4E5YA

Structure of human fx protein, the key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
307
Chain Sequence
SMRILVTGGSGLVGKAIQKVVADGAGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords GDP-L-fucose synthase
total genus 94
structure length 307
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e5yA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4e5yA02
1X0XA 3ITDA 1GEGA 1YWGO 4N7RA 1MC4A 4J1TA 3R1IA 3CMMA 3BHMA 4ND2A 4CMCA 3ANMA 1T2AA 3BHJA 4DQUA 3DOOA 3VKVA 1CF2O 3D4NA 2O3JA 5A4DA 1E1MA 2GD1O 3TF5A 1LC0A 2H63A 5DNAA 2O4UX 3IMFA 5AVOA 4K28A 5KTKA 1EBUA 1PGJA 2OXIA 3B70A 4K26A 3S1LA 1E0DA 2FPGA 4ESOA 1DO8A 4KUHA 2GYYA 4LW8A 4AJ2A 3P2YA 4TRJA 1XR3A 2QW8A 4R41A 4R5HA 3DOJA 1N7GA 5G0TA 4Z3KA 1B3BA 4HFNA 3JQ9C 1B8PA 3G1UA 4KOAA 2G0TA 1E7RA 2IRWA 3UOGA 3NTOA 1SC6A 4LK3A 4ZN6A 2NQ8A 3IUPA 4FJ0A 4MVJG 2P4QA 1S6YA 1V8BA 1R66A 3S2GA 2Q1SA 3CUKA 3K96A 1BXGB 1ORRA 3GZ4A 3L6OO 4D7AA 1S7CA 3DBVO 5JC1A 3RC7A 5G0WA 3WIEA 2O3SA 2Z1NA 2NLOA 2A94A 3PEFA 3WXBA 4CUJA 3F4LA 4L4XA 1GTMA 4R69A 1BDMA 4DIBA 4J0FA 4YRBA 3KETA 2GASA 3WYEA 2PH5A 3UH1A 1ARZA 4HKTA 3D1LA 1MXFA 1QLHA 3OH8A 3PPIA 5G4LA 3UCEA 4BNHA 1JKIA 1NTOA 1DEHA 4J43A 4JBGA 5ITWA 4DWVA 1DIGA 3FNHA 5B37A 3WR5A 4O0LA 3ROPA 5JO9A 2EEZA 4CM3A 1OC2A 1NQOA 3QVTA 3VPSA 1I24A 2AG8A 3EVTA 3DMTC 3CH6A 4IXWA 2HK8A 3OP4A 4DMMA 1I3NA 1M6WA 3LQFA 4DC0A 4FIZA 1EDZA 2B4QA 2VRCD 4UREA 3PTZA 4AJ1A 3IOYA 4XYBA 5CPBA 4DXHA 1VJ1A 4AFNA 2BH9A 4CV0A 3GY0A 1Y5MA 1N9GB 2FSSA 1BXGA 4UVGA 3NGLA 1P1FA 3WFJA 2WE7A 4CV1A 3NYWA 2YV3A 1ISJA 4JQCA 5KIAA 1ZKMA 4YQZA 5B12A 1R6DA 1QYVA 2GN9A 5A04A 3OECA 3GAFA 3FBTA 4PZDA 1NX6A 2NTVA 3IP1A 4R5MA 1DHTA 5TJ9A 1KEUA 3H9UA 4XIYA 3DONA 4AJNA 4BNZA 2P68A 1LJ8A 1QR6A 1O95A 4D0RA 4FC6A 4BO3A 2OO5A 1LI4A 1ZH8A 1Y81A 1O6ZA 4RVDA 4AJJA 1U3VA 3VPFA 1IZ9A 1P44A 3GNQA 4F3YA 1PIWA 2DPHA 1IE3A 3IUSA 4GQAA 3IDSA 4ALIA 4Q3BA 3W4JA 4DMLA 2VUSA 3H9JA 1T4BA 4ZQFA 3BMCA 4NU5A 4FD3A 1R0KA 3D64A 4FOSA 3P5SA 4F6LA 2P9CA 1I3LA 3AFNA 2EW8A 3AOEA 2H1SA 3QA9A 1U9JA 2ILTA 3FI9A 4NH4A 2YYYA 4OGWA 2HLPA 3R6DA 3H3JA 5CDYA 2Y99A 3F47A 4HWKA 4BL5A 1Y8QB 1HYEA 3E48A 2HO5A 2GNAA 3DZBA 2D2IA 4XJTA 4FC7A 2B4TO 4R68A 2Y0CA 5GZ1A 4NPCA 2O7SA 1EUCA 5JPIA 1HDRA 2JCYA 2VTEA 4PLVA 5KVVA 3ZWVA 3Q9UA 2PK3A 5G0SA 4CMBA 1UP4A 5T8KA 3ZHXA 1LQUA 4EYEA 3GGPA 5COAA 5H83A 1MV8A 1HDGO 3V5NA 3RWBA 4R51A 1FDWA 1OZAA 1SCUA 1CERA 1T1RA 4CQLA 1CWUA 5JC8A 3VDRA 2WDZA 4IUYA 4MP6A 5CEFA 2GR9A 3I9LA 1PU2A 3KTDA 5TSDA 2FOIA 1ENPA 3BTSA 3JQAD 5DULA 1TEHA 4DPLA 3FRJA 1PJTA 3S2FA 1E92A 3A1NA 3ETGA 3ZU2A 1DRVA 3W6UA 1ISFA 5TT0A 4CMAA 2Y0DA 3GQVA 5JLAA 3EDMA 3N74A 3O9ZA 4IMRA 3KOUA 3TOXA 3JCZA 3V2GA 2HSDA 4FOOA 4E5NA 4ZQBA 4E5KA 1NVTA 1GADO 1Y7TA 5FFFA 2OOSA 2C5EA 3UVEA 3BIOA 3M1LA 4WCFB 1QYWA 3E9QA 4CLRB 4Z0PA 2TMDA 5L45A 4MVJF 4BOYA 3DBRA 4FS3A 4WEOA 2WD7B 3Q1LA 1LRKA 3UFXA 3OICA 3PLNA 1YQDA 2PKQO 1XGKA 4CLOA 1Z82A 3NTRA 3N58A 3WGIA 1RM5A 2BF7A 1DAPA 1BSVA 3GRPA 5BSEA 5MGBA 1LQTA 3DHEA 4R3WA 1VSVA 3M2TA 3KZVA 3JQGA 3OMLA 4FDAA 4ZQEA 4U6SA 1ZXBA 2P9GA 3C1OA 1WZEA 3VZQA 2JJYA 2Q1WA 1KC1A 2VNSA 2AEFA 1DDOA 4CLXA 4IINA 3O38A 4XQGA 4YJHA 1SEVA 2QZ9A 5FF9A 4PCVA 3FR7A 1UAGA 3M2PA 1MLDA 3DO5A 4M8SA 1VI2A 1HE2A 1HKUA 3GFBA 4Z3DA 4DPKA 5BNIA 3RUEA 3LF1A 3PDJA 3H5AA 3ZWXA 3A14A 4UVEA 1PJLA 1HWYA 4IY1A 4CM6A 3H6KA 2PR2A 1XSEA 4J4BA 1B16A 3LDHA 2VZ9A 4G81A 1SB8A 5JYDA 2PWZA 4JNKA 5HS6A 3E1KA 4D79A 3WLFA 5JSFA 2Q4EA 1A4IA 1VL8A 1QSGA 3K2BA 3ASUA 3RU9A 4HFMA 3UN1A 3W4KA 4C4OA 5A9RA 3RBZA 1GUZA 3WWYA 1DRUA 4TVBA 4LSMA 1DLJA 2EHDA 5DCWA 1BDBA 4CLHA 2Y67A 3K2EA 3ONEA 3RCBA 4RVFA 1FDUA 2VUTA 4FSHA 2PKRA 1EDOA 4YJDA 3L0DA 4JGBA 2H9IA 2DTDA 4BNKA 3JYOA 2E48A 4P22A 3M6IA 4BKUA 4ZJUA 5K6AC 1HYHA 4TKMA 1N1EA 3KUXA 4YBZA 4CQMD 5ILOA 2VYVD 3QV1A 2AMFA 2D0IA 3ZNOA 1E7SA 4L76A 4NFHA 3D3WB 1LU9A 1N92A 3AM3A 2QQ5A 3WX0A 1ZSYA 1WWKA 4JK3A 4CM1A 5DCUA 5CDTA 2BFMA 4D3DA 2FHSA 1A9YA 1W8DA 2UV8A 1TVEA 4TKLA 3LC1O 1NQ5A 4EEXA 3C8MA 3ZWMA 1JU9A 1KVUA 4FFOA 4P4NA 1IPFA 2YDYA 1BVRA 3L77A 5TT1A 4W9NC 2PD4A 1ENYA 2BELA 5L4SA 4HUJA 4URFA 3EMKA 4GVXA 5I7EA 5T67A 5L7YA 4RPLA 1KERA 3GG9A 4GX0A 5EERA 2X6TA 3WGTA 1E5LA 4MIOA 4TWRA 4H15A 1DFIA 2RIRA 3Q3CA 4IDBA 4J9VA 4R1SA 2VOJA 4MVJD 3PZBA 1YBVA 1J6UA 3UKOA 4ND3A 3FHLA 3EY4A 4GLOA 4ITUA 3JQCA 5I7VA 4IXTA 2EG9A 1K6XA 3U5TA 2OBYA 2C59A 5EESA 4KDEA 1PS9A 2AEJA 1E7YA 4OAQA 2B5VA 5COBA 4E2YA 1BWSA 2GN6A 2NVWA 4ND1A 1ISMA 1WW8A 3P7MA 1EK6A 2O2YA 3MZ0A 4GAEA 4BV8A 3QWIA 4LMPA 4AJIA 5JAMA 5FI5A 1Q7GA 1PZEA 3RQSA 1XA0A 1ISGA 1I5RA 2PD3A 2QYTA 5JDCA 2IZ0A 1DOHA 4H16A 5JNLA 4PLFA 3H5NA 1NYTA 4L73A 2P9EA 5A5EA 4TVOA 5A9SA 3QVSA 4U0JA 4OSOA 3WJ7A 4I9NA 1UUFA 1UXGA 3FNEA 4U5QA 1EUDA 4JLWA 3PWKA 4XDZA 5L3ZA 4ID9A 2G5CA 3AM4A 4FBGA 1AXGA 3W4IA 5TGDA 1FXSA 4W6ZA 3RUCA 1C0PA 3NDIA 4HNGA 5JAZA 3JD0A 3S2EA 2YFHA 5DCYA 2V7PA 1A27A 4IDDA 4D42A 3L4BA 1Q1NA 1PSDA 4YDRA 4U0KA 1GYRA 2CD9A 2JCVA 3GGGA 2NU9A 3NT4A 3TZQA 2E82A 4BNGA 1YBMA 2TMGA 4MKXA 5MDHA 3K92A 3GR6A 1T2CA 4RLSA 5KNLA 3ZH2A 4LVCA 4B3HA 5GZ3A 4CMIA 2DFDA 1J49A 4MVJH 1H9AA 1ZJZA 3AU8A 3PI7A 3OHSX 4DGSA 1B3RA 3JV7A 4WNIA 1P1KA 1PL6A 1YJQA 3O8QB 3FBGA 3ZV4A 1E7QA 2CSUA 2JFFA 1NR1A 1AE1A 4XCVA 3JQDA 4E5YA 3AI1A 5IAAA 1ZFNA 4XQCA 4B3IA 3FN4A 3KLMX 1XCBA 3HB5X 2ZK7A 1MG0A 1EE2A 4KTTE 2JD0A 4E5PA 5JE8A 4RVGA 2HMWA 1M2WA 3N7UA 3DBLA 4BNMA 4ZRMA 2AEMA 2AHRA 3TZCA 1MP0A 2XPCA 5KKAA 2RHRA 3HZZA 4RL6A 3I9OA 3AY3A 5ICMA 3PJDA 4X54A 2ZB3A 3WWZA 1Q2XA 1XIVA 4MVJM 4BO5A 2CUKA 3OEYA 4YJGA 1V3VA 5EQFA 4CM8A 1LSUA 3ZWBA 4BGIA 3D5QA 2VZ0A 3CSDA 3ETEA 8LDHA 1J0XO 1U4OA 1V35A 4CMKA 4KWIA 1CRWG 2VHYA 1BRMA 3SC6A 3SC4A 5I7SA 3WJAA 1V6AA 3TOZA 2X58A 5IN4A 1RYDA 4F45A 4WEQA 4G5HA 1EFLA 3GUYA 2HU2A 5JDIA 4I08A 1PGQA 1CDOA 4ALLA 4FB5A 1I10A 3PJGA 1HDYA 3HWRA 4IJKA 2O4CA 4D41A 4CM4B 3PHJA 2EJWA 1P33A 4TRMA 2BHLA 1U5CA 1YL5A 1PQPA 2UUPA 4JBHA 4FCCA 3CE6A 3DZGA 3EGOA 3K5PA 4R1NA 4QO8A 3CEAA 1MX3A 1UP6A 1YOVA 4R54A 3R3SA 5KKCA 3TPCA 4IZHA 1U4SA 5THKA 3ADPA 2PFGA 3GG2A 3KXDA 2I9PA 3Q0EA 4IDCA 4BNFA 2Q3EA 1M66A 3KYDB 2QYSA 3ZU4A 1C1XB 2BMAA 3WMWA 4EZBA 1PGOA 2FPPA 3QVOA 3ULKA 3ZN2A 4CM8B 1LSSA 4UUNA 1D8AA 2QZZA 2BGKA 4DUPA 4XKJA 5DZSA 3WGZA 1CETA 2E49A 3I9KA 2O7QA 4IZIA 1QYCA 4IDGA 3H4VA 1WMBA 2I66A 4RZHA 1CIVA 2C5AA 3STHA 4N5MA 1B8VA 4CQMB 1BXKA 3OQ1A 1B0AA 3M1AA 2DFVA 1ID1A 2EGGA 2PKQP 3F6YA 2QX7A 1BW9B 2VT2A 3HHPA 3GEDA 1NPDA 4MVJP 1HL3A 2C54A 3KM0A 1K5HA 1AN9A 3WBBA 1E7MA 3JQGB 3GDOA 1HTBA 4DYVA 4E2WA 4FJ1A 3SVTA 1T2DA 2VHWA 4WLEA 4Z0TA 4BO1A 1Y9AA 3AUSA 3LLVA 4UUOA 1WPQA 4CL3A 2UDPA 3KLPX 5K6AA 5EMHA 3RC1A 1YB1A 2A35A 2PGDA 4KMSA 1DC3A 3WQSB 4A0SA 1KEWA 2VWGA 4FPXA 2JL1A 1XU7A 4R1UA 5ER9A 1C0LA 4DQXA 4NQZA 1U3TA 4ZQHA 5JYEA 1B2LA 1XLTA 2GDZA 4IJVA 4J2HA 2J5QA 1U3UA 4NBVA 4WNCA 1V9LA 4NBUA 1Z73A 3WYBA 2D5AA 1TXGA 2YV1A 1P77A 2YFQA 2Z1MA 4AVYA 3QWBA 3I6IA 7MDHA 3EAGA 4OXKA 2NUAA 3JYPA 1A9ZA 2JAPA 4OSPA 1EE9A 5F1KA 1Y6JA 1ZEJA 4DPMA 4J7CA 1YQXA 1KY4A 4EI2A 1ZMOA 4XEHA 4N5NA 1HDXA 3EW7A 4KQWA 4E30A 2NU8A 3WGYA 1GZ6A 1GFSA 4BKPA 4OKNA 4YAJA 1H2HA 2Y1FA 4GX2A 5HRUA 4PG6A 2OORA 2D4AA 2X5KO 1R4MB 2GGSA 2I3AA 2WTBA 4WLOA 1W6UA 3HN7A 3HG7A 4N18A 3DOCA 1BGVA 3RUHA 1KIFA 3NEPX 2GPTA 1UXKA 4WLNA 3U49A 4K9DA 4W99A 2PNFA 3LU1A 4ILKA 5HWSA 1M6HA 4WLFA 1EVJA 1NASA 1ZUD1 3UICA 1NNUA 4RLHA 1ISIA 3PFWO 3AJRA 3AUTA 2ZTVA 1N9GA 2X5JO 3WYCA 1LC3A 4IQ0A 4WKGA 5F1PA 1FDTA 1PR9A 3GH3A 4FW8A 1XEAA 2AQKA 1XHLA 3QRWA 1H93A 1PEDA 1JWBB 3OA0A 4M1QA 1KVTA 1HZZA 1PQWA 1SNYA 1ZIDA 2DTEA 3FD8A 3MJVA 2QRLA 4UVIA 5DF1A 3HNPA 1QORA 4QX6A 1RWBA 4BO7A 1JDJA 3AOEC 2Q46A 2HJRA 2GN4A 2QRJA 4NIMA 5ER6A 2HDHA 2RAFA 2W2KB 2W2LD 3JQBA 4BB6A 1NFRA 1R15A 3ONDA 4JCOA 4XGKA 3DMYA 2X9VA 1HSZA 4BNWA 1I32A 1O89A 1KS9A 3ZWNA 1ZW1A 3DZHA 3LK7A 4W82A 4OJNA 5KJ1A 3HDJA 4O6VA 4PLZA 3GF4A 4PLPA 1V3UA 2DT5A 4JXKA 2A4KA 4BV9A 2WM3A 3DZJA 4JIGA 2J3IA 4Q3EA 1QLJA 2CVZA 3E5RA 4Y6RA 3RIHA 4TRRA 5T64A 3ZWAA 1EQ2A 1YGYA 2P5UA 3GGOA 1VRWA 1I0ZA 3LSYA 1PWXA 4XIJA 4GL4A 1IZ0A 3E18A 3U4CA 1IY8A 3CZMA 4GMFA 3I9MA 2Q49A 4II3A 1NAIA 5I7FA 1F8FA 1PJ2A 1C3VA 3ZU5A 4N54A 4R9RA 5U4QA 2RH4A 3LYLA 4CM4A 2BKAA 5HS4A 5KOIA 3SLGA 4PZEA 5B4UA 2EKLA 5JS6A 1GPJA 4Y8VA 2VHZA 2D59A 3L4BC 1AUPA 1DFHA 2HJSA 2V6BA 2WD8A 2BI8A 2Q4BA 3GNSA 4XRRA 2EKPA 3GAZA 1UDAA 3KRTA 5EIOA 1GZ3A 4WOKA 4M55A 5T57A 4DA9A 1DC5A 3VKUA 2H5LA 2VNAA 5KJ6A 3HADA 1O9BA 3AY7A 3MTGA 3PRJA 4Q3DA 4INAA 1J4AA 3AM5A 2DVMA 3SX2A 4E31A 3I3OA 4QECA 1WDMA 1YXMA 5AXCA 3P2OA 3W8EA 1EEHA 2EXXA 4MIEA 2D5CA 1PJSA 2Y68A 1ZK3A 2ZATA 5J23A 5IZCA 3PIIA 4XGIA 3NV9A 4E0BA 1MFZA 1I01A 3LC7O 4AJOA 4XYLA 3HSKA 3JQ6A 4TZTA 4FFLA 1H6BA 4KDFA 2ZKLA 2PH3A 5JBIA 1ZK1A 3D3WA 1K0UA 2XXJA 4QUKA 2C07A 3ZI0A 4HV4A 4IIUA 3HE3A 4BQRA 1ZSNA 4NDNE 4MIYA 3ZWYA 4ALNA 3W8DA 2FPIA 3ZHYA 3QE3A 2Y1OA 3B1JA 1G0OA 2ZJ1A 2VN8A 3BA1A 3VZSA 4WCFA 3C7CB 5B1YA 3AW9A 1K2WA 2DUUA 1XQ6A 1YQGA 4KZPA 5F3RA 3WNVA 1YL6A 1K6JA 2WD7A 3R3JA 4II2A 1BTOA 4NBTA 4OXYA 3KYCB 4A73A 1GV1A 3NX4A 5L4LA 1E3SA 1GDHA 1LLDA 1RPNA 3ROQA 2LDXA 5CDGA 3RU7A 4B7UA 4BO4A 4XA8A 1WAMA 4XYMA 4PIVA 5JCJA 5JMPA 1LRJA 4YVFA 3UXYA 1RM3A 1E3EA 3F3SA 4LMRA 2PY6A 2O50A 1GL3A 3IP3A 5L7WA 2ET6A 1EMDA 1A4UA 5IG2A 4S1VA 1K89A 3ZGYA 2V6MA 3KYBA 5I9MA 1F06A 4YT2A 1B15A 2IEBA 2CDAA 2JD1A 2VHXA 1LLCA 3I52A 3QW2A 4IS2A 4CLEA 3OIGA 1DJNA 3V1TC 3UHAA 2PGLA 3TFQA 3F9IA 1DB3A 5KVCA 3OIDA 5LC1A 5TX7A 4L4RA 3FWZA 3QY9A 1MUUA 2W90A 5DDIP 3H9QA 1E1NA 4CM9A 4OH1A 2JD2A 1MB4A 4JJIA 4R16A 4YT5A 5F5LA 1DJQA 3E5MA 1E3IA 3CIFA 4K1LA 3EK2A 4P8RA 3ADOA 5CPFA 2CVQA 3H9EO 5JCXA 5KJCA 2F1KA 5A1TA 4XX0A 2B69A 2Q2WA 3JQAB 3QQPA 3TRIA 4BGEA 3Q6IA 5IDYA 2WWRA 4XR9A 1RKXA 4O59O 4QFDA 3ZNPA 3Q11A 4J3FA 2Z95A 5LDHA 3HFGA 1EVIA 2YJZA 4PLHA 1PJ3A 1SOVA 2YQ4A 3ST7A 4C7KA 5A9TA 3WQQA 2FR8A 3UW3A 2NVUB 3DFZA 4J4HA 2EP5A 3OFSA 4YRAA 4XYEA 1I2CA 3W1VA 4B79A 1YDWA 2ZB4A 2C29D 3BMOB 3FR8A 5IXSA 1P31A 3DL2A 3TN7A 1I8TA 2VYVA 3U0BA 4YRDA 4NNJA 3H2SA 5TRTA 2EV9A 3HDHA 1TA4A 4E3ZA 4RZIA 1PQUA 2J5RA 1EVYA 1ML3A 3IC5A 2OGUA 3E9MA 9LDBA 4J2OA 4BKOA 1IHXA 2R2GA 1NQTA 3NUGA 4OO3A 5ES3A 2GZ1A 5HA5A 3L9WA 2DBZA 4IDFA 2VUUA 3ANNA 2IXBA 3FPCA 4NJMA 3WS7A 4BNXA 2X0IA 4AJEA 2AQ8A 2ZIZA 3GA0A 4GPD1 3RUAA 2DPGA 3VTFA 2OP1A 2ZYDA 4Q39A 5CEJA 4WCDA 3GNTA 2G76A 3TQHA 3GLQA 4BB5A 1H6AA 1YJ8A 1YS4A 2GZ3A 3NJ4A 1Z75A 4J16A 3IL2A 5EINA 4DL9A 1DBVO 1DC4A 3MJTA 2CDBA 1DXYA 4OKIA 4UULA 2X5OA 2J8ZA 4YPOA 4EITA 4W4TA 2BD0A 5F1OA 4ZD6A 1VC2A 1XU9A 3D4OA 3KV3O 3RAJA 2PZMA 1U7TA 4CUKA 3PJEA 3JQ8A 1YB5A 1YL7A 4NMHA 3W8FA 3EHEA 1PL7A 3EZLA 1PZFA 4LRSB 4WUVA 1HZJA 1ZJYA 3B20A 3C24A 3QJ5A 1C1DA 2XOXA 4Y98A 3V8BA 3RJ9A 3AWDA 2Q2QA 4RPKA 4M86A 1JQBA 3DMTA 5T6BA 4D3FA 4XB2A 2DUWA 1ADGA 2J5KA 4OXNA 1SBYA 3JD3A 3BTOA 1I30A 3TSCA 1X0VA 1Z7EA 2PZJA 4PG4A 3DAFA 2J3JA 1M76A 2X7HA 2JKVA 1BHSA 3C7DB 4RV9A 5A3JA 5I9NA 4D45A 4NU6A 4Z6KA 4RORA 2YHUA 4B8ZA 3HJAA 3GVXA 3JQFC 3KB6A 1AHIA 2B0JA 3GVHA 4A10A 2HRBA 4RF2A 1YB4A 2UVDA 4F46A 3GPIA 1RJWA 3PWSA 3Q9NA 5DBIA 4UEOA 2IEDA 3DBHA 3HUDA 1Z7BA 4CJXA 4I1IA 1UAYA 2FP4A 3EC7A 3JQAA 1WP4A 4BMSA 5CHEA 3MJCA 3RVDA 3OM9A 2DTXA 5IF3A 1JAYA 1LNQA 4RDHA 3TZKA 3DZFA 2DM6A 1KOLA 1H2BA 4G2NA 5BSGA 4WECA 1NPTO 2JAHA 2Z5LA 1X14A 3QVXA 3I23A 3RUIA 4TRNA 5TQVA 1N1GA 4XB1A 2EGHA 3A9WA 1O94A 1WXDA 4RVSA 1XDWA 4MVJE 1E77A 2CF6A 4DLBA 3VH4A 3QHAA 3EYWA 3WB9A 4BUCA 5TF4A 1K6IA 4OOFA 5I9LA 1I3KA 3INRA 4YB8A 3HFSA 1PS8A 2O48X 3GFGA 4AJ4A 1G6KA 3H5RA 3WGGA 5IDWA 4BIIA 1SMKA 4CPDA 5DT9A 1F17A 5AXDA 4ZHSA 4YR9A 2J3KA 2B5WA 4Z0HO 3KYDA 3IQDB 2Y0EA 1YDEA 4PLWA 2VZ8A 3RBXA 1B14A 5G0UA 5JAQA 1Y5RA 3GVPA 4RF4A 2X1HA 4NJMB 2AQIA 1VM6A 4IGFA 4NFSA 4OHUA 4OIMA 4CM7A 1U28A 3ZHZA 1G1AA 3TDKA 3F5QA 1VKNA 2VCYA 3C1TA 1Y8RB 3COSA 2AE1A 4LISA 3OA2A 4Y6PA 4J6FA 1UJMA 4IIVA 1LDGA 4YAIA 5IZ4A 8ADHA 3D7LA 3E03A 4OYRA 3SXPA 3KBOA 4RO0A 4JROA 3VZPA 2GERA 1NWHA 5JO0A 1U8XX 2BFPA 3VVBA 1GAEO 3WMXA 1HF3A 1U1IA 3KSDO 3DDNA 1F8GA 1MC5A 1ULUA 1EK5A 4CLDA 2Q1UA 4BNTA 1GU7A 4GX5A 4DVJA 4MVJI 4B7XA 4BO8A 1F14A 4L0QA 4JBIA 4GX1A 3BXXA 4H7PA 3RC9A 3RFTA 2YY7A 1ZK2A 3QVWA 4D43A 4BGUA 1UXJA 4HFJA 2I3GA 2P5YA 5ADHA 3I9JA 2IYOA 3K6JA 3MOIA 1PZHA 2QG4A 3GK3A 3ZZNA 2FN7A 3BZUA 4MO2A 3AI2A 1CJCA 1HXHA 1P3DA 3JQ9A 1GUYA 3I6QA 3PHGA 1OOEA 3ZV3A 4CR8A 4HNHA 6ADHA 1E6WA 4BHTA 3ENKA 1OAAA 5B4VA 1HE4A 1N5DA 4XD2A 1FMCA 1XQ1A 1DIHA 2FZEA 4MP8A 4EEZA 4YT4A 1CQJA 1YONA 4Q3AA 4NK4A 2VQ3A 4MKZA 4CQLB 1NVMB 1E7WA 3PHLA 4IQGA 4YXFA 4AG3A 3O03A 2I67A 4NJOA 4XZ3A 3HB4X 2AG5A 2GZ2A 4IGEA 2FWMX 4Y9DA 5ENDA 5C7OO 4RVHA 4MDHA 3OJ0A 5EN4A 2R00C 4ZA2A 4W7HA 1LLQA 1KETA 2J6IA 4EUFA 3U09A 5ILGA 4EJ0A 2SCUA 2HQ1A 2D3TA 1VL6A 1P74A 4WK6A 1VPDA 1LDBA 2G17A 3GHYA 2HMTA 1JVSA 1QYDA 4LCJA 4Z9FA 1LSJA 1LA2A 3VVCA 1GEEA 1R4MA 2GUGA 1XWFA 2WMDA 3I83A 4BO9A 5A06A 5K0ZA 1VSUA 5TNXA 4B4VA 3PYXA 1GPDG 4XWYA 3IKVA 3RSHA 1HRDA 1V3TA 2BLLA 4BNUA 3GT0A 1H94A 3DBRB 1UR5A 2UYYA 2X23A 4J1QA 1YBAA 2Q45A 3VPHA 3FSRA 1U5AA 2DQ4A 3F4BA 4XRGA 4FFNA 5BSFA 1RM4A 4AJHA 1GY8A 4CR6A 4XYGA 2YHIA 4TZKA 2FZWA 1HYGA 4WCFC 1EUZA 4J4TA 1PWZA 2VYNA 3ONFA 1B8UA 2P4HX 3JQ7A 1UZNA 4YJFA 2C2YA 3K30A 1NP3A 1KVSA 3DXFA 2UAGA 3DQPA 3RROA 4R3NA 4CMGA 4QXMA 1AGNA 4MINA 1YOVB 3IAHA 4NZ9A 2QRKA 4J7UA 1NR7A 5I8ZA 4MPDA 4UEKA 1QXSA 3PQDA 1QRRA 4GGOA 1QV6A 2Y93A 4J7XA 5JCJD 4AL4A 3HN2A 4ND4A 2I65A 3PJFA 4G65A 3GN1A 2X8LA 3JTMA 3OETA 3ROMA 3NRCA 5A05A 1HDZA 2CF5A 3GEGA 1Y1PA 1ADFA 3LT4A 4MVJA 2C7GA 2Y66A 4E5MA 1W0CA 4Y67A 5BQFA 5BR7A 4A5OA 3Q2KA 5L4NA 3WOHA 1WVGA 2HK9A 3UCFA 1ZSVA 4E4YA 4I8XA 3U4DA 1NBOA 2CVOA 1BW9A 1LX6A 4HBGA 4ZQGA 2VWPA 1A71A 2DLDA 1A7AA 3H2ZA 3RBVA 3OJEA 2I6TA 5JFOA 4BNIA 4YJFB 4BVAA 3K73O 1JN0A 4XQ9A 3WGHA 3KYCA 4B3JA 3GPDG 3ICPA 4DQVA 5TJHA 4RCVA 1UDCA 1R0SA 3PDUA 4J9UE 3DB2A 3B1FA 5EQDA 3BMQB 1TB4A 1DSSG 4GMGA 2Y1CA 3PQFA 1HETA 3B1KA 3V1YA 1PL8A 4U7WA 1BMDA 4J1SA 1LUAA 3V2UA 1PZGA 3AY6A 1PGNA 1XELA 3I4FA 3PVZA 3R0IA 5IFLA 4BKRA 4BO2A 3KSUA 4EJMA 5KVSA 1H5QA 3EZYA 1ONNA 3BMOA 4MKRA 3ZWPA 3ZWCA 2GSDA 1D4FA 1U2DA 3F1LA 3GVCA 3H8VA 4O63O 5DOZA 4GH5A 5FYDA 1ENOA 3NAQA 3O8QA 1SO8A 3TJRA 4C7JA 4DIOA 1Y9EA 1GUFA 2NVBA 2OL4A 4IPTA 5JMWA 3AUAA 1U7HA 4BNLA 3SLKA 1PGPA 2B83A 3H7AA 2JHGA 4D44A 4PGFA 1DAOA 5THQA 4BNJA 1U3WA 4HFRA 4YCAA 4EDFA 1WNTA 2X22A 4XGNA 3OQ6A 1P0FA 3MOGA 5CP8A 2VHVA 4LRTB 1NHWA 3I1JA 2B35A 1DLIA 4YJGB 1MA0A 2EJVA 1OI7A 3HDYA 3AU9A 2F00A 1ZXLA 3FTPA 3L6DA 3LT1A 3RUFA 4PG8A 2LDBA 5GZ6A 4PFJA 2HMVA 2VWQA 3ANLA 3UGKA 4HXYA 3DC2A 3IS3A 2W98A 1LLUA 2E6UX 3FF4A 4I5DA 4A2CA 1TT5B 3GZNB 4ZRNA 3PXXA 3OBBA 4CODB 3O4RA 4XDYA 1GQYA 4A7PA 4JJGA 4TSKA 3CKYA 2HUNA 5LCXA 3VC7A 3CZRA 2NU6A 3KEQA 2CMDA 2V6FA 3EUWA 1NHGA 2ZB7A 1E6EA 5JXWA 1HE3A 2FR1A 4Y6SA 4IDEA 3G49A 4YACA 5AOVA 4YYZA 3TZ6A 1K3TA 5T8KC 3AI3A 1JKFA 2O3QA 3BYZA 1ULSA 4WGGA 4CM9D 5I8WA 3F46A 3TL2A 1NFQA 4OQYA 2DKNA 2JCXA 2QIOA 1P1HA 1YE3A 3GOHA 1XKQA 1ZNQO 4FR5A 4WE3A 2WSBA 4CLRA 1D1TA 2PA3A 1C14A 3JD2A 2NU7A 2ZTMA 1BG6A 1RM0A 2FSVA 4NR0A 5IN5A 4RDIA 2O23A 2POQX 5GY7A 1HE5A 1Q0LA 1YKFA 1X7HA 3GMSA 4DIFA 2D8AA 3DEYX 2Y1DA 3GC6A 4B4WA 1JA9A 1JTVA 3NT2A 3INTA 4NG5A 1AXEA 2VYND 5G2OA 5AQ1A 2A92A 4IJUA 5AXBA 3ICCA 3A06A 4P4GA 5IJZA 3ZNNA 2PZKA 4CV2A 4GGPA 4Z9XA 4IQ8A 1Q0HA 2AXQA 3VDQA 4IMPA 4OOEA 2C0CA 5CG2A 2PD6A 3E9NA 2ZQZA 1E3LA 2EF1A 1C1DB 5G4KA 3ASVA 2Q50A 4EGFA 2E4AA 3K31A 4MP3A 5HTOA 2GF2A 2IZZA 4BO6A 4RGBA 1MGOA 1TI7A 1WZIA 3MTJA 4UVDA 5BNFA 3VTZA 2BRUA 1QV7A 3PFFA 2C20A 4OM8A 5B4TA 4H3VA 3UF0A 2PGJA 5ICSA 3QWFA 3WG9A 3GRKA 4BNNA 1HDOA 5K9ZA 3PGXA 1VE9A 3RUDA 4L8VA 3ZDFA 2PV7A 1GD1O 1LDMA 1NVGA 4OMUA 4FGSA 2ZYAA 4R1TA 5T5QA 3G0OA 4I5GA 2YW9A 3ZW9A 5F21A 5FI3A 4B8WA 4PLTA 3S55A 7ADHA 1KBZA 2O2SA 1R0LA 2GRAA 4EJ6A 1VJ0A 1L7DA 5L7TA 3VZRA 3K8ZA 5DBGA 4B4UA 1Q0QA 2X4GA 4JP3A 1GR0A 1LSOA 4HX5A 2IODA 1ZO8A 1GQ2A 4W9NA 1LDYA 4NFYA 5L40A 4FFMA 1DHRA 4RJTA 4D0SA 1WDLA 3NTQA 2VRBA 1EQUA 1LBEA 3FNGA 1I3MA 2B37A 1ISHA 1T26A 2Q2VA 2ZCUA 3FWNA 3RC2A 1H6CA 3H3FA 3SBOA 5HM8A 5CAEA 4HY3A 4PN3A 2C82A 4QO7A 1SPXA 2GCGA 3E6AA 2WYWA 3KO8A 3OSUA 6LDHA 1IL0A 1U2GA 1JVBA 5KVQA 1R4NB 1CQIA 1LXCA 4AJLA 3TZHA 1B7GO 1QKIA 4XQEA 1BXZA 1C0IA 3KEOA 3QP9A 3U3XA 4GVLA 4BKQA 2CDCA 4I5EA 4QFCA 4PRKA 1LRLA 4BMVA 2X9GA 3Q2IA 4Q3NA 4ALKA 1ADCA 2I5PO 3AK4A 2NTJA 4WLVA 1IULA 2DAPA 5EJ2A 3PZRA 3QWHA 2AQHA 2YUTA 1O0SA 3DBLB 3H65A 5JAIA 5DOVA 1UP7A 5JY1A 4Z9YA 3VPGA 1ONOA 5FEUA 1B26A 4XR4A 2EKQA 1KEPA 4IBOA 5TC4A 3TNLA 4GKVA 1JW9B 4QSMA 4WOJA 3I4CA 3OIFA 3WSWA 1IHYA 2WJPA 4U8GA 2W2LA 3JSAA 3U4HA 3DFUA 4UVHA 4GSKA 1ZK4A 3WBFA 4ONEA 3UUWA 1E1LA 3DTYA 3PWZA 1Y8RA 3DBHB 4BQPA 3ITKA 3GMDA 1R37A 1YVEI 4M54A 2QHXA 3JQBC 4WLUA 4DC1A 1GCUA 3WQRA 2NADA 1ZCJA 3OJFA 1R12A 4PLGA 3WFIA 2H6EA 3B6ZA 1T1SA 3LC2O 1UZMA 1OFGA 4UUMA 4ZICA 1EZ4A 3NDRA 4MJLA 4DBVO 1X13A 1P1JA 1Z6ZA 3U62A 4YT8A 1A5ZA 1QG6A 3HDQA 3CMCO 4CMEA 1DPGA 1JLLA 1MFPA 1NXQA 1P9LA 2FMUA 2NVUA 2OP0A 4YA6A 3T7EA 3NJ8A 3IKTA 1PTJA 3GVIA 4JP2A 2B4RO 3NDJA 5JDCC 1A7KA 2RH8A 4Q9NA 4CMEC 3EVNA 4EUEA 3TWOA 3V1UA 1ZVMA 1N2SA 2Y05A 4KQXA 3JYNA 3PK0A 2J3HA 1NAHA 5AXAA 1MXHA 2ZCVA 3VH1A 2WYVA 2VWHA 3RKRA 4IJWA 2AA3A 1Z74A 2GO1A 2NTNA 1O8CA 1X7GA 2JHFA 1I36A 3BMNA 4E33A 4L75A 2IXAA 5L51A 4XJSA 3WTCA 1QMGA 4KUGA 5C5IA 1YO6A 5FWNA 3UCXA 1TLTA 1ZBQA 2HCTA 5HBRA 2CNBA 1VKOA 2OZPA 4UUPA 2P2SA 3MWEB 3CXRA 1P0CA 4JN6B 1E3JA 1GZ4A 4GSLA 2PZLA 2XAAA 3S8MA 3WIDA 3INGA 3MJ4A 2CY0A 4YQYA 1HDCA 2BI7A 2AW5A 3ZU3A 3X2EA 1A72A 4F6CA 4NBWA 2Q99A 4I9HA 3ZW8A 2WYUA 1ZMTA 3T4EA 4O5OA 4PVDA 1EFKA 3JQEA 1Z45A 4BNVA 3JD4A 2PTGA 4KWHA 1O5IA 1EVZA 4PVCA 5F5NA 4PLCA 3JQ7B 1CYDA 1HLDA 2DBQA 3LZ6A 3PHIA 5KWEA 2RBEA 3E82A 2YQ5A 3K9QO 3HQ4O 1DIRA 2EERA 3GEMA 4J90A 3W6ZA 3BAZA 4PLYA 4JJFA 3DHNA 3OJOA 1NM5A 3O26A 4FGWA 3VAZA 1LEHA 3H9GA 3L6EA 3FPLA 4RVUA 3WGQA 3OQBA 4A27A 4CV3A 4RPGA 4HADA 3WNQA 3L4SO 5EL0A 5ENVA 3VHRA 2X0RA 4OL9A 4KUEA 5AYVA 4J1NA 2EW2A 2R00A 5L95A 3LF2A 3RI3A 4E32A 2C2XA 2C7VA 4IM7A 4NK5A 1P45A 1IB6A 2OHXA 1PS0A 2PLAA 3QLJA 4L74A 3G17A 4A03A 4D3SA 1SEPA 3L07A 5G0VA 2Y1EA 2RHCA 3G1TA 2V6GA 4AICA 1EBFA 4GKBA 1ENZA 3DAPA 4FN4A 4YAGA 2ZTUA 1D3AA 4K6FA 5TLSA 4PG7A 4WJZA 4RF5A 4B4OA 2DBVO 3S2IA 1T24A 4CM5A 3VOSA 1L7EA 2R6JA 3DZIA 4BO0A 2W8ZA 1X1EA 1ONPA 4EBFA 1C0KA 1J5PA 1JWAB 3WGOA 4B7CA 1DFGA 1Y8QA 4DLLA 4CQMA 4J49A 5A5FA 4CL8A 3ENNA 2JFGA 4CLOB 5U9CA 5U1PA 2OMEA 1T25A 2A9FA 1W4ZA 2NNLD 4FFRA 1KY5A 1IPEA 2Y1GA 3C85A 2I99A 3PHHA 3V2HA 3LT0A 1N8KA 1TT7A 2IZ1A 1RYEA 2YZ7A 3IJPA 2UUOA 5DP1A 3DAGA 3U4IA 5GMOA 1SOWA 2FR0A 1ADBA 4K6CA 5JDIC 1WDKA 4WASA 2O3RA 5TS3A 3GDGA 3PGJA 5LDGA 2W4QA 3JQ8B 2XXBA 3UAGA 3TFOA 3PYLA 1F12A 3RD5A 4CUZA 1DIBA 2G1UA 2EP7A 2JFHA 2VT3A 4CMIB 1HT0A 1JKJA 3PQEA 3ZWOA 3OJLA 1X1TA 3RFXA 3AUUA 1KC3A 5C37A 1KVRA 3FTNA 3DTTA 4RPJA 4W7IA 1NWCA 1E3WA 4DLAA 3ROKA 1H0KA 1G0NA 4N5LA 1SB9A 1UDBA 5DN9A 3QWAA 4P4LA 3ZCXA 3C3XA 2EIHA 3BTUA 4MOWA 3GN2A 4EUHA 4AJKA 5COQA 2HRZA 1XYGA 5IXYA 3X2FA 3OEWA 1OC4A 1YH3A 3MCVA 1T2EA 3OF2A 3IJRA 5DP2A 1JAXA 1PJQA 2ZQYA 3VH2A 2ZTLA 2I76A 4HP8A 3LVFO 3FNFA 4R4JA 5C3MA 4GWGA 1IUKA 4E13A 1X7DA 5TIIA 4NHEA 1HSOA 3F5SA 1I2ZA 1XG5A 4YTEA 5C7IO 1M67A 3E8XA 5C7LO 2D1YA 2DU8A 1N7HA 3T7CA 1F0YA 5BT9A 1R16A 3LLSA 2OFPA 1OMOA 1PJ4A 1LDNA 3ABIA 4GI2A 3WSVA 5KJFA 4ZU3A 1KYQA 4FJ2A 1R4NA 4A26A 1NPYA 1GYQA 4BS9A 5ITVA 1M75A 3AFMA 1D7OA 4BMNA 1PR3A 4KP7A 3T4XA 1DC6A 2GN8A 5DBFA 1E5QA 5IDXA 1KVQA 2YDXA 1W73A 4LVUA 2X0NA 2HAEA 3ZV6A 5CG1A 1ZEMA 3VH3A 1YRLA 4QTZA 3KHUA 4PG5A 3BMQA 2G82A 5H81A 3RASA 1VL0A 3MWDB 2X0JA 1V0JA 1E1KA 5IDQA 1C1XA 4EW6A 3WDSA 2OUIA 1NQAO 1UZLA 2FY8A 2ZYGA 3WTBA 3A28A 4BGVA 3BMCB 4YWJA 1ZK0A 4FFPA 4QT0A 1LTHR 3KVOA 2O3TA 2RCYA 2EWMA 3C1AA 3RJ5A 4AJPA 1FK8A 3LT2A 3QIVA 4NI5A 4ROSA 4ALMA 1SZJG 4CMJA 1GCOA 1KEVA 2NSDA 4RQUA 4J0EA 4I9UA 2X9NA 3D3EA 4DREA 2VOEA 4LSWA 2V65A 4M89A 3WLEA 2HK7A 3QSGA 2OBNA 5H82A 1E6UA 1NFFA 1HLPA 5CFZA 1DIAA 4DYDA 3RKUA 3TL3A 5KCZA 1T2FA 3CINA 5L9AA 5CDSA 4O1MA 4YJHB 3BTVA 5L53A 2BGMA 3ZHBA 1FJHA 1PX0A 2ZB8A 4S3MA 4U6QA 1L1FA 1WMAA 3CTMA 4GWKA 4IDAA 2DBRA 2NV6A 2BGLA 1P1IA 3DR3A 3G79A 2AE2A 3GUCA 3I5MA 2P91A 2YHIB 4TROA 1I33A 2VTDA 1T4DA 2HMSA 3D5TA 2W2KA 4E2ZA 5IZCC 5JW6A 4E2XA 4R01A 3ON5A 4ZGWA 1ZZEA 3SJUA 4E6PA 4WPGA 1Q7BA 4KTVE 1WLYA 4M87A 4CR7A 4YEDA 4J91A 4QQRA 5A02A 3DHYA 4DBZA 1AHHA 3JD1A 4E12A 3BMNB 4RPHA 3JQFA 1IYZA 2YV2A 4L4SA 2NQTA 2BFOA 3JYQA 1FDVA 2HMUA 4OQZA 2O3UA 3WICA 1MG5A 1QYXA 5BSHA 3ZV5A 4UEJA 4FQ8A 5BNTA 4E21A 3ZNQA 1U8FO 2CZCA 1PJBA 1OBFO 2NM0A 2XF8A 3G3EA 1GQQA 1QP8A 2IDZA 4TMFA 4TQGA 9LDTA 3A4VA 3JYLA 3SEFA 4ZVVA 3MJEA 1BVUA 4BNYA 2IYPA 4M49A 1GV0A 1Q7CA 1UH5A 4IS3A 4R9SA 4YAKA 3ZWWA 4PZCA 2VRCA 3F1KA 1SAYA 5EPOA 2WE8A 3PYMA 4RQTA 1P1RA 4D46A 2NWQA 5CDUA 3ORFA 3RFVA 3ETDA 3SJ7A 1TT5A 3GZNA 1CEQA 1VLLA 3PIDA 3C7AA 1VJTA 1UXIA 4RF3A 3U9LA 2WEKA 3FCOA 3VPXA 2DC1A 5A3VA 3DZKA 3NT5A 4L9RA 4YAEA 2CFCA 2E37A 2HKIA 1IOLA 2FRDA 3D0OA 3DWFA 4P38A 3D4PA 4GBJA 4LCEA 3I9NA 2Q1TA 2B36A 1LDEA 3L9XA 5A9SB 4ND5A 1HEUA 1X15A 3GDFA 4GLLA 4LN1A 1FDSA 4UAGA 2GLXA 3MJSA 1GYPA 4CMHA 1E3WB 2NACA 2ZJ0A 3MEQA 3NGXA 4QEDA 5KJEA 4LGVA 4NBRA 1DRWA 1H6DA 1I2BA 3AOGA 3GHHA 2BFAA 2IE0A 3P19A 1UXHA 2X86A 1FF9A 1H9BA 1PJCA 3BHIA 3NKLA 1D1SA 4DRYA 5G4KB 4Q3CA 4JX8A 4DTIA 3KSZO 4I5FA 3IIEA 5A03A 3CPSA 3PLRA 3PP8A 4PRLA 5CEEA 4ALJA 5JY6A
chains in the Genus database with same CATH superfamily
4GG1A 3ITDA 4C3UA 1GEGA 2XMSA 3KK0A 3RARA 4H18A 1Z0IA 3OT5A 1MC4A 4WA7A 3CX6A 3R1IA 3RBAA 3HL4A 1KJJA 4ENTA 2JHCA 1WW3A 4D6YA 3HB7A 3LTEA 4TT3A 5HM6A 4CMCA 3K20A 5E3IA 3SEAA 1T2AA 3VSAA 1QDUA 1UJ2A 3DOOA 2R5WA 4DQUA 5A4DA 2O3JA 3W5HA 2GQ0A 3ES9A 4ER7A 4RADA 4F3NA 3TF5A 1LC0A 1WB4A 3O1IC 1G2PA 3IMFA 5DNAA 4G5FA 2WB2A 3AJEA 1Z0DA 1KO5A 4FHEA 1PGJA 3O92A 1IZ7A 1NMXA 1WCWA 1WEKA 2ZE8A 3FETA 3GWGA 3PX3A 4K26A 4PV7A 4RXMA 3R7SA 3V8RA 4ESOA 2GYYA 4TRJA 3DE1X 4DR5B 5CD9A 2CXUA 1UOQA 4GGMX 4R5HA 2ZRBA 2FQQA 3R9XB 1K4KA 3RUPA 1UDXA 4KOAA 2G0TA 1XZ8A 2IRWA 1OX4A 3NTOA 3WBJA 4LJ9A 2GEBA 4K0KB 2UKDA 3N2KB 4OUKX 3T1YB 4FYXA 1XD9A 4JT2A 1YE5A 1JILA 1K1EA 3K96A 3CT6A 5BMVF 3GD5A 1CP2A 3FYUC 4QPJC 1XAHA 2EFEB 1CIPA 2V9ZA 3DBVO 3K0CC 2IHKA 2GS9A 4YALA 3RABA 3IV9A 5G0WA 1N1MA 1XAJA 2Z1NA 3IDAA 5AI6A 5FTLA 5I4KA 3ELBA 4CUJA 4IHJF 4JR1A 4R69A 4DIBA 4UCWA 3FUVA 1YRAA 4DBLC 2ZANA 4U2EA 8GPBA 1Y6GA 3OTGA 5EPEA 4M0UA 2OG2A 1QH8B 1Z0UA 1C81A 4BYMA 1P6QA 2M9MA 3PPIA 4QOJA 2MMCA 5JXGA 1E96A 2LPMA 2G7MC 1KOJA 5DPMA 5C2JB 3V34A 4J43A 1RKVA 4KPGA 4EPWA 3NHLA 4R1QA 2F9LA 3OKAA 3QU5A 3WR5A 4DWVA 4MUNA 5FFNA 3ROPA 5JO9A 3TI7A 4PXYA 2NPIA 1BD4A 1UBRS 2BUAA 2OHOA 5H59A 3VPSA 2DJ5A 2VJKA 3W78A 1AU9A 3K7EA 4FHDA 3KQUA 5HBGA 1W4LA 1TU3A 4HXFB 4DC0A 4F1JA 3KHTA 3PNBA 4FIZA 3P97A 4UDXX 3JY6A 1NR5A 2OWEA 2PX0A 2D1FA 2H48A 3TLKA 2BMFA 3NTLA 1ZUNA 3OCCA 5K03A 1ZJ6A 2BH9A 3GY0A 3PUHA 2Q0XA 3QNUA 5J59A 4DXDA 3USZA 4UOQA 1QAMA 2C2ZA 3A1WA 1ISJA 5CW1A 3M3PA 1PK9A 1V96A 3FPAA 1KYZA 1D2GA 3OPYB 3R5KA 3HA3A 4JWKA 4DCMA 2XRMA 5LDDC 1X1BA 3NIWA 1ZKMA 4YQZA 2EIXA 3I5YA 8MHTA 3FBTA 4IR7A 3DT8A 5FWYB 1NX6A 3PGKA 3GMIA 2V8OA 2JJQA 3F96A 4RSHA 1Z2NX 1QE5A 1E63A 4ZO9A 3ZD9A 2F8LA 4ER0A 5IVKA 1C9MA 2RGRA 1QR6A 5FAKA 1SVMA 1Z62A 1WD5A 1XP8A 2I7TA 3ABZA 4FC6A 1MEJA 1I5EA 3AJDA 2FEMA 4RVDA 4Y2YA 1RP7A 1YRYE 4Q02A 5F77A 2AOUB 1VIDA 3T5MA 3VPFA 4JJ6A 2Z8YM 1WF6A 1RE1A 2YV5A 4G0PA 4DKXA 3DNMA 2J67A 3B7WA 1CRQA 2BR5A 1QDLB 3AX6A 1PIWA 3IP8A 9MHTA 3IUSA 4INJA 4E14A 4GQAA 4W5TA 4FINA 3TM4A 2VUSA 2ZXUA 4F4HA 1W5EA 3FMVA 2HLDA 2JFUA 1KDRA 3KQMA 3BMCA 3PC4A 1GL6A 4OJMX 4P33A 4QOHA 4RQAA 5IXJA 2R0QC 4F6LA 3P5SA 3NC0C 1I3LA 1L4NA 4ND8A 2KQUA 4D9NA 1FRFS 1DPFA 5DSZA 2ORIA 2NTYC 3P52A 2W4IA 2JIQA 5CDYA 7MHTA 4D82A 1L5VA 4BN5A 3EB9A 1U0NA 3DOEA 3LUBA 3PQ4A 5K4HA 1TJ5A 3E48A 4U4AA 2C2BA 4OHPA 2ZJ7A 2HO5A 5CVDA 5AW2A 4OP3A 1U31A 3NM4A 2C1XA 2XCOA 4FC7A 4I0WB 5IJWA 3OFND 1Q0ZA 3WDKA 1N0WA 2WABA 4ZVRA 5JPIA 1JQ3A 1U7OA 2FOXA 3SFZA 4WRRA 2ZI7A 1RMTA 1XBTA 2OVBA 1YV9A 5MN4A 4IIJF 3FGNA 2H92A 4UOEA 3Q9UA 4FYWA 1J8DA 1UP4A 1VP3A 2LKDA 4CMBA 1OAOA 2NZ8A 4EYEA 1KKMA 5COAA 3GAMA 1QK3A 2JEZA 1ULHA 2PPLA 3V5NA 5BWCA 4YCNA 3THXA 2Z2ZA 4R51A 2PANA 3SYMA 4ZJYA 1C41A 1JEQB 1CERA 1Z2CA 2OK8A 4JWTA 3MMZA 5HIKA 1CWUA 5JC8A 2FDXA 2VDOB 4RDXA 3DKKA 2HLNA 5BW6B 1QTNA 1T8YA 3I9LA 3NH9A 1WABA 5TB5A 4KXUA 1PLLA 3AP3A 5HCUA 1CLEA 3UXEA 4AYWA 4CW7A 4Q1CA 3JQAD 4DPLA 3E2MA 4JLOA 1G5TA 2ENUA 2PZBA 3BXEA 3CURA 1PJTA 1T3SA 1G6HA 5FULA 5IMBA 3WO1A 3ZQJA 4EM6A 1YZLA 3VR2D 1PF7E 1VG0B 1IWOA 1H3EA 1M0EA 3IAEA 3DUFA 2OXFA 3L0ZA 2VEOA 5FLXA 4Y2HA 4D02A 2YCLA 2BRUC 4OA8A 3N8NA 1YCFA 4CMAA 2QMOA 1JG2A 3O9ZA 1CJKC 3KYJB 3KOUA 3ZOKA 2XKJE 2O6LA 3OVMA 1RKBA 4R83A 2NGRA 4E5NA 3FW1A 3LWBA 3TTUA 3C6KA 2IF2A 2BCGY 2HCRA 3D5EA 2C31A 3DKPA 1GKKA 1TM3E 4XB6B 5K0BA 3UVEA 2C5EA 2OOSA 3BIOA 1HQKA 4QQNA 2ZVDA 4JR0A 1NF2A 2C2WA 2H52A 3QGMA 4NH0A 4Z0PA 1L5LA 3VAAA 4QREA 3ZY4A 5CCDA 4ETWA 1LB1B 1J90A 2A88A 4JYCA 5KNDH 4W8OA 2MYNA 3Q1LA 4NMMA 4AY6A 2AB0A 3OJXA 3OICA 4IWNA 4R6WA 1LPOA 2A0UA 1YZFA 2MSDB 3IAM1 4NU0A 5F64A 1TJNA 3QEOA 4CLOA 1Z82A 4DF3A 4A1FA 3NTRA 4O8ZA 1K5DA 4EVRA 2XBMA 2BIFA 1K08A 2GZAA 1KK3A 3M2TA 1GGHA 4DDHA 4F96A 1TTQB 4ZQEA 4H1WA 1XUOA 2XHEA 3OPYA 1WZEA 3ROXA 2KBFA 4G1EB 4W5JA 2Q1WA 3WK9A 1KC1A 3D4BA 4IFTA 2AEFA 3BKWA 4COKA 1YJBA 2Q41A 5EUCA 3O38A 4XQGA 5A5DA 1SEVA 1ADYA 2HSGA 1ACMA 2KW5A 5C8XA 3RVPA 1VI2A 3GFBA 1TYDE 5GAJA 1NVEA 2QAIA 1ZQ9A 5BNIA 3HYNA 1R9JA 3PDJA 1K9SA 3ZWXA 1BOFA 1DAKA 3CRNA 1M72A 1R8SA 4YCBA 3RYFA 4UVEA 1PJLA 3H6KA 2PR2A 4KFRA 1VL5A 4H1TA 3RFFA 2G6BA 4MKFA 2VZ9A 4G81A 5IP5A 5MHTA 1SB8A 3TR6A 2Q8PA 1LI5A 1UPCA 1S2NA 4WZ6A 4D79A 1Z0KA 3M1YA 1X19A 1EWTA 3WLFA 5ADWA 1S8NA 4DV0B 1A4IA 4N01A 4RACA 4LBYA 3ASUA 1Y6ZA 3C3WA 2X8JA 1N2GA 4HFMA 1F4LA 3W4KA 3RBZA 5A9RA 1LF5A 2V59A 1GUZA 1EA5A 4EKNB 4JT9A 2EHDA 1RFGE 2JARA 3QVLA 4LZPA 4B83A 1BDBA 4CLHA 5FJIA 3ZWKA 3K2EA 1I7LA 1EESA 4DY4A 2VUTA 1XTIA 1YNSA 3MC1A 3B3AA 2H9IA 3IMEA 2CW5A 2I2DA 2TSYB 3S28A 4EFKA 3QBDA 2JGNA 2N1MA 521PA 1U0GA 2E48A 2QVXX 2WWFA 3UHOA 4P22A 4COOA 4DNPA 4BPBA 4WJKB 5KPJA 4TKMA 1AV7A 5ILOA 4LF7B 2VXBA 1AMOA 4M99A 3ZD7A 4Q03A 5BRNA 3E4CA 3UJAA 4RTPA 2YY6A 1F6WA 4NVRA 2R6AA 1NVAA 2ZSEA 1N92A 2RIPA 1ZSYA 2SKDA 2H0RA 3BUSA 1RCUA 5CDTA 5CLHA 3HP4A 1SG6A 2PEZA 1BA3A 1L4GA 1GZHB 3OZXA 5FPHA 5JNWA 3DFKA 3IMGA 2ZIWB 3THOA 4U7TB 1KTIA 1BHJA 3GEEA 1WJGA 4QJ3A 2BMDA 2ZITA 2W11A 2A9VA 1JU9A 1YC5A 3OEHD 2J3DA 3QKTA 3IR7A 4HWPA 3HY4A 2OZKA 4ISBA 4RTSA 2WWHA 5TT1A 2XGMA 3QEAZ 2QNRA 4W9NC 3S7TA 1V8PA 2WAXA 4M6WB 2P77A 2L82A 3EMKA 2OXIA 4EPRA 2Y3IA 1KQPA 1XK7A 4CTMA 4JI0B 3IAAA 4OMCA 3V4PB 5LJIA 3EXG1 1T3TA 2Z04A 5E7IA 1KERA 5EERA 3I8OA 2PUFA 1H3FA 5JT1A 3AFHA 1JA1A 2AFHB 3E05A 3Q41A 1N1DA 2OFOA 4MIOA 1AKTA 4PU0A 3TLGA 3ZXSA 1Y42X 3F6RA 4TWRA 2A7QA 1DFIA 2JFYA 5DWDA 1HDIA 4IDBA 4PEVA 1KEZA 1MT0A 4NCJA 5EZYA 3ZGLA 3KELA 5AVRA 4ND3A 3FHLA 1F1BA 1RYBA 1Z39A 2XUKA 3JQCA 3QLEA 4M36A 4Q1AA 1ACLA 1G8FA 1K7XB 4MVCA 1H23A 2FKNA 1SOAA 3EMVA 3ZGNA 1W88A 4GU5A 2AEJA 4GKAA 5G02A 2BJVA 4XGQA 5ANRB 4DV1B 4HPXB 2WZCA 4E2YA 4DG8A 1BWSA 1TF2A 1SOMA 2NVWA 3IOEA 1ISMA 4ND1A 3V1NA 1GZDA 1WW8A 4KGVA 5HDBB 4YYEA 1EK6A 2O2YA 1FB5A 3B9BA 3KC2A 1AUXA 3NGMA 3Q0TA 3NUZA 4YH1A 1G41A 4GMHA 3A1UA 5EG5A 5FOUA 3TQSA 5FI5A 5JAMA 2AYZA 1PZEA 2DWCA 1CDEA 2GBLA 1M7GA 3EWSA 3TDNA 1ISGA 4Q82A 4KYTA 1Z17A 4UOZA 2CNWD 1FFEA 4CYMA 3R3WA 4GYYA 2P9EA 4MWEA 1JHDA 3II6X 4CN8A 2A7XA 3IULA 3QVSA 4U0JA 1K8RA 3PCTA 5CCXA 3OOSA 2Q62A 2PSJA 4L0CA 5D85A 4LJRA 4JLWA 1U8UA 2C0PA 2AC2A 3PWKA 3URMA 1T9BA 2G5CA 5BSMA 3ROTA 2K7FA 5JTTA 5TGDA 3DV9A 1QRAA 2Q3FA 3NDIA 3KJNA 1DJLA 1LPSA 3LGXA 2YFHA 3KQHA 3EOBI 1OGIA 2A9JA 1E1RA 4AZ3A 2ZI3A 4S1NA 2XJ4A 1WR8A 4LS3A 4TXLA 3VNBA 3VXKA 2HCFA 1KFJB 2BTQA 1MEOA 3CH4B 3TZQA 2NU9A 3NT4A 2EKZA 4IO1A 4BNGA 1OV4A 1EA7A 3JAWB 4MKXA 4B74A 4HQ0A 2VK2A 3UANA 5KNDD 3I3SR 3BXPA 3GR6A 4ZEVA 4B3HA 3OX2A 4N8DA 4XAQA 1I0LA 1RWMA 3THYB 2DFDA 2ZWPA 2QT9A 3CVJA 1T5DX 4MVJH 4O8CA 4B80A 4DJFC 4KYIB 3Q3GE 1CFJA 3JALB 3PI7A 3JV7A 2PKXA 1PR6A 2F59A 4WNIA 1DX4A 4UTXA 5EXPA 3RG2A 3SZRA 1XI2A 4EW3A 3KAJA 4MRRA 3TSOA 2CSUA 4LA4A 4XCVA 1AZLA 3CWZA 3M6XA 3H16A 1N3IA 3JQDA 1E8DA 1UJ5A 3WB1A 1Z4PX 1DMSA 1KRHA 3ENVA 3HA7A 1CY1A 1MORA 1MX1A 1NV8A 1ZFNA 3N0TA 4KMOA 5I3CA 5JS1A 3D8NA 4RETA 1WUTA 5AHKA 1MG0A 3AUYA 1M1XB 3DLHA 4DRXB 5JE8A 5DH9A 4HZIA 4BNMA 1YZGA 2AEMA 1PFKA 1OI4A 2XPCA 1HTWA 4KIUA 3HZZA 1EEXB 1SUAA 3K2QA 4W5HA 3RIGA 4X54A 4AB1A 3AXTA 4DCJA 5BWOA 2ZB3A 1YVPA 3WWZA 1Q2XA 1XIVA 4GM0A 1TO1E 3JAMA 2BUCA 5MFZA 3OEYA 4YJGA 5EE5B 5EQFA 1RYNA 4CM8A 2J3QA 1UBCA 3JX9A 3MWJA 1WUKS 3ZDYB 2V96A 2PL9A 3QLUA 3R7WA 2VDRB 2A57A 2IYNA 3CWCA 3ETEA 3UAOA 5ABPA 3OOYA 4HYEA 1J0XO 1F7UA 4WZAA 3LLUA 1QG2A 1YRBA 3MT7A 1RWOA 4HS4A 3JAKA 4KWIA 1BRMA 1S9DA 1K3FA 1YHYA 4QASA 3WJAA 5IN4A 4R2IA 1REQB 2HQRA 1JQAA 2VXCA 5HIIA 5KWSA 1CE8B 3P4YA 2CSXA 3TW8A 1W5BA 4I81A 1OU4A 3MW8A 1EFLA 3FI0A 5E3JA 3LDFA 3FKQA 1CY7A 2CL6X 4NFLA 1FDRA 2WUEA 1I10A 4P3XA 5I45A 3E7WA 1HDYA 5KU1A 2BL4A 4X9XA 5B7NA 1RTTA 1GA1A 3E22B 4IJKA 4EI7A 1P5JA 3QX3A 1GPBA 2EJWA 3TQOA 2Z3WA 1J2RA 3AEXA 3U3JA 1UOEA 1YL5A 4Y2VA 3TGWA 4BRZA 3E5NA 4QO8A 5KX5B 4P84A 4F56A 1R9NA 3TPCA 1AKQA 3IEIA 5AR1A 5THKA 1LV8A 5KOHB 4IGKA 3GG2A 3ONVA 3GPBA 2I9PA 1QV9A 3IAM6 4BNFA 1TKBA 4Y9UA 1M66A 1C7ZA 2XXAB 1EFRA 3KYDB 2QYSA 2W2MA 1CV2A 1C1XB 2IP4A 3H4TA 3QV2A 5B3AA 1PGOA 2O8EA 4JSRA 2CXRA 2EKBA 4C4YA 4EHAA 3C5VA 1BDJA 3QVOA 5T4EA 4F4DA 3LV8A 1CW2B 4LHVA 4B3BA 4EENA 3AW8A 1CR6A 1M1UA 1X7YA 1RU3A 3U7IA 4ESEA 5LQNA 3EA5A 3TD9A 3OJCA 4UUNA 2BGKA 2J6HA 1GKIA 2BGNA 1CETA 2WHXA 3I9KA 2CLEB 1UKAA 4QQFA 2CHGA 1ZKDA 5BYBA 1DV1A 5FHRA 5CLFA 1FU7A 1RAEA 2C5AA 4AKIA 2L2QA 2FPWA 3DDZX 2GJ9A 2QD4A 1B8VA 4E1VA 4DCTA 2WINI 5LU9A 1K92A 2EGGA 3AEUA 3I2YX 5GINE 1X80A 1EB9A 1XMSA 4IDOA 2JGDA 1HFEL 2ZDHA 2H4XA 1BA2A 3EH2A 2N1BA 3GEDA 4MVJP 3I2JA 2C54A 3KM0A 3AVOA 2Q5OA 3WBBA 1DQYA 1UQRA 1XRMA 2BR3A 2R97A 2VDPB 5IKEA 2GEVA 5EJAA 3H1TA 3DXYA 3HCEA 4E2WA 4ETNA 1JPNA 1T2DA 1WU8A 1QC5B 2VHWA 4UMVA 1QPGA 4Z0TA 2ZU0C 4KGZA 2ZJOA 4HLNA 3R8XA 3T4UA 1N6OA 3C87A 3IR6A 4HYTA 2P69A 3T3GA 4BIMA 3ETCA 4TYYA 3AUSA 3LLVA 3ZX4A 1L5QA 1RMYA 3KJIA 3QFHA 4BMPB 1AT1A 5EMHA 3GRZA 3STTA 5CYFA 1P19A 2XITA 1JYSA 4R8MA 3WQSB 4A0SA 2FX5A 2VWGA 3GROA 3KTAB 3SR4A 2W00A 4BLUA 2IYUA 1TCVA 1XU7A 3ZDQA 3OSZA 2IBMA 4B09A 4DA6A 4S1WA 4I46A 1TM1E 4BAUA 2GPJA 1V1RB 2DCMA 5HIAA 1DKPA 4FSDA 4MV5A 2XUQA 2XYVA 3D7KA 3BWXA 4MJXA 1V9LA 1FX0A 2CLHB 4XVHA 4YPVA 4P6VF 5A2GA 2IGTA 1W0JD 2Q6VA 1P77A 1R4AA 1YNOA 2CYBA 3BGIA 3QWBA 1YF3A 3ER6A 4FUTA 2AG1A 3W7VA 3EAGA 1XZAA 2B1JA 1IHDA 2NUAA 3AJAA 3JRXA 4LDAA 2GBGA 4E5UA 4E51A 5KQSA 5C9ZA 3HB0A 3E61A 4Q93A 1EE9A 1Y6JA 2PDAA 1MO5A 1YQXA 1W36C 5EJ8A 5FR1A 4YRLA 4LVOA 4N5NA 4EZEA 2QROA 2GT1A 5ICFA 1T4MA 2V7TA 3CTPA 4AM8A 5DHTA 1GZ6A 5F5XA 3WGYA 1UZUA 3Q8WA 5HYVA 3FGPA 4I99A 3R9XA 4KQ6A 4OKNA 5K8UA 4FTWA 3QPWA 4HWOA 3STUA 4GX2A 2XSZA 4F2WA 1IZYA 5JZOA 5HRUA 2Z6AA 1X38A 2AN3A 2D4AA 2V7XA 3BD8A 2HF9A 3CGWA 3FMFA 1R4MB 4G0OA 1TYAE 2IPNA 2WTBA 4WLOA 3WOVA 2BW0A 3HN7A 3HG7A 3HXQA 1Z07A 4B8YA 4RFSA 3U7HB 2YXDA 1KIFA 4CE6A 1MIOA 1UXKA 4RTLA 3N70A 4WLNA 3C97A 3HBNA 4RGVA 1NVVR 1GRRA 3IAXA 3L7MA 1DBPA 3UAZA 2FZCA 3IX7A 1SQGA 1GPWB 3IO3A 3RO7A 4XASA 5HWSA 1M6HA 4WLFA 3IURA 3PUYA 4O4IB 3MAJA 4XW2A 1SG9A 4F7DA 2CCJA 2ZUWA 4JU8A 3SQLA 4FOTA 1NNUA 1N6KA 1V48A 3H2KA 3ONNA 2NXJA 4YP6A 1W5FA 1IXSB 3EZNA 4RLHA 3UA3A 3RSOA 3K4PA 4YUWA 1YIAA 2ZS9A 1HORA 4FW8A 1ZINA 4YHBA 2O19A 1GNRA 1P6XA 4CTOA 1E9DA 1EWYA 2FG7C 3GUZA 3OA0A 4N8SA 2QJWA 1KVTA 1HZZA 1PQWA 1QUEA 1SNYA 2DTEA 3BDIA 4M0MA 1KJWA 4DQKA 3HNPA 2V0GA 3ZR4B 1Z5ZA 4Y6LA 1F38A 1JDJA 2IVZA 4CDNA 1T5SA 3AOEC 3FVWA 4BFZA 2DT8A 4UHJA 3ADDA 1CC1S 4AP6A 3O8BA 1KSJA 4DRXA 4V0MA 1ZESA 4DWOA 5DMHA 4BLVA 3ESAA 1RBMA 4N6GA 2ZAIA 4BB6A 4IILA 3TIIA 4DRZA 4OPMA 4PAQA 5A5VA 2PUVA 1T2UA 3EWIA 3OOJA 1OX6A 2IYWA 1NBME 3DZHA 3MXOA 3PEVA 1ECBA 3FDFA 4LJYA 4X63A 3WJ1A 5DYTA 2ZI9A 5LZ9A 2C03A 1AUQA 3QHQA 1XX6A 1C0EA 3G9UA 3P1JA 2A5FA 5EZQA 1FVXA 2WHRA 2AX4A 4PLZA 2ZJBA 4QKQA 3DR5A 2ZM5A 1R74A 5JMOA 1WSDA 3RIMA 5HSGA 1N8TA 4B76A 1DUVG 2JLXA 1MHTA 1T2NA 2JAQA 2VHEA 4UULA 1KMCA 1U0EA 1USKA 4REQA 1WOYA 2PKYX 4IDQA 1YGYA 2P5UA 2PZEA 5FAXA 3O4IA 1PWXA 4RK5A 4B0PA 3T6KA 3E18A 4UQLA 3U4CA 2VF7A 1IY8A 2WKSA 5HFAA 3UG6A 4Y2PA 3A36A 3HA5A 4FHFA 1U2EA 1GAXA 3H1EA 1PJ2A 1NVVQ 4EG6A 4D0GA 2B5OA 1O4VA 1VCIA 2NTEA 4G84A 3VMFA 4IHQA 2P62A 3ZQ4A 1U7ZA 4JYPA 4P53A 1L7BA 3SLGA 4CM4A 1ZMXA 3ZHSA 1IN6A 2V45A 2XBLA 5B4UA 1QC5A 1M54A 1RJFA 1FSZA 4OFXA 4HNUA 1R0XA 3I9V6 4CT4B 1QZ3A 3FYCA 1HYBA 1KAQA 2VHZA 3JSXA 2A33A 3L4BC 1E1QD 4UHFA 5CNJA 1FFYA 2E4WA 2V6BA 1Y7HA 4RPIA 1LPAB 1X3LA 2EKPA 1J2EA 1UEJA 2JFQA 3H42B 3GAZA 5EIOA 3G88A 1QTQA 3IT0A 1Y4UA 4EFLA 2EBFX 4EJFA 4M55A 1F6DA 4H1UA 5T57A 1OSNA 1AKEA 2VT6A 4DA9A 2GRUA 2WFAA 2P75A 2QR5A 3LSTA 3PRJA 4L27A 3DFMA 2QEQA 5KKNB 3SIWA 2PRYA 3GWZA 2DVMA 1M1YE 2FK7A 4E31A 2YCBA 1QB8A 3RWOA 3VPCA 3I3OA 1XMQB 4R1MA 3ESDA 3ME5A 2GAFA 2JA1A 1RWNA 1PJSA 1RRVA 2Y68A 3IBCA 1A1SA 1VB3A 1G98A 3PPWA 3U26A 3AQ4A 2Z4TA 3LGSA 3QKSB 4MS3A 3SS7X 4KQ1A 3PIIA 5IZCA 4AJ9A 3AM1A 1IXYA 3HSKA 3SXUA 1GITA 1BX1A 4DLRA 4X93A 4DHEA 5CDHA 5LIPA 4AWBA 2OV2A 4UW9A 1MX9A 3D6TB 1ZK1A 1UANA 2HU8A 1G5RA 2WKPA 1OV6A 2XXJA 2Z5FA 1LS6A 3KT6A 4KFTA 4NE7A 1Y4AE 4RD3A 4EG7A 1RYYA 1YGPA 2ZS8A 4NDNE 1NMSA 4MIYA 3ND8A 1WPXA 4ALNA 1MKYA 2BGWA 1HE1C 5GONB 5F9MA 1E69A 1ESCA 1UIRA 2W43A 2PWBA 3I1FA 4BZQA 3BA1A 3GAAA 4DCVA 5IJ9A 2R8ZA 1PT8A 3O4FA 1MIHA 1G5HA 3MD0A 1D2EA 2DB3A 5GZ1A 1VL1A 1BMTA 2C96A 4ZEWA 3SYKA 4IXDA 3WNVA 4WZAE 4D26A 3T38A 2Q1XA 5BYJA 4HVLA 1BTOA 1RXUA 2P2NA 3R24A 3SQWA 1KKUA 1L7XA 1RJEA 3AP1A 5E2BA 4A73A 5B6PA 3SKXA 4A8JA 5IU6A 2R84A 3SSOA 5F98A 1E3SA 4FFBA 3DO8A 1KQOA 3ZHUA 3KG2A 3FCSB 1G17A 4BO4A 1OXBB 4XA8A 1WAMA 3MXTA 1GDTA 2PU7A 2IH4A 4TWZA 4FEEA 4TS9A 3FSJX 1P29A 1RM3A 4ARSA 1EUDB 2GNOA 2QQGA 3R40A 2FLKA 1UOOA 3UT6A 2FGKA 2FFJA 4X60A 1Y33E 1GL3A 3DQQA 1VYTA 2PGXA 3KXLA 1CRZA 2NU6B 4PE5B 4B3FX 5L7WA 1L6IA 3NTVA 1Z8HA 3D8TA 3PC7A 1ZJWA 4S1VA 2V6MA 3KYBA 2PO5A 1B15A 2JD1A 3C2QA 1UC5B 2VHXA 3PI6A 4ROTA 3TG2A 2J0VA 1MB2A 2O57A 3BREA 3I32A 2QVZX 2J41A 3KFVA 3O3NB 3TFQA 4IHKA 4MROA 2ONYA 1AURA 4MI9A 3PGLA 1XE3A 2G40A 4RSRA 1YFLA 5KREA 3PVSA 2WU1A 4L4RA 1DZ3A 3FWZA 1MUUA 3QY9A 5HTKA 1P7CA 1B76A 3FNQA 3I0ZA 3RYCB 4OH1A 3N0RA 4JJIA 4BLQA 4NXNB 3RS5A 2FSUA 1YI0A 3E5MA 3PVCA 4YRNA 1KE2A 2XA9A 5CJPA 1M1YB 1E9AA 2H2HA 3HR4A 5FUXA 2GVDC 1UBJS 4P8RA 2WJAA 5BY2A 5LQSA 4Y6QA 1E2HA 4RIIA 4BVGA 2IP2A 1SFRA 4XX0A 2B69A 2Q2WA 3QQPA 2P0EA 2HIGA 3Q6IA 1BFDA 4ZOEA 3KR9A 1YQEA 1SC9A 1KPIA 2CMHA 4R2MA 2WQ6A 2ZWMA 2AUTA 3HVJA 1NMEA 1O9GA 4MRSA 1O6CA 3HFGA 1N6NA 2ID8A 1RLTA 2WPNA 4UKDA 5DLYA 4AZ3B 2P78A 4OHWA 5KWIA 5FOWA 3OUUA 1U3GA 2G3YA 2HXSA 4GF5A 2BWJA 4WZBB 4I2NA 1CF9A 1T9KA 2FR8A 2PBZA 1UC4B 4XPZA 3FYUB 1RXCA 2GYWA 1TK3A 4I1YA 1JLLB 2EP5A 4WN9B 4JP5A 5HQJA 2XAUA 4PWZA 5KCMA 3OFSA 4QPNA 1YUNA 5LN1A 4ZTZB 1E2KA 5CU7A 2BKUA 1NUAA 3FR8A 1FW8A 2AXEA 3QVVA 5JYCA 3O8CA 1E98A 2XDYA 4H7DA 4Q3OA 1HMPA 3H8SA 5D1NA 3GT4A 3ZCVA 3H2SA 4JJKA 3AKZA 2EV9A 5CTJA 2BBTA 3I04A 3WGMA 5KDDA 2DX7A 1KH2A 2F2TA 2MU1A 1B0UA 3FLMA 5CYOA 1GUAA 1TA4A 1V1RA 1E1YA 2MR5A 3D6FA 4YCDA 4CI0B 1DG9A 4OK3A 4E03A 5JQGB 1U9ZA 1EGQA 2V5VA 4MA0A 4AO7A 1YRHA 2IH5A 3A6JA 1Z5GA 1PQUA 2J5RA 3WP1B 4JUIA 1QGDA 5L6LB 3PIRA 4H3SA 1BHQ1 3OP1A 3K1AB 1H4TA 4BKOA 3BWEA 1FSFA 1Q3HA 3AUKA 4OO3A 4R8LA 5IAJA 3J81A 3LHIA 1MO4A 4RDCA 2DBZA 2IOHA 3FPCA 3JW8A 2BISA 1I6MA 4IIBA 4IIXA 4BNXA 3R7LA 4EHIA 3ELUA 3NLLA 2AQ8A 3GA0A 4LE1A 2PJRA 2XA1A 4NYJQ 2Z83A 1X1QA 4PSAA 3Q3IA 2OP1A 1E5VA 4Q39A 3QEJA 1FIUA 3SJBA 1ZQ1A 3GNTA 1P8AA 1QRDA 3ZL9A 1OGYA 1YJ8A 1EVKA 1FE8A 4YJKA 1Z75A 3OFJA 4J16A 3TRHA 4DL9A 2Q9AA 5AFSA 4YECA 1U04A 5EJGA 2LGJA 3D7SA 3JS5A 3GLGE 3WLSA 2QJFA 1J56A 4LF4B 3OWXA 3HXLA 2GK6A 3HR7A 5HF9A 4A8TA 3B9RA 4U3JB 3FJYA 2WJ3A 1U7TA 4TYPA 2A1TS 4CUKA 1Q0PA 1JTEA 5CAEB 4BEWA 1JEYB 5A0VA 3BWCA 4BAZA 1YDGA 4KVGA 4MWTA 1YJAA 3ZH9B 1EM8A 4QM7A 2VQ6A 1LVGA 1WVIA 2PZAA 1Y6FA 5SY6A 1PSWA 4LQ4A 5DLDA 1HZJA 4EO4A 3G82C 2YZKA 4TYMA 1XKTA 2DPYA 2Q5FA 1XRNA 3QVMA 2I87A 4Y98A 1PZXA 2IF0A 3V8BA 4ZO7A 4BVFA 1L4BA 2FUCA 5EZYB 1G2IA 1XRPA 3AWDA 4MYUA 5IANA 1FBTA 3DMTA 4AKSA 4M21A 4IDUA 3UUFA 4LOJA 2OEPA 4FDUA 1W5TA 1T0PA 3MB5A 2J5KA 1X2EA 4IP0A 1XYVA 4PTYA 1DT3A 4B2LA 3LYAA 1OTXA 1X1DA 1NOIA 1S2DA 1C3JA 3DV2A 3FLAA 3IV6A 4XUDA 3DMGA 1AX9A 4H7EA 1RAGA 1Z7EA 2EW1A 2PZJA 3L01A 1I4LD 2VPYA 1M76A 3UATA 4L3VA 4ZIRB 5CB4F 2BH2A 3GV0A 4TUYF 2IXGA 3IVGA 1KFBB 2ONKA 1BEUB 1MO2A 1FC0A 4A2WA 4Z6KA 5ADVA 1GZ5A 2NYVA 3QUTA 4WXHA 3HJAA 1DKUA 3LLMA 4H0CA 1V71A 2JBHA 4GXRA 3LO8A 3CZPA 1AHIA 1PFVA 3GVHA 4A10A 3LKZA 2HRBA 2QM8A 3LIPA 1YB4A 2PX2A 4LHZA 3GPIA 1PP4A 1RJWA 3PWSA 1E0KA 1NE2A 3DNFA 5HZMA 3Q9NA 3KP1A 4A15A 5KYWA 3MN1A 1XMOB 1PBNA 3FYDA 1AGPA 3DBHA 1BCRB 1Z7BA 1JQLB 2VJOA 2ZE6A 3WDLA 4DLWA 4EQ6B 3TXAA 3DD5A 2ISCA 4WK2B 4LHEA 3GJZA 3L18A 5IRCD 2ACKA 4WDRA 1WL8A 4C43A 4LPKA 2A9PA 5C0OE 4C4AA 2O8FB 2GXUA 4UC0A 4CF5A 2R25B 1NI3A 2IOFA 4RCYA 5KINB 1RC8A 2DY1A 3TZKA 2XKKA 2GWRA 1NT2A 3K32A 4G2NA 1NPTO 3I6BA 5H02A 4RW0A 2REQA 4NSNA 4AKEA 2Z5LA 4QUGA 2GVNA 3OM1A 5CFMA 3RRFA 3I23A 4PHCA 3RUIA 4OB6A 1JDBC 1ZMBA 3A9WA 3NALA 1RHJA 2C1EA 3NB0A 1E2PA 2P8JA 4RVSA 3AP2A 3QSYA 2JCSA 1ORVA 2PLNA 4LDNA 2EBHX 4H6WA 2CHQA 2R6R1 5FLEX 2EQBA 4B87A 1C8BA 4MCAA 1U1EA 3RRBA 5TF4A 1K6IA 4GR4A 3V42A 3B82A 4KIFA 3E9ZA 4XVRA 5JV5A 1I3KA 5JAUA 3K70C 2JRLA 5EJEA 2DGDA 4YB8A 1PHPA 3WHLA 2O48X 2PX8A 1WLSA 3WGGA 4R8VA 4B45A 2CHEA 3A32A 3I39X 1TZ2A 4O4JB 1CZOA 3EVDA 1I1QB 1FEZA 1XTKA 3PFIA 3KYDA 1L5KA 2Y0EA 3O2JA 1E94E 4J0JA 4PLWA 1E5DA 3PS9A 3ANYB 5A4FS 1YR7A 1QM5A 1FQWA 4GZ5A 5JAQA 3VJRA 1WZ2A 2RFLA 4PCLA 4RF4A 4TYQA 4G0NA 2AQIA 1QKJA 1DKLA 1X92A 3G2HA 2P2YA 4IGFA 3VR0A 4DV2B 3FZYA 3V4RA 2GPSA 5FUVA 1U28A 2O2XA 2ICAA 1ZIOA 4OQDA 2G77B 5KC9A 5C53B 4WFJA 4FWBA 2VCYA 3MBOA 2AE1A 1GCGA 2VJMB 4X20A 3W79A 4URXR 5GONA 1CUYA 2OHIA 5DBOA 1LDGA 5ETJA 4YAIA 1NU8A 2XIJA 3M3DA 1CT9A 1EK1A 3NWOA 1O6BA 1NLYA 3RS2A 5JZSA 2GERA 2QAGC 4QOFA 5K4GA 1HF3A 1GSAA 2FB9A 4FUQA 5HKOA 1F8GA 4R2HA 3ZDRA 2QL7A 4ARIA 1BH2A 1EK5A 1WXEA 2Q1UA 3NOXA 1GU7A 1HPLA 4GX5A 4B7XA 3THSA 3CH5A 1F14A 3DA8A 3OU6A 4B4KA 4DZZA 2OCBA 1F51E 1A2KC 3BXXA 3QXCA 4UBIA 3RC9A 2BZ1A 3LQ1A 3UKJA 1MRNA 2I6SA 2OBBA 1ZK2A 2R7AA 3AF0A 2YW2A 4P08A 2CXPA 5CBPB 2YFKA 3EBPA 4BGUA 4KYVA 3M49A 4LOKA 4QRHA 4ZOLB 4AY3A 3V1MA 1VGRA 3TTXA 1U0JA 3KUCA 4P54A 2R48A 1UBOS 2XDQA 4PTLA 1XNGA 4PFSA 1EXNA 3VC2A 2Z6UA 4U2KA 3C43A 2BZSA 1QHYA 3LGAA 3ZKWA 4PYMA 3NP9A 1HXHA 2XE6A 3FROA 3O9VA 2ZAYA 1SU8A 4HLUA 4ND7A 1E6WA 6ADHA 4TTVA 3ENKA 1OAAA 4RYDA 4Q1EA 2W48A 4TN5A 4BQNA 3G5TA 2JDID 5B3JA 5BW5A 2ARKA 4MP8A 1DG3A 4EEZA 4YT4A 4W9MC 3PR1A 1YONA 1ATZA 2VQ3A 3A3NA 5E4YA 1T15A 4MKZA 1P0PA 1PD0A 4RCZA 4WOBA 2OOKA 3SQNA 3S2YA 2HO4A 2PFSA 4YXFA 1KGSA 1T8TA 1FTWA 5CDFA 4XZ3A 3PWTA 1ZOLA 2GF9A 4LX8A 5A4AA 2GZ2A 4Y9DA 2FWMX 4M2LA 5ENDA 3W77A 2IY9A 1QH1A 4MDHA 4TL9A 4UTVA 5BP7A 2AZ4A 3PCRB 5FUYA 1SHKA 2AJTA 2PSSA 5BVHB 5IASA 1GLNA 2ZSUA 3U09A 3IE1A 3CN9A 2Z6QA 4LF8B 2O8BA 1Z36A 3HFJA 3F6PA 5AIAA 5LXTF 3UMJA 4B48A 1QF9A 2W70A 2OV1A 3HUEA 3MCUA 4YC7A 2FVXA 3L7KA 4LCJA 4N3AA 1LSJA 3RHZA 4GSYA 4ZYUA 2DLNA 2NPOA 4LBWA 2E4ZA 1Z0AA 1NKVA 3ORYA 4CBVA 1XWFA 5HJ5A 3I83A 2ZM6B 1VSUA 1XQYA 1JFSA 4B4VA 5LPNA 2WIFA 3BXGA 5FUQA 5KTSA 4TTJA 3FCYA 2GVZC 3CB2A 3SVLA 1V3TA 2ODBA 3GT0A 3RAGA 1YRQA 1L7RA 1QHIA 2H2GA 3P5BA 3VO2A 1JHMA 1VYUA 1JG6A 1UR5A 2WR8A 3WLOA 1NLMA 3VU9A 2Q45A 3NC4A 4OQQA 3FSRA 4EX7A 4JYBA 4XRGA 3A6KA 3QA3E 3MVEA 1BNCA 1GY8A 3DM5A 3A4LA 4KLNA 5C8YA 4ZYWA 3FFTA 4LE0A 4FWIB 2NQ2C 4ZGWA 4QU9A 1E4EB 3ZZ1A 4ZJPA 3GRAA 4OH7A 3QBEA 5F7OA 3OE1A 3LRTA 3RRXA 1FCJA 1MGPA 2DFLA 3RHTA 4A23A 2YBDA 1B8UA 2ASEA 2IU6A 2P4HX 3FKSD 4XQ0A 5AI9A 3NM5A 1MH9A 2C2YA 2F4NA 2O2JA 3AR7A 3GYBA 1KVSA 3RROA 3DQPA 4CMGA 4QDKA 1CUHA 2VDVE 3Q72A 2D2FA 3ZK7A 1XPOA 1G20A 3D6UA 2A78A 2AYYA 4RD1A 4AO8A 5HJEA 1MU0A 1RTKA 2IC5A 3DDWA 1YOVB 2VAVA 1WG8A 2J3LA 3QPBA 3WL6A 1K0FA 4EARA 5CFQA 3T1NA 1NR7A 3IUNA 3K3PA 4K6KA 3D2LA 3LP5A 1L5MA 5JCJD 2D5LA 5HGXA 3LVRE 3L8YA 5F1YA 3RYFB 5KYTA 5IBRA 1P7VA 3NKVA 2ZXEA 4G65A 2JC3A 4RSGA 3R7DA 3JTMA 3UJ9A 2I2XB 3OETA 2FZGA 4MS1A 3DL4A 4WZZA 2PSDA 1DV2A 1GPLA 4JLPA 1P2BA 2GZHA 3LT4A 3A27A 3BH6A 1L5RA 4IQFA 1KDVA 5BRAA 2PPVA 3D6MA 3B1VA 2QF7A 1O7JA 3CZ4A 4MIKA 5BQFA 3CU5A 4A5OA 1S8FA 1XEXB 2CLMB 3CUYA 3PC6A 1CJVC 1WVGA 5P21A 5T41A 4C87A 1BOOA 4FDTA 1BMQA 3IALA 5EE0A 1KSFX 5HVNA 2MIIA 3F3YA 3A4NA 4KWCA 4OP1A 1NBOA 3KR1A 1M2JA 2CVOA 2XUDA 4MUYA 4ZQGA 3UC9A 4P4UA 2DLDA 5EKXA 5TS2A 4DARA 1EFDN 2I6TA 3IESA<