4E5YA

Structure of human fx protein, the key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
307
Chain Sequence
b'SMRILVTGGSGLVGKAIQKVVADGAGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-fucose synthase
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
rcsb
total genus 94
structure length 307
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e5yA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4e5yA02
2EP5A 2GRAA 3UICA 2I5PO 2PNFA 3MJ4A 4NFYA 3BAZA 4MPDA 1XA0A 5JS6A 5T8KA 4YYZA 2DTEA 4J4TA 4LRSB 3VVBA 3HNPA 3KYDB 4D42A 1BRMA 1BXZA 1HDCA 4K26A 2HUNA 1UDCA 4BO9A 1VJ0A 2C20A 4EI2A 3EMKA 1DDOA 2AHRA 3UN1A 1MFPA 1SNYA 4G81A 3ZNPA 1L1FA 3U09A 2Q4EA 3S2IA 1P1HA 3ITDA 4NPCA 5GZ1A 3I9NA 1IL0A 1HF3A 4PLZA 2JCXA 2X1HA 4NI5A 3FTPA 4IMRA 2IDZA 3IAHA 4KDEA 3Q9UA 4Z9FA 3PWSA 4FOOA 3VZQA 4XQCA 1E92A 2W2LA 2JAHA 4NBWA 1J4AA 5F1OA 4KMSA 1ZK1A 4ALKA 3WOHA 1MA0A 3VTFA 4IJVA 3JD2A 3ABIA 1ZIDA 4H3VA 4JX8A 4IDEA 3TZKA 1GV0A 2Y66A 4BO3A 4LSWA 4G2NA 1Z6ZA 5DF1A 1O8CA 3OQ1A 1TVEA 5JC1A 3C85A 3D3EA 5KNLA 5JYEA 1SB8A 4LCJA 3TSCA 2WDZA 5KKCA 2NUAA 1FDVA 5BSEA 1CDOA 1J6UA 4OO3A 4R9SA 4TWRA 2BFPA 2OHXA 3GA0A 5A9TA 3K9QO 1K89A 1PJSA 3JYQA 2XXJA 1LJ8A 1Q1NA 4CMHA 4XWYA 1TLTA 5DZSA 1GUZA 3WIEA 3T7EA 3GG9A 1AHHA 1OBFO 4EUHA 1E6UA 3HADA 1TT7A 4XA8A 3EK2A 2B36A 5JE8A 1YKFA 1SZJG 2E37A 4AJOA 1C14A 4M55A 1P77A 1PGOA 3BXXA 1C0KA 4CMEA 4ZN6A 1WVGA 1EMDA 2PKQP 2FSSA 2Q2WA 3JYNA 4R1TA 2JCYA 3H9QA 4PLCA 3IQDB 3RBZA 3NEPX 4UUMA 3TOZA 2OBNA 1DC3A 4BO6A 4CM9D 1I32A 5I7EA 2GZ1A 4FCCA 3U4DA 4IDCA 3GVCA 4ZJUA 3EHEA 5T8KC 2J5KA 3CINA 4YAJA 5FEUA 4BIIA 2P4QA 4FB5A 1TI7A 3ANNA 4M86A 4E6PA 3F4LA 4R1SA 2EERA 2DBVO 2H9IA 1K3TA 4M54A 1HE2A 3ZW9A 2G5CA 2Y05A 2XF8A 2WE8A 5F5NA 2I99A 2A4KA 4WLNA 1A27A 1KBZA 2W2KB 1M76A 3KYBA 1H2HA 1P45A 4XDZA 2IEDA 4P4NA 4XB1A 3DDNA 3BZUA 4O1MA 1U8XX 4NU6A 3GQVA 4CQLA 3L6DA 1B3BA 3ULKA 5TGDA 3LSYA 2NU6A 3DEYX 4ZGWA 4ZA2A 2HMVA 1AXEA 1LC0A 1SMKA 3GC6A 3GRPA 3X2EA 1KEVA 5AYVA 4CUKA 2CDCA 3DO5A 2GERA 3DOOA 3GHYA 4XX0A 3G1TA 2CDAA 2VZ9A 3RBVA 4Q3BA 1LSOA 5JY6A 2NNLD 1D8AA 1YE3A 4IXWA 1PL8A 1UAGA 3RIHA 3JQ9C 4FDAA 3AM4A 3QLJA 1QRRA 3PVZA 3R0IA 3VVCA 3WNQA 2DBZA 3TFOA 2YZ7A 5KTKA 1PL7A 3LU1A 2VHYA 3PTZA 4Z6KA 2C2XA 4EBFA 3ZU3A 1VSVA 2YV1A 3IJPA 2O7QA 1GCUA 3PFWO 4LVCA 4DMMA 1NFQA 4CMBA 3NYWA 4Q3EA 1HLDA 3WX0A 3PJGA 4YJGA 3RVDA 4BNZA 4KTVE 3CH6A 1JW9B 4BNNA 2PA3A 4OXKA 1M2WA 2AW5A 1Z82A 4FW8A 4IZIA 5IN5A 4CMIA 5L95A 4BQPA 1LSJA 1EBUA 3RD5A 3QQPA 5A06A 1C0PA 1G0OA 2FPGA 3JYLA 1HKUA 3B20A 4BNGA 4ALLA 1PJLA 5HS6A 5T67A 1UH5A 1EE9A 1DOHA 5A4DA 2YJZA 2CSUA 4RV9A 2NSDA 2IRWA 3Q3CA 4DL9A 1BXKA 1ZVMA 2WWRA 4PG6A 2NV6A 1N9GA 5G0SA 4HBGA 2GDZA 3DOJA 3DL2A 1B2LA 1BVRA 3RWBA 4A5OA 1A72A 2BFMA 1R4NB 3N7UA 4IZHA 4FFPA 2XOXA 1HE5A 1HYGA 2DAPA 1X1TA 1V3VA 1YRLA 4R3NA 4S3MA 1BW9B 1JAYA 2HCTA 4MP8A 4NK5A 1N5DA 4R69A 4CV3A 4CPDA 3ZZNA 2DUUA 2ZJ1A 5B4VA 1GTMA 3PZRA 3ZWCA 1H6AA 2EJWA 3ZV6A 3LT2A 1XHLA 1AGNA 4BGVA 1DHRA 3WR5A 4HNHA 2X5KO 3HDHA 3OEWA 1KERA 2O48X 2VUSA 5EJ2A 1GCOA 4OHUA 3JSAA 4LISA 2NVUA 3QSGA 1A7KA 1KETA 4QXMA 3WG9A 4A0SA 4BB5A 4D3DA 3V5NA 5U1PA 2X9NA 2JHFA 4ZQFA 4IIVA 4NHEA 1UJMA 2QG4A 4JBIA 2O4UX 2ZCVA 3INTA 1NAHA 1RM3A 2ZTLA 4XKJA 1SEVA 3E5RA 3IS3A 4KQXA 4ITUA 1NQTA 3H9JA 1E3JA 4B4UA 3DR3A 1B3RA 1XKQA 1HDZA 3ROKA 2PFGA 3GPDG 5K0ZA 1M6WA 1MP0A 1QYWA 4EITA 2X0NA 2G76A 3BTVA 5AXBA 2CD9A 4AICA 1I2CA 3I23A 1NVGA 3ZH2A 5J23A 2HMUA 3S8MA 4U8GA 5B4TA 4RPLA 3AUAA 1GR0A 2Q45A 5L7TA 1U2GA 4CMCA 4BO5A 2OZPA 3M1AA 1K6IA 4CM3A 3ZGYA 1GD1O 1YDWA 3E82A 4M87A 4OYRA 3ONEA 1VI2A 1T4DA 3BMNA 4NQZA 3G3EA 4J2OA 4B79A 2Q49A 3DZFA 1DEHA 1YH3A 2C2YA 3HJAA 4GWGA 3H9UA 5CG1A 3TJRA 1DRVA 4FR5A 3U4CA 4D0SA 4YJFB 4CV0A 3VAZA 1HDGO 3LK7A 2AEJA 3PHLA 4CM1A 4E13A 1N2SA 1PEDA 3BHIA 1WNTA 1PJBA 4D0RA 2GCGA 1EK6A 2I76A 5L53A 4GWKA 1D7OA 2LDXA 5EPOA 2PD6A 1PL6A 2B4QA 3GPIA 4MOWA 1ZSYA 5ILGA 3PYLA 4NJMA 4W6ZA 2G0TA 3I9OA 3SC6A 1Y8RB 2B35A 2HK8A 3F1KA 4LK3A 4UEOA 4ZRNA 2B5WA 5B12A 1KVUA 1MG5A 2I65A 4J7XA 3RJ5A 3E9QA 3RI3A 4UVDA 3GVIA 2WEKA 3O8QB 3ROPA 4JGBA 3RUCA 4BMVA 5TS3A 1FK8A 2X86A 4LMPA 4O5OA 4TRRA 2VTEA 5DP1A 3ZWYA 3VPFA 1YBAA 4GH5A 3UHAA 5IZ4A 2JFHA 1OC2A 2C0CA 2EG9A 5JAIA 3OP4A 1Q2XA 3GN2A 1VC2A 4MVJP 3O4RA 2GNAA 4MVJM 4PLTA 3CPSA 3TNLA 1XU7A 4YT2A 2CMDA 2IEBA 4ND2A 3X2FA 3I4FA 3T4XA 4RDHA 3INRA 1RM4A 3IC5A 1PJCA 3GDGA 4TRMA 2GN8A 3UOGA 4DC0A 2V6BA 3F46A 3KVOA 4PVDA 5THKA 4AJJA 3JQ9A 4OH1A 3TQHA 2OBYA 2VWHA 3HZZA 1I33A 5FYDA 2JHGA 1E1LA 4M49A 1R0LA 2BD0A 1GZ4A 4MVJI 2J6IA 4Q9NA 1QV7A 3ROQA 2D4AA 1GL3A 5KJ1A 4R68A 3R6DA 3BA1A 4CM7A 4E31A 2YHIB 4RZIA 1HETA 4C4OA 1E1KA 5JO0A 5ICSA 1VPDA 2VRCD 4M8SA 5H83A 4D41A 1GZ3A 5A03A 2D59A 4XCVA 5A9SA 5BNFA 1T2FA 2I66A 5DCWA 1MV8A 3L77A 4XYBA 2GD1O 2HDHA 3TFQA 2G1UA 1ZSNA 3FPLA 2X5OA 2VT3A 4PZDA 4UAGA 2GUGA 4EZBA 5L9AA 3IIEA 1E3SA 1EE2A 4LRTB 1E7RA 3RUFA 2GLXA 3I52A 3C1TA 4DC1A 1U5CA 4RPKA 2J3IA 4N18A 1NP3A 1RPNA 3FR8A 2HMTA 3VDRA 4BNUA 2EEZA 5CP8A 3D7LA 3ZW8A 1IY8A 4E2ZA 3MWDB 4WGGA 3RC1A 3GZNA 4PLVA 4RF2A 1P1RA 5DT9A 5JAMA 5A3JA 1Q7GA 2OXIA 4FJ0A 4EEXA 2HK7A 4BNKA 2Y0CA 3ICPA 4UVIA 4BHTA 4XGKA 4TVOA 3HB4X 3PHJA 4DQVA 3MJCA 1JDJA 2O3TA 5JO9A 5ADHA 4AJLA 3ANLA 3JQFC 4E2YA 5T5QA 3ZV4A 1GEEA 1EFLA 2ZYGA 5FWNA 5I8WA 2OP1A 2E4AA 5G0TA 2C54A 1KVSA 1X14A 4KOAA 4XJSA 5DULA 3H2ZA 3LLVA 3STHA 2VQ3A 4DLAA 1KVQA 5JNLA 5ITWA 4QFCA 1WDLA 3O8QA 1YO6A 3K92A 3GOHA 3A06A 1DRWA 2PK3A 1LU9A 5CHEA 5KVSA 4GAEA 5KVCA 2ZTMA 4FFRA 1HTBA 4R9RA 1R4MB 4PLFA 4AJ1A 3OF2A 3ZWMA 4XIYA 1LQTA 2DM6A 3WGGA 3AUUA 2GZ3A 3JQFA 4UEKA 3GDFA 3E5MA 3QVSA 5GY7A 4WK6A 3VH2A 1KC3A 4PZEA 4EJMA 1UDBA 1A4UA 2FR1A 4NJMB 3WNVA 3I9JA 3ZNOA 3FR7A 4DREA 2EWMA 3EYWA 4WJZA 3TZQA 4DIFA 4EYEA 4DQUA 2RCYA 4I8XA 4PGFA 4TRJA 3OJEA 1PZEA 1JKJA 3H3JA 1QKIA 2X6TA 3FD8A 5G4KB 1X15A 1I3NA 1T2EA 3PLNA 4IUYA 4CLOB 4FGWA 4PZCA 3L07A 1DAOA 1N7GA 3ZU5A 1XEAA 1UP4A 4ZU3A 3SXPA 4FD3A 4IM7A 4IGFA 3WFJA 5TQVA 1MLDA 3VZPA 3GT0A 1XQ6A 5T57A 4XR9A 4P38A 5CEJA 2Z1MA 1U28A 3UCFA 2DBQA 1RM5A 1SOVA 5DNAA 1QR6A 1XG5A 2FOIA 3RFTA 3WGIA 3KOUA 1GYRA 1DBVO 1BTOA 3HN2A 4CJXA 4TRNA 2RIRA 3DB2A 4GMFA 4Z9YA 2B37A 4A03A 2O3UA 3DZGA 5K6AC 1U3UA 2OL4A 2CVZA 4I5FA 2NVWA 2WD8A 4W82A 2YQ4A 1ZXBA 3QVTA 2PD4A 4BS9A 2C5EA 4OL9A 3PIIA 3DBRA 1MGOA 4OOFA 1NWCA 2OO5A 4BO7A 1PGJA 3RROA 3D3WB 4HKTA 5DDIP 4J16A 3AOEA 1JLLA 1XU9A 4BNTA 4YQZA 4OKNA 3LF2A 2XAAA 4XQ9A 5IZCC 4K6FA 1ZK2A 4MVJA 3TRIA 3E18A 4BNJA 2NACA 4X54A 4RPJA 1XR3A 4F6CA 1UXGA 4DYVA 2D0IA 2FMUA 1L7EA 1E7YA 3KTDA 3WLFA 1BHSA 1A5ZA 1MFZA 2AE1A 2HLPA 4L4SA 4YBZA 5H82A 1SEPA 1O6ZA 2C82A 4IDDA 4IXTA 1PJ3A 2Y1GA 1FJHA 4N7RA 5CDUA 4YAGA 1KOLA 2AQHA 3B1FA 3QY9A 1Q0LA 3BMCA 3ZHYA 3LC7O 2JD1A 1BGVA 4GGOA 2RHRA 3PI7A 3PQEA 3UXYA 2V65A 2P5UA 1ISGA 4L4XA 4OAQA 5H81A 4RQTA 1NYTA 2GF2A 1F14A 1LDYA 5ES3A 4FIZA 4PCVA 3KSZO 1Q0HA 4BQRA 5TT1A 4CLOA 3D3WA 3NTRA 4FOSA 5HM8A 3WGYA 5L4SA 3GUYA 2HJSA 1LEHA 2B4RO 4XYLA 1WZIA 1ZXLA 2VN8A 5KVVA 2EXXA 3MOIA 1UUFA 4J49A 4WUVA 2UUPA 5FI3A 2D2IA 3T7CA 2IZ1A 3I1JA 3ZV5A 2VWPA 2IYOA 2PTGA 3GVPA 2X22A 4OJNA 3V2HA 2P9CA 3OQBA 2QW8A 5BSGA 4MIEA 1V9LA 2AQ8A 4NZ9A 3WSVA 2UV8A 3C7AA 1AN9A 4O63O 4F45A 1B7GO 3ANMA 3PGXA 4ZVVA 3H6KA 4INAA 4WEOA 4XEHA 3OFSA 3H9GA 3ZNQA 3OJFA 3UAGA 3WIDA 2ZJ0A 3W8FA 3SBOA 5DBIA 2I9PA 4YRDA 1BMDA 1LSUA 7ADHA 1VJ1A 4E33A 2A94A 1K0UA 4RVUA 4BGEA 2WD7A 3RC2A 3DBLB 5JC8A 3HDJA 2C29D 4YVFA 3H65A 3PYMA 2QIOA 4BVAA 2QYSA 3LT4A 3LC2O 1DC6A 3QE3A 2VYND 2WJPA 4LW8A 3AM5A 4MVJG 2QYTA 4PG5A 5HWSA 1TT5A 2GO1A 4FPXA 1AUPA 2GGSA 3GNTA 3Q1LA 5JCJA 4DPMA 3AK4A 2J3JA 2QRJA 4W9NC 3L6OO 4YTEA 2ZYDA 2E49A 1LDEA 2FZEA 4EGFA 5ER9A 3WDSA 2Q46A 3LT0A 3HFSA 4YB8A 4WNIA 2QQ5A 5F5LA 3GK3A 4XR4A 4YJHA 1QMGA 3JQAB 1OI7A 1CWUA 1PQUA 1P1KA 3PWZA 4II2A 1G0NA 2EGGA 4H16A 3I6QA 4C7JA 1H6DA 3QW2A 5JSFA 1I5RA 5JDCA 4FFMA 3JQAA 5EQDA 4B3IA 3S2GA 1T2AA 2X0IA 1VRWA 1CIVA 3OJOA 2X0JA 1ZCJA 1R0SA 4CLDA 1WW8A 3GN1A 1EUZA 1NQOA 4Y6RA 1IOLA 2VHXA 3FNHA 3JQGB 4HUJA 3ZU4A 4HFRA 3RQSA 1E7QA 2P9EA 4FGSA 2CNBA 3PFFA 1LX6A 3H2SA 4RLSA 1ADGA 3ETGA 4PG4A 1Y9EA 2GN4A 3ADPA 4DVJA 2ZTUA 2EJVA 3MEQA 2AXQA 1U8FO 4UVGA 5EIOA 4YACA 3QP9A 2EP7A 3JQBC 4IY1A 4M1QA 5F1KA 4MIOA 3A4VA 4DMLA 1U7HA 1PR9A 2NLOA 3WBBA 2YY7A 5EINA 1HE3A 3K96A 3PIDA 2FR8A 1ZK4A 2RBEA 2HKIA 4CMKA 4YPOA 3VPXA 4DBZA 5I9LA 4BO2A 1DRUA 2VWGA 2C7VA 4YQYA 1V35A 4UUPA 3W8EA 1GPJA 4BNHA 3LF1A 2VHWA 2Y99A 3NDRA 4P22A 4Q39A 3ZNNA 1JVSA 1UZNA 1YBVA 1WMAA 3MCVA 1EFKA 2GYYA 1F12A 3MTJA 4AJPA 1LRLA 5JMWA 1RKXA 3PJEA 2YUTA 4E2WA 3ZWAA 4PN3A 5JCXA 1X1EA 3KEQA 1B14A 1RWBA 3C7CB 3IP1A 4NNJA 4W99A 4YRBA 4J1NA 4A73A 3EW7A 5TIIA 2W2LD 3H5NA 4L75A 3TOXA 4ZHSA 8LDHA 1TEHA 4F3YA 1W0CA 1Y8QA 1LDBA 1SOWA 5HTOA 3V1UA 4D44A 4L9RA 3GF4A 1C0LA 4NJOA 3GDOA 3UCEA 5IF3A 4TZKA 3ONDA 3TZ6A 1JU9A 3I9MA 4R1UA 3EAGA 4BOYA 2VOEA 3F9IA 2X5JO 2V7PA 5G0WA 5THQA 5C7IO 3QIVA 3KEOA 5DBGA 1J5PA 3KBOA 4JP3A 1GDHA 2AEFA 1PS9A 1I30A 5AOVA 4IJUA 5TJ9A 1EDOA 4E2XA 1HE4A 1ADBA 1NFFA 3K30A 3PYXA 4RGBA 3KSUA 4TQGA 3HUDA 4DGSA 4TVBA 1UXHA 3KRTA 1WPQA 2CY0A 3BYZA 4Z9XA 4J9UE 4I9UA 1BDMA 1JA9A 1BVUA 2NQ8A 2O4CA 2Q1TA 4WLVA 4QUKA 4YJHB 1T24A 1I2ZA 1GY8A 3IP3A 4MDHA 1KS9A 1T4BA 2TMGA 1TA4A 3P2OA 4QSMA 4NIMA 4RVDA 3L4BA 1GQQA 3L6EA 4R5HA 4CMJA 5JAQA 3Q2KA 6LDHA 2ILTA 5BSFA 3GHHA 1PGPA 2R2GA 4NBUA 5A02A 3EVNA 5I7FA 1B8UA 1NQAO 1ZO8A 2UDPA 3MJSA 3WGZA 3WGHA 3LLSA 5AVOA 3ON5A 5I7SA 1GU7A 4E0BA 4W7HA 5C3MA 3GR6A 3DBVO 2JAPA 1T1SA 2GR9A 1KIFA 5B4UA 4ND3A 1LRKA 5ENVA 4FC7A 4AJKA 4IJWA 2Y1EA 4Z3KA 3WBFA 3U4HA 4GX2A 3FBTA 4AJ2A 1LC3A 3DWFA 4K28A 2D1YA 2YYYA 1BSVA 3AW9A 1SPXA 1AHIA 1I24A 4GKVA 5EL0A 3VPGA 7MDHA 4KZPA 4FQ8A 3MJEA 4ZRMA 1E7MA 2PV7A 4JP2A 2AQKA 2X58A 4QFDA 5KJFA 4TKLA 4D3FA 3JQGA 3PLRA 1MG0A 3WGQA 1UZMA 1X0XA 4WCFA 5C7LO 2VNAA 3MTGA 5GZ6A 3RBXA 4K1LA 3Q9NA 2VCYA 1PS0A 4CM4B 3PPIA 1YJ8A 2O7SA 3R3SA 1WMBA 4A2CA 3LQFA 3MJVA 4WLUA 2NM0A 4R51A 3RASA 2GSDA 1PZGA 1K2WA 3ZHXA 1KEWA 4E5YA 1FDWA 3JQ7A 4QQRA 2YDYA 3TL2A 3UCXA 3AWDA 3ZHZA 3LVFO 5F21A 5CDYA 1XIVA 1DIGA 2D5AA 1SCUA 3DBRB 4RCVA 3CZRA 1VKOA 2R6JA 3ITKA 3TF5A 1YJQA 2VYVD 3OM9A 2IXAA 1H94A 4H15A 4WCFC 3PWKA 3NUGA 1H9AA 2D8AA 4GLOA 1PJ2A 3AY6A 2J5QA 2OFPA 2YFQA 1GAEO 4DRYA 1BXGA 1JTVA 5EN4A 4BO8A 1HYHA 1NFRA 2BMAA 4AG3A 1M66A 1NPDA 5IDYA 2R00C 3OBBA 4GSKA 4B4VA 4B8WA 3OA2A 1B15A 1ADFA 2C07A 2JD2A 4IINA 3U62A 1Y81A 5BSHA 1HZZA 1X7HA 3QWBA 1J49A 1W73A 2D5CA 1EQUA 4FFNA 4GI2A 2Y0DA 4CLRA 3ZU2A 1Z7EA 5G4LA 3FSRA 2NTJA 2B69A 1E5LA 4I9NA 3LDHA 1WAMA 2B0JA 1D3AA 1HDOA 2I67A 3DMTC 1PIWA 2P9GA 2DTXA 4QTZA 1CETA 1YXMA 1MXHA 2GASA 1YL6A 5KCZA 4L74A 3EY4A 3NT4A 4J9VA 3AU9A 4BGUA 2BELA 1DIRA 3HG7A 5B37A 3JQEA 4E32A 4QO7A 2R00A 3RUIA 4DPKA 3IKVA 1BDBA 1DJQA 1JKIA 3JQDA 1OFGA 2HRZA 1LLUA 3P5SA 1ULSA 4ZQEA 1GYQA 3IUPA 4K6CA 1ZUD1 5G4KA 5BR7A 1PQPA 2VWQA 1GZ6A 1DSSG 1U4SA 4NBVA 4XYMA 2AG5A 5COQA 1H6BA 3DFUA 4MIYA 3P2YA 4OXYA 3V1YA 3GGPA 3GUCA 1O0SA 1P9LA 2Z95A 4A27A 2ZQYA 1W8DA 3HFGA 5TRTA 1XLTA 3KYDA 3W4JA 5IFLA 1P1JA 2DC1A 4R4JA 2O3SA 3GFBA 4J90A 2Y1DA 1B26A 1NPYA 4E30A 3GNSA 1GPDG 1P3DA 3UVEA 2GN6A 2DFVA 3C7DB 4RVGA 4OOEA 1ENOA 4TKMA 4MVJH 5CFZA 2Q1SA 4O6VA 1NTOA 1MC5A 1Y8RA 2O23A 3HSKA 3K8ZA 5JDIC 2UAGA 2FWMX 4CMGA 3V2GA 2DBRA 1E3WB 4XB2A 1P1FA 4CM8A 5CG2A 2VYVA 4ZICA 1DFGA 2JL1A 3FCOA 4MP3A 2O2YA 2QX7A 4IDFA 4Y6PA 3VTZA 5IXSA 4KUHA 4OQZA 1QORA 3O03A 3N58A 1KVTA 4MO2A 3EZYA 3VPHA 1LQUA 1K6XA 3M1LA 4IJKA 4Q3AA 3PHIA 1T1RA 3K31A 4DYDA 1LLCA 2NQTA 3QWAA 1DIAA 1DLIA 1P0FA 1P0CA 3DC2A 4YDRA 1TB4A 4QECA 1KC1A 4RVFA 4URFA 4ALJA 5JBIA 1OZAA 3KLPX 4MVJE 1M75A 4ND5A 5TX7A 4D79A 1Y9AA 4F6LA 4I1IA 3ZHBA 3TPCA 4D46A 3OJLA 2W8ZA 4LSMA 2V6FA 5A9SB 3BMQB 5CAEA 3DAGA 3L4BC 4BNVA 4YT4A 3IJRA 4FN4A 4GVLA 3A28A 4BNIA 2ET6A 2OUIA 3PJDA 3KXDA 3QJ5A 1NXQA 4IMPA 1IPEA 5L4LA 3HWRA 1ENPA 4R54A 2PWZA 3FWZA 3OECA 3D5QA 3B70A 5C5IA 4RL6A 4CLRB 4ID9A 3F4BA 3WQQA 3DBHA 1LLDA 4YA6A 5T64A 2DPGA 2YQ5A 2B5VA 4ALNA 5C7OO 1UXKA 3WJ7A 4J4HA 3VKUA 3RUDA 1X13A 1YDEA 3V8BA 5K9ZA 2P5YA 2C7GA 5HS4A 5JDIA 1O89A 1YB1A 4CQMB 1TT5B 2Q99A 5DOVA 2NVBA 5KVQA 4N5LA 3DOCA 4OKIA 1ORRA 5A9RA 5IN4A 4R16A 3VKVA 3ADOA 4CMAA 2OP0A 2PZKA 4E5PA 1N8KA 4CR7A 2A35A 3PEFA 1GQ2A 5JDCC 2NWQA 3ZCXA 2VZ0A 4RQUA 1C3VA 2Q1UA 3EUWA 6ADHA 4GSLA 3VZSA 3HQ4O 2FSVA 1EUDA 1U2DA 2PGDA 3P7MA 1OOEA 1WXDA 2BI7A 3PQFA 4RF5A 2AQIA 4AFNA 1P31A 3QWFA 4XRRA 1R15A 2C5AA 3T4EA 4DTIA 5GZ3A 3VH4A 1LXCA 3BTSA 3JD3A 4CM4A 3OSUA 4JJIA 3E03A 3I3OA 4Z0PA 1ZJYA 3RCBA 5IJZA 4RPGA 2DTDA 3PK0A 4C7KA 1ZEJA 1QSGA 3JD4A 1L7DA 3AUTA 1ISFA 1PQWA 3CTMA 4EW6A 2EKLA 1RYDA 2HSDA 3ETDA 3S2EA 1VL8A 2YHUA 4PRKA 4E5NA 4RVSA 3GMSA 1ADCA 5L7WA 1I8TA 3FTNA 4AJHA 3MWEB 3QA9A 3FNEA 2XXBA 3GZNB 5CDTA 4DUPA 1CQIA 4BGIA 4FJ1A 1U4OA 2PZLA 1IULA 1YL5A 1YOVA 1ENZA 1KY5A 4BO0A 1XSEA 4ILKA 1ZJZA 5I7VA 4R41A 2RHCA 4B3JA 2PH3A 2O3QA 3G0OA 4N5MA 1X0VA 3W6ZA 2Y1OA 1YQDA 1ZBQA 3ZN2A 4WOJA 2ZK7A 4GX1A 3RFXA 1JKFA 1EUCA 2Y1FA 4Z0TA 5LDHA 3WFIA 4TROA 3UGKA 3RUAA 3LC1O 5I9NA 5ENDA 2Y67A 4WCFB 4IIUA 2YV3A 1R4MA 5KOIA 4N54A 3C24A 1WZEA 1X7DA 3QV1A 2BKAA 1PZHA 1VE9A 2G17A 2DUWA 1NVMB 3WQRA 1NM5A 4I08A 1F8GA 5KJ6A 4UULA 2YDXA 1EBFA 3RU7A 3MZ0A 3WJAA 1NWHA 2JD0A 4PG8A 1W4ZA 4PLWA 4WLFA 5TJHA 1ISIA 4FFOA 5CEFA 2RH8A 1R4NA 2EKQA 2OOSA 4OQYA 4ROSA 5AXCA 3L0DA 2G82A 3S55A 4HP8A 2H6EA 3TN7A 1Z45A 3NTQA 3H8VA 2VOJA 2X7HA 3WYEA 3DAFA 1ULUA 1EZ4A 3OICA 4J1QA 4YWJA 4DIBA 3DAPA 3GNQA 3W4KA 1OAAA 2FHSA 4RJTA 3K2EA 3H9EO 1ZMTA 4FSHA 2PR2A 4EJ6A 4Q3DA 3IKTA 4NG5A 4CM6A 5ITVA 3D4NA 1PZFA 2VTDA 3KETA 4FS3A 1E1MA 2BRUA 4YAEA 4BNMA 5L51A 2CZCA 3H4VA 3WS7A 4YAIA 2J3KA 1DLJA 4MKXA 3B6ZA 2F1KA 4FBGA 1C0IA 2FR0A 1G6KA 4NU5A 2NU8A 3DQPA 4NH4A 3KLMX 2NVUB 3SEFA 3E9MA 2QZZA 4MINA 2GN9A 1P74A 1R0KA 3PGJA 4J3FA 2P4HX 2SCUA 4ONEA 1WP4A 3AI3A 1A71A 3NJ8A 4RVHA 1C1XB 1ZK3A 3U5TA 4KQWA 3FF4A 4LGVA 3KZVA 3O38A 4E5KA 5C37A 5TLSA 1MX3A 1O95A 2VNSA 3F1LA 3L9XA 4HFNA 4NBTA 3IMFA 5G0VA 1YVEI 1LDMA 4NFSA 2Q2QA 4GL4A 2ZQZA 3VC7A 3BHJA 4BMNA 1PS8A 3GLQA 4JN6B 3AM3A 4MP6A 1SB9A 1YQGA 5DP2A 1YOVB 2ZYAA 2EIHA 3EVTA 3QWHA 2NU7A 3OEYA 2ZATA 1S6YA 5A04A 1D4FA 3R3JA 1GFSA 1WDKA 3CSDA 3A14A 3VHRA 4LN1A 3ZWPA 3N74A 3UH1A 1KEPA 4L73A 4GGPA 2E82A 3CE6A 1SC6A 2DT5A 1ISHA 1U7TA 3PHGA 1ZKMA 3A9WA 3C1OA 1Y7TA 1QYDA 3C8MA 3VH3A 1SBYA 1H0KA 1F17A 2J3HA 1FDUA 5LCXA 3E6AA 4CODB 3OJ0A 3DBLA 1CERA 5JW6A 1QYVA 1UR5A 4JLWA 1ENYA 2ZIZA 3K5PA 3QHAA 4A7PA 3Q6IA 2X23A 4ALIA 4CV2A 2D3TA 2H63A 1WLYA 3CIFA 4K9DA 3WICA 4N5NA 2Y0EA 3D1LA 4BKUA 3JQCA 3U3XA 1IZ9A 5L45A 1PWZA 2POQX 4WLOA 3ZDFA 1O5IA 3DZBA 2X8LA 3OIDA 3INGA 4JCOA 1C1DB 3F5SA 2P91A 2VUTA 3SLGA 4HFMA 1LDGA 3VH1A 1NR7A 2CFCA 3ONFA 4HFJA 3E9NA 2P68A 4BO1A 4HADA 5MDHA 1DIBA 4XGNA 1QLHA 4WASA 3G1UA 5KKAA 4BO4A 4D7AA 1PSDA 4PLGA 4R5MA 1U3VA 4D43A 1EK5A 1NAIA 3DZJA 3OIGA 3WGOA 2IZ0A 4B7UA 1QXSA 4EUFA 3SJUA 2V6GA 1E0DA 3GGOA 1B8VA 4YT8A 3D0OA 3QVXA 3D5TA 4R01A 2O3JA 4YJGB 1DJNA 1LBEA 4EDFA 1Z74A 4HXYA 2Z5LA 3JD1A 3RFVA 4AJNA 1E3WA 2VRCA 4Y9DA 3AU8A 1LUAA 1FF9A 1ZFNA 4TMFA 5KJEA 3D4OA 4UEJA 3M6IA 1IB6A 2CF6A 3ST7A 2BGLA 1PGNA 3FWNA 4Z0HO 4EJ0A 3FI9A 3KYCB 3L9WA 1B8PA 2OGUA 4LMRA 2PZMA 8ADHA 1MUUA 3NGLA 2YHIA 4OMUA 5DCYA 3RSHA 2Q1WA 4JK3A 4NFHA 1I10A 2OMEA 3HB5X 5DOZA 4R1NA 4JROA 4RF4A 1HYEA 4BV9A 4GMGA 4E21A 4Y67A 4CLEA 2Q2VA 1H93A 2DVMA 3QRWA 4CLHA 1U1IA 1GV1A 1HDXA 3E48A 2ZB8A 3WYCA 4ND1A 4YCAA 3AUSA 4RF3A 3G17A 5JFOA 2BGMA 2BHLA 2BFAA 3Q11A 3BMNB 4IDAA 2WE7A 3CKYA 3CMMA 1IE3A 1B0AA 4FJ2A 5JXWA 3MJTA 1WWKA 2X0RA 4P4GA 2XPCA 3PDUA 1OC4A 2HMWA 4IQGA 5EESA 4BNLA 3C1AA 1DO8A 5LC1A 3IL2A 1E7SA 3ICCA 3SC4A 1Z73A 3WMXA 5CDSA 1UZLA 1XWFA 3A1NA 4IPTA 3GFGA 3ENKA 4PLYA 4PRLA 2WTBA 3W1VA 1PX0A 2PY6A 4TSKA 1A4IA 1UP7A 2FPPA 4BKQA 1I2BA 3JQ8B 4J2HA 3U0BA 3ZWWA 1VLLA 1VM6A 3NDJA 3P19A 4UVHA 4W4TA 3WTBA 4CM8B 4DBVO 4BB6A 5JPIA 3KHUA 3C3XA 2ZB7A 3EGOA 4A10A 1UAYA 2JKVA 1DFIA 1EVYA 1NHWA 5U9CA 4GPD1 1O9BA 4RLHA 4J7UA 3WWZA 4CL8A 1U3WA 3MOGA 1ID1A 1PWXA 2HJRA 3RUHA 3NAQA 5DCUA 3D64A 4WKGA 2UUOA 5LDGA 4KDFA 5TT0A 4CQMA 2BI8A 4XRGA 3OIFA 3GH3A 3JQ6A 3WYBA 4CM5A 5I9MA 1ZEMA 3VPSA 2BF7A 3WB9A 2PD3A 1I01A 4PVCA 2Z1NA 4MKZA 4Y98A 1C1DA 3RC9A 5GMOA 1NVTA 3OQ6A 5BNIA 3HDYA 4XQGA 5IXYA 1U5AA 4CMIB 2HMSA 1HSOA 1ONNA 1B16A 1R16A 1SO8A 2B4TO 1DFHA 2HU2A 2AE2A 2CUKA 2NADA 5AXDA 3UFXA 4AJEA 1IZ0A 3WLEA 1LI4A 4XYGA 3K73O 2HO5A 3LYLA 4CR6A 4J91A 2I3GA 3JQ8A 4G65A 3DZKA 2ZCUA 3Q2IA 1IUKA 4NMHA 4EEZA 3NX4A 3BMOB 1QG6A 1XQ1A 5IZCA 1DAPA 1XCBA 3R1IA 4HX5A 1T25A 1N9GB 1TXGA 3KYCA 3COSA 1HEUA 3WGTA 1UXJA 1CEQA 4CV1A 3QVWA 3IOYA 3UKOA 2PKQO 4PLHA 4LCEA 4GKBA 5A5FA 1FDSA 2ZKLA 4I5EA 4UUNA 3VOSA 1ML3A 1RJWA 4IS2A 4KUGA 3KB6A 5FI5A 3RKRA 3V1TC 4P4LA 4AVYA 1UP6A 3BHMA 2RAFA 3PZBA 3I6IA 4J7CA 2BH9A 2VHVA 3ZWXA 1E77A 2JFFA 5JMPA 1KEUA 3BMQA 3I4CA 1HDRA 1PJQA 4U5QA 2H1SA 5COAA 3I5MA 4PG7A 1QLJA 5MGBA 2PLAA 3B1JA 1H6CA 3GVXA 3E8XA 3PQDA 2VT2A 4M89A 1PJ4A 1LTHR 1PU2A 3WWYA 4UREA 5KWEA 1K6JA 4IBOA 5TSDA 5A3VA 1HWYA 3U4IA 4II3A 5HRUA 1DPGA 3DXFA 1QP8A 3CZMA 3NRCA 1EVZA 4WE3A 3BMCB 3TL3A 1YS4A 5HA5A 3BMOA 3NV9A 2FP4A 1JQBA 4XJTA 3TWOA 4JQCA 1RYEA 2YFHA 3NT5A 2CDBA 3BIOA 3RUEA 5K6AA 3LZ6A 1P33A 4UVEA 1PGQA 1U9JA 1P1IA 1V0JA 2WYWA 1NBOA 3RU9A 3DZHA 3F6YA 3K6JA 4WEQA 5CPFA 3O26A 9LDTA 2EW2A 1NR1A 4CR8A 4E3ZA 2PZJA 4RPHA 2LDBA 5I8ZA 2Y93A 2YW9A 5CDGA 5T6BA 3FRJA 2WYUA 3JYPA 4BKOA 2FY8A 5B1YA 1JAXA 3M2TA 4B4OA 1GEGA 4BNYA 3GGGA 3I9LA 1LA2A 2JCVA 5G2OA 5IDQA 3GG2A 3CXRA 2EW8A 2DLDA 1LDNA 1AE1A 2HK9A 3BTUA 3AJRA 2EKPA 4RO0A 2DPHA 4J43A 4QX6A 2CVQA 4Y8VA 1D1TA 1NX6A 3FNFA 3I83A 5ICMA 4AJ4A 4GX5A 1QYCA 4WOKA 3FHLA 1Q0QA 3DHEA 4I5DA 1J0XO 1HZJA 1XDWA 4XQEA 4Z3DA 5JLAA 3GEMA 2A92A 1CRWG 2VRBA 1QV6A 3PJFA 1N92A 4KP7A 4NDNE 1T26A 1IYZA 3KUXA 4BV8A 2A9FA 4DA9A 3S2FA 1OMOA 4PLPA 4E12A 5L40A 2W2KA 1Q7CA 1E7WA 2X4GA 4RORA 3FBGA 2O3RA 5IDWA 4E5MA 2VYNA 4JBGA 3UF0A 1C1XA 3CEAA 4BMSA 1SAYA 3NTOA 4L8VA 1V3UA 1NQ5A 2RH4A 4IS3A 3NDIA 2YV2A 3PXXA 2PGJA 4JJFA 4AJIA 4KTTE 4B8ZA 1V3TA 1W6UA 3IUSA 2EHDA 4J4BA 4CUJA 2EGHA 4WPGA 1F0YA 5TF4A 3JQBA 4J1SA 4B4WA 1DC5A 1KYQA 1A7AA 3CUKA 1I36A 1FXSA 4CUZA 3G49A 2NTVA 3KM0A 4NR0A 3VZRA 2BFOA 3EZLA 3Q0EA 3AOGA 4J0FA 3WMWA 4OSOA 4ALMA 1H9BA 1ARZA 1NASA 5FF9A 1Y1PA 3WQSB 3AI2A 3DFZA 3AI1A 3DHYA 3JQAD 3PRJA 2UVDA 3UUWA 4L0QA 2NU9A 1PJTA 4WECA 3K2BA 1T2CA 1K5HA 1P44A 5EMHA 5AXAA 2O2SA 3DTYA 1N1GA 3ZWOA 4OXNA 3DMTA 3ZWVA 3GY0A 4O59O 1YB4A 1I3KA 1ZZEA 3SLKA 4J1TA 3ETEA 2V6MA 4J0EA 1LLQA 2DKNA 4MKRA 3QWIA 3RJ9A 4BNWA 2HRBA 1E1NA 4NBRA 4MVJD 3JYOA 1Y8QB 2W90A 5A5EA 1DC4A 3ENNA 1ZH8A 5KJCA 3DONA 4DWVA 4U6SA 3U9LA 2HQ1A 1ZNQO 1M67A 3ORFA 5L7YA 3SJ7A 3OH8A 4XYEA 3GEGA 2E48A 2ZB4A 2IZZA 1E3IA 3WXBA 4F46A 5BQFA 1F06A 5COBA 4AL4A 2X9VA 1R12A 1PR3A 5IDXA 3DZIA 1KY4A 3HDQA 2JFGA 4IQ8A 3B1KA 5TC4A 2GPTA 3KO8A 3NJ4A 3ZWBA 3H5RA 2FN7A 4GQAA 1BXGB 1N1EA 2BLLA 2FRDA 4HNGA 4YJDA 1HDYA 1YQXA 2Y1CA 3W8DA 3AY3A 2AMFA 1YGYA 4B3HA 5L4NA 1D1SA 1X7GA 3PHHA 3AFMA 3AFNA 1A9ZA 2QRLA 3NT2A 3UW3A 4YJFA 3V2UA 1Z7BA 2OORA 3GVHA 4DPLA 3AOEC 3ZV3A 4BUCA 2WD7B 1ONOA 5DBFA 1QYXA 1O94A 1S7CA 4FFLA 4BKPA 2FZWA 1E6EA 3F5QA 4GLLA 1V6AA 2H5LA 5U4QA 3JTMA 4DIOA 1G1AA 5JY1A 3TZHA 1VJTA 4YR9A 5BNTA 4J6FA 4JIGA 4W9NA 2IE0A 3OETA 1A9YA 4BNXA 3FPCA 1YWGO 1AXGA 4QEDA 3O9ZA 5L3ZA 3M2PA 1LRJA 1EVIA 1XYGA 4H7PA 1DXYA 1DHTA 1E6WA 1MB4A 4BL5A 4XD2A 3W6UA 4RDIA 3CMCO 3NKLA 1GUFA 1I3LA 2Q50A 3RKUA 1N7HA 2VHZA 4HV4A 4ZQHA 1U3TA 3HE3A 1T2DA 4JBHA 4YAKA 4GX0A 1HSZA 4W7IA 4D3SA 2Q4BA 3L4SO 3W4IA 5A1TA 2AA3A 5F3RA 4CL3A 1ISMA 4DLLA 1FMCA 4FC6A 4Q3NA 2DU8A 4KWHA 2IXBA 4ND4A 5JAZA 1ONPA 3WSWA 1Z75A 2E6UX 4YXFA 1EEHA 3GEDA 1CYDA 1BG6A 1R37A 1YL7A 3BTOA 4IQ0A 2EF1A 3TDKA 1R66A 1XGKA 4XZ3A 3H5AA 1VL6A 2TMDA 3WTCA 1E5QA 2UYYA 4GBJA 2B83A 5AQ1A 5KIAA 2AG8A 5F1PA 1LSSA 3OHSX 3RAJA 1VL0A 2Y68A 4A26A 2F00A 3NGXA 4JXKA 3FNGA 1F8FA 4U0KA 1R6DA 1DIHA 3DHNA 4OIMA 2O50A 2IODA 4HY3A 3ASUA 2HAEA 3OA0A 4G5HA 4LVUA 3S1LA 4B7XA 4E4YA 5IAAA 1HLPA 3GMDA 1WDMA 4L4RA 2JJYA 2W4QA 1JWBB 2NTNA 4QO8A 2QRKA 4EUEA 1EVJA 4YEDA 4DLBA 3OMLA 4DXHA 3GRKA 4S1VA 2C59A 2EV9A 4DQXA 1ZSVA 4CMEC 5JYDA 3EDMA 1CJCA 1H5QA 4O0LA 3SVTA 2WYVA 2WSBA 1LNQA 4B7CA 1ISJA 3AY7A 3IDSA 4OM8A 4D45A 1E3EA 1E3LA 1UXIA 4L76A 3G79A 2AEMA 3EC7A 4CQMD 3JD0A 1Y5RA 4GVXA 2PH5A 4WNCA 3DMYA 2CF5A 4MJLA 3D4PA 1FDTA 1JWAB 2J5RA 4RZHA 1HXHA 4CM9A 9LDBA 2ZTVA 4I5GA 3ROMA 4CQLB 3HHPA 3H7AA 4XIJA 4I9HA 4PFJA 4PIVA 4KWIA 1ZK0A 4R3WA 3JV7A 3PP8A 1YONA 3I9KA 4OSPA 3ASVA 2X9GA 5FFFA 5EQFA 4Y6SA 1VKNA 4ZD6A 4QT0A 2QHXA 1NNUA 2J8ZA 2VUUA 1GUYA 4KUEA 4YRAA 1Y5MA 1CF2O 1HRDA 1CQJA 1GYPA 5ILOA 3H3FA 4MVJF 3F3SA 1NHGA 3PDJA 1YB5A 3U49A 1YBMA 3JCZA 5EERA 1IHYA 4YT5A 3DTTA 2PKRA 1Q7BA 4ZQGA 4Q3CA 2ZB3A 1MC4A 1H2BA 1RM0A 3KSDO 4U7WA 1JVBA 1HT0A 3HN7A 1HL3A 2I6TA 3RC7A 1XELA 4HWKA 1GQYA 1ZW1A 1I0ZA 2P2SA 4ZQBA 1PTJA 1ZMOA 1NPTO 2BGKA 2GZ2A 4U6QA 5A05A 4BNFA 4ESOA 5CEEA 1GADO 5TNXA 4NK4A 4U0JA 1BWSA 1IHXA 3FN4A 4XDYA 1VSUA 1Y6JA 2FPIA 5JCJD 4IDGA 3GZ4A 2I3AA 4CLXA 3GAFA 1MXFA 5CPBA 3VDQA 3DBHB 4TZTA 4XGIA 4BKRA 4JNKA 1I3MA 4IDBA 4WCDA 1M6HA 3JQ7B 3QVOA 2W98A 2WMDA 1EQ2A 2Q3EA 2DQ4A 5G0UA 2CVOA 1BW9A 3KV3O 5ER6A 5IG2A 1EDZA 5DN9A 4JJGA 5HBRA 2DFDA 4OGWA 3ZWNA 4P8RA 1UDAA 2WM3A 2IYPA 2QZ9A 4WLEA 4UUOA 2PGLA 3GAZA 1DB3A 1IPFA 3ZI0A 3SX2A 4IGEA 3LT1A 5BT9A 3F47A 1KVRA 3TZCA 3E1KA 1V8BA 2VZ8A 1JN0A
chains in the Genus database with same CATH superfamily
1TYZA 1C8LA 2EP5A 1JDSA 1L7BA 2GM5A 2GRAA 2XR1A 3JY6A 3LI2A 3MJ4A 3PR3A 1GKLA 4MPDA 1FU7A 3SZLA 3CEMA 5KC8A 1XA0A 3JWHA 3NZEA 3E1SA 5JS6A 4M99A 2ZIVB 2DTEA 5DGTA 1RADA 2QM8A 3QMPA 1XBTA 1ZI9A 4L5BA 4P7JA 4EB6A 1BRMA 1VG1A 5DM0A 1L9XA 1Z0DA 3BREA 1UDCA 1KR2A 2Z8YA 3AUXA 3IR6A 4WV3A 3RIEA 3U3KA 1UK7A 3OAAD 1XNQB 2XNJA 4D8YA 1E2BA 1X8LA 2FN4A 5B53A 3EMKA 3IAAA 1DDOA 3PD7A 3UN1A 2XUIA 3ZNPA 3HGMA 1CF4A 4NPCA 2G8NA 5IJ0A 3I9NA 4NAVA 1SBIA 1YK0A 2ON6A 2DEUA 2JCXA 4NI5A 2CLCX 1U1GA 1TDJA 4KDEA 4N76A 4JLSA 1ZNWA 4G63A 3U7FB 1A2OA 3X0DA 4DV7B 3ZJVA 2REOA 3HU5A 4XFJA 16PKA 4XQCA 2W2LA 5GQSA 5LD2B 2I7TA 4KMSA 5EVJA 4B2IA 3FRHA 2VVTA 1CSEE 1ABEA 1FPQA 3DVAB 4TPKA 4RKFA 4JX8A 4H0FA 2VYCA 1LNZA 3D4IA 5KZMB 4LWPA 1E1YA 3ROEA 1I2DA 4YONB 2J30A 5BT8A 3BFJA 1GV0A 3E4DA 3TB4A 1L5HB 2I6UA 2AYXA 4G2NA 4IDHA 4CEJA 3OQ1A 1TVEA 2GK3A 2JGIA 1DRJA 3GJRA 3O8DA 4UMVA 3BZWA 3C43A 2AMVA 3HYRA 3I1IA 4QELA 5JYEA 3GGCA 4QXOA 1FP2A 4S04A 5KKCA 1ZJWA 1FDVA 1Z22A 3PWTA 4UQOA 5BSEA 1XQVA 2RB5A 1R74A 1QGED 4R9SA 5PGMA 1BCRA 3QLTA 2CD7A 2BFPA 4FFBB 5E2BA 2FKAA 3BJEA 3DFFA 1NJ1A 2AX4A 4TTAA 4BJ5A 2AKYA 5TF0A 1W88A 1YR2A 2XQJA 4ECEA 3KSRA 2G0AA 4G0OA 1OXTA 3JYQA 4IIEA 4LEIA 3D3QA 3FCSB 4ZU1X 4LA4A 2C94A 2C3UA 2OLJA 3UJCA 3AR8A 3GLFB 2WVAA 3K2IA 1JHYA 2H18A 2YZKA 2WJ6A 2J3QA 3MB5A 4YRLA 4H7EA 1ZJ5A 5LZ5A 4OK6A 1GXSA 4UASA 4DJDC 2IKQA 4BEBA 1JU3A 4XW2A 1RQRA 4F97A 3IODA 4LK2A 1BN7A 1SZJG 3O4FA 2OYCA 2CCGA 2IEIA 3NFRA 2D4HA 2HCJB 4Q3LA 1TW2A 1ZCZA 2ZAMA 1EGMB 4A0HA 3BH6A 4B81A 3HCWA 4PLCA 4BB9A 5E3HA 1IXYA 4N48A 1WSBA 5KYUA 3C6MA 1I32A 2DG2A 4ARBA 1BMFD 3FLAA 2BJWA 4FCCA 4E5VA 1J07A 4DZTA 1HC7A 2PSJA 1NJ5A 5KHLB 1KO8A 2CLMB 1MJGM 2FPXA 3CINA 3BRWD 3QLVA 1AKQA 4IV5A 4NYMR 3OEEA 3T8YA 3EULA 5UKDA 4Y9TA 2HLHA 4M86A 1EXDA 3AKYA 1OBCA 4GM0A 4TXLA 2EERA 1MQSA 4M9ZA 4WINA 2B2XA 5JG7A 4DE5A 3K9BA 4EKGA 2WA2A 1KQNA 2C4TA 1EH5A 4WWHA 3NHRA 1PK7A 2LGJA 3D8BA 2WE8A 2AJLI 4O4IF 4OJQA 5F76A 4YPVA 3NTUA 4LQ4A 4WLNA 1VCOA 1FIUA 1ZDMA 1KBZA 1SCDA 2AR9A 4QBKA 3KYBA 4NOLA 4E46A 3TTUA 4P4NA 3SDBA 4BQFA 3BXHA 3DE0X 1U0BB 1XDGA 4YUWA 1GILA 3GQVA 2ZOSA 1QHGA 3MG9A 3PX3A 4CQLA 1FRVA 2BCEA 3R9KA 4Q34A 3DEYX 2FX2A 3KCQA 2O07A 3T12A 3G2MA 3Q8LA 2J4DA 3GRPA 4LWQA 1RTTA 3LUPA 4YJ3A 2CDCA 4CUKA 3DOOA 3P9SA 3G1TA 5ECWA 3B53X 4P35A 3M82A 1NVXQ 1UJNA 1H8EA 4WZAE 3GQBA 3KVYA 2XV1A 2FZGA 1RC0A 3V8VA 4B9AA 4EKYA 4RENA 3OTOB 4MTCA 1UAGA 3JQ9C 1KDVA 2XTMA 2GZSA 3AM4A 1YZLA 2QORA 3DZCA 1N5LA 3PVZA 3R0IA 2DBZA 3WNQA 3TFOA 4MR9B 4PWYA 3GLHE 3O92A 3D8TA 4LFCB 4DR3B 3E05A 3C39A 4G0QA 2PJDA 3LU1A 1L9KA 2VHYA 3EGXB 3PTZA 3GCZA 4RHYA 1S2GA 2C2XA 1F2UA 5JRJA 5JJ5A 1C4KA 4P92A 2O7QA 1QIMA 2R1VB 4G84A 4LXQA 3D6FA 2OCLA 3GW8A 3S2ZA 2GNOA 3JARB 3NYWA 1AK2A 3O2JA 3BS4A 4NDZA 2G4CA 3OOHA 4A0GA 4KPUA 4YJGA 4KN9S 4CDRA 3FCUB 2RK6A 2PA3A 3LQ2A 3FBWA 4NMXB 1QF6A 4X20B 1JYFA 3MYRA 1RC8A 4C4SA 5L95A 1CJUC 2BISA 4WZZA 1OUMA 1PFGA 2W6JA 2YJ5A 4JL6A 3RTBA 1JH8A 3LRXA 4UU0A 5A06A 3MWEA 4FDTA 4MZXA 3B20A 3EG9A 3CLSC 2G08A 1Z07A 1UDWA 5HS6A 1EE9A 1DOHA 3BD9A 2ODPA 4EMSA 2VDLB 4RKRA 3OPYB 1LS1A 3G8BA 4RV9A 4PQEA 5E7QA 2G4LA 3Q3CA 5HZHA 1IEVA 4EHHA 4ZJZA 1ZVMA 1XTIA 4C0LA 2DH6A 4DLXA 4XWTA 4YRFA 4TS9A 3ND5A 1B2LA 1R0WA 2EJCA 3LW7A 4IHKA 4IUCS 4A5OA 1NI5A 2OV1A 1Y8ZA 4IZHA 1V5WA 2OECA 1P62B 1U3GA 4FFPA 3QUTA 3RANA 1GVHA 4A36A 1JAYA 2IELA 2PU7A 3DH0A 1A4RA 1CUHA 1T4GA 4R69A 4LMBA 5E0KB 4CQJA 4CPDA 3JVDA 1XWWA 4DCTA 4ZIRA 1K8RA 2IU6A 3GCWA 3PZRA 3ZWCA 1H6AA 3AFIA 1RPTA 5U4XA 2DH5A 3LT2A 5I4IA 1D5CA 1AGNA 1VE6A 1OGIA 4XFKA 5BSUA 3OEWA 4UBLA 1QZ3A 2O48X 1TQ8A 3TDMA 3WMEA 5E7IA 2V5AA 1XMIA 3T7JA 2CE7A 1PT7A 2FEPA 4PO8A 1UL1X 3R74A 1Z4IA 2WB2A 4IDQA 4OHUA 4YXWD 3EDYA 2VPZA 4RVOA 1UK9A 1UMCA 2NVUA 2PXHA 3ESCA 4G8BA 3FSGA 4XCXA 4BMOB 1GQRA 2VT7A 3M5CA 4H59A 3X44A 1YR6A 5JWOA 3KK0A 4YDQA 2X9NA 1HQCA 4HEQA 2JHFA 5HK9A 3PT9A 4ZQFA 4MQFB 3K0AB 2IS2A 1OFUA 1HBJA 2O4UX 3T3EA 3GD5A 1OYWA 4MW9A 1NAHA 2EWVA 5BYBA 2ZTLA 1SEVA 1N6RA 3AP3A 1KDOA 2M98A 3ELBA 1P80A 2VO1A 1JQ5A 1FNCA 4ITUA 4ZT2A 1PVDA 1B3RA 1Y1RA 1YVDA 2B3DA 4HNTA 3H5TA 3R23A 4DYHA 3SSMA 3VPBA 5I51A 1KMNA 1P60A 3GPDG 2H07A 2Q9CA 4V0NA 5GAJA 3O6VA 1KMCA 1IWPB 1T0HB 1BEEA 2I29A 3ZBUA 4EITA 1RQLA 3LD9A 3GBSA 2GXQA 3BTVA 3Q5GA 3PCTA 3LGAA 1QF7A 3OTGA 4WNAA 4PTZA 3BULA 4UBIA 3BBLA 4FDVA 3BK2A 2QUKA 3CH4B 3AUAA 1ADYA 3C8ZA 4H60A 4I1UA 2C58A 4CMCA 4BO5A 3T7KA 1EK0A 1EWYA 2RG1A 1OTYA 3N53A 1JBKA 3CVVA 3MTQA 4IIJF 1E66A 3WLIA 1E3QA 3ECAA 4M6WA 1UFVA 3VYRB 1M2VB 3ZXXA 3M6LA 2IZ5A 3GJ0A 4NQZA 3ZJYA 421PA 3G3EA 4J2OA 2ZI5A 2Q49A 3CPHA 1ZGJA 1MENA 5CA1A 1CR4A 2JH8A 2JLCA 2CFTA 5CG1A 1Z4JA 2MSNA 2P4SA 4GLBA 2V98A 4LC9A 2E5LB 3PTAA 1XTUA 4E13A 4M0KA 1N2SA 1PEDA 1WNTA 3GJQA 3BB4A 1HX7A 3OFVA 1EK6A 3WRXA 5IKMA 5HMMA 1ZVVA 1TZMA 5LZ7A 1D7OA 2LDXA 4DQ0A 1PL6A 3IJ5A 2F8MA 3HVJA 1ZSYA 4GDMA 4TKZA 5P8WA 3PYLA 3G02A 5JQGB 1Z28A 3ILSA 4RA9B 3I9OA 2C7RA 1DV1A 2B35A 3CVOA 4KRYA 4LK3A 3P2MA 2VXCA 1CE8B 3FLEA 2EFCB 1Y8AA 3E8SA 2V7QD 4GOXA 2E5FA 1Z2OX 2FSGA 3BWEA 2QTRA 2VJLA 3IIIA 4QOSA 1IN1A 2CWWA 4NABA 4J7XA 3E9QA 4AX4A 1Z0IA 2ZEJA 4Q9JA 1DBRA 2ST1A 1SVWA 1Z4MA 3ROPA 1ICIA 3RUCA 3UXHA 4OH7A 5FKJA 4LMPA 4O5OA 4YJ2F 1KR5A 3IQFA 2VTEA 2FMXA 5DP1A 4AUEA 5EZQA 1JPVA 4ZZIA 1YBAA 5ADWA 4R8MA 3DMHA 2BV3A 1UJCA 5FUMA 1PFWA 3H2GA 4HHEA 4L28A 3ZZMA 4MVJM 3WJ2A 2V4UA 4CU2A 2KHZA 3PE4A 2CMDA 3I6ZA 1MCZA 3SBXA 3QJYA 2H06A 1GGMA 4ND2A 4G26A 1IWBB 4Y1FA 1GTJ1 3UHJA 1YZGA 3TW8A 1G2QA 3V32A 4FFSA 1H8HA 4RDHA 5CCXA 4O4LA 3GDGA 3T38A 2CMFA 1SKUA 3MXOA 1QVRA 4KRFA 2JDIA 1M2HA 4CEHB 3CFYA 3RR2A 1FRFS 5E4FA 2PXXA 2QROA 1CRZA 1YZ3A 2PZ8A 1TX4B 3OZRA 5MHTA 2I7DA 2JK1A 5FPQA 2A0UA 2L42A 4AJJA 4AKHA 4S1OA 3QKIA 2CGEA 3PGMA 2VNHA 2D74A 1T4MA 1FUUA 1W96A 1V8FA 3I9V1 3KKKA 4DV6B 3KUUA 3L7IA 1JFFB 1K9VF 2PX4A 3H13A 3LFUA 1R0LA 2V45A 1SBNE 2WF6A 1HG0A 1L8AA 3KWLA 1ZIXA 2QMQA 4MVJI 5J5VA 1QV7A 2QM7A 3ROQA 4X90A 4ZEOA 4F91B 4P3OA 2RHLA 3EWSA 1Y9ZA 2YHBA 3D8UA 2LCQA 3EDCA 3WDMA 4CM7A 4DUGD 2XGSA 2R8ZA 3K16A 4RZIA 3D3KA 4FYVA 1P8AA 1RHQA 2IHTA 1Z34A 3D3JA 4FGLA 4M8SA 1GZ3A 4QSHA 4C06A 3L0ZA 5BR8B 4RK7A 3AB7A 5A9SA 2JLYA 1NI3A 1VJRA 2QF7A 4CDMA 2R6DA 1T2FA 3IQZA 4JI3B 2GJ8A 2JH3A 1VIDA 4JFRA 2GD1O 2HDHA 3TLBA 3F74A 1IDOA 3X1XA 1YQ9A 1HFEL 4UAGA 1S1CA 2GEFA 1XCGB 1K2VN 5CR9A 3LQRA 3P9XA 3GJ7A 1KH2A 3OX2A 4MI6A 2XYRA 1EUDB 5BWNA 4Q48A 5CGQB 4JI1B 1LTQA 2MOKA 4J0HA 1E2NA 3H0CA 3DLAA 4RPKA 1Z5OA 1X3LA 1YUBA 2J3IA 1HDIA 4N18A 1NP3A 1RPNA 4RK6A 3VDRA 2EKZA 2OXCA 3LBFA 3HGTA 2IU0A 2QY9A 3OPVA 3PICA 2BFFA 5JISA 2P9TA 3LUDA 5CNJA 4NZMA 1ZRSA 2VS1A 3AUJB 3MWDB 4E2ZA 2I78A 4GEGA 1ZM2A 3JTEA 5CA1B 4OVKA 2I55A 3QFFA 1DDGA 4RF2A 1UT5A 3S1AB 5JJKA 1C4OA 4M1WA 2CLSA 2XE7A 4EEXA 2OAQ1 2QLLA 3NVAA 4BKMA 4E4RA 1YFKA 2FCRA 3TNFA 3H1FA 4XGKA 2RGAA 1YI8A 3FGNA 4BDSA 3HB4X 4L4ZA 3AY0A 4WBNF 2AOVA 1JHZA 1OB5A 1TM3E 4OGKA 4GKKB 1QQTA 1JDJA 1SIWA 2O3TA 5DPMA 1VDZA 1KJIA 5JO9A 2FWAA 3ANLA 4C6TB 4PYNA 2OV8A 1EFLA 5DM4A 3OZEA 4OATA 1L5WA 1N57A 2YVUA 2Q9UA 1CS0A 3STUA 3A32A 4U7GA 4XJSA 1D2GA 3KT6A 1GSHA 2OO3A 3H2ZA 1VBKA 5CLJA 1SQ0A 1RMYA 4NTZA 2VQ3A 4PSKA 4JQYA 3UYKA 5KO2A 2V7UA 4X61A 3HJNA 4QNMA 5ITWA 1WDLA 2XRFA 1C7JA 1AKUA 1FFGA 3GARA 1YO6A 3K92A 3ZCPA 5GP1A 4JLBA 4O4IA 3OCYA 1WBDA 3A06A 4RMHA 3VOBA 4MUNA 4RMGA 3SS7X 2PZBA 3HY6A 5JZOA 2YIMA 3RVJA 1Y6ZA 4YMWA 4KR2A 1KDRA 3E5MA 3QVSA 4EJMA 4WK6A 5BVHB 1GT91 4PZEA 4NJMB 5JZMA 1J99A 4AAYA 2CXSA 3FR7A 4DREA 2PKWA 4X91A 1CYEA 3HZOA 4P1ZA 4WJZA 3TZQA 5FOQA 2ETXA 4EYEA 3DLHA 3S1AA 2JIQA 3AF3A 4PGFA 2FUG1 3OJEA 1PZEA 3ZBQA 3IRUA 5JATA 3GRZA 4KITB 1MAUA 1U04A 2BEWA 1R18A 2WWFA 3GJ6A 3DCIA 3OWOA 2PR7A 3ZCSA 4D3YA 4YRKA 2HX1A 4YAUA 2B20A 1PEAA 3CLVA 3I92A 2MSWA 2MMCA 3PLNA 4O2RA 3ZW7A 1L1EA 4JSTA 2CFSA 3SP1A 4LVNA 4BCCA 1DKNA 1TQ6A 1DAOA 4C04A 4OREX 4Q18A 2DWUA 4PSDA 3E70C 4ZQHA 2R6HA 4U1RA 4IM7A 2WICA 3WFJA 6PFKA 4ZZ3A 5LP6A 3ZR4B 2D2VA 2X0DA 5KYYB 2N3ZA 5G41A 3CEPB 7YASA 3UCFA 1C7FA 4KLNA 1RM5A 2VJNA 5DNAA 3B78A 1QR6A 3O7MA 1QDEA 1T34A 2FOIA 3RFTA 3O4VA 3KOUA 1GYRA 3WYNA 1WL8A 2ISSD 1EFHA 1ST3A 3HN2A 1Q7TA 1KY2A 4YRGA 4EFLA 4UHCA 3TECE 3BK1A 5JBNA 3STXA 2G4VA 1Y6QA 3HXMA 3QLUA 1YB7A 3HGQA 1SKYB 3DZGA 3IVRA 2OHOA 1PYOA 1DT5A 2R751 3F98A 4FOTA 4O2BA 4RJ2A 3R7DA 3U37A 3WHIA 2Y6UA 2WD8A 3FVTA 2GFHA 2YQ4A 1ZXBA 4C22A 3P2IA 5HKKA 3UG7A 4ZMBA 5B3LA 3KS9A 1WQ4A 1ATZA 1IVYA 2C5EA 1ZGAA 4BUZA 4EF6A 3L7MA 4PV7A 2OR3A 3DBRA 3HA5A 1NWCA 4XTCS 1HO3A 1Y80A 3AB8A 3K1ZA 2QWXA 1WZCA 4W6QA 4IJMA 4J0JA 5FTKA 4J16A 3SS8A 1RS0A 3FUUA 3AOEA 3O82A 3FB4A 3PFIA 3QI7A 4YQZA 4LCBA 2WU0A 3LF2A 4XQ9A 2ONJA 1EG2A 3AHEA 4MVJA 3GMTA 1I9GA 2C2WA 2XODA 4EGJA 4BNJA 2XD4A 2V03A 4O2AB 4A8JC 2PPVA 1XR3A 2YXBA 4OQDA 4F6CA 1UXGA 2G06A 5JRZA 1H05A 4JXXA 2PT6A 1M1YE 1OJ7A 3A6KA 3OQNA 4M0FA 2FMUA 4BLPA 5K4HA 4CGZA 1L7EA 4UZEA 3TJMA 1UXOA 2ZS7A 2W00A 3FHOA 3LQYA 1XDBA 2VP4A 4I50B 1BHSA 3I12A 4Q6WA 3CUEF 4YBZA 2HLPA 3TOSA 3SN6A 4DEXA 5LOVF 3QPUA 1MX9A 4IDDA 4D9IA 3HBAA 2YJ4A 1BAPA 3GH1A 1C9DB 3N1UA 4LWOA 1KOLA 4LAFA 4K81B 2AQHA 3OUTA 4RXTA 3SM3A 3VGPA 4XDZA 1G16A 3B1FA 1ESEA 3MRXA 1Q0LA 3QY9A 3A2LA 4H6WA 4IZOA 4LPKA 4D5EA 2H1RA 2BMJA 3LC7O 3KZMA 4GGOA 2X4LA 2A0WA 3PI7A 5SICE 2JFPA 4XM2A 2IOQA 3KZKA 2V65A 4MQFA 3WL6A 4WXHA 2WPNA 1M7BA 4KBYA 4L4XA 4XJXA 4OAQA 4A8JA 1F2VA 1DXHA 4EW2A 1DE0A 4PU0A 3U3OA 2QTBA 1P2SA 1T1EA 4MV5A 1LDYA 1Z56C 3REQA 5L8VA 1XO1A 5FA5A 3W1EA 2QN9A 3OUUA 1A4XA 2EEPA 1E9FA 1DCKA 3WGYA 1W36C 4FR2A 1AMUA 4KXUA 1OASA 1LEHA 1I1NA 2ADFA 4B33A 4PHFA 1MT3A 5F7ZA 2MSLA 2XHEA 3MOIA 1KU6A 1RXYA 3HM2A 4AY2A 3W9UA 2FXVA 1JLRA 5DT2A 3ZQJA 5AKHA 1HDEA 2J09A 3AXSA 4QUEA 1H3NA 1E0JA 1P0PA 3IDFA 1H23A 2IZ1A 3H18A 1LY1A 5BV2P 5AKYA 5JSKA 2H51A 5HDBB 5FULA 2HSJA 3NRJA 3ILYA 2JGJA 1MIOB 4MGZR 4MIEA 1V9LA 4NZ9A 3SJAA 4DLTA 4EYOA 2XIQA 4QAQA 4GOMD 1VGVA 3LPNA 5KNDH 1XEFA 2F3QA 3OQJA 1N2CE 3PENA 4O63O 1S02A 3L7AA 2I4MA 1ZN8A 2WNHA 1GT6A 3ANMA 5A7HA 4R3UC 3W5AA 2AZMA 3LY7A 1D2HA 1NOIA 3OFSA 3WKDA 2AN9A 4X8OA 4MW6A 3NKFA 4Y3UA 3P20A 3CKMA 5EJIA 1AD2A 4H1UA 3UAGA 1GM5A 1JQAA 5E6UA 4JY7A 2O8EB 1R27A 1K86A 2QR2A 4ACAA 1V47A 1ZVQA 2ZUEA 1NIPA 1NJ6A 1LSUA 2HXSA 3E2MA 1EWVA 3IVXA 4RACA 4RVUA 3LSTA 3CISA 1XZBA 3TCKA 3WAKA 3VR3D 1R6UA 4EVSA 3VOAA 1QHHB 2R5WA 2HT1A 3BCHA 1XYVA 3CNNA 5BSKA 4N12A 4TYQA 4IV8A 1WXQA 2QIOA 4ETMA 2IE8A 4GLFA 2OHVA 4TXMA 1DC6A 4LYAA 1EDEA 4KRGA 4AY5A 2XQIA 3FHJA 1XZFA 2VYND 5K51A 4EHBA 3VR4H 4ISBA 3CF4A 4PQYA 2QYTA 4XLZA 1TEVA 5HWSA 1K1EA 3DMGA 2HUPA 5LQJA 3Q1LA 5JCJA 2B9EA 1QJ4A 5CXSA 4DNOA 3M9LA 3U44A 4W9NC 3LO5A 2VDQB 3M1YA 3JRWA 3IO3A 2E49A 2VHTA 5GONF 2VF4X 1G7TA 3C3EA 1E0KA 4NHOA 3O3OB 3LT0A 5IBQA 4G1BA 3N2ZB 4PX9A 2QQ5A 3H87A 2ZZMA 4XSVA 4LECA 3MT0A 4HVAA 5ALTA 1CT9A 1CDEA 3GK3A 3QX7A 2GPSA 1PQUA 3WGNA 4F3KA 1DDIA 3SDZA 2F3SA 3VR5H 4H16A 4J0KA 4BV2A 1Q3HA 3GV0A 3S40A 1ANKA 2AK2A 3I5AA 2WHXA 1IWOA 4MKGA 2P9QA 3KT3A 4U5XA 2ZT5A 1DELA 4YH1A 5LYJA 4F1JA 3W6NA 2WD9A 2CXRA 3B89A 1FVXA 1FXWA 3WB2A 1AA6A 1FZTA 1BOOA 1E58A 2VH2A 4D9BA 2VBGA 4CLDA 1DJMA 4TMWA 1EUZA 1IOLA 2QY6A 2VHXA 3FNHA 3KR0A 1F0PA 4FZVA 2P9EA 2P3LA 4E22A 3PFFA 1WB9A 4LJLA 3BD6A 3H2SA 4QXRA 4RLSA 2HHJA 3ETGA 5JVDB 1IFXA 1QLWA 4PG4A 1Y9EA 1SVNA 4DVJA 2QR3A 3H1PA 2BH2A 3JVUA 4Q66C 1E2LA 2PSDA 4UVGA 4WVFA 3HC7A 4B85A 3TX2A 3QXSA 2PL5A 4KFTA 3WLQA 4QAJA 3JQBC 3IMCA 4IY1A 4LC1A 1TOAA 3ASYA 5KNCD 1NVVR 1T3HA 2Y77A 1USIA 1PR9A 1AZWA 1T5DX 1W1UA 2FEKA 3NNNA 3MB8A 3JWPA 1HE3A 3EVFA 4AMUA 3RO7A 1HEYA 2IYAA 3OM0A 3SR0A 4J0CA 2RBEA 4WT7A 1F0KA 4D97A 5DM70 3ANYB 4DBZA 1WLSA 3MCWA 3M4NA 3L7DA 4ZQIA 2VH5R 2HQOA 1QGDA 1WV1A 5E6SB 3W04A 5ESWA 1WZ2A 1RXEA 4NLLA 521PA 1RMQA 4P22A 7AT1A 3Q5EA 1JV2B 2QS9A 4QU9A 1LBTA 5EP4A 1WMAA 3MCVA 1T0IA 1TYEB 3MTJA 5DGIA 3G5AA 1FBNA 1GNVA 4H3SA 4FVTA 1M7GA 4TL9A 4AJPA 4EFNA 4PPQA 4OPMA 4HG2A 1NN0A 1YJAA 4UOQA 5C1IA 3IUEA 4PYLA 1NVUQ 1VI6A 3LY5A 4PN3A 2WM9B 5CD1A 3KEQA 1FTWA 1GG5A 4MWDA 2C31A 1EK1A 1KF0A 1IN5A 2IX9A 2X9QA 3SX4A 1N32B 3M34A 4KQFA 4PIPA 3UMSA 2QUBA 3EW7A 2ODQA 4RZSA 1U2DC 4D4LA 3TR6A 4P7KA 3QH4A 2IF2A 1SOWA 1AUVA 2BY4A 2C9OA 3FE2A 1ES9A 3GF4A 4PHHA 1W76A 4NJOA 4JKOA 4EPVA 4WBNA 1M74A 3SFTA 5EJ7A 5JOQA 4F3RA 4FS8A 2QE7A 4RSRA 1WNFA 1X7WA 3P9IA 3IAM1 1YZQA 2ZDGA 3EBOA 2E9SA 1PHRA 2C5BA 2VOEA 3IUMA 4JWTA 4KO3S 5G0WA 5THQA 1REQA 3MGGA 4RW0A 4D0NA 1GDHA 2YZNA 3ZGNA 1I30A 3PUWA 1E69A 1K7SN 3KV1A 1NTRA 4CYMA 1OH7A 1G66A 1NV8A 4KI0A 4EP1A 4ERNA 1FYDA 3K9HA 4AZ3A 3PYXA 2V59A 3KKEA 3U26A 1ORHA 2OYRA 2CYBA 3F6SA 5FEMA 4TS4A 2WNSA 2Q4RA 4LHSA 4WACA 2EX0A 5AHOA 5A4FS 1QHNA 2CXNA 1EVEA 1Q1AA 1LCIA 1NMYA 2C95A 3FNIA 1BDMA 1JA9A 2XOKD 2GYVA 3C7KA 1FU4A 1VSBA 4TWJA 2VPXA 1MV5A 4MDYA 4G25A 4WLVA 3U40A 5D3KA 2NV2B 4BDTA 2K2WA 4IIJA 3AEQA 3CV3A 1DBIA 1GY8A 2WJ4A 3D8NA 3IFSA 2GFQA 3IP3A 2OA0A 3GRRA 4N3CA 4B6FA 4RVDA 3NWJA 4CMJA 4LZPA 1J0DA 3PQ7A 2W11A 3U7IA 4L8YA 1DU4A 1IZZA 4LF4B 1UZAA 6LDHA 1ZD2P 3Q6NA 2ILTA 4FHFA 2ZRDA 1T0UA 1BYUA 4NBUA 1A5TA 2BHNA 4NYJR 5BN5B 1KO5A 5LP6C 1A9SA 1DOAA 3I76A 1NQAO 2XKAA 3OM8A 1QC5A 2OMKA 2P1RA 4RJIA 2HM7A 3WGZA 2FX3A 1R9JA 3LLSA 3B7GA 3EOAI 4CIBA 4DT1A 2G5TA 4BVKA 4MQ4A 1G8JA 5C3MA 1WEHA 2QVGA 2RD2A 1KIFA 3OE4A 4XM1A 5ENVA 4Z3KA 1QB7A 3DVLA 1KE1A 3T3IA 4D8XA 4V0KA 3RVPA 2QD2A 1LC3A 4AJ2A 1VHJA 4OHVA 2GXAA 4K28A 2D1YA 2O2DA 1EAYA 2VXOA 1ZHHA 1JAIA 4KQMA 1SPXA 4X60A 1JTEA 4WK2B 4GKVA 5DLYA 2GHQA 4MEAA 7MDHA 1DT3A 2B2NA 4YXWA 5AIBA 2PSFA 4FQ8A 1RHKA 3A4NA 4GBED 1O54A 4TWAA 1E7MA 1HMYA 1L5OA 4ZRMA 3ZCRA 1Z5UA 5JD6A 2XGJA 2CLHB 4BQOA 4DDUA 3T1QA 1U6IA 3KDSE 2QTVA 4TKLA 5CCDA 4R1MA 1C81A 3JQGA 2AF4C 3PLRA 3WGQA 2GHTA 2FLKA 3VI4B 4Z7QB 4Q03A 4WFQA 3RBXA 1YUMA 4UU1A 2GAAA 3PRKE 4EAAA 5C51B 2WFMA 1SKMA 4CM4B 1YJ8A 2RGNA 2O7SA 2WHPB 2D5BA 5KYNA 4A2CA 4KIJA 2P8SA 4KN8A 3W78A 2XMZA 5L6MB 5SYAA 1KMIY 3HTXA 2AFRA 2ZI4A 4OP3A 2ZI6A 3W34A 1Z4PX 5CT6A 2GSDA 2PV0A 4MYHA 3GGDA 3RYHA 1Q19A 1K2WA 3WYAA 4QYMA 3ZHXA 3CEHA 4B71A 1DTSA 4XIFA 5FI0B 1FDWA 1N75A 2GK6A 1ZUHA 3JQ7A 4FBLA 4WESB 5BSRA 3WSTA 3UCXA 4PC3A 3I5YA 3HXQA 4DOMA 2F8TA 4LZNA 2WUWE 4IW3B 2WJ3A 2W71A 4UCQA 4GU5A 5DEIA 4JVOA 2XSZA 2HCFA 4Q1EA 4QODA 3OOWA 1VZ2A 3JZAA 2WUFA 2IXAA 3OCZA 4DT1B 4I6JA 5ALOA 3D6JA 3IIMA 1RYYA 2F4VB 3H5LA 3AY6A 1V1JA 4DRYA 4B87A 1JTVA 2GEVA 1ZXXA 2BMAA 3ZXYA 3NORA 1M66A 3OQOA 5AKLA 1G9SA 3KJFA 1JFRA 2QYOA 4GSKA 1KJNA 3HR7A 5CX1A 5FWDA 3BN3A 3H4TA 5HQ3A 1PSZA 2H2DA 2W58A 1VHDA 4YCJA 1B15A 1FYXA 3BRCA 4HDNA 2IDJA 5BYKA 4IINA 3U62A 4DV1B 3FFXA 1D6MA 1HZZA 3ZHRA 1K8ZB 3IIJA 4C2BA 4CLRA 1W73A 4NARA 4NEHB 3MMSA 2Y0DA 1TCCA 3K1JA 1WW3A 2Q4DA 1P17A 2IVFA 2ZS9A 2ZWIA 2NTJA 3FSRA 2B69A 1EFDN 4MVCA 4CGYA 1D3AA 1KPGA 4R2JA 2QMEA 3N28A 4IKEA 2VDPB 2ALJA 2PEYA 2DTXA 2PSEA 1A2KC 3W06A 1CETA 3LHFA 1MXHA 3EZFA 3N8GA 3UA3A 5KCZA 4L74A 3EY4A 4J9VA 4B5LA 1D6NA 4WA8A 2LUOA 4C7BA 1DIRA 5EYPB 2D0PB 3CZ5A 4HJXA 3TCXB 3QIAA 3A6FA 4E32A 4DV2B 3EDOA 4F7DA 1KI6A 3HO8A 1PL0A 2RHGB 1WU8A 4UHEA 3RUIA 4F71A 2NTYC 3IKVA 1J0BA 5EUBA 1JKIA 4Q9HA 1YQWA 1OFGA 1D0SA 5AH0A 3ENWA 4YMIA 2ZETA 1QHXA 4QJ3A 4ZI7B 2HZBA 3GUZA 1ULSA 4ZQEA 2OEPA 1TA0A 4K6CA 4BLQA 2FJPA 4EUSA 1CY6A 4GI1A 4P84A 1PQPA 5G4KA 3EZXA 1OXSC 4XWGA 5B55A 3OKAA 3I5XA 4H7DA 4J0DA 4RIHA 1U4SA 2PX5A 3HKEB 5COQA 3J81k 1H6BA 5AIAA 1QX3A 5IC6A 4OXYA 1NQUA 3CZAA 1KXJA 3GUCA 1O0SA 1HNZB 2Z95A 3B1WA 4A27A 1SXPA 4G5XA 1OIWA 5DTJA 4L08A 1V1RB 1XE3A 5IFLA 2D7DA 1UKAA 3IBCA 3OX4A 1XTVA 2QRNA 2ADOA 4XUGB 1MO5A 4BWVA 1MAVA 5DM60 1JI3A 4M21A 4D99A 5F7JA 1KMHB 1NN3A 4HOYA 4KQEA 4LS3A 4F2DA 3KQPA 2OWEA 5J4HA 2ZKIA 4MDEA 3C5VA 3MRTA 1NI4A 3NLLA 2Y1DA 1B26A 5HJ7A 4F86A 2EATA 3GNSA 3RF7A 5EXPA 2WIDA 4ZAWA 2QTWB 4LZJA 4RVGA 2ERYA 3B9PA 3EGDA 5CFZA 2VAXA 4O6VA 1NTOA 4J29A 3VR5A 3ZI7A 3FYTA 4AW9A 1NBMA 2PO7A 2UAGA 4AN1A 4CMGA 4KXVA 1H4QA 1OXXK 1S9HA 4A15A 3HXKA 4YECA 1M1YB 4CQNA 1BDJA 4MP3A 1N6NA 1T0PA 2X77A 4IX9A 4DADA 1YR8A 1SPBS 1PO7A 5IXSA 1MGPA 3LLMA 1U02A 2ZYWX 2IUYA 2FGKA 3J7AC 1KVTA 3EZYA 4R9UC 4RU1A 5JHGB 2ZBUA 3QPCA 1QV9A 1GHTA 1MN6A 2B25A 1MB3A 3HB0A 1CY2A 4UMEA 1KHHA 4RIFA 3R0QA 4BAGA 1WF3A 2HJGA 3HZHA 4EKEA 5H9WA 4LFAB 1LLCA 1RVDA 4GMXA 3SOZA 7MHTA 1USGA 1E3TA 2GEKA 2YXPX 3QWAA 3OQHA 4RPIA 1TLFA 3DC2A 4TS1A 1CUFA 1RLTA 5JBIA 1JNYA 3CRNA 4OMCA 2IPAB 5SZKB 1UBMS 2Q2OA 2V3WA 4FHCA 5G1NA 4CU5A 4C0SA 2JKYA 2O59A 5K0EA 1M75A 4ND5A 3AB3A 1JR4A 4OF4A 4AC9A 1BROA 1U2TA 3LP8A 4IYJA 4B45A 1FTNA 4C21A 4F6LA 3QU7A 1G20E 3OJLA 1NJ8A 3N39C 3ABOB 4LSMA 5K4AA 4DLPA 5CAEA 3QFCA 2HHLA 3L4BC 3CR7A 1K8XB 5DRTA 1X9GA 4BRSA 4GVLA 2V97A 4ZCLA 2ET6A 4IDOA 3RVOA 3PJDA 3O3NB 3QOXA 2VPIA 3RGWS 5HVNA 4IMPA 1JEYB 1IPEA 2BVNA 4MQEA 1R0ZA 2VDWA 4X0EA 1IIBA 3OECA 2WMOB 3GPLA 4YPFA 1MB0A 4X64B 1Y3IA 4KRXA 4CLRB 1VE5A 1VLMA 3F4BA 4IG4A 1ZJJA 5T64A 2LZ0A 3ZIUA 2YQ5A 1Y7LA 4RE5A 4ALNA 1SXJC 3H99A 2VR1A 4X00A 2OCKA 3M89A 3D6TB 2WJGA 1ONSA 3V8BA 4TUYA 3AKEA 4LBYA 1F9EA 3ZCVA 2P5YA 4B3GA 2OZVA 2P62A 5JQGA 1O89A 1Z0KA 2YCLA 3LPLA 3QUQA 4GLJA 3SEAA 1LFAA 4LOKA 3U17A 2AMYA 1DO0A 3GJYA 4CQMB 1O58A 2Q99A 1ZW6A 3WRXC 1D9ZA 1SY7A 4N5LA 1IY1A 4G9GA 1LZKA 4OKIA 3QPVA 3A10A 2NU7B 4IFBA 1NSFA 3I2YX 4R16A 4RY8A 1D2RA 4DNFA 2PUCA 3SS9X 4KVGA 2WJWA 5K1ZA 4B3FX 3AL3A 1N8KA 4CR7A 1JIXA 1EVLA 3OT5A 3R6WA 5BOSB 4ENVA 2NWQA 2C1XA 2QKYA 3CLRD 3GCXA 4RQUA 5EE3A 4MAMA 1IK6A 2Q1UA 4ZVQA 1IAQA 4ENSA 3MT7A 4H7JA 4GSLA 3TX6A 3WXMA 5C32A 4GI7A 1EUDA 1U2DA 3B5JA 3PT5A 1SZPA 2AQIA 4AFNA 3O0DA 2MWMA 3T0GA 3T4EA 1PBNA 3Q3GE 4F5EA 5GZ3A 4QE3A 3DE6X 1U0EA 1LXCA 3JD3A 4A0QA 1HQYE 1PUIA 4EA6A 3LBYA 2R8OA 2YTZA 3ZK8A 1Z06A 3RCBA 2P41A 1UFQA 1FNSA 2DTDA 4P0TA 1IUNA 5IF9A 1ZM3A 1U2EA 2E55A 1AV7A 4CIVA 1NI4B 2I4RA 3I6YA 5AW1A 1OWLA 1PQWA 1G41A 1GARA 3WB1A 4IXMA 4HF7A 2ZCJA 1VL8A 3KR1A 4K9SA 5BRNA 4E5NA 2C7BA 3C6ZA 3V9PA 3N7AA 3GMSA 1MPTA 1ADCA 3RS2A 2J67A 3F6CA 3E15A 3FTNA 3WLMA 3ZY2A 4AMGA 5LVAA 4NSNA 3GZNB 1U8CB 1UKYA 4NBSA 4DUPA 1XV5A 2Y4NA 1AJEA 4V1CI 4BGIA 4FJ1A 4LOAA 1P18A 2GH1A 3HKCA 1YL5A 5DX0A 1KY5A 2JJ2D 4RWEA 4EQ6B 5I7VA 3DW1X 1NURA 4WKPA 3QXGA 2RHCA 1OVMA 2BTQA 1P2UA 4B3JA 4CF4A 3OCCA 2PVSA 3M4YA 1DUVG 5DHQA 5HFNA 3G0OA 3THWB 5I7HA 2YHSA 2ZSFA 5K03A 3G0HA 1J1UA 1TK2A 1YQDA 3BCSA 3AETB 4AQDA 4DA8A 1QF9A 1NU6A 1ZMBA 2ZRMA 5KU1A 2AYYA 2J9FA 1AGPA 4RZ2A 1YQUA 1EUCA 3K70C 5LQSA 4Z0TA 4KODA 5AVSA 1PKEA 4P3PA 4DLWA 5I9NA 2BGGA 1W4RA 2YJGA 3DV0B 1RFGE 5D85A 4I7EA 4WCFB 1QU2A 2DHCA 1BCRB 4PYRA 5AVQA 4HEHA 2XZOA 3HFRA 1WZEA 3VYTB 2VQSA 3L0BA 4OM7A 2HC9A 5LA6F 4Q4AA 4OX9B 2BKAA 3DDCA 4FYYA 4JZKA 3V8EA 1NVMB 1HGXA 1E4YA 4H1TA 1FUYB 1CY4A 3I37X 3DL4A 3F8TA 3LBNA 4QOGA 3RU7A 2Z8YM 4V2IA 4X93A 2XJ9A 3WJAA 5I9TA 1MH9A 4URUR 3P4XA 3ZHQA 4A0FA 4KIWA 4WLFA 5D6NA 1CZHA 4AN0A 4U7DA 4FFOA 4URZR 4H3HB 1KP9A 3E9YA 4DSNA 2JJ1A 3EZ7A 4DLZA 3H7IA 3OVMA 2G82A 4GR5A 4K6GA 4WN9A 3S55A 3TN7A 3UJ7A 3VR4A 4FYPA 1QE3A 1Z45A 3RVNA 4Y2UA 4UC0A 2WVJA 3ZLAA 5F1YA 3NGMA 5IVDA 2JW5A 4FEGA 3OICA 2ZSKA 4YWJA 4DIBA 1VPTA 1W93A 1XWIA 4L5CA 4CTOA 1OAAA 1O96A 1TK9A 3SGLA 1G3MA 2H1IA 4FOLA 4ZVKA 1YDFA 4HVLA 1R0YA 1OPXA 1VHWA 2FPOA 2QUAA 1U2SA 3CRRA 3DFIA 4Y2PA 2CLOB 1F2DA 1T36B 2CBGA 1V1MA 4JUDX 5AW7A 3IQHX 3AUYA 3KETA 4FS3A 3AESA 4N7BA 3C4QA 5LU8A 3HO1A 3HJHA 2PJZA 3H4VA 5AM1A 1O6BA 1V1MB 4RKYA 3ROFA 4BEVA 1JJ7A 3OZAA 2Q5JA 1AS2A 1DLJA 5IT9A 2MSEB 2GQ0A 1H4TA 3N7TA 2EFEB 2MJLA 1M2OA 2F1KA 3KZXA 3QXJA 4NBNA 4OFBA 5SZIA 2NU8A 2RGYA