4YH1A

Structure of human scp1 bound to cis-proline peptidomimetic ctd phospho-ser5 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
total genus 55
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yh1A00
1CR6A 4ZEWA 1L7PA 2B8JA 4ZEVA 2WF8A 5AW9A 1AQ6A 3OCZA 5JJBA 5AK6A 1YS9A 4BEVA 2GFHA 1U7OA 3QNMA 4CF5A 1RMTA 4Y2XA 5AK3A 4HGRA 5ALUA 4NABA 1JUDA 1Q91A 1TJ3A 3U7GA 3FGOA 4UASA 1X42A 5AW6A 2W11A 2IOHA 4XPZA 2G07A 1O08A 1RQLA 4RETA 3MN1A 5ALVA 1L7NA 2IOFK 4JB3A 2PR7A 3MPOA 3ZTWA 3OCWA 1J97A 1TJ4A 2WHEA 3M9LA 2YMLA 1KYTA 1J8DA 2YJ5A 4L6CA 4EX6A 3QU2A 5AM5A 1LVHA 3KZXA 5AKKA 1YJ5A 2ZBGA 2ZBDA 4QJBA 3U7HB 4IG4A 4UATA 4CF4A 3ESQA 1RLOA 4BYGA 3NRJA 3KD3A 2FPUA 2YMQA 5AI4A 3L0YA 4FYPA 4EEKA 4EX7A 4EZEA 3J7TA 3W5CA 5AHXA 1SU4A 3PGVA 1YDFA 2EATA 3N8GA 2HOQA 4Y2JA 4PNHA 4F71A 3MC1A 4UAUA 3ET5A 3ZVNA 3QUBA 3ZU6A 3QYPA 1Z4NA 1WR8A 5AKHA 3OPXA 2WF9A 4KN8A 5IT4A 3QGMA 4HGPA 3WK7A 3FM9A 2RAVA 3OCVA 1N9KA 5ALHA 2ZOSA 1ZD3A 5AI5A 2HDOA 1VJ5A 1Y8AA 2C9MA 3MMZA 5ALZA 4BX2A 3DDHA 3IJ5A 5ALJA 1N8NA 3EPRA 4DWOA 5AVYA 5ALGA 4MWOA 2O9JA 5FP0A 2EAUA 3OCYA 4KYTA 3ZWDA 2HSZA 3L5KA 2FUCA 3W5DA 3HLTA 3WKBA 2RARA 4UM7A 3OTQA 5AVUA 3WKAA 5ALWA 4KNWA 5AKJA 3AR8A 3QUTA 5AI0A 4UMVA 2G08A 3B8EA 4HGOA 4OCZA 4BEWA 4HGQA 2WFAA 2HO4A 2IOFA 3QLEA 5IT0A 2WF7A 3WGVA 2WF5A 5AM0A 2NYVA 3AR6A 3QU4A 5AM1A 1L7MA 4BNDA 2C4NA 4BNDB 1IWOA 1LTQA 2FPSA 4UU1A 3R09A 3P96A 5A3RA 4I9GA 3I1YA 2CFRA 2I7DA 4NV0A 1U02A 1QYIA 4FFDA 1F5SA 2VKQA 3KC2A 3U7EB 2GHTA 2Q5EA 5ALNA 2YMMA 5AVQA 1U2TA 3SLRA 4DW8A 3RFUA 2R8YA 1Z4IA 3PDWA 2BDEA 1RMYA 1QQ5A 2AGVA 4YIKA 2W43A 3B9RA 2Q4RA 2HF2A 2I34A 2CFTA 1T5TA 4L57A 1T9ZA 4AP9A 5ALXA 1Z4MA 1Z4PX 5AI6A 3R9KA 1WVIA 4C4SA 3OCUA 1RLMA 4UMFA 4Y2RA 2C88A 3SF0A 5AKEA 2YMPA 3KBBA 1VJRA 2R8XA 3EF1A 5ALRA 3M1YA 3UMBA 3N28A 5AW1A 1L6RA 1XVIA 2YBDA 3ZUPA 3AR2A 2GMWA 5AM2A 2ZBFA 1Z4JA 1Z5GA 4UW9A 3WKDA 4Y2VA 5IS2A 1ZRNA 2Q4TA 2NO5A 5E0OA 5A3SA 5A3QA 2GHQA 2MU1A 1Z4LA 2JARA 4KNVA 1S8OA 3S6JA 3L8HA 5ALLA 2YJ4A 2OA0A 4FE3A 2HHLA 3QU7A 3ZVMA 1U2SA 2G09A 5AKGA 5ALTA 1Z5UA 3U26A 3AR5A 1U7PA 3L8GA 2YJ6A 2C8KA 4CF3A 2I55A 2P11A 3FZQA 4IFTA 1Z4OA 3QX7A 4NWIA 3UM9A 5AW7A 2QYHA 4YCMA 2GO7A 4C4TA 4GXTA 4G9BA 2G06A 3W5BA 4KX5A 1ZOLA 1Z4KA 1XPJA 5AW4A 4YCNA 3SD7A 2PQ0A 2ZXEA 3ET4A 3ED5A 1QQ7A 4Y2SA 4DCCA 2G80A 1WPGA 3RF6A 5AVVA 2D2VA 3U19A 3WK6A 2EARA 2OBBA 3DNPA 2B1QA 4BBJA 5ALKA 3WK4A 4HYTA 1SWVA 1VFPA 5ALMA 3DAOA 2B30A 2P27A 5ALQA 3BA6A 3E81A 1SWWA 3QUCA 2AH5A 4OFZA 4XQ0A 2O2XA 3OCXA 4DFDA 5AVSA 4Y2QA 3L1UA 5AIBA 4Y2TA 3D6JA 4J03A 3ONNA 2OM6A 2RB5A 3FPSA 3WK5A 1WZCA 1EK1A 2AUTA 3B9BA 5AW8A 1L8LA 4QQFA 3TLMA 5AI9A 3PGLA 3WKEA 2I33A 3QXGA 3I76A 5AESA 5ALEA 3UMGA 3SHQA 2G0AA 3NAMA 3L0BA 1Z4QA 5AICA 2ODAA 4UM5A 2OYCA 3AR3A 3SMVA 5AM4A 1NNLA 3KDPA 5ALPA 4E88A 1TJ5A 2P69A 4XE5A 3AR7A 5ALOA 1RPZA 2W4MA 3VAYA 2C8LA 4GIBA 5AKXA 3I6BA 3E84A 5AW5A 3WK9A 4F72A 2ZG6A 3N07A 1RLTA 1RKUA 3ZW7A 4OHFA 3E8MA 1CQZA 2YJ3A 3AR9A 5AVWA 3N1UA 1QQ6A 2YFYA 3A3YA 2HX1A 3QU9A 2HEGA 2BY4A 2R8EA 1NF2A 1YV9A 2B1RA 2FI1A 3HYCA 5AM3A 3IRUA 3IB6A 4OD0A 5AVXA 3WK8A 4YGYA 2IYEA 4AS2A 4J2TA 3ZVLA 3KOOA 3WGUA 5AVTA 3QU5A 1TA0A 4C4RA 5AVRA 1FEZA 4JDPA 3FPBA 3EF0A 5AKLA 2JAWA 5AI8A 3ZX4A 1YNSA 3GYGA 1L8OA 3L7YA 3ZWKA 4CE6A 2R8ZA 2JAOA 3E58A 3I28A 3EWIA 2MSNA 2FDRA 1ZRMA 3ZTYA 1RQNA 4MUMA 4Y2PA 2HI0A 3ESRA 3U13A 1NRWA 2DQSA 2JGAA 3K1ZA 2JAUA 1Z88A 1YMQA 2X4DA 1TE2A 5AW0A 2CN1A 3SKXA 3CZ4A 1EK2A 1L7OA 4NAVA 4BX0A 5AK4A 3ZX5A 1ZD4A 3AR4A 5ALFA 2B0CA 4AS3A 5AKYA 4Y2UA 2AMYA 1ZJJA 4EELA 3BWVA 4NFLA 2G1AA 2NO4A 1XP5A 1ZD5A 4ZEXA 3QUQA 3W5AA 1ZS9A 4YCLA 1RKVA 5ALIA 3NASA 3UMCA 2HCFA 3CNHA 2BDUA 3PCTA 1O03A 1RMQA 2PKEA 5AIAA 3SKYA 3R4CA 1K1EA 4HGNA 4Y2YA 3F9RA 2I54A 5AKIA 3L8EA 3L0CA 4UAVA 2FEAA 2HF7A 1S2OA 4KX3A 3A1EA 3N5KA 5AKZA 3A1CA 1Q92A 4BKMA 4Y3UA 1MH9A 3A1DA 4BX3A 2FUEA 2QLTA 5T41A 5AW2A 4EENA 1ZD2P 2ZBEA 1RC8A 4YIHA 4XOUA 2B8EA 3NALA 2YY6A 3L8FA 5ALDA 2IA5A 4RESA 5ALYA 2YN4A 2WF6A 4I9FA 1T5SA 2WM8A 2I6XA 4G63A 2CFSA 5AW3A 3NUQA 4B6JA 1RKQA 4UMEA 2RBKA 5AK5A 5AVZA 2P9JA 3DV9A 3U7FB 4H1WA 4L6AA 2FPXA 3L1VA 3FVVA 4O8CA 2B82A 4CNQA 1RRCA 4HAIA 2FPRA 3ZI4A 4UU0A 1RDFA 4UMDA 1QH9A 2FPWA 5ALSA 4UARA 3NANA 3WKCA 3NIWA 4YH1A 1PW5A
chains in the Genus database with same CATH superfamily
1L4FA 2JANA 1JH8A 1F9EA 3P2MA 1D2HA 4EW2A 2ZREA 1NDQA 2ACKA 3UY4A 1HNXB 5FTJA 4XDHA 3QVMA 2HJGA 2Q0SA 3SZRA 3FH0A 5CH3A 1YZTA 4I08A 1TO2E 3RJZA 4NMHA 1JGTA 4OB8A 4Y2XA 3HKCA 1CUVA 2J41A 2Z5VA 4UHCA 1GPH1 4DT1B 5ARBA 4BN0A 4K6OA 1PQYA 1XNHA 1J42A 2QMQA 3QELA 1RQPA 2GVZC 1KAMA 2VN8A 4FFVA 3CR7A 4ZYZA 4Z7NB 3VU3A 1E9SA 3R6WA 2VH2A 3BQMB 4WGGA 1QP7A 3AUXA 4TYQA 4PYNA 1T0HB 1U3VA 2O8VA 5TGDA 4B3FX 4DMFA 1L7NA 3IKTA 1I1HA 4LSWA 4G1UC 4GR9A 4YBRA 1N33B 2XTJA 2B4AA 4R9VA 1Q15A 4JENA 3PE3A 2Y05A 3SHVA 3FGPA 4NJMB 4OGKA 4C0AC 3I6ZA 2Q3JA 4D99A 2AR7A 2JFXA 3P9PA 2AD5A 3U7HB 4OLJA 3OM9A 4CTOA 1JBQA 4XGRA 1EDZA 2E48A 4LNUB 4EGFA 5L51A 3ESQA 1OYOA 5T6BA 3SJCA 4EKEA 1E60A 4G01B 3ZKWA 4BFVA 3QA9A 1LFDB 2QBYA 4WK6A 1R15A 2EYQA 3U4HA 3PEVA 4RH1A 1D1QA 1XQVA 4P31A 3WHIA 2PUFA 4HWOA 4M7PA 1RVV1 3MXOA 1ZXBA 2FSVC 2XMPA 2XUAA 4A91A 2ZRPA 3L43A 3H5WA 2Z2JA 3L4SO 4O2BB 5T4EA 3D02A 2ZS7A 4E03A 5JARA 5J47A 4JLVA 2RB4A 4FBMA 4AKEA 2J5RA 3GDGA 3WQRA 1GRNA 4E3WA 1P7ZA 4XD2A 3ZV7A 2OK8A 3ZJYA 4LMBA 1JI3A 3N8DA 1N4AA 3ZCRA 1AXRA 1ZD3A 1G8PA 1TXGA 3FFWA 1JHRA 1V6SA 2ZYDA 4MWZA 3H5RA 2C07A 2HDOA 4QGHA 4FCTA 2WY2D 4BX2A 1JEAA 2P2SA 3KTAB 2POCA 3LDHA 2QE6A 2X4LA 3MWKA 3UGKA 4OJYA 4JUDX 2P9ZA 2ZUUA 1RJWA 1MNQA 2EAUA 3ACCA 3N2LA 2XHZA 3O8QA 4MQ4A 4Y8VA 3TBFA 1JQ3A 1H8HA 4B81A 1TO1E 3W5DA 5F78A 1CF4A 1E94E 2IEYA 3LK7A 5AVUA 2R7MA 2IHBA 1IPHA 1I51A 1QF9A 4HDCA 1ZFNA 2B4QA 4HDMA 3VVMA 4BFXA 4ND8B 2PFKA 4BMSA 1SUEA 4Q82A 4QTZA 1UXJA 3IDOA 4E2XA 4HGOA 2LCFA 3F5MA 1GZSA 4WKPA 3ZE0B 4ZYVA 1ZHOA 4JODA 4GLJA 2CXQA 4A6EA 2BGJA 2RHTA 4R83A 2C7PA 1V0JA 3RABA 1B6SA 4H7PA 1NRJB 1OVMA 2ETXA 1FC0A 3WIVA 3EGXB 2W2QA 3AC0A 2CDBA 1ONPA 2WYHA 4BDSA 4DIKA 1NVAA 2KS6A 3K0BA 1PUJA 2BZ1A 2ZE6A 2D4AA 4PYOA 4RZQA 4IXDA 3V7FA 4A27A 1MX5A 3AEXA 2WP8J 2UV8A 5K05A 3OO0A 2WHRA 2P9YA 3D4OA 3VAAA 5FV4A 1CKEA 1SEPA 2O2DA 5A5FA 2OWEA 1G2QA 4NZPA 4PRZA 4QICA 4TTTS 2FN7A 3KC2A 4M0UA 4GLOA 5EEHA 4JNKA 3AVOA 1T1SA 3I9OA 5EAIA 3FCSB 3P52A 4C6SA 1U2TA 4I6EA 1K5GA 3DZIA 3ILVA 4B3SB 4CCYA 1CRWG 2HDNB 4DW8A 1V16A 5B3KA 2Y76A 2CZCA 3KQOA 1U2GC 2NXWA 1QAMA 3DOCA 3KV1A 4G1VA 1B1AA 5J59A 5B55A 4KHPB 4NMLA 3GC6A 4MNTA 4F21A 3STUA 1T0PA 3KD2A 2Q4BA 1EK6A 4DDMA 2Q4RA 1DAIA 1LDNA 1Q77A 1WDKA 3CG0A 4NV3A 1R4MB 3HZOA 4LGYA 5DBIA 4KWTA 2Z83A 1U8EA 5EZYA 1JW9B 4NARA 1SN7A 1WVIA 4MS4B 2Y6VA 5DYTA 1F48A 4AWBA 1RLMA 3HJCA 4LZOA 1DRUA 2B5WA 2QW8A 3B13B 3FCUB 4M83A 4TZTA 4UZFA 4HHEA 5LZ5A 1AKRA 2HU5A 2QT9A 3O94A 4JLOA 4XYEA 4D96A 2Q41A 4RKFA 1TVEA 4GBMA 1VJRA 4R3UC 3DGEC 1P33A 1JJAA 1G5TA 4KFTA 2QMYA 2XZDA 3G2LA 4MW5A 1AGYA 4URVR 1FNDA 2VDMB 2ZRCA 5E7IA 5DNYB 1KMCA 2PRSA 2PZ8A 5EQJB 1VLJA 4RENA 4OY3A 1Z4JA 4F5YA 1HM5A 4J76A 4ZQHA 4JLWA 2QL5A 2PX6A 5EXSA 1SBIA 3RRNA 1CQPA 5C8ZA 1JE0A 1X3SA 3O8LA 3SYNA 1IJFA 5JCOA 1CHNA 1FXWA 2GZ3A 4YQYA 2VJLA 5FNVA 3W0LB 5KU7A 3JU3A 1BDHA 1TQ6A 1XKXA 5IW8A 3UHJA 1BRTA 2VYVD 1YQXA 4LYHA 1DBQA 3LP8A 1TUBB 2X4GA 3W8NA 4Q16A 3GJXC 4MZDA 1GKIA 3S6JA 2QD1A 1U65A 4YV7A 2H5JA 4RZSA 1ISFA 5F73A 3CJQA 4DKJA 3NEPX 1RFLA 1G2OA 1NJSA 2P5TB 3ZIAD 3SZMA 2XCLA 4PLYA 4DYHA 1DAPA 4BJ3A 3W3AD 2EZ8A 4IW3B 1QZUA 4H6WA 1G5QA 2XKJE 3KT8A 1QU2A 1DEHA 3ZWXA 5EFOA 2NVUB 1THZA 1ISJA 2P11A 4TXNA 3K30A 5HS6A 5C1DA 5FWXB 4A0QA 4Q7EA 4KCGA 1UFOA 3DO8A 4IFTA 5CYPA 1ETUA 2AOWA 2GO7A 3A6PC 3TGLA 2O8EA 3I6YA 4KITB 2IWRA 1J4AA 3NTOA 2SNIE 5CCEA 4WNIA 3QK7A 3UJNA 4X6XA 1IMJA 4CCWA 1NW4A 2CL0X 4POOA 1Z4KA 1BXRA 4C7OA 3GI1A 5ES3A 3RFTA 1J90A 1F20A 2FUNB 4X90A 1SQSA 4HNQA 4UCWA 5JHGB 3ET4A 3ED5A 2D2EA 3KEGA 4KR3A 1WEKA 3V8EA 4DN6A 3I5UA 3RYIB 2ERYA 2Q8NA 1V7ZA 1XIVA 4BE4A 4ZRMA 5LR6A 2JAQA 3OQBA 4DDKA 3RRBA 2WD8A 4QQ8A 2Z2YA 3LXMA 2QRMA 3V2HA 3FCYA 3A2NA 2H85A 3E81A 1L7DA 3K1JA 2BJVA 4HWPA 4Y6SA 5JI3E 4J0EA 1GDDA 2B1JA 2FQYA 2GAJA 1U04A 1NUTA 4YBZA 1QMGA 2F00A 3DTTA 4OHUA 5JSZB 2VSYA 3C7DB 3Q3CA 4ENSA 4TXHA 3DWIA 1U3UA 4WCFC 5HZHA 3IXMA 1C4XA 3WK5A 3DCJA 4CLOA 4RSMA 1E1MA 4JASB 3WGMA 4BMZA 4BPBA 2EZ9A 1MHPA 4R1SA 1YASA 3MT9A 3O8BA 3BGOS 1MX1A 4DDWA 3TOXA 2A4KA 2O23A 3ZW9A 1EGAA 4JQOA 3UMGA 1ACMA 3PDIB 3NHYA 3PKIA 3C3CA 3E4CA 1JKFA 3GFBA 4FU0A 2VHCA 1QC5A 4M89A 3CZAA 4AKTA 3ZHRA 3ORYA 4KG7A 3J81k 1JG3A 3F9CA 4HN2A 4Q6WA 1D2MA 1N8SA 2E4XA 2P5SA 2XODA 3QE3A 4LTNA 4MA4A 4FSHA 1T5DX 1UBRS 1J56A 1W25A 3WADA 1RABA 4PGMA 4DQKA 2XCQA 3GBVA 4WK4B 4WLNA 3WOVA 4MKRA 6CHYA 1CUYA 4H0NA 4XE5A 5BVGB 1DLIA 1EEHA 5C7OO 2CYCA 3QFTA 2GH1A 3FDJA 1UIMA 4QO8A 3B89A 2C5FA 1PO7A 1UBGA 2JAPA 3I6BA 1P61B 4JLPA 4NBVA 3ZJ5A 1RE0A 3B48A 2ZBUA 3MPUA 4BO2A 1ZCJA 2N0SA 5DNEA 5JFOA 3QX3A 1GFIA 4F12A 4BNJA 3ZDAA 3MS4A 2G5TA 1EM8B 3T4XA 4NZ9A 1FVHA 1EXMA 2AVNA 3KEQA 5BQOA 2MR6A 1Z26A 1K9SA 1M74A 4Z0NA 2ACWA 3V1KA 2R6HA 4DR3B 2O8BB 2NPOA 1XMIA 4LF6B 2VK8A 4V38A 4ND1A 4X6YA 5JPIA 5GY7A 4JI0B 1OFUX 3EG9A 2UZ1B 3TZEA 5K09A 1W5TA 2XQKA 2PD6A 3FMPB 1CFZA 3DVAA 4TRNA 3JVUA 1XQ9A 1M6EX 1GPKA 4BJ5A 2UVDA 1IG3A 3J81A 4J2TA 1TAGA 1ND5A 3NI2A 4JSTA 5KOHA 3W2TA 1L7VC 2RI6A 1NQOA 3MA0A 3VZQA 3N70A 3WGKA 3ZKAA 1OH7A 1BGVA 1FFCA 1D2NA 5AKLA 1NASA 1RCTE 1FX0B 1W9MA 3DB1A 1PNOA 1YC5A 2PQ6A 2ID9A 2W6NA 5E2AA 2ILTA 1JA1A 2P6RA 3OZDA 1Z7GA 4V1CB 1NONA 5EESA 1QDEA 4B8YA 1ZCZA 4PLVA 2EF1A 4BAUA 5IT5A 2MYUA 2DBRA 3AKDA 3HSSA 5IAJA 3VSCA 2WC1A 1Q1EA 3N39C 3OC6A 1NRWA 3K9LA 1A9YA 5FBKA 3UW1A 1J1UA 1S9DA 2ZIZA 3BRSA 1RBQA 3AUAA 2GSWA 4H4CA 4DNXA 5K01A 5E4TA 1C1HA 1XN1A 2R65A 1F0KA 3IAS1 3WLMA 3W3ZB 1U5CA 5IXSA 1BOOA 5KMGA 2VNJA 1CPYA 1HYGA 3VISA 1GEEA 2A59A 5AQ1A 3KKOA 1T43A 3NYWA 3VOTA 2XYGA 2EQAA 2WZDA 3EG9B 1GVHA 3V00A 3ZX5A 1UOOA 3FNIA 3H2BA 5EMMA 4X64B 3GVHA 3DKKA 4EBBA 1HRKA 3ZS9A 3L1JA 2YHUA 3PNKA 2HRZA 2OO3A 2RHHA 3QHAA 3R1IA 4AIIA 4DF3A 1JKMA 4LRTB 1XQWA 5CA0F 4NYJR 5EIWA 4YP1A 1C3XA 3GEGA 2VATA 2J46A 3UMRA 4CMKA 4FHCA 1E3SA 1BH2A 3QWAA 4IDDA 4M7RA 5FEUA 3IQZA 1Y5NA 1ZNQO 3IGFA 3IIIA 2P1ZA 3UA3A 3PGKA 4C7BA 4PZPA 3AWDA 4QO7A 3PEYA 2WMOB 2ECKA 4JKOA 2XXAA 3NH6A 2TMGA 1XCGB 2FZLA 2Q5LA 2R66A 2WIFA 1K1EA 5HW0A 4Q37A 1N5RA 5DBGA 1FXUA 4HJXA 4I5IA 5HBRA 3DJFA 4PGHA 5AVJA 3BAZA 5KAMA 4B4UA 5DHFA 1UFQA 1YUBA 2OFFA 1TM7E 4EEXA 5JCPA 4KX3A 4CMGA 3A1EA 2OBXA 4JA0A 5AKZA 1ML4A 3ROQA 1EFKA 1RWPA 2VJQA 1X3LA 3C1TA 1A72A 1R8SA 3DDZX 4R2MA 3ZWVA 4F45A 1JEQB 1DBIA 2C58A 2Z43A 5CVJA 1K92A 1T4BA 3EVGA 4FB4A 1TVKB 4W7SA 1YE8A 2LKDA 4OMDA 1IXZA 3BE4A 2WG0A 3I83A 4TVSA 1G9SA 1CV2A 1M6VB 1OCEA 1WE2A 4XUEA 2Q9BA 5DYWA 2NO7A 4D98A 4K46A 8LDHA 4B3JA 4ECEA 2NZXA 3C39A 3ODGA 3TJZA 3GJ0A 1ESDA 4I50A 3PRHA 2BFDB 2GYYA 3B70A 1ULBA 4IUDS 4N7JA 4KQ2A 4MVJM 2PX2A 1RKQA 4DG8A 4M1ZA 4EMUA 4W9NC 5F1OA 2XDYA 4M0KA 3C5WP 4TRJA 3U3DA 2GZDA 4WKBA 4BQEA 1KO4A 1YH3A 1KOJA 1DWPA 2BFPA 2GA9A 5AOBA 3M6UA 4INZA 4L1KA 5KBYA 1U80A 3BQ9A 4XWKA 3KPYA 1JRLA 3UJ7A 5FBZA 2HAEA 3KYDA 1JR6A 4GPIB 5DI3A 5IYZB 2ZBRA 4B76A 2H7VA 3PEFA 5SY9A 3H3JA 2WMYA 2R62A 4XB1A 1Y9JA 3E9CA 4L4UA 3LV8A 4ETWA 1M0WA 1ONSA 2DT5A 3L7MA 2P4UA 2QRZA 3V32A 1UANA 3N59A 3R5HA 3KWLA 3TLGA 1CLUA 2FX5A 3GELA 1Z75A 1NATA 1FMFA 3ESCA 1U8YA 3Q6IA 3DZKA 1JIQA 5GOZA 3UOGA 1O54A 3WHPA 1EKXA 3V8MA 2H9AA 4AUNA 1PIWA 3G0OA 4DY6A 1TTTA 3UB3A 4DLTA 3Q5DA 2YYSA 2BR3A 3W8DA 3M5CA 1C0KA 2EHJA 3EDRA 2ZSEA 4ID3A 4ZODA 4ER3A 3BWBA 1RRFA 4IKPA 3ST7A 2RI0A 1DJOA 3BD7A 1LDYA 1QKIA 1J33A 1N6NA 4RH3A 4NU8X 2Q6OA 2QK4A 4IDQA 1H1LB 3D9QX 3OO1A 3DM5A 5DGDA 1A8HA 4IGFA 4EZIA 5EOVA 4C4PA 1M73E 1Q21A 4MQFA 3V8NA 1CQJA 1Y0BA 4DCPA 3PQ7A 4GMGA 2PR2A 2GB4A 3ETNA 4HQRA 1HE4A 4W9NA 4CM5A 1SXQA 4MGKR 4DJAA 4NENB 4EM6A 3G0GA 1D6SA 4JKYA 4XYMA 5K3SA 3GNLA 2X22A 2PFGA 4J2HA 2RBGA 4FFLA 2D4HA 3AM4A 3IQXA 4KAXA 1SEVA 2GBPA 3TS1A 2BJWA 4BN5A 1L5LA 1JEQA 2RGNA 2ZI6A 4DOMA 1PWHA 1LI7A 3OJ0A 1RLIA 1LVUA 4L6CA 4MSUA 4I55F 1WB4A 3CZRA 3KKKA 4GOJA 4PPYA 1ZG3A 2AFHE 2FU5C 1L5ZA 1SUPA 2JFFA 3BJZA 1EX9A 4RPIA 5E6SA 1P9WA 4CF4A 2YKGA 1YOBA 2EFHB 1EESA 2YMQA 5HK8A 1M6WA 3K53A 1I30A 2XOKD 4R81A 4R8KA 2H5EA 2C4KA 4V0KA 4K9LA 1RI2A 1E69A 4DE5A 5KSYA 5BVHA 3NMUF 3FPLA 4DRYA 3H7IA 4UAUA 4MGIR 1G291 1JTEA 4OQMA 4EJ0A 1POXA 5EHQA 2WM2A 4O4IF 1SVSA 2IY9A 5BMVA 1E5QA 3QBEA 2DCUA 3DEJA 2O19A 4FYKA 4E33A 3ZXXA 2VHQA 3GNQA 4D1YA 4YRTA 3WR5A 4JIMA 3AESB 2XXBA 3MEQA 4JLJA 5EJIA 4D97A 2JEZA 5CHYA 1AUPA 4K8RB 4YJFA 1PWZA 5JRJA 4JL6A 3BH0A 1YU6A 2H16A 5JW6A 1Z63A 1XLTA 4R0VA 3OSZA 1W35A 1POWA 2V1XA 3PS9A 4OYRA 2V7BA 3F3KA 3BKXA 4JB2A 5AI5A 1U6KA 1VJ5A 4MS4A 1JIKA 3DP7A 3NORA 1SKAA 1K2WA 1E0AA 2VZ0A 4WPGA 4TMYA 5ALGA 1UT8A 3NTXA 3SR4A 2WIJA 1BWRA 1Y1QA 8ABPA 2WT9A 4HXGA 1RP1A 4K9PA 3W77A 1RPTA 2B7CA 3A9WA 3X2SA 4WZBE 3HK2A 1MAHA 1GQ2A 1PT8A 2N1BA 3MIIA 2BFBB 3CNOA 4HB0A 5E9JA 2J3LA 2EZUA 4L9RA 2CW5A 4PYKA 4QQKA 5JQGA 3Q6MA 4ADSG 3H2YA 5AKJA 5LDDC 1KY5A 3OTWA 5JNSA 2BFOA 4AROA 1OYVA 4EGAA 1CUGA 2Z56A 3AUFA 3HXKA 3WGZA 2AFRA 5JS1A 1R2QA 5I9LA 4F5EA 3MUEA 2K2QB 1GYRA 4IHQA 4QOGA 2CXPA 2R86A 1GPWB 3MINB 1YA8A 1YFKA 1LDEA 2XVAA 3MQ4A 2GETA 3AQIA 3FGNA 4H7HA 4MKXA 2VQ3A 5EWLB 1FTSA 3UCFA 4N0DA 3KQTA 3R3UA 1JMKC 1OBOA 2OYSA 4BMCA 4IH9A 5JNUA 1P80A 3QPCA 4FZJA 1OWNA 2OHVA 1E9VA 1DX6A 5A3VA 3TTYA 3S0JA 2D1FA 4E94A 3DYIA 4EGCB 3SG0A 4OB6A 1OA1A 1E3LA 1V2GA 1S2MA 1WP4A 1GGFA 3M5WA 2I03A 2X9VA 4MV7A 1HWYA 1VHLA 4NK4A 1WZ2A 4BLPA 1OOEA 3W04A 1NAHA 2ZTMA 5A5DA 2B7BA 2C97A 1BVYF 3UMMA 1JHQA 3GUCA 3FOFC 5CDFE 2PWAA 4CKBA 2EEZA 1PX0A 2ZJ2A 1V1MB 4QKQA 1RJEA 2RHRA 2HSJA 2Q45A 3DR5A 3LYHA 4RZIA 2OKCA 4Y7CA 1NMXA 4XYLA 2J0SA 3RG8A 1Z4IA 1LY1A 2QD4A 3R20A 1L1FA 1B41A 3TD2A 1ZJ5A 2IYVA 1QQ5A 2VA9A 1ETHA 1JWBB 2NUPB 2BHLA 1Y9EA 4JI7B 2C3PA 3V4PB 1B00A 2A0YA 1QF6A 4AP9A 3FMOB 4PWZA 5DM1A 4KUEA 2F7SA 5ESDA 2QVLA 1GYQA 3QMMA 1L4LA 1S6YA 4LAFA 3HYSA 3ZHOA 2CNDA 2VT7A 3MRTA 4ETNA 3KOMA 3QP9A 1H3EA 3E3LA 1PTJC 4G0PA 5JDCC 4TS1A 1X1CA 1Y1SA 3ENQA 2F4NA 3K0FA 4RGBA 4C78A 1G59A 3HJRA 4RTRA 4L5IA 2W00A 2D1TA 1V3VA 2G77B 2WZQA 1PX2A 2YZGA 5DN9A 1U3DA 3ORHA 5AW1A 4V3CA 1N7JA 3VUFA 2YUTA 4RF2A 3LFUA 1GU1A 4PXSA 3F71A 3ZHCA 1EG7A 2YBDA 1D8AA 3TQQA 2VTEA 3MWYW 3MMXA 4A8JA 4U8HA 3Q4GA 1AKNA 2JJQA 2C7BA 4JIGA 3UB2A 4HNUA 4YCJA 4OPMA 1TVCA 3HEAA 4S3MA 3TX2A 1CXZA 3UVEA 3TMKA 4EB0A 2JLUA 2QBYB 3KQUA 4P3YA 1EBBA 2VK2A 1E7SA 4Y2VA 5FR1A 4RTQA 3ETLA 2F62A 1E2HA 1TFRA 1SBTA 2VHJA 3IP7A 4DUZB 2BCGY 3V55A 3I0MA 1MFZA 3RC3A 3FTDA 1D04A 2HEIA 1S8OA 2FPLA 3TOVA 4KJXA 4INOA 1Y1TA 2PZEA 3VPGA 4RWEA 5JQGB 4YUWA 3A2KA 4OGWA 4R51A 2P2DA 3H13A 3RASA 2P9TA 3D1JA 4L15A 4MJLA 1TECE 5EJFA 2PWZA 4F9GA 4X3OA 5KOIA 2D7DA 3R8FA 2PDAA 5IDVA 3DOJA 3L02A 2XEXA 1M33A 4CETA 5IULC 1OX4A 3RUHA 4KR7A 3GPCA 4RVSA 1DAEA 2GRAA 3E5HA 4FONA 1Q0SA 2ZDHA 4EPVA 4HLCA 5IBPA 2NP6A 4Q1AA 1L3CA 4NWIA 3BDIA 5EJEA 3LCRA 3W6UA 5JUWA 4E08A 4C06A 5C37A 1ESZA 4RPGA 3SC4A 3TRHA 1I7DA 4H7FA 3V3TA 1ZN2A 2V6FA 2XJ9A 1I7QB 2ZT7A 4DAOA 2J3JA 5DMHA 4BNHA 3PKJA 3THWA 1QZTA 3AESA 3RI3A 2C7RA 1EXDA 3R76A 2VBCA 1XPJA 3IUNA 3RW9A 4Y9TA 2PH7A 2BHNA 4J49A 1E20A 1YRAA 2YZ2A 3LMKA 4AZ0B 3Q0IA 3O4FA 4LPKA 1FYWA 4N39A 1ODTC 3R7NA 4DLXA 3F4LA 3PX2A 3DNPA 4CQMA 4X1KA 4D8XA 1PEYA 3G9XA 4IUCS 4HG2A 4NFHA 1XCLA 4J0GA 3Q9UA 2UYCA 3GJ3A 3GLFA 3QXHA 3WLQA 1JDUA 3QEKA 4TTRA 4AN1A 3CF4A 2BFCB 1DC4A 5LFAA 5MF6A 5BOVA 1H94A 1PJRA 1SWWA 2AH5A 4UVHA 4GNKA 2JZCA 2O2XA 1DBPA 5T8KA 3W34A 5CCXA 3S2SA 1DZIA 4E4YA 2ZRAA 1E61A 2Z8ZA 3BBPA 1WPXA 1ZK4A 3T3MB 4CL8A 5GONF 5J4KA 4S04A 1YHZA 2OZKA 2WP0A 4I4NA 1WV0A 4QTTB 4U7HA 4HSEA 2RH9B 1JQAA 2M6SA 4MUAA 5FPSA 3RS5A 1CIPA 3RVOA 3D6MA 5GQSA 1TLLA 1YOVB 5FORA 2VHZA 1G21E 2XQFA 3OG9A 4NPHA 4NENA 3T3PB 3LQFA 1GP2A 7ABPA 4G0WA 3BB1A 1Y8RA 2EFYA 1DC3A 1PWYE 3CE9A 2QR5A 1CUAA 3QKRB 1TOAA 3DUWA 4JX9A 2BI7A 2QSZA 1TGYA 4HQLA 4A0SA 3ZWMA 4NAUA 3RSCA 4BLUA 1DAFA 3L0BA 3NOXA 3S2ZA 4O08A 1CEYA 4DB4A 1CZHA 1WO8A 5AICA 4MI9A 3A1SA 4RL4A 1OIXA 3RUAA 2Q3BA 1EQAA 3O8DA 5DEOA 1GITA 4V0MA 5JXIA 1H65A 3RSSA 1A7UA 1XZDA 3RUDA 3ZJTA 1NN5A 3TL3A 4GOLD 3WC4A 1TJ5A 2G6TA 3G2MA 3HLKA 2HTEA 4R8RA 1BOFA 1PHRA 5IAKA 2OGTA 4MDYA 5JO9A 1XMQB 4YMLA 2N1MA 1N0HA 4DLZA 1RPZA 5EIHA 3PXCX 4JYCA 2A14A 1VL8A 3K4PA 1KI4A 4H7JA 4XVHA 3IKMB 2J33A 2P6OA 3MGCA 1AURA 2OV6A 4TMXA 4KXWA 4B2YA 3SXJA 4JJIA 2AI2A 3GFGA 2BEWB 1C0IA 1RLTA 2WKWA 3WIBA 4KOAA 4AYXA 2AG0A 4KK4A 3LJKA 2PMKA 2OBFA 4BNGA 3AKZA 1A9RA 2AZ4A 4IDGA 2J7PD 2EU8A 4PX9A 5LOVB 3W5JA 1YL6A 2RJNA 4R5MA 3GRCA 3X43A 2PRYA 3N1UA 1GAEO 4OU4A 3W1WA 2YFYA 3I52A 4RM3A 2BH9A 1FSZA 1E89A 5H4HA 1V6CA 5LPNA 2H4XA 2PV0A 1T5IA 1E1CA 3WSVA 1B0ZA 5FO0A 4JXKA 2FMIA 2VWQA 3EQ8A 3LOUA 4B34A 2CJYA 1M7BA 1Z5PA 3WMEA 2CT8A 4N76A 5BPHA 3O95A 2ZTHA 2ZZKA 1EQUA 4AJ2A 1HL3A 1XEWX 4KAAA 1F6BA 4X5OA 4C4RA 2FY8A 4RV4A 3TZHA 4OF4A 3RU9A 1JDNA 2DWUA 1M6VA 2AXQA 2CD9A 3SQWA 1KPHA 2I99A 5AJWA 2Q27A 3DDWA 4LK2A 1JT9A 3LZCA 3IUMA 4LJ5A 4QIHA 1ADYA 4R9RA 3EVEA 3MRSA 4JJEA 3L7YA 1C9KA 4BLQA 2I7CA 3QHQA 2P3LA 3ITEA 5EVJA 4C6RA 2QKYA 1P7WA 5JZBA 5SYNA 1WBBA 4O59O 1XJ0A 3EA4A 3Q88A 3ZDXB 1T0BA 2ZB3A 2CLCX 3RWMB 3U13A 1G4AE 1U11A 3A31A 4B0PA 2EFEB 1KR5A 4OYYA 5DW0A 2KPOA 5B4VA 1G42A 3NT5A 5J9FA 2B92A 3SM9A 1TK3A 5FWYA 1D4AA 4TTPA 4JCCA 4Q9IA 1VYVA 2RD2A 3L6BA 1CY7A 2P67A 3QOYA 4JI6B 2IU0A 4Y9DA 3I64A 3KX2A 5GPBA 3VV3A 3ER9A 4JBWA 4QPZA 1YWGO 4PS0A 3BFJA 4B2LA 3BMNA 4HLQB 1VJTA 2IU6A 3L01A 1DEXA 1NOKA 4BC0A 5I9NA 2JD0A 4HQ6A 1KEVA 1VCIA 5JNRA 1QGUA 1XNQB 3MJRA 3N3AC 2PZBA 4KQCA 4MRMA 1X80B 2FZCA 3D7RA 3ZBQA 4B43A 2DFVA 4X7PA 3TLKA 2OSBA 3RSZA 1RACA 3HTXA 1DX4A 1PTKA 1C80A 1X2EA 3JQRA 2NU8B 1D09A 4YDHB 1PBTA 3G9ZA 3L0IB 4W6ZA 3DZJA 3V4RA 2V0GA 3GRYA 7MHTA 4CIAA 3QX8A 4F2DA 5JE8A 3AW9A 1JLHA 4J4BA 4AJOA 2F1HA 721PA 4OUKX 1WBDA 1LSUA 1JF8A 5IJ9B 4MUKA 4Q7KA 4B45A 5E7MA 4CTJA 2ZSFA 3HCPA 4HLNA 3ADDA 1ICIA 4HB3A 5E9WA 1XHEA 1XTSA 1JA0A 3VYUB 2CJPA 5BN1A 3ZKWB 4RJJA 3F9RA 2JL1A 4EPWA 5JSUA 5K0CA 2YWJA 3I9V1 2GN0A 4OHVA 4W1RA 5TF0A 4UAVA 4LI3X 4BWGA 2VQEB 2V98A 2YINC 3COSA 4POAA 4F4CA 3CPHA 2RK4A 4R01A 4MZXA 1E7RA 1NP3A 2DFTA 2GBFA 1PFKA 2HMUA 2WJHA 3MJDA 1GKUB 2OILA 3BD6A 4N65A 1ABEA 2F6RA 9LDBA 1YCDA 2O0JA 3R8XA 1IJEA 1PUIA 1F1JA 3ZJVA 4W4TA 5AW2A 2VZEA 4BB0A 4DCUA 4QL3A 2ZQZA 3HDVA 4PC1A 4QGBA 2JIPA 2VEDA 3I2KA 4HTAA 4JVMA 2OXIA 4YIHA 1GUZA 1YZNA 1Q0HA 2QVXX 2NU7B 1HZZC 1TD9A 4HZIA 5ALDA 1THMA 4BGVA 2ZPUA 5LMCA 2O8FA 3K9HA 4N8EA 3PXBA 3DAGA 1EHYA 3WLIA 4LDQA 3CYFA 3E35A 2PZJA 4NCNA 1UWKA 4TMKA 2ZJOA 3LGAA 1GRCA 2HO5A 4BWFB 3ML1A 3PR3A 4YQEA 5L8VA 1RYNA 3LU1A 1K8QA 2AYYA 3AF4A 5H70A 4XX0A 2FWMX 4FN5A 1HEYA 1T1IA 4OQZA 3B6MA 4O8CA 1BXKA 3RC2A 4ZMSA 1UM9A 4RACA 1QGED 1Q19A 2ZJAA 1KAEA 3NT2A 3DYVA 3JRWA 5CVVA 1GUYA 3S55A 3ZK7A 2JIOA 5JR3A 2XGJA 2CYBA 1O9HA 5K0ZA 1DJMA 2FPRA 3LG2A 1P0CA 2VPQA 2IPNA 2DWPA 1GYPA 3BOSA 3FG9A 3EQ6A 4ITVA 5J4LA 5H02A 2FPWA 4HN9A 4P0TA 1QIEA 1W52X 3NTRA 4PGGA 2AT1A 2YQ5A 1UEXC 4REOA 5F1KA 4FLFA 1GSAA 1WCXA 2LDBA 3IPCA 3EGDA 2OCIA 1NU6A 2J9YB 2XECA 3DE4X 4KC0A 1MENA 1J1ZA 3KBOA 3RVNA 3QKUA 3ROTA 1XZJA 3N2KA 3OCZA 4IVQA 1E1RD 4RJLA 1GPAA 3EAFA 3QF4A 3Q9NA 3UAWA 3G5AA 2KLHA 1ISIA 4H0FA 4DLPA 4L08A 3BMQB 5EKSA 1J06A 2G04A 4J6FA 2ZU0C 4W6QA 3T9AA 3ABIA 2IX3A 3DL4A 4RF3A 4YQFA 3F46A 3V2UA 2X2EA 3MOIA 2GCEA 3KL2A 5ECDA 4CEHB 4NRDA 2BP7A 3U3ZA 3UIEA 5AXDA 4UTVA 1XE3A 3QKTA 5G0TA 4CWAA 1MAVA 2QN1A 5LMNB 1Q2UA 1ZK1A 2B94A 3GEIA 3MOSA 4OX9Y 3ZQJA 1MO4A 1YZUA 2HGSA 2IOFK 2O3UA 2R96A 2JG3A 2B8WA 1F12A 3K32A 1UXOA 4R9UC 3CH5A 5M2QA 5CP8A 5DK6A 4DZTA 1J8DA 1QJ4A 1N5IA 1B6RA 1BFKA 1BNCA 2WFZA 2PSJA 3DZHA 1HFKA 1O6FA 1C7JA 2HLDD 3DVQX 4RIEA 4EKYA 4Z4IA 4TWRA 5HEKA 2HQBA 3OFNA 1ZDMA 2OXEA 4RS3A 1HTTA 4L5YA 1H2HA 4RK0A 3WLAA 4ENRA 1P9OA 1Z2CA 5JY6A 3SYTA 4AMYA 2Z3VA 5A03A 5HX7A 2FPUA 2C7QA 4PLHA 5DWQA 1E0DA 1RBZA 4A26A 2TMKA 3NJRA 3UJ3X 4BZZA 1OHHD 5CM8B 3FN4A 3MC1A 3WRXA 5KNBA 2LKCA 2WBLC 2G4VA 1N8KA 3P9RA 5B30A 1SCNE 1XAJA 4JX8A 4C20A 2XMQA 1TKAA 3QYAA 3JARB 4GH5A 4EMSA 1OU4A 1T4CB 4UFOA 1RC0A 3OOYA 4YACA 4YT5A 5FBLB 4F85A 5JDIC 4ZK6A 1ONOA 4WX2B 2RONA 1WXEA 4JDUA 3BFXA 3MCWA 4P5EA 4MGHA 1SXJA 3OCVA 2OQVA 2XA9A 5KTYA 3OUUA 3E82A 1LJ8A 3D2LA 1J6UA 1SQ5A 2IZ7A 1BWQA 1I10A 4XD7D 5FFMA 1PEAA 3D0RA 1C5KA 3H1GA 9ABPA 3G68A 4ILKA 2YIMA 2R6JA 5LA6B 2ZWVA 1XX6A 4HF7A 4HZUB 1Y8AA 5I8PA 4EUEA 4EUNA 4C6TA 4ODIA 5B4TA 3QIAA 4B3RB 1WSBA 3V7WA 3I4LA 4LWQA 3QHPA 4FI3F 1UBHS 4CMBA 4ERNA 3W90A 3D7MA 4KYTA 1Q0TA 3DLCA 1UXKA 1A4IA 1H4SA 1W7AA 4KH0A 5HUHA 3JZAA 3GUUA 4E70A 2QUJA 3OT4A 2XE4A 1I7NA 4FFWA 1QCYA 2H2IA 1VP3A 3KL4A 2J08A 1FY2A 1P7PA 3O91A 3PXUA 4X8LA 4CT0A 5L3QB 4JVNA 2IV3A 3JTMA 3GLGB 3RS4A 5BSFA 3HYTA 2G08A 2VSOA 4LVOA 1A27A 1T2VA 4R0NA 5TPZA 1K7XB 3DL0A 2HHJA 1I6WA 3K8YA 1S1CA 1DDGA 3MTIA 4KODA 1UBCA 2VHXA 1Q0LA 4QPDA 4RLQA 5EMHA 2B3DA 3RSOA 5JANA 4NU6A 1NVWQ 1XJ5A 2CKMA 4NE9A 1RYMA 1RRVA 3TVDA 2PX5A 3DV2A 1MT3A 2VNAA 5C4MA 2G0TA 2ZRDA 3ZXIA 1TRKA 3A6DA 1LS6A 1O96A 3ISVA 1UKVY 1CY1A 2Q0QA 5DWVA 3TTTA 2Z8XA 4JLMA 4PICA 4QOSA 4F2WA 2IQIA 1U02A 3FE2A 4DY4A 2DE0X 1R12A 3U7EB 4UTXA 4N0MA 2KBEA 5EWMB 2AN9A 1BD4A 1FDIA 5BORA 3R77A 1JFLA 3M0EA 2YW9A 5BV8A 4D8TA 1ZGCA 2KX7A 1YZ3A 3DDOA 2HLPA 3NHUA 1XU4A 2XWSA 5FLYA 4H16A 1ZU5A 2J1LA 2NZVG 3DMRA 2Z08A 2B4RO 2VT6A 4MV3A 5DX1A 5EKDA 2C1EA 4JITA 3BZUA 1BXGA 4UJ3A 4LV6A 5LYJB 3C5HA 3LL4A 2QD5A 1FTGA 2R6R1 2MSCB 4EGSA 5KJEA 1ODKA 1Z4PX 2H1RA 2D1SA 4MRMB 2J67A 3CUEF 2G1KA 1A8UA 4QU9A 5D7BA 2XT9A 1H0SA 1SBHA 3OJOA 3UUFA 4EH1A 1W75A 1IB6A 2J6BA 1Q50A 2C9OA 2XIQA 2Y92A 2EEPA 2HCRA 1GAQA 4MV5A 3TOCA 4PBTA 3AJ8A 4QREA 2AJBA 1J39A 4F6CA 2YMPA 1KXJA 4K9DA 5DXJA 3Q7PA 1AQIA 3QPDA 3DS8A 4AURA 3JATA 4RVFA 1E2KA 1LJUA 2EL9A 1GR0A 1K7CA 1UUFA 1BSVA 1EZZA 1L4MA 3QZUA 3FNBA 3PNYA 5LQJA 2ZSKA 5KDOA 1M0SA 2DQ4A 1HMPA 2R5WA 5EIXA 4A0GA 4WXRA 3EFEA 3GR6A 1GSHA 2IF0A 1CCWA 4Y1GA 3DOFA 2VSQA 2H8KA 1ECLA 4R8SA 4F3CA 1SCUA 4E6PA 4K87A 2Q9AA 3LPNA 3D3WA 4RMJA 4YAOA 4WLOA 2UVPB 4BCCA 4PFKA 1KP9A 2XKAA 3A1TA 2W70A 4XEUA 2C84A 4JFRA 5KOJB 4HAVA 1CVLA 1LU9A 3OE7D 3VR3D 2IYPA 4BXOB 2FPGB 3AONB 2ZAGA 4JELA 4W9MC 1DT3A 1IFXA 3BX1A 2WUWE 2WHYA 3GFOA 4JJZA 3O8CA 2ZT6A 4II2A 2XMCA 3T41A 4QT4A 5BNWA 1VB3A 1GG9A 4HS9A 3Q8WA 1YR3A 4CUJA 5L4SA 4UUOA 1NQAO 1RD4A 4G6ZA 2BZGA 2W8BB 3O38A 4RCVA 4MKHA 1GV1A 3FVWA 4FT4A 4G0QA 3FAZA 5DXAA 5IH3A 1X92A 4N6OA 3ZLBA 4ASUD 1EXNA 4OIFA 3OQIA 2ORVA 1KYXA 1UJ2A 5IKEA 2WJGA 2PSFA 3PTZA 4FS3A 4LRYA 1Z2DA 2PSSA 3VU9A 4PBSA 3SVLA 3BWCA 2PE5A 2LXNA 2W2PA 4P80A 5AW7A 1ZUNA 3WO0A 1P5RA 2IZ1A 4ZA2A 1QU3A 1QV6A 1YMUA 2GCGA 5K20A 4PVCA 1N7HA 2Z8YA 5H8WA 1T3HA 2I2BA 3NRBA 4PX5A 5BYAA 1QP8A 2Q6KA 2WI8A 3NFYA 3QOFA 4D56A 4LMPA 3DBOB 1PGOA 2Z2XA 3AH8A 4A0RA 5A4JA 4V0SA 5HJ7A 5TMDA 5BMVF 2RGBA 5CLJA 1S2DA 3HXTA 2VJMA 3H4VA 4NY1A 4BLTA 3WBKA 2WV7A 2J6CA 2W6IA 2ZUDA 1J5XA 3ENWA 4QOHA 4P6VF 5DN6D 5CW1A 3A14A 2VJCA 3EA5A 2IV2X 4TLAA 4FGLA 3FWNA 4TL9A 4QPNA 1FMTA 5ALKA 1O97C 1FNNA 4ZJYA 5CB4F 2RC6A 3PFFA 3SZ3A 1EFRA 1UPFA 5JI2E 1UBFA 3A04A 4OA8A 2I4MA 2Y1DA 3AG5A 3TRFA 3ZBUA 2UU9B 4F3RA 1PLLA 1I1OA 3NDBB 1H0RA 2JLAA 3HDJA 1JG4A 1T4GA 4CQNA 1Y8RB 4EAAA 2O54A 2JEOA 4AG3A 2ZYRA 3GARA 2WJYA 2DYKA 1AKYA 2MHCA 3W5UA 1KK1A 2O0LA 4YMHA 1NJGA 3L7CA 3VNSA 3ND7A 2XLCA 4LJ4A 4CEHA 1DQNA 1GG8A 1PFYA 4LUCA 3TQSA 1A1SA 2Q4DA 3ZIUA 4V1CI 3CNEA 4A2QA 2I2FA 2RGAA 5CCBA 2WINI 1IG0A 4MLDA 1OFHA 4NK5A 3L6EA 1I1QB 3AF5A 5GVRA 1CZOA 1D7AA 2QM3A 3MJ4A 1TEXA 3O5AA 5CITA 4LCJA 1GU0A 3F7TA 3CLSC 2QM0A 1DTWB 5FUBA 3JV7A 1U1EA 1DC8A 2FRDA 3QXXA 4K6KA 1Z4QA 5FFFA 2GD6A 2BRUA 1UMBA 1UM8A 1N5MA 4UM5A 4DCVA 2FZVA 1BFDA 4JUIA 1EDEA 2EJBA 1QOQB 1OBHA 1OXKB 3L0SA 2IZOA 4BGUA 4CF6A 3DEYX 5KYKA 4DL9A 2YVKA 2VIIA 5K0TA 1LBIA 4R9NA 1RWQA 3TFOA 2ZTSA 1K8XB 4MIEA 1BA2A 1JEDA 4QBHA 1O6CA 1HG0A 4QTUB 4KQJA 1BD3A 5CJJA 1T3SA 3K5WA 1LPAB 2BLLA 3B5EA 1E0JA 1C9EA 1EDBA 2HWKA 4KGDA 3RRYA 1QHIA 5D01A 3A6KA 1X8LA 1ZGBA 3PC4A 5E1DA 1QM5A 3A27A 3QE0A 4JR2A 4JSYA 4W1PA 4OB7A 4R3WA 4BX8A 4DRXA 5LXTA 4DYVA 3M1LA 4G4SP 1WD5A 2DBZA 3HCAA 4I55B 1N5LA 3A0RB 1U2DC 2P0YA 5JFTA 4I46A 2ZR7A 4LJ6A 1NF3A 4OHPA 3C8ZA 5EQTA 3I6QA 1EZ1A 1TL7C 1TC2A 5CA1A 1P29A 1RYYA 3ELUA 1H69A 1WKBA 3PFWO 1V4NA 1O87A 1UZAA 1X7ZB 2DPLA 1MN6A 1W6RA 4RU1A 4UNQA 1H9BA 3PDCA 3T52A 1DELA 2GJ4A 2VLIA 3JRXA 3VR5A 2C04A 1G3QA 3SSMA 4IIBA 4EG4A 2CJXA 1UK8A 1Q95A 4NC9A 2GKGA 3GK3A 2Q4OA 3KKNA 3KOOA 3D4PA 3QU5A 2VF4X 2AIRA 4Q1FA 1RPNA 4YCDA 4F0JA 4EYSA 4MYUA 2P75A 3ZV4A 3AERA 1UKAA 1WQ1R 4LKRA 3DM9B 1Y6FA 2GF9A 5B3AA 1ZMRA 2HREA 1CJCA 2G9QA 5EPOA 4P81A 5EIOA 5TQ0A 1N57A 2W6QA 2YV4A 3TEMA 2Y1GA 1QK3A 3GUVA 1FZTA 4CFSA 2WILA 4HBZA 2WA2A 4ESOA 2UXDB 3EFOB 1RHRA 2P6NA 2IF2A 3ICOA 4JI8B 2VJAA 4CEJA 3LCJA 2M1ZA 4QATA 1OXSC 3NTQA 4DLBA 5TT0A 3K5IA 2PD3A 3FCXA 2Z5GA 3H2HA 5E1OA 3R7BA 3MSCA 4W7IA 3V34A 5JECA 4NZMA 3L4EA 5BWMA 5IAOA 5A9SA 5EJ7A 3IEKA 1HUQA 3R23A 1WXHA 4HDSB 4J0KA 1UBSB 5LU9A 3UZUA 2AB0A 1E9RA 1CUSA 1XZEA 2CNKA 3TW6A 5IARA 1FS4A 1O6BA 1SPBS 2I2AA 2L17A 3DMPA 2IZ6A 1JIVA 1TZ2A 4ERXA 4AZSA 4DB2A 4IILA 5K4HA 5C1PA 3RC8A 4G5HA 4HAOA 4KQFA 3Q8LA 3GIDA 3CF0A 3HHPA 4F2HA 5B2EA 4EELA 1E5DA 4J0JA 4C0SA 4ZYWA 3T12A 4NDAA 4RK7A 4DM7A 1H2WA 1XRSB 5I3ZA 4URWR 2GOYA 3AV3A 2ZR0A 1I14A 2C54A 4NIMA 1BCRB 3DEKA 4JL5A 2VQDA 3BTVA 1GTVA 1NT4A 5ALIA 1DIOB 5F52A 5SV2A 2NVBA 4H4EA 5TPZD 4MS3B 3T7SA 2E5WA 5KVSA 2ZUWA 5JRZA 2I6UA 1W5FA 2JCGA 1SIUA 3QKIA 2WWGA 4OV6B 4DR6B 5ADWA 1LI4A 4MV0A 3SQMA 4WLFA 2LR0A 4HGNA 1PR1A 2PMEA 3T9EA 4BMOB 2EIXA 1WXIA 2CLEB 5AMXA 5A5VA 5AKIA 1T8WA 2FWIA 2CD7A 3SEZA 4DVJA 4FJ0A 2DHQA 2CWWA 2RK3A 4GVLA 3I9V6 3HN7A 4D7AA 1SKQA 4UU8A 3DDSA 5B7QA 5FBWB 3FPCA 4EI9A 2G63A 3MW8A 3QWFA 4R2LA 2NSHA 1GU7A 5MN6A 4AS1A 2D00A 4UHJA 4TWJA 1N2OA 4FQ5A 3C16C 5BXQC 4EENA 1XEAA 4JGBA 1YDWA 2VP5A 2ZBEA 1T8SA 1WZUA 3MIZA 4B46A 3GZNB 4BVEA 4CZ2A 4CIVA 5AFSA 2VXYA 1XTRA 2VAMA 1Z47A 3B82A 3C3KA 4YASA 1AHNA 4PHHA 4IXMA 2ZFUA 4IMJB 3VR5H 4OBEA 3BXGA 4CV0A 4IHJF 1P31A 3GJTA 4XZ3A 5BOSA 5E7QA 2HA6A 3DONA 3R6LA 2VRWA 4B6JA 1BWSA 3RS0A 2GPWA 2H11A 1KY3A 4MJ3A 3HB1A 4P92A 3C6ZA 4P38A 5BYKA 5JS8A 2FWRA 1O94D 3GJ6A 3MMPA 4WIAA 4KRXA 1OF1A 1V96A 2HPVA 2VO1A 2YOHA 3C3EA 4LZAA 3LUCA 4CHTA 4J9VA 1OFGA 4UHDA 2V7TA 4ALMA 3UKDA 1LPPA 1KY4A 5I4BA 1D07A 1Y37A 3OUZA 3SDZA 2OHFA 4ARUA 2J3HA 4C04A 1F6WA 2XA1A 3BJMA 4IJVA 5FPTA 5J5CA 4BE7B 3I1FA 1W1WA 4RH0A 4UU0A 4KO2S 5HQTA 1OD6A 2CNLA 3CEPB 3RUEA 2HT1A 1MRZA 3F6YA 4MQMA 3IMFA 3PC8C 1LBEA 1RTTA 2BEJA 1VYTA 1YRHA 2DWQA 1R9MA 2VDOB 1L5YA 4RF4A 3BCHA 2ZTVA 2YMLA 3LCUA 4BATA 4BO9A 3HBLA 1SC6A 4FNGA 4TV8F 4B6QA 4L85A 4DEYA 1ZMTA 1EUDA 3O1HB 3X1WA 5DYIA 1JDBB 4YFYA 1TM3E 3ESBA 1FP6A 5LMUB 2C61A 1X1SA 1XZKA 1BN7A 1R5JA 5ALUA 4DZRA 5L3SB 2AF4C 4B7UA 1QVWA 2FGKA 2ZRGA 3MYYA 4MA0A 4R7TA 5JCJA 2XD4A 5HVNA 3FB4A 1C1DA 2FJ0A 3C3AA 5C8YB 2E4UA 1JPVA 1M3SA 1MB9A 1YBVA 2DSTA 3D6AA 3PEUA 1F8YA 4IOJA 3GRPA 4DV5B 2QLMA 4B3BA 3UJCA 1VP9A 2W11A 2NTVA 5IUKC 3SX2A 4XIYA 4MYSA 2X5OA 3B60A 4DREA 2CHUA 1SKBA 5C8YA 2XUOA 4JC5A 3W7BA 3DE2X 2XMRA 3NNSA 3OP4A 5K03A 4M7WA 1FRNA 2PWPA 4UD6A 1AA6A 2C2HA 5FBVB 2HA4A 2YOGA 3OKCA 2RG1A 3VPBA 2DFLA 3GFQA 3IUQA 4HS4A 2YJ5A 3SBEA 1G8MA 2JFWA 4XUGB 3AL3A 1BCSB 3GN1A 3LS2A 1IBMB 3W9UA 4PQEA 1YJAA 3HP1A 3TKLA 1T0UA 1Z28A 3AEQB 5F1PA 2X6RA 3HEBA 2C77A 4CQMB 4PZUA 1EUDB 3EAGA 1NNI1 3DF9A 1XDBA 4ZIRA 4MRNA 5AHXA 3GLTA 5M7EA 3QXJA 1N6HA 4Y2JA 2JFBA 2IP2A 4EG0A 3S29A 1A88A 2PMDA 4LGMA 3P0JA 1J2EA 4TWZA 4JLDA 4D9FA 3D0OA 4Q05A 4AF6A 2B0JA 1HNZB 5F3WB 1DWQA 1KH3A 3H5TA 5C1IA 2JASA 1SVWA 3CUSA 3OH8A 2A0FA 1GPMA 1UKBA 3JQ9A 3WK7A 1HQYE 3DAYA 1BW9B 1HSOA 3V46A 1EVYA 4BNMA 4F93B 1WMEA 4B6PA 5JJLA 3GLQA 1OX4B 3D5TA 4B3XA 4J6EA 4NG4A 4IIHA 1S01A 4Q1DA 2JCBA 4ZHQA 2ORED 2DR0A 4FXOA 1X74A 1G5RA 2V4MA 1NHWA 1ZLYA 4YQZA 1W19A 3LQYA 1Y4DE 1YZGA 5FP0A 1RPJA 3RUFA 1ZVMA 1LV8A 2J9FA 1U3CA 2PT7A 4GWGA 4Q0MA 4F97A 1L5SA 1KO1A 2C5HA 1L5RA 2IEBA 2HBRA 1DGQA 1F8UA 4JLKA 1NBOA 1JR4A 4MCHA 1OTYA 3OTQA 3WGJA 2JF0A 4IO1A 5C51B 3BJRA 3OLVA 4Q4HB 5CDSA 2VK4A 4Q03A 5BV7A 5ECGC 2C4VA 4IFEA 3QVGA 1N6OA 1L5FA 1PI3A 1DAKA 1YUMA 2B35A 2GZSA 2YNMA 3VNBA 3K94A 3H1TA 3LD9A 2FCRA 3H3FA 1WM1A 1H1DA 5KNDA 3VR4D 1QDUA 3EEQA 5JC1A 1G17A 3GEBA 4QDXA 4EG3A 4EO4A 5EJ6A 3N8NA 3S7TA 2AJTA 3TLAA 2DXIA 5HCNA 5TB5A 1SC3A 4JKIA 3JZDA 5TNXA 2J9GA 2XMGA 1IWOA 1PTJA 3GA7A 2FW1A 3Q1KA 1CR1A 3UAOA 1UZUA 5CGQB 1CRZA 1UZLA 1WOYA 3K9GA 2WM9B 3GWGA 3P0RA 4MXDA 1QYIA 1XTTA 2H8GA 2ZUVA 3QPBA 3UOWA 4DLWA 4TT3D 2Y68A 3ZY4A 1GDTA 3WE7A 3BRCA 3BM5A 4KWEA 1FIUA 4HMOA 4KIJA 5A4KA 4HUTA 3AEKA 4K2AA 1CS0B 3DXZA 3GT3A 1QPBA 4OGGA 4EHAA 1CERA 1U9IC 4M7OA 5KEIA 1VIDA 3WBFA 1MTOA 4JJFA 4KRFA 1EINA 2BDEA 3OP1A 1RZUA 2HDHA 3AG6A 2FE4A 3E2PA 3GJQA 3OIDA 4BB9A 4K6FA 4Z7OB 4B87A 3TZ6A 2HF2A 3G0IA 3K4HA 4Y2HA 3P32A 4FK8A 2IELA 3OESA 1GY8A 3R0QA 1FU7A 2H31A 3HJFA 5EP1A 3H8WA 2ODPA 3K35A 1P7VA 1EEXB 4L6IA 4Q1BA 4CG1A 2VT3A 3OZSA 4KGZA 4Y2RA 3VC2A 1JAIA 1GKYA 1SQGA 3T4EA 2R1TB 1SUFA 2QVGA 4DR1B 3BH6A 3EDMA 4HWGA 4YRMA 4K28A 2WYIA 2RC5A 4XEHA 1U0JA 2CVOA 3EOAI 3A2MA 3H6HA 3ONEA 3PNMA 1DEAA 2X1MA 4KVAA 1M0TA 2ET6A 2M6RA 4QBIA 5AK0A 3HVKA 1M2EA 4JBIA 4M9QA 4C08A 2NZWA 1DSSG 2Q21A 3EBLA 3ESAA 3MINA 3P27A 3C6MA 5AQEA 3R5SA 2OAQ1 2BR4A 2NX2A 4ZHQF 5C8DA 4HFRA 2H57A 2X40A 3GP5A 3MZ0A 2QLBA 1WCIB 1OU0A 2IYXA 3U61B 5LP1A 1U3GA 3VI3B 5BNIA 1KAOA 1QHHA 2QMUA 1A9PA 4OH1A 1QKJA 2W2NA 1BHQ1 2GHQA 1XMSA 3OX3A 2X7HA 1XD2B 4MQLA 3LHSA 4B7ZA 2GEBA 4BQQA 1SG6A 1NVTA 3H65A 4LA4A 3UH0A 1Y6JA 1RPAA 4LXTA 2BMDA 2FYTA 1CS4C 3BILA 4V24A 4ZI7A 1X7ZA 1L4HA 1Z5VA 4MOWA 4G5GA 4YLYA 1MDBA 1W88A 2AUMA 3U4AA 3ZXSA 3DVAB 4OQPA 3HVHA 2RHGB 3EGOA 4MUHA 3QJ5A 2REQA 1JSXA 3U26A 1QIGA 4F2GA 1Z62A 3A9RA 5GV8A 1A69A 2YIJA 3P0EA 3P5SA 2YJ6A 4JWTA 1L8QA 1NQVA 1OV4A 1ZK0A 1E62A 2CVQA 4K3VA 4KN6A 1G63A 4UE6A 3O7WA 4I6GA 1NUSA 5BW4A 4D0RA 3QOXA 4FS8A 2PH1A 4FOTA 5H9WA 1M2OB 3IIJA 2JIBA 1E6UA 4X60A 1S02A 1MTZA 2G06A 3LPCA 4UBMA 3VH2A 2Z95A 4L8LA 3TCXB 4YYZA 1X7WB 2BTOA 4LMRA 4PTLA 1F3OA 4EPXA 3A9TA 1NM5A 4X00A 1KFEB 3MTDA 2ZB7A 4F1WA 4HTFB 4BVKA 4LZLA 4DG9A 1ODLA 1IBSA 3VDQA 3W9BA 2ZYSA 4OJNA 1DBRA 5BVGA 3G5UA 4Y2SA 1IIRA 2YX1A 4GP6A 2EL7A 1GNSA 2DKFA 2HK8A 2FWBA 3CUYA 3KB2A 3AHCA 3F6BX 4DS3A 2QM8A 3RTBA 1AUQA 4PLWA 2Q29A 5DRYA 2DPGA 3DL7A 1SWVA 3PNBA 3V6MA 1D2EA 1RI4A 2GBCA 2QX7A 5ALMA 4EMTA 3MJCA 4UHEA 1TJYA 3UV6A 2XF8A 3HCEA 4BHTA 4RJ2A 5JO0A 3NVMB 2H4HA 2LV8A 1WQ3A 3MXTA 4LN1A 2A0KA 4FR0A 1B26A 4MW0A 4OXRA 3RB8A 4IDEA 5IK2A 1FMJA 3HFSA 2ODEA 1NQUA 3CZ5A 3D6UA 3I39X 3QEJA 2VNKA 4MULA 5K4AA 2IIBA 4YMGA 1KRXA 4Y2QA 2F9MA 3ZWOA 2E4AA 4M1TA 3CVXA 2O5EA 4Z6KA 4CUKA 1WZCA 3RIHA 1EK1A 2HRQA 2XCRB 3AB8A 3WL7A 3RIXA 4BLRA 3WB9A 1H1LA 2OAGA 4O63O 1RZ3A 3AVQA 2I33A 1LA2A 1FMCA 1KJNA 4ZCRA 2GX6A 2G0AA 3IPXA 4KOEC 3F3YA 2PUWA 4DG5A 3VR0A 5JFGA 3INRA 4IS3A 3IUJA 1IN7A 2D54A 1WJGA 1L4GA 2RKOA 4YC7A 5IDWA 2UUPA 3SEAA 4HPXB 3GN2A 1Z3IX 3FCAA 4LEIA 4CKWA 4BBPA 1YRYE 1YS4A 4IDPA 4QG3A 3AB7A 1QIKA 3NP9A 1NR1A 4LJYA 4PF1A 1G2IA 1W47A 5KQRA 2G7MC 2GGSA 2IPLA 3CBQA 3ANNA 1ODFA 4N7RA 3B7PA 2QY6A 5DTJA 4J3FA 3CH7A 1NW6A 2X5KO 2XT0A 2FUG6 5K8TA 3RFVA 4F8JA 4MYHA 1MB0A 8ADHA 1XQYA 4M1QA 2PTGA 4GR4A 2FP3A 5A5EA 1XLVA 4RHCA 3PVCA 1N1DA 4ALNA 2VQFB 1UBJS 1CIVA 2Y67A 4I4TB 3E23A 1J25A 2I66A 2HQRA 3PQEA 3RBVA 1U7XA 5C2JB 1N2SA 1SELA 3JTEA 4B2PA 2NVWA 3E18A 1W4BA 3GFSA 4J7XA 2H1IA 1EBFA 4DV4B 3A3YA 3GLHB 2IIQA 3MILA 3KU4A 2BGLA 4I50B 4RABA 4RXTA 3U3MA 1QRDA 4P4GA 3FKSA 2P2LA 3QVSA 2ACEA 3GNSA 4Z7QB 1NMYA 1WB6A 1PS8A 4G89A 4JHLA 2PUVA 3ANYB 4NBUA 1F14A 1RM0A 3WXBA 5HIMA 1U4SA 5I7VA 1CDZA 1Z07A 4QUJA 4TV9A 2O5CA 2REXB 4Y0VA 2J5XA 2O06A 1U9ZA 1WZEA 4NHEA 3WNBA 1YK0A 1EMDA 1Z7EA 2OO5C 4PFJA 4XGQA 5FLKA 4RKWA 4I36A 1B2LA 1UAAA 1BMTA 2YRFA 3IT2A 5BW6B 4PNPA 3QLVC 4L5BA 4UXJA 1CHDA 3MLEA 5CXSA 1FZQA 2CNBA 5EE9A 4YDSA 4Q12A 4HNAA 1RTKA 3A3NA 1YBMA 2BGMA 2GCNA 4XWGA 4P9NA 1ONBA 1EAMA 1RQNA 3KLMX 1J5PA 1W96A 4WK0B 4BNKA 1IU9A 1SXPA 1OXXK 4CM1A 2C9BA 3ZQ4A 2IIVA 3G8CA 1CZUA 2AJDA 3UGQA 2BGIA 1P0FA 3T9DA 2PK3A 3CLKA 4O3FA 3VTZA 3WFZA 2DULA 2E4VA 2P0AA 1IQUA 3WLJA 4PYMA 5F5XA 3PQ3A 3RJTA 2ZRFA 3EH2A 3ZDZB 4J1SA 1S8AA 3K20A 2H1LA 4IO0A 4IQ0A 3R3WA 4XB6B 3LLCA 4YB8A 1FXSA 4F3KA 4WTOA 1ONNA 1E59A 4IFIA 5IAAA 2ZT8A 2PAFA 3B85A 3CZ4A 3ONWA 5GGYA 3WNZA 4AMVA 2HMAA 5A4IS 1L7RA 4BX0A 2FOIA 5G0UA 3KVOA 4MH0R 1FUKA 5LYJA 2GM4A 3AR4A 4FFOA 1EA7A 2CVPA 2OD2A 3AO0B 3AINA 4GKBA 1D0VA 4PYIA 2Y1FA 2Q2NA 4O4JA 4QNRA 3TRJA 3CJTA 3SDBA 4FYMA 3GJSA 2Q2VA 1KE1A 3RVBA 2I7TA 4JI2B 1R4MA 4NL4H 3EJ6A 3NR2A 5KMGB 4BN4A 4C3UA 4MPDA 5DP1A 1RLUA 3O9ZA 4IZIA 3L77A 4OOEA 2ZAMA 4R2KA 5EA2A 1AS2A 5EYPB 4DSNA 1L4BA 5DDIP 3RHZA 2J8ZA 5B6JA 4N48A 1P9NA 3I4FA 4X54A 3OTOB 1CIJA 2Q0XA 1CY2A 2YHSA 3DBIA 4PN7A 3LA6A 1XC7A 4Q00A 4XTCS 1PGPA 1S2NA 4QASA 3R7FA 4IGIA 4CRWB 5THKA 4A23A 1YZYA 3R4CA 1GHTA 1GUAA 2REBA 1OAAA 3OT1A 5F5LA 3KSZO 2FSSA 5FPPA 4RTOA 4PY2A 5U4XA 3I58A 4KUGA 1U9JA 1JR3D 1XZCA 3OMXA 4LF7B 2VCYA 1L5GB 3I8XA 3TUIC 1OXMA 1XRLA 2GN1A 2ONCA 3OZUA 2CNWD 5F77A 1FX0A 1SBCA 1WRBA 2BHTA 3B9PA 3KJQA 3N9IA 3RH0A 2K7FA 3K5HA 4GMKA 4QWWA 3RS8A 4NDZA 3AFOA 2VPPA 2AE2A 2CSUA 3PWKA 4E5MA 4BX3A 1HE2A 2QG9A 3M3HA 3Q15C 2VDWB 3F4KA 1LLQA 1LV7A 2Q3MA 3B1KA 1QFMA 3EDCA 3L6UA 3VDRA 2XYRA 1SNYA 1ZM7A 1ZX1A 3A6JA 1UJ4A 2C8JA 2AQHA 4IWYA 4FMDF 4XRGA 1SD2A 2BWJA 3T1VA 1ZXLA 3AHDA 1UOEA 2QPAA 2J3IA 2WF6A 1XWWA 3O75A 4KBYA 5F76A 1ZI8A 4CL2A 1ADCA 4C6TB 1EIWA 1M6HA 3DCYA 5DVZA 2O8CA 3A2LA 4IOKA 1H9AA 3GFFA 4ZOAA 1SUAA 3DLHA 2WRZA 2XYPA 3CLVA 1E1KA 3EC1A 3DV9A 5F2KA 2ZXUA 2QTGA 3LVBA 1I33A 2RJOA 2ASVA 3E9RA 3O26A 4B33A 1XTUA 4MLZA 4QUGA 4L22A 4Q48A 4RYDA 3GJ4A 1NYLA 1KBQA 1ESCA 2O8DA 2CLOB 3M83A 4HAIA 1T4CA 4M99A 4MIOA 2WNIA 5KYWB 2Y0PA 3LDAA 4H1TA 1GADO 4L8FA 3C6QA 3PD1A 4BMNA 2YWGA 3EHDA 5CNKA 1COWA 1N2EA 1XO1A 3T3GA 2QIPA 3M3PA 4J7AA 4Q3LA 2IU3A 5TQJA 1VBFA 2FSHA 3WLKX 4IF4A 1JHMA 4FEYA 1NDUA 3ADCA 1M8PA 1TMYA 1P19A 3HO8A 3DE0X 4KIUA 4WERA 4X8MA 3SHOA 2FN9A 1OBVA 1ZMBA 4D6XA 3EG5A 5FPKA 2H7CA 2ZSBA 3RANA 4QGSA 2FSFA 1RYBA 2A1TS 4N8DA 2ORIA 4F91B 4QRHA 3GZJA 5D3MA 2INGX 4OYHA 3NAGA 1HK7A 1Z6AA 3PJDA 5DMXA 4U3JB 2AG5A 2G7ZA 1VE1A 1G19A 2W6PA 2VXOA 4JZKA 4OLAA 3ZQUA 2VDNB 4N9QA 4LXGA 3U7GA 2FJPA 4RIGA 4EL5A 1MB2A 2WYWA 4TLCA 1OZGA 4FKBA 1WUYA 1CE8B 5ESRA 3RRXA 1UQRA 1IZ9A 4AO8A 3LT4A 2JFUA 2DZDA 4RGVA 4LDJA 2J9FB 3G85A 4IHAA 3NHMA 5IKXA 3M9XA 1GL9B 1QWSA 2ZUCA 4HXEB 1H6BA 1ENYA 1VQ1A 1BYUA 1LDBA 3I3SR 4JB3A 1EH5A 3ZWNA 4ZCIA 1BGXT 1I4DD 1TJ4A 4Z0HO 2X77A 2H65A 4NOMA 2YJZA 3IQFA 2OEPA 3C8DA 2JJ1A 2JIZD 2W2KA 4RKRA 5DHRA 3ZXYA 4Z2AA 2QGZA 1DNPA 3NNNA 3NWOA 4KWCA 4LIPD 3I32A 4OJQA 1PW7A 3A1FA 2ZBDA 3PPWA 5LOVF 2H7XA 3ZDDA 4PSAA 2GXUA 4TQGA 4ZOCA 5TC4A 4PXAA 1CU1A 3K0EA 5AI4A 4ZOLA 4BKPA 2I80A 4GDMA 1V35A 2MYPA 5BSRA 2OHIA 5CRIA 4LDPA 1YVEI 3O2SB 5CLHA 4F11A 3GRVA 5D1HA 3RUPA 4TVOA 5EZQA 1IQPA 3F8SA 3ZD9A 1Z74A 1IJKA 2AJLI 2W2LD 2YICA 1LBSA 4GKVA 1ADJA 4FIDA 3GGCA 3H83A 4WN9B 2UYYA 4MHSA 4RCYA 1N9ZA 3KAJA 1KDOA 2GAFA 3INTA 4JUFA 4IRMA 4KAFA 1W5BA 3FOBA 5DNDA 1E2LA 4HGPA 4MPRA 3V8RA 1FYFA 2RFLA 5CCDA 5KTOA 1ZR4A 4ZVUA 3O0DA 5JSKA 4LGCA 1E9AA 1G16A 1HF3A 2WAMA 3Q3VA 3QI2A 4DC9A 4PC2A 5IK2D 1MW8X 1T2NA 1Z6ZA 4GU5A 1JQBA 4HEA1 3DULA 4PX3A 2G40A 3BBLA 5CFOA 3BRWD 1FOEB 4UHFA 1PJQA 1JDZA 1KARA 4Z2YA 1U8FO 1I80A 1BFUA 4LZJA 1G3MA 4AM8A 2B4KA 5IDYA 2CNNA 4N5LA 1VDZA 2QTWB 3ZWDA 1FFGA 1M6YA 2IYTA 4QJ4A 3WYFA 4PYLA 4B3GA 2HN9A 5CEJA 2A67A 3NKLA 3LSTA 3HU5A 2VDKB 4UM7A 3K2IA 1CR0A 3ROGA 2A3NA 2DF8A 2O2SA 4LHEA 3BMOB 5ALWA 5FNVB 3MK31 2CXNA 2NUAA 2EERA 1JAXA 3EYWA 1OX6A 3ZK8A 3OICA 2O5RA 4HGQA 4O4LF 3E7PA 4QYSA 1R8YA 2OVFA 2O3TA 2GFQA 2WFAA 3KE8A 3SNHA 4DV6B 4TZ0A 3B3GA 2GRUA 2DJ5A 3CLUD 3CO0S 1YQQA 4DQVA 3ADBA 2WF5A 4II3A 5AM0A 5ITSA 4M8LA 3RAEC 4D8WA 3ND6A 5JAZA 4O3MA 1QHFA 2AN1A 1NXOA 2C4WA 1B15A 4PNEA 2XQGA 4YV2A 5JS6A 4GI1A 5CPFA 3NM4A 4GPZA 5AUNB 1L6IA 1NVBA 1TCAA 2AXNA 2C5GA 2IC5A 2IXFA 2PAAA 5A3RA 3QVJA 4JT2A 1XF9A 2QPTA 3HPRA 3ZDRA 2AW5A 1X0VA 3LCVB 2MR5A 4YCBA 4ZQFA 5ALNA 2NSJA 5CVCA 1KZYC 4FHEA 4GI5A 3WLNA 4DMLA 1TQ8A 2VG8A 2AN3A 1ZC4A 2XMZA 1V8DA 3RFUA 3SU8A 1ZA1A 5IU6A 5IC4A 3F97A 1QMPA 2ZK7A 1I0LA 2OORC 3ZE9A 2XZPA 3WX0A 1MGPA 2WU8A 2EFCB 3BMXA 1L5WA 3DFFA 2E4YA 3KDAA 3NQ41 3GAAA 4LTMA 3SSNA 2R00A 2HU8A 5DEIA 1JYEA 5HQ3B 1F0NA 3OAAD 3A6LA 3AHIA 3W2GA 1L4YA 3HXMA 2BFMA 4PHFA 1IQ0A 2WUGA 4D0LB 4CCYB 3PC2A 4DMGA 3M6XA 2P1RA 3WMWA 5FLEX 2DFKB 1GQQA 2HLNA 1LRLA 1ZIYA 1PGQA 4UAGA 4ER0A 3NC0C 1YVDA 4NEGA 1F9AA 2AQIA 3GZNA 4QXMA 5EKTA 4DARA 1FUIA 3G0BA 1WA5A 3DKRA 5IJAA 3SF0A 1D5CA 2GCIA 1MC5A 1W94A 4PYQA 3UXHA 3QKWA 2BZSA 4U9UA 5ALRA 1FVFA 4RDIA 3TI9A 3U37A 4F56A 3TIXB 3Q2OA 3L1KA 1Y8ZA 1E2FA 4YP6A 4YMTA 3TNJA 5F12A 3U5TA 5HWSA 1RNLA 2VPIA 4ARVA 1IY9A 4LC9A 2ZYAA 1B4DA 3VMFA 2PLRA 3FNRA 4CLDA 2J85A 3WBBA 1UH5A 3UG7A 3CZ9A 3ZGOA 2CXXA 1P81A 3EARA 2WIDA 2UZ4A 4C4OA 3ZCXA 4WKNA 3UKJA 1OIVA 3WYGA 1QAOA 1AQLA 2HXGA 3SSOA 2PYDA 1XLWA 4WCFB 5FWDA 2ZZNA 3QY0A 4IJWA 4YNBA 2AG6A 1CBUA 1ORHA 1GRVA 3NPMA 3P2OA 4ND8A 4A5SA 1NFQA 1OW3B 2VSNA 4D5EA 2OCPA 2AEMA 1KJ8A 7YASA 4D9CA 2IYSA 4FYHA 2ZRMA 3NC4A 4TYPA 2B6NA 2OXFA 1USWA 3DMYA 3M6LA 3P2IA 3V8QA 1E4VA 2O7RA 4JT9A 3NP7A 2VWGA 3VZPA 2WKQA 3K73O 4BV2A 4KSYA 1KIAA 3IP9A 1BO6A 1NF9A 3ZVMA 2XNHA 2YYAA 4UASA 4CM8A 5BT8A 3IIMA 2JATA 4K9KA 3GAFA 2QN7A 3C3MA 3E3AA 1KK3A 3C7AA 3PDHA 1VIVA 3VR1A 4DA0A 3E0XA 3DE3X 2W4QA 4ZU6X 1E3IA 2J4FA 3LKBA 2XNSA 1XCJA 3A4NA 3IUSA 5CH8A 4QYWA 3T7TA 4B8ZA 1BWPA 3F2VA 3GIWA 4FIZA 4FVTA 1Q7RA 4YAJA 1SUIA 3VI4B 4BFTA 5K6RA 3JAKA 4OI2A 1QFSA 1XZLA 3EUAA 5CYGA 4JJKA 4TTJA 3S99A 2WU0A 3ROFA 1Z08A 3K0HA 2Q2WA 3MAJA 1SIBE 3AUUA 5IVKA 3OPYB 1PR6A 4EARA 3T3NA 4C4ZA 2L0XA 3GVXA 1HDXA 2IW3A 5GP1A 1X1TA 3RHTA 1PR0A 4CN8A 2XQJA 1KSJA 3D8HA 4RDXA 2I7XA 1E7QA 1TAHA 4KP7A 4YCNA 3UBTA 2JFOA 3E9EA 3PNQA 2ZXEA 4OP2A 1NVXQ 2FFQA 3FF4A 4DCCA 2I8CA 1WPGA 1M2VB 2XDWA 3O90A 2OLKA 3AQ4A 3KYJB 1P1FA 1H93A 1BMFA 2W83A 3IJPA 3JWEA 4YRIA 2CEAA 1T5LA 1JLKA 2OC4A 4X94A 2FN8A 1CVRA 5G02A 3L07A 1QRAA 1VCOA 3WK4A 4WJLA 4ZYLA 1XQ6A 3RYCB 3KYCA 1CNFA 2Q5CA 2R60A 2EGGA 3C3BA 3BA6A 3ZD7A 1AHHA 3BMOA 3QVTA 1HT0A 3ADPA 3ECAA 4R68A 1H1TA 3JQAA 9ATCA 1SQ0A 2C9ZA 5DI9A 1FF9A 4BQIA 2AF3C 4Q4DA 4UC0A 1KORA 3DFZA 4DFDA 4O29A 4CR6A 2UYHA 2WFMA 3BEDA 4Y2TA 1A9XA 3HB4X 4G1CA 2IH5A 1MAUA 1MFPA 3ONNA 4Y7DA 2CCJA 4HADA 4E5YA 3H2SA 1N78A 2R7AA 4KBFA 621PA 3WB0A 2PUJA 4XFJA 3JPYA 1GCOA 2EXXA 4RELA 3ZVKA 4DLUA 3TLMA 1DKQA 4WT7A 4EBFA 4FQ8A 1ORTA 3DXXA 5JIBA 3NHKA 4DDUA 3ADOA 3IODA 1J2UA 2ZBPA 3D7KA 3NBMA 1WABA 4BQOA 5KSOA 3E7XA 3I53A 1EFPA 1GKLA 2XWPA 5E7JA 2I71A 2WJJA 2ZWMA 1EFAA 2CDCA 7ADHA 4AKSA 2PL5A 2QMHA 4DSAA 3KFLA 1YT5A 3ZWCA 5BQFA 4GO1A 1LC3A 4BYMA 1S0UA 5C8VA 2B2NA 1MH1A 1IPFA 1X8JA 1TYDE 1U8TA 2ZDQA 3LXXA 4YRFA 2WYUA 1Y81A 5CB8A 1ID8A 5IBCA 2OK7A 1JL3A 3E9ZA 1QTQA 1HDYA 4UNSA 4W8OA 5DHSA 4JL8A 4U7GA 2BEVB 3OZEA 5IF9A 1KC1A 3ELBA 3G2IA 1YONA 3SFZA 3TG8A 4LF5B 4H27A 4U6QA 1FLAA 3FOCA 3I9JA 4ZRNA 1W36B 4GRIA 3FTNA 5BV0A 2BV3A 1PZXA 5CT6A 3S2EA 4M86A 4F72A 4BGDA 1IRIA 4Z86A 1LEHA 4EHLA 1EE1A 2HHCA 3G79A 5B7NA 3KJHA 5SYMA 5KQGA 3EGVA 4M4SA 2JH8A 2OCKA 2XUPA 2FDCA 1Z6XA 3DPSA 1IEWA 1DKUA 2NO1A 3IEIA 3KSDO 5K2OA 1PV4A 3QU9A 5GZ6A 1ZONA 1E1QA 1UKCA 4NU0A 4DBVO 3T0FA 2V9CA 3ZYZA 3IIKA 1G1AA 2DM6A 3KYCB 4YEDA 5CT5A 1B42A 1C7RA 2JIZA 3IT0A 1KS2A 5FOWA 3ZYCA 3HDGA 4O2AF 1KGSA 2OZPA 4DA7A 3QKSA 3CHYA 5DNCA 2E9SA 3PD0A 4QFCA 1SUBA 5D3MB 1YCFA 3QEOA 4J1TC 3A8TA 4JP3A 5G53C 5B58T 3RTEA 2QXYA 3KSRA 4WCVA 1QK4A 3ZK9A 1ZH4A 3L06A 3DBHA 4E07A 3VOBA 1QX3A 1N6RA 3LWBA 4GVPA 5G4KB 3ZWKA 4EB6A 1RR6A 2O7VA 4HT3B 1KAHA 4LNAA 4JC0A 3NIFB 4JI1B 2HSGA 3OPYA 4DLKA 1CT9A 2XUKA 4Q3NA 1XZBA 5HIAA 1BE1A 1QBKC 3M6AA 3OLQA 2C2GA 3LYUA 3K3PA 4H59A 4J8PA 5AJYA 4LV5B 2DLCX 1F60A 4K9SA 4MWGA 2GLXA 1LSJA 4ER5A 4LBVA 1QYDA 5I9IA 2RGRA 3UYKA 2ZKIA 1Y8CA 3WGNA 1N2CB 1CJMA 3K1ZA 4KKVA 5TMBA 2ZM5A 2AHRA 1KRWA 521PA 2LE0A 2PZFA 4CLRB 3IJEB 2R48A 3KZOA 3OA0A 4YONB 1R88A 1VKJA 3AHHA 4QQNA 2PX4A 4L8VA 4DABA 4KKXB 2O4CA 2HA5A 2FB9A 4PIPA 4TKVB 3GYBA 2QB5A 4PZDA 1ZGHA 3N75A 3TAUA 2GERA 4ESVA 5KO2A 4NE7A 2NUPA 2OFXA 2V03A 3BXHA 1ZIPA 2PO5A 1VMIA 2APJA 3LW7A 3OQIB 4Q4JA 5JD3A 9GPBA 4DWJA 3ZWQA 4JLUA 4K9NA 1RAAA 1W5SA 2HU2A 2Q62A 1GXSA 1XTKA 1Y9ZA 3F0TA 4TGLA 5THQA 3ZHSA 3LKDA 1ZEMA 4Q5IA 3F49S 3W3AH 3PG5A 3ESZA 1QH8A 2QWXA 4PW0A 1IWBB 5IVHA 1S9HA 2X23A 3E7FA 3L40A 2WFLB 4CKBB 4OK5A 3ZZ1A 5B57C 1QFXA 1PNTA 4IX1A