1C9EA

Structure of ferrochelatase with copper(ii) n-methylmesoporphyrin complex bound at the active site
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
306
structure length
306
Chain Sequence
b'KMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTOHEME FERROLYASE
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 112
structure length 306
sequence length 306
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA02
4KLCA 2PO5A 2XVYA 2PNJA 2AC4A 2Q3JA 4KLRA 2XVZA 2QD1A 3LYHA 1QGOA 2C8JA 3HCOA 2H1VA 2HREA 1C9EA 3HCRA 2QD2A 4KLAA 1L8XA 1LD3A 3GOQA 2H1WA 2QD3A 2JH3A 3HCPA 1C1HA 1DOZA 1HRKA 1TJNA 2QD4A 2XVXA 4F4DA 4CCSA 3HCNA 2PO7A 4KMMA 2Q2OA 2XWSA 1N0IA 2XWQA 2DJ5A 3M4ZA 2HK6A 4MK4A 2Q2NA 3W1WA 3AQIA 2QD5A 2XWPA 2AC2A 1AK1A 2HRCA 1LBQA
chains in the Genus database with same CATH superfamily
1EE1A 1JVBA 2R47A 4EKEA 2NZVG 3E3AA 4YV1A 4ED9A 2V7UA 5EC8A 5G0WA 1KETA 3L7OA 2VQ6A 2ZKIA 1G63A 1M8JA 2OPBA 3WGHA 2BEJA 2YJ6A 2YIVX 1BGWA 3RJMA 3ZBUA 2WWTA 3VX4A 1QQBA 2FP4A 1KMQA 1BX3A 1CJMA 2ZK7A 3LZCA 3M4YA 4B83A 3MJVA 5J2TA 4CEHB 3MWFA 3ANMA 1XCLA 2GZDA 4TXLA 1NZFA 3I61A 1FIUA 4AJ1A 4XVCA 3C3WA 5B7NA 4LC9A 3S2EA 2Q1UA 3DEYX 3MJSA 1PGJA 5D51S 4L27A 4J2OA 2HFKA 2F4NA 2ILTA 2OO5C 2V54A 4W5WA 5TEWA 3CUKA 4HDMB 3V1KA 4RYLA 1F4LA 1AN0A 1Q1NA 4X3OA 3H9QA 2PHZA 2P9ZA 3PX3A 1B73A 4BO1A 4FMPA 2A78A 2FK8A 3TSZA 1F8YA 3FPFA 3ZE6A 5MFPA 2GA8A 2P78A 4JBLA 4TV9B 2EBUA 3EGOA 4HKTA 4RQUA 1NMSA 1AV7A 3VR0A 1KEVA 2DBRA 1OFHA 4NMWA 4OH7A 5KDOA 1XXHB 5B53A 1D0IA 8GPBA 3AIKA 2JLQA 3QQPA 4RMHA 1X94A 1Y6JA 3ZU2A 3WLIA 3OFSA 3CCFA 4BIMA 1EP3B 1R0KA 1DZIA 1RWWA 4GZ5A 2V7QD 5ICFA 4EY8A 4L9RA 4M37A 1SCUA 1KDRA 3BSWA 2CVHA 3GBPA 1H5NA 4LJKA 2O07A 1TUIA 4UM5A 1PT8A 1XJWA 1UMBA 3NNSA 5LZ9A 4CWAA 2VJKA 2BWJA 2AI1A 5JDCC 4HNUA 1JFFB 4FNOA 3SN6A 1EFUA 1WSAA 3F6PA 3HEMA 4DCOA 1I6KA 2YJTD 1W88A 3EOAI 3IJEB 3KEQA 2VT2A 3RJZA 3GCZA 3VR6D 3H0CA 3BHIA 1N8KA 3V48A 7REQA 3EA4A 5ISMA 3TUIC 3V6MA 5JXJA 3U3RA 1N5KA 2Q7OE 3QJYA 4ZYYA 4TOIA 3ZCQA 3R7LA 3UAZA 3W6PA 3CWCA 1YZQA 5LOVF 3ISTA 3AHHA 3O31A 3K32A 4C5CA 1ONOA 1XKQA 3DF9A 1TMGE 5DM60 3RVBA 4D02A 4EGQA 4DLLA 2IH4A 2A0YA 3BWYA 3FBTA 3K7EA 3LT5A 2WG0A 2HBZA 2J7PA 1DRVA 2CF5A 3TZQA 1H1LA 5A3RA 3ADCA 1G3QA 3UW1A 5CA1F 1T2CA 3RS4A 5CD9A 8ATCA 2A9FA 3PQ3A 3RRMA 4WCFB 4LG1A 2WZDA 1WMEA 3BZWA 4WBNA 5I7HA 2P2YA 3JQQA 2PVSA 1XRRA 1U5AA 1E63A 2XZPA 2GZ3A 3UY4A 3G2LA 2BKLA 1EKXA 3ZV4A 5JJCA 4OHOA 4PIMA 4NEHB 1QWOA 3PHIA 3TUJC 3UENA 2C9MA 5DTJA 5LQSA 2CFOA 3HJRA 1QFMA 3SZLA 4MGKR 2PV0A 4TKUB 1NAIA 1EFCA 1Y8QA 2ZDHA 2HBQA 1X7YA 3KKQA 3P1JA 2NVOA 2GEUA 4EFMA 1M67A 4KHZA 4LHEA 1GV1A 2Y76A 3NU1A 1KOLA 4ZJZA 1ONPA 4YB8A 1P0MA 4Q4CA 2WSMA 4C76A 4HUTA 3PYXA 2WHEA 3JQEA 3KD2A 1U90A 3L4KA 3R6DA 4MROA 2O3QA 1G2IA 3OPYI 1XA4A 4IQ8A 4YTEA 1JPUA 5JAUA 5CFOA 1U3WA 5CNKA 4LJ6A 4C3OB 4FYMA 3LA6A 4O5AA 5M34A 1GU7A 2P5TB 1BCRA 3LO8A 5FBLB 3E84A 4LA4A 1KDPA 2P62A 4GE0A 4HGZA 2BBOA 3RUHA 5KSPA 1YK0A 4BBJA 1KO1A 1TEXA 1TNDA 3REOA 5I48A 5JQGA 2BIFA 3C7AA 4X61A 2Q2NA 2RDMA 4Y0NA 1U3FA 1E69A 2WQZA 4M2LA 5TQ0B 4YJDA 2X4IA 5T4FA 2R1UA 3K0AB 2C7PA 1JIXA 3V4OA 2H0RA 2O7NA 1P1JA 1OLSB 1XMXA 2H92A 1EM6A 1FC0A 2XCLA 2IT1A 3WGNA 3WV5A 1Z82A 1AKQA 3PQDA 4BNWA 4LPKA 4LOKA 2WJZB 1ZS9A 3THSA 2W93A 1ESMA 1GPWB 4LRTB 2XX3A 4P22A 4WZ6A 4QM7A 4HX5A 1JJBA 4B8YA 2IK8A 4CLRB 2VH5R 1Z56C 1FMJA 4ZI3A 5AI6A 1DE0A 2KB0A 4HS9A 3BRWD 4FFSA 4F9EA 4AJLA 2BL4A 1UBEA 1ULHA 2QVGA 1T0PA 4B6QA 1PHPA 3L6DA 5JDIA 5EE3A 4DIUA 4D4HA 4UASA 4X97A 3T7IA 2QV0A 3UANA 1V71A 1YJCA 3OMWA 1T1SA 3E22A 2BFEB 1XZMA 5H7XA 1NXSA 2R1TA 1RXVA 1HZZC 4CCYB 2Y1KA 2JGIA 2KWIA 4XLTA 1E1RD 1GGKA 2L17A 4MWDA 3KQNA 5GP1A 5SICE 1E2MA 4PRYA 5K8CA 4I6JA 1P44A 1WUTA 3D64A 3VO1A 2E0IA 2ZT8A 4R7TA 3SSAA 4UOZA 1K88A 4AJIA 3JXEA 4C1NA 3WK8A 4UMDA 7ABPA 1K7SN 3AOEA 3GBVA 3OJ0A 4K9LA 4TVBA 2L69A 2C31A 2IS6A 5CVJA 4U2DA 1IB6A 1P1FA 3MHTA 1YDEA 4TTIA 1PT5A 4N03A 4HQ0A 2ILVA 3KOZA 3VH3A 4UOEA 1PLJA 10MHA 1JVNA 3AQIA 1OY1A 1ZO8A 4JEUA 2WLSA 1LDYA 3RM3A 5I9BA 4EHFA 3SKVA 4L5AA 1FS6A 2MIIA 2GO7A 4EI7A 4MAAA 1W85B 1K7YA 3Q2KA 2VPIA 4LYHA 2Q4EA 3LD9A 4DY6A 2Q3MA 1HF3A 1AQ6A 1UPTA 4BLWA 2C99A 3OZVA 2J7KA 1KVQA 5IDYA 1FMTA 4QT4A 2R2GA 1GUFA 2BM0A 1LC0A 2HDHA 3H9UA 1R4MB 2Q9AA 3CUWA 4L7QA 4KXYA 4OD0A 5E3IA 3E05A 1MB4A 1G98A 1NYLA 1Y81A 2A6PA 1CUHA 3N07A 4H0CA 3H19A 4IS2A 4UBJA 5TMDA 1PNVA 1H4QA 5AVVA 3GEEA 4HB2A 1ZWKA 1VHQA 3VU8A 4OL9A 1JI3A 3TRHA 4C7JA 4DIDA 1QOZA 3FAZA 2KBEA 2BGGA 4IV8A 4ZCRA 1H3FA 1L9XA 4X92A 3GLKA 4PZYA 1FYEA 1DPFA 3IGFA 1GKLA 4GF5A 1EK5A 1Y3DE 4B3IA 4CM4B 2NZ2A 5AVYA 4MKHA 4O4JF 3OX1A 1II8B 1TXGA 4IQGA 4J43A 2GK3A 4KVGA 2FE1A 3CE6A 4OU4A 1PFGA 3SIRA 4CI0B 4IDNA 4FLEA 4LZZA 4MS1A 4PZEA 5I7FA 2JFZA 3I5AA 3KR0A 3DZFA 5KYVA 1LD3A 2PXHA 2DVMA 2PU5A 3FB1A 2QX4A 1N2EA 4GKJB 1LI5A 2FWMX 2XVXA 2A7XA 3ACCA 4TS3A 4EYQA 1SOVA 4II3A 4HNGA 2PVCA 1X38A 3K9GA 2AEEA 2GZHA 1B8OA 4RCZA 4WZBE 3RIGA 1C41A 2QR2A 2XA1A 1UQRA 3MFQA 4FB4A 4XGNA 2AMYA 2X6RA 1N7JA 1M34A 4IJUA 5JO0A 4WZAE 1RJDA 1IJEA 1DWPA 2WM2A 4ZOAA 3P9PA 4MO2A 4YO7A 2EERA 3RU2A 3SJBA 1C8KA 1YB5A 3B48A 2Z56A 3T9CA 1N33B 2J9GA 3IMCA 5DN6A 4B9EA 1ZD5A 4M46A 2AQKA 3SICE 3W04A 1JHYA 4K3UA 2ZJ3A 3JR7A 1RAAA 1VLMA 2XV1A 3GEMA 3GVIA 4OYRA 4Q4HB 5K2OA 1T8TA 1U2GC 1YAJA 4QDUA 5TQ2A 1ZEMA 1ZOSA 3RK4A 4QU9A 1HE4A 4ZYUA 3OT1A 1D7AA 4I46A 2J3KA 2BRUC 4M8NE 2ERXA 2GJKA 3A6DA 3KYIB 4XA8A 3GRUA 1XR3A 1N2SA 4IJ6A 2PKYX 1JMVA 1JU9A 2BGIA 2A9VA 2PMDA 3LI2A 2FI1A 2XNCA 4XB2A 1BGXT 1V8BA 1NAHA 2OCGA 5EP1A 4ZJPA 3LCCA 1VL8A 3VTAA 1I7NA 3QU7A 4MKFA 4D3DA 5IBQA 2WT8A 1JLHA 3TOSA 4DDWA 4L5YA 3GMSA 5DT9A 2FSUA 1SD5A 1WXWA 3K1AB 3GT4A 4YRKA 5AH0A 3C14C 1ZL0A 4HNSA 3IDOA 3JARA 1ENPA 3JSAA 4HDRA 2Y1DA 5IKPA 1YV9A 3SLGA 5KEIA 1O6FA 1U0NA 3G5LA 1U2PA 5L95A 4LE2A 2ZLBA 3VYTB 2YW2A 4XARA 1AZTA 4BE4A 3LUFA 1SEPA 1HDYA 5ARBA 4I08A 4LY9A 4QHYA 1DWUA 2F62A 2UKDA 3L0OA 1K89A 1LBIA 1UPFA 2P9HA 2RGDA 3PXBA 3K71B 3I4FA 3AG5A 2CJYA 4WZZA 3X1MA 4DMFA 1NJ5A 2BUAA 5BT8A 2HPVA 2HQSA 5GQSA 4YRTA 1QLJA 2ZBDA 4PNHA 1QAOA 1ABEA 1UWKA 1XMJA 2PZKA 3M2TA 3WMWA 1EWRA 1MT0A 4ESHA 1OIWA 3T7RA 4DYHA 1VIDA 1ADCA 4DA4A 3BH0A 4R68A 1T6NA 3ZK8A 2IDKA 1PVVA 2VH1A 3QOXA 4L95C 2CHGA 3EXG1 5MF6A 3UXHA 3WJ7A 2IKQA 2LD4A 1VOTA 4EKNB 4JC4A 2V6GA 4PR0A 2C3PA 4MV5A 4Y9SA 5BQOA 1XMPA 2GD2A 3FFTA 2RG1A 1TAQA 4WBSA 4ZRNA 4AULA 1MN6A 1VPDA 1PE0A 2WU3A 1F38A 1X1DA 2NTYC 4E32A 4JYZA 1CW2B 5M04A 4DLSA 3SYLA 2PMWB 3QEBZ 2OOSA 2Z9BA 3PEFA 2PUWA 1B7GO 3LT0A 4JSRA 3Q1LA 3SQDA 2HQBA 1K63A 1T10A 3B3JA 3DCJA 3NEYA 4IQ4A 1IY9A 1Z63A 1S2GA 4UEOA 4TSFD 3TVDA 1ZJ6A 3ZGOA 5BN3B 4YYZA 3GI1A 1CUZA 3ZBTA 5CDUA 3DLAA 4OOFA 1ZOPA 2PX6A 2AH5A 1JLRA 4DSUA 1AU9A 2GF9A 2AF4C 3AR6A 3PHCA 5KJFA 2B2NA 2QAJA 2GBGA 4ZDWA 1R8JA 1E60A 2QI9F 4ASUA 3OQPA 2W6QA 2GRUA 3P45A 5GM2A 5BMVB 2ATXA 3GXBA 2BZ1A 2HMWA 4KDCA 1GR1A 2XMZA 4LWZA 3AR8A 3WGGA 1HMYA 4B0PA 1P1RA 4MZDA 4DJ5X 1CC1S 4RADA 3G6WA 3OOEA 3JQFC 1AN9A 4TMVA 5EWLA 2WNSA 4S05A 2HA6A 1HLFA 3AUKA 2X2PA 1USKA 3BGWA 4E5UA 1SVWA 3KWMA 2IYYA 2OHOA 3GMIA 4KQ9A 2ZUEA 3RVOA 1NFRA 2D5LA 3FPAA 3SPXA 3I30X 3WGKA 3TTXA 5ADWA 5LU8A 2X86A 5G4KB 4PLCA 1QB7A 4BFTA 4QNNA 3R7WA 3U4HA 2FOXA 2Q3DA 3E0XA 4GEGA 1TW3A 2BM8A 1KIFA 3QLVC 2XNHA 4K9QA 2XQVA 4JP3A 4A82A 4PN7A 2R96A 3A36A 3R4CA 3MJRA 2IL1A 3RBZA 4PSKA 4UU7A 2DUNA 3WOVA 5K6AC 1QDUA 5E8JA 5AVWA 4WKPA 1WBJB 1X1EA 2NSHA 2B1RA 2ZR7A 2DLDA 3TIGA 1QFSA 4WA8A 4QU5A 2PKEA 2EP5A 3DTYA 1YIOA 3GBSA 2W2LD 2VS1A 4ZVKA 1NVTA 2YJGA 5T3UA 4LSGA 5TPWB 1K7CA 4G0XA 3UWSA 2WF8A 4MOWA 4CKWB 3CRW1 4O63O 3TG2A 2F8MA 3BK2A 3PDJA 2QLFA 3EQ9A 4BWYA 2LR0A 1OC4A 4MPRA 1ST2A 5AW3A 4OFZA 1X7XA 3ZWAA 3FUUA 2A3RA 4AQYB 2IUUA 2EKLA 3AM5A 4Y67A 3GA5A 2IHTA 1B8VA 2C8JA 2YXPX 2DC1A 3WIBA 2VPYA 2PJRA 3TSYA 4YHHB 3H3FA 4FIDA 3V7YA 5BUSA 1RJEA 5HTOA 2EJUA 1Z2NX 4DS3A 4OXIA 5HIMA 1P2BA 4MUNA 4DMKA 3RF7A 4A26A 4NI5A 4Q0MA 3IUYA 2WEKA 3R7SA 2BP7B 4AW9A 3CRNA 4RH1A 2ZM5A 3RVKA 5GIOE 4AUMA 1COWA 2X8JA 4S0ZA 4X3CA 3U7EB 1GCOA 3VSBA 3LVQE 2QJTA 3IVXA 3UQZA 2AZXA 2NUAA 4G07A 4Y2UA 3I9MA 4ARZA 1T6YA 3GLFE 1HV8A 1HQKA 5BNWA 4GWLA 3TS1A 1XFDA 1UJ5A 4V0SA 3TRJA 3TK1A 2ZEJA 5ELMA 2WY2D 1JDJA 3W9BA 1G8YA 1H2XA 1PT9A 3HLYA 3OX3A 4UXJA 3OKFA 4YP1A 2JKYA 1IPHA 2GESA 2YFYA 3GUZA 1OXKB 2UVPB 1RIFA 2Q8QA 2VOJA 3HADA 4C7KA 2JFVA 1O9GA 3P2MA 3GLIB 1XZAA 3GFOA 4XJXA 1KR5A 3SC3A 2LRHA 3PENA 3PXCX 1SRRA 3G0CA 2JLCA 5DW0A 1XPOA 1L5WA 3M4ZA 5A05A 1NLFA 1XALA 4F4FA 1N2XA 1KI4A 2EWVA 2ZUCA 2ISCA 4XQCA 4YNBA 4ISBA 1SELA 3MCWA 4BNFA 1OFUX 3DXYA 2O2IA 3A4VA 2ZYRA 1L8QA 4NCHA 4YQEA 1UUFA 4RD1A 5ADUS 3TJZA 3QVVA 1CY0A 1JKIA 2VHWA 4EHKA 4WWHA 3VPHA 3H5NA 1H5QA 5I9MA 3TPFA 3U1VA 2CZCA 4CFYA 3JAWB 1C9EA 5J2TF 2DMRA 1NFQA 3LQYA 3KD3A 2WJGA 1O1YA 1IHPA 1W73A 3DBLB 1MRSA 1ML4A 2Y4NA 4OYYA 5LCXA 1C2TA 2FQQA 5E9WA 4HL6A 4ZAFA 4B5KA 4Q3LA 4F11A 2OHIA 1X92A 1MABA 3FXAA 4ACAA 4YDHB 1M66A 4XIYA 4AK9A 2B7BA 3MAJA 3CSUA 3X0DA 4JT2A 2IWHA 3TD2A 3QVTA 2C9CA 5B4UA 3M9LA 4RK5A 2X8LA 3HCDA 1QHSA 4MV8A 2PTHA 4EA6A 1Z4MA 1U6JA 3KCQA 3E2IA 3HO6A 1OKKD 2BEKA 4AG6A 4XD7A 3QUTA 5K3FB 1CBUA 3AERB 1XD8A 4UUMA 5A5VA 3EH2A 3MA0A 2CD7A 1K97A 1SXJB 2PUTA 4DNFA 4KKVA 1FBTA 1U1IA 4QBFA 3FE2A 3ZKAA 4IDHA 5BV0A 4RDCA 5DWDA 1PTJC 1HL7A 2ZJBA 4C4SA 1Z7GA 3KR9A 4A73A 2D00A 4RZ3A 1LPSA 4W8OA 2OYCA 5KZMB 3NWOA 1Q3KA 3BJZA 2H7YA 4J16A 5ALZA 5TSDA 1IJFA 3TVYA 4FXOA 2B6NA 5BSMA 2EFEB 1TTTA 1POWA 1JTVA 4O2BB 3RS7A 4ZDKA 3AVUA 3BMOA 5CLIA 4FSHA 4MEBA 2VUTA 3TLBA 5IJ9A 1A9OA 1CS0B 1MFZA 2PQMA 3P20A 1FJGB 2XE6A 3QK7A 4BCBA 2GM3A 2PX3A 2ZRFA 1DV2A 4JQYA 1Z4NA 3EQ8A 4TVSA 2FLKA 3MXTA 5D84A 4YRPA 3ZWBA 3JCZA 2CNDA 3NDPA 4BPBA 3WSTA 2FMIA 2F48A 3M3HA 3D6UA 1DAMA 2ZAOA 4B6JA 1Z0IA 4XRRA 1EZ1A 3CN7A 1GGNA 4LN1A 4Z53A 1JA1A 3BCRA 2FA9A 1CJUC 4DHEA 3NBAA 4WIAA 2Y1WA 2ZYIA 1JA0A 1N5DA 1Z06A 3UAOA 3G9TA 3U3JA 2EGUA 1QZZA 5DEOA 3VUFA 3A25A 3WSVA 1KWKA 3WL7A 1SWWA 3QVJA 3C3DA 3HQ4O 5BNFA 3W6OA 4MVJE 4MIEA 5ARCA 4DA9A 1KKMA 2VP2A 2AQIA 5IH3A 5G3ZA 1E18A 1JKXA 1GQFA 1XQ9A 4WBNF 1TEHA 1KMNA 1LW7A 2IHZA 1CUJA 4G81A 3E35A 4L0QA 1PG0A 4Q82A 4B33A 2RE8A 4WPGA 3LJKA 3SWWA 3CNQS 2BGTA 4ZN6A 3JQAA 2PSDA 1N9GA 2R1VB 1DAOA 5KCMA 2PLRA 3LDGA 3OF3A 1ZN7A 2C3YA 1AKEA 2PH3A 3BS4A 4NYJR 1BS9A 4QIHA 2BE7A 2EDCA 2CLFB 1PWYE 2VJDA 1WUKS 3DZ8A 1TJ4A 4R0VA 5JWHA 4A5SA 4DM7A 5B1YA 4DDMA 1VPLA 4KR3A 4OQEA 3FPGA 2O48X 3R9XB 2C5EA 3BQ9A 3GJSA 4JBHA 4LMBA 2A9RA 2YDYA 4I0WB 3A2MA 3ZWOA 3LOPA 4JODA 2RONA 5ENDA 1UWLA 2I03A 1RPAA 1IC6A 2IYAA 4EUSA 1B8NA 4ZQEA 4EPYA 3IMEA 1EE2A 4X8LA 1A8IA 1IH8A 1SHKA 4LNUB 4DCJA 4CEHA 4ILKA 3H2KA 3P71T 5IM4F 3HFSA 2B5WA 4FI3F 4PYIA 3O9ZA 2V5UA 4Z3DA 2XKKA 2YC4C 4IIDA 4GDMA 1W581 4O6VA 3HWRA 5JQGF 3NV9A 1OGJA 3GWZA 4XTCS 5DTMA 1HDCA 3O0DA 3B1XA 4JIGA 5LA6B 1QVRA 4HDMA 2CE7A 2ZUTA 4R8LA 3IUNA 4HC4A 4B74A 3EMKA 4FD3A 2IPAB 2K87A 2Z08A 4FKZA 4N7RA 2WU0A 4TV9A 4BGVA 1L1EA 1TAGA 1QRDA 2DERA 4NHEA 1M2NA 2VDRB 3NR2A 1XXHA 4JEMA 4TMKA 1FE8A 1RVV1 3OF2A 1UC5B 5FWYB 3PQ4A 3ZVKA 1RKVA 1IZ8A 3IHKA 4YJGB 3VJRA 1CIPA 4M98A 1Z45A 3GGDA 4RV4A 1Y98A 4JJ4A 1KZHA 4FS3A 2I3ZA 2NVWA 2QMOA 3C43A 1E6LA 2EKDA 1PWEA 2ONJA 5JSQA 3KSBC 4MQMA 1R3UA 2DG2A 4YJKA 1X1TA 2ODAA 2IYXA 2WJIA 3DVAB 3LIPA 1KSGA 3ZH2A 3WZMA 3FI0A 3G7NA 4IUCS 1JRLA 3WG9A 3RTDA 1TQ8A 1UIMA 4HLCA 5AVOA 1YRHA 4BX3A 5THQA 4NZOA 3QYPA 1JFFA 4PG4A 2QVZX 3OEHA 5IBPA 5LMUB 1X1CA 4WH0A 2R6JA 2H2IA 1JLKA 2B1IA 5EE5B 5L7TA 3OSZA 5EKSA 2P79A 5F7OA 4DVGA 2XQGA 2O6LA 5KNCA 1TL7C 4LRYA 3K8ZA 5AMXA 1T9AA 4W5TA 3SHOA 3H8VA 3OURA 3WFJA 1T0UA 2RHTA 2JI7A 2WUVA 2IZOA 2YYYA 2XB2A 2XA2A 5FWXA 1RAEA 2AG6A 4NP6A 1QFYA 4L76A 2FN7A 3PNKA 2AOTB 2ZRNA 1UH5A 3KEFA 4OSEA 3U4IA 1ORRA 1VGQA 1Y80A 4FCCA 2PWPA 4LJ7A 4H1WA 1YQQA 4OHBA 5B6PA 4TXJA 1LXCA 3ZDRA 3OWXA 1XSEA 5K8TA 3RPEA 2FK7A 5BN1A 1VLJA 1O57A 1ETUA 2GS9A 3PIIA 2QTVB 1ZHHA 3ET4A 3M2PA 1BXGB 5E7IA 4D4KA 3WGLA 5G1OA 1A5SB 3ABIA 1FVHA 1C14A 3KB2A 2XQKA 2PGDA 3QUAA 1L1RA 3IVRA 4GPTA 3GCWA 2JRLA 3H42B 4IDOA 1G66A 1MW9X 3PU6A 4N12A 4F92B 5CHEA 4TKUA 4KVZA 3KPWA 1EH5A 1E2LA 3FAKA 1JKFA 3EZ6A 3ABQB 3HB4X 4MPDA 5F5LA 2OEPA 3UFBA 5KTSA 2AQ8A 4YGYA 5LKAA 2LP4Y 4GPAA 4LX0A 4DUGA 2UXDB 2CNOA 1F3LA 3UB3A 1TIBA 4TPKA 5TPZA 3H05A 4EF4A 4FJ1A 1B0AA 1XVAA 3HUTA 4JI7B 1NU6A 3L77A 5BQPA 3IDAA 1KZ6A 4YRQA 4BZPA 1A9PA 5EINA 3RS3A 2ODNA 2REOA 3E3LA 3W5VA 3VU9B 3KYDB 2DFPA 3I01M 3T06B 3AHJA 3H9CA 1U7TA 2GQ0A 2XUAA 1UDWA 2Q4TA 3U7GA 3CLSD 3OQIB 4NH0A 3MC1A 2W71A 4NAUA 1A9ZA 3EPRA 3H1PA 2DBZA 1BJTA 3CW2A 1GUZA 4HGOA 2CCJA 2A94A 2AEMA 1C3OB 4GMFA 4E30A 2AI2A 1Q22A 3UAGA 1D4AA 1R74A 2C78A 1IWBB 1PFWA 1UR5A 2H52A 4H3VA 1KY2A 4DMRA 4B3SB 4C7MA 5JALA 1DX6A 2ZDGA 1KI1A 3PR1A 5TQ0A 2C58A 2QYSA 2VHYA 5JPCA 1DNPA 3IMGA 2PGOA 1UAAA 4ZZIA 2REXB 4JWKA 4RAQA 1K75A 1T5IA 4DYDA 4OHPA 1VKNA 3AV3A 3F2VA 5ICGA 3W8FA 1A2BA 1I4LD 4Y9TA 5FBQB 3SQOA 1PUIA 2CEAA 4NF2A 2ZTSA 1EGHA 1P4RA 2PZMA 2X4GA 2X58A 3JVDA 4FJ0A 3QF7A 4L8GA 3TE6A 2JHPA 5AOAA 3UJ9A 4C89A 5JZBA 4CLRA 1N3IA 2FEOA 3Q5EA 2YWGA 1G4AE 4P86A 5CW1A 1Z4QA 4DSTA 4E5VA 2ID8A 5FOQA 2OCBA 3A1EA 3UXEA 2D2EA 3V55A 4RTQA 4H7IA 4RHCA 4HB3A 3PDWA 1K6MA 4MV3A 2ONZA 3D31A 4MWZA 3HL4A 3ENWA 3HFRA 1VL1A 2PRSA 4CDRA 4AWXA 2I1VB 4ZZ0A 2YV3A 1YZ3A 1X8LA 4KITB 5ECGC 3RTGA 3RJ9A 1P2SA 4K1LA 3GIWA 2VZ0A 4A2WA 3L43A 2H4HA 7MDHA 3PZBA 4RW0A 2WYOA 3UV7A 5DOVA 1BU5A 1M76A 2ZYVX 4HDKB 2X8AA 4CCYA 3TECE 2QENA 3T95A 4B3CA 1E0AA 2LE0A 5E1BA 1PJ4A 1RWVA 3OLWA 2JI8A 3WBFA 4EB6A 2CXUA 3L01A 3VR5H 3B7WA 1FRFS 4U7TB 1JQJC 2XRMA 3B8HA 1IBSA 1AKMA 3DT9A 5JWOA 2DETA 3TOVA 3PJEA 2Q1WA 3MYRA 4LJSA 2ETXA 3KVVA 1W9HA 1N9ZA 3TTYA 1H93A 1DKQA 2GAIA 2QZJA 3T3IA 4KYIB 1ZWLA 3RH0A 2X5KO 2FW1A 3V4LA 3PE4A 4U4AA 3RVMA 5L45A 5LZ2A 2ZU6A 2IYOA 1EFAA 3GFTA 5E0OA 5CB4B 4NV1A 2MHCA 4QWMA 3AEKA 3SAJA 5DM70 1W85A 4AP9A 1J22A 3PFIA 3VX3A 1A8HA 2UZ1B 1YJ5A 4C3UA 3WNDA 1ZY2A 4C4XA 4F06A 3PLRA 2IVZA 2XB9A 1Z6PA 3A6HA 2JH9A 2ADOA 4D5GA 3D7RA 1R4MA 3DBHB 5A4FS 5GAJA 4Z1MA 3HYNA 3DBOB 4PFKA 3VAZA 2GHIA 4Z9FA 3CVXA 5DTRA 3MPOA 4JASB 2BUBA 2RGAA 3OKCA 4YBZA 5B3AA 3GLHE 1RBYA 2VRCD 5CFRA 2KYRA 1NMZA 2JDIA 5B3JC 1VC2A 5EHIA 1DEAA 1ZLXA 3E5RA 2PL1A 1CRPA 3T9BA 4LS3A 4JC0A 2FWIA 2HB6A 1RYMA 4DV3B 4CM4A 2C5GA 4KSYA 3GCDA 1KI6B 3LQKA 5CVEA 3W2TA 4YRSA 1IM8A 2IEYA 4HXYA 1II8A 3MCVA 3TQIA 2XCRB 3GYBA 4N41A 1BD3A 4RS4A 3QU9A 2HA0A 4ZO8A 3SKXA 3LUBA 4O2LA 2JAHA 1G1AA 4FWIB 4M54A 4U2FA 4WFQA 2JKZA 2FX5A 2UAGA 3KVNA 2HDWA 4CMEA 4J8PA 1E2DA 5BPHA 2H9YA 4DTIA 4JKOA 1DHRA 2QTNA 1VB3A 3FZYA 1OR8A 1Z2OX 4I9FA 2I7TA 4JJFA 4XZ3A 3BL6A 3DTNA 4HQOA 3FPCA 2CNWD 2M6KA 3VBCA 3VPAA 3ZWPA 2CW5A 2P6MA 2BF7A 5FI0B 4MQFB 2A5YB 1EMDA 3OTQA 4UZEA 1QGAA 2YHIA 3D3KA 3EIQA 2JANA 4HLUA 4S1OA 3ZKWA 1CZOA 1KIAA 2XGOA 4XB6B 1GKYA 5G53C 5H4GA 3TDMA 3MAAC 3MD0A 5K0LA 3DBVO 3SF8B 2VHQA 3A9UA 3E3OA 1Q91A 3PKIA 3U3ZA 3TSAA 1HDIA 2BHNA 3KM0A 4Q4HA 1XC7A 2WUDA 1XWIA 1Y4ZA 3KOWA 5K8LA 3T0GA 1NW5A 2QRVA 1WDMA 4PINA 3K0FB 4XR9A 2YOFA 3F5MA 4CG1A 2YVLA 3QLJA 4RPCA 3USCS 1ZMTA 2YV2A 1BJKA 2HWKA 3IEXA 4KK4A 3COVA 1VQ1A 4KIWA 4HNRA 5JYEA 4GE3A 1VJTA 1YVEI 3L7NA 2ZIEA 2B7CA 4ZGGA 3IBGA 5ALWA 4MULA 3FZNA 3SEAA 3GEBA 4TXMA 5BSHA 2WSSD 5K05A 2UUAB 2W83A 2ZOSA 4PQGA 4RTLA 2MINB 3D9QX 2XD4A 3FDXA 5LP6C 4DFDA 1L5SA 3HXKA 1RKXA 1Z0SA 2QUAA 2X4LA 3K1AA 3M1AA 1K08A 2PWYA 5H9VA 1MVNA 1E2IA 4PYNA 4BNKA 4DM3A 1THMA 2W2MA 2NV0A 3K1JA 2LIVA 3V1TC 1URPA 2CLLB 3LCJA 4DVJA 2Z5VA 5DSTA 2R3SA 3KDPA 2WQ6A 2VF5X 2TMGA 2PLFA 5DI3B 1X70A 4KQWA 4MUGA 4B4OA 1D6JA 2EJBA 2HDOA 2Q1YA 4XYGA 4IOKA 2ZG6A 3CZ9A 1XQXA 4F3CA 5JATA 1RRVA 2UUPA 4D25A 3BA6A 4ZKEA 3IQHX 1NVKA 5I9NA 4QAJA 1U2ZA 1YL7A 5AO9A 1ODLA 4R05A 2VHTA 5KOJB 4C2AA 4CMAA 1L7OA 3PEVA 2IYUA 5EXEA 1LJUA 5IARA 4OMCA 1ZIXA 1CEQA 5DX1A 5K6TA 2V65A 5ALOA 2OXTA 3Q41A 2QW8A 2VF4X 3IJ5A 3LP6A 4N7MA 3VYWA 1DJLA 3O1JC 5CH3A 1GSAA 1QONA 1T8PA 1Z8DA 2IX9A 3TE7A 5B58C 1TAHA 3DOCA 2CFTA 1NV8A 1KEEB 4BVHA 4TTPA 2QUBA 4C6HA 4BX0A 2B94A 4E15A 1RWQA 1E2PA 1GV0A 2CNNA 1ODCA 2HJHA 2VT7A 1ES9A 4F5DA 2FRXA 2GVDC 2I6QA 5IX8A 1BFKA 1GA1A 3DGFC 2OLEA 3T9AA 3VC1A 4J0HA 5D3QA 5EUCA 3BMCB 1DXHA 1N5JA 3OOSA 3GN1A 1E9CA 2PKQP 1ZRHA 4HN2A 4NECA 1XPJA 1REQA 3FPEA 4RTKA 3I9V6 1XNQB 4Z3KA 3A4IA 4JLWA 3Q9NA 1PX0A 1O97D 2FETA 2MSCB 4PGHA 3OTOB 2R97A 2UZIR 1KFEB 1D0VA 1HQCA 1RQLA 2JGDB 4LNAA 4N18A 2H4XA 4RE5A 2Y92A 2AWNA 2X19A 4S1NA 3T34A 1QG4A 4UVEA 5BMVA 4KLRA 4PO3X 1SU8A 4BO2A 3L0CA 1P7ZA 4OBXA 4Q00A 1QH9A 4Z7OB 1FYVA 1PK9A 2P1RA 1HUQA 8LDHA 3UWOA 5HFAA 1ODIA 4M1TA 5ALIA 1EJ2A 1X74A 2G9UA 4AD8A 1YACA 3E3NA 4FDVA 3BGIA 4D9MA 4YCSA 1G16A 1CUIA 3IBCA 3PX2A 4UAVA 5BO5A 1L5HA 4LW8A 3TI9A 3T9FA 3HXQA 3H2JA 4YALA 3A10A 1P6QA 4JUBA 5CM8B 5AHWA 2JJYA 5G4KA 1H8EA 4LPSA 2CBXA 4ZI5A 4YPOA 2QW1A 3BQNB 1EHYA 1A76A 4Q9NA 1SEVA 3GL9A 1F5SA 1J8DA 1MOSA 3EEQA 4OLJA 3WMEA 4CU5A 8OHMA 5BYBA 2HPZA 3H4VA 3RUFA 3QKUA 4A27A 4UU0A 5JSKA 5KC9A 1O6ZA 1HA3A 3W5BA 3AHEA 1O5IA 5KYYA 1Y6GA 4M9RA 4P1ZA 2O06A 1FRQA 4DKXA 2C20A 2OV1A 1TRKA 5TPWA 3A1VA 4U8GA 1ZD4A 4Q7KA 3LY7A 3KQVA 4CKWA 4I55B 1RLUA 1YXMA 1GSHA 1ZIOA 2CWDA 3ABZA 3UAVA 2C5HA 3CHYA 3GFFA 2W0SA 3K9CA 2B3DA 4R81A 4RK1A 1H2WA 3COWA 4RU1A 5HCNA 2LWIA 3LMKA 3LHFA 1YJ8A 3QVGB 4V3CA 1GADO 2UU9B 2AGVA 3LGXA 3PPYA 4L3VA 1H0KA 3AR7A 5HKBA 1BW9A 5SZJA 3KOMA 1E3JA 4K9MA 4LF8B 1RVDA 2Q5JA 3DPUA 4EI2A 4ZYZA 1I32A 5JAPA 4FDTA 2WWXA 4TL9A 1QJCA 2X2OA 4M55A 3J81k 3MQFA 4I9NA 3N3BC 4DJEC 4JCOA 1JEJA 1L4LA 5COBA 2BP7A 1G5RA 4WQMA 1QG6A 2RHHA 4KR0A 2H1OA 1I3MA 2H4YA 2ZPAA 1BA3A 1JH8A 3VNVA 4R51A 1RBZA 3R74A 5IPFA 2XTMA 4V0LA 4ZOLB 1DQPA 1DKMA 1A82A 4HZGA 2EKQA 5A3SA 2E4YA 2B5OA 4FYKA 1J24A 1KF0A 4P3PA 4QRHA 2AC2A 5SY4A 2J6CA 2WKRA 1NQTA 2EHDA 2GN6A 3LRXA 4YJ2B 3AJRA 3KZ1E 2ZBUA 3AX6A 3GP8A 5DX8A 3E9CA 1FW8A 1C7JA 4P3YA 4AICA 2UVPA 2V6IA 3NYQA 2NXWA 3N0WA 1FLDA 3GLIA 4EMSA 3RUDA 4MHTA 5EQDA 1EFDN 3DFUA 3ZDFA 4HBGA 1TUBB 1ZH4A 2O3TA 3TXXA 5ALHA 2BFAA 2D0PB 3L82B 2C3OA 5I8ZA 5FDFA 5I7UA 5KNDD 4D9CA 5DGDA 4BS9A 1P9RA 4EHNA 4RDHA 2F64A 3MILA 1RAFA 1IG3A 2XWSA 4DT1B 3FOEC 3R5SA 2RK4A 3KEOA 3M6AA 1VFPA 4L6CA 4X1YB 2WHXA 3LXXA 4G1FA 4ZHQB 1UQUA 5K0ZA 8MHTA 4J2TA 2F1HA 1ODTC 3IDZA 3NBQA 3NORA 1UKYA 4Z4EA 1UK6A 2GX6A 1WZ2A 2CYCA 5F51A 3JAWA 4UD6A 4BQSA 1NPDA 4TVKA 1Q21A 4TLLB 3STXA 1N0UA 1KZYC 3DBLA 4WOBA 3EPJA 3GR6A 3O2SB 3H5RA 3PPXA 5JEEA 2VA9A 3GUUA 1LCIA 3OFJA 2DFLA 1MB0A 3ESRA 4QDOA 3O2QB 2QD3A 1WY7A 1SHLA 4X84A 3SE0A 5ADVA 5HYVA 3EDOA 1NN3A 4AL4A 1DBIA 2ZIUB 3CVYA 2GHRA 1HYEA 3MUNA 1HGXA 3HXPA 3HVHA 4AKGA 2BCGY 1Q16A 3AL0C 2RJ3A 4LOLA 4KLZA 1TDJA 2B83A 4MRAA 4TV9F 4B6GA 4AQ7A 1NVVQ 3AERA 3F78A 3PF8A 2A35A 3QXGA 4JP1A 2CHEA 1OXUA 3ER6A 1QFJA 1SXJA 3OAAA 1HE8B 2RI1A 3TUZC 5B1SA 3P9RA 4H4CA 3ILSA 1PQWA 3SJAA 3RV3A 3V3KA 4FK8A 1CQWA 1KZ7B 4QBIA 1OFUA 2QVLA 3IIKA 4RLFA 4IIEA 4PLWA 4BZQA 3I01A 4DUYB 2XUQA 3FBWA 1OH7A 3VFDA 2HSZA 3W6NA 4LF9B 5H8WA 5FH9A 4LGCA 4UULA 2Q3LA 4L6AA 4WVFA 4JY7A 2AX3A 4EY4A 2R6ZA 5JSZA 5IW8A 4DXAA 3LCRA 2Z6AA 4YCCA 4EKGA 2YOHA 1R0BA 2HM7A 2I4LA 3AEZA 2OCKA 1C7ZA 1IN8A 3CT6A 3HJNA 1CS0A 3N58A 4KWTA 5A9SB 3M49A 3GLUA 3QFCA 4PC1A 1E9RA 4GXQA 2AUNA 1I5EA 3AM4A 2OBFA 2CXPA 5B1IA 4WEQA 1EXDA 1EFVA 3DNFA 3N87A 4LGMA 5EUQB 2OOKA 1KJQA 2EG9A 5CTAA 2G5CA 3A3PA 3IOMA 1FUIA 3G17A 3WLHA 3AIOA 4QGBA 3NQ41 4NEGA 4DDHA 3JQGA 5DF1A 1PCXA 1XHEA 3GDHA 1GNPA 3ANLA 3DR3A 4LOAA 3ICEA 1OC2A 4CXMA 1Q0PA 2DGDA 2IZ5A 3V9PA 2CLCX 1SVLA 3WWCA 1MENA 4V38A 2KSQA 1HO3A 2ZSUA 1S6YA 3EC7A 5ERXA 2V5VA 5EA2A 4BVEA 2JIRA 1U8UA 4IEFB 1FDOA 1N8NA 2YYAA 4HWOA 4OREX 1YZGA 4TMYA 3FYUC 1DAGA 3MF4A 1WE2A 2ATVA 4NS4A 2IOYA 3OOHA 4D8XA 1FFGA 4FQ5A 3CKMA 4K6FA 2IU6A 3RW9A 4GKVA 2F67A 2VNIA 1HKUA 3FG9A 2QXTA 2R1VA 1G6KA 3IR6A 4J1QA 3X2FA 5KTKA 1YS6A 1I4OA 4KGZA 3X2EA 3PA8A 4BJ1A 4AURA 3NFRA 4B71A 1DXQA 1KJNA 2ZIAA 5AKHA 3G23A 5HZMA 5IMSA 4KPYA 4PF1A 1O6GA 5FEUA 1QYIA 4LDRA 2W4MA 2LIPA 2VN8A 1WV0A 2WBLC 3CU5A 3OD1A 5ES3A 4GAEA 2JH3A 3WLLA 1ORWA 2EQBA 3EDYA 3AW8A 1YS4A 3B12A 3NP9A 3TBHA 1XAIA 2Y1LA 5BYAA 4OXXA 3SM3A 2DY0A 3WYGA 4JXJA 1M2OB 1ZU5A 2HGZA 2TECE 3C70A 3PQEA 4G5XA 4YDQA 1NVWQ 4PY2A 1Y1SA 2FSVA 1N6HA 2IE0A 2ZCJA 3INRA 3EDQA 2ODEA 3KJGA 1JSRA 2V6FA 1MXHA 1UZNA 3L6BA 4NIMA 2IDMA 2G9ZA 2ZUVA 5A9TA 3T1TA 2O2YA 1VJ5A 3KR1A 2B36A 2IP4A 1JSXA 2RB4A 4D57A 2JGKA 4CMGA 4YMGA 2BGLA 3RSCA 1RWKA 2D13A 1PVDA 2PX0A 4X41A 1OXMA 4TMZA 4PZ0A 1ENYA 4HT3B 5AHRA 5JQWA 1CUSA 1E9BA 1GRNA 2QE7D 4OSPA 4RF3A 3TLCA 5ESRA 5JAMA 3PUYA 2AA3A 2H7XA 1AKNA 1G2OA 2IHVA 1Q5PA 2XUJA 3KLNA 2FTKE 1UOPA 3OTWA 3D3QA 3DAGA 4Z7NB 2C92A 3B2NA 4G41A 1Z3IX 1DUVG 3RHFA 4E2FA 1L5RA 4TTRA 3DL4A 2HRCA 3N8NA 4PC2A 1HEYA 1R8XA 3DHWC 1NRWA 2O5VA 1I01A 3BXZA 4NBNA 3W5IA 1LX6A 1Y9DA 2XTZA 2NUBA 3DOUA 1PS8A 4NX2A 2CMFA 3T5MA 3AOGA 4JHLA 3QELA 2Y68A 1ZYUA 3BGVA 4Q37A 3FTEA 1M9NA 1UXHA 1Y8CA 2CXOA 3QPAA 5L3ZA 3SIPA 2UZ4A 3RADC 1X1QA 4Z49A 4H17A 2V8OA 4IGIA 2WJYA 2J46A 1T3LA 5IAJA 1C4WA 4IV5A 3LU1A 3WI7A 2ZSBA 3INGA 2XTAA 3KKLA 4DRXB 1RRPA 4XIGS 4CM5A 3TQTA 3A58B 4L9SA 3FOZA 1BN7A 4GKBA 4CL8A 3OO1A 1KMMA 4ZWNA 1BDBA 3RE1A 4U39A 3EQ6A 2R8PA 1Z6AA 4AN1A 1NJ1A 4QQFA 2CL6X 3QOFA 4OJTA 4NK4A 3HVUA 2QUIA 1SBQA 3RNOA 3LDUA 5FULA 3ECCA 1LFDB 1ZH8A 2Q49A 2Z9CA 2EDAA 4IDQA 2F17A 2ZJ0A 4V0QA 3A27A 2H57A 2PZAA 1G8MA 2NYVA 3VDNB 5DLQC 4E13A 821PA 3FLBA 4BGEA 4G9GA 4U8HA 3HR7A 1D1TA 4WGFA 6Q21A 3KQPA 3R23A 3IEMA 1F2VA 1VYVA 4BO0A 4ZDIA 4BLTA 2IOFK 3GLSA 1P7VA 3KT0A 2PXAA 1R64A 1QPBA 1M8FA 4KC0A 4RKWA 5KX5F 4GYKA 5F98A 4TWBA 2V55B 1FNBA 2GZMA 2OBBA 1TI7A 5BY2A 4JLPA 5L8VA 2H11A 3ZUGA 4K2AA 3EHDA 2YXLA 5BOVA 3QU2A 1DXYA 4R5HA 4X65B 2ZWVA 5SV2A 3S8MA 1SHJA 3EGVA 2F1KA 2W6PA 3RUEA 1P33A 1Q0LA 1JDBC 2EFGA 4P2BA 1EHCA 1N2JA 4OFXA 4DF3A 4L4SA 4ZXPA 1OILA 3V1UA 4O1MA 5BN4B 1H3NA 4CGZA 3H97A 4A8PA 1SUWA 4IIJA 5T64A 2J9ZB 1HETA 5L4LA 2FXVA 1GAEO 1I10A 4L8LA 4X44A 1QE0A 4PANA 3IO3A 3PXAA 3QPVA 1B6RA 1U80A 3C8HA 2DHDA 1B23P 2OCAA 2XOKD 3Q7SA 4MUMA 4N9QA 4N8EA 3UCEA 3ZIAA 1S96A 3ZCPA 2V98A 3JWIA 1GQQA 5DVZA 4BAUA 5F2OA 1Y8RB 2I6SA 1AKRA 3BFXA 3NH6A 4H7KA 4HLNA 5DSZA 4CIDA 3W7BA 1UEXC 3H1AA 1WTCA 3A4MA 2ECOA 2FHSA 2O20A 4JQZA 1C3OA 4TS4A 4JENA 4E7PA 4GPZA 1NRJB 3C3PA 1SUPA 2C2XA 4U02A 5FQOA 4NV0A 5JZ9A 3HKDA 2VP0A 4QBTA 1FNCA 2GZSA 4IUBS 3DF7A 3A6PC 1UBGA 1UKCA 2MYNA 2NNLD 4BWFB 2Y2VA 3HP4A 3RFUA 1A9YA 1UXIA 3JVEA 1U0LA 4MITA 3JAKB 4OK3A 2IYVA 4N49A 4C7OB 3R5XA 1JEEA 3EWIA 3BORA 2W58A 2WR8A 4RY8A 3PPWA 3ZVMA 1A98A 2VDWB 4O08A 1UOQA 4TKVB 4R1QA 1FYFA 1IRIA 4MGYR 3QFRA 4X6UA 3ONDA 1IY1A 3PQ8A 5DMHA 2F9FA 4CCAA 1PW7A 2AG1A 2H48A 2ON6A 3KKEA 3LW7A 3PYLA 5BT9A 1J2YA 1S1MA 3JD4A 4Z4QA 3RIEA 4H3SA 4RWEA 5E6RB 5NLLA 2PT6A 2OV3A 3KJNA 1GG9A 4CM3A 2UUBB 1RTKA 1T2EA 1UZLA 3O4GA 3WL5A 4OB7A 5CX1B 4UCFA 4UTVA 4ZT5A 2P4HX 4FC6A 2H85A 3CBQA 3U3XA 2E82A 2QMZA 3IT3A 4OQNA 3S8EA 1USWA 3WK9A 3RT1A 1KRHA 3M6UA 5JSHA 2ZBEA 4QA9A 1OD6A 2HFJA 3OCYA 1A71A 2X6QA 2ORIA 4NAVA 3CXRA 2YN0A 2CDAA 4QQ8A 4DCNA 2W37A 2PRIA 4PTZA 4P58A 1T26A 3K9HA 3ADKA 2CVOA 1JG1A 4P36A 1CRLA 1V47A 3LK6A 4WL0A 1C0KA 2HA3A 3PT5A 1XF1A 3Q3JB 5EUMA 3SZOA 1AQYA 5BR7A 2AIRA 4X0EA 5BURA 3DKKA 1B3RA 1ECGA 4E09A 4M87A 1UDBA 4MQEB 5CUQA 3LFHA 3GG2A 2XLBA 5FAXA 1RQ7A 3LC7O 3D5EA 4NMHA 2ANCA 5CXSA 5CCBA 5JS1A 1TIKA 4GW3A 4PGGA 1P72A 1AT1A 2GTPA 1R4ZA 2VFAA 1EA7A 1EQ2A 3D2BA 4L5JA 1Q7RA 4C4YA 1IU9A 3OEED 3VH1A 1QQAA 4HGRA 3RVNA 4CIBA 4HYTA 3MXOA 5CB0A 2YZGA 4ARIA 5M5BA 5JO9A 3ND6A 2UZ1A 3TB4A 4DL9A 4FPXA 1SBHA 1E5VA 3FZGA 1TUGA 1Z36A 4PYRA 4RX1A 4S1WA 1E5XA 2YUIA 3DE5X 1R6VA 2Z04A 3MFYA 1VCIA 2B82A 4JP2A 2H16A 3OJCA 5HUJA 2DJIA 3P5BA 4PC6A 1YMUA 2D1SA 3SHFA 3GFVA 1CS4C 2PO5A 1J99A 1UOEA 1AB5A 2ZKLA 3LOUA 4TLMB 2O4CA 3EE6A 1J33A 1DOHA 1O4VA 2JGEA 1IBKB 4RANA 4BO4A 1CRZA 3WWYA 1L4BA 2C8KA 2WSYB 5BYJA 2VXYA 3PC3A 1GSIA 3DVLA 4RQAA 2ATCA 1FFDA 3T94A 1WOYA 4J0KA 3NDBB 2G72A 1U0OC 1FTQA 1S8AA 1XU4A 1TYCA 2CC2A 2ZI7A 4BEBA 5TLSA 3DDCA 1QV7A 3K05A 1OIXA 4FNMA 3SC6A 4Q9KA 3FY4A 1ZCJA 3GRYA 3HA2A 1E7RA 1JHXA 2HWUA 4OHWA 4XKJA 2RHCA 3WJAA 4IIXA 4RO0A 2HSDA 4F0JA 2BGMA 3ELWA 4MUFA 1GXSA 1EX6A 3G8BA 3RSZA 1OBOA 1DIAA 2EWWA 5J43A 2YIDA 4HDCA 3ZTTA 4CR7A 3Q7IA 4KE7A 2IU4A 1N25A 2Q3JA 3T5DA 1U02A 4L5CA 1CDOA 1RLOA 2CVZA 2IYTA 5BUZA 4CKXA 1CUVA 2DUJA 3A7EA 3FFBA 1CZKA 2ONKA 1BC5A 2CCGA 4HTFB 3MB8A 3WRWA 1RWXA 2Q7DA 1PR3A 2W4QA 3EODA 3FBGA 5IEBA 2FR8A 5FPKA 3E7XA 2J32A 1Z5GA 4JVLA 2OORC 2V6JA 1W2GA 1WCV1 4TTVA 2XA9A 3CVWA 1XZDA 3DGEC 1HYQA 5IVHA 5DI9A 1GL3A 4KLNA 1H9BA 5FBWB 3PHJA 3K0FA 4LWQA 5COQA 4ID3A 3KVOA 3OIFA 1BHJA 1JGTA 4DYVA 4LV5B 5CP8A 2VPPA 2OM2A 3BHNA 1XZBA 4AC9A 5IWCA 1L5ZA 1MJFA 5C8ZA 3L7DA 1K0FA 3BE8A 3PUZA 3QF4B 4CKBA 4ZTBA 4WZBB 3TJRA 5LNK1 3T35A 3C98A 4X1KB 4G1MB 2TS1A 5K99A 3C6BA 1G20B 2WINI 3R41A 3OLZA 5TF4A 4OBBA 5AM2A 4RPIA 3HY6A 1PL0A 2ZI3A 4Y30A 1NHGA 4MDHA 3IOYA 4CKZA 3BFVA 4YP7A 3VMFA 3SHQA 4EMTA 4GOMD 3M6IA 4N0EA 5DI3A 3H84A 2W9XA 5FUQA 2O1SA 3ZZUA 4FS8A 2VNAA 1YJAA 4MW0A 1WHSB 5BOSB 4AY6A 3L0PA 1X0VA 1QH8B 2F43B 3H1EA 3QUSA 3JWEA 5THXA 3CV3A 3UKDA 3OBIA 4U2EA 5AKIA 5KOJA 3VZRA 2RH9B 3VR3A 5MDHA 1FP6A 2QJWA 3MT7A 1ZRMA 5EXSA 1TT5B 2POQX 3BIOA 1R0WA 5AKLA 4I6GA 2PD4A 1TM1E 2BFCA 1PJ2A 2JIOA 1SZCA 1JQ5A 3SZ3A 1KZ1A 1YVPA 5CBKA 2WJVA 5EKDA 1MDFA 1SQ5A 1O0SA 1L1FA 1EFLA 4EFLA 5KJ1A 2WSIA 5I7AA 3W3ZB 1KEEA 3SSMA 4GBED 9LDBA 1GLVA 3QENA 4PYKA 4X45A 5SYMA 5K8IA 1MB9A 2ZW9A 1VCHA 2C95A 2JASA 2X3YA 4D80A 1RBMA 2BZSA 4IGAA 3OH8A 5T4EA 5F9MA 1OX4B 3DEIA 3GGJA 3QU5A 4F1JA 2RGXA 4AT1A 3GEPA 3OQ6A 4WOCA 3QA3E 1MH1A 4H27A 1MGOA 4WGGA 4DLTA 3CX3A 1QP4A 1GPLA 1H65A 4BKPA 1E9SA 1X1AA 3ENNA 1KA9H 3BMCA 1LBEA 1T91A 3O5AA 2RH5A 3LL7A 2FNAA 1D6NA 2NO5A 4RJJA 4OUDB 5DCUA 5DHRA 1NX9A 4BCDA 2W6CX 1QS0B 1DAPA 5C32A 5JS7A 5EWMA 5KNBA 3BGOS 5K3BA 2BKAA 1XCOA 3LWBA 1PFQA 2JGDA 5KYXA 4C20A 2EIHA 3AKYA 1CR6A 4XAQA 3CF0A 4OGWA 4MNTA 4S1PA 1OLOA 2UYOA 3AXSA 4XYBA 1ECCA 4BHTA 3M9WA 3H16A 1K5PA 3ZY6A 1MIOA 3JU3A 4BGUA 3FJ1A 2MMGA 1H2RS 2OO5A 1LTKA 1QR2A 1R16A 3OJXA 3HC7A 3V46A 4Z8XA 4GVXA 2DPHA 4AMGA 5JCPA 2QI9C 2QN2A 5KVCA 1A4RA 1HNZB 2J6HA 1RM5A 3SM9A 1NTOA 4GU5A 1XPRA 2DTDA 4N5LA 3FTDA 2FSIA 3CGGA 4L07A 5EE1A 4ARVA 1YE5A 2FY8A 3WQBA 4ZFNA 4GZ6A 4UU1A 4W9NA 3DXFA 2WF9A 5CHYA 3RU9A 4B2IA 2J9RA 4EUFA 5DBOA 1P2TA 4RV9A 2JGMA 4W1QA 3KLBA 5GONA 2PSFA 1VSQA 1M2GA 3KALA 2FMFA 2OD9A 4GRIA 3DTVB 3SKYA 4KWEA 1SC1A 4RNCA 3A31A 1W5EA 2IYQA 4DMGA 4GPBA 1HR0B 3FF1A 4UHJA 3DYVA 1VJGA 1JR3A 3IAM6 4H1HA 5HIIA 2H8KA 3UJ3X 2O2XA 1RQRA 2VK2A 4EG0A 1ULUA 4IVNA 2M9MA 4I55A 3GMTA 2IYRA 3LQ1A 2WP8J 3AKEA 1I36A 1SVOA 2WA2A 2ZYGA 3CPEA 3NHRA 4XIIA 4XEUA 3TZHA 3UWDA 4EHBA 1E1DA 2O2EA 4UUPA 2CJWA 1K4KA 1L4HA 3AUJB 4L5IA 1KP3A 2R6HA 3QVGA 2F59A 4YRMA 2NV6A 2VZLA 3FHTA 4ZAZA 4ZYWA 3JZAA 4CEIB 1BXRA 2GOYA 2C2GA 2ZTVA 3R9IA 4L51A 1NT4A 2CGEA 3BERA 3N28A 3KJXA 1BHQ1 5AM3A 1C1YA 2GAOA 4B82A 5L7WA 1RADA 3C74A 2IJGX 3MCZA 3IJRA 3M7IA 3PNYA 1Q17A 1DP4A 2VEOA 4P4SB 1OTXA 3GPDG 4H08A 4ZOLA 3F3SA 1L4YA 1R4NB 1M2KA 1X7DA 3ZWWA 4F93B 5CITA 4A0RA 4NZMA 3L07A 4PQFA 3G9ZA 2H63A 4ND8A 4OFBA 4OXYA 4MIYA 2P11A 2GXQA 3MTJA 3IMFA 4OHRA 4Q18A 3ZHXA 1P77A 5HQ3B 3ORRA 2O6HA 3QOYA 1RAHA 3BXOA 1JDSA 1LLQA 1I30A 2AV6A 1GG8A 4JJAA 2OP1A 4WEOA 1BU8A 1MJGM 1U3UA 2ATEA 3M89A 3N2NA 3HNRA 2A5LA 1TUBA 3FSRA 4QU8A 3AW9A 4X6XA 3H0KA 4HJRA 1PGQA 2O0LA 1NPTO 3P0JA 1LS6A 3V8NA 2RGBA 4CU2A 3OQVA 1J8QA 5J2UB 3TQCA 4EVSA 5JU6A 3W34A 3UH0A 3GFSA 2PR7A 3LQFA 2WT4A 1ANKA 1M34E 3JTMA 3KU1A 3P96A 1OZ0A 1S8NA 1UJ4A 4UTXA 1WRBA 4P08A 1QTNA 4QPJC 3IB6A 3R3SA 4X1YA 4ZU1X 4UC0A 1F8XA 3IAM1 3MWYW 3FDIA 3PGLA 1ZI8A 3Q8KA 4KAJA 3ITDA 1C3EA 4ZEVA 3EZXA 1XEWY 2ECQA 2QLBA 3G68A 1AG9A 5HCIA 5K0SA 3RSFA 3VR4A 2HJWA 4JNCA 1EWQA 1CG6A 3WMGA 4X6LA 1ODSA 1XAHA 2PSEA 4J03A 1YR7A 2P9GA 2XCSB 4R7GA 3FNBA 4JOBA 1UC4B 3BT7A 2EF1A 4BO3A 4ASUD 1G9XA 4EUEA 4ROSA 1HBJA 3AZPA 3PVZA 1PQUA 3KKKA 3OZIA 2LCIA 4KVAA 2VJQA 2ZP1A 2EJTA 2PIDA 3CZMA 4IZOA 2VPTA 2Q6TA 4EG8A 1EGAA 2O1XA 3AGQA 3A1UA 3PGA1 3TW0A 3ZWXA 5K4GA 4MAFA 4XPZA 4NEQA 3V8BA 2ZJ5A 4YHBA 1UP7A 1Z37A 3QI7A 5FA5A 2Y0EA 3TNYA 1A4IA 4AM8A 3U19A 1KL7A 4M3NA 2JJ8A 2WJ3A 2V74B 1E6EA 4WFKA 1ZQ9A 2V96A 4TT3D 1ZA1A 5AM5A 2XUPA 4AKHA 1N5OX 2FGJA 2EFCB 2KI5A 1XPUA 3E48A 3J7AC 2JCSA 2VK1A 4RL6A 4XW2A 2NYRA 3NVMB 3U9TA 4XQ9A 1U0HC 3ZE9A 1N0VC 4ZZ3A 3AYZB 1NNEA 4G0UA 3FYHA 3R0ZA 1FMCA 2Z1NA 1HZZA 1VE6A 2VBGA 4ZV4A 2YY5A 3EFHA 1FDRA 4ZVSA 3NJ4A 3HZOA 3W3AA 5A1JA 5GIPE 3GAFA 3HRHA 2VDQB 3C3CA 1ZVJA 4FOSA 1XDBA 4PV7A 1FXUA 1VJ0A 1I7SB 1G0OA 3ZK9A 5F2NA 3EFOB 1ULTA 3T1OA 4FILA 4IZ6A 5ED0A 2H5IA 4BUJA 4IFIA 2QIPA 4BMZA 4NESA 3B5IA 1EDDA 5EXXA 1Y9EA 4I2VA 2J41A 3MIZA 2CHUA 2J0UB 3AFHA 3O9VA 4LZPA 5HR5A 3OU6A 3RYTC 1DO2A 1NASA 2VF8A 2WVGA 4RSGA 3WB9A 4RK6A 3I09A 4MZXA 1QP7A 1U3TA 2PUHA 3ZDQA 1NATA 3IBYA 5BXQC 2Y0DA 5FO0A 4DZRA 1XQ1A 2ZRGA 4ML3A 4HH3C 5LYJB 4NABA 1WD5A 5K3AA 5HP4A 5JZMA 4U3JB 2YQZA 3S28A 3PTZA 2WV9A 4B0OA 3HK2A 4ILEA 1RYBA 3G2PA 4RMGA 5FBRB 3QFSA 2FFAA 4LCBA 4F8JA 2RGUA 3LUKA 3L4BA 3LPCA 4J6EA 4LJ4A 3KOXA 1UAGA 3T5GA 3OO0A 1W36C 1MX9A 3RV4A 2JAPA 3JQBA 1D3AA 1V43A 4U0JA 1OB2A 1T3HA 2QP3A 4JC8A 2C4HA 3UMRA 1SPBS 2EKZA 2V0GA 4N65A 3SJCA 4DNXA 4E46A 3ACBA 3KG2A 4XGKA 1FSFA 3P0FA 4IIJF 4LWPA 521PA 3RJTA 4P4TA 1CEXA 4Q9AA 1V16B 5KSYA 1LBTA 4BATA 5E6UB 1MB3A 1M2OA 1QQ6A 1AGNA 3PI7A 4B6FA 2YNMA 5AD1A 1I0IA 2YMQA 3KAQA 3PC4A 2W6JA 4Y2XA 1KPIA 3ZLUA 1IQ0A 1YA4A 3KUDA 4GXTA 2AW3A 4CLOA 5JECA 5DNUA 3UJHA 5IS2A 1BROA 3DBRA 1GAQA 4OHXA 1SUEA 3WQRA 3TOZA 2P2CA 1N5LA 3AJ9A 3PIDA 4OQ4A 4CGYA 4FI3C 4D0NA 2ZXUA 3U4MA 2RK3A 2VBCA 2FN9A 1KE2A 1VSTA 3VDXA 4G5RA 4F2DA 1B93A 1CJCA 4KTVE 4FBMA 3LFUA 3AEQA 1BXKA 3EBLA 1ZC4A 4M9UA 1L4GA 1GY8A 2FH5B 4JEHA 1O8BA 1GG5A 4C04A 2HCTA 4E5SA 1TO6A 3P4XA 1M6NA 2A8YA 1Z6QA 1DVRA 3N5CA 1CFZA 2PT5A 1U5BB 3OE4A 2LCQA 5LD2B 1KYYA 3A0RB 2ACVA 2QZZA 2ISSD 3L7LA 3WMRA 1MAAA 4KHPB 3QWHA 2RGNA 2DR3A 3H9GA 1ADFA 4IRXA 5J4YA 1I2BA 1ZINA 4I9UA 2OBLA 1USGA 2CL7X 4F84A 1MVLA 5AW0A 3Q2IA 3B7GA 3QH4A 4IXWA 5DGIA 2PNFA 3R7BA 1P4AA 1LLUA 5I51A 3L8YA 4Y6OA 5I8PA 4JJEA 1G64A 2I99A 1G42A 4QLAA 2X5XA 1V6SA 3AC0A 1WXIA 4ZZ2A 4EG7A 1H94A 2AUTA 2X9VA 5AKYA 5LPNA 3ZWDA 3QEAZ 1VPTA 4QGSA 1E9FA 3E7DA 4MRSA 5JDIC 2HR1A 3VNAA 4KN9S 4MV6A 2PX5A 1T5TA 2X7HA 3DEAA 2BDUA 4P4NA 4MSUA 1NN1A 4INZA 1RWNA 4QKQA 1JAZA 1VL6A 2DRIA 4M49A 1RAGA 1XZLA 1J0DA 1QIIA 4YMIA 2JG3A 1BVRA 2D0DA 4XRGA 2ZJ6A 1YU6A 4G3XA 2VWPA 2MSKA 3ICOA 4F86A 5IXJA 1J1UA 1WBDA 1TYDE 1ZMOA 4PVCA 5DBFA 2PBLA 3J7TA 5JNVA 1W0KD 1P19A 5TS2A 3AOEC 4LV6A 1G55A 1XNHA 2QNIA 2OXEA 3JALB 1LPBB 1EQAA 3HFJA 1Z8NA 4Y6GB 3IE2A 2D5CA 4XIFA 3GP3A 4CV0A 4DXHA 3HMKA 4KXWA 3H1FA 4EB8A 4A6EA 3UC9A 1BJRE 2AL7A 4MXDA 3HRIA 2R6R1 2Q2OA 2X1VA 4PPQA 3DKIA 2XCIA 4UZFA 4BIIA 4CE6A 2Z2ZA 3K15A 1ZGHA 2B92A 3DMTC 1LX7A 1PTKA 3DPIA 2HRQA 3QKSB 5KJCA 1U3CA 5FKJA 1U63A 1E3MA 2VLIA 1MIHA 2WPDD 1YIDA 5BN4A 1DBVO 4AUEA 1UADA 3TAHA 4JLBA 1GRCA 1WA5A 5F33A 1FLAA 4II7A 3AETB 4COKA 2YR0A 3B6KA 3F3KA 4HADA 4P3KA 1JG3A 4PWYA 4XTRA 2VOEA 4DV2B 3NC1C 1A4UA 1T5LA 2I7XA 4MVJH 3SEFA 2I3GA 3KFVA 4XPIB 3V2GA 2QTHA 4PZZA 1K0UA 2JFOA 4G36A 1Y8RA 5ALQA 3N2LA 1EWYA 3PQ5A 1V41E 5JAHA 5A4MS 1AF4A 1JJIA 4NU0A 3HDVA 4LF7B 2VHJA 3QFFA 1QC5B 1TT7A 2Y0PA 1L4MA 3P0RA 4KUEA 4RFSA 1EX9A 2QY6A 4LMAA 5LQRA 3PUIA 6ADHA 1ISRA 3WB1A 4PRKA 5EJGA 4OX9B 3JQFA 3NEAA 3F9CA 1HSOA 2DWQA 1A2QA 2K7ZA 3I64A 4WV3A 3UJCA 3C3XA 2PJUA 3K5IA 1SCIA 2CFCA 2QD1A 3JAKA 3R6GA 4CTKA 1DJMA 5FNVB 2JJQA 1LDEA 3OIVA 4C7OA 1LZKA 4D0RA 3KTAB 2VDWA 4OMUA 4TKVA 5HXAA 2RKBA 4GRAA 2G4CA 1NMQA 3ZLJA 2NSYA 1KPGA 1TYBE 2HQ1A 2DKNA 3KB1A 1SD1A 4C4AA 1KNXA 3DE2X 3THXA 3TEFA 2QLNA 2VDOB 2J5RA 2EQ5A 5KVQA 1R9NA 3G6KA 4W5NA 1N75A 2XYQA 1T9GS 1JW9B 4M21A 2IZZA 2W6ZA 4MPJA 1Z5UA 2Z1DA 3NOXA 2A92A 1VB5A 3BAFA 3F4KA 3WQHA 1TKBA 5A4KA 5HDQA 3B9BA 1YS2X 1WB6A 4FOTA 1L8LA 1JHZA 5CJJA 3U6BA 3KX2A 3ANSA 4QWWA 1KTIA 4YMHA 3EW9A 4KXFB 4RVCA 3T7DA 5B6JA 1EM8B 2F2TA 2P6PA 3AJAA 3BK7A 4JSTA 4UQOA 4RULA 2V7WA 2NU8B 3OFND 3R6WA 1W4CA 2OAEA 5DLPA 4CCSA 5F3RA 2C0QA 3G2IA 5CB8A 2W8BA 1LQUA 4MQEA 4BVFA 3RSGA 4PS0A 1WW2A 4WCFC 4ZEWA 3D8RA 2NUTA 1NSTA 3FN4A 3PJDA 4DG9A 4EAQA 2D06A 1BSVA 2JBAB 1R9MA 2GFIA 3TLYA 5IUJC 3LXUX 5KU1A 3B9RA 2RB5A 3A1WA 3DE1X 1X8XA 4NJEB 4EF6A 3CNNA 1HLDA 4QDJA 3AU9A 5JJLA 3NJRA 3ORSA 1JJ7A 4DC9A 3IBTA 5JS6A 5KSWB 5GVRA 3L8EA 4C7XA 1C8VB 4AS2A 2NT4A 5DGCA 2CKDA 3LZ6A 2B5VA 1GQ2A 2AR9A 3C3MA 3C5HA 1WVIA 2V0CA 2AK3A 1WZEA 1A3CA 2WTXA 1SPXA 4UDYX 1I33A 5HK9A 3O82A 1HL3A 1F0NA 3DW1X 3G0IA 4KQXA 2P8JA 1MCZA 4Z9XA 4TYNA 1Z0ZA 4N76A 2XE4A 4JB2A 2HNAA 2ZULA 4BMNA 4QFMA 4WXEA 3ICVA 2OZPA 4KOEC 2OY0A 3WGUA 5GOZA 3KOUA 2EZUA 5JH7B 1KAEA 2KPOA 4G85A 1H66A 5A3VA 1IM5A 4MJXA 1TFUA 4RMJA 1VXRA 3EJ6A 1KJZA 3QBJA 5EWJB 1WY5A 3DMGA 4PX5A 3DC7A 1DCTA 4DAOA 4V2UA 1EG7A 1X9HA 2HHJA 2YJZA 4OLBA 3O9MA 4ODIA 3SBOA 1S89A 4ZVTA 2NU9B 1W87A 1ZJ5A 3HGTA 1O03A 4EVQA 1D4ZA 3OLYA 4KYUA 5K4HA 3BMNA 1JBKA 1RWMA 3AMVA 4DUGD 2JAOA 2RAUA 2BUCA 4EYKA 5I3CA 1QO9A 1E3DA 3MTQA 4P7FA 3KS9A 4BQNA 4ETWA 3F4BA 3LPAA 1PN3A 1XXHE 4ENPA 4ZCMA 1DWOA 2P8SA 3IQIX 4KACA 5AHXA 3HS3A 4BOYA 1G6OA 1R6TA 1UJNA 4FZVA 4DMCA 3ER8A 1XUOA 1M74A 1SK8A 2HIGA 1KYXA 3H2SA 3NGLA 3MTGA 3MTBA 2X9GA 3QITA 1Q14A 1ESZA 3ASVA 4LXHA 3HO1A 5IU6A 3GRPA 3FSGD 3MB5A 4L7VA 1TC2A 4WNAA 4ZOCA 1O3YA 1Z2PX 3CKYA 3CUEF 1MJGA 2ZWOA 2Y1GA 1W0JD 2J07A 3GH1A 3GLHB 1YFKA 4HTFA 4BKUA 4YQZA 1M5UA 5CG2A 3OX2A 3USZA 1TM5E 4ZCIA 4C0SA 3PGKA 4XGQA 3VH4A 3Q9UA 3OE7D 1G7TA 3E9MA 2WFMA 1B0ZA 3BREA 5E6SA 1B00A 1X42A 3W77A 4CUZA 3VYSB 1G8PA 1EVJA 1NNUA 5GONF 4EY7A 3T99A 3WE7A 1Z18A 3ET5A 3RWOA 2O8BA 5E8RA 2G04A 3ZHQA 3HRKA 2H3HA 4I4NA 2BGWA 3R9KA 1K8RA 2ZBQA 2G9QA 5ALVA 3MCUA 1M2HA 1NI5A 4ZODA 4TZ0A 2ZREA 4M1EA 5DK4A 3QF4A 4CHTA 4UM8B 3OIGA 5IP5A 1DBSA 2OXFA 5IANA 1UQTA 5IM5A 4I55F 4ROTA 2JLVA 4UVGA 1GPNA 2RAVA 4X1KA 3X1KA 2EEPA 1DZ3A 1O95A 4JI6B 4X85A 1G20A 1IZZA 4GPIB 5KTMA 3C3BA 3CINA 4JA2A 4MQ6A 4AWAA 5U1PA 2Y67A 3PVCA 5HTKA 3WP0A 4NYIQ 4RTPA 4BNIA 2FWBA 2C3MA 3VKWA 1EUZA 4RD3A 1YS7A 4HAZA 1U9IA 4Q93A 5ENZA 5K03A 3HI4A 1Q1AA 2VTBB 3OHSX 1R27A 9LDTA 2VP4A 4WLNA 1N6PA 1V3VA 3DE6X 4M8IA 4DLPA 3A9CA 2BZ0A 3P8ZA 3UK1A 2F43A 3FSEA 4DEYA 3KVYA 1UPXA 2QX8A 3CLUC 3I1IA 3IUBA 2FZWA 2XUFA 4JU9A 4QFBA 3ZD7A 2DQZA 4KGVA 4ZOLF 4IOMA 2NUPA 4MQLA 1X8KA 3OJFA 4HYQA 1R37A 3GUVA 1O94D 3FYUB 3GK3A 3ZV5A 5FAKA 2TYSB 3ZXIA 2XZTA 1TU0A 3HCRA 1Y1KE 4BNTA 1R4AA 1E96A 4Q4AA 2TSYB 4KREA 2ORVA 2YH2A 3GFGA 4H7FA 3IOBA 1V5IA 3CR3C 3D43A 3GJXC 1KGDA 4HYEA 2R7NA 3GRAA 1M83A 4KE8A 3T41A 1DRJA 1VJCA 3IAHA 2NNWB 4J29A 4EHDA 3PWZA 3ITNA 1IEWA 4CBVA 4BXOB 2O1EA 3G49A 3ANTA 4RF5A 3UBTA 3FDJA 1E20A 4L0DA 3L79A 4EA7A 3H65A 2CT8A 3V32A 1SQGA 4E6EA 4WN9B 5C5IA 3KTDA 4KN8A 4II2A 1N2OA 2QR3A 3UJBA 1CZHA 3WWEA 1AHPA 1XZPA 1TECE 1QIFA 3PQ6A 3SR4A 3W8DA 3BJRA 2BBWA 3KQQA 1EGMB 1LV7A 4XFKA 5TXGA 4EM6A 4FLFA 4RELA 4LMPA 3OF5A 4GMDA 4W6QA 5LQAA 1PT7A 1KJWA 5LL6P 4J7AA 3TL3A 4UHHA 2GARA 3N2ZB 2PMCA 4D3SA 3WLPA 4EZBA 3MWJA 4HWPA 1YQEA 2OENG 2ZUDA 4D8VA 1V3UA 1T3TA 1F0YA 1UBOS 2EZTA 1U8YA 2O2ZA 1GHTA 2YWCA 3NFYA 4H7EA 4KO4S 3S3TA 2QG4A 4MYRA 4PO9A 1CJTC 2GCEA 1EFRA 4PHGA 4WECA 2EGHA 4Y6RA 1ZUHA 2CB9A 2E6UX 2FSPA 2DPXA 1G38A 2NM0A 3HKCA 3QXCA 4Z1OA 2B25A 2XBUA 3DVSX 3HWWA 3U26A 5G4LA 2ZVPX 3C7KA 5B7PA 3VH2A 2FDCA 4LI3X 2GEFA 1T9BA 3DWFA 4RZQA 4P5DA 1R2QA 3FR7A 1HE5A 1MUUA 2XWBF 3SZRA 3T38A 3QBEA 1XA3A 1YR9A 4TWRA 2GR9A 3DQPA 5MN6A 1FDWA 3EISA 4JITA 5EIBC 1FJHA 1CLEA 3FGZA 4K40A 2H08A 4NCXA 4LV8B 3K5WA 5BMOA 1GQSA 3N7UA 1ZMXA 2Z3VA 4ZTUB 1C7QA 1LPNA 1NQAO 1WLSA 2QP4A 1EB8A 3NM4A 4EVIA 5E4TA 3EVCA 5JPIA 3PD1A 1NW6A 3NMUF 1IBMB 1UBNA 5ESWA 5LBUA 1FFXA 1IEVA 1P1KA 3PWSA 4QRIA 4J16C 3FJYA 4NBRA 3M9XA 1XIVA 5EZQA 2BMAA 1AKYA 4XX1A 1N5IA 3DE4X 7AT1A 3N2GB 5E4FA 4X20B 5CXUA 3AUSA 3ZLTA 2JZCA 1J7KA 4ENWA 2B4AA 3BHMA 2F9MA 1EK2A 3BIFA 4DPMA 2P6RA 2FRVA 1DC7A 3QPUA 2VUUA 1TJPB 4OQDA 3EQZA 4M0EA 4GBGA 5BVGB 1O0CA 1ZK2A 1XZGA 4HPXB 5FUXA 1K8YB 4IIBA 4Y1GA 1HI9A 1JIUA 4WUVA 4MAMA 3AR4A 4R8MA 3D02A 4EUKA 4JI0B 5TR9A 1R4NA 1T2DA 3CPJB 3L2OB 5LOVB 2R6DA 1LZLA 1Z17A 2X77A 2O0KA 1QK3A 1UFKA 4FQ7A 3IERA 4P54A 3WK6A 3L7KA 4OB6A 1RQGA 2BFNA 5EHXA 1JEAA 5HQ3A 4PAMA 5KI6A 1VCNA 2FG7C 3HU1A 3L8DA 3EA5A 4CF5A 5CA1B 1QVVA 1KQPA 1ZUD1 4DNQA 2XMRA 3VM6A 3MCAA 4HVCA 2CDBA 4MCHA 1JIKA 2IHBA 3RSLA 1JDBB 1CUXA 2FGKA 3R8FA 3HLTA 3L6CA 2NTVA 2XQFA 2ERYA 4CEJB 1IQUA 1E4VA 3BMXA 4IOLA 3VYVA 2J6BA 2O2DA 4XEHA 5KAMA 3WGQA 2OB2A 4YRAA 4ENRA 1PEDA 4AJ9A 1KZ9A 1FPQA 3W0LB 3ZY3A 1CUGA 2P5YA 3LHIA 4RSRA 4DV5B 3DCYA 3E9YA 2GAJA 1OYWA 2B4TO 3OT4A 5BNTA 4D9EA 4QARA 3GJ4A 3HKBB 2G80A 1Y5LA 5K8UA 3L46A 2O8FA 3L9WA 3CCCA 4UEWA 1W5FA 4AO6A 4CQLB 3PJGA 1ACJA 3ITKA 3I2IA 6REQB 1DKNA 2YL2A 2G5GX 4YI3A 4OBWA 3IPCA 2P27A 4D4LA 1AGRA 3HYCA 1Y6QA 3L05A 5BRNA 3PSHA 3QXSA 3ERCA 1XA0A 4EGFA 1QK5A 1PWZA 2NO6A 2OUIA 4PIVA 4QYIB 2YS6A 1QLWA 2I2BA 1T9GR 4TTTS 1J5PA 2WF5A 4W4TA 4E31A 5L3VA 5IUNC 2C7BA 1OHHA 1Q7EA 3QU4A 4KAAA 2Y99A 3H4IA 3HBAA 4NHOA 4E5KA 5HZGA 1U0RA 1OI7A 4NU6A 1YBVA 3LBYA 3T7AA 1BMFD 4P4LA 1NF8A 4NNOA 3GDFA 3GRCA 1WDTA 221PA 3MWLA 1JPNA 4YPVA 3W06A 1T9DA 1PNOA 2QN3A 2Z5FA 3CUYA 4HRYA 3DULA 5JLAA 4M0PA 5GGYA 1GTZA 2P9BA 4MARA 4K9NA 4R16A 4QOGA 1YWGO 3ZXXA 1D9ZA 1H8ED 4MR7A 4AMUA 3R3JA 1JIQA 2AI3A 1KJ8A 5IFKA 3PA6A 2HX1A 3FF4A 2XXAB 3B53X 3LT1A 4HY3A 2J09A 3I9LA 4MCIA 3W05A 3FWNA 2FCAA 4MWSA 5H68A 4ZQHA 1B6TA 4GGPA 4TXNA 1E5QA 4YWJA 5IT9A 3A0UA 3VUEA 1YR2A 2C4UA 3L7BA 1WV1A 5JRDS 2N9UA 3PV0A 5DO9A 1T9KA 2HHHB 3K6JA 4ME6A 3U4QB 1NRIA 2ZRQA 4EWLA 1NW8A 2FPOA 3QSGA 4K6HA 5IH7A 1RRGA 5CFMA 2C98A 1AUQA 3EFOA 4BLRA 1QDLB 1Q0ZA 4JMLA 2OHVA 2ZZMA 3M4NA 5BUQA 4MQUA 3HCNA 4RDXA 1QMPA 1QYWA 1RQXA 4PBSA 1JALA 1RLTA 3GT7A 2C2KA 2J0UA 1QVWA 3EK2A 4BWGA 3SDZA 2G4LA 4KJZA 2CDCA 1RTTA 3RB8A 1KJIA 2JAXA 4GS5A 1XZIA 5EHGA 4J3NA 3REFA 1W5AA 1YMQA 2CYAA 3BN3A 3DWIA 2HWWA 3MSCA 1ZM2A 2OL4A 1T2FA 4JLSA 3HHPA 3MGAA 4PE5B 3A37A 2BSXA 1IXZA 3CQ9A 3TIIA 3K4HA 4JQCA 4JSYA 4U3JA 4X95A 3A4YA 3L40A 1U0GA 3EEYA 4HYYA 2C8LA 4PG6A 5DHAA 2J87A 2BD0A 4FX5A 3I53A 3RF6A 1J5EB 1IAVA 4KPGA 3PB3A 4EECA 1W2HA 1ND6A 2CXSA 3I58A 4S3MA 3U3DA 1EVKA 4QO8A 3BAZA 1KXJA 4PQRA 1YC5A 1FJXA 3NRCA 3AWIA 2NQ2C 1B0UA 4ZT2A 2XGSA 3ZU6A 3OJOA 1CT9A 2A9JA 3DZCA 2DBYA 3AP3A 4XCVA 1H1TA 4KLCA 3TFOA 1DCMA 3PLNA 4EW3A 1FTWA 5JPDA 1DTWB 1SUFA 2X9LA 1ACLA 1T0HB 2BHRA 2EX0A 3KO8A 2GVNA 4FZ3A 4LYJA 4UCXA 3VKUA 2QSJA 1PUXA 4MLPA 5CPFA 3HB1A 1HLGA 4XM2A 4ZVQA 3HCCA 3OKPA 3P9KA 5LQMA 1FFAA 3QVLA 2VI5A 2OV6A 4AJNA 3FVQA 1DO0A 1N7HA 5JHGB 2XZLA 4MYTA 1YFJA 4O4JB 3U40A 2ZXEA 4NFHA 3ER9A 4MGEA 1TA9A 1S01A 1FSSA 5P8WA 2AW5A 2VSOA 2FJ0A 2J0EA 4FYVA 1D2HA 2D4HA 4PHCA 3P9YA 3V5NA 5DWQA 3TAXA 3WXMA 5EHNA 5DNWA 3RAJA 1G9TA 4G0MA 5FJIA 4BQQA 2BISA 4ZPJA 3UAXA 5CR9A 2IYEA 3LVFO 3O1IC 5DHSA 5IAKA 3ZZ0A 2VK8A 2HCBA 3ZHVA 1WMDA 2UDPA 2YWEA 2Y27A 1K7XB 1LPAB 1EPUA 3IUEA 1L7VC 1M1NB 1LLDA 2PV7A 3ZHRA 4H6VA 4C7VA 2GBPA 1MGPA 1ESDA 3CLTD 1XT6A 2WYIA 2IIPA 3NEPX 3QBDA 3SMQA 1F60A 4PYJA 2JLWA 3HVIA 2EZ4A 5EMNA 3FVTA 3B60A 3B1YA 1ID1A 4F1WA 1SXJD 3Q40A 4F9GA 1P8JA 3NIFB 4BB0A 1QCZA 3CPSA 3EZFA 3L84A 5ADHA 1KEWA 4REQB 1BFUA 2W2PA 2JARA 1SURA 4D8WA 3KTFA 3BF8A 5G0UA 1FEZA 2EEZA 3CNHA 4X93A 3RS5A 1P2GA 3UH1A 1FU7A 2ZJ1A 1P0FA 5FFNA 1K3UB 4PBTA 3DDZX 2EF0A 3EIEA 3V7UA 1JFVA 3PC6A 4S2UA 1PQYA 4ND1A 2CUTA 5IT5A 3ZCRA 5AWFC 2H2AA 2IV7A 4PYLA 3O4IA 4UFNA 3WKDA 1W49A 2XF2A 4J2HA 2KMLA 3WLOA 1QCCA 4RA6B 3DAFA 4NE7A 3X1ZA 1D09A 2H17A 4I4TB 1XKLA 2J3MA 2HIMA 1VL5A 4TMTA 4X7PA 1V7QA 2A0FA 2BF4A 2WD9A 3IUQA 3C1OA 3RVPA 5THKA 2WVHA 3MINA 2O3SA 1Y7HA 3IBFA 3V4SA 5LN1A 3GLIE 3NB0A 1MNAA 4DWVA 1L2TA 3O8BA 1QVAA 2OXCA 3K8YA 2RHWA 2C7GA 2G63A 3VO2A 1PQ4A 5KBYA 2GCOA 3A6FA 3JYOA 3NGXA 4KQFA 3VNBA 1EGVB 1EIWA 1QG0A 1ZUIA 2FPKA 3OM1A 2IP2A 5CCDA 1Q83A 1WABA 4QG3A 1H9AA 1QPZA 3ZD9A 2XCTB 2YCLA 2G07A 5BUCA 4PQEA 3ZWYA 1JN0A 3GHHA 4FQ8A 2O7SA 5EZSA 3D6NB 4I2NA 5H83A 1PG5A 1RDFA 3TLXA 5L6MB 5IWAB 3HCPA 3QKSA 5JI3E 5KNDH 2E5WA 2BW0A 3S5JA 3DMHA 3F5FA 2E87A 3FMPB 3PC7A 4IW3B 4DUPA 3BWVA 2GZ1A 2D3WA 2OQ2A 3EVBA 3EVNA 3GPLA 3LA8A 2NGRA 2G67A 2PKWA 1W4RA 3IO5A 2NU6B 3GY0A 3OU2A 3EUWA 4QOIA 3B78A 2OPHA 1PWXA 4R9RA 3DZHA 4FINA 4U2BA 4TYWA 1KXZA 4NFSA 5FBKA 1OW3B 3AR3A 5KTNA 4AF8A 3T7SA 4Y6LA 1BEUB 1FFBA 5KYNA 3BD7A 4MICA 4BNNA 4XPIA 3PNPA 3Q2OA 3QY0A 4WNCA 1G41A 4ENVA 1QGYA 3R0QA 1FLNA 1R0LA 4GMHA 3FCOA 1OA0A 1SXJE 3D3NA 5JVDB 4MKZA 4F46A 3DMRA 4WADA 1OWMA 4E51A 2QHXA 3W2IA 1XLVA 2YJNA 2AJTA 1OPRA 2ABWA 4HNTA 1R00A 2Z8XA 1ISPA 2ODPA 4IDPA 4KQEA 4QJIA 1Z34A 3ZU5A 2XSZD 5C53B 4RTSA 4U5XA 4BMSA 2Y4OA 3BKXA 1ZUNB 1CF2O 2EBFX 4CMEC 2HV9A 4IIYA 2BH2A 4TYPA 4EG6A 2YRWA 3T1YB 2DCMA 2JLBA 3H3XA 5MFZA 5D8DA 2DUWA 4P35A 3E2MA 4HLDA 3RRJA 5A6VA 4QXPA 2RHOA 4R8KA 4UMEA 3ZE1B 3AI2A 3LQQA 3S70A 1EK1A