4YH1A

Structure of human scp1 bound to cis-proline peptidomimetic ctd phospho-ser5 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yh1A00
5JJBA 2YMMA 2WM8A 1Z4IA 5AI0A 3KD3A 4UAVA 3R9KA 4BX3A 4NAVA 3A3YA 3WGVA 1TJ4A 5ALLA 2G09A 4KYTA 2P9JA 5AKLA 3E81A 1K1EA 1O08A 4OCZA 4PNHA 1Z4JA 4JB3A 4OD0A 2CFSA 4BNDB 2G08A 5AKIA 2B1QA 4ZEVA 1L7OA 1L7PA 4NV0A 2I7DA 1QH9A 1AQ6A 4IG4A 4L6AA 1EK1A 1N9KA 4YIKA 4AP9A 5ALMA 2NYVA 4EEKA 3NALA 2YJ5A 3U7FB 3QU2A 3F9RA 2IYEA 5ALFA 5A3QA 4Y2QA 4JDPA 3OCWA 1N8NA 1PW5A 3E8MA 4OHFA 1Q91A 2D2VA 2G06A 2NO5A 2WF9A 3WGUA 1VJRA 2YFYA 2QLTA 5ALEA 5AK5A 2Q5EA 3IJ5A 3SKXA 4MWOA 4ZEWA 1Z4OA 4UMFA 1S2OA 1ZS9A 1RMTA 5AI9A 4CE6A 1QYIA 4C4RA 4GXTA 3S6JA 4YCMA 3ZTWA 2EATA 5AW8A 4G9BA 2G0AA 3CNHA 4AS2A 4I9FA 2ZG6A 5ALZA 1RKQA 2YMLA 3GYGA 5AVWA 2W11A 4BEVA 2FPXA 2FUCA 3OCYA 1ZRMA 3PDWA 3FGOA 3U7EB 2ZBFA 3L8EA 3VAYA 3WK5A 4CF5A 3KC2A 2C8LA 2HDOA 3MPOA 1Z5UA 3QU9A 2JGAA 2AH5A 1RQNA 1J97A 3W5AA 1XPJA 3EF1A 3PGVA 3I6BA 3AR9A 3L8GA 4YIHA 4HGQA 1U7OA 3W5DA 3B9RA 5AKZA 3OCXA 2BDEA 2RBKA 3ET5A 1TJ3A 4Y2XA 3R09A 2G07A 3QX7A 4I9GA 3HYCA 1ZJJA 4F72A 2FPWA 2P11A 5AHXA 3OPXA 5AI5A 1TJ5A 1ZRNA 2P27A 2I33A 4HAIA 2FPSA 1SWWA 1FEZA 3WKAA 5AM1A 2HOQA 3WK9A 3NANA 2I34A 5AW2A 2HF2A 3IB6A 4Y2SA 4NWIA 5ALJA 5ALSA 4BX2A 3KDPA 3HLTA 1CR6A 4UATA 3L7YA 4YH1A 3ZW7A 1LVHA 5ALNA 2BDUA 1L8OA 3QUCA 5AVQA 5IT0A 2W43A 5ALUA 3A1CA 5T41A 1Z88A 3KZXA 3NASA 2OM6A 5ALPA 2FEAA 3RF6A 1WR8A 5ALOA 1NRWA 3ZVMA 3UMBA 2WF8A 3MN1A 4DW8A 2HCFA 4H1WA 1Z4MA 4OFZA 4FFDA 5AM2A 5IS2A 3QU7A 4Y2UA 1F5SA 4Y2VA 2GHTA 2PR7A 1U2TA 1ZOLA 4FYPA 1QQ5A 5AW6A 3AR6A 2I55A 3FVVA 1NF2A 2EARA 3ZI4A 3SF0A 3QNMA 5AI4A 1L8LA 3ZU6A 2RB5A 4UW9A 4ZEXA 1RPZA 2JAWA 4CNQA 1JUDA 5AW0A 3L8FA 1YNSA 3U19A 1WPGA 2ZBDA 2B1RA 4XOUA 4EENA 2JAUA 4UM7A 2PKEA 4YCLA 3EPRA 3DDHA 1RC8A 2ODAA 3QUBA 5AKHA 2AUTA 2G1AA 4Y2TA 3TLMA 3FPBA 4UM5A 1RQLA 5AKEA 3WK7A 4Y2JA 4DWOA 4E88A 2DQSA 2WF7A 1T5SA 2FPRA 4YGYA 3U13A 4DCCA 4BBJA 4RESA 4GIBA 5AESA 2WF6A 3AR5A 3J7TA 5ALXA 2B0CA 1VFPA 2HI0A 3W5BA 3FM9A 2YJ3A 1EK2A 3W5CA 5AW5A 3BA6A 3IRUA 2JARA 4EX6A 3ONNA 1J8DA 2B8EA 2IOHA 3N8GA 3ESQA 5AK4A 3ED5A 1T5TA 4HGNA 2CN1A 3L1UA 3K1ZA 3QXGA 2R8XA 3ET4A 2PQ0A 4HGOA 2ZOSA 2WF5A 3WKBA 3AR8A 3NUQA 2MU1A 2WFAA 1QQ6A 5ALKA 4O8CA 3AR7A 3ZX5A 2YJ6A 3KBBA 1YS9A 4CF4A 5AKGA 3NRJA 1RLMA 1RMYA 3DNPA 3EF0A 2EAUA 2HX1A 1NNLA 3U7GA 5AM4A 3WKEA 5ALRA 5AIAA 3MMZA 3U7HB 1ZD2P 2FI1A 3A1EA 3ZVNA 4C4TA 2W4MA 2YJ4A 5ALVA 5AKJA 3OCZA 3UMGA 5ALGA 4NABA 3M1YA 1TA0A 3RFUA 3WK8A 3ZX4A 4FE3A 4KN8A 5AM3A 5AI8A 2ZBGA 4KNVA 2FPUA 4XPZA 2GO7A 3E58A 4EELA 4XE5A 2YN4A 3N1UA 1WZCA 1Z4LA 2FUEA 3QGMA 2WHEA 5AVYA 5AVVA 1O03A 3OTQA 4KX5A 2BY4A 5ALYA 3OCVA 4IFTA 5AKYA 5AIBA 1RRCA 1XP5A 2YBDA 4EZEA 1LTQA 3SHQA 3NIWA 4UAUA 1TE2A 3M9LA 3KOOA 2AGVA 1ZD4A 2JAOA 1Z4KA 1XVIA 4UU0A 2CFRA 3ZWDA 1IWOA 1X42A 1L7NA 1RLTA 2IOFA 1ZD5A 2GFHA 5AM0A 3D6JA 3UMCA 4UMEA 3N07A 2B82A 5AVSA 4C4SA 4CF3A 5ALWA 5ALHA 4UMDA 3QLEA 4RETA 2IOFK 1Z4PX 3WKDA 3QUQA 1SU4A 1VJ5A 1L7MA 1RMQA 2O2XA 1SWVA 2O9JA 4J2TA 2C9MA 4BEWA 5AI6A 1KYTA 1CQZA 2GMWA 2HHLA 4QQFA 3WK4A 3ZTYA 2Q4TA 2OA0A 4UU1A 1S8OA 5A3RA 3FPSA 2C4NA 4HYTA 2HSZA 2ZBEA 2RARA 5FP0A 3CZ4A 3SKYA 3B8EA 5ALQA 3I28A 5AVZA 1YV9A 4YCNA 3N28A 4UARA 2X4DA 2AMYA 1WVIA 4DFDA 3BWVA 4Y2YA 2ZXEA 2P69A 3QUTA 1RKUA 2OBBA 3OCUA 5AVXA 3ZWKA 4NFLA 4F71A 3AR2A 5AW4A 2C8KA 2NO4A 3L0BA 4Y3UA 3NAMA 4G63A 1YDFA 4Y2RA 3AR4A 3QU4A 5AW3A 2GHQA 3QYPA 4L57A 1L6RA 2R8EA 3L5KA 3ZVLA 3L1VA 4BKMA 3SLRA 3E84A 2HEGA 3N5KA 1QQ7A 2I6XA 3L0YA 4MUMA 3I76A 2R8YA 1YMQA 3EWIA 4QJBA 5AW1A 3AR3A 3ZUPA 2G80A 5AW9A 2VKQA 5ALIA 3SD7A 3P96A 3DV9A 4BX0A 3ESRA 2FDRA 5A3SA 5AKKA 1Z4QA 3L8HA 4J03A 2YY6A 4KX3A 4KNWA 4UMVA 2I54A 3FZQA 2HO4A 2C88A 5IT4A 4EX7A 5ALDA 5AW7A 3WK6A 3A1DA 3I1YA 5ALTA 1Z4NA 3QU5A 5AK6A 1MH9A 4Y2PA 5AICA 4BNDA 1T9ZA 1Y8AA 2HF7A 2B30A 3R4CA 4XQ0A 3WKCA 1ZD3A 5AVUA 1Z5GA 3DAOA 1Q92A 2OYCA 1YJ5A 5AVTA 3L0CA 4L6CA 2IA5A 5AM5A 2MSNA 3MC1A 5AVRA 4BYGA 2CFTA 5AK3A 2R8ZA 5E0OA 2Q4RA 2QYHA 5AKXA 4AS3A 3SMVA 2RAVA 3U26A 4B6JA 1RDFA 1RKVA 2B8JA 4UASA 3UM9A 1U7PA 4HGRA 1U2SA 3PGLA 2YMPA 2YMQA 4HGPA 1U02A 3PCTA 1RLOA 3B9BA
chains in the Genus database with same CATH superfamily
1WJGA 3K1TA 4IMJB 5KSWB 2OMEA 4K9LA 2EEPA 3VJKA 2NZYA 4EJSA 3E23A 4CGZA 2QTVB 1JHUA 1HGXA 3TLYA 3RKRA 3IP9A 3Q2IA 1RYHA 2P3LA 3QVLA 4UZSA 2J1LA 4YI5A 3A8TA 3AY6A 4YRLA 1FDTA 4RDIA 4REQB 4ZI3A 5F23A 1RVDA 1CVLA 2RI1A 4OQDA 3PHGA 4GGOA 4ZQGA 4AP6A 2QPAA 2QRHA 1UBMS 3IA7A 4B3HA 4DCTA 1W36D 2G08A 4X1YB 1I6KA 4QYWA 3KU4A 3BMXA 4KREA 2O5RA 5BSEA 2OUIA 1XZLA 1YQUA 1F1JA 2R7NA 3WDLA 4B8ZA 4ZVRA 3O8RA 3AY0A 3D8BA 3EZ7A 4YFYA 2ZANA 4OLBA 3VO9A 2PRYA 4EEKA 1JI3A 2XZTA 3GEMA 3GV0A 3TD6A 2IZ7A 4O4HB 2D74A 1TKCA 5DHFA 4G01B 3A2LA 4RVGA 4YREA 5ALFA 3LBHA 2HCTA 2IQ5A 1CS0B 4IV0A 5HKBA 2X23A 1H9CA 1QCZA 1V0JA 2JRLA 3UHOA 3VV3A 4ZGWA 2B98A 3KG2A 3S7ZA 1V5EA 3TZEA 4U02A 2Y67A 4W9NA 2YFYA 3IEPA 1E1NA 4B3DA 2Q1WA 5ALEA 5J2TB 4D5GA 1PJCA 5TEWA 3S8EA 1U5AA 2BR5A 2JI6A 5IUKC 1E1RA 4OI0A 2I4OA 4E5NA 3WY9A 4MS4B 5K0CA 2SBTA 1RXCA 1DEHA 4Z99A 5JRDS 2G8NA 1QV7A 1Y48E 4OHRA 5AJWA 3AVTA 1NGSA 2O2EA 4YDSA 5AXCA 4KK4A 4CU5A 3E9CA 1C9EA 4LGYA 1ZHFA 3LZDA 2J6IA 4URWR 1E60A 1ZOPA 3V4SA 1B6RA 2A35A 4HFMA 3T52A 2HLDA 5DI3B 3MQFA 1EI9A 4P98A 1MAWA 3QPWA 2FPXA 1HFWA 2E48A 2D5IA 4BVEA 3PC4A 4XVRA 1QUFA 4WINA 3U3XA 1DC5A 1WOMA 4HFNA 4KG7A 1YVPA 2P6NA 1R8SA 3OJCA 1NBMA 4DQDA 1ZAKA 2XR1A 2IELA 2XADA 3D7SA 4YC7A 1LJUA 5BVHB 2ZYRA 4YUVA 3WL4A 4NMMA 3HEBA 3OO0A 3U9SA 3UGTA 1I7NA 4WN9B 2RGRA 4LJ4A 2VSYA 1USIA 1PQWA 3I1FA 2UVQA 1TIKA 5JRZA 1GPAA 3PGVA 3K70B 1NYQA 3V4OA 4TZ6A 3E9YA 3JWJA 1NMQA 2Z04A 2NUTA 4UBIA 2ZFUA 4QIHA 5LP6C 4NBLA 3RKUA 1V26A 1VMAA 5TQ2A 3OCCA 3R0XA 4YQYA 3IH5A 5FPYA 3PF8A 1P73A 3F6SA 1VGQA 1IUNA 3AP3A 5E8JA 5C80A 4HJXA 1JJBA 4RTMA 4GMHA 1IATA 1FC0A 3QM1A 1JDPA 4MMZB 2OLJA 5JOQA 4RD2A 2X0FA 1PL6A 1E3DA 1WMDA 3L18A 3TVYA 3WLRA 4XDHA 1WUYA 1TO2E 4A4DA 3WHLA 1L5HA 1H65A 2GM3A 4F56A 1FEZA 4M9XA 2X76A 3HNOA 1ND6A 3E8SA 3ADPA 2GASA 3A4NA 5EZQA 1KMQA 3R0QA 4PXYA 3I9FA 3HVUA 4BQIA 3FCUB 3PQ7A 4DMHA 3CLRD 4CR8A 1CZUA 3AJDA 4MS1A 2HF2A 3IB6A 3R3VA 1XEWX 3FRJA 2QUZA 4X7BA 4CIAA 1ZIPA 1VDMA 1P4AA 3L7KA 3VR5H 2OWEA 2GM4A 3LPLA 2V7BA 1M83A 2X0KA 3PWTA 3HLTA 3IP1A 1N2XA 3IAXA 3SC4A 4C76A 3CX6A 4HMQA 4LAFA 3QE0A 2QV0A 2CUKA 2E7ZA 1VKJA 4IIJF 4MVJF 2FKAA 1VLMA 4YH1A 1LSJA 4FKZA 4ZT2A 3AB7A 1WNTA 4NNJA 1JIQA 3G1UA 1A9QA 3WNQA 4C03A 4LF9B 2PQ2A 3KL2A 1IXKA 1ABEA 3AILA 3OQBA 1L2TA 4MDYA 1MC8A 2IKQA 2VF8A 1Q57A 2C2BA 3PFHA 1MDFA 2FEAA 3WOHA 2COUA 5H7XA 4KC0A 1OAOA 1JLLB 5A7HA 3U09A 1N6OA 3ZS8A 1WR8A 2FQ1A 4MYUA 2XIJA 2XA2A 2GBLC 3L1IA 4L4RA 4CN9A 5CYPA 3NNSA 1PDVA 1AKRA 1V1RA 3IP5A 3KT0A 4PFQA 2CGEA 3AV0B 3ZKWB 5A4IS 3VZCA 5H4HA 2ZCUA 3IALA 3NWEA 5BRNA 5JASA 1SOVA 1M0EA 1EE2A 1JNXX 4GEKA 3DTVA 4BDSA 1D9ZA 4DCPA 1T24A 3KHUA 2JGDB 4F1KA 2PPVA 4MYHA 3UKOA 1N7IA 1N6LA 1W4BA 1WQ3A 4IGFA 2X3YA 2D1TA 3VR5A 4EMUA 3TL2A 2R00A 3VH4A 1SRRA 3QA3E 4RMIA 4Y0VA 2F17A 1VJGA 3ZI4A 1NONA 4N03A 1F48A 1NQXA 1LSUA 2VZEA 3GDGA 3PC8A 2RB5A 4OM8A 4XA8A 4XEUA 4BBPA 4AJ9A 4PQYA 3HNRA 4TMWA 3M33A 1KWGA 4HY3A 4RIHA 1A95A 3Q2KA 1HSZA 3L8FA 5BT9A 4PAWA 2IU4A 1SQGA 2WWWA 3FSGD 2XMSA 3P9IA 3PPWA 3TL3A 4MI1A 5KNCH 1U0LA 3ADBA 2B94A 4MJXA 3M4XA 3HY6A 2BUAA 5KTOA 2XRYA 1N1DA 1IYZA 3ECAA 3GDWA 1G20A 4JH0A 4PS0A 2P6UA 2H7YA 4Q9AA 5AKHA 3UENA 3QEMB 4D9NA 5B2EA 5ITVA 3NBQA 4I55F 2IU3A 3NBKA 2Q3DA 4A91A 2HSEA 4KI7A 2V9CA 4DGSA 4X9XA 3SHVA 5CBKA 4HRVA 1VL6A 4A0FA 5D6NA 5A04A 1ZZEA 2D7JA 1HXHA 1W581 2V98A 3KCQA 5F1PA 3ZN2A 2C2KA 2YXEA 1JDSA 3SOZA 2NO0A 3UWKA 3OJLA 1KZYC 2QWXA 4KWTA 5HHTA 1PJSA 1ISGA 1N2ZA 1W59A 4UTNA 2QAGB 3HMKA 3PE6A 3PLRA 3WB9A 2ZP1A 1EYZA 2C3PA 4FN4A 1FJGB 4DMMA 4LOLA 3AK4A 4M0MA 1MX3A 4UHDA 3IDOA 4X7RA 2XNDA 5J23A 1J2TA 2A58A 2MYTA 1G8PA 1MB0A 1Z2DA 4R01A 3QLUC 3S5UA 2M2IA 1WW8A 2XMPA 2IW1A 3LBIA 4YECA 5KNCA 3CE9A 1GNQA 1OX5A 1VKNA 3GFTA 1R6TA 1D2NA 4XDZA 9GPBA 2A88A 2IY9A 4GPTA 3WX0A 4DC0A 4A5OA 2EP5A 3AU9A 3AM1A 4RWEA 2W8BB 4TYPA 1FFSA 1QQ6A 2GD1O 3VR2D 2NYAA 1PEYA 1COWD 2HGSA 1EUDB 1NKVA 4P7JA 1PFKA 2R5NA 4NCNA 4Y7CA 2W2QA 2YIDA 2XT9A 3SSNA 4E09A 2AN3A 1PZXA 1NVFA 3GYBA 4MUAA 3G0OA 2O8BB 1O4VA 1PT9A 2GJ9A 1IY8A 1DUSA 1GCOA 2PL3A 3P97A 1DJPA 4HCJA 4KIJA 5LOVF 3QFCA 5CJJA 1LI7A 3ZE0B 4JQYA 2F4NA 2HO5A 2VTDA 5HSGA 1UK8A 2XUDA 4MR7B 1C8BA 1CY6A 3GPCA 1J00A 1NQ5A 4AURA 2HDWA 4K6CA 4DTCA 1WXQA 2A9QA 4F4UA 3KXDA 2ZSEA 4YHBA 2NNWB 4RJIA 3L7NA 1G55A 1V4VA 2IUYA 3KKPA 5AKJA 3UC9A 3LSTA 2XBMA 5GZ3A 4BWGA 3D7MA 4BMOB 4N18A 2QMZA 3RVJA 3HXTA 5LQAA 4KVFA 4NS1A 1P7CA 4KJZA 4G8BA 1YRAA 2F8MA 3PEUA 1UBOS 2Q2WA 2WB4A 4GMFA 3D4IA 5AI8A 1ECFA 5AM3A 2FPUA 2IYYA 5F35A 1RIFA 2HPHA 3KVYA 4GOXA 1UR5A 4EECA 3U9TA 2JL1A 2AA3A 4D8WA 1U81A 4UOEA 2JLVA 4W7IA 2FEPA 2YFKA 5CBPB 1WZIA 3RSLA 4J1QA 4U2CA 2WHEA 3WNVA 1SUBA 2QLFA 1DVRA 5HCUA 5K6RA 4EY8A 3NGLA 4XIJA 3SJZA 5A62A 2AMJA 5CAEA 1UEXC 1YONA 3GJ7A 4UJ5A 3ZE8A 1H2BA 1TK2A 1VQ1A 1I3MA 4BECA 4R7GA 4HG2A 2JAQA 3M3DA 1R7RA 1ZRSA 2PMCA 2IUUA 3GJTA 5CVUA 2GCOA 4TMXA 1XWFA 4X5OA 2YOFA 2I0FA 3EB9A 5REQB 1KRXA 1CZLA 4B4DA 1HRKA 2BGTA 4OQPA 4EITA 3NYQA 3K8ZA 4PCLA 4EI2A 5C4MA 5HK9A 3ZDCA 2FPGB 2AUMA 3JQ7B 3V1KA 4EG0A 5FTLA 1ZD4A 3PR1A 4M7RA 1ZZGA 1MLDA 4J0IA 2Z2IA 3G88A 2NXNA 3OZCA 3GJQA 4MYRA 3PVSA 3SR4A 2PFGA 1R66A 4TLAA 3UC5A 5CA0B 4BNHA 2ZETA 4UEOA 3R5XA 4F2GA 3DXYA 2H0RA 3BSFA 3PTLA 4LRQA 2VHWA 5JXIA 3UWOA 3K9NA 4O1IA 2ID7A 5HQJA 3IUBA 4WLUA 4DANA 2OCIA 4O2AA 5E9QA 2GF9A 1FDUA 1LSSA 2ZIAA 3LU1A 5ISMA 1KIMA 4NEQA 4II7A 1W44A 2YNMC 1TECE 4E22A 5IBQA 3WKDA 2CVOA 1ULBA 1U4NA 2JFGA 4IVNA 4PRZA 5TB5A 3IO5A 3VJMA 4FUQA 3BIJA 3WGGA 4DG5A 5AVJA 1CUSA 5A3VA 3ZI0A 3PZRA 1VGVA 2C5AA 2WHRA 4MRMB 2C9MA 5HP4A 1J1UA 4KRFA 1E1CA 3ICCA 5F7ZA 4MWGA 4FEYA 5C5EA 1A8SA 2C77A 1RD4A 2XT0A 4LBVA 4YQZA 1BJKA 2GHRA 1L4NA 2ZUUA 5D3ZA 3O3MB 3ICPA 1LKZA 4RSGA 4Y9TA 5IC5A 1CDDA 3V00A 3P9SA 2FF5A 1NXPA 2EG9A 1QAQA 5DVZA 3ETCA 3B85A 2JJ1A 3WADA 5DGTA 1IIRA 1WG8A 2HA7A 3HP4A 3CZ4A 3QLVA 4GBJA 2GTPA 4K28A 4QYSA 4OB7A 2OB2A 5F9MA 4YYEA 3EVAA 2D0DA 1Y0BA 1ICIA 2Z56A 3ZU5A 1DEXA 1CR0A 3W2GA 3Q4GA 5DP2A 1U1IA 1HPLA 2VHYA 2NVUA 4UDNA 2XGSA 4YLEA 4OHYA 3CW8X 1GUBA 3LRPA 5EIOA 3T4UA 3WLAA 5K0EA 3TCNA 1U8AA 2BFWA 5GJBA 1G5TA 4WQMA 3BGVA 1BDBA 1SC1A 4Y3UA 3L0BA 1DBVO 1P74A 4EUHA 2HKIA 2WZCA 4JBGA 1Y1PA 3U6BA 2OY0A 4AJ1A 4NHEA 5E0KB 3R44A 1M3SA 4HTFB 1OLUB 2I6XA 5BW5A 3CVVA 4N0DA 3BB1A 1H6DA 2BM0A 5DBOA 4Z3OA 1U1CA 2TECE 2JZOA 1NN1A 4M1OA 2P65A 3Q0EA 3FDXA 4ONEA 4ZYLA 3HABA 3INYA 3L9WA 2JLCA 1WMSA 2PA0A 4KQWA 3VR4D 1UP7A 5LL6P 3FBWA 4YGXB 3OOEA 4IWXA 1Z4QA 2D0OB 1OMOA 4RHUA 5KYKA 3LECA 3T9BA 1GZSA 2QX6A 1EZ1A 1UMCA 2B36A 2FFBA 3G8AA 2BEUB 3BF7A 4HDKB 1GRVA 5EJ8A 4KR0A 3KEFA 4QBHA 2I54A 1AB6A 3TECE 4B40A 5E4YA 3N7AA 1J2YA 5ALDA 1F8YA 1NNUA 1AD2A 2NYRA 2V7QA 3CRVA 4PYKA 3WLIA 1Z4NA 1FP4A 3DOHA 4F3NA 2HQSA 1FTNA 4G25A 1YGYA 5BN4B 4R2IA 6NULA 3NKLA 4DIDA 3TW8B 1QR2A 2YZKA 4Y30A 1N36B 3LQ2A 2BGNA 2OBYA 4X3CA 4I1VA 4D46A 4FUTA 1ZHOA 2RBEA 3ESYA 3D43A 3NHFA 4O4JF 1V41E 3LY7A 2XUOA 4FS3A 2P5YA 4RMGA 1XLTA 3VKUA 5AXBA 5T8KA 4EI7A 1QF6A 4ZIRA 5JXJA 2GXAA 1GQRA 4WESB 4Y6QA 4HJRA 1QQTA 3E3LA 1E2PA 5G0WA 2Q0SA 2VG8A 1Z35A 4QDZA 2OYCA 1N9GA 3LLUA 4FYMA 4XQ9A 3K0EA 5J5VA 1MEEA 2HHAA 3NHSA 3ZBUA 2XDQB 1B23P 1E2EA 2VA8A 5TDHA 3E4CA 1MVLA 3TMKA 1AY0A 3P0FA 2GBCA 3G0DA 2W4IA 2XD9A 4K87A 5CK4A 3SX0A 3D9QX 4R8RA 4AF7A 5BSGA 5JFGA 3BEOA 2R48A 1A9YA 1LK5A 5F2EA 1KTIA 1L8AA 2GA9A 3F5DA 2QYHA 3U61B 4G8JA 3H2SA 1CC1S 1N6NA 1U04A 2BTOA 2PYDA 4RIFA 4H77A 2MSLA 4B6JA 4EHDA 3OICA 4BWFB 3KP1A 5JS2A 2FXIA 2X8JB 2GAFA 3ZIUA 4ALLA 1FFGA 1XZHA 2I2FA 2I3ZA 3ND6A 5IAJA 1L5FA 4DV3B 1OLSA 3VV2A 2WLSA 2Q7OE 4Q7MB 3OM9A 4IXMA 4L5JA 5JJBA 3B9PA 2X8WA 2O20A 4U3JB 4UHCA 5B4VA 4YJKA 2BKXA 2UDPA 4CLOA 3BQ9A 3DFFA 2X9GA 3TI7A 1NXXA 2NU8B 1M7BA 3WJ7A 3VQTA 3UUEA 2G09A 2H9IA 1W88B 2HADA 2A0UA 3GAMA 5K8LA 1Q6ZA 1SKAA 1U0GA 2OXEA 2P2ZA 4YP9A 4CLEA 3R9XB 4D8VA 1UC5B 4OCZA 2D8AA 3O8NA 4AKHA 1WMEA 2XEXA 5GOZA 2PSSA 3AKCA 2W83A 1E2BA 3BXHA 3EHDA 3TTYA 2EDCA 3JRXA 4NU5A 2V59A 1QC5B 1EWYA 4UJ3A 4ZEVA 2XBLA 4NBRA 3KELA 4H7EA 4X8MA 3VYSB 4B6EA 4BPRA 4E4YA 3YASA 4B3BA 3ACBA 4ABTA 3GBSA 2ZSBA 3ULKA 1B6TA 3RGGA 4PCUA 3IR6A 1CEYA 1R0ZA 2WUEA 3GGDA 3EY4A 1W49A 4XR9A 3QKSA 2A0XA 5GVSA 1NBAA 1SXIA 4JOCA 1NJ1A 3OCWA 2EZ9A 2BTQB 4YWHA 1K5GA 2OK7A 2R6ZA 5B1SA 4MVCA 1K89A 1OI2A 1OTHA 2PUJA 1B8OA 4JYBA 3IPYA 4QHTA 2FSVA 4DV4B 4J1TC 2C61A 2GVNA 2DCMA 3PWZA 3TCKA 3DVQX 4B4OA 1OH6A 2UYQA 4QUBA 1X70A 1ZDMA 3EIWA 3PIRA 4EKGA 1VP9A 2F8LA 2QQFA 2I9PA 1DRVA 1K8XB 3UXHA 4DIKA 2QVCA 1RAFA 3BDIA 3S99A 1CJTC 2YHBA 1RABA 5KI6A 1U3GA 3GF4A 3RVDA 3ROXA 1ECBA 5ALZA 2XJ4A 1SVKA 3OLWA 1FPQA 3H0KA 3P52A 1SVLA 4HSGA 4UUQA 2REBA 1SCAA 1DRKA 1MDBA 4X1KB 3PQ6A 1P3DA 2HSGA 2ONJA 3AY7A 4BO0A 3DWIA 2E55A 3ABZA 5JZMA 2XRZA 4RL6A 3C1UA 2CJWA 2O06A 2GK4A 5DRYA 3FTNA 3QVGA 4FZ5A 2PH3A 2V0CA 5F73A 2IEDA 5GONF 4CCWA 5JDIC 1XPJA 1SOUA 4DIMA 1HYBA 1XR3A 3JSAA 3S2ZA 4B43A 4C6TB 2RGWA 4CCYA 4YP1A 1FMTA 5LZ7A 1XTPA 4W9RA 5C53B 5D3MA 1BE1A 1KOLA 3RRNA 2FZKA 2PEYA 1TEXA 1WRBA 3VPGA 4I3FA 2H31A 1I2AA 4AZ3A 4BP1A 1MEOA 4IEFB 4DY4A 3Q10A 3UAZA 4MAMA 2B25A 1XALA 3HYCA 4H08A 5E9WA 3F3YA 3KQUA 3IRVA 2YXDA 1X6VA 5AHXA 2BYTA 3OX4A 3PNPA 4Z4IA 2HQ1A 4Y9RA 3I8OA 3OX3A 3I2IA 4Q4HB 5C31A 2UUBB 5HBGA 1UKZA 2H63A 3HR7A 2DKNA 2FWMX 2WJAA 3WZ2A 5MN5A 4EB8A 1OZAA 1JRLA 4MYTA 2J0EA 3B8HA 1CUEA 3WKAA 5B7PA 1DAMA 2I2XB 5GM1A 4C5AA 3O3OB 2HOQA 4MRPA 3TGPA 4OHUA 2ZSFA 4H1VA 1QIIA 1RJFA 2ILTA 3H42B 2A9FA 5JCOA 3W77A 4LF6B 4YJ3A 5CVCA 2X1MA 4WY8A 3HO8A 4NMWA 3GRVA 3B2QA 4KWIA 3EQ8A 3KR0A 5B4TA 3ISVA 3MMPA 3THOA 3L41A 3ZC3A 4LFAB 5GJWC 2C1EA 1DAFA 4GBED 1HYHA 2B1JA 3TDKA 3H2GA 4YV1A 5CHYA 2LR0A 1HDEA 2ODBA 3LJKA 1N0UA 1U2DA 3VSAA 5E7JA 2H29A 3A7DA 1P61B 4QQRA 4DZTA 4TKMA 4EPTA 4M98A 4IHJA 1U80A 5SY9A 4E5YA 4JXKA 1JHRA 3LO5A 4MPJA 4E46A 3HB0A 2NWQA 3JZAA 3AHJA 1AIPA 3OUTA 1E96A 3A1TA 1AJEA 4CQMA 4CBVA 4G0WA 2PX8A 3UY4A 1XQVA 2OT3B 5D84A 3OQPA 3OC6A 3UMBA 3MJHA 2YW9A 3VKFA 1HG0A 3UJHA 4B35A 3E6AA 4A0QA 2EWMA 4C78A 3EPLA 3NONA 5JU6A 1UBSB 3R9IA 4GE0A 4F06A 2XF8A 4ZRMA 1BFDA 4U8GA 2F1RA 4MVXA 1T4CB 3EISA 4DG8A 1AKNA 3LVRE 1Q0HA 4V24A 2Q2OA 4HLDA 3RS9A 1NZJA 2PS9A 1XJ0A 3MJ4A 4OJQA 4R5MA 3NMUF 2CF6A 3HBJA 3B2EA 2PANA 4PLVA 4KCGA 2QR5A 5JSFA 1PYOA 2O8CB 4H59A 1XNJA 4PHGA 4RSHA 3SOPA 4CEHB 5CDFE 3EAQA 1DS6A 3KALA 3N7UA 3AHFA 3DHEA 1D5WA 2OV6A 2VBIA 4MCHA 1H5UA 2O7RA 5AOVA 3G6KA 4R1OA 1LD3A 1X9HA 2QG9A 3M6UA 1H8EA 2R6CA 2AI1A 3KEMA 3EGCA 1BS2A 3PL5A 4B85A 2R87A 4LJYA 2N1MA 2X2EA 1K8YB 4ERXA 4NZMA 4WCFC 3T7SA 1ZM2A 2AF4C 4ALNA 4Q1AA 4NNOA 4Q03A 4F7WA 5HG0A 8ADHA 1XTRA 4IO1A 4LBYA 4Y6SA 2BMFA 4UXIA 3GGOA 2NYUA 1TFUA 1MGPA 1B41A 3G8BA 5EVCA 5M04A 3BH0A 4MRAA 4OKSA 3EMDA 1L4EA 4DUPA 2G1AA 3JZMA 3M5WA 4UM5A 1KXJA 4WXPA 1D2RA 2IW3A 1P8AA 5KJCA 3ADDA 1PAUA 5F4BA 2XGGA 4RIGA 2QN1A 5LZ9A 4KAXA 2C7BA 1U8UA 1GYQA 3DBOB 2EL9A 2HD4A 1CF2O 3ORYA 4Q3KA 3UJ3X 5LZ2A 1D07A 1E66A 2ONZA 2P6OA 3K09C 4M6WB 1OPRA 2CLCX 3WRXA 2C9YA 1GGNA 2QSZA 1KIAA 2GLTA 2R1ZA 3I32A 1FYDA 3PSAA 4PLTA 1L5ZA 1YZYA 4XX0B 3W6UA 1R9JA 5IPFA 2AK2A 4CRWB 3J7TA 3MCAA 2NT3A 1SVUA 3OIFA 2WY2D 2B0CA 2Q21A 3TRKA 4ENUA 4FFBA 2QRJA 2FK8A 2YJ3A 3GEEA 3RS2A 2V55B 4QC2A 3KUXA 5FPTA 3SVTA 3GLFB 2P2CA 2EKPA 1FFDA 4EX6A 4I3HA 4RD1A 1DC4A 1Z0ZA 3HLKA 2Q7DA 1Z2PX 5HPYB 2P3OA 4KQCA 5CDTA 2OUKA 2WJZB 1TC2A 3DE0X 1Z2NX 3OCJA 5HF8A 1YI8A 2OZEA 2PQ0A 3DW3X 3WKBA 2VWQA 2AN5A 1RP1A 3DULA 3PXBA 4QICA 4ZCQA 1TTQB 4W99A 5JANA 1PR1A 2ORWA 1UKVY 4JWTA 2XCSB 3AM5A 2A9OA 2BUBA 2PYIA 3ZX5A 1IOWA 1QZZA 2ZUCA 5FOWA 3HACA 2J0SA 1DOZA 1RBQA 2ZUSA 3UQZA 1YS7A 1ZBQA 2BONA 4KN6A 3CVYA 2VDMB 3DWGA 4D9CA 1F8FA 3BK1A 1MFPA 1Z7GA 4EOGA 4Z1OA 1SC6A 3R4VA 3TEJA 3N53A 2WD7B 4MAAA 2Z8XA 5L3QB 4FWBA 1L5GB 4MITA 1ZX1A 1Z75A 3E3AA 1E6UA 3LYUA 2FRDA 4NJMB 3KJGA 2NO7A 2I67A 1P0CA 3BMOA 1L4UA 3KE8A 3VPFA 2GFIA 4OFXA 2VRNA 5AJTA 3SF8A 2YQ4A 1W0JA 2FZEA 1JSZA 1Y6ZA 3P1JA 1Q1GA 4FGWA 4G5HA 4MKGA 3DLCA 2WT8A 1SURA 1XF9A 3C15C 4N54A 4PNZA 2PKQO 1MAHA 1QV9A 3A7EA 1A2QA 4QOGA 5JIBA 3P2YA 4KXNA 3WTBA 3T5AA 4UFPA 5LB4A 1NN3A 3Q7TA 3AEQB 2ZBGA 3H86A 1T36A 4C1BA 1FSPA 1UKCA 2CXXA 4HWTA 1JALA 2R6HA 3DT9A 2PBZA 1QBGA 2JLBA 3OIWA 4F8EA 1BMFD 4GUDA 1OA1A 4Z9BA 5E7QA 5I8WA 1TGYA 1BXGB 5BYJA 2PNFA 1SJ9A 4UVDA 1WKVA 2FUNB 4XGNA 5DTJA 1CQXA 1IH8A 3UOWA 4CW7A 4DDVA 3QX8A 5EERA 1I94B 5E7MA 3KHKA 3SJAA 1BW9B 3WWDA 2A92A 2P79A 4EHNA 1XRLA 3R41A 1V7PC 2Q0XA 5B1EA 4Q9NA 3PEVA 3COWA 3FFWA 4N40A 1RU3A 4IFTA 5EMLA 5T4HA 1IOLA 4J3JA 5JMOA 1K7EB 1U5BA 3WIBA 1QCDA 3Q98A 5CCXA 3AUKA 2O54A 3RVKA 3P2JA 2YH2A 4HD8A 1SIUA 4UUAA 5AXDA 2HQRA 3VYRB 3GEPA 2WPNA 1ZPDA 4JUAA 4UAUA 4NE2A 3TQHA 3IMFA 5MHTA 3F7TA 4YONB 2Q8PA 4EYQA 1TK9A 5IVKA 2X40A 2G6TA 421PA 4DUGA 5HZMA 1IHPA 1MO5A 4FJ1A 4NP6A 1NFRA 1V9CA 1R4AA 2JFHA 4R7TA 5ADUS 1NR7A 2FFJA 2Q3HA 1T0HB 4FTWA 1YFJA 2XDWA 3EXG1 3IQIX 3NR2A 4C2AA 5K0JA 3ZV4A 5ADWA 1ZA2A 1AF7A 1WWKA 1Y6RA 3LT1A 1I2CA 2BZGA 4X93A 4JEMA 3SM3A 2WM9B 2O1XA 1SBIA 1GAWA 2BFEA 4P7GA 2H7CA 4QGAA 1ZW6A 1Z4PX 4UEJA 4ZT5A 2G1UA 3M83A 4NZYA 2Z08A 5LUBA 3AJRA 1BKYA 2HCBA 4X1IB 5CDUA 5C8YF 4RZSA 1NV8A 3TIFA 3ZDAA 5GZ6A 3VM6A 4BE7B 3A0UA 4WOKA 5FWAA 2AG1A 4F6RA 5A0TA 4BEWA 5IANA 2B0JA 1WZNA 1NN5A 5HILA 2PY6A 4IP0A 2WYWA 1RXYA 1RJWA 1O87A 4PX3A 2G0NA 3DAGA 5KVAA 3PX2A 2IS2A 1D4AA 2I4LA 1VJDA 4J43A 1HFKA 1D4ZA 5EPOA 1NM5C 4GH5A 1CUFA 1T1RA 4KLCA 3RTBA 2PUWA 4MGYR 2ZBEA 2A9PA 5DN6A 1HT2E 1YQEA 1E63A 1O94D 1QHHB 2RH9B 4JC8A 4MIKA 1DO8A 1XXHB 3FJYA 2AG6A 5DNEA 2BLLA 4ZHQA 4ZODA 1BHSA 4BMCA 5KSYA 4WZBA 4FFNA 3HCRA 2AHRA 3DUFA 1PUJA 1WVIA 2OHXA 4JLWA 4WAUA 1ZJ6A 1YDMA 4KVGA 3PBKA 1U0JA 2ZQZA 3ITEA 3H11A 3NC4A 4KP7A 3SHWA 1QORA 2ZPUA 5KHAA 1E1MA 3CUWA 1F8UA 1JX6A 3HVRA 2HJSA 3AR2A 2C8KA 1TLFA 4X97A 3WB0A 1ISHA 2BMJA 1Q11A 3VDMA 1BGVA 2OFWA 2RGYA 3FDIA 2JK1A 3L5OA 4V0OA 4ON9A 5DISB 2OR3A 2A59A 3LUDA 4ZN6A 2ZUFA 2D06A 1M54A 3SLRA 2HJRA 1K8ZB 3WL8A 2J5QA 1EXVA 1L7DA 1RM3A 1TMYA 2IYNA 3MB8A 4BKPA 3S68A 2DR2A 3EWIA 3WJAA 1DBSA 2WUFA 4EIWA 4GYWA 4IIFA 3TDNA 1AK2A 3FTFA 2A9KA 2HJWA 5I9MA 3V8PA 5BUSA 1VBKA 4AZ0B 3N8IA 5A0VA 1SUFA 2OMKA 3KBOA 4XEHA 1UINA 1SKBA 1KO5A 4ZOBA 1U8YA 3SNKA 1U0HC 1GSAA 2HV8A 2PX2A 3DNFA 3KB1A 3WMWA 4FFWA 4OQQA 4BLTA 1FP1D 2YY6A 3RSSA 2YXPX 3WQSB 4HWKA 5G53C 1DG1G 3CRW1 3CX4A 1R88A 3HA5A 4G0XA 2E5WA 5KOHA 3TK1A 2FQYA 4TLEA 1ECLA 3T0GA 1GUZA 2WJHA 5E6UB 5LBIA 2YVUA 1CYEA 3BTVA 3NH9A 1S2IA 2J7PA 4O4LF 1Y34E 5BMVA 3AHIA 3L1HA 2QA5A 3KTAA 4WLEA 3TNJA 3RAEC 5LZ4A 4J0DA 4D26A 3DL2A 1KI3A 1Z6AA 3G2IA 2I2WA 1S2DA 1FX1A 1Y8AA 5I5EA 4Q1BA 3MT9A 4MWBA 4LXXA 5CEEA 3P9PA 1B14A 2RHJA 5DOVA 3UJPA 4AG6A 3AFOA 1J21A 3W1WA 1H5NA 1KJJA 1IB0A 1LA2A 4DNXA 5F7XA 2Z43A 2FOXA 1XDZA 2JD2A 3GH1A 5E2AA 2AOTB 1IB6A 2RC5A 3F4KA 3CBQA 1U0SY 1UOPA 3O75A 1KEZA 1QPZA 3LWDA 1QKJA 4Q9HA 4LHWA 3FDZB 3OZSA 3TD9A 3D4PA 1KEVA 1FU4A 5DCYA 3I6ZA 1M8KA 1U8TA 2OHGA 2RKWA 3ZKAA 4HQOA 4E4RA 4M8NE 3SBXA 1CUHA 4W5TA 4JJAA 2P78A 1OF1A 4C4YA 1ZMOA 4E5DA 2B1GA 3C4VA 3B7WA 4PIPA 1QYVA 3LUFA 4HDMB 2YV1A 4BZPA 1VE7A 1ZKDA 4EAAA 1X3SA 5JE8A 3UM9A 2VJDA 3WGHA 2RK3A 4FVTA 3Q6NA 1QLJA 1SXJC 5D3KA 4TSRA 5AMXA 1BXRA 4HGPA 3K73O 3QF7A 4I4TB 4LJSA 4OTZA 4X95A 5T6MA 3SFTA 3VC7A 4QUJA 1VE9A 2ZYDA 2BH9A 1M8FA 3TIXB 5EJGA 5TT1A 1VG0B 3L0SA 3HU5A 3DAHA 1P17A 1EA5A 4Z1MA 4L4YA 3WLHA 1JEQB 3F0TA 3KD3A 2Z30A 3OAAD 1TJ4A 3LD9A 5FLEX 1E7SA 1QVWA 2VJKA 5EJIA 1W93A 5HGXA 3AVUA 1NVVQ 3Q3EA 4GMGA 4UVEA 1Q0SA 1HEYA 2RAFA 4JI5B 2H4ZA 1UZUA 3OWOA 4JASB 5IM5A 2PGOA 3OFVA 1O08A 3B1ZA 4PNHA 4QTUB 3U4QA 1I5EA 1RTTA 1UFKA 2FSIA 3HO6A 3ONWA 3TB4A 3LTEA 1PJZA 1Z33A 1QPGA 1VRWA 4QEKA 4DR3B 4S24A 3PUVA 4P7BA 4DYHA 4FOLA 4D25A 1N0IA 2V6GA 5KX5B 4K2AA 3ROEA 5G0TA 1VLHA 2QGNA 3T9EA 1BCSB 1N8TA 2O6HA 1G41A 2JFWA 1UBRS 3AJEA 4NMHA 1U0BB 2CCGA 4MQLA 1J8QA 2EW2A 4DWWA 2K87A 4JUCA 4XB2A 4YB8A 5B58T 2WJJA 4ACBA 4CV1A 3KWFA 3U5TA 1ONNA 5LJIA 2GCOB 2PUEA 3NM5A 4PU0A 5C1BA 4NENA 3VZRA 1KAMA 1KKLA 2HUNA 4FR0A 4B45A 2VHQA 1IEQA 2WF9A 3NKFA 4H7FA 4J8PA 4CG0A 3KKLA 4JR1A 3TDMA 3QPBA 3FZGA 4J0FA 4TYMA 3SKXA 4YA6A 5FI1B 2C3YA 3EFOB 1U3WA 5BN3B 1H93A 2F3UA 1Z06A 3Q41A 3TB6A 3ZK9A 1S2OA 2FP4A 3GVXA 4X66B 2C2MA 1XYVA 4JA0A 5AI9A 3ZZNA 5JBIA 2JGFA 3WNZA 1GQSA 1YBFA 1IAQA 2DWPA 1LJ8A 2XKAA 1A76A 1JG4A 3BAZA 3BWCA 3HWX1 3KOUA 2IXBA 2H2GA 1JHAA 2J30A 4UNQA 3L82B 4CIBA 2ZG6A 3QXSA 4JZKA 4YDQA 2HMYB 1KBOA 2IHTA 5TGTA 3E5MA 4PCVA 2CMDA 5HUQA 2Y1EA 3U7EB 1UBGA 5KZMB 1RHKA 3HADA 2FY8A 4XRRA 1XZDA 3GCDA 3H04A 1T5DX 1UK7A 5EIWA 1JFFA 5B6IA 5DX8A 1KEPA 1DWOA 2AH5A 4S1NA 1X7GA 4G4SP 1X7YB 5DGHA 1WZUA 2BGUA 1A88A 3IQZA 1KR2A 2B2CA 2IZOA 2ZJBA 5G0SA 2YV4A 3SVLA 3B5IA 1ID1A 3L8GA 2FR8A 1CYDA 2Q29A 3LNTA 4Y1EA 4NHOA 1RWMA 2HN9A 2EGUA 2ZRIA 4W8OA 5LU8A 3AKYA 4YJGA 2A5DA 1CX9B 2QLNA 3R6LA 1VL0A 4DT1B 1I4EB 4Y2XA 1KF0A 3BWYA 4IHQA 2E2WA 5CHEA 3EF3A 4PE5B 3AXTA 2H0AA 4EDFA 2QEQA 3LDFA 2A94A 3O73A 1C1YA 2NAPA 3MTBA 4BNJA 3A2KA 3N76A 3BSYA 2Y66A 4KZPA 4BU0A 3GLVA 4BCDA 4E07A 1QDLB 1S7GA 4XIIA 4YUXA 2QN2A 1GZDA 1ZRHA 1F4PA 4U00A 2R66A 2BRUC 4ZALA 2XMZA 4P22A 2V9ZA 2HA0A 2Q8NA 3D1JA 3MTDA 3Q3GE 4FOOA 4QELA 3QY0A 1Y7HA 3F2IA 3UK2A 1Q1ZA 2GESA 1OV6A 1NVVR 2JFVA 3UHAA 3HRKA 4Y2SA 2IH5A 1GITA 3K05A 4ZK2A 1ZNYA 5ALSA 2J41A 4XRGA 3SJUA 2WP0A 1WDWB 2A1TS 2V4ZA 4MUGA 5FTMA 1KI6A 2ORED 2XMQA 4YJHB 4KSCA 3MCTA 4C4ZA 1SCQA 2P5TB 3NTXA 3B38A 3ZCXA 2FQXA 3EXHA 1TUBA 1GNLA 2FFHA 2K2QB 1EMDA 2ZT5A 1Q77A 4G1FA 1L8OA 4NOJA 1EX7A 3LBFA 4A3SA 1H6AA 1Y8RB 3RGWS 5EXDA 2OPHA 2ZIXB 3KAPA 3VC3A 4BYMA 3HBAA 3WV5A 5KWJA 4TYWA 1SHJA 2GZRA 5BSVA 1H3FA 3V2HA 1V4BA 5ALOA 4TUYA 4WCVA 1E9CA 2VYQA 4HVTA 1VFNA 4QLOA 1U7XA 1ONBA 4B8WA 1C4XA 4FBGA 5E7IA 4XGRA 5KQGA 3GXOA 1QZXA 4HAXA 1GILA 3BFVA 4UZEA 5DT9A 3WLEA 2ZAOA 1KI4A 1MOSA 1Q20A 3QU7A 4GU5A 2JFPA 3W6NA 5A4KA 4HWOA 2YW2A 3I6QA 4RNDB 4WCDA 3FX2A 3DZJA 4RENA 3CZ5A 3I5AA 1EFUA 4KW7A 3IAM1 4KKVA 4KXLA 1U2TA 1O89A 5SY6A 3R77A 4MGIR 4DLSA 2VXCA 3IAS6 1NVXQ 3CX8A 4BIIA 3OY2A 5EZ6B 1LS6A 2XLBA 3PVCA 4RE6A 5F1OA 5IT9A 1UANA 1UPXA 3I1JA 5CB0A 4C7OA 1WY7A 5BPHA 5F9HA 4EB6A 5JTUA 3O4HA 2CVFA 1GEEA 4YJ2B 1IPHA 5IAGA 3TLBA 4CKBA 1NLYA 4IDNA 4F3YA 3BWDD 4WE3A 1K8QA 5AOCA 4BO7A 5LFAA 2Z83A 4E1BA 3UTDA 1Z5OA 1UAYA 2DBYA 3A6HA 4F9TA 4NFYA 2BFFB 1OI7A 1L6IA 3M6IA 4QU0A 4RH1A 4UM7A 5KTRA 4RF4A 3MGKA 3KQQA 3GIWA 1QIJA 2Z58A 2W2LD 3AV3A 3FLMA 4Y2TA 5K1ZA 4YRKA 1N1EA 4MKZA 4NJEB 4HDQB 3VPAA 3N74A 4ZCPA 1ILWA 2VUSA 4UEWA 3HCNA 1WXFA 1EIZA 3DLHA 2I66A 1QX3A 4UD2A 3UBMA 5KYNA 1EHCA 2AEMA 3PG5A 4B76A 4EW2A 7REQB 1YZKA 2DECA 2DUMA 3THSA 5KYVA 3V4VB 4D6YA 3Q3VA 3UV7A 1KI2A 3M0EA 1GUDA 5AJUA 1SKQA 2X13A 1KK2A 1RJEA 2FW8A 5AJYA 5E1MA 4BOYA 1AV7A 1SHKA 4HXGA 2E4YA 4X41A 2PKXA 1E2FA 2IVFA 1F2UA 4HDNB 5AP9A 1EFRD 4U7GA 3KNZA 1JFRA 2DT5A 3QTBA 4TV8B 1WP9A 4KO2S 1NVBA 2N3ZA 3ONNA 5ECDA 4URXR 2CWWA 4CDNA 2GR9A 3ZQUA 2PD6A 4EGCB 4RSMA 2L18A 3KS9A 1G5IA 3IQEA 1KFBB 1W1WA 5BR4A 1VGRA 2GERA 4R8KA 2R8XA 4F5EA 2WF5A 3G85A 1JYSA 4J0EA 5DLPA 4G9GA 1PGPA 4LYGA 2C94A 3I6IA 3LX5A 4CV2A 2H9YA 1O8BA 4BXOA 1BGWA 1DI0A 1JTEA 1GPJA 2WD8A 4N65A 4WW0A 4XFDA 4CFYA 2PLFA 3E1SA 4OQEA 3WQBA 1XPUA 4YPFA 3TLJA 1S4MA 4WHMA 1TCAA 2BGLA 3E27A 4I50A 5JXGA 2FFRA 1YVDA 2PU7A 3T4XA 1BO6A 1IXZA 3VNVA 1EJBA 1DG9A 4GOLD 2JFBA 2WUWE 2W8ZA 3BJZA 4RD3A 4RK7A 5GQSA 5CCDA 3VISA 4MRNA 2PXAA 2X6QA 5ALRA 4GR4A 5TC4A 5D85A 2JJQA 1M5TA 1D04A 2OSVA 3I5XA 4FD3A 3N3AC 4C4TA 2W4MA 4D2IA 1P1FA 2QQ0A 4POAA 4B4VA 5AHKA 3I9LA 4GGMX 4DQ0A 2VNKA 3JQPA 1UJBA 1R15A 1VHJA 1TA0A 4AG5A 5E6SB 3EGDA 3GD5A 1EXNA 2JDID 2XTNA 1UAGA 2ZTUA 3CLTC 4KO4S 5CIQA 1KBZA 2A5JA 4ZAZA 4ZCSA 3LZCA 5HFNA 2VRBA 3L8ZA 1XZKA 1DDOA 2FETA 3OPYA 2D54A 4L4SA 4GI7A 4KVAA 2YN4A 1SXQA 2YICA 4A8JC 4QDXA 1IY0A 2FUEA 3ND9A 3JATB 3DDUA 3H2YA 4MS3B 1HLPA 4R84A 4WEQA 1OVMA 4IS2A 3G02A 3QHAA 1VECA 1U90A 2AR0A 2YZMA 3CR8A 3JCZA 5HNKA 3OLYA 1JVBA 4G5QA 4JL8A 2C82A 3QXJA 4B6PA 1CUBA 1T9GS 2QW1A 5LC1A 2QVXX 1W6UA 1J33A 5A4AA 3ORHA 1HQCA 1QMGA 2RHWA 2X5OA 4H60A 1GGFA 4EL5A 2R4UA 1WNFA 4O4IA 4QPJC 4BKQA 1IBRA 3SHQA 2QPTA 3P26A 3N6XA 5EMJA 3SS8A 1FY2A 1QDUA 1WS6A 3II6X 1IJBA 1UZLA 2R68A 4E5PA 4BVJA 3GLSA 4DQVA 5KVSA 2RHOA 3S4YA 2OC9A 2X0RA 4AVYA 3TR6A 3MBKA 2IV7A 4WJKB 1L4BA 4X92A 3HPQA 3JRNA 1M2WA 3TR5A 2NPFA 4D8YA 1IWOA 1L7NA 1A4IA 4ZI7F 2IY7A 1X8KA 1BN7A 4YAEA 4WWHA 2MOKA 1TQ2A 3FDFA 3NXKA 3UMCA 4UMEA 2X8AA 1FU8A 4ZWNA 4C4SA 3Q0TA 4A0SA 2WG0A 2WTMA 5KVVA 1N7JA 1C41A 1Q7EA 1TT5A 1Q14A 4FDAA 1SU4A 3RJ5A 2IRWA 3ZZMA 1RMQA 1M75A 3KOWA 3LBAA 1WVGA 3ADKA 3BF8A 1Q95A 3FSEA 3TXAA 3JQFA 4FS8A 3U3RA 4EF5A 3DCJA 2BV3A 4RY8A 1BWPA 4A82A 5JBNA 4C9BA 5FBVB 1UOEA 1CQZA 1F1BA 1S1MA 3L43A 4KEAA 1NLFA 3RQSA 1OR8A 3O2JA 3T3PB 2AZTA 1NVAA 2W93A 3D6AA 4NBTA 4NEHB 4IOJA 2XVXA 1SU7A 2QSJA 1PR9A 1GCIA 1XNHA 1XKXA 4PLFA 2AKAB 1OAKA 2OA0A 2X9QA 4AJ2A 1BHO1 4NBKA 3TLKA 1AKQA 2X8BA 3ZV5A 1E2LA 4A1FA 1BS9A 1A7AA 2BELA 2HSZA 3I34X 3MSCA 4ZPJA 1A8UA 1MT3A 4ER5A 4AUEA 1RRPA 1VYVA 3FRHA 5ERYA 3B8EA 2C57A 1NI4A 1WMFA 2B78A 5ESWA 4YMUA 4BAGA 2UYHA 4IF6A 1V7CA 3BD6A 3TSYA 3FD8A 2JCSA 4QDKA 1NT2A 1YRYE 2DT8A 5EXEA 4C3OB 3I2JA 3IIMA 1CETA 2OBLA 2O0JA 3KIPA 4IZ6A 4PV7A 2JHAA 2ZXEA 2LXNA 2P69A 3I9MA 2MMCA 4HS4A 3TNLA 4AYWA 2OBBA 5AVXA 1N0VC 5J47A 4LXUA 1H2HA 1SG0A 3CKYA 1YU9A 3FY4A 3DYVA 3H2IA 1URPA 3WGKA 3HDJA 4OXRA 2DBVO 2NU7A 3NIBA 1POWA 1NP3A 4A8HA 2DPLA 1UT5A 1UP4A 1B0UA 3CEJA 5GGYA 1RWPA 4BWVA 2F55A 4HDRA 4F1JA 3PXGA 1CJSA 1E2NA 3KOXA 3T1NA 3UJ7A 3DLAA 1CZNA 5FQOA 3GG9A 2GPWA 3ICVA 2GZ1A 4LXQA 2X1VA 3OZBA 2DG2A 4NYIQ 4FNAA 1R8JA 3TGWA 3UJ6A 3NC1C 5L7TA 1MJGM 3K6SB 1J2EA 4RV4A 4M21A 5IJ0A 3GCGA 2JFQA 1CE8A 4JX9A 2WMDA 3HDQA 5KEIA 1RYYA 3BN3A 3GMDA 4M9QA 3L7LA 3NHYA 2FSPA 1EH5A 1QIGA 2RBGA 2ZPTX 3DKKA 3U7JA 2CDRA 4BUZA 4EF6A 3J80A 2JVKA 3CPHA 1R0YA 2XTZA 4O4HF 1U1GA 3FPJA 4OQYA 5FJIA 4INPA 3F97A 5EZYF 3HB9A 1GVHA 2XOKD 4HV4A 1LU9A 3IPAA 1Z15A 2X0DA 5G4KA 2C88A 3BC1A 3PNYA 1FTQA 2BF4A 1V6SA 2CBGA 3OKCA 5AD1A 1XTTA 2BFOA 4NMLA 1LXCA 4L02A 4NG5A 5J2TF 4CM8B 3EPKA 4ZQBA 3FGZA 2BCJQ 1CNFA 1MN6A 2VNJA 1JHXA 4LYYA 3NT4A 4YTEA 4P1ZA 2G82A 3T99A 2XUZA 2XUHA 3WB1A 1V2HE 1DIHA 2FX3A 1N1MA 1QONA 3SZLA 3THXA 1ITZA 2W2NA 3P45A 1A98A 2DJ5A 2HF7A 3QQ5A 4NF2A 3PPIA 3WKCA 3KKKA 5MF6A 2VHZA 1FYVA 1R5JA 3ND5A 5E3IA 5LMUB 3LDUA 1Q92A 4KPUA 1IQUA 3A70A 4IR7A 4LY9A 3L8DA 2X1LA 4IF4A 4W82A 3FCAA 2PT9A 1QZ3A 1OKKA 2H65A 1N5OX 1KSHA 1DXOA 2IPOA 1DKNA 3HCFA 2WWRA 3NTVA 3QBDA 2QJWA 4PZ9A 4XB1A 4FMBB 3W8RA 1NYLA 1QYCA 2MMGA 5BSTA 4FMCB 3DCNA 5I9IA 4XM2A 2JKZA 2W2KA 4MP6A 4PAGA 3SX2A 5DCUA 2BJVA 1WCIA 3QTTA 3LQ4A 1HQKA 3HWRA 1RI2A 4UKDA 1DMRA 1JKXA 2I6GA 3CZAA 3BJRA 3DMTA 3JR7A 1NUUA 3W5UA 1CFJA 1J1IA 3EGVA 3B1KA 1T10A 3ZR4B 1UJMA 1HT1E 1YFZA 4AT1A 2QRKA 4E32A 1HDZA 2P1RA 3OEHA 1CG6A 4FT2A 4PPQA 3UFXB 4CKZA 1N3BA 2ZAGA 3EFBA 3W2HA 2NTJA 3RYHA 3GXBA 3WG9A 4XFKA 2C59A 2AOXA 2LRHA 1VOTA 2AQKA 2PTHA 1YJAA 2Q0HA 4R2XA 3STWA 1UDRA 3P27A 1IXRC 3OE5A 1EGMB 2XRMA 2IXTA 3G0BA 3PNBA 3GVIA 4ZTBA 3VPDA 1YZTA 3G7NA 3Q15C 2XUPA 3VHRA 4AIRA 2V7XA 2EYQA 3FI0A 1LLFA 3ABOB 3AHCA 4HGZA 2B1QA 5B1IA 1EXMA 3WGTA 5L51A 4I4LA 2J3IA 4BCCA 4D3ZA 1QH9A 2H2DA 3D54D 4GPEA 4ECEA 2AMFA 4NYIR 2IV3A 3URKA 5A05A 4U7TB 4ARBA 4YMVA 1G5QA 3OZIA 5IJ9A 4JXJA 3GJ4A 1KOFA 3OQVA 1S2NA 1WF3A 2GCGA 1RQPA 1V95A 2BR4A 3RFXA 5ADHA 3EEOA 1EB8A 3L04A 3DV0B 4GRIA 3ZY3A 1EFPB 1RFGE 5HE9A 1B00A 2AOUB 3E8MA 4MPRA 4XSHA 3HA2A 4F4DA 5MDHA 4TL7A 2G06A 3KDSE 5CX1B 4TL6A 3E48A 4DMGA 4BO9A 3NVKI 2J0UB 2BGJA 1R27A 3CTPA 2ZITA 4HADA 4UCXA 5DX0A 3RG2A 3N2LA 9ABPA 4P34A 4EY5A 1Z83A 4NONA 1SUWA 3AKEA 2F1KA 2P68A 3PE4A 5DTIA 1FU7A 4MVJE 1JDNA 1KWKA 2ZK7A 3QPVA 2IUEA 3SXUA 4B2LA 4GXTA 4BFXA 1KR5A 1LZLA 1C30A 1W0KA 5K0NA 3ZD7A 1UWKA 4OMCA 1KVSA 3CS3A 5BYKA 3CNHA 2WKPA 1PS8A 3PNOA 3O92A 5JMWA 3IVXA 1C1DB 2ZM5A 2NQ2C 1TTPB 1JH8A 2YJNA 3I62A 4GI2A 1AGXA 3HRHA 2CJXA 4URFA 4ALKA 2JFOA 5CLGA 2WP8J 2ERYA 2NV2B 3DBRA 4PTYA 1A7JA 1AO3A 1FRQA 1P2TA 1NYTA 3VZPA 4PSDA 2YHAA 1F60A 3KC2A 2EP7A 4YRZA 3MPOA 3DW1X 2REOA 3KCNA 4F6RB 1O96A 2WT4A 3EPPA 4OXIA 2Z5GA 4Z7JA 3CVUA 1W5TA 3HJRA 4IPTA 3WS7A 1GDDA 1SXJE 3EXIB 2A1IA 2QN6A 1JBQA 2PLAA 2O05A 2EU8A 3BFJA 1UXHA 2QYOA 4S04A 2C5BA 2ZVPX 2JGLA 3L6CA 1M2FA 1K5HA 5IH3A 3T9DA 1W85B 4A16A 2RGAA 3A0RB 3H2ZA 3HCWA 2A4MA 4P7KA 1KK1A 4XM1A 2YCBA 5AHWA 3BHNA 1L3CA 3G0HA 1T4BA 1K3FA 3B9QA 2PSDA 3HYRA 4IIXA 4MI9A 1Z56C 2IEZA 4CM9D 1VSQA 1GL6A 3NDRA 4KGXA 4F72A 2QUIA 2PWYA 1B3RA 1SBTA 4V0KA 3M5CA 4CDGA 2IXDA 2QN7A 3ZU2A 4MWZA 3CSUA 3C6XA 5CURA 5EJ6A 4BC1A 4CMIA 4H7IA 3EGIA 2G77B 2CLOB 2BFPA 2CMKA 4K9OA 5K3CA 3S5JA 4DRXA 2WYUA 5EHGA 4RLHA 1OWLA 4GP9A 4BRWA 2EFGA 3HZHA 2COEA 3C5VA 3HJFA 1Y4ZA 3QLJA 8MHTA 3BMNA 4F4HA 2GKOA 2WWHA 3PLNA 2W2PA 1TUIA 3OPYI 2ZSAA 3IQXA 3AZOA 4H1TA 2BGIA 4GWLA 1NNI1 5JSZB 2I9KA 1QWOA 2CXPA 1BKSB 1PWXA 3A4YA 4ZARA 5H1YA 4B6GA 4BFWA 1ESEA 3ZCVA 3B1JA 3FOFC 4RJJA 1NSFA 3L84A 2RHDA 4LHZA 3OJEA 1J8YF 3JQRA 4LJ7A 3ZNQA 1E7QA 4YNBA 4CL2A 4XDGA 4XX1A 1ISSA 1MKYA 3CUUA 5F98A 2FW1A 1PTJC 3DE3X 3IEKA 4YACA 1EWRA 5IT0A 2R1TB 3IQWA 3JD1A 4XYBA 3EY9A 3DZ8A 3KZXA 4OKNA 1GL3A 1MT0A 4PZUA 3D7LA 1DCMA 3A6DA 3CJTA 2CCJA 1CNEA 3TSWA 3MSXA 4XSGA 1N5IA 1GN8A 2BI7A 2JJ2D 4HGYA 5GVRA 3TZBA 5LNK1 4H35A 1XRNA 1IEWA 2OORA 3EMKA 1E89A 4OFZA 4L8VA 3UGQA 5IS2A 1E1DA 2OZKA 3HVHA 4QATA 1CRZA 5CD9A 2NXWA 1B7GO 4RM2A 4YAJA 4YMGA 1JMKC 4LJ5A 4Q3AA 1UZNA 4Q9LA 4TSFA 5IFLA 2ZRPA 3WGQA 3CIOA 3RVQA 1VIVA 4WKBA 2NO6A 3T3DA 2OKGA 1ZK2A 2J3LA 3OKFA 4BKUA 4D56A 3NOQA 3TZHA 4Y0AA 4RGBA 1Y5LA 3PJDA 1L4GA 3TSAA 4JT9A 3QVVA 3L6DA 4LDQA 4OUDA 2P0YA 4FE4A 3SF0A 1L8LA 1N0WA 2WVGA 4N9WA 4UW9A 3CX3A 3HDVA 3ON5A 2CK3A 1S3IA 4AQYB 4P3XA 4DIUA 2C4MA 4KPFC 4HQLA 2G3YA 3IHLA 4EENA 1U9IA 3M4ZA 3A6FA 2O3RA 4U63A 1SUEA 2H57A 3DAFA 4TTVA 3TPCA 2JIPA 2P35A 1UWVA 4KFSA 2H1CA 4M1WA 4D9HA 3U44B 4RVCA 1WKBA 3BZBA 3DFUA 1QB8A 3AW9A 2FSUA 3DWEX 3ROKA 3F8WA 3OZVA 4FXOA 1A7UA 3TM4A 1I7SB 1AHNA 1B8PA 1MV5A 5KOJA 3LRTA 2CFOA 4ARVA 3K0FA 3MRTA 3QVJA 4FK8A 2RE8A 5CEFA 1IZYA 4BBJA 2JK0A 1ZJYA 2H2AA 2WAMA 1VBMA 5CA0F 1PQYA 1CVRA 3BWBA 3DEHA 3SX4A 3TKYA 2EKLA 4CDMA 1XEAA 3UAYA 2GZAA 2DLDA 2W2MA 2QL9A 3O9MA 4RIEA 3PJGA 4U0JA 1AGRA 1MORA 3WJ1A 3HHPA 2JNWA 1PR2A 2Y6UA 1BKDR 1N2BA 1E6CA 1CLEA 2V0GA 1FUYB 2PJUA 3LMKA 3ITNA 1SQ0A 3N2ZB 1E9FA 3AF0A 1U0RA 2L19A 5B64A 1G7SA 3JVUA 3ZJUA 3TG8A 4EG8A 1WSAA 5PNTA 4CMEC 3Q1LA 2FG6C 2JCVA 1LW6E 2C7RA 4TM8A 4NYJQ 5C7IO 4G65A 3OEED 4GLFA 2WHPA 3A9WA 3SYTA 3TLGB 2F3TA 3UBTA 3MT8A 4AD8A 1FQKA 1CY4A 3CN7A 3L4SO 4MV4A 4CI9A 3NBUA 3GT3A 3UANA 2WV9A 1G8AA 2MYPA 3AEYA 3LCRA 5CNIA 4JJ8A 2PO7A 5AIAA 5JC8A 3N59A 3RABA 5KBYA 5AQ1A 4ZYYA 1CLUA 3TRFA 3OLCX 3ASZA 5K3AA 3HN6A 5FX2A 1HNWB 4HNAB 4FD2A 5CR9A 1G2QA 4L5YA 4JT4A 2FP4B 3OT1A 4KPGA 4BV3A 4HATA 4YALA 4TVSA 4MGHA 3TKLA 4TL8A 1NXTA 2IYXA 3ESDA 2WEKA 4F1WA 3ZVKA 1LW7A 2IP4A 3C70A 5HBRA 2GYVA 4FFLA 5DYIA 5JARA 2OC4A 1ZG3A 1PGOA 5SYMA 4D79A 3WAGA 1TQHA 1X94A 3KYBA 3C4QA 3QJYA 3T5BA 2NZVG 3BGOS 1BN6A 1I3OA 1T0PA 3PC2A 3G2OA 1RXVA 3PFKA 2H5EA 5A4DA 2Y4NA 5KTKA 3L77A 5K7SA 4RVUA 5CDFA 4ESEA 3I3SR 5F5XA 1DX4A 1P62B 2NTVA 2E4AA 4QHSA 4Y9SA 1GA1A 1P75A 3IEUA 1XMOB 5JZ9A 3STXA 3ZLBA 1XAGA 2HH9A 3FTQA 3THWA 4W5JA 4PS1A 3R20A 2BY4A 2QRVB 1ZR2A 2D2IA 2ZJYA 3D2CA 1CIVA 1EM8B 1B93A 5EWLB 2C54A 1BDMA 3R3YA 3NV7A 4LXTA 5LP6A 5FUVA 1LTQA 2FQWA 1ZWLA 2FW9A 3UK7A 2CNKA 1ML4A 3FFBA 4TXLA 3A9UA 2B34A 2J33A 4HP8A 4OQZA 1NE7A 1QIFA 3M2PA 3PT5A 2GM5A 1SGWA 3QOXA 4RM3A 1EWVA 1KFCB 1MO3A 4Q05A 1WPQA 3NHPA 4WEOA 4E2YA 2C7PA 4QM6A 3PQFA 1T2FA 4JIGA 3VJLA 2AGVA 3H9UA 4K03A 1Z4KA 5J1TB 4DM3A 5HRUA 3DS8A 1J0DA 1Y8QA 1F8GA 1ZL2A 4ANFA 3JPYA 1GADO 3W2FA 1CVIA 5IKOA 2OV4A 4KKXB 1MO6A 3E9QA 2CZQA 2EF0A 2DHEA 1JR6A 4UCQA 5G1NA 2HU2A 5KSOA 4PZDA 5AVSA 3DQZA 3S3TA 2C1ZA 3IDSA 4ABYA 1SZPA 3BD7A 3EOAI 5I4CA 3RREA 3B1XA 2MSWA 3LGAA 3F6CA 4HZUB 1TYZA 3NHMA 4PY2A 3OFNA 2JA2A 3DOIA 2HSJA 3H16A 3D6FA 1P1HA 3ADOA 5FBZA 4J49A 2E5FA 3T5CA 5KCMA 1GPDG 4JBWA 8GPBA 1CF4A 1CPYA 4GOOD 1W36C 2WVJA 2Y1GA 1WCXA 4IGIA 1CBUA 4JHLA 1UQUA 2Z95A 2Y1KA 1K0UA 2Q4TA 4CDRA 1JXMA 4N82A 3DF9A 3T3NA 2KM1A 2Y9MB 2ZQ5A 4M7OA 4OSOA 5DRTA 4XCVA 1TF7A 3HBFA 4U39A 3DTTA 4WZAB 4WBNA 2H4JA 4AQ7A 1RT9A 5IAOA 4C89A 2Z57A 1EP2B 2I76A 4Q4JA 3EPJA 2NV6A 1RZ3A 3I28A 1UXGA 5JSKA 4MI3A 3B1YA 4QUIA 4CKEA 3M81A 4XM0A 5IM4F 4IFIA 1RBMA 2I3BA 2PUAA 4BZWA 3IDZA 2IP1A 5EUBA 1DBIA 3NEPX 2I71A 3FB1A 5GOTA 4M36A 4CIDA 4EW3A 4G84A 3ZXSA 3GUZA 3ZCRA 4ARIA 1U2GA 4POOA 1FMLA 2IYQA 2DHQA 1M2OA 1FNNA 2PUTA 1RKUA 5BR7A 3LCVB 1YNOA 5ADVA 5KS2A 1P9RA 4NOMA 1DJLA 3HPRA 3R0IA 4O2BB 2CUZA 3CLVA 4WFQA 3WWCA 2KS6A 5DTMA 5EZSA 2WB2A 4X71A 3DEIA 1M5RA 5KMGA 1JXOA 4XUCA 1C3EA 1M33A 2H17A 3O7MA 1W87A 4YRDA 1OY1A 4E2XA 1NMSA 1Y5RA 1JEEA 3EIFA 2BPOA 5KTYA 5FL7A 3AL2A 5GY7A 1TJNA 5JR3A 2HEGA 4W1QA 2PKCA 2FZ4A 4ZVVA 1UXIA 3PDHA 1S2GA 3WLQA 1Y98A 1IY1A 1VYTA 4KXUA 1FA9A 4C6RA 2I1VB 4DPLA 4I1PA 4D9JA 2O48X 1YA8A 2OGSA 4GM4A 3AF1A 1HZJA 4NH4A 1Y7PA 1CZOA 3RK4A 1B73A 1BFUA 1GZUA 3DV9A 3QLTA 4HL6A 1Z62A 1H05A 2CLLB 3OJOA 3Q11A 4KO3S 1GZ4A 2JFNA 4AZVA 5IDWA 2RC6A 5A3SA 2NOAA 1GFIA 2VRCD 2O1WA 2IOYA 4R9RA 4W5WA 3DB2A 1RZUA 3EZ6A 4AECA 3C1OA 1VKOA 4F38A 1SHUX 3CRNA 3PNSA 4WK2B 3T3GA 3SBDA 1YFKA 1DQYA 2W7TA 1Z7EA 4JLUA 2VDRB 1F0NA 3EOZA 1PYDA 5FBKA 4IRUB 3WRYC 1I4LD 1N2CE 1PR0A 2W6ID 1VSBA 4CQJA 2GLUA 1LNSA 3QSGA 4EEZA 3TQIA 5B1DA 2YR0A 2FWBA 2ON6A 3H9EO 5PGMA 4ZRNA 1AQYA 3FR8A 2PAFA 4MYSA 2AWOA 1QLHA 3LOPA 3ZJTA 3CNQS 4GBMA 5EUQB 1D1TA 1H0RA 1OYYA 4BQSA 521PA 4M88A 4TXJA 1PX2A 2ALJA 4KIFA 5DNWA 4ESHA 1TB4A 4Q9JA 3QLUA 3S40A 2F3QA 3D8RA 4QDTA 3VH1A 3U3DA 2B30A 3MWYW 3WZLA 3WNDA 1PK8A 5DF1A 3COJA 2VDJA 3H5OA 5KYYB 4PR0A 5MGBA 4IVQA 4R68A 1RHJA 5ILGA 3CB4A 4D98A 5H5JA 3CLRC 2OCAA 4JOBA 1W48A 2B4YA 3L0CA 4WK6A 4DDUA 3BTOA 2IDJA 4BZZA 4QNMA 1YSCA 2C83A 3M1AA 3O6VA 3T3MB 2IYUA 5AK3A 3UFBA 4BU1A 1P0QA 1Z8HA 1E79A 3KQHA 1HKUA 4B73A 1A71A 3O4JA 1CUXA 2UUCB 4UE2A 1YJBA 5FYDA 1TUEA 2NIPA 1IOZA 3TOCA 1EBUA 1Q44A 2O2GA 4R2HA 4HNHA 4A0HA 3KZKA 2NW6A 1YUMA 1W8IA 2NM0A 2YUTA 3FJ1A 3ASYA 5ER6A 4XYLA 3A4LA 3GEIA 2BL4A 2XVAA 1G8YA 3V8NA 4MMXB 3UAXA 1NLUA 4JI2B 5IK2D 2CT8A 3BA1A 4MQEB 3MK31 2IU0A 4J2HA 3ZZ1A 2ONKA 3W7BA 4FGUA 2C0QA 3PKJA 2QM0A 4HC4A 4CM6A 1D6NA 3FRIA 1BX0A 3RRXA 3X2FA 2I6QA 3BXEA 1L5QA 3IV9A 3K31A 4AO7A 5A5GA 1EK5A 4DB4A 2XCOA 4WKPA 1J20A 5GMOA 2VTBA 4YBRA 4ZVMA 3GP8A 3VZBA 1OZFA 1XVVA 2YYAA 4LRYA 3ZV3A 4YHHB 4EFLA 2G9RA 2NO9A 4GZ3A 4IY1A 5DCWA 1A04A 5DHPA 3NIFB 4Q7EA 2VUIB 5DM4A 3ST7A 5C18A 5AT1A 1YS6A 4MW5A 1X80B 4KR2A 4UUPA 3VR0A 1CQJA 4RPHA 2CW5A 1GPKA 2ZZKA 2FEMA 5HIIA 2DC1A 2HJHA 4MKFA 3L7JA 2BMWA 1AQ6A 1CY1A 5JVDB 4P5EA 4Z0NA 3W05A 4KFRA 4IVRA 4J0HA 1L7RA 1SCJA 1VIYA 4ND6A 1FYWA 3SM9A 5CD1A 1N5DA 1E1KA 1JNYA 3IERA 5FBRB 5FH9A 1SBQA 4IZOA 1XHEA 3FLAA 3ETNA 3CV3A 4MOWA 5AVOA 1T3TA 2HMUA 2PWZA 5G1PA 3RHTA 2IYEA 2GXUA 4ETIA 2XTAA 1KEEB 3O8DA 4BGDA 1H4QA 2QX9A 1EG2A 4CFZA 1E3EA 2FFQA 3QFTA 2QLLA 3GNLA 3K94A 5B3KA 4I1YA 2J4CA 5H59A 3F1KA 3TE6A 2H7VA 3MD9A 3NWPA 3QVKA 2IXAA 3TBKA 3DZDA 5ENZA 3VX4A 1P9NA 3P2EA 1J0AA 1XU4A 4O8ZA 4XDYA 5IVDA 3AL3A 4EW6A 3RYCA 3W2EA 1PGQA 3V9PA 2AOVA 2XQVA 3MRXA 4BV9A 4ZOQI 4Z4EA 4BNKA 2V1UA 1KZHA 1P4RA 5J4YA 3AF4A 5T7BA 4RYDA 1PWYE 1ETUA 3MQ2A 4PHHA 1KP3A 1BTOA 1RBZA 3S6JA 4YCMA 3D64A 4P08A 1XP8A 2IPLA 5FFNA 2YNMA 4B75A 4O59O 1GD1O 1E0KA 3HP7A 1G5PA 1R0SA 2FGKA 2NZJA 2B92A 1S5PA 3OUUA 3CUYA 2HU7A 1MQ8B 3Q87B 4QGFA 2A67A 4J7AA 1IJKA 3V2UA 2I6UA 2A5LA 1JMYA 1Y1RA 3HEMA 4D4LA 3B36A 1Y5IA 1GTJ1 1XWWA 3EVFA 2OD7A 1TMOA 3T34A 1FZTA 2RGXA 3R3HA 2ZBUA 3MA0A 4YV2A 3NPMA 3H6KA 2IJGX 3N2EA 1KPGA 3NLLA 3FOBA 3VC1A 3WAJA 2REQB 4NDAA 5I7RA 3KYDB 1HYQA 2PD4A 3I6BA 4IUBS 2IBTA 3SHFA 2GHIA 5K3BA 1AS0A 1BJTA 2WA1A 2HNKA 4QBKA 5LBUA 4UDYX 4KJXA 4FCVA 2BDEA 4WASA 3ET5A 3PWKA 4RVDA 2VK1A 3VHXB 3OO1A 2VCEA 3PEFA 4IX9A 5HQ3A 3AGQA 5DBEX 1LLCA 1OI4A 4P0PB 1KVRA 1ZJJA 4JWKA 4KIWA 4S05A 5HFJA 5AK0A 2RGCA 3LVBA 3E9ZA 5LZ8A 2BGRA 3NS7A 1W46A 2WVAA 4C5BA 5EJEA 1MIOA 4FHZA 4GR9A 4KO8A 5GADl 3RUPA 1IC6A 3LP6A 4RGQA 1ADYA 1NF8A 2OVFA 3ZLUA 2G8LA 2Q5OA 2GRAA 2ZUBA 1JKIA 3OD1A 1D9XA 4IIUA 4B32A 5D7BA 2O8EB 4TV9B 5AW2A 1G8KA 2B5WA 3DDSA 3GK3A 1P7ZA 2EC5A 5JQGA 4N41A 4MJ3A 3DF7A 4EKIA 4RAQA 3UCXA 4K6HA 5CG1A 4M89A 2ZROA 3IKVA 4TZTA 2Q2QA 3UAOA 4V1CA 2FVYA 4EP1A 1PP4A 1RRVA 2I8AA 1H85A 2QI9F 4D99A 1OD6A 2PNJA 2Q5QA 4CEIB 1FX0A 1WMAA 3QVTA 4L76A 5CIWA 4RXTA 3R7WA 3W2IA 1IQPA 3HXPA 2RFLA 3ZYZA 4CR7A 2P5SA 2DQ4A 3BH7A 3A1CA 5T41A 1Z88A 4RQAA 1J8MF 5AH0A 1YJQA 1ZD1A 4F4JA 4TQUS 1VMIA 2O4CA 3CO0S 4HN4B 2P9CA 3HQ4O 1K6MA 1MENA 3G0GA 4KIUA 4KO1S 5A03A 4I55B 4EJFA 2LV8A 1HE3A 4IICA 4W6QA 3DXXA 4Q37A 3STUA 3KAKA 4ECAA 3H9GA 3BRSA 2P4SA 3IP8A 2EFDB 2KLHA 3WO1A 4ZOLA 3EGXB 3FHOA 1PNRA 1F12A 2QB5A 5C1OA 4NI5A 2EIXA 4OJNA 4L72A 1CT9A 3LUBA 2HIAA 3QWHA 3FMOB 4O0LA 3UK0A 4YX9A 3C3YA 2UAGA 2V3CC 2E4ZA 2EV9A 3BJIC 1GZ7A 4N4AA 2LP4Y 3MMNA 3LOUA 4WECA 4CEJB 3B82A 2C04A 2XE4A 2RB4A 3GWZA 4NOLA 4UULA 1PF7E 3VRHA 3BBLA 3T9CA 2O2ZA 4PX2A 1QK5A 3BILA 2PJZA 3PFFA 1WZEA 1G19A 2YVLA 4JXXA 1P3JA 2PTGA 3OOYA 5DXFA 1WUIS 3KWLA 1Q15A 1UFQA 3I2GA 2J59A 1UJNA 4JP1A 2QJRA 1Z38A 4H17A 1TU0A 2OHOA 4X8LA 1FDSA 3M70A 3C8ZA 1BYIA 5HJ7A 1WTAA 4UHJA 4DKXA 5KDOA 3K92A 3PQCA 2IYRA 2VEOA 4RE5A 1N3LA 1WVMA 3ZNNA 4ZO4A 5FI5A 2YS6A 1TYDE 1PFYA 1SUPA 1Z5WA 1RPAA 4X62B 4LE1A 1I5RA 1NIJA 2WJ3A 3U5ZB 4JI1B 1LVGA 3V3KA 4BMPB 1XE3A 2WMOB 3DGFC 3AY3A 4O3FA 4XR4A 5LOVB 1XZGA 3IOYA 4FWTA 4GQIA 3AWIA 1EFKA 5IK2A 2Y1OA 5CM2Z 2WTAA 1GYRA 4G6ZA 4KXMA 4R0MA 3PK0A 3HCDA 1JJAA 1T3SA 2I8LA 4LVOA 3T41A 3A6LA 2YOGA 2AW3A 2PXCA 1CUGA 3S28A 1IN6A 2JCBA 2VOEA 3QYJA 1L0BA 4RLQA 1K7CA 2QV7A 3ACCA 4RZ3A 2WU1A 4EPWA 1WSDA 3GUCA 1F7VA 3W8DA 1WUKS 3Q9UA 1IVSA 4B7UA 4L85A 2C5LA 4HDSA 3A6PC 1EX1A 2CV1A 2A1TR 3ZGNA 1R8YA 4AJJA 3C7CB 3L8CA 3RJMA 2ECPA 5LBTA 1GFZA 1BYUA 2QDXA 2YX1A 4V2IA 2AYYA 4G1CA 5H16A 3ESQA 2VHEA 1SD1A 4HEJA 4MV5A 1VIDA 1L5YA 3SAJA 3VMMA 1LBHA 2CN1A 2B83A 4DLBA 1QH8A 3M4NA 3KLMX 4PLGA 2XXJA 4JL5A 3R7BA 4GM0A 2XE6A 3PJEA 1BDHA 4JBYA 2F3SA 2WPDA 3NJRA 4HK4A 4OOFA 4RKQA 1NL3A 2WFAA 4WADA 5A4MS 1NHWA 3IDAA 1OYWA 2HK7A 5EWJA 3HKEA 1JHPA 5BV1A 1H2RS 1G7CA 5AKGA 3GGGA 2IGTA 4KR6A 3E7FA 1B0ZA 1TEZA 5G0VA 5ENDA 1WW3A 1VLZA 3DLIA 1FL9A 1ENPA 4YN3A 1NI5A 1H4TA 4GPBA 2QUAA 5EQTA 1H2EA 1T2DA 5LB2A 3F4BA 1R6VA 5AM4A 2F62A 3EWAA 4YAWA 1SIOA 1E5TA 1Z74A 5A9TA 3M6FA 4J1TA 1AZWA 4X6UA 5TRTA 3U7HB 1FTSA 1KDOA 4YP5A 2H4XA 3O03A 2YHUA 5LVAA 2CKDA 2EP8A 4XD7A 1ORTA 2CL0X 3URMA 2Q4EA 4H4CA 3AERB 4JOSA 1JF8A 1K6IA 2VDQB 3OBIA 5KHOC 5EXPA 1GUAA 1XZPA 2IPNA 3BKXA 1EQ2A 1WEHA 3CCCA 1GTG1 3RFUA 4F92B 2O2JA 5DHTA 1GG9A 4GXRA 4HWPA 1A27A 4LJAA 5LDDC 5GM2A 3JQQA 2Q6IA 3WSWA 2I62A 3MOSA 4KNVA 1JDBB 4QQNA 5KQSA 3NDBB 4Q01A 4QPZA 5DLEA 2R44A 1MABA 3O1IC 1UQRA 3M5PA 1VM6A 1TRKA 1VPVA 2BM9A 2R2AA 3FWZA 5CLFA 5JO0A 2QD1A 3IAAA 1U7ZA 4I66A 4GYJA 1N2GA 4GWGA 4KAJA 5JDIA 4NEGA 5BUZA 4TQGA 1OYOA 3P9CA 3ZEAA 3DEAA 3UUFA 3IYLW 3OTGA 5I9SA 2O52A 2OQVA 3GQVA 1PT8A 4M53A 2VDLB 1C7RA 3V1LA 1EUYA 3CKLA 3HC7A 2H8KA 3KQNA 1XTBA 2XF2A 1OBCA 2LIPA 2HPZA 3O8QB 4ZO6A 5J3JA 5EIEA 3QYAA 3V1NA 2ZR9A 4D3FA 2PKYX 4BTVA 1W96A 4MJ7A 4LW8A 4M46A 1P3Y1 3BCRA 3IMCA 1LS1A 2B6NA 1X13A 2GNOA 4EW1A 2CFRA 4RDCA 3C3AA 3RKSA 2VNSA 5F3WB 4WJLA 1D4FA 2UVPA 1Y37A 1ZIDA 3O4VA 1GO2A 3PEYA 2OOSA 1JAIA 2SKDA 4CMIB 1N34B 3D6JA 3FAKA 4GVLA 4L5BA 4DCSA 5DX1A 3PNQA 3P9ZA 1FS5A 3BFPA 3ODPA 4QUHA 1FXWA 3MAJA 1DLJA 5TMPA 1DAOA 3GFGA 3ESCA 5JD5A 4GYYA 1SWVA 4OAOA 5HKAA 2PZMA 4H1HA 4Y6LA 1IN8A 1UJ2A 1FRFS 3QWFA 2VP9A 1JG1A 4YY3B 3FYCA 1MRNA 1YVRA 1FW6A 3HVIA 5DWVA 3GLIB 2WSSA 3D0OA 1MXHA 1VG1A 3EWNA 4ICIA 4I0WB 1HM5A 4X90A 4CWAA 4U6SA 2HHHB 3BD8A 2AFHB 2XY4A 2B7BA 5CT9A 5H83A 3DV2A 4RUKA 1V11A 3K96A 2C9CA 2X42A 4ND4A 3ZPXA 4HYTA 4ZOCA 1DC6A 1HDXA 3PHBE 3OURA 5JAZA 4PC2A 3MG9A 4IWYA 4CR6A 5CB4A 2E4XA 4YCNA 2XSZA 2MDTA 5HQTA 1CUCA 1FLVA 1LLDA 2WA2A 3NJ8A 4K1XA 5DYWA 1WHSA 1D3AA 1TM4E 3ROPA 4PFJA 3DBLA 4DFDA 2H2HA 5TF4A 1I1HA 1L7QA 5K2OA 1RPNA 2PRKA 3H9CA 1E5XA 2A4KA 1YI1A 4L5IA 2R5WA 3CE6A 2XQJA 3FNFA 3EVTA 1WA5A 4NFLA 3VR3A 1VB3A 5L45A 2J9FA 4TVOA 3HN7A 2F67A 4ME6A 2IDMA 1N9ZA 1OWNA 1Z47A 1LSOA 1YDFA 2D1FA 3NNDA 1V39A 4U9HS 1PZHA 1RKXA 2MSKA 3ASVA 3MRSA 4BV8A 3NUZA 3PR2B 4BO3A 1QQ7A 2PJRA 3L0YA 1D0VA 5J5CA 1E7YA 3FYHA