3DLTA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 85
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dltA00
3VISA 2IITA 4MWTA 5E4YA 1SFRA 3WMRA 1QTIA 2WUFA 2WJ6A 3DS8A 2WIGA 2H7YA 1ORWA 3LLCA 4ARBA 4C6HA 3G9XA 4X85A 3R3XA 3AIMA 2XE4A 3DKKA 2XQJA 2XUFA 5A7GA 5KBYA 2YH2A 2QUBA 1DT3A 4NMWA 3D0KA 5AM5A 3VJLA 4RPCA 4X71A 3BWXA 3AUKA 4HXFB 3D5EA 3A6ZA 3F98A 4J0HA 4M0MA 2R8BA 2DHEA 1CUZA 1XRRA 5AKYA 4MJ3A 4KAJA 1ZD4A 1IMJA 1P0PA 2C5GA 2DQZA 4PSCA 5KWJA 3FYUB 1QIKA 5J3JA 1Z68A 2PSFA 3HJUA 5K3BA 2ES4A 3IIIA 1EK2A 4L3WA 3I2HA 1A8QA 4UFNA 3C6BA 2ACKA 4DM7A 5SYMA 1WB6A 1F6WA 1EHYA 3ICVA 4Q3OA 2QOEA 4Y2UA 3F8SA 3BIXA 3ED1A 3PF8A 3M83A 2HFJA 2RONA 3IBTA 4H18A 4G4GA 5HF8A 2EEPA 3IUJA 2J3QA 3RKSA 4BZWA 3T52A 1IZ8A 3FYUC 5SYNA 1THGA 3FNBA 2B61A 2OAEA 1BCSA 1LBSA 4KE9A 3R3ZA 3V1MA 2WLSA 4OCZA 1NU6A 1VZ2A 1RYYA 5DWDA 1E8NA 4IHAA 4DNOA 3G9TA 5T4BA 5ISMA 5AKIA 3ZLVA 1XFDA 2BCEA 2HA5A 1EX9A 5JIBA 3W04A 4Y2XA 4QZVA 1DWOA 5AK5A 4P08A 4OU5A 4X00A 2BJHA 2WJ3A 1WPRA 5AIAA 1VE6A 1MAHA 1X2BA 2PBLA 4O08A 2E3JA 4MEAA 5DYYA 4DYHA 3TJMA 2VA9A 4F5ZA 3H2KA 2XB6A 2Z8XA 1VXRA 3IUQA 4FMPA 2CJPA 4MQLA 1CIJA 2V97A 2W6CX 4KJXA 3SX4A 2RHTA 4BP9A 3VVLA 2GBCA 5AKXA 4BATA 4HTAA 4NS4A 3K6KA 5AM3A 3FYTA 3KWFA 1CUIA 4Q34A 4BC0A 3E3AA 2OG1A 1J07A 5FLKA 5AK6A 3ESDA 3W9UA 4TPKA 5AOCA 2WHRA 2XUDA 5EFZA 4WY8A 1ETHA 1XRMA 3FLAA 1UZAA 4YK7A 2VEOA 2Y6UA 3GZJA 2JGEA 4CCWA 3AIKA 5A7FA 3O95A 4FNGA 5D6OA 1TKRA 1OXMA 2WHQA 5AH0A 4EY4A 1E8DA 2P8SA 4B83A 2K2QB 4QEKA 4OPMA 1GT6A 2QS9A 2AJ8A 3FOBA 1SC9A 2XQGA 1XKLA 3K2IA 1QO7A 3KOOA 3HYSA 5ALPA 5JD6A 3D3NA 2ZYHA 4FLFA 2ZVDA 2QMQA 2HA4A 4QA9A 2I3DA 4KE8A 3WK9A 1T2NA 3GROA 3EQ8A 4CCYB 3F97A 2IIVA 4KRYA 4AO6A 4LYDA 1UK8A 3G9UA 2WHPB 3WWCA 2I78A 4CG2A 1CFJA 4QDZA 2WUGA 1CUYA 1OILA 5AKLA 3PUIA 5C7YA 2YASA 5HKAA 4Q1VA 5ALZA 6YASA 1JMYA 3O4JA 3KD2A 4ETWA 3WA6A 1G4HA 5JAOA 4ROTA 4K6GA 2GZRA 3WWEA 2HRQA 4LHEA 4C4XA 3R40A 4AQDA 5AKEA 3H1BA 5I9IA 4Q3LA 1LPMA 1H2ZA 4KACA 4KE6A 2RHWA 1CUVA 4F60A 1AUOA 4E15A 4H7HA 1DU4A 4J0DA 1X2EA 5CW2A 3IULA 1AGYA 1LZKA 4AMZA 1UKCA 3H2HA 4PQEA 2XLBA 2Z8ZA 2BGNA 4KAFA 4NVRA 4Y2JA 3O9MA 4UUQA 2XMZA 4GW3A 4AXBA 4EY5A 2BKLA 3BL8A 4EB0A 2OCLA 4QWWA 2PUHA 5DYTA 3WKDA 1DX4A 1L7AA 3FLEA 1XZJA 2XUKA 4M0FA 2GBIA 3N0TA 3HLKA 1H23A 4ZRDA 5F4ZA 3V9AA 3R3WA 4C4YA 3CXUA 2WIDA 4FDMA 2X76A 3ZI7A 1Y37A 1YCDA 4GECA 3G9ZA 2HHAA 1XZHA 1QIMA 1ZJ5A 3DCNA 1EDDA 2AJDA 4L72A 3W06A 1GGVA 4G8DA 1CLEA 2Z3WA 1L7RA 3ZWQA 1XZKA 1JU4A 5ALSA 1R1DA 5D3ZA 2J4FA 4QDTA 3O4IA 4HZGA 3GA7A 3E0XA 1Y7HA 1XZCA 4UBJA 5ALJA 1VA5A 2WUEA 2JEZA 1LPSA 2WM2A 2C0PA 1BEEA 1SCQA 2ACEA 2QR5A 4GBGA 3WL5A 3YASA 5ALGA 5AJHA 3WQHA 2WIFA 5AK4A 4BAUA 5HZGA 1JT2A 5CURA 3HZOA 1UKBA 5EHXA 3QH4A 3QPCA 4G9GA 4UHBA 4QLAA 3JW8A 3FBWA 2RGUA 1ACJA 1ORVA 1CUUA 1ZIXA 3NOXA 2JGKA 2BAGA 3I6ZA 5CXXA 2RIPA 4TGLA 4AMYA 2OGTA 5EHQA 4KRXA 1F0PA 3G0GA 1YA8A 3ESCA 2VJCA 2FJ0A 2OCKA 2Y2UA 4OB6A 4QLOA 4LXGA 2HRRA 3EIOA 1W75A 3JYHA 4CIBA 3S2ZA 1ZGCA 2ZYRA 5D7BA 1GKKA 1VE7A 4AO8A 2V9ZA 2V96A 2XQFA 5K3DA 3O9VA 1XZDA 2VAVA 2O2GA 1YA4A 3HSSA 1ODSA 3NUZA 5DJ5A 3AFIA 1IZ7A 1UOOA 4UHCA 2PSHA 3A70A 1DWPA 1CPYA 3G8YA 5EIAA 1OCEA 3I2FA 4N8SA 5BWCA 3P2MA 1GXSA 3AIOA 1FFBA 3V1LA 5ALOA 3V48A 1XRLA 1KU0A 2QUAA 5AI9A 3IVMA 3L1IA 1X70A 2D5LA 5JASA 1LPBB 5K3CA 4YPVA 2WG1A 1QONA 3B3QA 4MEBA 3A2LA 1XQYA 2DQYA 3C43A 4PF1A 5JATA 2Y1KA 2XUAA 1EA5A 2HA7A 4W63A 4KAAA 2O7RA 2VT6A 3WKEA 5FV4A 4KR0A 2FJPA 1K63A 2HM7A 1S8OA 5T4HA 1CUXA 1VOTA 3C5WP 4A23A 1EDBA 2HA2A 1HL7A 2JEYA 2XUGA 1N5RA 5AOAA 3DYIA 1CUFA 5HQ3B 3OM8A 1CUBA 1KEZA 1MO2A 3LP5A 4FFWA 4RE6A 1YS1X 2C5FA 4QE3A 1XQVA 3OG9A 3PFCA 1ODCA 2WKWA 4F0JA 1BRTA 1THTA 3D2AA 5K3FB 1P0IA 3AILA 5LZ4A 4DNFA 4K5QA 4Y2QA 1IUOA 1U65A 2VSQA 4WJLA 5FXMA 2OAGA 3QMVA 3FSGD 1D07A 4HS9A 3FSGA 1XZIA 1TK3A 1GPLA 4EY7A 1EB9A 5IVKA 4DMFA 1UWCA 1NX9A 2W22A 4H7IA 2XUPA 3WKBA 4OUKX 2C7BA 3M81A 2PL5A 4U2BA 2GZSA 4J7AA 4TVKA 1GQRA 5DLPA 2OGSA 1BN7A 5CRIA 3VJKA 3I6MA 1E66A 1QOZA 3KWJA 2G5PA 2FUKA 4BYMA 4UHDA 1B6GA 3QVMA 3C6ZA 4JYMA 5IVDA 1TRHA 5T4FA 3WK5A 2HU7A 3R0VA 2AXEA 4I3FA 1CQWA 5CMLA 2JBWA 1CRLA 4AN0A 1K4YA 2BGRA 3EBLA 1O6FA 1E3QA 2XUJA 5YASA 1QIIA 2AJCA 2DHCA 5AIBA 3PUHA 1ODTC 5BV7A 2QXTA 5LKAA 1N5MA 1DQZA 3TEJA 4B6GA 5IH7A 1I6WA 4U2FA 5AI0A 1EB8A 5JD5A 2FX5A 2XUHA 1J1IA 3QITA 4UHHA 2WIKA 3C87A 5H3HA 4CFSA 4J0GA 4EZIA 4BTVA 4MQMA 3H1AA 4Y2SA 4I4CA 1PV1A 4X95A 1USWA 4FBMA 4RGYA 5ALTA 4WCVA 1QJ4A 4B84A 2XQIA 5K5EA 5ALRA 1TCAA 3WKAA 4X93A 1UFOA 1TCBA 1JJIA 3STTA 4Y2PA 5E4TA 2Y6VA 3Q8WA 2G5TA 1C7IA 1HPLA 1SCKA 5FDFA 3HACA 5FPQA 2RI6A 3CN7A 3F67A 4LXHA 1ZOIA 4BE9A 2ZSHA 2CUTA 3WJ2A 1P0QA 2HFKA 3PFBA 1FFCA 5ESRA 5K3AA 2HIHA 5CT9A 5FP0A 1SOMA 3DD5A 4UFOA 3VDXA 3NWOA 5FUMA 3I6YA 2HDWA 4WDQA 1XZBA 4EBBA 1VXOA 5C8ZA 4FHZA 4ZV7A 2UZ0A 3ICWA 2BUAA 4Q05A 4P9NA 3G0IA 3L1JA 5BWBA 4H7FA 1XLUA 3QMMA 3DNMA 5A71A 2O7VA 1Q0RA 3JWEA 5CTAA 3G0DA 4RE5A 2XMCA 1A8UA 3A2MA 3C8DA 3C8HA 3OURA 1XZEA 3PICA 4BCBA 5C8XA 1LPOA 1TIBA 2VJBA 4JH0A 4ZREA 4W1QA 4FBLA 5KREA 4IH4A 1EK1A 4FFVA 3H2JA 2VJDA 3DJYA 1J06A 1HQDA 5EIEA 4KYVA 2CMFA 1EH5A 1ZD3A 3ZPXA 4S0XA 5EIHA 4Q3KA 4ZWNA 1BROA 1B41A 2I3ZA 7YASA 2HA0A 4BZZA 3M3DA 2WUDA 1QIHA 2DCMA 1CEXA 3D7RA 4AZ3A 5AKHA 4AB1A 1FFDA 4BBZA 5LP1A 2C0QA 1JU3A 3WL6A 3SK0A 5ALLA 5CH3A 1FFAA 5I7UA 2XMBA 1U2EA 4DNPA 3OOSA 2CBGA 3I2GA 2CZQA 4HXGA 3V1NA 2WU3A 5AP9A 5IKXA 1TCCA 5C81A 2X8BA 4BAZA 1L7QA 1XQXA 1YAJA 3RARA 1QIDA 3MUNA 5AM2A 1LNSA 3AZQA 2G63A 4J03A 2ZYIA 4OU4A 3WWPA 2JGLA 3H19A 4UHFA 3BE8A 5AI5A 1XZFA 4N8EA 4G4IA 1UKAA 1XZAA 3CCCA 4H0CA 5JD4A 3WK6A 4JEIA 5ALNA 2NW6A 4BDSA 5JYCA 1CR6A 4J3JA 3GUUA 1EVQA 1RWQA 4GWLA 3R3VA 2OLEA 4HRYA 3QYJA 4J0JA 4GI1A 4MYDA 4J0IA 1VJ5A 1K8QA 1YR2A 5DNVA 1Q83A 2H7XA 4G4JA 3HABA 4BVJA 2CKMA 3DOHA 1GKLA 1F8UA 3T4UA 2QJWA 1LGYA 3Q0TA 4X97A 2B20A 2H7CA 3STVA 3WJ1A 2AJBA 1MX9A 5AI6A 4HRXA 3O4GA 3BXPA 4Y2RA 5AOBA 3OTQA 2HU8A 1J2EA 1E89A 4G8BA 3IUMA 4IH1A 1K5PA 2O2IA 1CUGA 3I1IA 3PI6A 3WK7A 3C45A 4N5HX 5AI8A 2VQ6A 3W9BA 5FOQA 5A62A 3ZLTA 2OCIA 1XKTA 5JAPA 2JGJA 4KEAA 1LZLA 4A16A 3PE6A 4UHEA 1AURA 3D2CA 1WHSA 3WWDA 5HK9A 1BE0A 4EY8A 1H22A 4Y7DA 3STUA 2EDAA 4IQ4A 1C7JA 4C01A 5BOVA 1WM1A 3LIIA 4X90A 3DDUA 3S8YA 1QIFA 3BF7A 4UPDA 4AN1A 1ZICA 3F96A 1FFEA 4XJVA 1HKHA 4Y2TA 3BIWA 1YS2X 1CQZA 3VVMA 2PX6A 3EF3A 1R3DA 2VF2A 1WPXA 4B85A 4BP8A 4RNCA 2XMRA 3ESBA 4WFJA 1LPAB 1XLVA 3MUOA 3OPMA 4OB7A 4U2GA 4ARAA 4G5XA 2C58A 3MGAA 2DFPA 2PSDA 1DTEA 1MTZA 3WLAA 5ALFA 3WKCA 2ZJ6A 5CT4A 2X5XA 4PSUA 1GPNA 3KDAA 2ZYSA 3C6XA 1JKMA 3ILSA 3RM3A 2XT0A 3LS2A 2WIJA 1ZI8A 2BUBA 2QM0A 4DMHA 3LCRA 4OD0A 5AO9A 1BN6A 5ALKA 5CH8A 1EXWA 3C70A 5I8PA 5HCUA 4EUSA 1DWQA 4XVCA 4WDRA 2ECFA 4ZI5A 1LLFA 4V2IA 4DSZA 3WYDA 5CT8A 5EHZA 3FWHA 1WB5A 4B82A 3W05A 1IUPA 3DLTA 1R9MA 2B9VA 2JIDA 3AINA 1QFSA 1GQSA 1QO9A 5CH5A 3BJRA 5LIPA 5AKGA 3SC2A 2J4CA 4QDOA 2WSLA 1VLQA 4OSEA 5DTIA 3EQ9A 4DNQA 4PSDA 2HA3A 4WFIA 1QIGA 1AC5A 2Y2VA 1YB7A 1DT5A 3WL7A 4E14A 4UBOA 3IB3A 2QRUA 1G5FA 4MWSA 4LXIA 1H2WA 3SWWA 4CG1A 1QIJA 4BAGA 1BEZA 2AJLI 5A6VA 4QNNA 2Q0XA 3IURA 1XLWA 2GYVA 5T4EA 1CUHA 5A2GA 5CBKA 4JNCA 1W1IA 2HL6A 4C87A 4JUIA 1EINA 1CV2A 4DLNA 5HF9A 2GBGA 4UBLA 2ROQA 3W2TA 1LPPA 1MAAA 5LZ5A 2XI4A 1BU8A 1JFRA 2D0DA 2VAXA 4GDMA 2IX9A 4KE7A 4EY6A 3B5EA 1FSSA 1CUSA 3WIBA 5EI5A 5CT6A 1PJAA 1W76A 4UBKA 4W1SA 2XQKA 4M0EA 3I2JA 2OPHA 1XZMA 4CG3A 4UBMA 4BDTA 5ALMA 3STXA 3AJAA 3VKFA 1W4LA 3WZLA 5LZ7A 5FPPA 1A88A 4FTWA 3HI4A 3QM1A 5AKKA 2ORYA 3GELA 1W52X 1YASA 4X94A 4X3CA 3PF9A 2WILA 1QZ3A 4A5SA 2I03A 4WFKA 1F0NA 3FVTA 3STYA 3C6YA 1UK7A 3WIOA 1VA4A 1SCIA 1TAHA 2ZSIA 3FAKA 1P0MA 3CCBA 1UK6A 2WU4A 4Y9SA 1Y7IA 1QIEA 3DKRA 1UOPA 3WL8A 2DHDA 1QFMA 1XRNA 4Y2YA 4PNZA 1PFQA 5FRDA 4OYYA 5AKJA 2XDWA 4G9EA 3M82A 5JADA 1XROA 4H7DA 2GYUA 1H2YA 1YSCA 1AMNA 3G7NA 1MPXA 1QE3A 4ZXFA 4EHBA 3TRDA 4ITVA 1LPNA 1G42A 1R50A 5JZBA 3EQ7A 2C4HA 3O0DA 4L9AA 3IUNA 3WA7A 4GLBA 4W1RA 2BUCA 1AZWA 4CCYA 2JGIA 2WFMA 3KSRA 4B81A 5DNUA 1XZLA 3HEAA 3FVRA 4B9AA 1WCYA 5KWIA 2WHPA 3H17A 1MN6A 3MVEA 1VKHA 3F9CA 1MNQA 3N2ZB 3D2BA 4IH9A 3R3YA 3I2KA 5IVIA 1UXOA 2XLCA 4FOLA 2PPLA 3H18A 3I1YA 4Y2VA 5EGNA 4BVLA 3HC7A 3D4LA 4X6YA 2PUJA 4GEGA 1AQLA 5CT5A 1N8SA 1ZJ4A 2ZJFA 3KXPA 1T4MA 2PM8A 1Q84A 1NU8A 3DQZA 1MX1A 3BJMA 4MXDA 3U0VA 5AICA 4B80A 1MT3A 3NGMA 5K3EA 2J3DA 3ESAA 3VJMA 3WI7A 1AX9A 4FLEA 1UOQA 2WG2A 4EA6A 1E5TA 2V98A 4BVKA 2BFNA 4YASA 3R3UA 1CUDA 4C89A 4X7BA 3WWOA 1YB6A 4XX1A 3D59A 4B0PA 3V1KA 1GPKA 3WYNA 5DTJA 1FJ2A 2PSJA 1MX5A 5ALWA 4DSAA 4X6XA 3FLBA 3GBSA 1JI3A 3DL7A 4QDUA 1CVLA 2VATA 3QMWA 4B7ZA 5AM4A 3DYVA 1A7UA 4CIAA 1QGED 2PSEA 4WY5A 3UMJA 2RAUA 1UK9A 4GHWA 5AI4A 1RP1A 2EDCA 4PV7A 2YYSA 5AHXA 4K2AA 4UBNA 3DOIA 1WOMA 2OGZA 5AKZA 1HDEA 5IVHA 2R11A 3G02A 4BRZA 2XUQA 1UT6A 1A8SA 5HK8A 5AM0A 3TGLA 1DX6A 1ZD2P 2PU5A 4NZZA 4PO3X 3ANSA 2O2HA 5LZ2A 1N1MA 1ISPA 5ALUA 4FKBA 2WFZA 1LBTA 2PVSA 3DEAA 2OCGA 5C8VA 3H04A 3H2GA 2DSNA 4FWBA 3QPDA 2OQVA 4U2EA 1ZGBA 4OYLA 2VT7A 4G1FA 4J0CA 3QZUA 2QVBA 4DMCA 5HF5A 4DTCA 1MNAA 1HLGA 4E11A 1XRQA 1MJ5A 5LLSA 2YXPX 3ANTA 5ALXA 1VZ3A 2XMDA 3H2IA 3I28A 5A7HA 3ZLUA 1CUWA 2JF0A 2WQZA 1XQWA 3UUFA 1GZ7A 1ACLA 1CUAA 5JANA 2WFLA 1K6EA 4G8CA 4BC1A 2B4KA 3H0CA 3FCXA 1H2XA 3FCYA 4ZGBA 4J0KA 5FKJA 4DGQA 5JZSA 1R88A 2QTBA 1ZIYA 4FLMA 4H77A 1DINA 2G4LA 1JMKC 4W1PA 3VXKA 3UUEA 3IA2A 4C4ZA 4N8DA 1EVEA 4MYSA 1C4XA 1DQYA 5AM1A 3E1GA 5ALQA 3AZPA 3BDIA 2XUOA 1CUJA 3IDAA 4DIUA 1W6RA 4D9JA 2CEKA 3ZV7A 3RLIA 5CXUA 3QPAA 5JAUA 4AX4A 1HBJA 1M33A 5E2IA 4INZA 4UFPA 4K6KA 1Q0ZA 2WTNA 4H7EA 4XIIA 2WJ4A 1CUCA 4Q82A 2WTMA 3R41A 1JJFA 1QTRA 2Z3ZA 4BTLA 3CN9A 1MU0A 1BS9A 5ALYA 5ALDA 4ZV9A 4I19A 2DR0A 1TQHA 5JARA 3HXKA 3X3HA 4B9EA 3STWA 1CUEA 4F21A 4AO7A 5JAHA 1R9NA 2H1IA 1EDEA 4H35A 3BF8A 1WB4A 4X92A 2LIPA 1IVYA 3O4HA 5HQ3A 5EHNA 3BDVA 2QZPA 4L0CA 2XMSA 3DL4A 4CI9A 1ZI9A 5LKRA 5K3FA 2QKYA 4X91A 3I2IA 2QXUA 5ALIA 2QT9A 4PW0A 1YAHA 4LKOA 4U2CA 3PDCA 2GYWA 3WZMA 3GFFA 4LYEA 2GBFA 5AK3A 5E4JA 1U4NA 5DNWA 5HF6A 4BE4A 4BCDA 5JZ9A 1XRPA 4LIPD 2OQIA 3B12A 3RK4A 4X6UA 2OXEA 4HXEB 3G0CA 5JALA 3OC0A 1BCRA 3FYUA 5DYWA 3LIPA 3QBJA 3E4DA 1XZGA 4YX9A 4Z49A 4OB8A 4H7KA 2WFLB 1EI9A 1IUNA 2PKYX 2XMQA 5LYYA 3G0BA 2VJAA 4QDXA 2JGFA 2QJRA 5LZ9A 1KU6A 2WG0A 2CB9A 5HFAA 1ZD5A 5D3KA 2XMGA 1O6GA 2JGMA 1JJBA 3AZOA 4HAIA 2Z5GA 1AKNA 4H7JA 4E46A 2PU7A 4GXNA 2XUIA 5ALVA 5HKBA 3C5VA 1G66A 4IO0A 4W9RA 4K6HA 4N5IX 5HFNA 3WK8A 4UBIA 4B0OA 4DMKA 3WK4A 5ALEA 4AZ0A 4P93A 2ZJ7A 4QWMA 2HA6A 2H9YA 2HU5A 4U2DA 2HADA 4XWGA 4FNMA 1ZI6A 1WHTA 4C88A 2ONCA 1QLWA 3L1HA 4JYPA 2VTVA 4P92A 4BB0A 5ALHA 3A2NA 3K9BA 4HVTA 3HRHA 3U1TA 4BRSA 1E8MA 1R4ZA 4BCCA 5LZ8A 1U8EA
chains in the Genus database with same CATH superfamily
4H31A 2CCKA 3VISA 5KZMB 1E5VA 2ZJZA 5E4YA 1BMTA 3IJPA 4G23A 2QV0A 2MU1A 1Z8HA 2OSBA 2JFPA 3I0NA 1OH5A 4C2UA 4RWZA 3P9ZA 2WUFA 3PC7A 1QR2A 1UJNA 4IJWA 4KQEA 3SS8A 4LHSA 4AG6A 4BP1A 3ZGLA 4FUTA 3ZCUA 4EF5A 3LK7A 4FFDA 2O2JA 5KC9A 2Y0CA 2G9RA 2RG1A 3DVAA 3QTBA 3LLCA 3LHSA 1QDUA 1EU1A 1XTSA 3JATA 1UDCA 3CEPB 3KJIA 4K9QA 4IQ0A 5EESA 2OMKA 3USCS 1PQUA 1J0DA 1Z0JA 4BFCA 4ZDKA 1UBLS 5HUQA 3AY7A 5F7JA 1CRPA 2RC6A 3F0TA 3GJXC 2F3PA 3G49A 1NJ1A 2B99A 2X5KO 3HA2A 4JSTA 2XE4A 2D1RA 3IAHA 2YW9A 5K0FA 5L8VA 3KTOA 2BOVA 4I4IA 4I4TA 2I6FA 3E9EA 4G24A 5DX8A 2XITA 3G6KA 2B35A 4NU5A 1WZ2A 1M72A 2DR2A 2XQJA 2XUFA 3H86A 3A9TA 4PR0A 3ZIDA 3AONB 1H2RS 3TRHA 5A3RA 3ESQA 5ENZA 3DE3X 1DT3A 3ELBA 3HXLA 1DZ3A 2C9DA 2G09A 4REOA 5DCYA 2WT4A 3OIVA 4G3XA 1AHPA 3OEED 1CWUA 4LF5B 4GMGA 1FU8A 4YROA 3Q88A 2KJQA 2W7TA 1X9GA 3AUKA 1A96A 3R4CA 4N0EA 4RMHA 4JU8A 4KQWA 3A6ZA 3VMFA 4BNGA 4MW4A 1FPQA 2VNSA 5EE9A 5ICSA 3AERB 1AE1A 1XL1A 4LKRA 4Q3AA 3UTDA 5FWYA 4ND7A 1ECJA 3GLIE 1HDCA 3I4CA 3KZMA 1G6KA 3MTQA 1CSEE 2FPMA 3KQSA 1PRYA 1ZN8A 3BILA 3RD5A 4BO9A 1U1GA 3NHBA 5AKYA 3ZD6A 1JQ3A 1S1CA 4Q5IA 3ND9A 5TE9A 1ND6A 4MJ3A 4ZU6X 1ZD4A 4Q15A 1WG8A 4YEDA 1CR4A 3RAGA 5DWQA 4DVGA 5K8UA 4AY2A 1Z12A 4RL4A 1ECPA 3TXXA 2LGJA 2PRJA 1P0PA 3OSZA 5EKUA 1TYAE 1E2DA 2OZLB 3RTAA 1AG9A 1JDTA 1PIWA 3HUEA 3D81A 2CVPA 3MRSA 4Y1RB 4ZU1X 3SJBA 1QCDA 3GU3A 1PL7A 4NH0A 4X64B 1QCCA 4EMTA 2HHLA 5J4LA 3AM4A 2AOUA 3FYUB 4Z7NB 3BG5A 5J3JA 4MUNA 5JTUA 5KWSA 3WLOA 3HUUA 4ZD6A 4A8JB 4EMUA 2YMPA 2VDJA 4RCVA 5LVAA 3AV0B 1RXWA 1YU9A 3EOBI 4JLUA 5JEEA 3EDOA 1RFLA 4JMPA 5CD1A 2VPYA 5HFJA 2H1WA 3WR5A 5LWQA 2ZRPA 4A1OA 4KO1S 1I4WA 4NYJQ 4BASA 1L7VC 1V35A 4J07A 1A8QA 2P5UA 1J0XO 4R0MA 3A3PA 4YCMA 2VHXA 4UHJA 4IJ6A 1RYEA 4QYIA 2OAQ1 1YR9A 5IWAB 1VI6A 1WETA 3NP7A 4O4JA 1P2DA 3KSZO 1V8DA 5GP1A 1UBFA 1SCUB 1RM5A 1XF1A 2VZ0A 2WIAA 3JS5A 3KAPA 4GOOD 1XO1A 4HD8A 1EVJA 4MP6A 3TJZA 1KFEB 4UKDA 5TPWA 3IDQA 1P2BA 1B6SA 2I1LA 2QOEA 4O8ZA 3DBVO 4O2BB 2VZEA 3GWZA 4PTLA 3DHYA 3R0JA 4QECA 3B1FA 3HP4A 4IJUA 2JFYA 2LKCA 3GHHA 3NWEA 5GIOE 3TK1A 1X7DA 2GR9A 2OGWA 2RBEA 3MLEA 1EFRD 3VZQA 1F2DA 1SJ9A 2IYAA 5A0TA 2OBNA 2F1JA 4BEWA 4LJ5A 3TH5A 2AKAB 5KUTA 4PG6A 3B1KA 2EEPA 4QJ5A 2P2DA 2YWFA 3EPJA 2JA2A 3IHTA 4QXMA 4BUZA 1I9GA 1ZISA 1EZZA 1X19A 1TECE 1DBQA 1THGA 2Y1LA 3Q85A 4ZTUB 1YRAA 2FXVA 2J0EA 1LBSA 3OCCA 4PAOA 4PZYA 2WF6A 3VKUA 5GIPE 2WLSA 3HNPA 4HI0E 2KSQA 2XB9A 5A02A 1AO3A 3KOMA 1GRNA 2PYZA 3JQ8B 1E8NA 4IHAA 4H27A 4DNOA 3LJKA 5GVRA 1WQ4A 1NFQA 2ZXEA 4EG3A 1IQPA 3VHRA 1T3SA 2NZWA 4ZOLB 1Y7TA 5THKA 4GQAA 4CMJA 1KL7A 5AVVA 2ZAGA 1P45A 1G18A 3P9XA 4FD2A 4D6YA 4TYYA 3TL2A 2IW3A 2FPGA 1FXUA 2VYVA 3QFFA 4MRPA 4AK9A 4P86A 3U4QB 1JI0A 3ONVA 1RXUA 2JI8A 5I7HA 2QTAA 2YJZA 1UPUA 4DWVA 5IASA 1KTVA 4X00A 2BJHA 4P8RA 5BUSA 4L5BA 2WJ3A 3E9MA 2PQ2A 2QRMA 2ZYAA 5FOXA 4LCBA 3HJNA 5E7MA 5JDCC 1GGMA 5AIAA 4WZAA 4ZT6A 4J7UA 1MAHA 1KJQA 1RQNA 1TM7E 3IV6A 1VL6A 3OD1A 1JJVA 3CQ9A 3GEHA 3HVUA 1J9ZA 3W77A 2AQHA 2HXGA 4GC9A 4ZCIA 4O08A 3EPPA 4P22A 4ZEMA 4OHUA 3QLUC 5EKXA 1W581 3B7GA 3D8RA 1GJRA 3OEHD 3HVIA 4CZ2A 1H8ED 3CX6A 5EQFA 3TJMA 4DYHA 4ERNA 3WNQA 3JZMA 3HB5X 1TPYA 4GVXA 3OQVA 2HHCA 2WAYA 3H9QA 5ER6A 1BH6A 3H2KA 3U80A 2ZYVX 1VPWA 1SQ5A 2NO4A 3NT5A 1MVNA 2BP7A 3P0IA 5BR4A 2XGMA 4IRXA 4C22A 3SC4A 3IUSA 1CIJA 1YKSA 2O1XA 5BV0A 1U4SA 2BFEA 3L06A 2QQFA 1XWIA 1G8KA 1D5CA 1YRQA 1KE2A 1GCOA 4BV3A 5AW2A 1U8AA 1DI0A 3VVLA 2D5AA 2X77A 4R9NA 3GGGA 5AKXA 5EUBA 4R7ZA 1G19A 2QLTA 4HYYA 5HA5A 3OF5A 3L4KA 4YUAA 2ZUFA 3B53X 2ODQA 1XMIA 3FGZA 3AL0C 2OLKA 2FFAA 2DWCA 2B98A 3ANMA 1UM8A 4Q3DA 1NNI1 2OP1A 1Z7GA 3NEYA 1J07A 5HEKA 5C2JB 1JG7A 3EDYA 5BV8A 1SIBE 2AC2A 1CP2A 3DQQA 3W9UA 3WLTA 4TPKA 4R1QA 5JYDA 2WHRA 4R1TA 1IOWA 3FM9A 1I4DD 3FOWA 4TTTS 1ETHA 2NXEA 1HM5A 1CQJB 3F9RA 2ZREA 5BSHA 2VH2A 3P9PA 2YHBA 4FGWA 5DU2A 4QYSA 2Y8EA 4WZBA 2VZ9A 4JLDA 2DPXA 2V8BA 1JDBC 3LGAA 1PV4A 1B3RA 4NV3A 1KQNA 4F3TA 4WJZA 3ZWBA 4EX6A 1H6CA 3WLRA 2CJFA 2JGEA 1QHXA 3MRVA 1GRRA 1EFDN 1Z7YA 3HHEA 2YXEA 4D9KA 3I04A 4ZHQF 1A2OA 7MHTA 3AIKA 1RM4A 1ZNQO 3MCWA 5AVJA 3TZEA 1HNZB 1T0JB 2O0JA 3DBRA 1KNQA 2QLNA 2V6BA 1O95D 3AR3A 1OXKB 4NV0A 2I3BA 2PK3A 1OV6A 3PR2B 4JI7B 3QI7A 2POCA 4RF5A 2Z09A 3BX1A 1EBFA 4MJXA 2P8SA 3ZVRA 3WGYA 5LP6A 2AF3C 1IEWA 2YV5A 3I8SA 4I9UA 3AETB 3PYLA 2K2QB 1E4EB 1YBMA 3LBFA 1NUQA 1ZG3A 5H3CA 2QS9A 2XA2A 3KHTA 3H5IA 1DEAA 1KRWA 1E92A 3M1LA 2IP4A 3VU1A 2RARA 4KX5A 2XQGA 2E4YA 1G6Q1 2C3PA 4LK2A 5JQGF 3RSSA 2ZRNA 1QBGA 5LZ4A 1PNRA 3UV3A 4ZQBA 1MFZA 4YT8A 2IPAB 5JD6A 1EIWA 1D03A 2ZYHA 4H7PA 4RHFA 1P4SA 2HA4A 3PFHA 2H85A 3TXYA 1AV7A 2RGGA 3G2KA 2YYZA 1J20A 4ME6A 3UPDA 1G4AE 3TPCA 2YFQA 2WK1A 2YVLA 1TM1E 2XTMA 2VBFA 2VK2A 1IPHA 4L6AA 1HQKA 1W8DA 1XMPA 3BB3A 3PS9A 2IH5A 1MR3F 3WK9A 2P6RA 1T2NA 1ZSYA 2I7TA 2VTEA 2RK3A 4OVKA 4ZKEA 3SX0A 4CMIA 1VSTA 4DADA 5J4VA 3EQ8A 1TX4B 3VFDA 4CCYB 4YXFA 1JQAA 2IIVA 2EFDB 1KGSA 4EYQA 1OASA 2G77B 2HTFA 2QJOA 3D7MA 3U7QA 4E2FA 1B2LA 1E4VA 3RUIA 1JDJA 2G71A 1U1FA 1SULA 3A4NA 2PWYA 3G9UA 5BWOA 1ORTA 2H0QA 3I0ZA 2AD1A 4J2OA 3WGTA 1MJGM 2PS1A 2I78A 1KIMA 5ULLA 4TMYA 4BZXA 5JJ5A 4QDZA 5C5IA 1R0BA 3W6PA 4TYWA 1B8UA 4D81A 1P9OA 2WUGA 3DHWC 4M0LA 2V9PA 3BXHA 1NNEA 3B2NA 1C3EA 4MTLA 2B4TO 1JB9A 1Q1NA 4OJTA 4RZ3A 1TI7A 2BEJA 2QX6A 3AM1A 1VIDA 3N0WA 1JX6A 1UJBA 2PEYA 3NEAA 3PFIA 1L4UA 2PT5A 4ZK2A 1T8WA 2ZUBA 3EBPA 2CFOA 2F59A 3DO5A 4JB2A 5GZ6A 4OFZA 3NC1C 2G3YA 6YASA 3UWKA 3M5DA 1JMYA 3O4JA 3KETA 3HVRA 3DVSX 1O89A 4ETWA 2NZUG 2FPSA 1FYVA 3GLQA 1UOEA 1I4EB 1F1BA 2YY7A 4RZSA 4OHZA 3B2EA 4CTKA 3TDNA 1PX2A 2B4QA 3OJLA 1O7JA 4KSCA 2CLEB 1PQWA 1V8PA 5JNVA 1QLHA 3F46A 2ZBUA 4XYBA 2JFFA 4LHWA 1VCOA 3WWEA 1LQUA 2A78A 2DPHA 2R96A 2JS7A 3OQIA 4KGXA 4HYTA 1AZSC 2EARA 3PFKA 1KDZA 4B3BA 2Q7XA 3JVIA 4RS3A 7MDHA 2FPIA 4XJXA 3OLYA 3L6BA 3R40A 2CCJA 5AKEA 5C4MA 2ZE5A 2OSVA 3TM5A 2XT6A 4GFDA 5A5DA 4Q3LA 5I9IA 1LPMA 2JH8A 4ITRC 1KY4A 1H2ZA 1T9GR 2BM8A 3WDLA 2TRSB 2MMCA 2ZWOA 5B1HA 1F17A 2NYUA 1RM0A 2R00A 5ES3A 4INAA 4KGVA 4PAGA 1VHWA 3C6MA 2FSGA 3LE8A 3T35A 5CW2A 1ENPA 1U0OC 1DLJA 2HRCA 1PK7A 3IULA 4PLWA 5DASA 3Q2IA 1AGYA 1RWWA 5HTOA 3RUHA 1JYSA 1UKCA 4IIHA 4LYAA 5P8WA 3MXOA 3HB1A 3TZLA 2RC5A 4KBYA 2FK7A 1GTJ1 4NVRA 4RPLA 4H9GA 4Y2JA 2XF2A 1JEOA 1E6WA 1UL1X 4XQGA 5LUAA 3RABA 4RTRA 1RQLA 3BH7A 4GKBA 4UDYX 1JDZA 3DZDA 1UPCA 4C4SA 1XQ9A 4B43A 1KMCA 4LI0A 3ZV6A 1T0HB 4PXSA 4XH9B 2EJCA 4EB0A 2Z58A 3OUZA 3RRYA 2OCLA 4RKWA 4QWWA 4CF3A 5F76A 1RHKA 5ER9A 2JKZA 2PUHA 2XNDA 3HCNA 2Q8PA 1YUBA 3GFBA 4NECA 4QFCA 1I3CA 5DF1A 5DYTA 1L7AA 4M2LA 2PL1A 1TZMA 3V2GA 1HYHA 2PD3A 2P11A 2Q50A 1E94E 3BD7A 5HKKA 1ZK4A 3ZZ0A 4JKOA 4KHZA 1BWQA 3O8OB 4R01A 4U63A 1I1QB 2G6BA 3D7NA 4ZO4A 4M0FA 1IY0A 1T9BA 2GPAA 3N2KA 3GZ4A 1H23A 4DW8A 1PCXA 3R3WA 3WV4A 2JLYA 2VDNB 1IC6A 3CFYA 4IILA 4NLLA 4C0HA 2HSGA 3VSDA 1TYDE 3A4IA 1OLSA 5JS2A 3VNAA 4FDMA 3NUGA 5C7LO 4ND1A 5BT9A 2H1VA 2QTMA 4WA8A 4W8OA 1GN9A 4WERA 4X3OA 1GFIA 3FR8A 2OWEA 3ZI7A 4JBWA 4DR4B 1OW3B 5BMVF 3LC1O 1U7DA 4PN7A 3V8QA 4MV9A 1ZGZA 4OAOA 3RTBA 5IDQA 1BYIA 2HH9A 3VDNB 4CW7A 1XZHA 2XZPA 4B3RB 1KVQA 1SQFA 3QYFA 3GRZA 3DCNA 3PXBA 2ECKA 3V80A 1JT9A 3GRRA 3LT2A 1RXYA 3W06A 3T94A 1EVYA 2OD9A 2RGBA 2VHWA 1U8FO 1M76A 1U9ZA 3B6KA 3S55A 1EM6A 2JZOA 2CXNA 3FPCA 3OZIA 2XB4A 1LTQA 1SWVA 3HDQA 1MABB 2LVBA 3B3GA 4LY6A 4NC9A 3DMHA 4R2IA 1BS1A 2ZVPX 1R1DA 4OSOA 4UAVA 1KMNA 4CQLB 5T3YA 1ESCA 1JBEA 1PDOA 3LC7O 1QO0A 2Y4OA 3QUAA 3GA7A 4NSNA 2ZT8A 5AWFC 1Y7HA 1EWKA 4X9XA 2NG1A 3CBGA 5BYJA 4YXWA 5JUWA 4AKSA 4EHKA 3RVRA 2QG9A 2O3JA 2JEZA 1PUXA 3HG7A 3WMEA 3MC1A 4EKYA 2C0PA 4ZALA 2M2IA 4ALJA 2OV8A 1ZZGA 2NNWB 1SCQA 3QXXA 3LUBA 1GFZA 4GBGA 1PR5A 2YJGA 3DCIA 3QJ5A 3MHPA 1K8ZB 2AXNA 3C7CB 3H05A 5FPKA 1KETA 3MIIA 4FFLA 4UD6A 4H3SA 3V42A 2QTGA 4EY3A 3L6CA 4LZAA 1DMRA 1OYVA 3GD7A 3WQHA 4CDGA 3LH5A 4TV9F 5B5SA 5TQ2A 2YY5A 5IAKA 2FN7A 1TUGA 3HCEA 4P31A 4E03A 2FFHA 4N0QA 5B3JA 2CLFB 3GNLA 4YJ2B 3ZW7A 3RAEC 1RKVA 2V0NA 4PS0A 2AI1A 1JSCA 4PPGA 4ZOQI 4U1RA 4IAOA 4EL5A 3DWFA 1NQWA 2CMKA 1Y5NA 3K1JA 3QH4A 1J33A 3QPCA 1K2WA 2BH9A 4UHBA 4UNPA 5EZ6B 1Z8FA 1ZCBA 2X41A 1EDZA 4QTXA 3H9CA 1O58A 4JN6B 1RVDA 2HB6A 3SDZA 1GYQA 4KODA 3C85A 5KAMA 1M8KA 4FS8A 1JHQA 2ILVA 2WPNA 4LXXA 4OK5A 4GLJA 5G0VA 5SY9A 2BAGA 5UKDA 1R5BA 3TTYA 4XIYA 4E0BA 5KC8A 5CXXA 3FJYA 1NZDA 5JMPA 4ABTA 1W5TA 2O6LA 2OUIA 1KSFX 3C3MA 1GVHA 3MTAA 2J5QA 4GAEA 4R81A 4XGQA 1I7LA 3WDMA 1I7DA 2HGZA 4Q9HA 3ECAA 1U11A 1XPJA 4C3ZA 2C8JA 2QGFA 1OF1A 1F4LA 2H2AA 3ESCA 1JZQA 1N3YA 1A77A 4B3MB 1ZUHA 4MUFA 1L4EA 1HSOA 3KJEA 1TQ4A 2Z6QA 4W7SA 2Q46A 3EIOA 4II3A 1C1HA 4XAQA 3SLGA 3C74A 3T7JA 1JIUA 3EQ2A 3PPYA 1GU7A 1ZGCA 3DPSA 3S2ZA 4CKEB 4G4SO 1N34B 4DPLA 4RD0A 5NULA 1NW5A 2PJZA 3EZ7A 3VHXB 1DUVG 1VE7A 2BCJQ 1EE2A 4MRNA 3WFJA 1FDWA 1UBCA 4AO8A 3WYFA 2VNJA 4X7MA 5THXA 3NV9A 4HNSA 3NAZA 1SURA 2VHJA 4X8HA 1UP7A 4M54A 1KZ1A 1JHMA 3FTPA 3ORRA 1PZXA 2OZPA 1S9HA 3EC7A 3NTRA 2HSJA 5KQPA 4U3JA 3UC5A 2AE2A 3AWDA 3MLAA 2Y1OA 3HSSA 3TRKA 1ODSA 4KB5A 3NTOA 1TZJA 3L8HA 3GLGA 3AFIA 1IZ7A 3V6MA 2MWMA 3C3AA 1A9XB 4PC1A 4PICA 2VXYA 2C78A 2R1VB 1DWPA 3A70A 3F6EX 5AHRA 1UZNA 1Y3AA 4I0WB 5EIAA 1S7GA 3GYGA 2OMEA 3RSCA 4F96A 4HQFA 4KVZA 5BWCA 1TA9A 2AVNA 3ZHCA 5JFGA 1E1DA 1GXSA 1A7JA 3QVSA 4R4JA 3GVPA 5IRCD 3AEXA 1AKQA 3AX6A 4HF7A 4IXWA 2CL7X 5ALOA 3ZZ1A 3U1VA 1UPBA 3VNQA 3KB1A 2A2ZA 2C7GA 4J2TA 1CY6A 2BBWA 3B2QA 3QW2A 1KJIA 2QUAA 1JKJB 2GOYA 3LQQA 4MV8A 5F7XA 4RULA 3F6PA 1A3CA 5T8KA 2O14A 3ZNOA 4R0NA 3L1IA 1X70A 1N6RA 2D5LA 3A37A 5K3CA 3VR4H 2A1TR 5AVSA 2FV8A 4N7RA 1D6NA 1JAIA 1OAOA 2QDXA 5TJ9A 3DDOA 3DAGA 3L8CA 3O4VA 1QU3A 1ZNWA 1KJ8A 1XQYA 2R00C 2XYRA 3ZCQA 3CKYA 1KDPA 2E85A 3BWBA 3CVVA 2UVDA 1L1EA 4JJAA 3EMDA 5K45A 2OECA 4O4LA 1G8AA 3PA8A 4DHEA 3C43A 5JYBA 4RLHA 3IAS6 1DOZA 5T3UA 2Y1KA 1NSTA 5BUCA 1G6HA 3F6SA 2R47A 3W3AD 1EJ6A 4BWYA 3BN3A 3AKYA 4V0ME 3KKZA 2O7RA 1NJ2A 4UMFA 3HADA 4X8LA 5BV2P 1KMIY 4C03A 1B93A 1O1YA 3HA7A 2NU8A 4QVIA 4IMJB 2CSUA 2FJPA 1PTJC 2A7QA 2XVZA 1NKSA 2H5JA 4TL8A 4U02A 4BP3A 3AI3A 2X4DA 3CSSA 4DN6A 2Y0BA 1XZ8A 1KR2A 2P9FA 4Y7CA 3WRXA 2GT1A 4AW9A 4DG9A 2IHVA 1NVUQ 2M1ZA 4FR0A 3MUEA 1NM5A 4GI5A 5DP2A 3REQB 1V1MB 2BKXA 3KT3A 4M8KA 3SC6A 3F6BX 4JS0A 3C98A 2AI3A 1N2CB 3IT1A 2CXHA 1BVUA 2BELA 3AFOA 5IT4A 1T43A 2ATXA 4FDUA 1E58A 1VDZA 1Z33A 2OORA 2RHHA 2YQ5A 3E15A 3FY4A 3I9LA 5KKCA 2ZYUX 3JQ6A 1EZ4A 3BL6A 4ZVNA 5IABA 2QTCA 1NXVA 3F3SA 3GVHA 4QC2A 4YJ3F 1CUFA 2O7NA 2OO3A 4GGOA 2IV7A 4IQGA 1DIGA 5LLTA 5K3OA 3W5AA 1W19A 2GHTA 1XC7A 3PWSA 1I6KA 4PE5B 5BN5A 4L5JA 3F6RA 2JAXA 1YS1X 1K5DA 1Z2NX 2E5WA 3DT8A 2C0CA 4ARZB 3P9NA 4FGLA 3ILVA 1SKBA 4HFRA 1BRTA 2H1CA 1R5JA 2P9EA 3UA4A 2ERYA 2RAVA 2GA8A 3KQLA 4D74A 4Y2QA 5F1PA 1IUOA 1MIOB 1F4PA 3D0QA 3TL3A 3T7DA 3BB4A 4RVHA 4HQNA 1WTCA 1JXMA 4QYTA 2NU6A 3ZW8A 1JQJC 1H1TA 1TJ5A 4CEHA 1C2YA 3QMVA 4CR7A 4EHJA 3R77A 1D07A 5LR6A 2R79A 5L53A 5C34B 2EJWA 3VAYA 1JYFA 3IUPA 2RGCA 3FSGA 3HO8A 2ZT5A 4HLQB 4EHAA 1GPLA 3B5IA 4IFTA 3NWJA 4UATA 3SM3A 2W48A 2YUIA 3OEEA 2IYYA 4RTLA 3SQXA 1BA2A 1KPGA 3BMCB 4PHCA 4CIXA 4P4LA 4MVJM 5ERGB 4DMFA 4D44A 3QX3A 1N2GA 5CAEA 3RT1A 1OZGA 2B1GA 2A9JA 4K03A 3PPWA 4K9PA 4EP1A 1FOEB 3A06A 1ZESA 2P5TB 2CUKA 2VKTA 1E9DA 4U2BA 4Z8XA 2UYOA 4Z9FA 4GICA 3VPAA 4AROA 3OEWA 4PQRA 3RROA 2RE8A 5LDDC 3OZEA 2JCGA 3FRHA 3LYLA 1QHSA 4FGKA 1R4NA 2R1UA 4HDRA 4KXNA 1JRLA 5DLDA 3SBOA 5KJCA 1QK4A 1WV0A 3LOQA 3PKJA 1PWZA 1BCRB 1NI5A 2D1TA 3Q3JB 4ARVA 4F8JA 2F3TA 4WY2A 1UBNA 3NDBB 3I0MA 4Q03A 1ZGAA 2CNDA 3ESZA 4R83A 5E1OA 5A06A 2IIBA 3EG5A 4CM8B 3ZXUB 3GP8A 3GLFA 3AWIA 3LC2O 3KZCA 2IXBA 4HGYA 4U8GA 2ZTLA 1O5IA 4UHDA 3GV0A 1N6LA 4PQFA 5B3JC 1E9SA 1OLUB 3ZK8A 1W87A 5IVDA 5T4FA 2ZBDA 2WT9A 1KK2A 1TIPA 3LO5A 4BQFA 4EW3A 4CEJA 3QBVA 4WNIA 2V9CA 2B1RA 2QAIA 1CQWA 5FR1A 1AHNA 5GOZA 1V7ZA 4MWBA 1ZD9A 5JNSA 4CR6A 3U6BA 4X20A 2A9RA 2GPSA 3IJ5A 4GIBA 1X1DA 2H4FA 3K15A 2YOFA 1W44A 4I1OA 3GJ3A 5T67A 1R0ZA 2XUJA 5YASA 1KARA 4QHSA 2IHBA 5DULA 4AKEA 1WAMA 4KOAA 5ERXA 3MERA 3LI2A 3QEBZ 4IEEA 1NV8A 4KFUA 2PZLA 4BLWA 2DHCA 5AIBA 5K6TA 4W5RA 5L9AA 3V8VA 4JJIA 3T9BA 1ODTC 3GJQA 4Q4CA 2O8DB 4Q1EA 2EBUA 1OAAA 4I81A 3RVDA 1R0XA 3TEMA 1T6XA 1EFRA 4MRAA 1KYTA 5IDXA 4FC6A 2UZ3A 4HLCA 2B34A 2ZSUA 4TS1A 2QP3A 3NOQA 2R48A 4WQMA 4F6CA 4YDRA 4B6GA 5IH7A 3ASUA 2SKCA 4U2FA 4AYWA 1C0KA 1YC5A 5JD5A 1NI4B 3FBTA 3LCJA 3GH1A 2P90A 1RW4A 3PWKA 4JLJA 3JPWA 3QTTA 2ZSEA 1MH1A 4P4SB 1J1IA 3UJ6A 3HRIA 4BRWA 4F5YA 3CPEA 1Y3CE 3CUKA 2FRDA 3KLBA 3ORYA 3OBBA 2C00A 5H68A 2NMVA 4EHHA 5FWDA 1DPGA 1X7WB 3FPJA 4J0GA 4CLHA 4G84A 3EFBA 4D0LB 4IHJB 2O0KA 2QBYB 4WLEA 1AQIA 4LRTB 5DFAA 4BO8A 2CLSA 4RGYA 4ZYXA 4QXAA 3ZDFA 4IHKA 1LVGA 4GMHA 3QGMA 3EUFA 4IM7A 2XQIA 5DW3A 3KEGA 4PHGA 4B84A 1HLFA 4ZEOA 3SHQA 3MT9A 4RCYA 2NO5A 5ALRA 1TC1A 2HLDD 2D2VA 4NX2A 4X93A 4CMHA 4M99A 2V3VA 1FE8A 1YUMA 1DAFA 1LVHA 1WP4A 3FGOA 1PR0A 4ZHSA 3PK0A 3WGNA 4DBLC 2IX3A 1BFUA 2K87A 3KL2A 3KT8A 4NEGA 1Y82A 4Q02A 1YCGA 3G1UA 4YI5A 1EVKA 1FNMA 4Z54A 5GZ3A 3AU8A 3GJ5A 1HPLA 3OZDA 1PJQA 2EC5A 3RYFB 4WLVA 5CNMA 1KI6B 1E7RA 3HYLA 2GBLA 3M89A 3HGTA 5J4HA 2P41A 4OL9A 4MZDA 3C1UA 1VIVA 2X7XA 4KAXA 1OBCA 5FR2A 4BE9A 3NG1A 1AKYA 2H5IA 4QQKA 3ZU2A 2XAUA 4LMRA 3J81k 1P0QA 2NZ8A 1LQTA 4N01A 3OEHA 3E5RA 4IQ8A 1SWWA 1EUQA 1GGKA 2JPDA 3PFBA 1H8EA 1U2RA 2WVAA 3LPLA 5T8KC 3RK1A 5B6IA 3N0VA 5EMMA 3C15C 1GL7A 4KHPB 5FP0A 4CXMA 1DHTA 1OAOC 2P2CA 3DD5A 1MAVA 5CP8A 4RDHA 5LN1A 1VKZA 3O94A 4UFOA 4C0AC 3DF9A 3EXIA 3KYIB 2P62A 4CTMA 2NADA 4XW2A 1FSPA 4MB6A 4D7AA 4DLXA 4TTPA 2VXCA 3BAFA 4XYLA 3I6YA 2HDWA 1JFFA 2ZDGA 3Q7EA 5FIUA 1NMEA 3I37X 4GYYA 1DO2A 2HZ7A 4FGJA 3OZCA 3IJEB 4FHZA 4HJRA 1N0UA 1YBVA 4OQFA 4WSOA 3N7TA 4XQCA 5IW8A 2PMEA 4DUYB 1GAQA 2GB4A 3K5IA 4CHGA 1GWNA 1V9CA 4P9NA 4JSRA 2FMFA 1YJCA 4KQ2A 5BWBA 5CB0A 2H08A 4H7FA 2X8JA 3V34A 1KA9H 5JZSA 2PBZA 2WU8A 3WRXC 1T3LA 2FW6A 1SK9A 4LQ4A 2P2GA 2VRCD 1NM5C 2Q28A 1NDQA 3HY6A 5CTAA 5KTOA 4ENPA 5C1OA 3EOZA 4RE5A 3HBJA 2HBRA 3G5TA 3KUDA 4D9NA 2HLPA 2IHYA 2P7IA 1HNNA 1TD9A 3COWA 4HUQB 3R9WA 1RAAA 3H2SA 1A8UA 3JQCA 2WBLC 2ODAA 4R1NA 3OY7A 4P33A 3DGFC 3EPKA 3BHJA 2PTGA 3E3LA 1AMOA 4AKGA 4DLTA 1U8XX 3GDHA 4V3BA 3C8HA 3M6AA 5BSEA 3OURA 1VHTA 4UMVA 5AHKA 4EPYA 5ADHA 1VLZA 1ZVQA 2H5LA 3WB0A 4BX0A 4EBFA 4UTRA 2D7JA 1VE1A 3BHNA 4E6PA 2O5EA 1FUYB 4IUDS 5A6SA 4DEVA 3CUWA 1JNYA 2C7VA 2NQ8A 1EVLA 3OFND 1A71A 2XHZA 3ZHXA 4EI8A 5B64A 1ULZA 4INOA 5T57A 4EFMA 1FLDA 5DI3B 1L6RA 1QNFA 3QVGB 1RYHA 2VP9A 3RU2A 4OY3A 2Z6AA 1NMSA 1J06A 5BSRA 3I8XA 2TECE 1UKZA 3PQ4A 4NNOA 3E9QA 4UDNA 4YRTA 1EEXB 3VM6A 2XA1A 4KYVA 1MZPA 2FVYA 4ZO6A 1E6MA 1FK8A 1FFHA 4KXYA 3RHFA 5M2QA 1RS0A 2C95A 4Q3KA 3S2UA 2G8LA 3F5MA 3RVLA 4P5EA 3VSAA 4BKPA 1BROA 1WO8A 1B41A 4FZ3A 1DEOA 5EYPB 1J8FA 1XRSB 1M0WA 1Q16A 2HEIA 3LXUX 2JANA 2HRZA 4L02A 3VJRA 1PR9A 3HCRA 1GGHA 1YZQA 3H1GA 1H42A 3LCUA 1FTGA 1Y5IA 3M70A 1OPRA 3QF7A 1XZPA 1R6UA 1M75A 3DNFA 5AKHA 4AB1A 1GN8A 1NVGA 3KSMA 2W2KB 3GUVA 3EVAA 3AF6A 4N41A 1Y8CA 2C0QA 1JFVA 1H9BA 1HFKA 1I4TD 3QKWA 4LCJA 3KJZA 4D98A 1O0CA 3R0QA 3CLSD 2FMTA 1E7WA 3TLMA 2HJHA 3TNYA 1WA5A 3LQ1A 2I22A 4MHSA 1KOJA 2P0EA 1GU0A 1OHHD 4MUXA 4W7IA 5FUYA 3MWFA 3VR6H 4G65A 3WBFA 5HXAA 2A0FA 1U2EA 5FPSA 3OOSA 1Q0SA 5JHGB 4B4UA 4LJRA 1GAWA 2GNAA 2LTAA 2J0VA 3OJOA 2CBGA 3R9XA 1BCSB 4QU0A 3QWBA 3L40A 5DXFA 2Q4RA 4L07A 4TKZA 2AG8A 1DV1A 1T6BY 1MQAA 2CZQA 2NTEA 4HXGA 4K81B 4Q48A 4C0BA 2R9VA 3RBZA 3B6JA 5AUPB 2ZG6A 3QYPA 3IUYA 5DTEA 3L9WA 3CUUA 1K2VN 3UH0A 3L41A 3KLPX 3OT1B 1N0IA 2EF1A 3L46A 1W8IA 3QHQA 4XYMA 2LBPA 1T0BA 3GRYA 3RGGA 5JBIA 4M49A 3JQ7B 3HO1A 5KVVA 5LQUA 1YDWA 2X8BA 3MWKA 5B12A 3K16A 3KZVA 2DUWA 3BDAA 3QWHA 4KIFA 2YHIB 1DRJA 1ZGHA 1Z5VA 2ODWA 1JQLB 3IQHX 2YV2A 4JZKA 4RVSA 4GZ5A 5AM2A 4QULA 1LNSA 1WDKA 3AZQA 1WXFA 3H0EA 2BDUA 4I9HA 5J63A 4D3XA 5E1DA 4JP8A 1C41A 1SUWA 2A5GA 4UUAA 2H3EA 2ZIAA 4EW6A 4C7OB 3S1AA 4M1WA 4UHFA 4S1OA 5CW1A 1XZFA 3L82B 1JIQA 1SU6A 1UKAA 2H48A 4IXMA 1TLFA 3GN1A 1FS5A 1KZ9A 1LW7A 4JUFA 1CTQA 3QQPA 2IODA 2ZIWB 2ZTMA 4H0CA 1EJBA 3HO6A 4HAYA 3ZKWA 2R5FA 3PD0A 3WK6A 2W4QA 4TLCA 3U7HB 5ALNA 2E49A 1OZ0A 2UVPA 3HWWA 4PVCA 4YIKA 3UY4A 2DAPA 2LUOA 5CGQB 2WKRA 3TQFA 3V7NA 2O8CA 4J3JA 1EP2B 4CN9A 4ZDWA 3IXLA 5H3LA 2O23A 2OLEA 2P30A 1TT5A 2FRDC 1P1RA 3CC8A 2W98A 4J0JA 5DGXA 1G2QA 3DLBA 2PUCA 2O5CA 3ZXYA 2I80A 2GWHA 1F8XA 4DV2B 1HT1E 1ORHA 3LZDA 3CO0S 4D8YA 2KMLA 1Q83A 2WLTA 4XDYA 2BW0A 3EGXB 4YY3B 2G80A 1P2SA 4Z2AA 3I30X 2CF6A 3HEMA 2ATVA 1DP4A 4O2AF 1FFXA 1FF9A 2HBYA 3GBPA 1QC5B 4PPYA 1DNPA 2EGUA 2NVUA 2B20A 3JQAB 2C5BA 1SEVA 1DAKA 4LY0A 4FONA 4RKRA 4O4IA 2O4UX 2Q2NA 3FN4A 2FH5B 3O31A 2ILTA 1XWWA 3AG5A 4GLOA 3SJZA 2Q2VA 4HRXA 4NAUA 1OD6A 2C4MA 4RDXA 1K8YB 3E8SA 2FYTA 5JECA 2OUKA 3FETA 3WHIA 1R8JA 5BY2A 3OTQA 4HGQA 3F49S 5J9FA 2C3MA 4ALKA 4AY3A 4WLUA 1LBEA 2R6ZA 4KLNA 1E89A 2Z04A 3PQCA 1NF8A 1NW7A 4G8BA 4JYCA 2QSJA 5ARCA 2GBLC 4EHNA 1SNYA 4JODA 4IH1A 3GL9A 1ZQ9A 2MDTA 4HX2A 5FO1A 1Y3FE 5FOUA 3ZDDA 3L8EA 3QG5A 4M1EA 4C5AA 4RFSB 3WGKA 1XCGB 1DBPA 4A82A 3HJCA 2ZUDA 1CUGA 5KYYA 4JVLA 5C1IA 3ZHBA 3HKBA 3JSAA 4IEIA 2OESA 2XYPA 3RS8A 1ISMA 1NL3A 1TRKA 4J4HA 1PT9A 1NJGA 1FNSA 4ZTZB 1TPZA 1N3IA 1S2DA 2X86A 1NATA 3CX4A 3ABZA 3HWX1 4PLVA 1IMOA 1YRYE 3AVQA 3PDIB 1E0KA 3ZLTA 2ENUA 1VG9B 2C8KA 2JGJA 3EODA 3AEUB 2AX3A 1L4HA 2ZRJA 4FFMA 1B1AA 1BU5A 1GSIA 4HK4A 5LXTB 1MLDA 1WHSA 3JARA 3RQSA 1ZX1A 1Y3BE 4GOXA 1SVUA 2QTFA 4PC2A 3SOZA 5AW8A 1L4GA 2JJ2D 4FX5A 1I3MA 5EJ6A 4TM7A 1HDXA 2EJUA 4IQ4A 4DCPA 2PZFA 4NU0A 2DQ4A 3UOGA 3L18A 5HKLA 3W2HA 5BOVA 1FX1A 1WM1A 4AZ3B 1DQPA 3ND6A 1YQDA 1RZVA 1T2AA 4NYMR 3AVTA 3S8YA 3KG2A 4LV6A 3DAHA 1TM2A 3UATA 4L9WA 1H6DA 5HCIA 1JGTA 1E6CA 3WHKA 3O47A 4OLHA 1ZICA 3DOUA 1TA0A 2AFIA 5D5HA 1M7BA 4HVAA 1FFEA 1FVXA 4JGIA 2JIPA 1R0LA 3V55A 3WFZA 4UE2A 1YS2X 1TYZA 3DMYA 1G7RA 3EARA 2Q6TA 4IIDA 4ECAA 3VVMA 3B1JA 1P1KA 1JSXA 3GCGA 3OPNA 1JSRA 1RI4A 1SHJA 2EKQA 3GEBA 1ZMRA 3ORHA 3R5KA 4BLVA 2HMYB 4O29A 5FBLB 1XHEA 2JHCA 1EX7A 3ESBA 4IF6A 1JG4A 5LQSA 2JZCA 1XLVA 3MUOA 4FT4A 3WMFA 5BXYA 3PSAA 1XVAA 1Q7TA 2XECA 1O95C 4K05A 2Q2OA 3T06B 3PX2A 2P1RA 3CR3C 3QOYA 2ZJYA 4MINA 4F4JA 1NT2A 2G1JA 2I29A 4KI0A 1E9AA 4RBNA 5ETJA 4DLSA 2V4UA 3HYTA 4MQFB 2NGRA 4DKXA 1QVRA 1ZOSA 3SNKA 4J7CA 5EIWA 4MO9A 1UMBB 3INNA 3D9QX 3PB3A 1S4MA 3VMMA 3K8ZA 4IIVA 5F3RA 2WJAA 1RADA 5TGDA 2ATIA 1SO8A 3TQOA 3RIEA 1N6KA 1B1CA 1W85A 1UBHS 2P9CA 4PYQA 2BVNA 3ZDXB 1ENZA 3DTVD 5JOQA 2YS6A 1UMDB 5GQSA 3GLIB 3L0IB 2CD9A 4L4RA 1E18A 3EVFA 1DTEA 1Z6GA 2PKQP 3AG6A 3UICA 1ZXBA 1RAFA 4ER7A 5JAIA 3ESRA 3UFXB 1X1CA 3WKCA 4BZPA 2C4VA 5H70A 1IONA 5KB3A 1L7EA 5DKFA 4DHWA 5CT4A 3MFYA 2O1WA 4PSUA 3IQIX 2HT6A 1R12A 3AP3A 4QICA 2OQ2A 1GHTA 1PT6A 4HH0A 1A9RA 3C6XA 3NQ41 4M87A 2GTIA 2UZ1B 3FZGA 1JKMA 3UHOA 3JPYA 4ZVUA 1SQSA 2ZT6A 1K9SA 2BC9A 3ILSA 1N6NA 3L0BA 3IMEA 4L95C 4AQYB 2QRQA 3PD1A 3WY9A 3CPSA 2J5BA 2WIJA 1ATIA 2WC1A 2R87A 3EASA 3FTFA 2AQ8A 2VFAA 2QM0A 1EGQA 2XTZA 3ORFA 1JHUA 3A36A 1DOAA 2IXGA 4OAPA 1Z73A 1VLLA 2TMYA 1YMUA 2XZDA 4OD0A 3EPRA 1TW3A 2EF0A 4INPA 3T54A 5EOVA 1N6PA 1RMQA 5CH8A 2YWXA 3CISA 3EVTA 5A3VA 3C70A 4KZPA 5KDDA 1RQXA 1C1XA 1ZLYA 4Y1RA 5MN4A 3OPYI 4CF4A 1BG6A 5IDYA 4EUSA 4F38A 3NX4A 4EVRA 2WJPA 4I1PA 1SHUX 1E4YA 1JDSA 4MVCA 4IIJB 5DHTA 3U39A 3ZXXA 5KKAA 3F5SA 4A8JA 2CLKB 5DNAA 3NR2A 1T5BA 1P8JA 3CZCA 3R76A 3PJFA 3H87A 2H0AA 1IBRA 1OR8A 3ONWA 4B82A 3DLTA 3N53A 4MA5A 5F35A 1WMAA 1QHFA 2ZIZA 1Z2EA 1HDOA 3AUXA 1ARZA 4ZT7A 1I2BA 3S7ZA 3THWB 4J16A 1MD9A 3FNFA 3W5UA 3VVBA 5GADl 4XWAA 4NJMB 1C14A 4L0MA 1WY5A 1QO9A 2YCBA 1FXWA 1JR3E 3KTAB 3L8FA 1D1SA 1SCUA 1QH9A 5ABPA 1IG3A 2VYQA 3IOBA 5CDGA 1ADGA 3VR2D 3EY4A 1I4OA 1VL1A 4F9FA 2WYIA 2YBDA 4L3OA 1E2BA 3VNBA 3J81A 1ZAYA 3NBAA 1VI2A 5DTIA 4NBKA 2BTEA 4O2BA 1KAQA 2WSBA 3ZEAA 1KDOA 3FPLA 3FSRA 3GP3A 1ZK0A 5EP3A 2DXIA 2X9NA 5AVOA 2HU2A 5EIBD 2P8JA 4JP5A 5F52A 4FWTA 2WU1A 1N0WA 1NVVR 2QXYA 3EWIA 3WL7A 1H5NA 1I1HA 3LHDA 4YO8A 4E14A 1C4OA 1NZFA 1HLPA 4IF4A 5F33A 4YWHA 2PEZA 4UBOA 5KU7A 5HJ5A 1G5FA 1WZNA 4Y8VA 1Q1BA 1U2TA 2G4VA 1IH8A 3DEJA 3NC0C 5B36A 1H2WA 1PNTA 3LUJA 4C4TA 1EFAA 1FJXA 4BAGA 3JASB 1RZ3A 1YUNA 1AGNA 3VKWA 2A0YA 5A6VA 3AB8A 2EKLA 2GYVA 2PDAA 3E7PA 5T4EA 4NBRA 3AVPA 4R3UC 2HMWA 3JQ8A 3JYPA 1CUHA 3B7WA 5DEOA 3UG6A 1ACMA 1SHLA 5F51A 4YIHA 1RXCA 1BGVA 5TPZD 2NYRA 3Q1KA 4TYPA 1W1IA 2HL6A 4TWRA 1H8HD 4C5BA 4DIKA 4MVJH 1OFIA 1EINA 5CD9A 6REQB 4DR3B 4CMEA 4ZOLA 4TMKA 1XCLA 4CMBA 3F1KA 1IHUA 1GLGA 1J56A 3DNPA 5FUWA 2XIQA 4CN8A 3AO0B 1A5BB 1QOQB 1JFLA 4J49A 2ZPAA 2G7ZA 1H05A 1UC4B 3GD5A 1MQ9A 3U4QA 3E23A 3Q3CA 1MAAA 2H2DA 3EC1A 5AVQA 1W5EA 3Q8KA 3IDOA 5CA0B 2H2IA 5KX5A 1Y1KE 2XYHA 6ABPA 3LKBA 4ZCTA 4OYHA 3IKTA 4CPDA 1W30A 1T9ZA 2ZR7A 1NLUA 2WZCA 1YI0A 1N32B 3DZ8A 3WWYA 2G1KA 1G1MA 3DBIA 3NHUA 1FRQA 4KE7A 1TCVA 1AK9A 4MUMA 1GTL1 2CD7A 3ID6C 3BXEA 1FSSA 1CUSA 4IO1A 4F4HA 4PN3A 2ZI3A 5EI5A 2YRFA 2YYYA 1FDTA 1SCDA 3B70A 1DJMA 1XVUA 4UBKA 2H7VA 2XW6A 1TZKA 3BIJA 3K1ZA 3QEMB 1G5HA 4ZCSA 5BW6B 1GZHB 2MT9A 3LXXA 2W6ID 3NLLA 1NUTA 2IV3A 3G2NA 4I4TF 1NBME 3Q8MA 3EBOA 2QPTA 4TV8F 3ZWVA 4B3HA 4OP1A 1YDEA 4IX1A 5LD2C 5KTYA 2YL2A 1EZ1A 1O87A 3S7TA 3AVXA 3WZLA 2W2LA 2V55B 4DWOA 2BF7A 1HGXA 1I7NA 1QK3A 2XE7A 4WXMA 5AKKA 3PEUA 1SBIA 5HILA 4BE7B 2WP0A 2ORYA 3WNCA 1G3RA 1M2JA 1FZQA 1QX4A 5DHFA 3ZS8A 1DQRA 3O4FA 4W8GA 4XVQA 3DVLA 4A03A 2GLXA 4WK0B 4WXYB 1JR4A 4X94A 3R23A 5B1SA 4BO4A 4QOSA 4OKNA 3ZHVA 2NO0A 5HX7A 4DXAA 1A9TA 1F0NA 2EZ4A 4ZQCB 2JAUA 2Q5FA 2ARKA 3PQ5A 4MS3A 2FPOA 5BWNA 5I5EA 3STYA 4JROA 1CEQA 1R3UA 1ULTA 3BRWD 1YQGA 2BV3A 1ZK1A 3PUXA 4R1PA 3LD9A 4V0RA 4D8WA 3RVNA 4E33A 5J2TB 1YC2A 2ZBPA 4Y6SA 1EUYA 3M8KA 2KQUA 4I08A 3RFUA 2WPDD 1M5TA 2GXQA 1CDZA 1U7ZA 4N18A 4PYRA 1NZJA 4KG7A 4ZCLA 4ZYLA 2JGNA 3K09A 1CQJA 3SXUA 3ESYA 4IKEA 3IUBA 4GKVA 1MORA 3C8MA 3G89A 4WOBA 1N92A 2X3UA 1RWBA 2GN6A 4O25A 5SZHB 3T3MB 5BN3A 3THYB 4OV6B 3O21A 4UU7A 3EEBA 2AN9A 2YX1A 3ZY2A 5IAEA 5D6NA 3RWBA 4CUKA 4QJ4A 3H5LA 3N5KA 2DH6A 4L76A 3U0BA 3WL8A 2DHDA 1QE5A 5EEHA 4EFLA 1NPYA 2B1QA 5H5JA 2FP3A 1JW9B 3PQ8A 1NI3A 4H1VA 4O33A 1F9EA 1R6VA 2GASA 1E5LA 4P35A 2P67A 1FNCA 1IBKB 4O4JF 1U0BB 3TCNA 2NT4A 2QVCA 3QEKA 1NPTO 1I80A 4KPGA 3ZTYA 4YRLA 1WQ1R 2XDWA 4E2YA 4CMAA 1T26A 1PFKA 4L1KA 5JADA 1O96B 4H7DA 3L1UA 1QPZA 1RKQA 3QF4A 5KJ1A 2GYUA 1AMNA 3E53A 3T5MA 4JGGA 2OT3B 1DE0A 4CM3A 5A4KA 2GS9A 1N2SA 1QE3A 3W34A 5JT1A 1Y6RA 5LMNB 4YHHB 2D2IA 4X41A 4G37A 3GJZA 3S8EA 1LRKA 1KHHA 4KPEC 4IDOA 4OHBA 4G1UC 1WW8A 4MVJE 1YR8A 1SXJE 4EKGA 4BIMA 3WGQA 2C31A 1FDUA 3DE6X 3GLUA 5D7NA 1AUPA 2J9XB 5JZBA 1G8HA 3E84A 4L9AA 4PZ0A 3VKHA 1SBCA 2R62A 1K89A 1TU3A 3LX4A 3WA7A 8ABPA 1YFJA 1ZM3A 4GLBA 3ITEA 5FH9A 3GF4A 4ZZ0A 1A4XA 2QI9F 3OLZA 4CCYA 3G0HA 2YVUA 3E48A 1V7CA 1Y42X 1GM5A 2A92A 4JI0B 4HN9A 2H00A 1Q0QA 3T3DA 4BIIA 5IT9A 2X8LA 4YI3A 4A8JC 3FVVA 2PX3A 1GZ5A 1KRHA 1JTVA 4UOEA 2V6JA 4CT5A 3CVXA 3UANA 2EAUA 3BXFA 1WCYA 2VTDA 4KO3S 3R4VA 4DM4A 3OP1A 3WIDA 5KWIA 1DKQA 3GAAA 1MN6A 3HHPA 1VKHA 4RYDA 4HNTA 1L4FA 5LL6P 1Z0DA 2JLBA 4DY6A 4IDBA 3ADDA 2HMUA 1HR0B 4J16C 1Y8RB 1HURA 4CMGA 3GT3A 4QVGA 4G1MB 5DBEX 1A72A 3CVJA 1NOIA 1OROA 1K66A 1Z5GA 2O48X 4L2IB 1ZEMA 1ISRA 2V7VA 4Z1OA 1FYFA 4LDZA 5F23A 3N6VA 1YVDA 3H3XA 4DCMA 4BQPA 2XLCA 3A0UA 2XCSB 1XIVA 3QNWA 3UCEA 4Q24A 3CIOA 3DXFA 2P35A 1U9CA 3WBJA 4AC9A 2LE0A 5DTRA 4TS9A 5EGNA 1W4RA 4TROA 4UTNA 4Q9IA 2J5KA 4ER0A 4M9SA 5IP5A 1N9GB 2AQKA 3N8KA 1R0RE 4O1MA 4Y6PA 2Z5FA 3PGVA 1IXKA 1YIAA 2ZJFA 1M34B 3R6WA 1Z34A 2DR3A 1T4MA 2JFNA 5I45A 4PLZA 3HXQA 1Q84A 1IOVA 1NU8A 1E2PA 1DTSA 4IEFB 4M0PA 4QUGA 1GUFA 2YQ4A 3QXGA 1GT91 4U39A 5FTKA 3TR5A 5LBTA 4CLEA 2X1LA 1LDNA 4MXDA 1P18A 5AICA 2VHYA 2WABA 3EXG2 1G2OA 5E6SA 5BN3B 1MB2A 1MT3A 3ZGZA 1OFGA 1JBKA 3VTKA 2AMJA 2H1OA 3VJMA 4J4TA 1CZUA 3WI7A 5IS2A 1AX9A 1TEXA 3C24A 4NY1A 4AURA 5FUVA 4BU0A 1SVWA 2FQQA 1U7XA 4FFRA 1M0EA 3GCWA 1GZVA 1DX9A 4LBZA 4OI2A 5MF6A 3TFQA 4DSOA 1Q7GA 4ML3A 3TRIA 4EA6A 3PKZA 3LVBA 3SFZA 5K2OA 1B26A 1Z0IA 2ZBFA 2SECE 4BGIA 5BQOA 5FA5A 3RYTC 1M2KA 2JHFA 3FMGA 4TKUA 5TMPA 2R6HA 4IFIA 1CUDA 1M6HA 4ATNA 4MUIA 4B40A 3GNTA 2VRCA 3GJ7A 3JQAD 4MR8B 4TTSA 4ZO7A 4CMEC 1R4MB 3H16A 2FWRA 4M0UA 2P78A 4DMMA 1AVTA 2OC4A 3B52X 1NLZA 3SQNA 3I5MA 3SF8B 3SU8A 1K7SN 2SCUB 5C7OO 4RTJA 3V1KA 4LE1A 2PSSA 3SR3A 3CVUA 4OJQA 2XCUA 4AG3A 5LMUB 4Y6LA 1IXYA 2MSLA 2A3RA 1T24A 2PSJA 2JAQA 1DO8A 2CJWB 1U5AA 2D0OB 5TQVA 3ZY5A 5JWRA 5AJYA 3L07A 5KTSA 2GCEA 2N75A 5TVGA 3DMFA 1JLMA 4JLOA 5CX1A 3IPXA 5IC4A 1AN0A 2BFDB 4Y98A 4ZOCA 2EX4A 2ZUCA 2GQ0A 3DL7A 5CU7A 3F74A 2W6OA 2DT8A 1O8BA 3KCNA 3H4IA 3FZNA 3GA0A 3T1QA 2PT7A 1QZZA 3ZY6A 2IYOA 3LKDA 4C3OB 4KK3A 2VATA 2PA0A 3OQ1A 5EE1A 2YRXA 5CDFA 1J90A 8ADHA 3QW4B 3U62A 4DIEA 1ZRSA 3T9FA 1UFRA 4LFBB 1AJEA 2IVFA 1IHYA 2ZTUA 3DYVA 2CVFA 3IV9A 4UNNA 2YIVX 2OCYC 5AM4A 3UTCA 3FHTA 1KDRA 1QGED 1YBAA 3LYAA 4JWKA 2PSEA 4J90A 3T9EA 1YL5A 5LP6F 5K9ZA 1GEEA 4KR3A 5LOVF 5C53B 3WP1B 1LTHR 3GRAA 3DBLB 4UNSA 1QKJA 4ZEWA 4YRBA 1R6TA 4M9RA 4MEJA 4LJ7A 4MYCA 3SSMA 3OCUA 4F3YA 2HCJB 3U6KA 1IVSA 4GHWA 5CLIA 3I6IA 3ZBUA 3VTAA 4MWCA 1WD5A 3ENNA 2IQ5A 1NE2A 1SHZA 3OZWA 3MIZA 1Q17A 3IMCA 4DAEA 5A1JA 1QUEA 1FU4A 2YYSA 3ILHA 4CEIB 1CS0A 2YWCA 3GJ4A 2P6PA 2GHIA 2E1RA 3DOIA 1F9AA 3CZPA 4COKA 2OGZA 2BEUB 2WKQA 3ITDA 1H1LB 3KX2A 4NBNA 4B7CA 5KVCA 1T9HA 5TY0A 3VPCA 3IQXA 4KYTA 5E95A 1G7SA 5IVHA 1HT2E 5IARA 1OHHA 3PHIA 4D79A 2QVXX 4JC4A 2O2SA 1IYZA 1RI2A 1IXSB 2P2ZA 3K0AB 4NU6A 3O1JC 4DTIA 1RJWA 3OIWA 3K09C 3RRBA 4EX7A 3Q9UA 2QE7D 3O8RA 4JCOA 4P3OA 5IXSA 1GZ4A 3Q10A 4HDOB 3GZTB 3IVGA 4O3FA 3WLHA 5KNBH 1DX6A 2V1XA 2VUTA 3P5BA 4MKHA 2E7ZA 4GUDA 1RYNA 3UXHA 4ROSA 3DKVA 3LQRA 3U3RA 4CTNA 3LWZA 2E0IA 2H4WA 4JCCA 4F3RA 1T25A 3CURA 3PJGA 1B0AA 5AVZA 2Q3HA 4X24A 4QQRA 1UC8A 2IOFK 3JZIA 1LWOA 3ZY4A 3HPQA 5IKEA 4PWZA 2RKBA 1ISPA 2X4LA 2O3TA 2DLDA 3DL2A 1DS6A 3WLJA 1ZR4A 4H6WA 1U1DA 1M2OB 3DEAA 2IUYA 3O91A 3SI7A 2OCGA 4Z4QA 3PUZA 1RYDA 5ADVA 1ZNZA 4NHEA 3CX8A 4W4TA 2R3SA 3WAJA 2NUPB 3CSDA 4GL2A 5B57C 3C3JA 4FE4A 3RIMA 1YRBA 3QPDA 1V6CA 4L4XA 1DXQA 3ZBTA 1ZKDA 1C9EA 2QTWB 1ZGBA 2EKZA 2WSMA 2VT7A 3TQHA 1B8VA 1E2KA 2DUJA 2OOSA 4G1FA 3RJMA 1SUIA 2MINB 4B09A 2O8CB 1XTVA 1NYTA 3QZUA 1Y4AE 2P3SA 5IAOA 1E1MA 2ACWA 5HR5A 4RKEA 3IAAA 2ORWA 2XVXA 4D9MA 3NVMB 4UEKA 3S3TA 1M0SA 3DP7A 2VSNA 3B13B 3RG2A 4ZQIA 1VMKA 2HUPA 5HIIA 4AVYA 4CV2A 4EQZA 1XUOA 1PT7A 4AM8A 4PYJA 3ZWMA 2PGIA 2QTHA 3E22B 1QQBA 1VZ3A 2JAWA 3MOIA 3SBXA 3LUAA 1UJ2A 2IS1A 1W5AA 3E9ZA 1BQ3A 1U2ZA 4EG7A 2FN3A 2WV7A 5JJBA 3KTFA 2AG5A 2C20A 2B8EA 2C99A 2UUOA 3KEMA 2JF0A 2WQZA 3OJCA 3PEFA 1XQWA 3PLNA 4QBIA 3BEOA 3RVOA 2NTYC 4TWBA 2FSSA 4N5NA 3IFSA 2L82A 3SZ3A 4KQIA 2FAXA 2FPLA 2Q3JA 3W5JA 5B4VA 5DTMA 2RSLA 2VPZA 3AUYA 4WNCA 4G8CA 3UF0A 2B4KA 3EZXA 3H0CA 5A04A 1XJCA 2DEUA 3RTCA 1H2XA 1O08A 4Y0AA 3UV7A 3HK2A 1CIVA 4J0KA 4UZEA 4WESB 5FKJA 2I33A 4DGQA 2C3OA 3LU1A 2P4SA 1U5CA 2Z4SA 3HBAA 4TQUS 5EJMA 1LBIA 4HTFB 5I7EA 2WR8A 1BW9B 2F48A 4F8YA 3N8HA 2JJMA 3T7AA 1DINA 1ULBA 4YAJA 4E21A 3HSKA 2G4LA 3BMOB 3QUTA 4MZXA 2CNLA 1JMKC 3LO8A 2Z56A 4YECA 3LPDA 4W1PA 5FHRA 3OTHA 1A9XA 4LZNA 4E51A 2R1VA 3IA2A 5GM1A 3NASA 1MEEA 5CFLA 3ZCRA 5HOEA 1HTTA 4GLFA 3CE6A 3WOHA 4C0QC 1U0EA 4G97A 3PXEA 5B3KA 2B5WA 1Q19A 4FXOA 3LY5A 3M6XA 4NNJA 3RC2A 3H84A 3PWZA 5AM1A 3IAS1 1PZGA 5F77A 2B94A 4GM4A 1DPFA 4YAKA 4NFHA 1CUJA 4Z53A 1L5FA 1ZUD1 1FYXA 4ZPJA 3WB1A 4TUYB 1U7OA 1ULUA 1X7HA 3GZNB 1P9NA 2VHCA 3IE2A 1YMQA 4PG4A 9LDBA 2WSYB 2JCVA 5JY6A 3RUAA 2V6MA 4Z4IA 3V33A 1AK2A 4BMYA 3CA8A 1HBJA 1UEXC 2WJJA 2ZJAA 2YXBA 4INZA 1VMAA 2CVOA 2B8WA 3D6FA 4DDKA 2ZU0C 2ZU6A 3EFOA 5EG5A 2WJ4A 1CY2A 2JJ2A 3HKCB 1CUCA 3LHIA 2IYVA 3BSSA 4ZJPA 2R66A 4LOHA 4Q82A 2WTMA 5AUOB 1SIUA 2JH9A 4O8CA 2M6KA 3ZWAA 3N74A 1JJFA 1ZRHA 1A7KA 1RZRD 3VZPA 1T1SA 2IYXA 3ER8A 2V7WA 5IHXA 2Z3ZA 2RGXA 4AMVA 4I5EA 1MU0A 4JJEA 2C9ZA 3R20A 4ZV9A 1EA7A 2V6FA 1SXGA 1TQHA 1VRVA 1RJGA 4IMRA 4LVCA 7AT1A 3BULA 4C0JA 5JARA 3OQ6A 6AT1A 5HRAA 3V4RA 1TC2A 2FCRA 3LL7A 4LWZA 1I94B 2WSIA 4RK0A 1AGXA 3E3OA 1TQ8A 2YIDA 4S2EA 3IJRA 3EYAA 3CKKA 3IP5A 3NKLA 3UHAA 1S8AA 2H1IA 4BVBA 1PGQA 3ANLA 3REQA 3Q3IA 1N2EA 1PEDA 1V1MA 4KVGA 3BF8A 4LZPA 4QUAA 1JLLB 1N2CA 1UBKS 2A5YB 4HS4A 5CFZA 3IO5A 4FB5A 1WB4A 3UC9A 4X92A 2F4NA 4BFTA 1T0PA 2Y1GA 1EAMA 1WS6A 3IPAA 1E0JA 3D3WA 1K4MA 1M3SA 2PL3A 1L4KA 1Z35A 4DKJA 5EWMA 4YYEA 4QSHA 2XD4A 4WUTA 5C9ZA 5DBHX 2R2GA 2GBPA 3AHDA 4L0CA 3I9MA 4HLNA 5LQDA 2XMSA 4K28A 1VLHA 5GMOA 2JJ1D 1X9IA 4MH0R 4Z0PA 4ARZA 4CI9A 3WYBA 5CVTA 2VI5A 5F98A 4V03A 4NZPA 1B4DA 1EWVA 5LKRA 1U0TA 5CCDA 3CVWA 2I6GA 2Z2XA 3M33A 3FPFA 4E3WA 2YJTD 4PG8A 4Q7JB 1MIOA 2BKVA 1U98A 3N2NA 3WVNA 3I2IA 4JOBA 2QXUA 3D7KA 4JVNA 3NBXX 3I76A 1T1EA 4NONA 1XHFA 1VYVA 1P4GA 3DTYA 4J2HA 4MIOA 4PSKA 5IU6A 5L3QA 1Y4ZA 3CLSC 2H1SA 1ODLA 1YULA 1EJ2A 3OE7D 1DC7A 1X8KA 3PWTA 3RUFA 1RTKA 1O5TA 2TSYB 3CRW1 1PX0A 2BFPA 3UMVA 4AS2A 4EYOA 2GBFA 2FSVC 4KDCA 1W93A 1XMXA 5FI3A 5TEVA 4X7PA 5AK3A 4MYRA 4KCGA 3HP1A 2HZBA 3LWDA 4LJLA 4BE4A 5KYUA 1Z74A 4E12A 4H3KB 3H99A 3O8DA 3FFWA 3C3WA 3HYNA 4B6JA 4E5KA 2JLVA 3LX5A 3LUKA 1ZN7A 4Y9RA 2VK4A 3TE6A 4RD2A 5A9TA 1H9AA 2E82A 4REQA 1SKQA 4LE0A 2ORIA 4NPAA 2O50A 3O38A 1H0HA 4FSXA 3KR0A 2PNJA 2FWNA 4JUAA 1XQ6A 1UXHA 3C5HA 5DSXA 1BCRA 3RJZA 3S28A 2QUKA 2HO5A 4LJYA 2PZBA 2CZCA 4PINA 3RSQA 1UFQA 4YX9A 3ETCA 5EZQA 4CM8A 4FYKA 4RSRA 4RV5A 4OB8A 5KOJB 2W6NA 1M66A 1NFRA 2ST1A 3EIUA 1Z4LA 4FOPA 2EIHA 4J0QA 4N3CA 4B4WA 3K05A 3V32A 2L69A 1IUNA 3FIJA 2PKYX 1OLUA 2ZBEA 4HZIA 2C97A 2QUIA 1P1BA 4C0KA 2Q5QA 3LZ6A 4FJ1A 2O52A 3QELB 1NJ8A 4R9SA 4Y1GA 3KB8A 1GG8A 1ZD5A 3FRJA 3BS4A 3FDZB 3X1ZA 4B32A 1OH8A 2XMGA 1X8JA 2JGMA 1JA1A 1SA0B 3U17A 2Q3DA 2Z5GA 1AKNA 4B1FA 4MGIR 2GPTA 4P36A 5HKOA 1NRWA 1BXKA 1YR1A 3AF3A 4E46A 2DJ5A 1HE8B 4RM3A 4I50B 4HQKA 3URMA 5EZYB 1WXHA 4JFAA 2IUSA 2OZKA 1GKIA 4GXNA 1FFWA 3L3BA 2P5YA 4U9HS 5ALVA