3DLTA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
molecule keywords Esterase D
total genus 85
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dltA00
3EQ8A 3R3XA 2DHCA 2ONCA 5ALHA 2WG0A 1TRHA 2AXEA 1VOTA 3WK4A 1SOMA 2HRRA 2CZQA 5AM2A 1HQDA 1Q0RA 3DS8A 4UPDA 3LCRA 3GELA 3DL4A 5C7YA 5CT8A 4L9AA 1LGYA 4C4XA 3C5WP 4BCBA 5C81A 2XMSA 1H22A 4GHWA 4FLFA 2QJWA 4N8EA 5HQ3A 2X76A 5CRIA 4QLOA 3FSGD 1TCCA 3IVMA 5E4YA 4B9AA 1P0MA 4J03A 5KREA 2HU7A 2WIFA 3G0IA 4G4GA 4AMZA 5ALDA 4UBOA 3V1NA 5ALIA 2HHAA 4FBMA 1J2EA 1QIJA 5A7HA 1C7JA 1K5PA 5AICA 4F60A 2WHQA 4GI1A 5KWIA 2BGNA 3OC0A 4WFKA 3LLCA 4X93A 3WK7A 5D3ZA 1AMNA 4B7ZA 3LIIA 3WKEA 2W22A 1S8OA 1BROA 1CUSA 2DQYA 4BBZA 3WIBA 5CURA 2I3DA 4YX9A 1MO2A 5K3FA 3A2MA 3WMRA 1UOOA 1QGED 4QWMA 4X94A 3G7NA 4X00A 3RARA 4IHAA 4BDSA 2B61A 3O9VA 2FJ0A 1QIIA 2ES4A 4X90A 1LPSA 1CUUA 4I3FA 5JAOA 3D59A 1NU6A 5HQ3B 1SCKA 2WUFA 1YSCA 3OOSA 2JGFA 3WKCA 2OG1A 4H7IA 3G02A 4PSCA 3L1JA 5E2IA 4D9JA 4YK7A 2GBFA 3SX4A 3UUEA 3BXPA 4MEBA 3ZWQA 4TPKA 4J0GA 4BTVA 5AKHA 3O0DA 3TEJA 2OAGA 4KAAA 3G0BA 2OCIA 4UHCA 4W1QA 5AKJA 1DTEA 1XZDA 1ORVA 1XQWA 5AO9A 5AKYA 1CUWA 5E4TA 5JAUA 2XUAA 1JFRA 2Y6UA 1XRLA 1TCBA 5F4ZA 4BE4A 1QTIA 1EB9A 1WHSA 3WWDA 4AO7A 5LKAA 2RHTA 2OGSA 2XI4A 1X70A 5DLPA 5AKZA 4K6HA 1U65A 5LZ7A 3WI7A 1ACJA 1WPRA 2WQZA 4OSEA 1IZ7A 3IUQA 2CUTA 5AI4A 2HU8A 4Q3LA 5A7GA 1MX9A 3UMJA 2HA2A 2QZPA 2RONA 1HL7A 3FCXA 4A16A 4FFVA 1H2YA 3WK5A 4ZV9A 2QT9A 5CH3A 5AK4A 4JNCA 3BDVA 4BVKA 1BN7A 3V9AA 4P92A 3HI4A 4Q3KA 3PFBA 1Y7IA 1JU3A 3N2ZB 4A23A 1GKKA 2Y2VA 4B9EA 2C4HA 1GPNA 3C8HA 2C58A 2FX5A 5LZ5A 3QMWA 1IMJA 2HDWA 4MJ3A 4BVJA 1HPLA 1UOQA 4J0DA 2QXTA 5AKLA 1LLFA 5D7BA 1T4MA 1T2NA 3IB3A 4RE6A 1Q0ZA 3A70A 4AO6A 2ZSIA 1WB5A 3EBLA 3ED1A 1F0PA 3T52A 4UHEA 3AJAA 3WA7A 1XZBA 4N8DA 2O2HA 1E3QA 3CCCA 4XJVA 1QE3A 1YS2X 2HA0A 2HA4A 2ZVDA 3WWEA 2PUHA 2WUDA 5DTJA 3WK9A 1MJ5A 3MUNA 5ALOA 5A2GA 4UBIA 4DNPA 2VAVA 2XB6A 2XE4A 2ZYHA 4WDQA 1XRNA 3G0CA 4AN1A 4KRXA 1GPKA 1W6RA 3E3AA 5AIAA 3MUOA 1SC9A 4F0JA 2HIHA 4PSUA 1LPMA 2BUAA 5E4JA 5JYCA 3GFFA 2WFLB 3R3WA 3I6MA 2BJHA 3NOXA 3QVMA 1CIJA 1ZD2P 1NX9A 3FAKA 1YASA 1AX9A 1ZJ4A 3E0XA 4AB1A 1R4ZA 2OCKA 5HF9A 5LZ4A 3V1LA 3DCNA 2WU4A 4X6XA 4B85A 3I2FA 5AOAA 1R50A 1EI9A 1SCQA 4XX1A 5ISMA 5FRDA 1E8NA 5HFAA 5AI5A 3O4IA 4CCYB 2PU5A 3C6BA 2EDAA 2PL5A 4HXEB 3STXA 2XUHA 2JEZA 3VXKA 4BP8A 3A2LA 4OYLA 1J07A 4AO8A 2VATA 4PSDA 1ODSA 5CT6A 1ISPA 3FYUA 2ZJFA 5JZSA 4Y2XA 2WG2A 4QWWA 4UBNA 4Y2QA 1W1IA 2WIKA 3ANTA 3VVLA 3STVA 5AK5A 1DQZA 4G8DA 5FPPA 4DM7A 3WK6A 2Z8XA 1P0PA 4NMWA 3F67A 1YA4A 3B3QA 1C4XA 3H2IA 1XRPA 2WFLA 4BC1A 1VZ3A 1XRMA 2WJ4A 1MAAA 1JJFA 1Y7HA 4AZ0A 2C0QA 1GQRA 3HRHA 1CUGA 3EIOA 1CUFA 3DOHA 3N0TA 2WILA 1QIEA 5IVDA 3ESAA 3I1IA 1W4LA 4M0MA 1PV1A 2VTVA 5A7FA 1XLUA 2CJPA 3IBTA 5LKRA 1XFDA 1SFRA 3PFCA 3WL5A 3KOOA 1DX6A 3G9XA 2PBLA 1IUNA 1N1MA 5AM1A 5DWDA 5CT4A 4WCVA 1TKRA 2X8BA 3H2HA 1XLWA 4CG2A 3R3VA 4BAUA 4LXHA 2Z3ZA 1Q84A 2HA6A 5ALVA 5ALTA 5CXUA 2VJDA 3OM8A 4X92A 1G66A 3W9UA 1WCYA 2B4KA 2G5TA 4G8CA 5A62A 4RGYA 5T4EA 1FFEA 3WWOA 3YASA 2DFPA 3ZPXA 4P08A 1QIKA 4OB6A 4J7AA 5EHNA 5ESRA 3F98A 3QZUA 4BRZA 1FSSA 5DTIA 5KWJA 1CUYA 4X97A 2VSQA 3STYA 1EVQA 4X71A 2PVSA 1H2ZA 4MEAA 5DYTA 2YH2A 3Q0TA 2BGRA 2NW6A 5JADA 4MWTA 2WHPB 4ZV7A 4MQLA 3PI6A 5ALSA 3QYJA 4ZGBA 3QM1A 3H0CA 2R11A 4INZA 2QOEA 1BEEA 5FKJA 1EDBA 1XKLA 1E8DA 2BFNA 4W1SA 1DT3A 2DSNA 2E3JA 4KYVA 4DGQA 1EA5A 2WSLA 2PU7A 5JD6A 3NGMA 1RP1A 3UUFA 3ZLTA 3K9BA 1O6GA 4KE6A 2DHDA 4H77A 3QBJA 1VE7A 4LKOA 3WL6A 3VJMA 1XRQA 1HBJA 5EHZA 3IDAA 1H2XA 4Y2RA 1VLQA 2O7VA 3HLKA 1UK9A 2XMZA 1F6WA 4FMPA 2WFMA 3G9UA 4P9NA 1KU0A 1ETHA 4C89A 1ZI9A 1IVYA 2ORYA 3FVRA 3G9ZA 2WFZA 1WPXA 4DNOA 5ALQA 1CUHA 4G9GA 4UBLA 4Q1VA 1MX1A 1THTA 2WHPA 3FLAA 1MNAA 1GXSA 3DYIA 4PF1A 2PSJA 1YA8A 1ZOIA 3D3NA 2FUKA 5EIHA 2XLBA 1JJBA 2CKMA 2XQJA 1ZD5A 3EQ7A 3GROA 3DKRA 4G4JA 5DYWA 1EVEA 2XUOA 4H7EA 4DNQA 1DQYA 2I03A 3DQZA 3W05A 3GBSA 4WFIA 1D07A 1AGYA 2XMCA 1GZ7A 4Y2JA 4BDTA 2J4FA 5CH5A 1XZIA 2UZ0A 1H23A 5AM5A 1EK1A 2OCLA 3VDXA 2AJ8A 4H7HA 1XZFA 5HKBA 4W1PA 3STTA 2Y1KA 4KE7A 2QJRA 4Z49A 2CEKA 2O2IA 3FOBA 4J3JA 1CUDA 2C0PA 3ICWA 3SK0A 3AFIA 3RLIA 3KDAA 4BZWA 3H18A 2OLEA 4H0CA 1P0QA 3L1IA 5AOBA 4QDZA 3G9TA 2BCEA 3I2JA 4BRSA 5BWCA 4OYYA 1A7UA 3WK8A 5SYMA 1OXMA 1AC5A 3R41A 1MN6A 5I7UA 4J0JA 1CV2A 3ZLVA 4PNZA 3D4LA 3H2JA 2HA5A 5LLSA 4HRYA 3AZPA 1USWA 1ZGCA 3L1HA 5IVKA 2LIPA 3H1BA 2XLCA 2OXEA 2RAUA 3H19A 1B41A 1PFQA 1E5TA 5JARA 1ZD3A 5LZ9A 2WUEA 4U2CA 3M83A 1VKHA 2YXPX 1GT6A 1ZGBA 2O2GA 1RWQA 5DNWA 2V96A 5K3CA 1TCAA 3E4DA 3D2CA 1MPXA 5FDFA 5JZBA 2H7XA 3BE8A 1QONA 1ZIYA 3AINA 1CUAA 1N8SA 3BF7A 4JUIA 1SCIA 3WQHA 5ALUA 5FP0A 3DLTA 1ACLA 4AX4A 4FBLA 3WZLA 4OCZA 5ALPA 4GLBA 1L7RA 5JATA 4U2EA 3C45A 5FUMA 2QM0A 4Y2VA 5ALNA 1CUJA 3WWPA 3WKDA 2H7YA 3C8DA 1XZEA 4EBBA 1DWPA 3G0GA 1BU8A 1CUEA 4I4CA 1DINA 3FNBA 2WIJA 2D0DA 2HA3A 1BCSA 1QIGA 3QPDA 1R1DA 1TIBA 4Y2PA 2V97A 1XQVA 2DCMA 4FNMA 3VKFA 4B80A 4OB8A 1AUOA 5KBYA 5DJ5A 3P2MA 3E1GA 5EGNA 5D3KA 5ALXA 5CXXA 4W63A 1EXWA 4QEKA 2ZSHA 5AIBA 3IUJA 3A6ZA 4JEIA 4J0CA 4UFPA 3VVMA 4Q34A 5AM3A 1KEZA 4H7DA 1OILA 4QDTA 3HABA 4DMHA 2GZSA 4N5IX 1IUPA 3C6ZA 1MTZA 4J0KA 3W9BA 2OAEA 4B82A 4TGLA 2DR0A 3V48A 1BEZA 2FJPA 3F97A 4B84A 2GBIA 2OCGA 2WG1A 1K8QA 3FCYA 3QITA 3PF8A 5HKAA 4F21A 4OUKX 2K2QB 3I2GA 5JANA 2EDCA 4DLNA 2XQGA 1CUIA 4L0CA 1JT2A 4EY7A 1G5FA 4EUSA 3G8YA 2HA7A 4BATA 3W06A 4TVKA 4QDUA 4BB0A 3IULA 4WFJA 1K4YA 3DJYA 3HEAA 3ESDA 1ZI6A 4ZRDA 5ALWA 3TJMA 3KWJA 3BJMA 4HVTA 5ALEA 3QMMA 3AUKA 1A88A 5AJHA 5BOVA 1JMKC 3VJLA 1W52X 1JKMA 5ALMA 1U4NA 4S0XA 4X6YA 5HFNA 1UKBA 3QPCA 1LPOA 1ZICA 3HYSA 3BWXA 4RNCA 5DNUA 1M33A 5AK6A 4Y2YA 1UOPA 1ODCA 4E14A 3PUHA 2ZJ6A 3F9CA 3FVTA 4FFWA 3H17A 3TGLA 2XMRA 5J3JA 5EIEA 1UK8A 4UHHA 5JALA 1DT5A 4C87A 3AIOA 3QPAA 1LZLA 5C8ZA 3WL8A 1PJAA 4UUQA 3WWCA 1FJ2A 3B12A 4GXNA 4YPVA 3CN7A 4BTLA 2JGEA 3OG9A 1QLWA 3IUNA 1NU8A 1QO7A 2XQKA 1GGVA 4DMFA 4UFNA 2G5PA 1DU4A 2V9ZA 3RKSA 3ICVA 4OU4A 2VJAA 1BE0A 2HFJA 5A71A 2Z8ZA 2IIVA 4HXFB 3R0VA 4QNNA 1YS1X 1LPAB 4H35A 4BCCA 1CEXA 5FXMA 2C5FA 5YASA 1AURA 1GKLA 3GA7A 2CBGA 5AP9A 2WTNA 1TK3A 4FNGA 1FFCA 1VZ2A 2PX6A 4G8BA 2D5LA 1HDEA 2YYSA 3G0DA 3BL8A 4GW3A 2HU5A 1YAHA 5JIBA 1J1IA 1VE6A 1WB6A 2JGJA 2WKWA 2XUKA 3VJKA 4FLMA 2WIGA 2JGLA 4C6HA 5AI0A 1ODTC 5HK9A 2W6CX 3C6YA 2ROQA 4KAJA 2P8SA 3H2KA 3ESCA 1DX4A 2G63A 4CCYA 2GYVA 3C5VA 3B5EA 2VT7A 3AZOA 1W75A 4MYDA 1LPNA 4OD0A 4CIBA 2H9YA 5DYYA 4QE3A 4QDOA 3F96A 2XUJA 1XZGA 1MT3A 1XLVA 3FSGA 2RI6A 4HXGA 4PV7A 3AIKA 3HZOA 4FDMA 2J3DA 4Y9SA 2QR5A 5LZ2A 1P0IA 3I2HA 1QFMA 1CVLA 4X85A 2IITA 4K6GA 3Q8WA 4U2FA 1ZD4A 3DD5A 1QZ3A 3WYNA 1A8UA 4B83A 4IO0A 2CB9A 2PM8A 2VQ6A 1XQYA 3JYHA 1W76A 1X2EA 2PSEA 4U2GA 2QXUA 5A6VA 3WA6A 3FWHA 4EY5A 2VA9A 3GZJA 4K6KA 3DDUA 3IA2A 3W2TA 2XMQA 1XQXA 1OCEA 4BC0A 2XT0A 1R88A 3S2ZA 2HL6A 4B0OA 1F0NA 1CUZA 2IX9A 3C43A 3STWA 4ARBA 2YASA 2G4LA 4FKBA 4EY6A 1EHYA 5ALLA 4ZXFA 1VA5A 5T4BA 3PDCA 1CUCA 4UHBA 2ZJ7A 5K3EA 2WHRA 5CMLA 1EDDA 1YCDA 5LZ8A 2QRUA 4AQDA 3BF8A 5JAPA 3F8SA 4ZREA 4OPMA 2HRQA 2PSFA 5EIAA 2XQIA 2VJCA 3PICA 3V1KA 1MX5A 5EI5A 4G5XA 4EHBA 1Z68A 5HF8A 5AKKA 1L7AA 1MAHA 1LPPA 3MGAA 2GYWA 5T4HA 4J0HA 4CIAA 1HKHA 2I78A 1QIMA 5FLKA 3I6YA 2XDWA 4NS4A 4BYMA 3HC7A 2HM7A 4HTAA 1EH5A 7YASA 3K2IA 1UK6A 4XIIA 1Q83A 3R3YA 5AH0A 5JASA 1WHTA 4CFSA 3SWWA 5HZGA 3HSSA 1O6FA 3AZQA 5FOQA 4W9RA 3ZLUA 3GUUA 3PF9A 3O4JA 4KAFA 4LYEA 1H2WA 2C5GA 4DNFA 3ESBA 5AOCA 1XKTA 4L3WA 4G1FA 4HS9A 4KRYA 2RIPA 4X95A 3HACA 4EY8A 4UHFA 2O7RA 2QMQA 1UKCA 1MNQA 3FLEA 5T4FA 4X91A 1CRLA 1LBTA 1CQWA 2HADA 5IKXA 1XZCA 2XUDA 3D2AA 2RGUA 2JF0A 6YASA 3D2BA 1X2BA 4OU5A 5I8PA 4V2IA 1CFJA 1XZJA 4GECA 4UHDA 1A8SA 1CLEA 1YB6A 4BVLA 3A2NA 3O4GA 2WU3A 5ALYA 3WL7A 4DYHA 4QLAA 4AMYA 5JD5A 3D0KA 5FPQA 1J06A 5K3FB 4HZGA 5K3BA 1YR2A 4ARAA 4KJXA 4FLEA 3NUZA 3WYDA 3BIXA 4N5HX 5IVIA 4B0PA 1QJ4A 3C6XA 2H1IA 3S8YA 4IH4A 1DWOA 1EX9A 4C01A 3HXKA 1ZI8A 5I9IA 1FFDA 4Q05A 4MQMA 1ZIXA 1HLGA 3EF3A 3FYUC 2PKYX 4DSZA 2XUQA 4WY8A 3I1YA 2QTBA 2JGKA 1BN6A 4BAZA 3DYVA 3FYTA 1QTRA 4WDRA 4A5SA 2WJ3A 3OURA 3WJ2A 3QH4A 4M0FA 5CH8A 1L7QA 4CG1A 5CT5A 1IZ8A 1FFAA 2ACEA 2CMFA 3WLAA 2PSDA 2BUCA 4GWLA 1EK2A 2VT6A 5ALZA 3QMVA 3T4UA 1YAJA 4DTCA 1ZJ5A 1XROA 3KSRA 4DMKA 4U2DA 4GBGA 1XZLA 3M3DA 1VA4A 2OGTA 3O4HA 4PO3X 4HAIA 2PSHA 3FLBA 4YASA 2GBCA 3C70A 3KD2A 5LIPA 3WZMA 4IQ4A 4AN0A 1UFOA 3K6KA 4FHZA 1UWCA 3R3ZA 5LYYA 5HK8A 4FOLA 1E89A 1WOMA 5K5EA 2WIDA 1E66A 3H1AA 4I19A 4X7BA 4KR0A 1MU0A 5AK3A 4DMCA 4M0EA 5D6OA 2AJCA 1N5RA 2X5XA 3I28A 3O95A 1RYYA 4BP9A 3WKAA 3BJRA 4H7JA 4KEAA 5HF5A 1GPLA 3R40A 5AI6A 4ROTA 2BKLA 4BZZA 2QUAA 3I2IA 4O08A 3ILSA 4UBKA 3DEAA 3U0VA 4UBJA 2QUBA 5AM0A 2GBGA 4FWBA 1UT6A 4ITVA 4KE8A 4E15A 4KE9A 2VEOA 4J0IA 4MYSA 1JI3A 5AKXA 3I6ZA 3D7RA 2Q0XA 3SC2A 5CTAA 5JAHA 4ZWNA 2WJ6A 1F8UA 1QO9A 4XWGA 3DL7A 1I6WA 1AZWA 3BDIA 2RHWA 2AJDA 3WKBA 4AZ3A 1CR6A 2JGMA 2DQZA 4H7FA 5CBKA 2Z3WA 3M81A 1UZAA 2WUGA 3TRDA 3X3HA 5H3HA 2XMDA 2H7CA 1XRRA 3CCBA 4MXDA 2XUFA 3STUA 2PUJA 5JZ9A 4RPCA 4ZI5A 5FV4A 5K3DA 5IH7A 4BCDA 3NWOA 4ETWA 2Y6VA 5HCUA 4X3CA 1QIDA 4NZZA 4B6GA 5C8VA 3OTQA 2AJLI 2QKYA 4P93A 3MVEA 1KU6A 2VF2A 1JU4A 4JH0A 1THGA 4HRXA 4LXIA 5ALGA 1WB4A 2XUGA 3DKKA 1U2EA 2GYUA 3KWFA 5BWBA 3JW8A 5AKGA 3DNMA 4DIUA 1CQZA 1A8QA 1BS9A 1G42A 2C7BA 1QIFA 2B9VA 5EHXA 1ORWA 1U8EA 2B20A 2XUPA 2VAXA 3VISA 4GDMA 5BV7A 1E8MA 3LIPA 3PUIA 4GEGA 2HFKA 5JD4A 1WM1A 1FFBA 4UFOA 2GZRA 3AILA 5LP1A 3IURA 2JGIA 3LS2A 3H2GA 4Y7DA 4LHEA 4EA6A 1K6EA 4MWSA 4IH1A 2XUIA 3RM3A 1R9MA 4K5QA 1UK7A 5AKEA 1LZKA 2AJBA 2JEYA 2VJBA 4Y2SA 2XQFA 4KACA 1XZHA 4LYDA 4G4IA 1BCRA 3D5EA 2J4CA 1C7IA 1B6GA 4LIPD 1LNSA 4C88A 2WM2A 1VJ5A 3JWEA 2PPLA 4Y2UA 3I2KA 4CG3A 4BAGA 4Y2TA 1XZMA 1UKAA 2Y2UA 3DOIA 4Q3OA 4XVCA 2Z5GA 1R3DA 4JYMA 4CCWA 3IIIA 4RE5A 4C4ZA 3BIWA 3OPMA 4E46A 1XZKA 1QFSA 2J3QA 3V1MA 3FBWA 4WJLA 3WJ1A 4NVRA 1IUOA 3ZI7A 2XMBA 2XMGA 4WY5A 3ZV7A 1R9NA 1DWQA 2WLSA 1QIHA 4JYPA 2OGZA 4G9EA 5HF6A 4X6UA 2ECFA 4W1RA 4CI9A 5CT9A 3LP5A 5ALKA 1BRTA 4E11A 3EQ9A 4UBMA 1LPBB 2QVBA 5C8XA 5DNVA 1EDEA 1JJIA 1XZAA 4IH9A 4QDXA 1TAHA 5AI8A 4U2BA 1EINA 1AQLA 2ZYRA 4B81A 1VXOA 4OB7A 5EHQA 2R8BA 1CUBA 1LBSA 4H7KA 3CXUA 4DSAA 1GQSA 3R3UA 1YB7A 4PQEA 1QOZA 4EY4A 2DHEA 4FTWA 4EB0A 1CUXA 3O9MA 2JBWA 2EEPA 1CUVA 4PW0A 4H18A 1VXRA 3M82A 5ALFA 3CN9A 4QA9A 1UXOA 1Y37A 4N8SA 2QS9A 3IUMA 2JIDA 1G4HA 1K63A 2ZYIA 2ACKA 1N5MA 2V98A 2WTMA 5AM4A 4C4YA 5ALRA 2BUBA 4QZVA 4K2AA 4EZIA 4F5ZA 4L72A 3C87A 2OQIA 5SYNA 3HJUA 5IVHA 5AHXA 5EFZA 1TQHA 1JMYA 4AXBA 1CPYA 4LXGA 2OPHA 3WIOA 3W04A 5AKIA 2BAGA 3KXPA 4Q82A 2OQVA 3AIMA 3H04A 5CW2A 2ZYSA 4BE9A 3RK4A 1AKNA 5ALJA 1EB8A 3ANSA 2I3ZA 3FYUB 3PE6A 3U1TA 5AI9A 5K3AA
chains in the Genus database with same CATH superfamily
3H2SA 1QQ6A 3KVNA 2PZEA 4AJIA 4B3CA 2DHCA 4OIFA 2DQSA 5EKXA 3PUVA 3P9YA 2YINC 4MKHA 5DP2A 2NT4A 2RE8A 4NZNA 4UXIA 1R8SA 2ZW9A 3Q6NA 1CNMA 4JAVC 1BHSA 2AXEA 3W3AD 4NCAA 3N07A 3N28A 1B0ZA 2ZUSA 2HRRA 4WD3A 3B9RA 1A2BA 3JS5A 1I5EA 2O2DA 2ZSKA 1Q0RA 5IAOA 3GELA 4WRRA 3ROTA 5C4IA 5KQLA 1L8AA 4RIHA 1E9SA 2GETA 5KNLA 3QA9A 1YQQA 1Z4LA 3W6ZA 2B4RO 3SJUA 5H68A 2Z3VA 1SIOA 3FCUB 4Y6PA 3SKVA 3WLSA 1JH8A 2YVQA 1GL9B 2REQA 1VLZA 2FVYA 3ZWPA 3RQIA 2CE2X 3DNFA 1MAVA 2WT8A 4I6JA 4WKCA 1CCWA 1SC1A 1AUPA 2P9EA 3NASA 6LDHA 5HQ3A 4IV8A 1U4OA 4HB4A 5CRIA 4MVWA 2QHXA 4NOJA 4A27A 1B15A 1L1RA 4YQFA 5FTLA 4IIXA 1ZM7A 3DZGA 5FUBA 3QEMB 4L76A 1TVKB 2HO5A 3I61A 2KLHA 3DHYA 5LLTA 4N0MA 1U1DA 1EP1B 1FRNA 2YDXA 1Q1BA 1P0MA 3MUFA 5B7GA 5CLQA 3ET4A 2C94A 2C92A 3IB6A 4AF8A 3PSAA 1HQKA 4PC1A 4DA8A 4U0KA 4BO6A 1BQEA 3BIOA 4J3NA 4MI9A 2Y1DA 3U7HB 1WVIA 5JH7A 1OAAA 1PJ3A 1T1EA 3AR7A 4QICA 3O1JC 1JBKA 1YZKA 3DMTC 1NVEA 2KW5A 3NP9A 5ALIA 3NS7A 2COUA 1U0TA 4NAHA 3EEBA 2PKQP 5F77A 1R8JA 2QAGC 4XA8A 1RLUA 1YZ3A 3O5AA 1C7JA 4HRVA 4YRDA 3DPIA 4YJFA 2X4DA 4EGAA 1FYVA 1FUYB 4WQMA 2WHQA 1VG1A 5AVUA 1CR0A 3LT0A 1I51A 1K7FB 4EMTA 1ZJYA 4RMIA 1DFHA 1W2HA 3L1VA 2OBBA 3HBNA 3OZVA 3QU9A 4PLGA 1EVYA 4WFKA 4YCJA 5IF9A 4G0UA 1U31A 2QPOA 3BMOB 3LLCA 3V34A 1UADA 2BGGA 1O95D 1VKJA 1N2HA 1ZVKA 2IUUA 5JUWA 1CIPA 4B7ZA 1AMNA 2IFTA 4M1YA 2IZOA 3HB5X 4KSBA 4W6QA 5IBPA 1QRSA 4OY3A 1S6YA 3B2QA 3WKEA 1YVDA 2UKDA 4J4TA 3ZZTA 4EKEA 1PJ4A 2W22A 4FEAA 4MPRA 1FLAA 5I9LA 1O8CA 2BBWA 4U02A 3H1FA 4DC1A 4DV7B 1W59A 1Z4MA 1P6UA 3P9ZA 1T5TA 2XSZD 3OP4A 4QODA 5EYPA 2OYCA 3VPSA 4BBZA 1FNNA 2C7RA 1DXOA 1QS0A 1E1RA 3ZJYA 1REQB 3NVMB 4MIYA 3I9KA 2VP9A 4JYBA 3VBCA 1BTOA 1R2QA 2N75A 2DUMA 5HS6A 1EXNA 2D2XA 5B36A 4H15A 1Y7TA 3L06A 3AL2A 4ND2A 2H57A 4X54A 4W6ZA 2PX5A 1GUDA 1TTQB 2EX0A 3PKZA 5BR7A 2JJYA 2B61A 3LFHA 3HKDA 3LT2A 3G5AA 1G98A 2R4UA 4TXJA 4TYPA 3SM3A 3TLZA 3ZWNA 2V1XA 1QIIA 2ES4A 3PDJA 4OK5A 2B0JA 3HU3A 1U2PA 2BEWA 3KJXA 3LF1A 2REQB 4EWLA 2HXSA 3MTDA 2I91A 1OX5A 2V0CA 5JE8A 3NBKA 1T5OA 4DLXA 2E37A 4GO1A 1YSCA 4R71A 3LHKA 3OOSA 3AM1A 1QE0A 1ZUD1 4N49A 4RTQA 1TZCA 4M8KA 2PZFA 3PTZA 1RBMA 4GS5A 2DERA 1MZVA 1MB0A 1OVGA 1R16A 1TUBA 3E9QA 4RC9A 4B34A 3AYXB 4LC9A 1UEXC 4PSCA 4MHSA 5E2IA 1BHO1 1DARA 1EIZA 1DIHA 1FDIA 1ZRHA 3DZFA 3SYTA 1QANA 3KOWA 4RA9A 4H7PA 3DV2A 4IVQA 4PO9A 4ZZ0A 4BXOA 4BV2A 3JYLA 1O03A 2LCFA 2VHUA 5DOVA 1NDHA 1VGRA 5TGTA 4MQUA 4NK4A 3QLTA 3CZ5A 1NW7A 4MEBA 4Y6LA 2G5GX 3ZWQA 2EZ9A 4R1NA 1I4OA 5JU6A 4D74A 4R8SA 4J49A 4OGKA 2DFTA 4C21A 1P33A 1AZLA 1U2RA 1FUEA 2ZS7A 3ZVKA 1DOZA 1T9DA 3BWYA 2OCIA 3LA8A 3LY8A 4Q16A 1ECGA 3DB2A 1GEEA 1Z0AA 3DCYA 4M8SA 4W1QA 3DW1X 2VRBA 1XZDA 4PG5A 3R75A 4QBTA 4JJEA 4XB1A 3P9IA 4ZO7A 5TARA 5KMGA 4D9BA 1DAMA 1GRVA 5BSWA 1SZDA 2XJ4A 5LSAA 4ZHQA 4HFJA 3KQKA 2BMAA 3BJEA 3KKOA 4KXUA 2YYYA 4IXMA 2QSJA 2GPBA 3IHWA 5K8LA 3QLUA 1G5IA 1H93A 1R8YA 3B6JA 1RHKA 3JQAB 4IRUB 3UKJA 1H0KA 3WRYC 1WBBA 1M5RA 3PLRA 2JI6A 3A14A 5EYPB 2J3KA 4IOMA 1ESDA 4TWAA 1KR5A 1XRLA 1M6NA 2NNLD 3ANMA 2ZJ8A 3IQEA 1Z75A 1L1FA 5F4ZA 2YX1A 9ABPA 4DUYB 1SG6A 1MEJA 5EY5B 2WWVD 5B4VA 2W2MA 5BWLA 3EN0A 2VAPA 4Z0PA 1QGZA 2X9NA 4QTZA 3U26A 3O9ZA 4MK4A 3S44A 4P53A 3ZDXB 3WWDA 1AHHA 4RXTA 1BZYA 3MXTA 4B3XA 2FA9A 3ETHA 2RHTA 4BWYA 5IASA 3KKEA 1Q7EA 3L8DA 4GZ5A 2GILA 1N8TA 4DR6B 3A4IA 2QVLA 1A98A 2JVIA 1QBGA 1Q20A 2UXCB 1BNCA 2NZ2A 1OLOA 5ELMA 1XTTA 2GZAA 4RMJA 3W3AH 1GV0A 1QDEA 1U65A 3OAAA 5GY7A 1CDEA 3GQBA 3QTLA 4LOIA 4LRYA 5LZ7A 3WI7A 3TZBA 5GZ3A 1LDMA 1XWIA 3IUQA 3RU7A 3VOSA 3MHTA 3U4IA 1NUPA 2SCUB 3JZMA 3QU4A 2EWVA 1FJGB 4JBIA 1UBTS 5D5HA 5AVRA 2Q62A 3OKFA 1X6VA 4FZVA 1WJGA 4O4JB 4K9LA 4LKRA 3CQ9A 4EVSA 3ME5A 4XX0A 3TQOA 4Q3DA 2WQ6A 3U60B 1Y4DE 1PKXA 2NACA 2O0HA 2QQGA 2QTRA 4BZXA 5L3SB 1M8PA 1I7PA 2EFJA 2VDWB 5JNRA 4ZYXA 2FQ1A 2TRSB 1MJNA 2E4VA 3W3AA 3VJRA 4LRSB 2ZT8A 2C0CA 3DVLA 3F8TA 4UUNA 5E7JA 3ZXUB 1QV7A 1WXEA 5CITA 3U5ZB 3C7TA 5JZOA 5EKTA 3ZCXA 5AK4A 2WM9B 1E64A 3GLUA 2VPTA 4DXDA 2H5LA 4MMXB 2XOKA 4E5PA 2O3UA 3BSYA 5JYDA 4KMSA 1HNWB 1PDWA 3SQOA 1P29A 4FYXA 2CSXA 1ZR2A 4EECA 2VA8A 4KHZA 4DHWA 3PRHA 4KGZA 1Z6ZA 4P92A 3TVTA 1W47A 2BHRA 3HI4A 3Q5GA 4JDPA 3DE4X 2QM7A 4Q3KA 1T1JA 1JYFA 1SK8A 2QX8A 3KEGA 4ND7A 4QASA 4TMWA 3M0EA 1PL0A 2HPZA 3WR5A 4A23A 1M2GA 1XD2B 4ZVMA 5FPKA 4G25A 4P54A 1WW8A 1NVBA 2JCBA 3DV0B 2B1IA 2H9IA 3KXIA 3D8HA 2C4HA 1LJLA 3VU9A 3EDOA 4NATA 4NARA 2GZ3A 1K68A 3I4FA 2FMHA 3ZIDA 5A2QA 2XCUA 4TV8A 2PWZA 3DMRA 5K05A 3U48A 1QP0A 3NHYA 1I6MA 3PQ4A 3G17A 3QMWA 1D6JA 1Z2AA 4RTPA 2RG1A 1E2KA 4GMKA 4PNHA 5KKNB 2ONJA 2JHGA 1IMJA 1HM5A 3OLZA 4J0DA 3E6AA 3HYLA 4UM9B 3ZNQA 5AKLA 4DLKA 5IFLA 3NJ8A 3CR8A 1V8DA 1YDEA 4RZSA 1ITZA 3QWIA 1T2NA 3NT4A 5EJ9A 3RSGA 1Q0ZA 4ZT3A 3ZV3A 2QAIA 4XW2A 2CXHA 3OLCX 3EBLA 3WSWA 1EUQA 6ADHA 1RP7A 1KOJA 2G6BA 1A50B 1JLSA 3Q41A 1J56A 2C96A 2JIOA 3COVA 1XP5A 2Z56A 2PHZA 1HMYA 4HATA 2H4WA 3SE7A 3WX0A 2F00A 3JD3A 5THQA 2BZ1A 2GPNA 3EUEA 2BI4A 2NO0A 4ZN6A 1DCTA 3UHJA 1BJTA 1MC8A 3LVFO 3NC4A 3ND9A 1VG8A 3KR2A 1BXRB 3TSOA 4XJVA 3GAZA 3GFPA 1DJQA 3I9LA 4M21A 2WSBA 4XUDA 4KR9A 2ZVDA 1KJNA 3INGA 4ZHSA 1O2DA 4QQNA 5EXTA 3CRW1 3QIVA 4DEXA 5KYXB 2I5PO 4KIUA 2JZOA 2X9QA 1JBQA 4PONA 5D85A 1XMSA 1K4KA 1QF9A 4XXHA 3NWEA 5ALOA 2YQ4A 1DIRA 4E07A 1V5IA 3QXSA 1UOEA 3UTDA 2QAJA 5A2GA 4ZEWA 4CMEC 4DNPA 2J9GA 3M7IA 5FNVB 4WIAA 2NSLA 1TT5A 3V3TA 4BLOA 1MJHA 1J09A 2VPQA 1C50A 2QAGA 4OX9Y 2XE4A 2ZYHA 2JBHA 2X8JB 3M6MD 4N6NA 4MW6A 2GVDC 4YTEA 5JNVA 1RE0A 2JI9A 2VUTA 2W83A 2FGJA 3R9XA 4IXDA 2ZI7A 5HNKA 2J9FA 4WNIA 2DTXA 1GPKA 3TS1A 5H9WA 4GI7A 5CU7A 3A6HA 1DG1G 4MCJA 4P3NA 3L6UA 5FQNA 4UTVA 2JFUA 8ADHA 5AIAA 4WECA 3MUOA 4WK2B 3BGIA 1Z28A 1WCV1 2G9NA 4XJXA 2B5OA 3BWMA 2GM4A 4HSGA 4PSUA 2RG7A 5SY6A 1LPMA 4V24A 1MOSA 4DV0B 3GLTA 2ZI4A 2ZIWB 1H8EA 2ODTX 3VH2A 2HNBA 4Q4JA 1G8SA 4PAWA 2WQ7A 2A9PA 2XD4A 1HC7A 2E21A 1C30B 3FH0A 3P45A 3ODGA 2W2PA 4PINA 4R1LA 4YONB 3RUDA 1IBKB 3ZD7A 4DAEA 1WXWA 4M7OA 1R5NA 4ZZ1A 1EXVA 4DIDA 3CS3A 6REQA 2GPWA 5EJ5A 2WD9A 1LF5A 1GITA 4P0TA 4R8MA 2GJ4A 1N0HA 4YACA 2JRLA 3RG2A 4EQ6A 2DB3A 1ODIA 3T3MB 2F59A 4QRDA 4AZTA 3EXEB 3JPYA 1I3MA 3DFUA 4R69A 1R4ZA 3LUKA 1VHWA 1FP2A 4LV8B 4MP3A 3RUCA 5HF9A 5LZ4A 3FPEA 3V1LA 4ZI2A 1OH7A 3AI7A 1BWPA 4H4DA 5D01A 4BVFA 2NMVA 3PWSA 1MO3A 1NW5A 1SULA 2WU4A 1Y1PA 4B85A 3ASUA 5F7XA 3A1SA 2IXGA 1CS4C 4W5TA 5C5DA 2VTBA 3CSSA 5JY1A 4RNDB 2F1HA 4BP3A 1R50A 3UHOA 4G23A 4GIBA 1PLLA 1XTVA 3AJRA 1BXRA 5AI5A 3PG5A 1PR4A 4K9QA 4L08A 3RYFB 2C2WA 2PL5A 2I3AA 2DT5A 2G36A 3AHDA 3N2KB 1A9XA 4W5OA 3Q5DA 4XYLA 3N8IA 4FJ2A 4QL3A 1UKEA 1F2UA 4F72A 4XWKA 3H8SA 4HXEB 4E30A 3HY3A 4BFUA 2NZVG 3AEKB 1ZVMA 4A1FA 4ZFNA 1E79A 3ILXA 3VXKA 1SQSA 3PLNA 3EBOA 3A2LA 4G85A 4JHLA 2YC4C 3Q7IA 1CQJA 4AO8A 5EZQA 4LGCA 1ODSA 4DLUA 5T57A 1NNEA 1NRWA 1F4PA 3IPXA 4NP6A 2GEDA 1I7LA 4YEDA 3X1YA 2ZJFA 4OHMA 1BQ3A 2F6RA 2AF4C 2BTQB 3R5JA 2WG2A 2QPTA 2XCIA 1MR3F 4KFTA 4OKIA 1P2SA 1V5WA 1V45E 4HZIA 4RQAA 4UBNA 5BPHA 3SJ7A 3CE9A 3QX8A 2BGUA 1S8AA 3F3SA 1ZAYA 3RPEA 1YMVA 1RJGA 3JXEA 5LA6F 2AEFA 4FW8A 2R4QA 5B12A 3BICA 1AU9A 1A4RA 4NXMB 4MUXA 4DLVA 1AGRA 1I2CA 3K16A 4AULA 3D3WB 2ZZMA 4GQAA 2Y77A 3C3YA 3WGNA 1T5SA 1I7QB 5TQVA 4J16C 1G5TA 2HQSA 2QVXX 2WV7A 3EA0A 3M49A 3WK6A 1EMDA 2OO5A 4JNKA 4NYIR 1NOIA 2FMXA 4L16A 2PTHA 1B8PA 1JXAA 1M2WA 2Y1CA 3A7EA 3H2IA 3DLPX 2YIDA 1NZFA 1QHSA 3QF4A 2EP8A 3ETGA 4EHDA 3KALA 4DEVA 3D6NB 1C8KA 3SBDA 5LBTA 2J0UB 4GT1A 2F43B 1XRMA 2FQWA 1MAAA 2Z04A 4BMPB 3GA5A 4AZ0A 1IN4A 3QE2A 3EXEA 4CDGA 1E32A 4FCTA 3OBBA 3ZTWA 3ZU4A 2BTEA 5F2KA 4QTTB 5K8JB 1FDRA 1NVXQ 4IYJA 4QOSA 2BFPA 3T9BA 3UKDA 4E6EA 1G6Q1 1QIEA 4KWTA 3EIXA 1VJCA 8AT1A 3VSEA 5G1OA 3INRA 2QMOA 1AV6A 3I62A 3QEMA 3GQVA 1J70A 1PV1A 3NKVA 1JDNA 3P0IA 4M0MA 3T7TA 2P35A 1USKA 3F7OA 2LCIA 1FX0B 5JC1A 4JC5A 5KC8A 3NHLA 1YHZA 3C3PA 4RV5A 4XGQA 1XFDA 1UANA 3PWZA 1OXKB 1W94A 3GVCA 3WL5A 4YP9A 4K7JA 2R68A 3BCHA 1A3CA 1DX6A 4IHKA 4DUZB 3QVGB 4TKLA 3HJAA 2YV4A 4N47A 2IGBA 3GXBA 4DBLE 4F06A 1VPLA 2ZSEA 5KNCH 4L0QA 1SUSA 4GMDA 3O1LA 3QKIA 3LWBA 3RDPA 4L4XA 1TKRA 1ONSA 1BU5A 3K1YA 4MKZA 1XLWA 2ATEA 5EZYA 4CG2A 1ISIA 2IHZA 1F7UA 1FUKA 5A0VA 4NOKA 4QT0A 1VKOA 3ZVNA 2Z3ZA 3AEKA 4NFSA 4QUIA 4PGHA 5DBGA 2RHJA 5ALVA 3BWVA 1SUCA 5EWLB 1H4TA 1HDYA 1E2BA 2OQRA 3K96A 4AJ1A 6PFKA 5ER9A 4BOYA 5I8WA 4N48A 4KP7A 4NNJA 1OZAA 3WGOA 5ICCA 3D7SA 1O0BA 4DCNA 5PNTA 3DWGA 2VAWA 2VJDA 3BE4A 3V8RA 3GRFA 1MB4A 2Y99A 3FWZA 3FUUA 3WLQA 2BTQA 1MW9X 2ISCA 1XXLA 4LDZA 2ZM5A 1ZWLA 2DQKA 4DG9A 4LF8B 1TJ3A 1RKUA 1UPTA 3JATA 3KVRA 1G66A 1JYEA 4MIOA 4U7TB 3W9UA 4IO1A 4JI2B 1GA4A 4YY3B 4AIIA 5KYWA 2G5TA 3IDZA 2DY0A 3CU5A 1RC0A 2QD1A 2NV2B 4ZPXA 5FOTA 3ZY2A 2UUPA 4FDUA 1NE7A 3A9SA 1RYDA 3ILYA 3JWIA 4Y1GA 3GF4A 2A5GA 2RK4A 1JGTA 2F1RA 1REQA 3KVVA 1LSUA 3EFOA 3ICOA 4DVGA 1QYCA 4COOA 3WWOA 1FIUA 4HD8A 3T94A 3BGVA 2DFPA 1PR1A 1C29B 4QUKA 1GNTA 5WRFA 3ZKWB 1K92A 4YPFA 4O25A 1HDRA 3C8MA 3UIEA 1GU1A 1VDMA 5AJZA 5ESRA 5J2TA 4GICA 4M8LA 1VP3A 1QU3A 5JNLA 3SJBA 3G8AA 4GQIA 3UT5A 1G3IA 1PJ2A 4BRZA 3V4OA 5LUAA 3MM4A 5CBPB 3AUXA 2R1UA 4I99A 4YAWA 5AHRA 5DTIA 1CUYA 1ZA2A 4S2EA 5KU7A 3TVYA 4X1KB 1C3OA 5BQPA 3VDMA 3F90A 4LJKA 3HA7A 1H2ZA 4NQZA 4O4IF 4X8MA 3VC3A 4DR4B 3NHSA 4MEAA 3RJ5A 2J59A 1K7EB 1QO0D 4DR7B 1Q5PA 1CLUA 3OU2A 4OJKA 3EGXB 3RABA 3FNFA 4A82A 3PDIA 1O87A 4YA6A 4YQZA 5JADA 5IW8A 5EVJA 3H3FA 2CHGA 2QVZX 1TO1E 2WHPB 4ZV7A 2GVNA 2HT6A 1GXSB 3PI6A 1YZLA 2AA3A 2PGXA 3PD7A 1VMAA 2HCRA 1KVTA 1CY1A 2XWSA 3U80A 4BUCA 1EBBA 1OVMA 2J6HA 3GRVA 2UVDA 3ISVA 4XGRA 3IUBA 4LZJA 1YULA 4NU6A 4INZA 5NULA 1NVGA 2VSOA 1MJFA 1WF6A 1NT2A 3HKCB 1BEEA 3UAXA 5CHEA 1UFQA 5DTRA 2V03A 1M0WA 1T9GR 1XMOB 1Y4UA 1Y81A 3CF6R 3DR3A 2PR7A 3D7NA 4WJKB 3VV3A 5KYYA 5A0TA 2G9UA 3BKWA 4G1UC 1T8UA 2ZCJA 1SG0A 1SEPA 3ZJUA 1YRLA 2CSUA 4BVBA 4EDFA 3V1TC 1X9GA 2WJYA 4JXXA 2IW3A 2OZKA 3HB4X 4MUFA 3K0AA 4W1SA 2IIPA 3WRWA 4WE3A 2YVLA 1VE9A 4BECA 5TPZD 2AKEA 1CULC 1FVFA 2ZUCA 1PVVA 1ECBA 1QYXA 3SYMA 2WNHA 4KYVA 2GCNA 4D4JA 2Q8NA 4ASUA 1YZHA 5FBQB 2NP6A 4TTRA 3HCBA 1ULSA 4NI5A 3I9NA 3WGYA 4B3BA 2DEUA 3I8OA 4EYSA 3NGMA 4WY2A 1RP1A 1XQ9A 1DP4A 2F3PA 2P3OA 5CR9A 2BLLA 2P67A 3HKBA 4C7MA 1N7GA 3UHFA 3ZY4A 4MW4A 4PYIA 2EKQA 2DHDA 3DR5A 4W9NA 3U7RA 3UWMA 3TRIA 3CO5A 1VE7A 4LKOA 2X7XA 4HNAB 4H1VA 2XUZA 1DTWA 2QD3A 1EFDN 3RFCA 4QATA 1YBFA 2YFHA 4DBVO 2DWPA 2XEDA 2ZIAA 2OESA 2BKUA 1HO3A 3QSYA 5F9HA 3II6X 4FMPA 3GYGA 2XNCA 3HJBA 4EENA 2PBFA 1R9JA 4PN7A 1ZNZA 4WL0A 5F35A 4MWEA 1PBTA 1KU0A 2FZ5A 4HX2A 5CUQA 3T3EA 1ETHA 3SC6A 1J2JA 3R6WA 1EFPB 4JR0A 3GFOA 2CCJA 4ACBA 5CBPA 4K0KB 3ACCA 5C37A 4QQFA 2F64A 1FCJA 2CT8A 1TVCA 4RIFA 3BWCA 3W9SA 2ORYA 3FVRA 3OP1A 2WFZA 4EFNA 4L1KA 2J33A 5LL6P 3FWKA 1N9GA 1PNOA 4KMMA 3QE4A 1CUHA 4BEVA 4XQEA 3COZA 4G9GA 1LNZA 2QMHA 4X0EA 2SBTA 2E4WA 5BMVF 3IYLW 1K6IA 1KOGA 1YR9A 2IEBA 1D2RA 3C8ZA 3DTYA 4RDIA 3GRKA 4YUXA 2G82A 2W2OA 3CLUD 3FLAA 2G8NA 2D6FA 4FR2A 1GXSA 2ZWIA 2AG0A 3DYIA 4JQSA 2R2GA 4Z0HO 3QVVA 2BF4A 4C1BA 2QN9A 1ZITA 3AIIA 4Q9IA 1NYQA 4A1OA 5FPTA 4EPXA 2NGRA 1IE3A 3OZIA 1OB2A 1U3VA 1SOAA 4WBNF 5H5JA 3BXFA 3UJPA 5JI3E 1R27A 2FSVC 2H59A 3KD3A 1OD6A 4EGFA 2O8FB 1COWA 3UAWA 4OXYA 3I52A 2J0EA 1EVEA 4PSVA 4QOGA 2CHEA 4MUKA 1QRAA 5JCZA 4DNQA 4XCQA 4MWBA 1J5PA 1DQYA 3IXMA 4WKNA 5ICSA 3Q98A 3IQHX 1F8FA 5DSTA 3DZDA 2R66A 3P8ZA 3TMKA 4EK9A 5EJ4A 5IBQA 2P5YA 3BOSA 2VWGA 2XMCA 4RAOA 1GZ7A 4Y2JA 1YGYA 3JQ8B 2UZ0A 3P2EA 2H2WA 3LPLA 1EEHA 1SAYA 1Z2DA 5BQOA 3SDZA 4YT5A 2R6GA 5KNCD 3PLAE 4F1KA 4PYJA 2Y71A 2AJ8A 2FU5C 5HE8A 4PPGA 5HKBA 1E0DA 4ZCPA 4IDCA 3STTA 2Q46A 3UOGA 4CRWB 4IV0A 2FWNA 2VJLA 2GM3A 4BNYA 1TM3E 1SG9A 1E1YA 4Z49A 3OEYA 4ZJUA 1R0KA 2V3WA 3H2YA 3I2YX 4OFWA 3EA4A 3D1LA 1JZSA 5DF1A 1OH8A 1LDGA 3FUWA 4UCXA 3CZ9A 1TQ8A 1Y9AA 2IXTA 1B6SA 1C0KA 3V2IA 4XRRA 3U39A 1D2MA 4LGMA 4RD2A 2YL2A 4QREA 3SHWA 5C52B 4LYFA 4QDZA 1ZAKA 3W0LB 2YJ3A 3HB0A 3OMLA 4BN5A 3G9TA 4YRSA 5BWCA 1NNUA 3WICA 3PNLA 1Q7GA 2H08A 1N36B 1JSCA 2VBGA 3PQ3A 1VI6A 3BT7A 1QO0A 2OFFA 5DX1A 3P9KA 5EIBC 1IOZA 4OYYA 3CUVA 3HKDB 1WKBA 4G5SA 4YIHA 1MEEA 3OX2A 3P9NA 4DDUA 3NVKI 4TWBA 1N2SA 3EAQA 1T2DA 3KJQA 4Q93A 1AC5A 3R41A 4JVLA 4UUAA 4E5KA 5DM70 1Z74A 2JD0A 3HJNA 3E3LA 1JXMA 2VF4X 3L0SA 4FFBA 4IWYA 4JEUA 5I7UA 5B7PA 4MLZA 4RO0A 3J81A 1QK3A 3HB1A 4J0JA 1BXGB 1FMTA 1VE5A 3C5HA 4QJIA 3TR6A 3PUJA 1GZVA 3D4LA 4HF7A 4I2VA 4RENA 4N6GA 3H2JA 4AWXA 1O0SA 4CXMA 2DAPA 1CZLA 4G6ZA 5FUWA 3TLXA 1YHYA 3WFJA 3OJ0A 5IABA 5AR1A 3EVCA 1K7XB 2DUJA 4Q9AA 4U7WA 2Q99A 4AJOA 4XIJA 1QDUA 4HRYA 2ZB7A 3TN7A 3UAOA 2Z1DA 3IEKA 3EQ6A 3ABQB 1UEJA 1T9ZA 2JIBA 5DPMA 2QPAA 3IOMA 3MWYW 4RABA 4RLHA 4V0LA 3OQIA 2LIPA 2ADOA 3H1BA 3MFQA 1QTQA 4FXPA 3PPXA 2FV8A 1MQAA 2Y05A 2YJNA 4ZP1A 1I0LA 3BSFA 5EJIA 3K8ZA 4HUQA 3GHHA 5BSMA 2O8FA 4U7GA 4YRLA 1AKUA 3OQHA 2IOQA 1TT5B 3H19A 2X4LA 1RJ9A 4GNRA 1KAHA 4TSFA 1E5TA 1P5JA 1ULTA 1P9OA 4BS9A 3AY7A 4YBRA 3BRWD 3IKTA 4PZYA 3JQBA 3M83A 4LX8A 2HHCA 1E20A 4U2CA 5GPBA 3VPDA 3R9XB 4WERA 1ZUNB 2HWKA 1SXJC 1F17A 2YXPX 3B3FA 3E82A 4K6MA 4M55A 4MKXA 2PT5A 5B1IA 3X43A 3DMNA 1J2UA 1P44A 1UFKA 2VUSA 2W6ID 3E5HA 4B6RA 1RWQA 4PGAA 1L3BA 1HTBA 3DDNA 4NY1A 4C7VA 5GZ1A 3S1SA 3EG9A 3NV9A 5IC4A 1DE0A 1RWVA 2V96A 2WV9A 3HM2A 2PWYA 4FFOA 3B5IA 1E6CA 3E4DA 1Z37A 2GZMA 5KOHA 2OZLA 1GKIA 1SUIA 1HE3A 5EIXA 4JJIA 5FL7D 4GOMD 2CXOA 1NBAA 1Z8NA 5BWOA 3BE8A 1KMNA 2EX4A 1Z2PX 1JWBB 1NW6A 1XHFA 3NM4A 2VNIA 3VO8A 1N8SA 3TSZA 3ZIAD 2W6OA 1XJWA 3GN1A 3BZBA 3HV2A 3BF7A 3VNQA 2W2XA 1SCIA 2NX2A 3L3BA 3LUDA 2L18A 2PMEA 5DM4A 4MVJF 4AJJA 5CA0F 1IOWA 4GX2A 4UHJA 4NYJQ 4HAYA 5ALUA 5LQRA 3DLTA 3F9IA 4AX4A 4BQFA 1B8UA 3MILA 4FBLA 4Z7JA 1DCKA 2BVNA 3UB2A 4EB8A 1CW2B 2ECPA 4BFSA 1OIWA 4GLBA 2O8DA 1CY2A 2AEJA 4HDRB 1UCFA 3R0IA 4U2EA 5FUMA 2QM0A 3V97A 4D0RA 4Y2VA 2BFMA 1E1DA 1GAWA 3BMCA 2F1OA 2LR0A 4F3TA 2DBRA 2Y0PA 5ALNA 3GHYA 4MDYA 3FHLA 2E6KA 3E3OA 3H99A 4ZARA 3WKDA 5JS8A 1DAEA 2ENUA 3E15A 4M60A 3TOZA 4EBBA 3G0GA 4GBMA 1JIVA 2ZRLA 1K86A 5H8WA 3GP3A 4HH3C 4LZOA 1MQ9A 2P8JA 5TT1A 2I6XA 4BXOB 3LSTA 3RF6A 2OAP1 2BEJA 3L07A 1H1LA 3WYEA 4PLYA 2AUTA 3T3NA 3UN1A 1AQIA 1NP6A 4QQRA 1CEEA 3AF5A 1ZM4A 1QIGA 1BE6A 3OY7A 1OPRA 2XAUA 1OX6A 2VF7A 4PBRA 1V35A 1XQVA 1PFVA 2EJWA 1OWLA 4B80A 2ZG6A 3DMGA 2I4NA 4B6PA 2R1ZA 10MHA 5DJ5A 3P2MA 1N5IA 1MOQA 4JUFA 1MB2A 1N7JA 4D3XA 1PLJA 7ABPA 3G89A 1ENOA 5IZCA 4Z5XA 1NQTA 3ZBPA 3WAJA 2XNKA 2HF8A 2QTVB 4NZMA 1GPBA 1R7RA 1Y3CE 4O2RA 2AQ8A 5K0FA 5JCPA 3GCDA 2C9ZA 4MDFA 3UMRA 1UMDB 1X74A 5ALXA 2GXQA 1E1MA 3RVQA 1ZL2A 2Y1FA 5I4CA 4HWGA 5AJWA 3F6PA 3NX4A 3AM3A 1Q14A 3A6ZA 4XDHA 1U7TA 2V7QA 4A92A 3O0TA 1U0BB 1JDSA 3MWEB 1QK5A 4C4OA 1XK6A 3RO7A 4BQOA 4JLUA 5GVRA 2FN9A 3C3AA 3KOZA 4FDVA 5ITSA 4QDTA 3FDZB 3CRRA 4EJMA 1JTVA 5ITZA 2C9MA 3N7UA 4NDNE 3IP8A 4B6OA 2IOHA 1U9ZA 3D3KA 4JODA 3WC4A 4OREX 3FJOA 5JPIA 1QR6A 3SC3A 2EGHA 3AI1A 1X42A 3S2YA 4D56A 3I4LA 3W9BA 1IM2A 4R9RA 1GPWB 3DEHA 4X63A 4JLSA 2X86A 3N5CA 1TM7E 4YJ3A 2DR0A 3D6MA 1IBLB 1BEZA 2SCUA 4TL8A 4NZPA 2FX3A 3A6JA 3DMPA 3PQCA 2EIXA 4J4HA 3CR3C 4WGGA 4NMMA 3AV0B 4E31A 5HOEA 3K92A 4CMIB 5E2BA 2NYUA 1SUDA 5HKAA 4HDRA 4UVEA 1AT1A 3I2GA 3MJRA 2DECA 3DO6A 4OEHA 1TD9A 3I04A 1Y6JA 4XPIA 3LVBA 4YRQA 1UAGA 3BMCB 3EVEA 4WZAA 4BQSA 3CLUC 4UCFA 2M9MA 1KA9H 4DLNA 2XQGA 3DTVD 3I4CA 2WZDA 1YJ8A 3F7NA 4XRGA 3NM6B 1RHMA 3KQUA 1YQ9A 5ICMA 2B1JA 3T7CA 4EUSA 2CHVA 3QWFA 3RJTA 4EX7A 4GVPA 4XGIA 2G67A 2SNIE 4Z9FA 4MCAA 3WRXC 4D98A 3IAM6 4TVKA 2IPNA 4DQKA 1QU2A 3IULA 3QVGA 3V2UA 1K4YA 3VDRA 4PZCA 3JQBC 1XCPA 1ULAA 2OR3A 3DJYA 4PAGA 3NBMA 4ZVKA 2AE2A 1G7SA 1XD9A 3ESDA 5F1KA 1ZI6A 4MB0A 1VC2A 4PG7A 5LB4A 3RHFA 5EZYB 4N9QA 4A26A 3HUFA 2EV9A 3MRVA 2QQFA 4I4NA 4NCJA 3R7FA 3TLJA 5BOSB 3BJMA 4J16A 3DF9A 3LG2A 3OHMA 4PFJA 5ALEA 3T06B 1A88A 4EOGA 4UD6A 3ESQA 5CIWA 2ZRDA 1PYGA 2IYOA 1JMKC 1AS3A 1W52X 3QW2A 5ALMA 4RZUA 3GN2A 5DIFA 2J08A 3ECSA 3ONFA 4CKXA 4B2YA 4X6YA 4O2LA 4Z8XA 1UKBA 3QPCA 3R1IA 2PLRA 4IHJA 1BH6A 3NYQA 4JIGA 4BVGA 4NJEB 2DULA 3MOGA 4Q3EA 4Z9XA 1WAMA 4NE7A 4JGBA 5EJ6A 2W6QA 1FQOA 2QMYA 3V4SA 1KSJA 2SKEA 3NUQA 5B6JA 3NTVA 2BE7A 5J2UA 3BJIC 3HYRA 5BQFA 2XNDD 4CUKA 4JLAA 2I29A 3A06A 4CCSA 2H4YA 3KM0A 4N5MA 2P3QA 4G36A 4OMDA 1UOPA 4ZOAA 4ECAA 1MQSA 4EHNA 3VZBA 4BX9A 4DLPA 4ZQHA 3T5GA 1QHEA 1XCJA 2B2NA 2B1GA 5FBRB 1NG9A 4LXUA 4JYAB 2QMUA 2OZEA 1Y6QA 3FVTA 2LD4A 3R5TA 4IIJB 1NW8A 3ZUGA 3GOHA 3V4RA 2M6LA 4DCMA 5KNCA 4HQOA 5EE0A 4GC5A 3GJTA 2X23A 4E5SA 5EIEA 1W4ZA 1XDSA 2WYOA 3BCSA 1DT5A 2I3BA 3EGCA 4F4JA 2O8BA 1BX3A 1I32A 5B64A 4C87A 4AJHA 3AIOA 2NV0A 2VBFA 3CZ4A 1NJ2A 2HJGA 2ZIZA 1C9JA 5B37A 1G38A 3WL8A 1FSFA 1QFJA 1DKMA 1PJAA 1XJ5A 1UQTA 4PYRA 2CLIB 1FTGA 3MTJA 2QZSA 2V7UA 4QGHA 5C7LO 2X5NA 3IJRA 3G7SA 2PGIA 2VVTA 1KH3A 1NXWA 2XKKA 4EHFA 4OQDA 1NWHA 3CN7A 4BNIA 4BTLA 1FUUA 3DZKA 5EGSA 1EZ4A 2GCPA 3Q88A 4OA5A 3FVWA 4RH0A 1J90A 5JXIA 4G37A 3RVBA 3CVUA 5DN9A 1NPTO 1QNLA 1RAIA 2JGEA 1UBHS 2QGNA 1V7ZA 4GXTA 3TSCA 4AK9A 1KO5A 1VKNA 5K20A 1NU8A 1G8GA 1PGPA 2XQKA 4QUGA 5FV7A 2BHLA 2VHEA 2BKXA 1ZMRA 2G5PA 5FNVA 1YV9A 1QGUA 3GCWA 1Y5LA 1IEWA 5THKA 2B2XA 1LDNA 4K0RA 2V7EA 3SGLA 2XVXA 4OAPA 1BE0A 3PCRB 5A71A 4US2R 4TXLA 3PTLA 2TMGA 1JAYA 2IIVA 1V8ZA 4RF2A 1MFZA 3K0FB 4HXFB 1WXQA 1HOTA 1N2CA 3TLAA 3MCUA 1DAFA 1GVNB 1JQLB 1LPAB 3I83A 3JR3A 4NBTA 4Q12A 2VFAA 4Y0NA 1JEEA 4BX8A 3QHAA 4UTNA 3LOUA 1PIWA 3SEFA 1I1QB 1K27A 4A8JA 2IV2X 2EARA 3U0BA 4E2YA 5DLDA 5G0SA 5L7YA 1GKLA 4IX1A 2F3QA 2G4CA 2YZMA 1ENZA 3L8HA 3PQDA 3DA8A 4Q7JB 1RRCA 4B2LA 2X2EA 1NM5A 2FUG6 2QSUA 5L40A 5CLLA 5KEIA 3S2GA 4BIIA 2KB0A 2QZ4A 2YYSA 2AVDA 4CMGA 5AVWA 5A4KA 2JANA 3ELUA 1TRKA 2QYOA 2GCOA 3GJQA 1ZGAA 4CMEA 2GAFA 3H11A 4C6RA 1PZXA 4GYJA 3AFMA 4F56A 1BMFA 3FTFA 5E3HA 3HBFA 4ZOQI 3PQFA 2IHVA 4PXAA 1JHZA 4WNCA 1ADCA 2B7BA 1TW3A 2I2DA 2X58A 3AEXA 3AKCA 2ZE8A 3VJKA 1E6EA 3AV3A 3I6BA 4HEQA 3HKEA 2FMKA 1UP7A 3G5LA 3MCWA 3REOA 3A25A 3FGNA 2WIGA 4LBVA 3JQGA 2JGLA 3HEMA 1OFHA 3RHSA 1VL2A 3KNZA 1EFHA 1QC5A 1T2VA 3NHWA 4IMJB 4P2GA 4P34A 1PNRA 2JW5A 3EVTA 3ZGVA 1XU9A 4HLUC 1I4LD 2V7VA 3ETLA 3O91A 1XTQA 4JA2A 2D7DA 3C6YA 3DFKA 1TQ6A 2CNNA 2FFQA 2HZ7A 2DPHA 2QG9A 1X19A 2AX4A 2TECE 3HBLA 3PXEA 3W5CA 1N7HA 1BFDA 1N6PA 4KAJA 4IGIA 2P8SA 1OTHA 1YL5A 1P1CA 3GU3A 1E2FA 2C99A 3ESCA 4K9RA 5HZHA 1A1VA 1XXHE 4M22A 5DHQA 1TM2A 4RF3A 4HB3A 1X1TA 5ECYA 4F3NA 1IAQA 3EH2A 4DQVA 4KFRA 4OXIA 1F60A 4BO1A 2JB9A 1W75A 4K9DA 4U4AA 4DV4B 3O3MB 1LCIA 4B6EA 5AVTA 1W9MA 1A7JA 3P9SA 1JFLA 1I80A 1JQ5A 1G4AE 1DELA 1SXGA 1UM8A 1C2TA 2EFEB 2Q9AA 3NDJA 4I4TB 4I5GA 4OD0A 4P38A 5IXYA 2H9YA 1R6XA 5FL3A 2VO1A 2JJ1D 4QE3A 3DD1A 2DC1A 2HSWA 2WJAA 5DYYA 1XZGA 2CDCA 1YCGA 3UW1A 2AEMA 2RI6A 2Q0SA 3PD1A 1VPEA 2H16A 3AIKA 4FDMA 4EL5A 1TMKA 4Y9SA 2QR5A 5C4MA 3WMFA 1IU9A 4RL4A 4QO8A 4ZAXA 3N9IA 1N3YA 1H1DA 3TD6A 4CL0A 2CMHA 3L84A 1EUCB 4JC8A 4AY2A 1UZUA 2OC4A 3IMFA 4X85A 1XEXB 1CR1A 5F2EA 2WC1A 3AKDA 1ST2A 1W0JA 2QN3A 1QG4A 3DD5A 2WEKA 2WWHA 1XTRA 2FHSA 1IHOA 3O21A 3S1LA 1N6LA 1OZHA 5ARBA 2IH5A 4OJNA 2QX4A 3T9EA 4CLDA 5K4GA 4O0LA 1XQYA 2GWHA 1FDWA 1W76A 2P6NA 4WOKA 3DT9A 2FLKA 4L7VA 1MCZA 4U2GA 2MYTA 4YRTA 4DR2B 4QG7A 1NLMA 2GJAA 2YV5A 3QF4B 1PX0A 1Z26A 4RUKA 1JX6A 3SOPA 2O5CA 4D42A 3R6TA 1YJQA 3A4MA 1ZN9A 4V0ME 2VA9A 4HBZA 4K6KA 4LQDA 1XDZA 1M8FA 2AI1A 3PUZA 4D4LA 4EG5A 2V58A 2BEUA 4YJKA 2XMQA 3W2TA 4ZDIA 3BSSA 2P2ZA 5DBOA 3R8XA 1Y4ZA 1XQXA 3INTA 4BC0A 1E60A 4BWGA 2W98A 1AXRA 1WRBA 1C1XB 3FVVA 5JJIA 1L7PA 3EFOB 1R88A 3G8DA 3S2ZA 5CP8A 5J4HA 4YJDA 1JHRA 5IKMA 5GWXA 4B0OA 1CUZA 1G7CA 2W5UA 2G25A 4ZI3A 3OLVA 1JTEA 3FRJA 4EABA 3ZKWA 4NPHA 1P2BA 1O58A 3W8FA 1FX0A 1GJRA 1QHGA 3UWDA 4BX2A 3K0SA 1MD9A 1XR3A 2EJCA 1OLSB 2ZS8A 4F4IA 1F6BA 4KOAA 2ZXEA 4TT3A 1L4MA 1QQTA 3KX2A 3OZEA 4WPGA 1QH1B 2Q3CA 4KOEC 1JE0A 1F1BA 3OE5A 1DX9A 2EBHX 5T4BA 1WUTA 2PRKA 4BO4A 2ZJ7A 2Y76A 4EGQA 2WPDD 2UYQA 1AB5A 1O94A 2A0KA 2XEXA 2YFYA 3V42A 4KFUA 4ZMRA 4JLMA 1ZC4A 3LCJA 4F3CA 1HE2A 1P1JA 3FTNA 3BXZA 1OV6A 2RH8A 1J25A 1AO0A 3GLIA 5JAPA 5L7TA 1KSGA 2B4QA 3F8SA 2VEDA 1I4WA 1JEDA 3IPAA 1CE8B 1RCUA 4P32A 4ZREA 3C8UA 3KUUA 2HRQA 3AVTA 4ZZIA 4Z3DA 4EG3A 2VJCA 1SHLA 4FJ0A 4UOQA 4OGWA 4B40A 1GO2A 4EYKA 2FW1A 1G5PA 3PICA 2IQ5A 1QYWA 2D8MA 1MX5A 3A11A 4HN2A 5REQA 1HX7A 2C2XA 5JRZA 4HS4A 4GLOA 3I12A 4PIVA 5JSZA 4N3BA 1V9CA 2H0QA 1UDAA 3N2IA 3OTWA 4ILKA 4P1ZA 4LGYA 2CFTA 3D4BA 3GIDA 3IVGA 4LUCA 4ZCSA 1IAVA 4F84A 3BGWA 2P6RA 3AF6A 5EL0A 1SIUA 4BJHB 1EVLA 2B4AA 2LKCA 2EU8A 5HDQA 4CIAA 4WCFC 2RB5A 2DLDA 4OK3A 2WTUA 3RW9A 1KEEB 2IIQA 4OM7A 3RU3A 1E5DA 3ZEAA 2EATA 2B8EA 3I6YA 4ACAA 2PKEA 3SYNA 2I6UA 1QAMA 4YO8A 5EESA 2B37A 3HC7A 2FZGA 2HM7A 4G2NA 4UMVA 2QTTA 5K0TA 4BVEA 3BK1A 3KZNA 1VMKA 1OC2A 2XWJI 1EH5A 2OZLB 1SCUB 2TMDA 3K2IA 4ODIA 1UK6A 2DE0X 3VR4D 3ZU3A 5BSEA 3TQHA 3R3YA 5KAPA 4ZYVA 5AH0A 3WBJA 4ILEA 5BVHA 2GKGA 3SWWA 2OHJA 5K0JA 4E2ZA 2H9AA 1DL5A 3UZUA 2NO1A 4F97A 4ZAZA 4YV0A 2H1RA 3C3EA 3HCWA 2O3RA 3AONB 3KQTA 1NOKA 4ZQEA 3ZLUA 3SSAA 1C1XA 2E4YA 4L4YA 5CA1A 1L5SA 1SXIA 1H2WA 2C5GA 2DLNA 4WLEA 2VNSA 1EJBA 5AOCA 3ZBUA 4DNFA 1SUWA 5GQSA 4LJ9A 2VUUA 4Q1FA 1A9QA 1GGMA 1RI2A 1ATIA 2XWQA 4EEZA 4EO9A 5BSFA 1QTNA 4DA4A 5LYJF 1TVKA 1CY0A 1ZY2A 4KZPA 4ZYWA 2H1WA 4R7ZA 2LUOA 2PBZA 1ELOA 5A6SB 2P5UA 1QXSA 5GV8A 2JAOA 2J3JA 3HACA 4IG9A 2DGDA 1H3NA 4NZYA 4TLAA 3IQDB 1JHUA 1E1KA 4R6WA 2AOWA 4RORA 5IC6A 3GNLA 1LS6A 4GLLA 3SU8A 1B43A 1UKCA 5I6DA 1NBOA 4LF7B 3Q3JB 3BXXA 1GQYA 3OHPA 4JC4A 3O2SB 3M1LA 1CRLA 3GVPA 3K5HA 4XEUA 2C97A 4YXWD 1H1LB 4TSKA 3Q2OA 4UAUA 3RBVA 1A97A 2E7ZA 1TYDE 1JMVA 2BFCB 4K1LA 5FFFA 5IKXA 3SF8B 2BMVA 1H8HD 4ND3A 1XZCA 3KTOA 1NFRA 2VJPA 3OZFA 4IZHA 3D2AA 3O3OB 2RGUA 1P1FA 1GR0A 2FTKE 5EJGA 4R05A 3BL5A 1X2BA 1WCWA 1QK4A 2O2SA 3EMDA 4RA9B 3AT1A 1L4KA 1L0BA 1MB9A 1WZCA 4UHDA 1A8SA 3A4VA 1Q11A 1FOEB 3WL4A 1T0PA 4BVLA 2JK1A 1NNSA 4IUBS 3USCS 3I3OA 2RI1A 1OBHA 3AHIA 3K35A 4JC0A 2WU3A 4RK0A 4ALJA 3AXTA 5ALYA 2ZUUA 3CPJB 3TIGA 3VTFA 5ES4B 3BGDA 2AMVA 1TMGE 3K15A 1HGXA 3AB3A 4OHVA 4UXJA 3ZX4A 4DIOA 2QJFA 3WP0A 2ZXUA 3D0KA 2XADA 3ECCA 2DZDA 3B52X 3EVAA 2A0YA 3O1IC 4Y1RA 5DNAA 1ZCBA 4FILA 4G1BA 1Q1QA 1ZZEA 3ZCRA 4TYWA 3GMIA 3EC2A 4ARAA 4XUCA 2B82A 2PN1A 2OB1A 5KMGB 4WTOA 2R6DA 2O59A 1W6UA 2J3MA 8LDHA 5LMZA 1XVLA 4LFBB 4M46A 3W4IA 3WYDA 2FEAA 1EFPA 4FX2A 4N5HX 1Y3IA 1V43A 4PEVA 4HVAA 3OTOB 1ADYA 1QJ4A 2PUTA 5BMVB 4TRJA 4WMLA 1TEZA 3AVUA 4NFLA 1UINA 3P97A 4LXQA 2BONA 1YRAA 2H1IA 3RJMA 3A6PC 2CYAA 4ZC1A 2VNHA 1LA2A 3KKQA 1RXEA 5E9QA 1DWOA 3HA5A 1EX9A 2SECE 2FP4B 1RYEA 3RAPR 3DJFA 2XYPA 4ENUA 2VSFA 2FMFA 1Z2EA 3ADOA 3MS7A 1DQNA 2ANBA 2PT6A 2WNIA 4LC1A 3SSMA 5I9IA 1EX7A 2ZAMA 3A4TA 1QVRA 3V2GA 5A6SA 4V3CA 3GCGA 1X39A 1G5QA 2HHJA 4M3NA 1ZIXA 1VL0A 1TGVA 1N2GA 5FTWA 3TQCA 1Q7CA 2PFKA 3R0JA 1HE8B 1G3UA 1IXRC 2ZJZA 1SBZA 2HRBA 1LJ8A 2H3EA 4L4RA 1LNQA 4MS1A 4QUJA 4FMDF 2HBRA 3I1YA 2GF0A 5GP1A 3REFA 2YDYA 4MAAA 4A6PA 3KJNA 1YHNA 3EC1A 5TLSA 4O63O 4OQYA 1GFWA 1LH0A 3P94A 3LKDA 3WBBA 3FDXA 3R09A 4A5SA 3FI0A 2CVOA 5EMHA 1EDOA 3LQQA 1EK6A 3OURA 4L5IA 1P80A 1X13A 4EI8A 3O8QB 4N9WA 3QH4A 4G5RA 2I99A 4B3JA 4WBNA 1RNLA 1CVRA 3LQKA 4M1WA 5CT5A 3JQ8A 3WLAA 1XD8A 3DTVB 3W79A 2PSDA 2BUCA 2VNAA 2PTGA 2RHHA 2QRPA 3I23A 3I45A 1TUEA 1YUMA 2VNJA 2GD0A 2FB9A 3M3HA 3MWGA 5ARCA 3WFZA 5KQMA 2KBFA 1YAJA 4DTCA 4Z3KA 4LG1A 1Z73A 2CDRA 1ZJ5A 3GLGE 3KSRA 2FEWB 1WP4A 3JQAA 5G0WA 1P4JA 3K05A 1JHDA 1T5HX 1YBVA 2B8TA 2FQQA 4DA9A 2Y1XA 4KH1A 5HG0A 1PYDA 4HEHA 3JCZA 3THYA 3ENQA 1FDVA 1SQ0A 4NONA 5C53B 2IS2A 1W2WB 4YUYA 3FZEA 3HZHA 5ERYA 5L3QA 1OAOA 5M5BA 1BWSA 2B30A 2D3TA 2FPKA 1DEXA 3E70C 3IXQA 3UK1A 1W73A 5JMWA 3T1OA 4NH4A 4AN0A 5KUTA 1XPJA 3KXLA 2C2ZA 5JLJA 4YRCA 3KT8A 3P0FA 4FHZA 2QRNA 1CF9A 2Q2NA 3NHMA 2IOFA 1XDDA 1XNRB 2JGDA 2WINI 5INTA 1WOMA 2WHEA 1NUSA 5FADA 3MHPA 3N87A 4LYGA 1YTLA 4X84A 2SKDA 3HBJA 3LRXA 3KB6A 4D5GA 1E66A 3A0UA 1NR1A 4M0DA 4NBRA 5LWQA 2IBSA 1FTSA 3JD2A 4A6XA 4A2WA 4W7SA 5D1HA 4OOFA 1AM4D 1A9OA 1P3Y1 1MU0A 1TF2A 1QJCA 1J24A 3LC7O 4MB6A 2CDBA 5FNVF 1ZA1A 2PRSA 1X8KA 4BPRA 4DMCA 2HTEA 3L6BA 1IULA 5D6OA 3PA8A 3OCWA 4O1HA 4R8VA 1EX6A 2V7GA 4V0QA 5HCNA 1X7DA 4RVGA 1NQOA 3TTWA 4HAOA 1RRFA 2II6A 2HPAA 4HQFA 4PXSA 3DWFA 2C2OA 3RYIB 2CFCA 3O95A 4ARZB 4YRKA 1VHJA 2QDKA 4PLVA 3PQ8A 2X0DA 1TZ2A 3WKAA 3BJRA 3QA3E 4H7JA 3IJ5A 4KEAA 4KQGA 4PRKA 4DUGD 1ZK3A 5HF5A 1PX2A 4ICIA 1N57A 2XYQA 3DSRA 1OIXA 2GAAA 1PZGA 4RSHA 5AI6A 1C4KA 3AP2A 4Q1EA 4ROTA 5DHTA 2NSHA 2H06A 4A7PA 5I8ZA 2MHCA 3FGZA 4BZZA 4EKGA 5K03A 3ILSA 1A5SB 3GPCA 4NKRA 5DBIA 5DO9A 1XX6A 3BH6A 4I50F 4FCWA 1OJLA 4EJ6A 1J0EA 2XYGA 1A76A 5CG1A 4BUZA 2FZVA 1IC6A 1Y8RA 2YXNA 2QUBA 5AM0A 5CVDA 2GBGA 5E9AA 4R2WA 5I47A 2YXDA 1WMFA 1UT6A 4MUEA 3K6SB 4UKDA 3HFRA 1LUAA 1ORTA 4IGAA 3WS7A 2HLDA 4KUHA 3OPVA 4IOKA 2PMCA 1T6BY 1QCYA 1ZIPA 3KLMX 3L1KA 4PC7A 4URZR 3WYAA 4KE9A 2HV9A 2VEOA 4B3IA 4Q5IA 2Y1OA 3TZQA 4J6FA 3IEXA 4C0KA 4I9HA 3ZLBA 3I6ZA 5TIIA 3D7RA 5J23A 3Q15C 3RWBA 3MJFA 4XTCS 1GV1A 2DFVA 3NBUA 1GAXA 2RGCA 4ZWNA 4Y9DA 1KVQA 4MUMA 1F8UA 3MWEA 4IF4A 1ORIA 4ZVUA 2EQBA 4BTEA 2UUAB 3VU1A 4HC4A 4HNHA 5F4BA 1NUUA 4IG4A 1E7RA 4Z9AA 4V1CI 1M1YE 1R15A 1LV8A 2IHJA 2AX3A 4Y0VA 5E3IA 3CVOA 4V1CA 5LJIA 2A33A 1K6JA 3VKUA 1Z22A 4XYMA 1U81A 3FVQA 3W6NA 2OCYC 2PGLA 2HF9A 2HH9A 3REQB 2NU7A 1WQ4A 2JEOA 1SVLA 1OZGA 2JGMA 1NXQA 3RTBA 1CJMA 1JSZA 3UGKA 1KFEB 3L79A 4OJTA 2OQ2A 4MAMA 2Z3WA 3H0KA 4YRJA 1ZCAA 1LXCA 1YMUA 1UZAA 4LDJA 4POOA 2WUGA 2IE8A 4IXWA 3TRDA 3PJFA 5IAJA 4DREA 3T7IA 1NJFA 1I9GA 1W4BA 4A0FA 5H3HA 3U3ZA 4EGSA 5AW3A 4DFDA 2CGEA 1LBQA 2XMDA 4XPIB 5AXCA 5IEJA 1ZGHA 4JB0A 4Q39A 2QD5A 3P52A 2X19A 4FE7A 3S5UA 1Q12A 3DTNA 4D43A 4U8HA 3WRXA 4QU8A 4PRLA 3EW9A 4R1TA 3TWOA 1TT7A 2KI5A 4FT2A 4E12A 1QH0A 3IC5A 3GLGB 1KYVA 3NCHA 2ODWA 3IAUA 3QEJA 4NBWA 5K3DA 3WMWA 5FV4A 2GSWA 4Q6BA 1T6NA 2XT9A 4ARZA 2FETA 2GR9A 4BCDA 5DRYA 4CIDA 4ZI7A 2VTBB 3FA2A 3O8LA 4JZKA 4P7KA 4UTXA 4CV0A 2I2FA 1FDOA 4QTYA 3HDYA 4X3CA 2V6MA 4NZZA 3IR5A 1IEXA 2IYFA 3GR6A 4D02A 1JHVA 4RADA 2JCSA 4OAQA 2QKYA 2M1ZA 7REQA 3ICCA 5C9ZA 5FT9A 2WPDA 1K9VF 2ATVA 4YJHB 4FT4A 2VF2A 5CNMA 3ELWA 1X7GA 4WH0A 3T9DA 4KB5A 1U3DA 4JJKA 5K0NA 3EEYA 1W5EA 2HCFA 1G9XA 4NJOA 3E5MA 5C1IA 4C03A 1T8SA 1M2KA 3ZG6A 1WB4A 3KZKA 4J75A 4L85A 4UEKA 3C98A 1Z6PA 1ZBDA 1ZGGA 3SEAA 3EGIA 5BWBA 2DHQA 3P26A 4GKAA 2JLRA 3ZHZA 3UENA 5AKGA 4CL2A 1FDSA 1LSJA 2BGTA 2FZWA 4HAVA 4OATA 1KZ7B 1G42A 3HK2A 1HRDA 1OLUB 2E5FA 1H9AA 5EHXA 3HHEA 5T7BA 3D3QA 3SQLA 3OCCA 4WKGA 3RSQA 3GFSA 2FWBA 5CEFA 2A7QA 4X7RA 3LIPA 4NJMA 1PGNA 3G2MA 3ZDEA 1O0CA 4J2HA 4NAUA 3L49A 4X1YB 1ARZA 3QYFA 3EWSA 1OA1A 3MT8A 4BKOA 2P6UA 5LVAA 4CMIA 4V1CB 1XMXA 2GZRA 4MDEA 4AY3A 1SXJE 4TWJA 2AKAB 3IURA 1FNDA 5EP2A 4DQDA 5L4LA 2NO7A 3ZCVA 1KY5A 1C5KA 2GYYA 3LWNA 4K40A 4LHEA 2B78A 3R4VA 1NY6A 2NU7B 3H1EA 1C3EA 3LKZA 1K6EA 3VDQA 1ULUA 1TPYA 1FP7A 2P11A 3HFSA 4I1SA 4MWSA 3T12A 3TG8A 4ZYTA 2BFDA 2DXIA 1VE1A 1R9MA 2NZYA 2ODAA 2ZRCA 2C9BA 3DDHA 3GEMA 4LSGA 5AKEA 1VJRA 3JQ6A 2V59A 1UJBA 3NC1C 4IJVA 4RX1A 4DLAA 4JHXA 1QH1A 3SQXA 2OLKA 4K9OA 3NHBA 1G19A 3PDHA 1U7XA 4RWZA 1P2DA 3K94A 4UCQA 3EVBA 3ZE7A 1D8TA 1Y8CA 3A6FA 4QARA 5DU2A 4E5VA 2RGNA 4R1PA 3Q2KA 3RSHA 4DDHA 1Q1GA 1QUFA 2B83A 4GPZA 3ZHSA 4D45A 1Y8AA 3CUYA 1N5KA 1ZXBA 3Q7EA 1KQ3A 4DZRA 2RHCA 3FPKA 5DN6A 2B3TA 1E1QD 3GT7A 2JC3A 2CNWD 2J7PA 4PYKA 5IKEA 4P58A 4YHHB 1ISJA 3TLYA 3VNBA 5LQKA 3VH3A 2UXDB 4QDKA 3UK0A 2P7IA 4QOFA 1ECCA 3SBOA 3T9AA 5JQGF 1QGUB 2ZBGA 3PQ7A 2RHMA 3WQSB 2QV0A 3NV7A 1OMOA 4B6QA 1ZGJA 3SBEA 1SU8A 1TGYA 2RHLA 3A7DA 3JARB 2GRUA 1NKTA 1PJLA 4P83A 3TNJA 3LWDA 1XALA 3ZOZA 2IZ5A 4WLNA 1P73A 5EQTA 1A71A 5EN4A 5KTTA 2REBA 4CG3A 3KJFA 4KXWA 2AI2A 1E7QA 4NBNA 4PGMA 5E2AA 4BAGA 4QKQA 4HDSA 1BXZA 2O14A 4QHSA 3FHCB 4B2PA 1JP7A 3T9FA 2JGNA 4LBYA 3ES9A 3KSZO 1U9CA 5EWLA 1IBRA 1GG9A 5K3SA 1RABA 4DYVA 1LJUA 1TI7A 3EZLA 4NIMA 2C8VA 4YUZA 2AZXA 1YC2A 3V8BA 4W8GA 4MLDA 3BIWA 1ZEJA 3AG5A 3W8NA 3LDUA 1YI8A 4LWPA 1NDQA 5F23A 1TUIA 3LC0A 5JCJA 1NF9A 1RMQA 2J3QA 3PIRA 5EIBD 3C97A 2ZGVA 2JLWA 2GVZC 1WMBA 1GTG1 4JT9A 4R8LA 2GAOA 1HT2E 4W5NA 4L5CA 3QVSA 3VR2D 5K8IA 1V1MB 4PTZA 4D8UA 4DA6A 3ESZA 1IUOA 2A14A 3OMWA 3EVZA 2W8ZA 3ETDA 2XMBA 4X1YA 5EZ5A 1YS7A 3ZI7A 3ZV7A 1Z15A 2OYSA 1U2DC 4JJ6A 1W5TA 4NBSA 1ZEMA 5CJ2A 3V7WA 1DSSG 2VLIA 3ZN2A 4A03A 1JFTA 4OX9B 1F8YA 5JH7F 2QA5A 5HIJA 4MQFB 4GZLA 2AYYA 2O20A 1ENYA 1B8VA 1DAKA 2IXDA 5EAIA 1E2NA 1WZUA 2R7LA 2OV2A 3OQPA 5CT9A 2C59A 2UYOA 4EFDA 2A9RA 5ALKA 3OOYA 3GRAA 2PZGA 4JJAA 1QYIA 1C9KA 1RR6A 2K6GA 5IK2A 5L3VA 1EVIA 3LUBA 4EM6A 4HPJB 3NEJA 5L3RA 3MGCA 3U19A 4BVAA 1PI3A 4CL8A 4BFTA 1SJ9A 2QVBA 2WVGA 3PHLA 2C7GA 2V7TA 3TM5A 3K0FA 1NQ5A 3NQ41 2KPOA 1L5MA 4V0MA 3ONEA 3UJCA 2QSYA 1VIMA 2AOUA 2YFKA 3DLBA 1T6ZA 4QDXA 1PJSA 1GILA 1HTWA 1C3XA 4OP1A 1GGFA 1F1JA 4TXMA 3I58A 1D9ZA 1K8YB 3FMIA 2V5VA 4X3OA 1SVOA 1HE1C 5JAMA 3FHTA 3RS4A 3QXGA 4KBGA 4B81A 1N4AA 4QTUB 1K4MA 2FOLA 4A4DA 1G0OA 1WQ1R 3MGGA 4LS3A 4P82A 4H7KA 5AW2A 2AFIA 3FOZA 1UJMA 4KLZA 1YF3A 5FD8A 3R3UA 4ZODA 9LDTA 4MKGA 5LC1A 3PGA1 3KLOA 2ID7A 3SXUA 4XGNA 3ZDCA 5KOJA 3CLVA 3GRYA 5CA0B 1XEXA 2DHEA 3H11B 4W5QA 4YO7A 1SHJA 2ETVA 2J48A 3KQQA 3M4ZA 4LOAA 4BMXA 3PC8C 1CUXA 2UZAA 3O9MA 1E7MA 4NEGA 3K0AB 4I8DA 5H3CA 4BASA 4IEFB 5F76A 2CJWB 3GVIA 4PNPA 5KX5A 3AUTA 1VCNA 4FPXA 3HP7A 4TQAA 4UU7A 4S2UA 4HT3B 4JMLA 3BG5A 3D7KA 4PW0A 1S2GA 3AC0A 2PZMA 1H2RS 4X20A 5HR5A 4NU0A 5MFPA 4N41A 2BKEA 3ZGOA 3DB1A 3LCMA 3UJ7A 4E09A 1K98A 1WSAA 1ESCA 1QC5B 3BM5A 2O2CA 3L6RA 4H0NA 2J3LA 4V0RA 5ALFA 3HRKA 5IJZA 1UXOA 2IXAA 1ZL0A 2QS9A 4N8SA 3ND5A 2F62A 1QHFA 3G82C 3QTTA 4IM7A 3WJ7A 3RWMB 4CM3A 4FWIB 4GL2A 2C42A 1KHHA 3O31A 3BUSA 2ZYIA 2GEVA 2UVPA 5EMJA 3GJZA 4ED9A 2JZCA 1ID8A 2ACKA 3LQYA 4BJ6A 3PR2B 2Z0MA 4UJ3A 1XTPA 2V98A 1G291 4TRNA 2WTMA 2Q3DA 1QP7A 3F73A 3ENZA 3M6VA 3V1YA 2BUBA 1CJCA 3AVXA 4U5QA 2WDZA 4GXRA 1FK8A 4K2AA 3SYRA 4QZVA 2H8KA 3EGXA 3RVNA 1G2QA 4