1C9EA

Structure of ferrochelatase with copper(ii) n-methylmesoporphyrin complex bound at the active site
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
306
structure length
306
Chain Sequence
KMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTOHEME FERROLYASE
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 112
structure length 306
sequence length 306
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA02
4MK4A 4CCSA 3W1WA 1HRKA 1LD3A 2XWSA 1C1HA 1L8XA 1QGOA 2H1WA 2PO5A 3AQIA 2QD2A 2XWQA 2QD5A 3M4ZA 1DOZA 4KLCA 4KMMA 2QD3A 2AC2A 2HRCA 2XVZA 2AC4A 2QD4A 2XWPA 1N0IA 2JH3A 2HK6A 2C8JA 2Q2OA 2DJ5A 4KLRA 2PNJA 1AK1A 3GOQA 4F4DA 3HCPA 3HCRA 3HCNA 1C9EA 3LYHA 2XVXA 4KLAA 2Q2NA 2Q3JA 3HCOA 1TJNA 2XVYA 1LBQA 2H1VA 2QD1A 2HREA 2PO7A
chains in the Genus database with same CATH superfamily
3E3LA 1CNEA 3ZJ5A 3H9BA 3UHAA 5FOXA 1L5SA 4IJMA 5KKNB 3V7NA 4ZK6A 3WRYA 2IHZA 3DVAA 3I73A 1HYHA 3LPLA 4TTVA 1UQUA 4UJ5A 3L9WA 3Q87B 1AIPA 1ZMOA 4FGZA 3EDYA 4HEA1 1SIUA 2GZSA 4KB5A 2C07A 2OZKA 4X8MA 1FQOA 1YR6A 2GHRA 3IL2A 1QAQA 4YUAA 3GMSA 1WKVA 2GCGA 4TKMA 2B94A 2V4UA 2ZSUA 3N2IA 4UOEA 5LLDA 3IA7A 3NCHA 1EM8B 4M9UA 4C04A 2P8JA 5KYGA 1K6MA 5AKXA 4KK4A 5IF9A 1N7GA 1UKYA 1YS6A 3BWVA 1KTVA 3TZQA 5AICA 1BCSA 4I46A 3PHIA 2IS1A 4AJ9A 2ENWA 4NF2A 2YXBA 2GBPA 1AMNA 1XMOB 4MW0A 5LD2C 1YRWA 2DJIA 3A4YA 3PFKA 3V7FA 5K4AA 1E2BA 3O83A 2PZFA 3UJNA 1T9GS 1RXSA 1Y9EA 4OI1A 1E3EA 4UTRA 1K08A 1AK2A 3HCEA 2FPGB 1EIWA 2GH1A 1PFYA 1Y3CE 1YBAA 5HG0A 2ZRQA 2FX2A 3QXCA 3KUXA 1BYIA 3TH5A 5ITWA 2YHIB 1A2QA 1ZWLA 4XIIA 2LNDA 3ZWOA 4NENB 4XQGA 2Q5EA 5EI5A 1XSEA 2OQIA 2XW6A 4B0OA 5BSFA 2H9AA 3T1OA 1R0XA 1BYUA 1KEEA 3BKWA 5TPZD 1BE0A 4JEHA 2O05A 3A2NA 4TL7A 2NMVA 2HUNA 2ZJZA 1POWA 3ZHUA 2VJOA 1PD1A 2GJAA 2GOYA 3EOAI 5LWHA 3A6KA 4IOLA 1E2NA 3N59A 4UOQA 5DRTA 4FNAA 3M33A 3QVKA 3FHLA 1QH8A 3MJSA 3RT1A 1NW7A 1GQSA 2AYYA 2HHAA 2QI9F 1IZZA 1YRYE 4GVXA 4OY3A 4OP1A 2I2XB 3DMTC 5G4KB 1RAFA 2YZGA 1P4AA 3E2MA 2H2GA 4MP8A 4UQPA 3ANSA 3PQEA 2V7XA 1TGYA 5EKXA 4MVJF 3U09A 3Q8LA 4FGJA 3VZCA 1DRUA 2JHAA 4OHWA 1Q0LA 1CUDA 1X9HA 1Y9ZA 3AEUB 1YDMA 2J48A 2JGLA 3ABOB 3I58A 4ZIRB 1OLSA 3H5TA 4FYJA 3C3WA 1OXUA 5JS8A 1H2EA 1PKEA 2C2KA 1GAQA 1MQ9A 3BDAA 3WQSB 1JN0A 4GZ6A 4LBVA 1G16A 4XYLA 4YIHA 1FMJA 1S9HA 3HUEA 3BJZA 5JASA 4AM8A 3EJ6A 4DMFA 3CWQA 3TEFA 3TTWA 3V8MA 4MYRA 4OF4A 1ZSNA 1SUWA 3HCCA 1M6EX 1J8FA 3GRKA 2EKDA 2VYQA 4JL5A 2VC2B 2YMLA 1Q3KA 4GPD1 1OI2A 5EWJA 4PRYA 1SKBA 4TWBA 3ONFA 3DL4A 1IJBA 4RPGA 2FR0A 3IEIA 4ZRDA 2BY4A 5HP4A 1GGJA 3U5ZB 2DPMA 1IHPA 1H22A 2JIZD 4MS4B 4JAVC 2H1LA 3KVVA 1QLJA 2FSUA 3MRVA 4HTAA 1E59A 3F5QA 3ZLVA 1RJ9B 1SUAA 1IQRA 3DE0X 3FMOB 3K5HA 3P0RA 3UV3A 1I4TD 1HL3A 2P6RA 4Q4AB 2FSVA 2CW5A 4F3RA 3REOA 2PUWA 2C58A 2Q4TA 3V55A 4F5EA 5IJ0B 5TVGA 1I7QB 2VHXA 1G8PA 1EP2B 3LK6A 1GCOA 4X3PA 4YN3A 1VMEA 1W8IA 1EQ2A 1IN6A 2AG1A 2ZJ0A 2HMYB 3KX2A 1Z2PX 2IEGA 3AJ9A 3C6MA 4Q4HA 1BXGB 1PBTA 3CJQA 4YV2A 2GBGA 4J1SA 1FDWA 2CHEA 3MQ2A 1V43A 3AL3A 4N18A 2VUUA 4W63A 2NTJA 2IYZA 3WJAA 1N2GA 3PJDA 3ZGYA 1EFCA 2O0KA 2ZBQA 5TGZA 2L69A 1UUFA 1SXJC 5GJWC 2J6BA 1J8DA 2G83A 1LRLA 2VN8A 3LF1A 2Q3LA 4MKIA 4WOJA 2OD7A 3T4XA 4D9IA 4Q3CA 5LA6F 3O91A 4XPIA 5L6MB 3L8ZA 5CYPA 4Y1RA 5JYDA 4BNWA 4G1FA 1R4NB 1ZNYA 4KDRA 1LLDA 3SBXA 4AS3A 2I6GA 2NUPA 4LOJA 4PYJA 4CCAA 1OIVA 1Z4IA 3HRIA 3KQKA 5KTRA 2AWOA 2Q1YA 3L1JA 5B7PA 1RPJA 4K9DA 3RUPA 3PC2A 1UOEA 1KEVA 4HH0A 2IP1A 5CLQA 3DEAA 4OHYA 4KRFA 3ZE7A 2EHDA 3GD7A 1JFFA 5ABPA 4CCYA 1VIMA 1OCEA 4HGPA 2W6ZA 3OCUA 2V7TA 3P4YA 2W2MA 3FROA 5FWNA 2G70A 4X85A 3RJ5A 1NE2A 1WQ1R 3BXZA 2PE5A 4V0SA 4M8IA 3T9EA 2C0PA 4LJRA 3HN2A 2JBHA 2Y1WA 4YJ3F 1K68A 1N9GB 3OCZA 4MB6A 3FCAA 4FGKA 4LC9A 4EL5A 2EKBA 4PXYA 2YRWA 3WWDA 2I3DA 3USCS 3NDBB 2FMHA 1L4GA 2GCNA 5EUCA 4FK8A 3ECCA 4RXUA 4PR0A 2YL2A 2Q3FA 2VIIA 3KQYA 2QS9A 5CVUA 1UDRA 2F3QA 3B6MA 4DIEA 1N7HA 4F97A 2YY6A 1AV6A 1MDBA 4MUIA 3TAHA 2CE7A 2O8EA 5B4TA 3T7DA 5JVDA 1LXCA 4KUGA 4Z86A 4KUEA 2W0MA 3LBNA 1PK7A 5IDVA 1FZTA 3OEHA 4M89A 1MLDA 2O2SA 2RI1A 3OZSA 1KDVA 3Q7PA 4XQ9A 3TQRA 4F5YA 1TFUA 3RVPA 3YASA 1F2TB 4LTDA 4WOKA 5FYQA 1AJEA 1NMYA 4M7RA 4OQNA 3D4PA 3ENVA 4CUZA 4BNDA 2JEZA 1NOIA 4WESA 6REQB 3C3EA 3RT7A 4HQFA 5A0FA 3WG9A 3LY8A 4CKBB 5DCUA 1RQNA 4F21A 5B2FA 2XZLA 5JC8A 3C8HA 1MT3A 1JHRA 2J3MA 2FTKE 4TLEA 3V1MA 1IBLB 2Y77A 3AG6A 4CQMA 1VL0A 2BEWA 3HZRA 4BEBA 5K6TA 4DT1B 1S6YA 5A1TA 1C8KA 5MFZA 3AVUA 3JWPA 5DYNA 2O06A 4QODA 4CIYA 4N7MA 1JBEA 1HDZA 1KYQA 4ZO8A 5HWSA 3ITKA 2BLNA 4BN4A 1EUCB 4LW8A 2X0IA 4WFJA 2R85A 2ZYUX 3LA6A 4LQDA 5IYZF 5MHTA 3F97A 2RSLA 3O47A 1FRQA 3QU4A 3FTPA 1WZNA 5FFNA 1X74A 2OCIA 1XJ5A 3EDRA 4KVAA 1KQGA 1L5RA 2CLDX 4LG1A 4C0BA 4NZMA 4GLBA 2RGUA 5LB4A 4IVQA 2LIPA 3T3IA 1K8XB 5K6RA 3O4VA 3IR7A 1PV2A 3NC0C 4EQZA 2Q2WA 3K09C 1T29A 1YAHA 4Y30A 1XPOA 3NHRA 3MYYA 2C4NA 2Q7DA 3OE5A 5SY4A 3UPUA 1HNNA 1QF7A 2OCPA 3VPBA 2PAAA 5KHOC 3PI6A 2AZXA 1XE3A 3WR5A 3AG5A 2WYVA 3ZWDA 1UJNA 2W00A 4WTOA 2VAMA 1ZD9A 2XAUA 1RQXA 1S8NA 1P19A 2BZ0A 4C03A 2Y1DA 5B2EA 2OGTA 1D1PA 4QUJA 2ZRNA 1RRMA 3C6BA 4JQCA 4CCWA 1CYEA 2HX1A 1GPDG 3ND6A 1OXSC 2J08A 3IQGX 1GA6A 4BWFB 3BIJA 1Y1PA 2WNHA 1YQDA 4HWKA 3C3MA 4AJJA 1KZ1A 1OLOA 1UKBA 2GWRA 1PNRA 2X1LA 3AETB 3IKLA 3CMMA 4MCJA 4P86A 4YP7A 3ZWYA 5EIHA 1DCKA 2ZT8A 4R1TA 3MD0A 2WHEA 4YP6A 1I7DA 3NB0A 4RD3A 2NU8B 1MH9A 3B5JA 2PSDA 3CURA 1NVAA 1UMDB 3S7ZA 2PGJA 5A4DA 4GKBA 4UBIA 1BKYA 5NLLA 2J3EA 2WQ6A 1AGRA 2CFIA 3C1OA 1U8CB 4UCFA 2ZSBA 5FB3A 3HP7A 3W4IA 3U6BA 3HU3A 2B37A 3DF7A 2VRWA 5BYAA 1RM3A 5DV9A 3U13A 4YT4A 1BWPA 1DRJA 5EFOA 3WBBA 2MYNA 2AGVA 2J3IA 1TAQA 3TE7A 1E7YA 2P2GA 2ZUUA 3ODGA 2OGSA 2XTNA 3KWMA 3MRSA 3TLZA 2R60A 4C0AC 1NW6A 2PA3A 4HPXB 3OOJA 1OBVA 1KXJA 5T8KC 4BO3A 3OCCA 1ZUIA 2YR0A 3AM3A 3K9QO 3JPYA 3ZEIA 1IB6A 3PXBA 5AW4A 4RX1A 3HVIA 1JEYB 3L0OA 5HIMA 3GJSA 2JLYA 1MB9A 2IHJA 5EVCA 3GRRA 4BWYA 3DAOA 4P1ZA 2QLBA 1M33A 3NTQA 3IILA 3KNZA 4LX8A 5KOJA 3RHSA 1P33A 2VNKA 2ZYDA 2EEPA 5A06A 4BX0A 2UUPA 2VNIA 2ZVPX 1K7FB 4FBLA 4DR2B 3A9TA 1WW8A 1R5NA 1UMKA 1E2JA 2C31A 4PYIA 4AZVA 2IV7A 4PPQA 3QJ5A 3A4VA 2ZRFA 3O0DA 5KJFA 1RRKA 3L0DA 2IYQA 2XRYA 3PXXA 3O1IC 3OE4A 4G0QA 1DT5A 3C16C 5CU7A 1F3OA 1YI8A 2W6ID 2OYRA 5C3UA 4A9AA 5BOVA 5KNDD 2XZOA 3ZDYB 4EPYA 1S8OA 2VAXA 2IYRA 3A6GA 4FDMA 4DLXA 4DCOA 2JPDA 4O2AF 1A71A 1PJQA 3CNOA 4BO1A 4UHCA 4BC1A 2N1MA 3AUKA 2BGUA 4URZR 2JCBA 2FR8A 1CP3A 3FKSD 4PC3A 2NAFA 2HO4A 2YVQA 2BSAA 3G59A 1RCTE 4L78A 1LRKA 5KYYB 3PJEA 5AOBA 1G5IA 1BDIA 4KWCA 1Z7YA 2B6HA 4LHSA 3USES 4S0XA 1PRYA 4J29A 2OLEA 3EASA 2V4ZA 1VGVA 1ZU5A 3HWWA 3PDJA 4W6QA 5K3AA 1SY7A 3R9IA 5FTJA 3RTDA 4D9KA 1TB4A 2FW9A 2GM3A 1RYFA 3CBQA 4WLNA 1JT9A 5FL7D 3ABZA 5M2QA 2OBMA 3FDJA 3EFEA 2IXAA 3IP8A 2GUGA 3D4LA 4RDCA 4DRZA 1U63A 3OOEA 5A5FA 1WHSA 3D0OA 3GAZA 5HHTA 3G8YA 3CCFA 4TQUS 1FY2A 5JTTA 1H05A 4Y2JA 2Y0EA 1WQ3A 2BJHA 5FI3A 3NTRA 4K03A 5HTKA 2HA6A 2OO3A 1ECGA 4ZOAA 1KE1A 3UA4A 5JMTA 3PL5A 3SICE 1RC8A 2JJ2A 1II0A 1EFVA 2HK7A 2VH2A 3BK1A 2CUNA 2RKOA 2PU5A 1S2LA 1MPXA 1KA9H 2ADFA 1SHTX 2VP6A 3AUAA 4WINA 4UW9A 3U3OA 4HNUA 1Y33E 2Y2VA 2EW1A 2I2BA 2QUHA 3VR6H 3HKCB 1K6IA 2ONJA 2QGNA 2PYZA 5ANRB 2JGJA 3EEQA 3I76A 5K0JA 3NNDA 5EJEA 3UUEA 4EJ2A 5KNCD 2V7QA 3S8MA 1ZGAA 2ZWIA 3R44A 4O2BF 4ETIA 2BFEA 2SKDA 2FEWB 4EUHA 1U9JA 1E9AA 1Z4QA 3FSGD 2D2IA 4GNRA 4KW7A 1W30A 3WZ2A 2YV1A 4NBTA 3ORQA 4IHAA 2B69A 3EN0A 3T15A 5DN6D 3CVWA 2IZ1A 1B14A 2H07A 3FNFA 3NH9A 2GFQA 5HDQA 4BMZA 4B7XA 1QNFA 3TX2A 4FYIA 4XRGA 2AR0A 1A97A 3DZGA 4LDAA 4NABA 3HL4A 4Y0AA 1VE3A 2RGNC 3S2UA 3OE7A 3O4HA 2XIJA 2KI5A 3LCRA 1Y37A 2E82A 2PDAA 3OCJA 1IC6A 3WZLA 1G4UR 1I10A 4KDEA 5JXJA 1V7CA 3T38A 3L9XA 1KOJA 1RYHA 3KPJA 4O4IB 2A4KA 3A1EA 1I33A 1XEXB 3O93A 3AHFA 3AEKB 1X39A 5AUQA 4CTNA 3UH1A 3WOHA 3DV0A 1X92A 2P9QA 4P3KA 2IZ7A 1C3EA 3AK4A 5EMMA 2OECA 3IIEA 1NKSA 1V35A 2QLJA 4L2IB 3J81k 1GPH1 3UNXA 1GPKA 2ZWMA 2XV1A 2BGTA 1NNEA 2CDNA 1PNOA 4KXMA 4JY7A 4LPSA 3OQNA 4CEIB 3THRA 4RDIA 4ZDKA 3BMCA 4HVLA 5DWVA 3G02A 3OZAA 4R84A 3PXGA 3S68A 1JIUA 1QCDA 5BUZA 4Y7DA 3H2HA 2XNDD 1L5QA 1K98A 3ES9A 1BEEA 2JHPA 4RM3A 1GNPA 4ZALA 3BULA 3USZA 1IN1A 1XXHB 4L5YA 1YRLA 3F5MA 2C4UA 5G1PA 5LDHA 3CZPA 1YOVB 1KDZA 3B8HA 4RETA 4ENQA 4DR4B 1N36B 3IV6A 3WDLA 3R9XA 1P91A 1Z2DA 3U16A 1ODCA 2EGHA 2O0JA 3U3XA 4JJEA 3DOEA 3COZA 5DGIA 3SJZA 3WA7A 1B00A 3LPAA 5JFGA 2Z4SA 8LDHA 1D2EA 2WJVA 2BVNA 3EVCA 1L1QA 2WWGA 1KDTA 1IN8A 5I8WA 1VSUA 5HF9A 1HE2A 1NW4A 1P4SA 5CLJA 4MV3A 2PRYA 1YZNA 4LXHA 3O90A 1MP0A 2Q9CA 1WR8A 1P0CA 2B7CA 1GGHA 3SQXA 4CL2A 5ICCA 4A6XA 4ASUA 3H83A 1LI7A 3K8QA 1QRDA 1U7OA 1F6BA 3I45A 4I1IA 1R0LA 3Q4GA 4BWGA 3IR5A 2XYHA 5IDYA 4TYPA 4KBFA 1F2UB 2QN2A 5COQA 3KXIA 1ORIA 1A0OA 3IPCA 2NTNA 3ESRA 4DIOA 1EB8A 4JUBA 3BGDA 2C2MA 1TD9A 3CKYA 2Q5OA 3F78A 4M8KA 1BJTA 3EGXB 1DBPA 4YAFA 1EG2A 3INRA 3Q12A 4U7GA 3RYFB 4ZYLA 3IVXA 3ORRA 1Y1KE 2AOVA 4ND2A 1OTHA 4ON9A 4FQ8A 3FRJA 3ZC3A 5IZCC 3Q8XB 4UD6A 4N6GA 6AT1A 1TLFA 3K5IA 4OH1A 1FTNA 3Q3CA 3WMXA 5LJIA 1N5OX 1Z12A 4D74A 4E31A 2PT5A 3ST7A 4RTPA 1ELOA 2WPNA 5BWCA 5L4LA 3TFOA 1R15A 1YKFA 3I0ZA 3KYCB 3MWLA 3OZIA 4HX9A 2W0SA 3GOHA 4G0NA 2WJ6A 2Q8QA 3KM0A 3LKDA 4ZI7A 2FQ1A 5EJ9A 2HHHB 3EW9A 1Q1QA 1TF2A 3AP3A 2HA3A 3CM0A 4U2CA 2X1HA 5TRTA 5EP3A 2BMJA 2FQQA 4ZFNA 2OFFA 5HXAA 3LUDA 2GYUA 3IMKA 1FRZA 2EX4A 3N28A 3FLEA 1GLNA 5BN5B 4DDUA 2FUG6 1A82A 4J43A 2WWIA 4HATA 3C98A 4UDNA 2O48X 3JR3A 2OHHA 2WA1A 3PXCX 5EXPA 4GPTA 3UY4A 2YIDA 1WMFA 1VDMA 2JK0A 1NLFA 3HXMA 4KR2A 2H2FA 3FYHA 3EULA 1GZVA 1R4ZA 3F47A 4P83A 5LZ5A 4AKEA 3GFGA 4KGZA 2YWRA 4MUGA 1CJBA 2JGDA 4PPNA 4QHTA 2JJ1D 3JZAA 2OZEA 2AL7A 1LGYA 2Z3VA 4RVCA 4UVEA 3TSWA 3PT5A 1U28A 1YZHA 1BU8A 4QU9A 1ZN8A 3WIOA 4G01B 1D09A 4UNSA 5CIYA 1XYGA 4QZVA 4E2FA 1XLUA 1DJLA 4V3BA 1N2JA 2YVKA 3BFKA 3QMPA 5BQOA 4DYDA 1Q19A 2FZCA 1WUKS 2AOUA 4PHFA 5ELMA 1L4EA 1L5GB 1NXOA 3RSZA 4P4LA 3S2FA 1VGQA 4MWZA 1BFKA 4PLZA 1JXQA 2NVWA 3RJZA 2QF7A 1S8AA 3NKVA 1QRUA 2BP7A 5AK4A 2LXNA 4NK4A 5EWLA 4K0RA 2NU7B 3LF2A 3AOGA 1YE3A 4MO9A 3A28A 2YXPX 3THYA 4EZEA 5E0KB 2BFBA 2G5PA 3H3JA 5LB2A 1D0SA 3HCAA 5K51A 5CDFA 3PR3A 4FEAA 3W0LB 1UPCA 3IELA 1UBUS 4EF4A 1QQBA 4MQLA 1KBQA 3MBKA 2IODA 3MT0A 3LL7A 4Y6GB 2E2WA 1AKRA 2Q3MA 2QTCA 1J2RA 2B2XA 3KJHA 4MKXA 1YVEI 3TJRA 4NJEA 2DPHA 4YO7A 4Q3DA 1G291 3DDWA 1RPNA 4Q1DA 3HRKA 4QLBA 5ENVA 1QRSA 2QM0A 4WNAA 3NDIA 4CMIB 1O95A 3F6CA 3BHMA 3EMBA 1CUYA 1EA5A 3A11A 4MOWA 4GXRA 3LW7A 1SBHA 1OILA 1Y7HA 3DBHB 3FB4A 2XUJA 4Y9UA 3QYAA 1Q7EA 1QUEA 2CLLB 4BQQA 5B4UA 2ECFA 4KFTA 4PZAA 1QYXA 4RSRA 5L6LB 3STTA 4AS1A 1NF8A 4Q24A 2XE8A 2ZYRA 3E5NA 4ZQEA 4EYOA 4O1MA 3TW8B 1Y3HA 2PKWA 4EPXA 4HT3B 3KZCA 5HKKA 1J42A 2QI9C 3LBHA 3FOAA 4IDPA 5GADl 1FS5A 4UU7A 2JGNA 1NMSA 2WI8A 4DSNA 4H1WA 2WJWA 2NZXA 3GGOA 4D8XA 5DIZA 1EZ4A 3RFXA 1E79D 3T7IA 1LK5A 1E2FA 4ZKDA 3Q7EA 4MMYB 1UBHS 4GC9A 5CDUA 1P8AA 3CEMA 1B43A 3C3AA 3IP5A 3TEJA 4MMZB 1Z13A 2BGLA 4Q0MA 3C8ZA 5CNJA 3PE3A 1DAKA 4IUCS 4Z49A 4PG5A 1K7XB 1LBEA 2YHSA 3LAWA 4BYGA 1OX4B 2VEOA 3GL9A 3LYLA 5EUBA 3UN1A 3EWIA 5ALIA 1XXHE 4QTZA 4R2KA 2NM0A 3HO6A 1ZK1A 4FN5A 3UXMA 3OG9A 5JCXA 3C8UA 1R5OA 5JZOA 2QORA 4F4FA 1YZUA 5KKCA 4YJ2B 5F1PA 3HFSA 4IMJB 1DCFA 1K9VF 3HYLA 4U2BA 3OY7A 5ETJA 5C35A 2EVWX 4P93A 1ULHA 2N47A 3U49A 1KIAA 4ZOBA 3WL8A 5FDFA 5JMWA 2ZM5A 2ZVQX 1A5AB 4Z4HA 1WU7A 1YQQA 1OFHA 3C7DB 2QRVB 1DC5A 1NW8A 2V9CA 3A7DA 4M0CA 5SYMA 4OMUA 4F06A 2AN1A 4PXAA 5IWCA 1OXVA 1HE5A 3HV0A 5ALSA 3TRKA 3V80A 2I2FA 2RH8A 4DAOA 3I8XA 3H19A 3PXEA 3W9SA 1SRRA 2WAAA 1NJFA 4NG4A 1GSOA 1GZUA 4IIDA 1DUIA 2PJZA 2V96A 4Q4CA 1QYVA 2H1VA 2HF2A 4G3XA 2BEUA 4FDAA 4P08A 5AD1A 4J0DA 3BCUA 3W1EA 1VE5A 2CF6A 4NQZA 1Z6AA 4H59A 3F7NA 1UK7A 1US8A 4JROA 2DFDA 3OP1A 3K1YA 3VR5D 1NOKA 3E3MA 1MHTA 1LU9A 5EPUA 5KJ1A 2RBGA 3HSKA 3IEMA 2V8BA 3JVUA 5BNIA 2VDVE 4HDNA 4XQCA 2OCXA 4EKIA 5K8CA 4XUCA 1GPNA 1JXOA 1QB7A 1YFKA 4OU4A 2WSBA 1HR0B 1ECCA 2CE2X 1TVCA 1YIDA 1A5BB 2C8JA 4P4NA 4PEVA 2OZVA 5BY2A 2M98A 3DCNA 4EY6A 2BBSA 4BPRA 1MKYA 1PL6A 2PBZA 4KXXA 5E1BA 1GUAA 4I7EA 5JXIA 3TCKA 4MJ3A 1DQSA 2NT4A 4RKRA 4GI7A 1NMXA 1SURA 1CQIA 1CULC 4EPRA 1HDXA 3EXIA 3H9JA 3I61A 5LZ2A 4X1YB 1R18A 1U0LA 5LZ4A 2XB2A 1Y42X 1M54A 5AVWA 3ELDA 3NHLA 1QV7A 1W75A 2H4XA 4PONA 3TQOA 1DG3A 3BIFA 3DL0A 2PX4A 2ZSEA 4IRXA 2YYAA 5D7NA 3A0RB 3WO0A 3ZYCA 2PSFA 4Q93A 3TVDA 2Q6TA 3IXLA 4C5BA 4N8SA 3NHFA 1QAOA 2B25A 5HCNA 1T4GA 4PLVA 1F6DA 1R0SA 4B4OA 4ZYYA 1YQ9A 4YR9A 3WP0A 1T2VA 3M9XA 5K0LA 3AR7A 4JLSA 1XKXA 2PY6A 3ZBPA 2QG9A 2WSSD 2A9RA 3CC8A 4UE2A 3U7JA 4IXNA 4F84A 3EEFA 5LXTB 1NTRA 1VG8A 2C4KA 3H3FA 5K0GA 2BFDB 4BJ1A 2PZBA 1Z2AA 1DP4A 3E7DA 1B76A 1JE1A 2BF4A 1DV1A 1ORWA 1VJ1A 3BSYA 4AJOA 1B6RA 5LKRA 4NFLA 2WP0A 1KJWA 621PA 3UW3A 4JZYA 1UJ2A 4IJWA 3NAZA 1Z33A 1ABEA 3OTIA 3OTHA 4Y6LA 2UUOA 2HMUA 4JWTA 5CB4B 1HDEA 1ACJA 1VM6A 1J56A 2RJ3A 2ZUDA 3CB4A 3MT7A 3P94A 4IEFB 4F1KA 4AJHA 1GNSA 2LW7A 3EH1A 3H5AA 3DDHA 2VHTA 3TR0A 1E62A 2Z4RA 3SC2B 4KE6A 3UOWA 4JUCA 2GTPA 2C2WA 4KN8A 4QPNA 2RGRA 4C6SA 3JQAA 4NLLA 2XKAA 3PUZA 4M1ZA 3HKBA 3AZPA 3N3AC 3GDOA 4WOBA 1U2DA 5JEEA 1ESZA 5E3JA 5EHIA 2GWHA 3HFRA 2AV6A 3UKJA 4ZJYA 1XNHA 5E1MA 1RZ3A 2XKBA 2HJSA 5ERXA 2WYWA 1R64A 3H11B 4WKNA 2YASA 4LOKA 1KOFA 3FF4A 4C3ZA 4HAVA 3S44A 4YNBA 4D43A 4BKUA 2I3AA 1SVIA 4KYTA 4U63A 4JQYA 1T2UA 3H0CA 4P53A 5ALTA 2PJDA 1E5QA 1A7UA 2DMRA 1A98A 1CB7A 4QSHA 4J3NA 2ZIEA 3W1VA 3BMNA 4G41A 1JIXA 3I9OA 1Z3IX 5DW3A 1S2NA 3H04A 2X3UA 3WAGA 1RYDA 3I12A 4WXEA 1G5HA 2HSWA 4MRVA 3BRSA 3EDCA 4O63O 3KOUA 4ATNA 3ED1A 3VJKA 4BP8A 1L7QA 1AA6A 1N8SA 2PLAA 1GG9A 1WTCA 3Q88A 2IS4A 3FFBA 3F9RA 2V6FA 2HLPA 2C7OA 1GM5A 3B1JA 1JLKA 3G5TA 1JDZA 3I01M 3D3WA 2E9SA 4MYDA 5CCDA 4L07A 5LM3A 3IT3A 3KYBA 2HOQA 3R0VA 3QXGA 4CKEB 5SYNA 1XLTA 4LS3A 2YC4C 3DZJA 2IOFK 1DDIA 5K2MA 3WZMA 4W5NA 4KPGA 2G63A 3AM5A 1YZFA 4CLDA 4X1KA 1ZH8A 3BL5A 4G1BA 4V1CI 3IQDB 1N57A 2A84A 5CX1B 4PHCA 2HRDA 5EHNA 3WWEA 5HM6A 5HQ3B 3S8YA 2PD4A 4QUAA 3R1IA 5FPTA 4CMEA 5HUHA 3VSDA 2XHEA 1CNMA 3KPYA 2Z30A 3C1AA 2HBRA 3QENA 4PRZA 3CX7A 5JAHA 3TQTA 1D04A 3TR5A 3OKFA 4P2GA 5DSXA 4EFDA 3DEIA 4A1OA 5LCXA 2ZM6B 1H4QA 1WXQA 2P90A 4E5VA 1U8TA 3LFUA 4I1PA 4DM4A 4ZAGA 3SG0A 4R0MA 1Q0ZA 1N5RA 2V7GA 4A8HA 3TMKA 1BS2A 2IRWA 3PT9A 5E8JA 1N4AA 5JWRA 3W7AA 2VYVA 2VWHA 4RBNA 3H4IA 4Y6PA 1ZR4A 1VE6A 1XZBA 4JVLA 2QT9A 4XLLA 2ZIXB 4L5JA 2XQKA 2QGZA 1ZD1A 2IGTA 3A6HA 2J9FB 4ARUA 1E6WA 4TLMB 5CP8A 2BGIA 3SDSA 4PZ9A 1S5PA 4FCVA 3RIYA 3N2LA 1XQYA 1W4AA 2AZDA 1BGWA 2IW1A 2BHTA 4LV6A 4DV3B 3OEEA 3CH7A 3BIWA 1DKUA 3H5IA 4L5CA 5C9ZA 1H2XA 1ZK4A 2V6IA 3L1VA 2GDZA 1JHAA 3RDPA 1T1JA 1FX1A 2EAUA 3RW9A 4JHLA 1C80A 4XJVA 3W4KA 3AVYA 1BMFA 1F8GA 2A1IA 1OYWA 5IN4A 4RKFA 2C03A 4KVZA 4MPJA 1E7QA 1VZ2A 4DMKA 3D2BA 5LC1A 3ZYZA 4OJMX 4QICA 4FFBA 1RLOA 5HQJA 4GDMA 1RRPA 3LQRA 5H68A 1MO2A 1CVIA 2ZBDA 1H23A 3MTBA 2RGCA 3QI2A 2OMKA 5CURA 4GX5A 3M83A 4EB6B 4LE0A 2J31A 3G1WA 3FY4A 1N6LA 1C0PA 3NWPA 4DCNA 1PTJC 5JR3A 3Q9UA 4NARA 4Q7EA 5EWMA 4DB4A 1P2UA 3FCOA 1T2DA 4R2LA 1XFDA 1XZ8A 3CLSD 4C7BA 4HDRA 1O1YA 5GTDA 2DUMA 3L6EA 1O54A 4G0WA 3NDJA 3OZEA 5AM1A 4F9GA 5FTLA 1QFMA 2QTHA 5IUNC 5KVAA 5KDLA 4I9NA 3NIFB 3UT5A 3UJHA 1FQJA 5ALOA 4GR4A 2YW2A 2GA8A 1W4RA 4H60A 1RQ2A 3WC4A 2CV1A 4X45A 4BO7A 1NYQA 3ETNA 1T5DX 4D44A 4YMTA 2QLNA 4MW9A 4B4VA 1PAUA 3VPSA 2I3BA 4ROTA 1LPOA 3BFPA 3ETJA 3VDXA 2X8LA 1ZVVA 4NOJA 1EXWA 4CTMA 2X8JB 4UM8B 3RG8A 1RYNA 1E7MA 4WVFA 2WF8A 4QU5A 3IXQA 3BXXA 4B3MB 4JI3B 3DYVA 1EBBA 1V3UA 2FZ5A 3A1VA 3GBVA 1N8NA 2P9BA 4OPMA 4WHMA 2VJYA 4JP1A 1VC2A 3R7DA 3LGXA 2JZCA 1DOAA 5ITZB 3SYRA 5IMSA 4QECA 1OZAA 3L8GA 3B3JA 2ISSD 2ACKA 2WOOA 5DYYA 1DPGA 3R9WA 2FE1A 4XASA 1AHPA 3GXOA 3OT5A 1IG0A 1V9LA 4IDHA 1NQXA 1QHGA 5BR4A 4PX3A 3F6EX 2XWSA 1TA4A 2V03A 5A9TA 4DLBA 1GRCA 2BM1A 1GUDA 1G17A 2EL7A 3M49A 5F3DA 1CF9A 3F71A 4QBFA 1DFHA 2O14A 6Q21A 2VRCA 3W9YA 3TZLA 3B2QA 1AKMA 3BIXA 4UQOA 4AI6A 3HM2A 3B6KA 2BSQA 1K8QA 1TVKA 4UEOA 1GCIA 1OLUB 5CUQA 3WGHA 1H9AA 5JNSA 1CFJA 1W48A 2VJPA 3F1KA 2Q0XA 4JB3A 3KXLA 4ZJUA 1MIHA 1DWPA 4FHFA 3RS3A 4RA9A 3O1HB 3R5SA 2H4FA 4IIGA 4TMYA 4V39A 5ALDA 4C06A 2O2ZA 2WM2A 3SIWA 1LI5A 1PZFA 4M8SA 3VPXA 1JYEA 1SBZA 1TUIA 4BO8A 3QMMA 4LRTB 3X0DA 1KO1A 1SD2A 3GRYA 4I5GA 2NLOA 4UHDA 2F48A 4XYEA 6REQA 2QTAA 2V45A 2H4WA 5LP6B 4DUYB 1JHXA 1E9SA 1UBOS 2LBPA 1CR2A 2P27A 2Q7XA 4W9NC 4FGWA 4EECA 3O8CA 2ODWA 2HWYA 4MIOA 2XQFA 4ZOLB 2GJ8A 2E89A 4YBRA 3N07A 4MKZA 1T6ZA 3LUFA 3UTCA 4UNPA 1W7AA 2CFOA 5I8ZA 2DLNA 1ZBQA 1X9GA 3CLTD 4DMHA 2ZXEA 3SM3A 3UK6A 3RTAA 4X6UA 2P5TB 2HHLA 3NVAA 4R3NA 3RNOA 4C78A 2GVDC 1O87A 1ATZA 3B70A 3U7IA 3JQ7A 2P5YA 4UAVA 2WF5A 3LQ4A 1Z39A 2QXTA 1N5DA 2YOFA 5L45A 3OFJA 3UQYS 3O74A 4MKRA 1F8YA 2ZE7A 3JQEA 1CUCA 2CXOA 2PH3A 4OQMA 2WD8A 1Z22A 4E7OA 3CX8A 1JR2A 3QVWA 4U6SA 5CNIA 4HSGA 3DBIA 5KYNA 2FP3A 3HDYA 2PRKA 2X5NA 3CZ9A 3AB3A 1CJCA 4BQPA 5KCMA 2NUTB 4CKCB 2MTBA 2J6CA 1L2TA 2W8ZA 3I4CA 4ZP1A 3T9FA 1CS4C 1W5TA 2A4MA 2QQFA 1AA9A 1QR6A 1ZYUA 4UM9D 1OA0A 4DLPA 3Q7IA 4G2TA 1DO0A 4RUKA 2VR1A 5EE0A 3TBHA 5CG2A 3KQMA 2NVBA 4B6RA 1ENZA 2NU6B 1O94A 1ZVQA 3KZ1E 3L93A 1MAAA 2IIQA 4OUDA 1L5VA 1T8SA 5BT9A 1WCYA 3C5VA 1L3CA 1MEJA 1LDYA 1CDEA 1TEHA 1RQ7A 3L7MA 4JFAA 2CXXA 5EINA 4D8WA 4GXNA 1AGPA 3ZW7A 3Q8WA 4QFBA 2PRZA 3QVGB 4M87A 4NHOA 5ESWA 5F5XA 5J5AA 4BB6A 3P4XA 2BEVB 4WZ6A 4BX8A 1UDAA 3EBLA 1I5EA 3MXOA 3TLXA 4OXNA 4O4IF 2F3TA 3DR5A 1WB6A 2QRKA 5DT9A 1PZEA 1JXAA 4M22A 3JAWA 1UMBA 4PU0A 4QYIB 3OEYA 3SD7A 3M82A 9LDTA 2HCRA 1C1YA 4NWIA 2VT3A 2ZSFA 2PLRA 5AJXA 3AINA 3SNKA 5BORA 2V3CC 4DDKA 4L8GA 2HIGA 4RFSB 4PSAA 2C2OA 1J2JA 2YIVX 5BP7A 3ZU2A 2VA9A 1S3GA 1BXKA 4WQMA 2O8NA 3TX6A 2UZ1B 3PCXA 2X5KO 4EYKA 4ZHSA 5JYBA 1BDHA 3VC3A 5JBNA 6GPBA 3KT3A 4ZI5A 1K5DA 1T1EA 1TK9A 1YULA 5I4IA 1N1DA 1BS1A 1ZRSA 3HJRA 3V4RA 5K5EA 1XRJA 3WFZA 3FTFA 4EJSC 2NZWA 2OK8A 4HWRA 4QEZA 2AN9A 5TMDA 2AI2A 4OJNA 2H92A 4PZUA 1JJIA 1GUBA 1UPFA 4HGRA 1UZAA 2WFZA 1Q57A 1KERA 5FI5A 2CL5A 3RYTC 3R6DA 3GUZA 3Q11A 1Q2UA 2CMKA 1M1YE 2LKDA 4D9MA 1XZGA 2V55B 3THSA 1OXXK 3AFOA 2R5NA 4RS3A 4OHRA 3BDVA 4QATA 5I6DA 5BV7A 2BKUA 4M9CA 1TYDE 3DEFA 3T9AA 1S3SA 1XB2A 3I42A 4PFJA 1U6JA 1W47A 2WVAA 4DDMA 1A9XA 4MROA 2NNWB 2VL7A 2DB3A 5CGQB 2PX0A 4D9GA 3VKUA 5FBWB 3G0BA 1UBCA 4RELA 1PIWA 1TKRA 3QHAA 4CPDA 5FJIA 3RU7A 4AJKA 1NXWA 1ZUNB 3I6ZA 4IX1A 1UC5B 1ZDMA 3PXDA 3EVTA 3B1YA 3IKMB 4D3ZA 2QZPA 2WE7A 3PKZA 2UVPA 4RMJA 3ABSB 4N39A 3UMGA 1J8VA 3ZHZA 2IYFA 5JS7A 3BL6A 5CAEA 3HKEA 1CKEA 1EKXA 2ZWVA 2I3GA 5M29A 1P5FA 1HX7A 4KYIB 5D84A 4JJFA 3K2BA 4CEJA 3EG9B 4HB3A 1DQYA 4KCGA 1A4RA 4IDOA 1E1QD 3N2EA 4QELA 4E14A 2XXAB 1OXKB 2GM9A 3TBFA 1PW5A 3AFIA 4TTRA 4J6FA 2PNJA 4WJLA 1ZM9A 1EVLA 3I39X 1L4BA 4J07A 4CLRB 4MWGA 2FZLA 3OLQA 2C0CA 3E58A 1L5FA 2EW8A 3IAS6 5J2UA 2JH8A 1H1DA 1ZG3A 1S7CA 3EHEA 1T1IA 1Z0KA 1YCGA 3LECA 3HO8A 5AOAA 1QIKA 1PGNA 2ZKLA 2VYFA 2PV7A 5AIAA 1TLTA 5TC4A 2LCIA 3DFKA 4JKIA 3B9QA 4IWYA 4ZODA 4KKVA 2UXCB 1VYTA 3CRZA 4N5NA 3A3KA 1Z25A 1ZH0A 3AV3A 4UMFA 3UF0A 5DNVA 4DG8A 5BQ3A 1VLHA 1PZMA 1Q77A 3CW8X 2CT8A 3NI2A 1FSFA 4AS2A 5E4FA 1JQ5A 3MT8A 4M9RA 2I1VB 2L42A 5IVKA 2GBLA 2H9YA 1Y82A 1BCRA 3GRVA 2ERXA 4W5HA 1WVIA 4UUBA 4ZCLA 2C29D 1XZIA 5H9WA 2FU5C 3A58B 2KLHA 2ZIVB 5REQA 4ACBA 1KWKA 3W5SA 3ENZA 4ZT4A 2BR3A 2P6UA 5I9IA 4GUAA 2PEYA 3KD2A 4EW1A 1V5EA 1C8VB 1BEUB 3QU9A 1K3TA 2HU7A 5EMHA 1V26A 2JCVA 2O3JA 3R3UA 3KZMA 4IHJB 3CH6A 2IELA 3AI2A 5FLXA 2RHJA 4EG3A 1UBMS 2W4QA 2ZR0A 1OREA 4HNAA 5HEKA 1NBMA 4BCCA 5K8IA 1P3JA 2IH4A 3DAGA 3DWGA 5A03A 4JNKA 1VLQA 3KWJA 3RC2A 5F1YA 4M6WA 4JI6B 2XGGA 4RDHA 1Q83A 3UHFA 1WE2A 1E1QA 4LDRA 3EVGA 3GDHA 4JYZA 1VLMA 2YMMA 5TLSA 1LPPA 1XAHA 4Z4FA 4AY6A 1Z34A 1E94E 1FU4A 2HCTA 2XUKA 4ENRA 4TWZA 5IT9A 2GLUA 1JEQA 2VJMA 3C3CA 3ZCPA 4W8GA 5AK0A 4C4OA 4EAQA 2O2CA 1EMDA 1JFVA 2QGFA 2GNOA 3TUJC 3UGTA 1XQ6A 1YQGA 4KI7A 2W8BA 4HDKB 5I5EA 1Q1BA 2BM8A 2MHCA 1N6KA 3AKCA 2W6NA 2XR1A 3H42B 5EY5B 3CY6A 3RAGA 1SR8A 3FPKA 3S2ZA 3UG6A 1NJ6A 1R8YA 4EX6A 5K01A 1BXRA 1Z73A 2E5WA 4RGQA 3VHQA 4DHEA 3ECSA 4QXPA 1JYFA 2XUAA 3VR3A 4RSMA 1VBFA 4NIMA 1LWNA 2GM4A 4U2DA 4DYVA 4LKRA 2QRPA 2AKAB 4O29A 3CUTA 4AF7A 4OJTA 4ALLA 1FFEA 3D6TB 4KH1A 2C78A 4MR8A 1FFHA 2XSZA 1SBTA 3WGVA 4EB0A 3FPJA 5K4HA 4AQDA 1QZTA 2Z6QA 4ZV9A 3LV8A 5JFOA 4S05A 2J3QA 2NSYA 2IU0A 3ZJVA 3PFBA 2GLTA 1QUFA 1R27A 1W6UA 2X3YA 4KQEA 3SF0A 4HAXA 3LLUA 1RCUA 4TTTS 4AZ3B 2AJDA 2Z58A 4FQ5A 2YDXA 2JGKA 4HEJA 4BNDB 4TRJA 3WNVA 1P6XA 5HNKA 3I5AA 3MWDB 1HE4A 4MRPA 1FJGB 4N48A 5KZMB 1PJ3A 1D9XA 2VAWA 2W4MA 3LA8A 3TI7A 4ZU1X 1NMZA 3NJ4A 4HDMB 1AS0A 2AEMA 3HCPA 5AJUA 5B7GA 4F4HA 4I2NA 1E64A 1GTVA 1CY7A 2P9FA 4YT5A 1ISIA 4YJ2F 3GJXC 2FI1A 1HQKA 2IEAA 2OV4A 3RQIA 3SWWA 4C6RA 2X1VA 7REQA 2F1IA 1JKFA 3E9RA 5HR5A 1CRQA 4FWIB 1JQBA 2HD4A 3IYLW 3MAJA 4H1HA 3TF5A 1I24A 1MHPA 2FEKA 2P69A 2TMGA 4MRRA 5BQXA 4JEIA 3T9CA 3OQ6A 3WGMA 5EXXA 4NJOA 3GJTA 2H63A 3V8QA 4F9FA 1W1UA 3I1YA 1QV9A 3DP7A 4OFZA 1CJVC 1WUJS 1NULA 2A5LA 1FX0A 2ZTMA 3MERA 4PYMA 2VBCA 4OBXA 1P62B 4WV3A 3QKTA 1T0JB 2BFCB 2GMWA 4MV9A 3SIXA 1M1UA 4XIGS 1UJ5A 4IILA 2VYND 1D7AA 3MEQA 4YAKA 1ZOPA 2NV2B 2RK3A 2IVFA 4FM9A 3REQB 2J46A 2O3UA 4UDYX 1C3LA 1FFCA 3A6JA 4UTNA 1QHHB 1SKUA 5IEJA 4H4CA 4HL6A 4ZICA 5A9SA 2H0QA 1N0UA 4FE3A 2O8FA 1VCIA 3U4GA 5A2QA 5JZ9A 3A37A 4MI6A 4IF4A 5HZMA 2DTEA 1YL7A 4BJ3A 2P2LA 2OPHA 2LIVA 3KLOA 4O4LB 2G9VA 1Z0IA 3RAPR 1WCV1 4EUSA 2DPGA 1JKJA 2J3LA 2Z3ZA 5EN4A 3KR9A 1FTWA 2WTEA 4PX5A 3I3SR 2RIRA 2FSIA 4YFYA 3GEEA 5D3QA 5JG7A 4CLHA 3HEAA 3K6SA 3PGVA 1DBSA 2FWJA 3QG5A 4DABA 2H0AA 4G09A 4H4DA 3HM9A 1WOYA 1BA2A 2P2SA 3G2IA 2EERA 3STUA 4MZDA 5C3MA 1U0EA 3O2JA 4XGRA 1DTWA 4BQFA 5LU8A 1HGXA 1NPYA 2ACWA 4QREA 1D4OA 1INLA 4J0CA 4JDPA 1RWOA 3NAGA 4F4CA 4LVOA 1M1NA 2GYVA 1B42A 5TMPA 1M2JA 1DAHA 4A2WA 1KI6A 5AESA 2V7UA 2Y9PB 1F06A 3GCXA 1Z4OA 3KAQA 3ZX4A 4B3BA 3VKFA 2CV2A 1ZSVA 3K15A 4RO0A 1QIIA 1VMIA 3JV7A 2NYVA 4G86A 3D02A 3EZLA 1MA0A 3ET5A 2DH6A 1I4EB 4RA6B 1EJ6A 5ILGA 3U7RA 1HTBA 2GA9A 4A82A 4H1TA 5DHUA 3NBZC 3VZRA 3F2VA 4YCNA 1NVEA 1O8CA 3WIUA 1I1HA 1AF4A 4WUTA 2PKRA 2VLBA 3T94A 1E1RA 3EE6A 1CC1S 4F45A 2C7BA 1LRJA 3L6DA 4X41A 2WM8A 3R76A 1SJ9A 1JG2A 1MJNA 3DTVA 3OHSX 3WNDA 5LXTF 2Q4OA 4BTEA 4ZGWA 3ERCA 5JD4A 1XQ1A 3I53A 1RQLA 3QV2A 5ALXA 1TO2E 3DV2A 1BE6A 1FFDA 2NZ2A 1KSGA 4C7XA 5LNK6 3ZDAA 2OXEA 3GRAA 4R31A 2GD0A 2WT9A 2DFVA 3I52A 3WNCA 4BLWA 1O8BA 2ZJYA 2P67A 4BVJA 3TSZA 1Y48E 4HS4A 4DZTA 3MG9A 4PO8A 5JISA 3THXB 4L0DA 1ODTC 3LE8A 4WASA 2F1RA 2OFWA 1GNQA 5CB4F 4UEJA 1LS6A 2I03A 3Q6IA 3OIYA 2Y0PA 1P6QA 2D62A 3IUQA 2I9PA 4PVCA 1DX4A 1W73A 2R6AA 4RF4A 1Z63A 3TMYA 4OYRA 2E4VA 5HOQA 2ZCJA 4CVNA 2JD1A 4MW7A 3ZHQA 3IP7A 3PICA 4B6JA 3QW4B 4G97A 2AQKA 4LOHA 1MV8A 4M1WA 2GN0A 2FRXA 3BRWD 4PO3X 4RY2A 3FNRA 2C92A 3DZDA 5EP2A 3RS0A 1A5TA 1Q7RA 4C7OB 1ZM2A 2BW0A 3FZYA 1DHTA 5JNLA 1HTTA 2FEAA 4HFMA 4X1OA 1ZH4A 2I66A 1P2TA 1VHTA 3DJYA 4KO1S 3HZOA 3W8DA 4JUAA 3AJAA 4MR7A 3PCTA 4PE5B 1NVUQ 5KSZA 4IINA 1CUAA 3F5DA 3ZXIA 4RFVA 4B33A 3CNHA 1GXSB 3D6VA 1XKTA 3WB0A 1E1CA 2MINB 2Q1SA 4Q3AA 4RJJA 5EZYB 5C1PA 4EA8A 1AT1A 4WFQA 4Z0NA 2BTQB 3MTAA 3BE5A 3R3WA 4FSDA 5E9WA 3CQ9A 1SWWA 1YGYA 5G0SA 2FEPA 1Y5IA 5L3RA 2X41A 1LSJA 2FPXA 1EK1A 3T3NA 3RV4A 1JWBB 1NPTO 2I78A 2N42A 3GFSA 5EPEA 4UNNA 3ZOKA 3QKWA 2QW8A 4EEKA 1DELA 3DV9A 4A0HA 1HK7A 4A15A 4NDNE 1Y5RA 2JLVA 2XT0A 1E3LA 3DB2A 4C4TA 3GA0A 2GARA 4GLLA 4NYJQ 5L3ZA 3TLGB 4L6IA 3B36A 1GPJA 4M0LA 1PVDA 5F7OA 1K3UB 4ZHQA 4JSRA 1QPGA 1UKCA 2PMCA 1THZA 1WXGA 1AKVA 1SKYB 4E5UA 4B09A 5FLEX 5I9LA 1NHWA 3HC7A 3WL3A 3FMFA 1D8TA 2AI1A 2YYZA 1U1IA 4A3SA 2XNSA 2QP9X 1T5IA 2XTMA 3L7IA 2C8LA 2JH9A 4P81A 5ED0A 4BMDA 4BNIA 2L19A 4DARA 4E94A 1PJCA 2JAOA 3D8UA 3RC3A 1J23A 2HMWA 3OPQA 2GZ2A 1TQ4A 3MPUA 4D9BA 1VSBA 4D9CA 4EIWA 4EOGA 1CNFA 2GM5A 3OM9A 2YWHA 1NFFA 5KTMA 2AH5A 3BYZA 3DNPA 2EFEB 3GFFA 3OC0A 4IKEA 4YH1A 3UAYA 3PHHA 1SCAA 3PDIA 3U37A 1N3YA 1ZMBA 2F1KA 3DT8A 3H1EA 3QFSA 5ALYA 3VOAA 3H18A 4AROA 1VB3A 1DKLA 1ONNA 3RU2A 3NETA 2Q1TA 1KVTA 1ORTA 1Y9JA 1JILA 1CF2O 1A27A 2FZKA 2Q50A 1P73A 1ZMXA 2Z1NA 1IAQA 2C9MA 4IDNA 1U0BB 4GYWA 5IHPA 5TR9A 4B32A 2YDYA 4QU0A 3LPDA 2ZVJA 4I2VA 4YAUA 2C83A 4XSHA 2HK8A 2Z4TA 4CXMA 2XCTB 3PQ4A 3AF5A 1KDRA 3NR2A 5AKGA 1JTFA 2PIAA 3A9SA 1T0BA 4PYQA 3R7LA 1SCUB 1EGAA 2JB9A 5L9AA 5DHTA 4KJZA 2HRZA 4ONEA 3QNUA 3G7NA 4BX9A 4F9EA 1WWKA 2W83A 3LIIA 3WYAA 5LQNA 4F04A 2O9JA 1YS2X 3MQ4A 4JVMA 3QUAA 1D5CA 5KOIA 1BFDA 3PNLA 1XV5A 3D2CA 2VA8A 1VI2A 4R98A 4DWJA 3EIEA 2CY0A 3ZWPA 3OJOA 4G67A 4MHTA 5FWDA 2VNAA 3HA5A 2AZMA 3NTUA 2DT8A 4PAQA 4QPZA 4TTPA 2PX8A 2IHNA 1JDVA 1SEVA 1P81A 3H99A 2W6JA 3D2AA 1K89A 3BM5A 2AOTA 1T0PA 4R8SA 5FR1A 3JASA 3RIXA 3ADDA 2CBXA 3DC2A 3PUXA 1PJLA 3AUUA 4IDCA 4R9VA 4ZARA 5JE8A 4G1EB 1L8LA 4KNVA 1PK9A 4DIBA 2Y93A 3U3JA 3D6NB 1IPHA 2HRCA 1CETA 2PZ8A 3EFOB 1CUBA 4IOMA 5EJIA 5I4KA 4XUDA 5T7BA 3WDMA 1UXIA 2XODA 3RABA 3S70A 3VR1A 3DKPA 2CL7X 5ILQA 1ZHOA 1MU0A 2OMEA 2RFLA 3K6JA 3NHKA 2ZTLA 3C87A 1LFDB 3U4QA 4XGKA 1WMDA 4FDLA 1FNNA 3SHTA 4GX2A 2R1TA 2YNMA 4GICA 2XQGA 3Q3IA 4ZZ1A 4WOCA 5LR6A 3IBFA 4RJIA 1VJRA 2P1RA 4YRNA 3AIKA 1WDLA 2PX2A 4LMRA 4TSFA 1X77A 3MJRA 4L28A 4YJGB 5JMPA 4AXBA 5FUWA 3IT2A 3VO9A 2GRUA 4A91A 4IEEA 2HPAA 5CLGA 3RK1A 1Y9AA 2GBFA 1AH2A 2H0RA 4ABTA 3KTAB 4PC1A 1I01A 2NAPA 3T99A 3H5RA 4RV5A 3U0BA 2FFAA 4E51A 2UZIR 3HCFA 4KR0A 4PSCA 1T25A 4EO7A 1NZFA 2DHCA 2CNOA 1C7IA 3M6UA 4F3TA 3EVFA 1XEFA 2ZWAA 1JSCA 1A1SA 1XD2A 1ULSA 2IHYA 4F5WA 9LDBA 2A1TS 1GZDA 3DOUA 3S81A 4FP9A 1P9WA 4LE2A 4DR7B 2YH2A 3GGSA 4HP8A 5JPCA 1NLUA 5TB5A 1U8UA 2NYUA 4UE6A 2I65A 2LRHA 3RYCB 1G0OA 1OAOA 2ONZA 3KB1A 1N2ZA 2JLAA 4MV8A 3TDMA 2ODTX 1DCMA 2XCLA 3MOGA 1ZNQO 3NHUA 5AI0A 4AU1A 2DRIA 4AY2A 1Z7EA 3ET4A 2AK2A 2J3HA 4RHTA 4DVGA 4ZYUA 2ETXA 4CN9A 3UMSA 4HGQA 2H1IA 1R74A 4GMXA 2Q4RA 2YY5A 3CW2A 1KETA 3QUSA 1EDEA 4LOIA 4QRDA 1M2NA 1ODIA 4ACAA 3S4YA 1E2IA 2VP4A 5L95A 3LUJA 5FLYA 4B83A 1ZY2A 4CKWB 2Q46A 3TZCA 5IH7A 1ZMRA 1M9NA 1AQJA 5LP6F 2JCGA 3D7LA 3TL3A 5BPFA 1MOPA 4CUJA 2K7ZA 1O57A 4W8OA 3I62A 2A6PA 4NNOA 3U7FB 1WHTA 1FZQA 3FDIA 3K1AB 3O26A 4HNSA 3BMOB 4ZOLF 2PXCA 3VQTA 4RK1A 3TZKA 4OA8A 4BMYA 5B55A 3N7TA 1Y80A 4GRAA 4J0EA 1IDOA 4QGHA 5JLJA 5K3EA 2VP0A 2IQ5A 4LYGA 3SQMA 1QG0A 4NCJA 1RKVA 2B0JA 4FMCB 3TM4A 2KB0A 1K0UA 4O4JA 3KR1A 1VSQA 1KPHA 2A9VA 4OGWA 4QGAA 1E1MA 5FRDA 2NU9A 4ASUD 4B3HA 4EYQA 3G9UA 2CK3A 2QAGA 4DLWA 3BFXA 1QZZA 1GUFA 2BUAA 3U4CA 1L4NA 3GOQA 3O2QB 1CUSA 1SKYE 2LGJA 1SCBA 2ZI4A 3MMSA 4JR1A 3T4PA 5IUJC 3VGJA 1XYYA 2FG6C 2WAXA 3JQ6A 3OOSA 4KUHA 3TSAA 5LMUB 4AZ0B 2FVXA 3QX9A 5HJ2A 1EEHA 4UM9B 4Z8YA 3WFJA 1MV5A 1R8QA 1ICEA 4ZCQA 3U62A 1RRFA 4Q16A 4CV0A 2RJOA 1I51A 1KEPA 3VKWA 2G06A 4CIVA 3CH5A 4COKA 5CBPA 4GDFA 1NSYA 4ND1A 2RAVA 3RKUA 1KO7A 2VJKA 4DJTA 2C5BA 5AKIA 2PUHA 4RJKA 1N7JA 4IQFA 3N5CA 2VH5R 2BKAA 2Y1OA 3AY7A 3WGJA 1NAIA 3RJTA 4QHSA 1YDEA 3N8DA 5BVHA 1GPYA 1FUKA 1VJDA 2CKDA 2YZ7A 3D4OA 2XMDA 3GROA 3OZFA 1FSZA 4GT1A 4PAWA 1EH5A 1BN7A 2WABA 1R9NA 4D99A 3F96A 4KZKA 5KO2A 4CIDA 5FORA 1JR3D 4E4YA 2RHLA 4U7JA 2C4MA 1NUUA 3WSVA 3RC1A 5IU6A 3ZJUA 1ZJ5A 2I2WA 1D2RA 3DMTA 5H8WA 1FCJA 1W59A 4DF3A 2EP8A 1U3CA 2COKA 4FFNA 4GKAA 3FZEA 1JHVA 2FN4A 4RK6A 3G5UA 1V4VA 1MABB 1WABA 4FXOA 4MCHA 2JKYA 5H4HA 5AI6A 1PWYE 1ANKA 3B78A 5BYJA 2QMQA 4EFMA 2AX4A 2QE6A 2PRJA 4GUDA 1I6KA 4D0GA 1V8PA 1P39A 2PCJA 4KMMA 1FRFS 2H65A 1N8KA 5G1NA 1NFRA 4Q82A 1QU2A 3DCJA 3VAYA 2R86A 4NBWA 4BV2A 5A4IS 3IUNA 3FD8A 1NP6A 3I4LA 4HLUC 4P6VF 4EB8A 3B5IA 3P2MA 1KF0A 3AU9A 3L84A 4PTZA 2ZRCA 3U7QB 5JRZA 1H3FA 2MJLA 1V9CA 3OPYA 1Y5MA 1MUUA 1XWWA 3JY6A 3P0EA 4M7WA 1AK9A 1QIFA 1X42A 3NWJA 1E69A 3X1KA 4CMCA 3OLZA 1B23P 3HYCA 3LUCA 3NYRA 4GZMA 5EXDA 1KEZA 1WU8A 3OAAD 4INJA 1TDJA 4YMUA 1GP2A 1JEOA 2HH9A 2QD2A 5JCOC 3X1XA 2ODEA 3E0XA 2G9ZA 2KJQA 2QNBA 5AI5A 5BOSB 2CD9A 3H3XA 2ZBFA 3ESBA 3MFQA 1B3BA 2HEIA 1O96B 2I8LA 4ZTUB 3C24A 2IPOA 5FO0A 3W5AA 3NHWA 2E87A 1YR3A 5TEVA 5YASA 5CD9A 4BUJA 2W2LA 4EFNA 3FPGA 1JJAA 3B20A 2WQ7A 4PCAA 1RJDA 3BWBA 3DKVA 1IQPA 2PGIA 2IF0A 2JHCA 3MLAA 4BFVA 1VHJA 2A7QA 2J33A 3LHFA 3L4SO 1AXRA 4LJSA 4RPKA 4C4RA 2J8ZA 1MIOB 3ZVRA 2B1QA 4D5EA 1WUTA 7YASA 2F8SA 1YF3A 2X2OA 2BYTA 1M73E 3FUUA 4TTSA 5E38A 1PS8A 1OE0A 3QELA 1YHYA 1TVEA 1IH8A 2G72A 1SXJA 2PKYX 2V59A 2JBAB 2C95A 2Q4EA 3A05A 2ZJFA 4DY6A 1Y9DA 2JAWA 2IZ5A 2XHZA 1ZL2A 2QDKA 4TV9A 1P9NA 3ND8A 4DR6B 4X61A 1IY8A 1NRIA 1H4VB 4KRYA 3RT9A 3T5MA 4C4SA 5HKKD 1W0JD 3L7CA 4AVYA 1G5FA 4X62B 1T8UA 4X92A 1RAHA 1I2BA 4NCBA 1VCNA 2IEZA 3FYDA 3O9VA 4FWTA 3M6LA 5I9TA 1L8AA 4Q7KA 1JPJA 3L77A 3VPCA 2GEJA 5EE1A 4W5RA 1JDTA 3DLCA 4TZ0A 4U7TB 1IUNA 4MQFA 3QBTA 2ZDQA 4AKTA 3RS4A 2IEYA 3TE6A 3ONEA 4Z3OA 5AFSA 5CCXA 2ODBA 4Z9AA 4DC1A 3L5KA 2O2EA 2OBXA 2ZUFA 1V7ZA 4D26A 2PUTA 5SZHB 2FB9A 4DLZA 1YJCA 4LV8B 1U4NA 2WR8A 4XARA 5F35A 3UUWA 2KX7A 3I9V1 1BCSB 5T3UA 2WU4A 3FMVA 3M7IA 3ZKWA 2O6LA 1NJGA 3E9ZA 3LHSA 4I55B 4KFRA 1PCXA 1W0KA 2KYRA 4GZLA 3HMQA 5EXTA 1WX1A 4O02B 1C9JA 4XJXA 5EE9A 2ZRHA 4FJ2A 1BC5A 4W5JA 1M5UA 2YFHA 2H16A 5K0NA 1L3IA 1SD1A 4ZYTA 1YWGO 3E7FA 3QLVA 4LHZA 5KYXB 3WNZA 3X44A 2QG4A 4AUNA 1SK8A 4P5EA 1NC1A 1NZJA 4GMFA 2JIRA 1VKOA 1TC2A 1XN1A 1ZN2A 1KEEB 2MWMA 1HQDA 1ISRA 3AJ8A 3ENKA 3NTOA 4EGSA 3Q0IA 5LN1A 4L02A 1UINA 1KC1A 5HW0A 1E5VA 5C7IO 4JI8B 1FBNA 3PXUA 1I9GA 3EXEB 4JV5B 3O2SB 1A9PA 1Z6XA 2OUIA 3FTQA 5BSVA 1LJ8A 1BFUA 2VP9A 3DCYA 3R4VA 5KQMA 2VDOB 2UUCB 3IJRA 4EBFA 5AM5A 4C0LA 4IHJF 1DBQA 1Y1TA 2QOEA 1EGVB 1KMCA 3KXPA 4Z8XA 1Z5PA 2GPJA 4IZIA 1BHO1 1OGYA 4AYWA 1PDWA 4DAEA 2JFNA 3PA8A 4PZDA 5AVSA 5U1PA 1IBMB 1BKDR 2WNSA 4ZKEA 4Q47A 1BQ3A 3F8TA 1IOLA 1J0CA 3BT7A 1S4MA 1QDUA 2B4AA 2PZJA 3CZ4A 4JCOA 1Y8QA 3OOHA 4RACA 2UVDA 3RR2A 4D7AA 1IZ8A 4J7UA 4N8EA 1XZPA 4MDYA 3D9QX 5G40A 1HA3A 4G0VA 1E8DA 1H6BA 2JVIA 2R25B 2ZP1A 4H1VA 4YLGA 4BFTA 2QK4A 1Q1AA 3JQ9A 5BVGB 3RVBA 2HREA 2Z2YA 2JZNA 221PA 2FP4A 2REQB 4QSMA 5AM0A 3L4EA 4A10A 1Q12A 1MC4A 2I4RA 3OZWA 4UATA 3W6NA 3UFXA 1RBYA 3DHWC 3KOYA 3PPVA 1IBCA 2HF9A 4WBSA 3RASA 4P35A 5CXXA 3MINA 5EGSA 3SU8A 3FYTA 2OILA 3FOFC 1P0MA 4G8DA 4CQNA 1Z75A 2OHXA 3CT6A 3DEKA 3H2ZA 1GG2A 1KP3A 2X4GA 1ZLYA 3VYVA 3IHLA 3LTEA 3WBFA 4AIRA 1IY1A 2X77A 2WKQA 5ICGA 5DGHA 1YRQA 3UV7A 2BL4A 4MQUA 3W6ZA 1KBOA 1JH8A 3G2OA 1DOHA 2EJUA 3DUFA 3KXKA 1BZYA 3T1TA 1SUCA 3OTOB 4ZJPA 1YFJA 1OH6A 4OFWA 5IKXA 1KDOA 2VCHA 1STOA 1C4OA 4RYLA 3KQNA 4OATA 3G2KA 1R4MA 4H27A 3IUBA 4MDFA 3DHEA 4KSBA 2AF3C 1HV8A 3ETCA 2GO1A 3MHPA 3PGKA 4X3OA 3SX2A 1TKAA 5JECA 1TCCA 5A3JA 4J7XA 3FH0A 1Q3TA 3ZWXA 5JAPA 2IYUA 1XZKA 2IYLD 3TK1A 2I1LA 3CEHA 1E3MA 1MH1A 1FXWF 4Z99A 3OPYI 4DGSA 2AQ8A 2FF5A 1CZRA 4BVAA 4OMFG 2W7TA 2ZRLA 3JR7A 5F9HA 2CJYA 1VYVA 3ZNNA 3M1IA 3DL2A 4HLDA 2IHVA 3ZNOA 4D3YA 5IXYA 4XA8A 1ZCFA 4HXEB 3HCNA 3PJGA 4B82A 3JQAD 4YQEA 2NUPB 4FZ5A 2VPZA 3HA3A 3Q40A 3HACA 3D1LA 5GZ3A 3ZDCA 2J09A 3T0IA 3NOQA 5JFTA 3DW1X 3MJVA 1CR0A 1DZ3A 3FWHA 2ZE5A 3GT3A 3KLMX 2F62A 5C0OE 1T9GR 1KMIY 3QFHA 4JI7B 1A9SA 2C2HA 2AXNA 3PFGA 4ZV4A 2RH4A 2DFKB 2VPPA 4TUYA 1XPRA 1E6EA 1M76A 1ZJYA 1DDGA 1WOMA 2JEOA 2CC2A 2PN1A 1TEXA 3JQ8A 4WZBB 5E9QA 3RODA 1KH3A 3T5CA 1T8RA 3B52X 3OX2A 4J1TA 1P0IA 3ZXXA 1NW9B 2PTHA 5D7BA 9ATCA 3EPHA 1O6BA 4QPCA 3A3PA 2WFLA 4RPJA 8MHTA 3FVRA 4P3OA 3E7XA 3P7MA 4Y2QA 2XLCA 4MLPA 3RF6A 4CZ2A 3CO0S 4OFBA 2K7FA 1Q16A 4DJ5X 3O94A 2CLOB 5BNZA 5C81A 3GLFB 2FXIA 3E9EA 1Q17A 4P3PA 1WMSA 3FYSA 4PHTA 3WGYA 1X1TA 4O4LF 3VPAA 2VI5A 4CU2A 4QXRA 5EMKA 3G2NA 5JAIA 2CLKB 2G7MC 4U7WA 4UCXA 2O8EB 1NWHA 2CBZA 3GLGA 2YFKA 3F6SA 3HY4A 5BW4A 2CLEB 2C3OA 3AHCA 4MGEA 4FZRA 1G0NA 1F48A 3A9UA 2C9BA 4AX8A 3G0HA 1M5TA 3FLBA 3IE1A 5IT5A 3WJ7A 4JLNA 3CCCA 2O0LA 3SBEA 2Q3HA 3VBCA 3C3PA 1DJNA 1DO8A 4MGKR 1FLVA 1Q50A 2NACA 3WKEA 4QJ3A 3CX4A 2Z5FA 2CFRA 1ADJA 4G1CA 2JKZA 13PKA 2AUTA 4L8YA 1Y1RA 1L4FA 1TJYA 2NSDA 3LRTA 4LJAA 4G5YA 2NSHA 4MS1B 1C0LA 5JTUA 4XCQA 4FW8A 4JLVA 4OKNA 3E3NA 3AEYA 4E5DA 4QOGA 3L8MA 5TDHA 3AR4A 4DDTA 3AR2A 2EIXA 1T6YA 3P9PA 3ACCA 3AF0A 1V1MA 4R2WA 4KQ1A 3IQHX 1ZIOA 5JSFA 5K0FA 1Z5OA 1PHRA 2M9MA 4M53A 1BXZA 4G4GA 3KCQA 1Q74A 3S3TA 1R8JA 3WQBA 4AYTA 4LJYA 2O19A 2VWQA 2V1XA 3E22A 4TS1A 4NP6A 4RTJA 1KGSA 3PUWA 1PBNA 2BSXA 5I47A 3LD9A 2FA9A 3IIKA 1VKZA 3MMXA 1FNDA 3MSCA 3U7EB 4YRZA 3N39C 4FXPA 4P5PA 1EVZA 4PSKA 2NO6A 3GNLA 5LBIA 1T9BA 4YJHA 5A71A 2R4UA 2XD4A 1ML4A 3MTIA 5TJ9A 1ZU4A 4ZZIA 4HJRA 2G5GX 2IU4A 3P5BA 2Q5FA 2QRJA 5IJAA 1XIVA 1D9ZA 4CV2A 1E3JA 1U9IA 4MWBA 2X6TA 3NBUA 3U4DA 4OM8A 1UOOA 2CYAA 1JFRA 1RWQA 2EFGA 4YV7A 3IT0A 5JSKA 3L6BA 4EKNB 2H3HA 4GQBA 5CB8A 5H4GA 1F60A 1XWFA 1OYVA 3OURA 1GFSA 3L0SA 5TQVA 2XE6A 4HZGA 4ZZ0A 1KPGA 4A8TA 4FGSA 3V33A 4TYQA 1RTTA 3HBLA 3NYWA 4AJPA 2OQRA 1G59A 2EGUA 2HA0A 2FRDA 4GD3Q 5ALHA 3E2PA 4MINA 4RU1A 3T8YA 3CNLA 4N5HX 4LF5B 3ZXYA 3RRYA 3GBPA 4D92A 1ISPA 2CNDA 3EEIA 1QHXA 4B3CA 4L76A 1OX6A 4RVFA 2GYYA 1I5OA 3BTOA 1DINA 1W1IA 2GDJA 5JCZA 2C5FA 1JTVA 1A4XA 2MOKA 4R9SA 3UCFA 4A2PA 4K81B 3JWJA 3UHJA 1NUAA 2FW7A 3RSSA 3IOMA 1C1DB 1T1SA 2GERA 1H9BA 2X76A 2XCIA 3HXKA 4HXFB 4ZOEA 4PLCA 5EZYF 3VV3A 1SZDA 4CR6A 5TARA 3R9KA 5HPYB 1EX9A 3L1HA 4JXKA 1E7SA 1SO8A 4QYTA 2JI7A 4YRFA 3LMKA 3U5TA 2TMDA 1KY2A 1LTHR 1NBAA 1U02A 2Q2OA 4F6RB 1JNYA 5ALWA 1YR9A 4TRMA 5GINE 3K4HA 1NC3A 4RJTA 1PKXA 3GT4A 3OTQA 1CDOA 3EIUA 1ZM3A 4HRVA 1SVUA 1Z06A 2LDBA 3HCOA 4QBGB 3EAFA 4YI5A 3G2QA 4RVGA 2WM3A 3IEUA 2N1BA 5EC8A 3WMWA 1RFLA 4HG2A 1EX6A 3L7AA 4TKLA 3QKSA 4QGFA 1CS0A 4CV3A 2JIOA 1L1FA 3SS8A 3EJWA 3IBYA 4BRWA 4G5FA 3COVA 1JG6A 2O2DA 4MVJD 3REFA 1UXGA 2NG1A 2WWHA 3EISA 3UH0A 5KOJB 1XVTA 4E5KA 1QJ4A 2OYSA 1IJFA 5IABA 1H85A 1YK1A 1CIVA 2P9ZA 1IZYA 3K0HA 4GFDA 4E70A 3IDQA 2UYHA 2SCUA 4HK4A 2OO5C 3TOVA 2CXSA 3ZUPA 2OKCA 2B4QA 2W2KA 1OSNA 5AW0A 2ZZNA 1WIWA 4RFLA 4U00A 5EJ5A 3LVFO 4PFKA 3TLJA 4DNQA 2ZR7A 2W48A 1L5NA 3I64A 3GFTA 5CM2Z 2B9VA 1XMPA 4BO4A 5FXMA 1GD1O 2EARA 2ATVA 2OGWA 2PQ0A 4OJKA 3T5TA 5IZCA 3ER6A 4PRLA 3PHGA 4CIAA 4HN9A 2RBEA 2AFIB 2PT7A 3X1JA 2WTXA 3TGLA 2NPOA 1GILA 4I6JA 2E18A 5CH8A 4M3NA 1SZJG 3I05A 1JA9A 3K94A 3EODA 1O0BA 3ZZNA 1U7UA 3I09A 3U4IA 4YRTA 4GLFA 1LJUA 2L2QA 2GK6A 4NPAA 5GJBA 1JH9A 4EGFA 3V3TA 4J94A 1E2GA 1XNRB 2FLWA 2G1UA 5HMLA 4A7PA 1AG9A 3EQ7A 2K2WA 4FNMA 1PZXA 3SNHA 3VR4A 2YY7A 3QWFA 3GCZA 2ZB8A 3OJWA 4JXXA 4PGHA 4NK5A 4IIUA 3PA6A 3MWEA 3R5KA 4YRLA 4AO6A 3WL6A 3QE0A 2B82A 2B35A 4RTQA 1I8TA 1IHXA 1VFPA 4LNHA 3RHZA 3P0FA 4PLWA 1IIBA 4ZREA 1HE8B 2C0QA 2I33A 1MTOA 1BSVA 1ONPA 4J9VA 1EFVB 2IY7A 1P45A 3IQZA 3W3AA 3BCRA 1OUMA 1WCIA 2HDHA 4KWTA 1FC0A 1U2PA 4U3JA 3HB9A 2QRNA 1TYAE 5BSGA 3A1TA 5AW6A 3HA2A 3FOEC 2XMQA 1U2GC 4HF7A 1PL0A 4EDHA 3BBPA 3BE6A 2BEJA 2AEEA 4B7AA 1TTPB 1X1AA 1RYMA 2B9EA 3FF1A 5LP6C 4BZXA 4DGQA 1QHIA 2FX5A 2QJWA 1X7YA 4INPA 4ZDWA 3UXHA 1YS1X 1WP4A 4PQRA 3R5FA 3F73A 2RE8A 3OUZA 1Z5ZA 3CPHA 4LJ7A 5LQJA 1OJ7A 3WRVA 3WB9A 2OHJA 4ZMSA 1PJTA 1KAGA 4HAIA 4N3NA 5D85A 4V0QA 1EBUA 3I6QA 4EGCB 2MSEB 2BFMA 1MXHA 3QGMA 1MEEA 3SEZA 3WLHA 3H87A 3LRPA 4IJQA 4YECA 5D3MA 1U7DA 4GKVA 4RABA 1L1RA 3K0BA 5CT5A 4DLKA 1UJ6A 1CG6A 2ZCUA 1I80A 2ZPUA 4DIKA 4B47A 3M3PA 3GHHA 1L3BA 3KT6A 1KAOA 4C2TA 1IB0A 1Z0SA 1YUMA 2QVBA 4KMSA 4B34A 4DCGA 1FRVA 3G5MA 1JEDA 2YXLA 2I0FA 3W2TA 4I4LA 3Q8MA 1EBFA 1H42A 3F46A 3B1FA 3D6JA 1DAEA 1WBJB 1JKMA 3WV4A 1CJUC 2HV9A 4OV6B 3IEKA 4DQXA 4F4IA 1KP2A 4K5QA 2GK4A 4R68A 3UT0A 3G85A 1N75A 3IO5A 2BMVA 5FPPA 1U6KA 5KPDA 3K9FC 3WYNA 1LDEA 4QOIA 4ZDJA 3VGPA 2BCJQ 3ISTA 4L4UA 4N9QA 4DN6A 5HZKA 4Q34A 4U1RA 3HNRA 4B3XA 2I3ZA 4DPMA 3OO1A 1E5DA 2J30A 5AMXA 3EH2A 1K6EA 3ZTWA 4LFBB 1O58A 1E0KA 3BS4A 5A0VA 3H97A 4JLWA 3MIIA 1G5TA 2R00C 3BD8A 3FPEA 3OA2A 3TG2A 3W8RA 2P9GA 3RSHA 4Z7NB 1R5JA 5CFPA 4PG7A 4LWOA 3C5EA 5AKHA 4H35A 3PHLA 4DR3B 2VBIA 4MYHA 2Z0MA 3KBBA 3WKCA 2ES4A 4BUZA 4UEKA 3MCWA 3R9XB 2WILA 1RPAA 3VZPA 1LZLA 2FSSA 2AFHA 3UO8B 2A3NA 5FI0B 1AKEA 2HBZA 4XSVA 1ISFA 4ARIA 4PZZA 4JN6B 4QWWA 4G89A 4TMFA 2CB0A 4EPTA 1H94A 4P0TA 4WGFA 5WRFA 1UP7A 1X7ZB 4WZAA 4YQFA 1QE0A 4YB8A 5KPJA 1H5NA 1OW3B 3DO5A 3RRBA 3WIDA 4E08A 4N0PA 3AVTA 3DLAA 3VNSA 4I6EA 5J40A 5EIXA 2CJWA 4PN3A 4NYMQ 4YUZA 4WLFA 3QFCA 2FKNA 1NJ8A 2F3RA 4KQFA 4X54A 1EXVA 3CO5A 5F7XA 1SQ5A 2I8AA 1JIQA 4B48A 3A32A 1C7RA 2Z1MA 2NN3C 3NOOA 3RM3A 4FMCF 4YC7A 1MMFB 3ZK8A 3VDRA 4P0QB 5HJ5A 1DKPA 3H5NA 3DOCA 3PWKA 1DBWA 3KQTA 3NWOA 4IO1A 5A05A 4IGAA 1VIAA 3GJQA 3UXYA 5DE3A 1MO5A 3LHKA 2YN4A 3NBQA 4FFLA 2Z08A 3RAJA 4NKRA 3GEDA 4EY3A 2PGXA 3H86A 3VNAA 4J03A 1T4MA 4B6PA 3B2NA 4GP6A 4LQ4A 1O89A 1PT5A 4YA6A 1ZUHA 3JVDA 5IVHA 1T2FA 3CR7A 1BW9B 4I1SA 4IQ0A 2GKGA 2JHGA 2RBKA 3T0GA 3EC7A 3M9WA 4C5CA 1RCFA 3WTCA 5B57C 3MUNA 3GELA 5CDTA 1Y3AA 2YIJA 2C61A 4G63A 4R1OA 3LLSA 5L3VA 2NXWA 2JIQA 1TJ4A 3TRDA 4OB7A 2ZBRA 1VZ3A 2VF4X 2H00A 3DSRA 4XFJA 5KEIA 3CS3A 1KEUA 5L3SB 2IUSA 3MWJA 4EG6A 5K8TA 2OB1A 2JDIA 4IQGA 2VDNB 3KOOA 3R6WA 4ZAYA 3KYJB 3ZWWA 5CIWA 4HUTA 2E7ZA 1GCUA 1F4PA 1ZQ1A 2ON6A 3QOWA 1AOXA 1WZEA 4JP2A 4X20A 4ESVA 3IOCA 1CUUA 4YXWD 3H2YA 2JLSA 5TX7A 2B4RO 2HN9A 4AX4A 4BASA 2EGGA 1NYLA 1B3RA 1RQRA 4GAEA 1OBHA 1A96A 1XDZA 1IXKA 2YZ2A 2HADA 2Y1KA 3CIFA 3I1IA 3R0IA 4JCCA 3T7RA 1LBIA 2P3SA 4LF6B 1KI7A 1TF5A 2G77B 4F46A 3U1TA 3LS2A 2SBTA 3L1IA 5KSPA 4EG0A 1VYHA 1ICIA 2XCQA 2R6R1 2XTZA 2HQ1A 4BLOA 1B74A 1KNXA 1WV0A 2C3PA 4BJ6A 2NO9A 1E96A 3A70A 3PYMA 4E5PA 3JD0A 3LPMA 4OXYA 3KKMA 1YXMA 4FOLA 4KFSA 4Y18A 1IDN1 4HNGA 5JZVA 1NV9A 1ZHFA 2DF8A 2VWGA 4GP7A 2BISA 5DLDA 5EWLB 1GCGA 2BGWA 3ZLTA 4YJ3A 3DZ8A 2VNSA 3C6QA 4YHBA 1M10A 1TKBA 5A0TA 4PQEA 1O7JA 2YN0A 2BFBB 2G3YA 4BRZA 3D6FA 1EPUA 1XTJA 5D1HA 1GGMA 3SGLA 2COUA 2PJUA 3GMDA 2OV1A 4J8PA 1XLWA 2C98A 4F8JA 4GPBA 2HYDA 2XEXA 3GQBB 3WRWA 5B64A 1BQEA 1K6JA 2UXDB 3ZXSA 4MA5A 4DCPA 2JJYA 1J2YA 1CZUA 1GQOA 4H7KA 4HWPA 4KPUB 2IW3A 3QE3A 4NJEB 4X8HA 5EVJA 3UM9A 5K99A 3E1KA 4D46A 4HBGA 2J5KA 5SYAA 1PG5A 4G0YA 4J2TA 4UEQA 4WNAB 3TLCA 1D4AA 3K0CC 2CNNA 3H1PA 4ND4A 5H5JA 5IC6A 1UDBA 2AJBA 5DMXA 5TPWA 4AWBA 4EA6A 2Q49A 4F2PA 5EIOA 1E9EA 1IQUA 3HS3A 3RREA 3TZHA 1K7SN 4WLVA 2XLBA 2J0UA 2R6ZA 1SXIA 5C8DA 1XL1A 4R2MA 2DP4E 1HT3A 1UOPA 4DEVA 1XP8A 1QJCA 3C3DA 1ECLA 3P20A 4K3VA 2O7SA 3UGQA 3Q0TA 4CT5A 4GPIB 3NV7A 3MPOA 4LZZA 3NC1C 5D01A 1NPDA 2A92A 2QYOA 5JSZB 2ZANA 2O2YA 4K9NA 5E6UB 1Z6TA 2DQYA 2ILTA 4DCJA 5E6RA 3KIPA 2HMAA 1YA4A 1JU4A 1TQ2A 3O1LA 2C77A 3SHOA 1JE0A 4AKSA 2V65A 2Z8YM 4DQKA 4G1MB 3KOXA 2G17A 5CX4A 3R3ZA 4IS2A 2DUUA 4NEQA 3S0JA 4BWVA 1W5EA 2DQSA 3ACDA 5FP0A 5A1JA 2J6HA 4X94A 1IWOA 3SQDA 1W9HA 3R7WB 4NR0A 2NZ8A 3HNOA 3EFBA 5C8ZA 3MB5A 3K7EA 5C5IA 1L4LA 3VU8A 2P62A 3IBCA 3R5TA 5HBGA 3MZ0A 4YP5A 4EO4A 2Q5HA 4HY3A 5E4TA 3S2SA 5BRAA 5ALGA 1NR7A 3OIGA 3GB9A 4I9FA 2WK1A 3J7TA 4GYYA 1JZTA 4PGGA 4CKXA 4TLLB 1FFBA 4JMPA 1AXEA 1RLIA 2KBFA 3EOBI 4XUGB 3ELBA 3QHPA 4YMGA 4ID9A 3WWPA 2HZ7A 1R37A 4H2DA 4B71A 2EWVA 1G41A 1XHEA 3UHOA 3LOPA 4KXQA 3W34A 4OQPA 3WSTA 2QAIA 4PZ0A 4EEXA 2PZGA 3GAMA 4EEZA 4DR5B 1B1AA 2AC4A 4I55F 4MRSA 3JQBA 1WV1A 1UFQA 3EYAA 3TIVA 1JQLB 4MVJI 1Y7IA 1XHLA 2I87A 3HMKA 2D1TA 1U0SY 3I2IA 3K5PA 4RTSA 5G3YA 3BH7A 3RF7A 3K73O 1HMYA 3HDGA 2ZSKA 1J8QA 5T64A 1EHYA 1US8B 2CVOA 4KE7A 5CBKA 5SZKB 4JODA 3O8NA 4MRNA 2OAGA 4H7PA 1RVV1 5CVEA 1DI0A 4HDNB 1ZMTA 3WGUA 1KH1A 3BWXA 3LUKA 3QY9A 1Q95A 2YWEA 4C22A 2X14A 2JFUA 3BXHA 4D4IA 2ZSJA 4EI2A 4NVRA 4OX9B 1AZSC 1U0FA 2V58A 2ZWPA 3MCAA 1V16A 3G9QA 4KO8A 5GJVC 2RAFA 3WK6A 3DMHA 4BZQA 3A4LA 1YR8A 3IMFA 3WYEA 4BYMA 2WIKA 3QU7A 3RTEA 2IQIA 1ZOSA 2WIJA 2VF2A 2ZWOA 3A9WA 4YPOA 1L4KA 2R47A 5AXBA 1MJHA 2Y92A 2DR2A 2ZIAA 1MB4A 4OXXA 3VR2D 5JQWA 2WIGA 4G0UA 3EXIB 4EFLA 2KHZA 1ZISA 4FYWA 2X3FA 4HWSA 3WISA 2HJRA 1VIYA 4LA4A 2ZJ8A 5I01A 1YVUA 2D5AA 2QRUA 4HWGA 4IOJA 4BLPA 1HDCA 1ZN7A 2XYPA 4XDHA 2WV7A 5F77A 1XRNA 3CKKA 1XG5A 2JFQA 2WSLA 4OXKA 4BE4A 1ML3A 1BMTA 3FHCB 4NBRA 4KR6A 1MT0A 2ZEJA 4X84A 3PR1A 5CXUA 2V5UA 4KVFA 4LHYA 2PKQO 2GAAA 3HGQA 4F60A 4DDWA 4QHYA 2VHJA 3EDOA 4B4KA 3I2YX 4LY3A 1UZUA 4GKKB 3GGPA 5CMLA 2ISCA 3H1FA 2VK2A 1LNZA 4OQFA 5EFZA 3CSSA 1UEXC 1U3GA 3KJNA 5FNZA 3CUUA 4KLRA 2C7QA 2TMYA 1G2PA 1VFNA 1XTZA 3Q85A 4DMMA 3AR5A 3REGA 4DLNA 1CERA 4M21A 1DWQA 4HRXA 4JU9A 3QITA 2QSYA 3W5VA 4TQ9A 4KX3A 2JI9A 1W52X 1G60A 4MA0A 3K9LA 4O2AA 1RQGA 3PDHA 5DEOA 1JDBB 4F6LA 1Q1NA 1MJGM 1UJBA 1PR9A 4PTYA 4YCAA 1X80A 1E1RD 5DASA 1U7TA 1G3UA 1IQ0A 2E4XA 1EFHA 1ZIXA 2EX0A 4NOMA 1JKXA 4X93A 5CK5A 1VL6A 4L22A 4DRXB 1ZI6A 4FX5A 3UMMA 1YASA 2Y4OA 4W9MC 3V1YA 3IP6A 4GP9A 5GOZA 4C14A 3M1LA 4MPDA 5F7JA 1NLMA 1CE8B 1OYOA 3NT4A 4QUHA 3W8NA 3KKZA 4AP9A 1D0IA 1G1MA 4UTOA 3FCEA 5CDFE 5KMGB 2F64A 5F73A 1XZJA 3RVNA 2G5TA 5KWEA 2VDLB 3TSOA 5IH3A 3ANMA 3DT9A 5ER9A 2GPTA 3JQAB 1KI8A 3MNFA 1YQEA 4R51A 1E6UA 4JS0A 4ZC8A 2C9YA 3NDRA 3HYNA 4S2EA 1VA4A 3GVHA 2O50A 4QG7A 4TKUA 1D1QA 1UXKA 2FPWA 3F3KA 3K4PA 4RCYA 5I7EA 3DE7X 3NJRA 2QXYA 2R7AA 3U4AA 4RM2A 3EZNA 3QBEA 3VFDA 3ETHA 2FWNA 4WY8A 5EYPA 2FJPA 1JRLA 5I7OA 3K0SA 1NQAO 4EDFA 1WSDA 4X00A 3GVXA 1AD2A 3DMNA 3H6HA 1M83A 3PYXA 2FE4A 3HN6A 3QFFA