1C9EA

Structure of ferrochelatase with copper(ii) n-methylmesoporphyrin complex bound at the active site
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
306
structure length
306
Chain Sequence
b'KMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTOHEME FERROLYASE
publication title Structural and mechanistic basis of porphyrin metallation by ferrochelatase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 112
structure length 306
sequence length 306
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c9eA02
4CCSA 2QD1A 2QD3A 4F4DA 1LD3A 1LBQA 2XVXA 2H1WA 2QD2A 2Q2NA 2XVYA 2PO7A 2XWQA 4KLRA 4KMMA 4KLCA 2H1VA 2C8JA 2XWSA 3W1WA 1DOZA 1TJNA 1C1HA 2AC2A 4KLAA 1N0IA 2XWPA 3HCPA 3AQIA 2JH3A 2QD5A 3HCNA 1QGOA 2DJ5A 2Q3JA 3M4ZA 3HCRA 3HCOA 2PNJA 1C9EA 2HK6A 2HRCA 1AK1A 2QD4A 2XVZA 2HREA 1L8XA 3LYHA 2AC4A 3GOQA 2PO5A 2Q2OA 1HRKA 4MK4A
chains in the Genus database with same CATH superfamily
3BHNA 1B8UA 4LXXA 4PC2A 1MDFA 3R5FA 3AO0B 2OHHA 4BNUA 3THXB 4XTCS 4RQUA 4YREA 4DB2A 1R0LA 3TJRA 4RCYA 3LECA 3B7WA 4F5ZA 1UK8A 1PEAA 1T9KA 1NYTA 2UZIR 4JI4B 2AKYA 3PHCA 3SQDA 1C8BA 2XIJA 2FPLA 2WKPA 3LPAA 4QYIA 4X1KB 4F6CA 1N0WA 1NLFA 3PNMA 2P9YA 3R6LA 3AKCA 1WDMA 5M29A 1ODTC 5A9TA 3WV5A 2B6NA 1GZ4A 2EARA 3GAZA 6NULA 3C14C 3AFGA 1XCGB 3OLXA 4AAYA 2BSXA 3RJMA 3DTTA 1BX3A 1LSJA 4FXOA 4MV4A 3MOGA 3G85A 3CNNA 2G0TA 4R01A 4UNPA 5KTYA 2CL0X 2QRPA 4KN6A 4OXIA 2Z4SA 3NTRA 4RL4A 1FCJA 1FX0A 7YASA 2XZPA 2QRZA 4B09A 3NHZA 5FA8A 3E7FA 1UJMA 4HJXA 4LG1A 4PU0A 4KXWA 3UFXB 3REFA 4CR8A 5EIXA 3J81k 2O8EA 1WM1A 3OF5A 4JQOA 5K09A 2GXQA 1EKXA 1IZ9A 5TRTA 4NZYA 4HH0A 3LU1A 1YIOA 2FUG1 3FBTA 3AR5A 4P31A 3OEHD 3VDQA 1B0ZA 1DV2A 1XK7A 4W8OA 4F2WA 1KH1A 4QPNA 4C5AA 4YCNA 3NZEA 4I2VA 1HLDA 1EXVA 1CY4A 5IVPA 1AQJA 1NOJA 3N2IA 1R0KA 3AVTA 5A2QA 3BSSA 2JGEA 2XXAB 2O19A 1OYWA 1MG0A 5JNLA 3QRWA 4TXHA 5DYTA 1W6UA 2FK8A 3HBMA 1JR4A 5L7WA 3H83A 3KOZA 3VZDA 4EG7A 5KYXB 3FCXA 3TEMA 4C4XA 3HVJA 4Z9FA 3ZHTA 1V1JA 5FNZA 2R00A 3MAJA 4C0AC 3DE3X 3RTCA 4BMDA 3R5JA 1H5QA 2EQAA 3DDSA 3L1HA 5LC1A 3RKUA 3CRMA 2BOVA 3PC7A 5ALZA 2FLWA 5KUTA 4QWWA 5ALRA 5JO0A 3CA8A 2HMWA 4G4SO 2VDWB 4CI9A 1EP1B 4HFMA 1JB1A 3RPEA 2E6KA 4KXFB 2OC9A 3CT4A 5PGMA 3AOGA 4BVAA 2BI7A 1VHDA 3LZDA 2NADA 3OEYA 1OCEA 2OBNA 1ADCA 1MQAA 1N2HA 4PX2A 2XRZA 4F3KA 3NNSA 2VDQB 4CR7A 3F6RA 3OIVA 1Z37A 5E6SA 3PNOA 4U7HA 4OB8A 2EL7A 4ZV7A 4ARZA 5B55A 5BVGB 1OH6A 3HYCA 3O90A 3UMRA 2FA9A 3RYIB 1IBMB 1QAOA 5BUZA 3ZGYA 1II9A 1FBNA 3ZV7A 5IAGA 2IOFK 1HNNA 3KKOA 4KUHA 3BE8A 1NUSA 2HK7A 4YS6A 5DBOA 1IBLB 3QQ5A 4FI3F 4M38A 3LP6A 1XQXA 3ZXUB 2OP0A 3ZGZA 4ZKEA 5HPYB 3VAZA 1SM4A 3KP1A 4EF5A 2AI2A 3EH2A 5ERXA 3MJVA 2O20A 5FPPA 1JEOA 3T5TA 1N8NA 4IIJF 3V34A 4G8DA 3WXBA 1JG4A 2QZZA 3P71T 2NZJA 4DIOA 3PA8A 1O9BA 1N8KA 4BX2A 1G8AA 3KPYA 3GOQA 3WIVA 1P39A 3DTVB 1ZMOA 4OTZA 1MOQA 1BFKA 3W4IA 1Z74A 3PDJA 4EA7A 1Z47A 5DBFA 4PNHA 1JIIA 1I6LA 4YAUA 1TYZA 2V5VA 3UIEA 4EX6A 5E7QA 2Z5VA 2Q1WA 1H93A 4UMFA 3QJGA 5IK2A 3R9XB 4CQMB 1E9VA 1VIAA 2G9ZA 5LP6F 4Z0TA 1MO2A 4BWVA 2K87A 4X90A 2VKQA 4PPGA 3EA5A 1UDRA 5FJIA 1I3KA 1N3YA 3SM3A 1CJTC 3AJEA 3P1JA 4XGKA 2MINB 4PQGA 3RG2A 5J4HA 1M8GA 2Q3FA 1F0KA 3DAYA 4N8EA 4YCAA 4DLSA 2AEEA 2QPLA 4LJ5A 3RSLA 1ZBDA 3ANNA 3MQ2A 5AXBA 2Q5QA 1N2SA 1NULA 4KQWA 4MI6A 3SFZA 4D8YA 1NX6A 1HG1A 1SD1A 1S8OA 1XR3A 1L7BA 3T6KA 2QN9A 2BTOA 2Y0PA 4HWTA 3DL0A 1K27A 4ZQIA 2IWRA 2XRMA 2YYSA 3G1WA 5BR7A 3TB6A 4NDNE 3B2NA 3IA2A 5F9FA 3ZV6A 3JZDA 2A1TS 1ZW1A 2OQIA 2ZSDA 1VE5A 1E4VA 1SXIA 2AI1A 3A9TA 5EP4A 5D3MA 5AXAA 3JQ6A 3QGMA 5ADWA 5JBNA 3ANMA 3DW3X 4G0NA 4JIGA 4MITA 2ZRJA 1CD5A 1DKRA 1MHTA 5G1NA 1UXIA 1F9AA 5BYBA 2OV3A 1M2FA 3QE9Y 4HH4A 3DPIA 1PZHA 4JA0A 1XF1A 3N2KA 1XZFA 4LECA 1IWOA 2YOGA 5H1YA 5JDCA 4E5MA 3E3LA 3CWZA 2Z2XA 2A5GA 1UPAA 2OCIA 2UUAB 1EUYA 1KA9H 2Q62A 2A0WA 3U3MA 1YZHA 2V1UA 4U3JA 5IK2D 1Q20A 1CC1S 3EG9B 2HQBA 1UDAA 2H06A 2PYDA 2PPVA 3K1AA 3LPMA 1V16B 4UBOA 2P6NA 3M5PA 2NU8A 4CCWA 1GTG1 2VQDA 3LZ6A 5A06A 1EE1A 1JPNA 2HUPA 4XR4A 4AY6A 1GZ3A 1XXHA 3F8WA 1E8DA 2WFAA 3NDRA 5AW3A 5IF3A 4OMUA 4OU5A 3UWPA 4WFKA 2IODA 2XB9A 2IX9A 1G41A 4Q24A 3WHIA 3BTUA 3QVUA 5FA6A 3PFFA 4OHYA 2Y71A 1WMFA 1ADJA 3BJMA 2N75A 3L8YA 1M1XB 1X7WA 4QT0A 3EOBI 1EINA 3CUTA 2C78A 1ISGA 1JVBA 1ZIDA 4HAWA 5CCDA 3D3QA 3INRA 3RS4A 4HKTA 1VMAA 2YJ5A 2QZ9A 1RBYA 1UDWA 3EVAA 3H4IA 3TFQA 2V7EA 3GLHE 4E46A 3GLRA 4Q37A 2C1EA 4WK4B 3ISVA 1IZZA 1XA4A 3LLMA 2C2KA 1XTVA 1Z0SA 4PG5A 1G9TA 2N47A 2GNOA 2PV7A 4RPIA 2PMDA 4K9SA 2M32A 4IV0A 2BT4A 1GOTA 3I1YA 3PVCA 2Q0SA 3TLYA 3EXHB 4HJRA 1WP9A 3UUEA 1CVIA 3WBJA 4YPOA 1IVSA 1Z88A 1KEZA 2I2FA 3EBPA 5K0ZA 1R6DA 1MAAA 3SKXA 1YR7A 1IN7A 2ARKA 3GT7A 5JQGB 4YAKA 3CVUA 2WTEA 3EIXA 3JQ8B 3ZYZA 4A6PA 4RTSA 1RZRA 1T13A 1Z7YA 1KRXA 3PE4A 1MB9A 1GYRA 1Z4IA 1G1MA 3C6BA 2HQ1A 1XKTA 2B1IA 2OO5A 3EBOA 3CX7A 3UICA 5J23A 1KORA 2D8AA 3FYDA 4ZGWA 4YCMA 3OTIA 3Q7SA 4TUYB 4OQEA 3V1TC 5L3QA 3FPBA 3I53A 1YJ5A 4MTLA 3WICA 3H3XA 3QNWA 2FP3A 2PUJA 4E2YA 3QVMA 4M0MA 1EVIA 1RKUA 3QPWA 4NESA 5EWMB 3ZHVA 4AFNA 2J3EA 5C7OO 4W1PA 1RFLA 3VX4A 4EVIA 3ZDCA 1IBSA 3T3GA 3EWIA 5B37A 2DLDA 3NWPA 1APBA 4K2HA 4L4SA 4WVLA 3FNRA 4DLTA 6ABPA 1H2EA 3K1TA 4IFBA 4CYMA 5E95A 4F06A 1YQXA 2VZ9A 4JBLA 1GRRA 2VP2A 4R6XA 5FBVB 4QOIA 4RNCA 3RV4A 1S2IA 3NX4A 2CFTA 4C1NA 2ZT5A 4WXEA 1Z16A 1Y5LA 4K2AA 2PE5A 1U0OC 4V0KA 1Z8FA 4NOJA 5ER6A 3UPTA 1AKYA 4LYGA 1XROA 2PSSA 1JIQA 3B8EA 5EE0A 1JTEA 1NMXA 3QFSA 1SCNE 4X7PA 4X61A 3EIQA 4F3TA 2N0SA 2VPYA 2ZOSA 3AQ4A 3DKVA 4LJ9A 1E6CA 2FDCA 4MKFA 2AOUA 2BFMA 2WSYB 1FSZA 1ZGCA 3JQRA 3WSWA 1CDDA 5AW0A 1OH8A 4IDCA 1RZRD 3ZW9A 3DPUA 3FFAA 3EF0A 3G82C 4TROA 5EZQA 2YVUA 1Y98A 2PT9A 1TEHA 3GFSA 4H7HA 1PG2A 3EWAA 4M0EA 1ODJA 3VKUA 4NCIA 1SVNA 4B2YA 1XDWA 2HW8A 4L27A 5IVKA 3L5OA 1Z62A 3C43A 2GKOA 3ZLUA 4XE5A 5JSKA 5CEJA 4KXVA 2IE8A 4N6NA 2FZ4A 3TN7A 4CLEA 1P31A 1W88A 4JL5A 2YWXA 4U6QA 5AI9A 3ZE1B 5EIHA 1R6UA 3FCSB 3KZMA 4MQBA 4PFSA 3WNQA 3KQHA 4CIYA 3VZCA 3MHPA 2RAUA 1PEYA 1NKSA 1JSXA 1P80A 4Q4HB 3RRNA 2C7VA 4C3VA 1J23A 2NQ8A 3SBXA 4RHCA 1PNTA 3GCWA 4L3WA 1J4AA 1V9SA 1ZUNA 3L18A 1JW9B 1PJZA 2QN8A 1IK4A 4JB0A 4J43A 2O23A 1G4UR 1SURA 1PFQA 3UB4A 1OFHA 3L0SA 3QMVA 4PS1A 4RD2A 4LHZA 5HJ2A 2D59A 2NXCA 1X1RA 3O95A 1TZ2A 5TF4A 2ICAA 3OPMA 3UV7A 2UDPA 3ZQ4A 3I9FA 1WV1A 2ID4A 2R1UA 2YQ4A 3G6KA 4ZN6A 5EJ9A 4MGZR 4OLBA 2J9GA 3F9IA 3WQRA 2PUDA 3WGIA 3KELA 3E9NA 3DBLA 4Q9DA 4F3YA 3IUSA 1MIOA 2H4XA 1NM5A 3A9CA 3IILA 3QP9A 2P4HX 2IXEA 2VRBA 5AKJA 1YCHA 4KXYA 3C85A 1GL9B 4MQEB 1UKCA 3WYNA 1SB8A 1PI3A 3N05A 3WIUA 2BSQA 4OHBA 1H0KA 4H7IA 4RKRA 5BMVA 3I2IA 5DLPA 3FB1A 1KTIA 5KVQA 1NBWB 4ASUD 3BF8A 4ENRA 1SJ9A 5FR2A 1GDTA 4WLNA 1EBFA 4KIGA 4BXOA 1Q1NA 1UIRA 1QFJA 3K5IA 4LZPA 2PZAA 4X92A 4AJ9A 1EE2A 1G3QA 4ENTA 1IJEA 1D9ZA 2H31A 4ES6A 1R5NA 4BO9A 4UPVA 1OOEA 1CQZA 2ZE7A 3RVSA 1N2OA 3A2MA 3ESQA 4MRVA 1RP1A 4ZQHA 4J91A 2ZJ7A 3RTDA 1KEEB 1PQ4A 3EPLA 3ZQUA 2HJHA 2EFJA 4FMCB 4WKGA 1XDGA 2VQ6A 3WL7A 1P2VA 2G0NA 1ZSYA 1IONA 4CV0A 4QZVA 2IUSA 1BYUA 1U1FA 4P80A 3W77A 2DSNA 5EHZA 4FGKA 3D31A 5TT1A 1C9NA 1O03A 4MIYA 3BFPA 4QDUA 1YVPA 2BGUA 4H7JA 4URVR 2GD2A 3ND8A 2P79A 2WJPA 4MGKR 4J75A 1M34B 4JT9A 2YW9A 3IBYA 3U1VA 3TSWA 4AVYA 4B6SA 1VJ1A 1L7AA 3AUAA 3NT4A 1XJQA 2LCFA 3ETEA 3UMMA 2HK9A 2BCJQ 4L5YA 2I34A 1DI0A 4LMAA 3G8BA 3T3DA 3WQSB 3OAAA 3JY6A 4LJ7A 1FDOA 3PRYA 4BV9A 2JD1A 3D5TA 5A9RA 4W1RA 3COZA 2DJIA 2DY0A 2QLFA 4DV5B 3DLHA 4ZDJA 1UPCA 4D9NA 3BWEA 3GLFB 1E9DA 3D4IA 1U7DA 4Q1AA 4MAFA 1SPXA 4JU9A 4RMNA 4UULA 4ZD6A 3MTJA 3GCXA 4HMPA 2RDMA 2P2YA 2MYTA 1OLXB 1YIDA 2HNAA 3CJQA 3VPFA 2A5FA 1TM1E 4I9HA 4UU7A 4C7XA 3DBRB 2QRJA 2QTWB 1PFUA 2VJBA 1H5NA 2JH9A 5LM3A 2FUEA 4NYIR 4O5AA 2WF5A 4BBZA 4AMUA 1PD0A 2HWXA 3ZXXA 2HJRA 2I2WA 1T1JA 2YQ5A 3WGZA 3PRJA 2D5IA 4OMDA 2GX6A 4NU6A 1JEQA 3ASZA 3QKSB 2B8TA 1YI8A 2W2KB 1XMQB 3Q3CA 2YMPA 4ALLA 1I5EA 3DLCA 3LE8A 2AYYA 2CLKB 1EBBA 1I1NA 4BEVA 4BFWA 3EGXA 4OQ4A 4D9BA 3UOGA 2FXIA 4TPKA 3NYIA 2GKGA 1XZBA 2VPXA 4MVJP 3RS2A 2Z2IA 2HU5A 1R4NB 1Y82A 5JZVA 1YHZA 4GMFA 1OYOA 2IUTA 5BQOA 5CA1A 1DFGA 2WNIA 5LDGA 1GARA 1V7QA 4RJJA 1G5RA 2FSUA 1RVV1 3RJTA 4CE6A 2JLRA 5IBCA 5JV5A 1ZPDA 3A4MA 4LHEA 4PHCA 4D42A 1QC5B 3ZU6A 5I7HA 4NFHA 3AW8A 4XCXA 4ZZ1A 3PFBA 4A27A 3W1VA 4K40A 4RM2A 1Y9JA 1SKYB 1RQPA 3FTDA 2GAOA 3DZKA 4BWFB 2FN3A 4MQ4A 4MWSA 3ES9A 3K73O 4MB6A 1IHUA 3JALB 2VYNA 3ELDA 4HZGA 4OP3A 3DMNA 5E2AA 2I4IA 1S89A 2RH4A 2J9XB 4JHLA 2YHIB 2WIFA 4R31A 4XCVA 1E1NA 5TB5A 3EH1A 2FMIA 4X1YB 5BV8A 1KRWA 2VAVA 3AIMA 1II8A 4DR3B 3L8ZA 4ARUA 2DFLA 4X7RA 1T25A 2J31A 2BM9A 3ZHZA 4RANA 3KYDA 3ZCQA 4FGZA 1U6JA 5GIPE 3GEBA 5H81A 2AMJA 2FN4A 2JFGA 2XUJA 3N2EA 4D4GA 4BGIA 1I2ZA 1GU1A 3PRKE 4DQKA 5KCZA 2Q5EA 1HDGO 4ZMRA 2NQ2C 1FLAA 1XGKA 3HDGA 4UHBA 3PQ4A 1R9MA 3I45A 2Q4RA 4LSZA 1QR2A 4JSYA 1FW8A 1T2EA 2IYEA 4KR6A 4M1MA 4FN5A 1C5KA 2XMPA 3AVPA 2V8BA 2WZQA 4O4HF 4QOEA 4WLEA 1BA3A 1ODSA 1DIGA 4GPIB 1IZ0A 2JRLA 2C2XA 5DB4A 4ZCQA 2OCYC 1JYFA 1EVKA 2XPCA 2YXLA 4J3FA 2PRKA 4OQQA 4WZBE 3AI7A 3TIGA 4AMVA 2FUG6 2GEJA 1S96A 5C1IA 3BQNB 3LTEA 3RC8A 1Y4ZA 5LDDC 1WNFA 1MQ8B 2Y3IA 3HWX1 4L4YA 1ORIA 3R3VA 4BQSA 1T4GA 2A7QA 4M7OA 4YCBA 3QUAA 2A9OA 1RE0A 3PYXA 1UKYA 4AUNA 1IDOA 2COKA 1TIBA 1NBME 2NM0A 3N3BC 5LXTF 3PR1A 5CBPB 2VYND 4P58A 1EFVA 5K51A 1QKKA 3OZIA 2GYYA 2B69A 1BTOA 1QVAA 3D7RA 3IERA 1U99A 1KEPA 2WYIA 5KOHB 1CY1A 3HB0A 4G1UC 4QPZA 3ESCA 4HFJA 4WKBA 1PSDA 3BWMA 3HXKA 3II6X 1HNZB 1XELA 3EFEA 3JWEA 4JGIA 3T4EA 4N12A 4JDUA 3LQ4A 2ACEA 4WUVA 2G70A 2QU8A 1DKMA 2QPAA 2XUQA 1EH5A 2G4CA 3KKKA 2EJWA 4N0DA 2F90A 4PZDA 4D4KA 1FMJA 3ZIDA 3KT6A 3N7TA 4US0R 4ZOLA 3GPDG 1H23A 4GPZA 4PWYA 1DT3A 1GD1O 5K20A 2WP0A 5FBLB 2WUWE 4NU5A 4FEAA 4FQ7A 1E5DA 2H3EA 2IDZA 2H08A 4G84A 5T67A 1HF3A 2DPLA 3F6SA 1OXKB 4DARA 1OB5A 5DBHX 2AW5A 1KI6A 3LT0A 5KPJA 1B0PA 1QG0A 2X2PA 4KQ6A 3PEWA 4PFJA 1X2BA 3HU3A 2VJLA 4FMPA 2C92A 4QJ4A 3UOAB 1GNTA 3O9MA 1Y8RB 3QMMA 4JJ8A 3WGGA 4BVBA 5C52B 4J0JA 4HUJA 2Q7OE 4DOMA 4YJFB 2KLHA 1YUNA 4LFAB 3H0CA 3PGVA 1E2EA 1DS6A 1E3WA 1WPQA 3QTBA 4C6SA 3HTXA 1QU3A 5T6BA 2CEKA 2QP4A 1QFYA 3SIXA 2NXEA 4B2IA 3IVXA 2EHJA 1E3TA 5DNCA 5IM4A 3EQ7A 2WKQA 3EE6A 1JSLA 5ESXA 3W5JA 5KQLA 1S4MA 4LBZA 4RPJA 3SZMA 5TPWB 3HPRA 3CLTD 4EVRA 1TM4E 3K0FA 3JPYA 3FDIA 5M3BA 1HORA 4AF6A 4QUGA 5HKOA 1TE2A 3H8SA 1QRSA 4HNHA 4X62B 2ZYSA 1KHHA 4GZMA 1QUEA 2WHEA 2KM1A 1USIA 1KMHA 1XKQA 1QDLB 1CRQA 1WUIS 1UC4B 2P9CA 2WHPB 1DCMA 4FOSA 4IWXA 4PV7A 4R7GA 4EZIA 1RHRA 2WR8A 4NU0A 3HCRA 1J2YA 4UTRA 1P8JA 3ZXSA 1PD1A 1W75A 2ZRPA 3DDNA 4UEOA 4Y6OA 2R7KA 2CXPA 5ALXA 5DYWA 4D98A 1UODA 2DFDA 4PPNA 4MWZA 4OBBA 4ZHSA 3ZLJA 3ASYA 3ZDEA 3HO1A 1KY2A 2DWUA 2IELA 3ZU3A 3LVQE 4I6JA 3AY0A 3Q9SA 4M89A 3TRDA 2GM5A 5FB3A 4UQOA 3UJ9A 1XF9A 4IDHA 2P3LA 4MTCA 5FBHA 3LKDA 4RAQA 4KKXB 2P5YA 2SNIE 3JRNA 3Q72A 4KLCA 5A7HA 2HMSA 1HLGA 2Q6IA 3OCCA 3R6WA 3U9SA 4MZDA 1SBHA 3VNAA 1OAOC 4YXFA 3AFHA 2LUOA 1GADO 5IVHA 3HCEA 3HKBA 1Y5NA 3WOVA 5BMOA 2E6UX 4GYKA 3UHFA 4BE4A 4PCLA 3WWOA 3ROXA 1IZYA 5CGZA 4LQ4A 1X70A 2BEVA 4ZT5A 2GT1A 5BQPA 3SMQA 4MW5A 3LXMA 1OBFO 1ZL2A 1TKBA 5GM2A 1KIFA 4JFAA 4CTMA 3KBOA 4ND3A 2C7OA 2M2IA 4OO3A 1U94A 2QUZA 4INPA 1PU2A 2I9KA 1RM0A 1S8NA 2HIMA 2Q2WA 4PCUA 3LNTA 3DAOA 4LMBA 2XWQA 3DDCA 1N6PA 2BMEA 4ALMA 2J6HA 3TD9A 4EPXA 1NJ8A 2J5XA 3IALA 1H8HA 5IWCA 4ARCA 3SF8B 4CDNA 2PIDA 4F91B 2C9DA 2G7ZA 5A5GA 1DHRA 3B51X 2H16A 4A16A 5KKAA 3CPSA 4J7CA 1EGHA 4YRRA 4BJ3A 3KNZA 4CMGA 3BZUA 4E5SA 3THXA 4JWTA 2F48A 4BYMA 4PYIA 4C0JA 4OYRA 4JBGA 2PNJA 3OPQA 1FQWA 3KD3A 4F2GA 2JATA 3RRJA 3UJPA 4Z7JA 4AW9A 3QI2A 1YR9A 5B57C 4IQGA 3RSFA 1DTWA 1U3CA 2O7VA 5EZYA 3K09C 3A26A 1EUCB 3CNEA 3L0OA 4J0IA 4Y8VA 4IR7A 5JRDS 5K3EA 4MRMA 2HK8A 4KGDA 1ND6A 2CLFB 2AXEA 5F78A 4BFSA 1TAQA 1YZUA 1A7UA 5H82A 1RXVA 4RSGA 5DHUA 4ZZ3A 5EUBA 4LMRA 4EFMA 4CNQA 3E7DA 1Q92A 3R24A 4WX2B 3T9DA 3GWGA 4DUYB 2FRXA 3VHXA 3I37X 3D8SA 1C3VA 3EY9A 3ZK9A 1JU9A 1SBCA 1II0A 1UFQA 4QQFA 4QJ3A 2XKAA 1NJFA 3L7OA 4N4AA 1VPEA 4MKRA 4OAQA 4X63A 3N5KA 4X91A 4D9FA 4UCFA 3NYWA 1GQ2A 2KSQA 1EYZA 3RCBA 3RSQA 3ZJVA 3HN2A 3RUHA 3SXJA 4DMFA 5U9CA 3SS8A 2GRJA 3PWSA 4Z0PA 1XPUA 4MWTA 4DIEA 2W8BB 2IK8A 4QGAA 4U8GA 2BIFA 1E98A 3VNQA 3E23A 1XLUA 5JMWA 1N2CB 3L82B 5LZ4A 5EWJB 1GAXA 4TV8B 2NO6A 3D3JA 3UJ6A 4AG5A 1C0PA 4NFYA 5DIFA 5IJZA 1ECLA 1OR8A 1Z5UA 3K4HA 1U2TA 2ZJ6A 4MRSA 4ZIRA 5FRDA 4Q66C 3DE5X 1LA2A 3JW8A 2YV2A 4M9XA 3LQ2A 2H7YA 3DMTC 5P21A 3QX9A 3IEPA 4EFNA 5IFLA 3S2IA 2CCJA 1MVLA 1CJUC 1MA3A 2ZIUB 3CR8A 3NIWA 4GOJA 1PNRA 3INNA 1SVSA 4WJZA 3O2JA 1U8UA 2EX4A 3A1UA 4GZ6A 3AB3A 3QVJA 4W6ZA 3EGWA 5HK8A 4EAAA 4IOMA 1WMAA 4UCQA 1FNDA 2GAFA 3LF1A 3LBHA 5CMLA 2EIHA 4Q18A 4DMCA 3U4MA 4LDZA 2J6IA 1BQ4A 2HRZA 3HJGA 4XA8A 2HY7A 5C8YF 1W85A 2LGJA 1QUFA 3OM1A 1EVZA 2LPMA 3DAHA 1ZGZA 3PUJA 4I4LA 2MCFA 3STTA 5CFZA 5L95A 1TCCA 3RYCB 1YI1A 2LCQA 2HMAA 2XADA 4AY4A 3U3RA 3F7TA 3RSGA 5H9WA 4CKCB 1E58A 3L8GA 5B3AA 2IGBA 3W3AH 4DDWA 2P2ZA 4GD3Q 4XLTA 1DG9A 4XW2A 3TTUA 1XPOA 1X0XA 1YL5A 3SIRA 1FUYB 2V9PA 3ZYCA 3K8QA 3EZNA 4KMRA 1EFPB 2PWYA 4BGUA 5CDGA 1TK2A 3UXMA 1TVCA 2SICE 2GSDA 2BBTA 4I7EA 2IY9A 4TTPA 1U81A 2RAPA 2GPWA 3TLZA 5DBEX 5EE5B 3T35A 2BFCA 2HDHA 3QXHA 3M4XA 1ZUWA 2ZJOA 1EWRA 5IW8A 4IUDS 3H8JA 4RVDA 4XGRA 5BOSB 2JLWA 3FI9A 3RU2A 4CLXA 1WDLA 2HA4A 3ENVA 4PE5B 5D84A 2QMUA 4ZU6X 1E9CA 4F04A 4J0QA 1WPRA 3V42A 5F77A 2D0PB 5LYJA 3KSBC 2JH3A 4N01A 2AVNA 3A2LA 2IUYA 2I3GA 4GPAA 4MYUA 3NAGA 2JA1A 1H42A 3WYFA 1VJDA 4G0XA 3C4JA 4JR0A 1E3SA 1YS9A 2X5NA 3RS0A 4ZO8A 1G2IA 3Q8KA 4BOYA 1O97C 2EV9A 2B9EA 4Y7DA 5F35A 1U0EA 2F62A 3HDVA 5A7FA 4M7RA 1OGYA 5KEIA 2XE7A 1IM8A 4RMGA 4E7OA 4IICA 1E2FA 4BPBA 4WK0B 3V2IA 1ZHHA 4KV9A 4QSMA 1W5TA 3TQQA 3T1QA 2E49A 2P90A 4URZR 2ZSUA 5DCLA 4W9MC 1OLSB 4KPYA 1F2TA 4WN9B 3L6CA 2GBFA 2ATEA 2J1LA 3LFTA 3EPHA 3O94A 3CW8X 4HX9A 4WHMA 3OY2A 5IF9A 2DUJA 4B0PA 3I6QA 1MENA 3AESB 7REQB 3U5ZB 1PG0A 5CAEA 5DMXA 3HB1A 2DQKA 3K6SB 3O84A 4MV8A 4G25A 2YCLA 3CPJB 4KVFA 2CMFA 1BRMA 3F5FA 5L53A 2ZBQA 3FG9A 3TG8A 1NBMD 1LGYA 1U5AA 5ALPA 3OLWA 1WLYA 4FLEA 4N82A 4W7IA 5EUMA 4J1QA 5T3YA 4GZ3A 2QMHA 4Y6RA 2H92A 3V6LA 3KTDA 1JU3A 4G0OA 5FOSA 4CM5A 4KO3S 5AVTA 3GFRA 2H3HA 3TL3A 4BJHB 1ZITA 1USGA 2WIBA 1IC6A 4M99A 2WTUA 1JWAB 1I7LA 2YWFA 1U3WA 2IUUA 1UR5A 1XEXB 5HRAA 4CEJB 4QOSA 3WGLA 2OGZA 2GZDA 1M2JA 4HWSA 5BPFA 4PPFA 2PKEA 4CM1A 5DOVA 4LTDA 4NJEB 4F46A 4PS0A 2V9ZA 2QTHA 5JW6A 5L6LB 1N6OA 4XEHA 1Z0JA 3ESYA 1RWBA 4OA8A 1D8AA 3QEAZ 1FS6A 2OLEA 1U0LA 4ALIA 4BLOA 3PJGA 2WAXA 5CD1A 1VL1A 4KPEC 3FJYA 1DJPA 1DADA 2JAUA 4WNCA 2FEAA 2BVNA 2YJGA 4PGMA 4LRYA 4ER3A 5FEUA 3B1FA 3H13A 5AIAA 4DLAA 4IJ6A 4MPTA 5EXSA 3N53A 4FMDB 4CHTA 5J4LA 3IBTA 3JQAD 3A2KA 2DFTA 4RGQA 2JFPA 1J07A 2G4VA 1Y1QA 1A1SA 1SKQA 5ARDA 1VLJA 3RUFA 4UNSA 1TUGA 3LWBA 1U5BA 4IIBA 4QOHA 4YMHA 2L69A 4NHEA 3ZWQA 5BWCA 1PHPA 2ZSAA 2KX7A 1NPDA 1ZESA 5JJKA 2D7JA 1KTVA 1R18A 1ZWLA 4BGEA 2IHYA 2W2LA 4UDNA 2X40A 4L6IA 1R4MA 5FTNA 4YRCA 2JJ2D 3C5WP 4ZTZB 2AZ4A 2VTDA 1CVLA 3VZRA 2GPTA 1ZOLA 1DMRA 3BJEA 4J4BA 1YBHA 5BV1A 1W9HA 1T9BA 4IDFA 2XMQA 4LYHA 5EJIA 3WJ1A 5AVSA 4JVSB 1NUPA 1JI0A 3PJDA 4R54A 4TLBA 4BB5A 1Y34E 5AK4A 5DF1A 4DLPA 3NEYA 4DIFA 2P1DA 2W6JA 2NSYA 3LT1A 5IH7A 5J4YA 1B1CA 3I5YA 4OSPA 1CUGA 1GNRA 2Q8NA 4MVCA 2GPAA 4RV5A 2NUAA 3TQTA 2I7TA 5JFOA 1ZN9A 2FPMA 1B16A 2NN3C 4YRJA 2OZLB 4Z49A 5D85A 4RQBA 2W6NA 1S5PA 4IL5A 1M1YA 2K4MA 3WB1A 3K8OE 3WY9A 3UCFA 1HE3A 4Q9NA 1XPJA 3J81A 4JXXA 4DDVA 1QIGA 4NZZA 4ER6A 3NC4A 2P65A 4QIHA 4WAUA 4WGGA 1KK3A 1ZC4A 4KYVA 4PZLA 2OORC 4YI3A 2VP6A 3OIUA 1NW3A 3HY4A 1Z5NA 5MF6A 3EISA 1Z5PA 4EJSA 4C7BA 3TW0A 2XYPA 1FDSA 3I3SR 4P53A 3BXOA 2O07A 2W2LD 3T1VA 4UNQA 1WU8A 3HUDA 3DZIA 2PLAA 4EG4A 1Q3TA 1JKFA 3MWEB 3PZBA 4ID9A 1DBVO 3WKBA 1EHYA 3BXPA 4UPEA 4K8RB 3OOJA 3IOBA 3G0BA 2OM6A 4GZLA 4BX3A 1AZLA 1NI3A 2G5TA 2WBLC 1RQRA 1GUDA 1RPTA 4LWZA 3BH0A 4OUDB 3EF3A 3BXGA 1ZJWA 3HJUA 1F4PA 1RXUA 2J0SA 4IJ5A 3FTQA 4HXEB 2OILA 1XZIA 2NZ2A 1UPTA 3FOFC 1ZD3A 1GHTA 1U4OA 3K92A 4QG7A 1VSTA 2RGGA 4BCDA 4DABA 4LE1A 3FPKA 1PVVA 1GUAA 4RMHA 2MYNA 4LNUA 5L3VA 4RVUA 4I14A 4O2RA 2PZ8A 5KYUA 1ILWA 2H57A 4MGEA 1UAGA 3F5SA 2XOEA 1V26A 5B2ZA 4I9NA 3H97A 5DXAA 1VJ5A 3V9PA 2JFHA 2JVIA 3AI1A 1GUZA 3LL7A 2Z2ZA 3OKCA 2XUOA 4DWWA 2AEFA 1FL9A 2AG8A 3CZ9A 3ORYA 3TNFA 1B00A 3NG1A 3CVWA 3UWOA 2DHEA 3K2IA 4LDPA 5FBKA 2VNIA 1NHGA 3P8ZA 4Y2UA 1K86A 1RHJA 1N92A 3ZNNA 3NIDB 1HRKA 2X5JO 2O4UX 1IN5A 2WV7A 3TXYA 3ZWNA 4MDEA 4YLEA 2ECQA 2X4IA 3PQFA 2WDZA 2DAPA 2GEFA 4MJ7A 1EEXB 3L7AA 5TF0A 3OH8A 3SE0A 1VBKA 1X1TA 2FP4B 1TCVA 3HCWA 3Q11A 4M9QA 1PT8A 3GFOA 1NNUA 3IIJA 1R37A 2QE6A 3B1ZA 5CFLA 1XKXA 3N0RA 2HFJA 4AX8A 4YRPA 3OJXA 4Z4EA 3VR3A 3PNVA 2OQ2A 1CETA 2AOVA 1LRLA 3UF0A 1F7VA 1BDIA 3R9KA 4YCLA 5H0IA 2HBRA 1KIMA 4K5QA 2O3SA 3KKQA 5F5XA 2XBMA 3HC7A 3NHLA 3GUCA 3IPYA 1XDBA 5BN3B 1V4VA 3CUVA 4H27A 5FQNA 1K7EB 2P27A 4KPUB 2OK7A 3HE3A 1MHPA 1GA6A 1P6QA 2EZUA 4JBNA 2QL7A 1PLLA 3CEPB 1RWQA 1GT6A 3ZWAA 5AK3A 1XPRA 1KYQA 4J0CA 4EUEA 4US2R 2XNSA 4P0QB 4QQKA 4TM7A 3H87A 4JUCA 1GZ5A 1N33B 3D2AA 2H2WA 2G9QA 2PKQO 5KVSA 2EX1A 2I1QA 3N70A 4PCVA 2ONYA 2Z30A 2WTMA 4HB4A 3NHWA 5GOTA 1VG9B 1XZMA 4OQYA 4C3OB 1TT7A 5IYZB 1KI3A 4B71A 4OQXA 2ZW9A 1VYVA 1US8A 1X87A 2QR2A 2VAPA 4L3OA 4TQGA 1Z82A 4URHA 5AI6A 4C22A 4DTCA 3GVXA 2WM9B 1W0CA 1QLWA 4GYJA 3AKZA 1CE8A 3RTGA 2IPNA 2VZLA 5DM2A 2VTVA 5AO9A 1J20A 3A25A 3C8UA 2VZ8A 4DA9A 4E03A 3L1JA 2ZIVB 5BYJA 1HDOA 2V6BA 5BSVA 2IIVA 3ID6C 3GJ7A 4KDCA 2GASA 3QVLA 4BNDA 4RY0A 3T7CA 1FYXA 4HVTA 1JQ5A 3SEFA 3KM0A 4NBKA 1EFTA 3HDYA 2YVAA 5EC8A 1IY0A 3E6AA 3HY6A 2D7CA 4HDSA 3N0VA 1IBCA 4KN8A 1WJGA 5G0WA 5LA6A 2ADMA 2PLFA 4RVNA 4U00A 3PCRB 1U9ZA 2JFOA 3NTQA 1XOIA 1SXJE 1WOYA 2GJ4A 2X8WA 4ROSA 4B35A 4OEHA 4B3IA 3ADKA 3D8HA 5CGQB 5T5QA 2NXJA 2Q99A 2R66A 2QN3A 3I0MA 4J9UE 4EHNA 1SD5A 4PX9A 1ANKA 3QE2A 2AFIA 3GXOA 3FIJA 1J7JA 4HQOA 4XYGA 3H0KA 1SD2A 4U2BA 2AN3A 4CIVA 2XVMA 4YYEA 5JMOA 4R1QA 4J3NA 3MIZA 5JNWA 1L4MA 1P5FA 2IZZA 2E4YA 3VRHA 2BDUA 2QOEA 2ZSIA 2RI0A 1V6SA 3ZTYA 2PY6A 1XXLA 4DPMA 1DAKA 1W34A 1G4HA 4OKSA 2JANA 5ALOA 4BVGA 5IMSA 4A0HA 1FFAA 3F6BX 4B85A 3CS3A 3PKZA 5ESRA 3TF5A 3PUKA 3HM2A 4JROA 4HVLA 4BDTA 4PG4A 1CRWG 3MWFA 4MP3A 5DI3B 3NBAA 3D8NA 1AURA 5FOTA 3SIPA 4QGBA 2HL6A 1ZD9A 2W37A 3LLSA 4RW0A 1JA0A 5J5CA 4DV6B 2H29A 1SBNE 2HSEA 3QG1A 4R84A 1O5OA 2BJVA 1GZSA 3JD1A 2ECPA 1FFYA 3D59A 4NLLA 2QTGA 2P0AA 3RF7A 2P9FA 3ZY4A 3ELBA 1J21A 2WF6A 2I6XA 5BW6B 5BV2P 1RYHA 3PT5A 2PX0A 4X1KA 4A8JB 1CZKA 5K0GA 3HK2A 1F60A 3OOWA 1DKOA 3V48A 4PZAA 3EFBA 1HH4A 3MELA 3DZBA 4J1TA 2C99A 1OGIA 4MH0R 3BB1A 5I7WA 1GLVA 1KRHA 4HZIA 4ZCLA 3WIDA 1IAVA 3CTMA 5A5VA 4HI0E 4YUAA 4F60A 4BS9A 1E5XA 2Q5JA 1A7JA 4QWMA 2YFQA 4FGSA 1NYQA 4HPJB 4TMFA 4DUPA 4I8XA 5CB0A 4MQFA 3FNGA 2RGNA 4MGYR 4MUMA 2O7NA 5EJFA 2Q2VA 4FFVA 1Z7EA 2HDWA 2O54A 1N7GA 5FXMA 2R0QC 2XODA 1EWKA 1QZ3A 13PKA 1T26A 2QN7A 1L8LA 3LDHA 3QFCA 4M0FA 3UFXA 5BR1A 1N36B 2UXCB 3KPJA 4PM4A 3ER8A 2YV1A 1J2TA 5KYKA 2J41A 4B5KA 1BEEA 1GPKA 5I48A 1R50A 1DXOA 1UT5A 4P4TA 4H4EA 4IIXA 2G77B 2W83A 3JS5A 4R71A 1CB0A 4I1RA 4O3MA 5DN6A 3DHYA 2G36A 5DYGA 5B1DA 1HY3A 1LV7A 2VDLB 3IX7A 3FAZA 2ZSJA 3C3BA 3EBLA 3K1YA 1A95A 3B3FA 3G8CA 3MWGA 4HV4A 2C9BA 2MSWA 1XTSA 3NJ8A 4M1TA 1F48A 3SHQA 2FPGB 3LIPA 1WXHA 2AIRA 5DGXA 1GCAA 2ODEA 4ED9A 2P3QA 4N76A 1MC8A 3Q9NA 1ES9A 4JNKA 4AQ7A 3H8VA 4DW8A 3L49A 4RK0A 2Q8PA 4K9PA 1E0DA 3LRXA 5F52A 3C3PA 5L45A 2D3TA 3EZFA 4JEHA 3QXJA 2VDWA 5KPDA 2AFVA 2D00A 3TTTA 4YGYA 1K08A 1TQ4A 1WCWA 2Z95A 3M1IA 3OZAA 3WIBA 1ZHOA 2PLRA 3DYVA 2OOKA 3H2ZA 3BMNB 4KFUA 2UVDA 4PIVA 4RCVA 1Y48E 2ZRQA 1ZAYA 4Z3DA 1AK1A 1MGPA 1YDWA 2ADOA 5ULLA 3TQHA 3ZWYA 1NN3A 1QE3A 2D1YA 4LGVA 1GQSA 4MHSA 5FFNA 4BLRA 3EHEA 4MMZB 2EYQA 1G291 4IYRA 3RYIA 1IUPA 3TVYA 1WDTA 1PK9A 5K6AC 4ZI7A 5K5EA 3V1MA 4CM8A 3GN1A 1RC0A 1KJJA 2I3DA 2R25B 4AN1A 4BV3A 4EYSA 5KTRA 5E3IA 1A1VA 5DN6D 4F7DA 1A8UA 1NP3A 2ZI9A 3R40A 3SYKA 3CLRD 3I6YA 4CG0A 5BMVF 4LXIA 5AKKA 3BSWA 5KJ6A 2B6HA 5KWEA 3AR6A 3EZ2A 1FFHA 2AUMA 2BELA 2ET6A 3ZGVA 1CJCA 1BNCA 3RADC 4LOJA 2QVCA 2QTZA 2WFLB 3AX6A 3HQ4O 2B61A 3M33A 3PG5A 2HREA 1NA5A 3DTVA 4OHWA 1ZH8A 1RHMA 4DIKA 3VZQA 1E59A 1Z7WA 3WE7A 4DXHA 1F06A 3ASVA 3D43A 3HP1A 4M4SA 4B45A 1AKQA 2E4XA 2I7CA 3IVRA 4H1UA 1RQ2A 1LQTA 4GR9A 4ITRC 2XY4A 4DWVA 4LVUA 1HE1C 1PFVA 2O3UA 1OFUX 2WAAA 4D97A 1GPBA 1O9HA 3NI2A 2MHCA 1S9DA 1R5OA 3O2SB 1OWPA 3OCXA 3ZDRA 1A77A 4E5VA 1J1ZA 3MFQA 4MKGA 1PJRA 1FXSA 5HIKA 3GLIE 1SU8A 3PHHA 2DSTA 1WWKA 4KSYA 2A92A 3AR8A 1BCRB 5FYDA 3KOMA 2YYZA 4OFBA 2Y1WA 4E09A 1ZO8A 4I50B 5TQ0B 3WK7A 2DM6A 2Q4OA 3BEOA 3ED5A 3I92A 2QLTA 3QPUA 1EK0A 4H3SA 4NFSA 4ND8B 4ZALA 4L72A 3SC4A 1C7IA 4PNPA 1CUXA 1PDVA 3U49A 4F56A 1Q7EA 1LRJA 2F3TA 2REBA 5JI2E 1I13A 3M6UA 2OQVA 2R2GA 2WF8A 5JWRA 2GK7A 1I7QB 2FCAA 2X9VA 4DADA 1TYCA 3X2SA 2DPXA 4E31A 3FOAA 3U31A 3G7UA 4D45A 4E4TA 3GJSA 4WFJA 3N8IA 3FPCA 4R2HA 2ZB7A 1VLZA 2H8KA 2F7SA 3ZNOA 4BP1A 4XB6B 4BKMA 5DULA 5CITA 1AGRA 4NZMA 4FGLA 2IQIA 3KT0A 4QGSA 1P9NA 1QHGA 3TZKA 2GVNA 1Z17A 4R2JA 1IDN1 3OLQA 1YL6A 1I51A 3HABA 3JX9A 3W79A 3VA7A 1X1QA 4WESB 3OCJA 4OF4A 3ZVMA 3PEVA 3ROQA 2X58A 5GONF 3THYB 1CWUA 4C4RA 5MHTA 4FS8A 4ZPXA 1U0JA 4WNIA 5TMDA 3PJRA 4BV2A 3GLVA 4MK4A 2IY7A 3EG9A 2R751 1V8ZA 1ICIA 2Q4BA 3L7MA 1V16A 2R6R1 1ZCBA 1P5JA 3ZEAA 5FTMA 4BO5A 3A3OA 1A76A 4YK7A 4LJYA 3WRXC 4CMEC 3U62A 1BVHA 3JSAA 1DFHA 1JDNA 2YR0A 2VP4A 3F73A 1R7RA 3GEMA 4DR5B 1GTSA 2B4KA 2P6UA 1A4UA 4KLAA 5DO9A 4QPCA 3USZA 4DLXA 3GGDA 3P32A 4JZYA 4OJMX 1JBKA 5CA1F 4IH9A 1R12A 4B7ZA 2X19A 3EUAA 5I9LA 1QV6A 3EB9A 4KSBA 5CNIA 4FCTA 2PH1A 1IHYA 1LBSA 3ZVNA 2UUPA 4KQCA 3I9JA 1JTVA 2V5UA 2D13A 2VYVA 3KXIA 3LKZA 1GZDA 3M49A 4GXNA 1PN3A 2Q2OA 4PIPA 4RZUA 3TMAA 2FSVC 3WNZA 1UXJA 2OCDA 2R1TB 3SR3A 4ZQFA 4XJTA 2G1AA 5UKDA 5I4KA 3MMPA 3NC1C 4ZOEA 4BEJA 4LS3A 1ZD4A 4EBBA 2XKJE 1KEWA 3ROFA 1LDGA 4EEKA 1UOPA 2QM3A 5ALVA 4AKGA 2HXYA 1U3VA 4JEIA 3SEQA 4RKWA 2C8LA 1X9HA 2DFKB 3H5RA 4ZO9A 3TECE 2Q3BA 1DU4A 2FVYA 2VUIB 3EXHA 5AKZA 4H7PA 2BBSA 3A4LA 1I6MA 1PWEA 2ZSBA 4HN9A 4B8ZA 4E70A 4EDFA 5B7QA 1P6XA 3PFNA 4BTEA 2Y1LA 5JNUA 4LOKA 2BFBB 5JQGA 4JC4A 3ZOZA 4IGEA 2V3CC 3C39A 2XTJA 2H07A 2EERA 1X1EA 4N18A 2ZRGA 5GOZA 5KNDH 1CLEA 3IP8A 4NULA 4YT4A 5IDVA 2J6BA 3TS1A 4YXWA 4EHFA 1DX9A 1OKKA 3KDPA 1V3UA 4QOJA 1UBNA 3MLAA 4FDAA 4TUYA 5DK4A 1B41A 2RI1A 4B47A 3HKEA 3IOMA 1NXVA 3BWVA 3E3OA 3GPBA 1PIWA 5JANA 2QMQA 5JAQA 2C9CA 5CB8A 3ZBUA 1DAIA 1NW5A 1UBJS 2CE2X 3KJZA 4XJSA 1SUCA 1S2OA 3RS3A 2HO4A 4IXWA 3SVLA 3CTPA 4B3FX 2YNMA 3ILYA 2HSWA 3Q9LA 4C89A 2PUFA 2CXHA 2W22A 4JDPA 1K97A 2CJXA 4FXPA 3H9EO 3TOXA 1VJTA 3UV6A 3WGTA 3DLIA 1FVHA 1AMOA 2PT7A 4EI9A 3O4IA 2ZJ5A 5FBWB 4EW1A 3R8FA 5DH9A 3V2GA 3E9ZA 3WZMA 1AKUA 4E1AA 2ATIA 1VSVA 4YDSA 1CZLA 1MQ9A 4GWKA 1SHLA 4FFLA 3E3MA 3HXLA 3IDQA 3NHKA 5B3JA 3WISA 3O6VA 2R5NA 4RF4A 1LX7A 4G4GA 4I46A 1IE3A 4Y30A 3WQHA 4ZOLF 2RGBA 4HAOA 2AFHA 2O1SA 4DF3A 4B3DA 5H4HA 2WKWA 1L7VC 4I1OA 2VYFA 4FPXA 4PBTA 3WZLA 4HVCA 4LF5B 4P98A 3R3UA 3WGMA 1NMSA 1T6YA 4Y9DA 2A88A 3BIXA 5GJVC 5JY6A 4NCBA 3P9IA 3I6MA 5TJHA 3B9QA 1FDWA 2PSJA 4IS3A 1ULHA 4KE6A 3WMWA 2PUCA 3OE7A 1XRNA 3IQGX 4QREA 5ALHA 4HAVA 4F5DA 2IYNA 5FBQB 3C4QA 4LCEA 3DSRA 5B5SA 1SVWA 5TQJA 1MTOA 4JI3B 5LQKA 3CSUA 3KYBA 4TX1A 1DOZA 1BDHA 4BNGA 1Z0ZA 2YNMD 4YFYA 1K7XB 4JLKA 4LI0A 5F5NA 1DEAA 3KAKA 1Z2CA 4Q4HA 1P1CA 4LYEA 1H4QA 3NYQA 2JIMA 2QSZA 3EVBA 3OQNA 2D3WA 3FLEA 1G5FA 4MB0A 1BHO1 1USVA 2YWJA 2HHCA 2JGNA 1Z39A 2C95A 3R20A 2HKIA 1FFXA 4NBWA 2ATCA 1I1OA 2C5FA 1EK2A 4XPZA 4CT0A 2F3QA 2R8RA 2ODWA 4IG9A 1SC4A 2ZETA 4RGBA 1WMSA 3WLJA 3OP4A 3DFMA 2HJSA 2HPVA 3CE6A 4NAUA 1QPGA 3IV9A 4D9JA 3S2GA 3ZN2A 5EHNA 1PWXA 3E8XA 2BZSA 3KR2A 1EE9A 1M76A 3VAYA 4X3OA 3SC6A 3LG2A 1QQ5A 4XQGA 1YRWA 4G26A 3U7HB 2H4FA 2PX3A 4PXSA 3DULA 2O6HA 4LVOA 3SVZA 3V3KA 2ZBEA 6LDHA 1AKEA 4K9LA 3U39A 4XRGA 1JSRA 1LU9A 3GJ0A 1G55A 1JQJC 1F4LA 3QOYA 4C7KA 3Q12A 5LP1A 1YU9A 3ANTA 3OE7D 1L5NA 4RLHA 1H6AA 2YJTD 5DNDA 4Y98A 1LNZA 2ERYA 1LX6A 1NQUA 3NGXA 4BCBA 1NF9A 1RRGA 2H4ZA 2WJHA 3LUAA 4ZK2A 3DW1X 3X3HA 1JBQA 5BRAA 5LZ2A 3KWFA 4U5QA 3KUDA 2R79A 3G0DA 4CUJA 3IODA 1DOAA 2QXTA 1G17A 4TKVB 4G89A 4MUXA 4GSKA 1AUPA 1EK6A 2B1JA 3ESBA 5SY9A 1MPXA 2G06A 1FRQA 1XMXA 3T61A 3L0IB 2ZT6A 4INJA 3FWNA 3P5BA 2K5UA 2ZIEA 2ANBA 5EP1A 1UBKS 4XQEA 4D9HA 2BMVA 1KFJB 2G1UA 3QKIA 4FHEA 3GNTA 3RHSA 7ADHA 2JVJA 1Z2OX 4YMWA 4CV1A 1Z4MA 2NUPB 4KXUA 4C01A 1T5SA 3MILA 2PX8A 1Y7TA 3L02A 4QXRA 1JMKC 4HUQB 4YAJA 1W0JA 4IJVA 1QVVA 5EIOA 3VSDA 4L9RA 4DBLE 1TJYA 2VATA 3OU7A 1VG1A 3FY4A 2MMGA 3DP7A 3H2BA 4G56A 4DYVA 4EG8A 4YRGA 3O7WA 4WSOA 2PGIA 4PXAA 3D4OA 2X9NA 4RK5A 5ICFA 1KO1A 1F17A 1NVFA 3AWDA 3NAMA 4GIBA 4WZAB 5EZYF 2JHPA 3LX4A 4EHHA 5I8WA 2P78A 4G5YA 4NR0A 4NYMQ 1FMCA 4DC0A 4YT5A 1V4NA 2A1UB 4AN0A 1CDZA 1XZ8A 5DHAA 1RYNA 5CJJA 4A0SA 3GDHA 4ZO4A 1V5WA 5SV2A 4E2WA 4NQRA 1NXXA 2XGGA 3VZBA 3WP0A 1EQUA 1D4AA 2IRWA 3NBMA 4N9WA 2PH7A 4YJ2B 5JSYA 3WHLA 3BFXA 1N4DA 4GKBA 1XZCA 1IN8A 1WZ2A 2IS1A 2B37A 3F2VA 3HZOA 4N54A 1OFUA 3JATA 4WDRA 3FFWA 1E94E 4PPYA 3T3PB 2WWIA 3MHTA 3RW9A 3QKSA 3TNDA 4H4DA 2W2KA 1KK0A 4FFWA 4E2XA 3CBQA 5J9FA 3QWHA 3R7AA 4EHLA 5EGNA 4BBJA 2G6TA 1ZQ9A 5THQA 3KHTA 1F8UA 4WK2B 1H4VB 3RVRA 1K5GA 2LKCA 3TPCA 3G0GA 1TTPB 1R4NA 1OI7A 2FX5A 4G1CA 1YMQA 3JWIA 4HTFB 4Q0MA 3UUFA 2G83A 3AL0C 2IYFA 1TK3A 1TD1A 1VG8A 3BTSA 3G6WA 3I2JA 4YAOA 3G1UA 2R8PA 5EY5B 4KAAA 1WXWA 4PAOA 2RBKA 3QU5A 3LVRE 4DANA 1QC5A 5BXQC 1QRTA 2G9VA 1DRKA 1XQ6A 4P8RA 5DNAA 1QG2A 1L1FA 4U2DA 4L5BA 1ZGBA 3B36A 4XWWA 2IGTA 2JAPA 1PX0A 1H8EA 1YT5A 4YRTA 1FE8A 2F43B 4UMEA 5K8LA 2PGAA 3E18A 1MZVA 3NT5A 3JALA 4FHFA 4MYCA 2J09A 5DGDA 5HCUA 4E51A 3DS8A 2P5UA 5EP2A 5G1OA 2FUNB 1XNHA 4RK7A 3UAVA 1HT0A 2WPNA 5CIWA 4YDHB 5ADUS 1IPEA 3GHYA 1LUAA 2B8NA 1BIFA 4AG3A 5BURA 3S8YA 4FWTA 3B48A 2VSOA 3NBQA 1C9JA 5JBQA 3GP3A 1NBEA 4OK5A 3I28A 1JAHA 3ZVRA 3NDBB 3Q15C 1JGTA 5DGHA 1XZLA 3L41A 2IWHA 3MGKA 4Q4CA 2FDRA 3TGPA 2XUPA 3SX2A 2AMVA 3WBBA 1YV9A 2QSYA 3ZY5A 4YAGA 2I2XB 1W4RA 2ZRNA 4FYIA 1XZGA 5GPBA 2JZNA 2DRIA 2PK3A 3RI3A 4Y3UA 3HCBA 5AXCA 4OGGA 1QRDA 2VF7A 3PFGA 5LQSA 5CXSA 4XB1A 1N0IA 4S2EA 1PKXA 3AIKA 4OLHA 2AR7A 2I22A 3IOYA 1G21E 1U6IA 1W59A 2ZRBA 3QW2A 1YBMA 4JUIA 3GCZA 1HOXA 4ENUA 1UP6A 1W0KA 4M83A 4CW7A 1XMOB 4DJJA 1DXHA 4A6DA 2A4MA 5IU6A 1NFQA 1UMDB 3W9BA 2GFQA 1XLTA 1SXJC 4S1VA 5H8WA 3OX2A 4TGLA 1BGXT 4BZZA 4ZOAA 3I04M 4PHFA 1LS1A 1H8ED 5LYJF 2YN2A 2BISA 1U1DA 2G9RA 3PI6A 4R8SA 5TMEA 5FWXB 2BMWA 1YR2A 4KXMA 3R8CA 4NHOA 4C0KA 5KU7A 2B78A 2MYUA 1OBHA 1E1MA 5KOHA 1Y1PA 3GGJA 4L50A 4PSAA 4FX2A 3STWA 3FUVA 1OB2A 5CTAA 4JQCA 3NH9A 1ZD5A 2Y2UA 5EJ4A 1L7RA 2WU3A 3TBFA 3DGEC 1RLMA 2Y66A 4O2BA 5SYMA 1P62B 1IL0A 2PCJA 2WE7A 2NUTB 2JLQA 2VJQA 4ZEMA 1AUXA 4J16A 3EVCA 1TO2E 3EWSA 3FWYA 1WZUA 4DCNA 1M5RA 5K9ZA 4QU0A 3WRWA 3K9CA 2HOQA 3VR4A 1W4CA 5JS7A 3D6FA 4HPXB 5DIZA 2VNHA 2O7SA 3CSSA 3KALA 2FMTA 1G3UA 3UBTA 1T15A 1ISPA 2ZPAA 2HCBA 3S5UA 4DQLA 2HRRA 2R00C 1U2DA 1W0KD 3GJ6A 2PNFA 3GMDA 4OSOA 4Q34A 4QTYA 5CTJA 3S40A 2A9PA 3GLKA 3ILVA 1Y8RA 3N28A 4BJ6A 3BORA 5EHIA 3U7EB 4YJFA 1RLUA 1VI5A 3U7RA 4MKXA 2ZQZA 5FL7A 5KBYA 4KO4S 1HDCA 1OXSC 3EVZA 3L7CA 5DNWA 4AECA 4AP9A 5IHXA 5M34A 2Q45A 5KOJB 1JIJA 2R7LA 2YS7A 4PC6A 4RQTA 5CUQA 3TSZA 3HSSA 3A10A 1DX4A 1YA8A 1LBIA 5KSYA 4FKMA 3FXAA 2P1RA 5TPWA 3B5JA 2OECA 1A9ZA 3AINA 3F5DA 3LYUA 2XRFA 3NKVA 1BH2A 1YJ8A 3IUJA 1MTZA 3HJFA 3KWJA 1YGPA 4YV7A 1M54A 3T9FA 3O0DA 2BE9A 1W36C 1E9BA 2R4TA 3LOPA 1CHNA 1ECCA 1KMMA 5IXYA 2WHPA 1ORRA 5TXGA 1QGOA 1NVMB 1XA0A 4KK3A 3U4GA 3QOXA 2HGSA 2W0SA 4GVPA 3V7NA 1IN1A 5GWXA 2VA8A 2J0QA 4FBMA 1QQTA 4L4UA 4ZZIA 2AJBA 3EOZA 3BHIA 3E58A 3UTCA 1EAYA 1PUIA 1YC5A 1DC4A 4AJEA 3O3OB 3F3MA 1K63A 1TQ8A 2HJVA 3W5DA 3S4YA 3WLKX 1DOHA 1W49A 2FXVA 1Q12A 3QWAA 4LX0A 4F9FA 3ROZA 5EESA 3CLVA 2ZCJA 1DL5A 3AHDA 2AN4A 4DQ0A 3EXEB 1PJAA 5D5PA 4IGFA 4RJIA 3B60A 3BZWA 2HBZA 2CB0A 1JDBC 2CCKA 1XQYA 3AXTA 2OBBA 4KODA 2R3SA 1FVOA 4KZKA 4QICA 4BO2A 1J0CA 1Y5MA 4DCOA 4NAHA 1Z5GA 1AKVA 4Q9KA 2G72A 3JWHA 1BMFA 4D79A 1EESA 4MYRA 3HJHA 3PE6A 5FAKA 1PR0A 1XSEA 3Q98A 1SOVA 1VHWA 2Q4DA 3AEUB 1MOZA 1PTJA 3E9QA 3IMKA 1CUBA 5GTDA 1FRZA 4QVGA 3QIAA 4CM9A 1UCFA 4I9FA 2QDXA 5K6RA 2C2OA 1R0XA 1ZK3A 4ME6A 3SF8A 2N3ZA 1KJIA 4IIVA 4YUZA 4CBVA 4YAFA 3FFTA 4UUMA 1MNQA 1CQJB 1DIHA 3QPCA 4V0SA 2C7QA 3SKVA 5DM4A 4RWEA 1CP2A 4NYJQ 3ZOKA 1WB9A 3KUXA 5A1JA 2GETA 4N48A 5JE8A 4JQYA 5ITWA 5TX7A 3V8BA 4ZVRA 2HR1A 3IMGA 2FSGA 5E2BA 3BMXA 4K6FA 1EUCA 1BWQA 3AVYA 4OQMA 1W4ZA 4P92A 1ZJ5A 4FR0A 3VNUA 1DXYA 3LFHA 4F7WA 3A6LA 3H1AA 1KZ6A 4JCCA 3QX8A 4L3VA 4Y1FA 1F8YA 4YBRA 4DNQA 4F8EA 1XI2A 3DZ8A 4W5RA 3MS2A 3W8EA 4QXOA 3IJEB 1BMFD 2OA0A 1G1AA 1VJCA 2ZJ2A 5DLDA 1GNQA 3FDZA 1V37A 1ZRMA 4NV3A 4HRVA 3H5VA 4X65B 1K8XB 1MT0A 2A9RA 4K9DA 2V4MA 3U48A 2JBAB 3FRHA 4QASA 3ANXA 1XVAA 3PITA 4FU0A 3H5IA 1P77A 1J7KA 1QQ7A 1S8FA 4LV6A 1M1ZA 3SJAA 3KSAC 4KRGA 1NG9A 2ZT8A 3D6AA 1KI1A 1NZJA 1GYPA 1E8MA 2PH5A 5ALWA 3GGCA 5G02A 1OX5A 1P7ZA 1NI4B 1U1CA 2CMGA 1FMTA 2E3JA 2W8BA 3HP4A 2CGEA 1FTWA 2JLYA 1E92A 2C98A 2MWMA 1KDOA 1ISHA 2X9GA 1JKXA 4ABTA 3ZH2A 2J0VA 2ZUSA 5EWJA 2Q1SA 1OTXA 2JLSA 4XM2A 3K2EA 4TV8A 4YQYA 1R74A 4D82A 3DLPX 4O5OA 1Z68A 1ZISA 4BMSA 3M3DA 1CUAA 2ZR0A 4WXYB 3RYHB 3ASUA 4MVJA 1HT3A 3VH4A 3ZPXA 4KXXA 3WDKA 3M6VA 4GOKA 2P3OA 3B1YA 1FSSA 3PGA1 3V5NA 1ID8A 2LW7A 3RUEA 1MRNA 5EPUA 2PKXA 5JEDA 4DGQA 1P33A 3UJCA 1D04A 3RRBA 1E2KA 2WM3A 4MR7B 3PQ3A 5J2TB 4FBGA 5CLJA 1RJDA 4JI0B 2CCGA 1M10A 1K3FA 4FW8A 3IESA 1EGQA 3BSYA 3R4VA 1ITZA 2VDJA 2GZ2A 2BI4A 2OAP1 1NRJB 2AA3A 4FILA 4OOFA 4RVHA 4R41A 1H9CA 2UYGA 2XUKA 2C29D 3JYPA 3A37A 3ONDA 4RVCA 5HX7A 3RYCA 1IPHA 3AP3A 1AS3A 3G68A 1K3UB 1UDBA 5FPYA 4CKCA 3AB8A 3WLHA 3QLUC 4HAIA 2FN7A 2JFWA 1KAMA 4K1LA 4BMOB 2HCTA 1MBZA 1AUQA 1RR6A 2HLDA 1YZVA 1LDYA 1EFPA 3KPWA 5JECA 1OREA 2P2SA 5LU9A 1N2BA 1VCIA 2C5BA 1JLSA 4MAAA 4JK3A 4XYLA 1E0AA 2WWTA 1ZKDA 5BSUA 4K9NA 4QYSA 1QAMA 3T3HA 1J2UA 4Q7KA 1L4NA 3FNHA 4XSVA 2J0UB 4W4TA 2JEOA 2IF0A 4CV2A 1QRAA 5C8ZA 5LWHA 3ZWBA 2IDJA 2FI1A 1LJLA 4FMBB 4LXQA 1IY2A 3IDOA 3A4VA 2FAXA 2IP2A 3KKEA 5SZHB 2DFPA 1UWCA 2H1FA 2VC2B 2PZEA 2QGZA 3CC8A 1EFAA 2NZYA 3M5WA 5JSFA 3RAPR 4I5FA 4ZOBA 4L1KA 4UVHA 5KAMA 2FDXA 2FW9A 4B9AA 4D99A 1NT2A 4W5HA 1YIAA 4IRUB 3R5KA 1KOJA 1Y1LA 3M0EA 1VDMA 2DWPA 2FG5A 2AX3A 2UUCB 3PI7A 2HIAA 3T5DA 3LLUA 3WLAA 1CR1A 5WRFA 4RH0A 1T6NA 2XVXA 3T52A 2FPSA 1OLSA 5CVCA 4QRDA 4XGQA 4WN9A 3S8MA 3R2JA 4B3RB 5KWVA 2YYYA 3O8CA 4K8OA 1E2GA 2C20A 2QN2A 4TWZA 2Q3EA 2J9RA 5IMBA 2HLDD 5LA6F 3ZD6A 4FLMA 1OA1A 3AESA 4MJXA 4QTUB 3TOZA 1E32A 2WV9A 1GEGA 4IMRA 4Q4JB 3K6SA 1TF5A 4Q3AA 1QJCA 4FHGA 2ALJA 2IXDA 4HS4A 5IJWA 5JS8A 2A78A 2QY6A 4B6JA 5FI1B 1XU4A 4OB6A 4L08A 4W9NA 3BK2A 3KZNA 2V6MA 2QMYA 1FTNA 1RWVA 4ZXFA 3U4DA 3LCUA 4IBOA 4ZYWA 3NFYA 1QRUA 1TU4A 3SOZA 3AF5A 4UUBA 3NEJA 5KYNA 1E3DA 1DAFA 2TMYA 3DB1A 4EL5A 2YFHA 1EXMA 5IJ0B 4DQDA 1GSIA 2KI5A 4CEJA 1D4OA 5DMHA 4B8WA 2HA6A 4RKFA 3F5QA 3HBLA 4XEUA 4GOOD 1R8YA 1WB6A 2F3PA 2GYUA 3C6ZA 4X85A 4NJEA 5CT4A 3IP1A 1NVTA 3O8NA 4KRXA 1WQ3A 1L5FA 4RKQA 3UK2A 1JDVA 1P9OA 1RJWA 2ZYIA 3AP1A 4UJ5A 4UHKA 5LLSA 3DV2A 1DQNA 1JT9A 4MKZA 4C4AA 3ZGLA 1NM5C 1RXIA 4ZAXA 4JLNA 4F2DA 5K0BA 3A32A 1L7QA 1Q0UA 2JNWA 3BH6A 3KJNA 4L76A 2V7WA 1UK9A 4RJLA 1IOVA 5ITZB 3SU8A 1KIAA 5ITSA 5INTA 4AKTA 1ONBA 2Q2QA 1N6LA 2OWEA 4GT1A 2FW7A 1SGWA 3JZIA 4KV7A 1UPFA 3C3KA 4KX5A 2A0FA 1AUOA 4BUZA 1KQGA 1DCTA 1Q22A 2BD0A 1F6BA 3HFGA 5HWSA 4JU8A 4A0RA 3QBEA 3ICQB 5E7IA 3UAGA 3T7DA 3ZY3A 1ZJJA 5BV0A 3PYLA 4QNMA 1UJBA 3TCXB 1EFHA 4DYHA 8LDHA 3U16A 2Z56A 4LXYA 1GV1A 5E3HA 3OFSA 2ODPA 5KSWB 3WHPA 4MULA 2XMSA 3TRJA 4LOLA 3FZGA 5AM2A 2QAIA 2I4RA 3HVHA 5KJEA 3GT3A 1GGVA 2CF6A 2NIPA 2X5OA 4M7WA 3RKSA 4GXQA 2YWHA 3UENA 3RSSA 1WY5A 1X39A 1J8QA 4IDEA 2CUKA 5JOQA 5KOIA 1KNQA 3DT8A 4J0DA 5CPBA 4WLVA 5D87A 2VP0A 5DU2A 4BMYA 4NATA 2UVQA 3CVVA 1QNFA 3P27A 4FP9A 3RSCA 1HZZA 4YAWA 5DWQA 2NG1A 4CIXA 3IIEA 1Y6FA 1ZQ1A 2OYRA 2QT1A 3BFJA 5E3JA 4GECA 2NV2B 3OQVA 4N65A 4OHCA 2RIPA 4Y6SA 1NDHA 2BGGA 2FE4A 4JYMA 4L5CA 3T7KA 1WXDA 1EWVA 3OTGA 3Q8WA 3OJLA 5DTRA 2GRUA 1FJ2A 2HYDA 1D0SA 1T34A 4NG5A 5FH9A 3DVQX 4DQXA 3GJRA 1BEUB 1QP8A 1GQQA 2DY1A 3H2GA 4JELA 3WGOA 3ZCXA 1UM9B 2Q29A 5HQTA 1RAHA 2AV6A 3BK7A 4P3NA 4Q5IA 2EKZA 3G2JA 1GAQA 1GDDA 4EB0A 2YVQA 2ZJBA 3W6OA 1D6SA 4KQ1A 4BMPB 1HFWA 4C29A 3VTZA 5KHLB 5AUQA 1XMJA 4FM9A 5J59A 1E7MA 2CL7X 1H2WA 1E69A 4A8HA 5FT9A 5FYQA 1J49A 1D2AA 1V71A 4LWPA 4NOKA 3MWEA 4ZVQA 1URPA 1DCKA 3V97A 2VEOA 2QAJA 4W6QA 2R60A 3IEIA 2R5FA 1FQJA 3ENQA 3EGOA 1LI7A 3PKJA 1A72A 3NPMA 3HKDB 3QLJA 2IV7A 4H1WA 2ZIZA 3FVWA 1AS0A 3M34A 4OUDA 1OI3A 3UWDA 4D3YA 2ZUFA 4AT1A 2JI6A 3B9PA 4ZI7F 3EASA 1QO9A 3LCJA 2ZREA 2HK6A 3WO0A 5K45A 3U13A 1RM3A 4K87A 2XKKA 3CU5A 1PLKA 4RXMA 3A0RB 1K5PA 4G24A 2ZU0C 5LXTA 1H9AA 2Q1TA 4BNZA 4NXMB 2IHZA 2ZTHA 3H8WA 1L1QA 4DBLC 5IZ4A 3H0EA 5FWNA 2Q3DA 4OV6B 2YVLA 3GARA 3RJ9A 5JXGA 4AROA 3OF2A 2ODNA 1SA0B 4M86A 5KDLA 4DZRA 2PWAA 4LE0A 3U3OA 1ZGHA 5ER9A 4Z9YA 3QVSA 4AKIA 2P1ZA 3I5UA 3JWJA 1R3UA 2JF0A 3I01M 2BZ0A 3HWSA 1OAAA 3K35A 1ENOA 1RWKA 2D5AA 3B53X 1IATA 5LUBA 3QEJA 1BXKA 2B35A 2XTMA 2Z3VA 3LCCA 3KETA 2O2ZA 4PZUA 5EWLA 1QVWA 2C59A 1UBSB 3CUWA 3TRIA 2A2ZA 3S8EA 5B1SA 3IKTA 1RBZA 3L4KA 1QQBA 1ZKMA 3C7TA 2FP4A 3FLMA 3ZJYA 2WJWA 2YJ6A 5CDTA 4M3NA 4XWKA 1EXDA 1V5FA 1YZTA 2H2FA 2HO5A 2WJZB 3WIEA 4CODB 3CZPA 3DBIA 4PCAA 4WJLA 4JLAA 2XYQA 4D6PA 1CR2A 1M1NB 1T5IA 2RAVA 1NQ5A 5DE3A 5GIOE 4NIMA 4MA5A 5IEBA 5E9JA 4JBWA 4DCJA 3R3JA 4QUHA 5EIAA 4ALJA 2HMVA 1W5FA 5F9MA 1F20A 3UCXA 4ENSA 4IOKA 4KI0A 4NJOA 3DNFA 4OHVA 4CEIB 3SE7A 1JJBA 3WBFA 5ESDA 2C0QA 3AY6A 4KPUA 3MJSA 4O0MA 1PGOA 2O2XA 3C8MA 1K4KA 5TV2A 2NYUA 1ML3A 1YBAA 1NBHA 5EMNA 4B73A 4B6PA 1H2ZA 1GKUB 4LRTB 2WLTA 1FUKA 4OHPA 5BW8A 2CF5A 2XJ4A 4I66A 1GGNA 3F9CA 1HL3A 2DPMA 2CLLB 3E61A 2JK0A 3LUCA 2YRXA 4JENA 3VISA 2BH9A 2W9XA 2FF5A 2JLXA 5K99A 4DPLA 2QUKA 1M0WA 1H6CA 1GWNA 1Y3AA 3RU9A 2P9ZA 3KZKA 1LVGA 2BEUB 3KE8A 1J90A 3KXKA 5D7BA 3UMJA 4ENVA 3SP1A 4TYWA 2LR0A 1JTFA 1GTMA 2XRYA 1SUFA 2A9FA 1T0PA 2B0CA 3LUPA 4BKQA 1YOBA 3I8OA 4KNYA 4DAOA 3TI7A 2G0AA 2PS1A 4BLPA 3HG7A 2YHUA 4MEJA 1Q1QA 2HDOA 1VE1A 3ZQJA 3WLQA 2MSKA 3CGGA 3FR7A 4G9BA 1RXYA 3BRCA 1T24A 1UMKA 3SLGA 1VPLA 2V4ZA 1MEJA 4LTNA 2WTAA 4EFLA 4PN3A 5JATA 2C00A 5CFOA 4RJTA 1FSPA 1TKRA 2NPOA 5DYNA 4O2AB 4F0JA 3TDNA 3AJRA 4NEQA 4TTJA 2Q1YA 4JP1A 3WLFA 1IHPA 2C7BA 2TMDA 4K9KA 4LF6B 1NUUA 1RM5A 2XQGA 3GUHA 2Q9UA 1P2TA 1BE6A 3QF4B 4ZVKA 3T38A 3P9NA 2GERA 4DMMA 5FNVA 4HWRA 1GPLA 4D0LB 1U1GA 1R0SA 2BKEA 2P2LA 1EJBA 3DDZX 4HWOA 1G4AE 1O87A 1XO1A 3EZYA 4L0DA 4M76B 5IDYA 1GPH1 3ZS9A 4YH1A 4QXAA 1N2IA 1FVFA 4KWIA 2D0DA 4MSUA 2ZJZA 4B43A 4C6TB 4PX5A 4DLNA 5C46F 4LYDA 4YWHA 1HSOA 3Q2IA 4TVOA 1JIXA 1PT6A 4QYIB 5JQGF 3DCNA 3WRYC 1FLDA 1M2GA 2ZTLA 3GP5A 4EAQA 4ZRNA 5C2JB 5IJ9B 2Z3WA 4M0UA 2XOKA 1TQ2A 3ZU2A 1DC7A 3M6AA 2NZWA 3FD8A 5DI3A 2P69A 4R1NA 2CLOB 2GN1A 1HWYA 2ZIXB 1EFCA 3V4OA 4QAJA 4B74A 1FFGA 4TUYF 1C0KA 1XU9A 2ZAOA 1K8QA 2VJAA 5HCNA 3OIFA 1FU4A 3MXTA 4FQ5A 2QRNA 1P9RA 2RCNA 1PYGA 2ENUA 1G20A 2OENG 4DILA 3CJTA 3LUFA 3HV0A 4FR5A 3O74A 1CQIB 1CJMA 1UEJA 3A14A 3I1FA 4DFDA 4A8JA 1XUOA 3AXSA 5AD1A 5AVVA 3F1KA 1YQQA 3LGAA 3M6XA 3QG5A 3SOPA 5M04A 2CFSA 5IP5A 4RU1A 2W6OA 3OT4A 4DE5A 2DHRA 1PQWA 1SOUA 2X1VA 1JQDA 1R9NA 3BMQB 4HDKA 3AEQB 4DV1B 1QGDA 4NBSA 4NNOA 8ABPA 2QVYX 3N86A 4XGNA 3I2YX 5I5EA 4IINA 1IY8A 5B58C 1QK5A 5FUQA 4BNIA 4US1R 1Q3HA 5JSUA 5L6MB 5JS6A 4L74A 3RT7A 3G02A 2IHJA 2X23A 4GNKA 1U9IA 1Y89A 1S7GA 4O3FA 1GGFA 1ZNYA 3BYZA 1QGZA 2AL7A 1SC6A 2HCFA 4W1QA 3B20A 1O2DA 3TOCA 1E1LA 3WGVA 4CTOA 4G0QA 4ZVLA 1WETA 2VWHA 1JILA 4L9AA 3VR5A 3TLCA 1G0OA 5B7PA 4NXNB 3SSNA 1YS1X 4O33A 1UC8A 5AHOA 1WDWB 3JYHA 1RXEA 3GV0A 5IKOA 2OG2A 1TVMA 1T1IA 3GRVA 2R2AA 1OFIA 1FZQA 1TRHA 3H4VA 2WD7A 4G5OA 4MICA 1MZPA 1OC2A 2GCOB 3L8DA 4GI1A 2OFFA 3CLUD 1JQAA 3P19A 4M37A 2FPGA 1ZGJA 1E2UA 2UV8A 1QO7A 4RVSA 4H08A 5FI3A 4JYBA 3V8MA 4YUVA 4DLZA 5HHTA 4QM7A 1WMDA 2R84A 2HLHA 5IBQA 1A8IA 4KMSA 1I01A 2GLXA 3P2MA 3PBKA 3LKBA 2BGRA 2APJA 4C76A 5HBGA 3OEWA 4Y6QA 3VKVA 2XD9A 4GI3A 3HXMA 3IRUA 2VF8A 4X6XA 5BOVA 5K0FA 1HDEA 4IUBS 1E3MA 5D8DA 4BN0A 4IOLA 4DCUA 2HU2A 4LJLA 2R4UA 2XQFA 1RPNA 2NVWA 2OD2A 3F5MA 1GFZA 3BMNA 2RARA 4KN5A 3PNKA 4MW0A 4PGFA 1D8TA 3U1TA 5LVAA 4II2A 3TQFA 3E9DA 4ZYTA 2VDRB 1ZN7A 3UANA 4CDRA 2GHQA 4CCYB 3CHYA 3VR5D 4QFBA 5CYOA 3RTAA 1DAOA 3HYRA 3SG0A 1CRPA 4KFSA 1MO5A 1QBGA 3HXTA 4F11A 5AVXA 4J0EA 4OFZA 2CVFA 1JH8A 2RHOA 4GXTA 1Y42X 2NT3A 3BDVA 3K9GA 4IF4A 5IG2A 4B6GA 1ZI6A 5EGSA 2ZYWX 1EHCA 1RLTA 2V6GA 1P4JA 3P52A 4ZJZA 2UVPB 4ZODA 5ED4A 3LYAA 2FPUA 3AUXA 1WKBA 3DTYA 1BVRA 1J5EB 3OA2A 3QOFA 2Z0MA 3V2UA 2Z2JA 4YO7A 4LF7B 3S70A 1ZICA 5C1OA 1I94B 3C6QA 5LQDA 2WPDA 1RKBA 3D54D 3SI7A 3LM8A 1XN4A 4B6FA 2WFLA 3KQMA 4DT1A 3RNOA 1IB6A 2P62A 1N9ZA 3UTDA 2GKSA 1ZRHA 1E99A 3C70A 3DYIA 4OXQA 4V0MA 4RTLA 3OX1A 3J80A 2H2DA 2OLKA 4CCSA 2N1MA 5DHPA 1NWHA 4DLKA 3UWSA 2FWBA 4L57A 4BLVA 4EARA 1X9GA 3EXIB 4LHWA 2J87A 3VHRA 2O5RA 1Q17A 5E4YA 5HJ7A 4BFZA 5TDHA 2IV2X 1Z75A 3OTOB 4NENB 1UJNA 4MRNA 3BEDA 2G6BA 4RZIA 4TLDA 4QPPA 5HEKA 3L79A 2ZUCA 4QLOA 4HFNA 1PRYA 2QT9A 2QDKA 3T5GA 2R8ZA 3AYZB 1ORDA 2W7TA 1IOZA 2X8BA 3HA3A 3ORFA 4OFWA 4JXKA 2B25A 4BQRA 2BCEA 1I0ZA 4I50A 1Y6QA 4ND8A 3KE9A 5HF5A 2X0EA 3IP9A 4F72A 5CDFA 3BHMA 1VDZA 4GS5A 4LJ4A 4GP7A 1BRTA 4JMPA 1A2BA 5HVNA 1EEHA 4C6HA 2XQJA 3ZBPA 3UATA 5EG5A 4ID3A 1MXHA 5DWDA 4DVGA 1BG6A 3RABA 4UU1A 1B93A 1U80A 3DM9B 4RKYA 2PZKA 3GD7A 4BE7B 2DOKA 3W8RA 4R3NA 5MN5A 1DKNA 4D41A 5DASA 3DDHA 5SY4A 4OJYA 4B9EA 3ETLA 3W5HA 2FKAA 1LPOA 1FIUA 2QRMA 4QEDA 3ML1A 3KL4A 1FU7A 2WPDD 1JHOA 2HRBA 1N7IA 1Y81A 3KB6A 4NV0A 4UPDA 4XQ9A 2QD5A 3BBLA 2IU3A 4H7FA 3NHJA 3RNLA 4MV6A 4N40A 2E48A 4MV5A 4WESA 2GRAA 1L4GA 4HDRA 3RLIA 2G5PA 4NKRA 1NJ5A 1Z0KA 3LDGA 2E2WA 4B4WA 2FGKA 5KTOA 3THYA 2JLBA 1V9LA 4XDGA 4X45A 4BRWA 1ZCJA 1JEEA 4MW9A 1NJ1A 3L1KA 3U7JA 4ZI5A 3W6ZA 5CP8A 2IC5A 2I4LA 4JGGA 2RCYA 3C97A 4P7FA 1Z29A 4WZZA 1Z07A 3Q7PA 5HCIA 4DHEA 1B14A 2G8NA 3SYNA 1YB4A 4V02A 4B6OA 2GLTA 3JZFA 1JR3E 1EWQA 2WICA 1V35A 3O9VA 3HJBA 1LDNA 3MBKA 3BQ9A 4FDLA 1CT9A 3IAS1 1BZYA 2BFDB 3PUZA 1I3CA 2CUTA 5C5DA 2IEGA 3H9CA 3Q0TA 4ZT4A 4NH0A 5B3KA 2G3YA 3PFHA 3GNSA 2PBFA 2V03A 3DV0B 3D0RA 3PC8A 3F4LA 5LU8A 1MUUA 1Z33A 1T5LA 1VIYA 2FFBA 4WASA 1OU4A 1S1CA 3W2HA 4CM7A 3HBNA 3KQKA 1ZN2A 2GZRA 3PX3A 3IA7A 2OV4A 4JYCA 1DP4A 4Y2PA 2QVLA 5AW8A 2QV7A 3V7YA 3S0JA 1FRNA 5C7YA 3PC4A 3PDIB 3BOSA 3H75A 3AVOA 3BJRA 4XJVA 3WVNA 4FEEA 3HN6A 4X20B 5FBZA 621PA 4C2UA 4JEMA 2XYVA 2OGWA 5K3OA 1D07A 4FFDA 3L7LA 3CXUA 1IQRA 5LKRA 2I67A 2WJYA 3MCZA 2FEXA 2PEZA 3O8LA 1U8EA 3OPYB 1G9XA 3TUZC 1P0QA 1UXKA 1MT3A 1AS2A 1QOZA 3ZU4A 3ZWMA 1DRUA 4FZ3A 5AVOA 4JCOA 3R3XA 4EJ2A 4EJFA 1G19A 2IEAA 4J2OA 3R7DA 2EYUA 2PU5A 4EMBA 1DWPA 1GUYA 3CCBA 1A7KA 1Y8AA 4CLRA 5H5JA 1C4XA 5AM4A 5K8JB 4JOCA 3ON5A 1ABEA 3O8OB 4LJ8A 3CNHA 4UARA 1FTYA 4WXRA 1LF0A 1WCV1 4QU5A 5EN4A 4JI5B 3X1KA 2QG9A 1EIZA 4J8PA 1ZA2A 4QDZA 2ZEJA 3SR4A 1J24A 2L42A 4JUDX 2F4VB 1OBVA 1L7EA 3E22B 3FE2A 4FEYA 3UK7A 1DPGA 4FC6A 1ZJYA 2IOQA 3WGQA 5IAJA 4IQ0A 4CTJA 2AOUB 1IEQA 5HK9A 4HAUA 1G7SA 3FDXA 4LAFA 3FFBA 3ICCA 3ZZUA 2XCQA 5CDUA 4JXJA 3D1JA 3M81A 4YIHA 2P4SA 4UBIA 1RXCA 4RMIA 4CRWB 1O6CA 2GN6A 4FGWA 4KL8S 4LYYA 4E3WA 3FOEC 4BB0A 4D81A 3IQIX 4A9AA 3SVTA 2R68A 4H7KA 4UM5A 3ZQKA 4F4IA 2C57A 3RROA 1GGKA 1L7NA 2W90A 3OMWA 3S1SA 1EK1A 1M6EX 2GJ9A 1K0UA 2IVFA 1NNLA 1DIOB 1EJ2A 3LQRA 4O8CA 3TLMA 2GD6A 2KW5A 4P4UA 2R47A 4EG5A 2VEDA 2YN4A 4GICA 4L7QA 4O2BF 3UT5B 3AHHA 2G1JA 1Z9BA 3JAKB 2Y27A 4EUNA 2XITA 3TL2A 4N5NA 1CY6A 1PT5A 1F8FA 2XMCA 4HGYA 4EJ0A 1QFXA 4JI2B 2FV8A 2ZXFA 3OO1A 4NMHA 1ZUNB 4L78A 3L0ZA 2JJQA 2XAAA 2EKQA 1I30A 5IJAA 5IEJA 4AY2A 2GGSA 2GEDA 1JWLA 4KOAA 1NMQA 1I0IA 2OAGA 4TKLA 3OD5A 1QWOA 2QD3A 2NMVA 1C0EA 2JFYA 4M22A 1T2FA 3CLUC 4R9RA 5IASA 2FR8A 3LCMA 3ET4A 1ZVQA 3THWA 1KJWA 1TPYA 3MT9A 4S1NA 4BAZA 4EJSC 1VBFA 4NICA 2ZI3A 5CU7A 2IXGA 2E5FA 3DBLB 2BBWA 5IUJC 2GH1A 1OX4B 5JZBA 3WJAA 3UW1A 3GH1A 3L6DA 5AESA 4AUMA 3BB3A 1NOIA 2X1MA 2YY6A 3VVBA 2DBRA 5F1KA 3S68A 3A8TA 4B4KA 3IEVA 1CEQA 4L28A 1I7DA 3AIIA 3ANYB 1RHKA 3H6GA 4Q15A 2BJWA 4HADA 2X4LA 4D92A 2E82A 3UT6A 2GXAA 5EFOA 1MJGM 3M1AA 2QZJA 3EMDA 4AUEA 1L4YA 4R3UC 4RYLA 1KE1A 3ZWDA 4DIUA 2B3TA 2FZGA 1JKMA 4P3PA 3EGIA 1PWHA 1M34E 3I83A 1Z28A 5KJFA 1XZEA 1BEZA 1GXSB 2FMFA 3UH1A 2FMKA 2H1VA 2H48A 4M1OA 4DEXA 4N1AA 3PHJA 1I4WA 4KE7A 3CG4A 1NIPA 1M2NA 4GRIA 3P2IA 4IXMA 1GYQA 2M9MA 5EMKA 2IHUA 4AMGA 1FS5A 3DD1A 3E9CA 3RQSA 5C8XA 2QRKA 3CZCA 3U60B 2BKVA 4X8MA 2PSDA 2OFWA 1A4XA 2QW8A 1AU9A 2CEAA 3GLFE 4EO9A 1PL0A 4GDFA 2BEKA 3MJTA 3ZLTA 2DB3A 2HB6A 2I6FA 4LK2A 1V3QE 1XN1A 3PHGA 3VPHA 1R8SA 2WIKA 4R1TA 5DGCA 4LZAA 4UXHA 2P67A 4XDZA 1YZNA 3O38A 1RW4A 4YJKA 3EDQA 3NRCA 4IZOA 4YRIA 1NXPA 3B38A 3C1OA 3M89A 4NG4A 1HOTA 2JA2A 4XD2A 4C78A 2X5KO 3MSXA 1KP2A 3K71B 1J8VA 2IEZA