1C9EA

Structure of ferrochelatase with copper(ii) n-methylmesoporphyrin complex bound at the active site
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
306
structure length
306
Chain Sequence
KMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords PROTOHEME FERROLYASE
total genus 112
structure length 306
sequence length 306
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA02
1HRKA 2XVYA 3HCNA 3AQIA 4MK4A 4KMMA 1QGOA 1TJNA 2QD1A 2Q2NA 2HRCA 3M4ZA 2XVZA 3HCPA 4KLCA 4KLAA 1L8XA 1LBQA 2QD2A 3HCOA 1LD3A 1C9EA 2DJ5A 2PO5A 2AC4A 3W1WA 2Q2OA 2C8JA 2XWQA 2HK6A 3LYHA 4F4DA 2PO7A 2JH3A 3HCRA 4CCSA 1AK1A 2XWPA 1C1HA 2XWSA 2PNJA 2QD5A 1N0IA 2AC2A 2H1WA 2H1VA 2QD4A 3GOQA 2QD3A 1DOZA 2Q3JA 2XVXA 4KLRA 2HREA
chains in the Genus database with same CATH superfamily
3ZHVA 3BTSA 3EE6A 1L7AA 2DHEA 2XAAA 4NZNA 5ER9A 1USGA 2H7XA 1R8QA 1GRNA 3IBGA 2BFCA 4U9IS 5CM9C 4YQEA 3T61A 4S1VA 1M6HA 1RKUA 2HRDA 2XXJA 5DNYB 4LMPA 4EJ0A 4Q03A 4BKOA 3MWEB 1ST3A 4DUGD 3SIXA 4EATA 2I7TA 4WXMA 1ZJYA 2AYZA 1T3LA 5TE9A 3ANMA 1B0PA 4MHOA 3IAUA 1T2VA 5JRZA 3HWRA 3PB3A 2EJVA 1ZJ4A 4N49A 4XGQA 2PA3A 4WLUA 3RFFA 1DAMA 1C3XA 2A35A 2PIAA 2AG5A 3HU3A 3Q2IA 5IJZA 1EP2B 1HKHA 1T6NA 2WLTA 2VG8A 1E2MA 3FCXA 3JQDA 4MR8A 3C6YA 2ODTX 2PQ0A 4LYYA 4QOGA 3WLOA 4CQMD 5JY6A 2JGRA 3DP9A 5CGZA 4RD4A 1U65A 1DIGA 3HN2A 3B36A 3WWOA 1O6FA 3DBHB 2G63A 3UW1A 2GVNA 5ERYA 4DQ0A 2CVOA 4OVKA 3I3OA 1AURA 2GAFA 3KKOA 3Q6IA 1ZEMA 4OGLA 1UAYA 1XKQA 1NVTA 1MOSA 2QYSA 2X9LA 1ZH4A 2XNJA 3L7DA 4P4GA 1I36A 4ZZ2A 4YLYA 3CCCA 4J1TC 4TOIA 3TH5A 1E5QA 3HZRA 1HG1A 1M2GA 1X38A 4HAYA 2PO7A 2C88A 4L9WA 2FQYA 4WEQA 5FQNA 3L84A 4IFTA 1II9A 4GNRA 3UY4A 3K9FC 1VMKA 5HS6A 1R0LA 4N6OA 1J8VA 4F84A 5JD6A 1PD0A 2C8VA 2BIFA 3M2PA 3PUYA 2GX6A 3T3OA 1VA5A 4HAVA 5JSKA 1I10A 3GWZA 4Y6SA 3VDMA 4GMXA 1QYCA 3QXCA 4PS1A 2GMWA 4PSUA 5J2TF 1VHJA 3QJGA 1T35A 4XQ0A 1KO5A 2JGDA 2LZ0A 4TS1A 3FYCA 1PG0A 4L5JA 4ZJUA 1KFJB 1OZHA 1W2WB 3HCBA 1KH1A 3K5WA 3UK6A 4LDAA 2BFEA 3E03A 2QI9C 3QU2A 4RTOA 1E7SA 3H1AA 1YR6A 4JUFA 5HKKA 4Q1FA 3ZHTA 3NDJA 5DTRA 3RVJA 3C6BA 3CPEA 4NPCA 3IA2A 4ZCRA 1GLNA 1C1HA 2HCBA 2QLFA 4AZ3B 4EJ6A 1WKVA 4AYXA 3KDPA 2OAQ1 3GT7A 4K6GA 3OIFA 1QX4A 2CN1A 3SS7X 3WRYA 4EEXA 2VLIA 1MDBA 1VPTA 5BMVF 1O08A 1VE9A 4WLNA 3S2UA 1JV2B 2NQTA 3VRHA 3DL4A 5A0TA 2AQHA 3DXFA 1KZ4A 3OIWA 4G5YA 3AVVA 2FWJA 4A23A 2AZ4A 1LSOA 2AG0A 4R01A 3VPFA 4H7FA 5LNK6 1W4ZA 3CZQA 3ITNA 4AN0A 1N2CB 4C4XA 2PUCA 3DF9A 3C8ZA 4GPD1 1AMNA 1W73A 3IPRA 3LCUA 3HUFA 2DT5A 3FWYA 3GEGA 4HLNA 5ALRA 2CLOB 5K3EA 2CLSA 1Y6JA 4RS4A 4ECEA 1SY7A 2FRXA 1NVGA 2BFBA 2QGNA 3EVNA 3JZAA 4INOA 1XAHA 4O2AB 3UANA 3ZWPA 2K5UA 1ZIYA 1ZM9A 3QPAA 4FFBA 2O48X 4KYTA 4PZAA 3LS2A 2CE2X 1K63A 2OCDA 3L46A 3K72B 4MGYR 4Q7MB 4QPJC 5DZSA 1KGDA 3BJRA 1S01A 1W59A 1E94E 2EBUA 2VQ6A 5DGCA 4KFCA 4ASUA 4MNTA 4ROSA 2QU8A 3B7WA 3LUFA 5K0CA 5K8UA 3GVPA 5AKGA 2X5NA 1USUA 2DQYA 3PHBE 4YV1A 3L43A 3W1VA 3VPGA 2Z6VA 1GUDA 4BJ5A 3P97A 2ODAA 4HBGA 4RD0A 1T3ZA 4B40A 3VM6A 4DIKA 1JU3A 1TK2A 1H3EA 2CHUA 1NT2A 3E9RA 4NV3A 4DNQA 1MJ5A 3P27A 3B38A 4I1RA 1TPZA 4I55A 2LD4A 5C80A 1N5OX 4C6SA 4LJKA 1Y1LA 3TIFA 2IGTA 2ATXA 4MH0R 4OB7A 5BN4B 2H16A 1HG0A 2ZIEA 4HEJA 3WP1B 5B3KA 4X8MA 4MIYA 1OY1A 2IU0A 3KFLA 2ST1A 4DLXA 3AEXA 4FJ0A 2XIQA 3UATA 4RH1A 1FP7A 3RABA 1RNLA 2C03A 1HK7A 2XVXA 2EOAA 1QHFA 1G1MA 3OLVA 1WMDA 3MMPA 3R0ZA 4ND1A 4QU8A 3VU1A 4UOZA 4G56A 3PPXA 2GTPA 2VSQA 3Q11A 3I2IA 1H3FA 4IZOA 1RQ2A 5LLTA 1RXCA 3IE1A 1OI3A 1WETA 2PZLA 4WZZA 5I4KA 5C5IA 5DBOA 1JHAA 4MVJA 3CJRA 3KQMA 4FYVA 1DARA 1W4LA 2HGSA 3AHFA 2VF5X 5EYPA 4WAUA 4PGHA 2HK6A 3DZDA 1ORDA 5IRCD 3PGMA 4QT4A 1FUIA 3LBHA 4OQDA 4POOA 3HJFA 2ZRPA 1MB3A 1N36B 3NRJA 1SUSA 5LA6A 2LXNA 3EOAI 4Q7EA 3VKHA 1D4AA 4BPBA 1SBTA 1E18A 3IO3A 1ZH8A 2PGLA 4P31A 4RK4A 3WBFA 2I5PO 2X5KO 4YHBA 1H4VB 1LPBB 1TF7A 1TZMA 3NOVA 2V74B 5CVTA 3FPGA 4N5IX 5JO9A 4RLQA 3OTOB 3QLVA 4EECA 4UHDA 3JATB 4RHFA 5AXBA 1ISIA 1KJ8A 4MAFA 3PK0A 3LQ2A 2PSEA 3I32A 1T0JB 4XIIA 3VC7A 2E4XA 2ENWA 1AMOA 4JR1A 1KC3A 1Y7TA 3SE7A 1EVQA 4J0JA 1IN5A 1SUCA 1X0XA 1GAWA 1PL7A 1KMMA 2VYNA 4AIIA 2JK0A 2Y1WA 5I3ZA 5BR4A 3DDOA 4LBWA 4G4JA 1ACLA 3JVUA 3RFCA 3WQBA 4P82A 3B9RA 1UBNA 2OMKA 2OQVA 5B30A 3BIXA 2F4VB 4E12A 2DB3A 3IALA 1LSUA 3QKWA 3F5SA 1X13A 1M2VA 3H1EA 1E3DA 5DKFA 1D4FA 4TTQA 5BUCA 2JKVA 2YCLA 1Z8NA 2PZ8A 4FGWA 4HADA 3TN7A 2PUDA 3VZQA 1L7NA 2J9RA 3RSGA 3SS8A 1KO7A 3GA0A 1C9KA 1I0IA 4HZUA 2NP6A 2R11A 1NXPA 1TF2A 2QTTA 3QPDA 4ETMA 4LG1A 2FMTA 1SPBS 2VCEA 3FNQA 4O4HB 3ZCQA 3AONB 3RUIA 2X0RA 5KZMB 1XCBA 1L9XA 4YCBA 3OJCA 1YFKA 2DWQA 2L17A 4JL6A 2QD3A 4CQJA 3GLGE 1NDHA 3OZ7A 3NPAA 2HD4A 5HEKA 4BLVA 1BXRB 2NO1A 4HGQA 4N6NA 1M2FA 1O9GA 2ZIVB 1XTKA 3HL4A 3N7TA 4LHXA 1SOUA 1YDEA 3VH1A 2P27A 4EAQA 4UEOA 3W2FA 3CN9A 1CE8B 1IN7A 2WUEA 5AJUA 4FFVA 1XVAA 2QF7A 3FCYA 5H59A 1TMOA 2BEVA 1SBHA 1XMPA 4XIFA 3RREA 2RGEA 5LQSA 3CSUA 3A2KA 3GJYA 3KOZA 4R31A 1D4ZA 2VL7A 2WFAA 2YXDA 3QX8A 5TF0A 2VRCA 5A4KA 2HNBA 2VAWA 3D8SA 4UE3S 4EKIA 1FX0A 3F46A 3H9QA 2JG3A 3ESRA 3KFXA 2AQKA 2YW2A 4O4IB 4WFIA 5K0EA 2QN3A 1DCKA 3GIWA 2P2SA 1H2FA 1Z0JA 4FYHA 1CZLA 5LMZA 3EGCA 1VSVA 5EMKA 2VDJA 2R0QC 2D3TA 4JUAA 5AK3A 3IIEA 5H4GA 1TYDE 3U0VA 5BVGB 5HGXA 3ZHCA 1FDOA 3GFPA 4LTNA 4NCBA 3S1SA 1SCBA 4KZPA 2CNNA 1SR8A 3K9QO 4D8XA 2P9TA 1OI4A 4DEVA 1F2TA 1DFHA 1X8XA 2WWVD 4IMPA 2JJYA 2CLKB 3P20A 2NAFA 4O25A 3TZKA 4FJ2A 5DWQA 3ZTYA 4CL0A 1R27A 3VHXB 1GG9A 2ZP1A 3ZQJA 2I0FA 3ILXA 3T3GA 3IP3A 2PMFA 4B8WA 3UKDA 2FV8A 3N5KA 3F0TA 4CTKA 3RRXA 4K9QA 1WF3A 2QDKA 4AK9A 3QF4A 5ALJA 2ZXUA 3TZ6A 2A1UA 2W2NA 2X5XA 2BV3A 3BZWA 1EIWA 2IITA 1NQUA 4N5HX 5HF9A 2BVNA 3VOTA 4MWZA 3EPHA 8AT1A 2EXXA 3R41A 2QD5A 2Z04A 1RLTA 4P92A 3TRHA 4BP8A 3THYB 1WULS 5IWAB 4D56A 4ME6A 3H2KA 4B1FA 3TDNA 4Z1MD 4AJJA 5CT5A 4GQIA 1U0OC 3A4TA 1E60A 3OU7A 3CX7A 3OC6A 4BIIA 1EAYA 1OUMA 1UXHA 3KJIA 1PD1A 4E33A 1MAUA 1V1JA 4IICA 1E3SA 1KNXA 3P9YA 5BURA 2Z2JA 2VK8A 3W6ZA 5JJBA 1LS1A 1SPXA 3PJFA 1MO5A 2QD2A 1N7HA 5H5JA 4Q24A 5KTPA 2B4KA 2NXJA 3FXAA 4F11A 1N9GA 1OOEA 2FLKA 3PR2B 2JAUA 1G55A 2D3WA 4MP8A 1QKIA 2H1SA 2ZE8A 1EGMB 1CZUA 4R9RA 5AOVA 2Q07A 3IVRA 3R3JA 2D62A 1KEPA 4N0EA 4MAMA 2AZMA 4KE7A 2HU2A 3CF4A 1L5WA 1ZHHA 1PK8A 1X39A 2ID8A 2QGZA 3L7AA 2IV3A 2PAFA 4D9NA 2OOSA 5SY4A 2FMIA 4BBAA 1LLDA 2CBXA 2ZI9A 1BWRA 4EW1A 2O8VA 5EGNA 1KL7A 1Z4QA 2PT7A 5HTOA 4M89A 3ZNNA 3FY4A 3A05A 2QHXA 4BVEA 2J41A 4O5AA 4TM8A 4A1FA 4Z4HA 3PQ4A 4LCBA 3Q3IA 1Y82A 3IBCA 5K09A 1YFJA 1I24A 4MJLA 1FMLA 1X6VA 1FJ2A 4BFTA 4DNFA 4DWOA 4CU5A 1F20A 3FLEA 5EMHA 1GKYA 4BWGA 1N78A 5KWIA 1I7LA 2C4HA 4U2GA 2NV6A 2VNAA 4O29A 5JBNA 2Q5IA 3A8TA 3OQPA 2V96A 3LLCA 5AKKA 5AHRA 5FL3A 3TD2A 3INGA 1H23A 2ZIFA 3BJEA 2OZVA 3FG9A 2Q1WA 5FTJA 2W6CX 1R9JA 1YJXA 3DMTC 2XNKA 1XP5A 4NH4A 2V58A 3FTCA 3L8YA 3P7MA 5IJXA 4DLPA 4UU1A 5L4NA 5KO2A 3QPCA 2OHOA 1VKNA 4YRMA 1N8TA 1CDZA 3K8YA 5IZCC 3UOGA 1JDBC 1BEZA 2AOTB 4OXNA 2VSFA 4MARA 1QTQA 4YMGA 3FNEA 2C7GA 1VG9B 3CNNA 3M1AA 2PS3A 3EOBI 4EY4A 4AP9A 4M1YA 4DOMA 1OYWA 1J6UA 4B3HA 4DJDC 2X7HA 2N75A 4BDSA 1XZJA 1R88A 3TQRA 3AERA 4ZKDA 4QPZA 4DMKA 5E95A 1AZTA 1A50B 2C2BA 2FPXA 1XEXA 5JVDF 1VIDA 1R0BA 2YMLA 5THXA 5KWSA 2Y1DA 4CF3A 1H6CA 4X7BA 4ZJYA 1TAQA 3HV0A 3MS4A 1XZCA 4IIHA 1ZBQA 4IX1A 4YUVA 1KZGB 1VLMA 1XDDA 2D0IA 2X0KA 2X5OA 3QITA 4QUEA 3L41A 1PHRA 4HAUA 3HBJA 3SY8A 3QVJA 2P4EA 1GQRA 1Z37A 1NVEA 2BBWA 1GRRA 2F4NA 4A8JB 1GV0A 3PC3A 2DR2A 4R41A 3W8NA 1IFXA 4ZAZA 4JX9A 5FOVA 3PA8A 1ZOOA 1KI7A 1RQPA 2OK8A 1VSBA 3R5FA 1BFKA 1M2EA 3H3JA 4HUTA 3EMDA 3RRFA 2B5WA 1DKPA 1Z6TA 1QC5B 3AUUA 4RLFA 4F38A 2X1LA 3NWPA 3ZX5A 3H16A 3AIIA 3TXAA 3BIJA 2EP7A 3BREA 5LZ5A 4EG6A 3FJYA 2HDWA 2HQSA 3I2HA 1J22A 2IELA 1TO6A 1E9EA 4J9VA 1QHYA 3EZ2A 3O2QB 1UOEA 4GSLA 1CS4C 3EULA 1VP9A 4RTLA 1PI3A 4LRYA 2IY9A 4QNMA 1O0SA 2WJIA 3L7BA 3ONFA 1E64A 3T9DA 2P9ZA 1RXUA 1SOMA 3L5OA 3LT1A 3KQNA 2CVQA 5DGHA 3BVPA 3ISJA 3KOXA 1I1QB 1Y1RA 5AW5A 3IS3A 2ZM5A 2ERYA 1BVUA 1WMSA 2QW1A 3A11A 3OCJA 4CGYA 1BDHA 4LF7B 1NULA 2D1SA 4YBZA 2IOHA 4IV0A 2O6LA 2QRLA 3VV3A 4DBZA 5A4DA 1Q1BA 3TJMA 3RK1A 2B25A 1MGOA 1VJRA 2I2AA 5DRYA 4DS3A 3ETDA 4F6RA 4URXR 4BRWA 4N3CA 2R1TB 3DXZA 4DQDA 4F2HA 3WLQA 1VE7A 2BKLA 2ZK7A 3SZOA 1VBKA 2W6OA 1DAPA 1X1BA 3M5CA 3K8OE 1M6NA 3E7DA 4M87A 4GXQA 1XHLA 3SJAA 4UXJA 2A4KA 3TRDA 1T9AA 2R6JA 1KDZA 5FTLA 3HABA 1MEOA 4KYVA 3OCCA 3BFJA 4ZREA 4BLQA 1R8YA 3GJRA 1B26A 4RGVA 3NTRA 2AFRA 4H7IA 4UNQA 2V9ZA 621PA 1JAYA 2VAPA 2YY6A 4GG1A 4D4IA 1FX1A 4NU8X 1S2OA 3KT3A 3NOOA 4IOJA 4RVFA 2Q0QA 5H3HA 1N0UA 4EW2A 4DV2B 5AVOA 3KEOA 4F60A 3EQ8A 1V39A 2EFGA 4TKZA 4RWEA 5LQCA 4RANA 1IWOA 3DZGA 1LEHA 1BWSA 1QFMA 1FLNA 2I1QA 2LIPA 5TPZD 3TBFA 5ADUS 1AMUA 5MN6A 3HA2A 1L6RA 1ZD2P 4QM6A 3O2SB 4IHKA 3H1GA 2R97A 4G0MA 4KIJA 3OZRA 4MKHA 3S1AA 4HNAB 4O5OA 3SAJA 3F6CA 2YZ7A 3CTPA 3UXYA 1JALA 4MB2A 1ZK1A 3UPDA 3I4CA 4BZZA 4FYYA 1UBEA 3ENZA 4XDGA 2ZSDA 3ZVNA 3DZHA 1JJIA 2CUZA 4FSXA 4XSHA 4FIZA 3F8WA 3HZOA 1JZSA 2Y0CA 1T0IA 1P6XA 3ZJ4A 3B1XA 4FC7A 4F96A 2PXCA 3ZIUA 5IU6A 5KYXA 3TTWA 1CF2O 1LZLA 4XX0B 1R0XA 2UYHA 2I4NA 1SUBA 4QBTA 2BMJA 3BL8A 5TRTA 6GPBA 2FMXA 4EB0A 1OTXA 3KJNA 3KKPA 4WZBB 1SOVA 1QYWA 3ZJUA 2MYNA 3NO4A 4BQPA 1Z8HA 4NBTA 5KX5F 2JBAA 3P9ZA 4B87A 1I1OA 4PFQA 2I2BA 2FDCA 2Q6TA 3GDHA 4XXHA 1SC1A 3TIGA 1A7UA 3HLKA 2KLBA 3R6DA 1EVLA 2DFNA 4OHYA 1EEXB 5DGIA 1RXYA 3OZCA 1SUAA 2CLIB 1QQTA 3AW9A 4HEHA 4HS9A 3IC5A 4TVOA 1U0BB 4YCJA 4R8KA 1G9XA 2WFLB 2LCIA 3K9NA 4I46A 1D6NA 3HDYA 4XD2A 4YO7A 4CUZA 5LP1A 1M5UA 1Y0BA 1AQ6A 3G8YA 2XMDA 2QJRA 4JLBA 4LY3A 3RB8A 4OO3A 2DWUA 3GEEA 4P2GA 1ZVVA 1YE5A 2D8MA 3WWEA 4D57A 2HJRA 3FMVA 2P5UA 3KXPA 4O1IA 2HF8A 3WC4A 2HMTA 3ZK8A 4EW6A 4RENA 4V3CA 3MWKA 1SIOA 3U7RA 1RM4A 3L7CA 1XTBA 4YMLA 3U19A 2EKPA 1PFWA 1N5KA 4FNGA 5DLDA 2J3JA 2VRBA 3NWBA 4JJ8A 3GOQA 1P5RA 4UUNA 2FR8A 4WEOA 1IN8A 2X58A 3KWJA 4U0JA 2BRUA 4PX5A 5C3MA 3GPLA 2ZS8A 2W2VA 4C01A 3IA7A 4L0QA 3HKEB 2ZT8A 5A7FA 4K9PA 4ICIA 4YUYA 2ORED 3A2LA 5FADA 1PV4A 3FPFA 1LUAA 3EMKA 1W85A 2R48A 3L49A 3K15A 2K7FA 4LOIA 3TUIC 4AJPA 5ETJA 2EBHX 2QTBA 2WPNA 4JOBA 4XWTA 3VR2A 3VVBA 1W0KD 5J9FA 1TK3A 1QOQB 4MMZB 2QTWB 2DU8A 5B7QA 2P0EA 2QPLA 3LP5A 5CA0B 4PGMA 5J4LA 3H3FA 3LDFA 4H1VA 3TLMA 1NVBA 3NUGA 4WNAB 4DL9A 3FBWA 4MUJA 4JENA 4Y0AA 3AP1A 4N3AA 2FEXA 2XITA 1XELA 1IZYA 1STOA 4RQAA 2OCYC 1XTUA 4GAEA 1OBHA 1G9TA 4F9TA 5EWLB 1A9OA 3TFWA 3JATA 4LMRA 2JW5A 1K92A 3ACBA 1KXJA 1PGOA 2QEQA 3KLNA 4HQKA 4JYZA 3TQIA 2R7NA 3RVQA 4LBZA 4K05A 4KUEA 3W8DA 4BFLA 3WK7A 5FHQA 3FSJX 4DR7B 2Z43A 2E3JA 4MQMA 2GAAA 2QP3A 2I6TA 1Q21A 3A6HA 1ZI9A 1EX1A 5AOAA 4ZZ0A 3I8SA 4X6UA 3ER6A 1XCMA 2WJWA 2ZUSA 2CKMA 3GLVA 2JEYA 3QEMA 3HA7A 4LJSA 2CV2A 1ZHOA 1BCSA 4EKDA 2VT7A 1VKZA 1DV2A 1W0CA 4ENUA 4LXHA 3OESA 1Z22A 3EQ2A 1O95D 4NPAA 4ZVVA 2BBOA 3E7FA 1CWUA 1H8ED 3I73A 4US0R 1Q5PA 3A9VA 1E2FA 1K2VN 1WXHA 3K73O 2D4AA 4HAWA 4OSOA 4RHCA 1IIBA 3EIUA 4Q15A 2XDYA 2XQIA 1TIPA 2MU1A 2R2AA 4IDEA 1QAQA 1KI4A 2H1OA 4LXYA 3AU8A 1Z7WA 1HSOA 5ALGA 1JECA 3ZCUA 2UUBB 5A4IS 1SVIA 3BMCA 1POXA 4BXOA 3SMVA 3AM1A 4L5CA 1JHDA 1GKUB 1IXKA 1T2DA 4TYMA 3WLJA 3QYFA 3CVJA 3IQXA 3VPXA 3WJAA 4DV6B 2A94A 3ROXA 2IPLA 1U9JA 1Y7IA 2VYFA 3IKVA 5E1BA 2ZUVA 3HJHA 4EO7A 4DREA 1KI8A 1Q17A 3EA0A 2HY7A 3GFFA 1NKTA 2TMDA 2BGUA 1AXGA 1T8WA 4CLOB 4M0MA 3ER8A 1L4HA 4QWMA 4A6EA 1YKFA 4FVTA 1KAMA 4GLFA 4A4DA 2CXSA 3EH2A 4WNIA 4MRPA 5AM2A 2IYTA 1TYBE 2EFJA 2YN4A 1GZ5A 4M8IA 4FINA 3L0PA 7REQB 1U31A 3B3QA 3D2AA 1J9EA 1U99A 3IDAA 4QJ3A 3T1TA 4JQSA 5KTTA 3ADBA 2NO7A 5ELLA 1JVNA 1GGNA 2OP1A 1SKYB 4CEHB 4PYIA 2C31A 1R4ZA 2PV7A 1CCWA 2JANA 5CXXA 4M1ZA 2F67A 3ZI0A 4CKEB 4QFCA 5TQ2B 2XQKA 4LXQA 4EG5A 3OCUA 4BLOA 1KEUA 4JI3B 4WOJA 3VO1A 5AI9A 1MTOA 1U8FO 2PU5A 2YXPX 5B3LA 5EJ7A 5CX1B 1ISPA 3WKEA 4BN4A 1GHTA 4RPCA 1Q3HA 1T0HB 3BAFA 4HYEA 2XMCA 4TN1A 3EIHA 3ZN2A 4EY3A 2LUOA 1N6LA 1JIXA 1O94D 3EEIA 5LDGA 3HM9A 4C1NA 1KRHA 1FRNA 1XNHA 1E69A 2CLDX 2CZCA 4KFSA 4LHSA 3UFBA 4G1FA 4AQ7A 4OJTA 2ZB4A 3SYLA 3SZRA 2IUTA 1KFKB 2B3TA 3OZUA 5EEHA 4DV5B 4YJFB 2W22A 3IKMB 5FRDA 4J16A 4GXNA 4L2IA 3WMEA 3H6HA 2JFXA 4F2GA 2R8ZA 1LDBA 4G5FA 5HK9A 4FN4A 2O3UA 4I7EA 2HXSA 5ALSA 3I30X 4PEVA 3F8SA 3GLIA 2X3UA 2NTNA 3F9IA 4J0EA 3O75A 4AX4A 4UMEA 1T1IA 2FWBA 2NW6A 4R7GA 3WK4A 5GVSA 2HFJA 1EG7A 4RVCA 4PPQA 3TYXA 2C96A 3HM2A 3TZCA 3MTDA 5LR6A 2VHVA 4BX3A 4EJSA 1OR8A 3KDSE 4KBGA 4C0QC 5BOSA 4XVCA 3K4QA 5HHTA 1K98A 1C3VA 2ECPA 3L4BA 2EW8A 1UJMA 2VJAA 3RAPR 1CJBA 3IPCA 3HB0A 4WKGA 4KXYA 1JVBA 4Y1RB 4WNAA 1XZLA 1Z8FA 1T15A 2R6HA 3FPSA 4L6IA 2A5JA 4YCLA 4H7JA 1WLYA 4H08A 4EG8A 5A9SB 1FDUA 121PA 2RG1A 3GGDA 3LKDA 2XIJA 2JRLA 3DV0A 4W1RA 1OASA 4OXRA 1YIDA 2O1WA 1WU8A 2M32A 2XGSA 5AHKA 1PVDA 3PT5A 4Z5XA 3HY3A 5DVZA 2RARA 1NYRA 3VHLB 5YASA 3CZRA 4HLUA 3NTUA 1G8MA 1GEGA 3KRTA 4F2DA 5FYQA 3NHAA 4HGNA 1TCVA 2VNSA 8OHMA 3VPAA 3T5GA 1G5TA 4B35A 5DNAA 4B8ZA 4FNMA 2O8DB 2V6BA 4U02A 4JEHA 3I2FA 1W36B 1YJCA 2ZJOA 4R9NA 4IO0A 1QTIA 1OWMA 3SC2B 3U3MA 1VG8A 1U4SA 4J7CA 2ONZA 3L9XA 3LLMA 2AVNA 4RQTA 4UVHA 4Q0MA 5IBRA 3DAFA 1BEUB 1OZAA 1YE8A 2PZMA 2WHQA 3C0KA 2P1RA 3QKTA 3EXHC 1Z18A 1KBQA 4P7FA 1DB3A 2IS2A 1FTGA 1L7EA 4RKEA 2XRFA 3R5TA 3T12A 2UU9B 1SBQA 2WT8A 2AX3A 3MTGA 4Z99A 1JHYA 1XTSA 1QNLA 2Z4RA 4REQB 3RC1A 1RD4A 3LVBA 2EDCA 4QHYA 5HTKA 3PITA 4UHJA 4KV9A 4C0WA 3UV7A 2XYRA 1AQLA 1M66A 3NORA 1WZNA 2BD0A 2PWPA 1SAYA 3DPSA 4P38A 2ZCVA 1J70A 3LX8A 1J1IA 3IVAA 4H35A 1EE1A 2C3PA 2O7VA 2QTZA 3NASA 2TMGA 3OMXA 4ZI5A 4MJXA 1JEOA 1R8JA 2GA9A 2ZWAA 5KUTA 2F9LA 1H8HD 4MRRA 1N5LA 5AKEA 5JQGB 1BO6A 2B6NA 2GBIA 1PZMA 2VFAA 5F35A 3KO8A 5C4GB 5TQVA 1BWPA 3ZWNA 5JASA 3RHTA 4NBVA 3ZJ5A 1GITA 4D79A 5EIFA 4CLOA 2K6GA 2AKYA 5IK2D 4BMSA 2XCSB 1P9WA 3IFSA 1ZKDA 1B00A 2DHCA 1AUPA 2C57A 2ZKLA 1CJTC 3IXQA 3MERA 3UM9A 3W6UA 4CV2A 3QEBZ 3LY9A 1KPIA 3EFEA 1EG2A 4GI2A 5IAEA 1I7SB 3HKBA 3NH9A 5CB4B 4MCHA 4WLVA 2KE5A 2VSOA 4KNYA 2DF8A 1DMSA 2YVAA 2AV6A 1PWYE 1J09A 1KO1A 2GDZA 4JSRA 1ECBA 1QORA 2IYRA 4HEQA 2GF9A 3P2EA 5AKYA 3C1UA 3TW6A 3F1LA 1G18A 1XWIA 4RS3A 4RHUA 4PICA 2OFXA 1IY0A 1YR8A 5E9QA 4CV0A 4TTAA 5IT0A 2XMSA 1N25A 1RYBA 3K05A 1SD1A 2X8AA 3QXSA 2HSWA 4E5KA 4F4FA 3LPNA 4FSDA 3AVWA 3C15C 4LJ6A 1XZBA 4KQGA 5FH9A 1C1DA 3VU8A 2RHBA 2Z3WA 4KI0A 5GONA 4FKBA 2QKYA 1E9SA 2TS1A 5ALZA 4OGGA 1GJRA 2ONKA 5C4IA 1FSZA 1G8AA 1K97A 1UPUA 1VYTA 2Q49A 3NV9A 1MHPA 2BZ0A 2DPHA 1XRMA 2NV2B 2C20A 2A58A 3PDIB 3Q3JB 2FJPA 2Q99A 2XA2A 4MR9A 3HTXA 4DC1A 3UJHA 3SDZA 1RCFA 4YYZA 2HNAA 4Q05A 5EQTA 4IIXA 3ZUPA 2BKXA 1Z3IX 2ZSHA 3IEIA 3R6TA 4B85A 4P1ZA 4DR3B 2BHRA 2C3OA 4M0DA 2HN9A 1CRLA 1E2EA 2H48A 3UG6A 4OMDA 2XE7A 3DHNA 1X74A 3EH1A 3PR1A 1DBSA 1ZD5A 2R85A 2JJ8A 4MS1B 4U9UA 1YK0A 1YRQA 5LQDA 3KPVA 1DO8A 3AY7A 5BRJA 2R00C 1QRTA 3PXCX 3FGZA 3GBSA 4GNKA 1I4WA 4IRXA 3ZGXA 5JI3E 2QVBA 5BNTA 1U2DA 5HW0A 4CMCA 4CEIA 5LIRA 1AQNA 2O3JA 4ZVLA 3EDRA 2A57A 1T9ZA 3MJ4A 3PYXA 5I01A 4OGWA 1E5TA 2WYHA 3GOHA 1EBBA 5JNSA 3TGLA 1RE0A 2NO6A 3GCDA 4HGYA 4LSZA 2EFHB 1RXVA 1N0WA 4BO5A 3MRVA 3W6PA 5EHGA 4R7TA 3RYIB 4DM4A 1UPBA 3D2BA 3WTCA 4YS6A 2GF2A 1WV0A 4J0CA 2I55A 4OHMA 4L2IB 4TMTA 2EZTA 1NGSA 5KTNA 3HC7A 2SECE 5FUQA 5AVKA 1UDWA 2PMWB 2Y0EA 3FWZA 3QBTA 4QU5A 2HDHA 3JVVA 5LYJB 2NIPA 2B2NA 2WOOA 1I3NA 2CVHA 2NVUB 1KDVA 4BB9A 2ZJZA 1COWD 5HJ2A 3SQNA 3U3KA 1OXBB 2JI4A 1E3IA 3RARA 3T7DA 5TB5A 3ZGOA 5FEUA 1PGQA 3I6YA 3LKBA 3NVAA 1Y6ZA 1IZ9A 1LB1B 2CWWA 4CQLB 2RHOA 1M0TA 5C1OA 3FDZA 1XZNA 4I1SA 4CEJB 4D9HA 2PXHA 1JPNA 3CY6A 1MR3F 5IM5A 3WIEA 4DA7A 5JH7B 5K0LA 3KKZA 1RHJA 4JC0A 2OMEA 8MHTA 4IEEA 4REQA 3QE4A 1Z6XA 2EEZA 3FSGA 4NZMA 5JC8A 3U4DA 1F6BA 1JXAA 3OC0A 5L3RA 3D3EA 3S4YA 2G06A 2RK3A 2QLJA 2ID9A 2QRQA 4FNAA 1Q3KA 3W5AA 5ECDA 5ADVA 4IILA 3BXXA 3E7XA 4C3UA 2W2LA 1T9HA 4FKMA 4Z3KA 5C5CA 4FEAA 4LRXA 3HUUA 4M98A 1WB6A 2PQ2A 3DNPA 4ZAYA 5HDQA 3ESDA 1OWLA 2PPVA 1N1MA 1D6JA 5EUBA 1ULSA 1W44A 5CB6A 3UNXA 1YF3A 1FYDA 2FWAA 2IVZA 2N0SA 2RCNA 3K6KA 5FA8A 4YCSA 2NMVA 4TV9F 3ORSA 3QNMA 3H2YA 4DJEC 5C7OO 2Z5FA 4QX6A 2R6CA 5AUQA 3ICCA 4FDMA 4H7EA 4OHFA 5E7JA 3U9SA 2YTZA 1ICIA 1GGHA 5KVQA 1CRWG 3C43A 4K8RB 4KXUA 4UAUA 4IW3B 4WKCA 2VA8A 3LVRE 3Q5EA 4IG4A 3NHMA 4OJNA 2PX0A 4V1CI 1JIJA 4M0EA 1SQFA 2WD7B 2JCYA 3CRNA 1LF5A 4W82A 1CUUA 1U8TA 5KDDA 1DFGA 1U7DA 3B8EA 5DHAA 2GVZC 2ZJ4A 2X1VA 3RTGA 1J5XA 4GVXA 3VZRA 3H9BA 2V5AA 2BHTA 2HQ1A 3BN3A 3GP3A 1EAMA 3FNGA 1IE3A 3MWEA 2NPIA 1I6LA 5I9SA 1WLSA 4G9BA 3L6RA 3CKMA 1BS9A 4HDSA 5EP2A 3Q1KA 4UZFA 1UPTA 4K5QA 2ETVA 1GCOA 3HXTA 1Y63A 4N9QA 1PJTA 1J56A 3QG1A 5IDWA 3Q1LA 1PFYA 5FFNA 4BNUA 2Q9UA 3T7TA 3QKRA 1U5BB 3TPCA 1A69A 3IP1A 2I6GA 3QVMA 1OX4A 4PAWA 2QN1A 3G1WA 3VHRA 4AJIA 3E2PA 4CETA 5IJWA 5TPZA 1RQXA 3QVTA 3OOHA 2IXAA 1KQPA 3H11B 1JHVA 5LZ8A 1DG9A 4LWQA 1N3IA 4QGSA 2BUBA 3FNFA 1OH6A 1I0LA 1RM0A 2X86A 3WIUA 4UE6A 4KO4S 3EAQA 1M67A 2FFAA 1GPBA 1C30A 4QGAA 3TLEA 2GZSA 4IGAA 4EPWA 1YTLA 4MWBA 3MILA 1TK9A 3RU9A 4JJEA 3JALA 3CEPB 3RK4A 4OGFA 4YPFA 4F5EA 3F4KA 1SMKA 1YIAA 1XPRA 2UXCB 1AY0A 5DM1A 1X94A 4BHTA 1ADJA 5CR9A 1DQRA 2IS6A 2R6FA 4GE3A 1JLLA 1Q91A 2CNDA 2F90A 2FZLA 3PSHA 1QGZA 5UKDA 3PUVA 2DEUA 3TL6A 1NRXA 5AVXA 4KXNA 3GRAA 2FRDC 5LMNB 3IUEA 1YL7A 5DM60 3JTMA 3QW4B 1GTG1 1DBRA 1FRZA 1TZKA 3E9MA 3LPMA 4BO1A 4JI1B 1D2HA 1GPAA 4N54A 3W5VA 4D9CA 3OAAD 4QWWA 2H1CA 4RKQA 5COAA 2HO5A 2P9QA 3TTYA 5KQPA 5DSTA 1IXYA 4TRNA 1RLUA 3I8OA 1L4MA 1KU0A 1NJ8A 1Z5VA 2M1XA 3HSKA 1UWCA 2B69A 3LJKA 5AW4A 1Z6GA 1XTZA 1FW8A 1RJWA 2YJ4A 3I6QA 1E61A 1KO8A 4LHYA 5H9WA 1RZ3A 3KR9A 4IGIA 3OTGA 1E6UA 5L6LB 2NO4A 3QEJA 2WKWA 1PWHA 1E5LA 2PQMA 3EGIA 4QU0A 3QBJA 3CLUC 4LRWA 5FI1B 3IVXA 4K03A 4Q1CA 3MELA 2ZSEA 1ADGA 4MDEA 2QWXA 4JSYA 1M1ZA 1NV9A 3Q88A 2VHUA 2PG3A 3EBPA 5AKIA 1NW5A 4RE6A 5REQA 1ZVKA 5EJMA 4FMDB 4DMHA 1O0CA 3REGA 4QG7A 3EC1A 3AEUB 1AB5A 4IO1A 3NVMB 4KXXA 1BN6A 5DEOA 4JLNA 1OGYA 5K3FB 2R47A 1LVGA 3LTEA 1UAAA 1PQ4A 1TA0A 2PBZA 3EG9B 1X7YB 1YVRA 3DHYA 3Q9LA 1DKLA 2A9PA 3E8MA 3O4HA 3E0QA 1P0IA 3R40A 2VDWB 4MVWA 3WBBA 4NR0A 2BKEA 3ZZTA 1EXDA 4KAXA 4U9HS 5IAJA 1E5DA 3RVSA 4BUJA 1H05A 4GC5A 2J4FA 3IAAA 3N3BC 5G0VA 3TIVA 1VG0B 3OCWA 4RMHA 1IIRA 1KARA 1YQWA 2JKYA 3NKFA 3JD0A 3DAPA 3A26A 3GMTA 3SBDA 4BNLA 2B9EA 1Z4LA 3SJ7A 1U0JA 1B76A 2O05A 3DDSA 4NS1A 3STWA 4YRPA 1KJ9A 4P93A 2YWBA 4OKSA 1M1YB 3LGXA 3T52A 4I6EA 3QLTA 1RFGE 4Z4IA 1A0OA 2FUG1 4GICA 3WHKA 2GCOA 2I8LA 4G1CA 4PHHA 4PVDA 5EZYB 1WDLA 2BH2A 2PS0A 4FYJA 4I2NA 4UEWA 3DZIA 4BAUA 3TL3A 5BV2P 1YZVA 2IYYA 4V03A 1KAHA 5A5FA 2Y2VA 3MG9A 1DUIA 5LM3A 4YA6A 5E6SA 3GYBA 2PJZA 2QZPA 3KJQA 3AUXA 4PGGA 2RHWA 3VKVA 1VYVA 4HN9A 4MJ3A 4UNSA 2AOVA 4Y6OA 3ZJYA 4X66B 2Q5QA 4PAGA 4J4BA 4LF5B 1FNMA 3PC4A 3NIDB 3FYUB 4ZV7A 5FO0A 3EG5A 4KXMA 5JMPA 4I4TF 4GRAA 4IDDA 1CLEA 4E5MA 1P1BA 1TO2E 4MWTA 1MJGM 2JBAB 2O5EA 3HMKA 4IIVA 4PX9A 1R4MA 2ECQA 1BXZA 4AC9A 3E1KA 4GBMA 1QCYA 5LXTF 1KJNA 3HSSA 5KEIA 3MLBA 3R6LA 5CFPA 3R4VA 3NKLA 1I2CA 2EWVA 4PLGA 3KHTA 1WE2A 3K70C 4UPVA 2F64A 1Z63A 4G89A 2J59A 2JCBA 4ZCPA 4XLTA 1CU1A 1KDPA 1QPGA 1Z2DA 2DUJA 2VDMB 5KWEA 1KEWA 2HYIC 3ETJA 5SY6A 5FOUA 5KPJA 1FU7A 3ILHA 1XJCA 3SBXA 1E62A 2Y93A 4N4AA 4WFQA 5HF8A 1M0SA 2ERXA 1GZ7A 2ZFUA 3X1YA 1L2TA 4HV4A 4OYYA 1ORVA 4P8RA 4Q00A 2QMHA 5D5QA 3ICEA 1D3AA 4I9GA 2VP5A 4Q93A 2B3DA 2FY8A 3R1IA 5GZ6A 1TDJA 1WWKA 3KJXA 1DKQA 4JJKA 4D45A 5JLAA 5LMCA 2AQ8A 1TLFA 4GYJA 3AL3A 4AVYA 2NUPA 2H4YA 2VPYA 5JZ9A 2BE7A 4Q1BA 2E87A 3QUQA 1K5DA 4PV7A 1DAIA 1XIVA 4Z53A 2VBGA 1Q3TA 2O2CA 2UYGA 3LOQA 1OW3B 4Y2PA 3BXPA 2ZYWX 2BC9A 3CG4A 5T67A 5I7WA 4HEA6 3OCVA 3ZWCA 3F6YA 4H27A 3ZCXA 1KS9A 2PN1A 4BATA 3HKBB 4UVDA 3LQRA 3RVMA 3L4BC 1E9CA 2OR3A 4IZ6A 2AVDA 1OAAA 3E22A 2AUTA 1P0PA 1ZGJA 2G17A 3PPIA 2BFDA 2XQGA 2ARKA 1NW6A 1W0KA 5A9TA 1OU0A 1B74A 3MOIA 4L7VA 4QUDA 5EC8A 3D4NA 4JN6B 2MOKA 5CYGA 1CUIA 1IMOA 1F2VA 1YD7A 3TECE 3CT6A 3TSOA 2X9GA 3HHEA 3OIGA 4QUIA 5ALIA 4CM8A 4X45A 2JIBA 4DRYA 4ZYZA 3OFVA 1JQAA 1NN0A 4Y0NA 4ARZB 2YW9A 3OX4A 4GBJA 7GPBA 1B0AA 1QS0B 1B0ZA 3GGCA 1AKNA 3AI7A 3B53X 3SJUA 4WOPA 2PCJA 3MINB 4BO3A 3TX6A 4UTNA 1EZ4A 3CEHA 1Y89A 1RPNA 4D41A 5HYVA 1GADO 2OTCA 2PBRA 1NJSA 1S2MA 2G1PA 3ESXA 2PLWA 2II6A 1H6DA 3GARA 5DISB 1OU4A 1P6UA 3PKIA 5FOTA 5FKJA 4GYYA 2HLDA 4HDRA 1FCJA 4MW4A 4ENWA 5I48A 1UBTS 1A2QA 2ZJBA 3KU1A 1JE1A 2B34A 4MZDA 5JSZB 2ZIZA 3G0DA 3ZNPA 3GUVA 5EIAA 1SXPA 1ECFA 2PUHA 1BH2A 1BMDA 4KPUB 3AJAA 3AJDA 4D25A 4UTXA 5CUQA 4AKTA 2VSNA 4MXDA 1Y4AE 4YREA 2I22A 5JWHA 4M54A 2OG2A 1QK5A 1FZQA 1J99A 3NTVA 4ZDKA 1GUYA 2RIPA 5GONF 1J8QA 3JQ6A 3FTNA 3LQ4A 4UTOA 3VHXA 4TYPA 1ZNWA 1VJ5A 2XADA 2HFKA 1YU6A 2BMDA 1FMCA 4X6XA 3GI1A 4XCQA 1OH8A 1QYDA 4LZNA 4OL0A 3PUKA 4XX0A 3D6UA 3HBFA 4BL5A 4U7PB 4BLRA 2QMUA 5J1SB 2JLZA 3LGSA 3AH8A 2BEWA 2BH9A 2BDUA 4LCEA 1P1JA 5BYBA 1QIIA 1CEXA 1KZYC 1E9DA 1LU9A 1KZ9A 1CIJA 1YS9A 5IJ9B 4IXWA 3JYOA 4WZAB 4J0GA 1L7VC 3B78A 5IAOA 2F8SA 2VBIA 4MGIR 4PBSA 4WCVA 4TVSA 2IXEA 4PN7A 3QF7A 3EZLA 1RADA 5GGYA 1WUJS 1O96B 3OQVA 3E53A 2ZIUB 4QFBA 1JL3A 2YWHA 3EDQA 4MO2A 1P7VA 5KDOA 4WI1A 3BGDA 3DTTA 3GGGA 3IXLA 3QKSB 1QK4A 7REQA 2H4WA 2IHYA 3OFJA 3G68A 3GAZA 3JQ9C 5EHIA 2DQ4A 3FZGA 2X8BA 3CURA 1NU6A 1EA7A 3V5NA 3E4DA 1E0DA 3VUFA 5FYDA 2G0TA 1Y3AA 2XTMA 5K0JA 4NCXA 1UAGA 4X7PA 2Z1DA 1K2WA 4MR7A 2CJPA 1WIWA 1LRKA 4TKUA 5BT8A 4UQLA 1QANA 3H84A 4R4JA 2NOAA 2OC9A 3D3QA 4BC1A 1KQFA 3BE6A 1SG6A 1H5NA 4H3SA 2GHTA 5JAHA 4DR5B 3BXHA 1XSEA 2JASA 4OLAA 1XLTA 2PRZA 4WLFA 3K9LA 1IAVA 4R8LA 1VE5A 3TBKA 3D0QA 2PGOA 3CLSC 1PAUA 4RM2A 3RYCB 4FFPA 4G5XA 4KH1A 4X7RA 1D5CA 3DULA 4UREA 1ODFA 2WDZA 3A58B 2D0OB 4DV3B 2WJJA 2G5TA 3KQYA 3FETA 3MYYA 1A7KA 1E66A 2H5JA 3PZBA 4CCWA 4KOAA 5EJEA 5ES4B 1HDCA 1TJPB 4H18A 4M49A 3U16A 2QQ0A 4LJ9A 4PCAA 1W85B 4D9IA 3H9UA 1IG0A 1Y98A 2PX5A 3UPUA 1V25A 4MV5A 4QG3A 4B5KA 1GNLA 2C7PA 1MX9A 2AWOA 4CIWA 5FULA 4DT1B 5JU6A 1P77A 3GNQA 3KOMA 4F71A 4F86A 2EVWX 1HYQA 2J5BA 4CF5A 4BN0A 2JEOA 3IB3A 3V42A 2GJAA 3WWPA 1GGVA 1S3FA 2G70A 4NATA 3TR5A 2QN8A 3JQFA 2XZDA 1TRHA 1B0UA 4MA5A 2HWWA 3PC6A 1VI6A 5FQOA 5B3JA 3TMYA 2EF0A 3ELWA 2Z1MA 1E1NA 1EFVA 4LMBA 1W87A 2Z2ZA 4LZAA 2RG7A 1Y9AA 1T1SA 3TRKA 1GQ2A 1R16A 3EN0A 2VZ8A 4C2AA 2WD9A 3A4LA 2QTLA 1M6WA 3OT4A 5DN6A 3DOUA 4X44A 1N2JA 1I4OA 1TU4A 5H3CA 1L5VA 5KNBD 3FTQA 3LY7A 4UOQA 3T54A 4G23A 2LR0A 3AKDA 5T6BA 2J3IA 4CT4B 3DEZA 5LUAA 1E6KA 1DQZA 2O7RA 3WDSA 2H07A 1G8FA 4DV4B 3MJHA 2UUPA 1YHNA 2E37A 3O93A 3OVMA 5IH3A 1BE0A 3RGWS 3WSVA 4Y2SA 3CX8A 1J2RA 4ZKEA 1R4NB 3D8RA 4CF4A 2JFHA 1TTQB 3KSZO 2WM3A 1QH1B 2FQXA 4B6OA 3CLTC 2DLCX 1UEIA 4L5IA 1XVLA 1XDSA 3BJZA 4ZZIA 4ETNA 2WTNA 3RCBA 3W90A 1KMIY 2RC5A 1DELA 3F6SA 3KTAB 4J2OA 2WF6A 2C9ZA 4D8VA 2NXNA 4R2HA 3E8SA 2PO5A 4K6CA 2IE0A 3AR7A 4LGCA 2FUCA 4XZ3A 3FD8A 3W8FA 4CFYA 1QVWA 3EGVA 4AECA 1DCMA 4AULA 3EC7A 4HDSB 2A5YB 1LV7A 3AVOA 4PG5A 4W8GA 2V4UA 1MX3A 3TO5A 4FGJA 4M9ZA 5F2EA 4DUPA 2XTJA 3O8BA 1IWBB 3AFGA 2PMKA 1QVVA 2YCBA 3FUTA 3L7MA 4RCVA 4CT0A 4G5QA 4MIOA 2MYTA 1JS1X 2N9UA 1XI2A 3T9BA 1K9SA 4M22A 4IKOA 1NBOA 1VLVA 1YASA 3O4FA 3GPBA 4HNAA 4FYPA 4GLBA 5B53A 3VO2A 3GG2A 2VVTA 2E6UX 3WDKA 3LZDA 4N7MA 4HSEA 3SCZA 4BECA 3ZH2A 2BSXA 3CEJA 4EABA 1OLXB 3GLKA 2COKA 2VTBA 4NHOA 5B64A 2ZSKA 5AW3A 4PHTA 2CW5A 1NN5A 2FWNA 3L7OA 2VQSA 1LDEA 3FZQA 4F5ZA 1XXHA 3SYRA 2DJ5A 4K3UA 1HOTA 1LI5A 4E2WA 2Y66A 5F5NA 3KJEA 2KX7A 4LY0A 5G1NA 3SC4A 4C5CA 1NF9A 1RI4A 3SE0A 3REQA 2OWEA 2ZRJA 2R6AA 4HAXA 2DAPA 2CK3D 4M76B 1MC8A 1PR3A 4F9GA 4FM9A 5BWNA 1GU7A 2CNBA 5AUNB 1BQ3A 3JQ8B 3GVCA 4II3A 1ETUA 1J5PA 4KDEA 4IHJB 2BKAA 4BX9A 5JO0A 1M0EA 1WXEA 3MXOA 2DE0X 2PDAA 1TEHA 4R83A 3G02A 4YJGB 3FCOA 3FOWA 3W6OA 3SWWA 3HRKA 1T1EA 3D6FA 1E7WA 1G7SA 4E5YA 2XZOA 2JHFA 2HQRA 1ZC3A 3QFRA 2PX4A 4DNPA 3VR5H 2R5WA 3COSA 5DRTA 1FQJA 1VHWA 4CQMA 3QOWA 1L7MA 4CKEA 3M89A 4ABTA 3DVRX 4LYEA 1UXOA 3SLGA 4G0XA 4IZHA 5A1JA 4J6EA 3KZVA 1U28C 2PH1A 1U1FA 3TINA 2CHFA 2VUHB 3TNFA 2Q6IA 4AUKA 1TNDA 1ZA2A 5KYYB 5HJ5A 5CVJA 1QKKA 1VJ0A 3DTVA 2WJAA 3ODPA 2HIAA 3ROGA 1J0CA 3EXHA 3ZBQA 1VKHA 2HXGA 3KB8A 2QAGA 2OFOA 3L1VA 1TJ4A 1CZHA 3PRHA 3BQNB 1Z4NA 3MJRA 2X41A 5ARCA 2GEVA 1O58A 5GZ1A 1FTSA 1KIFA 2I3BA 1QIFA 1ZAYA 2NO0A 1N7IA 4M7PA 3KELA 3T7SA 1PJSA 2VJYA 1FMTA 2IY7A 3I8XA 1JWBB 3L9WA 3N07A 3QBEA 2BEJA 1XWFA 4FS3A 1RWKA 3LK6A 3SKYA 3DMPA 3I28A 3I42A 2RGCA 2Z2KA 1A8UA 4HLUC 1N3LA 1GZ6A 4OBXA 3ILYA 1E6LA 2BN4A 1V5FA 4P84A 5IMSA 4YIHA 3SIRA 1TAGA 2W6MA 2XVZA 4JYAB 3DT9A 1G64A 1DE0A 2KW5A 3AUTA 3OX2A 4Z49A 4EYGA 2GZ2A 4C0JA 3SF8A 4EZBA 1Q92A 5JD5A 1CJKC 1GTJ1 1Y33E 3WHIA 2PZFA 1IOWA 3OCZA 1FUYB 2HHJA 2YBDA 2J9GA 2YV4A 4L78A 5D86A 3IX7A 3WKDA 3RBVA 4KQIA 1XMOB 3RR2A 3IJPA 3D4IA 2FR0A 4XIJA 1T36B 4MPPA 2R86A 2Z8XA 5CT4A 2F17A 2JA2A 4KXLA 2UUAB 1DBPA 2JRCA 5H02A 3RS8A 2IV7A 3E5NA 1WKBA 4PE5B 4YI5A 2QVCA 1XRNA 3HG7A 4LBYA 4YT4A 3U09A 1K8QA 2YVUA 6REQB 2OB1A 1U3CA 4GH5A 2HJHA 4M1KA 3WB9A 2C2XA 2XODA 4L5AA 2PEYA 3OEEA 5IAKA 2B1IA 3A3YA 4LHZA 4OQLA 4MEBA 5FV7A 2DMRA 3VJMA 3T7EA 1QG6A 2G9NA 3B60A 1SC6A 1GQOA 2XWQA 4BMPB 4L0DA 4NQZA 3KVYA 3PFCA 2WK1A 1LWOA 1YMVA 3HYLA 1ZUHA 4ZO6A 2E5FA 3TIIA 1XKTA 2C61A 5C7YA 5I5GA 1K0FA 3B6ZA 3DF7A 4BFCA 3LPLA 1QWSA 1J33A 5CVCA 1EK2A 5DBGA 3JWPA 1JWAB 3F49S 4M8SA 2P9GA 4XB1A 3L79A 4KCGA 4D5EA 5K0FA 5JI2E 2QZZA 1T5HX 5J5CA 2W00A 3P5BA 4AN1A 4BQFA 1L5RA 4FFMA 3TKAA 3EVGA 1H2EA 1HE2A 2RGYA 2YN2A 2DFVA 3U2QA 3JWIA 3K9CA 3G0OA 5LP6F 1YDWA 2HJ9A 3W5BA 1GA6A 4M9QA 4NYJR 2BFPA 4RMNA 4EHBA 4B09A 1CB7A 1ZL2A 4HVAA 2GFIA 4ZPJA 3FFXA 4M0CA 5U9CA 1ZXLA 4M8NE 5EP4A 1AUOA 4WZBE 4ALJA 1DBVO 4A0RA 3KHUA 4U2KA 3TQQA 1GAEO 2CLHB 3A6LA 1QHXA 2FOLA 1CUFA 1HFJA 3BB3A 1HEYA 3KQWA 3SZUA 1TVKA 4BQRA 3TOSA 4K6KA 4L22A 3OZDA 1CUJA 3N2KA 3TSZA 1HLGA 1YS7A 1J49A 2J4CA 4KQMA 4E51A 1U02A 3K0CC 4FHZA 4B9EA 3NHUA 1TJNA 4QXOA 1TYZA 4PR3A 4KSCA 1XTRA 2HDOA 1L5HB 4ARVA 2QG6A 4XPZA 2H7VA 2GT1A 1VYHA 1EGQA 2O52A 4EKNB 4PFJA 3IVCA 3SKXA 1E3TA 5IYZB 5KNBA 2O6HA 4EY6A 4MCJA 3K0FA 5ENVA 1C1DB 3B7GA 2GQ0A 5DE3A 1W4RA 1MAHA 1C3OA 4AJOA 3BEDA 2ZJ3A 3IAFA 4JJ7A 2CFIA 5F64A 4EYOA 5TPWA 1NI3A 3VSAA 2AG8A 4HX2A 2HCRA 3D0OA 4W1SA 16PKA 3JRNA 2VDPB 4IIJF 2O2SA 4C3OB 4N76A 3LBIA 1FNCA 2H65A 3H2BA 5TIIA 4CR7A 4JI5B 3K3PA 4CCYA 3BDAA 3MCWA 5EIOA 3CWQA 4MVJD 5DHRA 4JLDA 1Z28A 3LIIA 4YV7A 2GASA 5I7AA 4IIYA 3R74A 3TFOA 5DFAA 2PMEA 3TZHA 1ODJA 2B8EA 3TVDA 2TSYB 4ZFNA 1LNZA 1DGQA 1OFHA 2X22A 5E7IA 3R3VA 3FOZA 1UH5A 3RYIA 4JJIA 2WU4A 3T3EA 1U2EA 2HCJB 1CDDA 3V55A 4J94A 2J3MA 4LW8A 1SH7A 3EVDA 3I4FA 4R1PA 1WXIA 2XKJE 4C4AA 2COUA 2IC5A 2ROQA 3UUGA 2R3SA 1K1EA 5JSZA 2C00A 5E38A 3T5PA 3A1CA 1M2OB 3B1WA 1T0BA 4ZDIA 1WZIA 4FZJA 1E1KA 4NDAA 4NJOA 3R9XA 4MQFB 4WQMA 1QHHA 1ZVJA 1QIDA 4BBJA 3AVPA 2MJLA 2C2KA 2D5IA 1A5ZA 2GEDA 3GZNB 4Q3AA 4G1BA 4JLJA 4RF5A 4RNDB 3TTTA 4A5SA 2XUAA 1PU2A 1KETA 1FNDA 4XWYA 1C4OA 1HQYE 3EFHA 4KFRA 4C7BA 1XQ9A 1QVRA 3C1OA 3KYIB 4DILA 4LJ4A 4AY6A 2FVXA 1HGXA 3HY6A 4IPTA 4DN6A 3D9QX 3ESZA 1GWNA 1SD5A 3C2QA 3R76A 5FTNA 2C58A 3R7BA 3TLCA 5K51A 5TMEA 4MR7B 3UJ9A 3HE3A 5G0WA 5H81A 2IYQA 4RY0A 4E46A 3O9VA 1SXJA 1YQDA 2BMFA 1FXSA 3FPKA 3IIKA 4QQRA 3ST7A 5F7ZA 3ENKA 1HTBA 3GFGA 4RHYA 3RAEC 2JFQA 4B46A 1E0SA 1VPWA 5AVTA 2RB5A 3HYSA 1PVOA 6REQA 3NHZA 2DLDA 5BQFA 2GXUA 1YOVA 3QZUA 4JP2A 3OQNA 3SXPA 3UMSA 3ZYCA 1ULHA 1Z2NX 5EIWA 5SZKB 1CJCA 1LNSA 1GUZA 2GAOA 2DT8A 2H0AA 1H9CA 3CB2A 4RHTA 1BFDA 4YXFA 1T5DX 3ITKA 4RULA 3I5YA 4ZC1A 4WK6A 1A77A 4HPWA 3W79A 3RVOA 4L9SA 3JR7A 4I14A 1JJ7A 3AI2A 3RAGA 1HYGA 3C6KA 5AVRA 4BO7A 5JNWA 1XJQA 5KINB 3KS9A 4COOA 3F6PA 5CX1A 3JAWB 1FFGA 2XRMA 2YVLA 2H8GA 2Q5JA 3GLQA 1L6IA 2CLCX 4BZWA 2Y3IA 3AU9A 4LQCA 4YECA 3X1DA 5EFZA 3WIBA 3LKVA 3ZIDA 1UC5B 1JSRA 1NRIA 3AJ8A 2CHGA 1Y34E 3BBLA 3W78A 2VH5R 4X20A 1AO0A 4RH0A 3TLKA 2VDOB 2BGWA 4HRAA 1RDFA 3OT1B 5DSXA 5A6SA 1UWVA 4OFZA 1S8OA 2VDQB 3B3JA 2JIPA 3GRYA 4N39A 3RU2A 2X1HA 4PQYA 4OMUA 4F12A 2NG1A 2QN7A 1DX9A 2AJBA 3PXEA 1DWPA 1WXQA 2JFZA 3PGXA 1F0KA 1HETA 1L4YA 2IFTA 2ZPUA 4HLCA 5KJEA 5LSAA 1CF4A 2O2DA 1KSJA 3EPJA 4Q1DA 3C3BA 2P75A 2C83A 2D00A 1BGVA 3IUYA 4KJZA 3ZOZA 2PFKA 1XD8A 1XXLA 3RKUA 1J1UA 2ADMA 1N2SA 4JEMA 5AVJA 4XLZA 2ODEA 3CO0S 3QELB 4KX5A 3T5DA 4BKUA 1VA4A 2PCLA 3JD3A 4NY1A 1JG7A 5AM5A 2PLRA 3WL6A 1FUEA 2IIPA 3ZY4A 2PWBA 4MV7A 4D4KA 1BXGB 3GW8A 3PD0A 4GZLA 4H7HA 1LF0A 3I6IA 1ZL0A 2WZDA 4K9RA 3WZLA 5JMOA 4BC0A 1DTWA 3JQ9A 4HUQA 5AQ1A 5MHTA 2XGMA 2OGWA 1A3CA 3KPWA 1ZUNA 1GTMA 3VKWA 1PYOA 4G0PA 3FYDA 4LJ8A 5D00A 5DF1A 1RYHA 3TW0A 3PX3A 1CFJA 2JD2A 3D5EA 5JNUA 4UM8B 4E07A 5L3QA 3Q8KA 3DHWC 1TUBA 4PRZA 3MRXA 3A6FA 1CF9A 2AXPA 1XCLA 1L7XA 3IVMA 5DIFA 4AWXA 3QEMB 4P0TA 3W5CA 4OUDB 3NYIA 3OOSA 3C3WA 5FOQA 3AHJA 5ULLA 1G9SA 2R62A 2JGIA 2ZB7A 4LC0A 3DE5X 3N8DA 2ZBPA 4KRXA 4Q1EA 3ZVRA 4Z4FA 2WICA 4G41A 5CURA 4BJ6A 2YWEA 4A0HA 4BQEA 3EYWA 2GK3A 3A3KA 5I4BA 1DADA 1UPXA 1E1QD 2C4VA 3RODA 4KQEA 4DBVO 3IUBA 4IUDS 2OYRA 4BGIA 3I5XA 3VNSA 2WJYA 2NUAA 3QY9A 3R0QA 2IEYA 2RHGB 3KQTA 5JMTA 5LQKA 1D4OA 3L8CA 5J2UA 4LF8B 2ZQ5A 2GUGA 4HZUB 1H2YA 3ON5A 4RFVA 5F9MA 2WHRA 3RBAA 4JX8A 4M60A 5EPUA 1X8KA 2P6PA 3PXDA 5E3JA 3V4PB 1U7WA 3UZUA 4YUXA 1QO0A 2YVQA 4YGXB 1WDMA 3II6X 4GOKA 5K8TA 1U8XX 5F12A 3HVRA 1DHTA 1XPJA 1Y9ZA 2P90A 3R7AA 5EIHA 1GAXA 1DIAA 1QHEA 1WA5A 3RG8A 4S04A 5E3HA 2OC4A 3K1ZA 5E8JA 2G4LA 1E2GA 4G5SA 3ND5A 2ZS7A 5AJHA 3VU9A 4RLSA 3P0JA 1X7DA 1ADYA 1PR5A 2XZTA 3DFIA 3KE9A 3OJOA 4ZI7B 5AW1A 2CSXA 2I34A 3A0RB 3ML1A 2ZJAA 2ZUUA 2MR5A 3BHMA 2IWHA 4MPRA 2Z9BA 4BO6A 1U2ZA 5B2EA 3FPBA 1IPEA 3IMCA 3ANXA 5REQB 5KBYA 4GECA 3V8MA 1OFTA 3QUTA 5LYJA 1FA9A 4QHSA 5JS6A 2NSJA 4BJHB 2QSJA 4YXWD 1LPNA 3TXYA 4DV0B 1S9HA 1U8YA 3N75A 5K4HA 4HB0A 1JNYA 3FZEA 1EDDA 4AMBA 2NZWA 1KIMA 3FDFA 4M21A 2FZ4A 2ICAA 2I3DA 4CG0A 1NPYA 1PX2A 1JDBB 5I47A 3BZBA 3AFIA 4MV1A 2D4HA 2GDJA 2VDWA 3CRMA 1X70A 1V4VA 3GPDG 3L1IA 3LT2A 2IPOA 4JOQA 5H9VA 5BT9A 3TFQA 3VO8A 1DAGA 4HWGA 5JWOA 1HMYA 5KAMA 3ZZMA 1W5AA 5AWFC 2PWZA 4C7MA 1IN1A 4FDUA 1X1RA 4HYYA 2NZYA 5L4SA 2O8CA 2HJWA 4LJYA 1KNQA 5C8YA 1TT5A 3UFXA 2O0HA 2WPDA 5D51S 1EHCA 4RFSA 4UUQA 4EPXA 3BB4A 4OI4A 2H2IA 2ZIXA 4ZK2A 4GKBA 2QYHA 2IHVA 3SU8A 2VTEA 1K4KA 4WOCA 4YAJA 3MVEA 1U9ZA 2V0NA 1FUKA 3LA6A 1KI6A 1HPLA 1D1PA 2EBWA 4LPKA 3GEPA 4DBLE 4BU0A 3SC6A 4N01A 5AM3A 1MOQA 3T7AA 3MJCA 3RIHA 4FHGA 1P1KA 3QOXA 4RABA 2JJ2A 1RP7A 3NJRA 4EI7A 1Z29A 4DUYB 5JDIC 1NQ5A 1DHRA 4OQFA 1EK6A 2JFVA 1NNSA 2AOWA 2PYZA 2WM2A 2XUIA 3RNLA 3W9SA 3KZXA 4EJMA 4LNHA 5JTUA 3TDKA 3GLIB 1NM5C 2WHYA 3PENA 4FJ1A 5JWRA 3IYLW 1DUVG 4P3KA 1DG1G 2VIIA 2OOKA 3GLGB 2E1PA 4D74A 2QM8A 2I4OA 3O31A 3WNVA 4HRVA 4F3YA 2AMFA 1G38A 2XHZA 4JHXA 4KXWA 4TXMA 1CR1A 4BFZA 4ZDWA 4PLPA 1MD9A 4HWOA 2WJ4A 4WWHA 1NQOA 1U2DC 2VDRB 4EMUA 3DCNA 1IZ8A 3QKUA 4NZOA 2M9MA 4CTOA 4GZ3A 2SNIE 4FYWA 2OSVA 2QUJA 3DMFA 1M1XB 3PQ5A 4JGIA 1DTWB 4HXFB 4U3JB 3ETEA 4TKLA 1TZCA 2CUNA 2XXAA 4B3XA 4BMDA 2I62A 1CSEE 4BO0A 3K0AA 4RHXA 1F4LA 2A92A 5JH7A 2XQVA 4FFBB 4DQUA 4EI2A 1K3TA 3BFPA 1G3UA 4NBLA 3Q8MA 5CA0F 2HMSA 2AJCA 3QM1A 3GLHA 4PHFA 1GFZA 1E1MA 5C4MA 1L4NA 3NW9A 2VWQA 1JIIA 2A9OA 1QO9A 1I5OA 1TJ3A 2VJOA 4S35A 5EN4A 5HIKA 5ILOA 4OHZA 5B4VA 1HYEA 3JD4A 2E48A 2C9OA 1Z0ZA 3LHFA 4TMZA 5DASA 3RS7A 2V7WA 2H3HA 1MV5A 4MUMA 3WDMA 1YR1A 2Q8PA 4LY6A 4OFBA 3U7IA 3L6UA 3DWEX 4D9BA 2QXYA 1NATA 4D4JA 1GL6A 3UTDA 4RK1A 5BWMA 5J23A 2I1LA 4Y2TA 5CNMA 3VR6H 4YJ3F 3L0ZA 3X2SA 5C0OE 1QRUA 3FTDA 2PANA 2ZE6A 3RBXA 3QVSA 3MFYA 3AG5A 4HYTA 1QH9A 3RRJA 4R7ZA 2EL7A 4MQ4A 1VJCA 1U11A 2ZWVA 4FUQA 5K9ZA 1E1RD 1SXJC 3DNFA 3PDCA 4Y1GA 1FVHA 4DA0A 3G2OA 5E4YA 3HN7A 3SNHA 3FOBA 3QPUA 1NMYA 4LYJA 1K7XB 2R7LA 3BWXA 3CKYA 3ZBTA 2Q0HA 3NGMA 3OPYB 2A7XA 1GGMA 4NOLA 1NPTO 3G0GA 3A9UA 4RVHA 2GFHA 5SYMA 4B75A 2QMEA 4IQ0A 3HUDA 3SLRA 5ITVA 3KSMA 2W2KB 1RW4A 2FZKA 2IXDA 1NVUQ 1PNVA 1RKXA 1FFSA 2F3RA 2SKCA 2O57A 1O6ZA 2H08A 4YWJA 1AB6A 4CLHA 1VMAA 2P5TB 4FILA 5LP6A 4YP7A 4Z3DA 4MTCA 4OX9Y 3ITDA 5CB4A 4BNKA 5IVHA 5HGJA 2RGNC 3TZBA 1EFCA 1JGTA 4A10A 2Q2QA 3S29A 3BEOA 4RV9A 4UM5A 5J43A 2A67A 1OBFO 3L01A 3OJXA 3HUTA 4AZ3A 4EVQA 2VP0A 5MGBA 4Y3UA 1SVLA 3H1PA 2EP5A 3NGXA 2XWPA 5A5VA 2HLPA 1UMBB 2PSFA 1H3NA 2CLMB 2EQAA 5FBVB 2OPHA 2H1WA 2Q1SA 3UPTA 4K2HA 2G9RA 4KQCA 1JAXA 1HLFA 1G2QA 2ZYTX 3DCJA 1UC8A 1C3OB 3NM4A 5FWXA 1SVUA 2PHZA 2J5RA 2J4DA 3UMGA 4LYDA 4JB3A 2IS1A 2J3QA 3VZCA 3GLIE 4BLTA 2ZYDA 1R9GA 5JDIA 1XZEA 1I5RA 2PYIA 4UAJA 3BHNA 3HCAA 4US2R 4FZ5A 2EEPA 3C7DB 4O63O 4YDQA 3H8SA 2JLYA 5FD8A 4QJ5A 5TMDA 1SKMA 3C41J 1Y4UA 4OIFA 3CJQA 3K31A 4NWIA 3PEWA 2HEGA 3ROEA 3BC1A 1MX1A 2XAUA 1H94A 3JPWA 3QYJA 1PDWA 5FDFA 2XYHA 4OMCA 3LKZA 5I6DA 4HMPA 3E8XA 1E1QA 2OORA 3Q7RA 3V2UA 2W71A 3DBOB 3CA8A 4B32A 1CUSA 4ZQGA 2A84A 1YGPA 2ECFA 1P7ZA 5F2KA 4DDUA 3FI0A 3TE6A 5BR7A 3JQ8A 2C9MA 4KE9A 4E5NA 4RAOA 2FRDA 3L7IA 4ETWA 2GKOA 5JJCA 1OB5A 1I7PA 1T8PA 1MX5A 3E81A 1IK6A 5F7XA 1PBNA 2HSJA 2DOKA 2EW2A 2RDMA 3EB9A 2CDBA 3PJGA 2ZR0A 5JHHB 3PR3A 1U2RA 2E82A 1DJMA 3QUCA 1XQ6A 2JGLA 2RI6A 5JHGB 1MFZA 3WGLA 3JX9A 1RLMA 3FCAA 3ZC3A 1TVMA 1G4HA 4PSKA 3U80A 3L8FA 2CNWA 2MYUA 3PCXA 4EX7A 2DFKB 1RBMA 3EBLA 4F5DA 1ZNYA 2NTVA 4KGXA 3CVVA 1TM4E 1KDYA 2QUBA 1AHIA 3UK7A 1P9LA 4F85A 4IS2A 3AFHA 3VJKA 3T06B 4HO1X 2OXIA 3ABZA 3T9CA 3TAUA 2V3WA 1SHUX 3M5PA 1QHIA 4KFUA 2IEDA 3DE2X 3GJTA 3ORFA 4ND3A 3O83A 5DTMA 1IY9A 1Y48E 4D81A 2O8EA 4D0SA 3BFXA 3E5MA 1CZKA 1JDNA 2QAGB 5AOBA 1SZJG 1ZMBA 2XCQA 1OJLA 1ESCA 5AKXA 2IBTA 4BVFA 4ISBA 2D2VA 4YAWA 1UADA 2O1EA 4ZOBA 4U2DA 1N7GA 2XT6A 2FPGB 1NV8A 3RIEA 5FBZA 1GKIA 3QGMA 4L02A 1NC3A 4XGNA 4E1VA 1FC0A 1U6KA 3H05A 3ZCSA 5JZBA 3CBQA 3T4EA 3HY4A 1YCDA 3D6HA 5EE3A 4MYCA 2Z9CA 4I5GA 4BO4A 4KYUA 4FXPA 3O03A 4E3ZA 1XUOA 1NZDA 3LC0A 1KR2A 4RHEA 5DHTA 5BUZA 5ESDA 5LB4A 2NYAA 1Q0SA 2IYFA 5B1SA 5EMLA 3R0VA 2JBWA 4PWYA 5EI5A 5AHOA 2XBMA 2WOJA 3AFOA 3I6ZA 1AKTA 3QEOA 4KYIB 3W5IA 3ZHRA 4E4YA 4W5QA 3K7EA 1GQQA 4BNMA 3OF5A 1Z0DA 1N3BA 2F3SA 2X4DA 3ZCVA 3B2NA 4PLTA 4EA8A 2PH3A 4NZYA 4OH1A 2FSGA 1GFIA 2OV2A 3DVSX 3OWHA 4KIUA 1E79A 4P3OA 5FBKA 4C29A 4EA7A 5A03A 2WQ7A 3PFFA 4KXQA 5KNBH 4ZGGA 1WXGA 4JK3A 1Z4KA 2LKCA 4D8YA 3KEFA 1CERA 2XOKA 1XU7A 3WS7A 3FVRA 4BVLA 4B2PA 2QLMA 3TD9A 3IAM6 3B6IA 3VU0A 5AUPB 4ILEA 3NNNA 3N0RA 4GRIA 3PF9A 1XJ5A 1K7EB 1P4JA 2AN4A 5E1DA 4DLUA 4V2UA 5EHXA 4AKEA 2ZT7A 5HUQA 5CDUA 1R4MB 5CW2A 5BWCA 3OUZA 3W5JA 3IP7A 1R5OA 3SOZA 4A6DA 2IOQA 3SHOA 3DWIA 3AMVA 2D5AA 2EZUA 2FFRA 3L1JA 4Y1EA 4PSVA 4UBIA 3QA9A 3L4JA 4ZRMA 3JRWA 2BF7A 2XCOA 3LLVA 3PNPA 2YMQA 4EGFA 4QYWA 4ZYLA 4YCNA 3NDIA 3B5IA 3IPLA 2X15A 3JY6A 3O91A 4OLFA 1SN7A 3HWWA 4YONB 1FFXB 1YU9A 4NC9A 3PRKE 3PTLA 2FQWA 3PYLA 3I83A 1GRVA 2QJTA 4MO9A 4PZDA 5HR5A 1UOQA 3MYRA 5KVVA 1SQGA 1ELOA 2O2JA 3W3AH 3ZDAA 2CEAA 3QBVA 3MS7A 4ZGBA 1WNFA 4O4IA 1FVXA 1L1QA 1PSWA 3LUJA 2JATA 4EF6A 4O0LA 5CA1F 2AYYA 4B17A 5CEEA 3C5CA 1KH2A 3K70D 3JYLA 4ER6A 1ZH0A 2JGKA 2KBEA 4MA0A 2J3HA 5CDTA 1RLJA 2W43A 1ZGCA 5DB4A 1GO2A 1JUDA 5DHSA 2HF7A 4OAPA 4EKEA 1DEHA 5BSGA 3MQ4A 1U3TA 1XDGA 3CCFA 4U8GA 4L4UA 4BE9A 3A6JA 3EZGA 2ZPTX 3MT8A 2D7CA 3OHMA 3VR1A 4N9WA 2ZUWA 4AG3A 2DBYA 3ZHQA 3TVTA 4K2AA 5AVVA 3M4NA 1E7QA 4P32A 3VA7A 1FMFA 4OK5A 4FCTA 5DWVA 1ZUIA 4C6HA 1ZGBA 1XEWX 3AV0B 1JPVA 1MOPA 3MM4A 2IIQA 3N2ZB 1JHQA 5FB3A 3TPZA 4DSAA 1PZNA 1CUGA 1T1JA 2Z56A 3C3JA 4OYRA 2Y99A 1ZYUA 4IDFA 2C7QA 4AI6A 1FNBA 4OI2A 4BV3A 5I9NA 1J39A 1SELA 1ID1A 2BJWA 2HLDD 1NJ2A 1KDOA 4ZHQA 1N4DA 1NXQA 1IHYA 1YSCA 4TTSA 3A1UA 3LQYA 1A2BA 5DM4A 2DX7A 1GFSA 2VHTA 5AO9A 3AGQA 1XD2A 1G8YA 1T9GS 2VF8A 4KR2A 3ND8A 4G5OA 1M72A 4D3ZA 4EPVA 1R4AA 2HPVA 4NMMA 4ZT6A 4B3GA 4GX2A 1WS6A 2COEA 2LNDA 4YYEA 1XRPA 3LUKA 5JXJA 3MOGA 1WHSB 3NBKA 4MW2A 5LDHA 1Z3CA 5HE9A 4UDXX 1SCQA 2Q21A 3BD9A 1ZI6A 1TEXA 1I1HA 4D82A 4TTIA 4TLEA 2HK9A 3PKZA 3O6VA 2R8XA 4NYIR 4I3HA 2QTVA 3W05A 1G4UR 1YJQA 3C6XA 3GD5A 3JQEA 3QI2A 4HXGA 4L16A 4ZCSA 3WNCA 4CKBA 2P91A 3DLHA 3ODGA 4GPIB 5GAJA 4PLZA 4FOTA 4FCVA 1XDUA 2WWWA 4WECA 5EQJB 2FPUA 1EXVA 4O8CA 4UU7A 4NRDA 2YYAA 5KSPA 5F1YA 1JKJA 1U6JA 2C2MA 1ZJ6A 1QE3A 1QH0A 2HLNA 4HQNA 4PANA 2CKDA 3DYIA 3PVSA 3SOPA 3BK7A 3ETGA 4KAFA 2FGKA 3LC1O 4MYSA 1ZW1A 3U9LA 4EB6A 4I99A 1JHOA 2XYVA 2FTKE 1BOOA 2OP0A 5CFZA 1X77A 3DV9A 4UU8A 5D3MA 3OQMA 1O97C 3NJ8A 4ZOLA 2QLLA 2HWKA 1WCIA 2P6NA 5K3AA 3P1JA 5LA6F 1RZRD 1UJBA 3B52X 1MGPA 2H18A 1E4OA 2BGGA 1G98A 4U6QA 5IASA 4QO7A 3MJVA 5JSUA 3ZD9A 1IOLA 1NBHA 4ALNA 2VWHA 1CVIA 1FSPA 2UYYA 4JMPA 1CHDA 1IBRA 3DBLB 2DPYA 2FPGA 2O07A 4H0NA 3IBYA 4X3CA 2ZTHA 1JHMA 1LFDB 2GUWA 4ZCQA 3GRCA 3R4CA 1ZESA 2X8JA 1ZGGA 3K8ZA 3GHHA 2PZGA 4IVNA 3ROFA 4ENTA 2UZ4A 1INLA 4TMXA 2XW6A 2ZWOA 4UCQA 4RETA 3TDMA 3QPBA 1QP4A 3BMQA 3KIPA 4LECA 1EFAA 2MDTA 721PA 1MO2A 1AJEA 1QG0A 4JJFA 4FDAA 3PXGA 1YRYE 4TV9B 2OPBA 4EKYA 1RC0A 1EUYA 2ZTMA 2D2XA 1PK7A 2XX3A 1T2EA 2UVDA 2AXNA 1FFHA 3FE2A 3FFBA 4FHDA 4M8KA 5EP1A 2FG6C 3QYPA 2H5EA 2OYCA 2VT2A 1J8YF 3HI4A 4GR9A 4F4CA 1NW7A 4CHGA 5U4QA 1PWZA 3E27A 1TYEB 2A5FA 4QPNA 1Y1SA 4TL8A 4ZVMA 1MW9X 1UR5A 5CA0A 1SVWA 9MHTA 3AC0A 4EYSA 2BHSA 3PZRA 3IHLA 3N6RA 1NYQA 2AFHB 3K09A 1BRTA 3IUJA 1ULUA 3ZLJA 1KSFX 4TT8A 3MJDA 4IBOA 4Z9XA 3T3HA 2I3GA 2JH8A 2NT4A 1KVSA 4NSNA 5TVGA 3ZWBA 4JC8A 2J32A 4LE0A 2BDEA 3WWYA 2YXEA 5AW7A 5ITZA 1YZHA 3PE6A 2P6UA 3H42B 2G1KA 4FQ5A 3U3RA 1KE1A 3GH1A 4BNJA 2NU7B 3BDVA 1FPMA 4R8MA 3GGOA 3U7FB 1BCRA 4Y2GA 5LOVA 1X7WB 2HU5A 1CXZA 1PR9A 3AWDA 4JJ4A 4CT5A 2O5CA 1PTJA 3H5LA 3OMWA 4M37A 1R9MA 2YRFA 3PQFA 1V7QA 2GGSA 2BTOA 1P5HA 4Z4QA 1HX7A 2CCKA 4C1BA 1AUXA 3SHWA 1MA3A 2HU7A 1KTIA 1X0VA 4ZCMA 2NAPA 5CG2A 2GKGA 3ESCA 1I13A 1QP8A 1APBA 2EW1A 2O59A 3C6QA 1GVHA 2N46A 3OKFA 4CM9D 1WCXA 3GEIA 3Q0IA 4OHVA 4F6CA 2BBSA 3W2GA 3KYBA 3QE3A 2CV1A 2WJ6A 3N8GA 4HUQB 5BVHA 2V6IA 2XCLA 1RLOA 4IG9A 2Q6LA 3KAQA 2J46A 4ZEVA 1JHPA 3KALA 4ZEOA 1N1EA 3TOZA 4KMRA 4NENB 4N5NA 1ENZA 1JR6A 1GYPA 3Q12A 5J4HA 1D1TA 2FE4A 2Q7XA 5TS3A 3IB6A 2YNMC 4AQYB 1E0AA 1DAOA 3AHHA 2ZRDA 1X42A 5CBKA 5T5QA 1L3BA 2J87A 2WVHA 1RQGA 3QMPA 3QP9A 4GUAA 5FPTA 4Z9AA 1E2UA 2W2TA 3TM5A 2ZI7A 3PNBA 2FKNA 3VOSA 2GPSA 2HSDA 3EUEA 3WK9A 4F4HA 1Q0QA 3HZHA 3R7DA 2O2XA 1HQDA 3G0BA 2IEAA 1EKXA 1UL1X 2ID4A 3IP5A 3KYDB 3U40A 2JLCA 5JPDA 1IQ0A 1NUQA 3PGKA 3CVYA 4C21A 5KNDD 4MYHA 2E4ZA 1EP3B 1BGWA 1YB4A 2WQZA 3USZA 3FOCA 3J7AC 2AEFA 3RT7A 4BEWA 5KJCA 1ECCA 2JFUA 2LDXA 4C7XA 2J9ZB 4IVRA 4GYKA 4XTRA 1MB9A 2XKKA 5AI5A 2GZRA 2UV8A 4C7KA 3DE4X 4IDOA 1QG4A 1P2BA 1XRRA 2QJOA 2P6MA 3R23A 1JG6A 4JLAA 2XTAA 4X1IB 4TLLB 3H2SA 1E3JA 5TV2A 1JHRA 1Q1QA 4I6GA 3R3ZA 4FMDF 1Z15A 1YQ9A 1ZW6A 2XE8A 4RY9A 5JNVA 4DA4A 5FPPA 2ZJ1A 4KFTA 5M5BA 1J07A 4QAJA 3PHJA 2X0JA 4C07A 1ZK3A 3HU1A 5A4JA 4R1TA 1YCFA 1N5DA 2FWIA 2P4UA 2ZJFA 3I0MA 3EPKA 3AKYA 2FZ5A 3DMYA 4KGZA 1JDPA 2ZB2A 1J0XO 1ESEA 3I6MA 4PTZA 1PDVA 4PWZA 1A1SA 1ZXBA 3ETCA 4J76A 1F2UB 4OLHA 2H1LA 3RK0A 1NZFA 1TVEA 2Q3FA 2IHTA 1D6MA 1PHPA 1RWXA 2AEEA 2C2YA 3MJTA 1VHLA 1HE3A 2C2HA 3NC4A 1HDXA 3KHKA 4JCOA 3WYCA 4ASUD 2KMLA 2XVYA 4I81A 4C4ZA 5JT1A 4YHHB 3I62A 1KZ7B 2J5XA 4TX1A 4JC5A 3VX4A 4FYMA 1VBNA 4B2LA 4G8CA 2C2GA 3JPYA 5HCNA 1FNNA 4X00A 5BY2A 4P22A 2PZEA 2YWRA 3FZNA 1SG0A 3KU4A 5DLQC 1VCHA 1UJ2A 4LK2A 4B3CA 1J8FA 5HXAA 5KHOC 2ZREA 1RRMA 5EWMB 2M1ZA 3SYKA 4YRKA 3KKNA 4MA4A 3DTVD 1KFCB 1QHHB 4O4JB 1CP3A 5L3ZA 4PPNA 3S1AB 3IEMA 1NHGA 3QFHA 4X1YA 4J0KA 1L5FA 3SHQA 5JDCC 4OQMA 2R44A 5F1KA 1UCFA 1FP4A 3EZXA 4BIMA 5M7EA 4XVUA 3A3NA 3F5QA 1M34E 2Q0XA 3QVKA 2PVPA 5B12A 3IAS6 4KQ6A 4P34A 2OBXA 2Q9CA 3D6TB 5K0NA 2RIRA 3QEAZ 1NXSA 3QHPA 4CN8A 4RVOA 3FW1A 4EY7A 4IFEA 4PG6A 3WRXA 3R3SA 4HNSA 2X23A 4ZA2A 3GELA 4KREA 5FORA 3HXMA 1VDMA 2YKGA 3SP1A 1B2LA 2P69A 1JEQB 3Q7QA 1Y3IA 2QTRA 3FOAA 4UCXA 4B47A 4DYVA 1U28A 1JFVA 3BWVA 2R79A 2Z95A 3DUFA 5LWQA 3DVAB 3L0CA 1YKGA 3N58A 4B3RB 1C2TA 4B43A 4MIKA 5JAMA 2YJGA 4RDHA 3AESA 4P7KA 5LOVF 4OGKA 1V5WA 2QV7A 3DDWA 4K81B 4PHGA 2QGFA 2PX3A 1Y5LA 1DC6A 4YAKA 1M2WA 2GI4A 6ADHA 2QJFA 2IHUA 2Z3ZA 1QHNA 2NN3C 3DV0B 2JH9A 3U6KA 4XR4A 1TAUA 3CGGA 3I9LA 1ZMOA 4NBNA 3DLTA 3KD2A 3C87A 1OMOA 1KEVA 1DC4A 1KTVA 2NSHA 2JAQA 3NC0C 4Q4AA 5HFNA 2VS1A 4PAOA 1G5FA 1HWYA 2A14A 2QTHA 1U5AA 4KUHA 1JDVA 3I1FA 5CM8B 1EI9A 4PRYA 5DXFA 3RVBA 1ULBA 1L4BA 2OUIA 1X1AA 4KQ1A 2RC6A 3BCUA 1V16A 4WPGA 4DCVA 4X6YA 4LYFA 1FZTA 2W2QA 5EHNA 2YHIA 3KLOA 3G7SA 2E4VA 1CC1S 4TPKA 4FGLA 5U4XA 2VJCA 4HOYA 1FYWA 1OKKA 1ZK4A 2PH7A 1ULZA 3Q3GE 4GDFA 1N2GA 4HDQB 3FUVA 4MUHA 2WSSD 4GKKB 2HA4A 4IP0A 4Z7NB 2C5FA 4ZEMA 1JQDA 2ZDGA 1J7JA 3IJRA 3LPDA 3O47A 3PD7A 4PYKA 5BSFA 3GQBA 5KYNA 2O3RA 1Z73A 3V1TC 3C8UA 1VCNA 1QONA 1V11A 3UK2A 5DN9A 2I71A 5JS7A 4KPEC 1Y6RA 4A8TA 2FLVA 3I04M 3P4YA 4MKXA 1V1RB 3LV8A 1A9PA 2NVBA 2I2FA 5JPIA 4C2BA 1EB8A 4R98A 5CHEA 3CU5A 1OFGA 2J0QA 3OIVA 5LDDC 2QTFA 1O95C 3I9NA 3SSMA 1O5TA 2Y1XA 3EIFA 1PJ3A 1US8B 3QLEA 1I6MA 4FFDA 3GF4A 1JG4A 1GLGA 4CNBA 4DLAA 1ZINA 3EZ7A 2EV9A 1RCTE 4NFSA 4R81A 4PC7A 3NETA 4DCSA 3E9QA 4GQAA 5HBRA 1RJ9B 4MS3A 2D5BA 3P2MA 4HEA1 4XJXA 4YAIA 2YUTA 1OH7A 3K94A 4PPGA 1W94A 1JQ3A 1F1JA 3CUSA 3D59A 5HKOA 3LYAA