4E5YA

Structure of human fx protein, the key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
307
Chain Sequence
SMRILVTGGSGLVGKAIQKVVADGAGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GDP-L-fucose synthase
publication title Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
rcsb
source organism Homo sapiens
total genus 94
structure length 307
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e5yA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4e5yA02
3RUAA 1EE2A 2RHRA 4JX8A 2G17A 3A06A 3QWBA 4RF4A 1V8BA 3IP1A 4XA8A 5I8ZA 5JO0A 2HMVA 2HMSA 4FBGA 4H15A 3DC2A 1UXHA 2ZTVA 3VH1A 3JQFA 1LEHA 3PFWO 2D1YA 3N74A 4L4SA 3DMYA 1QV7A 1ZSNA 1T26A 1BWSA 2QIOA 4MVJD 3O4RA 3H9UA 4XKJA 2NVBA 1A71A 1IYZA 1PQUA 4I5GA 1I2CA 5L3ZA 1YGYA 3ETEA 2NU8A 2WM3A 4DPKA 1B3RA 4U0KA 1H9BA 3BMCA 3ROKA 2R00A 4YAEA 5JMPA 3KO8A 1D4FA 1DIBA 4HUJA 1Q7GA 3IKVA 5ITWA 4D45A 4K6CA 2UYYA 4AJPA 4ROSA 2VTDA 1EEHA 4BNUA 1SC6A 1DFIA 3ZWAA 1XDWA 2ZB8A 1AE1A 4DPLA 1OI7A 1Y81A 3PHGA 2DBRA 4CMHA 4JBHA 1VJ1A 3JSAA 2C20A 4GVLA 1E5QA 4BB6A 1QLJA 1LLCA 5JDIA 4CMIA 3MTGA 5TIIA 3F4BA 4OYRA 3RUIA 1JN0A 1PGNA 2XXJA 1KC1A 3I9MA 4N54A 1WZEA 3MEQA 4OGWA 4DPMA 5JCJD 3RASA 2NNLD 2H1SA 2EW2A 9LDBA 4NU5A 1DRUA 3O38A 1N1EA 5THKA 1JAYA 1D1SA 5TLSA 1YE3A 1WAMA 3OA2A 3C1AA 4I5DA 5K6AA 1F8GA 1AGNA 1XYGA 3E9QA 4R9RA 3IOYA 1XCBA 3PDJA 2JFHA 3WFIA 1IUKA 3FWNA 3U0BA 3WGGA 2VN8A 1E6EA 1MA0A 4WOJA 4HY3A 5L7TA 1W4ZA 4XX0A 1LX6A 4J9VA 4BMSA 3GPIA 5LDGA 4JCOA 3ENNA 1IOLA 2X0IA 2HK9A 3GY0A 2Q2WA 3FF4A 3BTVA 3BHIA 4UVGA 1EK6A 1LSJA 1TVEA 2HCTA 2CVQA 2HK7A 4D0SA 5KOIA 3WYEA 4KOAA 4M1QA 1MFPA 1NWHA 3GNQA 3HNPA 2WSBA 2VYND 3EHEA 4CQMD 4TSKA 1P77A 4AG3A 3RKRA 5F1PA 1M67A 1YVEI 4H16A 2EW8A 4E5PA 2GERA 3LF2A 1MUUA 4FIZA 1NPDA 4W7HA 4YCAA 2UDPA 4CM8A 4R41A 3ASVA 2O3QA 2O4UX 4D3DA 4HNHA 3WGQA 1DLJA 1B2LA 3ZH2A 1ZSYA 4NK4A 3K2BA 3PIDA 4AJLA 4EUEA 5L45A 1YBAA 2VUTA 2YDYA 3LT1A 3JQ8A 1NQTA 3UVEA 4OM8A 2GASA 4ZQGA 2HK8A 3AM3A 1E3EA 2OMEA 4OAQA 3S2FA 4NI5A 3NDJA 1BSVA 1T2EA 3PQDA 2Z1NA 1OC4A 4JQCA 4EEXA 5EESA 1QRRA 3MJEA 2J5KA 2BFOA 1IPEA 2VRCA 3WGOA 3OJ0A 4MJLA 2P9CA 1V6AA 4UVIA 1QORA 1X14A 3DOJA 2Y1CA 3OIFA 2DQ4A 1PJBA 3U5TA 4IS2A 3B6ZA 3VHRA 5DBGA 1PGQA 3ENKA 3CEAA 5A1TA 2IYOA 3SLKA 4WLEA 4MINA 4RZHA 4FD3A 2JAHA 3DZFA 2YHIB 4O6VA 5I9NA 2JFFA 1IL0A 1LQUA 1VI2A 3LF1A 4FN4A 3NAQA 1WXDA 3H8VA 2JKVA 2GRAA 5IZCA 1YH3A 2Q1SA 3RUHA 4DBZA 3RCBA 3PHIA 3I4CA 3KOUA 1R0LA 1SPXA 1YDWA 4GPD1 1SCUA 4PN3A 1B8VA 3EGOA 1I01A 1I3MA 3A14A 1L7EA 2VOEA 3GHYA 3QSGA 1VPDA 2QRKA 3LVFO 5G4KA 4BNGA 3VH2A 1JWBB 2OP0A 1LTHR 4R69A 5EN4A 3ROMA 4E31A 1VLLA 2C82A 2EWMA 4R54A 2HRBA 2Z95A 4RPJA 1P1FA 3F46A 5JBIA 2R2GA 3WBFA 4X54A 2HSDA 4P38A 3H7AA 1HDOA 4Z3DA 4NU6A 1M75A 2CF6A 5CEFA 2Y0CA 2HJSA 2VHVA 3OA0A 1MV8A 5C3MA 2Y0EA 1WVGA 3R3SA 4OHUA 5DP1A 1HTBA 2YV1A 3LYLA 1LDMA 3S2GA 2E49A 5ES3A 1PIWA 3DHNA 1E92A 3IUPA 5KNLA 3WWYA 4J2HA 3AW9A 1R66A 3L9XA 3UXYA 4XWYA 1LLDA 4Q39A 1I24A 3WGZA 1XU7A 2O2YA 4E32A 5BSEA 2I76A 4KMSA 3GVXA 2A4KA 3IL2A 3ONFA 1I5RA 2X5OA 3DBRB 3DZIA 2GF2A 4WUVA 2UVDA 5TT1A 2WE7A 4YT5A 3GF4A 3TN7A 3WMXA 3WQSB 5JAIA 3NDRA 3OP4A 1EQ2A 1D7OA 3DHYA 4CL3A 3EYWA 1E1LA 2FZEA 3ZWVA 1E7WA 4JXKA 1MXHA 5EQDA 1NFRA 4MOWA 1PSDA 4M49A 1Y8RB 4O59O 4Q3AA 1BDBA 1Q7CA 4OJNA 5GZ6A 1YQDA 4XIYA 4N7RA 1NAIA 4DMMA 3U9LA 4Y67A 2NTVA 5I7VA 4RVUA 3I4FA 1S7CA 2FR0A 3DBHB 1N92A 1ONPA 1R16A 1XEAA 4G2NA 3HDQA 4GBJA 1IULA 4A2CA 4AL4A 3ZW9A 3DL2A 4DL9A 4G81A 4BIIA 2DLDA 4GWGA 3QRWA 1YOVA 1SOWA 4XJSA 3NTRA 1ZK0A 4J0FA 1BTOA 3T7CA 3NT2A 5L7WA 3TZQA 2NTJA 1WWKA 1JAXA 2Q4BA 5ER9A 3I83A 4IDFA 3H5AA 2J8ZA 2YQ5A 8ADHA 1QYVA 4U8GA 2DUUA 4CQLA 2DUWA 3T7EA 2AG8A 1GCOA 1JU9A 1Y7TA 2W8ZA 3FNFA 2NUAA 4XDYA 2JD0A 3WOHA 1LLUA 1X7GA 3GOHA 3ZWBA 1NTOA 4OXNA 3ZGYA 3L6DA 2J3KA 1EDOA 1PTJA 2C7GA 3LDHA 3PJGA 4JK3A 2VRCD 3OHSX 3JYOA 1P1JA 1U3UA 1E5LA 2NV6A 4AJ4A 2FPPA 1VM6A 1DLIA 1DAOA 4CLHA 4IXTA 3TSCA 4BQPA 4RL6A 4UVHA 3GFGA 2AG5A 1LC0A 1M6HA 2GPTA 3CSDA 4BL5A 3EAGA 1Y1PA 1E3SA 3GDOA 4DYDA 4J43A 4XYGA 5ENDA 3ON5A 2GO1A 3M1AA 2ZK7A 3LT2A 4MVJM 1MXFA 4O5OA 2VOJA 4TZKA 1R6DA 1FJHA 4YJGA 2GUGA 5CPFA 2OXIA 4A27A 5KCZA 4MDHA 1PGPA 4NDNE 1PJQA 3K30A 4D3FA 3Q2IA 1HDXA 5JDCC 2QYSA 1B16A 3PJEA 1X15A 2RIRA 3IMFA 1GEEA 2PD3A 3Q0EA 3UW3A 1YOVB 1OZAA 2J5RA 2D8AA 4J7XA 1UXKA 1F17A 4NZ9A 5F1KA 2Y66A 3ZCXA 1JKIA 1R4MA 3DWFA 2CFCA 2X0JA 1ISJA 3CZRA 4D79A 3RAJA 5FF9A 4XYMA 4L4XA 3D3WA 4FPXA 1G6KA 1GFSA 3GN1A 2CZCA 4ND1A 1VL8A 2Y67A 3ZWWA 4B3HA 4OMUA 1PJCA 2VYVD 4PZCA 4E5MA 3LZ6A 4AJIA 1U1IA 3KSDO 4P4LA 4UREA 3MCVA 1A7AA 1BW9B 3VC7A 2BGLA 3AFMA 3INRA 5IDWA 5HTOA 5JAZA 5T57A 2BHLA 1E6WA 3A28A 4FR5A 4IIUA 2IZZA 3U62A 1E3WA 4J7CA 3KRTA 3QWAA 3QVOA 2OBYA 2I66A 1MG5A 4UEKA 1U2DA 2NQ8A 4KDFA 4IZIA 4NJMA 1EVIA 3MWDB 1HDZA 4GGOA 4WE3A 5JSFA 3TOZA 3FR8A 1T2CA 1GQ2A 1MC4A 1ZFNA 3MTJA 4UULA 4YR9A 1UP7A 3QE3A 2X9NA 1T2DA 1G0NA 2C54A 4AVYA 5I9LA 3HHPA 2AHRA 2I3GA 1R4MB 3G0OA 4IY1A 1A4IA 2YDXA 3WX0A 1DRWA 4M87A 4BKOA 3NGLA 4ZGWA 3M2PA 4WK6A 4MIYA 3RSHA 1PGOA 3JQGA 4WCFC 4J91A 2FZWA 2PKQP 2UV8A 3EY4A 5A4DA 1SMKA 5JFOA 5A9RA 4CV1A 2VZ8A 1UUFA 4QX6A 2AE2A 1PL6A 4CUJA 3I9JA 2QQ5A 1EMDA 3T4EA 1ADBA 3PJFA 4BNFA 4GQAA 5L53A 3NGXA 1UAGA 4BO2A 4YA6A 4CR8A 1ZCJA 1X13A 3GGOA 1XWFA 4IXWA 4IZHA 1A72A 4CM3A 1CF2O 4BGIA 3F9IA 3IJPA 2ZCUA 1KEVA 2OFPA 5T8KC 4A03A 4U7WA 3QVSA 1QV6A 2DT5A 3EMKA 2X6TA 3OICA 1IHYA 3RC1A 1P45A 4D0RA 3HADA 4W6ZA 3F6YA 2NVUA 1UJMA 3AK4A 1Y8QA 3GMSA 5AQ1A 2B69A 2GNAA 3WSWA 4FSHA 3ANNA 4N5LA 4R1UA 2PTGA 4Y9DA 3FI9A 5CDTA 4XD2A 4ZVVA 1IHXA 4W9NC 4O1MA 3WGIA 1GZ4A 1SOVA 4S3MA 5DULA 2VUSA 2VCYA 4CMCA 2OZPA 1NQOA 2DFDA 3H6KA 5B12A 1SEVA 3VKVA 5DBIA 5HA5A 3FRJA 1E7SA 2GYYA 4IJWA 2CDCA 1WPQA 1MLDA 3ZWCA 3E48A 3TZCA 4FOSA 1VC2A 1NX6A 4B7XA 3DZBA 4J1TA 2X7HA 3EVNA 3W1VA 2X0RA 4DYVA 1ZMOA 2RH8A 3GZ4A 4Y6PA 3V2UA 4BMNA 3FBGA 1Z75A 2UUOA 4IDAA 4E5YA 3LU1A 4QQRA 5HBRA 1T2AA 4E5NA 3GPDG 3U49A 4OQYA 4ZN6A 3OFSA 5KVCA 1FDSA 3I23A 3ITDA 4RDIA 1TXGA 3NX4A 4TRMA 4QEDA 4BKUA 2I65A 2Q99A 1H94A 5U4QA 2ZB3A 1H6CA 5EPOA 5A3VA 1T1RA 2W2KA 2NADA 1YJQA 1GUYA 3C7AA 3PWKA 4GKVA 4N5NA 4RVDA 1DFHA 4LSWA 3G49A 3JQEA 4HFNA 4WCDA 5F21A 4WLNA 3WGYA 4E30A 1KEWA 1NWCA 2YJZA 3D0OA 3WLEA 2C07A 4E2WA 2CDAA 2DVMA 2PK3A 1NVGA 1YS4A 2AW5A 3NYWA 3W6ZA 2YV3A 1RYEA 4GX1A 3H5NA 4RVSA 5AXDA 3HB4X 4HWKA 1PWZA 1WMBA 3MJCA 2FPIA 5JY6A 2VT2A 1ZH8A 1QMGA 2O3TA 3H9EO 4LMPA 2ZQYA 2J3IA 2NTNA 4YJDA 1HE3A 4DUPA 2WJPA 4FFOA 1I8TA 4UEJA 3R3JA 4KQXA 4YQZA 4CMAA 3D4OA 4CMJA 3OMLA 1DO8A 5JDCA 3QWHA 4HFRA 2VNAA 4CM6A 4CM9D 1WZIA 1WMAA 2D4AA 5EINA 3IKTA 5T6BA 4BO4A 1CETA 3EUWA 3NJ8A 5HS6A 3PP8A 2I6TA 3I5MA 3VZSA 1BXKA 3ST7A 2PY6A 2A35A 2EV9A 2GZ2A 1KYQA 4LGVA 5JC8A 1ZXBA 1GPDG 4BS9A 4TRJA 3UHAA 1XSEA 5C37A 5A04A 1ENYA 5JMWA 2DPGA 2VHXA 4YWJA 1UXIA 4RV9A 4JROA 2W2KB 2GN9A 2PGLA 4E13A 1A9ZA 1XU9A 3AM5A 3KB6A 4EUFA 3C3XA 3ORFA 3RFTA 4E2YA 1HDRA 4IDDA 5AXBA 3KYCA 4DIFA 7MDHA 3A9WA 2DAPA 3QIVA 5KWEA 1ORRA 2XF8A 4CQMA 3ZV3A 3W8FA 1XELA 1XR3A 2X5JO 1M2WA 1WDLA 3EZYA 1XA0A 4FCCA 1JLLA 4PG7A 1ZK4A 1GQYA 1X0VA 1YB1A 2FRDA 4R01A 5TS3A 2EIHA 3C85A 3AY3A 4KTTE 4BOYA 4DBVO 3AI3A 1DJQA 1NHGA 3RC2A 1E1NA 3Q6IA 1ADCA 2FMUA 2O3SA 3FR7A 4YBZA 3RWBA 1I10A 3OJLA 4XGNA 4LN1A 1RKXA 2OGUA 4DREA 1LDBA 2YZ7A 4R9SA 1Y6JA 1J4AA 1LSSA 4PFJA 1U4SA 5JO9A 1KY5A 1UZLA 1HWYA 1NXQA 1YQGA 3ASUA 3K2EA 4FC6A 1Z74A 4YJHA 1ZMTA 1BGVA 1ZEJA 1N7GA 4WCFA 4ESOA 2O50A 3HWRA 1UDAA 2VQ3A 2HKIA 1H93A 1PZHA 5AOVA 1YBMA 3CZMA 2P5YA 1EFKA 4A7PA 4CLRA 4KZPA 2V6BA 4XJTA 1Z6ZA 5F1OA 3PZBA 1MFZA 3W4JA 4OO3A 2PZKA 2QZZA 2UUPA 3GVPA 5JPIA 2Q2QA 3WTBA 3MZ0A 1ZK1A 3U09A 2VZ0A 1M76A 2YFHA 4K1LA 1N2SA 2RCYA 4CQMB 1ZW1A 3HDJA 2O3RA 1E3JA 1MP0A 1ONOA 5DNAA 3JQ9C 4LRSB 5T8KA 1OAAA 1XIVA 4XYEA 4YJFB 4S1VA 3GZNA 3ADPA 3QV1A 5G0VA 4CR7A 5ITVA 2PZLA 3C1TA 4MKRA 1IE3A 4BNZA 3S55A 3QW2A 1NFFA 3QQPA 1N1GA 4KWIA 1ML3A 3JQAA 5ER6A 1DXYA 2AQHA 1C1XB 3D5TA 4R51A 4GL4A 1ZO8A 2UAGA 3K92A 1LQTA 1GDHA 4A73A 3AOGA 1F12A 2B36A 1I3LA 1VJ0A 1P9LA 4W9NA 1K5HA 4ILKA 1NNUA 4IMRA 1RWBA 1QG6A 3AI2A 4PLCA 1DHRA 4YJHB 1F8FA 4PLGA 3GR6A 3IQDB 2X86A 2YHUA 4FJ1A 3H2ZA 2AMFA 5I7SA 3AY6A 4H3VA 4QSMA 1VL0A 1GADO 2WEKA 2Y1DA 1K2WA 4OKNA 4Q3BA 4GX2A 2O3UA 1ULUA 1U3VA 2AEJA 3HN2A 4CMBA 1Z7EA 4EYEA 5GZ1A 3DXFA 4YAGA 2CUKA 1YJ8A 4L0QA 4Z9FA 4W99A 3AFNA 3Q9UA 3BMCB 1TB4A 4ZJUA 1B8UA 3PHHA 4HXYA 1W8DA 1DHTA 1Z73A 2HQ1A 4HFMA 2Y1GA 3FWZA 3IC5A 3LT0A 3VPGA 1OC2A 4DQXA 3N7UA 2EKQA 1DC5A 1DIHA 1GD1O 2AE1A 2W2LD 3FN4A 3AUTA 1QLHA 5KVQA 3GG2A 4RZIA 4ALMA 3LT4A 4TROA 3ZWMA 4E2ZA 5KKCA 3JD0A 4J16A 1GZ3A 1HYEA 4RDHA 1JDJA 4MVJF 3WICA 3B20A 1MC5A 3E8XA 4CMIB 1H2HA 3MOIA 2P4QA 2QYTA 1GL3A 1SO8A 1DFGA 4I5EA 4L75A 3U4DA 3ZHZA 3CPSA 4R16A 1SBYA 5FI5A 3DQPA 5I7FA 4RQUA 2Y1OA 2HLPA 1BHSA 4FGSA 1DRVA 5KVVA 4J7UA 4MP8A 4Z6KA 4CM4A 4YRAA 4B7CA 4ITUA 1BXGA 3VZRA 4ZQEA 5IDQA 1H6BA 4JLWA 1XLTA 2A9FA 3PFFA 2BMAA 4BO5A 2HMWA 2ZB4A 2VT3A 3UH1A 3OETA 1KBZA 4CUZA 1V3UA 4MO2A 1JA9A 1R15A 2GDZA 5CDGA 1JVSA 2D59A 4RF3A 4PCVA 3HFSA 3IAHA 4Y98A 4IQ8A 3KVOA 4Q3EA 4R5MA 2IRWA 4OSOA 4TRRA 3GH3A 4AJEA 3W8EA 5KJ6A 1KY4A 3QWIA 4MVJI 1W6UA 2VHYA 4PGFA 1GU7A 5EJ2A 1MX3A 3HB5X 3ZWXA 4DLLA 4EJ0A 1NP3A 3JD4A 4RLHA 3GRPA 3FHLA 4XQGA 1NAHA 3OECA 4LRTB 2Z5LA 3WGTA 1WNTA 1P1KA 2EP5A 2TMGA 4EUHA 4F6CA 2BFMA 4L76A 3D64A 3I6IA 4JJIA 4JP2A 2C5EA 5JY1A 5JAMA 1PJLA 4P4NA 3FBTA 5FI3A 5LDHA 1E3LA 2B4TO 5DOZA 4MP6A 4FFNA 3Q3CA 3TNLA 2WD7A 4CM8B 3PYLA 1H2BA 1EUDA 4CM4B 4RF2A 3KXDA 3ZU3A 3VDRA 4RORA 4AJ2A 4RGBA 4PLTA 4DIOA 2ZTMA 3JQAD 4YEDA 2GR9A 3K96A 3HZZA 5FYDA 4C7JA 2GLXA 2G5CA 3TOXA 3UCXA 7ADHA 3D5QA 4XB1A 3EC7A 2EXXA 2PR2A 2OHXA 3JQ8B 4B3IA 5U9CA 2E6UX 1HYGA 4EEZA 2VHZA 2VYVA 2IXBA 1KEPA 1SNYA 4ZQFA 5DCUA 4Q3DA 1LI4A 4RPKA 2FY8A 4N5MA 3IJRA 4MKXA 4IS3A 1QYCA 1U4OA 2X22A 2ZYGA 3JCZA 3P19A 3E5MA 3GGGA 1GTMA 3HG7A 1I32A 3DMTC 3ABIA 3WMWA 4CV2A 1CQJA 4LSMA 4CMEC 4WGGA 1PQWA 3DFUA 3WIEA 3AUSA 1N7HA 1Q1NA 3GK3A 4XEHA 4A0SA 3K31A 1VL6A 4U6SA 4GGPA 5TGDA 5A5EA 5BR7A 2GZ3A 5LCXA 3DFZA 5B4UA 2PKQO 1UXJA 3BXXA 1ID1A 1ZKMA 3KYDA 3GT0A 3I6QA 5JYEA 1ZXLA 2EEZA 5L4SA 4EZBA 1NQ5A 3JQ9A 3LSYA 2FP4A 4CR6A 4PG4A 1EVJA 2DKNA 3OJEA 4LCJA 4WKGA 5G4KB 4PVCA 6ADHA 2ZKLA 4EGFA 1AN9A 2EERA 2FWMX 3GRKA 1C1DA 4GLLA 5L51A 2GGSA 1KEUA 2B83A 2QG4A 1K6IA 3ZNNA 3RUCA 3GNTA 4OH1A 4NBWA 2DPHA 4BB5A 4EI2A 4ONEA 1U7HA 2Z1MA 3WIDA 2BGMA 4J6FA 2GN4A 1ISFA 3CTMA 3PK0A 3ADOA 4OOFA 3HQ4O 1CEQA 1FF9A 3FNGA 1VSUA 3AWDA 3PQFA 3DTYA 2FOIA 1C3VA 1CRWG 2PLAA 3IDSA 3F5QA 5TX7A 3RI3A 5KJ1A 1QR6A 2DBQA 2C59A 3PLRA 3SC4A 4PG5A 1GYRA 1WLYA 4R4JA 1TT5A 2Y68A 2Q4EA 1LXCA 3GDFA 3WQQA 3BMQA 3GLQA 1JTVA 2P9EA 3KYDB 4CMGA 3JYNA 4DMLA 5CG1A 3HDHA 1Q0LA 2HO5A 5EIOA 2DM6A 1KVQA 5CEEA 3D3EA 2A94A 3PWZA 2SCUA 1EQUA 4DXHA 5LC1A 3KBOA 4DIBA 2J5QA 1C1DB 4Z0HO 2EP7A 1P1RA 1PS0A 4RPGA 3VVBA 4FJ2A 3PXXA 2P2SA 2NU6A 3ONDA 1C0IA 2NACA 5BQFA 1ISHA 3AUAA 3PHLA 4NHEA 4ZQBA 3ZHBA 3B1KA 4OKIA 3TPCA 4BO7A 3IS3A 4O63O 3PGJA 1E77A 4NBVA 1A7KA 3VPXA 1GPJA 1WP4A 1X1EA 3L6EA 4XYBA 4LW8A 3ROPA 3OIGA 1Z7BA 4G5HA 4NQZA 5A5FA 1XQ6A 5IDYA 4WECA 1C0PA 1BMDA 2FPGA 2ZATA 4LMRA 1R4NA 3Q2KA 4CQLB 4D7AA 4YAKA 4I9NA 1B15A 1E1MA 3FCOA 4OQZA 1NM5A 4M54A 4ND5A 3WTCA 4YPOA 4E3ZA 1O94A 3SLGA 5CAEA 4OIMA 1AUPA 3ROQA 1EK5A 2ZCVA 1KERA 4QFCA 5KKAA 3LC7O 4II3A 1B8PA 4II2A 2ZYDA 1EZ4A 3WYCA 1O9BA 3R6DA 2OL4A 1LNQA 1O8CA 1T25A 3CH6A 4GMFA 3DDNA 2AQKA 2X4GA 4PLZA 4PVDA 3ZV5A 4RCVA 1DB3A 1H6DA 1ISIA 2O7QA 3FNEA 1U5CA 1YONA 3F1KA 5IN4A 5G4LA 2DU8A 1ZEMA 3ZWYA 2Y93A 1IZ9A 4YJGB 2IDZA 4JIGA 5A03A 3CE6A 3BTSA 3OEYA 1JQBA 4QTZA 3GAZA 3JYLA 4CM5A 3KV3O 3UOGA 1ZJZA 2NVWA 3QVWA 3CMMA 3E1KA 1YB4A 2HU2A 4F3YA 4MPDA 1A9YA 5TJHA 3L07A 3WFJA 2NLOA 2W98A 2VRBA 1FK8A 3Q1LA 1LC3A 3RD5A 5ICMA 4CM9A 1K0UA 3ZWOA 3QP9A 5IXSA 3D3WB 1GYPA 2Q45A 1PX0A 3SJ7A 2D0IA 1HLPA 3GEMA 5HWSA 1YL6A 3AUUA 4Y8VA 4YQYA 3C8MA 1E7YA 2PH3A 4GWKA 4U0JA 5BNFA 2IEBA 1X7HA 4BKQA 3RFXA 3A4VA 4R68A 3RQSA 1AXEA 3RUEA 3K5PA 1FDTA 3X2EA 2XOXA 4P22A 2JFGA 3OQ1A 1DAPA 3WGHA 1E3WB 1LU9A 3VTFA 1JKFA 2VWHA 4MP3A 5IG2A 1ZJYA 4JBGA 3H3JA 4NBTA 3BIOA 1GQQA 2BF7A 1NVMB 4NJMB 1GUFA 4I9HA 4CMEA 3MWEB 3GUYA 4FQ8A 4M8SA 4IJUA 4MVJE 5CG2A 3AM4A 1OOEA 3L0DA 1S6YA 4KQWA 1LDEA 1LRLA 3E18A 4AJOA 4BUCA 3V8BA 4F46A 1QYDA 2EGHA 2C5AA 3AOEC 2JCXA 4J90A 4J1SA 4NFYA 1H9AA 5DDIP 4MIOA 4FFPA 3V1UA 3KHUA 5L9AA 4B8ZA 3VH3A 3UCFA 5AXAA 3FSRA 3E9MA 4PLYA 1UDBA 4BKPA 3PWSA 2X8LA 2YQ4A 4OSPA 3V5NA 4BNYA 2JAPA 3JQGB 3OIDA 1TEHA 2GN8A 2IE0A 1DIGA 4FW8A 5C7IO 1E7QA 3UCEA 3H3FA 1NR7A 3SC6A 3KETA 4OXKA 3NUGA 5L95A 4FOOA 3LK7A 2P91A 1B7GO 4ZQHA 3KLPX 5A05A 1B3BA 1PJTA 4PIVA 3L6OO 1JVBA 4IQ0A 4Z0PA 1PJSA 1UAYA 1V0JA 3I3OA 2BI7A 2X0NA 1RM4A 3OF2A 3DZGA 4ND4A 4DGSA 3NKLA 1W73A 1YDEA 4OL9A 2RAFA 1LBEA 1TLTA 4GLOA 5EL0A 4CM1A 2H63A 4DTIA 3M2TA 5I8WA 4K26A 1ZNQO 4C7KA 1LDYA 3EK2A 2LDXA 1EDZA 3HN7A 1UZNA 3ICCA 1HSOA 4P8RA 3STHA 2AQIA 1IY8A 3GNSA 4M89A 4PG6A 1I33A 5IF3A 4FFMA 2YUTA 4YAIA 3TZ6A 2NVUB 1E0DA 1Y8QB 4J9UE 4BGUA 2ILTA 4LISA 3EVTA 4E5KA 1LRJA 1HE2A 5AXCA 4CJXA 4IDGA 2G1UA 3HUDA 4YDRA 3CMCO 3TWOA 4BO6A 1UXGA 5KTKA 4CODB 2G76A 5F5NA 2VUUA 1QYXA 5TT0A 1P0FA 2O2SA 3QVXA 2FSVA 5KIAA 1YBVA 1IPFA 4ND2A 3MJTA 3ZU5A 4BNLA 4E12A 3PIIA 3DOOA 3E82A 4TVBA 3GC6A 3CINA 3KM0A 5KJEA 2QHXA 4O0LA 4OXYA 5B1YA 1XG5A 2BI8A 2V7PA 3S2IA 3F3SA 2GZ1A 1GEGA 4ALIA 5C5IA 1UDCA 3WJAA 3V1YA 3BTOA 3WWZA 4ALJA 3ZN2A 3ZU2A 5L4NA 3SEFA 4KP7A 3ANLA 4A26A 4IGEA 2TMDA 3O03A 4DA9A 2IEDA 2CVZA 3K8ZA 1WDKA 2GCGA 4YRDA 3B1JA 5CDYA 1NFQA 5IDXA 4PLPA 1N9GA 2Q49A 4JN6B 3GA0A 3DAFA 1VSVA 5JW6A 4I9UA 2E37A 4AJ1A 2X9VA 2WDZA 2D5AA 1L1FA 2NM0A 1J0XO 1EBFA 5C7OO 4L9RA 2RBEA 3UN1A 2AQ8A 2PFGA 2W2LA 3W4IA 5DN9A 1WDMA 2A92A 2FHSA 3SXPA 1QYWA 4NFSA 4BNWA 3QJ5A 4QT0A 2P68A 5KJCA 4KDEA 5B4TA 4XIJA 1LRKA 2VTEA 1E6UA 5K9ZA 3O9ZA 1H6AA 3VAZA 3L77A 3P7MA 4NPCA 1NASA 4QO8A 3B1FA 3G1UA 1TT7A 4PZEA 5BSFA 1CERA 2JCYA 5B37A 2AEMA 5JC1A 4GVXA 4J3FA 5G0SA 5A9SA 2B0JA 4WNIA 1ENOA 3DAPA 5AVOA 2AA3A 3PGXA 1OFGA 2Y05A 1I0ZA 2GN6A 2HJRA 4LVCA 1A27A 4EJMA 3OJOA 2FN7A 4XQEA 3FTPA 3NJ4A 1ZIDA 4J1QA 2J6IA 1G0OA 2VNSA 1RM3A 3INGA 2H9IA 3O26A 4FS3A 3BHMA 5JAQA 1PQPA 3DEYX 2E48A 5FFFA 1M6WA 1VKNA 2X9GA 1V3VA 2G0TA 3WSVA 5BNTA 4F45A 4FJ0A 1GV0A 3KZVA 3ZI0A 4CV0A 4Z3KA 3E6AA 4J4HA 3SJUA 2WD8A 3KYBA 4JP3A 5TQVA 4IDCA 2Q2VA 3RJ9A 4EW6A 5A3JA 2O7SA 3DR3A 3MJSA 2ZJ0A 3PHJA 3GUCA 3I9OA 5DT9A 1CYDA 3D4NA 1P1IA 3U4CA 5MDHA 2CVOA 4NR0A 1R0KA 3TFQA 4Q9NA 3KYCB 4CLXA 4BNJA 1UP6A 4FGWA 2X5KO 3UF0A 1PS8A 5T5QA 1HDYA 2X1HA 1UH5A 3WB9A 2EHDA 1MG0A 4AFNA 4GH5A 3FTNA 2B4QA 2JJYA 3S2EA 3JYPA 1P1HA 3TZHA 3GVHA 3VTZA 3U4IA 4YT8A 5A9SB 4B8WA 4JJFA 1NHWA 1EE9A 1ONNA 4I8XA 1T2FA 4PLVA 3FD8A 1J6UA 3I1JA 3IUSA 4NMHA 4E4YA 2FR8A 3TZKA 2YY7A 3QVTA 4UAGA 4W4TA 1W0CA 5CEJA 2C2XA 4L74A 5JNLA 4KWHA 3AOEA 1KETA 2WE8A 4WLFA 2BKAA 3C24A 3ZU4A 4BKRA 1IB6A 1V35A 9LDTA 1YXMA 3BMNA 3WLFA 2Q46A 4LVUA 3TRIA 3PPIA 2Y99A 4HX5A 2BGKA 1L7DA 3H4VA 3DOCA 4YACA 4YVFA 3FPLA 5DP2A 3KLMX 2R6JA 1T4DA 4WCFB 3GAFA 5DBFA 1E3IA 3KUXA 1KVRA 1R37A 1PZGA 5H83A 2DTEA 4IJKA 2LDBA 3P5SA 1YL7A 1J5PA 3E03A 4CLRB 4R3NA 1ZBQA 1P31A 1U3TA 4E21A 4YAJA 2AXQA 1DDOA 2B5WA 4E6PA 1HXHA 1UR5A 2X23A 3WQRA 5GY7A 4J49A 2C7VA 5CFZA 5FEUA 4R1SA 1X7DA 4QFDA 4TQGA 2I67A 4LCEA 4UUMA 3I9LA 4Q3CA 1DBVO 3GZNB 1RJWA 4ALLA 3JD2A 1C0LA 3BA1A 3QLJA 2NSDA 5DCYA 2JHGA 3R1IA 2RH4A 5CPBA 5JE8A 3ZWPA 3JQAB 1DIRA 3F5SA 2CF5A 3KEQA 2Q3EA 3GFBA 4RF5A 4RPLA 3EZLA 3PYXA 3ZHXA 2DTXA 4IM7A 1CIVA 4PLFA 5C7LO 4HFJA 2OO5A 3BMNB 4J2OA 1PZEA 3RU7A 2B4RO 1NVTA 2O23A 4BNKA 3V2GA 2OUIA 1O0SA 3RROA 3D1LA 1HE4A 4BO1A 1GY8A 1HYHA 2CY0A 2X58A 3HDYA 2O4CA 3JD1A 3NEPX 2BD0A 2NQTA 4PRLA 1F14A 3OEWA 3V2HA 4E2XA 2YHIA 2D5CA 3IP3A 1T24A 1XQ1A 4Y6SA 4D42A 2YW9A 3VH4A 3ZNOA 4RQTA 4U5QA 5TJ9A 1PJ2A 1HE5A 2PKRA 1U5AA 1HSZA 5HRUA 4KUGA 2IZ0A 2Y0DA 2CSUA 3JQBC 4GKBA 4IINA 3QHAA 1A4UA 2I5PO 4YB8A 4KTVE 3AU9A 3DHEA 1C0KA 3NTQA 1DOHA 1V9LA 1O6ZA 2HUNA 4DC1A 2QZ9A 3PJDA 1T1SA 1HRDA 3W4KA 1X1TA 4FC7A 2VHWA 4OOEA 4M55A 3GG9A 1GV1A 5CDSA 4QO7A 5G0UA 5COQA 4G65A 3S1LA 2BFAA 4NFHA 4AJJA 3VPSA 1PJ3A 2Y1EA 5L7YA 2ZIZA 1HZZA 2ZYAA 4BQRA 4UVDA 4FDAA 4XZ3A 1DSSG 4RVGA 2E82A 1NQAO 3AY7A 2EGGA 4CLOA 2PNFA 3D7LA 1PEDA 1D1TA 1VE9A 5IXYA 4BHTA 5GZ3A 5I7EA 1H5QA 1PR3A 4IGFA 4R1NA 4GMGA 4JBIA 5EQFA 1ADFA 2WWRA 5H81A 1U28A 2IXAA 1YKFA 3F1LA 4XGIA 1OBFO 5DCWA 1BXGB 1N8KA 1HZJA 4IQGA 1PS9A 5DZSA 4YYZA 1MGOA 2I3AA 3LQFA 4RO0A 4D41A 5H82A 1K89A 2JCVA 4AJKA 1U2GA 3BTUA 5IJZA 1DEHA 4QXMA 1IZ0A 1GAEO 4PLHA 4GSLA 4D3SA 4YTEA 3PVZA 4UUOA 3OSUA 4E33A 1BRMA 3RU9A 3DBRA 5I9MA 1CDOA 1ISGA 1DJNA 4B4WA 5DOVA 1ZUD1 3HSKA 4ZICA 5COAA 1I2BA 1K6XA 3NV9A 3LC2O 2WYUA 2DBVO 4XQ9A 1QSGA 4ZD6A 1FXSA 4IMPA 1QXSA 4IPTA 3R0IA 4XCVA 1M66A 5THQA 1PL7A 2FR1A 1Y8RA 1C14A 5TRTA 3KSUA 5G2OA 2J3HA 3VKUA 3P2YA 3COSA 4UUPA 3FNHA 1ULSA 3SX2A 1GCUA 1B0AA 3DBHA 4WLUA 3JQCA 3H5RA 1YWGO 4AICA 5J23A 3WS7A 2CMDA 3ANMA 1D8AA 3BHJA 1Y9EA 4CLOB 4RJTA 4A5OA 1JKJA 4RLSA 3OH8A 3F47A 3K6JA 4WPGA 2YYYA 3U4HA 2WD7B 2PZJA 3I9KA 4WEQA 4XR4A 3JYQA 3BZUA 1PZFA 1GYQA 2PA3A 5F5LA 3RUDA 4WASA 4Q3NA 4GX0A 1YB5A 1A5ZA 4WLVA 2C29D 5FWNA 1O89A 4LK3A 2VWPA 1X0XA 4BNNA 1G1AA 5EMHA 5HM8A 3NTOA 2DFVA 3GEGA 3VPHA 1FDVA 2JL1A 1HDGO 3OJFA 1T4BA 3KSZO 3AI1A 1NYTA 3RFVA 3T4XA 3ZDFA 3ZHYA 1EVZA 5MGBA 1YRLA 2JD1A 3C7CB 3G79A 2OBNA 3F4LA 3INTA 4NK5A 1BDMA 3JTMA 4DQUA 2BRUA 2Q1UA 4CUKA 1RM0A 3PTZA 3WDSA 2HAEA 1VJTA 4MVJH 3CIFA 2PV7A 4L4RA 2PH5A 2ET6A 4NBRA 1GZ6A 3SVTA 3ETGA 4RVHA 4Z9YA 2CD9A 4YXFA 1N5DA 3UAGA 1CQIA 3DBVO 3JQ7A 3PRJA 1K6JA 5JYDA 4JGBA 2GD1O 2OOSA 2P5UA 5G0TA 1FDWA 1LDNA 2ZTUA 1YQXA 3JQ6A 1I2ZA 1BVRA 3O8QA 4ZRMA 2G82A 3EW7A 3L9WA 3ZV6A 1DC4A 4DRYA 1VRWA 4XRGA 1KS9A 1RM5A 4GSKA 4Z9XA 4BNVA 4CV3A 1UZMA 4P4GA 5JLAA 4BV9A 4EDFA 2DBZA 2VZ9A 1O95A 1SB9A 3DZHA 5BSHA 1TA4A 4H7PA 1NPTO 4ID9A 1YO6A 4F6LA 2C2YA 3OQ6A 1WW8A 2PD4A 4AJHA 1BW9A 3JV7A 3L4SO 5HS4A 2F00A 2NU9A 5F3RA 2WYVA 4Z0TA 3KEOA 4C4OA 3K9QO 2RHCA 5CDUA 3OM9A 4ZU3A 3M1LA 4PG8A 3TDKA 1LLQA 2DC1A 3GN2A 5ICSA 4MVJG 1NR1A 4HADA 3JD3A 1LUAA 2ZTLA 5EERA 4ZHSA 4DQVA 3ITKA 5A9TA 2D2IA 2BFPA 1NBOA 4K6FA 4PZDA 1GR0A 3JQ7B 3ZV4A 4B7UA 3X2FA 1NPYA 1TT5B 2B35A 4WLOA 3CUKA 3GGPA 4NNJA 1CWUA 4ND3A 1PR9A 3BMQB 3O8QB 4K9DA 1HETA 3H9GA 2QW8A 3WNQA 3JQBA 1I3NA 3A1NA 6LDHA 4DLAA 1AHIA 1KVSA 5TNXA 1HLDA 1Y9AA 3VZPA 4GAEA 3NT4A 3DZJA 4J1NA 3WJ7A 5JXWA 3GDGA 2Y1FA 1ZK2A 4IBOA 4IDEA 1E1KA 2C0CA 2XXBA 5COBA 4D46A 1EUZA 2AEFA 3WG9A 3ULKA 2POQX 1QKIA 1P74A 2H6EA 3VOSA 1DPGA 1QP8A 1P0CA 2B5VA 2FSSA 2EJVA 3DB2A 4WOKA 4D43A 4XRRA 1E7RA 4TVOA 3W6UA 3I9NA 2NWQA 1ZZEA 2YFQA 4IDBA 4BNHA 4KUHA 3LLVA 1EFLA 2Q1TA 4W82A 3L4BC 4TKMA 1AXGA 4BGVA 1EBUA 4MKZA 1PGJA 3UICA 3VDQA 4HBGA 3W8DA 2WMDA 3LC1O 4BO9A 3H65A 1D3AA 3PDUA 3BYZA 4L8VA 2JD2A 4I1IA 1B26A 3RBXA 1R4NB 3UFXA 4D44A 3UUWA 2I99A 3GVIA 4XQCA 4FFLA 4TRNA 4URFA 2E4AA 2QRLA 5KJFA 1Q7BA 1ADGA 3HE3A 3QWFA 4AJNA 1SEPA 1R12A 4ALNA 4YT2A 4BV8A 3RUFA 4BO8A 2O48X 3LLSA 5L4LA 2PGDA 4UEOA 2Q1WA 3K73O 2ZB7A 4BNTA 4PRKA 3TL3A 3DO5A 3UGKA 4GI2A 5K0ZA 3GEDA 3PEFA 5AYVA 1BXZA 2EKLA 4ALKA 3JQFC 3DMTA 3CKYA 4WNCA 1VKOA 4XB2A 1J49A 2CDBA 1BVUA 2XPCA 1YL5A 5ILOA 3AU8A 4EITA 5U1PA 3UKOA 4CPDA 3C7DB 3RC7A 2PGJA 2IYPA 4DLBA 5IZ4A 1P33A 4B3JA 1P44A 2H5LA 2R00C 2YV2A 4NH4A 5TF4A 1U8XX 5T67A 1U9JA 3FPCA 5L40A 1GUZA 1V3TA 3ETDA 4INAA 3VPFA 4EBFA 1PWXA 4DVJA 2BELA 3DBLA 5GMOA 3OQBA 3MJ4A 1I36A 1ZSVA 4BVAA 3HJAA 3PQEA 3H9JA 3DTTA 2OORA 3M6IA 1CJCA 1LDGA 4MVJP 2IZ1A 5JDIC 3OBBA 5KVSA 3H9QA 1KVTA 2VWGA 4BNIA 1JWAB 4XYLA 4KUEA 4J4BA 1E7MA 1EUCA 3NRCA 5B4VA 5T64A 2V6GA 1AHHA 4TZTA 5A02A 3D4PA 2HRZA 3AJRA 1Q0HA 2W90A 3BMOA 4R3WA 1LSUA 1HF3A 4N18A 4XR9A 3TF5A 4I08A 4ZRNA 2P4HX 1HT0A 1F0YA 3DAGA 5BNIA 4I5FA 2WTBA 4M86A 4TMFA 1RYDA 4MIEA 5K6AC 3Q11A 3NT5A 3ZZNA 3WBBA 5G0WA 3VVCA 4B4VA 1SAYA 1EVYA 1PU2A 4BGEA 4BO0A 4GX5A 2WYWA 5ADHA 1FDUA 2P9GA 4JJGA 3QA9A 4W7IA 1SB8A 3GMDA 4MVJA 1DIAA 2EF1A 4TWRA 1TI7A 2ZJ1A 3WYBA 1KVUA 3DBLB 3E9NA 1I30A 3PLNA 1U7TA 5A06A 1P3DA 4NJOA 2EJWA 2PZMA 4BNXA 4FFRA 1O5IA 1RPNA 2HMTA 4DC0A 1K3TA 1BG6A 4U6QA 3SBOA 3U3XA 2B37A 3ONEA 3ZNQA 2F1KA 5IAAA 1DC6A 2EKPA 4IJVA 4L73A 1ZVMA 4PLWA 3JQDA 2BLLA 1XHLA 1LSOA 1OMOA 1XGKA 3TL2A 3TJRA 3VZQA 1Q2XA 2HDHA 3RVDA 4CLDA 5TSDA 1R0SA 2V6MA 3BMOB 3H2SA 3QY9A 1JW9B 5TC4A 3RKUA 5DF1A 4J4TA 1XKQA 3I52A 2ZQZA 1SZJG 3G3EA 3V1TC 4NIMA 4WJZA 3P2OA 2QX7A 3KTDA 1B14A 5CP8A 1HEUA 3Q9NA 3RIHA 8LDHA 1MB4A 4WEOA 4B79A 1PL8A 5JCJA 4FB5A 1Z45A 2CNBA 1Z82A 4BNMA 2I9PA 3WNVA 3ICPA 2OP1A 3IIEA 4JNKA 1HDCA 1H0KA 2VWQA 3PYMA 3TQHA 2JHFA 4RVFA 4TKLA 4HNGA 4XGKA 1FMCA 5BSGA 5JCXA 2XAAA 1ARZA 4HP8A 4Y6RA 5CHEA 4QECA 3E5RA 2O3JA 5IN5A 4DWVA 1KOLA 3WR5A 4A10A 4ZA2A 4IUYA 1DC3A 4CLEA 3ZWNA 1UP4A 3PZRA 1Y5MA 4HKTA 4BO3A 4BMVA 4IIVA 2EG9A 5BT9A 1HL3A 1ENZA 4UVEA 3TFOA 1ENPA 2BH9A 2NU7A 3HFGA 3NDIA 2HMUA 3DZKA 4HV4A 4B4OA 4R5HA 4NG5A 5ENVA 3MOGA 4YRBA 3RJ5A 1LA2A 3C1OA 3GQVA 3GVCA 3RBZA 4EJ6A 4CL8A 1F06A 1KIFA 1I3KA 4K28A 4E0BA 2D3TA 2W4QA 1LJ8A 3G17A 4CM7A 1ZK3A 3RBVA 1PJ4A 3G1TA 1HKUA 5IZCC 4RPHA 4YT4A 2DTDA 5ILGA 4XDZA 3S8MA 4B4UA 2VYNA 2IODA 2QRJA 1ISMA 3L4BA 3DONA 5IFLA 1N9GB 4YJFA 3B70A 2Q50A 3ZW8A 1Q0QA 1KC3A 3MJVA 3PI7A 5JS6A 2J3JA 4NBUA 2PWZA 1U8FO 2PD6A 1Y5RA 2V65A 3GHHA 3WXBA 3EDMA 4QUKA 1C1XA 4CMKA 3CXRA 3BAZA 4R1TA 2GSDA 2V6FA 3RC9A 4UUNA 3ZNPA 3N58A 4J0EA 1U3WA
chains in the Genus database with same CATH superfamily
4GMXA 5DM2A 4BXOA 1ES9A 4OPMA 3TO5A 2BSQA 2GH1A 3I01M 3T3PB 1GPBA 3W5HA 4A0GA 4G67A 4BN4A 3R41A 4OREX 5I8ZA 5JO0A 1V8BA 3IP1A 2HO4A 4TMXA 4CGYA 1FUYB 1F2UA 2AXNA 1A8QA 1RQXA 2HMSA 3HSYA 3KZCA 3LKVA 3OIYA 4P7GA 4CQJA 4RK7A 4GPIB 3E53A 1UXHA 1L7QA 4MPTA 1KH1A 2ZTVA 2HMAA 3MWLA 2Q4TA 2RHOA 1LEHA 1T9BA 3HVUA 5FBKA 4V2IA 1XZCA 2HXGA 3WQHA 4H4CA 3RYHA 1QV7A 4PS0A 1M54A 5BURA 2BGTA 4DV7B 1USUA 4JSRA 3M6WA 4Q4AA 3H9UA 3HP7A 5IW8A 1A71A 1IYZA 4RK1A 2JI6A 3SQXA 1JDTA 5EXDA 1OR8A 2C5GA 2BEVB 1B00A 3NPAA 4F84A 3JWIA 5JMPA 2FMIA 1FLDA 1DIBA 1M2VA 4RD4A 4D4JA 4P86A 1PEKE 3BHNA 3AVWA 4AJPA 3GPCA 4ROSA 2HYDA 4O4LF 1RC8A 5EFOA 4D26A 4GNRA 2HBYA 2W6JD 4Q48A 4DQ0A 2VEDA 2WU4A 4RZSA 2FZGA 3IMKA 2OHFA 1VIDA 1N2CB 1TC1A 3N6RA 4ZWNA 4D98A 2C20A 2IYAA 4H31A 5EIBD 4BB6A 4EYGA 3ECAA 3IVMA 3VR1A 3DEHA 3TTVA 2J85A 2Y77A 1ESCA 4PO8A 3VZBA 4CMIA 4OYRA 5TIIA 4I2NA 3RSOA 1O0CA 1OLSA 2PKCA 4X64B 2OPHA 3B6JA 3P9IA 1SXJB 1WZEA 2AGVA 3MEQA 3NATA 4L6AA 1KYXA 2ZPTX 2OXEA 2NNLD 2VHUA 2JPDA 3G9ZA 2H1SA 4D4LA 1VE3A 9LDBA 4PFKA 4FK8A 5DJ5A 2EFYA 2QJFA 4JUAA 3BE8A 2GAIA 3ZS9A 3SBEA 1T0JB 1SCJA 3GLTA 5THKA 3ZX5A 2OQIA 3UBTA 4F4HA 3D2LA 1HT2E 3OTHA 1KYTA 3PXCX 4NBNA 4P2BA 1YR9A 1LF0A 3U48A 4I5DA 2MSKA 4ZJZA 3PC3A 2XYVA 2WPDD 2JLZA 1XYGA 3E9QA 1ZI6A 2PZBA 1O97C 3WLNA 1UJ5A 2NU8B 2FW1A 3U0BA 1G21E 1V8FA 2IS6A 2P62A 2QR5A 3OQHA 1JH9A 2XD4A 3UWMA 4JMPA 1NE2A 2PLNA 4HY3A 2Q4DA 2AMYA 1DJLA 1Q1QA 3IP5A 3C3AA 3PNKA 5L7TA 4QU9A 4ENPA 5LOVF 3GPIA 2NZ2A 2QQ0A 4O08A 3ZIDA 2ZM5A 3LI2A 2ZDGA 2V9PA 1PR6A 1EX9A 1QQ5A 2QZPA 3DDOA 4XPIB 4E1BA 1XTVA 4J0DA 1IOLA 5K8LA 1J0BA 1Y3HA 1A8IA 2HK9A 3O4GA 2Q2WA 5EQTA 4P32A 3BTVA 4ODIA 5CFRA 3UA4A 1ODJA 5IT5A 2YNMC 4RULA 2ZVJA 1SWWA 3HZRA 4ZO8A 1UFQA 1JEAA 3S2YA 3H9CA 4F9EA 2E5LB 1DZIA 4EM6A 2PQ2A 3QXSA 4KOAA 4DS3A 1GG8A 1ZOOA 1C9KA 2JIBA 3EHEA 2RCNA 3F3KA 3KJNA 1HLGA 4MRNA 4QTXA 1PV1A 2VF7A 2I03A 3PHBE 5ALHA 3RKRA 3KZMA 2OKGA 1WIWA 3D1VA 4X92A 2GERA 2Y2UA 5CGQB 1JH8A 2GS9A 1NPDA 4W7HA 4KFSA 4JGGA 4MW4A 4CM8A 4R8KA 3KOWA 4RGVA 4DV4B 1RADA 2FKAA 2GCOA 3WGQA 1EFRA 4DV3B 4OBEA 4ZVMA 4NK4A 1N3LA 2QVGA 1XX6A 4U7FA 3WBJA 3EG9A 3P0EA 2BJVA 4AJLA 1NBHA 4HGZA 4TLAA 3V4PB 2GBFA 2VUTA 1NY5A 4UNRA 1O08A 2H8GA 3QHPA 1XZJA 2EARA 5JU6A 1CF9A 4AS1A 5D1NA 5HUQA 1CZRA 1NLZA 3DT9A 1TGVA 2Y9PB 5K09A 1L1RA 3WBKA 3TLCA 2Z1NA 4JQCA 5KS2A 3JPYA 1QRRA 4C2BA 2J5KA 4FHCA 1IFXA 3E27A 3I72A 2QL9A 4L1KA 2WWFA 4PEVA 3WGOA 3OJ0A 1C4OA 1V6AA 2BMDA 2P9CA 3AHGA 1AGXA 3F9CA 3OIFA 4GQIA 4UVIA 3V8QA 5BR8B 5H0IA 3B6ZA 2GCPA 1E4OA 3DPUA 3P2KA 5G1PA 2H0AA 2HF2A 2P1ZA 4AZVA 3CEAA 3A4LA 3WYDA 3SLKA 4ETIA 4WLEA 4MUEA 4D6YA 4RZHA 2O0JA 1SU7A 3DZFA 5EWMA 3O8CA 5DB4A 4UARA 4EKEA 4O6VA 3T7AA 5I9NA 1UMDB 1WULS 1YZUA 1CRQA 1NN3A 2FPSA 2JFFA 1IL0A 3LF1A 1WCIA 4QXRA 4FN4A 3F71A 3NAQA 3L7JA 4AKEA 1U7UA 3BS4A 1ULZA 2CB0A 3DAHA 3L7MA 4MQFB 4N5IX 1J25A 3AHFA 2VFAA 2O1WA 3UJ3X 3OMXA 3UBMA 1M5TA 3GJ8A 4HLCA 3LGAA 1R0LA 4INOA 4RJKA 2VZEA 3QJYA 5FO1A 1B8VA 4HEHA 4KH1A 5ARBA 2VOEA 1E5VA 1U3FA 2RK4A 5KYXB 1JWBB 1LTHR 3R75A 3H3XA 5KTSA 2C82A 2EWMA 1TD1A 4IG9A 4ZHQB 1U9CA 1JJAA 2ZIGA 3E7XA 2R2GA 3H05A 3WBFA 4X54A 5HZHA 3CRQA 2FEOA 2QRUA 5AOBA 3MHTA 1HDOA 2XWJI 2WKPA 2YQZA 1R4AA 4MV9A 3KPYA 1QPGA 1NW3A 2IYSA 3OA0A 1PQ4A 2OENG 4P93A 3V8PA 3VR4H 3SMVA 1MV8A 1ZA2A 3BXZA 1N6LA 2J0UA 2WOOA 2OCIA 3LYLA 3S2GA 2VT6A 2GNPA 4LKOA 4QHTA 3GLFE 3DHNA 3X2SA 1U8YA 5DU2A 5KNLA 2P7HA 3AW9A 4EF6A 1TTPB 3GMTA 1BS2A 4Q39A 3WGZA 1YAHA 2IPLA 4R84A 2GCEA 1Q92A 4TZ0A 5BSEA 4QD3A 3MRVA 3P2MA 4UDNA 3BH0A 3WLRA 4D4GA 2GF2A 1TMOA 2QW0X 3PPVA 2PSJA 4WRRA 2MSLA 2JVKA 1EQ2A 2R6GA 1W34A 4TS1A 4BZZA 3CKLA 1H2RS 1XTJA 4K5QA 4AW9A 1U1CA 1GRVA 1SCUB 3IGFA 3ZWVA 5AICA 4BV2A 1NFRA 2QLFA 4MOWA 1RR6A 4ZT4A 4CDNA 3PDIA 2YHSA 2O54A 2F3QA 1TO6A 4LF9B 1G7RA 4C5CA 4TYWA 2FWIA 1Q7CA 3M6XA 2V0GA 5GZ6A 1RLIA 4XIYA 1P91A 3SI7A 3BE5A 1GTG1 5H8WA 3EULA 4UBMA 2BFFB 2V7EA 3AERB 4F3KA 4IX9A 2YVKA 1N92A 2XGOA 1I13A 3P52A 3P71T 2XDQB 5KTNA 3ZW9A 4DL9A 2EGUA 4G81A 3I9V6 4Y3UA 5JQWA 4JP1A 3REOA 3RGGA 4HXFB 3QENA 1FW6A 1JKJB 2OLEA 1CS0A 2MYNA 3HL0A 4KYUA 4N8DA 3NT2A 2RC5A 3DUFB 4TKUB 3E3OA 3OWOA 5EJ8A 1WWKA 4GOKA 2F43A 4DDUA 3I83A 1WHTA 1Y8CA 3JZFA 5FAXA 2N75A 2LV8A 4HJRA 2D0OB 3RB8A 5B7GA 4LHWA 1VYUA 4XD7A 1CKEA 4NDZA 3T7EA 2AFIA 4PCAA 1GCOA 1W75A 3WOHA 2W8ZA 2NUAA 4UTXA 2B25A 5PGMA 1HL7A 2O2IA 1X7GA 4OXNA 3ZGYA 3LW7A 1JJVA 3L6DA 1PTJA 1NKVA 2JIMA 3PJGA 2NQ2C 3B3FA 4II7A 2XECA 4JQSA 2WZDA 3ZJ5A 4X65B 2BFEB 4B3CA 4EYQA 1RXSA 2QTVA 4BEBA 2JIRA 1VM6A 1Z56C 3CNEA 4KQ9A 4CLHA 1DCTA 2FSVC 2ZUUA 2HSWA 4QOEA 2ZR8A 5J2UB 1LC0A 4LYAA 4YO7A 1VECA 3EAGA 3T95A 4ZVUA 1F2TA 2PYDA 3FFTA 4XYGA 4WDRA 3ON5A 2O6LA 5FUVA 1UBOS 1FB5A 3LT2A 2ORIA 1FYXA 3W1EA 2VOJA 4RTNA 3ROXA 1PFWA 4WSOA 2GUGA 3AKDA 5CPFA 1Y3FE 2QW1A 3L92A 4YQFA 5KCZA 4MDHA 3FOBA 4K6OA 1PJQA 1X7ZB 3ZWDA 3Q2IA 3K0HA 4CIAA 4JR1A 1XLVA 1GUDA 1MN6A 2C2MA 2P3LA 3P8ZA 4XTRA 3GDHA 5JDCC 4ILEA 4A8HA 2G71A 1GEEA 4DV1B 3Q0EA 3UW3A 1YOVB 1E58A 1L5MA 4JJ4A 3GAMA 3IVXA 1BNCA 1G9TA 2BWJA 2D8AA 2J5RA 4MW0A 5DNUA 2Y66A 1JEDA 3AR6A 4G8BA 4D79A 4QOJA 5A4JA 2Z58A 3DS8A 3O4VA 2EWWA 5DWDA 4H7HA 5FF9A 2UXBB 1O5OA 4FPXA 4HDNB 3KLBA 1DADA 3GN1A 4UBKA 3O8OA 4TT3D 4ND1A 3HVIA 5EE9A 4YAUA 5AVTA 5KOJA 4FFWA 1K8RA 2VYVD 4PZCA 4IKEA 4A8TA 3LZ6A 3HB1A 2R66A 3KSDO 1KFJB 3BERA 4E09A 3CX3A 2WYIA 4P4LA 2FW6A 2NYRA 4PGMA 3TKLA 5LD2B 4OYLA 3ICEA 1JHVA 1A9XB 1TIBA 4C0KA 4ARCA 2FW8A 3C16C 4C22A 5IDWA 3GLGE 1OI4A 1VGVA 3GW8A 2IYLD 5T57A 1WO8A 2BHLA 2CNKA 1E6WA 2GOYA 2KS6A 1XTKA 4FDMA 5ALGA 5T4EA 1OX5A 3UT6A 1P8JA 2VL7A 1OF1A 1W581 3NWEA 4QYWA 3GP8A 3TE7A 2XF2A 1RHUA 3WL7A 2C2GA 3QWAA 3EPRA 4LJAA 4D3ZA 4Y7CA 2HJWA 2PCJA 1DS6A 1V11A 4QGHA 4BQIA 1NVDA 2XITA 3PUKA 4UEKA 2O2XA 3UAOA 3O1HB 1QAMA 1TYDE 2GJ9A 5JPDA 5JSFA 3MTQA 4UUQA 4S0XA 3TOZA 1T5HX 4N7JA 1LKZA 2GX6A 3DKPA 3WC4A 3A26A 4E22A 2JIOA 1CSEE 1VRVA 2HZBA 3DV9A 3ZCRA 3STUA 1F51E 1AB5A 1L5ZA 2YW2A 4Y2QA 5JMOA 4OLFA 1T2DA 1G0NA 2CNDA 2XMSA 4N5DA 4QIHA 3TQFA 3VYVA 5DGDA 4D80A 2P40A 1VBFA 4DLWA 1G3MA 1SHTX 2I3GA 4RE6A 1JG4A 3EFOA 4CG3A 4ZVLA 1ZHOA 3E05A 1EJ2A 1G8AA 4RIFA 4TQUS 1DRWA 4TWAA 1RI5A 2WF6A 3PA8A 4RWZA 4ZGWA 3GBSA 1RWOA 4MIYA 3JQGA 4J91A 1TU4A 4BMPB 3ROZA 4J76A 2D1SA 5GJCA 3ZGNA 1MHPA 4P5PA 4HLUC 2VZ8A 4DCCA 4LXGA 3O2SB 1L8XA 2B8NA 5HJ2A 3L1VA 1EMDA 3CEHA 3PJFA 3HB0A 3OZAA 4WBSA 2X8JA 1L7BA 3OLWA 4B46A 5KTPA 1ZCJA 1YCHA 4YDSA 2PMFA 3NEYA 3PNLA 1SXJC 1XWFA 3LXRA 4IHAA 5F9MA 1MH1A 4KR9A 3V7UA 5IC6A 1A72A 5DGTA 3NNSA 4CM3A 4WBNA 1WEKA 3IXLA 4DIUA 3TPZA 3U2QA 4TMVA 3E2PA 4BGIA 3IJPA 4F12A 4XD7D 1KE2A 2ZCUA 2NAPA 4O2LA 1YRAA 3QYAA 2QXTA 3RU2A 3KAQA 3N3BC 1UJBA 4ZZ3A 4CF3A 3D6UA 2X6TA 3H9BA 3SKVA 3PNYA 5A6SB 1UPCA 3A7EA 5E0OA 4W6ZA 4H77A 3NYIA 3AL0C 2R7LA 4NX2A 1QKJA 2ZLBA 5JCZA 2G4CA 2NVUA 3KKNA 4LJ8A 4X24A 1FUUA 5KWIA 1N6IA 3ZK7A 3GMSA 4EFDA 4F9GA 5AQ1A 2B69A 2XLBA 1Y42X 4CDRA 2QUHA 4N5LA 2PTGA 4Y9DA 1Q20A 3PXGA 1E79A 2IUTA 4ZVVA 1I9CA 1T4CB 1PAUA 3AQIA 4I4IA 2CLLB 4M7RA 4O1MA 4U1RA 5SYAA 3WWEA 3PCRB 2NOAA 3WGIA 3SM3A 4E5UA 2UZIR 1T3HA 2F67A 2VUSA 5FO0A 2JFQA 3U7QB 3UJDA 1J8FA 1YA4A 4GG1A 2FW9A 1L5KA 1NLYA 3OTIA 5JRDS 3EQZA 4I9GA 1JXMA 3CBGA 3ONVA 1DC7A 2FWPA 5HA5A 3TD9A 3P2IA 3FRJA 3FKSA 2GYYA 1AKWA 4PAWA 4IJWA 2CDCA 3TM4A 1TZCA 4OFWA 1QNFA 4PZPA 5AI0A 3TZCA 3VNAA 1FVFA 1ZC3A 4FXPA 1DTEA 1AIPA 1UADA 1EGVB 3PUYA 3B7PA 2X0RA 1OFIA 5J2UF 2ZDQA 1W1UA 4MRVA 3TVYA 3ZY4A 1KOGA 3K5IA 2I7DA 4Y6PA 4KQIA 5CVVA 2H4WA 2OESA 2UUOA 5B1HA 1C30A 2OGZA 4BMNA 3P26A 1CF4A 2I6XA 1OVMA 5HBRA 1VKRA 1T2AA 1BKYA 1JIKA 3FUVA 3CR8A 3QPCA 2BDTA 5H7XA 3U49A 1W44A 4ZN6A 3VU1A 3QPBA 4YRZA 1O94D 2AOUA 2Q5CA 5DHTA 3IA2A 2D2VA 3AESB 3ITDA 4PCUA 1E2FA 1R50A 3DV2A 4TRMA 1QH8A 2H1FA 1OTYA 3DULA 1IRIA 1H94A 3ELBA 1O03A 4A23A 3F3YA 1B93A 3TUZC 1T1RA 2I55A 2W2KA 2WAMA 1QZUA 3C74A 3E2MA 1WSWA 3E9RA 3OPMA 1GQOA 1PT6A 4N5NA 4NPAA 3TRDA 4AF7A 1LW6E 1R0XA 2IP2A 3ENQA 3L7DA 4HFNA 4WCDA 5CLHA 5JG7A 4ZC1A 3ZXXA 1KEWA 2R84A 4UU1A 2C07A 4KYVA 4ZJPA 1AQNA 2PK3A 1YS4A 4H17A 3FUWA 1X1SA 1FU7A 5DM0A 3W6ZA 1Z16A 2O07A 2X5NA 1IU9A 2P2GA 2G5GX 3OKAA 4UE3S 4BFWA 3A6HA 3FYUB 4DR4B 2GK6A 1OAOC 2HF9A 3HB4X 3G2JA 1WMBA 1YQ9A 3M34A 1E62A 3MJCA 3Q98A 2VT2A 5IYZB 1ZH8A 4BECA 1QMGA 3H9EO 4JKYA 3UJ6A 2ETXA 4C76A 3C3PA 5BYAA 5JSQA 3RVNA 2Q5LA 4LMPA 1C3JA 2IOYA 4RLQA 1WF3A 2JFWA 3IV7A 2ATXA 5FUBA 5CA1F 4HT3B 1W2HA 3A36A 4RD2A 1QTQA 3AVOA 3K0AA 4B81A 4I3HA 3RS7A 4KQFA 2HJHA 4RD6A 2XCSB 5JVDB 2FDRA 3LFUA 4G0UA 1DO8A 2JIQA 3GARA 4TYYA 1J09A 1TZ2A 3ED5A 1G20A 4PRYA 5CFQA 1ZRHA 2NSYA 2W0MA 2DFLA 3CHYA 3VFDA 3G82C 2HJ9A 4QVIA 2VEOA 3NJ8A 5HS6A 2G8NA 1FTSA 1CY8A 2I8AA 2Z2ZA 3A0UA 3ST7A 4BMZA 1EGMB 3EJWA 4AP6A 3CFYA 4GFDA 1PLKA 4YJ3A 1FL9A 4LGVA 5GPBA 1VCOA 4TRJA 3UHAA 5KDDA 4NYIQ 4RADA 3RVMA 1V16B 3QH4A 4LZOA 1PLLA 5A3QA 3NWOA 1NONA 4ER6A 1H2EA 2DJ5A 1AQ6A 1YZYA 3E81A 3FVWA 3G2NA 2UZ0A 4R40A 3WKEA 3QXXA 2PGLA 3L3BA 1KORA 2ZBDA 4XEUA 1P0MA 4PFSA 4E13A 1TD9A 5D87A 1XCGB 1TO1E 2V9ZA 4EKYA 3I9FA 3KB6A 3THXB 3EQ9A 3RFTA 3KQKA 1TNDA 2DFNA 4DIFA 2DAPA 2PMWB 1I6KA 3PC2A 5DMHA 5BWMA 5H5JA 2W9XA 3KWMA 2AG6A 2H8KA 4WZAE 1KMQA 3I53A 4ZCPA 1BHO1 1JAIA 1XR3A 2AX4A 1RWPA 2FQ1A 4TL9A 4FEAA 1JLLA 1RVV1 3QG5A 4FMBB 1MDBA 1SKYE 2JGEA 1C7IA 1X1RA 2B4AA 1U2GC 3PA6A 4J0IA 3NBZC 3C85A 1T8PA 5AM4A 1IWPB 5ERXA 5FADA 4BBZA 5B55A 1ZVQA 4JHLA 1D2RA 4X61A 3ZHQA 3TZLA 4B71A 2P9FA 2H2HA 5F7XA 1DG1G 2C57A 1OFTA 3Q6IA 4IDUB 2FMUA 2O3SA 3AEQB 3LPNA 1G5FA 2C8VA 3KL4A 3NBMA 4GOXA 4EX7A 3V48A 4I1UA 6Q21A 5LMCA 1FNMA 3LO8A 3RVLA 5G1OA 3T3OA 3ZGXA 4FZJA 4J3NA 1XL1A 4HNVA 4US0R 4LECA 2HA0A 3H18A 4I81A 4RHFA 3FKSD 4L95C 5KTMA 2ZIXB 3EIHA 3K2EA 2C98A 3LWBA 4PWZA 3DLPX 3PFIA 1YB2A 1BGVA 1K97A 1N7GA 1NYQA 1ZEJA 4KVGA 4EEKA 1UDAA 1M6YA 3C3BA 3NIGB 5DYWA 3H5VA 1AKTA 5DTMA 3IPAA 2C2BA 3E8SA 1NF8A 1PZHA 4NKRA 2AUNA 3EFHA 5CT6A 5F3DA 4A92A 1EFKA 1BD4A 3A4NA 3BA6A 1UM9B 1XAJA 3HDGA 2WFLB 4JMLA 1S2MA 4R0NA 3TXYA 4CLRA 1K9VF 4KZPA 4PZAA 2QP4A 2X15A 5EPEA 1M33A 4OI4A 1TUIA 1TU3A 1K98A 4OO3A 5KNCH 4XFKA 3BB1A 1D5CA 3GVPA 3R5KA 5FWXA 3S28A 3WTBA 3U09A 1ZK1A 1M76A 2QAIA 3IBGA 2O3RA 3C7TA 2CHGA 1QRAA 1AT1A 4HZUA 3KOOA 5AKJA 1RTKA 2RH5A 2PMDA 2ZSUA 4N49A 2QVYX 4JEIA 1D6NA 5T8KA 4F4FA 2PUGA 4JB0A 2WIFA 4MCHA 3IESA 3OWHA 1U0LA 3HV2A 4JT8A 1OREA 4N40A 3QJGA 3VPAA 4MUFA 2J0VA 4U6NA 1XMIA 4C89A 1LPNA 4BNZA 2XE6A 4DCGA 1W6RA 3RS4A 4P98A 1Z07A 5BSRA 4BVGA 3FGOA 2VAWA 2CVHA 4KWIA 1UQUA 4PYJA 2R1VB 5ER6A 1DXYA 2AQHA 3FHJA 4O3MA 4QDXA 2UAGA 4N3GA 3T7RA 3K92A 4UHKA 5JZVA 1ZISA 5AW7A 2VLIA 4A73A 1SHJA 1F12A 4RXTA 2FPOA 3P45A 1Y4AE 2NT3A 3CLKA 3T9CA 1MAAA 1XZEA 2IX3A 1NNUA 4DV0B 2JIPA 3RYFA 4IMRA 2BRUC 4K9RA 3T1HB 4PLCA 3SEAA 4YJHB 1O6GA 4PAOA 2ADOA 1H1DA 4FJ1A 1CUDA 3A6KA 4OHCA 5CUQA 1O6CA 4EQ6A 5CH8A 4LTMA 4LQLA 1VZ3A 5I7SA 4EPRA 2HCRA 1WJGA 3AY6A 2NSHA 4QSMA 8ABPA 4QUHA 3QELA 1FUEA 3SYNA 4Z86A 4GX2A 1FFBA 2PIAA 1UBMS 4W5WA 5HK8A 3K70C 2AEJA 4AUKA 3HR7A 4WH0A 1Z7EA 4WXMA 3B9RA 4CEJB 3DXFA 5DHPA 4C4ZA 4YAGA 1YJ8A 3N2NA 3W3AA 4NECA 4O1IA 1O6BA 2R48A 3GIWA 4P08A 4W99A 5AW0A 1O0BA 2CJPA 2IWHA 4DV5B 121PA 1E1YA 5IYZF 4ZJUA 1U8AA 1MOZA 1W29A 2PA0A 4Q4LA 2Z5FA 4Q9HA 3CT4A 2Y1GA 3FWZA 3QKSA 3LT0A 4KPFC 1OC2A 2XUOA 3CNQS 3I37X 3VPGA 3UZUA 1Q2UA 2XB8A 1DC5A 1DIHA 4K46A 3AVYA 1VL5A 4PXAA 2CNWD 4QVKA 3R0JA 5FBVB 1YTLA 7REQA 3M6AA 2NNWB 4EW2A 2CK3A 2QUBA 3KQTA 4E2ZA 1ZITA 5JVDF 3LKBA 2JIDA 4PSVA 1WPGA 5BP7A 4QPCA 1NY6A 2V9CA 3JD0A 4I6JA 5BWNA 3HKCA 3OZUA 1NVXQ 3FNBA 1HRKA 1XZ8A 1JDJA 2E4XA 4MVJF 1RRMA 1Z2CA 3B20A 3KTAA 4WUTA 3WLAA 2QYTA 2QSYA 1SO8A 2R2AA 4L75A 5CW2A 3RRJA 4DDWA 1PX2A 3P9NA 4FYHA 1LH0A 2X13A 1MR3F 3WWCA 1NU6A 2YBDA 2FH5B 4KK3A 5FI5A 3O4JA 1J20A 2IBMA 3DQPA 3HCCA 4B7AA 1MJGM 2NO9A 4L5IA 4RQUA 1JG1A 5CCEA 4KQ2A 3R76A 3HTXA 5KVVA 2G40A 4MP8A 2WWYA 2YZ2A 3MJFA 4CM4A 2OCDA 2P65A 1BXGA 3VZRA 5WRFA 2GBLC 1H6BA 2ZBGA 5AIAA 2A9FA 4ZAZA 3ZOZA 2XMQA 1ZPDA 1QCDA 3ESDA 4LAFA 1GNQA 3DDSA 5LMZA 2WAYA 1N0WA 2ZUSA 4FLEA 1C8KA 1B76A 1JHDA 2HMWA 2XI4A 4UCFA 2DR3A 4PV7A 4WNYA 3UH1A 1XO1A 2Z5GA 4CUZA 3OEEA 5E8RA 4MO2A 5I3ZA 1APBA 2UUBB 1XDZA 4HATA 1S4QA 2GDZA 1ETUA 1SHLA 2PR7A 4RF3A 3SSOA 2QYOA 3GJ7A 3H1FA 3HFSA 4Y98A 1E5TA 1L4UA 1JDBC 1ZN9A 3W8NA 2PAFA 2WTMA 3IBCA 3LUFA 4TRRA 1COWA 2JLYA 1UPUA 3D7NA 4KV7A 4GM4A 1X8KA 1MO4A 3VR5D 3S3TA 4AJEA 2K2WA 1NW6A 3MB8A 3W8EA 5K0NA 4MVJI 1O77A 4ISBA 4UE6A 1MX3A 2CFOA 1YFKA 2YYZA 2XQFA 3HB5X 4LVNA 4DLLA 1BC5A 4YRCA 3UPTA 1FTNA 1NP3A 3BILA 4WN9A 2ZIVB 2JAUA 2VP5A 2RI6A 5KUTA 3FF1A 4Y1RB 1C3LA 2V7QA 3ED1A 2BBTA 3UB3A 4YV7A 3W5BA 1P1KA 3NXKA 3AFIA 2EP5A 3NM5A 2BFMA 2BUCA 2XCOA 1L7AA 2CXOA 4BLVA 4GYKA 5CBPA 3G8AA 5FI3A 4HS4A 4DQKA 3VSCA 1E3LA 2B4TO 4DMHA 3CRMA 3MD9A 3CRZA 1NKSA 1L7XA 2WD7A 3HCEA 3DF7A 3PYLA 1CP3A 3K9WA 1R18A 2FGKA 2G5TA 4N6OA 4UASA 4GQBA 1MTZA 3VDRA 3EXFA 4AJ2A 4DIOA 1X9GA 2ZTMA 4TL6A 3PVSA 4YEDA 4K6HA 2VT7A 3DDCA 1G8GA 3D2BA 4IFBA 4OI2A 5CM2Z 5FYDA 2DHEA 2MINA 7ADHA 5FBWB 5E7QA 3T0GA 3L0YA 2G77B 5D3MA 3IIIA 3EGWA 4MAFA 1VMIA 1PZNA 4B3IA 3W6OA 5BN4B 3I5YA 4HYYA 4BLPA 4EEZA 3MD0A 4ZTUB 2QD2A 4QAQA 3R9IA 5IP5A 1PR2A 4GNKA 1KEPA 1CHDA 1C7RA 4S2UA 5DCUA 4ZQFA 4PU0A 3LIPA 4Q6BA 4XLLA 3WLHA 2ZRPA 3LYUA 3IJRA 1AUVA 1N8SA 4G07A 1MZVA 4MV8A 1U0RA 3AG6A 1QYCA 1U4OA 1VRCA 1LVGA 2AT1A 4IVNA 3JCZA 3DLAA 1GTMA 5DGCA 2F64A 1XLWA 2V5VA 3USZA 1JXAA 2AFVA 4D9MA 5I8PA 1CQJA 3AKZA 2QL6A 2VI5A 2I4LA 1GG2A 1PQWA 1WUIS 2G9RA 1RWMA 2RD2A 2W70A 3NPMA 4LDZA 3QKRA 3K31A 4U6SA 3W3AD 2WQ7A 2GHQA 4U9HS 5A5EA 2GZ3A 1WW2A 2HBQA 2OUKA 2QT9A 7AT1A 3GLIA 3U44A 1BGXT 3R9KA 2Q9CA 6YASA 4L02A 1JHUA 2DHRA 3W34A 2OQRA 3O4HA 4ZO4A 2JFBA 4UAUA 1VMKA 3LKDA 4OX9B 2FMHA 3TLEA 3LNCA 5L4SA 2MJLA 2NO7A 3NIWA 3JQ9A 2DOKA 3M83A 3LSYA 4HB0A 5EY5B 2R4UA 2ERXA 3FMPB 2XIJA 4LCJA 4P6VF 5G4KB 4PVCA 3FB1A 3SQMA 4EGFA 1EX7A 3IAM1 1UWKA 2GGSA 4KDRA 1KEUA 2B83A 2WWTA 4KLNA 3V8MA 3PC6A 4G37A 4E14A 2IBSA 4S1TA 3HUFA 5D8DA 1M5RA 2QNIA 2ZJ2A 2R6R1 2Q5JA 4GXRA 4UXJA 2A1TR 3BGVA 1QK4A 4E2FA 3R7FA 5DHQA 2QN7A 3MAJA 4UOEA 5KHLB 4KO3S 1J8QA 3CTMA 4Q1CA 3FYCA 4B4KA 4Z49A 3HQ4O 1FF9A 5DNDA 2QM7A 2NYUA 2VJQA 4M0EA 4QDTA 4UCQA 1X2EA 4QYTA 5LZ2A 1I6LA 1WOYA 3SZOA 3KJHA 1QWOA 1V45E 3G89A 4H27A 2PLAA 3F5QA 3F6RA 4F6RB 1RRKA 1UBNA 4P36A 3RI3A 1QR6A 2VCHA 1IONA 2AD5A 2C59A 4C3VA 2V6JA 4MLDA 4DLZA 3R4CA 3SC4A 3GCZA 5IBCA 2QYHA 1U1GA 4JFRA 4ADSG 1XOIA 1JG3A 3IR6A 5I7AA 2Q4EA 1LPPA 2EFDB 3WQQA 4TMKA 3BMQA 3GLQA 5D00A 1A5BB 1EGAA 1COWD 1MQ9A 1YJBA 1EKXA 2L69A 3JYNA 1J33A 3EUFA 3R3UA 3TAXA 3VGJA 2C92A 3QGMA 3RANA 1DXQA 3Q7IA 4NCAA 1BA3A 2LP4Y 821PA 1SXPA 1RW4A 3L7LA 3E7FA 1N9KA 4NYJQ 3TINA 5K51A 5JV5A 1CUXA 3HA7A 4HTFA 5LC1A 1VG9B 5CIQA 4EJFA 6GPBA 4DB2A 3GJ0A 4R98A 5K0BA 2OGWA 2QBYA 3R8CA 4O2RA 2DH5A 4K6MA 5E9QA 3SR0A 1T6YA 5HJ5A 3HSSA 3VVBA 2YNMA 3OIVA 2R6ZA 4G0ZA 2NU6A 3ZDXB 1C0IA 1O8BA 1P61B 4C7OA 1C3XA 4W5HA 4RY8A 5CB4A 1ISHA 2AOXA 3ZLJA 2ZUDA 3OKFA 2YKGA 2E6KA 4JAVC 5AKXA 4O63O 1JEQB 4Y2SA 3NBQA 3M33A 2CMHA 1KZ6A 3N53A 1GPAA 1KZ4A 2CUZA 3MNFA 3L8FA 2TS1A 3L6EA 3SQLA 4QL3A 3TFWA 4KR6A 3OIGA 5BN5A 2OCYC 1CR6A 2REXB 2JW5A 1S9HA 2WY2D 3D7KA 3PGMA 4NQZA 3UW1A 4RTMA 1YR3A 2IUUA 4M8LA 3QPUA 5IDYA 3LPDA 4P92A 5KKNB 2H18A 2A58A 1SWVA 3LSTA 1ODIA 4LMRA 1QB7A 4NYJR 4D7AA 4YAKA 4LV8B 2VJMB 3C43A 2Q8NA 3WLSA 3K6SB 1DUIA 1OWLA 2HT6A 2CLKB 3VNBA 1AKYA 3L0ZA 4CT0A 2OAQ1 3O92A 1TUBA 4JDUA 4OIMA 2WD9A 4FTWA 3H0EA 5JXHA 4WOBA 4EPXA 4J8PA 2JJ1D 1J2UA 1EDEA 3ESAA 1KERA 4PNPA 1KEZA 3ZY2A 3JW8A 4Z4HA 3SYKA 4I1VA 3LC7O 2WHRA 4II3A 3K09A 4II2A 4TTQA 3DZDA 2FPPB 4GBGA 3IEMA 1O9BA 2VNJA 3R6DA 1GVHA 5LQCA 1LNQA 2H7VA 1O8CA 1OIXA 3L6BA 3THRA 1U5BB 3VAYA 1I7LA 2V0CA 2X4GA 1HOTA 3OD5A 4PLZA 5F23A 4CEIB 1TEVA 4O4IB 1DB3A 3MELA 1U5CA 1YONA 5JCOC 1C2TA 1IZZA 4M22A 1EIWA 2H3HA 1M8KA 1U2QA 2CHVA 2DU8A 1JQAA 2PKXA 3O7MA 1T34A 2Z2XA 3WL5A 2GM3A 3ZWQA 1IEWA 3ZCQA 4CN8A 2Y93A 3KKMA 4EGQA 2G28A 4YJGB 3DLCA 1XZBA 1Y7IA 2CXXA 1FFAA 3CE6A 3OEYA 1JQBA 1OYVA 2OM6A 4DA0A 4CM5A 2DWPA 3AILA 1SG6A 4E94A 3O1JC 1YB4A 1KYWA 1FRQA 1IM2A 5DI3B 1JDNA 1PO7A 3L07A 5LLSA 5TJHA 1H69A 2I4OA 1TZMA 3V32A 2QPLA 4PNEA 2W98A 3IBFA 2PUJA 1N7JA 4CM9A 4MIKA 2JB9A 3LY7A 4O4JB 4B0OA 4LRXA 3Q3JB 4P3PA 1Z7WA 2Z04A 5A6VA 1NN5A 1GYPA 2EZ4A 1AV7A 1UXOA 1FU4A 1E4YA 2D0IA 1SQ5A 3CZ5A 4KFUA 4NS1A 5A2GA 1YL6A 5HWSA 4RQAA 1NP6A 4YQYA 1MOPA 3K72B 3VJLA 4EMTA 4UQPA 5ALQA 3PWTA 2PH3A 4GWKA 4MDYA 4R2IA 4DN6A 3E3MA 3RFXA 3TNJA 2ZUFA 3BSSA 2R8ZA 4RL4A 1ZQ9A 5SZHB 3GWZA 1MJFA 3EAFA 1Z7YA 3KK0A 3O8BA 2WWGA 4ME6A 4NV1A 1E3WB 1NIJA 1OUMA 3VTFA 1NJ8A 1JKFA 3R23A 3I05A 2FEMA 4WOCA 4MP3A 1A2QA 3I2KA 5H4GA 1E63A 2ISSD 4ICIA 3KKPA 4FD2A 3K9CA 4DEVA 2BBOA 3BIOA 1GQQA 1NVMB 2H00A 2EFJA 3GLRA 4I9HA 4CMEA 3GUYA 3ACDA 2R7NA 1QNLA 3CRVA 1OOEA 1SQGA 3E22A 3QY0A 4G8CA 4O4LA 2FR8C 4YRFA 5F51A 4JEUA 3JS5A 4F46A 5C53B 2C5AA 3AOEC 4RJ2A 2JCXA 2Y4NA 5KHAA 2RAUA 4JBXA 4KVAA 4MIOA 4ZAFA 3B13B 2JGKA 1ZJ5A 3DD1A 4EFNA 4F2HA 5IWAB 4R8VA 3ND6A 4ROTA 4QUGA 3UCFA 3TZBA 4XW2A 5AXAA 1P2SA 2OFOA 5F12A 1HMPA 1AA9A 2SNIE 5REQA 1SUBA 1UDBA 2H4XA 4BKPA 5M29A 3TSZA 2C2ZA 4KO4S 5LQKA 2WJ3A 3OIDA 2QRZA 5L3VA 1OD6A 5IXYA 5EHZA 2GN8A 4KR7A 1A3CA 1E1RA 4RNCA 4WN3A 5C8XA 1H4SA 1K86A 3G2LA 4R7ZA 3AVPA 3KETA 1OI2A 4BCDA 5DHSA 1CY7A 3CEJA 3ANTA 5L3QB 1IG0A 1JVBA 3IHLA 4Z4GA 3I3OA 1M1UA 1W48A 3OX1A 3BBPA 2Q41A 1R0RE 2R86A 4MI3A 1W73A 1YDEA 1AKEA 3IQWA 2QE7A 3OCCA 3OZEA 4GLOA 4XOUA 4QYIB 5FR2A 2XCIA 3M2TA 1KQFA 1DGQA 2MU1A 1ZNQO 3CUTA 1LDYA 4LDJA 4NTZA 4QUIA 3TTTA 3M1YA 1UZNA 2PUBA 3HGMA 1G41A 1NSTA 3D6MA 4Y2HA 1PSZA 2MTBA 3STHA 1IY8A 2VHQA 2JFZA 3PXAA 3TI9A 4E08A 4GDFA 2IT1A 3SZMA 3U7HB 4AP5A 3GPBA 4FFMA 5IF3A 5GONB 5JADA 2YUTA 5LQDA 4FM9A 3GFRA 2WWIA 3I0ZA 3L2OB 4B6SA 3E35A 1SOAA 2PH7A 3G7SA 5ELMA 3KKLA 4BGUA 3AETB 5ESXA 2VBGA 1JRLA 4MYRA 1TU0A 4GKKB 1R3UA 1IXRC 1M2EA 3F0TA 3IDQA 4YDRA 3T3IA 3TG8A 4HR7A 4BN5A 2I29A 3TWOA 1CEYA 1DIOB 3TQTA 2I6SA 3A9UA 1QRTA 2XTMA 4CODB 2I91A 2ICAA 3WI7A 1Z38A 4JCCA 5FRDA 3T9AA 5TT0A 4A8JB 2ZZMA 1P0FA 1QO9A 3QVXA 3TQSA 2FSVA 3X1WA 4RXMA 1IN8A 4ND2A 3ZU5A 3IDZA 4OMCA 3PIIA 3EASA 2P6RA 1GSHA 4OI0A 1X3SA 2Q6VA 4C30A 3KVVA 4ABYA 4B31A 3CINA 4I4TB 3KM0A 4C7VA 4EHDA 2P27A 1DV2A 5KJEA 2ZR0A 4OXYA 4M1EA 5B1YA 2BI8A 1A9SA 1JHRA 2V7PA 5HUHA 1CB0A 3F3SA 4JUBA 4ALIA 1YI1A 5C5IA 3RAFC 1UDCA 1MT0A 2HIAA 3TBHA 3AUYA 4ALJA 1W96A 3DE6X 3Q7RA 3ZN2A 3SEFA 4IGEA 4O4IF 1T6NA 1WPXA 1Q0RA 1VCHA 2VHCA 3O03A 4DA9A 5B3JC 1XN4A 2AI3A 4MR8A 3O91A 3G8YA 1IBKB 1MEOA 1TEXA 1MW8X 1Q22A 1DDGA 2X9LA 4QGSA 1AX9A 1QHGA 3B1JA 3QMVA 2BIFA 2OBXA 1UEXC 5IDXA 1CUBA 1FLAA 5K4GA 2RAPA 3GA0A 3DAFA 3EZ2A 5CX1A 4CCYB 2JH3A 2UYGA 2WB4A 4I9UA 4C0JA 3B6EA 2UZ1A 3OFNA 4PX9A 2D5AA 1L1FA 2A7XA 2Q7XA 1BWPA 1SKMA 4B6QA 2OV1A 3PTLA 4KN5A 1CLEA 2KJQA 4RVNA 3INYA 4KXVA 1WZNA 3N28A 3I4LA 3OF3A 5DN9A 1HFJA 5HOQA 5CCXA 1L8QA 4UCXA 3TX2A 2PDAA 2CDRA 3R5HA 4ML3A 4H7DA 4NFSA 1QZXA 1BOFA 3BGSA 3RC8A 3UO8B 1PFVA 2XEDA 1U80A 2VA8A 4KDEA 3A1EA 2QN8A 5C34B 4MAAA 1LRKA 5BR4A 3OCJA 2HLHA 4MUIA 2NYAA 3O9ZA 2WINI 4GOJA 4X3OA 1R6BX 1TM2A 2ZI7A 4S1OA 4XCQA 4OFZA 3G1UA 4JL6A 4D4IA 4N4AA 3U4MA 1TT7A 3WO1A 1KJZA 1CERA 2RHDA 3UGQA 3ZKWB 1FFXB 3K9HA 5B37A 3HCFA 5DLQC 3M5CA 4TWZA 3GJSA 3ZBPA 5M7EA 2JLXA 5A9SA 3I39X 3L0CA 2NGRA 2OFXA 3E61A 4WNIA 4ZI5A 1E2BA 1ZN8A 2J67A 4BWYA 1OFGA 3VZDA 4KLCA 1ND5A 3FGZA 1X7XB