3DLTA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
b'FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
molecule tags Hydrolase
source organism Lactobacillus rhamnosus
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
total genus 85
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dltA00
4QZVA 4CCYA 4L9AA 1CUXA 3SC2A 4AMZA 4EA6A 4HRYA 2WFLB 2PU5A 3WWPA 1JJFA 1JJIA 1GQRA 1HQDA 4GW3A 4N8DA 1JKMA 4Y2QA 3KWJA 5A7GA 2I78A 1KU0A 3G0GA 3KSRA 1CUUA 3X3HA 2Y1KA 4NMWA 5AI4A 5D3ZA 2AJCA 4WY8A 2WIKA 4E11A 1UKBA 5ALXA 1UZAA 3WZMA 5HK9A 2G63A 4UHHA 4A16A 2XMZA 3U1TA 1AMNA 1U65A 4WFIA 1CUVA 4H7KA 5A7HA 1TCCA 1LPBB 5D6OA 5D7BA 1H2WA 3W06A 5AM0A 2QZPA 4HTAA 4PSUA 2J4FA 4GDMA 1VXOA 3K2IA 3L1IA 5AOAA 4RE6A 1XZHA 2XMCA 2CBGA 3IULA 2J3DA 1ZICA 3E4DA 2X8BA 2LIPA 5AM4A 4MWTA 3DEAA 5LZ9A 4EY5A 5C8XA 4UBKA 1CQWA 4INZA 3D4LA 3H0CA 3H2JA 3HJUA 2WIJA 3C43A 1GPNA 3RARA 4Y2UA 2JGKA 2H7XA 2GYUA 3Q0TA 3R3WA 4X6UA 2G5PA 1WM1A 3I28A 3DDUA 2WUDA 4EHBA 2HA3A 1GXSA 1O6GA 1G4HA 5FOQA 4OB6A 5YASA 1JMKC 2VSQA 3G9XA 2O2IA 2ES4A 3A6ZA 2AJ8A 5HKAA 2XUDA 3BIWA 1JU3A 3VDXA 3IUMA 3BIXA 3D2BA 4HZGA 4UHDA 2C58A 2OXEA 3WK5A 1IZ7A 3O9VA 5JAOA 4LXIA 5HZGA 5K3DA 4UBLA 3WKCA 3WKAA 5JASA 5HF6A 4PV7A 1T4MA 1AUOA 4B6GA 3AIMA 5KBYA 4W1RA 1MPXA 1FSSA 3BL8A 5ALIA 4HRXA 4Q34A 3G9ZA 5DYTA 1M33A 1MNQA 5LZ7A 1LBTA 1SFRA 2RONA 3I2FA 2OQIA 1VZ2A 4KAAA 5CT6A 2B61A 1N5RA 2ZJFA 3V1MA 1EK2A 2DHEA 4H35A 1UKCA 4OD0A 2PBLA 4AZ0A 5CXXA 1A8UA 4KAFA 3PDCA 3V9AA 4HVTA 5AI9A 5DNVA 5AI8A 1D07A 4L0CA 3LCRA 1NU6A 4X85A 1AGYA 1WPRA 4BRSA 4EUSA 2XQKA 2O2GA 3K6KA 3PUIA 3WIBA 4QA9A 2XUJA 2HHAA 1BS9A 2DCMA 3ZPXA 3W05A 5LIPA 1NU8A 5ALOA 2XMDA 2WIDA 5HK8A 3FCXA 4G8BA 4Y2SA 2OQVA 3G0BA 4KE9A 5FDFA 3O0DA 1NX9A 3EQ9A 2AJLI 4WFKA 2HIHA 3IURA 4BRZA 1K63A 4B81A 4CG1A 3PF9A 5HQ3B 1TCAA 1VOTA 1R4ZA 3WJ1A 1ORVA 3HYSA 4F21A 3DS8A 1T2NA 1YAHA 5ALQA 1BE0A 2RHTA 5JARA 1XKLA 1BCSA 4Q82A 5A2GA 4Y2RA 4UBNA 2WUEA 3NUZA 1Y37A 4UBJA 1MO2A 2C4HA 3O95A 1WB5A 5AH0A 2V98A 1UOQA 4YK7A 2B20A 1Y7HA 4E46A 1ODSA 3I6MA 2PSHA 2HU5A 3PICA 5FPPA 4MEAA 1SCKA 5JD6A 3FVRA 3C6BA 4H7FA 2QMQA 3M82A 4H7HA 5JZSA 3ANSA 4FFWA 2ZVDA 3QPCA 2WFLA 4B83A 4X93A 4E15A 1DT5A 2OCGA 2JGEA 1B6GA 2WM2A 4FLFA 2HA2A 3BF7A 5E4JA 4J0KA 4W9RA 1TRHA 5T4FA 1QFMA 1XQWA 2XQFA 4MYDA 1UXOA 2GZSA 3P2MA 5KREA 2DQYA 3RM3A 3QMMA 4GWLA 3WK7A 1LZLA 1XRQA 4RE5A 5EHNA 2OGZA 3IVMA 1F0PA 1XKTA 3B3QA 3WK4A 1EVEA 2HU7A 1ZJ4A 5LZ4A 2CMFA 1UK6A 1MX5A 4BAGA 3R41A 3LLCA 5ALNA 5DWDA 4G9EA 4AZ3A 1ACJA 2H1IA 1CUJA 1RWQA 3HXKA 3HZOA 4M0MA 5EHZA 1WPXA 3BDVA 1WCYA 2I3DA 5K3BA 1XQVA 3O4HA 2HRQA 4PO3X 4EZIA 2JF0A 1P0PA 2Z8ZA 2VF2A 4P9NA 4KE6A 1SCIA 3GA7A 4DSAA 5DLPA 4K6GA 5LKRA 3R0VA 3LIPA 2JIDA 5AHXA 1EH5A 3ZLVA 1EK1A 2VATA 4B0PA 2JGJA 2OGTA 1YASA 2VAVA 5I9IA 4ZXFA 3VJLA 3RKSA 2QKYA 4JH0A 1ACLA 3MGAA 1C4XA 4OU5A 3KDAA 3UMJA 3FLBA 3I6YA 4EY4A 3FNBA 3WK6A 1PFQA 3WL7A 1BN7A 4JNCA 3GFFA 5AJHA 3OC0A 2ZJ6A 1CUDA 4KEAA 3H1AA 4H7EA 2VT7A 5CRIA 1DT3A 3WYNA 1BN6A 4XWGA 1EA5A 5ALEA 1IUOA 3FLEA 3MUNA 5JATA 4X6YA 4FNGA 2C5GA 5ALUA 1ZD2P 2HA7A 4GHWA 5BV7A 4BAUA 2GBFA 3ZV7A 4BP8A 3SX4A 4Q3KA 2BGNA 4Y2YA 1THGA 3WQHA 1LZKA 1XZGA 3IUJA 2XT0A 2PSJA 5CW2A 4CCYB 4B82A 1GZ7A 1AX9A 1DWOA 2G4LA 4GI1A 5DNWA 2WILA 2QM0A 4DGQA 2EEPA 4IH4A 3PI6A 3WLAA 4UHBA 3H04A 5E2IA 3F96A 4QDOA 4H7DA 4X6XA 4WDQA 2XUPA 5AK5A 4PSDA 4DTCA 5CH3A 5J3JA 4CIAA 4IQ4A 5AIBA 4MXDA 2VJBA 1S8OA 3H2IA 4UHFA 3QVMA 4C4YA 1Q84A 1R1DA 4PW0A 5AP9A 3F67A 1G66A 5BWBA 3C8HA 3DOHA 1JMYA 1LPNA 2UZ0A 5IVKA 4UBOA 5KWIA 2V9ZA 3SWWA 4DMCA 1LPOA 4IH1A 4BAZA 2VJDA 3AIKA 1QIMA 1HKHA 3V1NA 1VJ5A 5AKLA 1G42A 4LHEA 2E3JA 4C89A 4AN0A 4O08A 4PQEA 3VVMA 1H23A 2PX6A 4EY8A 1RP1A 4N8SA 4IO0A 1XLWA 5LZ2A 5IVHA 4I19A 4W1PA 4AO6A 2JGLA 2VEOA 4AN1A 1IUPA 4MWSA 2I3ZA 1QIFA 1USWA 2ZYHA 4BDTA 1CQZA 4KR0A 3AILA 3D0KA 4DMFA 1MU0A 4QLOA 2XMRA 5FP0A 2Z8XA 4OUKX 4OYYA 4G4JA 3EIOA 4U2DA 3GBSA 1CUCA 2WJ6A 2ACEA 5HQ3A 3C87A 1QE3A 3AUKA 4N5IX 5CBKA 1EI9A 2GYVA 4RPCA 4LXHA 1TIBA 4C01A 2YYSA 1WOMA 1XZIA 4I4CA 2Y6VA 5HF8A 2QUAA 5JD4A 5AM2A 4QWWA 4RNCA 1JJBA 3F97A 2DFPA 2YXPX 4AX4A 3WZLA 3OM8A 3TGLA 5LZ5A 5EIHA 5FXMA 3R3VA 1CRLA 4QDUA 4BZZA 2BFNA 1L7RA 1X2EA 1EDDA 4W1QA 4X3CA 4Y2PA 4GXNA 4FMPA 4DNOA 3TJMA 5HF5A 1TQHA 2XE4A 3E3AA 2QRUA 3CCBA 2WUFA 4KAJA 2WSLA 3WKBA 2ZYIA 4Y2TA 2X76A 5JAHA 2VJAA 5JIBA 1CUEA 1YAJA 4J0IA 3ICWA 3STXA 1Q0RA 4HXGA 4J03A 1Y7IA 3GUUA 5BWCA 5K3FB 1K5PA 1ZI9A 1BRTA 1PJAA 3QH4A 1QGED 3HI4A 2H9YA 3H18A 1CUGA 1GQSA 2WTMA 3G9TA 2DHDA 5AM3A 1CUHA 2HDWA 5ALJA 1UK9A 2ZJ7A 2Z3WA 5T4EA 3GROA 5F4ZA 3O4IA 3WI7A 4PF1A 5AKIA 4U2CA 4X7BA 3FYUC 1KU6A 1X2BA 5ALVA 4V2IA 1ODCA 4J0HA 3WK8A 5FUMA 2VTVA 1LLFA 1FJ2A 1CUSA 3N2ZB 1ZIXA 4FKBA 3H2GA 4WFJA 5ESRA 1UWCA 1UK7A 3ESCA 1C7JA 2BUCA 2JEYA 2H7YA 2WIGA 1BEZA 4X00A 1UFOA 4G9GA 3T4UA 1TK3A 2RHWA 4BTVA 4H7IA 2V97A 5HKBA 1CUZA 2VJCA 3IUNA 2WG2A 2JGIA 3CN9A 1ZD5A 1CUYA 5ALZA 1HL7A 4W1SA 5H3HA 4BCDA 2C0PA 4MQLA 3FAKA 5A7FA 4BP9A 3QPDA 5KWJA 1G5FA 2QOEA 1XQXA 1ZOIA 3PFCA 3R3XA 5K3FA 2QUBA 5D3KA 4BVKA 4BCCA 5AI6A 1J07A 4B9AA 1GGVA 1LBSA 3H19A 4Q3OA 5AI0A 4JUIA 5K3CA 5K5EA 2GZRA 4PSCA 4S0XA 1JI3A 3QM1A 1BEEA 3MUOA 2HA4A 2DR0A 1ZGBA 4Y7DA 5ALHA 1DINA 1VZ3A 4GBGA 4F60A 4KRXA 5A62A 1MJ5A 1A8SA 1XZKA 5ALYA 4HXEB 5AKJA 4HAIA 3VXKA 4XX1A 1ZD3A 3VJKA 4UFPA 5EIAA 4AO7A 3WWOA 2C0QA 2RIPA 3AINA 5HFAA 3WA6A 1UKAA 3DOIA 3PUHA 4OCZA 1DQYA 3CXUA 1W75A 2QJRA 3BF8A 4X90A 5CMLA 5I8PA 5JADA 4OSEA 4XIIA 2FJPA 2YH2A 3A70A 4CFSA 3WJ2A 2IX9A 1EX9A 1XZFA 2CUTA 3AZQA 3IBTA 4B0OA 3VKFA 2AXEA 4NVRA 4U2BA 3WL6A 1WHTA 3A2NA 1A8QA 2QVBA 1CVLA 2QXUA 4X92A 5K3AA 1CEXA 2D0DA 4BDSA 4P08A 1IUNA 2Z5GA 4FFVA 3QPAA 4FHZA 4J0CA 3O4GA 3ZLTA 5BOVA 4EY6A 2PSFA 1W6RA 1XRRA 1YR2A 2ECFA 2R8BA 1GPKA 2HA6A 3IDAA 4F0JA 2QJWA 4B9EA 1A7UA 4DMKA 2OAGA 2HRRA 2PM8A 1OXMA 5LP1A 2QS9A 2CEKA 4FBMA 1CUFA 3AFIA 5SYNA 3V1LA 3R40A 4K2AA 1MAHA 3C8DA 4E14A 1QZ3A 3NOXA 3NWOA 1DX6A 2IIVA 2WJ3A 2GBCA 4DNPA 4UBMA 5IH7A 3OG9A 2J3QA 4KRYA 3R3UA 2XQIA 1YS1X 4MQMA 5HFNA 4G4GA 1QIEA 3WL5A 2O7VA 3W04A 4UHCA 2XUFA 3STYA 4L3WA 1CUWA 2PPLA 7YASA 5JALA 5AIAA 3C6YA 3ZI7A 4CG2A 2ZYSA 4KYVA 4UFNA 1E8DA 4DSZA 4H0CA 1K8QA 1E8NA 4X94A 4ZWNA 3ESDA 4OB8A 1GT6A 1UOOA 2RAUA 3WL8A 3IIIA 3DYIA 3W9UA 4BC0A 4DNQA 2HU8A 4W63A 2ZYRA 1XZEA 4BVJA 2JGMA 5AKHA 1XZJA 3VISA 5I7UA 1U4NA 3QZUA 4IH9A 4JYPA 1QO9A 4GECA 3DQZA 4Y2XA 5ALTA 4JYMA 3LP5A 3ICVA 1C7IA 4M0FA 5A71A 3F9CA 3FLAA 3STWA 5A6VA 2H7CA 2O2HA 3S8YA 4FLMA 2NW6A 2OGSA 3STUA 4FWBA 4UFOA 1DWPA 3BWXA 4H18A 2OCLA 1WB4A 1LPPA 1TKRA 2WJ4A 2XUQA 1BROA 5AM1A 1IVYA 3DJYA 2RI6A 1DQZA 2V96A 5CURA 4C88A 4YPVA 1DWQA 3WIOA 4D9JA 5AO9A 2QTBA 2PSDA 1ODTC 1Z68A 4BZWA 4CIBA 2DSNA 1K6EA 3S2ZA 1FFDA 5SYMA 1AQLA 2K2QB 2XUIA 5ALRA 3D5EA 2JBWA 1ORWA 4QWMA 1IZ8A 3PF8A 2WG0A 1XRMA 2W22A 3FSGA 1XLUA 2EDAA 2XMSA 1QIDA 3V48A 2HADA 1I6WA 4AQDA 3C5WP 4LKOA 1W52X 4GEGA 4BE4A 1VLQA 2ONCA 5AI5A 3I2HA 4QDXA 3NGMA 3U0VA 1QLWA 1VA5A 3HLKA 4Q3LA 5LKAA 1RYYA 1JFRA 2BCEA 1QIKA 2ROQA 1ZGCA 3AJAA 4C87A 1VE7A 4NS4A 2OCKA 4B7ZA 1H2YA 5EHXA 2CKMA 3UUEA 5K3EA 4XVCA 1AZWA 2GBGA 4DIUA 4X95A 4Q05A 1SC9A 3I2IA 4YX9A 2XUGA 1O6FA 5ISMA 5AK3A 5JAPA 3CCCA 1THTA 3AZPA 4LYEA 1EXWA 1ZD4A 3DLTA 1JT2A 2AJBA 4X71A 2CJPA 3I1IA 1CUBA 1FFCA 3R3YA 4DMHA 3IA2A 1YB7A 1QTIA 2ZSHA 3JW8A 2VA9A 3B5EA 2JGFA 3QITA 3WK9A 2BJHA 3ILSA 2FUKA 5EGNA 4KJXA 3AZOA 1FFBA 3ZWQA 2C7BA 3D2AA 5LYYA 3G0DA 3QBJA 1ETHA 4C4ZA 1CFJA 2ORYA 1K4YA 5E4TA 2XUAA 1OILA 3WKEA 2C5FA 1P0IA 4RGYA 3I2KA 2PKYX 1J2EA 4ZI5A 1MX1A 1A88A 4ZGBA 1B41A 3FYUB 1XRPA 3I6ZA 5CT8A 1YS2X 3W2TA 2BGRA 2OPHA 2PL5A 3L1JA 3M81A 2JEZA 4FNMA 1HPLA 3WKDA 4DNFA 3STTA 1QIHA 3DNMA 5ALSA 1CPYA 4QDZA 3C45A 2HFKA 4WCVA 5AKZA 3QMVA 1XZCA 3I2GA 1CUIA 4ZV7A 1WB6A 2PVSA 5CH8A 6YASA 2CB9A 1VKHA 4QLAA 3O9MA 2GBIA 3G7NA 2XI4A 2XLCA 4UPDA 3D7RA 3DCNA 3KWFA 1EHYA 4QNNA 3QMWA 3SK0A 5CT4A 4WY5A 4EB0A 3FCYA 3WWDA 2BUAA 2HFJA 1MTZA 2HM7A 2ZSIA 2VQ6A 2IITA 5AOBA 4TVKA 5LLSA 4B85A 4P93A 5IVDA 1CUAA 2HL6A 4G4IA 1LGYA 1HBJA 1YA8A 3H17A 3BXPA 2WHPB 4CI9A 4TPKA 1VA4A 3HABA 4N8EA 2WTNA 4BYMA 5E4YA 5EHQA 4KE8A 5DTJA 1N1MA 5EFZA 2WLSA 1LPMA 1LNSA 1QJ4A 3HC7A 4ZREA 3A2LA 4ROTA 4MJ3A 2GYWA 4WJLA 5ALPA 4FLEA 3OURA 2WIFA 2W6CX 4BB0A 1XZDA 4NZZA 1H2XA 1YSCA 2PUHA 2OLEA 5FV4A 3OPMA 3FYUA 1R9NA 4FTWA 1ZIYA 1E8MA 4IHAA 2XMQA 3VJMA 3BJRA 3GELA 1W76A 1VXRA 4BC1A 3BJMA 5FRDA 4AO8A 3KD2A 5T4BA 3DL4A 2CZQA 5CXUA 5DYWA 3DD5A 4Y2VA 2PUJA 3RLIA 1MN6A 5DYYA 1N5MA 3D59A 1VE6A 2XMGA 3WMRA 1EVQA 3WWEA 2WHPA 4OYLA 2XDWA 4BVLA 5ALMA 1J06A 4LYDA 4U2FA 3HSSA 2XUHA 3JYHA 2HA5A 5AICA 5JANA 4JEIA 3LS2A 4G8DA 1UOPA 3OOSA 2OCIA 5AKEA 1F6WA 2WU4A 5LZ8A 4K6KA 1U8EA 5C81A 5JZBA 3PE6A 1X70A 2HA0A 3D2CA 3O4JA 4FBLA 1XROA 4HXFB 2QXTA 1L7QA 2DQZA 2WG1A 4AXBA 1QTRA 1WHSA 1CIJA 4WDRA 3OTQA 1F8UA 2XUOA 1XZLA 1PV1A 5ALWA 3ANTA 1EDBA 1XLVA 3BDIA 4Y9SA 1DX4A 1Q0ZA 2QT9A 4QEKA 1H2ZA 5C8VA 2O7RA 1Q83A 2PSEA 2XLBA 3G9UA 2XUKA 3FBWA 4EY7A 3L1HA 1N8SA 3WA7A 2J4CA 2VT6A 3V1KA 5FPQA 3AIOA 1IMJA 4P92A 5AK6A 3TRDA 1QO7A 3LIIA 2AJDA 1QONA 3QYJA 4J3JA 5AKYA 3FOBA 5CH5A 1XZAA 4K6HA 3FYTA 1OCEA 1ZI6A 2Y2UA 5ALDA 4J0GA 4FOLA 1W1IA 3WYDA 3WWCA 2R11A 4B80A 3EF3A 2D5LA 3PFBA 2WHQA 4B84A 4OU4A 1LPAB 4KE7A 4EBBA 1QIGA 3FWHA 2WHRA 5ALFA 3JWEA 4A5SA 3F98A 1DU4A 5EIEA 1EINA 3EQ8A 5DNUA 5AKXA 3IUQA 2XMBA 4UBIA 3BE8A 1MT3A 1XRLA 2OAEA 4C4XA 1ZJ5A 1EDEA 4F5ZA 4H7JA 5AK4A 3Q8WA 2FJ0A 1LPSA 2Y2VA 2DHCA 5EI5A 1JU4A 3HEAA 4U2GA 3G02A 1GPLA 4X91A 2I03A 4ARAA 2XB6A 1SOMA 3G0IA 4MYSA 4CCWA 5FKJA 5CT9A 3EQ7A 5ALLA 4M0EA 3H1BA 3E0XA 3YASA 3A2MA 1R88A 3C70A 1P0QA 3DKKA 4QE3A 4GLBA 4AB1A 2BKLA 2XQJA 1FFAA 4Y2JA 3E1GA 5HF9A 1XZBA 3GZJA 3R3ZA 5JYCA 4TGLA 3ZLUA 1AURA 5JAUA 1BU8A 1QIIA 5T4HA 1MAAA 4ZRDA 2EDCA 4J0JA 4H77A 4ITVA 5JD5A 5C8ZA 1SCQA 2WFZA 1E66A 4QDTA 4ETWA 4UHEA 3DKRA 2WKWA 2WQZA 3KOOA 2WUGA 2ACKA 4PNZA 5AKKA 4XJVA 4FDMA 1UT6A 5C7YA 4YASA 3M83A 4DM7A 2BUBA 3M3DA 4BTLA 4A23A 3ESBA 3IB3A 4I3FA 5DJ5A 1XFDA 2Z3ZA 3G8YA 5ALKA 1EB9A 1U2EA 1W4LA 1QOZA 1HDEA 3STVA 1R50A 2P8SA 4ARBA 3C6ZA 3T52A 4Z49A 3G0CA 3D3NA 2Q0XA 3UUFA 3B12A 2WU3A 1L7AA 4CG3A 5AOCA 5IVIA 1FFEA 1TCBA 2VAXA 3FVTA 3I2JA 3FSGD 3F8SA 3VVLA 2BAGA 5ALGA 1E89A 4OPMA 1E5TA 1XQYA 3ESAA 1ISPA 4AMYA 5JZ9A 1TAHA 4G8CA 4K5QA 3C5VA 2PU7A 3W9BA 1QIJA 1MX9A 4BCBA 4UUQA 3HRHA 2XQGA 1CV2A 1H22A 2Y6UA 4BATA 3CN7A 3MVEA 1AC5A 1XZMA 1YB6A 3H2HA 2QR5A 3H2KA 4BBZA 1ZI8A 4C6HA 2YASA 4G5XA 1GKLA 2OG1A 1EB8A 1MNAA 5IKXA 4G1FA 4HS9A 4ZV9A 2RGUA 3DYVA 4L72A 1DTEA 4N5HX 3RK4A 2G5TA 1GKKA 2X5XA 4Q1VA 1R3DA 4LIPD 4J7AA 3K9BA 1UK8A 3DL7A 1QFSA 4MEBA 2B9VA 3N0TA 3HACA 1KEZA 5FLKA 4DLNA 4DYHA 1R9MA 3C6XA 2WFMA 2FX5A 5AKGA 1BCRA 1E3QA 5CT5A 5HCUA 4J0DA 5CTAA 4KACA 5DTIA 3EBLA 3TEJA 1HLGA 3I1YA 4OB7A 1CR6A 1AKNA 1XRNA 3KXPA 5AM5A 2B4KA 3ED1A 4X97A 1CLEA 1J1IA 1YCDA 4U2EA 1P0MA 4BE9A 1F0NA 4LXGA 1YA4A
chains in the Genus database with same CATH superfamily
1HYGA 5F7XA 1ZJYA 1KAGA 1B4DA 1L5RA 1DEAA 1UINA 3LVRE 1JV2B 4TYWA 1VQ1A 4L9AA 3CH5A 1XVAA 4ON9A 4AQYB 5SZHB 2X0DA 4YAUA 1VCOA 1P61B 1CUXA 1QYCA 1S3FA 2PMWB 3THRA 4LYGA 2YHUA 4I66A 3GEHA 3U7QB 5HKKD 4AMZA 5G0SA 4IBOA 4D8XA 3PFKA 4G4SP 4O4IB 4FFPA 5FCDA 5TPWB 1C1HA 4B7CA 4D97A 4DARA 2H3EA 1O8CA 2KLBA 2CZCA 2RGDA 4HRYA 2IZ5A 3LDFA 2WFLB 3REQB 2W90A 5FOSA 4BVAA 5FULA 3NP9A 1SZDA 5KTRA 4PICA 4KI7A 2X8WA 3T7JA 4EHFA 4BJ6A 5A0TA 2W2OA 5E95A 3RBZA 4BUJA 3MBOA 4A5OA 4CKZA 3IPCA 3KAJA 4WESA 2RGCA 4BNJA 1SXIA 2NU7B 2CVZA 4N0DA 2UUBB 4JOQA 5DMXA 4B3HA 1ZAKA 2GEUA 3KSRA 3BSFA 1CUUA 2PL9A 4N5MA 1NQOA 3I04A 3BWDD 1YU9A 2EWVA 5TMBA 4D3FA 1E1NA 2ANCA 2ZVPX 3BE4A 1ZC4A 2Y1LA 3O21A 2QQGA 4HWPA 2AJCA 2PAAA 1KQOA 2K6GA 4LY0A 1PKEA 1RFGE 2YJNA 2WPDD 3UJ9A 3EPJA 1MRZA 1V11B 4XUDA 1PX0A 3U3RA 4D0GA 4MCAA 5JC1A 1DQPA 4I4TA 4JUBA 1I4DD 3P4YA 5COAA 2H54A 1MDFA 3ZN2A 4FR2A 2Y0EA 5H81A 1WHTB 3NT5A 4FJ1A 3ZXUB 1J9ZA 3U1TA 1GUBA 5DK6A 1J8FA 1F12A 3SHTA 5ERGB 2WAYA 1L8AA 3EIUA 1U65A 3KOUA 3EZLA 1SZCA 4QBHA 1SIUA 4HX9A 4NU8X 2CBXA 4OJYA 5EGSA 3TSYA 4QGBA 3L92A 3KB1A 2I1WA 1PGOA 3H9QA 4DUGA 5I7SA 1RJFA 4LAFA 4ND2A 2F3PA 3UICA 2Z0MA 4P0TA 1QRRA 2QF7A 4L9WA 5PGMA 2ZAIA 5D86A 5D6OA 3SIXA 5D7BA 3UPUA 1IL0A 2IU0A 3SEZA 4J07A 3T7DA 3CVXA 2OWDA 3OX4A 3WGZA 3P97A 1RYFA 2G77B 3HVUA 4J49A 1A9SA 1A9QA 4J29A 4HOYA 3W6OA 4ARZB 4E94A 1H5QA 1DKPA 4PSUA 5KDLA 4F45A 3THWA 4JNKA 1V4NA 3DHEA 2ID4A 2R7LA 1Y8CA 4U39A 2FW7A 3OTGA 3GMDA 1EJ0A 3HCDA 3GLFA 1XHFA 4BP1A 3CV3A 4NX2A 4YTEA 5HDBB 4JT2A 2XGJA 3L1IA 3LSTA 3TCXB 4RE6A 3A4VA 5FQNA 1XZHA 1VLMA 2XMCA 2GVNA 2BFEA 2ZS9A 4NXMB 1V35A 1IZYA 3GLRA 2F6RA 3B36A 4F6LA 3DQPA 1T3LA 2BJWA 1DAEA 3NRCA 5THQA 4KC0A 2BCJQ 3VC2A 5KJ1A 1ZICA 2Z4RA 4M54A 4NEQA 3E4DA 1EVZA 2VAPA 4NATA 2C9OA 4CU5A 1U0BB 3L7KA 1NMQA 4QAQA 1E2NA 2QLTA 3LPLA 4FYXA 4MWTA 1KOLA 3KEOA 1VG8A 3I9FA 4XR9A 3NU1A 1QH8A 3H2JA 3IIEA 4ZVKA 3LZDA 1N2XA 1XD2B 1YGYA 3E18A 3GJ6A 3OCXA 5B2FA 2UYHA 4Y2UA 1EUCB 4E2ZA 4DG8A 2OQ2A 1KAOA 1N1EA 1WM1A 3ESYA 1YHZA 2ZU0C 5KTTA 2AOXA 3DDUA 4J4HA 4CL2A 3W5AA 1CJUC 2HA3A 2C98A 3NC4A 1KJQA 1U8CB 4Z9BA 1XTVA 4RTLA 4PHTA 3EF1A 3ROGA 4F3TA 1O6GA 2EX0A 2XNSA 1MAWA 5FOQA 5BV1A 1X1QA 3DHVA 3EOAI 4JJEA 2IDZA 4JVLA 4LOKA 2K7FA 1O0CA 5IH3A 1HT1E 4PZDA 5DPMA 2Q1TA 1GSOA 1E58A 3Q6IA 3IUYA 1JI0A 1RI5A 5IAGA 1QYDA 3MAGA 1DRKA 1MJHA 1O87A 2O2IA 2VTDA 2ES4A 4JODA 2XUDA 3BIWA 2FB9A 3D6AA 3TZHA 2V4ZA 4CN8A 2E48A 2OCAA 3BIXA 3HY6A 1T10A 4D8VA 5IDXA 1WXFA 4NBWA 2OXEA 4PS0A 1SKYB 1JG4A 4DR5B 1IZ7A 3OZIA 2GZ3A 4LUCA 4MUKA 1HTBA 2IUSA 3TZCA 4PN7A 3IB6A 5JFOA 5E1MA 2B5WA 1V48A 1FMTA 3B6ZA 4HDQB 3FZGA 5JAOA 2EIXA 2H4YA 1R9GA 4L8WB 4X8OA 2QZJA 4MA5A 2V5UA 1JKXA 1YR3A 4X95A 3RKUA 1Q0UA 3WFIA 4EPTA 4GVPA 1QNLA 3WKAA 3PHJA 1ODKA 4RF3A 4EP1A 1KXZA 3UENA 1O77A 3FR8A 4R1LA 4RX1A 3TTUA 1J21A 5DM0A 5TPZA 4L5JA 4PYMA 1PE0A 1RYNA 1G9XA 1JWBB 5FUVA 5HF6A 3R75A 3W3AH 3OCCA 1RZ3A 4QEDA 5C5CA 2FPLA 3CTPA 3HKEB 1T6ZA 4PV7A 3F73A 2RGYA 4RTSA 2GBPA 4OK5A 4B6GA 3HYLA 1GZ5A 3AIMA 4W1RA 1WLSA 3ASZA 3EVDA 1MPXA 4UDNA 2BLLA 2RGEA 4H2DA 3BL8A 3DL0A 3QVOA 1P60A 2OENG 1HYEA 3QE4A 3UMMA 2NQ2C 2HBRA 1A95A 4ZCSA 5LUBA 3I9JA 2VZ8A 1PV4A 2GBLA 1X7ZB 2V7WA 2QL7A 1MNQA 5LZ7A 4WKGA 1VMKA 3NM4A 2AVNA 1QHHA 1ZJJA 1LBTA 1E3EA 1YDFA 4RLHA 4ZT5A 4BZXA 1RLJA 1VLJA 1N5KA 3DO6A 5BSUA 1OXXK 5THKA 2RONA 4JX8A 5DU2A 4CQMD 1PS0A 5FWYA 3AKDA 1ZA1A 4KAAA 1IY8A 5CT6A 3U3KA 1DJPA 1PBTA 3DMRA 4Z8XA 4EG7A 1EK2A 4B6EA 4EI2A 2DHEA 3OI7A 5CU7A 1NV8A 3RI3A 1W88B 4O2RA 3RRXA 2RHBA 4CTNA 1IBLB 1UKCA 3F1KA 5CP8A 1QKIA 3UT5B 2W43A 1IYZA 2PBLA 1GUZA 5SV2A 4AWXA 4U5XA 4DZRA 3RFFA 2D7CA 1ECGA 3UMBA 1Z45A 4RABA 4RVDA 3T3EA 2CUZA 3VZSA 4EJSB 3PDCA 5IKPA 4JJGA 2IBMA 5HS6A 1BJKA 2H52A 4HGZA 5FA6A 3UKDA 1D07A 5B4TA 2GXAA 1OFIA 3W7VA 1C1DB 1Y6QA 3LCRA 5BXQC 1W36D 1C7RA 2JFXA 2B8NA 1NU6A 5FQOA 1ACMA 3NTRA 2XZTA 4MMZB 3N7TA 4P2BA 1HNXB 1X15A 5P21A 3I64A 1E98A 3DSRA 3AHDA 3RC7A 2ON6A 2YN4A 4RA9B 1U7PA 4NPHA 3T1QA 2BTEA 3NV9A 3GLKA 2P90A 2WJHA 2ZRMA 1LQ2A 2A4MA 2BZSA 3CJQA 3BXOA 4LNAA 2YHAA 4M0KA 8ATCA 4P0PB 1Z8DA 2OD7A 3PUIA 4G36A 1MQSA 3W7BA 2ECOA 3FMVA 2P7IA 4AG3A 2NP7A 1T5IA 3NHWA 5FUBA 1UFRA 1EQUA 1KVRA 2IYTA 2WSSD 2YWXA 1W5TA 3E53A 4LSGA 4YBRA 5A4JA 5P8WA 2G1KA 4X24A 4L5BA 3ZPXA 4KW7A 1SN7A 1XTSA 2P30A 3ELWA 3M6UA 4PLPA 3LD9A 1QR2A 3T9DA 3U39A 3W05A 4C78A 2VUTA 3EMVA 2GAOA 3H7AA 1RU3A 1M5UA 1GU0A 1A9TA 1EWTA 2I99A 2NQ8A 2OHIA 3NP7A 4YRCA 3RCBA 3WLSA 4BRWA 5HR5A 4DANA 2CCJA 1Y8QB 4PCAA 5HK8A 2GX6A 3ZWDA 5CHYA 4G8BA 3MK31 1GIAA 2IHJA 1DJMA 4J8PA 4M9RA 3J80A 4J3NA 1XTQA 2OBFA 1VIYA 3O0DA 4UNSA 1YCFA 4Q9IA 4P81A 3TXAA 3HUUA 3MBIA 1J7JA 3F3KA 4WFKA 5BSVA 3CJTA 3D1LA 2CW5A 2VPQA 2XD4A 4R01A 2FEWB 2JI7A 3OM0A 3UMVA 4F93B 4O5AA 4AIRA 4RV9A 1BE1A 2H07A 3MBKA 4ZCTA 1A72A 1MJNA 1JAYA 1FFWA 1PQUA 4B81A 1CDZA 4CLXA 3D0OA 1RIFA 5J2TF 3RS5A 1XWWA 4KR6A 3GPCA 2UZAA 1DFIA 4FXPA 3G6KA 4YGXB 1UXJA 4MGEA 2MT9A 5CXSA 5FUXA 3RVNA 5C53B 2C7PA 2GNPA 4GM0A 3EH1A 3LCMA 4PVCA 1TCAA 3KAKA 2X4DA 2O5EA 5EXXA 2C8KA 5H9WA 1NN0A 1PQWA 1U8TA 5CCBA 4HYTA 4BN5A 2DUMA 2YXNA 3DS8A 2OM6A 1LBIA 4DQLA 4E5PA 1YAHA 4D6YA 2PKXA 4R51A 1I36A 4BEBA 4MLZA 1RI4A 4BGIA 2C94A 5ADWA 2QTFA 4QTTB 5FTWA 4F6RB 5IYZB 3SZUA 1WSAA 4TS3A 3PEYA 4O02B 4BMYA 1YZNA 4YVFA 1QPZA 2Z30A 1RQNA 1Q17A 1L7DA 2JFPA 3FMFA 1E1LA 3A0RB 1MMFB 1USUA 1ZYUA 2VBCA 5A2GA 2JGNA 1RW4A 4P3YA 1Q0LA 3K0FB 1FXSA 1G8FA 4JBYA 2HX1A 2AFHE 4PC1A 1Y89A 3K72B 4K9PA 4D6PA 1P4SA 1Z29A 4UBJA 1A97A 3ZHBA 1MO2A 4ZCRA 3LUDA 2C4HA 1B0AA 1FU4A 1QDEA 1MHPA 3AUFA 2QRJA 3A1TA 2IXFA 3LHSA 4N01A 4YK7A 2IS6A 2XGGA 2HF2A 2B20A 3M3PA 2GPBA 1O3YA 4AYWA 4MUNA 4E46A 1R6DA 1ZY2A 2IHBA 3M4ZA 4PG4A 2ZRHA 1X77A 3KWMA 2NPFA 3EUFA 4GPIB 2PSHA 1K5DA 2ISSD 1H42A 1GGMA 3A58B 2HU5A 4V0ME 3DAYA 4JL5A 1Z63A 3E9DA 2GXQA 1SQFA 2R7MA 2EKPA 3MCAA 4JR2A 2O4CA 4EB6A 4YUYA 4MEAA 1SCKA 1B6RA 2FFJA 1EE9A 5JCOA 2CHQA 1E2HA 5CAEA 1E61A 3BWYA 3C6BA 2WYWA 1L7EA 1VBFA 4IMPA 4LJ8A 2OHVA 3KT8A 2PMKA 3BMNB 3ZWYA 3JQ6A 5G0UA 2XY4A 4FW9A 4ZD6A 4YJ2A 4YJFB 2FWAA 3NVMB 1RYHA 1W2GA 3MWDA 3ANSA 3PGKA 4DMRA 4FFWA 4DIOA 1E4YA 2GN9A 4MUGA 3RUDA 1U9CA 5K6AC 1XEWY 3UFBA 1OB2A 4YMHA 4Q9DA 1LRKA 1RAEA 4YO8A 1RP7A 3QEMA 1TTPB 3QPCA 1WMEA 4UASA 1USVA 2WFLA 4BUZA 1OZFA 4IOJA 1YIDA 2FSIA 2EQ5A 1L8QA 5DBFA 5JFTA 4O4IA 1ONNA 2ZXEA 2WR8A 4E15A 4ZYXA 1MBZA 1YBHA 2W70A 2PJZA 4RDIA 4GU5A 2ET6A 1E2IA 1HG1A 1JR4A 1V1MA 3I1FA 3ZDQA 1B6GA 2BGJA 1J0DA 1ZH8A 2HCTA 2X6TA 2FQQA 4TLCA 2HGZA 3D02A 2OEPA 3FXAA 3W9SA 3BF7A 2IUFA 3H3XA 3PRHA 1N2ZA 3VPAA 3S6JA 1JAXA 4B2YA 4NMLA 2JFWA 1JH9A 2ODWA 1NE7A 1OJLA 4PINA 4NTZA 5T4FA 3RUCA 3T1NA 1NQ5A 2GASA 1BMTA 2C9ZA 2BTQB 3GCWA 2CXOA 3U48A 3DOEA 1I6LA 4WAUA 2GRJA 3O8NA 3R20A 4MYDA 3TTTA 4FUQA 5KREA 1OGYA 4K9MA 3R8FA 5JQGB 1PJZA 3UK0A 3R7NA 1F60A 4BKRA 1CHDA 5L4SA 3I73A 2VT2A 2WTUA 2V5AA 2Z04A 3NTVA 2EOAA 4WK4B 4ZOLF 3ET5A 3GLGB 1HKUA 3E5NA 1LZLA 1W4ZA 5CNJA 2VP2A 3V2GA 1S8FA 3AR2A 2GCPA 2HJHA 4KX3A 2Q2NA 1N5LA 1HT0A 3GEBA 3RH0A 4D43A 2XBUA 3WGLA 4D9IA 1RPAA 2FPPB 3FDZB 4Z51A 4BFTA 1CY8A 3AEQB 3P4XA 5AVWA 5KNBH 2Q7XA 3CPSA 1H1TA 4EARA 3RYFB 1DJLA 1W93A 3ZC3A 1F5SA 2HU7A 3IV6A 1X87A 2IOHA 1G55A 2ZBVA 3LCJA 3IBCA 3U19A 1DE0A 3ENVA 3RS3A 4FYHA 4AD8A 1L4EA 3KELA 3LLCA 1XDDA 4GT1A 4C0AC 2XWSA 3H3FA 4RFLA 2LCFA 3HJRA 3LF1A 4AZ3A 4BNMA 3W4KA 2AQKA 4PEVA 3RV3A 3RC2A 3QBVA 2ASEA 2I4TA 2OOKA 3LC2O 1L5ZA 4J91A 3VU0A 2BC9A 2OZPA 4CV1A 1KZ1A 3B7GA 3QPBA 1C30A 4UZSA 3T7EA 2EHDA 2CLDX 3GG9A 4MWZA 3B1YA 2C8VA 2VLIA 4Z4GA 5A1JA 3C3AA 3PTZA 3BRQA 4F85A 3DC2A 4NDZA 3N2YA 3PGMA 2TMDA 3BDVA 4X8HA 1D2RA 2HAEA 5L3QB 3OPYB 4PQGA 3FPGA 2GXSA 2H18A 4XFKA 3O4HA 3HO8A 1PDOA 3E3LA 2WF6A 3C85A 5DEIA 5EMHA 3CWQA 3A9RA 1IXSB 5CLHA 1I24A 1WKBA 3VNUA 1FDTA 4DXAA 1TO6A 1QS0A 5CVEA 3TW6A 2JF0A 2WW8A 3WYFA 1HDXA 3I76A 3HPRA 3D8NA 1N2JA 1OH6A 1ZSYA 1STOA 4HAYA 4ZRMA 4YUXA 1Q7CA 1Z0DA 5EVJA 4YFVA 1EEXB 2PWYA 2XOKD 5DLPA 4YXFA 3C7CB 1Q6ZA 5FI1B 1O08A 2HPHA 2FP4A 1XIVA 3HXQA 1FRZA 4EKDA 4XOIA 5FEUA 4I5GA 5AHXA 1KOFA 1WNFA 3OJCA 1U6KA 3V7WA 3ZLVA 5IEBA 1S2OA 4EATA 3NR2A 2ODPA 4O8ZA 1FUYB 1ZOSA 4EYOA 2JGJA 3GVCA 4WBNA 3R4CA 4HAOA 1I8TA 1JH8A 3QFFA 2FZLA 2REXB 2ZIVB 3OM9A 4IOLA 2WT4A 3P9RA 3LTEA 1VIVA 2WUVA 1XMSA 4KUEA 3ZIDA 1ACLA 4IJWA 1KZGB 4RPHA 5I3ZA 1MKYA 4P4LA 3KDAA 2PYDA 2JC3A 3I6YA 3O4RA 1VJTA 2P3LA 3IVXA 4KOEC 3VM6A 3T5GA 1B8UA 3BQ9A 3NWJA 4LYAA 2C4WA 2GLTA 1ODIA 4B3GA 3Q7QA 5JAQA 5AJHA 3NHPA 5MFPA 1R6XA 3ENWA 4KEAA 2LCIA 2X19A 2ZSFA 5L3QA 1XMOB 1XYVA 2GI4A 3G59A 4HRVA 5EIBD 2VT7A 2BFOA 3CLTC 4COOA 1TEXA 3K05A 2C5BA 5JQGF 2CYCA 2RAVA 3SEQA 3W9YA 3OECA 3EVAA 3AEKA 4OJKA 2NUPA 1VGVA 3WV5A 1NG9A 1EA5A 4GO1A 4JJKA 2O3RA 4KRFA 2B37A 1J0EA 4N47A 3MUNA 1NDUA 1D6JA 3LCUA 1CRQA 3KFLA 3MQ4A 2GN6A 5DHRA 2WBLC 5AW9A 4TTJA 1ZD2P 1DOHA 2XJ9A 2HA7A 2CFCA 4Y2HA 5DNYB 1NT2A 1ENPA 3IP9A 3TAHA 2GBFA 1UBFA 4BP8A 2DUJA 1XR3A 4LJRA 5G02A 4B3DA 4CBVA 1GWNA 1THGA 2IYPA 2HUNA 4WT7A 3WQHA 2AMJA 2YWHA 3I5YA 1R6BX 2EJCA 3IUJA 5C2JB 1H3NA 2FTKE 1BHO1 2PO5A 2PSJA 1MGPA 4NZPA 4BMNA 4CCYB 4FNAA 1YUBA 1GZ7A 2EKBA 3BMCA 3JQAD 4TKUB 2C7RA 1Z83A 3DDSA 1JHXA 1Q1ZA 4ZJYA 1BQEA 2G4LA 2YWFA 1U3CA 3HKCA 4GI1A 4P5DA 1U1GA 4I3GA 2HQRA 4I8IA 4WGGA 4IGFA 3WLAA 3HY4A 4D02A 4EFDA 4YCMA 3MSCA 4RHXA 1GU1A 5K3SA 1M2NA 4JS0A 5G4KB 1SULA 3GK3A 3NGXA 1QX4A 4Y3UA 4R0NA 5AW7A 2D0OB 1NXWA 2GD2A 2DBQA 1YS6A 2H9IA 2RDMA 1NW9B 4OBBA 4DHEA 3DW1X 3H16A 3KM0A 3J7AC 3ZKAA 2DLCX 1E20A 1QGUB 3GA0A 3CVUA 3NI2A 1FSZA 1W0KA 3OQ1A 4CL0A 1MW8X 4EHJA 1GKUB 5AK5A 4PSDA 2MYPA 5CH3A 4FKMA 1OBVA 5CPFA 3WVNA 5BPFA 1NSTA 5BUSA 4HX2A 1EVYA 5B1YA 2KW5A 4M46A 3HV0A 4CF3A 4IQ4A 3PJEA 4JL8A 4KXVA 1DBRA 3AY3A 4RKYA 3VUEA 2VJBA 1S8OA 2VK1A 4AZ3B 2Q1YA 1Q84A 1AKTA 2VKQA 3C1OA 3IXMA 3TNJA 2CHEA 4G0UA 5BWBA 2PXAA 4JJ7A 3IEXA 3GAAA 1R8XA 4M1YA 2AFHA 5JSZA 3VR3A 1EWYA 4R31A 3LPAA 2IP1A 4YQZA 3OLQA 4ACAA 4DIFA 5IVKA 1KF0A 2C1XA 2GNOA 3OPXA 1L6RA 4GYJA 3G17A 1EUDA 2I6QA 2J3KA 1WXDA 1T0UA 2WU0A 5KWIA 2XW6A 2WF7A 1X6VA 4DMCA 3SWWA 3QX9A 2NNLD 2BMDA 1SC6A 2A0WA 3MD0A 4IH1A 3SG0A 1KIMA 2F59A 2RBEA 1LI5A 1XNHA 2XEDA 3FIUA 3DUWA 4MUMA 3TUJC 3GU3A 1ZUNA 1OW3B 4YJKA 3B6KA 4IWXA 3OFSA 2W6IA 1QIMA 3V9PA 3OT5A 5HCNA 2E9SA 3DGEC 2FQXA 4L6IA 1N2HA 2OHFA 3AOEC 4OK6A 4LKRA 5EZYA 3V1NA 3TD2A 1VJ5A 4ED9A 3L40A 3B60A 1KETA 2ZJBA 3SIRA 1QMPA 5FBZA 3H8WA 1FF9A 2X86A 2CMDA 3A6EA 4N18A 2O1SA 4YRRA 3ZIUA 3REFA 2ZIUB 3FMIA 1NKVA 2B69A 1TUBA 4PQEA 1SPXA 3KQHA 4ISBA 2PX6A 4RZQA 5FBHA 4BZPA 4XYBA 1BX1A 1A5SB 3HVKA 3JR3A 3DAFA 3V7FA 3TZ6A 5LZ2A 1QHIA 3UV6A 3R9WA 2DR3A 2J6CA 2G9ZA 3F7NA 1BQ4A 3K3PA 3MCTA 4P22A 4W5WA 4AJPA 2FG5A 4F1JA 1Q0HA 2VEOA 1WY7A 3LLUA 5B1DA 4F7DA 1CQZA 2FEAA 4O8CA 1WUIS 3PL5A 3B51X 2HWKA 4G1MB 4RH3A 3D0KA 4HGQA 2IJGX 3RC1A 4E51A 1YQEA 2CLEB 1S4MA 4ZVRA 4CV3A 3KZ1E 3EWIA 4LTNA 1WA5A 3ZEIA 2HUPA 2NADA 4MA0A 5ILQA 3N7UA 3JQ9A 1OAAA 3EIOA 4UE3S 4IIDA 3SQDA 3A32A 4MOWA 4XIFA 3GBSA 4Y0VA 2G04A 3IJEB 2ACEA 4HH1A 3CR3C 2XDAA 4DG5A 2XB2A 2CGEA 3KEQA 1QE3A 4N5IX 4NU5A 4JLUA 3GQVA 1EI9A 3Q5EA 4JASB 5HILA 3GT7A 1N3LA 4X45A 2MSCB 1D4OA 1C9JA 1MB2A 2VIIA 2YXDA 4MW1A 3R8CA 4CEHA 4KWTA 2IEDA 2Y6VA 3LYLA 1U9YA 1H69A 3AB7A 2R751 3DWEX 4GRIA 2ZITA 4KNWA 1DKLA 2Y0PA 1QAMA 3O7WA 4NFYA 4D9GA 2ODAA 1Z2EA 2X8AA 3GLTA 3HSKA 5BWOA 3W8EA 4HDNB 2O8DB 4GWGA 3FOAA 1C8LA 1NVMB 2O23A 1GGHA 1FS4A 1BFKA 3D3KA 5AJWA 5EXDA 4S04A 4MZXA 4WLFA 4IV0A 3FSRA 1IHPA 2HMWA 1F4PA 1KVUA 1K7SN 2JKZA 4AX4A 1IC6A 2I5PO 3N2GA 3OM8A 3L43A 3R7LA 1Z6TA 2V4MA 5LZ5A 1P39A 3RUAA 3SVZA 4E5MA 5BN3B 4DV3B 1TDJA 1CRLA 2FRDC 4ZQFA 3WRXA 1SB8A 3ZJVA 3Q3EA 1NRJB 1P81A 2ZK7A 4YQFA 1MORA 3SEFA 2Y9MB 4WNIA 1YA6A 3P2KA 5LMUB 4W1QA 5C80A 4X3CA 2DEUA 4GXNA 1ZD1A 4BNUA 4BMSA 4DNOA 1YTLA 3NEAA 3RODA 3CUVA 5IU6A 2Y77A 4L5IA 2XE4A 4BQIA 1C3JA 1H4SA 1WCWA 4CETA 2EJVA 3CF2A 2PL3A 2WUFA 2DB3A 1UBNA 2PFKA 4M9SA 3P9ZA 3NW9A 1A9RA 4L22A 3TQRA 3WKBA 3OO0A 5A03A 2O2XA 5KYVA 4X6LA 1M0TA 5BXYA 5JIBA 1J22A 1I7QB 1YAJA 3JD0A 3ICWA 4J0IA 5AVTA 3GFRA 4DYVA 1EVIA 2YINC 5NLLA 3U3MA 1Q0RA 1UOEA 4J03A 1IWOA 4EWLA 2AEJA 1X9GA 3GUUA 2Z9DA 4FDVA 3OOJA 1K5PA 4YJ2F 5K3FB 3HKDA 2QZ9A 4FE3A 1PJAA 2DRIA 3BSWA 2MSWA 3HI4A 3REGA 1TF5A 2FG6C 4DW8A 5DNCA 1MB9A 4I1OA 3DLBA 3DW3X 1Z5GA 3CNBA 1CUGA 3BK2A 3KTDA 4M89A 2SCUB 2VA8A 4PAOA 5K8CA 1Y3IA 2YFQA 1M0EA 2GFHA 2QX4A 3CH4B 3IILA 5F9MA 2XXBA 4DMLA 1DEOA 1MO3A 3A04A 3KKKA 4Q9NA 3V4PB 2UUAB 2EZTA 2HRZA 2OUKA 2HNKA 2VCEA 3G8DA 4M9ZA 3WIEA 5B58T 1B3RA 4M9UA 5BMVF 4JJZA 1ZCZA 2GETA 3DVSX 3V1UA 4QHSA 4MW0A 4ARSA 1VI6A 1YVDA 1CUHA 2HDWA 1U2GA 2WICA 1PEAA 3TD9A 1NYTA 3H65A 2W6ZA 3SZOA 16PKA 1H65A 4OREX 1V3QE 1YRLA 3O8BA 2QUIA 2ZBPA 2UDPA 5T4EA 3N7AA 4XWYA 3O4IA 4G0YA 1J1UA 3QPVA 3WI7A 2PY6A 4M7WA 4H16A 4EL0A 4PF1A 1NSYA 3BWCA 4KSCA 4FU0A 4RD2A 3VTZA 3FGZA 4DLZA 5H82A 4RNDB 3FDIA 4EH1A 4BVGA 3IEIA 4HLUA 1NMZA 1UCFA 1S8AA 3K1AA 2AXQA 3ELBA 2RAFA 5LUAA 2ORWA 1IJFA 2SNIE 3D8UA 1X38A 3L41A 4WUVA 1U2QA 1D8AA 5FPYA 4OHRA 1T6YA 1UC8A 4LTDA 1Y1KE 4V2IA 2PZFA 2GZAA 1UMCB 3WK8A 1FS5A 4WINA 1B8VA 3OJLA 4HZUB 5DI3A 2IPNA 2YWRA 3C16C 2YMQA 4YECA 4MRVA 2NVUA 3DAHA 4R54A 1FJ2A 1KDRA 3NBMA 1CUSA 3FWKA 3N2ZB 3RGWS 3UT5A 4FKBA 1NVXQ 1IJKA 3NVAA 5GZ1A 3OPYI 1EJBA 1CU1A 3NHFA 1QTNA 3Q2KA 2OECA 1WPGA 1AIPA 4Q4AA 1WV0A 1F2DA 1YRQA 1N6OA 3GRRA 1MQ8B 3MTAA 2H1CA 1CSEE 3HDHA 4KGXA 4S12A 3ROPA 3RW9A 2O8BA 2DPMA 3PFWO 3WIDA 1UFOA 2YOHA 2H4WA 2XZDA 3CNNA 3E3MA 3P27A 4FI3C 4LY9A 3ESQA 2RHWA 4IDPA 2AEMA 1SUAA 4BX2A 5FAXA 3ZS8A 2B2XA 4FOSA 4X60A 1QUFA 1GLGA 4E2YA 3QVKA 1G5QA 2ZRKA 1NT4A 2VJCA 4CEIA 1YUNA 4JU9A 2JK1A 3Q7RA 2WG2A 4JXKA 5IT5A 2FSSA 4J2TA 2HQBA 1CNMA 3D1JA 1Y5RA 2AXNA 1FK8A 3TLGB 3WP1B 4DA0A 1WCXA 2WVAA 1L2TA 1HL7A 3SNKA 4W1SA 1I80A 1LCIA 2VSNA 2FRXA 1P73A 1IDN1 4F6CA 2C0PA 4UEKA 3FAKA 3VZCA 1T5SA 2O7NA 1ZCAA 3KQWA 5A7FA 1PJQA 4J4TA 5KWJA 1G5FA 2HDHA 2HNAA 2QOEA 2WFAA 2JB9A 3B1VA 5REQB 3T34A 1ZOIA 1L4UA 4RVOA 5B3LA 1C8KA 1EA7A 5CDTA 3DEHA 1WW2A 5K3FA 5C31A 2MIIA 5D87A 5JSYA 3TQQA 2QUBA 3O1HB 5D3KA 4AZWA 4EO4A 2O8FB 2G8NA 3N86A 1WJGA 3KQMA 4HDSA 5AI6A 1J07A 1UJNA 3B1FA 4KWHA 4G5SA 4G56A 5BYKA 10MHA 5CVTA 5KTOA 2HCRA 1OXVA 2JK0A 4PYOA 4U7GA 4ZI7B 3ROMA 3ZG6A 1KJWA 1TTHA 4Q3OA 4GYKA 5EE0A 4MQFA 1OI2A 4KXYA 4XCQA 5I9LA 4JUIA 5AI0A 4CYMA 2IQIA 4LCBA 3NC1C 5F5XA 3EC2A 5C46F 1KJNA 1NI4A 2VPTA 3L5KA 5DNDA 3IPXA 1Z22A 2GZRA 1KVQA 4KN5A 4S0XA 5CVCA 5K5EA 1LQUA 3EG9A 3L7IA 4C6TA 3QM1A 1X9IA 2ECPA 1NNSA 2XGSA 3HE3A 3QKRA 3H2SA 5LC1A 2Q5EA 1AMOA 3MUOA 3LDHA 4FFRA 1FDOA 3U44A 1J09A 2ZR8A 5ALHA 5TMDA 1P2DA 4UULA 1GPH1 3R6TA 1DINA 1VZ3A 1Z7GA 4GBGA 4P3XA 3ADCA 2XZLA 2Q9BA 1JSZA 3KT0A 5IBCA 1T4GA 5DOZA 1KGSA 2BSAA 2VQ3A 4OHKA 3PIDA 2FR8A 4EMUA 5LU8A 4C4RA 3D7NA 2H4HA 3DV9A 3RADC 3PKIA 3MYYA 3SYMA 4EHNA 3K5PA 1CF2O 3RJ9A 3M33A 4LJLA 3VXKA 3KX2A 4XX1A 2PEYA 1ZD3A 1Y3DE 4YS6A 3FWNA 4XLTA 1NQWA 1SGWA 1S2NA 3WRWA 4G1BA 1OTHA 4R40A 3WWOA 4TT8A 3BD6A 3RSHA 2YX1A 1QG6A 1GLVA 3GA5A 4U7DA 2O5VA 2FUCA 4Y9UA 3CT4A 5F2OA 1UKAA 2F1KA 4JT8A 4DOMA 3JQ9C 1RSZA 1KH2A 2ZU6A 1DQYA 2ZTSA 4PLTA 2EKZA 1W75A 1X7WA 1HRKA 2FLWA 1NIJA 1SHZA 1PQYA 2BONA 3JAKB 3QYFA 4OHMA 2GO7A 4LMPA 1CYDA 3ZH2A 4JV5B 3NV7A 3RU7A 4L73A 3K6JA 4I55B 1TYZA 2ZPUA 1VRVA 3HB9A 1A7JA 2C2WA 3CA8A 4OSEA 5CK4A 4ZYLA 3ROQA 1N2CA 4AS1A 4RF2A 3HGMA 3LUFA 3EGEA 5CD1A 1SIOA 2ONYA 3DO5A 1TYBE 1TQ4A 1ZVQA 1EX9A 3EAGA 2OMKA 5ERXA 3BULA 2Q3HA 3CRZA 1WMDA 4XGNA 4XSHA 5CX4A 3VKFA 4B0OA 3LT4A 1E60A 1FRQA 3ZGYA 5L6LB 2AXEA 5JDIA 5TR9A 2HKIA 4V38A 3RSOA 3FPHA 4PFJA 4C3UA 3AESA 2LKCA 4U2BA 1UEJA 4H1WA 3WL6A 3W90A 2HJGA 1A8QA 2SKDA 2QVBA 3AI1A 2ZCVA 2KLHA 2ATIA 3L05A 3L7CA 1PHRA 5A5EA 1H3FA 4MRMA 5DW0A 3GLHA 4KDFA 3ROFA 3WHPA 1OIVA 2D0DA 2D2IA 3S70A 1L1RA 1RHQA 1X94A 2ACVA 2Z5GA 1ADJA 1M2FA 5JH7F 2WHXA 3QPAA 3LUHA 3BD8A 4Z9YA 3SZGA 3TVTA 3M70A 3ETLA 4XGQA 4DMGA 3T9EA 1UZUA 1Q12A 2VJOA 1U3GA 3IUSA 4D4JA 1ZVKA 1AHPA 2CV1A 4BWGA 5EAIA 2IYEA 1K75A 2ORIA 3NDPA 4BIMA 1U7UA 3SBXA 1HDGO 5C7IO 2PSFA 2AUNA 4F9TA 2HH9A 4NBTA 2ECFA 4A8JA 1PR2A 1UPCA 3B1JA 1F5NA 1V9CA 1RKVA 2P6PA 3IE0A 5IPFA 1SUFA 3IDAA 4IFTA 3X43A 3AF6A 3BXGA 1JS1X 2CFOA 3ZI4A 1XK6A 1IY2A 3ANNA 3ZE6A 2QRNA 2ZBDA 5DHFA 1JEJA 1T1IA 1JAHA 4ZAWA 5SY6A 3A9TA 5DHSA 1ISFA 3I9KA 4EYEA 3ZDBA 1EIWA 1LD3A 5BUZA 2IIQA 1P7VA 2HRRA 2XPCA 1ZGZA 3COVA 3K0CA 3NQ41 4M4SA 5TEWA 4RK5A 4DR1B 3CMCO 3BQMB 3HP7A 4WRRA 3RABA 5LP1A 1PFYA 2PJDA 3S2IA 1Z15A 2GAJA 2P1ZA 3NO4A 4IGAA 1E5LA 4JZKA 1R5BA 2WNSA 3U56A 4EA7A 3R40A 2H16A 4K2AA 4GE0A 1SBNE 4Y6QA 5AW1A 1JRLA 1O95C 3C8DA 1NC3A 3ILXA 3NYRA 3OEED 4I50F 4Z4QA 4EHDA 1ZH2A 2C20A 3KXLA 3NBQA 3NOXA 3H4VA 4H3VA 4BMVA 3ZBQA 1UDXA 4GSLA 2X14A 5KKAA 3NWOA 2A6PA 2JFOA 3JYPA 3WGGA 1G5IA 1JJ7A 1T1JA 2BFBB 1TYEB 1DBPA 1J99A 2P5YA 4TWJA 4L8LA 4RJKA 4WJZA 1YZFA 1OH7A 4TWIA 3AEUA 2IIVA 2J3EA 3O90A 1GRNA 2WJ3A 3OQVA 3CZAA 1NFQA 3V7YA 5FIUA 2IBTA 2ZZNA 3ER6A 4YQYA 1E5QA 4MV5A 1JFVA 1NUTA 2FZGA 3MRXA 4X0EA 3SQMA 2PT9A 3R3UA 3FTQA 1DIAA 3P9NA 2E18A 3A3PA 2XQIA 3T38A 2CL6X 3TOSA 2V6FA 2YWGA 3ZI0A 4IIFA 4DBLE 1NQUA 3GFTA 3JZAA 5HFNA 3RVMA 1WS6A 4M0DA 4NSNA 3U61B 1GZUA 1VB5A 1J20A 1B1CA 2OMEA 2RK3A 3WL5A 2Q8QA 2CB0A 3FGOA 5BW6B 3EFOB 3T4EA 4FYKA 2YRFA 4EUEA 3D7LA 2V7EA 3KB8A 7YASA 1W36C 3JWGA 3SC3A 2E4ZA 3DVRX 3MOGA 4EW1A 3PFFA 5JJIA 1M1YA 3ZIAA 4L8YA 3N8HA 2V1XA 2E49A 4OHCA 3TPZA 4YRDA 2QSZA 1QHNA 2ZYSA 3NDIA 4UFNA 4K40A 521PA 3SSMA 4EHIA 4DCGA 2IEZA 3AH8A 1OIXA 4ZEWA 5K4AA 3LHFA 3OIYA 4K8OA 1N0VC 1X80B 5CNMA 1PFWA 3GIWA 2POCA 5AUNB 1K8QA 3C24A 5K4HA 4O2AB 5KNCD 3BMOB 4ZWNA 1X1EA 3ESDA 1QO0A 4J9VA 4NCXA 3ZDAA 2RAUA 3WL8A 1R6TA 1UBTS 4JA0A 4DCNA 3VAYA 3KZKA 1ANKA 2H4JA 2HU8A 4TKMA 4QG7A 1NF8A 4NHEA 4CUZA 2JFUA 2K4MA 2D0PB 4PFSA 3AEXA 5LXTB 2PUFA 3TJZA 2YCLA 4D98A 1GZ6A 5E9QA 1XELA 3OUUA 2II6A 2W8BB 4JUCA 2AOTA 1Y9ZA 2Z09A 2ZIXA 2V0CA 4UPEA 1P31A 1MR3F 3QZUA 5H80A 4IH9A 4WTOA 2PN1A 2Z6UA 2QL9A 4DCMA 3GV0A 1T2CA 1ZK0A 3FAZA 5EMMA 4PLGA 3SYRA 4Q9HA 2GDZA 4GECA 3HR7A 1TQ6A 4IXWA 4UM9D 4EPVA 1GQOA 1P7PA 2Q1UA 3DD1A 4Y2XA 4NYIQ 2VDWB 4UREA 3NNNA 3UUGA 4KHPB 4ZI7A 4MV1A 1ZC3A 4RJJA 1TF2A 1K6XA 1DAHA 2O2HA 2YDYA 2E6KA 2WZCA 4F3NA 2M1ZA 1WBBA 2C5AA 2NW6A 4GKJB 1PP4A 5FWXA 3E2IA 3AXSA 4I4LA 2J5XA 3EZYA 4UXIA 1EPUA 3DTYA 4HEJA 2QRGA 3Q6NA 1AS0A 4H18A 3AQIA 1Y6RA 1LWNA 4MI3A 1WB4A 1EDZA 2GD1O 4XVQA 3A3OA 3ENKA 1Y42X 2P0EA 4PZPA 3U4GA 4CUJA 4F21A 2IYXA 3E0QA 1YZQA 3L4BC 1BROA 4GSYA 3EW7A 5EMJA 2ZRBA 4CW7A 1MFZA 1IBRA 2WK1A 4ZQHA 1JIUA 1XEXB 1GV1A 4HADA 2RI6A 3ZQUA 5C9ZA 4C88A 1TGYA 1C0PA 4FN4A 2G7ZA 4CDGA 3ORRA 4DCJA 5TLSA 3ZQJA 1QS0B 3W1WA 1L5VA 5DMHA 1OXUA 4AN4A 1P18A 3DBOB 3DBLA 3NBAA 5AO9A 1R4MA 1E1QA 5T6MA 1P1FA 3N59A 4QUDA 3GZ4A 1D2GA 2A58A 4JI1B 3RUPA 2W8BA 1TT7A 2H17A 2NZYA 3GRVA 3ISVA 3LBHA 4TWZA 3VH1A 2E2WA 1SCUA 3EZFA 2JJYA 5AJXA 2EP7A 1K6EA 4BPBA 2B0JA 1JU9A 4DMMA 3AIIA 4E6PA 1MO5A 3KPUA 1DCKA 1QYXA 3K1AB 5SYMA 2AUTA 1JFFB 4KXLA 4WN3A 4NZNA 3VU9A 3VZQA 2IUUA 3CISA 2K2QB 4B43A 4KUGA 3OD5A 1T4BA 2Q46A 4TWAA 3ZBUA 1V6SA 3EVBA 1IZ8A 2RJOA 1DIOB 1JQJC 1KQGA 2YMLA 3K73O 3LT2A 1L7BA 1E2UA 2WG0A 5AVOA 5B64A 1XRMA 3HADA 5L6MB 3ETHA 5AHRA 5FEMA 1HGXA 3FPBA 4C2TA 1DRWA 4MARA 4WOCA 2YNMD 5HJ2A 1R8SA 3IYLW 4KLRA 2QVZX 2C77A 1BSVA 2XMSA 2VSFA 3I04M 1Z5PA 3KC2A 5G1PA 2I7TA 3V48A 5F9HA 3SSAA 2HADA 2OOSA 2O54A 4LKOA 2GXUA 4G0WA 2G0NA 3PR1A 1JBQA 3A7EA 1UXKA 3KT6A 1WTCA 2AJTA 4M88A 5IN4A 3IP3A 2PWZA 4ND1A 5CM9C 4I3HA 2BEWA 3S29A 4O2LA 2OZVA 3NC0C 3QHPA 4WEQA 2WJJA 1TZMA 3IALA 3LX6A 4KREA 3ZK9A 1JHMA 3KTAB 4NV1A 4NE7A 3LU1A 3NXKA 5AI5A 1WL8A 3VTAA 4FR5A 3LW7A 4PU0A 3N74A 5K8IA 3ZZNA 5IJWA 3OQIB 3QVGA 3LUJA 3WGJA 3RG2A 4IG9A 4C7XA 5CDHA 5HGXA 3TXXA 1JFRA 1V1MB 3FH0A 5SICE 5JS8A 3QFSA 1I9GA 4Y9TA 2XZOA 3DAPA 3BT7A 2V3VA 1L4NA 4LXQA 3CVVA 3VYTB 1J0BA 3O4VA 4H0FA 4KMRA 2CL0X 3TXYA 1KFEB 1PYOA 1ZGCA 2YXBA 1J7KA 3AERB 4CKWB 7MDHA 4AK9A 3W34A 5ECDA 2CFIA 1CZLA 3T3IA 2CYAA 1YJ8A 1I3LA 1VE7A 4NS4A 1GDDA 1Y3AA 2CUKA 1Q11A 2QWXA 2X1LA 1Z6YA 2Y71A 3CUEF 3HA2A 4JSTA 4LZJA 3TZKA 3NPAA 1UQRA 3NTXA 3IE2A 1OBCA 3RKRA 1OH5A 1FYVA 1H2YA 2OZLA 5DNAA 1ULAA 3K31A 1VHTA 2D2FA 4DBZA 4AJNA 2V7UA 5K3EA 4NCNA 4XVCA 5C5EA 5JSFA 2XVXA 4D8WA 1CY4A 1SM4A 2SECE 3UJBA 1JW9B 5JY6A 3VTKA 2YZGA 1SVWA 3E8MA 2E82A 5D85A 5LBTA 3S2YA 4EDFA 3LGAA 2UYCA 1GM5A 1OZHA 5SY9A 3KQLA 3FOCA 2HF7A 1HE3A 1HTTA 1G3UA 3EMKA 3N76A 4Q05A 4RDCA 1ZH6A 3SIPA 4F4CA 1H5NA 4BXOA 1W36B 2F90A 3OZTA 4EO9A 4PX3A 5BRJA 4DLXA 2XUGA 3TMKA 2J9XB 3GG2A 2ZRCA 4E22A 3AHIA 2Q45A 3CCCA 1WETA 3U37A 4Z1MD 4BN4A 1C3OB 4UOEA 1Z25A 4BNZA 1OYVA 3CVWA 3U2QA 4PGFA 2O0MA 4YO7A 4JVSB 1YS7A 3QP9A 3Q9UA 4RKRA 1ZNXA 3UJHA 3JD1A 1ZL2A 3I1IA 3T5PA 2EFEB 5BSRA 3TW0A 2HRDA 2O1XA 1XN1A 4HWKA 4N7BA 3KT3A 4G0ZA 4GOJA 1Q44A 3HVIA 3K0FA 4YB8A 3RAFC 4UOZA 1TADA 3NRJA 3T7RA 2ZSHA 1DKRA 1C81A 2UZ3A 3HV2A 4NE2A 2VA9A 4RDHA 1XA4A 1VPLA 1XX6A 2B7CA 3QITA 3WK9A 5IX8A 1HMPA 2FUKA 3A6PC 2AW3A 5EPUA 1UAAA 1P3JA 4KJXA 3RVKA 4LFAB 1CETA 3OY2A 3U4DA 1XEWX 3HGQA 2VYFA 3B3AA 4ZC8A 4PGHA 3ZV4A 5LYYA 3Q88A 4DLPA 1ZCJA 1CWUA 4LOLA 4RTQA 2JLRA 5JZVA 3RSFA 3VMFA 2DHQA 4DY4A 2ZE7A 4ZGGA 5HZHA 5E8RA 5K9ZA 1IXYA 2ZTHA 1NN3A 4ZYZA 1A7KA 4S3MA 2FA9A 3HFRA 5D51S 1P0IA 4ZAVA 1DEKA 1XCGB 5JV5A 1SXJB 1J2EA 1Z5WA 4B8YA 2XWPA 4MW2A 2Z6AA 3K8OE 4I1PA 4ZVLA 2KMLA 1ZNYA 5EG5A 4HEA1 2FKAA 1TM1E 1MX1A 4GBED 2GQ0A 3AYXB 3TWOA 2XYVA 5LP6A 2FEKA 3U9LA 2H2FA 1E6MA 3GOQA 3HLTA 4MQEA 3C6QA 1GGEA 1E7QA 1WVIA 3SHWA 3R5SA 2AYXA 4LSZA 3W2TA 2Z8YA 2MYNA 2RAPA 4REMA 2WRZA 4ZVQA 4MRSA 3PEEA 4MVJM 1ZQ9A 4F8JA 1LVHA 2J30A 3NTOA 3DV0A 1VL5A 4IW3B 2WWTA 4OTZA 2P9GA 4CHGA 3UMRA 5IKMA 4IXNA 5F64A 3WKDA 1XRSB 3BA1A 2X2EA 3FOWA 1C9YA 1SVOA 3QUAA 5DXJA 2OORC 2H11A 4PSKA 5H3CA 4CWAA 1HEUA 2NU8A 3ZWVA 3PLAE 3N2IA 3QU9A 5TY0A 3SJAA 3GZTB 2HSDA 3RAJA 4GQIA 4E4TA 2Q6KA 1FNCA 4WCVA 2IV7A 1Z6ZA 4DQKA 2LVBA 4M22A 4B48A 1SCUB 3VKVA 4YCLA 2R47A 2ATEA 2NO0A 2W0MA 2ZWVA 4R8KA 2PUDA 3KD3A 3SJUA 2WOJA 4C0JA 3SJCA 3PRYA 3E23A 1XVIA 5KJFA 2DECA 1YV9A 4UU1A 1I10A 2CB9A 3CBGA 3PFNA 3IKVA 1WDKA 4OI4A 4QLAA 4WBSA 4YMSA 1LX6A 1DIGA 1JXOA 3RVOA 4Z7QB 1VKJA 2GBIA 3NHAA 2GJ9A 2OFXA 3ORQA 3VC1A 4BN0A 2XCQA 1XLTA 1SUIA 1PHPA 1B8NA 1MABB 1N6HA 2VNKA 1Y8AA 2MJLA 5DN6A 3H86A 4KG7A 3QKIA 4I1UA 4MJ7A 4MS4B 2HCBA 2PPVA 5DISB 4LCEA 1BHQ1 2ENWA 4QIHA 4F2HA 3N8GA 3QMWA 3U17A 2MHCA 4BFZA 3ACBA 3JRWA 4D4LA 4XARA 4EB0A 3FCYA 1MZVA 1O57A 2BUAA 4NRDA 5DYIA 3UK2A 2HFJA 3I62A 3K8YA 3QV2A 2HM7A 2BGMA 3QPUA 2ZSIA 1UR5A 2J6HA 5HE9A 3ZWWA 2NYRA 3NKVA 3UAZA 4ENPA 3DZBA 3GNTA 2V8BA 4QQ8A 4N76A 1BYIA 1CZKA 4KITB 4YR7A 4UJ5A 2ZANA 4BKPA 1HC7A 4FB5A 2ZTUA 4B85A 1T9GS 2EZUA 4JI2B 4I55F 4Q12A 2FZCA 3BILA 3MS7A 4BJ3A 3UMSA 3HCWA 5LXTA 4V0MA 4A2CA 2I4NA 2CNKA 4WXPA 3OFJA 3KDSE 3TE6A 3UXHA 2R86A 1BFDA 2VDOB 2PGXA 4ID3A 5HZMA 4QPDA 3UA3A 1Z07A 1TEZA 4J9UE 2PLAA 1BDIA 4PLHA 4L78A 3RFVA 3PPXA 3HB0A 4D46A 3OFNA 2VUUA 2BBSA 4QGFA 4YAEA 4DDMA 3OZGA 2IH4A 3BXPA 3Q3GE 1GCAA 3ZQ4A 5JEEA 1GCUA 5DRYA 3U1VA 3WFJA 3NT2A 1ZINA 4ESVA 3ZY4A 4CI9A 1E2KA 1JTVA 2RGWA 5A9SA 1HF3A 4N8EA 4Q7QA 2ZYUX 4GICA 5ITZA 4HV4A 3E15A 4OMDA 5TQVA 5D1NA 1YVPA 4WECA 2LTAA 2WUWE 4NWIA 3QG5A 1LQTA 1PFKA 2QX8A 4QYIB 5TQ2B 5EHQA 5KYUA 4GL4A 4LV8B 2IL1A 4A82A 3UMCA 1YK1A 3M49A 4KE8A 5KWSA 3TM5A 4FS3A 5ELMA 4AJIA 4WZBB 2WLSA 3KPJA 5CGQB 3K8ZA 4U8GA 3TBFA 1QJ4A 3HL4A 1LXCA 2Q5HA 1W35A 4RYDA 4ADSG 1JLLA 1P62B 1XHEA 3PJFA 4I9UA 5DTEA 3T5CA 2JAWA 4NYIR 4FLEA 3OURA 2H06A 2W6CX 3GNQA 1HMYA 5BN3A 1AXEA 3MT8A 3WLQA 1CT9A 3PC6A 4YIHA 1Q6YA 2I2DA 1K0FA 3OZBA 1EQAA 2GN1A 1OUMA 4CQJA 1LLDA 2ADFA 4FI3F 1U80A 4NLLA 4Y30A 4OL9A 4O33A 1PZXA 5FV4A 3TDMA 1T8PA 3IXQA 4RHYA 2HLPA 4TM8A 4G1VA 3KPVA 5T3YA 1JFTA 4WXHA 5T57A 4PGMA 1R9NA 2GHIA 3K92A 4P53A 3ZHSA 1KBQA 3D6UA 4LE0A 1ZIYA 1H6CA 4I6EA 2J3MA 3HN6A 4YJGA 4FOTA 4E12A 1KNQA 4ZYTA 1PJ8A 3VJMA 2ERXA 3B9RA 3O91A 3WISA 4L74A 1NF3A 1QVWA 1XK7A 4AVYA 2JW5A 2IZ6A 4G24A 1T6BY 2GM9A 2O6LA 3K1TA 1SXJA 4QNMA 4BC1A 1E9FA 8ABPA 4I50B 5FRDA 2YYZA 4ZYUA 2VI5A 5AXDA 1SXJD 4HF7A 4FC6A 3I52A 4N03A 2CZQA 1QH0A 1OQAA 2AOWA 3SE7A 4BEVA 2Y1DA 1INLA 3OBIA 1GTZA 5DYWA 3LC7O 1G2PA 2A7XA 2PUJA 1WVMA 4ZV4A 1NGSA 2ZAGA 3TPFA 4EGCB 4YP9A 4R7GA 2DOKA 5A3SA 1G9SA 1ZM2A 1YCHA 2Q6OA 1EVQA 3AOEA 5JNRA 3MD9A 4PZ9A 3EXIA 3D4NA 3QYPA 4FIDA 1I5OA 2WHPA 3UFXA 4AJ1A 3EPHA 4BU1A 2CZGA 4OYLA 4KIGA 5KYNA 5ALMA 4KNVA 4EECA 5KNCA 3W8NA 3WAKA 4RFSA 1DDIA 1A98A 2JBHA 2Y66A 3OMXA 2X0IA 4G85A 2JI9A 3GGJA 2HDOA 4MZDA 3UC9A 5BNWA 5GJBA 4ND6A 1IQPA 2YZ2A 1W48A 4XZ3A 3ITDA 3EFBA 3RDPA 3WFZA 1JZTA 2RBKA 1FW8A 4L15A 1I30A 1KDOA 1UH5A 4HGNA 1PNVA 3KXDA 1G16A 3BWBA 4G5FA 1SQ5A 3E84A 1LI4A 3NWBA 2EYUA 5FNVF 2W00A 1EBFA 3CKKA 3EQZA 4MMYB 1Y6FA 1HZZA 2WSIA 2WU4A 3OUZA 3TE7A 4REQB 4XTCS 2FE1A 3WSWA 1RQRA 4JDPA 4TN1A 3C5CA 2JLQA 2HQOA 2G9QA 1U0SY 3R6DA 5DHTA 5H83A 4C06A 3VO1A 1ZJ6A 4KWIA 4RKEA 4F3KA 3PE6A 1JVNA 1K86A 2KE5A 3NHKA 3PNLA 4GNRA 4W9NC 3L2OB 1C3VA 3TR5A 5KYXB 3D2CA 3NJ8A 3WMWA 1KAEA 1A69A 4FBLA 5B5SA 3EXG1 4BJHB 1PIWA 1YRYE 3MGBA 4RUKA 2IXGA 1FYWA 1S3GA 4HXFB 4LE2A 5AHWA 2FCAA 5EA2A 4EA9A 1VCNA 3CNHA 1ZUWA 2X4LA 1GTSA 1UKZA 3ABQB 4NJMB 4YRAA 4H15A 1I2AA 3A1WA 2A1UB 2PS1A 3OZRA 2JIMA 4WKBA 4E5VA 1AV7A 5JNSA 5KUTA 3WGIA 2XECA 1VPDA 3TKYA 4LMBA 5LP6C 2A3RA 3C3XA 3E7PA 2JFYA 1C29B 1YQWA 3BC1A 1I13A 3D7KA 1C0IA 2CJXA 1XDWA 3UNXA 3VAAA 3TLJA 1AK1A 1SUPA 4A8TA 3B6EA 3WYEA 1KVTA 2XUOA 3OTQA 1PV1A 2VRCA 5K2MA 4OF4A 3GJTA 1R6AA 1W94A 2VRNA 1KO4A 3FI9A 3L46A 4ZI2A 1RBMA 1LUAA 2J1LA 3JAKA 3ZTYA 4S1PA 4W7IA 3BGWA 4EJ6A 1OKKD 2HBQA 3C5HA 1DX4A 5CIWA 1UBHS 1S02A 3OT1B 2QT9A 5EPEA 1LW6E 3GRUA 3WRXC 1UZMA 5IEJA 3ZLJA 2Y0DA 2ZJ8A 3O8OB 5C8VA 5EJ5A 1U2PA 3X1YA 2AGVA 4KQMA 1WMSA 2OHXA 4ZVUA 2PSEA 1H85A 5B58C 5M5BA 1FXUA 3T35A 2R9VA 1GAWA 3FBWA 3G2NA 2G4CA 2IEAA 3E6AA 1E9SA 4HAZA 3DM9B 3L1HA 4XR4A 3K5HA 5CBPA 3TOZA 5IXJA 3DPUA 3MMPA 3ZXIA 1MJGM 3WA7A 2J4CA 4MIKA 4C43A 4I14A 3AIOA 2I6XA 5JUWA 4DE5A 4H4CA 2PA3A 1EP3B 1ITZA 1MOQA 1N6NA 2G40A 1HFEL 1Y5LA 2JGDA 1QONA 3D8SA 4WGFA 4MQUA 4DHWA 3FCUB 4DXHA 3B2EA 4J3JA 2ZR0A 1XTPA 4MYCA 4GPD1 2FY8A 4H3SA 1NM5C 4HNAA 2DE0X 2X23A 4BKUA 1Q0QA 1GAJA 1XOIA 3EGXA 4FE4A 2L2QA 3ZZMA 3RTEA 4QXAA 3VGPA 2JLWA 1LTHR 1XZAA 4IL5A 4K6HA 3FYTA 3VOAA 4CNBA 1EXVA 1PR9A 2DLDA 2I62A 1YL7A 3ECCA 2HDNB 1RWXA 2Q5QA 3GDFA 1N5JA 1EJ2A 1P9NA 1ZP6A 3FG9A 1NJ1A 1W1IA 3NHSA 5F5NA 5B3AA 3BFPA 3VU9B 3ZKWB 4EUKA 5BV8A 5EWLA 2BR5A 3OJFA 3ICCA 1DPFA 2WY2D 4OLJA 1QDUA 4QO8A 4TVSA 2Y9PB 2NYVA 4IJVA 1RAHA 2QTVB 2GYYA 4FZ5A 3ZDCA 4I5EA 3ZVRA 3EVEA 4YJ3F 1P1IA 3C3EA 1H0SA 1LPAB 4H3KB 1O97C 3ILVA 4HGRA 3FWHA 3RVBA 3U4MA 4A0QA 3BH6A 2PJUA 3EK2A 3JWEA 5G4KA 1PJRA 4J16C 1DU4A 1ICEA 1SOAA 2O3SA 1FSPA 4P4NA 4QOEA 1VIMA 3ZY3A 5KYWA 5KQRA 3QBEA 4LZAA 3EQ8A 4WXEA 2WPNA 2J33A 1IG3A 5DNUA 1HK7A 1NVEA 4RZSA 5E2BA 1DXOA 3IHKA 1EM6A 3IQZA 2Z5LA 3LVQE 3E2MA 3TQFA 5CDFA 1NW7A 1ZWLA 1Z7BA 3EXHC 3UH1A 4WBNB 2OCXA 1LSJA 5BWMA 1OB5A 1HDCA 5ELXA 1CS0A 2CJWA 4ER7A 2OAEA 1ZMRA 3HK2A 4CF4A 3GXBA 2C59A 1A76A 1V5IA 3N2KB 3ZWXA 3AF5A 4URFA 5IG2A 2D54A 4RQTA 1Y80A 2TMGA 5AK4A 2O0HA 4GXQA 3T3HA 2NN3C 3Q8WA 5BVGB 4I4TF 2BVNA 1RMYA 2DHCA 2PWAA 4QJ3A 5FWXB 4LDRA 1JU4A 2ZTLA 2UXDB 2H0QA 4PO8A 2IU4A 4X91A 1XMVA 4QYIA 5J40A 4EGSA 3PB3A 3T4XA 4DEVA 1BZYA 1QFYA 4RD0A 2KJQA 3D6HA 4G0NA 5EKSA 1Q0TA 1FIUA 3T3OA 1SOMA 2X8LA 2OC9A 2QE7A 1E1RA 3OVMA 5ED4A 2C2BA 1F9EA 4IR7A 1OWOA 1I1NA 4XX0A 1RAFA 4GP6A 1ZUIA 2ZJ2A 5DM60 3PKZA 2IE8A 2QPOA 2SKEA 2VRWA 5HS4A 4FYIA 3IJ5A 3LQFA 1JPNA 4LVOA 5IYZF 1QLHA 4XD7D 3YASA 5SZJA 3ZK8A 3A2MA 4EX7A 1IMOA 3RHFA 3N8IA 4NECA 5F3RA 4JKOA 3F78A 3R7WB 4ZZ2A 2GPAA 3UW1A 1K0UA 1ESEA 4WE3A 5JAIA 4CMBA 2I8CA 2PX8A 1FFAA 3OAAA 2CDBA 4Y2JA 4G23A 1GEEA 3PE3A 2BFDB 3E1GA 4TTPA 1G4AE 2ILVA 2QGZA 2OT3B 1FP4B 3F4LA 5B1IA 3RUHA 2RHLA 4Q16A 4QPPA 5EJ7A 5IJ9B 2IUTA 3BMOA 4OLAA 1Y82A 4ASUD 1RAGA 1AQ6A 1E2GA 3ANXA 3WNCA 2B9EA 3Q6MA 1RPZA 1VE1A 3P5BA 3ZLUA 1IJBA 5JAUA 1B0ZA 1JEQA 1ZGHA 3KLBA 3MFQA 3MMNA 4B4UA 5CX1B 2G80A 3A6DA 4HS4A 2EDCA 4KDCA 1DCMA 5HSGA 2R8OA 5K45A 2R1UA 5C8ZA 2PBRA 4DEYA 3FF4A 1Z7YA 4KXQA 2O06A 1T29A 4UHEA 5CYFA 4P98A 1XDGA 4I8XA 5I4KA 3D3WA 1XZPA 3EZ6A 1Z34A 1O6ZA 3JALA 3NBZC 5K1ZA 3AVYA 2QTHA 1U9JA 3HM2A 3RC8A 1KC1A 3MPOA 2H65A 2QG9A 3L7OA 3ETJA 5KDDA 4OGGA 4TSRA 2R4QA 7ADHA 1SXJE 4PS1A 5KOJA 1P4AA 1A9OA 5EWJB 5TQ0B 3KLMX 5AVJA 3V8EA 5HE8A 2R7NA 1ORIA 5KZMB 1FW6A 1KPIA 2GGSA 1U7TA 2ZSAA 3GVPA 3L3BA 4GVLA 5ES3A 2E5WA 3SNHA 1VBMA 4BTLA 4A23A 1CZOA 1OPXA 4OXYA 3H5RA 1GPJA 2P4HX 3L8EA 2JBAA 1F2UA 3HUEA 2CLOB 4RKWA 1P91A 3H11B 2OD2A 5DP2A 2ZULA 3N07A 2OXIA 4YRMA 5IF3A 3PEUA 2AG8A 3G8YA 4UEOA 5ALKA 1LJ8A 3V4OA 2D1SA 3VU3A 1XMPA 5EIXA 5JCOC 2OKGA 4URYR 5F35A 5IS2A 3AVPA 2PMEA 1T1EA 3ZD7A 3K2EA 4ZT2A 2CDCA 2PRZA 4EAAA 4X1KB 4AMGA 3COZA 1JEYB 3ET4A 1HDEA 1VG0B 2NU6A 1MX3A 1R50A 3STVA 2O3QA 3FFWA 4AJHA 5ICEA 4PY2A 1FX0A 3I9LA 2QAIA 2A9JA 3C6ZA 4G0OA 4K6CA 1TJ3A 2GBLC 4OJNA 4Q1EA 2LCQA 1T3ZA 2JCVA 3D3NA 4L85A 3K5WA 2RK4A 4XDHA 5SZIA 5EXSA 4R9VA 4KYIB 2I76A 3RS7A 4NJEB 3AR4A 5GPBA 1C2TA 3HYRA 3I37X 5U1PA 5A5DA 4HUQA 3NEPX 3HXTA 5LQSA 5FPHA 2FP3A 1JQLB 5ENVA 4OQZA 3WZLA 3EYAA 1W19A 4BLSA 3D64A 4II2A 4RSGA 4TMTA 3H9BA 3SQLA 4H08A 2VUSA 2B34A 1KJZA 3I2JA 3GO4A 5E8JA 4CT4B 1WR8A 1TOAA 3EHDA 2VDUE 3F8SA 3HJTA 3KYCB 3Q3JB 1D1QA 2HRCA 2P62A 4KJZA 3VVLA 2O0KA 3NEJA 3ZD9A 4F9FA 3GZNB 2BMEA 4IIHA 2B4TO 4U7HA 2PGAA 3Q7TA 4MLPA 4QRHA 2GN2A 3S2GA 1VMAA 4LI3X 1ISPA 2MMCA 4TQGA 5BO5A 3W8DA 3TEMA 4L07A 2XKBA 2EG9A 4YUWA 3GCDA 5LFAA 1AS2A 1DARA 3TDNA 5A04A 1PZHA 1Z73A 1M34E 2PU7A 1PYDA 4GD3Q 1MX9A 2XBLA 5KAPA 4DNFA 5BOSA 4HNSA 1CV2A 4OAOA 1GA6A 2ICAA 1JPUA 1A5BB 1ES9A 1YI0A 2E4UA 2WD7B 4NBLA 4MLDA 1H0RA 4OQDA 3QV1A 3MVEA 1ZZGA 1V96A 4IXTA 4NABA 4DCVA 1BE8A 1U3WA 3K4HA 3W4JA 4ENRA 3H2HA 2QR5A 1SU6A