA 4TWRA 4UUNA 4V0LA 3BJEA 1J39A 3FMGA 2FR0A 5EIBD 4QO7A 4TQGA 5IDYA 4AZSA 2C4UA 4D4LA 1AQNA 5BN5B 2GBIA 4WIAA 4C30A 1JR4A 3MTQA 4BKMA 2QX9A 5ALTA 1IBCA 2QSZA 5CT5A 3U0BA 1QFSA 2NT4A 1OASA 2FZ5A 2GM5A 2JFYA 3CUVA 3T4XA 2FPRA 2RCNA 5FNVB 1O96B 2WKSA 4PPYA 1X7DA 2XSZA 3RYHB 3TLYA 4J7XA 2XNDD 4OGLA 1G8YA 3SHOA 3BDIA 4K2HA 4PWYA 2JIRA 5EXTA 4ZCPA 3KD2A 2ZUWA 4ENWA 1T0PA 1GILA 2J46A 4MQLA 4RGVA 3BZBA 3RREA 3DH0A 3K7EA 1N6KA 3GAFA 4HDSA 2AKEA 1NBHA 2APJA 2WB2A 1J70A 1HQDA 1ECGA 1PL8A 1QGDA 2VOJA 2CMFA 2Z5GA 3DZFA 3ICWA 4RQBA 5KYTA 5BR8B 2Z9DA 3BMQA 4MIYA 1QTIA 2B1GA 1GL6A 3WKCA 3PC7A 5GP1A 1SA0A 2QRQA 4FZRA 4KNWA 5EHIA 4BJ5A 4XRGA 1ELOA 1HE5A 2BFFA 4C3VA 4HNTA 3UHAA 2CL6X 3VC1A 3SJAA 1IN7A 4G37A 3PJDA 1YVRA 2HZBA 2VDMB 4EHKA 5CFOA 5F23A 4XWAA 2Z8YA 8OHMA 4E33A 4BY9E 4JHLA 1WUIS 3F6RA 2Q5JA 4BE9A 5GIOE 1PN3A 1QK4A 1YACA 3C48A 4DKJA 2P0EA 3V2UA 1JG7A 3AUSA 5JJKA 5DFAA 1D2RA 3SYNA 2V59A 4ITRC 1DQRA 2JJ1A 3WBFA 1SU6A 1L7XA 3PNVA 4B5KA 1JQJC 3W4IA 3CUWA 3L8ZA 3LLVA 2BFNA 1CIPA 3E9EA 1XLUA 2QGZA 2EWMA 4D0NA 3PZBA 5EWJB 1C30A 1FP4A 1H8HA 1NJFA 2GZ2A 2YBDA 3BBPA 4GS5A 4MVJE 1FNDA 4F2HA 2XCRB 5HP4A 2OCXA 4GG1A 1Z0JA 2C58A 4ZC1A 3VKFA 3FDXA 5J4KA 5JTUA 2JZNA 2P9YA 3MWEB 2TECE 1XT6A 3WSVA 1RPTA 3NWOA 4NE2A 1EVIA 1Z4OA 2CEKA 3JYPA 1LDBA 1XXHA 2WTEA 3RC9A 2IYNA 2QYOA 5H81A 3CUSA 5I7FA 3H5IA 3D4BA 1NR5A 3DR5A 4OXKA 4IINA 4BYMA 2H8GA 3CPSA 1PL7A 4DQUA 2WU0A 2A5JA 3ZHCA 2WYVA 3HCRA 3ELDA 4NV1A 2BFPA 5IASA 4YVFA 2NZYA 1V8DA 4OB7A 4PONA 3TAHA 1GFWA 1WZUA 4IVPA 1W4RA 1XKQA 5DM2A 3LXXA 3K70B 1D0SA 1S9DA 1FX0A 1J0XO 4YJFA 5D5HA 4LOKA 5T4EA 1XAHA 2I4TA 3DO6A 2CFCA 1LX7A 3K1AB 1NU6A 1O8BA 5JAQA 2M6KA 4R3UC 1NVGA 4G8DA 4YFVA 2VWHA 4PTYA 2I4RA 2E6KA 2OBFA 3QG1A 1XQ6A 2Z5FA 2WDPA 2QSJA 3F4BA 4D5EA 3EXG2 1W94A 1OI4A 2BBSA 3UXYA 3PWZA 2VF5X 1O5TA 1EWVA 1OXXK 1BCSA 1K06A 3AVPA 2JGLA 4K9KA 2ONJA 4HVLA 1EX6A 1GGNA 4P93A 4HEA6 1IQUA 3DP7A 4XE5A 5AVXA 4RIHA 1KYQA 3X1JA 3PC6A 3PQ3A 1GKIA 1OYOA 5CH3A 3VOBA 2C2XA 3E58A 1JKMA 1PGPA 4KO1S 1CNFA 3CF0A 4JU9A 4BV8A 3L7LA 1P33A 3SGLA 4XVQA 2WE8A 4Z9YA 2ZR9A 5K05A 3RG2A 1EFTA 2WDZA 1GA4A 5A71A 5JLJA 1V45E 1QLHA 2KW5A 4RSGA 1VG9B 1USGA 3WVNA 4BE4A 3G8DA 1EHIA 1Q1AA 3ZE8A 1Y1QA 1Q1QA 4F06A 3CEPB 4R2LA 4ZO4A 3E5MA 2Q0QA 4TKZA 2XQVA 2IKQA 1YMVA 2Q1XA 3BVPA 4OV6B 1WBDA 1RYNA 4N5IX 3KQHA 4IHKA 5FPSA 2PZJA 4LW8A 4U9HS 4UBOA 3FSRA 5HTKA 5CYGA 2O5RA 4P80A 2J67A 2Y1GA 3K5HA 1QGOA 2X23A 3COSA 1G0OA 3WG9A 1M33A 1YK0A 2N75A 3IVRA 5E9QA 1D2CA 1FUYB 3Q8KA 3BSFA 2C9OA 4IXDA 3MS4A 4LPKA 2PZEA 1P61B 2Z95A 1MQ9A 2Z8XA 2V6JA 1T1JA 2FMFA 1GKUB 1UBUS 3K31A 3MERA 4ZEXA 5HS4A 1QG4A 1VBNA 2XQKA 2XTAA 3QKSA 4H6PA 1FXUA 4TV9B 5DE3A 5F5NA 3RK1A 1IH8A 3AI7A 2CT8A 2X8LA 1T2VA 5IC5A 2WW8A 4N48A 1U8FO 3EXEA 2XA9A 2ZETA 4DOMA 3ZD7A 3TXAA 3RV4A 1F6BA 2E1RA 8ADHA 4JBNA 4POAA 4PC7A 3IQDB 4LQ4A 4PQGA 1F8XA 1XO1A 3BMCB 2NYVA 1PQYA 3S1AB 2VZ9A 4KWIA 4MPDA 4TWBA 1TYEB 3ZIAA 1ZR4A 2XXAA 3AJ9A 1RW4A 3W2GA 1AS0A 4DUZB 1C1DA 1KU6A 3C3YA 2KB0A 3QEKA 4L78A 5BNFA 4IOLA 2PKYX 1E9FA 3DAGA 1XL0A 2R5WA 1I4EB 5EJAA 5F2EA 3VZCA 5M34A 2XODA 1Y8QB 1DG9A 4Y30A 4MXDA 4M54A 3LQQA 5ADWA 1N5KA 3I76A 3OU2A 4OQMA 1LBHA 2GO1A 3OF2A 5BUSA 4AJOA 1E1DA 3EWAA 1VXRA 1CWUA 5AQEA 3U5TA 4YCNA 2PT9A 1QR6A 2H7VA 4KX5A 1OH7A 4HDSB 3KZ1E 1I7PA 1TU4A 1EIZA 1QIGA 2CLDX 4YMSA 5KJ6A 1DI0A 2XCLA 2HMVA 4BP9A 2IU6A 2XWSA 1VB3A 3BMQB 4EG8A 3D6AA 5SY4A 1DKQA 2XCSB 3PS9A 4U0JA 1SA0B 2MYNA 4XJXA 2A94A 3O2SB 2BT4A 5EHNA 2R25B 2VK4A 2BFFB 3Q9LA 4J1SA 3E2IA 1QZUA 3WWDA 3I9V6 3T9CA 3GY0A 5KNBA 3NHFA 2V8OA 1XCJA 2VFAA 3UC5A 3KVVA 4GVPA 4YLEA 3OD1A 4E2FA 4UVIA 2ZWMA 1QV9A 3BHJA 1LS1A 3NAGA 3R77A 5JY6A 5K0GA 5AVKA 5ALQA 2OZVA 4D2IA 1UDXA 2XHEA 4YRLA 3DHNA 4AS2A 5ARDA 5GJBA 4FNGA 1TM4E 1YB7A 4R51A 2W6IA 1XVLA 1QVVA 4ITVA 5KSPA 3L8HA 1KH1A 1Z4QA 2VTKA 3OT5A 3Q2KA 4PAQA 4QAQA 4QHYA 2Y66A 2VUTA 1C30B 1FP4B 2P30A 3DDCA 3KDPA 4ZAWA 3ZD8A 3WOHA 1R50A 5I7UA 2V1UA 2BPOA 1ECFA 5ER6A 4ZQGA 3M4YA 4KH1A 4ZICA 3TL3A 4HGYA 1DX4A 1UFOA 3DFMA 1YRBA 2FPUA 3INTA 3GQBA 3A9VA 4PFJA 3UK1A 2BJVA 3WQSB 4BVGA 4KQ9A 4CM9D 4F4DA 1ISJA 1MB4A 1PR2A 1XXHB 3DMHA 1Q19A 1Y63A 1P7WA 2OV4A 4IMIB 1I5RA 2PVPA 4KVZA 3FKJA 4RZUA 3VH1A 2XECA 2O4CA 3EIXA 1RI5A 3NV9A 5L40A 4BNMA 1RLUA 2NO1A 3NCHA 4C0SA 1COWA 1ZXXA 1XKXA 3VSDA 3JVEA 4C4SA 2FF5A 2IBMA 2XY4A 3V2IA 5BN3B 3IL2A 1QVWA 2H5EA 4KN9S 2R85A 3LBHA 5H3LA 5H0IA 2YFKA 1JR3D 1SPXA 2IYXA 3FNGA 1Y37A 4YJGA 4YRCA 3THWA 4KRGA 4KR9A 4YJFB 2F8SA 3E3AA 3V8QA 5K03A 5DVZA 1KQGA 1ADCA 1IM8A 1CUWA 4UUPA 4YHHB 2CWWA 2Q5IA 3C87A 3T1VA 1G3QA 3H2JA 1R64A 4X92A 3PUJA 1AGXA 1J23A 1M0SA 1AGYA 4QDKA 5WRFA 3EVCA 2PFGA 3EUEA 4KXNA 4V0NA 4CLOA 4DV6B 2X9LA 1BCSB 4JYPA 4MQBA 4LMBA 2OZPA 3G5AA 1U0EA 1J5EB 3VH3A 3O4IA 3HGMA 4P36A 3GLQA 1L8XA 3W3AH 4UE6A 4ZAZA 2XKAA 2IZ5A 2OESA 3JATB 3VZPA 4GE0A 2O9JA 2Y8EA 4OYHA 4GRAA 1QDEA 2V5AA 4RHTA 4V0QA 3R6GA 1ZVMA 5AVJA 3B60A 2X0JA 1JHDA 3BE4A 1G7RA 4MVJI 4ZVOA 4YV1A 2G7ZA 5KNCA 3D3NA 2GEKA 1OI3A 3NWBA 1YASA 1Z26A 2L2QA 2PU5A 2HB6A 3D6HA 4PZPA 1ICEA 4DJTA 3PGMA 1IVSA 4UZFA 2D1RA 3SBXA 2B5OA 4E5PA 2R8RA 2OORC 3IURA 4QXRA 4TOIA 3T0IA 3UAYA 1CY4A 1K7XB 1U3TA 1C50A 1XD8A 1CB0A 2M6RA 1PI3A 1EGAA 1LH0A 3RKUA 3SKYA 4CI0B 5KSYA 5LLTA 3O2JA 1JHRA 5DCUA 3F1KA 2QRUA 4IVRA 4ER3A 3M3HA 3C3EA 1O9HA 2X5OA 4KPFC 7YASA 2ODWA 5CVTA 3BBLA 3KLOA 3PDHA 5DNUA 5HUQA 1JQ3A 2HN9A 2ZIAA 5CP8A 1O94C 5ALLA 1A72A 1H2HA 1ZJJA 3FKSA 4PYJA 2X1LA 4BYGA 4JZKA 1NG1A 1JHVA 3FDZA 4NFHA 5C3MA 3N6RA 3M6AA 4PS0A 3OCUA 2K7FA 1NMEA 3JZAA 4TT8A 4OO3A 5AUQA 3ZHBA 4YJ2F 1XDSA 3HE3A 2B36A 3DFZA 2QP3A 2QJRA 3ZWNA 1Z0ZA 2JGEA 3EXEB 2XUHA 3KL4A 2QIPA 5IZCA 1GPAA 4G65A 2AR0A 2BL4A 2HMAA 1E77A 4Q82A 4QREA 1T5OA 5K4AA 1K98A 5EJ6A 3F6BX 3U40A 4V1CI 5IF9A 4MUYA 2QDXA 3JQRA 3MUNA 3OM8A 1L4HA 2Z4SA 3HY3A 2O7VA 3ZDZB 4HEQA 2BEWA 1R5NA 4OUDA 4RELA 1XU9A 4BNZA 4BN5A 4ED9A 3EA4A 4AB1A 3A1VA 5C7LO 2UXCB 1RRPA 1NVMB 1TTQB 3H04A 5DYYA 1U7UA 1C1DB 4N0MA 1G98A 1WXQA 5JCZA 1R0YA 5ALYA 2CD7A 3CUKA 4OH1A 1L7AA 1MRNA 2PR7A 3UMRA 3IRUA 2ZSIA 2EKPA 1OVMA 2WLSA 3QLTA 1J5XA 3A6EA 1XZAA 4UASA 4INZA 4RLFA 2ZI9A 5KKAA 3RJ9A 1JZQA 3OC0A 4EG4A 1QP4A 2EW8A 2G77B 4MZDA 1KFBB 4LYFA 1P9OA 4WJZA 4KQWA 4XYGA 4A82A 2H2HA 5DWQA 2R8XA 1QH0A 3KQQA 4MWDA 4JR1A 3R7DA 3V1KA 1V48A 3QW4B 4KGXA 1RJ9B 1XJ0A 1CVIA 2X41A 621PA 4ZVSA 3DGFC 3FCUB 2ZRFA 1WVIA 4EJ6A 3L46A 1WKBA 2JZOA 5DNWA 1G4UR 1C29B 1VCIA 3D7SA 1G2PA 4DLXA 5AUNB 4TV8F 2CXSA 1VC2A 4LY0A 2F59A 1O95C 3CBQA 3CBGA 3A0UA 4DNPA 3NHYA 3ND7A 3CX7A 4DCGA 4PAOA 3RRJA 3B8EA 1Q83A 1TJNA 1MQAA 4FUQA 1LWNA 4MEJA 4P84A 4XTCS 1JWAB 4TLDA 4ZU3A 5DMXA 1ZGGA 1LB1B 4TTJA 3VV3A 4OX9Y 1QHFA 2XUZA 1K8QA 4ZCQA 2PKQO 4GT1A 3FPSA 2C7BA 3JAKA 2JAUA 1EBUA 4F71A 4JMLA 4HYEA 2LZ0A 2YOGA 5KQSA 2AE1A 1PNQA 2EP7A 3K16A 4K1XA 1YJQA 3T7KA 3W5DA 4HNRA 3C6ZA 5ELXA 2NSDA 5F9FA 1LLUA 4S12A 4OXXA 2H1HA 4G36A 3DW3X 5KX5F 2JKVA 3L8EA 1GP2A 3JZDA 3K6JA 5ERXA 3EZ9A 2GPAA 2QMZA 3CLVA 5BWLA 3GELA 5K3EA 1TM1E 4XUGB 3DGEC 3PUIA 4Q3AA 9LDTA 4Z4GA 1JIUA 2A0XA 1P2SA 2FPLA 1I7NA 3Q41A 5E95A 1KERA 1GZSA 1M7GA 3QFSA 2VPZA 3W5JA 2ZBVA 4DDHA 2VHZA 3SXUB 1NFQA 4CODB 2BCJQ 1CF2O 5LWHA 3SIPA 3HUDA 4E4YA 4CEJA 1NY6A 4M0PA 2HA0A 2FG7C 2R4QA 5BOVA 2L69A 3V1YA 3T7DA 1FUUA 3PRKE 4M8NE 2FSHA 2QRGA 1UKBA 3EXIA 2BY4A 5B1EA 3V1TC 5AHXA 4JK3A 1LRJA 3HEBA 2HD4A 3AVVA 4R6XA 1OWNA 4YJGB 2YYYA 3QJGA 3THWB 2LP4Y 4MPPA 3IVAA 2B82A 4KL8S 2YHAA 1ZGJA 4PYOA 3VPCA 4RQAA 4BMCA 4IWYA 4XYBA 4F92B 3U4CA 1P77A 3WGJA 2WKWA 4FNOA 5IK2D 3HB7A 1TW2A 2XVYA 4IX1A 3IEVA 3O4FA 4M0FA 2Q3FA 4ESVA 2ZTHA 4IMPA 4CN9A 3KWMA 1N7IA 5T4HA 3MK31 3VYUB 5EKTA 5T6MA 1JVNA 4YXWD 3QVJA 1BWRA 3K5PA 1SIUA 521PA 4HXGA 2V8BA 1GAQA 4QWWA 2X4GA 4CLOB 4MW1A 4TLAA 1YBVA 5KWSA 1YQUA 4L75A 3GHYA 4D96A 2B1IA 2VJPA 3EXG1 2WHYA 1Z5OA 3QV2A 4GM4A 1DZ3A 4V0SA 2Q0XA 1FDRA 4J0KA 2GBCA 2P6MA 2FN8A 3LZCA 2CK3D 3UVEA 2VDVE 3B6MA 4Y1GA 4Q9LA 2EKDA 1DAHA 1P45A 2OM6A 4ZHQB 4JJEA 1DXQA 5BSRA 6YASA 2PJDA 3ZK8A 1YDGA 1IAQA 2HSGA 1YNSA 4JP3A 3ZIUA 3QLUA 5J1SB 1ZMOA 3M9WA 4WUTA 3C14C 3Q7EA 2ODPA 2WSSD 4JT4A 4WERA 5F1PA 5A4KA 4U2KA 1Z5VA 4R1MA 2PA0A 2WFAA 2QN1A 2EJTA 3HDTA 4HFRA 3S44A 1ZC4A 3OPMA 1XA3A 4YNBA 3FTQA 2WF9A 5CNIA 3C4JA 4B9EA 1WETA 1DDOA 1JHMA 1LPAB 1U9IC 3IHKA 2XUDA 4X1YB 3ZUPA 3ZCRA 1ZN2A 3QVXA 4EHNA 3MFQA 1SURA 3EPJA 1XFAA 4EYQA 4QGGA 5LQNA 3LUKA 1E0DA 3EQ8A 3OI7A 4QLBA 3T7AA 4DG5A 2HWYA 1YVPA 4B6GA 1N2XA 3WNCA 3S0JA 1XNHA 2V3VA 1OC2A 3BH7A 3PT5A 3M6WA 3ZWKA 1IIBA 4LWQA 2H0AA 2AOVA 4DRZA 1PQ4A 3SIXA 2JEZA 3OOEA 3WB2A 4E2YA 3VPXA 3DHEA 3HR8A 3EA0A 4DCCA 1DO0A 3HKBA 2LCFA 3QVGB 2IPLA 3AHEA 5KNDH 5DEOA 3U4DA 3BMOB 4X8OA 2GF0A 3JYQA 4FHZA 1IHDA 3GD5A 3NHMA 2PXXA 2FK8A 1Q0RA 3PA6A 2OGUA 5FUBA 5KNCD 1XB2A 5AYVA 4RPCA 2VBFA 3I05A 3IIIA 2BEWB 4OUDB 4PXSA 5A0TA 1R8XA 1PLLA 3DFIA 4G6ZA 5JXJA 1KEUA 1OV4A 2IIVA 4MJXA 4WXPA 3ZWBA 2BC9A 3V5NA 3ZVKA 2W2LA 1E2LA 3MCUA 2W6MA 4HYTA 1UOEA 1NLYA 5BQXA 3W2EA 3SMQA 4TVBA 3HM2A 1MV8A 2V0GA 3Q3VA 1H4VB 3KTAA 5LD2B 3QLVA 4ETWA 4IJVA 5FLYA 2AF4C 3GF4A 3TPFA 1AA6A 3AP2A 1COZA 3AR4A 1QNFA 1TVMA 4NMLA 1R9JA 2PMDA 1O57A 3H2ZA 1LDYA 4F3NA 3QXXA 4EQZA 1SG6A 1V7CA 1Z28A 3QU9A 1P2UA 3JAWB 3GJ3A 3GL9A 1LI5A 4BX8A 4DANA 3U1BA 5FFNA 2HMTA 3NCTA 1EA7A 3CNNA 3NTRA 4DM7A 4E13A 1D7AA 3FYUC 1E5TA 3D7KA 4B3JA 2HK8A 1SXHA 3A6ZA 4N01A 4RIEA 3R5SA 1E61A 3MOGA 2IXEA 3K0KA 2C2BA 1NIPA 3SHVA 5JZ9A 5HOQA 2JFZA 4OKIA 1LFDB 3AW9A 3EIFA 4WKCA 4BN0A 4QSMA 4DQDA 2D7JA 5LP1A 4ND1A 3DEYX 3TGPA 4UTRA 2XBUA 2G06A 4UDNA 3PCXA 2P62A 1A9YA 2OM2A 3W1EA 3UG6A 1QG2A 3DV2A 5EXSA 3O3MB 1U0OC 3OPYA 3URKA 2G80A 4XDYA 3BCUA 1QF9A 2IRWA 3ZX4A 4AD8A 3G1UA 3EEQA 3HYTA 3I9KA 3JAKB 1SUAA 4BBZA 1SHTX 2VT2A 3R7LA 1H2XA 4TTRA 1E18A 1CDEA 1K9VF 3EZ7A 3VV2A 1G8GA 4PYLA 2ZLBA 4B33A 1GZVA 5DTEA 1JHAA 3BK1A 3JYNA 3SDBA 2PMBA 5CHEA 2GNPA 4ZDKA 3AJ8A 3BF7A 1ZESA 3MWDB 4ECEA 2C5FA 2PCJA 2PUHA 4H60A 4ZU1X 4NE9A 2WHXA 3EPRA 4CM8A 1UFVA 2ZBFA 3NATA 3NM4A 4J49A 4WTOA 3KJEA 2E21A 4PGHA 4Q4AA 1CUBA 1TVKA 3WISA 2VJQA 1DXYA 1XD9A 3IUBA 1F4LA 3IRVA 4L5AA 3RVRA 3ZGXA 1XN4A 4ZJUA 4MCAA 4TT3D 1SR8A 1YMUA 1CR0A 1GA1A 1XSEA 3CINA 4RZSA 3BILA 1FX1A 1KQFA 2PRKA 3I01A 2QZZA 4DLZA 2Z6QA 5JVDF 3PRYA 4XDHA 2FWPA 3RR2A 4OAPA 4BVBA 4AXXA 2J5KA 3RG8A 1O54A 1PQPA 3RJTA 1E62A 1FDIA 2WU1A 3D8BA 2WFZA 1RAGA 1DPGA 2VHJA 2HDHA 3BAFA 5EESA 3IT2A 1BVHA 2I0FA 2DH5A 1ID1A 3KLMX 4MTCA 4X6XA 2P2SA 1RXIA 1RYBA 1G3MA 1T2CA 4K6OA 4XCVA 1AU9A 2ZWAA 3OZFA 3ZGVA 4BB6A 4F38A 4CETA 2H1SA 3P0EA 1AIPA 2CXXA 4L57A 5JNWA 5EXPA 5ALMA 2ZTVA 1FMLA 1O4WA 2FUG1 3M8KA 3N0VA 1BVYF 3LCRA 1E3LA 4NYMQ 4WLFA 1DC7A 2RC5A 2DYKA 2ZT5A 4YAFA 1YDHA 4N8SA 4WNAA 2VH1A 5AQ1A 3LX5A 2VHXA 2I71A 1TMGE 3FVVA 3C43A 1UKVY 3FYTA 3A6JA 4N7BA 1MAHA 2HGZA 1Z8DA 1NQWA 1L8AA 3FVWA 2OKCA 3LTEA 5FL3A 2BEJA 2I29A 4AMVA 4ZXFA 2FHPA 2GTIA 3GDFA 3WXMA 3ZLVA 4I9NA 4KKVA 2BRUC 3CZ5A 1DIOB 4CLXA 3FTCA 1M0TA 5IULC 4UM9B 4OHVA 2JFOA 2Q1TA 5DISB 3WQQA 3CF2A 3DM5A 4MGEA 1EEHA 5IARA 2EGUA 1JH9A 1DLJA 1ST3A 1XHFA 5BXQC 5HM8A 2ZUUA 3U6BA 3U1TA 1NBIA 3I0NA 5GM2A 3H6HA 5IJ0A 2AJTA 4B71A 1K68A 1TJPB 2GAJA 4CLRA 2XMGA 3IAEA 4LSGA 4U2CA 3Q15C 1O0SA 3WYCA 4B3RB 2BWJA 3ZDQA 4FIZA 4WVLA 3BCRA 2QK4A 1JHPA 4L0MA 1P19A 3B1ZA 3HXMA 3T7CA 1BMQA 2OXIA 2D2IA 3FPAA 2OCKA 5FLKA 4CPDA 1LVUA 2HRQA 1PTJC 1YFJA 3DEFA 1MAWA 4PZEA 5AKXA 4L5YA 5AJYA 1V3TA 2QIOA 4J1TA 5FIUA 2D5LA 3GWZA 3IR7A 2C8VA 3U81A 4BKQA 3HKBB 1PO7A 1R0ZA 2QRNA 1DV1A 3GIWA 3LQKA 3MBOA 3SVTA 5JI2E 2Q9AA 2HBQA 3V7UA 1JWBB 1RLMA 2G82A 1XJ5A 2XB6A 1RADA 4KMOA 2V6IA 2ILTA 3TXYA 2GPSA 3PE3A 3VKVA 3O73A 3K6RA 4FHCA 2R86A 2DBYA 1Y9ZA 2FVXA 4JLOA 3U37A 1DBRA 4OGWA 3T1HB 2C2HA 4MV3A 4R0VA 3DFUA 4IV8A 2WM3A 4D9BA 1C9YA 1MAAA 4GYYA 3KEMA 3KZCA 1YR1A 2QQ0A 4ZV9A 5B6JA 2IE8A 1Y6RA 2XT0A 3FTPA 4UZEA 3L1KA 4X1IA 3UWDA 2HLDA 3FOCA 3VSAA 1A2KC 1J1ZA 1SQ6A 4G0PA 2XYGA 3ZZMA 1DUIA 5ECGC 5CFPA 4HO1X 1ENOA 2A7QA 4HDRB 1YQXA 1Y1RA 2FSGA 4LISA 1GNVA 4NY1A 3CKYA 4LDZA 4UPDA 4A3SA 3SQOA 4A6DA 4B6RA 4E3ZA 1A3CA 1U2GA 1L5FA 2AKYA 2RHBA 4RDXA 3TIVA 3KTAB 3I45A 1SK8A 2EZ9A 3DZBA 2O8CA 4MP3A 2GX6A 4G5XA 4DYHA 1G5PA 2VQDA 2MT9A 3JWJA 1P7ZA 2C5HA 2GVZC 2W2KA 4WOPA 2HRZA 4D79A 4IFEA 3TWOA 1NL3A 3VZRA 2O1SA 3ITDA 1K2VN 1K27A 1TJYA 3BMNA 4DMGA 4QBKA 4DSZA 4R31A 3WLNA 4B6SA 1ISSA 1M34A 5KTOA 3HVKA 1TNDA 3IVCA 4O5OA 5IFKA 4J6EA 1E1YA 2OSBA 3C24A 2NSYA 3FB1A 5REQA 3IMKA 2P9FA 1RJWA 3PR1A 2GTPA 1CP2A 2IY7A 3C85A 2UVQA 3FCAA 4UOQA 3TNDA 5CDSA 1T6NA 1FVXA 4ZO8A 5E8JA 1JMKC 2QYSA 2Z2YA 2C4WA 3B6IA 2ZE8A 3MWJA 4Z0NA 4AKGA 4X5OA 4CXMA 4BVLA 2JFVA 2YXNA 3DR3A 4KEAA 1GYQA 2I3DA 1K4MA 3DEKA 3VAZA 3C97A 4EQ6B 3DMRA 3NOXA 4Z3KA 2JBWA 1OZFA 2QN2A 4C3UA 4WXEA 5CPBA 3OPYB 3LX6A 4NWIA 3G3EA 1Y5NA 5KHAA 2FDRA 3HYCA 4Q7QA 2ZJ4A 4OQFA 3G9TA 2JGJA 4AQYB 2LD4A 1GCAA 1Q74A 3D3QA 1SOUA 2VAWA 4EVIA 2CUZA 3JWGA 3BERA 3UYKA 3D8UA 2W2OA 4XXHA 1YZKA 5LYYA 3C41J 4TWJA 4YMUA 4HLUA 1QKIA 2LIVA 4YAOA 1M72A 4JENA 4DC0A 3CMMA 5K45A 1WG8A 3TUJC 1NNLA 4BQRA 2G08A 4WCDA 2IYLD 1TVKB 4Q4AB 4MWOA 5I48A 3BB3A 2WM2A 4AJ4A 3DL0A 3UN1A 2OBMA 2EP8A 4Z9BA 2X14A 2QTZA 2EQBA 3L40A 5B57C 2I1VB 1I14A 5JARA 3M6FA 1TZBA 3H83A 4W5QA 2C00A 3ZDCA 3BKWA 3L2OB 4RD4A 1V39A 1D5WA 4Z4EA 1IQ0A 4GPIB 3W6NA 3KE8A 1QIIA 4ZKEA 5TMEA 3GJ0A 2CMDA 4DNQA 2CV2A 2ZB3A 1T5TA 1QQ6A 1Z6TA 2WFMA 3PHGA 1OAOA 4EI9A 1J0AA 3DZCA 4H1TA 5KAPA 1JJBA 1QHXA 3DVRX 1A9TA 4XH9B 3S1LA 2VBGA 4EL5A 1RC8A 1O8CA 2FPGA 3DVQX 1Y7TA 5KJFA 2P1ZA 3IDAA 2XZTA 2ZYGA 3O84A 4XX1A 4GOND 5G40A 5F2KA 2L82A 1RYDA 4YYZA 2VVTA 3UHPA 4WNAB 2PIAA 1D2NA 1S3IA 4TL7A 5JZVA 2ASVA 1BD4A 2Q2QA 2R96A 1P9LA 2B9EA 3NBQA 3AIIA 2WY2D 2P69A 1GQQA 3AUUA 4JKIA 5GONF 1Z5ZA 4J0HA 4K28A 3STXA 2UXBB 1KDPA 3AFHA 3ONFA 1HH4A 1UKZA 2VXOA 2E18A 4FXOA 2B2NA 1UP4A 2WIDA 1M2WA 2WAXA 3DE2X 4IDAA 4IRUB 3N05A 4HN2A 1CUJA 1DEKA 2ZKLA 4MW7A 2ID9A 4TMTA 1QG6A 2I34A 3UK0A 1T0JB 3G9ZA 3GCGA 3L6OO 2GD2A 1XZJA 3AY7A 3WYAA 2ZDHA 2ZB2A 4ZYXA 1QIJA 5TARA 3KIPA 1GU1A 2OV1A 5IJ0B 1NQOA 4G0ZA 1URPA 1JB1A 4XR4A 3OQHA 2ZI7A 2YW2A 4LTNA 4CLRB 4CKWA 2IYYA 4KE6A 3WGTA 4IKEA 2PD3A 4JUIA 3COJA 1J9EA 3CUYA 1CQIA 2DHEA 3FX2A 4JT2A 3BWMA 1XRJA 2WJ3A 4M9UA 1FSZA 4PGGA 5PGMA 4AM8A 1W0CA 2AJ8A 3BICA 2QN6A 1WA5A 3VZDA 3TM5A 4CBVA 1BDMA 1Y42X 5DGTA 1AQLA 2CNBA 2CBGA 3D6NB 3I32A 1DINA 4M7RA 2VPWA 4V0MA 3S8MA 1ZICA 5BUZA 5HKKA 2OGTA 4GDFA 5JXGA 5KHLB 1Z7EA 4EGCB 1QQ7A 4BFTA 1VECA 5DHRA 1L7NA 1TAUA 1K7SN 5B4VA 5THQA 1WPRA 3SFZA 1KVTA 1X1EA 4DG9A 1EQUA 3OSUA 3MT9A 3VYTB 3ZWAA 5I4BA 2HXSA 1EUYA 1KJNA 2WYHA 3C6KA 4MRNA 4F85A 1KY4A 1Y98A 2AQ8A 4K86A 5KMGA 4D9JA 3KOWA 3TRHA 3UAGA 4AUKA 2B3DA 2OY0A 1ADGA 3PJRA 2ZYTX 1X42A 3LDAA 3B85A 2R48A 1WSAA 3N59A 4CKEA 4D4GA 4YUAA 4LMAA 3D0OA 1HZZA 1YI8A 2CLHB 3KX2A 4YONB 4OLBA 1U0NA 2PS0A 2I55A 1OGIA 1VL2A 2CZGA 1IJKA 1PFWA 1E6UA 2ZTUA 4WZZA 5CMLA 4IZ6A 4LTDA 1NUQA 1TQDA 1RQPA 2A5GA 4OM8A 4PYMA 5TPWA 5L7TA 3LPCA 2O8CB 2QL5A 2KJQA 4NX2A 3EVDA 2W2KB 3MEQA 3VO2A 1JNXX 4DNOA 4LZOA 1WU8A 3DOIA 4WOCA 3BMNB 4YQYA 4WBNF 1E1QA 1ECCA 3AM1A 3D5EA 5KBYA 1PYOA 5DK4A 3F5SA 2QX6A 1HE8B 1Y4ZA 2QNRA 1S0UA 2P9QA 3BXPA 3EMDA 4WXYB 3UV3A 4GX0A 4G24A 1T3TA 1YS2X 4FEEA 2QORA 3LF2A 2WJ4A 1TZMA 1XTBA 2ZYHA 3GJ7A 4M9SA 3WNQA 1J1IA 4KJZA 3DTVA 4GW3A 2PL3A 3VR5H 3BWXA 4CM4A 4CR7A 3PQCA 2CY0A 4ND3A 4XCQA 2BVNA 5TPZA 3WLRA 3ZE7A 5HJ5A 4JLDA 1I6MA 3OX3A 3S4YA 1SOAA 1G5RA 3C7CB 3FAZA 1OYWA 2ZB7A 1ACJA 3RCBA 2HC9A 3IQFA 1E9DA 4KXYA 2Q27A 3C5WP 3PCTA 4MVWA 1M74A 1X39A 5EEHA 2DXIA 3V32A 5D1HA 4D1YA 4DCUA 3V3KA 3S70A 1FW6A 1TO1E 4PC1A 3RS8A 3U3XA 3EDOA 2P2DA 1ORDA 5KDOA 5KTMA 4QECA 3L8MA 3AF6A 4ZVNA 5F1KA 1VI2A 2E4YA 1T25A 3RS0A 2ZYDA 3IKJA 3KB6A 4PCUA 2VLBA 3CH5A 2JGFA 2PZMA 3GUZA 4MROA 4BU0A 2DR3A 1IUNA 1ODSA 5JFTA 3IUJA 4DGSA 3BZWA 3NTUA 3OE5A 4QUAA 1OVGA 1G7TA