2BKUA

Kap95p:rangtp complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for Nuclear Import Complex Dissociation by Rangtp
pubmed doi rcsb
source organism Canis familiaris
molecule tags Nuclear transport
total genus 47
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bkuA00
4BGDA 3K09C 3P4XA 1P3JA 1AGPA 1CXZA 3THYA 2AWOA 2RGCA 5CLQA 3T61A 1Q3TA 3SJCA 4PR0A 1DOAA 3B1WA 3W9YA 3AVVA 3VKGA 1W2HA 1A1VA 2O52A 4QJ5A 3IIMA 1KJZA 1EX7A 2O8EA 2AHOA 1Z0JA 3CWQA 3SQWA 2ZJOA 4YMSA 3SBDA 5C4GB 2LWIA 3ADKA 2J5XA 3OFND 1HY3A 1BOFA 2A2ZA 2FE4A 2QQ0A 3IDQA 4NYMQ 1KSGA 2CNWA 3GJ4A 3BFXA 3DZ8A 4TLDA 2V3CC 2W6ID 2GZAA 4XOIA 2QORA 4TQUS 4GNKA 4HB0A 4BLQA 3CB4A 2FSIA 1YZLA 2IA5A 3FDIA 2H5EA 3VR3A 4LBYA 5SZIA 2XNDA 1NIPA 1DADA 1P61B 1HV8A 2GETA 3EWAA 1JB1A 3FKSD 3AVPA 1Z3IX 2DWOA 2BMEA 3T5GA 4KI0A 4IVQA 2CHQA 5CYPA 1TQ2A 2ZRDA 5AUQA 1RC8A 1HQCA 2OFWA 2OLKA 1XCPA 1P60A 3T1TA 1LFDB 2AFHE 1SVLA 3ZVNA 1FMJA 1GNPA 3NH6A 2BBTA 3SBEA 5LB4A 5AR1A 3X1ZA 4PC1A 2AD5A 5KSZA 2JIZD 2ZVPX 3P26A 4NYIR 1AZSC 2J7KA 4QGGA 2Q6TA 1TQ4A 4F92B 4PQFA 1CKEA 3A4MA 4RKEA 5HCNA 1G8FA 4JLPA 4CT4B 2OBMA 1VECA 1AS0A 4DLWA 4LX0A 3A1UA 3QIAA 2GVDC 1E6CA 3WYFA 4HAYA 5E7IA 4LJYA 5JWHA 3ZIAA 2IYSA 2XXAA 4QHYA 1VCMA 1E0KA 2QQEA 2XOKA 2XB2A 4IJMA 4OQFA 1E9BA 4IRUB 5KUTA 4PHTA 2ZRPA 3CLVA 3NHAA 3HDTA 2J59A 4DT1A 2QRZA 3TRFA 4LC0A 721PA 4ZCMA 2WJHA 3D6TB 3I32A 3DOFA 2J41A 3RC3A 2WICA 4AKHA 2ONJA 4WAUA 2P5TB 4NCJA 1R0WA 1MKYA 1HH4A 1W4RA 1OB5A 1F2UA 4BZPA 3BD9A 5DN6A 2WKRA 4TYPA 3KXIA 2JASA 1U8ZA 3GLHA 2I3BA 3OIWA 2D06A 2JA1A 3Q7PA 1XMSA 3DKVA 4ZKEA 1NBME 4A0FA 2WHXA 1SXJA 1U9IA 2RGNC 2GEVA 3ADCA 2PCLA 3X1DA 2QTHA 4YXWA 1A7JA 1M8PA 1Z6YA 4UXJA 3TUZC 2BCJQ 1G8YA 2ZRKA 5JMTA 4AC9A 2B8TA 4DB2A 3FKQA 3BB1A 4JSYA 3ZVLA 2N46A 3AP3A 3LAWA 4Q21A 5K8IA 4MRVA 3KJIA 4Q1DA 4B71A 3Q85A 2RGBA 1CBUA 3VKHA 3AVWA 1X6VA 1II8B 5AK0A 1XNJA 1BYIA 3SDZA 2G0NA 2PJZA 3TIFA 1CEEA 3BAFA 1TTTA 1GKIA 2ZJ8A 1AS2A 3KQHA 2GXUA 4XWOA 5EP3A 2OCBA 3Q8XB 2WWWA 3TR0A 4WZBE 3FHTA 1D5CA 5CIWA 1QF9A 4B2IA 1OFUX 1Z6XA 1KK1A 2CK3D 1DAHA 4A6PA 1NN3A 3W6NA 4URXR 4M21A 1TMKA 2F1HA 4V0ME 1E3MA 1E2LA 5EJEA 1KK2A 3FOZA 2FPLA 5E7MA 2WAYA 2WJVA 3LXRA 1DAKA 2ZSFA 3X1XA 4DB4A 1NVWQ 3W8RA 2WSMA 4GDFA 5KDDA 5FOTA 2QM8A 2HV8A 1EESA 2V54A 4KCGA 2WAXA 2FZ4A 1E0AA 3F3YA 3GPLA 2Q9CA 3N5CA 5E3HA 1DG3A 3IUYA 2IUSA 1KZGB 1AQYA 2WPDA 2AXPA 4URUR 2QTFA 1IOZA 5LDDC 3G82C 3D8BA 3R9IA 1JEDA 4ACBA 3K0EA 2YOHA 4YMUA 3LRPA 2ZXUA 4RFSA 5FBWB 4JLMA 4HDQB 3A6PC 4LUCA 1R8SA 2GRJA 5AJYA 4CEIB 2V55B 3BE4A 1YZTA 2ZTSA 2IK8A 1SVOA 4BFUA 2IYVA 3D7MA 4JLBA 2VP6A 1JR3A 4LJ5A 2OAQ1 4V02A 3TH5A 1KY2A 2A9KA 2YVUA 3CF2A 2OCYC 4TMXA 1W5SA 4MITA 4B33A 2QROA 4JVSB 1L8QA 3DMNA 3ECCA 1RJ9A 1UKEA 4DHEA 5JJKA 1QRAA 1IXRC 4TSFA 2WSSA 3ASZA 5EXPA 3TMKA 2BEKA 4LV8B 5HPYB 1ZC3A 4DC9A 1VIYA 2ORIA 3L0IB 3MWLA 1QHNA 2Z4RA 1D6JA 3MMPA 1E2PA 1OE0A 2OEPA 4M1KA 4Q4LA 3LX5A 4URVR 1V5WA 3KB1A 1VKJA 4PAQA 1D9XA 1G5PA 4UJ5A 4P4UA 4C0JA 2G1JA 4N1AA 5DNYB 2FGJA 3K0FA 4B34A 2CL7X 1G7RA 1TUEA 1GRNA 1P2UA 1DEKA 1Q57A 4WXPA 1ZM7A 4XWKA 3KQKA 1M2OB 4KJZA 4LCBA 3VR2A 2EFCB 2IS2A 1K5DA 4KFRA 2FEOA 3PUWA 5HR5A 1NN5A 2P5SA 3A37A 3FWYA 5JRJA 1UEJA 2VA8A 1AN0A 3CH4B 4PPQA 3GJ3A 4RZ3A 4DCNA 5JJIA 1SVMA 2GDJA 3PUZA 4Z8YA 3TAHA 5JZVA 1QHHB 2CMKA 3CPJB 1Z6TA 4Z54A 5EZ6B 4B3CA 4IEEA 3A8TA 1OYYA 4PC7A 4XD7D 4ZCIA 4CGZA 4FCVA 3SZRA 1QHXA 4EPRA 5CJPA 5TXGA 3VNUA 1W4CA 2IXGA 3L43A 4AG6A 3QSYA 1NLFA 3MLEA 4BFXA 2HLDA 2Q21A 1XTIA 4RSGA 4KLZA 1R0XA 4JYCA 2R44A 3AEZA 5J4VA 2PX3A 3AF2A 2OCPA 4Q1CA 3NBZC 2ZEJA 1E32A 2EFDB 1KO8A 3QPWA 4BEJA 4MRRA 3KUDA 5A5GA 3FE2A 2DYKA 4CEJB 5FL7A 5GJWC 2IYQA 4RCZA 4ON9A 1RZ3A 4H1UA 1TQ6A 1ZVQA 4NDZA 2H16A 4JLDA 221PA 4US0R 4HLDA 2F55A 3GJ0A 2VTKA 1NMZA 2RCNA 5L3RA 3KKMA 4RZXA 1W0JA 4GP6A 5EZ5A 5EXTA 1F48A 2UVQA 2QEQA 3CPHA 2D7DA 1ZM2A 3ZZTA 1P4SA 2ZREA 3OF5A 3THWB 1JR3E 4ITRC 1FUKA 4GBMA 1XD2A 2FSGA 1UDWA 2FSFA 2QMUA 3EPLA 4FMDF 1Z83A 1CRPA 3AP1A 4LBVA 3EAQA 1G3RA 2Z0MA 1Z6GA 3GP8A 3CR8A 1YZKA 621PA 1TUIA 4MKHA 4IDNA 1J7KA 2IL1A 4D25A 2NOAA 4MRSA 2D62A 2ZJBA 2OM2A 3NC1C 4XVQA 1WB9A 4D4JA 3AUXA 4ZIRA 3GJ7A 1LV7A 4BASA 3QXHA 2G0TA 4EPXA 1KI2A 2KBEA 2ZRJA 3GLIA 1PLLA 3BORA 4JZKA 1EXMA 8OHMA 1EWRA 1Z08A 3VHXA 4Q7JB 1E1QA 4C0BA 5FBVB 1HQYE 3MUFA 2MMCA 4KHZA 4AURA 3SYKA 1G64A 4TL9A 2B7BA 4BLPA 4OHXA 4HDCA 3T34A 2NO1A 1PJRA 2GKSA 4RD0A 1XP8A 1DAMA 1QHSA 2FU5C 3TNFA 4TZ0A 5EQTA 2KB0A 5DI3A 5KYKA 4PZLA 5ANRB 2ZE5A 3ND9A 2XNSA 1N0WA 5TDHA 5G40A 2BOVA 4PXAA 5L8VA 1AKYA 1BO6A 2ZM5A 4GOJA 1GNQA 1ZAKA 4CRWB 3OAAA 4Q48A 5J4YA 5LPNA 1RKBA 3GLFE 3UKDA 2VP0A 4GZLA 1BIFA 1Q44A 4FMCF 4FI3C 1RRCA 1BMFA 1A5TA 4ESHA 1E9DA 3HPQA 1NSTA 5KOYA 3NEYA 1X3SA 4NH0A 2JAQA 4GSYA 3IILA 3GLGE 4LYFA 1XJQA 4KITB 3UXMA 2RGNA 3MD0A 1ZUHA 4Q66C 1NVVQ 1JJVA 2J0QA 2FPMA 5AJZA 2O5VA 5EE0A 4QNRA 2NQ2C 4KLNA 5L3QB 2F9MA 1G18A 4AD8A 1XEFA 3SFZA 4BFWA 2NIPA 1DPFA 1MO3A 2JLWA 1RW4A 3KDSE 1W0KD 2QY9A 3UG6A 3K9HA 4EKDA 1OJLA 3CX7A 1VHTA 3ND8A 1VYTA 1H65A 1GRQA 2ZRNA 1U0HC 4IDQA 2C04A 2Y8EA 1P9WA 3AP2A 4KBGA 4OYHA 3AH8A 2NPFA 5AJXA 2GEUA 1GIAA 1YRAA 2Q3MA 1ZNXA 2Z83A 3I73A 3LBNA 4G0NA 4C9BA 4DZZA 3ZD7A 2ZRHA 4TTRA 1XXHB 1G6HA 4Q9HA 5KDLA 3UANA 2V1XA 1J70A 4PANA 1KY3A 2WMNB 3B1XA 2AK2A 2IYLD 1SKYB 4PHGA 1G20E 1L2TA 4OHWA 1W5TA 2WMOB 1JBKA 4A92A 4QBHA 3UG7A 1KDOA 4MKIA 2HDNB 5EUMA 1IN7A 3J81k 1TU3A 1QBKC 1WCV1 1BKDR 3SHWA 1EGAA 2GBLC 4KVAA 3SE0A 4A0RA 1KTVA 3W34A 3B7GA 3CRW1 4M0LA 1T3LA 4OJQA 2EW1A 4BPBA 4FCTA 4KAXA 3FHOA 5L3VA 2IC5A 1E4VA 1EFRD 1KKMA 3U4QB 4RJLA 3QE0A 4GT1A 1E9CA 1M34E 4UJ3A 3CNLA 5JSZB 1XB2A 4A2QA 1Z07A 4I1OA 1E9RA 4A1FA 1S4QA 2REBA 1CJUC 2FMXA 3QEJA 1LY1A 1VMAA 2ORVA 2VHTA 4BFYA 3BB3A 1NMXA 1NF3A 2HF9A 3RS7A 2V6IA 1P2TA 1ZM4A 3TLXA 2YWGA 4W5WA 4ESVA 1KOFA 3K9GA 3KX2A 1OHHA 1KDRA 2JDID 3OHMA 1A2KC 5JHHB 2Q0HA 4D4MA 1NY5A 1A2BA 4A8JA 4JLOA 3BC1A 1P7CA 1T3HA 4LHZA 3QENA 4V0KA 2OFOA 3QKTA 1VCIA 4MYHA 3L8YA 4P33A 2AXNA 2W6JA 4C0KA 1NNEA 4EQ6B 3HYTA 2F1IA 2XZOA 3SQXA 2VSFA 1E2DA 2GF9A 1PVOA 2IXFA 1NL3A 4TL7A 2QPAA 2QBYB 3RYTC 2IXEA 5FOUA 1KI9A 4M1MA 4IXNA 1VCNA 5LBIA 2ZRFA 1KO4A 2ZYWX 3PQCA 2A7QA 1N6RA 2R6AA 1FL9A 1F3OA 3V4RA 3RHFA 3L82B 2J7PA 4C4PA 1R5BA 2ZUCA 2RAPA 3DL0A 3OESA 1RVDA 2CVFA 4P3YA 1IY0A 4R7ZA 3GLFB 2PT7A 1TF7A 1JEEA 3ZGXA 2MMGA 1JJ7A 1II8A 3AKCA 1G7CA 3RWOA 1CU1A 4B3XA 3ASYA 3QKUA 1E9FA 1NKTA 2QAGB 3LNCA 2Q3HA 4ERNA 4ACAA 4M1SA 4R2HA 1P9RA 4QGAA 4B3GA 2ZS7A 4DCTA 4JL5A 2JGNA 4OHYA 1N6OA 3PEUA 2QPOA 4PFSA 3ONWA 1GTVA 2BDTA 4AWXA 2IYWA 4S35A 2ZSDA 2QM7A 4PQRA 1ZD1A 5IK2A 4TLEA 3T12A 4Q1AA 4C0HA 1J8YF 3U3MA 1KO5A 3CWZA 1YRBA 1D2MA 1VCOA 3BGWA 3TBKA 1H8HD 3KKNA 1JAIA 2JJ1A 2NO0A 3HU1A 1OXUA 4DCSA 4TMWA 1ZMXA 2BJWA 3LW7A 4BFTA 1YZUA 1NN1A 1YR9A 2FFQA 1OIVA 3AF0A 1A4RA 3RABA 2ZRAA 1EWQA 4TTPA 5KSYA 1T5LA 2ZYVX 5HKKA 3ICQB 3JZMA 1ZUIA 2FZLA 3DKPA 1T0JB 4MH0R 1GAJA 4MKGA 1DS6A 4U02A 521PA 3GEHA 2IYXA 1R6BX 4GPTA 1PV4A 1E4YA 5DI9A 1QDEA 4IVPA 1W36D 4CEIA 3C16C 4ARZA 1ZBDA 1G7SA 5F98A 1XJCA 4A6XA 1Z29A 1N3BA 3ETLA 3IBYA 2R6FA 1KNQA 1H8ED 1XTJA 2YWEA 3DPUA 4WZ6A 2G6BA 4O3MA 2ZJ5A 2QGZA 1W47A 5P21A 3RRZA 2CLDX 2ZUBA 2P67A 1N5KA 3U6KA 1IM2A 3AF4A 4GOXA 4C3ZA 3LA6A 2B7CA 3M0EA 3KUCA 2OUKA 4NE2A 1G3UA 1JPNA 3P4YA 3I61A 2ZI5A 4K8OA 1YVDA 2GEDA 1YR6A 3U7FB 2CCGA 4TQ9A 421PA 5CM9C 1KHTA 1XCGB 3FB4A 3U3KA 4Z1MD 2IF0A 4LYHA 3B78A 1NVXQ 4HAVA 1KSHA 1VG0B 2IYUA 2NGRA 2BMFA 4G5SA 4MA4A 3UMFA 1ZIPA 4JL8A 5DGXA 1CS4C 2GJ8A 3CRVA 4Q1BA 2YWHA 3QKSB 4O0MA 1U8AA 4YC7A 2QAGC 3AKDA 1TEVA 2C77A 2QZ4A 1U94A 2OSBA 3IO5A 2G77B 1GVNB 2PCJA 1P73A 2X2EA 1NBMA 2PH1A 1LF0A 3NH9A 1E2MA 1HT2E 1QHHA 4TT3A 5JFGA 2IHYA 5GVSA 4QRHA 5AUOB 1DG1G 4HUTA 2YKGA 1CJKC 3EW9A 1G5RA 5G3YA 4ZI2A 3FFBA 3LVQE 2EFEB 1GILA 4FINA 3PXGA 4B44A 2YC2C 1W49A 4LHVA 4P32A 4EJSB 4CF7A 1G6OA 1VHLA 3BWDD 1J2JA 2Z6VA 3LWNA 2VEDA 4A36A 3QXXA 1B23P 1M6NA 3UK6A 4KU4A 1YZQA 2HYIC 1EFUA 2QP9X 1GL6A 2C9CA 1FQKA 1HA3A 2Z4SA 4ZPXA 5JHGB 5ELXA 4JVLA 1C1YA 1SKQA 4JT2A 5JI3E 2BKEA 2ODWA 4CEJA 4H9GA 2HF8A 3RSOA 5FTNA 1ZC4A 1M7BA 2PLRA 1S8FA 3PENA 1SGWA 5C4MA 3T15A 4C0QC 2QSZA 3BOSA 4M9ZA 2QA5A 3CH5A 3PV0A 4V0MA 3EASA 2XTNA 1C9KA 4PO1A 2OV2A 1E94E 1NP6A 2JLUA 3K8YA 3BH7A 2K5UA 2WWXA 2CEAA 4I4LA 2ZRMA 2UZ3A 1ZU5A 2ERXA 3SR0A 3HR7A 3QPVA 3QG5A 1Y3AA 2BCGY 5CJ2A 4OQXA 4E03A 2CLSA 2ZI7A 1NVUQ 2GTPA 3EZ2A 3B85A 3A4NA 5JS7A 1XEWY 2B21A 2D7CA 3DZDA 3PG5A 3LLMA 1EFHA 2ZI6A 4ASUA 2CLCX 1ZP6A 3GJXC 1S96A 5JS8A 3H2YA 1G4AE 1ZM3A 4Q18A 5B58C 3A4LA 4K46A 3X2SA 3SYNA 3VFDA 4QL3A 2XZPA 4M9SA 4AKIA 4QHSA 1XMIA 4Q00A 3QXCA 4XVUA 1ANKA 4DLZA 5F9FA 3PEYA 3GFPA 4Q9JA 3OE7D 3QBVA 4JSTA 4DRZA 5CB8A 1KI6B 3H1TA 2A5JA 4CZ2A 3P1JA 2OAP1 1N2CE 4Q4JB 1KIMA 2QP4A 4LOAA 3ZVMA 2GBLA 4F4JA 2P6NA 1E98A 3PIRA 4DLSA 2FFAA 5KSPA 1S1CA 1NMYA 4M9QA 3EA5A 2HLDD 4V0LA 3LQRA 1MO6A 2RGEA 3WY9A 2G3YA 3NG1A 4DUGA 3MJHA 2BBSA 2F43B 3KFXA 2IYYA 1L4UA 2YNMA 3NBFA 4N0DA 2VP9A 4CDGA 4NCIA 1OLOA 2D3WA 3BFVA 2GILA 1SHKA 2GESA 2CCKA 1N6NA 2PJRA 4MDFA 1CP2A 1DAFA 4EJSC 3N2IA 3B82A 1G7TA 1E79D 3HR8A 1IXZA 4D0NA 4I1SA 3DEFA 3RRYA 2ONKA 2R6CA 3B1VA 3RANA 4JLAA 4HLUC 1T4GA 1E9SA 2W0MA 2ZUDA 3CO5A 1R0YA 5BYKA 1DO0A 2BKUA 3NTUA 3A1TA 5K8TA 1KK0A 4AI6A 3WBKA 3MJRA 1L7VC 5B57C 1W1WA 4LRWA 2C5LA 4NTZA 2HXYA 1I4DD 4KSBA 1D2EA 1NJGA 1NVVR 2DB3A 3VR4A 1X86B 3QXSA 2BC9A 2IEZA 5L3QA 5IHPA 3O8CA 1G3IA 4Q5IA 3RC8A 1KSJA 4LV6A 1RPZA 3OEED 4PHHA 3W90A 3K70D 4UNPA 1ZU4A 4F4CA 1XFAA 1HUQA 3KZ1E 4LJ4A 2LCFA 1DARA 3QKRA 4M8NE 3LD9A 3K53A 2OT3B 1OT3A 1X8KA 4IFEA 2ZJ2A 3UATA 1DE0A 4G5GA 4Q01A 1XXHA 2RKOA 3LBIA 2IWRA 1CR2A 3FTQA 3PVSA 2GXAA 3E70C 4E09A 1AGRA 1E2HA 2MSDB 3ZS9A 1FFHA 1R10A 2OO7A 1US8A 5K8LA 4DIEA 4NBSA 5G3ZA 4EFNA 1OPXA 2ODEA 3LFUA 3EZ6A 4RD1A 1E9AA 1P6XA 3N2EA 4Q4AB 3AGPA 3TSZA 2XGJA 3KB2A 2R9VA 1KMHA 3EZ9A 4NZYA 1KI8A 5GVRA 3PJRA 1JALA 3W3AA 5H70A 2R62A 5FOVA 4DBLC 3L0SA 3CNOA 1OSNA 2ZSBA 3FFAA 1E2GA 2HUPA 1SVIA 4MYCA 3K0SA 1LW7A 4OI2A 1P5ZB 4Q4HB 3OFNA 1N5IA 1NSFA 2H7VA 2XB4A 3TSOA 3WMEA 4BE7B 5FTKA 3EG5A 2W6IA 5J4KA 2XEXA 5JSZA 4OKSA 5F2EA 4G5QA 1TPZA 5FUVA 1UBCA 3TJZA 4BZQA 3MWYW 4JBYA 1N5JA 3RSLA 1E1RD 2F1JA 2IHBA 1QHIA 3LLUA 3Q7QA 4ILEA 3U3JA 5FPHA 4F4IA 5HZHA 2DFNA 5FOSA 4MYUA 3SC3A 3FKSA 1N5LA 2D2FA 4TLAA 3TW4A 3G0HA 1W46A 1ZW6A 1XX6A 3SEAA 4DVGA 2XTMA 2I4IA 4LC1A 4W5JA 3SS8A 4CW7A 1WE2A 2O0JA 1OKKD 2O8DB 3AVUA 1WMSA 1XRJA 2ZU6A 4A2PA 3RS5A 1NY6A 1HURA 4X8OA 3C14C 1COWD 4DSUA 1KI3A 2WJGA 2RHDA 5FTLA 4QC2A 3SU8A 1TADA 2BV3A 3DM5A 2ZS9A 4EQ6A 2WOOA 4DCVA 2GZHA 2OXCA 2HT6A 2JIZA 4MRNA 3WYAA 2VHCA 2QBYA 4P0TA 4A2WA 2C78A 3SN6A 2EFGA 5C2JB 2DWQA 2NZ8A 2QTVB 2X19A 3K09A 4L15A 3HPRA 4R71A 5CDFA 2EYUA 2KE5A 3WMGA 1YU9A 3C5HA 4P4TA 5DHAA 4ABYA 3QF7A 3WMFA 4A82A 3GLFA 2ODNA 2QAJA 3Q9LA 1ESNA 4FCWA 5BW8A 4MQBA 2O8BB 1Q3HA 3BJIC 2QAGA 2JJ2D 4HB4A 2JLXA 4KFTA 3KXLA 4YMVA 2O8EB 3WBJA 4KYUA 5EP2A 1XWIA 4O25A 2AD1A 2G88A 2ZPTX 1XXHE 3IHWA 3QQ5A 4HUQB 4U5XA 5H68A 3WNBA 5BN3A 3GLGA 1WXQA 3UMSA 1V43A 4FMDB 2ZRLA 3ZDQA 3I1FA 1F5NA 1T9HA 1KNXA 2PMDA 4Q7KA 4X8HA 4C2TA 2HJGA 3CKLA 2ZJYA 1YZNA 1X1SA 4WBSA 2BEJA 1TAGA 1SKYE 5CK4A 3CZPA 2YC4C 2CJWB 1T5IA 4TN1A 2VBCA 1ZIOA 4M1YA 4Q9LA 4K81B 1MO5A 1YR7A 2C96A 2Q3FA 1D9ZA 5FFMA 4ZI3A 3DO6A 4GRAA 2JLYA 1IJFA 2O8CB 4BWYA 1J99A 3MSXA 1OXTA 3C5CA 3CUEF 4KVGA 1MT0A 5J40A 2AKYA 2QN6A 1ELOA 3EPJA 2WVJA 3FMIA 4M1OA 2XSZD 3TR5A 2AK3A 2V1UA 4WW0A 1KDPA 3AB3A 3AVOA 4BFVA 1NLZA 1X1RA 2VL7A 4IOKA 1KGDA 4OJKA 5F9HA 1U90A 1CLUA 2OXRA 4XVRA 1IN4A 3IEUA 2P6UA 5L3SB 2FNAA 4G5OA 2R8RA 1HT1E 4PC2A 2AL7A 2XJ4A 1Q1QA 4FMBB 1TL7C 4DSOA 1G3QA 2PLFA 2A3RA 4TYNA 1P9NA 3VX4A 1G4UR 1OXXK 4JS0A 4US1R 3QI2A 4YMWA 5FOWA 2GK6A 1M1YE 4D26A 3K0CC 1XTQA 3GCGA 4FMCB 3LBHA 4PAOA 2FDCA 1DAEA 1AZTA 3BIFA 5BN5A 1FP6A 1T3SA 5JEEA 4A0GA 1X8LA 1UPTA 3S1AB 5FTMA 1E2IA 4RD4A 1CJTC 2J3EA 4F38A 2GZDA 2CK3A 1ZCAA 1S0UA 3NHBA 4YLGA 3EPHA 3DM9B 1UAAA 2IS4A 4QKQA 1KYIA 1FPMA 1T6NA 2DFTA 1W48A 3FHCB 4DSTA 4TMKA 2BBOA 1T8TA 3LO5A 4I1UA 4ZKDA 4GL2A 2ZRCA 5HE9A 4TYQA 3I72A 4PC3A 1U0LA 4LK2A 3EZFA 4TL6A 5CDFE 4TLBA 2HCBA 3QKSA 1GFIA 4KFSA 4X8MA 2V7QD 4UQOA 3X1YA 2RGAA 4G5RA 4BLRA 2JJ1D 1P75A 1N0VC 4LJAA 4DEYA 3NBYC 3GLHB 3PUYA 3VQTA 1SVSA 4HZIA 3PUVA 2IUTA 4UKDA 2OFXA 5DE3A 4MGKR 3R8CA 2YOFA 2A5YB 4AYWA 1W36B 5FH9A 1UADA 4LPSA 4DDTA 1U8YA 2FGKA 3OIUA 2Q9BA 5JLJA 1M7HA 4C0AC 2ORWA 1WF3A 2ZVQX 2AN9A 4WZAE 4EJSA 3AVYA 1Z2CA 4PZYA 5CLLA 4Q19A 3QVUA 5GJBA 3BK7A 3AVTA 3RAPR 4V0NA 1IJEA 3UMRA 1Z0KA 2D2EA 1E99A 4HLUA 3VR5A 3NXSA 1N6IA 3CF0A 2DHRA 2FPKA 2RH5A 4B6FA 4ZDJA 4DJTA 3KJHA 3BERA 3JVVA 4ZDKA 2PEZA 1MABB 3QUSA 4POAA 4XTRA 3HJNA 1OB2A 1JAHA 3VKWA 2ZI9A 1GDDA 4WOPA 2CE2X 2ZSEA 3HWSA 4HZUB 4L16A 4LJ6A 3IEVA 4QFMA 1B0UA 2ZR9A 2PL3A 4HAXA 4D0LB 4B74A 3E5HA 2ZSAA 4HLQB 1HYQA 1UM8A 4FN5A 3GJ6A 1CR4A 1CIPA 1RRPA 1KAOA 2DWPA 1G8GA 4FW9A 3V4FA 3WNDA 4UNSA 1KI4A 1EX6A 2EQBA 2JATA 2WIAA 4JT4A 3PEWA 2H1LA 1O3YA 2C98A 3TE6A 4UNQA 4NMMA 2RGXA 1N6PA 2IYZA 3KL4A 1XBTA 1R5NA 4XD7A 1NJFA 3TSWA 1NI3A 1NBMD 4Q9KA 3EA0A 2VQSA 4PO8A 3IIJA 2H8KA 3OEHA 2YV5A 4DDVA 2PX0A 2QE7A 1GM5A 1U98A 1D2NA 1KI1A 4IOJA 4KFUA 4A4DA 2NMVA 4EPVA 4Q4JA 2WOJA 2F3RA 5TY0A 3R7WB 1SZPA 2FV8A 1IN5A 1R8QA 2CNWD 1Z22A 4Q7MB 5BYJA 4MGZR 4B3BA 4MYTA 3WP1B 3U44B 4L9WA 1P2SA 1ZNYA 3ICEA 2ZRGA 1NLYA 4PSAA 3WRXC 2XNDD 3L2OB 3T5DA 1E2FA 1R2QA 3RS4A 2F43A 3VR6A 1G291 1QG2A 1SXJC 1W36C 2O8FB 1HE1C 3THOA 4KODA 4C7OB 3BB4A 4EPYA 2NO9A 2QT1A 4NU0A 3U5ZB 1W2GA 2NO7A 4QGHA 4P31A 3IBGA 1KAGA 2FSHA 2ZE7A 5KPDA 2ASEA 1G21E 4YONB 1MV5A 3ZD6A 2AKAB 2WKQA 3SI7A 4OK6A 3CRRA 1OFTA 1KMQA 3TQFA 3GMTA 5E7JA 5H1YA 1QHGA 4OI0A 3K0FB 2J0UB 4IOLA 5J47A 3H4MA 2JCSA 1GKYA 5B64A 3T1VA 1G17A 5FPSA 1XPUA 3EC2A 1QHYA 4B32A 1FNMA 2QNRA 3ZLJA 2ZJAA 3KKQA 3AVXA 1MRNA 1MR3F 4JIMA 4MGIR 2E87A 1XZQA 4B76A 2GJAA 2QRNA 2OLJA 4EIWA 4EDHA 1VG9B 4E07A 1R0ZA 4G1UC 4XJXA 1MRSA 3ZIAD 3R9XA 2ZRBA 4G3XA 4HAZA 2WTUA 2J1LA 4IDHA 3ZJYA 1GNRA 4B73A 5KNCA 2XOKD 2ECKA 1Q1EA 4B3FX 2B92A 4YQFA 2QMHA 3EX7C 1KK3A 3P20A 4GFDA 4JLNA 4KO8A 2BIFA 5JCZA 4RZ2A 4JJKA 4JKIA 2GVZC 2D4HA 4CEHB 1AA9A 1Q0UA 4BUJA 3WRYC 4PAMA 1P2VA 3AM1A 4D0GA 4Q9IA 3GJ5A 4D4KA 3THXB 2YOGA 1Q20A 2PZFA 5CYOA 1LB1B 4HEJA 1ZUNB 1ZD9A 2NPIA 4WIAA 2XZLA 2WWHA 3U7EB 5DN6D 1XD8A 1KSFX 5E4FA 3C15C 5IF9A 4URYR 3B9QA 3W6OA 1N25A 1N6KA 4H1VA 4Q4AA 2PMKA 3I62A 2MSEB 2ZR0A 2VLIA 3W5IA 3DMDA 2QT0A 3I5YA 2VHUA 1SXJD 1ZM9A 5A4JA 4NL4H 1GL9B 2OBNA 3KJGA 1FQJA 1XPRA 4YXWD 1J90A 2N42A 4M22A 4BLTA 2GCPA 4QXAA 2BM0A 5KPJA 4TZ6A 2H17A 4IKEA 3G5UA 2B6HA 4Q4HA 2VHQA 4D4LA 3IIKA 4F7WA 4L9SA 4PO9A 1M74A 1T91A 3ZQ6A 3I3SR 1QZXA 2EYQA 3K70B 3L8ZA 4I81A 1Z0FA 4URZR 1W0KA 3FGNA 1E69A 2DBYA 3FMPB 4DLUA 4M1WA 4URWR 2QL6A 1E2JA 2XTZA 3U2QA 2NTYC 4W5HA 3EIQA 1FX0B 3REGA 3U7HB 2A5FA 1Z63A 1S3GA 5KHOC 3SHFA 5FL3A 2G1KA 1XEXB 2FJUA 3GQBA 4RY2A 5D3MB 2CCJA 5G53C 5D3QA 3R9WA 5A0FA 2O8DA 1ZNZA 5FUWA 2CHVA 4XTCS 1GSIA 3GLIB 3K0CA 4Y0VA 3ZVRA 3JZAA 2I1QA 2FX3A 1LNZA 4LSGA 1W4AA 2AX4A 4UNNA 3H84A 4B2LA 1Z06A 1W4BA 4QHTA 1LTQA 3D3QA 1AM4D 4L5BA 4M53A 5EE5B 3T06B 2GAOA 1CULC 2JJ8A 2GNOA 4LDJA 1C4OA 5TB5A 1SVKA 2OCAA 1Z6AA 2KWIA 1TQDA 1KDTA 2V4ZA 2Z5FA 3VAAA 5DI3B 3QEOA 5AJVB 3SOPA 2W58A 1D8TA 4KXFB 5J4LA 2ANBA 3VHLB 4FXPA 3Q5EA 3MWKA 4IXMA 2QMOA 3WXMA 5JWOA 1G8HA 2WPDD 5CIQA 1MH1A 2ANCA 1BH2A 5B30A 4FWIB 2O8BA 3NVAA 1J8MF 1EFRA 3KQLA 3CRQA 4DDWA 2CL6X 1GITA 2L0XA 4Q7LA 3NDBB 5C18A 1LS6A 2C9OA 3CX6A 4R98A 4OQMA 3LW8A 1G9XA 4HUQA 2VIIA 3VU9B 4IVRA 3M6AA 5TVKA 2IS1A 4HB2A 2VSXA 2X1VA 3IGFA 4BLSA 1JR3D 1RYHA 2WBLC 1N6LA 4NONA 4JLKA 5LB2A 1KJWA 2CXXA 2P3SA 4RKFA 4E5UA 3AKYA 1G1MA 4JBXA 4B47A 1Z0DA 2CJWA 3IPXA 1NIJA 4FD2A 4OBEA 5FBRB 3SNHA 1TF5A 3DOEA 5HZKA 2ATVA 1W7AA 1PLKA 1GOTA 2JDIA 2QU8A 3F5FA 1IQPA 3N70A 3A36A 4B6EA 1WRBA 4TSFD 2WSSD 4HI0E 3TUIC 3IO3A 3L0PA 2O8CA 2ZAOA 2C95A 1G5TA 3U6BA 2DR3A 3W8NA 4ZO4A 4M2LA 4NHOA 3RLFA 4MGYR 2FN4A 5M04A 3O8RA 1YQTA 2AWNA 2X8AA 2H92A 3THWA 4NYJR 1S1MA 4IEIA 1FTSA 4NPHA 1Z0AA 3KKPA 2BJVA 4TMZA 4DLRA 3K70C 4HATA 1G19A 2WJYA 1UFQA 2OBLA 1YHNA 3HU2A 3RRMA 1G3MA 3NC0C 3GFTA 5L3SA 1ZJ6A 1N0UA 2PBRA 5DH9A 2VP2A 2QI9C 3B8HA 2J0SA 2CDNA 1BS1A 3M4YA 3F8TA 4WVFA 1S9DA 2R2AA 1RIFA 1RE0A 3I8XA 4JKYA 4MDEA 2VF7A 1TNDA 2W0SA 4D6PA 2EFHB 2ATXA 3QXJA 1JNYA 4PC6A 1QG4A 3P32A 1Z28A 5E95A 2J46A 4JL6A 4NCKA 1OF1A 4OK5A 3S1AA 1P72A 4MKFA 4X8LA 821PA 1HE8B 4OL0A 2C2HA 3K9NA 5AUNB 4OI4A 3T1QA 1G41A 2HYDA 1HEIA 2WV9A 3EC1A 3OIYA 4RFVA 1OIWA 1Q1BA 2W00A 1H8HA 5BN4A 4DSNA 3BH0A 4DEXA 5JRZA 5FL7D 4J0QA 1UBEA 1ESMA 1KZ7B 1OH6A 3AGQA 5JCPA 2JLVA 4O2LA 2ERYA 2ZYTX 2A5GA 2XITA 4XWAA 3VR1A 1E9EA 3VNVA 1AK2A 1M7GA 4TYWA 2FWRA 3KQUA 4LHWA 5JBQA 5IRCD 2GCOB 3H0KA 4AKGA 3PFIA 4C0SA 3ADBA 3CZQA 5EXXA 4A8JB 2QG6A 2BHRA 3EIEA 2F3TA 3F0TA 5EXSA 3EWSA 1W0JD 2WWYA 3AV0B 4WA7A 4WXRA 1L4YA 1Z47A 5KU1A 2YZ2A 2DCUA 2RGDA 2WZQA 1P62B 4KYIB 4GI7A 2P0EA 4D82A 1TU4A 3LXXA 4LJ8A 1FMLA 1SVWA 2QENA 4JLJA 4QJ3A 2ZU0C 1N6HA 1H8EA 2EWWA 4LWZA 4TMVA 4LJ7A 2X2FA 2GWHA 1GZSA 2HEIA 2NG1A 4L8GA 1U0JA 3VX3A 4DDUA 1XJ0A 1IXSB 1ZINA 3A1WA 4ZDWA 1PUJA 1VYVA 3MG9A 2ZR7A 1KI7A 3FMOB 1I2MA 3RDPA 4D81A 2E1RA 2C8VA 1XTRA 2BMJA 4NCHA 4BRUA 2ZANA 4BEBA 1MABA 3KQNA 1IONA 4RD3A 2X77A 1XDBA 4Z1MA 2FFBA 1E1QD 1GG2A 1II0A 1AIPA 2REOA 4HZUA 1TX4B 3LV8A 1ZD8A 4Q02A 5UKDA 2B8WA 3CX8A 2PEYA 3AKEA 1XMJA 2DPXA 2ZI4A 5DIFA 3WHKA 1S9HA 1JPJA 1IN6A 3RVBA 4ZV4A 3U61B 4P4SB 5KSOA 2QUZA 1NRJB 1ZYUA 3QNUA 3RS0A 3KTAB 3RRNA 4OHZA 1GP2A 5HE8A 1TF2A 3KKOA 3OAAD 2IYTA 3FPAA 2IX3A 1GRRA 1DBSA 1E2NA 2IBMA 3B60A 4W7SA 3EPKA 1VG1A 3U4QA 1Q21A 4EFMA 3CF6R 5J4HA 1BMFD 6Q21A 1JQJC 4DWJA 1E96A 4EFLA 2GK7A 4TTQA 3FMFA 2NO6A 2OE2A 5FTJA 3QJYA 1R7RA 2PZEA 3IQWA 2MSCB 3GFOA 4Q47A 3R7WA 3HU3A 4ARZB 5FI0B 3TVDA 3AF1A 3QBTA 1DELA 2RHMA 3NKVA 3QF4B 5H8WA 3BS4A 1F2TB 1WA5A 4LZZA 4Z51A 1DAGA 3B2EA 1AJEA 3U44A 1OW3B 1PLJA 1RYFA 3WYGA 4AG5A 1S3SA 4BECA 1LVGA 3K0AB 2VP4A 4A8JC 1Z0IA 4LYAA 3TW8B 5SZHB 2ZE8A 3IHLA 4UXIA 4M1TA 1RFLA 3ZQJA 3GLHE 3OZXA 2O8FA 2WJIA 4C7OA 4A0HA 4PX9A 4QBIA 3DVLA 4RD6A 4DLTA 3UIEA 3I92A 1SXJE 1R4AA 3MCAA 4GZMA 3SJZA 2C99A 2G83A 1EFTA 4Z8XA 3LQQA 3MGCA 4FWTA 1TEXA 2ZIAA 2A78A 2WM9B 3THYB 1FOEB 1UDXA 4GP7A 4QOSA 1WQ1R 3PUXA 2QSYA 5FUXA 4AYTA 2ODBA 3E2IA 2J0UA 2ZROA 1DO2A 2FA9A 3A1SA 3B1ZA 3O8DA 1IAQA 3GJ8A 2P65A 3MAAC 4DLYA 3EXAA 2HCJB 2W2VA 4V03A 5GJVC 1FW6A 4B2PA 2WJJA 2EWVA 3CIOA 1E0JA 4ZDIA 1MO4A 5BWMA 3OE7A 1XZPA 4CT5A 1XMVA 1JI0A 5G41A 2P2LA 5FPYA 3AVQA 1UKVY 2OILA 2VO1A 3B6EA 3HP1A 4NKRA 4R9UC 5BQ5A 4AKEA 3CNNA 4MRPA 1II9A 1UBFA 3WHLA 2R6GA 3R8FA 2ZITA 1XF9A 1Q1ZA 3OEHD 2GJSA 2W2XA 1Z5ZA 2QE7D 3CONA 3REFA 4DIDA 4CEHA 2GCNA 4RCYA 3BBPA 1I4TD 3U3RA 3V00A 3THXA 4Y0AA 4UXHA 3VMFA 4G01B 1ZCBA 2A5DA 2BBWA 1E2KA 1LS1A 1T8UA 2O0HA 3PEVA 5CM8B 5FBLB 5JWRA 3A1VA 1OHHD 1CR1A 4M4SA 4TQAA 2A30A 2XJ9A 3I4LA 5DYGA 4LHYA 4NYJQ 4B35A 3HYRA 4LBZA 4LV5B 3UWKA 1BYUA 1E79A 2CL0X 3R20A 4M9XA 3CM0A 3IQXA 2YWFA 3W6PA 4I1VA 2W6JD 1Y63A 4D2IA 1UKZA 2F6RA 1YJ5A 5JEDA 3DHWC 1G8PA 1UKYA 1VYUA 2V6JA 3O47A 4C2UA 5EP4A 2H57A 5DO9A 5KDOA 2VRWA 3X1WA 4NYIQ 2XAUA 2WIBA 1A82A 1EFCA 1SHZA 3PITA 5KTYA 5KNDA 4GMXA 4HLCA 3LH5A 1OH8A 2V8OA 1K6MA 5JJLA 2DY1A 1IBRA 3PR1A 4OQLA 4PSVA 2J7PD 5FBQB 5C1BA 5DSZA 1E2EA 4AY2A 2YYZA 3RNLA 3OEEA 3SJBA 3BFKA 4B75A 1FP7A 2FEMA 5FR2A 5IT5A 1UBGA 2UKDA 3NEJA 2XXAB 3CRMA 5GADl 1JXOA 2VSOA 2XX3A 1VPLA 3NBXX 2D74A 4XSHA 4QBGB 2HT1A 4LJ9A 1JXMA 3QOFA 1FX0A 1LF5A 3TKLA 3A58B 1WDTA 3KJEA 4NCNA 4A15A 1DVRA 4L4UA 4JJZA 2QP3A 3ZS8A 5KO2A 2LKCA 1XEXA 2VF8A 3NIBA 5D3MA 3M1IA 1YE8A 2JEOA 4XH9B 4DT1B 2TMKA 3C41J 4PQYA 1WBDA 2IW3A 3CPEA 5TMPA 3KXKA 2H18A 3EZ7A 2E9SA 5TV2A 4EPWA 5SZJA 5IK2D 2YINC 4F93B 5KNBA 3UWOA 4CYMA 1CRQA 2W83A 4GOKA 3TK1A 4TMTA 1F2UB 4EAQA 2P6RA 2HXSA 1YZGA 4II7A 1K5GA 1RRGA 1U99A 1GL7A 3QG1A 2F1RA 2GXSA 3NWJA 3LDAA 1XEWX 2VP5A 4PPNA 4QM7A 5C46F 1SXJB 3ZYCA 2AFIE 2CVHA 2IS6A 3B5JA 3W3ZB 5FR1A 5HKKD 1KO7A 2O0KA 4RZUA 1OIXA 2AR7A 2JLSA 5B2ZA 1CTQA 1CJMA 5FPTA 3T35A 1KKLA 3QPUA 2IYRA 3Q3JB 4ZCLA 4KBFA 2UZIR 5HTKA 4AIIA 4LY6A 3ZZ0A 1GUAA 5FUYA 3LVRE 3B9PA 3VU9A 2BM1A 3P27A 1JECA 1ODFA 4OQNA 1FUUA 4EUNA 5K8UA 3L0OA 1E1RA 4JYBA 5TARA 3UPUA 2BWJA 4QNMA 2WWFA 4NYMR 4S2EA 2ZETA 1VIAA 4HSEA 4JLVA 1OH5A 1FZQA 2KJQA 4HDOB 4DLXA 4PZZA 3K1JA 2QPTA 5DLQC 1OFHA 3QKRB 2C03A 1OKKA 2JLRA 2LKDA 2IT1A 2NZJA 2I1VB 2WWGA 3AF3A 5EE3A 1COWA 1XU4A 2CBZA 5DYIA 2ZAMA 4E22A 1AS3A 3MRSA 2BMDA 1WBBA 3MWJA 1ONBA 2ZE6A 2IEYA 1R5OA 3B1YA 4KSCA 2GHIA 3C8UA 3H86A 5EP1A 2RMKA 2R6DA 5HCIA 4US2R 1WP9A 1US8B 3NDPA 4CVNA 4BFZA 5CK5A 1O87A 2OESA 4IW3B 3VTKA 5GJCA 4U7DA 3W5JA 2F7SA 3BXZA 4O2RA 4PHFA 4DXAA 5LD2B 4TLCA 3C7KA 2Z43A 3RS3A 4TT3D 1G16A 2JJ2A 4B48A 4RFSB 4OI1A 4TL8A 4BRWA 3TVTA 1JQLB 3RWMB 1KI6A 1KMHB 1Z2AA 4MUBA 4LI0A 1U81A 3IPYA 5BXQC 2SHKA 4QBFA 2GAAA 3KFVA 1OYWA 1QVAA 3GLIE 1XD9A 1VTKA 3JVUA 2RB4A 3BRWD 1YKSA 3WNCA 1FNNA 5DHFA 2IUUA 2KI5A 1Q12A 3LY5A 4OHVA 4FIDA 1JR6A 4HAUA 2R65A 4W9MC 4A9AA 1RJ9B 1ZRHA 2J87A 4IHQA 1U9IC 3T1OA 5AUPB 2FG5A 1CR0A 4JBWA 3RS2A 5F3WB 1VG8A 3CW2A 4C30A 4AYXA 2VH5R 4LPKA 1PUIA 4F91B 5DISB 2FH5B 4U00A 2W2TA 3OIVA 5IDVA 2GJKA 5CB6A 2GCOA 2CE7A 1OXVA 2EU8A 2XSZA 4HYYA 2ZYUX 3AUYA 1ZNWA 1HTWA 1NKSA 1OXSC 2FOLA 2IF2A 2J45A 4B43A 2J9RA 3D31A 5FI1B 1I2DA 2JLQA 4PSKA 4PPGA 1T0HB 4N3NA 1RRFA 1GKUB 3WP0A 4EPTA 5EE1A 1E0SA 2VPPA 3IKJA 3PCRB 2V9PA 2FFHA 4Q1FA 4CIDA 4ASUD 2GA8A 1FTNA 3QVVA 2WWIA 4IFBA 5AJWA 1MOZA 4KV9A 1XCMA 4IDOA 2FF7A 1UF9A 2HJVA 4YDSA 3SYLA 2DFLA 2EVWX 1UJ2A 3U7GA 4NP6A 2QGNA 3BH6A 1PZNA 4DLVA 3K9LA 4PTLA 3EIHA 3TUJC 3U60B 2ZQ5A 4JVNA 2CHGA 3GEEA 1DTSA 3GLGB 4IDPA 1EK0A 1IHUA 3CBQA 2YHSA 1ETUA 4V0OA 1KJYA 2Q9AA 1SULA 1VDZA 4XIGS 1AKEA 2VHJA 2KSQA 5JI2E 3TQCA 4QGFA 3C4JA 2IWHA 5LD2C 1XTSA 1U2RA 1NG9A 1AQUA 2GXQA 3O8BA 4D80A 4DUGD 4TWZA 3B13B 3MFYA 5SZKB 4P4SA 1NG1A 4Q1EA 2V7QA 2F9LA 2YJTD 2VYFA 3TGPA 1X8JA 2DFKB 3KTAA 4BZXA 5EUQB 4LYJA 1IN8A 4LBWA 2REXB 1EG7A 1DAIA 1YR8A 4MUAA 5CITA 3EARA 3ZH9B 3LX8A 3V9PA 1IY2A 2GF0A 2ZJZA 3TAUA 4IOMA 1CJVC 4OK3A 2ZRIA 4XSGA 4UNRA 2JLZA 2PT5A 1E2QA 3FYHA 2OZEA 3FVQA 3GEIA 1OV4A 2J0VA 2PZGA 1NN0A 2QMEA 3GD7A 4HB3A 4YDHB 4LGMA 4QJ4A 1CF4A 1XPOA 4BQSA 5FOXA 2OHFA 2WKPA 4LHXA 1XD2B 4RD2A 3DDCA 1QVRA 1KO1A 2RGGA 4JVMA 3I5XA 4B3DA 1GWNA 3Q72A 5J5CA 2ZS8A 1IY1A 121PA 3SJAA 4QG7A 3E1SA 5EE9A 2OG2A 3I8SA 3QY0A 1I4LD 2N1BA 4GMDA 2G9NA 4BLOA 3CR7A 3QF4A 4RVCA 1F2TA 5AWFC 4DKXA 4YMTA 1F60A 3ZZUA 4QM6A 4ZIRB 4TYYA 3K0AA 4Q03A 1SQ5A 4I99A 5FPKA 3AQ4A 1Q22A 3SFVA 2GJ9A 4JMPA 4AK9A 1K8RA 1UEIA 2KBFA 1Z8FA 2BVNA 3U3OA 4R2IA 4PPFA 5JECA 4DCUA 1OH7A 1OFIA 4N0EA 1W44A 3ADDA 4HAWA 2C9YA 2ZI3A 1S2MA 3Q5DA 4C0LA 1F6BA 4BFSA 1XTKA
chains in the Genus database with same CATH superfamily
1SBTA 4G8JA 4I5IA 1BU8A 3E3AA 4PYMA 3P4XA 4BB0A 3QE3A 3PDCA 1AGPA 1CXZA 4X54A 2ZSIA 2AWOA 5DLPA 1UPFA 5CLQA 1N9GA 4U63A 3W1EA 3SJCA 5KIAA 5ILOA 5LNK1 2H4YA 3PJFA 1DOAA 2Y0BA 2PK3A 3FVWA 3L8GA 1DIHA 6LDHA 3AVVA 5FB3A 5IAJA 5I7UA 5HDQA 2M9MA 3KOXA 1U9JA 1A1SA 1XT6A 2HHCA 1Z2EA 4QULA 2IE0A 2O52A 2O06A 1S01A 1LLCA 2OFFA 3HSSA 3JWPA 1NFFA 1Z36A 1WPQA 2PUAA 5KTPA 1EX7A 3CWQA 3MN1A 2K87A 3LO8A 3U7QA 4YMSA 5CPBA 3IE1A 1Z75A 5C4GB 3WA6A 3W0LB 3SQLA 1VPWA 1LPSA 4BQRA 2J5XA 4AMGA 1YT5A 4J7AA 4MQUA 2AMVA 3L1JA 1QQ6A 3DXXA 3KEGA 5AKGA 1Z88A 4Z9FA 5AVVA 4QFCA 1KSGA 4KJXA 1MGOA 1RR6A 2CNWA 4E88A 2DFVA 1FJHA 2VWQA 2J31A 2W6ID 3RUHA 3ELBA 3IAAA 3NOVA 4BLQA 4B4UA 4FMPA 2Z8ZA 3HBAA 4Q34A 2OYCA 3FOFC 2H5EA 3LHKA 1ODJA 1UCFA 3ZWPA 3OM8A 2XNDA 3U7RA 1DADA 1R64A 1DKQA 1P61B 1HV8A 2GETA 1JB1A 1LPOA 3KU4A 2AG1A 3L0CA 2IVZA 3VJMA 4F5EA 2O7NA 5C3MA 3CSDA 3FYCA 1ESEA 2W6OA 2XY4A 4E5YA 3GUCA 4G0VA 1HM5A 4YGYA 2OLKA 5EKDA 3KOMA 5H9WA 3S2GA 1PL7A 1JFFA 5EQDA 1QAQA 5H7XA 1Y6ZA 2BFBA 5K6AC 2G1AA 3O95A 1N8KA 4N18A 1JHYA 5AR1A 5KSZA 2AD5A 4F2GA 2XKBA 5LWHA 1Q14A 2XQFA 3HDGA 3P26A 1AZSC 1XDWA 3U62A 2HN9A 4QGGA 3U9LA 1TYEB 5NULA 1TQ4A 3QOYA 4HJXA 1UJ6A 3GT7A 5MN4A 1Q0ZA 1U2PA 3HI6A 4KDCA 4KR6A 2G06A 1SUPA 2V74B 4H7PA 5HCNA 3AR3A 4GL4A 1MIHA 3E3NA 3UJHA 3UWDA 3USZA 3L05A 3V4SA 3OE4A 2QX8A 5JARA 4NBVA 5CLGA 2JIOA 5F1PA 2GVDC 3WSVA 4HNHA 1C2TA 3A0UA 3DE5X 1IATA 2E4AA 3ELWA 5G02A 3LIIA 4QHYA 1GEEA 2WTXA 2DZDA 1X0XA 3Q7IA 2FFRA 3DKRA 2QQEA 4D9FA 3T4PA 3SVLA 3MMSA 1YL7A 1C3JA 4RUKA 5KUTA 4AJIA 4OP2A 4HRAA 3P8ZA 4MI1A 3ITDA 3MQ2A 4YJ2F 4AJEA 3K5HA 2F90A 5EFZA 5BNWA 2PWPA 3OCVA 3BWCA 3TRFA 1LBHA 3VSDA 2W2MA 4NRDA 3O94A 4MYSA 3TEFA 2PH5A 3D6TB 3I32A 3KU1A 3SC6A 3UV6A 3AI7A 4F2WA 2WICA 4UC0A 2ONJA 3AHGA 4COKA 4EITA 4NZNA 6ABPA 1HH4A 2E0IA 4BZPA 2PQ2A 4YWHA 2Y1OA 3K1AB 3TBHA 4DVJA 5HDBB 1U8ZA 2IDKA 5E4JA 1P91A 2JA1A 2SCUB 3EMDA 1JMVA 2Z1DA 4CHTA 3P2KA 4HXGA 1R6VA 4F9GA 1CZOA 2GEVA 4S24A 1JKJA 4WNAA 2PIDA 3PVCA 4YMLA 3ILHA 1XLWA 1A7JA 1M8PA 3PF9A 2BCJQ 3EFBA 5SYNA 1G8YA 2PZAA 2YVQA 2ZRKA 2M32A 4JX8A 1PEKE 2K7FA 3PS9A 4HDAA 2B8TA 1H9BA 4XGKA 1U0BB 1Z6ZA 4JSYA 1B41A 3JZFA 3QW2A 5ILQA 3WK4A 2E5FA 3LAWA 2ZDGA 4TWRA 2XUAA 1X7XA 2OXFA 4FGUA 2JFXA 3TRJA 2DWCA 3L01A 4MW0A 3KJIA 1R0BA 1QUEA 3CF4A 2A67A 4UCWA 4B71A 1TD9A 2RGBA 5B2EA 2B4AA 1X6VA 1ZONA 5CLFA 3ZW9A 1C80A 5AK0A 1XNJA 1M2VB 5AI8A 5C5DA 4EJ0A 2PJZA 1V39A 2OO3A 3E9MA 3BAFA 2FYTA 1GKIA 4ZHQA 2XADA 4K8RB 4YJKA 2A84A 5GTDA 3HE3A 4G07A 4XWOA 1NUHA 4ZRMA 4KTVE 4RJ2A 4YDQA 2Q62A 3Q8XB 3M6XA 4OGKA 3MCUA 1UMDA 2NYRA 1YVPA 5IHXA 1JDBB 2PY6A 1DAHA 3KYCB 4IGEA 2SICE 4URXR 4M21A 4YACA 2QG4A 4XYBA 1E2LA 3N1UA 1Z9BA 3FOZA 4J90A 1JB9A 5E7MA 2A4MA 4U7PB 2YJNA 1DAKA 2IDZA 2ZSFA 4KH0A 1O77A 4MP6A 2XUHA 1SCDA 1NVWQ 2FRXA 3PKIA 1FC0A 1A9XB 4YVFA 1H3FA 3W8RA 4ETWA 1X19A 2WSMA 4MGEA 4EI9A 5KDDA 4RJKA 4LEIA 5BUSA 5BPFA 2Y1DA 2HV8A 4X93A 3P2MA 1S2NA 4AULA 4DIMA 4YAUA 2VZ8A 1ODTC 2P7IA 1E0AA 1EB8A 1P17A 2BFPA 3F3YA 3RK4A 5E3HA 5JAPA 4J1TC 4YASA 1CUCA 3DOOA 3UJ8A 1H2HA 1EHYA 1WUHS 4O1HA 3VZDA 2YV2A 1ECFA 4AJPA 3E22B 3G82C 4URFA 1JEDA 1CEQA 2COEA 4DDKA 4ACBA 1RXSA 2AFVA 3K0EA 2SNIE 5IH3A 5I8PA 2GPYA 4U6NA 3HJTA 3NLLA 4QOHA 2WI8A 1PGOA 2GRJA 2Q2WA 3ETCA 2NUPB 2AR0A 3K0BA 3QPCA 3P0IA 4FC7A 4CEIB 3D4BA 3W5UA 3BE4A 2ZTSA 4JD5A 2J6IA 4ZEWA 1SVOA 3V34A 1GG9A 2IYVA 4N49A 4MPPA 4IO1A 1Z33A 1JR3A 3SLRA 5K8VA 1ADJA 1TJPB 3GXBA 1KY2A 2XVZA 3F9IA 2YVUA 2OGTA 3CF2A 3LF2A 1Y5IA 4TMXA 2HHJA 2NU9B 4B33A 1BD3A 3U7IA 2FFJA 2FTKE 2Q45A 4O1MA 2CXRA 3BRQA 3VR5D 4B3HA 2O2CA 3A32A 3DMNA 1WCIA 4DJEC 4IS3A 1RZVA 3EHEA 2JCGA 2A92A 3MUNA 5K3OA 1CUAA 5ERGB 1AKQA 2GH1A 1YV9A 3MPOA 4TSFA 4CPDA 2UZAA 3KFLA 1N1DA 4Z2YA 2ORIA 3D64A 3SZGA 3V2UA 2I66A 1BCRB 3ZDBA 3ZU5A 2B94A 2PGLA 1QQ5A 3MMPA 5ENZA 2GERA 3LX5A 2WU3A 2H54A 3KPYA 3NRJA 1ND6A 3AETA 5GWXA 4URVR 4BNNA 5LN1A 2HA7A 4C0JA 5BY2A 1YQEA 3KYIB 3T3IA 2D54A 1NFQA 2FGJA 4ITVA 4U7HA 1HYEA 1D4ZA 1L3IA 1G7RA 2YRFA 1QVVA 1O03A 3VKVA 5IXJA 4UBMA 4WXPA 5A9RA 5JH7F 5KNDH 1XCOA 2AV6A 3FDJA 3E7WA 1NJ5A 3ESQA 2BDEA 2PYZA 4KJZA 1TOAA 4HG2A 5AOCA 3SZ3A 4CLXA 4D79A 2AUTA 2OK8A 2IS2A 2P5SA 3VOAA 3FWYA 2FPPB 1UEJA 2EKDA 3JWGA 4JUFA 4E3WA 4K9DA 5JRJA 1MG5A 4RZ3A 4Z49A 5JJIA 2I2AA 1BCSB 5J43A 4KSYA 4POOA 1UC8A 4C3VA 3CPJB 3DT9A 2ZZNA 4M8IA 4YXWA 1AVTA 5HEKA 3A8TA 1OYYA 2JIDA 2X0IA 3ONFA 4PC7A 1GQFA 3C45A 4UBKA 2LCQA 5ETJA 5U4QA 4B3JA 4RQAA 1C30B 1EP2B 1V3VA 2A94A 4H17A 3SZRA 1CG6A 1JSZA 1KS9A 2V7XA 3FSEA 4BU0A 5THQA 4F6CA 5IUKC 3P94A 4G24A 3VNUA 1L5RA 1W4CA 1OWNA 5AW5A 4MVJM 2Z3ZA 1RE1A 3MLEA 3COJA 4BFXA 1HSOA 1TI7A 3O1IC 1K6IA 2F8MA 4MUMA 4RSGA 1J22A 3DG9A 3OEYA 4R8LA 4NICA 4OJYA 3NBZC 3MINA 2R25B 4Q1CA 4OKIA 3EVEA 5GOZA 3GW8A 3V8BA 3QPWA 4BEJA 5KNBH 4FDTA 3FE2A 4PGHA 4BTLA 1H1TA 1I10A 1O94D 1X9HA 4OVKA 1T29A 1FYXA 2HCFA 3G7UA 4IKOA 3UICA 4OUDA 4RCZA 3REQA 1IXYA 3KQOA 1YBMA 3BE6A 4HP8A 1K7XB 4E31A 5CHYA 4I4IA 2E4WA 4D56A 1J33A 2H16A 4JLDA 2HNBA 3HZHA 1KJQA 4F71A 1I2CA 3GJ0A 1ZL0A 3GQVA 5DCUA 1GL3A 4YJGB 3VAZA 1YB2A 1YACA 3TMYA 5EZ5A 3MK31 4CCAA 1X1EA 4QODA 5I9LA 1X3LA 1Z68A 2XWSA 1W5BA 1F48A 2YWDA 4INZA 5K4HA 3V5NA 5K7SA 2YHIB 3M4ZA 2QT9A 5BOVA 4X7RA 5K01A 5KYTA 1UDWA 1MTZA 4HGQA 4C3UA 2ORYA 2Q46A 3KS9A 3W9BA 1CRPA 2J0EA 4B09A 1G3RA 3O21A 4Y7CA 3GP8A 3LA8A 1R0LA 3CR8A 2APJA 2V5UA 1MTOA 1YZKA 2C59A 3JYHA 4XIIA 1KYVA 4MKHA 1U8EA 2P77A 1I33A 1YMQA 4ID3A 2OTCA 1YB5A 4NDNE 4ROTA 4CKBA 5JY6A 1M66A 1TYAE 2IHTA 3EQZA 5F1KA 2RAFA 3B2NA 4MRSA 4YAFA 1FYWA 2JGLA 4D4JA 4U7WA 4AJHA 3G0BA 5JD6A 3TI7A 3MCWA 4ZZ1A 2VFAA 1KI2A 2KBEA 3H05A 5FWXB 5JVDA 5KNCD 1EXMA 1M73E 1G9SA 5KVCA 4JOSA 1O58A 4Q7JB 5FBVB 1CZLA 1PGJA 2XUPA 2H00A 3MUFA 4MUNA 3JAKA 4JQZA 1PEAA 3F6SA 1KXJA 2ZWIA 4TL9A 3SYKA 4G86A 1Y4AE 3UGJA 3NBUA 5I9IA 4OHXA 1Q83A 3A0RB 2BFDA 3T34A 4RMJA 4TUYA 1M10A 3HBLA 3QVLA 4NBKA 4RD0A 1YVUA 1QHSA 2AZXA 1P74A 2HQ1A 3HDYA 3OJWA 1QCYA 2KB0A 5TR9A 1KIFA 5EKTA 5DI3A 5TF0A 4EZBA 4D8XA 2DHCA 4TRMA 3S5JA 4ZOLB 5KREA 2Q4BA 5ANRB 1GPAA 3ND9A 2VF2A 1R6DA 1XFDA 2CKMA 2WYVA 4XJTA 2YZ7A 5G40A 2BOVA 5TDHA 3SJ7A 2EP5A 4NS4A 3NMUF 3F7OA 5LPNA 3E9QA 2C58A 1DHRA 5T4HA 3GLFE 4QOJA 2OBBA 3V46A 4C2BA 1G59A 3UKDA 3WKCA 1MIOB 2VP0A 3ZXXA 3QUBA 2W48A 5C8YB 4LNUB 3GCDA 1JWBB 4K2AA 3WWCA 2HMYB 2PGDA 2AI1A 4FMCF 3GC6A 1H5NA 4XARA 3K1ZA 1BMFA 2QD2A 4ESHA 2R8OA 3DWEX 3WAKA 4MIYA 2HK9A 4NBRA 7MHTA 1JRLA 2HHLA 3FCSB 4W1SA 3UVEA 3FYUC 3VOBA 4R05A 1TLFA 3JYPA 1DT5A 4KVZA 4MWEA 4LYFA 1XJQA 4I9UA 4D0SA 1PR2A 1ZUHA 1NVVQ 1JJVA 4DIBA 5HIIA 4V1CA 2OAEA 4QNRA 2NQ2C 4C7VA 4AD8A 5HF6A 4Z8XA 4UM9B 1F4PA 4DFDA 1P29A 5B55A 1DPFA 2CNKA 3H5NA 5KQMA 1JDVA 1OI2A 1PU2A 1RW4A 2OD2A 3A1EA 2PYDA 3QPAA 3UFXA 3UJCA 1AB5A 2AOTB 3I9V1 1Z45A 2FK8A 1OJLA 2MYNA 1AN9A 2CDAA 2IZZA 1XPJA 4YFVA 1JIKA 4JJIA 3ND8A 5T8KA 2UXDB 1C1HA 1GRQA 3T7DA 3WGVA 1DWPA 3K92A 3T7SA 3Q8LA 2XUQA 1YRAA 3I73A 1ZNXA 1FK8A 1FYDA 3C3JA 3EGIA 4V24A 4C9BA 2ZPAA 1JR2A 1H2AS 4Q9HA 5KDLA 1P2DA 3UANA 2JHGA 2V1XA 2QN7A 1EBBA 4HRYA 4PANA 5KVQA 4HQ0A 2WMNB 2CWWA 3ZX5A 2XQJA 4YLEA 3B1XA 4ZVVA 2WFAA 3ZD8A 1F1JA 1JLRA 1CT9A 1JIVA 4N7BA 3ZU6A 1YJBA 4PHGA 1QYCA 2ZWMA 1NM5A 4RHUA 3FVVA 1W5TA 2WMOB 2G5CA 5AVTA 4O4LA 3KZMA 1G9TA 1U9YA 2FY8A 2YMMA 1GPYA 3ME5A 3MFQA 1TA9A 3P9RA 5E38A 5EJGA 5BMOA 1L5HB 2PMBA 2AW3A 4M9UA 5JXJA 3I37X 2FW7A 3J81k 4AY4A 2JG3A 3V8MA 4EUKA 1RVV1 1IEXA 1SCBA 1EG2A 1ATIA 2VDUE 4KVAA 3FTDA 3B7GA 1KJ9A 3OM1A 2EW1A 4BPBA 1JT9A 1XAGA 3QMWA 3MERA 2PS3A 5D01A 4RO0A 1CY0A 1E4VA 3UHAA 1EFRD 2E2WA 3P0RA 1CEXA 2QN9A 4DMUB 3HLKA 2DRIA 3D7NA 4ZVNA 4AJKA 3T6KA 1KBOA 1TEHA 2R97A 3CNLA 4ND3A 4FOPA 5T6BA 3H7IA 3OZRA 3EQ8A 1KRWA 4I1OA 3PRHA 1XWFA 4Q9DA 3NIDB 2XWBF 3IEKA 3TLMA 2ZYDA 4A1FA 3CX3A 4RGYA 1CJUC 3QEJA 4W6ZA 5A5FA 1VMAA 1NVBA 2LRHA 2XTJA 1QU2A 1GRVA 4RK4A 1NMXA 1NF3A 1UBLS 3K4HA 4O2AB 1DX9A 1VLVA 3PXAA 4R9RA 2CMHA 3RS7A 1H4QA 2YWGA 3FPKA 3LWDA 1XLTA 4W5WA 1KOFA 4BO9A 2I4LA 3P9PA 3KX2A 3DSRA 4IZIA 2QN3A 3FJYA 1KDRA 3PRYA 3KQVA 5JHHB 4XEUA 3PDIA 3DCIA 1WZCA 1A2BA 3EEFA 4A8JA 4JLOA 1KWGA 1TZBA 4FU0A 4OH1A 2EBWA 4KR7A 4LHZA 4D7AA 1DBRA 1JA1A 3IT3A 3QLVA 1K4MA 2IOYA 2JARA 1VCIA 2WP8J 1N5RA 3LF1A 3L8YA 4MYHA 4L3VA 4P58A 4QYMA 3U81A 1XIVA 2V65A 4C0KA 1NNEA 2C4TA 2OA0A 2F1IA 4RGVA 4K1LA 2VSFA 3BRCA 4OXXA 4DCJA 1IY8A 2ES4A 4JB3A 1PVOA 2IXFA 4DSAA 5LM3A 2P4SA 4YQYA 3SR3A 3FGPA 1KR5A 2IXEA 3RYTC 1KI9A 4BO4A 3HXOA 4HVTA 1VCNA 1A04A 1Z6PA 1MXHA 3KWMA 2ZRFA 5G1PA 3BCRA 2IIPA 2Y2VA 5D2CA 3N58A 8LDHA 1W5FA 1F3OA 3V4RA 2J7PA 1U7XA 1MG0A 1R5BA 1RCTE 2VA9A 2ZUCA 3EIOA 3KZCA 1RVDA 3N07A 3OESA 4R7ZA 7REQB 2PT7A 3DBRA 3M8KA 1JEEA 1I80A 2I7XA 1JJ7A 2EGGA 3MVEA 5KQRA 1II8A 3D2CA 3PLNA 1CU1A 1N7JA 4B3XA 5IHPA 3ASYA 2CZGA 1ENPA 2J5BA 1E9FA 1NKTA 3GAFA 3N2NA 3T0GA 3Q10A 4H7IA 3AEUB 3FOCA 3V2IA 1OYVA 5IT9A 2X8JB 4JI0B 3DE6X 1SD5A 3H8VA 1OZHA 2Q5HA 3QFCA 3RASA 5JD3A 3ZJTA 3AY7A 1QZTA 3OPMA 1N6OA 3DP9A 3PEUA 4KZPA 4UTZA 3VBEA 4HDNA 3F4BA 1XVVA 4RIEA 1XQ9A 3G2PA 3HHPA 1GTVA 3ZHBA 1QB7A 2I9PA 4S35A 4MWSA 4WZAB 5AK4A 1WAMA 4YNBA 1ODIA 2Q5EA 2QDKA 1ML3A 2X9QA 3OX2A 1ZD1A 3KLOA 4PQRA 1ADFA 3E7PA 4MUIA 5LJLA 1T1JA 3ZG6A 3UUGA 5BQFA 2FRVA 3KQSA 1H8HD 3BIXA 3FYSA 3I30X 3KKNA 1XC7A 4IIXA 1OILA 1UBTS 2F4NA 4URHA 1OXUA 1U8CB 4NOMA 1T5HX 4DCSA 4YRRA 4BB6A 5AI0A 3RQSA 1TGYA 3RTDA 1CNEA 2QRLA 3WGNA 4LJKA 1JT2A 1HKUA 2D5IA 2FPRA 3UYLA 4KE6A 3N7TA 1ZWKA 1EWQA 4CLRA 1V8PA 4R81A 5I47A 1U3UA 4CF4A 3AB8A 2ZYVX 3GEDA 4ODIA 3SCZA 3JZMA 5A3VA 3RYIA 3VDMA 1GAJA 3KVNA 3C3YA 2C88A 3FYDA 1UT8A 4ERXA 2WJ3A 3E9ZA 3RK1A 1OAOC 1TKRA 3A4IA 3EDCA 1E4YA 4NI5A 4R1LA 4EI7A 1QDEA 1WUYA 5CB4B 2XD4A 3PFNA 4JIGA 4ER7A 4ARZA 4ZTZB 3UAWA 2G07A 2PBZA 3DNMA 4WLUA 3DVAB 1NW3A 2QMQA 3INTA 3QMMA 4M6WB 4UMVA 1MC1A 3RYHB 1V5IA 3PCXA 1W52X 1Z29A 3D6HA 2R6R1 3CMMA 4FKZA 1CUGA 3DPUA 4WZ6A 1Q0PA 1SUIA 4AQYB 2ZJ5A 1W47A 1YC5A 2TMYA 1QGDA 3A6LA 4P8RA 2ODTX 3EBLA 3WB1A 2P67A 4JB8A 4YHBA 3AF4A 4C3ZA 2B7CA 2O0MA 4L4ZA 4DV6B 5C7OO 1QIHA 4NE2A 3WIBA 3IV7A 3ER6A 1O0CA 5HW0A 2AEJA 4ALKA 1YR6A 3SLGA 2PZJA 6AT1A 3ZHZA 2C2MA 4YPFA 2VNHA 1XCGB 1NWHA 1KZ1A 4LZJA 4OIMA 3I9FA 5TMEA 3IBFA 1XELA 1BRTA 2IF0A 4QICA 2C0CA 1JP7A 4HAVA 1KSHA 4NFSA 1U8FO 4B7AA 2NT4A 2BMFA 3NR2A 3EVAA 4G5SA 2EJTA 1PKEA 3VH4A 1CS4C 1QYIA 4DIOA 1LQTA 4Q1BA 1RYMA 3W78A 2EBFX 3E84A 4BJ5A 2YWXA 4CXMA 2AGVA 4N6GA 4OQDA 2NYUA 4Q3CA 4YC7A 1KEZA 2VAVA 4BMOB 1TEVA 3O7WA 1U94A 1A71A 1VL8A 1RYNA 2G77B 4IG4A 3WLMA 1K9SA 4P3PA 2OK7A 2ZP1A 1LF0A 1V4BA 3AOEC 1WF6A 2FP4B 1H2RS 3PT5A 5LQNA 1QHHA 1G6KA 2PYIA 4GG1A 4RH1A 5JFGA 1QR2A 1NF8A 4IV0A 5DP2A 3UO8B 1HDOA 3E9EA 4JR0A 5LYJB 1G5RA 1ESZA 4ZI2A 3GA7A 1GGHA 3AEXA 3LVQE 4ZAGA 5DHUA 3ABSB 1N0IA 1GAEO 3ROFA 4HDRB 2Q6OA 1QV7A 1GPH1 4DMLA 3GGSA 4P32A 1IOVA 1MCZA 1IUKA 1W1UA 5HF9A 1X80A 3OO0A 2J67A 4HTFB 3LWNA 4WE3A 4BMPB 1UC5B 2QUIA 3QXXA 4EDFA 4P38A 5A4DA 4KU4A 3EDOA 1YZQA 5K51A 2HYIC 1EFUA 1LLFA 4KNYA 2C9CA 4CV1A 4ZPXA 1HA3A 3OEWA 4RTLA 5ELXA 4ZU1X 1C1YA 2BEVB 3IV6A 4MA0A 2EWMA 4YCDA 5JI3E 1GPNA 1NW4A 3E48A 4CEJA 1Z0ZA 1OBOA 2I55A 2VHYA 2ST1A 4CLDA 2HF8A 2ALJA 4G84A 4UE2A 2PLRA 2RI0A 3A9CA 1YQXA 2ASVA 3NIFB 3ROQA 5C4MA 1DCKA 2A5LA 4MMZB 3L8FA 1NV8A 3EA4A 3K71B 3CH5A 4RY8A 2EZUA 1OAAA 1RAFA 2HM7A 4YRFA 3TRDA 4HGNA 4RVSA 3RV4A 2XTNA 3T3GA 4JOCA 4PO1A 4TROA 3RUPA 3UV7A 2GAFA 1E94E 1NP6A 3BH7A 3E81A 3KNZA 2WWXA 4GLOA 4B87A 1MAVA 4BVJA 2YICA 3NONA 5AHKA 4J2TA 2ERXA 2Z9CA 1BE6A 4FGSA 1I7NA 3HR7A 4RHYA 3QG5A 4CMAA 1Q7CA 3ET4A 4OQXA 5J5AA 4CG0A 3FUVA 4E1AA 3IOCA 5IH7A 2ZI7A 1ISIA 4HFNA 3EZ2A 2ZIWB 3ORRA 3B85A 3MBOA 1AKUA 3NO4A 4G4JA 5EIWA 3G02A 2WJPA 5JS7A 5K0GA 5A06A 1EFHA 2P4EA 3HADA 2OV6A 1ZK3A 4KQKA 4DMKA 1G60A 3H2IA 1JVBA 4GMHA 3HFSA 2WIJA 5JO9A 2AN1A 3VZPA 1BROA 4Q18A 3ZH2A 5JS8A 3A4LA 4EG0A 2JIPA 1MDFA 1U2DA 3X2SA 3A2KA 3SYNA 2HF7A 3HA7A 1M8KA 4QHSA 1XMIA 5DFAA 3BDIA 1ANKA 5T4EA 5BR4A 1SQSA 3LQ1A 3F96A 5B58T 1V16A 4D9NA 3GI1A 1X7WB 5M3BA 2I33A 3QA9A 3OE7D 3GRRA 4GVXA 4QSHA 5EYPB 5ER6A 5JY1A 3AYZB 1KI6B 2A5JA 4Q4JB 3G8CA 1JU4A 1PZHA 1ZY2A 1NVTA 3I01A 4M60A 1EJBA 4AUEA 3ZVMA 2PHZA 1E7SA 2FZVA 3M6LA 1ISJA 4EENA 2P6NA 3AI3A 4R5MA 5FBHA 1E98A 4F4JA 3NTXA 4LY3A 3JQGB 2GN2A 1E3IA 1X1CA 3DXFA 4DG8A 1LD3A 5NLLA 4M1QA 2R5NA 3AG6A 1MO6A 3L0BA 1JQEA 3LXMA 5EOVA 4H3KB 1YI1A 4JJ6A 2FXVA 4A2CA 4J1QA 1T3TA 4YH1A 2F43B 1RWQA 4N0DA 1L4UA 3NBFA 3T41A 3ZDDA 1OLOA 5CJJA 5F7ZA 3BFVA 2GILA 5TQ2A 4ALJA 2CCKA 3CHYA 1K89A 1VC2A 2Q8QA 3DBVO 3R6GA 4MYDA 3C6QA 2C2BA 1V11B 1SC1A 2HA4A 2XCIA 1J6UA 1DAFA 1FTYA 3LHDA 3LCUA 4KXQA 3GRVA 5LA6A 3J7TA 1ABBA 3DMGA 4D0NA 3DEFA 1ZVKA 1R8XA 2R1VA 3RAFC 1A7AA 1DMSA 4GPD1 2P0YA 1E9SA 2HQSA 2ZUDA 3CO5A 4NMWA 4A5OA 4AM8A 3NTUA 4MR7A 5EIBD 4AI6A 3T0IA 4WESA 4WJZA 3QEKA 3IUQA 4OSEA 4COOA 3PFCA 1D2EA 4LK3A 5KNDD 1IBKB 3Q15C 4UUNA 1JILA 1SJ9A 3IP3A 3FRIA 3IALA 3L0YA 5E1OA 3OT4A 2CY0A 2JIQA 2JH8A 4QU9A 1MJNA 1GYQA 1RPZA 3OEED 2VAMA 4UNPA 1K9VF 4F5YA 3AHIA 1CNMA 2XDAA 1THZA 3R9XB 2AX3A 3KZ1E 4LJ4A 4Y6GB 1CDDA 3QKRA 3DE1X 2Q5QA 3LD9A 3K53A 1JG4A 3M1LA 5BSTA 1VJTA 3V2HA 1IHXA 5CBKA 5JMWA 1SC6A 1SD2A 1DIAA 3HB5X 4Q3EA 1SIWA 1OT3A 4N4AA 1LX6A 3R9XA 1V8FA 2BE7A 4N40A 5JASA 3K1TA 3PDHA 2AVDA 2CVZA 1DE0A 1TMOA 2FEWB 1XXHA 2VBIA 2FUG6 3ADOA 3I4FA 2RKOA 3LBIA 4IHAA 4E2FA 1BDJA 1EHCA 3MGBA 2IWRA 1FU8A 3F3MA 3AHJA 2RONA 3TD6A 4F46A 2YR0A 2A57A 3GBSA 4YRMA 4N5NA 4HNVA 3ZJUA 1R10A 3QMVA 2F3QA 1A7UA 4FZRA 1CB0A 2G9RA 4DQ0A 5KNBD 1QQTA 1UKAA 4JWKA 4MWTA 4NABA 1E0DA 2W70A 2LNDA 1BS9A 1TVCA 1HRDA 2ODEA 3GLRA 3HNRA 4DMRA 4XPIB 3R75A 2PMFA 1V8BA 3J80A 1TIPA 5CT6A 2AQIA 5IBCA 3GYGA 4FILA 4ZFNA 4RANA 4G1EB 3LLVA 4FK8A 3RFXA 1C9NA 3CJRA 4DA9A 3EZ9A 4BMYA 1U7OA 1ZMBA 3H5OA 1PFYA 3KQYA 5CNJA 3BULA 1UR5A 4IDAA 3IUNA 3L0SA 2PBLA 4UHDA 3FLBA 3LVBA 3ZI7A 1RXIA 4MYCA 1PQYA 5DU2A 3K0SA 1LW7A 2HPVA 4OX9B 4OI2A 4CMKA 2H7VA 1EFKA 4BE7B 3KOYA 3RTEA 2E18A 3DZCA 3GVHA 1E5QA 1XCBA 3ANSA 5JSZA 4OKSA 1TPZA 3V1NA 2MJLA 1ISHA 1UBCA 3BPSA 2PZMA 4RPIA 4D9CA 1N5JA 3QNMA 4HXFB 2IHBA 4W8OA 3GN2A 4JROA 2QRQA 1THMA 4F4IA 1QMGA 2VKTA 3NUGA 1J9ZA 1LTKA 2DFNA 1GCIA 5FOSA 1HE3A 3UC9A 1WSWA 1OXBB 2D2FA 3RYFB 4CTNA 1QE5A 3LCJA 3G0HA 1KVRA 1XX6A 1ZW6A 3C1TA 4Z99A 1K63A 3IMEA 1XVLA 3DZFA 1M1YA 2XT9A 2I4IA 4GH5A 4W5JA 3WLEA 4OMCA 1EFAA 3TPFA 5IUJC 4QRIA 4YCAA 2DCMA 3VO2A 2A0XA 2O0JA 1OKKD 2RARA 4RVFA 2JIBA 4L4SA 2Q1TA 1XRJA 5DYYA 4Y6SA 4G63A 1NY6A 3RS5A 3TTTA 3ZI4A 4HNSA 1RLUA 1N7GA 2HBYA 2JC3A 3FTNA 1OI4A 2RHDA 1E3MA 4QC2A 3OZUA 2HLNA 2EG5A 5LSAA 1A5AB 2OXCA 3H1AA 2NNWB 1XJWA 3ST7A 3WYAA 3T5AA 1QPGA 3VVLA 2CVOA 1UXGA 2VHCA 3P7MA 4KPGA 4HWGA 4P0TA 3R8XA 1SVUA 3AJRA 4PGGA 1T2DA 2PMWB 4NFLA 1T9CA 3BAZA 5C2JB 3JZIA 3NAQA 3D1LA 4R71A 3K09A 4CFYA 1MHTA 2G36A 2XQIA 3NOOA 5CDFA 3A28A 1O5IA 1WM1A 1YU9A 1X1AA 3C5HA 4P4TA 5TC4A 1Y98A 4ABYA 4ZKDA 3AMVA 3KAJA 4ZD6A 3AFHA 3GLFA 2J30A 4IINA 3R5XA 5EHNA 3PNMA 4FCWA 2IIQA 1NOJA 2MDTA 3AM5A 3LECA 3VO1A 1YS4A 5BW8A 4IP0A 1BSVA 1HFKA 1Q3HA 2QAGA 1ZRNA 3EGDB 4BE9A 3DP7A 3WIOA 4C4ZA 2CSUA 4YMVA 3WBJA 1Y3IA 3GZ4A 4U2DA 4O25A 2Y9MB 1TA4A 1RM0A 2G88A 3QQ5A 4MWDA 4U5XA 5BN3A 1QO0D 1WXQA 4YEDA 1SQ0A 4HMOA 4FMDB 3UMSA 1R3UA 2H5IA 2PMDA 3I2GA 2HJGA 3PP8A 2OGZA 3A9WA 1YZNA 1ORDA 2ZYHA 3IKLA 2A0WA 1LPBB 3QVGA 1FP1D 2BEJA 2IHKA 3NP9A 4ZCSA 3ZV7A 1A8HA 1Z5NA 3CZPA 4EBFA 5TGDA 3P9XA 1MA0A 1RACA 3EIWA 4WFJA 4ZGGA 1WOMA 3ONDA 2JPDA 3R0JA 1PNOA 2Q9UA 3CN9A 2ZBFA 3FIJA 1BVUA 1MO5A 3LPLA 1D9ZA 2XNCA 2XB6A 4GRAA 5KWEA 1NOKA 4AROA 1IJFA 2O8CB 4BWYA 1J99A 4DC0A 5T7BA 2XVXA 2RK3A 3FAKA 5I9BA 5CA1A 3CUEF 4YMGA 4FFMA 5J3JA 1VE6A 3EPJA 1CWUA 1LPPA 3FMIA 2HSWA 3DOCA 4QDZA 3HB0A 4M1OA 5FBZA 4I5DA 5TS2A 4QLAA 3SZOA 4X7BA 2AK3A 1W5EA 2IPLA 4BFVA 1G2OA 2I7DA 2OUIA 3DZKA 4H35A 4E2XA 4G4SP 3HG7A 3L8CA 3IDAA 2OV4A 1OLUA 4IOKA 5EWMA 5T4BA 1U90A 3BYZA 1CLUA 5K3EA 1RHRA 2QNIA 2NSLA 1L4BA 2DUNA 4NJMB 1IN4A 4G5OA 1XTTA 2IZ7A 4P35A 1QLHA 5G0SA 2NV0A 1MB0A 4TZTA 2E6KA 4R7TA 1H2XA 2DQZA 4FMBB 4QQFA 5J63A 1LK7A 2Y27A 4OREX 5CFOA 2TMDA 3B6KA 1W0CA 5CFNA 3BMOA 2J4FA 2Q6VA 3ZI0A 1OXXK 4WWHA 4BV8A 4YPVA 3QI2A 5K20A 4RJJA 3GHHA 3FJ1A 2I8AA 2GK6A 1SHUX 3MTBA 4L08A 4P82A 5EGSA 3GCGA 4MIKA 4AZWA 4PAOA 4PGMA 3X43A 1AZTA 3BIFA 2FDCA 1P45A 4OV6B 4FEGA 3FSGA 1C7ZA 2D2VA 2OYRA 5LA6B 2RBGA 4RS3A 4XX0B 4A0GA 2YJ6A 4EF4A 1FIUA 1AG9A 4YAJA 2OCGA 3GCWA 1CJTC 3SQMA 2CK3A 3EJWA 1S0UA 3NHBA 3TGWA 2REQB 3PWTA 4F1WA 3DM9B 3R4VA 1LDEA 1D09A 1KYIA 1FPMA 3PDWA 1JG1A 1W48A 4DSTA 3QQPA 1O2DA 4RF5A 4WRRA 4RSHA 2FN8A 3KT3A 3I72A 4QDJA 2ZKLA 3TLJA 3I2FA 1U0LA 4CMIB 3EZFA 4FYVA 4MJXA 1MN6A 3HCEA 3B6IA 2FB9A 4TLBA 3TE7A 3T3EA 5JBIA 3QKSA 3DMHA 1SQ6A 1V1MB 2QN1A 2C7GA 4TS1A 5EEGA 3II6X 3X1YA 3CE9A 3G0CA 3PL5A 3V1LA 3Q87B 4EY7A 4G5RA 4G0YA 2PX6A 4BLRA 1N0VC 3TL6A 3GLHB 3JYLA 4CM3A 2XMDA 3K35A 3PUYA 3VQTA 1SVSA 3RW9A 1I2AA 3MS7A 4L76A 3NHYA 2JCVA 1PQWA 2ZBGA 5F52A 4I8XA 1YULA 4F06A 2PSEA 3DL2A 5DE3A 3ZJ4A 4W9RA 4PXSA 3TDMA 5AK6A 1L7DA 3TZKA 3OQIB 1QF6A 2FMKA 2Q9BA 3M4XA 1FB5A 3GRFA 1E8NA 1M7HA 3OLQA 3TRKA 4WOKA 1XRQA 2ZVQX 4KVFA 4WZAE 4EJSA 3EGCA 2FJPA 1NDHA 3QVUA 5EESA 1ND5A 3TTXA 1LJUA 3AVTA 4ZVKA 4MUEA 2D0IA 3C85A 3UMRA 1XLUA 1DC5A 2CVPA 4BNXA 5I45A 2B1JA 3NPAA 3CF0A 3PRKE 2DHRA 2FPKA 1PQ4A 4GBJA 1NYLA 4FYKA 4ZQFA 2DR0A 3IEXA 1TJ3A 4DHWA 1CJBA 1IEWA 1NZFA 3KJHA 3NBQA 1Q7BA 2UYGA 4ZDKA 2PEZA 1NQUA 5TPZD 4DM3A 2Q49A 5I6DA 3HJNA 4FFSA 3T99A 4UTRA 1OB2A 4ZI5A 3VKWA 4CQLA 4WOPA 3A3PA 1EVEA 4MNTA 4ARIA 5GONA 1QIGA 1Y89A 4HZUB 4L16A 1Z8DA 4LJ6A 4QFMA 4E6EA 2PL3A 3JRXA 4TKVA 3ITEA 3E5HA 3IMFA 5HYVA 5JPDA 1HYQA 4MJLA 2C20A 1BWQA 4FN5A 3E5MA 1CR4A 1IC6A 2EDCA 4GR5A 4RA6A 1KAOA 2DWPA 1RI5A 1Y0BA 1AV7A 5HG0A 3AWDA 3DUFB 3SF0A 3VZBA 1QE3A 3F49S 3RIEA 4Z3KA 3DMFA 5AVQA 1IHPA 3LKDA 3PHJA 5ALSA 1Q6ZA 2H1LA 3RJZA 3TPZA 5KVVA 1D7OA 3HSYA 5LLTA 2FOXA 3EIFA 1F51E 1UXJA 3GJSA 4UNQA 2RGXA 3N2YA 1JTVA 1R5NA 1TVEA 4LY0A 2HJWA 4ZHQF 2W8ZA 4RTMA 3FNHA 3OM0A 3ZTYA 3LYHA