4E5YA

Structure of human fx protein, the key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
307
Chain Sequence
b'SMRILVTGGSGLVGKAIQKVVADGAGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-fucose synthase
publication title Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 94
structure length 307
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e5yA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4e5yA02
1NQOA 4M1QA 3ZI0A 1PEDA 3A1NA 3FNGA 4CMJA 5KJ6A 5IZCC 1HTBA 3VZRA 3AOEA 3GRKA 4UAGA 4YAJA 1H0KA 5DBIA 1UR5A 4E4YA 4PN3A 4A26A 1Q1NA 2O3RA 4A2CA 1LA2A 3WJ7A 1AXEA 1E1NA 4BNXA 4XEHA 5BNIA 4LRTB 1LSOA 3H5NA 3WGIA 1I2CA 2LDXA 4DUPA 3HFGA 2P4HX 1WZIA 1T4BA 5ITWA 1O0SA 1G0OA 4CM4A 3TOXA 3A9WA 1LEHA 3H6KA 1O8CA 4TVOA 4WNIA 1GYPA 1QLHA 1SEPA 2C29D 5A9RA 4EI2A 1SZJG 2IEDA 2PWZA 4OJNA 1PGJA 1YB4A 2H9IA 3NDJA 4YJDA 1PS0A 4J9VA 2WTBA 1DOHA 4A73A 3W1VA 4R3NA 4EDFA 2R00C 4PG4A 4B3IA 5I7SA 2BH9A 4BO0A 4B79A 5H81A 1M66A 4GI2A 3JQAA 4TRMA 3MJVA 4OXYA 1I36A 3HSKA 4RDIA 4WLFA 4N7RA 3QA9A 2ILTA 4RVDA 1X15A 5L7YA 5KVVA 2D4AA 3JV7A 3E9MA 3I9MA 4QT0A 3SVTA 3RASA 3AOEC 4W7HA 4MP8A 3INRA 3BAZA 4DWVA 4DYVA 4FFRA 4CM9A 4CV0A 3F5QA 4FR5A 1VKNA 4Z0HO 1U2GA 4CQMA 5B1YA 1ZK1A 3PGXA 3PZBA 4AJPA 4JBGA 1ZO8A 3H9QA 3WWZA 4NFSA 3MJSA 1LXCA 3DBRA 4GQAA 3GVHA 4UUMA 3VZQA 5DP1A 3UGKA 2NSDA 4RCVA 2VWPA 1EE2A 3KSZO 1X1TA 4CMGA 1NYTA 3IC5A 5K0ZA 3QWFA 5L4LA 5FEUA 4Y6RA 1EVYA 1BDBA 4WLOA 1NNUA 3BMNA 3DTYA 4RQTA 2JFHA 1KEUA 4XYLA 3WYCA 3I23A 4KUHA 3ONFA 1YWGO 3M2PA 1GUFA 2RH8A 5CPFA 1JAYA 2GZ3A 3KZVA 1M6WA 2J3IA 2NUAA 4WCFA 3PJEA 2FPIA 4XIYA 2D3TA 3JQ6A 1UXJA 4NU6A 3WDSA 2JHFA 2EGGA 2QW8A 5I9NA 2J3HA 1K5HA 1H9AA 4DQVA 5BNFA 1TT5A 1Y9EA 1IE3A 3U0BA 4A03A 1Y9AA 3Q9UA 3S2IA 4I08A 4J2OA 3ENKA 1FF9A 1VC2A 2X0NA 3Q6IA 4E2YA 1RM0A 4YT5A 1YBAA 2JD1A 4CM5A 1BVRA 3L6OO 1Z75A 3QWAA 1P77A 3F3SA 4XD2A 1N7HA 1E92A 5FFFA 4F3YA 3EVTA 1ULUA 2EGHA 4R1TA 4DPKA 1S7CA 1WNTA 2Y0CA 3I4CA 2OBNA 3T4EA 2AQIA 2NU9A 4ILKA 3NEPX 4BNFA 5F5NA 5DOZA 3TQHA 4E32A 4ND2A 4WEOA 1EQ2A 3JQGA 4NBWA 2OORA 2P2SA 4UVGA 1VL6A 3GEDA 4B7UA 2NQ8A 3OF2A 2ZYDA 3C1TA 4WCFC 1TT7A 4JK3A 1GQQA 5ICMA 1PZGA 2AQ8A 4IJWA 4BNZA 2YV1A 1ZEMA 4B4OA 1OAAA 1UP6A 5FWNA 3A06A 4ZA2A 1BXGB 2X1HA 2B5WA 3D7LA 5F3RA 4RF3A 4YRAA 2ZYGA 2RBEA 3WQSB 1PJQA 4BGVA 3NKLA 1Z45A 5ICSA 2AG5A 3GVIA 3K2EA 3ST7A 5EINA 2Q1TA 1DC3A 3AM3A 3KLPX 4Y67A 1W73A 4Z9XA 5G4LA 1BTOA 2YW9A 1BXKA 3ONEA 3JCZA 3GAFA 4NK4A 5AXCA 2BGMA 4BNKA 4HV4A 2O3QA 2VWQA 4L4SA 4MP6A 4AJEA 2WE8A 1ISFA 1ENOA 3KRTA 5JAIA 2Q1WA 2GCGA 4S1VA 3LT4A 5BR7A 2W2KB 1BMDA 5B4TA 2Q2QA 3GNTA 5ILOA 2NNLD 3FF4A 2ZK7A 3TDKA 4TRNA 3UVEA 3WX0A 4WEQA 7ADHA 4XYGA 3TSCA 1M2WA 4AJIA 3RC1A 3JYLA 2PGLA 3IOYA 3GVCA 4E13A 1U7HA 2WYUA 1L7EA 3GY0A 4ZICA 1J5PA 2FP4A 3HDYA 1R4NA 3F4BA 4W82A 3WYBA 3CE6A 3G49A 4IJUA 1Z73A 3GF4A 3OJLA 3JYNA 5AVOA 4YJGA 1YBMA 3P2YA 4J0EA 5T64A 4QECA 1QSGA 3PHLA 4FFMA 2JFGA 4BKRA 4QFCA 1Q0QA 3MOIA 4Y8VA 3ZV3A 3DZFA 4DMMA 4RVFA 2BD0A 1RPNA 5TX7A 2FR8A 4FFOA 4CMAA 4OSOA 1NQTA 5BSFA 1F8GA 1TXGA 1UUFA 1N8KA 3E18A 4J4BA 8LDHA 1PGPA 1OOEA 5T67A 2E48A 5CDUA 4XR4A 3JTMA 1C3VA 3NRCA 3OEYA 2HJRA 3GZ4A 4C7KA 2DUUA 3JYQA 4MOWA 4EEXA 1W6UA 1EVIA 3PI7A 1R0LA 3NGXA 4FB5A 1YOVA 1VJTA 2HMTA 4E5KA 4CR7A 4NFYA 2FSSA 1PGQA 3RBVA 3GNSA 3ZN2A 5I7VA 5KCZA 3ZNOA 2WD7A 5CAEA 2ZB8A 3ZWYA 3VC7A 3T7CA 3FNEA 2NVUB 2Y05A 3I9JA 3UF0A 4OMUA 1UH5A 1C1DA 1UXKA 1ISIA 3ENNA 3KYCA 2GDZA 4FQ8A 2X0JA 2Y1CA 4JP2A 4TKLA 3VAZA 4BV8A 5TNXA 4CUZA 3SJ7A 4PLPA 4ALLA 3ETDA 3I6IA 3RUIA 3DDNA 4FPXA 1O95A 1GADO 3ICCA 3ZWNA 2DTEA 3RVDA 3TZQA 5HRUA 1U5CA 2NTJA 4NJMB 2ZTLA 1NPDA 3RFXA 4GH5A 4IXWA 1AUPA 2ZTMA 5ITVA 5HM8A 1E7WA 2D2IA 4OAQA 4BV9A 1PR9A 1XYGA 4CV1A 1LJ8A 2DBQA 4W6ZA 3E9NA 1QG6A 1JKJA 2EWMA 4ONEA 4I5EA 2I76A 3HWRA 3M1AA 4U7WA 3IJPA 4BS9A 1E77A 1MFPA 1P1JA 2EW8A 1P1FA 1UAYA 3D3WB 2C5EA 4W4TA 1TVEA 4XZ3A 4FBGA 1SB9A 2CUKA 1DAPA 2NVWA 3AI2A 2I65A 3FNHA 2EKPA 1PX0A 1E5QA 3I9KA 1I8TA 4FJ1A 1E3SA 1Y81A 1HLPA 4P4GA 1U8FO 2C54A 4WJZA 4TRRA 1ZEJA 4BGIA 2XAAA 2B35A 2PH3A 5C7LO 2Y99A 4A7PA 1B14A 2I67A 2Q3EA 5CEFA 4J3FA 1FMCA 4B3JA 4IDGA 5JCJA 2YHUA 3RBZA 3ROKA 5IDYA 2EV9A 3HFSA 3ZHYA 1EDOA 3GVPA 3NJ8A 1I0ZA 2DAPA 3B20A 3BMQB 4BO2A 4YVFA 3U4DA 4BKUA 2BF7A 3TL3A 1LRJA 1GD1O 1HT0A 1F0YA 1PJBA 1CDOA 1P0FA 3D1LA 3BHIA 5FF9A 4LISA 2B5VA 5EMHA 1JQBA 3GT0A 3ZZNA 1V9LA 4YQZA 1I3KA 1R6DA 3AM4A 2D5AA 2WJPA 5G0UA 3LC2O 3Q0EA 1NBOA 3QIVA 4E3ZA 2ZTVA 1IULA 4IM7A 4KWIA 5CG2A 3B1FA 4RF4A 4UVIA 4D44A 2IZ1A 3D64A 1QYXA 4FC7A 3EZYA 5T8KA 1GTMA 4UUPA 2E82A 3VH4A 5C37A 3Q9NA 1HDCA 1MC5A 4R16A 2YDXA 3RFTA 5TIIA 4GGOA 4R01A 3ASUA 4RV9A 1U2DA 2D1YA 1A71A 1V35A 1GV0A 3ROPA 4WLEA 3DONA 4BNJA 2WMDA 1I32A 4BQRA 3O8QB 1EDZA 3OICA 3PLRA 4FFLA 1I33A 4IS3A 4RJTA 5IDWA 3AU9A 1D4FA 3DO5A 2V6FA 4GX2A 4AJ2A 5ADHA 3AUSA 3LVFO 1PJ2A 3JQ8B 3GZNA 4ZQGA 5B12A 3WTBA 3Q3CA 1F14A 3WYEA 2YDYA 4XRGA 1HXHA 1RM5A 5JSFA 3AW9A 1GZ6A 4E0BA 3Q2IA 2O2SA 4TVBA 5KJCA 4IQ8A 4LCEA 3S2EA 3KUXA 5BSHA 1E3IA 1KC1A 1BHSA 3H4VA 3ZWOA 4BQPA 3I5MA 2X5KO 4EUEA 2VYVA 5T8KC 2EJVA 4RZIA 2NWQA 4MVJA 4NH4A 1R15A 3L0DA 4DGSA 4E21A 3HB5X 1LQUA 1VSUA 3CZMA 4NJOA 3TRIA 3E1KA 5B4UA 1T2FA 2CF6A 4RVGA 1KVQA 1R0KA 2VHVA 5G0WA 4XJSA 2Y1DA 3OIDA 5DNAA 3QW2A 3OMLA 2ZCUA 5TRTA 2NM0A 2HQ1A 4Z6KA 1Q7GA 1A7KA 2BLLA 5T57A 5BT9A 5EESA 1ADGA 2ZYAA 4OSPA 1HYHA 1E3JA 1PJSA 2ZQYA 4OM8A 4CMKA 1I24A 3AUAA 3NAQA 1JA9A 4WKGA 1DJNA 3E82A 5CDYA 3N7UA 4GMFA 3ZWPA 2OO5A 1UJMA 1L7DA 3D0OA 2VRBA 1JU9A 4DIOA 1GDHA 2EW2A 2QRJA 1PIWA 4NNJA 3GN2A 1Q2XA 3IAHA 2B36A 4Q9NA 3SC6A 4XYEA 1GYRA 1TLTA 1CJCA 4CM4B 1X14A 1PZHA 1U1IA 2IXAA 4IY1A 4BNIA 4YB8A 1DC4A 5JY6A 3GDGA 3SXPA 2AA3A 2CVZA 3AJRA 4JLWA 3I52A 4JJFA 2IEBA 3N58A 1V3VA 1YBVA 3RD5A 3OECA 4Q3DA 1M6HA 1ORRA 1QYVA 2DTXA 2HRBA 2CVOA 2HCTA 4BNHA 2BMAA 3VH1A 1ZK0A 2PKQO 1N1GA 4FGWA 3JQAB 1Y8RB 1B26A 1H93A 2AQHA 4GX0A 3V8BA 3QSGA 3DQPA 3P5SA 5A1TA 5C7IO 2BFAA 4O0LA 3TJRA 1YRLA 2JJYA 5L3ZA 4Z0PA 3ZHZA 1B8UA 5THQA 4I9NA 1P45A 4E30A 5A04A 2PD6A 4J43A 1B15A 3QRWA 4CMIA 2W4QA 3G0OA 1IZ9A 3RUAA 1UZLA 1LDNA 2WWRA 2X0IA 1PZEA 1ZCJA 3GH3A 3U4HA 3PQEA 4CQMB 4AG3A 1SEVA 1YVEI 5KJEA 4AJLA 2X6TA 4D43A 3GUCA 3PHJA 2D8AA 1AN9A 4IBOA 1NPYA 1I3LA 1P74A 4U6QA 1QORA 1NP3A 2O3JA 3VTFA 4I9HA 4G65A 1EK5A 2QG4A 4E5PA 4H3VA 3UUWA 1QYWA 1ARZA 1ZSNA 3QLJA 1HWYA 3BMNB 3W6UA 2EG9A 3M1LA 4B8WA 4WASA 1KY4A 2C5AA 1N92A 2RHCA 4Q3AA 1X7HA 3K6JA 2VOJA 1U8XX 1NX6A 1GPDG 3I6QA 2ZATA 4I9UA 1TI7A 2VHZA 1KVSA 2CZCA 3G17A 5A4DA 5DULA 5JYDA 4XGNA 3DTTA 4BNYA 2X0RA 3VDRA 3PPIA 4AJOA 4DC1A 1DFHA 1E3WA 1IHYA 3KO8A 3PK0A 2NU6A 2CFCA 2G5CA 2PZKA 4XX0A 1Q0LA 1TT5B 2VHYA 4KTVE 1LSJA 2QIOA 1QYCA 2G1UA 3ADOA 5L4SA 1DFIA 3DMYA 2HO5A 1YL7A 3JQBA 3PWZA 4IMPA 3WGGA 1U4SA 2PR2A 4JCOA 3OJ0A 4GGPA 3DL2A 4HFJA 1RYEA 3D4NA 1RKXA 1WAMA 2UUPA 4F6LA 1P0CA 5A3JA 4O5OA 4UVDA 5K9ZA 1YDWA 2EERA 1E7SA 1GR0A 3JSAA 1QKIA 2GN4A 5IDQA 4J0FA 1SBYA 1X7GA 5EQDA 3VPFA 3PLNA 2W2LD 4HUJA 5KKAA 3TNLA 1F17A 3ZH2A 4DREA 1EE9A 4DLAA 1C1XA 4XR9A 2W90A 4IINA 1FJHA 1GYQA 4ZQBA 4D42A 4YR9A 5TJHA 3WIDA 1H2BA 4YT8A 1H2HA 3WFIA 1P31A 4YXFA 5G0TA 5EL0A 4GL4A 3OQBA 5ER6A 2UV8A 5BNTA 3UICA 4B4UA 1J0XO 5KJ1A 3PYMA 2OP0A 1R16A 3FTPA 1FDTA 4CMBA 3JQBC 4GSLA 4IJVA 4D3SA 2OMEA 1ZK4A 4MVJH 2B37A 4HXYA 2VTEA 4XDZA 1LC0A 1U9JA 4D41A 2GUGA 2VQ3A 3WG9A 3MJ4A 3C8MA 4F45A 2D5CA 4ND3A 1SMKA 2BGLA 4TZTA 1HF3A 4O59O 1I3MA 2V6GA 2VUUA 1RYDA 1U3TA 5TLSA 3OH8A 4J91A 1K2WA 1X0VA 3VKVA 5L95A 1V6AA 1LTHR 3NT5A 4PZCA 5JDCA 5JS6A 3ZU3A 2C0CA 4P8RA 3GC6A 3JQCA 4YBZA 4BMVA 3HN2A 3H9JA 2DU8A 5AQ1A 1YGYA 5TT1A 4UEKA 1E1KA 2E4AA 1MV8A 1XKQA 2Q49A 3ZWMA 3PJDA 4PGFA 1KIFA 2VRCD 1R37A 2FPGA 4IQGA 1F12A 3RIHA 1PWZA 3LU1A 5JMWA 4Z0TA 1ZIDA 4OO3A 3FCOA 2FY8A 1YB5A 3GRPA 5KOIA 3VVCA 5L40A 1U3UA 3LT0A 1R4NB 1VL0A 1VL8A 1NM5A 3CZRA 3QWHA 4Y6SA 4YJGB 4R3WA 3TOZA 5I9MA 1PJ4A 4BNVA 3B1KA 4DIFA 3WS7A 4AJNA 3ZWCA 4CM1A 3DHEA 1E7QA 1A27A 3DBVO 3W8EA 1P1IA 3E8XA 3JD1A 3PJFA 3DFZA 1D3AA 1QP8A 1CQJA 1J4AA 4CL8A 4E31A 4IIUA 4NFHA 5JDCC 3GK3A 1DFGA 2TMDA 5KTKA 3K8ZA 4QO8A 4MP3A 1HZJA 5JBIA 1MC4A 4IIVA 3V2UA 1KETA 1H6DA 4B4WA 1CYDA 1QRRA 4XYMA 4YJHA 4MDHA 1Z6ZA 1ZBQA 4BO7A 1ZW1A 1H9BA 4M55A 1DBVO 4BNTA 1XCBA 4NIMA 2CY0A 1LLUA 1P1RA 2WD7B 3KHUA 5JC1A 4UEOA 1MX3A 3PQFA 5IN4A 3JQFA 5JYEA 2I99A 2O7SA 2B4QA 3QE3A 1E7YA 2NVBA 3QQPA 5GZ6A 4B7CA 3QVXA 3IMFA 4BO1A 4CQLA 2B0JA 2J8ZA 4E6PA 3GG2A 4KDEA 3H9UA 2UAGA 3ZHXA 3EAGA 1E1LA 4N5MA 5L51A 1YH3A 1Z7BA 4PCVA 4R1SA 4Z9YA 1XELA 3JYPA 1A7AA 1DAOA 4DRYA 5ENVA 1I01A 3V2HA 3PTZA 3V1UA 2HK8A 4HP8A 2X22A 4FGSA 3ZU4A 1E7MA 3S2FA 1ZNQO 3DBLA 4P4NA 4YJFA 4PZEA 1R0SA 5CPBA 3ABIA 3PWKA 5JAQA 3ZWAA 4MKRA 1MGOA 1PL8A 1UP4A 1D1SA 2FHSA 2WE7A 4NK5A 4E5NA 1SC6A 4IDBA 1CEQA 4CMHA 2VYND 1ZXLA 4ZHSA 3M6IA 2VCYA 5KIAA 3ORFA 3JQFC 3F9IA 5TGDA 3PRJA 5DP2A 4GX5A 1QYDA 5KWEA 2YQ5A 2HRZA 4NPCA 2X5OA 4EUHA 3PHIA 3ANNA 2W8ZA 1P44A 4YWJA 1C14A 4R69A 3ROQA 4NBVA 1ZK3A 1GQ2A 5J23A 1XQ6A 1V0JA 4HWKA 4L4XA 1GFSA 4XGKA 3BA1A 1X7DA 4JBIA 3A4VA 1FXSA 4WOJA 3WMWA 3DAFA 4L73A 1D7OA 3HE3A 3JQ9A 4R9SA 1BW9B 1VRWA 2PY6A 5DF1A 4BB6A 3DZHA 3H5AA 4GMGA 1N7GA 1ZJZA 4S3MA 3RUHA 1OZAA 4BVAA 5IF3A 1LI4A 4BO8A 4EYEA 1JKFA 1SNYA 4RPLA 1R4MA 2PTGA 2OOSA 3SJUA 2PZLA 4WE3A 4PLGA 4ZJUA 1ZSYA 4PVDA 1XEAA 1GAEO 4J1QA 4PG8A 2DVMA 2JHGA 3KEQA 3GPIA 1TA4A 3JQ7A 4LK3A 4URFA 1DLIA 2AEMA 1PQUA 2NTVA 2AG8A 3RKRA 5CDGA 1DIAA 1ML3A 3IDSA 5I8WA 4HADA 2E6UX 1QV7A 5BQFA 4FOSA 4GSKA 3TZKA 4JIGA 4YACA 2R2GA 4MKZA 3ON5A 1KYQA 1K0UA 2GN8A 2YZ7A 2Z95A 1M76A 3JQAD 3F4LA 3PIDA 3RFVA 3V1YA 1FK8A 3JQ9C 1P1HA 3FN4A 1N9GA 3H5RA 4R41A 2DUWA 4BNUA 3B1JA 4E33A 1XA0A 3R3SA 4XKJA 4IDAA 3QVSA 1H6AA 4ZRNA 2A92A 3L4SO 1WWKA 1SO8A 3ITDA 4XGIA 3RWBA 3A28A 5U1PA 3IP3A 5MGBA 1FDUA 3DAGA 3H2ZA 4CM9D 3F1KA 1AXGA 1MUUA 4PZDA 3TFOA 4RL6A 1HDYA 2Q46A 3PHHA 4CQMD 3OEWA 1I5RA 4J7CA 1BDMA 3P2OA 3RC7A 1U7TA 2O2YA 1KC3A 2CDBA 4MVJI 1SOWA 2H1SA 2P9EA 5DBFA 2VTDA 3IIEA 3K5PA 4E2ZA 3AUUA 4DPLA 5L4NA 4JNKA 4IXTA 3LC7O 2DBRA 2VUTA 2Y1EA 4BUCA 1NAHA 3PFFA 1GUZA 3NT2A 3I1JA 4D79A 2GERA 3N74A 1CQIA 4A27A 3INTA 4K9DA 4N5LA 4WGGA 4FFPA 3KYDA 2PK3A 4XA8A 3ZHBA 4CR6A 5IAAA 2BI7A 1DIBA 1Q7BA 2Y0DA 2UVDA 3QVTA 3LQFA 4LRSB 4DC0A 3RC9A 2WD8A 4PRLA 4I5DA 1HE3A 2RHRA 4EJ0A 1GUYA 1T26A 3WBFA 5FI5A 4FFNA 3PGJA 4PLYA 5KJFA 2JAPA 1GEGA 3IQDB 4KUEA 2WEKA 3I9NA 3KEOA 1OI7A 3DWFA 4BO6A 4DA9A 3KBOA 2ZJ0A 4XB2A 5JMPA 2I66A 1XGKA 3VKUA 6ADHA 1Y6JA 1WDKA 2OXIA 4NG5A 3X2FA 1LRKA 2CMDA 4YRBA 5A9SA 2VUSA 4J1NA 2WDZA 2O7QA 2EF1A 4YT2A 2JD0A 2B83A 1IB6A 4EEZA 3KYBA 4L76A 3WLFA 1AHIA 2W98A 3GGGA 4CM3A 4D3FA 5T5QA 4KQWA 1B8PA 2PZJA 3AWDA 5BSGA 3SLKA 4QSMA 3B6ZA 1OMOA 3MOGA 4RDHA 3GEMA 4G5HA 1DRWA 4HFRA 3CSDA 4MVJP 4RLSA 1E7RA 1N2SA 3R6DA 4OKIA 4WOKA 4ALKA 3GR6A 4EUFA 5IDXA 4H7PA 3ADPA 3IKTA 1UXHA 3WGZA 2NU8A 4MVJE 1WLYA 3W4IA 4CMIB 2V6BA 4MJLA 4IZIA 4EBFA 3ZNNA 1Z74A 4Z3KA 3HQ4O 3NGLA 2CSUA 3CPSA 4B4VA 1XSEA 4NBRA 4RLHA 1EEHA 4CPDA 3V2GA 2CNBA 2B69A 1O94A 3GAZA 2X8LA 2PLAA 5GY7A 3CINA 4RORA 4OOFA 4NR0A 3FHLA 2X7HA 1C0PA 3WSVA 4E2XA 3KTDA 4BKOA 3PXXA 5G0VA 4RF2A 5G2OA 4D0RA 5AXAA 5THKA 1BVUA 1K3TA 3BMOA 3ETEA 3W4KA 4RPHA 3EC7A 1K6IA 4EITA 2A35A 1XU9A 1B0AA 1H94A 2XPCA 4UEJA 1IY8A 2J5RA 3W6ZA 1YQXA 3X2EA 5TJ9A 1EFLA 1HDXA 1SOVA 4YT4A 2ZTUA 3CH6A 1E1MA 1UDAA 2P91A 3GDOA 5IXYA 1M67A 1T25A 1WMBA 4YQYA 1E3WB 2FOIA 1EK6A 1A4UA 1EQUA 3KLMX 1HRDA 1NFQA 2QYTA 1FDVA 1UDBA 4J7XA 4JX8A 3AY7A 5ENDA 5HTOA 4RVUA 1KY5A 4F46A 3RAJA 3GFBA 2G82A 3DZKA 4J90A 4CMCA 4MVJM 5C3MA 4IDEA 4RO0A 2BHLA 4UUOA 3DZIA 4NBTA 3FRJA 1XQ1A 3TL2A 1VPDA 1KVUA 4YYZA 1BXGA 2PNFA 3NV9A 3GG9A 4XYBA 4DQXA 1A72A 4GPD1 1ZZEA 2DBZA 4E2WA 4XCVA 2PD3A 1YS4A 1OFGA 3U4IA 3DOCA 1X0XA 1GU7A 1AHHA 4E12A 4Q39A 1GL3A 1B3RA 2VZ0A 1U4OA 2ZQZA 4NBUA 1BXZA 2PKQP 3EHEA 3HDQA 5A9TA 4R4JA 2X23A 2Q50A 3GPDG 3MWEB 3LC1O 1W8DA 1OC4A 1DJQA 2HMSA 1LRLA 3DB2A 3ICPA 3SC4A 3K9QO 1DHTA 1HLDA 3L9XA 1IOLA 1EBUA 3D3EA 1VJ1A 3GGOA 4CLOB 4N54A 4PG6A 1YO6A 1EUCA 3RU7A 3PHGA 1IZ0A 3JYOA 2Y67A 9LDTA 4G2NA 4J49A 3A14A 3RC2A 1ISJA 1B3BA 4R5MA 3E03A 4BKPA 1NFRA 4YAGA 1ENPA 4D46A 3GMDA 2GF2A 3PIIA 4Y6PA 1TB4A 3I9LA 2PGDA 4JP3A 1JWBB 2NTNA 3WSWA 5CDTA 1MP0A 2OHXA 5H82A 1ISGA 1PS9A 1LDMA 1LC3A 5CFZA 4YDRA 1C0IA 3JD0A 2ZJ1A 3OA0A 4KDFA 4NU5A 2EKLA 3COSA 4R51A 4AICA 3E9QA 5JDIA 2FR1A 4GAEA 1VSVA 3Q2KA 2Y66A 4YTEA 5K6AA 4IZHA 5G4KA 2CD9A 1ZXBA 4QX6A 1U5AA 2HK7A 5A05A 4DLLA 4EJMA 4CL3A 3NDRA 3VOSA 2G0TA 3BZUA 1GZ3A 2DPGA 3GNQA 2BELA 2O3SA 4CLRA 3ANMA 3C24A 1HDOA 4CLHA 4ITUA 3AM5A 3E5RA 4JJGA 3HB4X 3OJEA 3HDJA 5B4VA 3TFQA 5JCJD 3IUSA 3UKOA 4LMRA 2FMUA 3ZU5A 4PIVA 3RJ5A 3GFGA 1Y7TA 2XF8A 2DTDA 1I10A 3K73O 1WW8A 1QR6A 2NVUA 2AHRA 2P68A 1GY8A 2FR0A 4RQUA 4YAIA 2O4CA 5A5EA 4U6SA 3DZGA 4ND1A 3UCFA 2DBVO 1UAGA 3JD2A 4YJHB 4BKQA 2JL1A 1PGOA 4IDDA 2Y1FA 3FWZA 5JDIC 2C82A 4DLBA 3OIGA 4CV3A 1HYEA 3PQDA 2GR9A 5K6AC 2D59A 4AJKA 5TQVA 4U5QA 5H83A 4Q3CA 2PZMA 3SBOA 3H3FA 4WLNA 3DHYA 3NT4A 4JQCA 4UVEA 1NWHA 4EGFA 5F21A 4CQLB 1TEHA 2Y1GA 2HAEA 2JD2A 3FSRA 1ZKMA 2HK9A 4P38A 4BIIA 4PLVA 5DZSA 2YYYA 4AVYA 3NTRA 3DBRB 1KEWA 1LDEA 3WQRA 1GCOA 3TF5A 3BYZA 3CIFA 4IQ0A 3HHPA 1EVJA 2IXBA 4OXKA 3C7AA 1YONA 4Y98A 3PDJA 3NYWA 1ZVMA 1P3DA 4H15A 1IPFA 5KVSA 3G3EA 2P9CA 3D3WA 4FCCA 3WMXA 2A4KA 3DBLB 4GLLA 4CM8A 5TS3A 2Q1UA 4WCFB 3RI3A 3O9ZA 1VI2A 1MB4A 1E6WA 1E3LA 1N1EA 1NQAO 2FRDA 2TMGA 3VZPA 3QJ5A 3ZCXA 1KVTA 4HFMA 3PVZA 4LN1A 3IJRA 1LLQA 2J3KA 3DHNA 2GASA 1P1KA 3P7MA 1QMGA 4ZN6A 2VYVD 3Q1LA 4MVJD 4WK6A 1OBFO 1B7GO 5I7FA 4BGUA 4AJ4A 3WNVA 1MXHA 4MVJF 2BGKA 4BGEA 5GMOA 5MDHA 2EKQA 3CMCO 4MVJG 2FN7A 2P4QA 3HNPA 1G6KA 4X54A 1XU7A 5DOVA 2QQ5A 2OL4A 4FW8A 4R54A 4Q3EA 3H3JA 4N5NA 1ZMTA 4XRRA 1R66A 2HDHA 4MIOA 4II3A 3V5NA 3U4CA 1G0NA 3WB9A 3PWSA 3JQGB 1NFFA 2IZZA 3RJ9A 5KVCA 3DFUA 5COBA 3G1TA 3IUPA 3O4RA 2GN9A 2H5LA 2Y1OA 3GUYA 3FNFA 4UULA 1LU9A 4J16A 2Q4BA 3W8FA 5JW6A 1N5DA 1ZUD1 1R4MB 2CDCA 2RIRA 3BIOA 3C7DB 1KBZA 4C7JA 5I8ZA 5A02A 2Z1NA 4WUVA 1DO8A 4LW8A 3H2SA 1DLJA 3H65A 5F1OA 4KMSA 4MO2A 3U3XA 5JO0A 5F1PA 2O4UX 4BO9A 1NR7A 5COAA 3BTSA 4L0QA 2IZ0A 4FIZA 4ESOA 3JQ7B 4A10A 4J9UE 2O48X 1U28A 3LDHA 2LDBA 1T24A 1YE3A 4HNGA 1GCUA 4K6CA 5LC1A 2P5YA 2ZCVA 2IYOA 3JQ8A 1RM3A 3FPCA 4PLZA 4PLTA 5F5LA 3K31A 4DMLA 1LNQA 1E0DA 2I9PA 2JFFA 4J2HA 3GDFA 2DFDA 1DRUA 1IYZA 4DQUA 1N9GB 2VNSA 4OKNA 4TROA 1NR1A 4L9RA 1LLDA 2VWHA 1IPEA 1F8FA 4FDAA 4PLWA 1ENZA 3LLSA 2X86A 2HMUA 3AI1A 3RROA 5T6BA 3DEYX 3PDUA 3RSHA 3PYLA 2BFOA 1LLCA 4QQRA 3WGQA 2JKVA 3I83A 4KUGA 2I5PO 1UZMA 4O6VA 2IYPA 2Z5LA 1Y8QA 2PV7A 3DXFA 4HFNA 3DZJA 1HEUA 3BXXA 3BHMA 5JY1A 3AUTA 3H9GA 1R12A 1LSUA 1U3VA 1ONPA 3ANLA 3RUCA 3GA0A 2O3TA 1NQ5A 4NDNE 2A9FA 3T4XA 5JPIA 4D3DA 1EFKA 4R68A 2C20A 2IODA 2PD4A 2NV6A 4D0SA 3M2TA 3EGOA 1SB8A 3FBTA 2Q45A 3W4JA 4RF5A 3KYDB 1A5ZA 4MINA 1CF2O 4LCJA 2HKIA 3CTMA 4ND4A 1C0LA 2OGUA 4UREA 5IXSA 3C1AA 4QFDA 3MWDB 9LDBA 4JROA 1DIHA 3OJFA 3LT2A 4DIBA 2YHIA 4TZKA 1WPQA 2FSVA 3INGA 2I6TA 4RGBA 1YOVB 3VPGA 5HBRA 3VPHA 3AY6A 3L9WA 5LCXA 4HKTA 3QP9A 2RCYA 2OBYA 2GRAA 2P5UA 2O3UA 4CLDA 3O38A 1E6EA 2PGJA 1S6YA 1DEHA 4BNNA 3PEFA 1LDYA 3ZV4A 3F5SA 3LT1A 2YV2A 1C1DB 1YQGA 3KYCB 4M54A 1O5IA 3ZNQA 5A9SB 2BI8A 2YJZA 1PSDA 3PFWO 2AW5A 1Y8RA 1JW9B 3OBBA 2QRKA 5CG1A 4TSKA 3DBHA 3F6YA 1HSOA 3KXDA 4NQZA 4NMHA 3DOJA 1KERA 4FS3A 4PLFA 3ZNPA 4BMSA 3UCEA 2BRUA 4QXMA 1LQTA 5IFLA 3NJ4A 1DB3A 4RVHA 2AMFA 5CEJA 1RJWA 4DBVO 3TN7A 3BMCA 1HE2A 2JAHA 1HSZA 1YDEA 4U0KA 5EJ2A 3RQSA 1D8AA 1HKUA 1QV6A 2YUTA 4CODB 4P22A 1BWSA 3VZSA 4OQZA 2FZEA 3UCXA 1DC6A 2YV3A 3CUKA 3RUEA 2C2XA 4PLHA 2OP1A 4CJXA 3EYWA 2GPTA 3PJGA 3FPLA 1PTJA 4IGEA 1HETA 4WLVA 2D0IA 4R1NA 2AE1A 4ALNA 4QEDA 4XJTA 1BGVA 1MXFA 2A94A 3JD4A 2ZB7A 2G17A 3RKUA 3EMKA 5BSEA 4PRKA 1PJCA 1NHGA 3UH1A 3SX2A 3NX4A 3AU8A 4MKXA 2VN8A 2WSBA 1DC5A 3D4OA 3E6AA 3OM9A 5ILGA 5HS6A 4BOYA 2J5QA 3E48A 4MIEA 5HWSA 1WDLA 3D5TA 3BMOB 3NTQA 3VDQA 2EP5A 1YL5A 4FSHA 4IPTA 4NI5A 3WGYA 5CP8A 1QLJA 1NVTA 7MDHA 2NQTA 5EQFA 1JWAB 3C7CB 3R0IA 5A06A 4Y9DA 4YAKA 5L53A 4ALIA 3WFJA 4K6FA 4IDCA 4JN6B 1CETA 5DN9A 3WNQA 1T2CA 3FWNA 3CMMA 2B4TO 1I2ZA 4FJ0A 5FYDA 3EUWA 5AOVA 3ZWVA 1HDZA 1Y1PA 1EUZA 2GD1O 2NACA 1LUAA 1KEPA 4Q3BA 3DMTA 1CRWG 2QYSA 3STHA 2EHDA 4Z9FA 5ES3A 4EJ6A 3AOGA 5DCUA 4PG7A 5L7WA 4ALJA 4M89A 3H9EO 2UUOA 1T2EA 5B37A 5KKCA 3UOGA 4I5FA 3TZHA 1O6ZA 3JQDA 5JXWA 3OFSA 3U9LA 1IHXA 3FR8A 2GGSA 3L6DA 5LDGA 3OQ6A 3VH3A 5C7OO 1L1FA 3EW7A 1T1RA 3OIFA 3AFMA 5HA5A 5C5IA 4J6FA 2ZB4A 1J6UA 4II2A 5G0SA 5LDHA 4TQGA 3LK7A 3ITKA 3D4PA 3CXRA 1I2BA 3GZNB 1J49A 3PZRA 3VH2A 4Z3DA 4ZRMA 4L75A 5EPOA 1BG6A 4O63O 3H7AA 3O26A 3DMTC 2X9GA 1C0KA 3KV3O 1VE9A 1Y5RA 4BL5A 3KETA 3E5MA 1UP7A 4FD3A 5DDIP 3BTVA 1PJ3A 4XQGA 2GN6A 1BRMA 2I3AA 1XG5A 3DOOA 1PWXA 4OXNA 3EVNA 4GWKA 1QXSA 4YPOA 3MJEA 4UUNA 3VPXA 4A0SA 3OQ1A 1MLDA 3D5QA 4W7IA 4WLUA 3VHRA 1ADCA 1W0CA 1Q0HA 4LGVA 1LBEA 4GVXA 3F47A 1MG5A 4XQCA 4ND5A 1KEVA 1WVGA 3BTUA 2DQ4A 3FD8A 2AE2A 3RUDA 2DC1A 1RWBA 1EVZA 3UHAA 4LVUA 2CVQA 2XOXA 5AXDA 2Z1MA 3P19A 2AXQA 4JJIA 3EDMA 4B8ZA 1WDMA 3IS3A 1A9ZA 3OP4A 4GX1A 5JC8A 4XQEA 3S1LA 3U49A 2BKAA 5G4KB 1AE1A 4PG5A 4W99A 4IMRA 4KWHA 1W4ZA 1FDWA 2HJSA 1MG0A 3C85A 2PH5A 1YL6A 3UAGA 4BNLA 1JTVA 5AYVA 2JCYA 3GQVA 1U3WA 2VOEA 3MZ0A 4J1TA 2X4GA 1K89A 2J3JA 3GHYA 5I7EA 4XDYA 2EP7A 2GLXA 4CLRB 4M87A 3QHAA 1B2LA 1EZ4A 4WECA 3WBBA 5L45A 2Q4EA 2Q2WA 4M86A 1P9LA 4HY3A 1A4IA 4GVLA 1T1SA 1UZNA 1JLLA 4KQXA 2YY7A 3FI9A 2E37A 1X1EA 1D1TA 2C2YA 1CERA 2VHXA 3OETA 3U62A 3U09A 1PQWA 3G79A 4CM7A 5CDSA 3FTNA 4Q3NA 2C59A 5TF4A 2ZIZA 5DCWA 4CM6A 4R1UA 3ZV6A 5CHEA 4JBHA 5TT0A 4BNWA 1ZJYA 2EXXA 3JD3A 4PFJA 4XB1A 1H6BA 3G1UA 1A9YA 1JAXA 5EIOA 3WLEA 1YB1A 2Q2VA 4FJ2A 3FR7A 5KVQA 5JAMA 2JCVA 3L77A 3RCBA 4U0JA 2FZWA 2XXBA 2JCXA 4QO7A 3WICA 2V6MA 3U5TA 1WZEA 3WOHA 1ISHA 2OUIA 1JVBA 3QWIA 4J7UA 1XIVA 2B4RO 4E5YA 2I3GA 3K30A 3AI3A 4DYDA 1KS9A 4KTTE 2IE0A 3C3XA 1SCUA 2BFPA 4R9RA 4OYRA 3MTJA 2J6IA 3ZW8A 3L4BA 4DBZA 2Q1SA 3PYXA 4RZHA 1YJ8A 5JO9A 3NTOA 3AK4A 4CM8B 1ONNA 4INAA 1PS8A 1AGNA 2EEZA 3ONDA 5COQA 1ADBA 5IJZA 3ZGYA 4KP7A 1DHRA 1PJLA 4YA6A 4PLCA 2H63A 3AFNA 1DXYA 4BO4A 4R5HA 3TZ6A 2UYYA 4DPMA 1XR3A 3K96A 3MCVA 3OJOA 4I1IA 5JLAA 4TKMA 5JFOA 3SLGA 1ADFA 3HDHA 1XLTA 1VKOA 3MTGA 2X9NA 3OA2A 1NHWA 1PU2A 2HLPA 3DR3A 4DVJA 1BW9A 1HYGA 3B70A 1XDWA 4N18A 4RPJA 1ONOA 3DZBA 2Y0EA 3QY9A 1UDCA 4FC6A 2X5JO 2UDPA 5A03A 3LSYA 4D7AA 3LF2A 1Z7EA 3L4BC 1MA0A 1V3UA 1VJ0A 2YFHA 3HADA 5EERA 4ZU3A 1YJQA 1C1XB 3ULKA 2AQKA 5IZ4A 2PA3A 2Y93A 1GPJA 1JDJA 3EK2A 5EN4A 3SEFA 3T7EA 1V8BA 5TSDA 2EJWA 4OL9A 3V1TC 1E5LA 3S2GA 1NVMB 3MJTA 4OHUA 2GNAA 4QTZA 4WNCA 1DSSG 4CMEA 3GHHA 1M75A 1WP4A 4CR8A 5L7TA 4GLOA 4TMFA 3QV1A 4RPGA 3W8DA 2O50A 3LF1A 3ETGA 1WXDA 4WPGA 5L9AA 3UN1A 2VT2A 1KVRA 3K2BA 3I3OA 3R1IA 1YQDA 5DCYA 4L4RA 2W2KA 6LDHA 2X58A 4UVHA 5U9CA 2DKNA 2FPPA 1DIRA 4CLEA 1Z82A 5DT9A 3KSUA 1GQYA 3KVOA 2OFPA 5F1KA 5JAZA 1XWFA 3F46A 4OH1A 1T2DA 3HJAA 4L74A 1YKFA 1ZMOA 4BO5A 1NTOA 4M8SA 3BTOA 3FBGA 4DXHA 2CDAA 4W9NA 3WWYA 3DC2A 3HN7A 2EIHA 5HS4A 3LYLA 1O9BA 5ER9A 1ZSVA 4LSWA 2Y68A 2FWMX 1PL6A 2E49A 4KOAA 4CMEC 2YFQA 4AJ1A 1IUKA 2P9GA 4AJHA 5A5FA 1WMAA 3ZU2A 1Y8QB 4YRDA 8ADHA 2Q99A 3EZLA 4ZQHA 4KZPA 1I30A 4BO3A 4C4OA 1LDGA 2NADA 3L07A 4J4TA 3GOHA 1NXQA 2W2LA 4ROSA 4G81A 3HG7A 4GKBA 3LLVA 3TWOA 3WIEA 1HDRA 5JE8A 3IL2A 1E6UA 4HX5A 1K6JA 4AJJA 1I3NA 4FN4A 1ENYA 1YXMA 2RH4A 1X13A 2ZKLA 1ULSA 2H6EA 1EUDA 5JCXA 4GKVA 2NU7A 4MIYA 3RUFA 1PL7A 5GZ1A 1CWUA 2NLOA 1IL0A 4RPKA 3UFXA 3VTZA 1B16A 2AEJA 4XWYA 4ZQFA 2DFVA 3GEGA 2VNAA 4H16A 1XHLA 4IS2A 2YHIB 4K26A 4W9NC 1BSVA 4P4LA 4TRJA 5JNLA 4BNMA 1DDOA 4MPDA 2VT3A 4RVSA 4XQ9A 5TC4A 4CV2A 3ZWWA 1T2AA 4J1SA 2HMVA 4NHEA 3EY4A 3WQQA 3ZW9A 4QUKA 2PFGA 4IUYA 3UXYA 5DBGA 3WGOA 4AFNA 2O23A 4NJMA 5A3VA 2C7VA 3HUDA 4LSMA 1KOLA 2J5KA 4JXKA 4ZQEA 1B8VA 2V65A 1LDBA 2QRLA 3L6EA 3DBHB 1GV1A 3H8VA 3WGHA 4BMNA 1PR3A 4LVCA 4GBJA 3Q11A 2C7GA 4GWGA 1H5QA 4NZ9A 3WGTA 2VRCA 3CEAA 3QVWA 1JVSA 3BMCB 3IP1A 3ZDFA 4OGWA 4YJFB 4DL9A 3S8MA 1OC2A 3WXBA 2RAFA 3KM0A 2AEFA 3KOUA 1NAIA 2VZ8A 4IDFA 2ET6A 1P33A 1ZH8A 1NPTO 1ZFNA 1JKIA 4WCDA 3OSUA 1NASA 3QWBA 3R3JA 3PP8A 3VVBA 1HE5A 2WM3A 2R6JA 2F00A 3O03A 3TZCA 4ZD6A 1NWCA 3ZV5A 1CIVA 3TPCA 4HBGA 2IDZA 2SCUA 3LZ6A 5IG2A 4BB5A 2WYWA 3KSDO 3BMQA 3GGPA 1O89A 1V3TA 1HE4A 4OOEA 4CLXA 1G1AA 2GZ2A 3I4FA 1UXIA 3ZWXA 3GMSA 4YAEA 2YQ4A 4ZGWA 4M49A 2XXJA 4A5OA 1HDGO 2VWGA 4AL4A 3IKVA 1JN0A 4OIMA 4TWRA 4OQYA 5GZ3A 3I9OA 5U4QA 3C1OA 4DTIA 4I5GA 2GO1A 1MFZA 1VM6A 1Q7CA 4JGBA 2C07A 3S55A 3HZZA 4IGFA 2HUNA 4ID9A 3WJAA 4FOOA 1DRVA 2VZ9A 5CEEA 1SPXA 2PKRA 3GVXA 4EW6A 2QZ9A 2G76A 2QHXA 4J4HA 1EBFA 4ALMA 2DT5A 3DAPA 3JQEA 2DLDA 3O8QA 3WR5A 5KNLA 4BHTA 2BFMA 3AY3A 1LSSA 2VHWA 4L8VA 5FI3A 3MEQA 1PGNA 1Y5MA 1NVGA 2QX7A 2HU2A 1DPGA 2V7PA 4BNGA 2X9VA 1VLLA 3QVOA 5IZCA 2F1KA 1GEEA 2DPHA 2HSDA 2GZ1A 3OHSX 2WYVA 4K1LA 1HZZA 1DIGA 4LMPA 4CUJA 4F6CA 1H6CA 1PZFA 3UW3A 2VYNA 5IN5A 3ZWBA 2HMWA 1ISMA 1ID1A 1PQPA 2CF5A 3BHJA 2GYYA 4E5MA 1RM4A 2QZZA 2OZPA 5AXBA 3ASVA 4YCAA 3K92A 3F1LA 1F06A 4YEDA 2GSDA 3GN1A 1EMDA 4EZBA 3MJCA 4U8GA 4CLOA 1ZK2A 3CKYA 1GZ4A 1PJTA 2ZB3A 4I8XA 3RBXA 1T4DA 1E3EA 3KB6A 1SAYA 4O1MA 3NUGA 4K28A 1FDSA 3NDIA 4B7XA 4D45A 3RU9A 2POQX 2R00A 3GLQA 4IJKA 4ZVVA 3ROMA 2DM6A 3WTCA 4XIJA 4B3HA 3VPSA 5I9LA 4HNHA 4PVCA 2IRWA 1UXGA 1LX6A 4CUKA 1HL3A 1K6XA
chains in the Genus database with same CATH superfamily
3BKXA 2PGIA 3ZXIA 1PEDA 3A1NA 3IVMA 4GDMA 2IU0A 3BH6A 1NKVA 1Y98A 4FHFA 5CT6A 4BQNA 4JZKA 4D98A 5IZCC 1KI1A 2JCSA 1OE0A 3H99A 4RJIA 2Q7XA 1N8NA 4YAJA 1HZZC 5DBIA 3W05A 4OLBA 2BJWA 2ZUCA 3PXBA 4U9HS 1IATA 4A26A 2O3RA 3BRWA 4PN3A 3F6RA 3CQ9A 1AXEA 1FYXA 4A92A 4KAJA 1GKIA 1JJ7A 2WFMA 4LYAA 1YDHA 1ZCFA 2ZR8A 4O02B 4AXBA 1IU9A 2O8NA 4DUPA 1DQNA 3F7TA 1T4BA 3FOWA 3PC7A 5JWRA 2V59A 1LEHA 5DN6A 1C9KA 3IAS6 1I4TD 4RSHA 4RY0A 4EI2A 3ODPA 4LC9A 4FZRA 5HFAA 4BVEA 2IYAA 1RHKA 4JLJA 4YJDA 1CUSA 3TL6A 2R60A 2Y1KA 4BPBA 1P7VA 5KMGA 4CL2A 4MEBA 1S2OA 4V1CI 4AY6A 4ZAWA 1T3LA 3EOAI 3AF3A 3JQAA 4ED9A 1DV2A 1N6RA 4WLFA 3ZDDA 2XY4A 5KVVA 2W2TA 2ZPTX 4O4JF 2NUTB 1WHTA 1FX0B 2D4AA 2FA9A 2HZ7A 3GJ5A 2GXSA 3JV7A 2I2BA 3CVOA 4QT0A 4BE4A 4WNAA 3TW8A 4BX2A 3Q88A 4F5YA 2OT3B 5L3VA 5A6SB 5BSVA 2BC9A 5IPFA 3BAZA 2ZUDA 4FGLA 3ZCVA 4EPTA 2I55A 2PIAA 3GFQA 1Y4SA 4MR9B 5FFMA 5AKIA 1SD1A 1X7ZA 3H1AA 4DLXA 4AUKA 4MUEA 5FLXA 6YASA 1U2GA 3H6HA 1NLZA 4JBGA 1ZIXA 3FFWA 3DWEX 4Q47A 1LXCA 1HQKA 4GQAA 4FMCB 3VZQA 3UGKA 3GPLA 3BCSA 1SUBA 3RRXA 1N3IA 1X1TA 4CMGA 1NYTA 3IC5A 1GTVA 3NCTA 3QWFA 1WO8A 2ZI7A 3DEHA 2IUSA 4OMFG 4QU8A 1EVYA 1KI3A 2GDJA 4TQUS 2K2WA 1NOIA 3DV9A 1TJNA 3NP9A 3OZDA 4OJTA 5F33A 1J1UA 3V4LA 3WWEA 3TLMA 4ESVA 4RFVA 1RAIA 1MW9X 2EFEB 3DTYA 2FMIA 4P5DA 1PWEA 4EPVA 1KEUA 1IZ7A 3I23A 1I13A 3ONFA 3M2PA 3KR2A 1QIHA 4L57A 3CF6R 2FDRA 3FDZB 2GZ3A 3KZVA 4JEMA 3B1VA 3G68A 3OECA 1U2RA 4KQIA 4RENA 5ARDA 6REQB 2FPIA 4XIYA 4HL6A 2QL5A 1DTEA 4JYCA 4Q4AA 3A0UA 1D0SA 3QYAA 1UXJA 4B6OA 2WU1A 3UT5B 1XT6A 2QQEA 4QM7A 2D74A 4FNAA 5GJBA 2RHTA 1XZBA 2YJTD 3IT1A 5KYUA 2HU7A 2YJ6A 3DEZA 2Q3MA 2P79A 3LOPA 5JWHA 1XV5A 3I2HA 1Y9AA 3Q9UA 3S2IA 1TIPA 2WYIA 4Q0MA 4D4HA 4J2OA 3GEBA 4WQMA 1FF9A 1XZNA 1VC2A 2I6SA 4NCHA 4E2YA 1CDDA 4WA7A 1HLFA 1H4SA 4BFCA 3SU8A 1YBAA 3HKEA 4DYHA 1MC1A 4B9EA 3THYA 2BTQA 3FPFA 4UQLA 1Z75A 4R71A 1CJMA 5CLJA 4XD2A 3PE4A 3WDKA 1PR6A 4GYJA 4R1TA 4M0FA 5D85A 4DPKA 1M34E 1S7CA 1A95A 3D7SA 1A2KC 4MK4A 2OBNA 1RRKA 3HKBA 4QDJA 2AQIA 1BKSB 1TMOA 4TT3A 2PSFA 1JL3A 2WM2A 3TQHA 4ARZB 1NXXA 4E32A 3GO4A 4Y9TA 5D5QA 3GLFA 3GLIB 3A6PC 2FUEA 2QUAA 4UXIA 3ZI4A 4I5IA 3I9FA 2GCNA 2J32A 2M1XA 2XUGA 4WCFC 2FF7A 1MB3A 2OCBA 4R2LA 1GQQA 1JYFA 4PEVA 4DEXA 2PN1A 1L5HB 1PZGA 4XARA 4H2DA 4KEAA 3BXPA 5DRTA 5HF6A 3HJRA 5AHRA 5CXUA 1SXJC 2EBUA 2W6JA 3IQEA 5DM2A 1RLOA 1IXZA 5FWNA 2K6GA 4FCWA 3EEBA 2JB9A 2OWDA 2FE1A 2NZVG 2X1HA 3TQIA 2B5WA 1E0JA 4QLBA 4XIFA 5F3RA 3MQFA 3IEMA 4PICA 3WK5A 1F2UA 1DG3A 2RBEA 3SSMA 4U7GA 4X1YB 4UTXA 2DYKA 4HGRA 4BAZA 1REQA 4BGVA 3PD7A 3BUSA 2C96A 1C0EA 3RANA 3GLTA 4CI0B 2AG5A 3GVIA 5ICSA 3K2EA 5EZ5A 4LFBB 3M9XA 1GPYA 3AM3A 3M5DA 5G4LA 3JCZA 4K8RB 3GAFA 3NIWA 4NK4A 3GT7A 2ODWA 3I2KA 1Z6XA 5AXCA 3VOAA 4DSAA 5I4CA 3WLRA 5IJ0A 1FNCA 4Y9UA 4PX9A 5FOUA 4L4SA 4MP6A 4AJEA 3ZGZA 3G2NA 3MPUA 1L4UA 3JZFA 4CN8A 2H7CA 1RYNA 4X1IB 1WEKA 1ZD2P 5KNCA 3AEKA 2Q1WA 2GCGA 2NTYC 4S1VA 2CBGA 1B73A 1QG4A 2OORC 2F7SA 2VXCA 3MAAC 2OILA 3MF4A 3N86A 4W63A 5MF6A 3DVRX 5DK4A 3PD1A 2OXCA 2PJUA 3PGMA 4FD2A 4KNVA 5KYWB 2J08A 3FF4A 2ZK7A 2IIPA 4F6RA 1WULS 1SBTA 3O83A 4TRNA 1RI5A 1WF3A 2VL7A 3KUKA 4WEQA 4BNDA 4XYGA 3TSCA 1UMDB 5C1DA 4EATA 3MWGA 4M83A 2XOKD 5FBLB 2ETVA 2UUAB 1E3DA 1T0PA 4J07A 4RTSA 1XMIA 4YUZA 3LUFA 3GY0A 4IJ6A 3SC3A 2D1FA 3ZZMA 1DEKA 3WLPA 1W9HA 4ZICA 2J33A 3TD9A 3B1YA 4U2DA 4LA4A 1E6CA 2XCQA 1T9BA 5K0TA 4Y7DA 3CE6A 4IJUA 2ZJ3A 3GF4A 5FPPA 3GT4A 4YJGA 2BR5A 5I51A 3O8CA 3GLIE 2DWOA 1QSGA 3ZCPA 3EOBI 1E1CA 2JFGA 3WWPA 1MAHA 3MOIA 5FR1A 3E7WA 1B4DA 1X7YB 2QTTA 1GKYA 3WL3A 2FR8A 3HR8A 2XV1A 3ZLJA 1CEYA 3VKHA 3OHPA 1F6DA 3DP7A 3O2NA 3E18A 1VMAA 4UUBA 1S89A 2AVNA 3BBLA 3AR7A 4YHBA 4EHDA 8LDHA 1QFZA 3A9RA 4UNNA 3UXMA 4Y1EA 1SCQA 3QFFA 4LFAB 1OTHA 2A0YA 4XR4A 2P6MA 1N5KA 3B51X 4TLCA 4YAOA 1U11A 3SN6A 2HJRA 4MOWA 4MDYA 1VYUA 1BMTA 1W6UA 3PI7A 1ZG3A 3Q3JB 3R4VA 5TQ0A 1VSQA 3K8QA 1LBQA 2C2HA 1VJTA 4FB5A 5LDDC 2Q4DA 2H54A 3ESYA 5I8PA 1HMPA 1VIYA 2FUKA 1PGQA 2PSDA 4NFYA 3GNSA 3ZN2A 3DDCA 1OIVA 3R0XA 4P82A 3UK7A 3ZNOA 3VC7A 1IHUA 4PAQA 3EVDA 4Y2HA 1GAQA 5D2CA 5JASA 5K0JA 1UK7A 3U17A 5DW0A 1C1DA 1SZDA 1ISIA 1UXKA 3KYCA 2AN9A 2CWDA 1T3TA 3LG2A 3PCXA 4WD3A 5HSGA 1UJNA 1I4DD 4YRJA 4D4JA 1G5RA 4B7AA 1OGJA 4HXFB 4M6WA 4C3ZA 2BCJQ 4MQUA 2Y1CA 4TKLA 1Q0PA 4XVHA 1QK5A 1YZQA 3VAZA 1GSHA 2OHIA 3SJ7A 2YXLA 4D9IA 3P9NA 2W8BB 4DA4A 1ESCA 3OFVA 1U98A 5CXXA 5I47A 2B6HA 2IXTA 2YZNA 4YPVA 1O95A 3GRFA 3CO5A 3OM0A 1EGHA 1WCXA 3FAKA 5HRUA 2NTJA 4NJMB 3DZ8A 1T5OA 4GH5A 1BKYA 3D8NA 1GRVA 3WNBA 4EYSA 4ZT5A 5KSYA 1WB6A 5ITVA 2WP8J 1H8HA 3A2KA 1DIOB 1PR2A 2D2IA 4HWSA 5CYGA 1PR9A 1KEEB 1XYGA 1W0JA 1G4AE 4R1QA 4CV1A 5JZOA 4OLAA 2QDKA 3REQA 1WXGA 1RJFA 3Q0TA 3T7TA 3WKBA 1JEYA 5AI0A 2QRMA 3DE0X 4EHJA 2I76A 5SY4A 4U2CA 1A9OA 2B1GA 2GFHA 1D2GA 1E77A 5BSRA 3RYHA 2B3TA 3R0VA 4UNRA 2R8BA 5EQJB 3JPYA 3EFOA 4A16A 3RADC 3WAJA 1XMPA 2KBFA 4C0BA 4GOKA 3RABA 2Y6VA 3T1TA 5GOZA 3P45A 4FBGA 5FRDA 1SB9A 2R86A 4UOZA 3WLAA 1JB9A 1EYZA 3FZYA 4Y2UA 1P0MA 2P2NA 2FN3A 4QOHA 3VUEA 1I8TA 4FJ1A 1E3SA 4WJZA 4P4GA 2GBLC 1VHDA 4MYHA 3UGTA 4QICA 3DPUA 5LQNA 1DOAA 2B35A 4UTOA 1JIQA 3C6KA 2I67A 3CUUA 3I2YX 1SU7A 4HPJB 5CEFA 1L3IA 2DUJA 1TFUA 4N8DA 3OPMA 4ZT4A 4IWNA 2IVFA 3OURA 1WHSB 3BXGA 1RC8A 3U3MA 1JDUA 3R3XA 2Z58A 5BQOA 2C57A 5DCLA 5TMEA 4EOGA 2BWJA 2E4XA 2REQB 2FG7C 1DKUA 4YS6A 1P3Y1 2P9FA 5EKUA 1P18A 2D2XA 4F8EA 2ZWIA 2DAPA 4BO2A 2FSUA 5CYFA 4YVFA 4A0FA 2WU8A 2WSSA 1LRJA 2YIVX 2QN8A 1IONA 1TZ2A 3KHSA 2C9CA 2G07A 2H1RA 1DC7A 4N7BA 4W6QA 1Z2AA 3BHIA 4KNWA 4LISA 3ZDXB 3NNDA 4MVWA 4F9GA 4ZDKA 3KK0A 2PE5A 1V9LA 3AHGA 4P84A 1R6DA 2WJPA 5EYPA 1U8UA 5AVYA 2X4IA 3G2OA 3PXCX 5EKSA 1T1EA 3ILXA 1P5FA 4KJZA 4TV9B 2FDXA 1Y1TA 3ZWQA 2F43A 4OU4A 4D56A 2JVKA 4IM7A 2IYTA 4KWIA 1V1JA 4MWEA 3VR5D 3ZBQA 3B1FA 4RF4A 1FLVA 4ZAFA 4D44A 2CV1A 2IZ1A 2WVGA 3D64A 4CIBA 1G21A 3EZYA 5T8KA 1GTMA 2G67A 3IDAA 4UUPA 2MYNA 1HDCA 5K3SA 1C3OB 3RE1A 2A7QA 4C4SA 1JEQA 3AHEA 4V39A 5FDFA 4RV9A 1JR6A 1XTUA 1JDSA 1MORA 3A4LA 2VNKA 3BERA 1KSJA 4G4SO 4RC9A 1V7ZA 4BNJA 1Z35A 1O6FA 2BKXA 2OB1A 2V7UA 2BE9A 4L9WA 4JS0A 4JHXA 1Y37A 3IB3A 1ZM2A 4YH1A 2FWNA 1AS3A 2IW1A 2IY8A 2YNMC 3HDGA 3SHWA 4TWJA 1LX7A 1ADJA 3T3EA 5IDWA 2BIFA 4PX5A 1C8KA 3AF2A 1POXA 2AW3A 1D4FA 3FHOA 3A1TA 4JLPA 3W79A 4E1VA 3L93A 3QU7A 3GZNA 3M5PA 3X43A 1G5TA 2XJ9A 4RSGA 3K1AA 2W2OA 3Q3CA 1BDHA 4NAVA 4EGSA 1RM5A 3UAXA 1GZ6A 5EZYA 4E0BA 3ZVMA 4ZOEA 3OU7A 2GTHA 3ZTWA 2JZCA 4O2BB 2VTVA 3OE5A 1EK2A 1U8YA 4HGQA 4FS8A 1BHSA 5FBRB 3ZWOA 1N6IA 3IDFA 2J87A 3EPRA 4BQPA 1ONBA 2JW5A 3ILYA 3UKDA 4EUEA 2CXHA 4H1VA 3VNAA 3BG5A 4NH4A 3ERCA 1UC8A 1HORA 2TRSB 4JR0A 5E4TA 5B4UA 1Q16A 1R0KA 2HQRA 4RVGA 5CNIA 7MHTA 5G0WA 4XJSA 2WTUA 1LK0A 3INNA 1NLYA 3QW2A 4AMYA 2ZCUA 3L2OB 5LKRA 5BN5A 3L8ZA 2EZ9A 5I9BA 4DCUA 1CR1A 1KZ1A 4AULA 2A0XA 3VR6H 2ZYAA 121PA 1E3JA 2NZWA 2HA0A 2VJDA 3AESA 4EL5A 1QKKA 4OM8A 5JNTA 4JB3A 4I46A 1EK0A 3HB1A 2WV7A 2ZKIA 4TKUA 4K9MA 2XMBA 3N7UA 5AO9A 2EYUA 1S96A 3D8TA 4W5HA 3EA5A 4ZVNA 1XJQA 1UJMA 4XUGB 2UZ3A 3BGSA 2EHJA 1JU9A 1RWVA 2VRBA 3D0OA 3RC3A 3TUJC 3OOEA 1ACJA 1GDHA 2QRJA 1E8MA 1FDRA 4B6PA 4CCWA 2GRUA 4BJ3A 2Y0PA 721PA 4WK2B 3IAHA 1QWOA 4X94A 4MQ6A 3EH1A 3G6KA 3K0KA 3UHFA 3QF7A 4BN0A 3KT0A 2PYZA 4PC6A 1MX5A 4ER7A 4X97A 2QAGB 4CM4B 1X14A 2HWYA 4WJLA 1OXTA 2XTNA 4HN2A 2UVQA 3B89A 4IY1A 4YB8A 4FSXA 3STWA 4YLYA 5EJEA 2WR8A 5NULA 4ER5A 4HNVA 3A2NA 1A9XB 2QD2A 3UWSA 4S0ZA 3T1YB 3FCXA 4QAJA 3D2CA 5I9TA 5EP2A 1PT7A 3N58A 1R18A 3LWZA 4QJ5A 1J97A 1J5XA 4Y30A 2HRBA 2XNKA 3RQIA 2UXDB 2IS1A 1KRXA 2BMAA 4RVOA 3TCNA 2B8WA 1VPLA 2BHSA 2PKQO 1NVAA 5DHTA 4UAJA 4MB6A 3HYSA 4EHIA 3UHOA 1L9KA 1QWSA 4NE9A 2AQHA 3BSFA 1D4AA 3DQPA 3P5SA 3WMEA 5BVHB 3T54A 3QKWA 5C7IO 2WAOA 2CHQA 3BWDD 1CE8A 3V34A 1HFEL 4O0LA 1UK6A 2I1LA 3A2LA 1QIIA 1IBRA 3O4GA 4I9NA 1D09A 5THQA 4ASUA 1NJ8A 1P45A 5A04A 4RTMA 4DV5B 2PT7A 3LYHA 4L50A 3VRHA 3NYIA 4B85A 1N2BA 4CMIA 1ZD5A 3KLBA 1IZZA 4HN9A 4I8DA 1YUBA 3ROEA 2CXOA 2X0IA 1MU0A 1KR5A 2E1PA 5CX4A 3DKIA 4F11A 5HHTA 2SKCA 2FZ5A 2IYQA 3CV3A 5KJEA 4AJLA 3ENZA 3L0ZA 1IWOA 3PHJA 3O4VA 4IBOA 3LLMA 1QORA 1NP3A 2CL5A 2CNWD 2YXNA 3AWIA 4BZQA 4TN1A 1ZVKA 1G8PA 4OBBA 1JAZA 5DLYA 4YAWA 2AJ8A 2DFTA 4I9HA 5CIYA 1PRYA 1QS0A 1T8YA 3C3CA 4U7DA 1KYWA 4E5PA 2IOFK 3ZLVA 2LNDA 5EJ7A 4EHNA 4TTQA 1Q6ZA 3FYUA 3GLGA 1PW7A 1HWYA 3W6UA 4X44A 2XKKA 1SVWA 4RJLA 2EG9A 1CCWA 3X1XA 1Z6GA 5TPZA 4WASA 1Z16A 2AMVA 2MSLA 1JTFA 1K0FA 2YMQA 1YJCA 2G08A 1IZYA 1PAUA 4Q3AA 4PGHA 1X7HA 1JR3E 3N0RA 4GYWA 4Y9SA 1RIFA 2B1RA 5FL3A 3SF8A 4ARAA 4QYIB 2Q6OA 3QBVA 3V1NA 2QM7A 3QTTA 3OM8A 3OOWA 1KVSA 2CZCA 2HHLA 2C58A 3G17A 5DULA 4C0XA 2NAFA 5JYDA 3TSOA 3MLEA 4BNYA 2X0RA 4R0VA 3NC1C 4YDQA 2UZAA 4FI3C 4NHOA 3KO8A 2H7VA 3PK0A 4Q3OA 2JATA 4QBHA 3UJ7A 4EGCB 1KRWA 1TT5B 4KTVE 2JASA 3GFRA 1LSJA 2QIOA 1E6LA 1YR6A 1QNFA 1C4OA 2PG3A 3CB2A 3PWZA 1FW8A 2VNIA 4ZYXA 2XMGA 1S7GA 5EXPA 3NQ41 5KBYA 4GGPA 2UYQA 1SVLA 2I2AA 2FPSA 5KU7A 4F6LA 3UFBA 1JKXA 1P73A 4UVDA 3U61B 2VAXA 2R7KA 3LXXA 4GFDA 2ZULA 2FPUA 1A8IA 2ORED 2H92A 3JSAA 2VDWA 4HD8A 3PT9A 4ETIA 3U1BA 1SBYA 3BE6A 3IP8A 2UVPB 3TH5A 4I8IA 2QVBA 4MA0A 2GJ8A 5FWXA 3DW1X 3VPFA 1YJXA 1E4EB 1LH0A 3ELBA 4KN6A 3TNLA 3M1IA 5CYPA 1YZTA 3HJBA 1G8HA 1EE9A 5UKDA 1LPBB 4TV8F 3R7WB 1C1XA 1Y5NA 3G8CA 4IINA 4OAOA 1X42A 4YR9A 2CXQA 2B34A 1C9JA 3L4EA 4KXQA 4FNGA 1YD7A 2XVAA 3CUEF 2FAXA 4GZ5A 3WIDA 5CLFA 2ZT6A 1S3IA 2WJ6A 1H2HA 3G0BA 5DHFA 1MO2A 1RD4A 3NYQA 5FR2A 1XPJA 1Q7EA 4JGGA 3CPEA 3EZ7A 3KWJA 4FEAA 4FB4A 2GZSA 3UICA 1CUFA 1UM9A 4M1KA 3HJNA 1FDTA 4CMBA 3MWEA 3A25A 3HJHA 3JQBC 1TD9A 4D3SA 1ZK4A 1P2DA 3D0KA 3GJ8A 4MVJH 1KPGA 3SHQA 4TL6A 4B6SA 4E70A 5FBVB 4HRYA 1H69A 3KQKA 3C87A 4XDZA 2JGFA 4D41A 3D8UA 2GUGA 1WUHS 2VHQA 3WG9A 3UUFA 1B23P 3SKVA 3C8MA 3N6XA 2D5CA 1JH8A 1QNLA 2BCGY 3FCSB 1L7BA 1MO3A 2XYGA 2BGLA 2ZFUA 5F9MA 3HCCA 4YPFA 4OTZA 3R3VA 4FYHA 4TTVA 4Z4CA 3TKYA 2D5LA 3OH8A 3SHOA 1U3CA 4MW7A 2M32A 3VKVA 4D4GA 1GZ7A 3AIOA 2WP0A 3T9FA 1VYTA 3NHYA 4XW2A 4Q1DA 2C0CA 4P8RA 4MYTA 4UHBA 4HDNA 1VECA 5H4GA 5AQ1A 3H9JA 2DU8A 2BGGA 5JVDB 4ARSA 4C88A 2V0GA 3CGWA 4GP9A 2WA1A 1BC5A 2WK1A 4LYGA 4UEKA 1W36B 4JXXA 1MV8A 3PJDA 4H6XA 3TLBA 4PR0A 1F12A 3ZYZA 2V7VA 3QVGA 4BV2A 2QLLA 1PUJA 3QX8A 2NO0A 4JI4B 4LY6A 2FCRA 5TPWA 4MV3A 2FY8A 3AILA 1YB5A 5CH5A 1VG1A 4ZGGA 3MT9A 5DHQA 5FPHA 5L40A 3MGAA 3UG7A 1B8OA 3QXGA 2R751 3EVCA 4QEKA 1AXRA 1K08A 2H1WA 2HX1A 3L8EA 1OAKA 2DF8A 3B1KA 3VJRA 5BRAA 2A5YB 2QG6A 3Q6MA 1MNQA 3N8NA 2CL7X 1AURA 5ALKA 3RK0A 5EIEA 1N2OA 3GLRA 3F7MA 4EL0A 1QCYA 4RKFA 4IIHA 1A27A 5LZ5A 3BCUA 4MV6A 3TR0A 2H1HA 1J2JA 3HKDA 2WHPA 1DX6A 1V1RB 4J0IA 1CQJA 1J4AA 1U2SA 4PC2A 1JPJA 4NFHA 4ZZIA 2AI2A 1EP3B 3ASYA 1TO2E 3E35A 4MP3A 3PR3A 3V2UA 4N5DA 4OGKA 1CS0A 4B4WA 1Y7PA 4MDHA 5DGCA 3DSRA 1H9BA 3H18A 3FKJA 4FHDA 4BLRA 2LPMA 4D74A 3P20A 2V0NA 3VI4B 1JQJC 1P1RA 2FETA 2WD7B 5CAEB 2BMVA 3JWIA 2H0RA 3PL5A 4EGQA 3JQFA 2FWPA 1OPRA 3D59A 2O2EA 5ESWA 3M83A 3TSWA 1E7YA 5AUPB 1HX7A 3VVLA 1WB9A 1QHIA 2V54A 3IMFA 4RCZA 2J8ZA 2O0LA 2VBGA 4ZVPA 3BGVA 4TZ6A 2M98A 1XZEA 1J24A 1ZRSA 2CMGA 4OQ4A 3H5IA 3DXXA 1U3GA 1P81A 1QGYA 5DBHX 5L51A 4AYTA 1YH3A 1Z7BA 2X1VA 4R1SA 4PF1A 2JVIA 2BSAA 4URWR 4Z9YA 4YROA 4WHMA 5A4FS 3V2HA 1DBSA 1OLXA 2C61A 2HL6A 2HK8A 3WBJA 5KWJA 3LNCA 3S2FA 1ZNQO 1NVXQ 3HO8A 4ZVQA 4A91A 4C3VA 2O06A 5DWQA 3LNTA 4Y9RA 3ZZ1A 3TXXA 5CVDA 4FN5A 5JAQA 3T5MA 1JFFA 4IAOA 3ZWAA 1OA1A 4FX5A 5LQJA 1MGOA 4KQMA 1JKJB 1UP4A 2FHSA 2KW5A 3AHFA 3BWEA 4NK5A 4TWIA 4XYMA 3ESZA 2A67A 1HQDA 3VPAA 5E3IA 1M8KA 2VF5X 3V4PB 1X7WA 1TU4A 2F2TA 4ZHSA 1LPSA 3L7IA 3K0SA 4DQKA 4Y2GA 4DUGD 5FUMA 3F9IA 3R6TA 4BEBA 3D6VA 4QBGB 4X8MA 1BH6A 1ZY2A 2OV4A 1Q77A 1J07A 3SG0A 5BNWA 3R7DA 1OX4A 1PJRA 5KWEA 4P3PA 4XVCA 2YQ5A 4D9BA 1N4AA 2VPXA 3ZTTA 3PHIA 2VQEB 1L7NA 1V1MB 2DJ5A 1P44A 2W8ZA 3KD2A 5G1OA 3LYUA 4YWJA 5IC6A 5IH3A 2L82A 3ROQA 5E8RA 2OV3A 2XODA 1I7LA 3UMSA 4UBKA 5J23A 4O4HF 1XQ6A 3ES9A 3KS9A 1ZICA 3QNWA 4JBIA 2WJVA 3QF4A 4UZFA 2B21A 1PG5A 3DAFA 3ABQB 4AK9A 1U0FA 4HGZA 3JQ9A 4L73A 4EECA 1FNNA 1ZMXA 4LCBA 1X1QA 2X3FA 4H7EA 1TU3A 1VRWA 4BB6A 2BM1A 3GJZA 3DZHA 4XSHA 4GMGA 1XZ8A 1C7EA 2P9YA 3CUVA 4RHUA 4ZAVA 2CUTA 2JANA 4S3MA 1OZAA 2QAJA 2W2QA 1TZMA 3V7YA 5IF3A 1QDLB 2R47A 1SNYA 3AEYA 5AJWA 4C9BA 4DC9A 3VUFA 2W6CX 5J2UB 4EUKA 2PTGA 5A5VA 5B6PA 5JQWA 3SJUA 2VK4A 3M5WA 2Y1XA 1TCUA 4AYXA 1A4XA 1C4XA 3I2GA 2LZ0A 4JLSA 2II6A 3CX6A 2EAUA 3AMVA 1XK6A 4L8GA 2OEPA 2XD9A 4RZXA 4M9RA 5BMVA 4LK3A 4URFA 3JQ7A 3ETJA 2NYUA 5KTOA 4BRWA 1QGUA 1RQLA 4B3CA 1U9ZA 1Y34E 4IR7A 5IP5A 1DIAA 3PGVA 2VJPA 2V1XA 4GRIA 2E6UX 1QV7A 3BB3A 4HADA 5JPDA 4I55F 3TZKA 1MC8A 4JIGA 4AZ0B 5KYXA 3U7JA 4YACA 1W5TA 3CHYA 4MKZA 4P0QB 4ZV7A 1T0HB 4DM4A 1XTTA 1K0UA 3CW2A 3P9CA 5T7BA 3JR3A 3F4LA 3KAJA 1H2AS 4EO9A 4PSAA 2JFOA 3AETA 3D3JA 2QUKA 4HS9A 3V32A 3WSTA 4CEIB 3H5RA 3D8SA 2BBTA 4HX9A 5BW4A 3NP7A 1E0AA 4DOMA 2C5HA 4HBZA 4RYLA 1NMZA 4CHTA 4R0MA 4LOIA 2NMVA 2P4UA 2A92A 3DT6A 3S7TA 3VYUB 1SO8A 1Q0SA 4KHZA 4B6QA 1FTYA 3M6AA 3PC2A 5U1PA 3IP3A 3MJDA 4MI1A 1QHHA 4A82A 1HURA 1RRVA 3H2ZA 3OCYA 4PZDA 2XA1A 1MUUA 3T7SA 3TFOA 3R40A 2Q3CA 1V8DA 4RL6A 4CQMD 2RAPA 1T2UA 3M6UA 4CEJA 2QTZA 1U7TA 1R0BA 5J4HA 2CDBA 2I71A 1SOWA 4OI4A 4XSGA 3FYSA 3G8AA 4F8YA 4RK6A 4DPLA 1N5JA 3KELA 1JLRA 3EXIA 4JNKA 5HNKA 2OMKA 4IXTA 1OH8A 3EOZA 4XM2A 1KPIA 3LC7O 3O1IC 5HKKA 2O8CB 4G8JA 1NAHA 1V47A 3ZDBA 3NT2A 3SC2B 2Z8YA 1VGRA 2BEUB 1CT9A 3DDHA 1JDBB 4K9DA 4N5LA 3VR0A 3DZDA 4RE5A 3ZHBA 1OU0A 4CIVA 1ZR4A 3Q72A 2P3QA 5JZMA 4QGSA 1BX3A 4U3JA 3CH7A 4EI7A 3DXZA 2Y0DA 1KQNA 3UXEA 1Z0IA 1MOZA 2BHTA 2UVDA 3GJRA 3H11A 3QVTA 4LRSB 3RS5A 3RC9A 4WNYA 4LOJA 2AUNA 4I5DA 2PZAA 2ONKA 4R05A 4EJ0A 1TE2A 1GUYA 4OBWA 2OV6A 4FEGA 2XLBA 1YZVA 5HQ3B 5K2OA 2ECKA 4OBEA 3KOOA 2RI1A 4P7BA 1FSFA 1FPMA 2AJDA 3IQDB 3QBTA 4KUEA 2ZJ4A 1TJPB 5GVRA 2QA5A 3C8UA 5KYVA 2Z8ZA 3ADDA 1FP7A 2OQ2A 3PDHA 5E0KB 1Z5OA 3LCRA 5T4FA 1DKOA 3KQPA 3P9KA 3PQ2A 2I66A 4WMLA 4CHGA 1J21A 2XIJA 3E4DA 3O8NA 5H68A 1W0KD 3VKUA 6ADHA 3HXMA 1Y6JA 3T9EA 1V71A 5AW4A 2CMDA 3FDJA 4PZUA 2VUSA 2WDZA 2WMNB 4LRUA 1U63A 5CW1A 4F84A 3S81A 1IB6A 1CR4A 3KYBA 2CXRA 3IPRA 3O4HA 3OEED 3WLFA 3MA0A 4NCKA 1DXOA 1S8AA 2FW8A 2WWXA 1UM8A 1DUIA 3GGSA 2B3DA 1NV8A 1QCZA 1S4QA 2VJYA 4G4IA 2Q5CA 2I9KA 2CL0X 1LK5A 1IDN1 1BE8A 1M83A 4NARA 4XH9B 3L8HA 3V42A 4NRDA 1AKNA 1TM7E 1TQHA 3QXSA 4WN9B 1RJ9B 1QPBA 1CSEE 4L7VA 4LRXA 1PG0A 3TLAA 3FYDA 4WL0A 3MTBA 5ADVA 3CSDA 4O4IB 4ZDWA 3T52A 4XSVA 3QQ5A 4ALKA 4EUFA 1O0CA 1G4HA 3MNFA 1ZYUA 4LDAA 4FGKA 2CNDA 1GPUA 1N5MA 3A3PA 4H7PA 1JJAA 3AKDA 1RYMA 5FV4A 5SY6A 3D3QA 2C99A 2V8OA 3W4IA 4RH3A 4IZIA 4EBFA 4NC9A 4Z3KA 1FC0A 1IM5A 3CLUC 3NGLA 5GINE 1G7RA 3CPSA 1CLUA 5K8JB 4RJJA 1M5RA 1UT8A 1YJBA 3EAQA 3OOYA 5D6NA 5FBQB 1O94A 4KREA 1XA3A 2ZI3A 5GY7A 5BSTA 5JS8A 2AOTB 4RORA 3EXFA 4WXEA 5FTWA 1N2HA 4F8JA 4R7ZA 1AJEA 3A9VA 4DUYB 5JQGB 1ZRMA 3WLHA 4E2XA 4L08A 5G0VA 1OREA 1Z0FA 2PMCA 5LA6F 2X13A 221PA 4HDSA 3ZWDA 4A0RA 2MINB 3KAPA 3ETEA 1K3TA 5LBTA 4ON9A 2QTFA 3HSSA 5GONA 1R50A 4F92B 2R6CA 2GSWA 2AI1A 3WGVA 7REQB 1KFKB 1K6IA 4MHOA 5IFKA 2PJRA 4O5AA 3TE6A 2A35A 2XCRB 1H94A 2XPCA 2R6ZA 1IY8A 1JIIA 3ZCRA 4X95A 2J5RA 3W6ZA 5CM8B 4GD3Q 4K87A 4P4TA 1FP4B 1HDXA 1SOVA 4YT4A 1J00A 4X6UA 2Z2IA 4HLCA 4JC5A 4M7RA 2EZ4A 2O5CA 3NBMA 3GDOA 5IXYA 1M67A 1Z2PX 4JYBA 4ZIRB 4G5XA 1Z7YA 4YQYA 1E3WB 4ZK2A 1J33A 4L8LA 1EK6A 1ZI8A 3GJ7A 4XX0B 5CTJA 3LS2A 4LJ9A 3UHPA 2QYTA 3GIDA 4MKIA 1MH9A 5PGMA 1ESDA 3DMPA 3EG9A 3N0XA 1KMCA 5JNUA 5HDBB 4V0OA 5AVRA 1KY5A 1T8RA 4FDUA 1EFDN 1JJIA 2OENG 3GFBA 3MN1A 4N9WA 4F46A 3PEYA 5FWYA 2P6OA 4MGEA 4G07A 4BP9A 1XP8A 1AKQA 2I22A 2YVLA 4PZYA 2ID7A 5C3MA 1N78A 4NOJA 4IDEA 4J0DA 3L8CA 4UUOA 1J1ZA 1D07A 2N75A 3MTIA 4NBTA 5D00A 4S05A 1VPDA 2GLTA 2R1TA 4I3GA 4YYZA 1E2HA 2WIAA 2WU0A 1YB7A 1ECFA 3VR2A 4BNVA 2PDAA 3A6EA 3MCWA 3DL7A 4I2NA 4XYBA 2D7JA 2VYQA 3GI1A 5TMDA 1UC4B 2C88A 2DBZA 4GPD1 3ZHSA 2OO3A 4ILEA 2IITA 3WGMA 1VJDA 4IFIA 3M33A 2YWFA 2FSPA 3O2SB 3P8ZA 1GU7A 4I66A 1COZA 4Q39A 3TOSA 2FG6C 4PXSA 1FUKA 1Q22A 4IP0A 2ZAIA 3AHIA 1F38A 2Z9BA 5A9TA 4FOLA 1M73E 1OW3B 1MABA 3SJZA 1ZCZA 2FVXA 5C8YA 3U7QA 2R7MA 3LC1O 1W8DA 3OT1A 1GKKA 5B58C 2QJTA 5K0FA 3DB2A 1INLA 2I4IA 3HI6A 3ICPA 1T35A 2HNBA 3LPMA 1RWWA 2SHKA 4G1FA 1P62B 1QUFA 3K9QO 1HLDA 4S1TA 1VJ1A 1BQ4A 3HRIA 4CLOB 1LTQA 2Z2JA 3NW9A 4DWWA 1YO6A 3CVVA 1EUCA 2AVDA 1W4BA 2V3WA 3QGMA 4KX5A 4YECA 2I8AA 3JYOA 3COJA 2P6UA 1UPCA 2Y67A 1ZRHA 3RC2A 4OXQA 1ISJA 2BDEA 1C1HA 1NFRA 1FQOA 2A33A 2EFHB 2ZYIA 2YXBA 3GCGA 1Z83A 3KVNA 4B34A 1EM8B 3I9LA 4M0MA 1O2DA 2R6R1 3ZGVA 4OATA 1P29A 3IQXA 4CF5A 3JYHA 1QH8A 2K5UA 1AM4D 2Z2YA 3JD0A 2W4MA 4CCYA 3P0JA 2RDMA 5FL7D 3EVBA 4NU5A 4C0LA 4C4XA 2WI8A 3OZWA 2HLNA 4C7BA 3WA7A 1EWQA 1SULA 5IJAA 1VSVA 1DPFA 2R25B 4Y2QA 4NBKA 3FGPA 1ZNZA 2FQYA 4GVPA 3VM6A 1RC0A 2CJYA 2CVPA 3TLGA 3R09A 4S2UA 5DLPA 2M9MA 4CT0A 2KSQA 4O1IA 2NPFA 4FEEA 1EZ1A 4U9UA 1S9DA 3VOSA 2G0TA 3BZUA 2RI6A 1NJ6A 1U94A 3OEHD 1W5EA 4W5RA 1RU3A 4HO1X 3DGEC 4JOBA 2WJ3A 3ANMA 2QAIA 4CLHA 1FQJA 1XWIA 2VK1A 1PI3A 3A4TA 3E5RA 2W4IA 3Q3EA 4ITUA 2IK8A 3L7KA 4WZAA 4RD4A 2C4WA 6Q21A 5KPDA 5JCJD 2PUEA 4EFDA 1EGVB 3L40A 5DHSA 2FMUA 1WV1A 3ER9A 1M6VA 4YUVA 1IN7A 1Y7TA 4YJ2F 4CG3A 1I10A 3MGGA 1XXLA 3IQZA 4F9FA 4QOIA 4EFKA 1MGPA 1QR6A 1I7SB 2GZHA 3G2MA 3CTPA 4MGHA 1VDMA 3RRJA 4YAIA 2ODAA 4WY5A 3TTYA 1HG1A 3LCVB 3DZGA 4ND1A 4BKQA 2DBVO 3JD2A 3O3OB 3OQVA 2ZRPA 2Z5VA 4NVRA 5JDIC 1R8SA 4DV6B 2B5OA 4CV3A 4OAPA 3ZI7A 1XKTA 1RAFA 2R8YA 1JFTA 1QE0A 5K6AC 2D59A 3IALA 4XGRA 3OZAA 5TQVA 1I3CA 1V4BA 8GPBA 1BEUB 1X9IA 1Z63A 4LGYA 2ZUTA 4WLNA 3DHYA 2O2GA 3MGBA 3PQ8A 4JQCA 4YCJA 4CQLB 3BN3A 1TEHA 3WO1A 4P38A 3FSRA 3NAMA 1ZKMA 4FFSA 4BIIA 4ZDJA 4G0WA 4PLVA 1IAQA 2CJFA 3N6VA 5DZSA 1O87A 3FZEA 3I1IA 3NTRA 2KB0A 4ROTA 1LDEA 4AVYA 3NBFA 3URMA 1V6CA 3WQRA 2C2MA 1JNXX 3PGA1 2YYSA 1QC5A 5CM9C 1C3JA 1ZWKA 1VJ5A 1PR0A 2B30A 4ZT7A 5AESA 5BV2P 3HHPA 4OXKA 2ZM6B 2EKZA 2F55A 1ZVMA 3R5XA 3CW8X 4G6ZA 1E62A 4H15A 3J81A 1JIKA 3E7XA 2FUG1 3A11A 3QE4A 4Q16A 5GGYA 2RG1A 1NOKA 3A3OA 2H31A 5JJ5A 1CQPA 3EUEA 2XI4A 2P9CA 2XYRA 4OUDA 2D54A 4UZSA 2J09A 4GLLA 4X20B 3DQQA 2JK1A 4CM8A 2KLBA 1GPNA 2B4AA 3V8MA 2X14A 4JKOA 1VBFA 3RI3A 3Q9SA 3VOTA 2QMUA 1JJVA 4PSVA 1VI2A 1JUDA 2FPIB 1C7FA 3SICE 1MB4A 3IRUA 4KWTA 1M0SA 4Q4AB 3VZPA 2VJLA 4JZYA 3GRCA 2QY6A 4UCWA 1B00A 3TR6A 1KVTA 2AMJA 3NFRA 4HFMA 4ARCA 2XSZA 4LN1A 4S24A 1J56A 5KYUB 1RACA 4K86A 2SBTA 1II8A 1P1KA 3P7MA 3SX4A 2D7CA 2A5DA 2AFIB 2VYVD 1NVUQ 1RZUA 5I3ZA 4RYDA 1MXHA 4MVJF 3C5HA 4MQFA 4IDOA 2E1RA 2A4MA 2PUDA 2QX8A 2J3LA 3N2GA 1PK8A 3L7OA 3W2GA 1KI9A 2HHHB 2FEWB 2FN7A 2P4QA 1G6KA 1K7SN 4O4JA 2OL4A 3LWBA 1UCFA 3K70D 2EWVA 3HKBB 1DZIA 1ZMTA 3CLSC 5EWJB 4C7VA 4MIOA 2X6RA 4MRRA 5FJIA 4GNRA 1PD0A 3M9WA 3U4CA 4OHMA 2X5NA 1QVWA 3PWSA 2WU4A 3EDQA 3RJ9A 2CLKB 5BUCA 3DFUA 5KVCA 1E64A 3G1TA 5EP3A 2H5LA 2PU5A 2YOGA 1FFWA 3QW4B 4LHZA 1A9TA 4O1HA 4A8HA 2AX3A 4B6EA 5CCBA 1Y1KE 3FSJX 1S8OA 4FFBA 4TMZA 1N2ZA 1XQVA 1RQGA 5JW6A 3DG9A 1N5DA 3VFDA 3C70A 2G1AA 3D7NA 1G20A 2A5JA 2VJBA 3BIOA 1KBZA 1R74A 4C7JA 5A02A 4BATA 2Z1NA 3UEOA 1YRYE 4ZHQB 1CU1A 3GLUA 4KMSA 4LWZA 1NR5A 2BZSA 2OD7A 2WMOB 4H1HA 4MO2A 5LZ7A 4RD3A 1TUIA 2PIDA 2G4LA 1F2UB 5COAA 3PX7A 3ER8A 3C3JA 4X24A 2GO7A 1CUEA 1HEYA 1RYBA 2VDRB 4J9UE 3N0TA 4I2VA 1JIVA 4A10A 5HJEA 1U7OA 1YE3A 4RMIA 4HNGA 5LQUA 2G04A 1SBIA 3DLIA