2BKUA

Kap95p:rangtp complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
169
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Nuclear Import Complex Dissociation by Rangtp
pubmed doi rcsb
source organism Canis familiaris
molecule tags Nuclear transport
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
total genus 47
structure length 169
sequence length 169
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bkuA00
3MJRA 4G5SA 4Q19A 2ASEA 4AIIA 2GA8A 2N46A 3WNDA 3IHWA 2J7PD 1HE1C 2O8DB 1W4AA 2QMOA 4NHOA 2D74A 4BFVA 2HYIC 2QBYA 4G5OA 5JSZB 5CJPA 4FIDA 4KBGA 1ZC4A 5TVKA 2HYDA 1SVIA 2CK3A 1NMXA 4NYJR 5DHFA 1AS2A 2NO9A 3B6EA 1BH2A 2EU8A 5JRZA 2FA9A 3AP1A 1OHHA 2CL7X 3AB3A 3R7WB 1BKDR 1MRSA 3CX6A 4Q48A 2VHCA 1E1QA 3OEED 1G7SA 1NBMA 4LI0A 1A82A 2C78A 3MUFA 4V0LA 2QGZA 4ZPXA 2WJJA 2ZS7A 1J8MF 1ONBA 3HU1A 4AYTA 3K0AA 1XJCA 4MDEA 2GXUA 2H17A 4KVGA 5GVSA 2IXFA 3N2IA 4LJ7A 5E7JA 1SGWA 3RABA 5FR2A 3PVSA 2YOFA 5FBLB 2IS2A 1OV4A 3SNHA 4FN5A 1TTTA 2YYZA 1TEVA 4OQXA 2EVWX 5IK2A 4QG7A 4A0HA 3SI7A 4Z8YA 3CR8A 1HEIA 4IEEA 1Z0JA 1AGPA 3LX5A 3AKDA 1QHXA 5H8WA 1UDXA 3BH7A 2REBA 5F2EA 1OXXK 4JJZA 1E94E 2QQEA 1OH8A 2ZJBA 4QFMA 3QBVA 1GZSA 4PTLA 2C99A 4URUR 5C2JB 1J2JA 4PQRA 2OBMA 5FOSA 1X1RA 1EX6A 4DEXA 5KDDA 3I62A 3KXIA 1PUJA 1MO6A 4JL6A 3TR5A 1E0KA 4AK9A 3EXAA 3FFBA 1E2IA 4QGFA 5FTLA 2CMKA 3TSWA 2BDTA 3DOFA 1P5ZB 2IX3A 1PLKA 1XPUA 3KFVA 3QJYA 2G1KA 4HB2A 3FMOB 1KJYA 2WM9B 3L0OA 4TQAA 1DS6A 4IVQA 3T35A 2A5JA 1VCNA 1A1VA 3T34A 3QKSA 4C4PA 3KQKA 4BWYA 1MOZA 2FX3A 2JLUA 3LBNA 2CNWD 2JLRA 2IL1A 2ANBA 3ASZA 3FHOA 1YZTA 5KDLA 3VR1A 5J4YA 2IUTA 3PIRA 2KWIA 1JECA 2ZI3A 4DDTA 1G18A 4P31A 2Q9CA 3IQWA 5KUTA 2J0VA 2DB3A 2WIBA 2IEYA 4DB4A 4OKSA 3AQ4A 1AQYA 1CR4A 3EZ9A 1SKQA 1ZD1A 4BECA 2J59A 4ASUA 3DMDA 1P73A 3T15A 1BYIA 1E0SA 1ZM7A 4ZCLA 2A78A 4Y0AA 2OT3B 3LW7A 2JLZA 1E79A 4JSTA 3TQCA 2A30A 1E9SA 2WWXA 3QKTA 1WP9A 4GOKA 1Z6XA 2C03A 1H65A 1EXMA 1UKVY 2VP6A 3W8RA 4D0NA 2UKDA 1CF4A 5B2ZA 2W6JD 3QXHA 3P32A 1R6BX 1H8HA 1TPZA 1Z63A 1UBGA 2QTFA 3IQXA 4PHFA 1E96A 121PA 3UANA 3N5CA 2C9OA 4GP7A 3VKGA 5B64A 4B6EA 4JLMA 1Q0UA 4LRWA 1S8FA 3P20A 3TGPA 4Q4AB 2AD1A 2FEOA 1KDOA 1XD2A 3B1VA 1VCIA 5TDHA 2LWIA 3OIVA 1I2MA 4C0JA 1FTNA 4JJKA 1S2MA 5AR1A 3R9IA 1E2GA 2QP4A 4JL5A 4LUCA 5SZIA 2CXXA 2ZJZA 4KFSA 1N5KA 2DHRA 4F4IA 2H16A 2FZ4A 4ZIRB 4V0KA 4B35A 4E5UA 2HLDD 5C4MA 2BMEA 3QEOA 4IDPA 1KY3A 4AYXA 2EFEB 5ELXA 1VCOA 1G3RA 1MT0A 4BLRA 1WMSA 2KE5A 3W5JA 3AF1A 4KYUA 2VSFA 2WOJA 4HAVA 2D62A 1WBBA 3P4YA 2BBOA 3QXXA 2RGXA 1HE8B 2AKYA 1XPRA 1XD9A 3CR7A 1WDTA 4KLZA 4AI6A 2WHXA 3K0EA 3PUYA 3KKPA 1P2SA 4HAWA 1JJVA 1RYFA 5FOWA 3FKSA 4B3BA 2RMKA 1DO2A 1NVUQ 4C0LA 4JLJA 2OBNA 4D0LB 1GRRA 2QENA 3IPYA 2C9YA 1X86B 1GKYA 1G7TA 4LHXA 5AUQA 1N3BA 1T5LA 1GILA 2GJ8A 1VKJA 4LGMA 4DLYA 2YZ2A 3KFXA 4JLPA 2X2EA 1XEXB 3I8XA 3WMGA 1PV4A 2BM0A 4TZ6A 5KNBA 5FI0B 1FNNA 2GJAA 1KZ7B 1X8KA 2H7VA 2ZREA 5JBQA 3TSZA 3LVQE 4NCKA 2QE7A 1KO4A 2DFTA 5DN6A 2P3SA 3AV0B 4MYUA 5KSPA 4RKFA 2Q3HA 2CK3D 3VHXA 3P1JA 3BFKA 2NIPA 4DBLC 2IA5A 3SU8A 5TXGA 2IW3A 3AEZA 1N6OA 4KFTA 4O0MA 5EXXA 4EPRA 4D4JA 2EWWA 2V6IA 1OIWA 1FX0A 1TADA 1KI3A 3CH5A 1KI2A 2FFBA 5SZKB 5AUPB 1W5SA 2DWQA 2GZAA 1C9KA 2QAGB 2VLIA 1OT3A 3RS3A 2X8AA 4A9AA 1W2GA 1TF7A 2NQ2C 3GJ8A 5E95A 1GRNA 3HWSA 3BS4A 4G5RA 2NG1A 2V7QD 3NBFA 3RS4A 2C04A 3QUSA 4NU0A 4OHZA 1CIPA 1H8EA 3ZIAA 4QJ3A 2Q9AA 3K0SA 4LHWA 3BRWD 2GCPA 1N0UA 2FSHA 1W0JD 1JNYA 1SXJA 1ZD8A 1P2VA 4E22A 1XRJA 2WMNB 2ZRNA 3LH5A 1W36D 2VEDA 5GADl 3GLGE 2VF8A 4DIDA 3LQQA 1KO1A 4BGDA 1XU4A 1D2NA 2BHRA 1C4OA 4NTZA 3LWNA 2Q21A 2GEUA 1N0WA 2ZRMA 5BYKA 2WVJA 2VSOA 1B23P 2WSSA 3WP0A 2TMKA 2GCOB 4AURA 1KSGA 1A5TA 3C15C 4ESHA 3CZPA 4LV5B 3KKOA 4DRZA 1LVGA 1CJMA 2GJKA 3W5IA 5F3WB 1R2QA 3Q72A 1O3YA 4ZKEA 1HURA 1QRAA 4KSCA 2R2AA 2YJTD 4TYNA 1OHHD 2AFHE 4WZ6A 1JAIA 2EWVA 3Q9LA 3MAAC 1ZM3A 4OQFA 1C1YA 2X2FA 3EIQA 2ZR9A 4KI0A 4F91B 1UEJA 2XB2A 2ZYTX 3GEIA 1WF3A 4B44A 1W46A 4BUJA 3PENA 3L2OB 1ZC3A 2ZITA 2XOKD 1Z6GA 4Z54A 3KB2A 2JLWA 3U3KA 1I2DA 3B8HA 2X1VA 5FR1A 2XSZA 2DR3A 1R10A 4IDOA 3I3SR 2FFAA 4GI7A 1E9BA 1J70A 2V6JA 4DT1A 4G1UC 4LJAA 3QSYA 1CJTC 4OQNA 1E2DA 2ZEJA 1XZPA 3P26A 4UJ5A 4CEIA 1FW6A 1XD2B 3B60A 1HYQA 4PC2A 1W4RA 3REGA 1Q1BA 3VQTA 2YC2C 4D2IA 5D3MB 2XZPA 2PT7A 4MKIA 2ZE6A 5J4LA 4TMKA 4M1KA 1GP2A 1KO8A 4KU4A 1ZU5A 3X1WA 1TX4B 1CJKC 2ZUDA 1K6MA 4US1R 1SVWA 4OK3A 3U5ZB 4U7DA 3KQNA 1N6RA 3MWKA 5BW8A 4CDGA 4QRHA 1OE0A 2HUPA 4CEHB 2G6BA 3SHFA 1YR7A 2NPIA 3SEAA 5F98A 1AN0A 4GPTA 1W48A 4RZ3A 3DMNA 2ZUBA 2CJWA 4JLAA 1Z83A 5FPTA 1Z0IA 4EPVA 2OG2A 5CIQA 3NC0C 2NTYC 2VSXA 5AJWA 3QPWA 3RS2A 2GVDC 1KI9A 5CB8A 3K53A 3CF2A 1ZW6A 5EZ5A 4G0NA 2RCNA 1G4UR 1N6KA 5G3YA 1XEWX 2PLRA 4IDQA 1SULA 2FFHA 4M0LA 2GEVA 4BZQA 2V8OA 3CRMA 1UFQA 3MRSA 4TQUS 4M22A 4L16A 3CLVA 1KI6B 3AVPA 4A2PA 4UXIA 4LDJA 4QGAA 1NMZA 1TQDA 2E87A 3CWZA 2F9LA 4TLDA 3H4MA 4IDHA 2PZFA 2P6NA 1XZQA 2YINC 521PA 2NOAA 4M1OA 2G77B 3CUEF 3NH9A 2J0UB 4KV9A 2H18A 5GJWC 1AA9A 4UQOA 3WY9A 3GLFB 1SXJB 3VKWA 1E2LA 4JKIA 4LBVA 3O8RA 1T3HA 1YZNA 2Z4RA 3FTQA 3GFOA 3LD9A 4GZMA 4JZKA 4EPYA 1UAAA 3T1QA 3BD9A 3TNFA 1NNEA 4GOJA 3U3RA 3OAAD 4EQ6A 1NN5A 4V03A 4LJYA 1MRNA 3KB1A 3EPJA 1SVLA 5B30A 4ZDIA 2HJVA 1KI7A 2IYVA 4O2RA 3HU2A 1OIXA 3LNCA 3Q5DA 4LPSA 4Q9IA 2IUSA 3U4QA 2FN4A 5EZ6B 1F2UB 1U90A 4LK2A 4P3YA 1OPXA 2W2VA 3TH5A 2D7DA 1RRGA 1FQJA 3VU9B 3EASA 4C7OA 4Q4HB 4TMXA 3SFVA 2QBYB 4Q5IA 4MRNA 3TUIC 3J81k 1GUAA 3Q7PA 5AUOB 2REXB 3I73A 1P9RA 4FMCB 1BOFA 4J0QA 4HZUA 1TQ4A 4MGKR 3OIWA 2QAJA 4PZYA 1DADA 3BIFA 1KTVA 4LJ4A 3GEEA 5KSYA 3FHTA 4A92A 3CIOA 3T61A 3KKNA 3KUCA 4URYR 1M6NA 5AUNB 3UKDA 1L7VC 2XSZD 3PG5A 1R5BA 5EXSA 3KUDA 4PANA 3TUZC 1HT2E 1TL7C 2QM8A 1Z5ZA 1Z0KA 3F3YA 5CB6A 3K70C 2IYWA 3ASYA 5EE5B 2XNDA 4DSNA 3KL4A 2IF2A 4FMCF 3HJNA 1G6HA 3KTAB 1S9HA 3SYNA 4MITA 4Q4AA 2RGCA 2XJ9A 3QPUA 2ZANA 1NP6A 5C18A 4HZIA 1F2TB 3IGFA 1XCGB 1YZGA 2IWHA 4Z1MD 4QOSA 3A6PC 1G5TA 4MGIR 4A4DA 4G5QA 4ASUD 2B21A 2F1JA 4MUBA 3IHLA 5FOXA 4XH9B 1PLLA 3QY0A 1F2UA 4M2LA 4US2R 5HZHA 4OK5A 5HE8A 1I4LD 2D4HA 3WRXC 1CBUA 1QHGA 2BEJA 4L9WA 3TKLA 4Q9JA 1ZAKA 5JRJA 2UZIR 4BLPA 4Q01A 3LO5A 2P5SA 4JSYA 1G3MA 2YWHA 4BFXA 3C4JA 2AXPA 4M1WA 4ZI3A 4DVGA 4Q1EA 2ZTSA 2OV2A 4CZ2A 4EAQA 4W7SA 1R7RA 2V1UA 4OK6A 2CE2X 2BOVA 3A4LA 1NLYA 1N5IA 3WMEA 4IRUB 2WWFA 3D31A 1SXJC 4ARZB 1OW3B 3ZYCA 2W6JA 1KK3A 1G1MA 1TUIA 3CZQA 3HPRA 3X1YA 1G9XA 4A0GA 3RANA 1LNZA 3GJXC 1XXHE 4UNQA 1JR6A 2EFCB 4L5BA 3KTAA 5J47A 2V4ZA 4H1VA 2V1XA 4HLUA 5TMPA 1YRAA 2QEQA 4N1AA 5DI9A 4KJZA 1OH7A 1DARA 1QHHB 1QHIA 2J1LA 3OFND 4JBYA 3T1OA 3QXSA 4D81A 1DAKA 1NJFA 2MMCA 4IOJA 1XCMA 2XEXA 3TUJC 4IFBA 1P72A 1G5PA 1G5RA 4Q02A 1UBEA 3I1FA 4WAUA 5J4KA 3I5YA 2FDCA 1NG1A 1XBTA 3KJGA 5GJVC 5LB4A 2CLSA 1KDRA 2OFOA 3A8TA 1KJZA 1M1YE 3ZGXA 3THYB 2DFLA 5EXPA 2CL0X 2WWYA 1P60A 1VMAA 2BMJA 4NDZA 1NBME 2J7KA 4Z8XA 2ZRHA 3W8NA 1SQ5A 3ZDQA 4LY6A 2ZSEA 2C2HA 1T6NA 2RGDA 2YWGA 4LJ5A 1OH6A 4DHEA 3QOFA 1D8TA 1TQ6A 2DCUA 2XZLA 2JJ1D 3BORA 3IEVA 2ZROA 4OHXA 4MYTA 2C96A 5HTKA 2A7QA 3QPVA 3NDBB 3GLIA 2V55B 2ATVA 2OM2A 2RKOA 4A6PA 1X8LA 1IQPA 721PA 3QQ5A 3OE7A 5KPDA 4A15A 3CONA 4KODA 1VYVA 2WV9A 3CBQA 4DSUA 2FSFA 4F4JA 3EZ7A 2O8BA 4RY2A 1US8A 4UJ3A 2LCFA 3WP1B 5LD2C 5G53C 3AF2A 3AVOA 3CPJB 2QTHA 4URZR 1U0JA 2CE7A 2FJUA 1H8HD 4ZDWA 4AKEA 4IJMA 3CNLA 1E2PA 2B8WA 2V54A 2W0SA 4C0KA 3DKPA 2BMFA 2RGEA 1VECA 4LOAA 1GKIA 3C5CA 3EIHA 4XTCS 1JALA 3KXLA 1WBDA 1N6PA 2EQBA 4M53A 3FMPB 1RRCA 4AKGA 3IPXA 4PHGA 3LBHA 2BM1A 2XOKA 2ZS8A 4PC6A 1OXSC 4ILEA 1VYTA 3RNLA 4PC3A 5DNYB 3GLIE 3K70B 4B43A 3BJIC 5J5CA 3FOZA 1ZNWA 2B7CA 4DLTA 2Q6TA 1Q22A 4W5JA 2VTKA 1RYHA 3BFXA 5EP2A 1DELA 1L2TA 4IVRA 3TVTA 4DCTA 5JJKA 3BOSA 3SQXA 1N2CE 3RYTC 1QF9A 2FSGA 3K0CA 5JSZA 1PLJA 2RGAA 4GFDA 2ZJ2A 3VR4A 1OB2A 3PEWA 3X2SA 4HEJA 4M21A 3EG5A 1Z28A 4UNSA 4B33A 3K0FA 1E9EA 2WIAA 4M1YA 4LV8B 1YU9A 5BYJA 4TMWA 3UK6A 1OH5A 1Z08A 1B0UA 3X1ZA 1MABB 3JVUA 2CLCX 3QG5A 1E9DA 1NRJB 1KAGA 2CL6X 3ZIAD 2GILA 2RHMA 3SBEA 3TE6A 1PJRA 1F5NA 2ODEA 3QF4A 4P0TA 5DI3A 1SXJD 4YMVA 3U44B 4F38A 2WTUA 4U02A 5ANRB 4TYWA 2FMXA 2PX3A 1YE8A 2QTVB 1E2NA 2H5EA 3RSOA 1E9RA 4CEJB 4GOXA 3HU3A 1E2MA 2VPPA 4W9MC 1WB9A 4JLKA 3GLGB 4DLSA 3IDQA 3C14C 1VG0B 4I1SA 3WXMA 4X8MA 2WKPA 3M1IA 5L3SB 3BFVA 2R6DA 4I81A 2GRJA 4P4TA 1GG2A 5HE9A 3U60B 4HB0A 3ZLJA 4YDSA 3GP8A 5B58C 1TMKA 2Z5FA 3W9YA 4HUTA 3FMFA 4A0FA 4AKHA 2VHUA 2HJGA 2FEMA 2IYSA 3LLUA 2CJWB 2F9MA 3P4XA 3HPQA 3SR0A 2EYUA 2WBLC 1LS6A 3E70C 2JIZD 1Z8FA 1CKEA 4PFSA 3HR8A 5EP3A 2FWRA 4FCVA 1HUQA 3OIYA 4LJ8A 5KTYA 1UDWA 5CIWA 5TARA 1Q1QA 3ZQJA 1KZGB 3QF4B 4QGGA 5DI3B 4B47A 4Q7KA 1KDTA 2CNWA 1E2KA 1OKKA 3QNUA 3E2IA 3ZVLA 5HR5A 1DPFA 1R5OA 3BERA 1QHHA 3GFPA 3X1XA 1QVAA 4GZLA 4QNMA 2CHQA 2GNOA 1KK0A 2ZI5A 3ND9A 3DEFA 3A1SA 5HZKA 2JA1A 1E2FA 2ZYUX 1W0JA 2ZU0C 4Q7JB 4FMBB 1KI8A 1XMJA 3DDCA 1P6XA 4Q03A 1LY1A 1M8PA 1U99A 1GAJA 3TLXA 3U3JA 2WOOA 4CEIB 3TK1A 1E2HA 4TYPA 2ZM5A 1II9A 4LC1A 1SHKA 3QEJA 1P3JA 1U81A 1I4TD 3UG6A 2ZRCA 1DE0A 5G3ZA 1R8QA 2GCOA 1OFHA 3TVDA 1EWQA 3DM9B 3PR1A 1G3UA 2D7CA 1JXOA 1CJUC 2VHTA 1W5TA 1Y63A 1E3MA 2IF0A 1FOEB 2GZDA 1LTQA 1CS4C 2AK3A 4RD6A 3CF0A 2WKQA 4ZDKA 2J0SA 1SVMA 3S1AB 1S9DA 2WJVA 3TW4A 1XPOA 2NZ8A 2F6RA 1F60A 2B6HA 2ATXA 3SYLA 3THWA 1XJQA 1YJ5A 4V0ME 1LV7A 1R0YA 2VP5A 3RS0A 2LKCA 1G291 3IKJA 3WYFA 1LF0A 5JWOA 2RAPA 4MGYR 1TUEA 3QENA 3P27A 4IVPA 4AD8A 4LHYA 3C5HA 5FI1B 1O87A 1OF1A 3SFZA 2BV3A 4GSYA 1IY2A 4PX9A 1J8YF 1N5LA 2ERXA 2SHKA 4U00A 4HLUC 2ZPTX 1KGDA 3U6BA 4C2UA 1CP2A 4OI2A 5LD2B 3T12A 5J4HA 4AYWA 2ZRGA 1PVOA 4MKHA 4BFUA 2K5UA 4TL7A 5FPSA 1D2MA 1Q3TA 1P61B 3A1VA 3K9GA 3PJRA 3GD7A 2F43A 3B82A 3GLGA 1XEWY 2JLXA 1D2EA 2AKAB 4EJSB 1DAIA 4RD3A 1SZPA 5LDDC 3FPAA 1XMVA 3EARA 2XAUA 4TN1A 3QKSB 4DIEA 4BEJA 2AHOA 3ZD7A 5CITA 1MH1A 5LBIA 3AVTA 3H84A 1MABA 3MD0A 2UVQA 1QHYA 1GNQA 4PQFA 1GL7A 2QNRA 4PAMA 1NKTA 3SHWA 4JBXA 4DCNA 5L3RA 1KO5A 2AN9A 4BLQA 1KI4A 3W90A 1S1CA 5CM8B 4GMXA 1ESMA 3D7MA 3BBPA 4HAUA 4MUAA 1HY3A 4HUQA 3SS8A 4QGHA 3RDPA 3THOA 3WRYC 2WZQA 1N6HA 1WCV1 1Z0FA 4TL6A 3ZD6A 3R9XA 1EFUA 2VL7A 5TB5A 3FDIA 4B71A 1WE2A 1RE0A 2NO6A 3M0EA 4TSFA 5EJEA 2JJ1A 4OHYA 2E9SA 1KMHB 2MSEB 3LQRA 4KFRA 1DVRA 2ZRLA 3IUYA 2HDNB 4B34A 4Q9KA 1D5CA 4B3XA 2NMVA 4P33A 2BBTA 4EFNA 3GQBA 2QN6A 4OQLA 1JAHA 1FMLA 2IS6A 1EWRA 1VCMA 4B2LA 4KVAA 2DWOA 2QSZA 3ZZUA 5J4VA 5JJIA 1KK1A 2PT5A 4NE2A 2FV8A 4TL8A 4A6XA 3K0CC 1QDEA 1NLZA 1TF5A 3CKLA 1NN0A 3Q3JB 1CLUA 1MO5A 1ZNXA 3KJEA 4Z51A 3TAUA 4M9ZA 1Z3IX 4OI1A 1WRBA 1TU3A 3OIUA 1NIJA 1TQ2A 1VG9B 2Z6VA 3B85A 3MSXA 3AGQA 4RZXA 4DDVA 1KDPA 2QQ0A 4HB4A 1RZ3A 1U94A 2BJWA 1RRPA 1EFCA 2WICA 3NH6A 4GDFA 2BIFA 2PLFA 1BIFA 1XTSA 4OQMA 1UEIA 3SC3A 4DZZA 3DO6A 3I92A 1KJWA 2OZEA 3ZVRA 4IFEA 2NGRA 4R9UC 3AP3A 3FKQA 2J5XA 1N25A 1VTKA 2R6GA 2W2XA 2FSIA 821PA 2GXAA 2RB4A 4Q66C 5GJCA 3UATA 3UMRA 1US8B 1XP8A 2PMKA 5E3HA 1AZTA 1II8B 1ZNYA 1GWNA 2GKSA 4E07A 4IW3B 1JR3E 3LVRE 2P6UA 2RHDA 3CRVA 1SXJE 3QXJA 2ZI4A 3EIEA 3SDZA 3CWQA 4CYMA 2HCJB 2W6ID 4WXRA 2WJGA 4PZZA 3MWLA 2AXNA 3BH0A 3L0SA 4FI3C 1VIAA 5CK4A 3NG1A 1GSIA 4C3ZA 4LBZA 4B76A 5FPHA 4QHYA 1ODFA 2FG5A 4OHWA 1W0KD 2GDJA 1JPNA 3OEHA 1DAHA 3CRRA 4GL2A 4N0DA 4NCJA 4UNPA 3GPLA 2Q0HA 3IIJA 3EWSA 1IN5A 1T0JB 2WWHA 1LFDB 2CCJA 3H86A 3O8DA 4HAZA 1JPJA 1NJGA 1T8UA 5FL3A 3AUXA 1UF9A 3T06B 4EIWA 3A37A 2GJSA 3ZZTA 1BS1A 2I1QA 2MMGA 3BB4A 2X77A 3FFAA 4FWTA 2R6AA 3EWAA 5BN5A 1IBRA 1IN6A 4OI4A 3U2QA 1H8ED 3A4NA 4YMSA 2ZYVX 3SJBA 4DLVA 4LJ9A 2QT0A 2NZJA 3AVXA 2O8EA 1IN7A 4D80A 1S3GA 1OFTA 3V9PA 2IT1A 3IEUA 4IDNA 2PJRA 4NYMR 2FPMA 4LHVA 4ZI2A 1XWIA 4X8OA 2DFKB 2QRNA 4NCIA 1YVDA 4LPKA 1R4AA 4XWAA 5DGXA 1HTWA 1JJ7A 5B57C 5FPKA 4KSBA 1N6IA 2W2TA 4E03A 3IBGA 4TT3D 1QVRA 5G40A 4JLNA 4CEJA 3MLEA 5D3QA 1FUKA 2GK7A 5LPNA 1EFTA 3EW9A 3H2YA 1HH4A 1XDBA 2WSSD 3DOEA 2JATA 3UPUA 3R9WA 5FTJA 2J0UA 1SHZA 3QKRB 2JLQA 4G5GA 3R8CA 4B3CA 1NIPA 1NY6A 2VBCA 4OBEA 3CW2A 5FH9A 1DEKA 2JDIA 5FL7D 1ZIPA 2FH5B 1T3LA 4Q1CA 3BK7A 3Q8XB 3GJ0A 2JJ2A 2EYQA 1FZQA 4NL4H 3UMSA 4EFMA 2O8FA 1MV5A 2FOLA 2W83A 4RD0A 2VO1A 4TLAA 3U3MA 1DAEA 2ZVPX 3RAPR 4UNRA 1QHNA 4TMVA 2HXYA 1ZRHA 4NCHA 1COWD 3LFUA 1CRPA 1E1RA 3VNVA 2BBWA 2XZOA 4D4MA 2FZLA 4C9BA 3NWJA 3SZRA 1UKZA 4QBGB 1WQ1R 3LAWA 1Q20A 3NDPA 4DT1B 1IJFA 2OCPA 4DLRA 3O8BA 5P21A 3B2EA 3CPHA 1IM2A 4L9SA 4IOMA 5EXTA 2J3EA 2WMOB 4KHZA 2FPKA 2IEZA 2QORA 1X8JA 2XGJA 3CNNA 2ODNA 4B73A 3N2EA 4OJQA 4AC9A 4ZCIA 4QXAA 2CHVA 2ONKA 4RJLA 3TQFA 2RH5A 2C8VA 3U44A 3VR3A 1ZM2A 5FTMA 5J40A 3GFTA 3LV8A 4FMDF 1ZP6A 1HT1E 2Q9BA 2OAP1 2YV5A 2ZETA 2ORWA 1OSNA 1TNDA 4II7A 4I1OA 1XJ0A 4Q9HA 5HCIA 3U4QB 4JT2A 3NKVA 2QMHA 1CU1A 4PO9A 4H9GA 1BMFD 2ANCA 4NYMQ 5CYOA 5BN3A 1DOAA 1P4SA 3ICQB 1X6VA 5FUXA 3KQHA 5K8UA 4CEHA 3ETLA 1OIVA 2IBMA 2OXCA 4HZUB 2ORIA 2O0KA 1Z07A 3EZ2A 2RGBA 1EGAA 3IO5A 1ZUNB 1G8PA 2IS4A 1T91A 3A1UA 4JVLA 4XD7A 4A8JB 3OHMA 4JLVA 1AQUA 2FU5C 1W4BA 1P9WA 4UKDA 3LXRA 1FNMA 1NSFA 1XNJA 5H70A 2G1JA 4NYJQ 3K9LA 4HUQB 4RZUA 1LF5A 1W4CA 3B9PA 3WBJA 2HV8A 1OXTA 4Q4LA 1GNPA 2H92A 2QPAA 3AF4A 1Z6AA 4LX0A 2FGKA 5HKKD 5KSOA 2FFQA 4EUNA 3W6PA 3GLHE 4NH0A 1IXRC 3NTUA 2OE2A 2O0JA 3AF3A 2R6FA 3GLHB 1R5NA 2G88A 2GHIA 5EUMA 4F92B 1NVXQ 2IXGA 1SVOA 3BXZA 1EK0A 4TMTA 1JEDA 3RHFA 3U3OA 1TEXA 3OZXA 1FUUA 2IYQA 4A2WA 1KNXA 2YOGA 1E9FA 2OFWA 4CF7A 4PR0A 1D6JA 5JHGB 5LB2A 4MDFA 2BVNA 2N42A 1OFIA 3EA5A 1Z29A 2QGNA 3HP1A 4PXAA 1W1WA 4JKYA 1I4DD 1FFHA 2YHSA 4YONB 4CW7A 5A4JA 3FE2A 5CK5A 4ZV4A 1KNQA 4KO8A 1N6NA 1AK2A 2GZHA 3B78A 3ZJYA 4V0OA 1W7AA 1V43A 4YLGA 5FBRB 4R98A 2NPFA 1W36C 2IHBA 3NVAA 2IS1A 3FWYA 1SVSA 5BQ5A 4DUGA 3THXB 2CBZA 1JQLB 3QKRA 2BMDA 2H57A 1G64A 2LKDA 1K5DA 2IYXA 3CF6R 3AH8A 3C16C 1NVWQ 4B3FX 1Z2CA 4Q1AA 1GFIA 3UG7A 2P6RA 2J45A 4TMZA 4XVRA 3M4YA 5IHPA 1ANKA 2GAAA 4B75A 3EZFA 3G5UA 3ZS9A 3DKVA 4NPHA 4FCWA 4BFYA 4JVSB 4ESVA 2V3CC 2QUZA 2ERYA 2F1IA 1Q57A 4O3MA 1E2EA 2QM7A 3EPHA 2G9NA 5JI3E 2VP0A 4BZPA 4K81B 4MH0R 3DPUA 1G3IA 4JYBA 3U7FB 3ND8A 5KU1A 4S2EA 2OSBA 1SVKA 4JBWA 2KI5A 3TAHA 4B32A 4BEBA 3BE4A 3W34A 1KHTA 3A58B 1DO0A 3HYRA 2OFXA 1AS0A 3W3ZB 1PUIA 2GXQA 1W49A 2P0EA 2QMEA 1Q1ZA 1MKYA 2AWOA 1V5WA 3AVUA 3BB3A 5DO9A 3VR6A 1GOTA 1HQYE 3RRZA 4RD1A 4RFSA 3RRYA 2E1RA 2QP3A 2QPTA 1M7BA 1G8FA 2BC9A 2CLDX 3RRNA 4DDWA 3AM1A 4G01B 4IOLA 2CEAA 1YR6A 4BZXA 3RWOA 5IDVA 3DVLA 1CJVC 2Y8EA 4PC1A 3O47A 4JLOA 2D3WA 4RKEA 2ZQ5A 1G17A 3ZS8A 1NI3A 4QHTA 4LSGA 4A8JA 5JECA 3AKCA 1GL9B 1FX0B 1P9NA 1GDDA 1KI6A 4QBFA 4BRUA 3V4RA 1G3QA 4Q7LA 3BC1A 3T1VA 5JLJA 4M9XA 4S35A 1E2JA 4WW0A 2IYTA 1CULC 5AJXA 3GLFA 1VDZA 4GNKA 2JASA 1XTQA 4DKXA 1G8YA 1NN3A 3AVQA 5L3VA 4K8OA 4HAXA 4TZ0A 1OB5A 2B8TA 4B2PA 4XTRA 1LS1A 4TTQA 4D82A 3ADBA 1YKSA 3H0KA 2OHFA 2ZJ5A 4EJSA 2CHGA 4MQBA 5EP1A 2J46A 4YMUA 4PQYA 8OHMA 1Z2AA 1MO4A 4BFWA 4PZLA 1AKYA 4R2IA 4URXR 2ZJ8A 3PCRB 4QKQA 1L8QA 4C30A 3EPLA 1VPLA 2RGGA 4H1UA 2OXRA 3E5HA 2VP9A 2F7SA 1PZNA 3BH6A 3NC1C 3UXMA 2O8CA 3PUWA 4Q4JA 3PITA 3PEYA 2ZRPA 4TTPA 1E4VA 1OXVA 2IYRA 3EC2A 3FGNA 4B74A 4DLZA 5IRCD 4OL0A 4M9QA 3LDAA 1IHUA 4WXPA 1FQKA 4TT3A 4DCVA 4NZYA 4LYAA 5GVRA 1U0HC 1KK2A 1IN8A 2Z0MA 1U8AA 2JEOA 2AD5A 2UZ3A 2C9CA 5JHHB 4MYCA 3KX2A 1D9XA 3SN6A 3GLIB 4DLWA 2F3RA 1FMJA 1Z22A 2GF0A 2ZE5A 3NIBA 2W6IA 3TR0A 4A0RA 5JJLA 4IOKA 5E7IA 3WHKA 5E4FA 3AVYA 4QM7A 4DXAA 3RS5A 1XX6A 4QC2A 1XTKA 1XXHB 2AK2A 3AKEA 1T9HA 2A5YB 3NEJA 1HQCA 2NO7A 3B13B 2ODWA 4I4LA 5L8VA 4QM6A 4WVFA 5L3QB 4DJTA 3KQUA 4DCSA 2WWIA 3PEUA 2XJ4A 5GJBA 2OO7A 2O52A 1UKEA 4ZO4A 5D3MA 3QG1A 4DEYA 3PUZA 1IONA 3LRPA 2ZAMA 1UJ2A 1OLOA 1XTRA 2QU8A 3SYKA 2ZRFA 2VP4A 1OYYA 4HAYA 3C8UA 1ZU4A 4JIMA 3LBIA 1AIPA 2KJQA 3C7KA 1XMSA 5EE1A 4MA4A 2XXAA 3C41J 2NO1A 2ZS9A 2ECKA 3MGCA 1KAOA 4A36A 2G83A 1YZKA 3VU9A 4JL8A 4C7OB 3REFA 1FP7A 4P4SB 4BRWA 3FMIA 3EX7C 3AP2A 2QAGA 4ARZA 3OE7D 4MRVA 1NVVR 4TTRA 3V00A 3I4LA 1E98A 1ZIOA 4W5HA 4EDHA 4CT5A 2ODBA 2IHYA 3CB4A 1ZVQA 3L8YA 1NVVQ 4C2TA 4EPTA 1ZMXA 2J7PA 3CO5A 3IIMA 4RCYA 1Q21A 2G3YA 2ZIAA 3PUVA 4HDOB 5DIFA 4GRAA 3SJCA 3O8CA 2A5FA 5FPYA 1P75A 2ZJOA 1QG4A 4ACBA 5L3QA 1RC8A 4UXHA 1E4YA 3A1TA 2QZ4A 3K1JA 4XWOA 5KNCA 1AS3A 5SZJA 4W5WA 4BQSA 1NN1A 4TSFD 5CLLA 3VFDA 4F93B 1UPTA 2ZRIA 3CH4B 3QIAA 1G4AE 5FTKA 2OLJA 1Q44A 3FHCB 1TU4A 5DHAA 2N1BA 4RSGA 3VTKA 1E1RD 2EFGA 2OILA 1CEEA 1XTIA 1YRBA 2XTMA 3TIFA 4FD2A 4PSVA 5KOYA 4BPBA 3VNUA 2WJYA 2YVUA 1YZQA 3QE0A 2D2EA 4YC7A 3GJ4A 1VG1A 2GETA 2V7QA 4WZBE 1GKUB 2ZRKA 3NXSA 1YR9A 2W58A 3OEHD 1YHNA 2FF7A 3GJ3A 3KKMA 1BYUA 5UKDA 1NBMD 1GVNB 1G41A 1X3SA 3I72A 2PEYA 5KPJA 4JS0A 2AX4A 2VYFA 3UMFA 2BJVA 4Q4JB 2H8KA 1XFAA 4Q7MB 5KO2A 5KSZA 3L0IB 5JS8A 1GL6A 1MO3A 4MKFA 2F3TA 1KYIA 4Q1DA 2WPDD 4CRWB 1A2KC 2ZSFA 2R65A 2BCJQ 5H1YA 4NYIQ 4A2QA 4M1MA 3K0AB 4LYHA 1U9IC 4IHQA 1F6BA 4QJ4A 4GT1A 221PA 1E0AA 1ZJ6A 3QXCA 1Y3AA 1KKMA 4IKEA 4JLDA 2QROA 3QF7A 4Q00A 1IY0A 1JBKA 4N3NA 1JEEA 3GCGA 4HI0E 4D25A 2QT1A 2VIIA 2JLSA 4DC9A 3JVVA 2H1LA 1NLFA 2GXSA 5DH9A 3Q5EA 5C4GB 4C0HA 5CJ2A 4HYYA 3QI2A 3THYA 4XD7D 2YWFA 2MSCB 2IWRA 3K09A 1NG9A 2GBLC 3W3AA 2OAQ1 2EW1A 2IXEA 3GMTA 1QBKC 1U98A 1S1MA 2QMUA 3QVVA 3MJHA 4I1UA 5KNDA 2F55A 4C0QC 3T5DA 5DISB 4EKDA 4KFUA 1W44A 2XTNA 2HCBA 4A8JC 2CDNA 2F1HA 1J99A 4KBFA 1Z47A 1ZCBA 3HDTA 2ZR7A 2Z83A 1Z06A 2HEIA 3TSOA 3RSLA 5FBQB 4YQFA 4EPWA 4BFSA 1T5IA 2GF9A 1R0ZA 1XMIA 1GIAA 3OEEA 4TYYA 2ZI6A 3NEYA 4PPNA 4ERNA 5CM9C 3PXGA 4POAA 4LCBA 2JGNA 4C0SA 5IT5A 1U0LA 2VA8A 4XIGS 2ZUCA 1JB1A 2PZEA 3TBKA 3MFYA 1CTQA 2OUKA 1W0KA 2WAYA 4TL9A 4N0EA 3TRFA 1J90A 4L8GA 5C46F 1JI0A 3NBZC 2W0MA 4GBMA 4WA7A 3BWDD 4ZDJA 4Y0VA 5EUQB 1J7KA 3CX7A 4BLSA 1RJ9A 2ZJYA 3ICEA 4AG5A 2WKRA 2B7BA 4R2HA 4Q9LA 3GLFE 1QG2A 2QSYA 2ORVA 2R62A 4EJSC 4NMMA 1WA5A 4D4KA 2F43B 4LYJA 1IY1A 1QZXA 2F1RA 2OLKA 2VRWA 2GK6A 2R44A 3V4FA 1F2TA 1EFRD 1XCPA 4B6FA 4AG6A 1ZBDA 3U6KA 3KJHA 5EP4A 3FVQA 1II8A 5HPYB 1EFHA 1VHLA 2GAOA 2I3BA 1U8ZA 4US0R 3U61B 1RIFA 2ZSDA 4HLQB 4MGZR 3ONWA 2GJ9A 2ZRBA 2ZRAA 1N6LA 1W36B 3I32A 1XD8A 2GWHA 3WYGA 3RC8A 5TV2A 3UWKA 5TY0A 2C5LA 3NBXX 4PO1A 1Z0AA 3DL0A 1W47A 3ADDA 4L4UA 1P2UA 2HT1A 3AF0A 1RPZA 3W6OA 5EE0A 4PPGA 3JZAA 2P2LA 4FMDB 4UNNA 3EC1A 1E9CA 3L8ZA 3G82C 2O8FB 4MRSA 5JCZA 4ZIRA 1R0WA 2ZRDA 1K5GA 1QHSA 2IYLD 2KBEA 2X19A 3ZVMA 4LWZA 2HT6A 4BE7B 2QI9C 5DLQC 5BWMA 2PCLA 3KQLA 3KDSE 2ZAOA 1EESA 3X1DA 4ZKDA 1T8TA 4LJ6A 3PEVA 4TLBA 3U7EB 2IYYA 2JLYA 2O8BB 2G0TA 2V9PA 3CPEA 1AJEA 3D3QA 1ZM4A 2R8RA 1G7RA 4PAQA 3AGPA 1N0VC 3PFIA 1KSHA 1T3SA 2O5VA 4K46A 4NCNA 1M34E 3DZ8A 3KXKA 4Q1BA 3RS7A 2A9KA 1M7HA 4Q18A 1R0XA 1E99A 3CM0A 1NF3A 3B5JA 4NYIR 2QPOA 4XSGA 5F9FA 1F48A 4BLTA 4L15A 3B1ZA 5JI2E 4HB3A 3IIKA 1Q12A 5SZHB 1NKSA 3VX3A 3AVVA 5KHOC 4D4LA 5AK0A 3S1AA 1E6CA 1BMFA 4GMDA 2VH5R 1EG7A 1Q3HA 2HXSA 4HDCA 5G41A 1U2RA 3AUYA 4NBSA 4YMTA 5FBVB 3QKUA 4JYCA 1ZCAA 2BWJA 2ZSAA 2IK8A 1NY5A 3L82B 4P4SA 4A1FA 4M1SA 2QAGC 4KLNA 5EE9A 2ONJA 3D6TB 1MR3F 3T1TA 2HF9A 4AKIA 1KO7A 4XJXA 1DBSA 1FL9A 1T0HB 1N5JA 1IN4A 2VF7A 4M9SA 2L0XA 3WBKA 5FUWA 1KIMA 4YMWA 4PHTA 2CVFA 1DG3A 1DTSA 3R7WA 3F5FA 3ECCA 1F3OA 3FYHA 2CVHA 4YXWD 2NO0A 2IYZA 1II0A 3MCAA 4FCTA 2ZRJA 1LW7A 5FOUA 4WZAE 4RFVA 2WWGA 4DWJA 3U7HB 1KMQA 1ELOA 2KB0A 4NP6A 4TLEA 3GLHA 1NSTA 1XF9A 4PPFA 3RLFA 3B1WA 4MRPA 2FE4A 4Q21A 1E69A 1KI1A 3IBYA 1E0JA 3EZ6A 3RC3A 1COWA 1D9ZA 4B3DA 3MWYW 4DB2A 4RFSB 2HF8A 3WMFA 2DYKA 4FXPA 3OESA 4CGZA 3BGWA 3D8BA 1A7JA 4ON9A 1E79D 1CR0A 1T4GA 2A5DA 2XNSA 4HLDA 2VHJA 2JJ2D 4C0AC 3I8SA 1HA3A 2QA5A 2VQSA 3L0PA 3GJ6A 3GEHA 2ZE8A 4LBYA 1UBCA 3I5XA 3FKSD 4QNRA 4CVNA 2VP2A 2AFIE 4DLUA 3A1WA 5AJVB 5C1BA 4PO8A 2GTPA 1CRQA 1UBFA 3Q7QA 4HDQB 4DUGD 4XVUA 2OEPA 4R71A 3K0FB 5DYIA 3THWB 3U7GA 3SE0A 5JMTA 3B1YA 2A2ZA 3IILA 1R8SA 5K8TA 1S96A 4BLOA 5K8IA 4WBSA 3K70D 1RVDA 4UXJA 4HATA 2RGNA 4G3XA 4O25A 2AWNA 1Z6YA 4KXFB 1YQTA 2WAXA 2O8EB 2XB4A 4RD4A 1U9IA 3K8YA 4TLCA 5JFGA 5IK2D 2C95A 4LYFA 3RVBA 1P7CA 5AJZA 1XEFA 1RKBA 2YWEA 3TMKA 3CRW1 1GNRA 1KMHA 2HLDA 4OHVA 3Q85A 5JEEA 3LA6A 1JXMA 4QBHA 3UIEA 1IXSB 2IUUA 1JQJC 5F9HA 4MRRA 4V0MA 1FP6A 5FFMA 5L3SA 2JCSA 4HSEA 3K09C 4D6PA 2GBLA 1FPMA 5FUVA 3LW8A 5H68A 4A82A 3F0TA 2YOHA 2Q3FA 3LXXA 3ZQ6A 3E1SA 1DAMA 1RFLA 1RW4A 3JZMA 4YDHB 5DYGA 1UM8A 2JDID 5FL7A 5KYKA 4B2IA 5A5GA 2J41A 1G8HA 3KZ1E 5DSZA 1S4QA 4B3GA 4CT4B 4X8HA 1AM4D 2XXAB 2IYUA 2PEZA 3FB4A 4I1VA 4FW9A 3IO3A 4HLCA 1IAQA 4RCZA 5JEDA 4E09A 2R6CA 1M74A 5JZVA 1DAFA 3VR2A 2I4IA 2ZJAA 1RJ9B 3EPKA 3DHWC 1G6OA 1VG8A 2Q3MA 1DG1G 3DM5A 4RZ2A 4XSHA 5DN6D 2JAQA 2C98A 3CRQA 4LC0A 1Z6TA 2C77A 1GTVA 2ZU6A 1TAGA 3T5GA 3R8FA 1LB1B 3ADKA 3LX8A 4KCGA 1AKEA 1VYUA 2DWPA 3MG9A 3VAAA 4PPQA 5CDFA 1Z0DA 4LHZA 1YR8A 4JMPA 3PV0A 4JLBA 2PH1A 4Q47A 2FPLA 4TYQA 4QHSA 4D26A 5FOVA 1SKYB 4JVMA 5JWRA 2OBLA 3LY5A 4AY2A 1ZNZA 3EAQA 3MMPA 1NL3A 2B92A 4PSKA 3OF5A 4QJ5A 1P2TA 2KSQA 2D06A 6Q21A 1FTSA 3SJZA 4JVNA 2A3RA 1G8GA 2CCGA 2OCBA 2BBSA 3HYTA 4M4SA 2Z4SA 1ESNA 2KBFA 3MWJA 2QRZA 1XTJA 3NBYC 3PUXA 5CLQA 2O8CB 4O2LA 2OCYC 1ZUHA 3WNBA 5KDOA 4KITB 4F4CA 1GM5A 4BASA 4F7WA 3W6NA 4V0NA 1S3SA 1U8YA 3QVUA 2WWWA 2AL7A 2ZVQX 2WJHA 3DZDA 3M6AA 4IXMA 2DBYA 3TJZA 1E32A 3CNOA 3PQCA 4KAXA 2JLVA 5EQTA 1P62B 3TW8B 2P65A 1KKLA 5FBWB 2ZI7A 3A36A 4DDUA 2O0HA 4Q4HA 3OAAA 1VIYA 2WPDA 5FUYA 2J87A 5JWHA 3WYAA 2O8DA 4OYHA 2XTZA 2REOA 1XB2A 1CR1A 4D0GA 3G0HA 4LBWA 1EX7A 4QBIA 1JR3A 4IXNA 4M8NE 3VHLB 4DCUA 1DAGA 1K8RA 2GCNA 5E7MA 2FGJA 2GVZC 1IJEA 4TQ9A 2QY9A 2Z43A 2VHQA 4P4UA 2PL3A 4OI0A 4ITRC 2YNMA 1E2QA 1KY2A 1SKYE 2I1VB 1OYWA 4PSAA 1OJLA 4X8LA 2QL6A 3H1TA 4XOIA 4FINA 2YC4C 4I99A 3WNCA 2JIZA 2G0NA 3AKYA 2J0QA 1AGRA 1IXZA 3VX4A 4RVCA 2J9RA 3NHAA 4FWIB 4RD2A 4BFTA 2DFNA 2PCJA 4YXWA 4AWXA 1ZYUA 3SJAA 3SOPA 5JCPA 2A5GA 421PA 1KSFX 1RRFA 4TWZA 3CX8A 3SQWA 4IEIA 3A4MA 3F8TA 2QE7D 4GP6A 5CYPA 1ETUA 1Q1EA 1NMYA 2P67A 621PA 4XWKA 2CCKA 3SBDA 4CIDA 3B1XA 5BXQC 2W00A 1CR2A 2R9VA 2AR7A 5HKKA 4Z1MA 1OXUA 4DLXA 4WIAA 2XX3A 3L43A 1W2HA 1E1QD 3VMFA 3N70A 3B7GA 4U5XA 2PJZA 2BCGY 2XITA 2EFDB 2GESA 1AZSC 1ZD9A 2DPXA 1XEXA 1GRQA 1L4YA 3HR7A 1G7CA 3LLMA 1UKYA 4EFLA 1S0UA 2BEKA 2BKUA 4ZCMA 4PAOA 4QL3A 3EA0A 3ADCA 5K8LA 5BN4A 1G20E 1L4UA 4WOPA 4DSTA 4Q1FA 1X1SA 3KJIA 2PBRA 3ZVNA 3K9NA 5AJYA 1HV8A 2ZR0A 4NONA 5EE3A 2FNAA 2QP9X 4MKGA 2EFHB 2YKGA 2ZYWX 2QG6A 2IC5A 4LZZA 1CXZA 2WSMA 4EPXA 3I61A 2WJIA 1G19A 5A0FA 3NHBA 1VHTA 5FOTA 2ZE7A 2PMDA 3GJ5A 1BO6A 3OFNA 3ZH9B 4ABYA 5CDFE 1G16A 2PZGA 1E9AA 4PHHA 2RGNC 5JS7A 4C0BA 5DE3A 1OFUX 3BAFA 3QBTA 4XVQA 5HCNA 3UWOA 3RRMA 1ZINA 2P5TB 1XXHA 3AVWA 1WXQA 1GITA 4NKRA 4V02A 2OCAA 1YZUA 2GEDA 4DSOA 4ACAA 4URWR 2ZXUA 1KSJA 3K9HA 4B48A 1OKKD 2PX0A 2MSDB 4R7ZA 3ZZ0A 1A4RA 5AWFC 4P32A 4KYIB 1KOFA 1UADA 2XNDD 3VR5A 3WHLA 4MYHA 5M04A 5IF9A 4OJKA 1G21E 1JR3D 4LV6A 3R20A 3B9QA 1YZLA 1M7GA 3RWMB 2JJ8A 1M2OB 4JT4A 2OESA 1IOZA 1EFRA 4URVR 4BFZA 4M1TA 2ZSBA 2ZI9A 3GJ7A 3BB1A 3THXA 2BKEA 2D2FA 1A2BA 3VKHA 4EQ6B 5FTNA 2DY1A 1TF2A 3KKQA 4PC7A 1ZUIA 1ZM9A
chains in the Genus database with same CATH superfamily
3MJRA 4ALLA 1O95C 2Q5FA 1L3BA 3QUCA 1Y5MA 4XLZA 4B83A 1J09A 1V16B 3RFUA 5BNWA 5DLPA 4Z7NB 5EXEA 4AIIA 2N46A 5TIIA 2PKEA 1WSWA 2VYCA 3DFUA 4D4GA 2OC4A 2QMOA 4JROA 1LLCA 4BFVA 3AX6A 1CJBA 2ZAYA 4RTMA 1CUAA 3V8MA 1FUIA 4M37A 4FIDA 1ZC4A 3HADA 4S24A 5TVKA 3RVMA 5KTNA 3X1MA 2BISA 1NMXA 4XPZA 3G0OA 4WCFC 4U7PB 4OUDB 5F4BA 1K98A 2E1PA 4JBHA 1AS2A 3B6EA 4YLEA 4MCIA 3UKJA 2HLPA 3AP1A 1OHHA 3AB3A 4ZVQA 1BGVA 3KPWA 1BKDR 4UUAA 3WR5A 1MRSA 2QG9A 2PA0A 1S5PA 2VHCA 4TWRA 4XA8A 5E2IA 3OEED 4AP6A 5JNVA 1DXQA 5I4KA 4UBLA 2JCBA 2PR7A 1SUBA 3FMGA 3P9XA 3GUUA 2ZK7A 1OA0A 1C1HA 4ZPXA 2VDKB 1J8MF 1E3DA 4W9NA 4K05A 1RWQA 5BN4B 2EKLA 2J9ZB 3ESXA 3L7JA 3TGWA 4MDEA 4BVKA 4MWTA 1XZMA 4CQMA 4FUQA 4C7OA 3HA2A 2OV8A 1QYIA 1O08A 3ABRB 1W1UA 2EIHA 3DUFA 4FZ5A 3OQJA 3IKVA 1CCWA 3PX2A 1O0CA 3KJNA 2HDWA 3HGTA 3AYXB 3B53X 4JUDX 1K08A 2QW8A 3I4FA 4Q24A 4Y9DA 2YYZA 3BIWA 1TTTA 3MELA 3VO8A 3GCDA 3LP5A 4LQDA 3RF7A 2Q4TA 1GTG1 5IK2A 3KQYA 1NUPA 1GQYA 4QG7A 2ZAIA 3N53A 4LI3X 4LZAA 1T8PA 1ZY2A 1Y1PA 3DMYA 1C4WA 4W99A 5KYUA 3DVAA 1WB5A 3FCAA 4OYYA 1JRLA 5E9JA 3SI7A 4B31A 1HEIA 3TQOA 4F11A 1FFCA 3KXPA 4CDRA 5CGQB 3N87A 4LW8A 2J9FB 3ZXUB 2V7VA 1UDXA 1WXHA 1H0SA 2CLMB 4FNOA 3BH7A 4G09A 3ZQKA 5JCOC 3IUEA 1LKZA 3HWX1 1OXXK 4XIYA 2AMYA 4XQGA 2QQEA 3V8NA 1OH8A 2JAPA 1EBFA 3EY9A 4TV8F 2YV3A 1B16A 3QBVA 1PX2A 4BIMA 5C2JB 2M98A 5BR4A 3H4VA 1M8JA 1T36B 4U6NA 1E6UA 1Y7PA 4BX0A 1VSQA 2YNMC 3TM4A 1YQQA 3L6OO 3RD5A 5IASA 1E2IA 3KCNA 2EP5A 4QGFA 4FHDA 1F2VA 2CNOA 5T41A 5E6RB 1U1FA 1H66A 4O02B 1XPUA 1E58A 3GF4A 5FEMA 2HUNA 4HB2A 3FMOB 4WVLA 1M54A 3LLCA 2WT8A 3G9XA 3LP6A 2O2ZA 2JAHA 2JKVA 4IVQA 3B6MA 3U17A 1O96A 4FDVA 4ZVPA 3TR6A 1QV7A 1A1VA 4JXZA 1MOZA 2E0IA 5ERXA 5DK4A 5I5EA 1NNLA 3NPAA 2XCTB 2REQA 3RTDA 1JEYB 3PJGA 4MHTA 4WKCA 3PIRA 4L27A 4FD3A 4YWJA 5I9LA 2ZI3A 3RUDA 4LZLA 5CLJA 2JAWA 5EN4A 3AF6A 1G18A 4P31A 1YGYA 1YDEA 4C4RA 3OCZA 1NFRA 3RVNA 5D7BA 2DB3A 1JKXA 3PNSA 4BRSA 5KOJA 1D04A 4ZZIA 1E66A 4DB4A 4OKSA 3AQ4A 2OBYA 4YO8A 4ZD6A 3AWDA 5FQNA 1SKQA 2CYAA 1KE1A 4RIHA 2J59A 2G08A 3PFCA 1PBTA 4ASUA 3DMDA 4HDMB 2DRIA 4X5OA 1E0SA 5BYBA 3TMAA 4N5IX 2A78A 2NZYA 1FNBA 2JFVA 2OT3B 2YQZA 4WESB 4DIBA 2JLZA 2YXLA 4B8WA 4JSTA 3TQCA 3KKLA 2R6HA 3ZU5A 3FYUC 1Z6XA 2C03A 3AJAA 2H0QA 3AHJA 1CS0A 1MOPA 4FOPA 5BVHB 5CVTA 1EXMA 3W8RA 2XGSA 4QECA 2Q3BA 2Z1DA 3LWDA 5CT8A 2F2TA 1PJ8A 1QMGA 1C0LA 4LJKA 2BRUC 1RE1A 1XKQA 2I55A 3VPBA 2O19A 1H8HA 2WABA 1UBGA 4MAMA 4Y2YA 4YJKA 2WM2A 3QYAA 3UANA 3SLKA 4YCCA 3T3PB 4GP7A 2QTAA 2II6A 1G66A 4CXMA 4YMHA 2X1HA 3EOBI 4TV8A 1ETHA 1RQNA 1UKCA 2E4AA 1VZ2A 2PX4A 2WIDA 1CEQA 1K89A 3DG9A 4Q4AB 5AOBA 2Q0XA 3UAYA 3VR4D 3TGPA 3SYMA 2M2IA 5J2UB 3ABZA 2Q4RA 4DPLA 4ZEXA 1V4VA 3QW2A 2Z8YA 3HC7A 2WJ6A 2O4CA 4JJKA 5AR1A 2LPMA 3HLTA 1DKOA 1F0YA 2P5UA 1YB5A 1JLLB 4ND5A 1GAXA 4XEHA 2P30A 1EZZA 3W1WA 1RWPA 4YCNA 4QODA 1ISGA 4ZIRB 1V1MB 4E5UA 4B9AA 4WKGA 4BNHA 4DWOA 3M1AA 1M5TA 2BY4A 3QEOA 2YN2A 5F33A 2EFEB 2HGSA 4S1TA 2DTXA 4BLRA 5JQGB 1P74A 4L4YA 2KE5A 3OCJA 3AF1A 4KYUA 2VSFA 1P2FA 2WOJA 1Z37A 1ZH8A 2D62A 1GGMA 1JU3A 3QXXA 5IBQA 3H5IA 3EAGA 2AKYA 1L6IA 5T4BA 3QI7A 4DC0A 3RG8A 2AB0A 1TTQB 2RAUA 3E2MA 3CR7A 1CV2A 1KVSA 4AQDA 9ABPA 1QIJA 3AT1A 3K0EA 5CH8A 5ES3A 4QAQA 3ZW9A 4Q16A 4HAWA 4FB5A 1ZCJA 1Q0RA 4KQMA 3O3OB 4C0LA 2WUEA 1GO2A 3C7CB 3K73O 7ADHA 4ZCTA 1X86B 4E0BA 3MUOA 1T24A 1GKYA 4LHXA 4QUJA 4EKNB 3KELA 4RIFA 1FYFA 3WK7A 1GILA 3UHPA 3M82A 2GJ8A 1VKJA 4LGMA 4RDIA 4UTNA 1RC0A 1R0BA 1XJWA 2PANA 3A9CA 3K4QA 1HFWA 3E1KA 1JAYA 2Y1LA 2AJ8A 3FZGA 2FN8A 2YNMD 4TZ6A 1BWPA 2NYRA 2QTVA 5LQKA 3LOQA 3EMDA 1PYOA 1KZ7B 3JARA 2CDAA 2NU8A 2AG6A 1EHIA 1O96B 2EJTA 3FSRA 5AKHA 5AKYA 1JMVA 1U8XX 2FEAA 5E4JA 3TSZA 3H2BA 4NCKA 2GSWA 3GJRA 3K2IA 1ZN2A 4IICA 4TVKA 2QE7A 4MI1A 2EFYA 4DOMA 3WHIA 2OCGA 3AV0B 1GGHA 1XVTA 2HJWA 4RKFA 2Q3HA 1ZJWA 3BMQA 3BFKA 3SU8A 3QM1A 2V98A 3RYFA 3AEZA 3F3KA 1NHGA 3ETHA 4KFTA 4N6GA 1PS8A 3MS4A 5B55A 2R0QC 2JIDA 2XMDA 2EWWA 2V6IA 5SY9A 4MHOA 1CK4A 1FX0A 1TADA 3Q9SA 4EMSA 2BHNA 3FW1A 1NVGA 3U7JA 3ZGLA 5AUPB 3DTYA 4RH0A 5CNJA 1NBOA 2GASA 1ATZA 2DWUA 1OT3A 3LDHA 4S05A 1YJ8A 3F1KA 2X8AA 2Z2ZA 4JOSA 4NMLA 1OI3A 2PY6A 5FUMA 1W2GA 2DTEA 3TZBA 3R5KA 3V4SA 3ZWDA 1J9ZA 4HMOA 3HWSA 4QPCA 4UVEA 3RYIB 4HRAA 2EZUA 4X1YB 2I1WA 5KTSA 4NU0A 4OHZA 2BGLA 3ZIAA 1MZPA 2Q9AA 1Z5GA 1N0UA 4TTJA 1W0JD 4E22A 1ZD8A 3E58A 4HWSA 3P52A 4BN5A 3PEEA 1KYXA 4YV1A 1DRJA 2AUMA 2ZRNA 4IJ5A 3IBFA 5ELLA 5GADl 1NI5A 2KMLA 1YVUA 4BVAA 3T5PA 2B1JA 2RH4A 2VPXA 4MQFB 3L4SO 2VF8A 3IUQA 1TJ4A 3YASA 2VT6A 3DLPX 3TZLA 2P2DA 1VMKA 2HQBA 1C9JA 3LWNA 3E05A 3WLAA 3TECE 1GGJA 2VSOA 1USUA 1VP3A 3WP0A 3U31A 1TYEB 2NU6A 3PQ2A 3R3JA 1ISSA 2AJBA 3HL0A 2WG2A 3VVBA 1KSGA 3UAXA 4AURA 3FOBA 4ER0A 2WG0A 2VG8A 4W1SA 5HMMA 3V46A 3W5IA 4DRZA 2OECA 1N1MA 4R2XA 4RPCA 1MENA 4ZOLB 4ZKEA 1SKUA 1SZCA 5FNZA 2OENG 3ZCQA 1OHHD 2FMFA 4XXHA 4NXNB 2EWVA 3MYRA 3IVCA 2VDWB 4A91A 2XCIA 4C2AA 1H2WA 2HTEA 1VSVA 3WLTA 4BOYA 1C1YA 4N4AA 2X13A 3NFRA 1I6LA 2IP4A 4F91B 3GEIA 4K6KA 3U4DA 1WF3A 4BL5A 1W46A 4BUJA 4YUWA 3AZPA 4DE5A 2ZITA 1NW9B 1KZYC 5HFAA 1CEYA 1DBWA 3D6VA 1V3TA 3N8GA 4Z54A 2FTKE 4Z4QA 3CLUD 4ZOLF 2D8MA 2X1VA 5KEIA 2W2PA 2XSZA 3GRFA 2DR3A 3FWZA 4IDOA 3I3SR 1G1AA 2CFOA 1DBIA 3HB1A 1QQAA 2D0PB 4RY9A 2V6JA 3PFKA 4LJAA 4J1SA 5AI6A 3AMVA 2PTGA 1E2DA 3HP7A 4BAZA 4BHTA 4DA9A 3P26A 4TRJA 4E1BA 1XD2B 2ZSHA 1CHNA 1I0IA 3LC2O 3JWEA 1WHTA 1FW6A 1WMAA 5K0NA 1GYPA 5FWYB 3LUGA 1SD1A 4QELA 1Q1BA 3H1PA 1UH5A 2YC2C 3DNFA 5D3MB 2AI2A 3VQTA 3ZK7A 1VIMA 2Y71A 4B5KA 2O8BA 5J4LA 4GXRA 5K3EA 4MMXB 5EZSA 4XGKA 1GNTA 4M1KA 1RPAA 3WDLA 4UD2A 4NFSA 1PFKA 3X1WA 1CJKC 2FW6A 4G8BA 4US1R 3KWJA 2AIRA 3PKZA 3U5ZB 3A1CA 2AYZA 1MRZA 2HWXA 1N6RA 1IM5A 4F2DA 1L7NA 4GQBA 3WL8A 2HUPA 1NUUA 1X92A 3F6CA 1A9SA 3D4PA 2JLBA 4RORA 3BGDA 2B1IA 1XRQA 1U3WA 1YL7A 4YNBA 3SEAA 5F98A 1AN0A 1REQB 1UP6A 4GPTA 2YIMA 1M6VB 4G0YA 1NR5A 3R44A 2VXBA 3BMOA 1RKQA 3DMNA 3HACA 2Q3EA 1LRLA 2AMVA 3FLBA 1ZK2A 2DQKA 3AIKA 3V4VB 1EFLA 1T4CA 4DQKA 1V25A 5KVSA 4MUXA 1RHQA 2Q5IA 5C3UA 5KTPA 3NC0C 4YQEA 2R5WA 1KOGA 1I7SB 1EQAA 1Z45A 2IHZA 3JQGA 2GVDC 1KI9A 3FETA 4BKRA 3AB7A 5CB8A 3VYVA 2FP4B 3B3AA 3K53A 5IYZF 1W52X 1ZW6A 3FYUA 1AB6A 3IT3A 1G4UR 4G0NA 4MYDA 3D7RA 5EZ5A 5G3YA 3T94A 2UZ1A 1ZD2P 5K4HA 3EJ6A 5I8ZA 4M8KA 4NXMB 2JCVA 3X2EA 2GEVA 3IR6A 1Z38A 3QLJA 4Q05A 7YASA 3C8ZA 1JFRA 1BS2A 4L16A 2QRHA 4EP1A 5JXHA 1OC2A 3OIDA 5IX8A 1WCXA 1DG9A 2C07A 1GFZA 3PNKA 4QOEA 3ZWMA 1NMZA 1WPGA 3KWMA 2QLLA 2F9LA 3N8HA 3H4MA 4IDHA 4TLDA 1T9BA 2W5UA 3R77A 2FRXA 1E1CA 3KV1A 5C52B 521PA 2B98A 3GN1A 3NH9A 4KV9A 2H18A 3WY9A 2VDNB 2X0JA 3T3MB 1X42A 2M1XA 2XXJA 3QLUC 1ULZA 2P6OA 3C3EA 7MDHA 1DNPA 2EEPA 2ZJ0A 2V7PA 3CUUA 3KE8A 3QVKA 4JZKA 2BH2A 3T1QA 1JQKA 4RW0A 3NLLA 3Q3CA 3TNFA 3P45A 3BJRA 4MNTA 3TX6A 3SS9X 3O0TA 3PVZA 3CPSA 2BLLA 1RWMA 2Z4TA 2ZYRA 3F3MA 4GOJA 4JV5B 1FFAA 1I7QB 1NN5A 5LA6B 2QLTA 2O59A 1A5ZA 2CB9A 3FI0A 3ESDA 4OU4A 3GOHA 3IQHX 3KB1A 2PX8A 5IJ9A 5B30A 4ZDIA 1J1UA 3KAPA 3RSCA 4JJEA 4ZCQA 2HJVA 3HXMA 2ZZMA 1TVKA 5AKIA 2O20A 4O2RA 2Y77A 1RQ2A 3GHHA 1NC1A 3HJTA 3LNCA 1VJRA 3MB8A 4Q9IA 3ZH2A 2IXBA 4BMSA 4D0SA 2DT8A 3O84A 4O4JF 5EZ6B 3PNYA 5LFAA 3U4QA 2WHYA 4E3WA 3TH5A 4LE1A 2O3TA 2UV8A 3A4YA 1DIBA 3OMLA 1SUPA 2WHRA 4XUGB 4BQEA 1L9KA 4EI7A 2QBYB 4Q5IA 4LDAA 1I6KA 5LA6F 1GUAA 3IUBA 3FRJA 1P9RA 1YRQA 4NC9A 1GCUA 1L5WA 3KV3O 3LX6A 4LJ4A 3KOYA 3GEEA 4IUDS 5B1EA 3CIOA 4OQDA 3T61A 4CPDA 5IDXA 4D3DA 3KKNA 4LYEA 3WB2A 4C76A 3UKDA 1L7VC 3U7GA 1GN9A 1C3JA 2JGIA 4MW0A 5EXSA 3ZTYA 1JBEA 1HT2E 2CJPA 1Z5ZA 3F3YA 3GCZA 2R7NA 3JALB 3OC6A 2IYWA 5DBIA 3SVTA 2XCRB 2WF9A 1V8BA 3ZI4A 1ONOA 3VO9A 3WLEA 5LMNB 3KL4A 1H9BA 5TF4A 1PK7A 1G6HA 1S9HA 4KQKA 4HD8A 4BKOA 5CURA 1TZBA 2PBZA 3BDAA 3ORQA 1JJAA 3AOEA 3FLAA 2BR3A 5AW7A 5C18A 3C8HA 2C9ZA 1WZNA 1XCGB 3ILYA 1OYVA 3BUSA 5F2OA 4QOSA 2K2QB 2YWCA 4A4DA 2VQ6A 1VJCA 4ASUD 1SCIA 2DH6A 2C42A 1P0MA 3RGWS 1DKQA 1RWXA 1P5FA 3IHLA 1H4QA 4J7XA 3GA7A 3QY0A 4M2LA 3PXAA 2X2OA 5EA2A 1N9ZA 5HE8A 1KDZA 1L1FA 2CDRA 2P8JA 2VRCD 1AX9A 3D3NA 2AG8A 3K8QA 4Q15A 5CCDA 5AW0A 3VKVA 2SCUA 2PPVA 4Q01A 4C6HA 1F38A 1M0SA 4JSYA 4BFXA 5CG2A 1VLVA 4HXGA 3U16A 2AJTA 3WGTA 2OV2A 2ZIZA 3UYLA 1R0SA 4U2EA 2HLHA 2XIJA 4HRXA 5DX8A 1OMOA 3AXTA 3EXFA 2CE2X 1J97A 1JQ5A 3K6SA 1AKQA 4OFZA 3L6CA 4J7CA 4DPKA 3ET4A 4Q39A 3C6KA 2W2LA 3ZW7A 2VDMB 3BXPA 5HX7A 2PLNA 1EGQA 3OE4A 4P8RA 2Q8PA 3DEAA 1OW3B 2PD6A 2FDRA 3IXLA 2EKPA 3EDOA 3FJ1A 1G1MA 3KOXA 3HPRA 3WKBA 1OLSB 1TC1A 5FUQA 5DHTA 1G9XA 4KQ2A 2KPOA 4ZEOA 3GJXC 2EKBA 2CC2A 3MTJA 4L5BA 1PZEA 4O6VA 3DP7A 5KCZA 1FRQA 3NIWA 2QZPA 4TTSA 5TMPA 1EHCA 2BJHA 4HEA1 5EMKA 2FJ0A 2QEQA 4N1AA 2DULA 3ZJ5A 4ZVVA 3OZBA 4DR7B 1MDBA 4R2MA 4WCDA 1N7GA 1QHIA 2JIOA 4JCCA 4X93A 3K0BA 5CH5A 2QDKA 2G5CA 3GRVA 2PMEA 3T1OA 3TGLA 2B7LA 2XEXA 1HNZB 4Q02A 1P72A 1ZCFA 1UBEA 3HCOA 4X3OA 2FDCA 2RI6A 1XLWA 3KJGA 5LB4A 2X3FA 3C3XA 3HK2A 5EWMA 1P1RA 2I6TA 1BFDA 1NU8A 4AJJA 1XQXA 3LUCA 3LZCA 3UK1A 1F6WA 5EXPA 1QFMA 3NWEA 4EVIA 4F7DA 4CL8A 1NAHA 3V8PA 5DZSA 3LKDA 4XCXA 5IDQA 3U3XA 2XMQA 4Y9SA 5JAIA 2XUQA 3S2IA 3A2KA 3VJRA 2ZIVB 1KQFA 4Z8XA 2X0KA 2Y68A 3ZW8A 4BBAA 5KTTA 4LY6A 2V58A 2ZIGA 1PZFA 2YWGA 4KRGA 4OX9B 4YAOA 1ZSNA 2PS3A 1JHYA 3QOFA 1T5OA 3I2HA 2DCUA 5AQ1A 5HHTA 2JJ1D 1BDIA 3IEVA 2ZROA 4OHXA 4RLSA 3W05A 2YV2A 1N2SA 5B5SA 3QHPA 1B8UA 3PD1A 2NUBA 3R7FA 3NDBB 2VSYA 1VPVA 2V55B 3E3NA 1T15A 2ATVA 3DC2A 4BB9A 5KC9A 2J32A 1IQPA 1LLFA 4XIFA 2D2XA 3QQ5A 3TRKA 3OE7A 4IMPA 4KXXA 3FR7A 3PIDA 5I7UA 5KPDA 4A15A 1UPUA 2PLAA 4KODA 3CBQA 1VLQA 2DWCA 4IIGA 3VTFA 4CCYB 1TCVA 3K5HA 5JSFA 4RH3A 1BDBA 2I2CA 5AM5A 2LCFA 1ORDA 2EIXA 3AF2A 4Q37A 2G25A 3CPJB 4WLEA 2JVKA 3PC2A 2HQSA 4NABA 4JP1A 4XYBA 3WK4A 4XLLA 5K0CA 1RMTA 3EXG2 1OI4A 4JK3A 4ZU6X 2FJUA 4X7BA 1H8HD 4UU0A 4KWHA 4ZDWA 5C4IA 3KEQA 4G1EB 1W59A 4IJMA 2B8WA 2AOWA 2V54A 2SBTA 3U9SA 1UQUA 1VECA 4MR7A 4UTVA 3L4KA 1JALA 1N2ZA 4JR0A 1XDGA 1J07A 1VLLA 4FLFA 1RRCA 4BNXA 1AO3A 2PUJA 2ZBFA 1ECFA 3M3PA 2WAAA 3IOEA 3ZQ4A 2GGSA 3A3KA 3RNLA 2WTAA 3L6EA 3H5NA 1EUDA 4BQPA 4GVXA 1FTGA 4QBKA 5GGYA 2X1MA 3VU1A 1YIDA 4RM2A 1EZ1A 1X0VA 3ZKWB 2P3LA 3KJZA 5HUJA 2E3JA 3WKDA 5TS2A 3BXXA 1DELA 5KC8A 2PD3A 1QLWA 4G26A 4GPZA 4M7PA 1N2CE 2BGNA 4FNGA 3TFWA 3GN2A 3SIRA 4R54A 2GARA 3M1YA 3H65A 2ZJ2A 3I28A 2I2XB 4A23A 4RQBA 5BPFA 1PR3A 2ETXA 1XLTC 4HEJA 3PNBA 3SVZA 4YRSA 1BX0A 4ERNA 1Z28A 1C9MA 2AZTA 1Z7EA 1QLJA 1QZ3A 2WJPA 3K0FA 3SIXA 4B33A 2WIAA 4M1YA 3RSGA 3UK6A 4TMWA 1BEZA 1BZYA 3X1ZA 1A88A 3DULA 3FFTA 3QG5A 1A7KA 1RXIA 5MF6A 1PWYE 1UOEA 3SBXA 1NW5A 1N4DA 5LUBA 1VE9A 3R5SA 3EODA 2PGLA 3DL2A 3QF4A 5DI3A 3N39C 4P0TA 4XX1A 3VPFA 4YMVA 4F38A 1C0PA 3WA7A 1DTEA 4OBXA 1QIFA 4U02A 2NN3C 3QLUA 2HFJA 3WWZA 4TYWA 2FMXA 2PX3A 5JS1A 2FWBA 3HRIA 2H5EA 3GGPA 3NIFB 4TKMA 1PSZA 3I3OA 4CLOB 3TW6A 5IDWA 2I6GA 1L5LA 4G25A 1IG0A 2HBZA 1ZR2A 1IIRA 3EYWA 2HPHA 3WXMA 3DLTA 5DGHA 3M1IA 1L7QA 4DIMA 3BFVA 2OP0A 2VXOA 4U2CA 1Z6ZA 3VSAA 3QFHA 4Y1GA 4R1PA 5IMSA 1GG2A 4FBGA 2J3DA 4XGRA 2H1VA 4C22A 3U60B 3GP8A 1SPXA 4AO6A 1Y5IA 1CIJA 2A0YA 3GFQA 3N7AA 4NMXB 2UUAB 3EFOA 1KERA 2GD2A 4A0FA 1RCTE 3M49A 4I5FA 4CI9A 4QDTA 2ZUEA 4UULA 2VHUA 2XYPA 5CDGA 4R8MA 2QW0X 1W8IA 3QZUA 3SFTA 2VJKA 2EYUA 2BH9A 4FDAA 4TXNA 3GZ4A 4D8UA 1Z8FA 3O8OA 4AUNA 1DWPA 4RKWA 4J3FA 2B6NA 4KZKA 1SN7A 4FCVA 2P40A 1E8DA 1B26A 1R6UA 3DZFA 2G9ZA 4IS2A 2ZTLA 4QDOA 1T4MA 1Q1QA 4N65A 4RNDB 5TARA 3LY9A 3QF4B 1MTZA 1ZVJA 4QGGA 1Q95A 4Q7KA 5DI3B 5U4QA 4B47A 2AJCA 1USGA 2CNWA 2O5RA 2FMUA 1EUZA 1HORA 2KS6A 2QVBA 3QU4A 2BKAA 3KYCA 3SZUA 3ZVLA 4AXXA 4TPKA 4HH0A 4IINA 2B4RO 3JQBA 2X7XA 5B12A 1B93A 4GW3A 1CETA 2WIGA 3N0XA 1I3LA 3ND9A 1FDRA 1NQXA 4KE9A 3HXOA 3B6JA 4WZBA 3H9EO 4NPAA 2ZYUX 4DLNA 3SGLA 5BMVF 1W0JA 4CKCB 4W5RA 3K2BA 1E4EB 2C9BA 3AOEC 3H17A 3NOVA 3KAKA 1KI8A 2A0KA 4H6PA 5CAEB 4Q03A 1LY1A 1M8PA 4EAAA 4CEIB 4JEHA 7REQB 2QTGA 3OKPA 3EMVA 3W5DA 1E2HA 1CY2A 1QH0A 2PO5A 1II9A 4L9AA 5T4EA 1SHKA 3QEJA 4NBRA 4INPA 3WLPA 2BMAA 2W8BB 5A2QA 1NP7A 2BL4A 2JEZA 3QWBA 4UUPA 4WLOA 1PT6A 1QH8B 4M0UA 4A6EA 4D9IA 1EWQA 1HNNA 4F04A 3RT7A 3SBOA 2D7CA 3IPCA 2VHTA 3DGEC 2CUNA 3GAZA 1XJ5A 2VCEA 1T9ZA 2XB8A 4O2BB 2BZ0A 3TMYA 4EHHA 1LTQA 2X4GA 1ZX1A 3G0DA 4RD6A 5KNCD 1GHTA 3OO1A 4GYJA 4C7JA 1SVMA 1S9DA 3PGLA 1OAOA 4IS3A 3JCZA 4ER5A 1ABEA 1F60A 1KVQA 1R6VA 2D2IA 4WJLA 3THWA 4KNYA 1NJ8A 3VC2A 1YVPA 1EA7A 2FZWA 2R87A 4MGYR 3OECA 1TUEA 3FPCA 3ZHXA 2CXTA 4BKPA 3KSUA 4IVPA 4YCMA 3IV6A 4AJHA 1ZI9A 1H23A 2GN2A 5FI1B 2OGZA 2Q29A 4HKTA 5BUCA 3SFZA 2GBPA 2MIIA 3Q7RA 4ZTZB 2SHKA 1QK5A 1UXOA 4U00A 1JHVA 4HLUC 3RU2A 2O2EA 2ZPTX 1KGDA 1P7ZA 1RLOA 3BF7A 3D5QA 4B85A 1T9DA 2QJWA 4RGVA 2BKXA 2YJ4A 1K7EB 1U6JA 2YTZA 2YXPX 1XAGA 3FYSA 4RXUA 3C4QA 4XDZA 4FOTA 3U3DA 4D79A 5K99A 2Z3ZA 1GZHB 2CY0A 1ACMA 3E2PA 3B7WA 1DCFA 3GW8A 3A1VA 4H60A 3RPEA 3CVOA 4WE3A 5DX1A 3PJRA 2IH4A 2H3HA 1NVKA 1XEWY 5AHOA 3PQDA 3ZIDA 2JLXA 1WY7A 4WUTA 1R6XA 3IV9A 3KO8A 1DAIA 4N12A 4RD3A 2EJBA 1EBBA 2IFTA 3HCFA 2ZTVA 4ZARA 3PDJA 5HMLA 1U8FO 4QOIA 3EGXA 1JVBA 4JT8A 4Y6QA 1OJ7A 2JARA 2L19A 4DIEA 3JARB 2YS7A 1ZMRA 4ONEA 5EQJB 4E6EA 2VJMA 2AHOA 5B53A 2YHAA 2VKTA 3V2HA 3RC1A 3RJ9A 3NZEA 1H2BA 1X3LA 1DEHA 2F62A 2X0NA 4EMUA 3BHIA 4AMGA 1QHYA 4R6XA 3CEAA 1S2NA 5H59A 2FMHA 2GCEA 4PAMA 1NKTA 1USWA 3RBAA 3SHWA 3WG9A 2QRMA 2FG6C 5L3RA 1KO5A 4C6SA 4DCNA 3DOCA 4BLQA 1FDWA 1M34B 1KI4A 2VFAA 5CM8B 4EG3A 4GMXA 4YK7A 5HTOA 1ZDMA 5A06A 5CLGA 2CW5A 4Q1VA 4ZXFA 4MUGA 2MWMA 3BBPA 4HAUA 4MUAA 4TS9A 3BMNB 5FBZA 1FP4B 2IHTA 4HNTA 3RKRA 3T3IA 1ZI6A 3C3DA 4FOSA 4M7OA 5CHEA 1M75A 1I3CA 4FDMA 1PYDA 4QQFA 4YAEA 3RDPA 3THOA 2WZQA 1OX6A 3A7DA 1Y3IA 4L76A 2ZPAA 4MUIA 1SOUA 4ID9A 4OJNA 3FIJA 3ZD6A 2WQZA 4D0RA 3AL3A 3Q10A 1NSYA 1AKVA 1RE0A 2NO6A 3C8MA 3G5LA 4ZVKA 1YAJA 3W7VA 4DYDA 5EJEA 1L5ZA 2B1GA 2JJ1A 1GRCA 2PR2A 1KMHB 3AQIA 3BZUA 3D8SA 3LQRA 4GKAA 3BWVA 4KFRA 5CNKA 1DVRA 4QUDA 4DRXB 2HDNB 1X2EA 1I0LA 3MT8A 4KPUA 4B34A 4U8GA 4LNUA 3ROEA 1Z5UA 2GEJA 3F2IA 4NU6A 3UTDA 3ZLVA 1AXRA 2IYOA 4J7AA 5B6IA 4ABTA 4B2LA 1N33B 4KVAA 1R27A 2QSZA 1H5NA 3H5AA 4P22A 5FO0A 1BTOA 1QO9A 2FV8A 3U26A 1SQSA 4D6XA 5IC6A 2DH5A 1T1GA 4XJVA 5LMCA 1MO5A 2H1WA 1YI1A 2FW8A 3KJEA 3L0CA 4M36A 3UHOA 2GPYA 2BUBA 2Z6VA 3ICCA 3MSXA 3R7SA 5JDCA 4W5QA 4RMGA 5CEEA 1RZ3A 2WICA 1RRPA 1V8ZA 1YONA 3D9QX 4JB0A 4GDFA 2Q1UA 4MUNA 2JAOA 1VKHA 2E21A 1PQUA 3Q7EA 4Y2HA 2GR9A 2QS9A 4KAJA 3SC3A 4MICA 1FZTA 2XMBA 1YDHA 2MYTA 4MWEA 1KJWA 2LDXA 4M54A 4OQPA 3ZVRA 4MVJG 5TGTA 5IBPA 5AD1A 5IG2A 2IPXA 1N25A 1Z2NX 2NSHA 4PZ9A 1JHRA 2FSIA 821PA 3MPUA 2ECQA 4PLYA 1LSOA 1P3Y1 1Y8AA 1DP4A 3PJDA 4PYNA 1WZ2A 2GKSA 2IKQA 5AKLA 1JR3E 4UM5A 1AO0A 4DRXA 4EX7A 3ETNA 1WMDA 2P6UA 2RHDA 3CRVA 3QXJA 4DA4A 4N39A 1P8AA 4EEXA 1LLDA 1SOVA 2ZI4A 3QWAA 4X20B 3SQDA 5JNLA 3A31A 4RVOA 3N07A 2WZBA 2XE8A 1FVOA 3MM4A 1O0BA 1QX4A 1P29A 4FFNA 2AX3A 1HE4A 2Z8YM 2ZWIA 3ENKA 4O5OA 2FE1A 1Z4QA 4PZZA 3L0SA 4FI3C 5CK4A 2WFLB 1C3VA 1RAFA 2AOUA 2JHPA 3NG1A 1NQ5A 2XKAA 3PQ4A 5BNTA 4BQRA 5A2GA 3UW1A 4GR5A 1P4GA 4O4IF 4X6UA 4OHWA 1W0KD 1CZHA 2GDJA 2XEDA 1JPNA 3CKKA 3H2IA 2BFMA 3ZG6A 3G2NA 1SR8A 2H1SA 3IMKA 4WOCA 4ZT6A 4F86A 2C57A 5I7VA 2I34A 4AF8A 1Q3KA 3G02A 3HVKA 1LFDB 2B4TO 1YIAA 1T8UA 3PE6A 1NX9A 2PJUA 2XIQA 3QW4B 5FL3A 4Z53A 3A37A 1A3CA 2GJSA 1VMEA 5CYGA 1A4UA 2IY9A 5DWDA 4AZSA 5K8JB 2YVQA 1MNQA 1C29B 3RJMA 3V48A 4IGKA 5BN5A 1IBRA 1IN6A 1O5TA 3ANYB 1C0EA 1VKZA 1AMNA 1H8ED 2PUGA 2ZYVX 3C4VA 3R75A 1YDFA 3BRWA 3TLCA 2B4AA 1V95A 3L1JA 4WA8A 4MQ5A 1IZYA 1OFTA 3V9PA 3DKIA 2X86A 4DUPA 4NYMR 4YREA 1GADO 1M2KA 1QWSA 1FLAA 2DFKB 4NCIA 1DEAA 4XWAA 3MTQA 1JDBC 5LQAA 3RFTA 1AVTA 5ED4A 3IBGA 3SZ3A 1QVRA 5G40A 9ATCA 3ZHVA 5I48A 1U5BB 4ME6A 3O75A 4ARAA 4BMOB 2GK7A 1EFTA 1T6ZA 3H2YA 3LYUA 2JATA 4ZU3A 2G09A 3QIVA 5J5AA 3NTOA 1L5HA 4AP9A 2LNDA 4IZHA 1O5IA 2XI4A 5TQ2A 4WLFA 2P77A 2QUKA 3PWZA 3R8CA 1NIPA 3LO8A 4OBEA 4ZP1A 4QATA 3CW2A 1GLNA 1DEKA 3W5HA 3NUGA 5FL7D 5FH9A 4RPKA 2WYOA 3G2MA 1BVRA 2J48A 3QMMA 1DQZA 2EYQA 1FZQA 4NL4H 3UMSA 1MV5A 4B8YA 3A4IA 4D9CA 4CTOA 3HEAA 3U3MA 2FPSA 3SYTA 2ZVPX 3RAPR 1PZMA 1XZAA 3TKAA 1QHNA 4TMVA 4BKMA 1NW7A 4NCHA 2QIPA 2Q9UA 3ETCA 1CUEA 2DZDA 2X3YA 4ISCA 4K8RB 3FNIA 3THSA 1A8QA 3PE4A 1TIPA 5JYCA 3BGVA 5HF8A 3ED5A 1LDBA 5CLHA 1N5DA 2V8BA 1UKZA 4ZOBA 2C9MA 1WQ1R 4G67A 5HM8A 2EW8A 3OTGA 1T10A 3R4VA 3K9CA 1A98A 3HCAA 2HJSA 6REQB 3D0QA 2R1TA 4D74A 3FNGA 1SC6A 3INNA 5JH7F 3VVMA 3T5MA 4B1FA 3DXZA 2QXYA 3WL7A 1JH8A 3AHGA 4D57A 2BP7B 1X8JA 5FI3A 4PG6A 1UCFA 3CCBA 5TC4A 3UWDA 4EA8A 2ONKA 4ARBA 3VZQA 3WGNA 3T9CA 3VR5H 1MJGA 3NJ8A 1L5RA 5K8VA 2ZTUA 3HMQA 4GRDA 2WAOA 1C3LA 1ZP6A 2B2NA 1NONA 2GT1A 2B30A 5EJ4A 5H5JA 4E32A 2OAP1 2WA2A 3BSWA 1C80A 1L7BA 3BQ9A 1X87A 4QJIA 3V6MA 4H1WA 2QXTA 3LF1A 4I1OA 1XJ0A 1SC4A 4FEYA 4QEDA 5H7XA 3REQB 5HXAA 3D7NA 1FPQA 4JT2A 3UT5B 2ZB2A 3WWEA 1CU1A 4PO9A 1DMSA 3TZ6A 4PN3A 2HHLA 4ENUA 5CYOA 4UDYX 1NVBA 5BN3A 1DOAA 1NV9A 1P4SA 3OT1B 1U1IA 3RIYA 5ILOA 3MIIA 1D1SA 3I2GA 2M6RA 5AM4A 4ZMRA 2VYQA 4AO7A 4CEHA 1JXAA 1D7AA 2OB1A 2EZ9A 2AYYA 2O0KA 1XA0A 1Z07A 4EL5A 5BUZA 3LC0A 3SDBA 4UZEA 1X14A 3IO5A 1T91A 4XD7A 4YX9A 3V4OA 3DT6A 4W8OA 5C5DA 5JAOA 1VLHA 1W4BA 2QLMA 3LXRA 4ZO8A 1FNMA 2RGYA 2G1JA 3TD9A 2N9UA 3FSGD 1PTJC 5J9FA 3ZCUA 5BWBA 2Q49A 4MWGA 2BFEA 4YRKA 2RJOA 3L8GA 1E8NA 4JJ4A 2H92A 3AF4A 4LX0A 2BEUA 4JJGA 5SV2A 1LJUA 5F77A 5KSOA 4A5SA 3GUZA 2A0UA 1MN6A 1I3OA 2BGUA 3DLIA 3NTUA 3H8WA 5G2OA 2C2XA 2ACVA 3D2CA 4XQ0A 3SY8A 3LTEA 2R6FA 3U9TA 5A9SB 3WO1A 1WKCA 4FZ3A 4F4UA 1RJDA 1A9RA 4F92B 2X40A 1NVXQ 2GAFA 2WWTA 3JD2A 1NUAA 3MMXA 3NHLA 4JQOA 4TMTA 5B1SA 3U3OA 4ENRA 4ZYLA 4BV8A 5CT9A 4WN9B 4JNKA 4EI8A 2JFBA 4O4LB 5AICA 3A06A 5EPEA 2OFWA 5BSUA 1U5BA 1XQ9A 2QUAA 3D4LA 1D6JA 2N42A 5BNFA 4CCAA 3SX2A 1Z29A 1W1WA 4LZPA 3V7UA 4DC1A 4RVDA 4ND1A 3FXAA 3FHLA 3IJPA 2R1ZA 4HNHA 2C3PA 4CW7A 1A69A 1NXXA 1M1ZA 2XCLA 3FE2A 1EP2B 1V9SA 5CK5A 3TOVA 2CT8A 4P86A 4I8IA 3MXOA 3AI2A 3QMWA 4OHUA 3F6PA 4V0OA