4YH1A

Structure of human scp1 bound to cis-proline peptidomimetic ctd phospho-ser5 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
b'QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4yh1A00
1Z5UA 5ALXA 2IOFK 3ET5A 5AI5A 3I28A 4DCCA 3B9RA 2I34A 4J03A 2AH5A 1EK1A 3SMVA 4YCMA 3KZXA 5ALIA 5AHXA 2YMLA 4NV0A 1QQ5A 2YMQA 2ZG6A 5AW6A 1WPGA 3QGMA 2C4NA 3NIWA 1Z4QA 2P69A 4BX2A 1L8OA 1NF2A 3CNHA 5AVUA 2PQ0A 3ZVNA 5ALPA 3FVVA 3UMBA 3WKEA 4CE6A 5AVTA 3U19A 2HO4A 3DNPA 3PDWA 5ALKA 3ED5A 3NANA 2P11A 2PR7A 1MH9A 3E8MA 3QU9A 2VKQA 5AW3A 4EENA 3OCXA 2FDRA 1EK2A 1L7PA 3QUCA 4YCNA 3QYPA 4DWOA 5A3QA 2YJ3A 5AM2A 5A3RA 5AVXA 1RC8A 3WK6A 4QJBA 3ZU6A 5IT4A 3N5KA 4KX5A 1ZJJA 4RESA 1K1EA 2EATA 3QU4A 4OHFA 1J97A 3QU7A 4ZEXA 1XVIA 4BBJA 3I6BA 2OYCA 4BEWA 3W5CA 1YJ5A 1F5SA 1LTQA 1RLOA 4GXTA 4IG4A 2B1QA 1ZD4A 4Y2JA 5ALLA 3KBBA 2EARA 3NALA 1Z4OA 1Q92A 5AM5A 4IFTA 3IB6A 3WGUA 5AM4A 1O08A 1NRWA 1L7MA 2R8XA 2JAOA 1JUDA 3DAOA 4Y2XA 4MWOA 3ZI4A 4UW9A 2B8EA 5ALFA 3AR7A 1Z4IA 1VFPA 1U2SA 5ALVA 2I33A 4AS3A 1VJ5A 3W5BA 4PNHA 5AVRA 4OFZA 2BY4A 2D2VA 5ALEA 2BDEA 3AR2A 2R8ZA 5ALNA 1YDFA 3KD3A 4Y2YA 4Y2SA 3L8GA 3M9LA 4OCZA 5A3SA 4CNQA 3EF0A 4HGQA 3HYCA 2C8LA 1ZRMA 1ZS9A 2QYHA 5ALUA 3WK4A 3ZX4A 3UM9A 4UMVA 1RLTA 4YGYA 2G06A 5AI6A 2MSNA 3PCTA 4KN8A 2B82A 5AI4A 2WF9A 1RPZA 1RQLA 3OCYA 4BX3A 1Z4KA 4I9GA 4UASA 3WK9A 1ZOLA 3L8EA 4HGPA 1SWVA 3QLEA 2P9JA 3OCWA 1XP5A 4HYTA 1T5TA 1QYIA 2HOQA 5AW5A 3A1CA 1ZD3A 1Z5GA 3ET4A 3L0YA 4C4TA 1L7OA 2B0CA 3R09A 5JJBA 3KC2A 3ZVLA 4EX7A 1RQNA 3FPBA 1N8NA 1L7NA 3QU5A 5ALZA 5AI8A 1WZCA 3E58A 1AQ6A 4NAVA 5ALHA 4HAIA 3J7TA 4YH1A 3F9RA 3NUQA 3SF0A 3U7GA 5AKIA 3SKYA 4HGOA 1SU4A 2G07A 2P27A 2HSZA 2C9MA 3OCUA 1YV9A 4FE3A 2AMYA 2HF7A 3W5DA 3QU2A 4JB3A 2IOFA 4KX3A 3AR4A 3NRJA 3P96A 3ZWDA 5AVWA 3OCZA 2JAWA 1L8LA 2I6XA 4GIBA 4YCLA 2HDOA 4HGNA 4F71A 2CFTA 2WM8A 4G9BA 3B8EA 3L1VA 2AUTA 3IRUA 3KDPA 2YMPA 4UM7A 5AKLA 3WKDA 3MPOA 4Y2PA 2OA0A 4B6JA 3NAMA 3D6JA 5AKZA 4C4RA 1RMYA 5AK4A 3U7EB 1U02A 2EAUA 2CN1A 2AGVA 3R4CA 4J2TA 5ALWA 2G08A 2I7DA 4BNDA 1KYTA 4EZEA 1T5SA 1CR6A 4L57A 2GHTA 4AP9A 1QH9A 3OTQA 4Y2QA 1T9ZA 4C4SA 2ODAA 2OM6A 3L7YA 3QX7A 5AW0A 4G63A 1RMTA 4CF5A 3CZ4A 1RKQA 3GYGA 2OBBA 5AKKA 1Z4LA 3A3YA 1RLMA 2WF6A 3E81A 5ALMA 3N28A 3EF1A 5ALOA 2FUEA 4BNDB 4KYTA 4CF4A 2HF2A 3KOOA 5AK3A 4XOUA 5AW8A 2WF7A 4NABA 3U7HB 1QQ7A 1WVIA 2HEGA 3ONNA 3ZTWA 5AKEA 3PGVA 4JDPA 4NWIA 2IA5A 3FM9A 5T41A 4Y2TA 1QQ6A 5AKHA 4HGRA 2W4MA 4MUMA 2IYEA 3L0BA 3L1UA 4E88A 2ZXEA 5ALSA 5AM1A 4BEVA 2WF8A 4UMEA 5AM0A 4EEKA 5ALQA 4FFDA 3MC1A 2YN4A 4I9FA 1ZD2P 4DW8A 4EX6A 4CF3A 3QNMA 4UU0A 2FPSA 2G1AA 5AM3A 4L6AA 2FPUA 3QUQA 1NNLA 3ESQA 2G0AA 2R8YA 2FEAA 2B1RA 4O8CA 3K1ZA 2Q4TA 2W11A 1RKUA 3FZQA 5AW7A 1Y8AA 3A1EA 2JAUA 3WK8A 2RB5A 5IT0A 2FPRA 3EPRA 4UATA 4XPZA 2RARA 3IJ5A 3N8GA 1YS9A 2WF5A 3ZTYA 4UMFA 2YY6A 1TE2A 2CFRA 2JARA 4Y3UA 3SKXA 5AW4A 1ZD5A 4KNVA 3NASA 5AVVA 4OD0A 4ZEWA 3W5AA 3DV9A 3S6JA 5AKJA 3WK7A 2HX1A 3L5KA 1VJRA 3BA6A 1FEZA 4Y2VA 2G80A 3AR6A 2BDUA 4XE5A 5AVYA 5ALYA 5ALRA 5AW1A 2YMMA 1S8OA 4NFLA 5ALGA 1Q91A 2ZBGA 3WGVA 4UAUA 1U7PA 2JGAA 2FI1A 3ZX5A 2CFSA 1RKVA 2I55A 5AVZA 5AI9A 3M1YA 4H1WA 5AKXA 1WR8A 2QLTA 3I76A 3U26A 4BYGA 1J8DA 4YIKA 3OCVA 3OPXA 5AKGA 4BKMA 1RRCA 3DDHA 1Z88A 3L8FA 3TLMA 1RMQA 1Z4JA 4UM5A 3A1DA 5AW2A 1RDFA 5FP0A 2NO4A 2NYVA 3MN1A 4XQ0A 3U7FB 2RAVA 1S2OA 1TJ4A 3HLTA 1IWOA 3FGOA 2FUCA 4RETA 3VAYA 2X4DA 3N1UA 3ZUPA 5AKYA 2NO5A 2GHQA 4UU1A 4Y2RA 4Y2UA 3QUBA 3RFUA 1O03A 3WK5A 4FYPA 2YBDA 4ZEVA 2RBKA 1Z4NA 3WKCA 3ZW7A 2HHLA 3R9KA 2WHEA 3BWVA 3QUTA 3RF6A 2Q5EA 5IS2A 1U7OA 1SWWA 3UMGA 3L8HA 3PGLA 2ZOSA 3SLRA 2C8KA 2I54A 5AIBA 1X42A 2O2XA 1ZRNA 3E84A 2GMWA 5AW9A 2YJ5A 2MU1A 5AI0A 5E0OA 2GO7A 3WKAA 3I1YA 3AR9A 4EELA 3AR8A 5AVQA 2ZBEA 2WFAA 3ZVMA 2ZBFA 2GFHA 1YNSA 5ALDA 1U2TA 3L0CA 1CQZA 1L6RA 5AK5A 5AVSA 2W43A 3ESRA 1LVHA 1N9KA 2YJ6A 4UMDA 2HCFA 2Q4RA 2HI0A 2B30A 4UAVA 1TJ3A 1YMQA 2C88A 3SHQA 4AS2A 5AK6A 5ALJA 3U13A 3ZWKA 5ALTA 3WKBA 2B8JA 3MMZA 4UARA 3AR5A 3SD7A 1TA0A 3QXGA 4KNWA 1PW5A 2YFYA 3UMCA 2ZBDA 5AIAA 2FPWA 3AR3A 3EWIA 1TJ5A 3N07A 3FPSA 2R8EA 2DQSA 2IOHA 4L6CA 2FPXA 4QQFA 4F72A 2YJ4A 5AESA 2PKEA 1Z4PX 5AICA 2G09A 4BX0A 4YIHA 1XPJA 3B9BA 2O9JA 1Z4MA 4DFDA
chains in the Genus database with same CATH superfamily
2B4YA 3CIOA 3KOUA 3AUUA 1R66A 3ACBA 3NWEA 3FTNA 5DEOA 1NR7A 4H3KB 4YV1A 4YMWA 1ZSVA 3FRJA 2AMLA 4G1EB 2QQ0A 2FXIA 3RD5A 4BDSA 3WL4A 2AVDA 2PIDA 3CSSA 4B8YA 5C80A 4COKA 5IDQA 1GL6A 1KEUA 3UH1A 4D9FA 3FHJA 4YC7A 4QU8A 1SULA 3IB3A 4WZAB 3E1GA 5BQOA 1T9GS 3FSGD 1TECE 3GGDA 1QCDA 4ASUA 1YA4A 5HSGA 4OI4A 1QS0A 3L4BC 5KNDH 3INGA 4PXSA 4EO4A 4YRSA 5K6AC 1VECA 4PRLA 3ZVNA 1TDJA 4BNXA 5A5GA 4N12A 1XU4A 2BPOA 1ABFA 2H31A 4O2AF 5ITZB 1UBGA 3RHTA 3EXHC 1UFOA 3FWZA 2I1QA 4NE2A 1FRZA 2QQFA 3LUDA 2OXIA 4RX1A 3ZV5A 3H2SA 4LTNA 3CWCA 2X9QA 3NANA 4DUZB 3SVZA 3SOZA 2ZIUB 3KPWA 1J2YA 2Y0BA 1N3YA 1OXUA 3CA8A 3DLIA 1T6XA 3GJ8A 2VKQA 1G8SA 4GQAA 4HNGA 4MYRA 4NNJA 5F5NA 3WMXA 1R74A 3LOPA 4OLAA 3NBQA 1ENOA 1TF7A 1US8A 4MAAA 5CBPB 2GTHA 3LQRA 2AN3A 1JNYA 1SVWA 1RQRA 1XCLA 3Q3GE 4LS3A 4ARZA 2NACA 4FZ3A 5CB8A 2Z30A 3N0TA 5J2UF 2DQYA 2JRCA 3GDGA 1N1GA 3IP6A 2C9OA 3ZZ0A 5E6UA 2JKZA 5IT4A 4OLJA 4KX5A 3QVJA 5KTMA 3LP5A 4UQOA 1L0BA 4J7CA 1OHHD 2C2MA 1S89A 1RHUA 1B8VA 1YR7A 4QL3A 4ZAYA 4ZEXA 1CF4A 1XPUA 4MVJA 3KYDB 4NQRA 2TMDA 4XH9B 4ZCSA 2I9KA 3RYIB 3HYRA 2H4YA 4I5FA 3E2PA 3EMKA 4UNNA 3V9PA 4HQ6A 3SC6A 3N2NA 1NMZA 4MCHA 4L0DA 5L8VA 3ROZA 4HLCA 3VC3A 1C9NA 5K3BA 2UYCA 1ZEJA 4AW9A 3N2EA 4DIEA 1Q84A 2B5WA 3ETDA 3M4ZA 5H0IA 1A8SA 1L7BA 1Z4OA 2QXYA 1OD6A 4LRYA 1YACA 1X7XA 2R4QA 2VJOA 5A3VA 3TI7A 3E7FA 3IB6A 1SH7A 3ZJVA 1WG8A 4G0PA 3THOA 1R88A 4KIGA 4LGCA 1VPVA 2P2CA 4CM4A 3EXEB 3K09A 4X9XA 1WMEA 1ZUHA 3M9WA 1UFRA 4CETA 3GT3A 2WE8A 4HWOA 1HDEA 5NULA 2XT6A 4JVSB 2J6HA 3Q6MA 1M2FA 1G8AA 2BFFA 3MWKA 2NIPA 3LBFA 4PGFA 3O8NA 3AI2A 1RRPA 3H9JA 2JBAA 1DQSA 4RXTA 5JTUA 4ZDWA 2MMCA 3EG5A 3HJHA 1SEVA 1ML3A 1TTPB 4N5NA 1YL7A 3MTEA 1UC5B 1BZYA 2JJQA 1FB5A 2CHEA 2I33A 4ESEA 2GM4A 3NKFA 1KE2A 1DQRA 1Y3IA 1HG0A 1NV8A 4HRVA 3LTNC 2Y1CA 2ZZKA 4GEKA 1GXSB 2X14A 4R6XA 2XRZA 2GASA 1H42A 1W30A 3BULA 5CVEA 4OQZA 1UOQA 3BHMA 2ZIXA 3WI7A 4L5CA 4BKQA 4ZMSA 2EFHB 4BRZA 4CKEA 4EATA 1Y1LA 2BCEA 2RHRA 4FI3C 1EGAA 3TLAA 5KSPA 4JKOA 5JQGF 3MBIA 5E4JA 3DW1X 3ESDA 3KV3O 4OQNA 2C84A 3GLSA 4AO7A 2H06A 4Q01A 3ZCQA 4F5EA 3PWKA 1BDBA 1T6NA 5EIFA 5JHHB 5KI6A 4M0PA 4KWTA 2BSXA 2J0UB 3K0BA 1EAMA 3VISA 4EHNA 2O3SA 2XSZA 3ICWA 1PL0A 2WJIA 1QNFA 5EZYF 1MHTA 4JENA 2C4MA 5ILOA 5EMLA 5CM9C 1CJSA 5EHNA 2YZKA 3ONEA 3PP8A 4OJQA 2ZVPX 1T8SA 3ONFA 5JZBA 1UKZA 1NFRA 4YTEA 1OKKD 2DJIA 3DBLA 4LOLA 5FLKA 5GGYA 5BYKA 4I9GA 5DX8A 1BSVA 2CLDX 2X5JO 2G0NA 4HLNA 4MYSA 1ES9A 3R40A 1DAOA 4RD6A 5E7JA 4P80A 3CCFA 2GRUA 2IYXA 1NJGA 2F3QA 2KE5A 5TF4A 2P9YA 3G8YA 4HYTA 2CCGA 5D6OA 3QM1A 3ZCVA 3Q2KA 5LZ4A 1ZD3A 3G0IA 1J25A 3RKRA 5THKA 1EUCA 1RYNA 1R4ZA 3IEPA 5I5EA 2W4IA 2R1TA 5LZ8A 1L4YA 5CGQB 3TIIA 2OCBA 4H08A 1BWRA 1WMAA 4NS1A 3S8MA 4CGYA 2MT9A 4HYQA 4Y1RB 3PUIA 4UTOA 1L4MA 2NSJA 2BKAA 4W8HA 3WZLA 4LV6A 3F6PA 4KIWA 3RVLA 1PF7E 1FL9A 1AC5A 1PNQA 4NBTA 1IXZA 1CTQA 2D1FA 1U6JA 2FSUA 3E9YA 3PXBA 4KMRA 1OYWA 4WXEA 5FNVF 4AQDA 4UTNA 3LAWA 1H85A 2C29D 2CJFA 1XWFA 5TMDA 4DQDA 1JEOA 1EXWA 4QAQA 4U2CA 1YCHA 4YJKA 2ZI6A 1L1QA 3SYTA 2CCJA 2K2WA 3BWDD 4TLBA 2A5LA 3HYLA 4IDGA 4II2A 3OIVA 1B2LA 3UAGA 4EHDA 4JN6B 5CLQA 1ZK4A 4JUAA 1R00A 3C1UA 1CUGA 1YI0A 3PI7A 1QHFA 2ORYA 1WVGA 3MT7A 3P27A 4QDJA 4BE9A 1F12A 2OP1A 1RTKA 2XY4A 4QDOA 5ICCA 4KCGA 2I3ZA 1Z38A 5ELLA 4WL0A 2M1XA 5AVWA 1ONSA 1HRKA 3HXPA 3PEEA 2XNCA 3WB2A 2XUGA 4F12A 2IZ0A 2HDOA 4HGNA 1XZLA 1XL0A 3HKDB 4MWEA 4UUNA 2GUWA 3CCCA 2D2EA 3B8EA 2AUTA 4H0CA 4YMLA 1ZWLA 4NJMB 2PX0A 3S2YA 4LRWA 1XZQA 1P0PA 4IJQA 4J76A 4RA9A 4C0HA 3FZNA 4EG4A 2BHSA 2NZXA 1KWKA 1PWXA 4YP1A 1KDRA 4FIDA 5F2OA 2OA0A 4ZICA 1YRBA 1KMCA 3OSZA 3EBLA 3EDRA 4X92A 5CB6A 1U2EA 2WYWA 1EIZA 4IQGA 2ANBA 4C05A 1TVCA 2NO7A 2HTEA 3GD7A 4HDRA 2EAUA 4KQJA 2ACEA 3ZYZA 4DABA 4ECEA 1QVWA 3GAFA 4ZYTA 1E9CA 1RWNA 1JAHA 2I80A 4XVRA 1DRKA 1ZGCA 2JI9A 3DXFA 3F78A 4NBWA 2N3ZA 3NUZA 1BEEA 1JQJC 3TI9A 2EF1A 4TV9A 5DLPA 3VHLB 1KQ3A 3I9JA 1LSSA 4EMTA 5IPFA 4PSUA 3A7EA 3EY9A 5BMVB 4XVQA 1M34B 3OOWA 3M4XA 3HDTA 3F8TA 4L9RA 5EP3A 5DTJA 1HNZB 1WUYA 2Y1KA 4TTIA 1ZJ4A 3V1MA 3BMQA 3C7CB 1M7BA 3T06B 2X1HA 3RIMA 4CF5A 1XLTC 4QOGA 3VTZA 5I4BA 1P31A 4DQXA 4N9QA 5FA5A 4RS4A 1FRQA 3JR3A 3HYTA 3FCSB 3HDVA 1N77A 5JZMA 3BGVA 4PANA 1Y4SA 2F59A 5ITVA 5D7BA 5K8CA 4E33A 4PZCA 1ZQ1A 1BXRA 2K6GA 1Q3HA 3FUXA 2W2KB 4GOXA 3WL8A 4UFPA 5JBIA 3HP7A 3AZPA 5F77A 2HXSA 4OYHA 4F5ZA 5K2OA 1YU6A 1M2OB 5BR8B 4UREA 1GPLA 4KHPB 3D4BA 1B42A 2BZ0A 4K9KA 4NABA 1U2ZA 4H16A 1DC7A 1GZ7A 5E9QA 4EY5A 5MGBA 3AFNA 2FG5A 2I29A 4UHEA 3IKVA 1CS0A 5C4GB 4BLWA 3SFVA 2A1UB 2WP0A 2CEAA 3KKKA 5AKEA 1FYVA 4MYUA 1I3CA 1DDIA 1NZDA 4LA4A 5BNIA 2W58A 4HAWA 5FL3A 2CK3D 4ZVQA 1LUAA 3JWJA 1I7PA 1EVEA 2MSEB 3NHAA 3Q9SA 1GM5A 2X0EA 4P0PB 5B3JA 5JUWA 3IEIA 4GXRA 1Q7EA 3L1UA 3P9NA 3NCTA 2ZXEA 4G36A 4ITUA 3DONA 5LA6F 1QRRA 5GIPE 3C7AA 4FT2A 3EDYA 1T0PA 2I66A 4DL9A 4UNSA 1DAIA 5IARA 2C5LA 3MRTA 1QYWA 4JR1A 1PHRA 2LPMA 3EIXA 4LYDA 2HCRA 3R3HA 1I4DD 3KUDA 3W78A 4FJ0A 2BBTA 4E1BA 5JSZB 4I9FA 5HUQA 1R0WA 4FDAA 2ZRGA 2F17A 3O1LA 1Y5RA 3GLGA 1WQ1R 1EFKA 1AD2A 1ODCA 1P1FA 1KFEB 1ZMOA 2OESA 2PZEA 3AUYA 1GQYA 3DWEX 3QXXA 1N0UA 4EY6A 1NNLA 1JQEA 3AKDA 1PJRA 2VOJA 4Z51A 4DMCA 3R9XA 1JT2A 2QUZA 3RTEA 1ECFA 3KJZA 1CUCA 1SKMA 2G04A 3IT1A 1I4OA 1TM1E 2FSSA 4IZ6A 1SUEA 2HRDA 4PCVA 2WNHA 4IPTA 1SG0A 1FMCA 2EX1A 3A25A 1BWQA 3AILA 3P97A 4WADA 5B7GA 4QM6A 2RB5A 2EIXA 3OCCA 4WE3A 5JIBA 1JXMA 1MT0A 4PPQA 1TIPA 2X8JB 3CEJA 4XPZA 3IJ5A 4XDYA 3ORFA 4B3FX 1XRPA 4KVZA 3C85A 3HUUA 4BFYA 1NXQA 4HNSA 3ZWCA 2IF0A 3WVNA 1WMFA 4AZ3B 3JYPA 4AXXA 3ESXA 1VHWA 4RY8A 3WGMA 4IDAA 1W88A 4QJIA 1Q1GA 5K0LA 1FBNA 4NNPA 3GZNA 5AJTA 2YYAA 5CEFA 3LLUA 1KARA 4YHBA 3PHHA 4OL0A 1DCMA 1G20A 3C6QA 4Q3DA 3UHOA 2ZAOA 1GCAA 1FCJA 4H0NA 4EMUA 2R47A 2PY6A 1ZXBA 5H83A 3FF4A 4NENA 3REGA 3WGKA 4WLFA 3CX7A 3BT7A 3FR8A 1LNSA 1NVUQ 2IW3A 4FCCA 2GZSA 4LCJA 2JA2A 4NSNA 3RS5A 3WWZA 4UOEA 5CEJA 5JI2E 2QLBA 2COEA 2DFPA 1GRRA 2UYYA 4N0DA 2Y05A 2QD1A 3AWDA 4MMYB 1R0RE 5T8KA 4IVNA 1KSGA 2O14A 4OMFG 3HU3A 5KNBD 3TLCA 1DC3A 2OMKA 2XQVA 2VO1A 3FD8A 3OQBA 1DIGA 3PFHA 4FMDF 4O08A 1TM7E 5ESWA 2Y77A 2B8TA 2POQX 4KZKA 3TECE 1E6UA 2AT1A 5G1NA 3V4ZA 4CIAA 2BFCB 4FOPA 4B71A 4F4JA 4QLOA 1AV7A 4XUGB 3WYDA 2BMVA 1FX0B 1H0KA 2GAJA 4J1TC 3OCVA 5E0KB 1MW8X 4G1VA 5JANA 2H4HA 2E82A 4AO6A 2EKZA 1P7WA 2C92A 2ZIGA 3IUEA 4KH0A 1UK8A 1T9GR 5C35A 5I7FA 1JFSA 2G4LA 3CF4G 1R1DA 3JQPA 3WGLA 1V39A 2E4VA 4PNPA 1Y5NA 2NO4A 4YRJA 4AF6A 1DKLA 4BO0A 1UT8A 1J8QA 2NYVA 4E14A 3ANLA 1UKEA 1ULZA 1USIA 2NO6A 4DMUB 4RKQA 1DDOA 1WU7A 4IIBA 1XTKA 4ER5A 1NLYA 5JCOA 4OLBA 2ZDGA 3L7DA 1JEDA 1CY0A 4QUBA 2B37A 2X76A 3KEGA 1IDOA 5D3MB 5LCXA 1NVFA 3WQBA 4RETA 4BNNA 3Q6IA 3HR4A 2ON6A 4YAUA 2H3EA 4M1SA 3MHTA 2XWPA 2V6MA 1C14A 4P4UA 3ZK8A 1C7IA 2PSEA 3I8XA 2XCRB 1BYIA 5TV2A 1U7UA 5GPBA 4OLHA 3PNYA 4UCXA 1V11B 4FX2A 1YE5A 3DUFA 3KEFA 4QX6A 4BFXA 2I3GA 4ECAA 1Z4NA 1TQDA 1ZGJA 3HUEA 4HATA 3R9KA 1NF3A 4G0NA 3U31A 4DNPA 5JO0A 1YNOA 2E4XA 4RVNA 2O3RA 1WZ2A 4GNRA 3L2OB 1EESA 4EG8A 4KO3S 4MAMA 6REQB 5FUXA 4RF5A 2C4WA 2ZYRA 4PTYA 5FO0A 4D9NA 4WOKA 3UMGA 3U7RA 4P92A 4P3OA 2ZUTA 4B79A 3FPLA 1JLLA 1PQPA 1CJKC 4TV9F 1KPHA 4NAUA 2UYQA 1ZI9A 4PZZA 1ZCAA 3EPKA 2YVKA 2NU7B 4Q82A 5KYXB 2PZGA 4U8HA 3TUIC 5E3HA 4Y8VA 3WKAA 3WR5A 3I1YA 1Z0SA 1XU7A 5CJJA 3T7KA 2Y0CA 2WLSA 3DO6A 3NYIA 4P7JA 3TG8A 4R2KA 1JA1A 2A3RA 5C52B 3AIIA 2PFKA 2I4NA 1DAEA 3BK1A 5LP6C 2P6NA 4WZBE 1MX3A 2NQTA 3KCNA 5KWIA 2EGUA 2W43A 4IUCS 2EP8A 3K0CA 3ZLJA 2HPVA 4J43A 5L4SA 2XDQB 1VI2A 2EVWX 1HURA 2ID8A 3A4MA 2JI7A 3NHWA 1QFJA 2Y76A 3RU3A 4QSHA 3X2FA 3DOIA 3LX4A 4RJ2A 1AS0A 3U13A 2AC7A 2DOKA 2GN6A 3HY6A 2V7TA 1JDZA 3T61A 4CKYA 3EGDA 4EPYA 3GEMA 4AFNA 1ZM2A 4BO8A 4DSZA 2JKVA 5CVVA 4KHZA 1J0BA 2FY8A 3PGA1 3JWHA 4Q4DA 4DLYA 1X7HA 3V8QA 4JC5A 4TMFA 1NXSA 2CLEB 1LFAA 3RIHA 1KQNA 2AJTA 1QONA 3N53A 2I99A 1M6NA 3ENWA 1H1LA 5F1KA 2ZJ3A 2DX7A 4R8MA 1E32A 1RI5A 2YRXA 5PNTA 4D4MA 3GAMA 4C06A 3SYMA 2VJBA 2VF4X 1DBPA 3BVPA 1FSPA 4Q7QA 2IZ1A 2FPXA 3L4JA 5HX7A 1KJYA 4QQFA 2GM3A 4NPHA 4WFQA 2XYQA 3WADA 1TKBA 1Z3IX 1A8HA 3F1LA 5CX1B 2GETA 1XJWA 2DY1A 3HI4A 3RS0A 3WRYC 3SY8A 1W0KA 3FKSA 5KOIA 5C1IA 1WXDA 3NHMA 2ASVA 2NG1A 3H5TA 1E7RA 3STVA 3LZCA 5K0CA 1FDOA 1P62B 2P77A 5C9ZA 1L5ZA 1T24A 1C4XA 3CVVA 5GV8A 4C3OB 1O77A 1J39A 3QHAA 3PTLA 4FDLA 4NECA 4EI9A 2JFNA 3F9CA 1PVVA 2PS9A 2PZJA 1IWPB 3OJLA 4JJ8A 3JAMA 1EHCA 2D06A 1DFIA 1HTBA 2VP2A 3GPDG 3QWBA 4L74A 3ZNPA 5IJ0A 2W8BB 3C0KA 2NZJA 4L9SA 3AUTA 1UWKA 2GF9A 1UXJA 2HIHA 3TOSA 2J9YB 3A36A 3HA5A 1NUPA 3PUZA 5CT9A 2ZW9A 3BORA 3NRBA 4AZTA 3IHLA 3R0JA 1E9DA 1S2NA 2X77A 3H8JA 1JFTA 1QVAA 4CMJA 4L9AA 3A04A 1HFKA 4NEQA 1F17A 4DXAA 1TLLA 1KVQA 4P3KA 2D1SA 2W2VA 3FTDA 1YIDA 2GXSA 4KQ1A 3WX0A 1ZITA 1V3QE 1E1QA 4MW0A 2FDRA 4L6IA 3EHDA 4X3OA 3D8UA 1IY1A 2EL9A 6NULA 5CFLA 1ZSYA 1WF6A 5WRFA 1P3JA 2RJOA 4QASA 2YJ3A 4YUVA 5A06A 2XHEA 4AYXA 5FAKA 3I42A 4KJZA 1X8JA 5KEIA 1X2EA 4M4SA 4Q4LA 3PQ8A 3N5KA 1KJ8A 3FAZA 2XOKA 3SZRA 3LI2A 4LYGA 4D99A 2NAPA 4BZXA 4ND8A 3PR1A 4EB3A 2ISSD 5K7SA 3L82B 1PDVA 1QV7A 2VJYA 3MTAA 3DDOA 3H18A 3WFIA 1V5FA 4U7GA 5HFJA 1TPZA 2AXEA 1RI4A 1MO5A 2WG0A 2YWXA 4W63A 1LV8A 1LBSA 3AKYA 4RAQA 2B1QA 3VPAA 3A9WA 4EKGA 1VB5A 1WZEA 1C80A 1FMFA 2M6RA 4RMJA 3IO3A 3RIEA 4IFTA 1CZNA 1T8UA 4ENVA 5GADl 2WAOA 2JAOA 1MA0A 1BA3A 1XYGA 3KJFA 3R23A 2AQKA 1CUSA 3FX2A 4P36A 2R3SA 3AJRA 3N76A 5FTJA 1QH1B 5ICSA 5KWSA 2ZJ4A 4DIDA 1E4EB 1FS5A 2AFIE 3GMIA 1FUUA 4UW9A 2VBGA 5J2TF 2FDCA 3AR7A 5A9TA 4DILA 4RWEA 3HP1A 4X66B 4BCBA 1EIWA 4BMVA 1DO8A 4RWZA 5DTIA 5LQDA 3OP4A 3GFQA 5FLYA 3MCWA 2ZIVB 2P6MA 1GNLA 1IXRC 2ZROA 3I2YX 4IFEA 3UB3A 4O33A 3VVCA 3H87A 3PDCA 4R9RA 3G23A 2XB2A 4NZPA 3EUEA 2BM8A 4X5OA 1O0BA 2VBFA 4RCZA 1G21A 4EPXA 2XNDD 4AKSA 4FMBB 4XOIA 4BC0A 5IN5A 5HKBA 3CUVA 3FE2A 4KQ6A 1QBKC 1QFYA 4W9NA 3GLIB 4AY6A 2JHPA 2FE1A 1GKKA 1QVVA 3TMKA 5HK9A 2A9QA 4WNCA 3T4XA 1N7HA 1D0IA 3AEKB 4WEOA 5ED0A 2AK2A 3ID6C 3P4YA 3RWMB 4BNHA 5F73A 2HM7A 5J4VA 3KYCA 4BNTA 4E5KA 2DY0A 4NZZA 2C95A 3VXKA 2FNAA 2ZAGA 2E0IA 1XNHA 3GZ4A 4J16C 4UJ3A 3A1UA 5DJ5A 3Q5GA 1KNXA 3QWFA 1YR9A 4GVPA 2WMDA 5BW8A 5AI6A 4FWTA 3ORYA 4I9HA 4AECA 5IJXA 4HNTA 4KXUA 1PO7A 3I09A 3VR3D 1GV1A 1PR0A 2ZPUA 1HE1C 3QYJA 4R68A 4ARUA 5M34A 2PNJA 4LZJA 1JTFA 5DWVA 3HGMA 2JAHA 3RT9A 1EXVA 2XGGA 3UNXA 4K1LA 1RTTA 1Z16A 3AEXA 3V8MA 2ZQYA 3L92A 4EYEA 1QYIA 1K8QA 2NTYC 4DSUA 4TXNA 2ZT7A 3PPIA 3IXQA 2PS1A 5EQFA 3A6PC 1RI3A 1VHJA 3BK2A 3ZVLA 4D4IA 1J49A 3HEMA 1L7NA 1WZUA 4PIPA 5ALZA 1ZNXA 4U2DA 3WIDA 1E0AA 2WMYA 3AZQA 3C41J 1K27A 2HL6A 3DFUA 4Q16A 4C3ZA 4GKKB 5ULLA 2GILA 2Q1WA 3IBGA 1DKQA 1ECJA 3VSBA 4EY3A 5DP2A 2LIVA 5KOHB 3ZQ6A 2OD9A 4FYMA 3VKHA 2ASEA 1Y98A 2EKPA 5FUBA 3L9XA 5TS2A 1FDUA 2J3JA 3B8HA 4DE5A 5FBZA 2YXLA 5TPWB 4D6PA 5A4KA 1OXTA 1YV9A 1RRFA 2VATA 3OPMA 4EYQA 2A92A 2YOFA 3IC5A 3ZCSA 3L43A 2R6R1 4NH4A 2IEGA 4FFOA 1SIOA 1XQWA 2WVJA 3EXIB 1NT4A 4J9UE 3K8OE 5D01A 1U2DA 3AX6A 4OOEA 4RK0A 3I1IA 1IM2A 4FGZA 4R2WA 2QU7A 1K8XB 3TLGA 4YQYA 3WSWA 4I50B 2WM8A 1UM9B 2HTFA 3L1VA 1DQZA 4Z8YA 4R1TA 2OXTA 2DRIA 1XTTA 3IRUA 5BUZA 4PCAA 3LC1O 1ACJA 2O2CA 4QSMA 1K3TA 1PJ2A 1KK1A 1OBHA 2ZBRA 2ODNA 1KIMA 5TJ9A 4GI5A 1HE4A 3P2JA 3PNVA 4YJ3A 4TWBA 4PYQA 1Z22A 2G83A 4QYMA 4GR5A 2HEIA 2RGXA 2ERYA 2I5PO 4JUCA 4QRDA 1DRVA 5ES4B 4IGKA 4KPGA 4RYDA 3AINA 3ETHA 1HDZA 1DWOA 2Z9CA 5HRCA 1H1TA 3V9AA 4EAQA 5FTKA 3SSNA 3GDHA 2VF2A 4X1KA 8LDHA 1BGVA 3AXTA 3KR1A 4X3PA 4G1UC 1XT6A 1NASA 2PZKA 3PFBA 1NVVR 1XHLA 1Z0JA 1QF9A 4HNAA 4KYVA 4EJSC 3DCNA 3G5MA 4KMSA 3V97A 1DPFA 2V7QA 4CT0A 1M1YA 2H1SA 2J4FA 3BSYA 1Z15A 1KY3A 4UEQA 1U7WA 1MVLA 2D5AA 4DLLA 4GMXA 2PANA 2WFMA 2GGSA 5JHGB 1N2EA 3NEPX 1QZZA 1JTVA 4P4SB 1S4QA 4JJAA 2QTVB 3I39X 3CX3A 4UPVA 3I3SR 4OJTA 3IKLA 4EHBA 3NIBA 2ZITA 3ANSA 2MYPA 2C1XA 3TD2A 4C4PA 3G9XA 1XV5A 3KOOA 3QBDA 4FMCF 4DM7A 3ZH9B 2UVPB 3NWOA 4UTPA 4RD3A 4LCEA 3T9EA 4QOSA 4DJFC 5K8VA 2IX3A 2FZKA 1IUNA 5ICFA 5G2OA 5TGZA 5KVAA 1PEYA 2PN1A 3U7HB 3U17A 3C3EA 4ARAA 2CHQA 4DJJA 4WACA 2ATCA 3T52A 3HXQA 3QXHA 2WV9A 3TFOA 1OGYA 4W1QA 5KSOA 3PNBA 4G6ZA 3CNQS 1MEEA 3H3XA 3A0RB 4A6PA 4GMFA 4FYKA 1G8GA 4U9HS 2P67A 3T3DA 1O3YA 1IJKA 1G291 3T7JA 3U81A 3TF5A 4V02A 1XTBA 2OORC 4RHFA 2ZWOA 4BVKA 1Z3CA 5JEDA 1PG2A 3U0BA 5BSVA 2NP6A 2D5LA 2QZ4A 3LHDA 5AOBA 4AKTA 4JUFA 3KKNA 2D2XA 5J47A 4REOA 4PN3A 4GH5A 5CW2A 3STUA 1YZHA 4XR4A 1Q11A 4AY2A 4OI1A 1FNCA 2XUDA 4H6VA 1G5HA 4S0ZA 4YY3B 3CZ5A 4INJA 1ID8A 2FQQA 4G0ZA 3T5PA 1CV2A 2HNBA 4TZ0A 3A3PA 1B8PA 2X2EA 2ZLBA 1NWHA 3PQ7A 3P2MA 2YVLA 4NZNA 3WJ2A 2XCOA 3JAKA 1B8OA 3TOVA 3GLTA 5AM3A 3QUSA 3B3FA 1KI4A 4KC0A 5K8TA 2JBHA 2OB2A 2XE8A 4BGUA 1V3VA 5EKUA 3ZG6A 3ADOA 1U9IA 3OJWA 2IELA 1Y6QA 2IXTA 2YUIA 4KSCA 4JL6A 5H59A 4UDOA 1ZIPA 2BP7A 1J70A 1I94B 3CVJA 1YUMA 2QTWB 4O29A 4YK7A 2Q49A 2HHAA 3OMLA 2JASA 5E6SA 3H0KA 5IH7A 2EWMA 1A96A 3JQGB 2RGCA 5HUJA 1HZJA 1Z8NA 2GJ9A 3RGGA 3OUZA 4JLKA 1AKWA 1KGSA 3LX6A 2YNMD 3TXYA 2XDWA 3C4JA 1IVYA 3DZKA 2A9VA 4MRNA 3CG0A 3GFTA 3MT9A 3CB4A 2ZRPA 2IHYA 5AVVA 2G76A 4KI7A 4UUBA 5HQTA 1I6LA 4CHTA 5KX5B 2CLMB 3IEKA 2GDJA 3BUSA 3V4SA 4EARA 2Q8QA 2PS0A 1LQTA 4HUQB 3SM9A 2QN8A 4FYVA 4RM2A 3S1AB 1ADBA 1A9SA 1WMBA 2F3UA 3IMCA 1W5BA 3JD4A 3QF4B 3R0QA 4GSKA 1KH1A 3P9IA 5CNKA 1IUOA 1OLUB 5BPFA 3LK6A 3IIMA 3H04A 4Q3EA 5E6RB 1H6DA 4WHMA 3W9SA 4N3CA 4G0MA 4CZ2A 4RPJA 3NNNA 3PIDA 4JS0A 3RK1A 2O1EA 2FZVA 3FNIA 3NV9A 1X1BA 1X74A 2B34A 2HMUA 3C39A 1TFRA 3PDUA 5FTMA 3ZHBA 4ENTA 4Z9AA 4HDQB 2FN9A 1H8HD 3WHKA 3B89A 3B70A 1SXQA 4Q7JB 1PKXA 4OVKA 1BOFA 3UH0A 5K4HA 1WD5A 3OPYB 3W7AA 4M8LA 4HWPA 3ZDEA 2RK6A 1ONPA 3UXEA 1J8DA 3VU1A 5KTYA 1EX6A 4HZUB 1NDHA 1T0BA 2V58A 3K9FC 1KY4A 3QXSA 3DE2X 4OK3A 1YVPA 1CIVA 2YXPX 1RMQA 3AUJB 1G16A 1MNAA 5GZ6A 3V8EA 5DSTA 2VAMA 5LM3A 1L5VA 1GIAA 2JF0A 2BCJQ 3IS3A 4PX5A 3A6GA 1KVTA 3NIDB 2BFEA 2AN4A 1OQAA 3JARB 3KYIB 4KBFA 1JPNA 1U6KA 3GQVA 4V0QA 4KQCA 4M89A 5EFZA 3HLTA 4E2XA 1NX9A 4LE1A 1LDNA 1JILA 1L6IA 4LJKA 3BDVA 2IHUA 3CRQA 3S28A 1JFFA 2NVWA 2QUIA 4MVJI 5DHSA 2X9NA 3KQLA 4OB8A 4JLBA 1KZ6A 3TZEA 1PR2A 2BF4A 2N47A 2Q0SA 3FPJA 2YTZA 3P9YA 3QUBA 4F1JA 1AGNA 4FYPA 3R8XA 4L4UA 1W6UA 4O25A 5JMPA 3P4UA 4YJ3F 4BOYA 2CD9A 3K1TA 1XXLA 4EY7A 2HHLA 4ON9A 1SGWA 3GG2A 4MITA 4WCFA 1UBJS 3BWVA 4KO4S 3RHSA 4MW9A 5KQRA 4OF4A 3V33A 5IS2A 1P45A 4AKEA 1YGPA 2I1VB 2IIBA 4AUKA 4ZN6A 4W5QA 2YH2A 1J1UA 1BCSB 1DSSG 2LZ0A 3GCGA 3LYAA 2J3KA 3HEBA 3AC0A 1SO8A 3JW8A 2IYAA 4ZHSA 2YNMC 3T4UA 4EYKA 4LDPA 3VX4A 2H1LA 4ILKA 2BTQA 3OQOA 1T1SA 4K6OA 3T0FA 2HRRA 5K05A 1CRQA 1Y1KE 3Q1KA 4AVYA 1A98A 1T6BY 1WY7A 1MJ5A 1Z36A 2PZMA 2DZDA 1H9CA 5DHAA 3RRYA 3BJIC 4JWKA 4RVSA 2G8NA 2R79A 1MABB 1ECBA 4JQYA 1YNSA 2FW9A 4IV8A 4QU0A 5GONA 1TYCA 3ZZTA 1W35A 3G13A 4HFNA 4IJMA 5BSGA 2IYSA 5DCUA 1I4LD 1KYVA 1U0NA 2AOTA 4OOFA 1USKA 3ZDXB 1IXYA 4U9UA 1ZY2A 5EWMB 3LUAA 1DCKA 1WPXA 2EKLA 1NI3A 4M1QA 4AB1A 4AQ7A 1KORA 4HV4A 3C3BA 3GGCA 1P1CA 2NVOA 3VI4B 2B21A 4CQMA 1B15A 2H65A 4MWDA 2ZCUA 5JRJA 4R69A 4N8EA 1FU7A 4YT4A 1WUIS 2Y1WA 4J7XA 4F5YA 4YECA 4QGHA 2NPOA 3ZZ1A 4UQLA 3COYA 4M8NE 4WD3A 2YRFA 4E15A 1FNDA 1PW5A 3B51X 3NVMB 4INPA 3USES 2FSPA 2R8BA 3DL2A 3F0TA 4EG3A 4HB2A 4RZQA 3NTQA 1IJBA 2EW1A 5HUHA 3UKOA 1EUYA 2ZCJA 4B4WA 5LOVF 1W47A 4DDHA 1YR3A 3UK6A 1V8PA 1GNPA 3AB7A 3ETNA 3IP5A 2PKEA 4TLAA 5DGXA 3RW9A 3ZBPA 3I8SA 2QQEA 1NW8A 1FOEB 1GP2A 3EF3A 4P4LA 4YRTA 5L95A 5LMNB 4MQEA 2Q28A 1Z4MA 5CK5A 5KTPA 3GV0A 2NPIA 1XTZA 1CSEE 1E2QA 3UXYA 3DV2A 1QE3A 3UFXB 2GAAA 4A0SA 2AH5A 4UKDA 1N9GA 2CHGA 2VHUA 3DV0A 1ETHA 1MGPA 2ZS7A 4FOTA 5AO9A 4C78A 4URVR 1JSCA 5TXGA 1OC2A 2C77A 1P7PA 1XKTA 2I2CA 3CLUC 3EE6A 3Q10A 4RPIA 3FNEA 4LVUA 3QG5A 4F6LA 3BL8A 3PENA 3LKBA 3SZOA 1VLZA 1DQPA 2GA8A 1HTWA 1YFZA 1Z4QA 2DFVA 4S2UA 2XI4A 5HKLA 3T4PA 4RC9A 3DEHA 3NGXA 1GR1A 1GHTA 3CNHA 3NEAA 4JLOA 2W2LA 2HQ1A 3HL4A 2WQ7A 3H9CA 1OLSA 3R7AA 1V5EA 1WF3A 4GP9A 4OP2A 4GAEA 3V4FA 3PFWO 1ABBA 5FUVA 4EMBA 1D1QA 2NNLD 5HFNA 2Z08A 3UTDA 2VG8A 4QPZA 4EHKA 1UMCA 4WZZA 5FOWA 1ONOA 4J1SA 4P2GA 1IYZA 2OGTA 2GVDC 5ER9A 3D0KA 3CIFA 3DLHA 4M38A 5AW3A 1WZIA 1JHUA 3MIIA 2CMDA 1P9OA 3B1JA 3I6YA 3MPUA 4JIMA 4G3XA 5IEJA 1ZUNA 5EXPA 4MQ4A 5CT5A 5IVIA 2WOJA 3ZC3A 4DWOA 1DMSA 2HIGA 3CJQA 4C87A 6Q21A 2AC2A 5B1YA 4HPWA 1QMGA 5EJ8A 1ZR4A 4OX9Y 4TZ6A 3MS7A 1XDBA 2WINI 3KDAA 5HG0A 2YVAA 1CNEA 2FLVA 4HWGA 2CJXA 1J97A 4HFJA 1I7QB 1U5BB 2WOOA 4BZWA 3E5NA 1MH1A 4GQBA 3HL0A 1UEXC 4XWAA 5C81A 2QY9A 1R6TA 4O4JA 3P0HA 3FSJX 3QHQA 4YP5A 1C0LA 3HKCB 1WB9A 1COZA 2FHSA 1PP4A 3I3OA 1SC6A 4GM1A 4M6WA 2WJZB 1OLXB 3BFJA 2G6TA 3D5QA 3H5IA 1O6FA 4J4BA 3PXXA 4URYR 2IYFA 3AF2A 5DTRA 2XT9A 5CXQA 3IJRA 4XJVA 2H2AA 2OCYC 2QA5A 4MV6A 3TO5A 3TSYA 3L7LA 3HPRA 1EGMB 3IQEA 1O08A 3IV9A 1T4GA 2R8XA 1M1NA 3HXKA 5AFSA 4Y2XA 1YVEI 2P3QA 2P9EA 1CLUA 4B7UA 2FSVA 4BV3A 3QE9Y 3RJMA 5JEEA 3VV3A 1Q22A 3GEEA 4GLOA 5KSZA 4CMIA 1AMNA 2X41A 4X84A 2GN1A 4H60A 2HA4A 2PX8A 4DSAA 4I55B 4J0IA 3CNBA 2WKPA 5D1HA 3UUEA 5ALVA 4AN0A 5BWMA 3CZCA 4FW8A 4HDNA 4OTZA 4XARA 3WGJA 2F8SA 1MZPA 4LTMA 1FX1A 1KETA 2WHXA 4NU6A 2AN1A 3N9IA 5EP4A 2DH6A 1SVMA 4LYAA 1NLUA 1N7JA 4HEHA 3KR9A 3U3RA 5ALEA 2D2VA 4WCDA 3TJRA 3WZMA 5U9CA 5C1DA 3HJAA 4YUYA 1XIVA 4L7VA 2CUNA 4LXTA 5JH7B 3HKEA 2Q45A 1R0CA 1SXHA 5E3JA 2HD4A 1V5IA 3DA8A 5CJ2A 3I05A 2EBWA 3ACCA 4XIYA 3IT0A 4PTLA 3X1MA 1E9AA 2AYYA 4G37A 2EYUA 2IV3A 3C24A 3K1JA 3JSXA 3WJAA 4CNQA 4JGGA 2WFLA 1T5HX 2WZQA 3AFHA 4KRYA 3KFLA 2XWJI 3X1DA 1EP3B 4M1MA 4JEIA 4GOND 2V7XA 2II6A 3ME5A 2UUBB 4BO4A 1RJ9B 4RKWA 1TRKA 3LWZA 4DLPA 1QAMA 5LD2B 1PL8A 2ZUBA 4DCGA 3JQAD 1GKLA 1WW8A 3QKSA 1TCAA 1RQLA 4DRYA 2BJVA 3FMVA 4DV3B 5K3FA 4NF2A 2UZIR 4ZAVA 5SZIA 3B6JA 4TWZA 5CHYA 4Y6GB 1ISPA 2BR3A 4HGPA 1E98A 5GONF 3DBVO 4I9UA 4E5NA 4N47A 4RM3A 2OPBA 4BMPB 4JYZA 2J0VA 3UWMA 1T2CA 4EM6A 2Q0XA 2P90A 4NBSA 1SUSA 2SKCA 3AFGA 3DMNA 1T9AA 4J0DA 1IATA 1L7OA 5FFFA 4CW7A 5JJBA 3RS9A 3SSMA 4F93B 2ZCVA 2C2KA 2JI8A 4CM5A 2I67A 1XDDA 1SOVA 3ZW9A 3OZUA 2C42A 3T9CA 1E2KA 1CVLA 1U7HA 4BN5A 1Y0BA 4PPNA 3IOMA 3KQMA 4Z2AA 6PFKA 1YQEA 3BXPA 3VR4H 3OF5A 4YFYA 4KQ2A 2XUZA 3RSHA 1JR3E 1K6EA 1V8ZA 1J0EA 2B2NA 2GEKA 2YIDA 4JELA 5NLLA 1L7RA 1UINA 2I6FA 4XX0B 4TSKA 2R4UA 2DQZA 2IYVA 5JD6A 2RH8A 3TINA 5F3RA 2WTAA 3UK7A 1HPLA 5JSKA 1CJVC 3QVMA 5F7OA 4RULA 4LF7B 2EJWA 2ZYDA 3KJQA 3CG4A 5BUCA 2V3CC 5EINA 3GAZA 3IMKA 4UNQA 1JMKC 4IVQA 3EISA 1ST3A 2LKDA 3R5TA 4C0WA 2HK6A 1JHMA 2WBLC 1OXVA 2ORIA 2VBIA 3HCBA 1RZUA 3NFYA 3PQFA 4QVGA 1QQBA 2W6OA 5DM2A 3PHLA 3FIJA 1OTHA 2JJ8A 3QVTA 3KOZA 4GIBA 1PQWA 1ZH8A 2EHDA 3CX4A 4KQKA 1POXA 2FQ1A 1OWMA 1X38A 5FBLB 1OX5A 5HF6A 4DBLE 5DISB 3TTSA 2QW1A 1SRRA 1Y1TA 2WC1A 4BQPA 5DW0A 2YMPA 5K45A 2I3AA 1FDRA 4M60A 2M6SA 4RQBA 3Q7QA 5HMMA 4IDOA 3DSRA 3CT4A 2I4MA 4AJLA 3BQNB 5H3CA 3HR7A 2DWQA 2IXGA 2DHQA 3C4VA 3DEIA 3NAMA 3QPUA 1E7YA 4QNMA 2F43A 1FNNA 4E1VA 3D6JA 4RSMA 3W34A 1WXEA 1CHDA 2PT5A 1GPAA 2ICAA 1OY1A 3LM8A 4LAFA 3U4GA 2HC9A 2QU8A 2R7NA 2UVDA 2FWAA 2DPXA 1SBYA 1YDGA 2R1UA 2WSLA 2I7DA 2OFXA 3MFQA 4RORA 1E0DA 2CBGA 4ZA2A 4ALJA 4ZYUA 1ILWA 5IEBA 3SZ3A 3AEUB 2H29A 3QV1A 1E2FA 4L7QA 4EFLA 1RWMA 4QUIA 3QX7A 2OM6A 1K8ZB 1YS1X 2XWQA 4EEXA 3KETA 1G3UA 3PLAE 4Q9AA 2B35A 5C32A 2VPWA 4QXPA 3TNDA 1DTWA 1C30A 4WJKB 2PV0A 2VJAA 2Z04A 3GYGA 5EHGA 3TQTA 1Z63A 1TTHA 1HNXB 1EA7A 2OB1A 2XA1A 1QCZA 3L1JA 3ZU4A 1PTJA 2G9VA 3E81A 5JMTA 4ZVVA 5SZJA 1HORA 1PK7A 1TF2A 2J9FB 2XE6A 4PGGA 4DCOA 2CUTA 4R1LA 1R0XA 3PJGA 4O4JF 3WBBA 2C96A 3G49A 4HQKA 3V1NA 3CKLA 4X91A 4ZOCA 1G9TA 1OXSC 3LQ2A 1U8XX 1CUVA 3PEVA 4KQMA 1FUYB 1KKUA 1MQ8B 1NYLA 4Q1BA 4R2XA 3MCUA 4WINA 3MA0A 1U1GA 2VK4A 3ZDRA 3RNOA 3EMDA 2BFMA 1N34B 4HNRA 2REOA 3HXOA 5JS1A 1S6YA 3P8ZA 5KTOA 3T5TA 5IG2A 2FTKE 3CVXA 2JFBA 2XUQA 1TMOA 3NTOA 4FOSA 3SQNA 2ATVA 1PJSA 2PIAA 3LH5A 3VZCA 4AY3A 2Z2XA 2BRUA 3N7UA 3DL0A 4KE8A 4MGKR 1HT3A 5T3YA 2VPIA 1OIWA 5F7XA 1EE1A 3CEPB 4E88A 3KXIA 1Y4ZA 3SQLA 3CTMA 4PAQA 2XDYA 4B3SB 4GRDA 1C3JA 2P7HA 3GFPA 4E11A 5AM0A 4ZU3A 3BMOA 1BW9B 3EQ2A 3RI3A 4JH0A 4WSOA 1W93A 2A5GA 4TVSA 3QOYA 4BJ6A 4N18A 1CQIB 3RR2A 2YN4A 3A27A 3RG2A 3SLGA 1F1JA 4HD8A 2R65A 4MLCA 3QITA 1E8NA 4L75A 4CF3A 1XMOB 5DHPA 3D0RA 2IYOA 3PNQA 2G1AA 2G1JA 3MWDB 3W2EA 3OP1A 3F5DA 2HT1A 4REQB 4DC0A 3E5HA 4OATA 4V3BA 5B6JA 3KT0A 4K1XA 1T13A 5C5IA 2VP5A 4QTTB 5I4CA 2CLLB 2L82A 3MELA 1YR8A 3VO2A 1FRFS 4MW7A 3GFVA 3GJ3A 3S7ZA 2FPRA 1AN0A 2PX6A 4JA0A 3TMAA 2A0XA 2Z9BA 2AE2A 3GFBA 3O0DA 2ZJ8A 1XEFA 3Q6NA 3RTGA 1YS9A 3U9TA 1TOAA 4KFCA 4BLVA 4OXYA 1DC6A 5I8PA 4LXXA 4XSVA 4L1KA 2VAVA 4QLBA 3ESZA 3SKXA 3HZHA 3V1UA 1Q5PA 4LC1A 5BN5B 2X2PA 5DHQA 3SR4A 1XN4A 3AXSA 2VTKA 4WESB 4RGQA 2ZI4A 1GPUA 4JP8A 4QPNA 2P30A 3BB1A 4HWRA 2WQ6A 4MQBA 1Q0ZA 3WTCA 2ENUA 1R9JA 4NU8X 3PXCX 1EB8A 4D0LB 4OXXA 1J2UA 4JLPA 4PWYA 5HRAA 1HDYA 2G80A 1SHTX 2ZE6A 2BCGY 3LCVB 4GOJA 5F2EA 2DYKA 2H57A 4KVFA 4UM8B 2ZANA 2C7RA 3B7WA 1Q95A 4CCAA 4QBHA 2QYSA 3PWZA 1NQTA 4ZTUB 2YN2A 5ALGA 2KHZA 3WGVA 1ZL0A 2F4NA 3FUVA 3ROEA 1KJIA 2MYNA 3SZGA 1EFRA 2GYYA 2YOGA 4RSGA 1NPDA 5A4DA 2DMRA 1OFGA 3I4LA 3WLOA 2HV9A 2C20A 4IIJB 1H2HA 3C6XA 2ATEA 5I7UA 2BELA 2X6QA 4JBWA 3DHYA 1B0ZA 3FAKA 3PA6A 4GWKA 4JBLA 1HYHA 3V4LA 2V5AA 3U60B 1MJHA 2XX3A 2EKBA 3A1TA 1F51E 3EXFB 2M2IA 2BFAA 4LNUA 4Y30A 5BN4B 1R8XA 2P9BA 3PPVA 3LCMA 1XHFA 1ZOSA 3EA0A 3NC1C 3INRA 3LW7A 5F9FA 1AKQA 2RHWA 3HXTA 1UPXA 1T5OA 4ESHA 2REQA 3KP1A 2OWEA 2H2HA 2H2GA 2V7EA 5TNXA 2WJAA 2NLOA 3DM9B 1E1KA 2OAEA 4N5MA 2VTBB 1DBWA 4ZYXA 3ROQA 2QAJA 3MAJA 5H1YA 1J8FA 1KA9H 2VHXA 3OKAA 3PXUA 2HHHB 1TJ4A 2XUKA 3QQ5A 4BCCA 5G4KB 5IZCC 5KYWA 4MRPA 3IL2A 5FL7A 1ZOPA 1XEAA 2VDWB 3Q40A 5ARDA 4D45A 5F9MA 3HFSA 1XYYA 4XWWA 4IKPA 1FS4A 2O3UA 3DR3A 4TTVA 2I7TA 3LDFA 4HVAA 4UBLA 1J4AA 1BU5A 3OOHA 4XGNA 3RVBA 3S2FA 3TQRA 2F8LA 4B46A 1CEEA 2VP9A 4ZCQA 3D6MA 5E38A 3PXDA 1CNMA 2XD4A 3WK5A 4AF7A 3G8DA 1LPOA 4KODA 1KRHA 4KZPA 2OHGA 1QLWA 2JDIA 5JWRA 4HNVA 4AKGA 821PA 1T2DA 3PYMA 5DASA 2B7LA 2NSYA 4LX0A 3PD1A 3IE1A 3U7IA 5FQOA 1XKQA 1ZCJA 4A36A 2C61A 2R00A 4RDIA 4GW3A 1LK7A 2LE0A 4AJJA 2DQ4A 1WXIA 4P7BA 1PJ3A 1T4MA 3B2QA 3PGLA 4MS1B 3X3HA 3ZJTA 4OHPA 5LLTA 2R7LA 4WBNA 3D3WA 1VE3A 4JD5A 3SFTA 2I4OA 4TRNA 3I9OA 2BGGA 3O21A 5KYUB 3NTVA 1C4WA 2ODTX 1VBMA 3L9WA 2HN9A 3V8RA 4ZHQB 4PC1A 2WFAA 5DGDA 3SIPA 3IVXA 2VQDA 2QRHA 1GNRA 5FHRA 4CF7A 1RCUA 4FONA 4Z1MA 1IULA 1VSVA 1F2DA 4HF7A 1SCUB 2TMGA 3LVRE 5CXUA 1SKYE 3ESRA 1ZA1A 1N9KA 3A28A 1EWVA 2HCFA 2QMEA 1QRUA 1KDPA 3ZDAA 4F60A 1XWIA 3NBXX 3KL2A 2ZSUA 4HDAA 2ZUVA 1L4UA 3E3LA 1GUYA 4HT3B 1XR3A 1MAAA 3E4DA 4IXMA 5JPCA 4GKJB 2MMGA 5JAPA 2OM2A 3Q3JB 5ERGB 4XQEA 5CT4A 1RABA 1OYVA 1G5TA 2QVXX 4C6TB 1E7WA 3UA3A 5FLEX 2PZAA 3EWIA 4I4LA 5JFOA 2YXEA 3G6WA 5D5QA 1U8CB 2WD8A 1GT91 1RZ3A 4YJGA 1ECLA 3COPA 4V39A 4AI6A 3CZQA 4X20A 3SOPA 1CU1A 2OP0A 2ECKA 5COBA 2CDRA 1M3SA 3OECA 2XQFA 5FBRB 2G9NA 1I01A 1M7HA 1PNOA 3EIFA 4A8JB 5BYAA 1GPBA 3H97A 2QP9X 2E5LB 3GN2A 1VSTA 4UVHA 2PMWB 2O8CB 1SK8A 1KK3A 3LK7A 5EIOA 3T9FA 2O8DB 1OXKB 2P6OA 1A7AA 4GYYA 5ITZA 3R9WA 2D00A 2H5EA 2Y6VA 1G1AA 4US0R 2QX9A 1LVUA 5I01A 1AGXA 1RRGA 1WXXA 2YWEA 3HWWA 3QLUC 4JLWA 1WUTA 1QGOA 3U09A 5ALIA 4OHCA 1H3EA 3BN3A 3EUAA 1A69A 5KJFA 1EWYA 3COWA 1EGVB 4PLPA 1FLAA 1P4HA 2GBIA 2XYPA 4FR2A 5JE8A 2KMLA 3S2SA 1KVUA 1YBFA 2P69A 1L8OA 1W34A 2XNKA 5TGTA 3ZBQA 2UXBB 3RS3A 5CVTA 4HVCA 2DGDA 3NCHA 3VH4A 2VYND 1AZLA 4QQKA 5DDIP 5BNFA 2XJ4A 4YUZA 5HKKA 4I3FA 5ALPA 4X8LA 2ISQA 4OIFA 3KYDA 5HZHA 1CLEA 5IKPA 4RY9A 2O8FA 3U44B 1ATZA 3DNPA 1ND6A 1XEXB 8ATCA 2OLEA 1BDHA 5JG7A 1P2TA 4EVSA 2W6JA 5CYFA 4B4VA 4RXUA 1ONNA 1KJ9A 3MB8A 2JLZA 5FOXA 4TMKA 2CKMA 1G7SA 1EK2A 4EENA 3H6HA 4B6FA 5C46F 3SU8A 4RV4A 4RTJA 3IE2A 1HDOA 5BORA 2Y2UA 1S7CA 3L7AA 1W76A 5DV9A 4PLVA 1IBMB 5BV7A 3DEYX 3PB3A 3ZE8A 3WMGA 1I36A 3NOXA 4XRGA 2PLRA 3DW3X 1XEWY 3PBKA 4PPGA 4K88A 5CLHA 4Z3OA 3T94A 4HX9A 2W2QA 1M1XB 3O8LA 2QNIA 3IAXA 2C03A 4JEUA 5EE1A 1M0EA 3E9RA 5K0TA 2EG5A 3W5CA 4MA5A 4TM7A 2B2XA 1VLHA 2XQIA 3WMWA 3PX7A 2W2XA 2XNHA 3DTVA 1THZA 2CVZA 2YQ4A 5HFAA 1JJFA 1YZYA 4Z8XA 1EFUA 2FMTA 3I9V1 2WJPA 3EXG2 3BL5A 3M4NA 2PSFA 3M6AA 4IGIA 1HQYE 1SB9A 2OTCA 3ZDDA 3BXXA 3WGUA 2BSQA 2IK8A 4GMHA 4CTMA 3A1NA 2KLHA 1OI2A 4F3CA 1OH7A 2VJPA 4LFAB 2NTJA 2XMRA 3KVOA 2QM8A 3C8DA 3UCEA 4DV6B 4R81A 3Q3CA 5CFRA 4IOJA 1WCIA 3BMXA 3GVIA 4J49A 3OHSX 4RANA 4N5IX 2HAEA 4YAEA 1MLDA 1E0KA 2RHCA 2VRWA 1XVVA 4QT4A 1SUAA 2VHEA 3SM3A 3KB2A 3GT0A 4LWOA 4G8BA 1KDZA 1ISGA 2OXRA 4PNHA 2B6NA 1Z2CA 2JIQA 1LBTA 3GOQA 1Q0HA 3MS2A 2VEOA 3ORHA 2BDEA 3KWLA 3AR2A 3MMNA 3P0EA 3EQ6A 2YXDA 2PT7A 2PUCA 4KQIA 3QELB 5MDHA 2BZ1A 2QK4A 4JUIA 4OCZA 4HLUC 4X93A 2E4ZA 4N5LA 4BO9A 1U1DA 3H5VA 5KTTA 5KNDD 1IAVA 2UVQA 1NQUA 2AEEA 3I01M 4H7IA 4BJ5A 3K0SA 1JH9A 2I78A 1UXKA 2Z2ZA 1JVNA 3L6BA 3PFFA 1NMQA 2F55A 3ASYA 1TD9A 1PBTA 3IBCA 4LVNA 1KDTA 1M8GA 1RWOA 3ETEA 2XKAA 3LS2A 3EGWA 5TC4A 2ZQ5A 4M1TA 4WBNF 2FE4A 3EDOA 1YBVA 1TJPB 4YRKA 3K6KA 1Y8ZA 1TZKA 2HDNB 3PJFA 3ZUGA 5K3OA 1W8IA 2FPPB 1RPZA 2O7QA 3T54A 3HBJA 4Z49A 4HH3C 5CFPA 1A1SA 1WBBA 2Y3IA 1XOIA 3FPFA 3N0RA 4UASA 2SICE 4DBVO 3F4BA 4Q7LA 1SIUA 2CNDA 3I5XA 4FE7A 1E6KA 3HCFA 2JGLA 3MWEB 3KQYA 4QUGA 1TW2A 5FKJA 4X1YB 1R10A 1UC9A 2FQYA 2WK1A 4BRWA 1IC6A 2C7BA 5JVDB 1OVGA 1HKUA 2KYRA 1OF1A 3H7IA 3L0YA 3AFOA 1IPHA 1FFHA 1Q7GA 4K81B 4QBIA 2EEZA 1CULC 4BBZA 3BJZA 5G0VA 4G8JA 1SZJG 4IF4A 3TCXB 1JWLA 4BFVA 3D64A 5ITSA 3FPBA 1ZUD1 3TPCA 4KK4A 3EPHA 2EW8A 4ONEA 5AI8A 1WZCA 3JRWA 5B4UA 3T5AA 4AKHA 1EX1A 4CMKA 3SF0A 4DEYA 5CLLA 1A5TA 3G85A 4QGFA 2W8ZA 4C2TA 3OHPA 2C7PA 1LPNA 5AKIA 4A16A 4NJMA 2SKDA 2HWUA 2OCLA 4TZKA 3WAKA 1LRLA 2EJVA 4RZUA 3H2BA 5HZMA 5LZ9A 4BN0A 3QPVA 4X7RA 5DP1A 2JAQA 4CKXA 4EECA 4QYTA 3U49A 5CG2A 3PQ5A 4E46A 1MQAA 3MMXA 1FW8A 5IUJC 4JYPA 3PVCA 4FGSA 4LDAA 3USZA 2Y68A 2CUZA 5HQ3A 3V1TC 4CG3A 2FA9A 2BW0A 3F5FA 3QEJA 4DDWA 4ZQIA 3AI3A 3ZI7A 1JR6A 4MVCA 2ZUSA 4YV2A 2Q9AA 3HVIA 3SVLA 3EEFA 1LPAB 2Z2YA 4WY2A 3U4CA 3IKTA 3F5SA 2WMNB 3VPFA 4X94A 1JJIA 4LG1A 2J7PA 1SCQA 4YJDA 4JXXA 4XB6B 3CVOA 1C7EA 2IV7A 1XYVA 1ZWKA 3KTAB 5B2FA 2VAWA 2VL7A 2R8PA 5CPFA 3E9EA 1NYTA 4QBTA 1YB7A 3I0MA 3O91A 3UG6A 5DXFA 2OD2A 3B6EA 1P1BA 1WB6A 3DL4A 1QTRA 3GFFA 3H2GA 3VZDA 3WQRA 4CIBA 1C29B 1NG9A 3FYUA 2CXUA 3IXLA 3KHTA 2CBZA 4K6MA 1KFBB 2AL7A 5JQWA 3EVZA 5J2UB 5JTTA 1RLJA 1E66A 4LZZA 4MS4B 3WIEA 5SV2A 5SZHB 1LPPA 4CYMA 4ZKDA 3DG9A 5IWCA 3KXKA 4DV2B 1KPIA 2PBRA 1JYSA 1QIHA 1WMDA 2O0KA 2SECE 3H4IA 3TSAA 2HCTA 4RGYA 5DBOA 1YB6A 2VUTA 3TW0A 2K4MA 5J4HA 3JQ9C 2AKAB 1T0UA 5LXTB 1NBMD 1MAHA 4ZWNA 1QRAA 2VHQA 4FILA 4R9SA 3SBXA 3VPCA 5KS2A 1KR2A 1BJKA 1PFVA 3MUNA 1TYEB 5DF1A 1FTNA 3UWOA 1L8AA 3QVUA 4DTCA 4EW2A 4ZXPA 4UXHA 2NX2A 1P9WA 3NOVA 3CZ4A 2V0GA 3BK7A 2I65A 5B58C 3TQQA 1E2PA 1NLFA 1UFQA 4MPRA 3A31A 5JAUA 1U0BB 3A8TA 2FJPA 1RAHA 1N57A 1OXXK 3QPDA 1V8DA 2OFFA 3MYRA 3I9FA 2WHPB 1G59A 5DM70 1L4KA 2QR2A 3DEAA 1XD8A 5BSEA 2ZB4A 1S1CA 2WF6A 4YVFA 3A1SA 5LQCA 2FN3A 1AQLA 1CETA 4LQCA 2QW0X 3F3YA 3VU3A 3ZV4A 1CZHA 3G2PA 3RREA 4ASUD 3D3KA 4ZK6A 3QX3A 4PEVA 2G17A 1OFUA 3ROPA 4AXBA 1A2BA 1TRHA 3FN4A 4B7CA 4IEEA 3ER9A 1PJ4A 2VA9A 4MVXA 1HYEA 1BD3A 1O4VA 3EBOA 3LHSA 4IZIA 4R1NA 1A5SB 3VU0A 2QX6A 4QHTA 4JI1B 2UYHA 4URUR 1BKYA 1ADFA 3JPYA 3OFSA 4FQ5A 4B1FA 1Q7RA 1USGA 2ZRCA 5TS3A 1AQUA 2AJCA 2XOXA 4I1SA 1I8TA 4EB0A 2W71A 2BONA 1R5JA 1UDRA 2BEVB 5LOVA 1VP3A 1OE0A 1Q3TA 5KCZA 4OUKX 4HQRA 4QODA 1FC0A 2QGNA 1J2JA 1FDTA 3GUYA 4C7XA 4GWGA 5JQGB 4BZPA 1JBKA 2WAYA 3E4CA 2H5LA 1J24A 3GFOA 2QAGA 4J9VA 2GN0A 3H1BA 2R6HA 3EZ9A 2RAFA 4CUZA 5LP6B 2CNBA 1K8RA 4CM8B 5C8ZA 4W5TA 3FHCB 3BFXA 4PLTA 3M5DA 5KJ6A 4PG7A 2ATIA 3KE8A 4IDNA 3ECSA 1VG8A 2A6PA 2DKFA 4P08A 1Y5MA 2DTEA 5EZYB 1B1AA 1AKTA 1P0FA 2PRSA 1BA2A 3MJSA 3UY4A 4DJ5X 1WU8A 2LDXA 1W94A 2FG6C 2QOEA 4LEIA 1PYGA 5J23A 1ZCFA 3A1VA 1MB9A 3QUQA 3GMDA 4GVLA 2I7CA 3SC3A 5J4KA 5F98A 1IIBA 5KWEA 1S2MA 1F3OA 1N3LA 3Q8WA 3WNCA 2AFIA 3K1ZA 4MHSA 3GLHB 5FWYA 3A3NA 4ZEMA 4G2NA 5K0JA 3CZMA 2ORVA 5FHQA 2OKGA 3KM0A 3HM9A 1DU4A 5D5PA 1VHDA 3E9ZA 1KIFA 3LBAA 5E7IA 4Y9SA 5IT0A 1FMLA 2QMYA 2Q7OE 3A2MA 3E61A 5JJCA 4IDDA 2E37A 2FQWA 4DV5B 2OLJA 1L5FA 1JZQA 4INZA 8OHMA 2JCYA 2TYSB 4RHYA 4KQHA 2IITA 4Q48A 2WF5A 4I6EA 3K9CA 2NU6B 4YMHA 5EUMA 2AG6A 4E2WA 1OZHA 3KXLA 1UIRA 3TGPA 2JW5A 5FNVB 1JRLA 2JHGA 3HCRA 3QJYA 4Q15A 3VHQA 2BKEA 2C3UA 3G8BA 4TMYA 4OU5A 2YJNA 4EYGA 1AVTA 3EZYA 4PYMA 1O9HA 3S3TA 4X60A 1SZDA 1ZISA 3FFBA 5EQJB 3UUFA 1CY4A 3G2OA 4UU7A 3DEZA 5GVRA 4RHXA 1PYDA 4Q05A 1Y5IA 2PRZA 2BDUA 1I13A 2MR5A 3IBYA 3LT2A 4MICA 3LP6A 3IQFA 4QIHA 5ALRA 5KDOA 1AKUA 1PGNA 1N8TA 4ZRNA 1ENPA 1HEUA 2C4UA 4ZRMA 3NDBB 1C4KA 1JQKA 2EGHA 4MI6A 3G2MA 3QW2A 1LNQA 3PXEA 2UZ1A 2IEAA 3QLVC 1UZUA 2Q3JA 1QHIA 2BSAA 5G4LA 2XSZD 2J31A 2V98A 5COAA 5D3MA 1WHTB 2CYBA 1VSUA 2IYPA 4F4UA 1OAOC 2FRDA 3E7PA 4PX3A 3EZXA 5FYQA 4H1WA 3O4JA 1VJTA 4A4DA 1WV1A 2BL4A 2J08A 4JV5B 1VMKA 1W5EA 1MDFA 2HPZA 3OPXA 4JC4A 3W2IA 1RP1A 4RK1A 3T3OA 3REOA 4CRWB 4M1WA 5JCZA 3NHPA 1IOZA 2QZSA 2V74B 4OJKA 1JB9A 1DRUA 2QN9A 2YV5A 3DYBA 4WLVA 4IXNA 5EN4A 4BFTA 2IP2A 1ISJA 1C1XB 1D5CA 4FCVA 4EPVA 1AHNA 2GVZC 4QEZA 1PGOA 4X0EA 5CCBA 4KITB 1PJCA 2GCNA 1Z56C 3O73A 1T4DA 3ZEIA 1S2OA 1QS0B 3ASZA 2FK7A 3H42B 4KK3A 4KQEA 2I71A 2CHVA 1MOQA 4JLNA 2GZRA 2QD4A 3IAS6 4ZK2A 2WU3A 4RK4A 3FYDA 2OHHA 1K86A 3N1UA 3PUHA 4Q0MA 3ZUPA 4DR3B 4EJMA 1DLJA 1XJ5A 1AGRA 3DF9A 5D3QA 5IC6A 3BJMA 3GU3A 1GPNA 4XD2A 4YP9A 1P7YA 4AZ0A 4B6QA 2F48A 2QTBA 3G5LA 4G0WA 4X8HA 4KQXA 3L7JA 5DCWA 1RXCA 3SEZA 1ZONA 4AMGA 1PR4A 4D4GA 4H59A 4Y1EA 4ARZB 1YJXA 3MLBA 2Z8XA 2HKIA 3R74A 2XTJA 5IULC 2CKDA 1CUDA 3FXAA 3JZAA 4GLFA 4TT3A 3VAAA 2BBOA 1QM5A 3UV6A 3WIVA 1FQKA 1G18A 1BE8A 1QYDA 1S3FA 3CYFA 3L8MA 3ZE1B 4DHWA 1BGXT 3BE8A 3LQKA 4N3AA 4EH1A 4J3JA 4KPEC 1ZRNA 4XJTA 1K6XA 4CWAA 3H65A 3K9GA 4E5MA 1ZKDA 4RVGA 1FU8A 1S02A 4A6DA 1VCNA 4BEJA 5HGXA 2V1UA 3TX2A 4JI3B 3RRBA 1YR1A 2HA3A 4IJWA 5DGCA 4EELA 1AZWA 5AVQA 1YHZA 4Z7OB 3SDBA 2GKSA 4PYJA 5FADA 1ADJA 1HSZA 1SG9A 4NNOA 2C04A 3VUFA 4DIUA 4BWVA 1WETA 1E6LA 5LMZA 4RACA 5AOVA 1II9A 2UYOA 5IKOA 5DGTA 1X7XB 3K7EA 1FQOA 4DLVA 4HB0A 4YMUA 3FWNA 3D9QX 2B5VA 3RC8A 1OAAA 2QX7A 1P19A 1SUBA 4OSPA 3EC7A 4CM4B 3UG7A 1YBHA 1J1ZA 4LPSA 4CM1A 2ZYGA 4OH1A 1CY6A 1EUDA 3EZFA 4NFHA 3V8BA 4B34A 4DQUA 4HS9A 2BFFB 2RAUA 4Z0HO 1C0EA 3WNBA 2DEUA 2JBAB 2RGGA 3LZDA 1GKIA 1YCGA 5L3ZA 3CONA 2ERXA 3RASA 4BATA 3UB2A 2EP7A 5JYCA 1FXSA 1XUOA 2F1HA 2OK8A 3UMCA 1UKYA 3EGOA 3DFMA 3EAQA 2RIRA 2LR0A 1LS6A 2P65A 5AJWA 3STTA 2PLFA 3CO0S 1U3DA 3B38A 3V7YA 4PLYA 3ZLBA 1CR4A 1FYXA 1JPVA 2YFHA 2ZIXB 5TX7A 3K2IA 1S1MA 2NQ8A 4L0CA 3H9EO 5KVCA 2X4GA 2A9PA 4V2IA 4Q9HA 4CKEB 1Z0KA 3BRWA 3OOYA 4EI7A 4W7SA 3TLBA 2DB3A 4KE9A 1OBFO 3SPXA 1GA1A 5DK6A 1UDBA 4WFJA 5LL6P 1NQOA 3D4PA 1OBCA 2PSJA 2HY7A 2O9JA 3N75A 2DSTA 2H9YA 2WJ6A 1WSDA 2YHUA 5DSXA 3B9RA 2P2YA 3DBIA 3R8FA 4MTCA 3GLRA 4R1OA 3SMVA 1GRQA 3W6NA 1KL7A 4JCCA 4KWHA 2BGIA 2WWYA 4M9CA 5L4NA 4ZI7B 2WT9A 2JCVA 5IABA 3OQVA 3CZ9A 1MTOA 2ZJZA 3P5SA 3UAZA 3C97A 1HRDA 1NVBA 2A5JA 3DBLB 3K20A 3KJEA 4G56A 3HJTA 4IQFA 1E9RA 1VZ3A 3LWDA 2JLSA 5AOCA 4C9BA 1DKPA 2VCEA 1KYWA 3D3NA 1JSXA 1T1IA 1P5HA 2IPLA 2JLBA 2QZPA 2ZSHA 4GRIA 1D2AA 4IHAA 2R44A 3EASA 1BO6A 2PVCA 4S1TA 3F1KA 5DFAA 1VKZA 4LXYA 2GCPA 3D6UA 3EPPA 3TTUA 3GXOA 4C89A 5CNMA 4CI0B 2XZDA 4L50A 3OLZA 1EUCB 2V6JA 4UXIA 5C4MA 4MX8A 1ISMA 4HYYA 3VYSB 5EXEA 2DFDA 1JAZA 1JU4A 2QL6A 1UP7A 2BFOA 1UDXA 4BP8A 2CNWA 5CLIA 4D0SA 2XGOA 4FMDB 1CY8A 1KZGB 1DS6A 4W6ZA 1ZD8A 1RYEA 2EW2A 1W36B 4ALIA 4O4LB 4Q7EA 2ZRKA 4ZGGA 5CH8A 4L95C 1R4NB 2BI8A 4LOIA 2HUNA 2ZIWB 3RAFC 1GNSA 4M1YA 1U2GC 3IPRA 1EXDA 3QU4A 2P6PA 2BGRA 3N74A 1UMDB 3NLLA 5F51A 5A7HA 1O94C 3THSA 1UBOS 1ZK3A 2QEQA 2VNJA 4JY7A 4KFRA 4R2HA 5DB4A 4D96A 5CB0A 2CFOA 2FWIA 4BBJA 5GQSA 3FUTA 5EJ6A 4BEWA 5GZ1A 1RQ7A 4E3WA 3ULKA 4D3YA 3EQ7A 1AF4A 3RYTC 3U1BA 3LWNA 4YN3A 3R6WA 4HRYA 4MLZA 4XRRA 4MR9A 3SNKA 4PC2A 1F0YA 5DCLA 1MHPA 4HRAA 1FNMA 1NM5C 3Q11A 4YONB 1ZD4A 4ER7A 2CZQA 5IJ9B 4GICA 1GKUB 5TE9A 4LSZA 1M8PA 3UHFA 2XUPA 2PMCA 3HEAA 3F73A 2W6CX 3BM5A 3IQDB 1QHSA 4EPTA 3NM5A 5DX0A 4C21A 4G4GA 4B5LA 3QVOA 2W0MA 1RQPA 3R3UA 4RA9B 3UMJA 4B44A 1M2KA 1QOQB 3DAOA 1UZNA 3PSHA 4FYHA 4D81A 3CRRA 2ERCA 1K9SA 1W9HA 2FUG6 2RGBA 2Q29A 3KSDO 3UICA 3BB3A 5JS8A 2VA8A 3DXYA 3MRVA 1T4CA 1Z45A 4GUDA 4N48A 4X8MA 4LGMA 1U2SA 1KGDA 3QZUA 1VBNA 2FETA 2LIPA 1J00A 1CY1A 4EYOA 1NW5A 3CW9A 3LW8A 3SQDA 1K7FB 3G5AA 4AS3A 4ENQA 4D25A 4NFYA 2O57A 1M6VA 1IAQA 4OYLA 1SXJC 4LFCB 1V43A 5GWXA 4TV9B 4F8YA 2FN8A 4F11A 4D0NA 5KNBH 4P32A 1NHGA 4OFXA 1XLVA 3ESAA 3NHRA 1UIMA 4NBKA 4TMTA 3HMQA 4H1TA 3TSOA 1PZMA 4R2LA 4QLAA 3L7BA 1JFRA 3AP1A 3M9LA 1DWPA 3O83A 5AVKA 3V48A 4I08A 3W2HA 3KAKA 1T5IA 1XROA 4CTKA 3AOEA 3BMQB 5CDSA 4TXHA 4DR4B 3BCRA 3A14A 3KSRA 2F3SA 1DZ3A 2UKDA 1U3GA 1HDIA 1JU9A 4KXWA 4NU5A 2QORA 1CUEA 1H2ZA 5DM0A 1RR6A 2W93A 5I9TA 2W6NA 3ZCPA 2CSUA 3G59A 3IESA 5ALUA 2A7XA 4F21A 4E6PA 1FVFA 4E5YA 4HPXB 4CN8A 4RPCA 1RQ2A 2YR0A 1BXRB 1BX0A 2J45A 3KUKA 1G0OA 4S0XA 2QUHA 2WIJA 3DOFA 4Q39A 1L5HA 9LDBA 2B82A 3BC1A 3WYCA 3P9SA 3CRVA 3CISA 4K8RB 4OQDA 1A71A 2AMFA 1KH2A 1ZIYA 4M0EA 4WNAA 1YZFA 4ZO6A 1DV2A 4D6XA 2QVBA 3W1VA 3A1WA 4YRAA 4ZYYA 4B3TB 4E13A 1CS0B 2QROA 1RIIA 4KXLA 3ZKWA 2QG4A 3TLJA 3C5HA 3FETA 4TTRA 3LQ4A 4FEGA 1SVKA 4Q9JA 2IPAB 1U98A 2Q6TA 2VTVA 4ZYZA 3C1TA 4JKIA 1M67A 2C98A 3HB9A 1T8YA 1G5IA 4HX2A 4GPEA 3L77A 4Z99A 4Z4QA 2CSXA 3O8QA 1E4VA 2HLHA 4U6QA 4V3CA 2Y9PB 4HL6A 2QSUA 5AJUA 1RPAA 4NAVA 3F67A 2H2DA 3LLSA 3QNWA 1NMYA 3ESCA 4B8ZA 3NYQA 2OL4A 1YJ8A 1HLDA 3FIUA 3TRDA 5L45A 1E2BA 3DOOA 3CSUA 4G1BA 3A70A 1E58A 1SU4A 1GU7A 2YOHA 1W44A 4EITA 5I7OA 4Q3BA 3OCUA 3GLGB 4DY6A 1NULA 4HDCA 4RTRA 2YVQA 1N2SA 1UKBA 1KMHA 3ISJA 4FOOA 4HMOA 2XLBA 4XFDA 3UWKA 3VBEA 1YJCA 1SEPA 3R9XB 3AHEA 1YQGA 3PWSA 4BBAA 4JKYA 3AR4A 2VC2B 1AQJA 1H8ED 2FMUA 3GCZA 3NRJA 4UPEA 5FOUA 2QJRA 3OCZA 1LC0A 1HY3A 4Y7DA 2ZM6B 2A5YB 2BF7A 3IOBA 3MRSA 4M0LA 2J67A 4YJFB 4CLOB 4QGSA 1FY2A 3DMDA 3TDMA 4MDFA 2REBA 4NV1A 2Q1YA 4YCJA 4PSDA 3FTQA 1MG5A 1XVUA 2C59A 3AHIA 3V80A 1PZXA 3F6CA 3MNFA 1NBEA 2ZYSA 4MP3A 5G40A 1W88B 3IUMA 4Z4IA 2ZRAA 3G9UA 4IFIA 1XCBA 2QPTA 4JOQA 4JLSA 1AKRA 4RH0A 4D98A 4X7BA 3OX4A 3ZGYA 1XN1A 2PX5A 4FIZA 4D9JA 1WP9A 4IUBS 1GZ6A 2EX0A 1ODFA 1P2SA 3H1EA 4E5PA 4NENB 1THGA 2GWHA 1PUIA 2ST1A 2WDPA 3L04A 3TDNA 4DBZA 5K8UA 2JIPA 1A04A 4WPGA 3KKMA 4CCYB 1G38A 2WTNA 3DMRA 3E6AA 3JATA 3PNSA 3R9IA 2PJUA 2UVPA 1XRQA 4ABYA 3VC1A 5JZSA 3FKSD 3QOWA 5J5CA 5F5XA 4HAUA 4PLCA 1X2BA 4EA7A 3FBTA 3TOXA 5JMOA 5BNWA 1CT9A 2PGOA 4I8XA 4OQPA 1HX7A 2O1XA 2PPLA 2WU4A 4EDFA 3MQ2A 5JMWA 4ZT4A 1JDBB 4YRMA 2DKNA 1DIOB 3L8CA 3BGDA 3BSSA 4KAAA 2JAPA 3I92A 3A4YA 3CLHA 5ECDA 2XKBA 2ZBVA 3PK0A 2W6QA 1U94A 5ALMA 5K51A 3O4HA 2DPLA 4PAOA 3NQ41 3PJEA 4BNDB 2O2IA 1CVRA 3FF1A 1A50B 3D2BA 1IY9A 3WS7A 1V95A 2I6QA 2JGJA 2PLNA 2QR3A 4MYDA 1KJQA 3DZCA 4G89A 5DHRA 1FZTA 1XZGA 2A57A 4Y0VA 2UAGA 2G9UA 3JWEA 1L7EA 3MTIA 4WBXC 3EAFA 3RIGA 3ZDYB 4A9AA 3F4LA 3ZNOA 5FUMA 1OT3A 4MHOA 4LMPA 5TIIA 3CRZA 8AT1A 4C43A 4AJ9A 1KK2A 1OFVA 4P5PA 1E1QD 3FNRA 2NV2B 4JJIA 3DE1X 2YN0A 3IQWA 1VRWA 3M6FA 1QQ6A 1JKFA 2J87A 3Q0TA 3MHPA 4DDKA 1NT2A 1RM5A 1ZINA 4M8SA 2ZRLA 3DUFB 4GPZA 4XKJA 3ZYCA 1A8UA 4BO3A 4CV3A 3W79A 4DNQA 4BXOA 1YKGA 3GH3A 1QHGA 2HQSA 1WDLA 4OMDA 1NVVQ 1I6WA 2W2OA 4K9NA 4F85A 1N5JA 2XOKD 2XE4A 3CPEA 4LWZA 4BFZA 5HZKA 1E92A 4CM7A 4YREA 4PLWA 1PDOA 5TQ2A 3UGTA 3AFIA 4FFDA 4LKOA 5IFLA 3SMQA 4QO8A 1T36A 1Z74A 3OEHA 1F8YA 5G3YA 4QREA 1ZN7A 2RIPA 3EDQA 3U80A 2D62A 3R76A 3EOAI 3OLXA 4F0JA 4DXHA 4KXNA 4PRKA 2FEAA 1ODJA 2N0SA 1R12A 2PTGA 2X8WA 2BEKA 4B3HA 2XQGA 4MRRA 4EFNA 3IVRA 1T3GA 2EOAA 2P2DA 1GSHA 1U2PA 3TRIA 4JNKA 4N49A 4M87A 1QH8A 3FZQA 4PFKA 3H2ZA 2V9PA 3EOBI 2EU8A 2HWYA 2ZXFA 1X1QA 5K0SA 2XBLA 2QNRA 1IL0A 3H11B 3N8HA 1PUXA 4FM9A 5KDLA 3IUBA 5C8YF 1FK8A 3QXJA 5AHKA 3ELBA 2JARA 1U0GA 1FTWA 1W1WA 1EI9A 1XDZA 2WI8A 3CH7A 4GBJA 2WE7A 4K28A 1XKLA 2PKCA 3GROA 3LPNA 1CRZA 3SBOA 4ZARA 3FWPA 4D97A 1H65A 4IGEA 4C4XA 1XVTA 1LW7A 4OB6A 3SXUA 5AKJA 1JBEA 2XNSA 3AETA 3DBOB 2ZEJA 1BOOA 1D8TA 1DE0A 2JL1A 2Z1DA 3GEBA 4RSHA 5GTDA 1ZZGA 3IODA 4Y2VA 1EVJA 4WLEA 1I3NA 2CXNA 4XE5A 1AUVA 2NXNA 5DYGA 1F4VA 3B3GA 4MIOA 4RZ2A 7GPBA 2C4HA 5A0TA 4M22A 4OAOA 1AKVA 3UJBA 4JNCA 1M8JA 3K2QA 4WKNA 1P91A 4FMPA 2I03A 2ZR7A 4NOLA 1XTRA 1FP7A 5ERYA 1MC4A 1ST2A 2IBMA 3TFWA 4DMRA 3EX7C 2IEZA 4QFBA 1ZH0A 1W5FA 1UXOA