4E5YA

Structure of human fx protein, the key enzyme in the biosynthesis of gdp-l-fucose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
315
structure length
307
Chain Sequence
SMRILVTGGSGLVGKAIQKVVADGAGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-L-fucose synthase
publication title Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 94
structure length 307
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e5yA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4e5yA02
4GX2A 1GEEA 3UCFA 4WECA 1ENZA 3QVTA 2B5WA 2HK9A 2Y1DA 3NGXA 3H65A 4YQYA 1H93A 3IUPA 3WMWA 3QLJA 3QVSA 4MP8A 4TRMA 1BXGA 2WYVA 3RKUA 4BO9A 3PQFA 3O26A 3ZHZA 4G2NA 4GQAA 1Y8RB 4BV9A 4MVJD 4NI5A 4MIEA 1C14A 3WTCA 4EJ6A 4FFMA 1VPDA 3BMCA 3KB6A 2C59A 3LT1A 1NVMB 3MCVA 4N54A 3U4CA 4AJOA 4B4VA 1DC6A 3GLQA 4DQXA 1UUFA 3GMSA 3VVCA 4BB6A 1ADGA 2PV7A 3K9QO 4WCFA 4PVDA 4BKOA 2GZ1A 2CF5A 2V6MA 2CDBA 3KYCA 3ZU3A 3OIFA 5DCYA 4MVJP 5A02A 3NGLA 4YDRA 4B7UA 2UUOA 3NDJA 4I5GA 4JIGA 4L75A 3VC7A 5I7EA 4E5PA 4X54A 2VNAA 2VZ0A 4NHEA 3KLMX 3WX0A 2CDAA 2RHRA 2VCYA 3PHIA 5G0TA 3D1LA 4IXWA 1Q0HA 5B1YA 3X2FA 1VJ0A 3OM9A 1Y5RA 3GNQA 1AE1A 1T2AA 3DOOA 1Y6JA 3HWRA 1T1SA 2Z1NA 4QT0A 2QG4A 2C2XA 2Y68A 2EXXA 1UZLA 2VHYA 5DBGA 2YQ5A 2BRUA 4U6QA 3ZWWA 1ISFA 4Z6KA 4I5DA 3DZIA 4XB2A 1OC2A 3CINA 4XQ9A 4JX8A 5AOVA 4J2HA 3K6JA 3JQGA 2BFOA 1WW8A 4Z9XA 5L7TA 3DFUA 1Z82A 1GUYA 3KUXA 3NDRA 2XF8A 1DXYA 4DPKA 1O9BA 4W6ZA 2JD1A 1T1RA 3PHGA 2IEDA 2QIOA 2W2KA 1VSVA 2AE1A 1S6YA 1LXCA 1DC5A 4GL4A 2BLLA 1XSEA 5JYDA 4KWHA 5U9CA 1BDBA 5DP1A 4HX5A 4BL5A 4J4BA 3ZHBA 3LC1O 4QO7A 1SCUA 1E6WA 2Q4EA 5HS4A 1UP6A 1C0KA 2PZKA 2Z95A 3A1NA 4UUMA 3VH2A 1W0CA 2I65A 1KC3A 2JCVA 2NQ8A 2O2SA 2G82A 1NVTA 4BGUA 1LDEA 4IM7A 1HYHA 1BMDA 4M86A 1FF9A 4MDHA 3AW9A 1Y8QA 3FNFA 4J49A 1PL7A 3GUCA 5JDCC 2GN8A 3WGQA 5IF3A 5CPFA 5CAEA 2GERA 4BNWA 4W9NC 5B12A 1GL3A 3R6DA 2CDCA 2WD7A 2HMTA 4D44A 4L4RA 3UFXA 5IDYA 3DOJA 3FPCA 3ENNA 1A71A 3HB4X 2PNFA 3RUCA 3BTSA 5JAIA 1C0PA 2QYSA 1DBVO 1B8VA 1VE9A 3KTDA 4IDEA 3HQ4O 4W7IA 4BO1A 3CXRA 3GEGA 4ZVVA 1LC3A 4E0BA 5K9ZA 1JVSA 4MO2A 4O1MA 4D0RA 1C1DB 1EE2A 1HKUA 5GZ6A 1YDEA 2DBVO 3N7UA 2BFMA 2I5PO 3WGYA 1UDAA 4QQRA 2OGUA 3AJRA 3GC6A 3TZKA 4YAGA 1I8TA 5CG1A 4BO6A 3RC9A 4UREA 2E82A 2J3HA 4GWGA 4NFSA 2H6EA 5A3JA 5A9RA 4CM9A 4FD3A 2VWPA 4ND1A 4AFNA 1QYDA 3ZWOA 3BMCB 4YYZA 2GPTA 1OAAA 1N7HA 1E3EA 4ZQBA 5L40A 4UEJA 4I5FA 5T6BA 4IDAA 1P1JA 3K8ZA 2YV2A 4WCFB 2RH8A 4A5OA 2RHCA 2PKRA 3GK3A 1BDMA 1Z6ZA 4PLCA 3ETEA 3ZWPA 3UOGA 4Z3KA 2Q1SA 1BVUA 1YGYA 3DXFA 4TZKA 1GPDG 1Z7EA 4GX1A 5JY1A 4R1NA 3GEMA 3OQ6A 1R16A 2XAAA 4KQXA 1E7MA 3SC6A 2PA3A 4F45A 3TL2A 1X15A 4L4XA 4RV9A 1MV8A 2ZCUA 1LRLA 2Q3EA 3ZHYA 5B37A 3PK0A 1DEHA 1U4OA 4FJ2A 3S1LA 1EEHA 2CZCA 3H5AA 3I9KA 4LVUA 1KVUA 2WDZA 3PHHA 5GMOA 5B4VA 5G0WA 4NBRA 3H4VA 3BTVA 1LUAA 1CWUA 1PZFA 3NEPX 3AOEC 3SLGA 1AXGA 1WZIA 5F5NA 1IPFA 4M1QA 3VZPA 4CM1A 1EK5A 2OFPA 5KVCA 3WBFA 2X8LA 1DRUA 1U3VA 3JQGB 4HNGA 3AU8A 5DZSA 3TWOA 3GRKA 1P0FA 4N5MA 5HA5A 2Q49A 4XDYA 3TL3A 3IC5A 4RLSA 2PKQP 3KETA 1RM0A 2W2KB 1D1TA 3RJ9A 1PGOA 3T7EA 3V2HA 4PG8A 3U4IA 5TLSA 4E4YA 3HN7A 3OIGA 3JYNA 3A4VA 2HO5A 3E03A 1NQAO 2POQX 2VHVA 3OBBA 3DHEA 1N7GA 1AHIA 1BSVA 1DC3A 3B70A 1EMDA 5H83A 2C29D 3OA0A 3H5NA 3T4XA 3PXXA 4I8XA 4UEOA 2DAPA 2BMAA 5T8KA 3FPLA 3OEWA 4XR4A 1I32A 1BG6A 4WLFA 2IRWA 4ALKA 2QRJA 3ABIA 1RM5A 3SXPA 1ISMA 2FMUA 1NVGA 2WD7B 3RU7A 4BNKA 2PLAA 1H6DA 2EEZA 4QSMA 1LDMA 4EEZA 2CFCA 2IZZA 2AHRA 2I3AA 5A06A 1XCBA 3ROKA 1B0AA 1UZMA 4CLEA 5CDGA 3ONFA 3ZV3A 4E2XA 1OZAA 4O5OA 3DBVO 4UVDA 4YACA 4WLOA 5IAAA 5COBA 3BA1A 1PS9A 3S55A 4R16A 3BZUA 3GGGA 1PEDA 2W2LA 2YHIA 1GPJA 5KTKA 1ISHA 5JAZA 3QWAA 2Y0EA 4J2OA 2CUKA 2I9PA 5A04A 1QLHA 3O03A 1JLLA 4OO3A 4ESOA 2JHFA 5A9TA 2UVDA 1XHLA 4P38A 3QSGA 1AN9A 4RF3A 4YR9A 2C54A 2DKNA 4CV1A 3I1JA 5EL0A 2OHXA 4YAEA 2AG5A 4L8VA 9LDTA 2NU9A 3FRJA 1TT5A 4MP3A 5EERA 4ZICA 4LISA 2PKQO 3MWDB 1DC4A 1A9ZA 3ONDA 4IIUA 4CMCA 4KDEA 3KO8A 1ZZEA 3GNTA 2PH3A 2DVMA 3OICA 1FDWA 3I5MA 3WJAA 1JU9A 2FPPA 3ZI0A 1ONPA 3S2FA 3E18A 4E33A 3LLVA 3WGHA 3G1UA 4ALIA 1LDNA 3H2SA 1LDBA 5JMPA 2FN7A 1KVSA 5F1KA 5U4QA 3ZNQA 1R6DA 3PRJA 1A7KA 4JK3A 3IAHA 1KS9A 5L3ZA 3ST7A 1F8GA 1EQUA 3LYLA 3DL2A 1O5IA 4EGFA 1YJ8A 3F9IA 4JJIA 5IJZA 1P31A 3TPCA 3CTMA 2HDHA 4B8ZA 1V0JA 1LX6A 2FSVA 4A2CA 1RM3A 5JSFA 1MXFA 3ZWYA 1BW9B 4PLGA 2PGDA 2PZMA 3I83A 1NAIA 4ZQHA 1ZXBA 5DCUA 3DMYA 1TB4A 1U3WA 1XQ1A 2NVBA 4W82A 2BI7A 2BFAA 4MIYA 1MA0A 1EVJA 3TJRA 1UDCA 5IZCA 1YOVB 3B20A 2GASA 3RU9A 3BTOA 3H9QA 5JFOA 4MINA 4ZN6A 2AW5A 1SEVA 1P1RA 2EERA 2UYYA 5JW6A 3SLKA 3VZSA 2TMDA 4ZD6A 4K28A 5C7LO 1PR9A 3F1KA 1HYGA 1HDRA 1MXHA 1O94A 3JD0A 4WUVA 1LA2A 2RH4A 1H9BA 1W73A 2EP7A 4RPKA 4ZJUA 3WBBA 2W98A 4J9VA 3WLEA 4DC1A 3SEFA 1UP7A 1DOHA 3AM3A 1ZSNA 2P2SA 5KVQA 2B0JA 4JN6B 3FNHA 1E1LA 2CNBA 4QFCA 1FMCA 4RPGA 3QE3A 3ZNPA 4YRDA 2WWRA 4DLLA 5KIAA 1HT0A 4B8WA 1I3LA 3HDYA 1SB8A 1IULA 4FFNA 2LDXA 3DBHA 1MG0A 2AEFA 2E6UX 3RVDA 1DRWA 4P8RA 3U0BA 1EBUA 5AQ1A 3GOHA 5KJEA 3IKTA 3HDHA 3KSZO 4BGEA 1GADO 1U2DA 2AQIA 1KY5A 3OMLA 3G79A 3WYEA 2X7HA 2BELA 1HE5A 2HMSA 5A4DA 1YKFA 3U4DA 4WE3A 3GNSA 4ND4A 4AJLA 1HLDA 1FK8A 4DREA 2V6BA 4L73A 5HTOA 4RZHA 2R6JA 4CUJA 3VHRA 3WNQA 2YHIB 3WQSB 2WE8A 3WYBA 2B4QA 4J7XA 1UP4A 2NU7A 5GY7A 4Z3DA 1PGPA 3BHMA 5L4LA 1HF3A 3E9QA 4YJHA 3GA0A 1A4IA 3TNLA 4KDFA 4NBUA 3QW2A 3CMMA 4D3FA 1XU7A 2NWQA 1VRWA 4PGFA 2X58A 1WMAA 4CUZA 4AJNA 4WOJA 2YV1A 1PX0A 1NHWA 5ILOA 2GR9A 2J3KA 4GWKA 4A26A 2QW8A 3U62A 2NTJA 4NK4A 3D4PA 5BSHA 3C1TA 3W8FA 2AQKA 2HUNA 1HEUA 3QVOA 4MKXA 4J7CA 2CD9A 1V3TA 3VPSA 1QP8A 2YFHA 5C3MA 4PIVA 2AQ8A 2GNAA 1Z7BA 4OIMA 3VH3A 1UXKA 1HE4A 1ZK0A 1HZZA 1VKNA 5EIOA 1Z45A 1PJ4A 5BNFA 4B3JA 3RKRA 3OJ0A 1VM6A 1HE3A 4C7KA 3BMOB 2AEJA 1XA0A 3MJ4A 5F5LA 4CQLB 1R4MA 4E3ZA 3F4BA 4DLBA 2X5KO 1R66A 2BKAA 5TSDA 2VHWA 3B6ZA 4BO3A 1P1FA 3P2YA 3WWYA 3DEYX 2BH9A 3P2OA 3TDKA 3F6YA 1WVGA 1F8FA 2VTDA 4FOOA 2Q4BA 1X7DA 1D7OA 5EQDA 1NR7A 2Y99A 1B3BA 4J1QA 5K6AA 3M2TA 1D1SA 4W4TA 1CIVA 1JWAB 4NJMA 2Y93A 4DGSA 2NLOA 4A03A 5TRTA 4INAA 3DMTA 1G1AA 2VUSA 3RC2A 4L4SA 5JS6A 3V2UA 2A94A 2OMEA 4GGOA 2EHDA 1FJHA 1ZW1A 4WLVA 1R15A 5TS3A 5JO9A 4MVJG 4IQGA 1CDOA 2X6TA 3BIOA 2B83A 3GPIA 1KEWA 2PK3A 1UXJA 2GN6A 1MC5A 3MJEA 3RFTA 2YFQA 4IY1A 4HUJA 3RBVA 3D7LA 2I99A 3GMDA 2R00C 3C7DB 3K2BA 3RFXA 3PP8A 4MVJE 4YAKA 5CDUA 2Y1OA 1YL6A 3FI9A 5T67A 4BS9A 2Q46A 4DQUA 3COSA 1VKOA 2AE2A 3U49A 2C2YA 3FCOA 5AXBA 4J90A 3OJEA 3AY7A 3TN7A 1T4BA 2H9IA 3WNVA 4OXKA 3K31A 3H9UA 1NASA 4GGPA 4OXYA 2V6FA 3O4RA 4CLXA 1F06A 4KUEA 3R0IA 4CMGA 3IJPA 2ZTMA 2Z1MA 2NNLD 3HN2A 3UN1A 1TI7A 3GEDA 3GVPA 1PJQA 3T4EA 4YJHB 3BMQA 3BHJA 4HNHA 3R3SA 1V3UA 3WSWA 2D0IA 2V7PA 1H5QA 1GV0A 4I9HA 1Y81A 4IJVA 2JKVA 4RPLA 1BWSA 2ZB4A 2YZ7A 3LT0A 3C85A 4BQRA 1CQJA 3GHHA 5KVSA 2JFFA 4RPJA 3DZBA 1YDWA 4XYMA 4BNLA 3GH3A 3AUSA 4AJ2A 3ZWCA 1HDZA 1HL3A 1Q1NA 2ZTVA 2HCTA 5TX7A 2AA3A 2JCXA 5ES3A 4YJGA 1D3AA 1K5HA 2D4AA 5CEJA 2J3JA 4OSOA 1CF2O 1FDVA 5I9MA 1XU9A 5BNTA 5EN4A 3ZU2A 5C5IA 3WS7A 1V35A 3I9LA 3OJLA 2YY7A 2ZJ1A 1QV7A 4WCDA 2OBYA 2ZKLA 4CLDA 2NACA 1ZMOA 5BQFA 2X22A 5DDIP 1R4MB 3I6QA 4HXYA 4PZCA 5T5QA 4FR5A 1ENOA 4RQTA 1Y9AA 3I6IA 3NTOA 3FWZA 4WCFC 5F1PA 5JC1A 3MOGA 1HXHA 3UICA 2WD8A 4CLHA 2NU8A 1I33A 1L7DA 1MC4A 3G49A 1KBZA 4ZRMA 3WGTA 2D1YA 2W2LD 4Y8VA 4BNXA 3JQDA 4CL8A 3PYLA 4Q3NA 1UAGA 1X1TA 4IMRA 3SJUA 2X5JO 3DZGA 5TT1A 2IODA 1UR5A 2JFGA 4AICA 3AY6A 3OH8A 1ZJYA 2CVQA 3GUYA 2B5VA 1NR1A 1U3TA 1N92A 4K9DA 1C1XA 2HK7A 2VYVA 3RI3A 1U8XX 1U5AA 3QA9A 4IQ0A 4TMFA 4BO5A 4CR7A 1GQ2A 4FC7A 1I30A 2Y0DA 4P22A 3GFGA 2X23A 3QY9A 4M49A 4YB8A 3DFZA 3IOYA 4BNFA 4CODB 4E6PA 4ALJA 4KTTE 4CLRA 2O3RA 3TFQA 4PLVA 4GSKA 2J6IA 1DJQA 2P5UA 1GY8A 1QRRA 2H1SA 4BV8A 1DJNA 1ZBQA 2ZQYA 5CDSA 2ZJ0A 5G0VA 4FC6A 4UVEA 1H0KA 3EK2A 4DC0A 1DIGA 5KJ1A 4KMSA 1E77A 1NM5A 3C8MA 1LDYA 5CP8A 4WLUA 1RKXA 4PLYA 3UF0A 5JYEA 3F4LA 5FI3A 4D0SA 4D7AA 1SNYA 3E5MA 4RO0A 4HFRA 1JQBA 5ICSA 2DLDA 4LRTB 4XYGA 1YVEI 1T2FA 3VKUA 4ZGWA 4NFYA 3D4OA 1CJCA 1GQYA 3NT4A 3RROA 2VUUA 4KUGA 1DAPA 2GN4A 3KXDA 1NQOA 4A27A 1P33A 4DYDA 4YPOA 2HQ1A 3AUUA 1R0SA 3RJ5A 2J3IA 3S8MA 5G4KA 2ZQZA 5KOIA 2AG8A 4PZEA 4C4OA 3GVCA 3BMQB 1F17A 4AJIA 3AWDA 3QVXA 3PWKA 1ADBA 1YBVA 3ROQA 4BNZA 1NFRA 4U7WA 4GMGA 4NBWA 2PD6A 3BMNB 4JQCA 4PZDA 4D3DA 3D3EA 1DDOA 1ZFNA 3IP1A 1ENPA 4MOWA 3E9NA 5F21A 3FR8A 4OH1A 1YWGO 2W8ZA 3W6ZA 4D45A 2PZLA 1FXSA 2FZEA 4XGIA 4DPMA 1PQPA 1VL6A 5GZ1A 3DB2A 1Q7GA 3IS3A 3NT2A 4K26A 1E7WA 4RVUA 2PD3A 3HFSA 4GI2A 3QHAA 1VJTA 2E37A 4OSPA 4QX6A 4CLOA 1PZEA 1BHSA 2Y1GA 2ZYGA 3ICCA 4A10A 3WYCA 3H3FA 4QXMA 1X7HA 5FYDA 4BNVA 1HLPA 3OEYA 3I4CA 1DHTA 4J4HA 3SBOA 1OMOA 2CSUA 4WGGA 2DUWA 4MVJI 4CMAA 2RBEA 3UCEA 1GZ3A 3GFBA 4OOFA 3VTFA 3U9LA 4YT8A 2ZTUA 1BXKA 2GYYA 4IDFA 4YJDA 2VWQA 1RYDA 2DFVA 4OKIA 1I10A 1OC4A 1XDWA 1ZCJA 4TQGA 5BR7A 5JO0A 3HFGA 4B3IA 2P9CA 2GF2A 1ADFA 1YJQA 1ZK4A 2FSSA 1QR6A 4DLAA 2PGLA 3L9WA 3GDFA 5F3RA 4E2ZA 2OZPA 4QUKA 3VTZA 4BNTA 1ZK1A 4YCAA 5ENVA 3LZ6A 1BXGB 5JNLA 3MTGA 3QVWA 4KOAA 3NV9A 1SO8A 3C1AA 2PFGA 1DRVA 4Y6RA 1AUPA 1A5ZA 1NPDA 2JJYA 1EFLA 4B4OA 1IZ0A 1X7GA 3WICA 2B69A 4JBHA 4OL9A 3BXXA 3WLFA 3ASVA 1RM4A 3H9GA 3KEQA 2C0CA 5A9SA 1NFQA 3TF5A 2BGMA 2YYYA 4UAGA 1R12A 1XQ6A 4Z9FA 5TNXA 1YXMA 3KYCB 5FEUA 4GVXA 1E3LA 4EI2A 4L76A 5A3VA 3E8XA 4FFOA 3RIHA 1GR0A 2VWGA 2CF6A 1PZGA 1EUZA 1X14A 3CMCO 3JCZA 1U1IA 3DZFA 4JJGA 4MKZA 4Q3EA 4R4JA 5A5FA 5DN9A 2FPIA 1ENYA 4AJJA 4OXNA 1JAXA 5T8KC 5L4SA 3INTA 1E7SA 2Q1TA 4J9UE 5DBFA 2HAEA 3RBXA 2Q1UA 3WGOA 5AXDA 3H7AA 2EW8A 4YWJA 1JTVA 4BNIA 4D3SA 1T2CA 1CERA 3ZDFA 2SCUA 3WSVA 1LC0A 3GQVA 2VWHA 1ZK2A 2DBRA 4GLOA 5KCZA 2X9NA 3I9NA 3GF4A 4LCJA 2VRCA 3ZW8A 1VSUA 2JHGA 3DBLA 4A73A 2AEMA 3PJGA 4XR9A 1PWZA 4KQWA 4NG5A 3OFSA 1A7AA 4CMIA 4MJLA 2ZYAA 1IL0A 1E5QA 1PJCA 3GAFA 1WDKA 4CM5A 1P0CA 1JKIA 2O3QA 1CRWG 3BAZA 2HMUA 3IKVA 4S1VA 1K6XA 4TKLA 2XPCA 2QZ9A 3O8QA 3PJFA 3AK4A 5CDTA 4IDDA 1D4FA 2UV8A 3ONEA 1I2CA 4CR6A 1C3VA 3MJTA 5J23A 5ADHA 3E82A 5JCXA 3SC4A 4I5EA 4CLOB 1ZKMA 3H6KA 2H63A 1DLIA 4YJFA 4Z0PA 3LC7O 4Q39A 2B35A 3EVNA 2FR8A 2HK8A 1GTMA 3C7AA 4AG3A 1TVEA 5BSFA 4RDHA 4JJFA 2B4RO 1Y8QB 2IXBA 4IXTA 3CEAA 3FHLA 1NWHA 1W4ZA 3L9XA 3O9ZA 4HFNA 3S2EA 3VDQA 3G17A 4NNJA 2VT3A 4J7UA 3U5TA 3MEQA 3D3WA 1AGNA 4FSHA 1EUDA 4K6CA 4CMBA 3IQDB 3WMXA 1K89A 1W6UA 4O0LA 4WLEA 3M6IA 5EQFA 4FOSA 5IDXA 4IZHA 4Q9NA 4EJ0A 3VH1A 2IE0A 3G3EA 4OQYA 5KWEA 1OBFO 3JD3A 1PS0A 3ZHXA 2I6TA 2OP1A 2C07A 3RQSA 1G0OA 3C3XA 5U1PA 4CMEA 1N9GA 4EW6A 1PL8A 3N58A 3K92A 3M1LA 2WEKA 3RASA 1W8DA 4UVHA 1N2SA 3V1UA 4ALNA 2PWZA 1PL6A 4QECA 5FI5A 3ETGA 3F1LA 1EDZA 1B26A 3HHPA 3P19A 4J91A 3AUAA 4U0JA 3TRIA 3ZN2A 5A9SB 5IZCC 1IZ9A 5L7YA 1KY4A 2EGGA 2YDXA 5IDQA 2VHXA 1ZEMA 4LRSB 3VPHA 4XKJA 4IIVA 3WGGA 1IE3A 4XDZA 3RCBA 2VQ3A 1B8UA 4BGIA 3PZBA 3UAGA 2X4GA 2A9FA 2YHUA 3ZH2A 1WNTA 1E92A 3WQRA 3RC1A 1QLJA 4PG6A 1HYEA 2YDYA 2PZJA 1EFKA 1LJ8A 3GZNA 3DONA 3DR3A 2O4UX 1GAEO 2DTDA 1MX3A 2DU8A 4FS3A 2D2IA 4BMVA 1N1GA 4NJOA 3PYXA 1MFPA 1UXIA 2F00A 4ALLA 5MGBA 4YXFA 3U3XA 4BNJA 4UVGA 3A14A 1MFZA 2WYUA 3D64A 3R1IA 1HETA 3KYDA 4WK6A 3OIDA 1UAYA 4NBVA 1DFGA 1LSJA 4D42A 1F14A 2GZ2A 3F5SA 1XG5A 1YO6A 1H6CA 3EY4A 2HMVA 2VYVD 3DBLB 3STHA 5G2OA 4XZ3A 3ZV4A 4CMKA 4EEXA 4CQMA 4H16A 3L0DA 3E48A 1IHYA 1LLUA 5CFZA 4CMIB 1K2WA 4ROSA 1ISJA 3ZNNA 2NADA 2WJPA 3EDMA 3LK7A 4PVCA 2A35A 2P9EA 4TROA 4H15A 1HSOA 1QYVA 4ZHSA 4BOYA 1LLDA 3FD8A 4OHUA 4ZQFA 1JAYA 3CKYA 4Y9DA 3D0OA 2I3GA 3PHLA 2PD4A 3A9WA 4FPXA 3ZWMA 2ZATA 5DOVA 1ZO8A 5ENDA 4NIMA 2O7SA 1WLYA 1U8FO 3V5NA 4MVJH 5T64A 4GAEA 4XYBA 4Y98A 2WE7A 2X1HA 3JSAA 3TSCA 1GFSA 4BIIA 3GVIA 2BF7A 1YB1A 4FFPA 3RUDA 4QFDA 1P44A 4L74A 2ZYDA 5I8WA 4NMHA 1GUZA 4WPGA 3ADOA 1WDMA 3PJEA 1MLDA 3RC7A 4R9SA 5C37A 4FQ8A 3QQPA 1NPYA 4J43A 4TZTA 3D3WB 1M2WA 3HSKA 1GDHA 4CUKA 5ITVA 1B14A 1VLLA 3EZYA 3D5TA 3QWFA 2XOXA 3HJAA 4BGVA 2X9VA 3GDOA 3I4FA 3V1TC 3V2GA 2A92A 3JQ7A 3L4BC 4ND2A 1I3NA 4UUPA 3CSDA 4ZU3A 4HFJA 5DNAA 1NHGA 3ZWVA 4WOKA 3JYLA 1VJ1A 6ADHA 3IL2A 2OL4A 4W99A 3RWBA 3OECA 1N9GB 1I01A 4RVHA 3DHNA 5IXSA 1GV1A 2GUGA 2E4AA 3WWZA 3DC2A 4IGFA 3AU9A 3EVTA 4OJNA 1GYPA 4J4TA 1PIWA 2DPHA 5CEFA 3E6AA 1TT5B 5TQVA 1GU7A 2Y1EA 3KSUA 4BKPA 1T2DA 1MGOA 4G81A 1N5DA 2C7VA 2FR1A 2Q45A 2C82A 4R1TA 4RF5A 1YL5A 1K3TA 3Q2KA 5K6AC 1J49A 4ILKA 1PWXA 5L9AA 4HY3A 1ULUA 1FDSA 4XYLA 1LQTA 3GZNB 5EESA 3EZLA 3DMTC 4LK3A 5EINA 3L4BA 4DMLA 2O3JA 4IPTA 3LT2A 4QO8A 1R0KA 1Y1PA 1O0SA 1B7GO 2Q99A 1NBOA 1G0NA 1DB3A 1HRDA 4QTZA 4IMPA 5IN5A 5JC8A 3ROPA 2QX7A 1E3WA 3VZRA 4XA8A 2GLXA 1V9LA 1WDLA 4N18A 5JPIA 1HDOA 3TQHA 1NNUA 4DRYA 1YQGA 1I3KA 3KYDB 4I1IA 4LN1A 3TZ6A 3C7CB 3R3JA 4RVDA 4GMFA 5JBIA 2AMFA 2X5OA 3ZCXA 5CEEA 4WJZA 1UZNA 3WIEA 5EPOA 1O6ZA 4DVJA 4I08A 3UXYA 3UGKA 3C1OA 3GN2A 3KSDO 3GGOA 3JQBA 4WEQA 2D5CA 1KERA 1LRKA 1YQXA 3KEOA 3LC2O 4E5MA 4CM9D 1XYGA 3P5SA 1YH3A 4IINA 3NTQA 3NRCA 4BMNA 2ZB3A 4DPLA 3GDGA 3Q0EA 1TEHA 3PIIA 3M2PA 4EUHA 2JAHA 3OF2A 1LI4A 2C5AA 2ILTA 3H9JA 3NTRA 1F0YA 2VRBA 2FRDA 3FNGA 4EYEA 3PLRA 1E7YA 3UKOA 3JQ9C 1PQUA 3KBOA 5DBIA 1Q0LA 1I5RA 5DF1A 4DYVA 4F6CA 3IP3A 1Q7BA 1CEQA 3DBHB 1F12A 4C7JA 2HSDA 4Q3AA 2G0TA 4J0EA 3F46A 1H2HA 3FNEA 2Q2VA 2Y1FA 4AVYA 1RPNA 1SC6A 3I9OA 4O6VA 4B7XA 3ITDA 2O50A 3JQ6A 3KHUA 2YW9A 4BKRA 3INRA 4LSWA 3FN4A 4PLTA 4NPCA 2Y0CA 3AI1A 3LQFA 4JLWA 4TVOA 4XB1A 4NZ9A 5IFLA 4R1UA 5THKA 3I52A 2C5EA 3LSYA 4DQVA 3WR5A 4PLFA 1X13A 2YUTA 4R54A 2VRCD 3LT4A 3OHSX 4AJHA 2BFPA 4MIOA 4IBOA 3Q9UA 3H9EO 1P1HA 1DIHA 2LDBA 3OSUA 5B4UA 1X0XA 4PN3A 4YRBA 3JQ9A 1E1MA 4GVLA 4ITUA 3LU1A 2W4QA 5THQA 1E3SA 3EYWA 4J1SA 4EUFA 1DFIA 2Y66A 3ETDA 1NQ5A 1NX6A 4RZIA 1LQUA 3HNPA 1V6AA 3DAPA 1IYZA 2ET6A 4DBZA 4Z0TA 3OA2A 1LSSA 1TLTA 3OJFA 4NU5A 1S7CA 2GZ3A 4K1LA 2UDPA 4R5HA 2C7GA 5CG2A 5IN4A 1HSZA 1HDGO 2NVWA 4BMSA 3JD1A 4IZIA 3JD2A 3NDIA 3QJ5A 3FWNA 3PEFA 4XGNA 4OAQA 1T2EA 2OBNA 3IDSA 3TZHA 4O59O 4FJ0A 4RCVA 4E13A 4ZQGA 2DBZA 5DP2A 5AXAA 1PJ3A 2CVZA 1E3WB 1SMKA 5L51A 1B2LA 1IUKA 1SOVA 2P9GA 4B4WA 1DLJA 1B8PA 2ZCVA 1E7RA 1V3VA 4DWVA 3FTNA 3JYPA 3VKVA 1KC1A 4PG5A 1CETA 2JCYA 4GPD1 2HLPA 4LMRA 1YBAA 3AOGA 3Q6IA 3VPXA 4II3A 3ZWAA 1V8BA 2GN9A 3F5QA 2Y05A 4CR8A 1PR3A 3W4KA 1XGKA 5HWSA 3JTMA 3GVHA 5LC1A 1M67A 1U4SA 2UUPA 4RLHA 1BXZA 2NTNA 2GGSA 4NJMB 2YJZA 1PGNA 1YB5A 5DCWA 3RFVA 2B4TO 5L95A 3KVOA 3HDQA 4FIZA 1G6KA 3PDJA 3RUAA 3G0OA 4PFJA 1YBMA 1E6UA 2I66A 3I9MA 2VOJA 7ADHA 3T7CA 3I23A 1ISGA 1SZJG 5JDIC 4CJXA 3F47A 5ER6A 3WQQA 1GYQA 4CM6A 1KEUA 2G17A 4RPHA 2FP4A 3MJCA 4UUOA 2BD0A 1C1DA 1KOLA 4MKRA 5HM8A 4YVFA 3ZNOA 5TJ9A 3ZWXA 3D4NA 4CV3A 4IDBA 2Q2WA 4ZQEA 3DQPA 4P4LA 4R1SA 2FZWA 2G1UA 5K0ZA 2EWMA 3MJVA 1L7EA 1VC2A 1WMBA 4PLPA 3EGOA 4Y67A 2FHSA 1IB6A 4O63O 2DQ4A 2GD1O 1ARZA 3PFWO 4IS2A 5JAQA 6LDHA 3S2IA 4IGEA 1N1EA 4P4NA 1ZSVA 1ORRA 1IOLA 1K0UA 3WG9A 4XRGA 3QP9A 5A05A 3PFFA 3IMFA 4EUEA 3BTUA 1XEAA 5I9NA 1KVRA 2DT5A 4YQZA 2O2YA 4YT5A 3GY0A 1I0ZA 1LLCA 1Z74A 1O8CA 3KOUA 4NDNE 1LBEA 4CM4A 4U5QA 4CQMD 3CUKA 2O23A 2DTEA 5JDIA 1C0LA 2V65A 3PQDA 1YE3A 4NBTA 3W4IA 2V6GA 1P1KA 3LF2A 1SBYA 4Q3DA 1I2BA 1KVTA 4GH5A 5TGDA 2JD0A 3IUSA 3VAZA 3DZKA 4NH4A 1E1KA 4PLHA 4XYEA 2FY8A 1EVYA 3JQFC 2NVUA 2BGLA 4B7CA 2NV6A 4HKTA 4WEOA 4YJGB 3I3OA 2NUAA 4DIFA 2WSBA 1MG5A 3MOIA 4J1TA 2H5LA 2DTXA 4WASA 4QEDA 4U6SA 5JXWA 4R3WA 3NUGA 3JYQA 1SB9A 3E1KA 3FBGA 3MJSA 2HJRA 3N74A 4DIBA 3NAQA 1OOEA 4B4UA 1J5PA 5ICMA 1J4AA 3JQAA 4BHTA 3DWFA 5KVVA 4UEKA 2JFHA 1PGQA 2XXBA 3GGPA 2VUTA 2VNSA 2ZB8A 2CVOA 4M8SA 2R2GA 1P1IA 1UDBA 5IZ4A 1A4UA 5L45A 1PSDA 2WMDA 2YV3A 3AFMA 5IDWA 1A72A 1KETA 1UJMA 4XQEA 4IQ8A 1D8AA 1KVQA 2O3SA 3PZRA 5I7SA 1NXQA 4GKBA 4CL3A 3ZW9A 2P4HX 4XWYA 2ZIZA 3JQFA 1EUCA 2IYOA 2JAPA 3DOCA 3KYBA 3LDHA 3MZ0A 1C1XB 3K96A 1QYXA 4WNIA 2IDZA 2PH5A 1A27A 1U5CA 3W1VA 1HDXA 1XLTA 1C0IA 3IJRA 2X9GA 1ZXLA 1EDOA 1U28A 2J5RA 3Q3CA 1H6BA 1DIAA 4CLRB 5LDGA 4AJPA 5BNIA 4PG7A 1TT7A 3JQCA 1ZEJA 2J5KA 1E6EA 4ND3A 1ADCA 4BKUA 1ZMTA 1NWCA 3AI2A 4JXKA 4ND5A 2D5AA 5A1TA 1H9AA 4U0KA 1Z75A 3UH1A 5COQA 4L0QA 1N8KA 4TSKA 3OP4A 3PWZA 4BNYA 2G76A 4E21A 4BNUA 3F3SA 5G0SA 2DUUA 3S2GA 4B79A 3ZU4A 4PRKA 5TJHA 1DIRA 1SOWA 3A06A 4G65A 5JDCA 1QKIA 2YQ4A 4ALMA 1K6JA 2WTBA 3ROMA 4F3YA 3QWBA 4W9NA 1L1FA 1JN0A 5A03A 4XCVA 2VTEA 3NYWA 5BT9A 4PRLA 4TWRA 4E2WA 5JCJA 5FFFA 3OETA 1ML3A 1E1NA 4FCCA 4NK5A 1TXGA 3ADPA 5G4KB 4CM4B 3W8EA 5JY6A 4TVBA 1X1EA 3GG2A 3L6DA 4YAJA 3OQBA 4ID9A 4YT4A 5HBRA 2UAGA 3RAJA 5KKAA 4CMHA 3UUWA 2NSDA 1H6AA 5AVOA 1P45A 4E2YA 1JVBA 5BSEA 3LVFO 1NAHA 3PIDA 5G0UA 3DBRA 4IJWA 1HE2A 2D3TA 1Q7CA 4RGBA 2DBQA 2DM6A 1BW9A 3QV1A 1M76A 5T57A 3AI3A 2DFDA 2NVUB 3Q11A 2X0NA 3RUEA 4BNGA 4DMMA 1RWBA 4GSLA 3AY3A 5ER9A 1A9YA 4JROA 2JD2A 1XKQA 3DDNA 4XQCA 3DAFA 1YOVA 3NJ8A 3KLPX 1NP3A 4W7HA 5JMWA 4UULA 2IXAA 3I9JA 3CH6A 4RVGA 4CMEC 3MTJA 4GLLA 1M75A 3ULKA 5I7FA 5MDHA 1VL8A 1DIBA 4YEDA 2O4CA 2B36A 2VZ8A 3KRTA 3RBZA 3WDSA 4FDAA 1YB4A 3DAGA 3JQAB 5ITWA 3CZRA 1UH5A 1FDUA 1GZ6A 3H3JA 1XR3A 2EKQA 1EVZA 3WGZA 1E7QA 1DPGA 1EE9A 2EW2A 5EJ2A 2E48A 3DHYA 3ASUA 3M1AA 4OMUA 1GZ4A 3E9MA 3W8DA 3JV7A 4YAIA 3TZQA 4CMJA 1ZJZA 3AOEA 4DTIA 5BSGA 5L7WA 5I8ZA 1EK6A 2QZZA 5AXCA 2QQ5A 2BI8A 5JLAA 5KNLA 3RUHA 4P4GA 2P5YA 5KJFA 1ZSYA 1IHXA 3GRPA 4XIJA 3GN1A 3TOXA 4BB5A 1R4NA 2VYNA 4M89A 1YL7A 2VZ9A 2PTGA 4RORA 3ON5A 4FB5A 2VOEA 4R41A 1NFFA 1LNQA 1CYDA 2EKLA 1AHHA 1HZJA 2IZ1A 5A5EA 5C7IO 4H3VA 3PTZA 3HG7A 5FF9A 1JKJA 1ISIA 4LCEA 3L6OO 2Q1WA 3AUTA 4DA9A 1I2ZA 1BTOA 1KEVA 2D59A 3A28A 2X0IA 4M55A 3GR6A 3ENKA 3UW3A 5I9LA 3O38A 4DBVO 2GSDA 3OJOA 3KZVA 5EMHA 2O3TA 4XIYA 3ZV5A 1P74A 1T24A 1QSGA 4MVJM 1T26A 1LSOA 3Q2IA 4LMPA 1TA4A 2ZK7A 3LLSA 2VT2A 5I7VA 1WXDA 4WNCA 1YQDA 4GX0A 2AQHA 2A4KA 5KJCA 1DFHA 5L53A 1PJ2A 4I9UA 2DPGA 5TF4A 3SVTA 3VPFA 3HDJA 4BKQA 1ZIDA 2CMDA 1AXEA 2TMGA 4MVJA 4EJMA 1FDTA 4HADA 4MPDA 2W90A 4WLNA 5G4LA 1B3RA 1OFGA 5L4NA 5AYVA 4Q3CA 1U7HA 1QXSA 4CV2A 4GBJA 4YA6A 3KM0A 3NJ4A 3JQ8A 1QMGA 3H5RA 1M6WA 1YS4A 4CV0A 1U3UA 5B4TA 3LF1A 5GZ3A 5LDHA 1DHRA 4JCOA 1Y7TA 4AJ1A 2FR0A 3DZJA 4AL4A 3E5RA 4RVSA 3PQEA 1LEHA 3DBRB 1LLQA 3WIDA 3ZV6A 2AXQA 4F46A 3BMOA 1PU2A 3JQEA 3JD4A 3O8QB 3QRWA 4CQLA 4KTVE 1EVIA 1PJBA 8LDHA 1U2GA 1U9JA 3AFNA 2G5CA 3DTTA 2QHXA 3NKLA 1H2BA 2JL1A 5TC4A 5CDYA 2OORA 4R3NA 1QG6A 4YJFB 4R51A 4ZA2A 3H8VA 1ONNA 3CIFA 4EITA 1VI2A 2NM0A 4M87A 3FF4A 1Q2XA 3GT0A 4J3FA 4JBGA 4NQZA 5KKCA 4E31A 4XJSA 3VZQA 2P68A 4XX0A 4TKMA 2QYTA 1XIVA 4A7PA 4EZBA 1WP4A 4LGVA 1VL0A 4BQPA 3FTPA 1PTJA 2O48X 4IDCA 1GCUA 3L6EA 3H2ZA 4KZPA 2PGJA 2EV9A 3ZGYA 4EBFA 3EW7A 3RUFA 4D46A 4CM8A 2IEBA 1P77A 1UXGA 5ILGA 2VHZA 4L9RA 1E5LA 4XQGA 3HZZA 4KP7A 4IDGA 2EG9A 3AM4A 3Q9NA 4DL9A 4E30A 3GVXA 3K73O 3G1TA 3INGA 4YRAA 1BGVA 4RF2A 2HRZA 1HDYA 1DAOA 4FBGA 1GYRA 4IUYA 2FWMX 4CM7A 1EZ4A 4HP8A 4WKGA 5C7OO 1R4NB 4XGKA 1PJLA 1ZH8A 3B1KA 1E3IA 2RAFA 1DSSG 1OI7A 3MWEB 4UVIA 3U09A 1GEGA 1KYQA 4NFHA 1NQTA 3EC7A 3ZU5A 3DO5A 4JP3A 2NTVA 4OOEA 3VDRA 1GQQA 3PHJA 4KWIA 3PVZA 5DOZA 2I67A 1I36A 2OXIA 3L4SO 1SPXA 2HJSA 4FFLA 4GKVA 4IJUA 3BYZA 3JQBC 1PGJA 1YONA 4FJ1A 1LU9A 1M66A 1LRJA 1T4DA 1NPTO 1M6HA 4BUCA 5DT9A 3TFOA 2GRAA 1E0DA 2J8ZA 3DZHA 3JQAD 4FGSA 3WFIA 4BO2A 1PJSA 2FPGA 2VN8A 1EQ2A 3K2EA 4URFA 4RL6A 4TRRA 1QORA 2OO5A 3V1YA 1LSUA 4R01A 2B37A 4JP2A 4TRJA 4F6LA 1YRLA 4PG4A 5IG2A 3HADA 2HKIA 1CQIA 4XRRA 1LDGA 2Q2QA 4JGBA 4FW8A 1HWYA 3PI7A 1T25A 2EJWA 5DULA 1DO8A 1IY8A 5LCXA 3JQ8B 2WM3A 1QYCA 3RD5A 2BGKA 4R68A 4NU6A 3JYOA 3GPDG 3PGJA 3EMKA 3IIEA 4HBGA 3L07A 4BO7A 1H94A 3DTYA 3RUIA 1QV6A 4OYRA 3PLNA 3RSHA 1LTHR 4CQMB 3BHIA 5CHEA 2E49A 3UCXA 1HDCA 4U8GA 1X0VA 1I24A 2PR2A 8ADHA 1MB4A 3VPGA 4CM3A 4ONEA 4Q3BA 4LW8A 2EIHA 4FN4A 3L77A 4D41A 2RCYA 3W6UA 5JE8A 1J0XO 4DUPA 3ANLA 3VOSA 3W4JA 4YBZA 1U7TA 1GUFA 4R9RA 2Y1CA 3ANNA 2QRLA 5KJ6A 3KV3O 2C20A 1Y5MA 4Y6SA 3B1JA 4J6FA 1QYWA 1KIFA 4JNKA 4NR0A 4OQZA 4KUHA 4E12A 4MP6A 4E32A 1MP0A 2EGHA 2O3UA 4RVFA 4DIOA 1GD1O 1ID1A 4XJTA 2GO1A 2OUIA 4J1NA 3PDUA 3HB5X 3GG9A 3VVBA 1JKFA 4Y6PA 4BO0A 1K6IA 1O89A 3HE3A 1BRMA 2ZTLA 3GAZA 4Z0HO 5CPBA 1Y9EA 4R69A 1Y8RA 2BHLA 2X0JA 5H82A 4PLZA 1PZHA 2CY0A 2NU6A 4CM8B 5JCJD 3QIVA 4B3HA 4PCVA 4ZRNA 4XEHA 1ZVMA 1I3MA 4HWKA 4BNNA 3JQ7B 1J6UA 1WAMA 3K5PA 1XWFA 3HUDA 4II2A 2P4QA 2Y67A 1RYEA 4H7PA 3NX4A 3CPSA 4AJ4A 2DC1A 2NQTA 1IPEA 4RQUA 4EDFA 2EJVA 1P9LA 2HRBA 2RIRA 4Z9YA 4M54A 4E5KA 1PQWA 3ZZNA 5HRUA 4OM8A 4BO4A 4D43A 1JDJA 1Z73A 2D8AA 4RDIA 4J16A 3TOZA 4BNMA 2XXJA 4LVCA 3PJDA 4OKNA 2HMWA 3C24A 1PS8A 4I9NA 4JBIA 1ZK3A 3ZWNA 4BNHA 5F1OA 2I76A 1EBFA 5JAMA 4GX5A 4N5NA 3EAGA 2OOSA 3V8BA 2Z5LA 4AJKA 3QWHA 4OGWA 3ANMA 1B16A 1MUUA 1WPQA 4HFMA 2EKPA 2X86A 1GCOA 1RJWA 3TZCA 3WB9A 2QRKA 4FFRA 3X2EA 4BVAA 1JWBB 2X0RA 4D79A 3GHYA 2O7QA 4XD2A 4E5NA 2P91A 1JA9A 3WOHA 3ITKA 3K30A 4YT2A 1SAYA 2EP5A 3D5QA 3ORFA 5HS6A 9LDBA 1JW9B 2IYPA 4LSMA 2IZ0A 3U4HA 3OQ1A 3WJ7A 4A0SA 1O95A 1B15A 4AJEA 3BMNA 3B1FA 3ICPA 2WYWA 1UXHA 3QWIA 3NT5A 2R00A 4HV4A 3FSRA 4N5LA 3UHAA 5IXYA 2EF1A 1R0LA 4YTEA 3WXBA 4DXHA 1NYTA 3PYMA 5H81A 1KEPA 4BO8A 3WGIA 3Q1LA 1P3DA 1WZEA 1ZNQO 2J5QA 3SX2A 1HTBA 3EUWA 5COAA 4R5MA 1WWKA 2OP0A 1R37A 1XELA 4UUNA 4G5HA 3PGXA 3WTBA 3CZMA 4K6FA 3ZWBA 1ULSA 1ZUD1 2PY6A 3EHEA 3PPIA 4N7RA 3VH4A 2Q50A 1ONOA 2VYND 7MDHA 4MVJF 3CE6A 1NTOA 1SEPA 4IS3A 5TT0A 3GZ4A 4E5YA 5TIIA 3FBTA 4J0FA 1Q0QA 3SJ7A 4PLWA 1BVRA 2F1KA 3PWSA 4IJKA 1PJTA 5FWNA 4RF4A 2GCGA 2ZB7A 1E3JA 2HU2A 3AM5A 3WFJA 3P7MA 4FGWA 2GDZA 4CPDA 3FR7A 4TRNA 2FOIA 4RJTA 4S3MA 3UVEA
chains in the Genus database with same CATH superfamily
2JJQA 1UM9A 2WKRA 3EVFA 4JLDA 2GA8A 1XX6A 2BM8A 4N82A 1NVBA 4WECA 1WVIA 2HK9A 3QVTA 3NGXA 3N8GA 3P20A 4JEUA 2ZRIA 5EYPA 5A4KA 3X1ZA 1HK7A 2D7DA 3K4PA 1H2WA 4HPXB 1TEVA 2JLAA 3QVSA 5ECWA 5AI0A 2RI0A 2WYVA 4EKDA 4IG4A 4JLKA 1R0RE 4RTSA 4L5BA 2ZT6A 4REMA 2PYIA 3ENWA 1Y8RB 3BEDA 3PA8A 1LQ2A 5K0NA 1CZOA 2OK8A 4LOIA 4RA9B 5JRJA 1W4CA 1XTIA 4DNXA 1T4CA 2MYUA 5K0FA 1JIXA 1OB2A 4A36A 1V9CA 1Q1EA 1G2IA 1X86B 4UTRA 1P17A 4FFMA 3EEYA 3LBAA 1MB9A 5F12A 3HXQA 3KB6A 5B3JA 2OA0A 1NUQA 3KJHA 3CF2A 3CNLA 1U2QA 3D31A 4B4VA 1NTRA 1WCIA 5HJ5A 3TR5A 4J1TC 2CL6X 4QUIA 1BD3A 2XDQB 3VVCA 3DBOB 2PV7A 3AHHA 3I3SR 2FRXA 5ALVA 2H4HA 2I6UA 2CF5A 3OOYA 2V6MA 1NXVA 2CDBA 3OOWA 4TT3D 5KI6A 1ORIA 2A9JA 3ZU3A 1U4NA 3OIFA 4MVJP 3THWB 4Z99A 5A02A 1R6AA 4DDWA 3P9ZA 3VYUB 1M34B 1UINA 2UUOA 3WSTA 4B7UA 3MT7A 3VC7A 4E5PA 3CF4G 4X54A 4HOYA 3KLMX 1FYFA 5G0TA 2NO4A 3P0HA 4B35A 2GZHA 4JQSA 1VJ0A 4X24A 1WX1A 2HZBA 1VPWA 2V1UA 1Q0ZA 3GNQA 4P31A 4LJAA 4MPPA 5AM1A 4JX9A 4QT0A 2QG4A 2Y68A 4TXHA 3MHTA 1VE1A 2C5FA 2QLFA 2YQ5A 1OQAA 2AC2A 1UKVY 5JWHA 3ZWWA 4URUR 5FV4A 1EFRA 3LFTA 4XB2A 2XCTB 2XVZA 1IY0A 2OCIA 4FUQA 2JLYA 1M1NA 5AOVA 4ENUA 2ZS8A 3D3NA 1OB5A 3R8FA 2BFOA 1Z4MA 2IOYA 1RI1A 1UANA 2W6CX 4O2AF 7ABPA 4WIAA 3GQBB 1GUAA 4QC2A 2GARA 4A4DA 5HUHA 2EARA 1H3EA 1XLTC 2AWNA 1VI5A 2OXTA 2XF8A 3QFCA 1O9BA 1NYLA 1Q95A 3STUA 3PHGA 4NY1A 5CTAA 4LFCB 3FOFC 1TQ2A 4L8WB 3BCHA 3Q7RA 3QUAA 1W36C 3GFPA 4QPJC 5HCNA 1S6YA 5IJAA 2HOQA 1CZKA 4NZNA 5C32A 5JYDA 3QELB 1RWVA 1GGFA 3HJTA 3UV6A 1BJRE 3TI7A 1V8DA 2HF2A 3H8JA 4HX5A 4JP5A 1VBNA 2OHJA 1ZJ4A 3LC1O 4MUFA 5C53B 1XZDA 2ZI6A 3A1CA 3MELA 4F71A 3AQ4A 5BWLA 4UUMA 2P67A 3VH2A 2I65A 2NQ8A 1NJ2A 3KR1A 4CTJA 2G82A 4QBKA 1MJFA 1NVTA 2DT8A 3DD1A 2C77A 1USWA 3HNRA 3LYUA 3RC3A 2QJRA 3LDAA 5P8WA 3AW9A 5BXYA 4Z9BA 1TMGE 1JI3A 1TD9A 2DP4E 2ZSIA 3GUCA 3M6FA 4Z0NA 2H1OA 1QF9A 5HQJA 3E3AA 2GTHA 3B3QA 5EMMA 2CLKB 5JNVA 2IPMA 3FJYA 2H1CA 3B5IA 3BX1A 3RADC 2PLNA 2ZSEA 1GL3A 4NCKA 3R6DA 3UAVA 5E6RB 2AN4A 4L4RA 4QYMA 1NE2A 1W5SA 4RY0A 3L0YA 2OGWA 3K0HA 3A70A 4PHTA 2IC5A 4IRXA 5AW7A 1AXRA 2YIMA 1AC5A 3FVVA 1T4GA 1CUDA 3I0NA 4N3CA 4Y2HA 2IGTA 5BT8A 1E4EA 2B8JA 1B8VA 1NBWB 5FLKA 1Y48E 4B0PA 2H07A 4COKA 3LXMA 5B55A 4EZIA 4RK1A 2N42A 4CG2A 1JILA 3GEGA 1LC3A 3T94A 5K9ZA 1JVSA 3N2NA 1C1DB 1EE2A 4D0RA 5C1OA 1YDEA 5BQPA 5TQ2A 2I5PO 1XTBA 4Z8XA 3L18A 4MS1B 4HLNA 4QQRA 1F8UA 1UOOA 1KU6A 3AETA 3AJRA 3GC6A 1I8TA 4CGZA 5TEVA 4BO6A 2E82A 4F2WA 2J3HA 2QQFA 2BFFA 4XLLA 1N33B 2FUNB 1GIAA 1TCCA 3MB5A 5AOCA 1BN6A 4DG5A 5A3JA 1J0EA 4PNEA 1SU7A 3MFYA 5I48A 4KMOA 3H1EA 1U9IA 5GINE 4ZTZB 1SK9A 1XHFA 3ZGNA 4NCIA 5TF0A 1V5EA 2W48A 3EB9A 1M2JA 3EZ9A 4RHTA 5CXXA 3Q85A 4PBRA 4WCFB 2RH8A 3EXFB 4A5OA 4X1IA 2DHDA 4PONA 4Z3KA 4HAIA 4U2CA 3D7KA 3JPYA 4IP0A 1YGYA 4IH4A 1GPDG 2NXJA 4C88A 1EP2B 5JY1A 3LZCA 5KAPA 1ES9A 3ABSB 4DCUA 3QA3E 3NVMB 2XAAA 2XWJI 2G8NA 5DX1A 3LD9A 3M6WA 4FNGA 4XTRA 3T7AA 1AA9A 2A5GA 4BFCA 4E2FA 1DBQA 1J8DA 1SVIA 1X15A 1G42A 4XD7D 4ZT7A 1U8TA 3NU1A 4OHZA 1MV8A 3R75A 2ZCUA 4UNSA 1E4OA 1FMFA 3ZHYA 1SUCA 2VBIA 2XRZA 4MROA 2QA5A 4OLHA 1P0IA 2WF7A 3R3XA 4XWWA 2BHRA 3PGLA 2P6OA 3PK0A 1C4OA 1AGPA 1U4OA 1TVKA 2VK4A 3LDFA 3R24A 4RQBA 1TE2A 3ZLBA 4KEAA 2PCJA 1W1IA 2CXNA 5HOQA 1U80A 3PHHA 4BQOA 5GIPE 3HFRA 3D0RA 5G0WA 1F4PA 1Q44A 5BUSA 4OYHA 2MMCA 2GO7A 1CWUA 4GOOD 3ZQKA 3E2IA 1GPKA 3KV1A 3SD7A 1JFFA 3FLEA 1KSHA 4EFMA 3DT6A 1OASA 3UEOA 3PWTA 1WZIA 3KOYA 1VP3A 4M1QA 5EY5B 5F5NA 3VZPA 1B6SA 4LPSA 2ISCA 1U3VA 3JQGB 3ZVLA 3FCUB 3PRKE 4HWOA 4R2MA 3MJHA 2VTBB 4BWGA 1C3EA 1ELOA 4N5MA 5KQRA 3FOAA 1X7YA 2Q49A 2Z2KA 1OBVA 4IDPA 4XDYA 1GTRA 4LZZA 3QH4A 3LBIA 2EFJA 4RLSA 2PKQP 3U7QB 2FWPA 3KETA 3HXTA 3AGQA 4YMGA 3FAKA 2R0QC 2GETA 4JFAA 4QOEA 3WNCA 4E4YA 4Q9IA 4OFZA 5H3LA 4N76A 5J1TB 3CNQS 3M0EA 2PEZA 1TGVA 3A4VA 2PRYA 1RHRA 2CKDA 3PNPA 1JVNA 1JKXA 1RWOA 2POQX 2VHVA 2UZ1A 5LFAA 1N7GA 1WO8A 2R7AA 3KDAA 1BSVA 4U9UA 4ZPJA 4B6RA 4C76A 5AKIA 3TKAA 1U1CA 3FSJX 2QK4A 3T4XA 4AECA 4ERNA 3PXXA 3WB0A 1XMJA 2BMAA 1F0NA 1X1BA 2F4NA 1KIAA 1CUYA 4EX6A 3R41A 4IFEA 4M9ZA 4YPVA 3TH5A 1BG6A 1ZA2A 2XMPA 4MWTA 4N8EA 1G5FA 2IRWA 3NFRA 4WLFA 4F91B 1IXSB 4GXRA 4BN4A 2R6HA 3Q3GE 3GP5A 4MYUA 1QGUA 5HIMA 3AP3A 1X80A 1ISMA 2Z9BA 3UK1A 1NVGA 4BNKA 4Z2YA 1CEEA 3ETNA 2EEZA 2DJIA 1A9QA 3IVXA 4FINA 3V1MA 2RD2A 3AR7A 4AX4A 5BY2A 3FSGD 3ZV3A 1PQYA 3O3MB 1ZPDA 1MJNA 2VP5A 4O5OA 3R9IA 4H7HA 4TQ9A 2QOEA 2GD2A 4X66B 1WXQA 5COBA 4E14A 1NXSA 4PXAA 2HSEA 3AHEA 4CIVA 3HXOA 5BWBA 2EP8A 4HO1X 3DEIA 5A62A 3WYGA 3FTEA 2XVMA 2AVNA 3OFJA 3VDXA 1OZ0A 1O95D 5BRJA 4DA0A 4FM9A 1ZA1A 1EFTA 1GZHB 1YZGA 1A9TA 2Y0EA 1XZPA 3PNYA 2I9PA 3RJZA 1Z7GA 5A04A 1J5EB 2PKEA 1IUPA 1Z7YA 2E89A 1XHLA 3AXTA 3N0TA 4RF3A 3ITNA 4BQSA 3T34A 1POWA 3WHKA 2C84A 4CV1A 1LBIA 4GR9A 4DMCA 3PVSA 3W2TA 3ORQA 1Q11A 3P96A 3RHSA 4L8VA 1XDBA 4AQ7A 2NU9A 1G8MA 4MWZA 1P4HA 3QU4A 2PKQO 3QE4A 4FYIA 1YBHA 3MWDB 4D8TA 4Z54A 4AO6A 1AB5A 4IICA 4CMCA 5E3HA 5LQJA 2XQGA 4AKEA 1GG8A 3OICA 4JLUA 1FDWA 3FM9A 1H9CA 1JU9A 2FPPA 3NTXA 3ZCUA 4Y2GA 1L7BA 3E18A 4E33A 3WGHA 4B84A 3DDCA 2RHJA 4JL8A 3GA7A 3C3AA 3EVEA 3T3HA 4D26A 1QB7A 3VZBA 1IC6A 2OAGA 4R1LA 3ZNQA 3U1BA 1PTJC 1Q6ZA 3NHAA 4A9AA 2C42A 5LQCA 3DL2A 2XUJA 1QBKC 3EHDA 1E5VA 3IR7A 1HYQA 2IY9A 3E84A 4CEJA 1O5IA 2Z58A 1YJ8A 3MGKA 4N5IX 1ZHOA 4JJIA 1HDIA 3CB2A 1P31A 3OZTA 4B8ZA 2I6XA 2FSVA 2I9KA 2OZLA 5JSFA 4RD1A 5H02A 1G3UA 1P4GA 4B82A 2RAVA 1Z06A 2PGDA 1D07A 4RHUA 2WWXA 1NJ6A 1TB4A 3L5KA 2ZIXB 4PX5A 5A4FS 1G21E 2PKCA 1J23A 1TIBA 2VQSA 2WJVA 4QQFA 4EARA 5A0VA 1WETA 4HZGA 2DECA 1NF2A 5IZCA 1YOVB 3RU9A 1U2DC 4J0HA 4TKUA 1Q19A 4ZN6A 1OY1A 3A2LA 3GRCA 3BXHA 2MINB 3QNUA 2R8ZA 4PO9A 2WZBA 2TMDA 4G8CA 2W0SA 4GRDA 3F1KA 1T9AA 1NNSA 2BBTA 1HDRA 1DTSA 5JZSA 3JD0A 5JYBA 5F51A 1IXRC 1GITA 4M9UA 2QENA 2IY8A 1H23A 4RPKA 4CL2A 2W98A 1DPFA 2BAGA 2NPIA 2Q9CA 3SEFA 1V5FA 4X20A 4P7GA 3S44A 3UAYA 1LVHA 3KAPA 2CNBA 3AJAA 2GHQA 1MA3A 5F7OA 1ZJ5A 1QF7A 1SOAA 1TFUA 3ZQ4A 2P8SA 2IPAB 4YRDA 2WWRA 1FX0B 1UFVA 5KIAA 1J5XA 2HPZA 1W2HA 4X8OA 3VU8A 2XD4A 4BWFB 1CPYA 2FEKA 3NFYA 1IIBA 3QX8A 4Y3UA 3KZMA 3H1FA 4NF2A 4ZU1X 5F2NA 2LDXA 1K8XB 1FYWA 5GGYA 2H16A 3DBHA 4BV2A 4TKZA 5CYPA 2PMEA 3UJDA 2YOFA 3U0BA 1EBUA 3W06A 3KSZO 5JXHA 1U2DA 4Q7MB 5ALHA 5B6PA 5E1DA 5D3QA 2M6LA 3KPJA 2YZ2A 3RUPA 1KEEB 2A8YA 2PZGA 1JH9A 2HMSA 3UPDA 3ROXA 2G4VA 1KFCB 2NP7A 3B13B 3GNSA 4RH0A 1QIJA 4RU1A 4ND4A 4U9IS 4NNPA 4Y2VA 1FK8A 1Z4PX 2B30A 1ECLA 2PZAA 4KLCA 4HAYA 5HDBB 2MYNA 2B0CA 2IP2A 3N0RA 5C5DA 1TZJA 2IU4A 4RZHA 4E6EA 1TVMA 3LSTA 1EWRA 3GV0A 2YHSA 4IAOA 2REQA 2YHIB 4YJ3B 3WQSB 4D3XA 2K2QB 2B4QA 2FPWA 4J7XA 2HPVA 1CR2A 1HY3A 2NU7A 4S1OA 3REQB 5HZKA 4DV4B 2YNMA 3SMVA 5L4LA 1HF3A 3AIMA 1B0PA 1YULA 2X0EA 1VBMA 3L92A 2AEEA 3TNLA 4CYMA 2YXEA 4HSEA 4UBLA 2JAQA 3SJAA 5JTTA 3B6EA 1L4LA 2WNIA 2B61A 1XU7A 2QTGA 2ZWIA 3L2OB 3UUEA 2I6SA 2PNJA 4BE9A 5AVQA 1YQQA 4PGFA 4QICA 2QJOA 4QQKA 2X58A 3MBOA 5K7SA 2AX3A 3ILXA 3PNLA 4AJNA 2CHQA 2DFTA 2X8WA 2J6CA 4MUJA 5ILOA 1N0HA 1I13A 1NW3A 2V8BA 4ILEA 4RFLA 3AVTA 2C9OA 4A26A 2QW8A 3IFSA 1XZLA 4RVNA 4NK4A 4PYIA 1V5WA 3W8FA 4TPKA 4C05A 1JRLA 1C81A 3DE0X 4FDLA 4EPXA 2AQKA 4ENSA 4MKXA 4QTYA 5HFJA 2JGDB 4J7CA 1NG1A 1LB1B 1V3TA 2ACEA 2YFHA 2ZDQA 3H5TA 3LWDA 3PFBA 4GPEA 4JC8A 3VPSA 4BC1A 5C3MA 3JU3A 2G1PA 4N65A 1UXKA 3M34A 3NBAA 3C3CA 1OIXA 2FN9A 5EIOA 4ZT3A 1Z45A 5CM9C 4LG1A 1MKYA 3RRJA 3RKRA 1UEJA 4B3JA 1VM6A 4TTQA 1HE3A 4C7KA 1IRIA 1DQNA 3BMOB 2ZUCA 9MHTA 3BQNB 2WG1A 5FTNA 1F8XA 4CQLB 1JT2A 1OJ7A 4E3ZA 1PNRA 3W7VA 1GJRA 1VMAA 1U81A 3IDAA 4FHZA 3TTVA 3PFKA 2BKAA 3PCTA 1PKXA 3ER9A 4LJ9A 4JI1B 3DE7X 1XU4A 2BGUA 2P6PA 2ZT7A 1P1FA 1WJGA 4M83A 4G1UC 3LPLA 2RFLA 3DEYX 3NIDB 5CJJA 1LW6E 3P2OA 2F9LA 5LWHA 1IN7A 2DHEA 1ZH0A 4XWTA 1N6LA 3TPFA 1O6BA 1K3FA 1OD6A 1VRVA 3SHWA 1NR7A 1W25A 4C0KA 2DG2A 5EJEA 2ETXA 3Q8XB 5KOHB 1FTNA 5FD8A 4J16C 2M32A 5EVJA 1POXA 2FMXA 3O2QB 4Q4JA 2Y93A 1LJUA 3FUCA 3HU3A 3E9EA 1L8LA 4TL8A 1E2DA 1H0SA 1PEAA 1PD1A 2OMEA 5JJLA 3CX8A 1W88B 2R65A 1FJHA 3NEYA 1X42A 3HRHA 3MTQA 2FWNA 2H2AA 4LYGA 4OJMX 3V6MA 3V7FA 4M1YA 2QT1A 3C8UA 3ZHUA 2PWBA 2IV7A 4K86A 4IQGA 2HRQA 2FFRA 3NS7A 3GPIA 3RIYA 3PL1A 5K2OA 2GPBA 3PFCA 4H31A 4V38A 1MC5A 3MJEA 5AVXA 2DWUA 2WQ7A 2OGTA 3G59A 6GPBA 1O95C 1E9EA 1I6WA 3RBVA 1PR4A 2AUNA 3AQIA 4KXVA 1G20B 4ZOCA 1GGHA 3NVDA 4QJBA 3THYA 3OPVA 4I1RA 2PDAA 3G8YA 4PS1A 5CDUA 3HLKA 3L43A 4MKFA 2O6HA 2BHTA 2QE7D 3CYFA 1W35A 3E61A 3FCOA 5AXBA 4J90A 4C4SA 2Q5FA 1JIQA 2WU4A 2GPWA 3D2CA 3E3MA 3OJEA 4HLDA 1U8AA 3ET4A 4FBLA 3WIBA 1T4BA 4G1CA 4R2JA 5EIWA 3LBNA 4JI7B 5TY0A 2OAQ1 1E2MA 4AMUA 2FZLA 5EHQA 1NN0A 4L1KA 1NASA 4FVTA 4OXYA 1MTZA 2V6FA 5ALQA 2WYHA 3TGLA 5KTTA 4CMGA 2XGMA 2ZTMA 1GTZA 1PDWA 2O0KA 2OBMA 2HMYB 3RVKA 3ZS9A 2NNLD 2FMHA 4B4KA 1Z6GA 5FOTA 3IP6A 1QDUA 1X70A 3BGOS 1PJQA 1J1ZA 3FKJA 3SFVA 3UTCA 4BBJA 5JAOA 1Q1BA 4GQIA 2X41A 4WV3A 1JEJA 1PVOA 3VR6D 2WFLB 3BHJA 1ESEA 1P3JA 3DLCA 2LP4Y 5TEWA 2FPGB 2W71A 1BN7A 1G9XA 2B4KA 3RS7A 4FE7A 4PWYA 4GUDA 4OU5A 2JKVA 2Q2OA 4ZYUA 1TKRA 4FI3C 3HKCB 2DUJA 3COZA 3DB1A 1N2CE 4ARZB 3OZUA 2BTOA 5TR9A 1O87A 5I9IA 1AMOA 1Q1NA 4J3NA 4MKIA 3W9BA 4Y6OA 1PE0A 5IVPA 5E4JA 1GOTA 1XTUA 4LYFA 1E0KA 4YJGA 1IFXA 1TOAA 4OBXA 2JIZD 1Y3DE 3LA8A 1FDVA 1D6SA 4BAUA 1DINA 1L1QA 1DU4A 4GM0A 4UDXX 4GZ3A 2QZSA 3UMRA 3VRHA 3W05A 1V96A 3OTOB 3M9XA 2YY7A 2ZJ1A 1JDUA 1QV7A 4LE1A 3CGGA 2DWOA 3VYVA 1JYEA 4A8HA 4BV3A 2A58A 1KP9A 2NACA 4QL3A 3AL0C 2IDKA 2X22A 5BSVA 1KHHA 1SVLA 1R4MB 1ADJA 1WCXA 1Z2CA 3FTDA 4IXDA 3QPVA 5CIYA 4XFDA 3NTOA 2AG0A 5EHXA 5IBCA 1N8SA 3F49S 4WCFC 4WHMA 1TGYA 1L4UA 1HXHA 2B2CA 1Z68A 2NU8A 4OP3A 4ZRMA 3G49A 5HP4A 3WGTA 1EAYA 3W6OA 4PSCA 1D4ZA 3P9KA 4BNXA 1P2BA 4JKOA 3F3MA 2LW7A 4CL8A 1K8ZB 3HBLA 4R98A 3I5YA 4ZT4A 2QS9A 1CG6A 4IJ6A 2H9AA 5IBQA 3T5PA 1XNQB 2Y76A 1OKKA 2EKDA 3FNBA 2AI1A 2Q5LA 4N7JA 5EOVA 1EVLA 2B5VA 1U2EA 2YFKA 1FYDA 4W8OA 4DKXA 1C1XA 1JU4A 2HK7A 3HR7A 1MC1A 2JI4A 1XKTA 2ZE7A 4RKFA 1N3BA 4JXJA 3R7BA 8GPBA 2NUBA 2BE9A 4O4LA 3F78A 1O0BA 2HHLA 1QHEA 5HKBA 5I7OA 1YOBA 4IQ0A 5THXA 4DR6B 4QNRA 2H8KA 5H59A 1TFRA 4P22A 2FWIA 4DBLC 4BEJA 1ORHA 2C99A 1A04A 3DUFB 3QY9A 4TKVB 3IOYA 4M7PA 4P2BA 3JZMA 4Y2XA 4YB8A 4BNFA 4CODB 4EFDA 5E1OA 3L8EA 1SU6A 1ML4A 3IIIA 3O74A 2AF3C 4I50A 3R2JA 4DMRA 4LXHA 5FPSA 4BV8A 1XMXA 3I76A 1XJ0A 3DLHA 3A8TA 1JE0A 3TX2A 5L3VA 3RABA 1Z37A 1K6MA 3GU3A 5CDSA 2CL7X 1QGDA 2HHCA 3SYTA 1FNBA 4UVEA 5KJ1A 13PKA 1DIGA 3C6BA 4QPDA 5KQPA 3UWSA 1E77A 5CB6A 1LDYA 1MO3A 1CE8B 5EWJA 5FUVA 5TMEA 4JWKA 4FKZA 3ZVRA 3H2JA 3UF0A 4DS3A 2FW7A 3KVVA 3F4LA 4OV6B 3CB4A 3RB8A 1KE2A 4D57A 5ECDA 4D7AA 2C9MA 1P4AA 2ZJ4A 2J0UA 2RG7A 3B9RA 2GJSA 3HDVA 3IBFA 1ILWA 4LRTB 4L3WA 4XYGA 1YVEI 3R44A 3V2IA 1UWLA 3E58A 3NANA 3RROA 3ICWA 4YIKA 3THSA 3R5TA 3O3NB 2VF5X 4EO7A 5AM2A 4FDUA 1YZYA 2R8PA 4JT9A 1NQOA 2OV4A 3BXOA 2VUHB 1U5BB 3G2HA 3ODGA 3OX3A 1WUYA 1P33A 4DYDA 1NVKA 2H0QA 3DPIA 2FMFA 3UK6A 4FLEA 2J3IA 3WV5A 4XVHA 5G4KA 3ZD8A 5EJ9A 2EZTA 2BF4A 5A2GA 3GVCA 3U7GA 3U7RA 3WC4A 2MR6A 1KYWA 4JSTA 2Q21A 1L4HA 2CNOA 4J03A 3ROQA 1NFRA 3I8SA 4U7WA 3A7DA 4KU4A 4DJTA 1KHTA 2R4QA 3OZVA 3EXHC 4GMGA 4GXNA 5C1IA 4JQCA 4QUGA 1P2UA 3HJFA 4JI2B 3DOIA 2DWCA 4D3DA 3UJNA 1EIWA 1RAIA 5NULA 3E7PA 4QPNA 1XNGA 1SUFA 1I4WA 1SKBA 2ZITA 3L1VA 1CEYA 4Y6QA 3E9NA 5J3JA 3FR8A 3SJBA 1Z08A 3EGVA 2PZLA 1ECFA 1FXSA 3IAM1 4EPVA 1UCFA 3ZDYB 4XJVA 3TD9A 1U7PA 4DPMA 3K70C 3A3YA 1VL6A 5GZ1A 3I04A 3GUUA 4HZUA 3BKWA 1GR1A 3VNUA 1E7WA 3QKSB 4RVUA 2EJCA 2PD3A 1SQ5A 4J6EA 3VV3A 4P58A 3QHAA 1VJTA 4HQFA 4KO8A 4QX6A 2CC2A 4PZZA 2OTCA 5AWFC 1KZ1A 1CZHA 4OGKA 1BHSA 2ZYGA 3V8NA 4A10A 4DM3A 4POOA 1X7HA 4BNVA 1HLPA 2A4MA 3S8EA 3V32A 2QUIA 2X8AA 2BGIA 3NGMA 1X6VA 3ZI4A 4PYRA 1LY1A 3TW8B 1HPLA 3IIKA 3EH2A 3DLBA 2QM7A 2FZ4A 3OT1B 4JJZA 1H2RS 2G9NA 4YT8A 4YJDA 2GYYA 2OSVA 5BRAA 1X2BA 2VWQA 2XCOA 3UHPA 4FFSA 2OUKA 4FOTA 3E5HA 4R83A 4D4GA 2XUZA 3EXHA 4KE9A 4J0JA 1I10A 1OC4A 1XDWA 1ZCJA 3U3RA 4A2QA 1OI3A 1F2DA 4TQGA 2ZU6A 5CVUA 1XOIA 3HLTA 1XXLA 1Z5UA 2ZWOA 4EENA 4XFJA 4DCSA 1EDDA 1VSTA 5BPFA 5KHAA 2FSSA 1UM9B 2YS6A 2CLLB 4KH0A 1OXSC 3SQXA 4MCIA 2OZPA 5FLEX 4IKOA 4BLOA 4CIYA 1J9GA 3KD3A 3KXIA 3OLZA 4YUYA 3WB2A 5LYJA 5FPTA 1Z15A 2VH2A 3OZXA 1FFDA 3II6X 2I2FA 3QHQA 1JDNA 4M1WA 3SOZA 5KYUB 3SM3A 2FQWA 4PTZA 1PF7E 1SO8A 3CSSA 3ZEAA 5BYBA 1U2PA 3TIFA 3A2NA 5I3CA 2VBFA 5LZ7A 1NPDA 4MUHA 2B8NA 4TLCA 4QT4A 3SF8B 1T4CB 4C7BA 4B4OA 5BR1A 2WSYB 3I5AA 3QKIA 1Z7WA 2IUSA 4OL9A 2WJGA 3WLFA 4R2XA 3ASVA 1QDLB 1RM4A 1Z18A 2XDWA 3H9GA 5AUNB 5E3IA 3TTXA 4DJFC 3U7JA 3TOVA 1NFQA 2XTAA 1Z5ZA 2BGMA 2QMUA 1VBKA 5AW4A 1VE6A 1NRJB 3FE2A 5HVNA 2DB3A 2BW0A 4PQGA 5JS1A 5ALIA 1MO6A 1YZTA 4ZOLA 1QZXA 1XVLA 5T7BA 1FSPA 3AFGA 1W1UA 1O57A 5A3VA 5KKNB 3MT9A 3AONB 3RIHA 1IAQA 1RI3A 4H08A 4WBSA 4Y2YA 4DRXA 4YP6A 2ZRDA 1C1YA 2D4HA 1PR5A 3QFFA 1EUZA 5FFMA 2IHUA 3NXSA 3VZCA 4C20A 4C7XA 1ZN9A 3P97A 4RQAA 3AZOA 4Q3LA 2QN9A 4MA0A 1XLVA 2ZR8A 1U1IA 3DZFA 4MKZA 4R4JA 5A5FA 4OA8A 1WMEA 4PWZA 4EI8A 3IR6A 2G4CA 3IP5A 4MX8A 3AP1A 3AVVA 1TJYA 2FOXA 3HU2A 1U7OA 1JAXA 2J7KA 3PC8A 4L4ZA 3RGWS 4O0MA 3D8SA 2CD7A 2WTXA 3KQSA 3N7TA 4C7OA 4N0MA 4V0LA 4I81A 2Q1UA 3SIXA 3H7AA 4LZLA 4BNIA 1TMKA 2HRRA 1CERA 3ZDFA 1ZHFA 1M1NB 1LC0A 2G0NA 3K5HA 4G0YA 4OMDA 4UFOA 1VG0B 3G8DA 2X9NA 1C9DB 3COVA 3Q5EA 2IS2A 4ZAFA 1HI9A 2VRCA 3W5SA 1VSUA 3HTXA 1WU8A 4BUJA 1DQZA 2AEMA 3BE6A 3IHWA 4RKEA 4XR9A 1J09A 1HURA 1SUWA 2APJA 5B7PA 1UBCA 4GMHA 1P81A 1NI3A 3TUZC 1QQ6A 2PQ0A 2GPYA 3OFSA 3WWDA 4E7PA 2ZYAA 1IL0A 1E5QA 2VPXA 4KQCA 3X1KA 4AZ0A 4FFBA 3ZZ0A 3IKVA 3KQKA 2HMUA 2R4TA 3N59A 2XPCA 5KHOC 2RARA 2EZ9A 1UFOA 4M2LA 2E6KA 3F9CA 3AG6A 3ONEA 3EXEA 1I6LA 4I3GA 1MOPA 4P3KA 4CEIA 4RD3A 2QSYA 2GZSA 2FFJA 3ZHTA 2QRGA 5HBGA 5JCXA 3R9XA 5AIAA 1RWKA 4D5GA 2BN4A 4HS9A 4YJFA 4EPYA 1MPTA 2V0GA 3LC7O 2W2MA 5KMGA 5E1BA 1YNSA 5HKLA 2X8JB 4AG3A 5BSFA 4JJFA 1INLA 3VU9A 3RF6A 1OGYA 3CUVA 4IXTA 3ZCTA 4MTCA 3W2FA 4HXFB 3B2EA 3K9FC 3CEAA 3KYJB 1KK0A 1E89A 2XBLA 2VHEA 1AF7A 3L9XA 2VNKA 3R0QA 4HFNA 1KI1A 2WT4A 3S2EA 3T7IA 3V9PA 4NNJA 5B1DA 4EPTA 5LXTA 3IEUA 4GRAA 4M22A 2NSHA 3BFKA 3U5TA 3MEQA 5DXJA 4AY2A 1EUDA 4H1VA 3KFVA 1M8GA 3L7AA 3IQDB 3KZNA 2JBHA 3LUJA 3LW8A 4O0LA 4DG8A 2QY6A 3H5IA 5IT9A 1FY2A 3ZJ5A 3M6IA 1Z9BA 2J59A 5GVSA 4PXYA 5IDXA 5JJKA 4Q9NA 2M98A 2ZM5A 1KU0A 3SBXA 4QOSA 1RYNA 1YRBA 2QR5A 3G3EA 2CUTA 3OE4A 1ZM3A 1BIFA 3HHEA 2CCGA 2JGIA 4W5WA 2I6TA 3D4BA 2OP1A 5EJMA 4R8RA 2C07A 4OJQA 1PO7A 4FONA 4RS4A 2RG1A 4JLMA 3AETB 4IKEA 2CHGA 1N9GA 3RO7A 3UMCA 4CMEA 2XZOA 1KAMA 1UJCA 3I9V6 3L5OA 3V3TA 4EW6A 2A2ZA 3RASA 2WEKA 1W8DA 2EZ8A 3NTLA 3WIVA 1R10A 4UVHA 3QMWA 4O4HB 3V1UA 4L85A 4OAPA 2QX6A 3X1YA 5K0JA 2PWZA 3WJ1A 3ICEA 2JGEA 4QDKA 2JVKA 3GJ5A 1B26A 3D2LA 1VA4A 2L82A 5AVZA 1KDTA 4U0JA 1SIBE 2EDCA 4RK0A 1XTPA 2W2PA 3CRVA 1MEEA 5CTJA 3NWEA 5L7YA 1EWYA 3W3AH 2ZT8A 3B8EA 3I8OA 4X1IB 1ZEMA 1RAFA 4EW3A 4TYYA 2GPAA 4TVSA 4PAGA 4O4LF 1SC3A 1IE3A 3DKIA 1KK3A 3OE7A 4XDZA 3RCBA 4BGIA 1L7OA 3PZBA 4DTCA 3ICQB 2P2LA 4RPIA 1MX1A 4ETMA 1DGQA 5EJFA 3ZH2A 1WNTA 1EB8A 3GJ3A 3CRNA 3N5CA 2YDYA 4OB6A 2PZJA 2ODEA 7YASA 3I2HA 3NJRA 3C14C 3O84A 3DR3A 3FYDA 5JAUA 1MENA 5A71A 1Y9JA 2GKSA 4FCWA 4I50F 1FNSA 2WR8A 4LRXA 2DU8A 4P35A 4ML3A 1QVRA 1TVKB 1MO4A 1EA7A 3QPWA 4O25A 1V8OA 3INNA 1Z8HA 3KCNA 4KH1A 4M38A 5FPPA 5MGBA 4DUZB 4YXFA 2FFHA 3MK31 1MT0A 3A14A 1JFFB 5JECA 1MFZA 1F3OA 3OCUA 3TXAA 2OHGA 4YCJA 1BH2A 3Q2OA 4ASUA 4OQLA 1DKRA 4NJEB 4RMIA 2G9ZA 5CNIA 1X7ZB 3TRHA 2AOUA 1PW5A 1Z16A 4M46A 4JB3A 1TKBA 5H80A 2IHNA 1FBTA 5DU2A 4BDTA 3F97A 1QH0A 1ZL0A 3PPWA 1YR9A 2VYVD 1UBOS 1XK6A 2O8DA 5FV7A 4KOEC 3FTCA 4EEXA 1GCIA 3KLBA 3QPBA 2GLTA 2P9BA 4KI0A 4MV0A 3L0DA 3E48A 4O1IA 3OZDA 4ZOQI 5JMTA 3ZQJA 4BJHB 1KDPA 2PO7A 5KDDA 1QFMA 4L9AA 4R1QA 2I78A 3EA5A 4ZVMA 3A1TA 4HMOA 3L1IA 4BC0A 5L8VA 4KSCA 3OC0A 3KKEA 1XKXA 1LLDA 3K9LA 1I6MA 4F6RA 4PTYA 4DNFA 2VPYA 1JAYA 2R6DA 2EX4A 3CKYA 3ETLA 4QJ5A 1XJQA 3AWIA 2I3GA 2FKNA 4KO2S 1HQDA 3BF7A 4R0VA 3VO2A 3ZWMA 3RHZA 3QFTA 5ABPA 1WLYA 1Z2OX 3U1TA 2JLVA 1UOPA 3GJ6A 1NN1A 2WT9A 3EWNA 3Q7IA 4AJ9A 4XYBA 1N2CA 1DUSA 3WRYC 3CH5A 1USUA 1D2AA 1ZNXA 2IU6A 3B38A 2XY4A 3GVIA 4JUCA 5HCIA 4XIIA 3K15A 4MLPA 1PFUA 2F8TA 2Y27A 4L74A 2BTQA 5FBKA 5I8WA 1Z8FA 3ZHQA 4MV8A 3EVZA 3KQWA 3THRA 1JIKA 4XB6B 2IYFA 3A4NA 4YFVA 3FVQA 4A2PA 1WDMA 1X80B 3FWYA 2HZ7A 1Y9ZA 3PJEA 3RRYA 4GOMD 3VO9A 4BP3A 1AQYA 1NPYA 2E4ZA 4TZTA 5C37A 1L8XA 4GMDA 1M2WA 2PSEA 3X2SA 3Q8MA 3HSKA 3NRBA 3EG9A 4LYEA 5AUQA 4AUNA 3I09A 3VR5A 3R9KA 4PQYA 1G66A 3EZYA 4M0CA 3RG8A 5KHLB 1LWNA 1VKZA 3MXTA 1JTFA 1W5AA 4HHEA 4TX1A 2QQGA 4OXIA 3UXEA 1C8BA 4DA4A 1RLIA 5EJ4A 3G2MA 4ZC8A 3MCZA 2O8BA 4ZVPA 2OSBA 4XDHA 3L4BC 2RI1A 4TYNA 4F8JA 1FUUA 2HWKA 3OX2A 3SJZA 1JXMA 1VMEA 2ZBPA 3HH8A 1W5TA 3UA3A 3JYLA 2PS3A 3PUZA 2OL4A 3ZU6A 4RK5A 1GT91 4XPIB 3TSYA 3ESCA 1YS9A 4LJLA 3P0FA 4YMLA 2IXDA 4OJKA 3R4CA 5JCOA 4PYJA 1ZR2A 2Y8EA 4EHIA 3QMPA 3WIUA 3VI3B 2I54A 4OHYA 1C29B 2EF0A 1TAUA 1WD7A 1VSBA 4UMEA 2JF0A 2CHUA 2H0RA 2ZUDA 3AU9A 4IGFA 4LY3A 4IWXA 3ZD7A 1VL2A 4M1TA 5EEGA 1SHUX 1GARA 2O1XA 4RV4A 5DEIA 4N7BA 3ZBQA 5KWVA 5FORA 2LUOA 3MAJA 1II8B 3KSUA 2QGNA 1Z0AA 2FR1A 1OLUA 1Y5IA 3LWZA 4UUBA 4WCVA 3LI2A 4YGYA 3SQDA 5KTYA 5LYJF 2PV0A 2IUTA 4QUHA 5K6AC 3QTLA 1G8FA 3D59A 3NLLA 4E07A 4F12A 5JBQA 3ZL9A 2LZ0A 3HB7A 4ENVA 1N3LA 3C15C 4MW6A 3WXMA 1ETHA 1FDSA 3DSRA 3KJGA 4NE2A 1TYBE 4RY2A 3LLUA 3UB2A 3EZLA 2CMHA 3C87A 3DMTC 4DW8A 3UYLA 1B0ZA 5J58A 3L4BA 3LIPA 1P9OA 2O3JA 3LT2A 4IPTA 4QO8A 2L0XA 3UIEA 2Z8XA 1Y1PA 4YXWA 4BVKA 1B7GO 3U3MA 5DBOA 1WSDA 1IN5A 1CS0A 4IHQA 4CEJB 1WP9A 3C3YA 1G2PA 3NPAA 3AVQA 3H1BA 3Q1KA 4MHSA 4PW0A 4QTZA 4XVRA 4Y0NA 4ZO6A 1RXIA 5EXSA 4CG3A 1YJBA 2I80A 4ZOLF 4R71A 1D9ZA 2FEWB 3CG0A 2FX5A 1FJXA 2IH4A 3TQHA 1NNUA 4DRYA 4F5DA 1YQGA 1I3KA 3KYDB 4LN1A 2F17A 3QUBA 2QXUA 4R9UC 5AW6A 4GMFA 5EJIA 3UQYS 3B1YA 5KNBA 3GLHB 1PZNA 3WLOA 1DO0A 4YX9A 4QE3A 3PD7A 2AMFA 4B73A 1FUYB 3KXKA 5CEEA 4WJZA 3SFTA 4RTJA 5FA8A 2HLNA 3HCFA 1SC1A 4UM7A 2L69A 3DEHA 1AUQA 3E35A 1USKA 2ODPA 3MMNA 3MRTA 4FNAA 4MV5A 2VDWB 4EECA 1AMUA 3UXYA 1DEOA 1P5FA 3C1OA 2ORWA 1PT8A 2OHVA 5ALSA 1UT6A 1NV9A 1VHTA 2FQ1A 2QR3A 3IUYA 4GEKA 4EF4A 1KJZA 3TKYA 1CY8A 1XAIA 2ANBA 3OZGA 1C8KA 3MD9A 4G5FA 3G0DA 4E15A 4C78A 3AIKA 3MW8A 4BMNA 4DPLA 4RHXA 3GLFE 1VB5A 2HIGA 4HWRA 3TLGA 2G6BA 2CLOB 1ORDA 3Q0EA 3EBOA 2AR7A 4AUEA 5TE9A 3M2PA 3PRHA 1KPHA 1HFWA 2QQEA 4DQ0A 2XZDA 1LI4A 4ZANA 3TUJC 4EYGA 2IEZA 2OLJA 4LOAA 1XAGA 1T5LA 2JB9A 4PPNA 5C7YA 3FNGA 1V1JA 1ZOSA 2OKGA 2KSQA 2W6IA 3ZDAA 2EYUA 2AFIA 2GBPA 2IA5A 2B3DA 3JQ9C 3L0SA 3KBOA 2V4ZA 1Q0LA 2QTZA 1I5RA 4RWZA 4ZAXA 4WBNA 3HV0A 1Z8NA 4K6KA 4AF7A 3DBHB 1FL9A 2D1TA 2GRUA 1KI3A 1B6TA 1L7AA 3TMYA 4AULA 4C7JA 1F6BA 1MJHA 4Q3AA 3F46A 1H2HA 2EWVA 5DNWA 3ZK9A 4KI7A 5F9FA 2EZUA 4RKQA 3FNEA 4N4AA 4AVYA 5HZMA 4IUBS 3JQ6A 3ELWA 4CCWA 3ZE6A 3INRA 1CU1A 1LH0A 4H17A 5KSYA 4DZTA 1PVDA 1R74A 4TVOA 2XV1A 3CUYA 1I0LA 5D7BA 3STVA 1W8IA 4MYCA 1N0WA 2PA0A 3IO5A 3TIXB 2CXRA 1GXSB 2QMEA 3A1WA 1OROA 2B25A 3O82A 4K9SA 2B9VA 5ISMA 5EIXA 1GNVA 3KJZA 3JS5A 4G86A 4PLFA 2B1IA 3HVKA 3IBTA 4FR2A 4R54A 4CF6A 5E2IA 4C2UA 5LXTF 1A9PA 4RY8A 2JANA 5C31A 5ETJA 3NZEA 4AJHA 1EK1A 1YNOA 4DMGA 5EEHA 3SS9X 1P1HA 1DIHA 2AD1A 3OSUA 3EXG1 5B4UA 4TZ0A 1XALA 4E4TA 4YRBA 5DK6A 3JQ9A 4QVGA 1E1MA 1J99A 2KI5A 1Y8CA 1L5OA 4I66A 5KYYA 2BISA 3EYWA 3CPHA 3E05A 4TMVA 3IQXA 5E7IA