2BKUA

Kap95p:rangtp complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear transport
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for Nuclear Import Complex Dissociation by Rangtp
pubmed doi rcsb
source organism Canis familiaris
total genus 47
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bkuA00
3UMSA 5FOXA 3LXRA 2YNMA 1NSTA 3GEIA 1RKBA 1L4UA 3KUDA 1W4AA 3QY0A 1D9XA 2AXNA 4NDZA 1QHHA 2BOVA 4GDFA 1H8ED 1KO7A 1RW4A 2XEXA 1GNPA 3FKQA 1T0JB 2GWHA 1GAJA 4MKGA 3AF0A 1UKZA 4IVQA 3RC8A 4FCWA 3P32A 4ON9A 2RGXA 4X8LA 1E98A 2B21A 2F9MA 2IT1A 4BFUA 4L8GA 1JAHA 3AP3A 4C4PA 4WZAE 2ZJ5A 2PZGA 2R8RA 2HYDA 5HKKD 2BEKA 2H18A 4B6FA 3W6NA 5IK2A 2GF0A 3U7FB 2J7KA 1AZSC 3FMIA 1Z6GA 1OIWA 4BZPA 1W0KD 1K5GA 2I4IA 2PZFA 3RS0A 5AUOB 2VSXA 4V03A 5HTKA 2ZJYA 3CUEF 5JJKA 3AF3A 4MDEA 2ZRGA 2WPDA 2R2AA 4ACAA 1JR3A 3THWA 1DBSA 2QBYB 1Q0UA 4IOJA 4WIAA 4MKFA 3SJZA 1OV4A 3DO6A 1XEXB 2RGBA 4LBZA 1ZM2A 4I1VA 5L3SB 2JLXA 2WAYA 3AVPA 1GZSA 4RCYA 3SS8A 1KI8A 2P67A 2RGAA 2F43A 4CZ2A 1GL6A 3ZVRA 3OESA 5CITA 2ZRLA 3THXB 2RGNC 5AJXA 2IYYA 4EQ6B 4LHXA 1QG2A 5IF9A 2QGNA 2CE2X 4CGZA 2XNSA 5JJLA 1E9FA 1DEKA 2IF0A 1ZINA 2BV3A 4KV9A 2KJQA 4LYFA 4TYNA 1KMHB 5K8TA 1JBKA 3AH8A 2FGJA 1UKYA 2AN9A 3VAAA 3THXA 2LCFA 3U3MA 1KZGB 2IYVA 1M74A 5KPJA 3PJRA 4GP7A 3LW8A 2FV8A 5DH9A 3ZLJA 3GEEA 2JIZD 3BIFA 4PHFA 1Z6TA 2QU8A 3PQCA 1KAOA 1KSHA 2QM7A 5FH9A 1MR3F 1ZNXA 1KMHA 4YXWD 2QQ0A 1PJRA 4XWAA 3AP1A 3K0CA 1D8TA 4JJKA 4YLGA 3W5IA 3THYB 2BJVA 2ECKA 3KKQA 5JFGA 3TK1A 2OO7A 3SN6A 2VHUA 3IKJA 4HB4A 4MUBA 4KSBA 2PJZA 1JEEA 4DDVA 4TMTA 1SULA 2CJWA 4C2TA 4PC7A 2Q21A 3ZVMA 3R8FA 1LW7A 3DMNA 1KY3A 3AKCA 2CNWD 2ZYTX 3W3ZB 1N6PA 4UQOA 4BFSA 3SYKA 3K70B 3QVVA 1T0HB 2OLKA 4FN5A 3FE2A 3MJRA 4B76A 3HU2A 3QKSA 1Q44A 3T1OA 5FOUA 1O87A 3U5ZB 1XP8A 3X2SA 1KNQA 4TLEA 3KJIA 3Q7PA 2XXAB 1H65A 2HJVA 3RYTC 2FH5B 5FBQB 1NN5A 3GP8A 4B33A 2ZJZA 2D2FA 3FFBA 4Q19A 2JJ2A 4QNMA 1E2IA 3X1YA 1FP7A 3RSLA 3ZZUA 1EFHA 1NG1A 5FPSA 3IHWA 4QL3A 2FFAA 4IFBA 3MUFA 2IW3A 3TLXA 4QJ4A 4B73A 4RZUA 2FA9A 4G5QA 1MO4A 2F3TA 2YWGA 4S2EA 3QUSA 1OFUX 4EPVA 2QP3A 1F2TB 1X6VA 2W6JD 3KB1A 3BOSA 2EQBA 2X77A 3E1SA 3RWOA 5JWRA 4WBSA 5HR5A 4TQAA 1G9XA 3C41J 5J4HA 2P0EA 4ZIRA 1HA3A 3MLEA 5AUQA 5JWHA 2CL6X 1PUJA 1XU4A 3MMPA 3D8BA 3AVXA 3AVQA 4LI0A 4BE7B 2KI5A 1N0WA 1GG2A 3H1TA 4TTPA 4LJ8A 1NVVR 5EXXA 4IFEA 1UADA 1R5NA 3K8YA 3FHOA 1CJKC 2C95A 2JDID 2PL3A 3QENA 4NBSA 4CEHA 4DDWA 4QGHA 1G3RA 2O0KA 3PUWA 2QNRA 4RZ3A 1ZRHA 3R7WA 1MV5A 1EX7A 1SHKA 3NBFA 5CLQA 3VKGA 3IBGA 1X8JA 1BKDR 4JYCA 4JKIA 4MH0R 4JLMA 3CKLA 4YMSA 2WJVA 4M1SA 4PC6A 1QRAA 4F38A 3NC1C 2A2ZA 1ZP6A 2ZYWX 1SKYE 4Q4JB 1GRRA 1OH8A 1W36C 5F98A 4OHYA 2B92A 4U5XA 4R2HA 1YJ5A 3I92A 1JR6A 3R20A 4KBGA 3RNLA 4DWJA 3ZDQA 4PO8A 2O8BB 4EFMA 4TZ6A 3B5JA 3PUVA 5DGXA 1JNYA 2ANCA 2YKGA 2VSFA 1Z28A 1W4BA 1LS1A 2CDNA 4LJYA 4HATA 5IK2D 1G7TA 5TDHA 2RB4A 4US1R 2QAJA 2E9SA 5DI9A 1RRPA 1UKEA 3BFXA 4HAWA 4JBXA 5C4GB 3EZ6A 1LF0A 3SBEA 3CR8A 1EFRA 1XTKA 3C5CA 4RD2A 2NO0A 3B1VA 1ZIOA 3AVOA 2WPDD 4DSOA 1JR3D 1EX6A 4BLRA 2GVZC 3B7GA 3QQ5A 2O8EB 2FFBA 1VTKA 1XD9A 2QUZA 4TT3A 3EC1A 1U90A 1UBEA 5A4JA 4PZZA 4M21A 1SKYB 2A7QA 3JVVA 2YWEA 2IEYA 3TJZA 2VP5A 4CEIB 1KGDA 2AK2A 3BE4A 4PPFA 2GEUA 2VH5R 1TF2A 2WAXA 3A4MA 2OHFA 5FBLB 5JCPA 3W6PA 5JRZA 2REXB 4CEJB 1OH7A 3WMGA 1DTSA 1YHNA 4A15A 4TMXA 1N6HA 1F48A 3M6AA 3BJIC 4HB2A 5BYKA 3C15C 2VYFA 1VCOA 1II0A 3LX8A 5JBQA 1VG9B 4CEIA 1G291 3LBHA 3LDAA 4POAA 3C4JA 1AA9A 4US0R 2XTZA 4PSVA 4PAMA 4RKFA 2IS6A 5L3QA 2OSBA 4CEJA 4TL6A 4OL0A 4ZPXA 2C9OA 4LHWA 3G82C 5L3VA 4GI7A 1DO2A 4Q9JA 3G0HA 1E2NA 1N6NA 2OLJA 4PPNA 2R6AA 2AFIE 3QG1A 4RVCA 3WMEA 3UG7A 1KI7A 1E2FA 3B82A 4BFTA 1G8GA 4M1TA 3T1VA 4AD8A 5TY0A 4LYAA 2WBLC 2ZRNA 1ZBDA 2D3WA 3BBPA 2WJGA 4OQLA 1OE0A 1SXJE 2ZITA 3EZFA 1R0XA 2GK6A 5AK0A 5IDVA 5J4VA 3VHXA 1BH2A 1E2GA 3NHAA 1JAIA 2W6IA 1Z83A 4BQSA 4D82A 4BEBA 4XWKA 1MT0A 1ONBA 3SQWA 1X1RA 4IEEA 2PH1A 1KI3A 1TU3A 5B2ZA 3EPJA 1R8QA 2Z4RA 2WM9B 2CMKA 4PQYA 3U7EB 4V0LA 4OBEA 3DHWC 2F55A 3B78A 4BFZA 3WRXC 4GOXA 2A5DA 4I1OA 3HR8A 3U3JA 1UFQA 4M4SA 1JI0A 4LV6A 4P4SB 2ZSEA 3B9QA 3PUXA 5FR1A 8OHMA 4B3XA 2XAUA 3A36A 3Q7QA 2O8FB 4U00A 3UIEA 5F3WB 4M22A 1GNRA 2JJ2D 2VBCA 3ZYCA 2F3RA 1YKSA 2IL1A 3QXJA 1GL7A 3VX3A 4GMXA 1G4AE 1A2BA 2NIPA 2YC4C 2RH5A 4G5SA 2YOGA 4UXHA 4EJSC 4E22A 1E3MA 4B2IA 1T5LA 4AG5A 1DPFA 4EDHA 4OYHA 3TKLA 1SXJB 2GAAA 1E2HA 2C2HA 2G3YA 4LJ5A 4ZCLA 4L9WA 2BMFA 1R2QA 4D26A 3Q5DA 1M34E 3W90A 2W2TA 4A0RA 2H92A 3UANA 4F93B 1RPZA 3J81k 1L2TA 4WOPA 2WWXA 2QY9A 3WNBA 1WRBA 4NE2A 1UDXA 4E07A 4ZCIA 2PLRA 2GJAA 1LB1B 1ZM4A 2BBWA 1AQUA 2G0TA 1Z2CA 3SYNA 5CB8A 4Z54A 3LW7A 4NCNA 5HPYB 1U0LA 3GLGE 1G3IA 1H8HA 1KIMA 2EWWA 3QKRA 1E0KA 5JHGB 1JXOA 4HAYA 2MSCB 4D6PA 3DPUA 3I1FA 4RCZA 4OHZA 3WHKA 4NYMQ 1FL9A 3A58B 4A6XA 2XJ4A 4DB2A 5LB4A 3AVTA 1CF4A 4AYWA 2XITA 3K9NA 4AKGA 4N1AA 4D4JA 1Z0IA 2ZJAA 3IIJA 1NN0A 4CYMA 4EFNA 1KNXA 1OT3A 4TLCA 2ZI5A 1E9RA 2DCUA 4PO9A 2DFNA 1TQDA 1W47A 2J7PA 4LJ6A 3EWAA 3A1SA 2AFHE 5J40A 3RANA 3ZGXA 1DELA 5SZJA 3AGPA 4MUAA 1II8B 2ASEA 2WJHA 1E4VA 2AXPA 1HEIA 2A9KA 4X8HA 1Z8FA 1U94A 5FR2A 3T34A 1EFRD 4PSKA 1QF9A 2GILA 3AVVA 1UBFA 4IW3B 3P27A 1X3SA 1YE8A 2I1QA 3SHFA 5JMTA 2MSEB 4Q7MB 2A5YB 2FF7A 4BFXA 1JECA 5TV2A 4TT3D 3EPLA 1SQ5A 3EZ7A 3R9XA 1R0YA 1IXRC 4QOSA 3ETLA 4YDHB 1G18A 4KYUA 4ZO4A 2ZRIA 1IXZA 3TSWA 1CR0A 2AKAB 2NPFA 3TMKA 1KKMA 3BH6A 3NH9A 4ARZB 4M53A 3LAWA 4XIGS 2RHMA 3KX2A 4PTLA 5FTKA 5DYGA 3AUYA 3BGWA 4G5OA 3BERA 2Z6VA 2A5FA 3CWZA 2QP9X 3A1UA 1RIFA 3L8YA 3TNFA 1I2MA 3NDPA 4RZ2A 4YDSA 5JSZB 1MRNA 4Q4LA 4OQXA 3QIAA 1NG9A 4YMUA 3QF7A 4ABYA 3LY5A 4C0LA 2EW1A 2ZYUX 4QFMA 4A2WA 4ARZA 2OFOA 2BVNA 3Q85A 4ILEA 1M1YE 5EE9A 4B2PA 3GPLA 3CRW1 3B13B 2YZ2A 4KFSA 1KZ7B 4QGAA 2AX4A 4C0HA 5FBVB 4BLSA 2DR3A 2R6FA 2RAPA 5CB6A 1UBCA 1YR6A 2XOKA 1K8RA 2ORVA 2WSSA 3RDPA 4B3FX 1QHNA 3W34A 1D6JA 4LBVA 1NKSA 1WBDA 3P1JA 1G3UA 4A6PA 2F7SA 2ZJOA 1ZIPA 2PX0A 3W5JA 1ODFA 2RGCA 2VL7A 5SZKB 2EFEB 2GETA 5FBWB 4ZKDA 4O3MA 1ZD9A 2W6ID 2YOHA 3HP1A 3ZIAA 1LS6A 3FKSA 1UM8A 3K1JA 4C7OB 1ZUNB 4YMWA 1KDPA 1S2MA 1VECA 4QKQA 2WSMA 1WA5A 2Q6TA 3QF4B 3WHLA 4DCSA 4YC7A 3U3RA 3VKWA 5IHPA 2FFQA 1XTSA 4FD2A 2XZLA 1NBMA 4KFUA 1A4RA 3B1WA 4Q9LA 5AJVB 1FUKA 1VCNA 2OM2A 4PR0A 2WVJA 3SQXA 2FZ4A 1KDRA 4LJ9A 1TADA 5TXGA 1IQPA 821PA 4OI0A 1LV7A 4DDUA 3V9PA 3KQHA 2QGZA 4B35A 1NF3A 2D4HA 2FE4A 3EARA 4RY2A 2L0XA 5FUYA 3HU1A 4DZZA 1L4YA 1ZJ6A 4BLPA 4LPKA 2ZSBA 3LLMA 3F5FA 3IDQA 2JEOA 2BCJQ 4QGGA 4R2IA 1Z0AA 4O25A 2GBLA 1Q1BA 3ZVNA 3L2OB 3C7KA 3I8XA 1IJFA 3CONA 1HT1E 5EE3A 3FFAA 4D25A 1YR8A 2WJYA 3QG5A 3TIFA 1P9WA 1HUQA 4HSEA 3WYFA 4URXR 2GCOB 3QKTA 3KXKA 4XJXA 1AS0A 2PT7A 4JVMA 1BO6A 2O5VA 4RD6A 3ZH9B 2JCSA 1AJEA 2ZE5A 4HAVA 2X19A 5TARA 2QAGC 3K0EA 4TSFA 2HUPA 4PC1A 4KVAA 3VNVA 1VMAA 2HCJB 1E2EA 1E0AA 5KU1A 1T4GA 3SBDA 1TEVA 3N2IA 3MWJA 1N6OA 3QEOA 1XEFA 4MYTA 1E2MA 3TW4A 4PPGA 3QJYA 4NP6A 1EFUA 2ZROA 2KSQA 1H8HD 4HEJA 3K53A 2GXUA 1F2UB 3LH5A 3VU9A 1D2NA 3I62A 1CJVC 1Z0KA 2IBMA 1KTVA 2XZPA 4M9QA 1E2PA 2QN6A 3OZXA 3I8SA 3RVBA 4DRZA 4IXNA 1IN6A 1N6IA 5BXQC 1P2SA 1FFHA 1G41A 2JA1A 4DXAA 1XF9A 2H17A 1A2KC 3NTUA 4IVRA 3AQ4A 3AVUA 4QBIA 1W44A 5L3RA 3B60A 4RJLA 2BJWA 4B6EA 1DO0A 2J7PD 1OIVA 2D7DA 5KDDA 1TL7C 1N6LA 5GJBA 5C46F 3BH0A 4DC9A 4B2LA 1B23P 2E1RA 1ZNZA 4MGZR 3AV0B 3IQWA 4JVSB 3NEYA 4V0ME 3RSOA 3T12A 3T1TA 1W1WA 1HE1C 1P5ZB 4A8JA 1TMKA 4TMKA 3VKHA 2P6NA 4K8OA 4TMVA 1J90A 1UEIA 3T06B 1DAMA 1GIAA 4ZDIA 5EJEA 5F9FA 1Z6YA 2QZ4A 3PEYA 3A37A 1CU1A 1WQ1R 2R62A 3HPRA 3LVRE 3REFA 2O8CA 1VDZA 1OPXA 2UVQA 3VR1A 4GL2A 2IYSA 4OHXA 2X1VA 3OF5A 1CKEA 3Q8XB 4MYHA 4IRUB 2NOAA 4Z8XA 5LDDC 1Q20A 4XSGA 5E7MA 5JRJA 2UKDA 2ZSDA 2OFWA 5DSZA 3JZAA 2ZPTX 3U4QA 3RS2A 4QJ3A 5BW8A 2O52A 1J70A 4HLCA 5LD2B 1F5NA 1DAIA 5K8UA 3M1IA 2G88A 1P60A 3ZD6A 1KI1A 2N42A 1XJCA 2CHGA 1JQJC 1CJTC 1V43A 3QBVA 4PQRA 5EXTA 1EFCA 5FTMA 4NTZA 3T1QA 2B7BA 3LA6A 4Q4AA 4UNNA 2FSFA 3PFIA 4GRAA 3AKDA 2YOFA 4NYMR 3GLHA 1JQLB 3A4NA 4HB0A 2WSSD 4ZDJA 5HE9A 4IDNA 1U81A 4YMVA 3BH7A 3GD7A 4UNPA 2ZAOA 4JLJA 4LC1A 3DEFA 1TUIA 2QBYA 3FVQA 1XTQA 3K0CC 3N5CA 4P0TA 2BBOA 2XB2A 2IYWA 3GFOA 1FTNA 4DVGA 1IN7A 4JLBA 1JJVA 5UKDA 3PV0A 3ZIAD 3FKSD 3U44B 2EFCB 5G3ZA 2ZVPX 1E9BA 2FN4A 3HR7A 1G7CA 2SHKA 1FZQA 2H5EA 5JEDA 4HYYA 4M9XA 5GJVC 3HYTA 2IX3A 5DYIA 4Q18A 1NBMD 4D2IA 3WP1B 2OZEA 4LCBA 3CB4A 3BAFA 4A0HA 5GJWC 1SHZA 3U44A 3R8CA 4M1MA 1M7HA 4TL7A 4BRUA 4AIIA 1NI3A 4HLUA 4W5HA 1D5CA 4GZLA 3AF2A 4Q9IA 1T3SA 4KHZA 4FMDB 4Q4HB 2ZJ2A 4JL6A 3M0EA 3KKOA 1G8FA 2P3SA 1R10A 4DCVA 1TPZA 1N5KA 2VSOA 4M9ZA 4X8OA 2FSHA 1XJQA 2BKEA 2A78A 2V6JA 3OHMA 1OH5A 3KJGA 3MD0A 2QA5A 2QEQA 4R98A 2IUSA 1DE0A 1XX6A 4JS0A 3DOEA 1KDOA 3B2EA 2NQ2C 2HJGA 4Q7KA 3ECCA 4I1UA 1XEXA 5L3SA 1YZLA 1RYFA 1GKYA 3TE6A 1E4YA 1P61B 2YJTD 3FWYA 4TSFD 1T5IA 4M0LA 2ZSAA 1KY2A 3BD9A 5J5CA 2YWFA 1WBBA 5DI3B 1G19A 1HT2E 2ZXUA 1Z3IX 2LKCA 4MGKR 1BS1A 3KTAB 4EQ6A 2CCKA 1VG8A 3GJ4A 1ZYUA 4KYIB 2CCJA 4KO8A 4O2LA 1VCMA 5DHAA 1RC8A 2PJRA 3HPQA 3K9HA 5EP3A 2B8TA 3SR0A 3W8NA 4Q9KA 1EFTA 3WMFA 1MOZA 2ODBA 2WOOA 5FFMA 4G5RA 2CLDX 1OXVA 5B30A 4DLWA 3V4FA 2XSZA 2YWHA 1TEXA 4AKIA 3RS5A 3VNUA 3L0OA 2VHTA 4TYPA 3EWSA 1XTIA 1DAGA 2IF2A 1SVLA 1FNNA 2VPPA 1HQYE 3R9IA 3I72A 1P7CA 4FCVA 5P21A 1BMFA 2Z83A 1YZNA 3THYA 2QRZA 4URUR 5H68A 3B1XA 1CBUA 2WZQA 1NSFA 4YONB 2NZJA 2O0HA 4ZI2A 1S4QA 1N5JA 2DYKA 3IILA 1GOTA 2NTYC 3WXMA 3ADKA 4URZR 4NMMA 1ETUA 4JT2A 1W2HA 4JLAA 3ASYA 1Q1EA 4HAZA 1FUUA 3Q3JB 3K09A 2VHQA 3ASZA 5AJYA 3A8TA 3CH5A 3GJ8A 2KBEA 4RKEA 2FNAA 4U7DA 2XXAA 4GOJA 1JB1A 1KMQA 1WXQA 4OQFA 2ODEA 1NLYA 1VYUA 2B7CA 3M4YA 4N0EA 2A5JA 2GAOA 2PLFA 2QROA 2YINC 2WMOB 4G0NA 4V0KA 2D74A 1DOAA 1Q1QA 2DFLA 2F1RA 3B8HA 3RRNA 4KI0A 1NY6A 5H8WA 2V55B 1IJEA 2ODNA 3ZJYA 3T5DA 3I73A 3BORA 3OIVA 2GJ9A 1F2TA 3I61A 3EPKA 3U6BA 4EAQA 1K5DA 4B32A 3OEEA 4PHTA 3C8UA 2OCAA 3U7GA 1NN3A 2V1UA 4B48A 2E87A 3NG1A 1G21E 4RD4A 5G3YA 5FOWA 1CJUC 2RHDA 1XCMA 1XJ0A 1NN1A 4Y0VA 4Z51A 3SHWA 1NJFA 2F1HA 121PA 1EXMA 3LNCA 2AWOA 4PHGA 4O2RA 4L4UA 1Q22A 1ZU4A 4LYHA 1G5RA 4DCNA 1KK0A 1CRPA 3I32A 1T6NA 2BKUA 3H2YA 4QHTA 4DLYA 4HDOB 2R6DA 2Z5FA 1ZCBA 5SZIA 2RGDA 3ZQJA 1NJGA 2FSIA 3SOPA 1XEWY 3NBXX 2HXYA 2Q3HA 1RYHA 3F3YA 3OAAA 5CIWA 2F9LA 1TQ4A 1NY5A 3CRMA 1DG3A 2H16A 4PHHA 4BWYA 1D2EA 5CK5A 4YMTA 2WTUA 4Q4JA 2JLYA 2FX3A 5FTLA 1P3JA 2HXSA 2XJ9A 3CIOA 2GEVA 3VQTA 5HE8A 1AKYA 2CLSA 4URWR 1P72A 3QPWA 2O8BA 2J0SA 1Z47A 1I4LD 5CDFE 4QBGB 2WJJA 3VR3A 621PA 3SU8A 5DNYB 2J3EA 4A2PA 2EU8A 3C5HA 3L43A 5L8VA 1XZPA 2ZI3A 2PMDA 2V1XA 5DN6A 4NL4H 2GXQA 4FW9A 4MRPA 1YRBA 4TLDA 2ZI6A 3CF6R 2ZE8A 3EW9A 1KDTA 5F2EA 5GADl 4GZMA 1G3QA 2IYRA 1DARA 3N2EA 1P9NA 3JZMA 2WICA 4WA7A 4X8MA 5SZHB 4DLXA 5E7JA 5GVSA 1YR7A 2V7QA 2GJ8A 2O8EA 3CH4B 4OKSA 3K0SA 3KB2A 4W5JA 4JSYA 1P73A 4Z8YA 1SZPA 2FU5C 1EG7A 3L0IB 4KBFA 1XDBA 2GCNA 3W3AA 2EFDB 2OBLA 3ZS9A 3KQNA 2XGJA 1US8B 3RS4A 1ZUIA 5J47A 1J8MF 4BLQA 4BLTA 1GKUB 1ZD8A 2QPAA 3NVAA 4JL5A 3BWDD 1AK2A 2ZEJA 3WNCA 4NZYA 1P6XA 1G8HA 3FTQA 2EFHB 5GJCA 4P32A 4C3ZA 4KITB 2REBA 2FDCA 2WWIA 4FWIB 1S0UA 1KO5A 2ONKA 3QOFA 4HAUA 1OKKA 4IHQA 2BBSA 3KXIA 5DIFA 3ADBA 1HH4A 3BK7A 5E95A 5JS8A 4L9SA 5C2JB 2XSZD 4R7ZA 2D06A 4MRSA 2ZJ8A 4CT5A 5DHFA 2XTMA 4BLOA 4MRRA 4DLUA 3FMPB 3MJHA 1B0UA 2VHJA 5G41A 1W36B 1U9IA 2ATXA 3H86A 4Q9HA 4LBWA 5FOSA 4DKXA 3GLFE 5FPTA 5H70A 1IM2A 2O8DB 1G5TA 4JKYA 1BMFD 1WE2A 2ODWA 4B3BA 1MH1A 2G1JA 1E2DA 5EP2A 2IYXA 2W58A 4PAOA 2FEMA 2QM8A 3TVDA 421PA 4E03A 1HE8B 3KKMA 3NBYC 1SGWA 4NPHA 3MGCA 3ND9A 3AVYA 1OLOA 2ZSFA 3F0TA 3REGA 2QMUA 1KI4A 3ZS8A 2O8DA 2OXRA 2PZEA 4QC2A 4C0BA 4KJZA 4L16A 2IS2A 2VP2A 3DM5A 3Q5EA 1IY0A 1W2GA 1W5TA 3FMOB 4PC2A 4RFSB 1NMXA 2VHCA 3K70D 1ZNYA 5JHHB 4GFDA 2ZE7A 5E7IA 2N46A 2HV8A 5CYOA 1E1RA 4L5BA 4LJ4A 1YR9A 4Q00A 5KOYA 1XRJA 2Z4SA 4II7A 5B64A 5ELXA 1P9RA 4JVNA 1LNZA 4P4SA 4WXRA 2PCJA 3AKEA 2O8FA 3AF4A 4UNSA 2B6HA 4LX0A 3IO5A 3GLFB 4N0DA 2H8KA 3UK6A 1Z07A 2ZI7A 3LLUA 2ZTSA 1UAAA 3I5XA 3SJCA 3UWOA 2OG2A 3O8RA 3ZVLA 4ZDKA 2WIBA 1PLLA 5JI3E 5KNBA 3RRZA 3PUZA 3OEED 1G8PA 1SXJA 1FNMA 2V8OA 1OW3B 3EZ2A 1Z0FA 3X1WA 4A1FA 2VF7A 4DCTA 3MFYA 5KHOC 3IEUA 2C77A 3LD9A 4DSTA 2DBYA 3LBIA 2JGNA 4JT4A 1Y63A 3EX7C 3HYRA 3MAAC 5GVRA 5JS7A 2X2EA 4HZUB 1A7JA 1TX4B 2GEDA 2XB4A 2XNDA 2ZYVX 3GLIE 1XCPA 2P5TB 2OCYC 4BZXA 3DL0A 4M1KA 2J5XA 1GSIA 4DBLC 4EPTA 4IXMA 2G9NA 4B3DA 4TN1A 3WBJA 3TRFA 1P62B 1G64A 1UPTA 3IUYA 2GXAA 5IRCD 4HZUA 1W46A 2OESA 2RKOA 3HWSA 2NGRA 1CEEA 4IVPA 1HY3A 3OAAD 5FL3A 4Z1MA 1R7RA 2ERXA 3LFUA 1NVXQ 1CJMA 1R0WA 3B1ZA 1NLZA 2V4ZA 1RRGA 1OXXK 2EWVA 3U6KA 3NBZC 5EXPA 2A3RA 4KFRA 1KSJA 1XBTA 5JLJA 5EUMA 4PSAA 4RZXA 2ZJBA 2IHYA 4ESVA 4XSHA 1AGPA 3RAPR 3GLGB 4W5WA 4OJKA 2V6IA 5KPDA 3DMDA 2ZUDA 1II8A 3DVLA 4EFLA 5DN6D 3GLIB 3GEHA 5AWFC 4F4JA 4XOIA 3CX6A 4BEJA 4AYXA 2WWFA 3IBYA 3UATA 3OE7A 1M7BA 2JLUA 3GLGA 1FMJA 1P2TA 2GBLC 1BIFA 1JEDA 2CLCX 3KXLA 4O0MA 4Q1DA 2V7QD 1QHIA 3KFXA 2F1IA 4KVGA 5EZ6B 3BB1A 4CRWB 1ZW6A 1E9AA 1QBKC 2QRNA 3ADDA 2W00A 3QI2A 1NMYA 2KE5A 3WRYC 1X86B 2ZRCA 2HLDA 3DOFA 3EASA 1CR1A 1O3YA 1FQJA 3MWYW 4OJQA 4M1YA 3EIQA 4C0KA 2VP9A 4LYJA 2P5SA 4P4TA 1CIPA 1PVOA 1DVRA 1E9CA 1HYQA 4M1WA 2CEAA 3GJ5A 4K46A 4AURA 1DAKA 2FPMA 5JSZA 4KSCA 2CVFA 1SVKA 2J9RA 2Z0MA 4KCGA 1OKKD 2GDJA 2R9VA 3I3SR 4A2QA 4BZQA 2W2XA 2WWHA 3GQBA 4ZKEA 4DT1B 1XTRA 2ZS9A 4ZV4A 2J0UB 1T3LA 1LVGA 1E9SA 4MQBA 4AKEA 4TZ0A 1KK3A 2HEIA 3I4LA 2JLZA 4DDTA 4WAUA 3NKVA 4IKEA 1IOZA 4LJ7A 2NMVA 3D7MA 5G53C 1W5SA 5AJWA 1E79A 1E96A 4Q1BA 1MKYA 1GP2A 3CWQA 2FMXA 4GSYA 2RMKA 5HZKA 1N25A 5J4YA 4WZ6A 3FMFA 1G16A 3MG9A 5D3QA 5KYKA 1Z0JA 2EVWX 3TAUA 3EAQA 4OI1A 4M1OA 4AYTA 1R6BX 4KAXA 3AF1A 2JATA 4URYR 4JSTA 4D0LB 5CJ2A 2QTVB 2WIAA 4C7OA 4B71A 4A92A 2RGGA 4HZIA 3TUJC 2ZANA 4QBHA 3QF4A 4OK5A 5HCIA 4A8JC 4I81A 1E1RD 4Q03A 4PANA 4Q5IA 4QXAA 3NH6A 1ESNA 2HYIC 3MCAA 4TLAA 4A0FA 4D4LA 2D2EA 2AR7A 1NL3A 2PT5A 4AI6A 3U60B 3QBTA 3LWNA 4RSGA 4Q47A 1QVAA 2FSGA 2XX3A 1EWRA 1OB5A 1KYIA 3K9GA 1LY1A 3TQFA 1R4AA 721PA 4JLOA 2QQEA 2FPLA 3RS3A 4PFSA 6Q21A 1U0HC 1Z6AA 4DIDA 2O0JA 3IIMA 3RRMA 1CLUA 1SXJD 1K6MA 5FPYA 1P2VA 2GA8A 2PCLA 4AG6A 1TF5A 3FB4A 1M8PA 1U8ZA 2GCOA 1XMIA 1OXTA 2HT6A 4W7SA 2GJSA 4IOKA 4AWXA 3EZ9A 1E2LA 4KU4A 3X1ZA 4PZLA 2WWYA 3V4RA 3IHLA 1IONA 2XNDD 1TNDA 3GCGA 5B58C 3AM1A 2IXGA 4MGIR 3SFVA 4W9MC 4LHVA 2Q9BA 1RVDA 2CK3A 5F9HA 1XEWX 1CXZA 1OB2A 3AEZA 1XMVA 4G1UC 1G20E 4JLNA 1D2MA 1S3GA 2IK8A 1TU4A 2GESA 1FX0B 1XMJA 2ZRAA 3EXAA 1F2UA 3SYLA 4NYJQ 3QNUA 1RJ9B 4NH0A 1NVVQ 4JLDA 1E1QA 1WMSA 2HDNB 4B47A 3RWMB 1OH6A 2ZU6A 4ASUA 4MITA 4Z1MD 1IY1A 1TF7A 1XTJA 3KJHA 3RLFA 1BYIA 4C0AC 1JPJA 1SVSA 1A82A 2FEOA 3W6OA 1UEJA 1KI2A 1E2JA 4PXAA 4DLSA 3CRVA 3U61B 1XXHE 3CZQA 4I4LA 2ZQ5A 1XB2A 4A82A 5JEEA 2GZDA 1GRQA 3A6PC 3UG6A 4XH9B 2MSDB 4KLZA 4NU0A 4DEXA 3U7HB 1XMSA 1CULC 3L82B 2MMGA 4HLUC 4TL9A 2VP6A 3PVSA 2AWNA 3S1AB 4D4MA 4MKIA 3NIBA 1W4RA 5TMPA 2ZRDA 3BC1A 4FIDA 4NCHA 5FOVA 3OE7D 2W2VA 3B9PA 5LPNA 3SZRA 5CLLA 1E2KA 1WF3A 3U2QA 4OK6A 2J87A 4BUJA 2DFTA 2IYZA 4R71A 1C9KA 3S1AA 3B85A 5HCNA 1M2OB 4F92B 1EESA 2DY1A 2QAGB 5KSPA 1C4OA 1G1MA 2CXXA 1KI6B 2HLDD 2QPTA 3THOA 1AN0A 2W83A 4FMBB 5M04A 1KJYA 1GRNA 1MABB 4M8NE 4QM6A 5DO9A 1Q12A 4M2LA 3AVWA 1OIXA 4XWOA 4GBMA 3K0FB 2AD1A 1N6RA 3O8DA 4QM7A 2XOKD 2QTFA 4LBYA 1E94E 3TSOA 5A5GA 3SEAA 4LY6A 4A4DA 1NMZA 2VTKA 521PA 1XCGB 1IY2A 3CR7A 1JR3E 3CPJB 4V0MA 4MYUA 4MA4A 2ZE6A 1E32A 2WKQA 3K0FA 3VMFA 3CNLA 1G4UR 1GUAA 3HU3A 1DAHA 1WB9A 1YZQA 2BMJA 3GFTA 3KDSE 1RE0A 1YVDA 2OEPA 3DDCA 4P31A 4NYIQ 5KSOA 4TTRA 1E79D 2VA8A 2ZRHA 2ZI9A 4GPTA 2OXCA 4AY2A 1NVWQ 2AHOA 3BFVA 5D3MB 1ELOA 1GM5A 1UKVY 1BYUA 3FYHA 1A5TA 3LVQE 3BB3A 3OIWA 3TQCA 3CNOA 1Z29A 2CBZA 4EUNA 3ZZ0A 3DKVA 2QT1A 3PCRB 2I1VB 1VG0B 5EP4A 1M7GA 4MGYR 5BQ5A 4US2R 2FWRA 3K70C 2QMEA 4P4UA 2G1KA 3PXGA 5BWMA 2NPIA 3EA5A 5D3MA 1W7AA 2Q3FA 3AP2A 3K09C 3THWB 2P65A 4E5UA 2ZAMA 4CW7A 2FGKA 4WZBE 4AKHA 1PZNA 2OCBA 2WJIA 5IT5A 4Q21A 2YV5A 2V9PA 1T8UA 2QT0A 3OIYA 3TSZA 2JLVA 2F43B 4HB3A 1KHTA 4UJ3A 4Q4HA 1MO5A 5FTNA 1OF1A 2NG1A 1DADA 2BMEA 5DE3A 1XD2B 1U8AA 4GMDA 1IN5A 2Y8EA 1PUIA 1EGAA 2JJ1A 1Q21A 4J0QA 4OQNA 5EE0A 1Q57A 1N2CE 1G3MA 3L0PA 3PIRA 2KB0A 1TQ6A 3AUXA 2ERYA 1ZC3A 4JLVA 2GJKA 3SDZA 2OCPA 1S3SA 2OV2A 3N70A 1XD2A 5LB2A 4NCJA 2IXFA 4FCTA 1PLJA 5DI3A 1MO3A 3CF2A 3MWLA 5BN5A 3P4XA 1TAGA 2CK3D 3K9LA 4RD0A 3KL4A 4JJZA 3ZQ6A 3IQXA 3KTAA 4LDJA 3EIHA 3EC2A 2ZU0C 2GZAA 3BRWD 4V0OA 4NKRA 4QHYA 3T61A 1U8YA 3VR5A 1CR4A 4UJ5A 4HUQB 3DZ8A 2FZLA 3IIKA 1N0UA 3PITA 3KQKA 1FOEB 2GCPA 2WV9A 3X1DA 1Z22A 2ZVQX 3EG5A 3NXSA 1E1QD 1OHHA 4CF7A 1PLKA 4ASUD 1LFDB 1R5BA 2CJWB 2AL7A 5J4LA 2HT1A 1QHGA 1JXMA 3TVTA 1U99A 4BFYA 3QXXA 4URVR 5ANRB 1PV4A 3MWKA 4HUQA 1Q3HA 2ZETA 1NP6A 1FP6A 3ADCA 2IHBA 3QKSB 4MRNA 1N3BA 3K0AB 2IWHA 4JBWA 1XWIA 2AKYA 4LZZA 4JLPA 3ZD7A 4C9BA 3KFVA 5BYJA 3TAHA 4A0GA 4F4IA 5EE1A 1VIYA 4QNRA 2DHRA 3IPXA 4XVQA 2IYUA 4HI0E 1GVNB 3B6EA 1CR2A 4Q7JB 4DLRA 4TYWA 2N1BA 1JJ7A 4M9SA 4P33A 2HF8A 3G5UA 3K0AA 4JBYA 3NEJA 3V00A 2G0NA 1ZAKA 4AK9A 1LF5A 2A30A 2D7CA 1F60A 1G7SA 1QHYA 1OXSC 2P6RA 1AIPA 3GMTA 3UKDA 1VKJA 2IS1A 2PEYA 3QVUA 3GJXC 3OFNA 3QKUA 4LSGA 2W0SA 4D0NA 2C9CA 4A9AA 4U02A 1UDWA 1VYTA 2VLIA 4PQFA 5FI1B 3WP0A 4FWTA 1S1MA 1KAGA 2GHIA 3PG5A 3D6TB 2A5GA 3W9YA 3DZDA 4ZIRB 1YZKA 4ITRC 1ZNWA 2RGNA 2JLSA 3MRSA 1Z2AA 1RFLA 4IJMA 4C30A 5KO2A 5TB5A 3QXSA 2J46A 1FQKA 4F7WA 3KKNA 4IDOA 1Z0DA 5A0FA 4CEHB 5KSZA 5C18A 2WWWA 2VP4A 2JAQA 4Q48A 1ZC4A 2QL6A 4NCKA 1ZM3A 4GP6A 3R7WB 1F3OA 3E5HA 4NYJR 4HLQB 2QPOA 5FUVA 1E69A 4OHVA 4PX9A 1S9DA 3T15A 2CL7X 4DEYA 4ACBA 4BFWA 3GJ6A 1U9IC 4UNQA 1VHLA 1CS4C 3R9WA 4JZKA 1YZGA 4DUGA 1NIPA 2GTPA 3FGNA 3GJ3A 3RS7A 3VR4A 2F1JA 2ZRBA 1GITA 2B8WA 2ANBA 3P4YA 4L15A 4DLZA 4HLDA 3ND8A 4B43A 2ZREA 3UMFA 4CIDA 4G3XA 2ORWA 2QE7A 3H4MA 3RC3A 5FTJA 4BRWA 2IXEA 1NKTA 1VPLA 2BIFA 3SC3A 2NO9A 3LQQA 5TVKA 3MSXA 2WHXA 5B57C 1QZXA 3VR6A 2PEZA 2KBFA 1U98A 1VYVA 4KXFB 1AQYA 4Q01A 4B34A 1EK0A 1P2UA 4C0QC 2ATVA 2BM1A 1ZD1A 2H1LA 2CE7A 3TH5A 1UJ2A 3A1WA 3SE0A 1TQ2A 5C1BA 1R5OA 1GFIA 5DISB 4G5GA 2P6UA 2Q0HA 2IWRA 4JMPA 1FPMA 1I2DA 1N5LA 1WCV1 2OE2A 1ZMXA 4N3NA 1L8QA 2J45A 3KKPA 4IDHA 4QRHA 2MMCA 5EXSA 2J0QA 5CM8B 2XZOA 4TMZA 1DAFA 2AD5A 2ZS7A 3O8BA 1Z63A 5CM9C 5BN4A 4LGMA 1G8YA 2JJ1D 4QHSA 1XZQA 3TR5A 2V3CC 3WBKA 2VRWA 3VR2A 1SXJC 2YC2C 3TW8B 4DJTA 1XPOA 4MKHA 2P2LA 1X8LA 4H1VA 3UMRA 3LO5A 4B75A 1MRSA 3ICQB 4H1UA 4V02A 5L3QB 5FOTA 2UZIR 2REOA 3BB4A 1I4TD 1DG1G 1US8A 1ZM7A 3C16C 1IAQA 4GOKA 1UBGA 3E70C 1X1SA 4MDFA 1ZM9A 4Q1EA 4HUTA 1KOFA 3PUYA 5KDLA 4C0SA 2VF8A 3D3QA 2ZM5A 1IBRA 5CK4A 4UXJA 2DPXA 5CDFA 3ZZTA 4NYIR 2OAQ1 2QG6A 4P3YA 2PBRA 1TUEA 4S35A 3W8RA 3U3KA 2HF9A 4Y0AA 2BDTA 4PAQA 2PX3A 1OHHD 4LC0A 1L7VC 1XFAA 3FHTA 3VTKA 1FMLA 1NVUQ 3BFKA 2QMOA 1YRAA 1W48A 2I3BA 4TTQA 2F6RA 2JJ8A 3O8CA 3JVUA 1KKLA 2FJUA 3H84A 4DHEA 2GKSA 2C96A 3AB3A 3FDIA 4PC3A 3EA0A 4F91B 1OYYA 2EYQA 1OFIA 1J2JA 3B1YA 2JASA 3CNNA 2C5LA 2ZRPA 5CYPA 3OEHA 4XD7A 1EWQA 5JJIA 1HQCA 2LKDA 2ZS8A 1P75A 5EUQB 1AGRA 1E6CA 2VO1A 3UWKA 1W0JA 4C0JA 2C78A 1YZTA 2RCNA 2GRJA 1OXUA 2WKRA 2C04A 2CL0X 3FHCB 4DB4A 4MYCA 4ESHA 1CP2A 1COWA 1IXSB 2ZI4A 1R0ZA 3PENA 1ANKA 3CBQA 3EIEA 4RFSA 1C1YA 2DWPA 2CHQA 2YVUA 3BXZA 3NWJA 4IOLA 2CHVA 2QTHA 2ZRJA 2ZR0A 3OFND 5KTYA 2QMHA 2VIIA 3TUZC 1ZUHA 1F6BA 1ZCAA 4A36A 2NO1A 3CF0A 2X2FA 3KJEA 3LQRA 4CT4B 2WWGA 3DM9B 5KNDA 5J4KA 2BMDA 4EKDA 3GLFA 2IA5A 2ONJA 4AC9A 4JVLA 4TMWA 3WYAA 3GJ0A 4TQUS 4EPYA 2AK3A 4MRVA 1OFHA 4D80A 2R6GA 3SNHA 3TBKA 4GT1A 1WDTA 4TWZA 4LK2A 4UXIA 3QKRB 3SI7A 1MO6A 3A1TA 3CZPA 1E9EA 2J41A 3C14C 2Q9AA 1QG4A 4OI4A 3T35A 3VFDA 3ONWA 4FINA 1KO1A 1NIJA 3PR1A 1FW6A 4TQ9A 5JCZA 4FMCF 2OBNA 2R6CA 4B3CA 5FI0B 1OYWA 4DUGD 1W4CA 5KSYA 3AKYA 4B74A 1J7KA 4PPQA 1QDEA 2DWQA 2JLQA 4IDPA 2IUUA 5JECA 5FL7A 2QENA 3GJ7A 1QVRA 4OHWA 3QE0A 2V54A 3CPHA 4LOAA 5HZHA 2QE7D 4NHOA 4EPRA 3DKPA 2QP4A 3CX8A 4R9UC 1KSGA 1XD8A 1VIAA 1T8TA 1RRCA 3UXMA 1SVIA 4LV8B 1ZVQA 2JLRA 3LXXA 4JLKA 4DCUA 2D62A 1G6HA 1G6OA 3QXHA 2J59A 4ZI3A 4PZYA 1T9HA 3PEVA 3QPVA 4CVNA 5FUXA 4XTRA 4BPBA 2IUTA 2OUKA 3CX7A 4LJAA 4EJSB 3QSYA 1RZ3A 1R8SA 3L0SA 1DAEA 1SKQA 1U2RA 3VHLB 5FPKA 3I5YA 3NDBB 3KUCA 4XTCS 1HURA 1JALA 5BN3A 1Q1ZA 3GLIA 3LV8A 4DSUA 2Q9CA 4KODA 4B44A 1ESMA 1SVWA 2CVHA 1GKIA 3LRPA 2WMNB 5AUPB 1T91A 1IN8A 4EJSA 4TYQA 1GL9B 2FG5A 1AS2A 3IPYA 1XPUA 2C03A 4Q1AA 1JPNA 3FOZA 2ZRMA 2H57A 1NBME 2IS4A 1WP9A 4QJ5A 5EP1A 5E3HA 3BS4A 1KO8A 4ZDWA 1SVMA 1YQTA 1V5WA 4LWZA 3TUIC 3RHFA 2DFKB 4QG7A 3WYGA 4DIEA 1FTSA 4UNRA 2PMKA 3ICEA 3QEJA 5LBIA 1D9ZA 2G6BA 1A1VA 2W0MA 1VHTA 1S8FA 4TYYA 2OT3B 3IEVA 4HDQB 1TTTA 4OI2A 5DLQC 3FPAA 3WNDA 2QORA 1S96A 4FMCB 4G01B 4TL8A 2OAP1 4NCIA 4RD3A 3A4LA 3CRRA 4IEIA 5JZVA 4EIWA 5JWOA 4DT1A 3O47A 1II9A 2J0VA 3VX4A 4JYBA 1P4SA 2G83A 2J0UA 1H8EA 3PEUA 1LTQA 1Z08A 1W36D 1GILA 3CO5A 2ORIA 1IHUA 1XNJA 1DS6A 3SJBA 3OEHD 4XD7D 1NNEA 5K8IA 3LBNA 221PA 3TGPA 2K5UA 3F8TA 3CLVA 4PO1A 1W0JD 1KO4A 1I4DD 2J1LA 4Q1FA 4K81B 1XPRA 3HDTA 4Q1CA 2WKPA 3AGQA 1BOFA 1G17A 1HV8A 4WW0A 1COWD 5HKKA 2BHRA 5AUNB 4IOMA 2GK7A 4KLNA 5G40A 1W0KA 1YU9A 4JL8A 1IN4A 3P26A 4Q66C 4HAXA 1GNQA 2Z43A 4FXPA 4GNKA 2YYZA 1N0VC 1QHSA 1U0JA 1VG1A 2BWJA 5AR1A 1AS3A 3OIUA 5JI2E 1E2QA 1HTWA 1VCIA 3SFZA 1N6KA 3A1VA 4OQMA 3KQUA 4WVFA 1QHXA 1GWNA 3TR0A 2NZ8A 2ZR9A 3E2IA 1E0JA 1W49A 2ZUBA 5LD2C 1S9HA 1GDDA 2BEJA 3Q72A 1E9DA 3L8ZA 4LPSA 3VU9B 2BM0A 2IYQA 4Q7LA 2EFGA 2HCBA 2FPKA 1Z6XA 4D81A 1E99A 1KK1A 3X1XA 5CIQA 2X8AA 1G5PA 2BCGY 3IO3A 2JIZA 1ZU5A 4D0GA 1CRQA 3GFPA 3KQLA 2LWIA 2JLWA 1OFTA 2NO6A 4H9GA 4HDCA 3RABA 4YQFA 1AM4D 5H1YA 4OK3A 4YXWA 4C2UA 1RRFA 2ZUCA 4EPWA 4I1SA 2IC5A 3QPUA 4F4CA 3UPUA 2GZHA 2FFHA 4EPXA 1KJWA 4LV5B 4D4KA 5FL7D 1FX0A 3HJNA 1AZTA 3RRYA 2DB3A 3P20A 4WXPA 2GXSA 2IYLD 1RJ9A 2KWIA 2OFXA 3NHBA 4KFTA 4BASA 3LX5A 4Q02A 2GF9A 4BGDA 2NO7A 5K8LA 3SJAA 5KUTA 1J8YF 5E4FA 3CPEA 3IGFA 3EPHA 2C99A 2CNWA 4A8JB 1G7RA 2Q3MA 3WY9A 4DLVA 2QI9C 1KSFX 2R65A 1AKEA 3GLHE 3CW2A 2H7VA 2C98A 2C9YA 4V0NA 4CDGA 2ZRKA 2UZ3A 5EE5B 2QSZA 2GVDC 1NRJB 2O8CB 3PEWA 4BFVA 4LUCA 2TMKA 3KZ1E 5C4MA 4B3GA 1Q3TA 1Z06A 1UF9A 5KDOA 1YZUA 2VP0A 4DSNA 4I99A 2QSYA 5AJZA 2FOLA 2YHSA 1S1CA 2XTNA 4LHYA 5FUWA 3U4QB 1KK2A 2IYTA 5FPHA 2VQSA 2EYUA 4QBFA 4XVUA 3CRQA 5CJPA 2RGEA 2R44A 2WOJA 4E09A 4FI3C 1KJZA 4FMDF 1Z5ZA 4LHZA 4UKDA 1XXHB 1J99A 4LRWA 4RD1A 2ZIAA 1X8KA 2OBMA 2W6JA 1OJLA 5EQTA 2IEZA 5FBRB 1T3HA 2CCGA 2GNOA 2DWOA 4TLBA 4XVRA 4BECA 2G77B 3NC0C 1Y3AA 1M6NA 2QAGA 1KI6A 4QGFA 3H0KA 3Q9LA 4IDQA 2C8VA 1NLFA 4JIMA 4Q4AB 1KI9A 2OILA 3GLHB 4RFVA 4ZCMA 1OSNA 1XXHA 1MABA 3QXCA 3U3OA 1GTVA 1QHHB 3D31A 4ERNA 4NONA 2VEDA 3CM0A 1CTQA 2BC9A 1SVOA 2ZR7A 5KNCA 2ZRFA 1N5IA 3T5GA 4DLTA 2JDIA 2BBTA 5EZ5A 1E0SA
chains in the Genus database with same CATH superfamily
1WTAA 1L5YA 5FOXA 2EIHA 1ONOA 2FWNA 1NJ2A 2ZB2A 4GYKA 2YNMA 4LE1A 1Y81A 4QJBA 3V4SA 4V1CI 2XOXA 1XU9A 3HMKA 1WF6A 1YGYA 2FPPB 2FR8A 2GEKA 1QHHA 4GDFA 1H8ED 1VE1A 3F74A 3BSFA 2JZOA 5E1BA 3P9XA 5L95A 4OA8A 2P2GA 4H27A 4EQZA 5EESA 3O0TA 4G5FA 4IJQA 4ZYYA 2P2ZA 1Q1GA 4FCWA 4H31A 2NSYA 4JJEA 4ON9A 6ABPA 3ZNPA 3NVKI 5KYUB 2AHRA 1EQ2A 4XRGA 4DV7B 1H3FA 2B21A 3VSCA 2J5RA 5IEBA 1Z4OA 5GZ6A 4B8YA 1DKOA 3NFRA 2X7JA 2QK4A 1RXCA 3AP3A 1A9RA 4J1QA 1XT6A 3WLJA 4F46A 2PZGA 4KPYA 4MVWA 3E7XA 4HS9A 2HYDA 4CR8A 2H18A 3Q7EA 4B6FA 4ECEA 1WWKA 2JLBA 3G9ZA 2UXCB 5IK2A 1MF7A 2J7KA 4XGQA 1T5SA 5CEJA 3ISVA 5HUQA 4NDAA 5EA2A 3DONA 4BZPA 3UM9A 4COOA 4DLAA 3WLQA 2BR5A 1U1EA 4FDAA 1YS9A 1B1AA 1K5GA 3RS0A 5CRIA 3VU1A 3G02A 2EGGA 4GZ6A 3TX2A 3FETA 3PSHA 3CFYA 4OQ4A 2GPNA 3CUEF 5HZGA 5JJKA 4JI4B 1LVUA 4QECA 1Q0UA 1C7JA 2AOTA 4MKFA 4UQLA 1ZIYA 1OV4A 1HDEA 1U2ZA 3Q5GA 1XEXB 3OOEA 2ISCA 5L3SB 1ZM2A 3A3YA 5C7LO 5I5EA 3NWBA 1E3IA 1ULBA 4I5FA 2CGEA 2BH2A 2WAYA 3AVPA 1GZSA 3MXTA 4UTOA 3TTTA 2ZQYA 4BNWA 4BWVA 1C0KA 2P67A 2NQ8A 1TCAA 2BLNA 1Z73A 5CITA 2XBMA 2ZRLA 3THXB 2LNDA 1N1MA 2DTXA 2YFYA 4J8PA 5T57A 1TRKA 2FLVA 5IF9A 3PF9A 2CE2X 3QVMA 4KR9A 4CCYB 4WZAB 1DWUA 1IHDA 3FYUC 2WIGA 1RJGA 3FYCA 3HEBA 5BMVB 2OPBA 5K8TA 2Z1DA 2II6A 3A7EA 3AH8A 3JQEA 1ZMBA 4TZKA 4HQLA 4XCQA 1UKYA 1ZZEA 5KYNA 4HNAA 2ISSD 3I9KA 1KZGB 3EG9B 3V1YA 5EJ5A 3GA5A 1XWFA 2X5KO 1U1FA 5KPJA 1T13A 4ZAVA 1KWKA 3AXSA 1XC7A 1OPRA 2GN0A 3GEEA 2CYCA 3PNMA 4MW5A 4UHBA 3BIFA 4KO2S 2P9FA 3UWPA 3TW0A 1VL0A 1RQGA 2A9OA 3GJRA 5FH9A 4YAFA 3WL6A 4YXWD 1PJRA 1FJHA 4KMRA 1DAOA 3OQ6A 2GVNA 2B4KA 1JE1A 1U3FA 3K0CA 4C5BA 3LY9A 4JJKA 4YLGA 3W5IA 2WK1A 4U4AA 2Q4EA 4GI5A 4RL4A 3Q7RA 2OO7A 3PQ3A 2D5AA 2VHUA 2X6QA 3KAPA 4HB4A 4M60A 4KSBA 2GO1A 5I3ZA 3A6FA 1UFRA 4K40A 4DDVA 4DV0B 1KS2A 2CJWA 4C2TA 2VDNB 1SD1A 3AM3A 1OAOA 1TJ5A 1PSDA 1NJ1A 5U1PA 2L69A 3DMNA 8ADHA 3R8FA 1TM5E 1DGQA 1N6PA 4BFSA 1A88A 3Q2KA 5AICA 1T0HB 3PLNA 1WKVA 1USKA 1HDOA 3LUFA 3MJRA 1I5RA 1EE9A 4Z9YA 3HU2A 3WYNA 3QKSA 3TTYA 4BO9A 5FOUA 3LLVA 1ENPA 1V96A 4JN6B 3X2SA 3JR3A 3VBCA 1U31A 3A9VA 3KJIA 5EL0A 3JWEA 3EGDB 1W9MA 3RYTC 2ZUSA 4U2CA 5ALOA 2HBYA 1RYBA 1VCHA 3ID6C 1K2WA 5KYXA 3WSWA 4O4HF 5HA5A 4JXJA 4R1QA 1Z4QA 3PQDA 4UU7A 2ZJZA 2C29D 3FFBA 2C1EA 1QM5A 2JJ2A 4QNMA 4BDTA 4HNGA 1FP7A 3A2KA 3TEFA 1UXGA 1NG1A 3HYSA 4DG8A 3IHWA 1V3UA 2CB0A 2PRSA 3P2YA 2OP1A 3P2OA 2DQZA 2IIPA 3O7WA 2EQAA 3P9QA 5I9MA 3TLXA 2ZUWA 2C8JA 3OKPA 1L5OA 3D5EA 1ICIA 3GVPA 3H1FA 2OORC 3FRIA 1MO4A 1ZGAA 2F3TA 5EY5B 3W6OA 3WKBA 2ENUA 2R00C 3CCCA 3VH2A 4EHNA 3REOA 2AYXA 1WCYA 1SJ9A 3EEFA 3KB1A 5ECDA 1LD3A 3RU9A 1L5GB 4BAUA 5CBPA 4B3MB 1QUFA 1V41E 2VR1A 4MI9A 3RWOA 1MAHA 5JWRA 5KWIA 5LIPA 4OQYA 4WBSA 5HR5A 5LNK1 2PRKA 1G9XA 3PPXA 4FHZA 3SK0A 4K6OA 1TJYA 3F1KA 1HA3A 1WPXA 4FFDA 4PG8A 1PUJA 1XU4A 3ODPA 4MWSA 4R54A 3AVXA 3AVQA 2HN9A 1HL3A 5D01A 2JLCA 4BE7B 5AW3A 4IZOA 1Q11A 4QDUA 3UEOA 1JVBA 3ZKWB 1XQYA 2X58A 4LJ8A 3WGTA 3ZKAA 4BTVA 7MHTA 3TB4A 2GHTA 3RUPA 2GQ0A 2ZJ6A 4NBSA 2G67A 2PRYA 3IAFA 2X41A 3I42A 1QOPB 1SKMA 4CMEA 4JD5A 4PPYA 1M2KA 2O0KA 2WI8A 4YPVA 3SX2A 1RS0A 4MB2A 4RV5A 2IY8A 1J7JA 1LUAA 2A0FA 2O2IA 2B4AA 4BLVA 4INOA 1FRQA 4FGUA 1EQUA 4F3YA 1P4RA 2GK3A 2GZ1A 2KHZA 4J2HA 3VJRA 2WJVA 1OYOA 1IDN1 1QRAA 2IOFK 4IIVA 3BJMA 1LX7A 2A2ZA 3NC1C 4IVNA 4AX4A 4Z7QB 1U2GC 3G2OA 3O82A 2B92A 4U5XA 3I92A 4EH1A 2Y2UA 3OPMA 3W9SA 2WHRA 1PZEA 3T41A 3RNLA 4BQPA 3WJ7A 1Y4UA 3F9CA 3TCNA 4EFMA 3B5JA 1Z38A 4X3OA 1JNYA 1SBCA 4X7MA 1SRRA 4BNLA 3JW8A 3SZLA 1JIJA 4GEGA 1Z28A 5HCUA 1CY2A 1LS1A 3I6QA 6CHYA 4KPUB 3RADC 4HATA 4PCUA 4US1R 2RC5A 2VN8A 2E9SA 4QUGA 4O08A 1RRPA 1UKEA 4BMNA 1ULZA 3BFXA 2PSDA 4O4JB 4RV4A 2OBYA 2V7UA 3SBEA 4K28A 3CR8A 4TXJA 4UARA 1K66A 2BEUA 3C5CA 2ORYA 2QSJA 1P1FA 1K8ZB 3C3PA 3H4TA 1MV8A 5AOBA 2PUEA 1XQ6A 3NAGA 3OMWA 3GEDA 3RQSA 3WA7A 3RIXA 1XD9A 2QUZA 1Y33E 4GMFA 4HQNA 3HB5X 2HBRA 1VBKA 3DYBA 1ZXXA 1UBEA 4DIFA 3LQFA 1N2GA 1D6NA 5A4JA 3KDPA 4I19A 1SKYB 1F0PA 3C1OA 3JVVA 2YWEA 4TXMA 2VP5A 1KRXA 1KGDA 4DADA 5T8KA 2GEUA 3NANA 2VH5R 2WAXA 3F6RA 2EARA 5A9SB 5JCPA 3DXYA 3W6PA 5JRZA 5LKRA 3STXA 5FWNA 1OH7A 4CIBA 3F9RA 3KELA 4TMXA 1F48A 5F7ZA 2WF5A 3OF3A 4D6XA 1G8MA 3C15C 5LC1A 3I9MA 4PRYA 4ISCA 4GZ3A 4WFJA 3KZMA 2BELA 3JRNA 1II0A 1KJQA 2EOAA 4L78A 3TW8A 3M34A 1J97A 2AOVA 6AT1A 3H18A 5DRTA 3KT6A 1OA0A 1S7GA 2Z9DA 4UOEA 1GPMA 2X1HA 5A3RA 4H77A 2JGMA 4DLKA 8LDHA 3OA0A 3U16A 5L3VA 2QVGA 1DV2A 4GI7A 1PWZA 1LBQA 4AZ0B 1CZHA 1K7FB 2E4UA 1ISJA 1QG6A 2P90A 4HZGA 5IM5A 2OLJA 2C2OA 3KSMA 3WYBA 3TL6A 1MDFA 2QYSA 2R6AA 1KEEA 3HGTA 3WZLA 3TD6A 1TK3A 1KS9A 3B82A 3PRJA 3T1VA 4M1TA 5FFFA 1Y1TA 3FDZB 4AD8A 1NW9B 3WGUA 4IF6A 2ZRNA 2D3WA 1T25A 4P22A 2WJGA 4OQLA 1LDYA 1OE0A 1TI7A 4LVUA 4BQQA 2ZITA 3EZFA 3H5AA 2GK6A 3O4VA 3QWHA 5AK0A 5IDVA 1ISIA 3O7MA 4BAZA 5J4VA 1BH2A 3NHAA 2AC7A 2VCYA 4HBZA 1JVSA 2QX4A 1YQQA 1U0BB 2OK8A 4BEBA 5LR6A 3NRJA 1YI8A 3W2FA 1ONBA 1YNSA 3IAS6 4K7JA 3SQWA 3AI2A 1KI3A 2Y77A 2LVBA 3L01A 3BSSA 4DV6B 2ZWOA 5ENZA 2WA1A 2RIRA 4PQYA 1AMNA 4FDLA 5K4AA 5DW3A 3QLTA 1R6UA 4QXQA 3OJXA 4GOXA 3V97A 4BFZA 4I1OA 2C92A 1JI0A 1FUYB 3TLMA 3WO1A 4KOEC 1XE3A 5AESA 2DG2A 1G5QA 3IULA 3Q7QA 4FE4A 4IGAA 5CB0A 3W2IA 5LA6F 1GNRA 2QL7A 2UYYA 3PNKA 1WUYA 1YKSA 2IL1A 2VA9A 4BV3A 3IUBA 1YVUA 3B38A 1HC7A 2PWBA 1NFFA 3NNDA 2CSUA 2O7NA 1UWKA 4QDZA 2RH5A 1UKBA 3A6HA 4UXHA 4EJSC 4OHPA 3UAVA 4BCDA 1IVYA 1I7QB 5BR1A 4OYHA 4ZP1A 1B0ZA 1SXJB 4RY0A 4LJ5A 1E2HA 2C2HA 4YVFA 1A5ZA 1C1XA 4BMVA 4D26A 2ADFA 4G8CA 3DFZA 4LDQA 4QTZA 2ON6A 4E31A 5JQWA 5K5EA 1H2AS 3EXHB 1LCIA 1QR6A 3CNQS 3SEFA 3G1UA 4F93B 2FPGB 3PBKA 1U1GA 2R97A 3QV1A 4U3JA 4UBKA 2QY9A 3TQRA 5J2UA 5EQJB 1YA6A 3IOBA 1Q7CA 3IBCA 1ILEA 5H0IA 2FUG1 3P9YA 3KYDA 4NE2A 2AQIA 3EDOA 1QH8A 3UJ7A 1FSZA 1ZM4A 1AQUA 4BBAA 2G0TA 5CFPA 1U5AA 3IHTA 1BMDA 2Z2XA 3G8YA 3LW7A 4U2FA 4JMLA 5IP5A 3ROTA 4FFSA 5EZQA 4DMRA 1NXPA 3P97A 2UYCA 2XB6A 1U0LA 3A9RA 3QKRA 4UEOA 3L1JA 5JHGB 5KWJA 4RNDB 3G2MA 3U0VA 4BNJA 3LDUA 1TRHA 3CIFA 1GUFA 1U63A 3UAZA 4JJ7A 4FFPA 5CH5A 4C4SA 3WHKA 5K4GA 3D4LA 4E33A 1FL9A 2ZIXB 5A06A 2XJ4A 1ML4A 1CSEE 3RVSA 5JD5A 3AVTA 3PHLA 1CF4A 4AYWA 1RI3A 2I4TA 1WCIB 2PX6A 3D0OA 1J5PA 4CMIB 2ZKLA 2C7PA 4AKGA 1AKRA 5DGTA 1FSSA 1Z0IA 2C0CA 2ZJAA 3NTLA 1L8OA 2Z3WA 4P81A 1EH5A 4QUDA 4EFNA 1KNXA 2B4TO 4PO9A 1EMDA 1VIDA 2DFNA 4ZVPA 1W47A 4NF2A 3GVHA 3NWEA 4LJ6A 4QO7A 3EWAA 3QOXA 2AFHE 2GZSA 5J40A 3ZWVA 4YCSA 2OV8A 4J29A 5KSWB 1DELA 5AM4A 5SZJA 4AL4A 1T15A 1JKXA 1W93A 1II8B 2ASEA 3ONVA 2AXPA 1F8UA 3GLVA 3NETA 4JI1B 4EB6B 3GMSA 3PNSA 4PSKA 2P30A 4XW2A 2YUTA 1SIOA 5I48A 4IW3B 3U4HA 3EFOB 4JWKA 1EUDB 2RK3A 4MV1A 5BSTA 1W19A 5ER6A 1R27A 2FF7A 3F6SA 3LC2O 4BFXA 1HMYA 2Y71A 3BWEA 3UGJA 2PGLA 1JECA 4RA6A 4L85A 4DJ5X 1O9BA 5DOVA 4GYYA 4OTZA 1SWVA 3VOTA 1RBYA 3ROPA 5AW1A 5JALA 3PVZA 1IXRC 4EHBA 3BMQB 4ZO4A 1ZH0A 4J4TA 1K7YA 3O91A 4R81A 3VR2D 1LPSA 4FKMA 5BW6B 4XX0B 5K3SA 5TPZD 4XYBA 3STYA 4KH1A 4QULA 2GBGA 3Q88A 4Q3NA 1DJQA 2BSAA 3P2EA 3KX2A 2QOEA 3RK4A 1WABA 3RK1A 4LDPA 2O7SA 1FXWA 3RC7A 4IS3A 1TXGA 4Y2JA 4F11A 5KNBH 1RIFA 1RM3A 3AJ9A 3NDPA 5ER9A 4YDSA 2D5LA 4MLCA 5EINA 3MWGA 3V4VB 4O1IA 4OQXA 1NG9A 1W35A 3FF1A 4ABYA 1NNUA 2QLNA 1WSBA 4A2WA 4QFMA 3NV9A 4GKBA 3Q85A 4PE5B 3B6KA 1NOIA 1NRWA 1KYVA 5JAQA 5D5HA 4AJLA 4HNHA 3TQOA 5JBIA 3DDWA 5J59A 1LBHA 4QGAA 2AX4A 4C0HA 4HV4A 2V4MA 2XNKA 1UXJA 4BLSA 1E18A 5FBVB 2WHYA 2RAPA 4S0ZA 5EFZA 4L1KA 1J0DA 4OQEA 5ES3A 1IY8A 4TV9A 4RHEA 1UBCA 2XQFA 4MUJA 1JFTA 4EYQA 2WSSA 4AP9A 2BRUA 1PAUA 2V8BA 3EGEA 1GZHB 1D6JA 3H1GA 3MB5A 3MINA 1WBDA 1FFGA 1XF1A 2H8GA 1SUFA 4J1TA 2AG5A 3FRJA 1SCQA 5K3AA 1ZOSA 2ZJOA 1ODFA 2RHJA 1R6AA 4LE2A 3C5VA 5CLFA 3P9NA 4QTYA 3IPAA 1CY6A 2GETA 4ZKDA 3AONB 1JHRA 4RH3A 2R7KA 2W6ID 2Y27A 1EK6A 1RKUA 1DP4A 2YOHA 3SHQA 3WB0A 3L07A 1RFGE 1VI5A 4K6KA 5FTWA 3WIOA 1NKVA 1RQRA 3EQ6A 4PG6A 4QU0A 3ILXA 5DHQA 1ZUNB 4UBMA 1JX6A 3RV4A 2PKWA 4AKIA 1E4EB 1S2MA 1LJ8A 3QF4B 1SFRA 2BGJA 5K3OA 2O2ZA 4I46A 4QDJA 4WLEA 1YFJA 2XZLA 4FD2A 5TGDA 1FU7A 2H4JA 4N5NA 4IPTA 1A4RA 5DCWA 1LPNA 2GHQA 2ZSHA 5EJMA 2OYRA 3KOOA 2IS2A 4QWWA 1FUKA 1VCNA 2OM2A 4P3XA 4GLJA 4PR0A 1H2BA 4M0PA 4LJ9A 5DGHA 3STHA 5TXGA 1IQPA 3IBFA 1KY5A 4OI0A 4HWRA 2FDRA 4YUVA 3W7AA 2C4HA 3IAAA 2FOXA 1HNNA 2Q1TA 3M5WA 1MQ9A 1MDBA 3AUSA 3U62A 1KIFA 2DX7A 2O0MA 4P80A 2H0RA 1P0FA 4LPKA 3S29A 2ZSBA 1W29A 2YL2A 3F5FA 2IPXA 3IDQA 3JRWA 2TRSB 3Q1LA 4NMXB 2XGMA 5G4KB 4OG2A 3ZVNA 4IH9A 1NJ8A 3P9IA 2I29A 1ECGA 4FFWA 3A9TA 3MIIA 3CF4A 3AJDA 1QYRA 3O0DA 2WJYA 3QA9A 1P9WA 1HUQA 3QX7A 3WYFA 1JDBB 4RMIA 2GCOB 4DYDA 4UAGA 4R7TA 4RTNA 4ZPJA 1AS0A 1HG0A 2O5VA 1DQYA 4RD6A 4YTEA 2GDZA 1BJRE 1AJEA 2WIKA 2WVGA 3WIBA 2Q28A 2X19A 4D4IA 1HWYA 2ECFA 3DCYA 5BVGB 4ARCA 4GUAA 2HUPA 2HUNA 4C3UA 4MB6A 4JDUA 4PSUA 4N3BA 5LJIA 1E1LA 5HJ5A 2P79A 1MU0A 5KU1A 1M33A 5MDHA 3RJZA 4QDOA 1ESZA 1LI7A 3ZCUA 2P3LA 3N2IA 2YRFA 4AIRA 1R4ZA 2IPAB 4NP6A 4F86A 3TZKA 1ZK1A 2GFHA 1MP0A 1AO3A 1WUHS 1H8HD 3BMCB 1UFKA 5NLLA 1NGSA 1F2UB 1T0UA 3LH5A 3TQHA 3OWHA 1JBQA 5AQEA 1CJVC 1Z0KA 3GR6A 1FUEA 2OVFA 3WRWA 2Z2KA 3OZXA 3I8SA 1HDIA 5G2OA 3MZ0A 3EUEA 4DRZA 1M2VB 5AJTA 3E4DA 3CH7A 5K0CA 1DBRA 4IXNA 2PUBA 2BI4A 3N75A 1F9AA 3UK1A 1V8BA 4J03A 3W5UA 1K3UB 3HLYA 4LI3X 3UFXB 5IYZB 1IN6A 3G9XA 1N6IA 3K5HA 1DKRA 2BT4A 1VE7A 2GM5A 2XZTA 4W7HA 1Y3BE 5BXQC 3WVNA 3GG9A 3K3PA 4XRRA 3K8QA 4UEKA 2A0YA 3SZ3A 5ADUS 1YS2X 1C9NA 2FI1A 1IYZA 4OHOA 1W44A 4G5HA 1H6AA 5CP8A 4DJDC 2Q5HA 3B60A 5ALFA 4WFQA 1R66A 1DO0A 1GPDG 1WPQA 3TZBA 1J5EB 1OIVA 5L6LB 3OX3A 5KDDA 1C9EA 3O4RA 1OYVA 1N6LA 2WTNA 5IBRA 1QGUA 3ANXA 4IIDA 1C8LA 2G1PA 3C3MA 3OTQA 1IUOA 1OZAA 4DC9A 1B23P 3AV0B 2WFMA 4JLSA 2BGWA 2BFEB 2LE0A 3RSOA 1Z6QA 4I3FA 2FEAA 2P9EA 2DWUA 4YRAA 1N2XA 2QSUA 5FWXA 4RLFA 4RXMA 3VKHA 2P6NA 2BGTA 4TMVA 3LCMA 3JQAD 1TPYA 1J90A 3LUDA 5F9FA 3FLAA 4R1TA 2QZ4A 4FHEA 3PEYA 1CU1A 4ROTA 3UAOA 4G84A 4F1WA 2UVQA 2BISA 3OPQA 3UFBA 4GL2A 4OHXA 1XMOB 1OBHA 2ATCA 5L51A 1GT91 4MV3A 3HA2A 1AKVA 1CKEA 3FWNA 3ISTA 4MICA 1WV0A 1QS0A 1T4MA 4PICA 1BJKA 1CRZA 1TTHA 4U39A 3DAGA 4XSGA 3BG5A 5LDDC 1R0SA 1RQLA 1FP2A 2OBFA 5JRJA 1GPAA 1JTEA 4FI3F 4TVOA 1JG2A 5ALIA 4AZWA 3AF6A 1AVTA 3DAFA 1SN7A 3UHPA 5BSFA 3EGVA 5GPBA 4EA6A 3SPXA 3FUCA 3OSUA 4JJIA 3ENQA 3EDCA 2NYUA 4ZEOA 2ODAA 2HREA 3M1IA 4CGYA 4CKZA 2DAPA 4FEEA 1ES9A 3E9NA 4KL8S 3KYIB 5DMHA 3HDGA 4AY4A 4B3SB 2N42A 4J1SA 3ZD6A 1VLQA 1XJCA 5LZ9A 3HTXA 3B20A 3W4JA 4DPMA 4S05A 1QVWA 3ZZMA 1CJTC 2F62A 1V43A 4ROSA 5EXTA 1KQGA 2BM9A 4YS6A 4LZWA 1M8KA 4PLVA 5FTMA 2ZT8A 3TRKA 2B7BA 3M81A 1X13A 4B2YA 4C21A 2BDUA 3PFIA 5LBTA 3QMMA 1N92A 2F1KA 1K7EB 3GLHA 5E6SB 5HE9A 4ZDJA 3T7IA 1MAVA 4NULA 1YJXA 2FN8A 3TYXA 2Y0BA 4HLNA 1E3DA 4R2XA 1H85A 2G17A 3EDMA 1TE2A 1HDGO 5ETJA 7ADHA 3FVQA 3TLEA 2D1TA 2EKPA 5BMOA 4F6CA 3D7SA 4KLAA 4P7KA 3AWDA 3GFRA 2IEGA 2PXAA 5ABPA 4N54A 3DL2A 1L4NA 4UFPA 2FPPA 2I7CA 3PL5A 4JLBA 2YZKA 3ETCA 4QBTA 5DTRA 1KQ3A 3QFRA 5UKDA 2ZVPX 2PIDA 1D1TA 2XODA 3GLSA 2EFYA 4BN4A 5CXQA 3PE4A 4FFLA 1DKPA 3GWGA 3HR7A 1G7CA 4GPIB 3I37X 3P5BA 5JEDA 4QNNA 3L4EA 4EAAA 2IX3A 3FZYA 4Q18A 2KYRA 5KYUA 4D2IA 3SSNA 1FDRA 5LM3A 1S01A 4A0HA 3P7MA 5GJWC 1SHZA 3U44A 1M1NA 2WD7B 3KVRA 4N3GA 4TL7A 5GV8A 4JX9A 2XGOA 1A9PA 1YZVA 2WAAA 3A31A 3GRPA 2IODA 4F2GA 4P0QB 2H4XA 3AF2A 3J7AC 5FORA 3UYLA 3RRJA 1NVEA 4KKVA 4XM2A 3WRVA 2JAUA 3KKOA 3PUJA 3HS3A 1JIVA 1R10A 2VAMA 5CIYA 3Q8LA 1N5KA 1BN7A 2G6TA 2FSHA 4FJ2A 4WY5A 3OHMA 3M5PA 3PC8C 3EVEA 3R41A 1OH5A 3MD0A 2JCBA 3OLYA 2VXOA 3C39A 2WC1A 4PEVA 2QEQA 3WSTA 4GVPA 3O2QB 4B4KA 4YUXA 1NW8A 2QD4A 3BFJA 3M9WA 3R7SA 2A0XA 2I3ZA 3KYCB 1XA3A 1TVMA 2FZWA 3NFYA 1V47A 4I4CA 4MVJG 3TXXA 1XEXA 2I6FA 4REQA 3UY4A 5KINB 2H59A 1UK8A 5L3SA 4RH0A 3TE6A 4ENPA 4JXKA 2M6LA 2NTVA 4FZ3A 4HQ0A 1M0TA 1EJBA 2BL4A 2XDQB 3IAS1 1I01A 5J5CA 4EA7A 5CA0B 2H1VA 1ST3A 2I4MA 3O6VA 4OBBA 5DI3B 2B83A 2R5FA 3DG9A 2HSJA 5LXTF 1Z3IX 3DF9A 1VE9A 4B6JA 2CCKA 3GJ4A 2CCJA 3HL4A 1VCMA 1RC8A 4CCYA 4WZAA 4XGKA 4GSKA 3BTSA 2AGVA 2C0QA 3ETJA 1CUIA 1NHWA 1VB5A 3KXDA 5BMVA 3DPIA 3GY0A 2B6NA 5H9VA 1J2UA 2VC2B 3WMFA 1MOZA 1NDHA 2VBFA 5J3JA 1XK7A 5KVVA 1RMQA 1ONSA 2PLNA 2IPLA 3X44A 3EG9A 4Q05A 1DEAA 3PGMA 1W94A 3DNFA 4B0OA 3V4FA 4J1NA 4M0EA 1QG0A 1V5IA 1Y4SA 3M70A 3L18A 2G5CA 2XYVA 2RHTA 2VHTA 1PK7A 3TTWA 2R68A 3VNUA 1HK7A 3GO4A 2Q1XA 3HH8A 3LPMA 2VPPA 4DNQA 3AU8A 3GBVA 4ZREA 1SK9A 1UL1X 2C3OA 5JNTA 2WJ3A 5KJ1A 2Z83A 2BZGA 4N3CA 3C7CB 4JQYA 3LF2A 5ALVA 2QRZA 1J06A 4URUR 1ITZA 3B1XA 3U1BA 4D44A 5EOVA 2H4HA 3C8HA 4ZOAA 2WZQA 1PNTA 3ZDDA 2QTNA 2X7XA 4PX2A 1L6RA 4ZI2A 5DNDA 4AS2A 1YACA 2DYKA 2WIFA 1GOTA 3IILA 3WXMA 1I3LA 4AMGA 1WD7A 4KMOA 3ABZA 1I3OA 5BWBA 1JB9A 1GYPA 3DTTA 3S1SA 4ABTA 4II2A 2DHQA 3U7QB 1P6QA 3OD5A 4YR7A 2VAVA 4Z5XA 3Q3JB 3K09A 3A8TA 3V7FA 5IU6A 2K6GA 1Q1NA 4GYWA 2NU8B 3GNQA 3RK0A 3CG4A 1HXHA 3PI7A 5IC6A 2RIPA 1D0SA 3PEFA 4GOJA 4RVNA 1KDZA 1UJNA 2LRHA 2OCDA 2QVZX 4EYKA 1LXCA 1P7ZA 2I03A 2QVCA 1QFXA 3CUVA 1NLYA 1LU9A 2AJDA 2IHKA 4NATA 1E6KA 3T4UA 3IOCA 1NVDA 1Y8RB 1TTQB 1NZJA 2EJTA 2R84A 3SVLA 2LW7A 3HYLA 1Q1QA 3OP4A 4YJKA 1N2BA 2DFLA 2F1RA 1HDYA 1HQDA 2QRPA 3Q10A 5ITZB 3QU7A 2WA2A 3W2HA 2WV7A 3U4CA 3I73A 4YV1A 2EBWA 1NUUA 1PF7E 1K5DA 5DYYA 5KTSA 1BKSB 1CCWA 1VPVA 3ZWQA 4F9GA 1L5RA 5CURA 4I0WB 1X7YB 3REQA 1FVOA 4IX1A 5ADWA 1FLVA 2EBFX 5G3YA 1G21E 4RVFA 2C2YA 3AB7A 4MX8A 5FOWA 2INGX 2GBCA 2RE8A 2IZ6A 3ZOKA 5HKLA 3FPHA 2VK1A 2ZTMA 5JDCC 4D4GA 3KSRA 1VL2A 3Q11A 4Z51A 4ER3A 2O2YA 4YA6A 1Y1SA 3ZKWA 2QN2A 1Z5VA 2DH5A 4NEGA 3V6LA 1E1CB 3VR5H 1ZU4A 1UODA 3Q3IA 4I4TF 5EKUA 2DLCX 2XWBF 4C03A 3R3VA 1KK0A 4U9HS 3SC4A 4C22A 3I32A 1CRPA 1T6NA 2BKUA 4LWOA 4C0XA 3HABA 4OXQA 3OZTA 4DLYA 4CQNA 2I99A 3HFJA 4Y1EA 1CIJA 2RGDA 1EZ4A 2FSIA 1Z88A 4OU4A 3TGWA 3C70A 3F3YA 4FGZA 3LCVB 1TQ4A 1WEKA 1Y3HA 4BWYA 4CJXA 1D2EA 1JMYA 1M8FA 2D5IA 1E3SA 1OWPA 1J8DA 1ORVA 3NHUA 2QY6A 1UK6A 3CS3A 5FTLA 3I2HA 4HH1A 2JLYA 3LXMA 5B7GA 1C7IA 5EJ7A 3VQTA 4M0FA 5HE8A 3NTQA 1UMDA 1A8HA 4WEOA 2KPOA 1Z39A 2XKBA 5GM1A 1F8XA 1DPGA 2JAPA 2IU4A 3E3LA 3LYHA 4G63A 2I87A 3ZCRA 1IOVA 2WJJA 5DNYB 1YOVB 2B3TA 2VJCA 1GA6A 3TSYA 4OMUA 3EAFA 3OOYA 4A2PA 4F4FA 1UXOA 1TAUA 3HXTA 2JFFA 2M98A 1YOBA 1RHJA 2PMDA 2UZ0A 2PU7A 3N2KB 2WLSA 1MB2A 5LQMA 1GCAA 4K88A 3F90A 5JUWA 3ZWOA 1G0NA 1SU8A 1WIWA 4MRPA 1YRBA 1DDGA 1ZK2A 3LZDA 3O4GA 1BWSA 1HLFA 2WJ4A 4TLDA 4NK5A 3V4ZA 1IK6A 1CB0A 2HK8A 1XMPA 3CF6R 3EW9A 5F2EA 1C7RA 4ZVLA 4GZMA 4BWGA 2H54A 1P9NA 2AUNA 1AKWA 1NATA 3QE2A 4FFVA 4WA7A 5F4ZA 4UATA 4DLXA 4ZEVA 1BE0A 3CH4B 2R2GA 3K0SA 4W5JA 1M5UA 5JTTA 1AHHA 2GD1O 1CDOA 5IJZA 4KAAA 1EG7A 3L0IB 1XDBA 4O4LF 2GCNA 1YRHA 2EFDB 4KQIA 1QQ7A 4QLAA 1US8B 3F73A 1R0RE 4DY4A 1J8MF 2GARA 1DBQA 2FWJA 3IXQA 3A0UA 2VNIA 1GKUB 2YZNA 5HGJA 1Q7EA 5LZ7A 1H0RA 5IWAB 3BWDD 3NM6B 4BQFA 5EXDA 3OOJA 5E8RA 4X1IA 2Z8ZA 3B6IA 1OBOA 3MA0A 4E12A 3D7RA 1CZUA 2EFHB 5A4KA 3K2EA 5F7OA 2FPXA 4KITB 1S0UA 3ET5A 3UAWA 3KPWA 4HAUA 3ILSA 4C7MA 4B3RB 2XRFA 4WPGA 4P92A 2WF9A 1IU9A 1VXRA 5ALJA 5C2JB 1AK9A 2EAUA 3SSOA 5JS8A 5KZMB 2EGHA 4MRSA 3MJFA 4BLOA 1ZNQO 2WF7A 3KOWA 1LRJA 5C5CA 4BCBA 4AZ0A 4PLCA 1B0UA 1EHIA 4AM8A 2OLEA 4Q9HA 1TQHA 1FK8A 2P6MA 3UMMA 3GXOA 3JSXA 1IM2A 5IAGA 2PPLA 3C7DB 4JKYA 4DABA 4Z7JA 1IHYA 4ZI7B 2ODWA 3JD2A 4DBZA 1CVIA 3CZ5A 5EP2A 3FDZA 1Z4NA 2IYXA 3L7YA 3VR4H 2BZ0A 2QM8A 1JH8A 4PCAA 1WZCA 1GPKA 1QO0A 3KKMA 5LBUA 1KVSA 2MYPA 1SGWA 1G6KA 3PQEA 1E4OA 3MGCA 3OO0A 4OLJA 3RBZA 3REGA 4CM9D 2J33A 4IH1A 3ZS8A 2O8DA 2OXRA 2PLWA 2QTTA 4IV0A 3GH1A 3R77A 1FVFA 3C3WA 4L16A 4QBKA 4GWGA 3VR6H 4J0KA 5GIPE 2VHCA 4UZFA 2EZ9A 1ZNYA 2P2YA 2N46A 1P7WA 1E1RA 3P0FA 1P74A 2FWBA 2JGFA 1NR7A 4R0VA 5BNFA 1SH7A 1S2IA 1P29A 1POXA 5ELXA 1P9RA 1R6DA 4QQFA 4XLZA 2EW8A 3IOYA 1LNZA 2W2QA 3EVTA 2PA0A 4HF7A 2PCJA 5L6MB 2DETA 1Q3KA 5LOVF 1MZPA 2RGYA 4G8DA 4FR2A 1CHDA 4WINA 5BUQA 1I3NA 2B6HA 3FNGA 4LX0A 4IMJB 1PNQA 4GIBA 2O2DA 3EFBA 3GLFB 1Z07A 2ZTSA 4X0EA 3VYVA 2V9ZA 2CLLB 3B48A 1P45A 2YZ7A 4LN1A 3N8NA 5ALUA 1ENZA 3OCVA 2VNSA 4CCWA 4ZDKA 1PLLA 4DQKA 2ID4A 3MMZA 4BGIA 3RRZA 3BHNA 1MG0A 1PJ4A 1G8PA 1SXJA 2B8NA 5HEKA 4D4HA 5IKEA 2C4MA 3GK3A 4NZMA 3EUFA 5E2IA 3X1WA 4DCTA 3AHIA 3IEUA 2YN4A 4IYRA 4L07A 3LD9A 2H52A 4XB1A 3EXHA 2WMYA 3BD7A 3LLSA 2FPGA 1MOSA 3NT2A 2UUCB 4C20A 2AVNA 4WFKA 2WNHA 3G0BA 5GGXA 1YBHA 1ISHA 2PLAA 2XNDA 2ZYVX 2BR4A 5ESDA 1I51A 4Q6BA 3U80A 1QZTA 2OGTA 3DL0A 4M1KA 2J5XA 2LDXA 3FCSB 2Q3CA 3EEOA 3EIUA 4LDAA 2W42A 3MERA 4IHJB 3VDMA 4ZMRA 4MQ4A 4MVYA 3IALA 1GLVA 4GX2A 3T54A 1WUJS 4X00A 3TRFA 5KWVA 1NI5A 1UPTA 1PV2A 1SG6A 2MHCA 3CSSA 4HDNB 3EZXA 3QMWA 4Y6RA 1B7GO 2OESA 2OQVA 4BX9A 2EJUA 3VDNB 1TD1A 4IVPA 2ZIXA 4UD6A 4CLOB 2ERXA 4INPA 4Y7CA 4M98A 2OK7A 4DPKA 3V33A 1OXXK 4FSXA 3NBZC 4HX5A 4BNTA 5G0TA 1GGMA 1N0HA 1RQPA 2A3RA 2DUMA 4NV0A 4JCOA 5EXPA 3WQHA 1XBTA 3A28A 4PSAA 4MEJA 5EUMA 1YMUA 5K2OA 2OOKA 4Y9SA 3F1LA 4ALKA 4JJ6A 4CMGA 2QUAA 1AGPA 1R6VA 1AUVA 1BE8A 1JLMA 2WYIA 1B00A 2JF0A 4QYIA 3R3SA 3NZEA 5C8YF 3DMDA 5IW8A 1FTYA 9ABPA 5LWQA 3I01M 1B73A 1II8A 3DVLA 1PK8A 4P38A 4EO9A 8AT1A 4MUGA 9LDTA 4XOIA 3CX6A 4DR4B 4HDAA 2IEDA 3I9V1 3F5QA 4XJSA 2XDAA 4O8CA 1FA9A 1QONA 3UATA 1NXSA 3T5AA 5JU6A 1M7BA 3EFOA 1TK2A 1EUDA 1QFYA 3DE5X 3GX1A 4MJ3A 4MUHA 3GLGA 3W6ZA 1BIFA 1K6IA 1VP3A 4Q1DA 4GKVA 1PV1A 5A03A 3KFXA 2F1IA 5AMXA 5EIEA 1VBFA 4GX0A 1NRXA 4CFSA 1H3NA 2O07A 2H51A 4U7HA 3WV5A 2IOQA 2PV0A 4DR7B 4ZYLA 3BMQA 1QBKC 1ESEA 2QRNA 2DPMA 1X94A 1IXKA 3R76A 3ADDA 1XKTA 3C1UA 1XI2A 1G8KA 3KT3A 4XX0A 4ITUA 1YBMA 4CM7A 1X86B 4Y2HA 2BZSA 2HLDA 4HEQA 3RVNA 4AN4A 3BGSA 4IV8A 4J9UE 3CJRA 4L8YA 2GASA 4QQRA 1A71A 3CLUC 4RPHA 1FQJA 4OJQA 3K96A 1GRCA 4C0KA 3K9CA 4HJRA 1C29B 1Z62A 3EQ2A 1U0RA 4K6GA 2A57A 4LYJA 1JDBC 1EA7A 4N0PA 3VM6A 1DVRA 2GMWA 1LRKA 3B53X 1E9CA 2Z56A 1DIHA 3CLSC 3GJ5A 4M1WA 4K46A 5IABA 2R86A 1R6TA 2GRAA 2ZBUA 2AX3A 2CVFA 2YIJA 1H22A 2Z0MA 1OKKD 3LP6A 3N6XA 1XVVA 4R05A 4ZGBA 1HYHA 4ZKEA 3WZ2A 4DT1B 1LPBB 4EF6A 5I7OA 1XTRA 2R11A 3VZPA