4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
4DC9A 1AS3A 3DZ8A 4ITRC 5FOUA 2GXUA 3N5CA 3P20A 1ZIPA 2BMEA 1R5NA 1GKIA 2W2XA 1KJYA 3KFXA 4M21A 5IT5A 3W9YA 4XD7A 4M1KA 4XOIA 2NGRA 1OLOA 2I3BA 3R7WA 4GDFA 2WTUA 5DYGA 4TYPA 1MH1A 1VPLA 2IBMA 4ZI3A 4AKIA 2V7QA 4LJ9A 4Q48A 3FKQA 1TQ2A 2ZXUA 3ETLA 1YQTA 2JLQA 2AFIE 2VHQA 2VA8A 2WIAA 3B82A 5DI3A 2ZS8A 5KYKA 1J99A 4ZPXA 4V03A 1ZM2A 4ASUA 3HR7A 4IEEA 2QE7D 4JSTA 2BJVA 1YR7A 5C4GB 1Z0IA 4HYYA 1FMJA 2GF0A 1KMHB 2NG1A 3CRMA 1EFCA 1N6HA 4HDQB 4F7WA 4ZDJA 3G82C 1U99A 2FDCA 1E79A 3GEHA 5IHPA 4FCWA 1ZW6A 3QVUA 2QP3A 1R0XA 4HATA 2GKSA 2CHVA 4PSVA 1F2TB 5F2EA 3UMSA 5AUNB 2A9KA 4JT2A 4C0AC 1BKDR 1HT2E 4LX0A 2JLSA 1X8LA 3AV0B 4S2EA 1NVUQ 5EQTA 4CEIB 2VP6A 1G17A 4URYR 4RKEA 1SQ5A 4JLOA 1NY5A 2WJYA 1Z6GA 2ZRFA 1NF3A 1FOEB 4HEJA 2F43B 2ORIA 2ZUCA 1XBTA 1W4BA 2J87A 4DLTA 2VO1A 3IEVA 2QENA 1AZSC 4KU4A 3FWYA 3EC1A 3CNNA 3AVTA 1DO2A 1RJ9A 2GVZC 1G3MA 2CMKA 2C9CA 2HT6A 1FP7A 1ETUA 2B8WA 3D8BA 3OE7D 4B76A 4LYAA 4YMWA 1T0HB 3UG6A 1G3RA 4RY2A 3IQWA 4HSEA 1LNZA 1T6NA 5DGXA 3GQBA 1UPTA 4YLGA 2AHOA 3EASA 1XTIA 1RW4A 4F4JA 1DO0A 4DEXA 4MGZR 2PJZA 4M1YA 4PO1A 3SQXA 4LPSA 1FNMA 2GEUA 3SBEA 1ZC4A 3UKDA 1ZJ6A 3BORA 2K5UA 1MABB 2AWOA 3MUFA 4WZ6A 2VP2A 1EFHA 4D82A 4AYXA 2GHIA 4NP6A 4ZKEA 1RRGA 3GLIA 2D7CA 4OJQA 1B0UA 3R20A 4C7OB 1U0JA 3WNBA 1R5BA 3ZZTA 3PEYA 3GD7A 1SVSA 4JLAA 5HCIA 5E3HA 1II8A 1HQYE 1EFRD 4FIDA 3TLXA 3A4MA 2J1LA 4XWKA 2AKAB 1S3GA 5JRZA 3CR7A 4PQRA 4II7A 1ZUHA 5F3WB 2CLDX 4DLWA 3K70C 2BOVA 4KV9A 3IIKA 3OFND 3LX5A 1CU1A 3EPKA 1YHNA 3BS4A 1DEKA 1E2PA 2PMDA 2UZ3A 4F38A 3UANA 4Q9KA 2O8FA 4ZV4A 1NN3A 3DVLA 3FPAA 4HAWA 1CF4A 2D2FA 1IJEA 2F3RA 4LBWA 4US2R 3LA6A 1KZGB 3L0OA 3PITA 4LYJA 1E94E 3GLFB 2W2VA 4DDUA 4ASUD 3AP1A 1M7HA 1XTJA 2YVUA 1AA9A 3NBZC 4L8GA 4UNQA 3WBKA 3CH4B 3HWSA 5FPSA 4EJSA 3VKHA 2HJGA 2OBLA 5CLQA 1UDXA 3T5GA 4RD1A 3B78A 2ZVPX 1RRPA 3NC0C 4C9BA 1XMJA 4CVNA 5FUXA 1OH7A 4MYHA 3EPLA 3QKTA 4GPTA 3WRYC 2WOOA 3P4XA 4L15A 1T91A 3FKSA 1ZVQA 1OF1A 3DOFA 5LD2B 5BN3A 3C8UA 1RKBA 1XU4A 4F93B 3FB4A 2PCJA 4C0BA 1P3JA 5J4KA 1GL7A 3Q5EA 4AYWA 4KODA 2GXQA 3NH9A 1COWD 4LHYA 4NCHA 3VR4A 1OXTA 4KFTA 3VR1A 1XD9A 4A82A 5KDLA 3BB4A 2FX3A 2OILA 3GFOA 4EUNA 1CXZA 1MT0A 3O8RA 4TYNA 1W4RA 4IFEA 1N0VC 1W44A 3DKVA 1GP2A 3F8TA 3MJRA 2HLDA 2AK2A 5G40A 4E03A 5JHGB 3JVUA 5CB8A 3MG9A 3ZZ0A 2HLDD 2VBCA 4B3DA 2WSSA 2REOA 1G5PA 1I2DA 1F2UB 4BPBA 2IXGA 4YMUA 2FZ4A 3OIVA 3L0PA 1KTVA 2ZUBA 4RZUA 3B5JA 5J4LA 4RSGA 3AEZA 4A15A 3VFDA 4BFYA 5J47A 3ZVMA 2KJQA 1JJVA 2R2AA 3S1AA 4M22A 2ZRCA 3CIOA 3I1FA 4TLBA 3KUCA 3FKSD 5FPKA 5JJIA 2ERYA 4GOJA 2VP5A 2QT1A 3I73A 1OH5A 5E7JA 2OV2A 2FEOA 2ZI7A 2GNOA 1J90A 1L4UA 2CCKA 2H1LA 3IEUA 2MSCB 3QKSA 2AD5A 1ZYUA 2A7QA 3C15C 2NPIA 4M9QA 1E2FA 3SS8A 3IGFA 1G8YA 4TYWA 2CVFA 2EFEB 3NHBA 4DBLC 2GTPA 5JHHB 3AVQA 1MR3F 3OZXA 1WMSA 1I4TD 4BFXA 1XD2A 2QP4A 4EJSB 1U9IA 2IS4A 2C95A 1Q1BA 1TTTA 4B44A 5AUOB 4HB4A 4DLXA 2PCLA 4BZPA 2V6JA 3KQUA 1RJ9B 2YINC 1E32A 1VTKA 1FZQA 1CRQA 1X1RA 2JJ2D 1TEXA 1KAGA 2HCJB 4MRRA 1UKZA 1R4AA 4QGAA 1NVWQ 2BHRA 3IILA 4QHTA 2ZI9A 1E1QD 2ZR0A 4LRWA 2ONJA 4BQSA 4Z51A 3QKSB 3AVPA 5BW8A 4ESVA 2PL3A 3AVOA 1YZNA 3BWDD 4EPYA 2V55B 1IBRA 4PQYA 4POAA 1A82A 3AM1A 5C18A 5JCZA 1QHIA 3I62A 2SHKA 1NSFA 4NHOA 2NZJA 3PEWA 1NJFA 4PHHA 3DL0A 4B43A 1AM4D 2XNDA 1Z22A 3CPHA 1VECA 3R9XA 4EPRA 3S1AB 2JJ8A 3EZ9A 2WHXA 1HE1C 2FWRA 3B6EA 3QQ5A 3K0FB 2FG5A 4JJZA 1JXMA 1W0JD 5FL3A 2QGNA 3HPRA 4JBYA 3H1TA 4HAYA 4PPFA 3D6TB 3WYGA 1ZCAA 1II9A 2E1RA 3VHXA 1KO7A 3ZJYA 5KO2A 1XEWX 1OH8A 4QC2A 5SZHB 1DELA 3B7GA 3LBHA 2A5YB 4KVAA 5AJXA 4LJ4A 5CITA 5KDDA 5M04A 2GJ8A 2ZRMA 4Q7MB 1FTSA 3EZFA 2D74A 2XOKD 5EP4A 6Q21A 3GFPA 2J0UB 1N6RA 2WOJA 2P5SA 2QTFA 2XGJA 3K70D 1VIAA 3T1TA 2FPMA 1KSJA 4BZQA 2BJWA 1S4QA 4RD6A 3BFXA 4JVMA 2OHFA 1Q3HA 3QXXA 1LY1A 2Q3HA 2AXPA 1KMQA 4Q66C 3D7MA 1N3BA 2DHRA 2OO7A 3EC2A 1US8B 2ODWA 2BMJA 3Q85A 1KI2A 4U00A 4AWXA 4Q1AA 1IN4A 1R6BX 3RS7A 1GL9B 3SFVA 5FTNA 5FTMA 2CNWA 2NO9A 1ODFA 2ZI5A 1N2CE 1D2EA 1EGAA 2X8AA 4HAUA 2QI9C 1ZUNB 5E95A 2D2EA 2ZRDA 1AKYA 2G0NA 3ND9A 2AK3A 3VR6A 4QNRA 4TMZA 4WOPA 3IPYA 1Z2CA 1JEEA 2QQEA 1C1YA 5K8UA 1A2KC 3KXIA 1PZNA 2XEXA 4RD3A 2P6UA 4DLUA 4D81A 1WE2A 1E4VA 5LDDC 4C0SA 2H5EA 1KKMA 1YZQA 1CJKC 2OBMA 1U0HC 4IOKA 2BBWA 4A2PA 3A1WA 1UEIA 1NSTA 4CGZA 2VSFA 2BKUA 3KKQA 4G5GA 5L3QB 3FMIA 4FMCB 4QBFA 2E87A 2YKGA 1BYIA 1J70A 1UFQA 4JZKA 4JT4A 3GLFE 4GNKA 1XTQA 2HDNB 4LC0A 2G83A 1KHTA 2WWHA 1E9DA 2ZJ5A 4DB4A 5DO9A 4LHWA 1SXJA 2BWJA 3K0AB 4P31A 1EESA 2IHYA 3EX7C 3K70B 3OAAA 2WWWA 2X19A 2B6HA 4YDHB 1KJZA 4KFUA 1M7BA 4FXPA 1HEIA 3V4RA 4IW3B 3W6PA 4G01B 4IDNA 4Q4JA 1ZINA 3CZPA 1U90A 3TE6A 3I8XA 5HKKA 1OHHA 2OCAA 2C9OA 3X1WA 5KDOA 1MRSA 2A2ZA 4Q1CA 3SJAA 2FPLA 2NPFA 2DFKB 3FGNA 5LB2A 1ZRHA 1DTSA 4URUR 1VHTA 1ZCBA 2PEZA 4MGKR 1XXHA 1ESMA 1OKKD 4FW9A 4LGMA 1CEEA 3FYHA 3MGCA 4M2LA 1JB1A 5SZJA 3F0TA 2CHQA 2NO6A 5KUTA 3Q9LA 4CEIA 1MOZA 1F2UA 1TPZA 2D7DA 1XMIA 2VHCA 3NIBA 2JDID 2LCFA 1GIAA 2GZAA 2AFHE 4EQ6B 3CBQA 4HZIA 4JBXA 5BYKA 4GBMA 2CXXA 4YC7A 1EFRA 4KLZA 1OIXA 1G4AE 5FUYA 4Z1MA 1FTNA 3AVUA 4IXNA 1QG2A 1JR6A 5LB4A 1GKYA 3RS5A 1NRJB 3EAQA 4C0LA 1XRJA 1Z6YA 4GOKA 2HV8A 2WJHA 1GRNA 4MKIA 3A6PC 2WWXA 3T12A 2HYDA 2NZ8A 1F6BA 1ZNZA 2C04A 4FINA 3KZ1E 4JLNA 2PBRA 3FE2A 1P73A 4BLRA 3C16C 1E6CA 1TEVA 3R7WB 1GVNB 1GRQA 1H8HA 3NVAA 4MRSA 1T3LA 3QG5A 4TZ6A 1XX6A 1AK2A 2IYWA 3NH6A 5FL7A 3CWZA 5JWHA 1TQDA 4Q9IA 3SYLA 4NYJQ 3BFVA 1XP8A 4QBHA 2V1XA 1NG9A 4F4IA 5FI0B 3GJ5A 2XAUA 4O2LA 2P6RA 1IXZA 2GCOA 4PZLA 2I1VB 3U7FB 4DEYA 2Z0MA 3U7HB 2H8KA 4NMMA 3THYA 2B7CA 3L82B 5BWMA 2G1KA 2F7SA 3L8ZA 2FFQA 2ZANA 3C4JA 2GDJA 4ERNA 5KSOA 2ATVA 4W5WA 5KPJA 4Q5IA 3AP3A 2RGBA 3VX3A 2XTZA 4JIMA 4TTPA 2BMFA 5TB5A 2PT5A 1KY3A 4KXFB 4W5JA 4B32A 2O0KA 1RRFA 1D5CA 3RVBA 4UXJA 4TLAA 1QVRA 2PMKA 2J3EA 3THXB 5EXPA 4TMKA 5FBQB 1S9DA 3MLEA 5CM9C 3FHTA 1Q44A 3LO5A 4IJMA 3SN6A 3G0HA 1VYVA 1T8UA 2IF2A 2ZITA 5EP1A 1U94A 2CCGA 2KBFA 2N1BA 4LHVA 4XVRA 1VG1A 5HZKA 3KXLA 1OFIA 1Z63A 3N2EA 1OT3A 5E4FA 2OM2A 4JKYA 3WYFA 3MD0A 4OK6A 3RWMB 2F6RA 3SOPA 1Q12A 2QP9X 1AS2A 2ZI4A 5B64A 5IK2D 1AJEA 3PJRA 4LHXA 1SZPA 4QOSA 4B35A 2OESA 5JS7A 2RKOA 1E9FA 2A5GA 2JEOA 3QXCA 1OB5A 5L3SB 2Q0HA 3A4LA 3DPUA 1U98A 3SBDA 4BUJA 2FSFA 4PZYA 3W34A 1OW3B 1W7AA 2RGNC 3LLMA 4FI3C 4TQ9A 4A6XA 1N5LA 1JR3E 4LWZA 5EP3A 2IS6A 1ZP6A 4Q02A 4JLBA 4RD2A 3BFKA 4PQFA 2BEJA 3BGWA 1XNJA 4FN5A 1E69A 3B85A 1E2DA 1FMLA 3D3QA 4OI2A 3UWKA 4MRVA 2JLXA 2VP4A 2O0HA 4OK3A 2A5FA 2OBNA 4ZCLA 4EIWA 2NO1A 4JLVA 4CRWB 2QSYA 2BBSA 4YXWD 2IWRA 1WXQA 2B21A 1P2TA 5AJWA 1NN1A 1P2UA 2BBTA 2WJIA 2J7KA 2YJTD 3Q3JB 1NVXQ 4FCVA 1GITA 1UBCA 2OXRA 5DI3B 3CWQA 1QHYA 1P4SA 2WWIA 3IIJA 3A8TA 221PA 2NTYC 4TYQA 4M9XA 2J41A 3LWNA 1LV7A 5AJYA 4B2LA 4MUBA 1J8YF 1XD2B 4P33A 4JLDA 3T61A 5FFMA 5JSZA 1KI7A 1US8A 4Q01A 4DSOA 3CW2A 3EA0A 3GJ3A 1Y63A 2FE4A 1E2EA 3KKMA 1G7SA 1ZM7A 5C2JB 3E2IA 5FOXA 2ZI6A 1DG1G 1CLUA 1G64A 1MO3A 4H1VA 2OCPA 2HEIA 5H8WA 1KI6A 4M1TA 2F55A 2UKDA 1KSGA 5J4YA 4GFDA 5FBWB 2F1JA 1OSNA 2ZRKA 4UJ3A 2F1RA 3M4YA 1OFUX 3TK1A 4NYMQ 2NO0A 4UNSA 2ZPTX 1F48A 1G3UA 4TN1A 2QAGC 4ACBA 2J5XA 5DNYB 2QM8A 4HLUC 2W58A 4RD4A 3UMFA 5C1BA 4RZ2A 2WJGA 3HYTA 4KFSA 1HA3A 4URZR 3Q72A 5IK2A 2QPTA 4A36A 1YZGA 4U7DA 1E2KA 3KB2A 3H84A 3U6BA 5DHAA 1IN8A 4DB2A 3BK7A 2ZJOA 3EWAA 3AKYA 3T35A 4B3GA 1PVOA 3EPHA 4G3XA 2J0VA 2ODNA 4OHZA 2CHGA 1KZ7B 2EW1A 4HLDA 1KI4A 2PJRA 5FTJA 3GJ6A 3K0CA 2C03A 2EFCB 1ZMXA 4LJ8A 4QHYA 4GI7A 1JAIA 1RYFA 3WYAA 4Q4JB 5FPHA 4P32A 1R8SA 4Q1DA 2O5VA 2IL1A 4P4SB 4Q00A 1SXJC 3R8CA 5HZHA 1G21E 1KDOA 2ASEA 3OEHD 3WMFA 1SXJE 5TARA 1R5OA 3OEHA 3RRYA 1YVDA 3IQXA 1K6MA 1OXUA 1Z0FA 3PUVA 2FN4A 4G5SA 4KSBA 4WXPA 3ZVLA 3GLGA 5KSYA 2BDTA 521PA 2R6GA 3WBJA 4AURA 3GLFA 4Q7LA 2VYFA 2BM0A 1KY2A 2DWPA 3AGPA 2ZREA 1JR3A 1W48A 4NBSA 2GWHA 4F91B 4EKDA 5TMPA 4OHYA 4I81A 4CIDA 1UKEA 1E3MA 5P21A 2OAP1 3E70C 4OBEA 2QMUA 3NXSA 3K09C 1NVVQ 2Z4SA 5CDFE 1NP6A 1TQ4A 3NBFA 2VPPA 4NE2A 1G7RA 4BLQA 4MITA 1XD8A 4IOLA 1VG9B 5FL7D 2XZPA 3WY9A 2GBLC 3O8CA 2Z6VA 3WP1B 4CW7A 2W6JA 2YOGA 2ZYTX 4OJKA 2GF9A 2IEZA 2AR7A 4IRUB 1KDRA 2QBYB 3GLHB 2ZU0C 4OKSA 4RCZA 4CZ2A 3B1ZA 4A2QA 2HUPA 1FP6A 1NKSA 4JMPA 1Z6TA 2QQ0A 4I1VA 1SGWA 3MFYA 5KHOC 3AKEA 1Z2AA 1SVWA 5G53C 1XMSA 3SDZA 4R7ZA 5FBVB 1WA5A 1K5DA 2UVQA 3O8DA 4HLCA 1TF7A 3THYB 2REBA 1LFDB 3SR0A 4Z54A 5AJVB 2O8EB 1VCOA 2ZRJA 4LHZA 3F3YA 3Q7PA 2R6DA 4TSFA 3NDBB 1KK0A 4E07A 4I1UA 4LDJA 1RYHA 1XPUA 4LJAA 3U60B 2J0UA 3I8SA 4KSCA 4N1AA 4NCNA 2F1IA 1W4CA 1GWNA 4PXAA 3GJ0A 1E98A 1I4LD 2I1QA 3A1VA 1G1MA 1P7CA 3AH8A 1CP2A 3OIUA 1TF2A 3BD9A 3EZ2A 4A8JC 2DY1A 3GEEA 3WNDA 3VKWA 1XTRA 2CE7A 1ANKA 2A5DA 5AK0A 2GZHA 3KJHA 3N2IA 3A1TA 3LRPA 1IONA 2PLFA 2G1JA 3QPWA 4YMVA 1FX0A 4Y0AA 2BEKA 2EVWX 4A0GA 2RB4A 2MMGA 1XFAA 3K0SA 4Q1EA 1W36D 1UAAA 2P3SA 421PA 2GXSA 1GNQA 3BB3A 3IBGA 2NOAA 1K5GA 2JLYA 2WSSD 4BZXA 4OQLA 1VHLA 2FEMA 4PPQA 3PXGA 4DJTA 3A4NA 4Q4AB 1NNEA 2C9YA 4C2TA 5H1YA 3LVQE 1IY0A 2FU5C 1RC8A 2OSBA 3G5UA 2UZIR 3A36A 3LV8A 4JLMA 3QPVA 4P3YA 3WMEA 3HU1A 4BECA 1P9RA 1DG3A 2EYUA 2N46A 2XXAB 3UATA 1ZIOA 1P9WA 3QBVA 1W1WA 4R2IA 4TZ0A 1IQPA 1P72A 1UF9A 1T4GA 1YR6A 4CEJA 4URXR 1XCPA 4TTQA 4PAMA 4TQUS 3WHKA 1OYWA 3RS0A 5CIWA 1YR8A 5CB6A 2HF9A 1GUAA 4QGHA 4AC9A 1G6OA 1HH4A 2HXSA 4Q21A 5H70A 4E22A 4HUQA 4QJ4A 4L9WA 4PPGA 1KI9A 4NZYA 1EWQA 2V9PA 2FGJA 5AR1A 3MWKA 4JLJA 4ZDKA 3KQKA 1PLKA 5DISB 5EUQB 4A6PA 2FOLA 3MCAA 1Q1EA 2ZSAA 2RH5A 2IYRA 2RGAA 4KYIB 4MKFA 4QGGA 4B3BA 1NN0A 4UJ5A 1VIYA 5FOWA 2C98A 1N6NA 1JR3D 3ADCA 1NBMA 3AF3A 2FMXA 3ZS9A 2JJ1D 3X1DA 4FWIB 1XZPA 2A5JA 3HJNA 3ZQJA 2YOFA 3QY0A 2NIPA 2YV5A 1KOFA 2P67A 1WB9A 3QBTA 2GCNA 3AVVA 3LFUA 2O0JA 2WPDD 8OHMA 1LS1A 1UM8A 2QNRA 3ICEA 1U8ZA 3ZD6A 2Q3MA 1FNNA 3WHLA 5BN5A 4RFSA 1VKJA 3EARA 1AN0A 2ZROA 1IXRC 2HXYA 3KTAB 5JMTA 3BRWD 4LSGA 1TQ6A 4RFSB 1DAEA 1GZSA 3O8BA 1VG0B 2G9NA 1G18A 1OXSC 2QTVB 2YC4C 4Z1MD 1NIPA 5C46F 4BGDA 4AIIA 1LF0A 4IOJA 2A30A 3UIEA 1I2MA 3I32A 4G1UC 4XSHA 1AIPA 3EA5A 4OQXA 4XWOA 2ZI3A 1I4DD 4K81B 3KUDA 2ECKA 3CF6R 3LY5A 2JDIA 4OI0A 1XEXB 2GVDC 3CH5A 4WBSA 2EU8A 2Z4RA 4PC7A 4H1UA 4M53A 4WXRA 4Q9JA 1M1YE 3QUSA 4A8JB 3QPUA 4MDFA 4W7SA 1D8TA 3CM0A 1S96A 4M1SA 3U3MA 3MWLA 2OUKA 4GMXA 4BRWA 3FMPB 1MABA 1R8QA 1OV4A 2YWFA 3CNOA 3KDSE 2WSMA 1AS0A 1Z0DA 2GAAA 1L4YA 3BJIC 4EFMA 5LPNA 5JEEA 1QHSA 2HYIC 4JVLA 4F4CA 1SHKA 2YYZA 4PSKA 3NTUA 2Q9BA 1Z47A 1KO5A 3SC3A 2O8EA 1G6HA 2CK3A 5FR2A 2JLUA 2WKRA 2ZEJA 1D9XA 1XEFA 2GEVA 4NYIR 5L3RA 3CZQA 1M74A 3QKRB 3VX4A 1W5TA 4QJ5A 5HE9A 4M1OA 4UNNA 3ZQ6A 2XJ4A 1T3HA 3VR5A 4ABYA 3K0FA 3V4FA 2NMVA 2G77B 3C5CA 5DLQC 3DMNA 1OFHA 3GLHA 4DSNA 1WQ1R 2QE7A 3FFAA 1RVDA 2BVNA 4M0LA 4A8JA 2J0QA 5D3MA 1BOFA 4K8OA 4C4PA 3X1XA 4MYCA 4Q4AA 1VCNA 3DO6A 1NBME 2IYYA 2WBLC 1GM5A 3K0CC 4DDWA 1MO4A 1G5TA 5KNDA 5J40A 3AUYA 3DM5A 5FBRB 5HKKD 4MA4A 2V7QD 4Q1BA 1E2QA 2ZE8A 1EFUA 2OE2A 3BBPA 2OEPA 4V0OA 1QDEA 3U3JA 4C0KA 3QSYA 2DFLA 4A9AA 4EPTA 5DN6D 4PTLA 4LK2A 1AGPA 1E2MA 4M4SA 3I4LA 4YXWA 5FH9A 1L7VC 2ZE6A 4D26A 1IAQA 4JVNA 3PEUA 2R44A 2CCJA 2OLKA 2W6JD 3AF0A 1C9KA 5SZIA 3QKUA 1Q22A 5FPTA 2YHSA 1Q0UA 2QEQA 2OZEA 2C99A 3FOZA 3U2QA 2PZEA 1QVAA 4LJ6A 3TW8B 1XJQA 1NMXA 2BCJQ 4PO9A 3SJBA 3CRQA 1J7KA 3UMRA 1KI1A 2ZJ2A 5JWOA 2ZU6A 2O8CA 3IO3A 1MO5A 1XDBA 3PCRB 4PHFA 1X1SA 1T0JB 1VDZA 3IIMA 2WZQA 1X3SA 4OI4A 2PLRA 2JLRA 1BIFA 4BFZA 1F2TA 4LJ5A 3FMOB 3L0IB 4EPXA 2YWEA 3THWB 3LH5A 1JBKA 3K9GA 3UWOA 1N6IA 4NYIQ 4D4KA 3ICQB 1NLZA 3HR8A 4HAXA 1II0A 2BM1A 1GILA 1QG4A 3QVVA 4LV6A 2ZM5A 3EXAA 2H92A 4R98A 5FPYA 1GFIA 1IY2A 3T1QA 1X8KA 1BMFD 1QHHA 1G8FA 4D6PA 3VNUA 2ZE5A 3CKLA 4DIDA 3QXSA 5EZ5A 2XSZA 4C0JA 2XB2A 4B2PA 3OF5A 3V00A 2XXAA 2BMDA 3NKVA 3B9QA 2VRWA 2C78A 2W6ID 2QMHA 4WIAA 4IKEA 1UKYA 5JFGA 3QOFA 4MUAA 2FGKA 3ZVNA 1KI3A 4JL6A 3W8NA 5F9FA 1XTKA 5D3QA 4NKRA 1U81A 1XXHB 1YKSA 3CPJB 2PZFA 2V6IA 2XNDD 2JLVA 3U44B 4MDEA 1S0UA 1DAKA 4QL3A 2BV3A 2ZE7A 3CRW1 2D3WA 1W4AA 3DMDA 3JVVA 3OEEA 2X2FA 5FTKA 3RS2A 4A0HA 1CR0A 1Z28A 2H57A 4NCKA 3SZRA 3M6AA 3TUIC 4FMDF 1RZ3A 4BFTA 4MGIR 1YZUA 2XB4A 2VLIA 4US0R 2V1UA 1G8GA 3AF1A 2QY9A 1E1QA 2WM9B 3NHAA 4XTRA 1GTVA 1KK3A 3PQCA 3PG5A 3K53A 5TXGA 2IYQA 1FL9A 1T5LA 821PA 4LI0A 2VHJA 1FFHA 2NO7A 3IDQA 3WNCA 1W0JA 4I1OA 2J59A 2A78A 2QPOA 5L3SA 2QROA 1OB2A 3ZD7A 2ZJAA 4JL8A 2P0EA 2FF7A 3BE4A 4LV5B 1TU3A 2LKCA 5JECA 5JCPA 4B3FX 1E9BA 2ZRAA 1R0WA 4IDHA 4XTCS 4EDHA 5CLLA 5EE1A 2FA9A 1FW6A 2G6BA 3ADBA 1PV4A 2XTNA 1DS6A 2VIIA 1TF5A 2ZSBA 4V02A 1JQLB 1XF9A 2G0TA 2IYSA 1CIPA 3CLVA 4GZMA 4R2HA 2FFBA 2GJAA 2ZAOA 4A0FA 1BYUA 1RRCA 4IOMA 4QXAA 3GPLA 1KKLA 3ASYA 4D4JA 5AJZA 3QENA 1EX7A 2VL7A 1E1RA 4ZIRA 4GL2A 4ILEA 2JLWA 4R71A 3KQHA 4BFWA 2BC9A 3U44A 1G3IA 3WXMA 2CEAA 1Z0AA 2R8RA 3PUWA 4HAVA 1KI8A 3E5HA 1SXJD 3SYKA 4DCSA 2R9VA 3VNVA 3NG1A 2QUZA 1MV5A 4IFBA 1KO4A 3SJCA 1YRBA 1T3SA 3THOA 1PUJA 3TVTA 4URWR 3RRNA 2V54A 1N5JA 4QNMA 3J81k 2WJJA 2RMKA 1KO1A 3IUYA 3DDCA 4G5OA 3T1OA 4BFUA 1XZQA 5CYPA 3K1JA 3U3KA 4UXHA 1ZD8A 5A5GA 3P32A 2IUSA 3H2YA 1Q3TA 5JSZB 5KNBA 5L3VA 1KDPA 1R0YA 3QIAA 1NLYA 4FWTA 4B71A 1CJMA 4FMCF 1UBFA 3FTQA 4TL7A 4DCTA 5JZVA 1WDTA 2WV9A 3RANA 1TL7C 2QL6A 3A1SA 5CJPA 3B2EA 3EZ7A 1H8ED 2FPKA 1BS1A 2GETA 2WKQA 4NH0A 3RYTC 2FSGA 1WRBA 4F92B 3BERA 1KGDA 1LS6A 1SVOA 3B60A 2D4HA 3V9PA 2IS2A 1HE8B 1DAHA 1CKEA 2VQSA 1YRAA 4FMDB 1WF3A 4WA7A 1GL6A 4NCJA 3KQLA 2DYKA 1FUUA 2CNWD 4L4UA 4BLTA 3FFBA 4M9ZA 1DAFA 1IN6A 4LUCA 4QG7A 2JA1A 2QRZA 4DCUA 1F5NA 2W0SA 4EQ6A 2QU8A 1X86B 2GZDA 2GCOB 5DE3A 3I5XA 2O8DA 2B92A 2JAQA 4B48A 2QM7A 2CLSA 3K0EA 2FSHA 2W2TA 4S35A 3AF2A 5EE5B 2YWHA 5BXQC 1PLJA 2FNAA 4IVQA 4QFMA 3T15A 1XCMA 1XXHE 4O2RA 3U4QA 2IUUA 1MO6A 4HB2A 3AGQA 2R6FA 5J4HA 3IHWA 2RGXA 1QRAA 3CX7A 3CPEA 4DKXA 1MKYA 4BFSA 4DCNA 4BEJA 1R10A 3A37A 4LOAA 5FOTA 2ZS9A 4DIEA 3P26A 5CM8B 3KL4A 3MWYW 1P5ZB 3P27A 4O3MA 1VYTA 5GVSA 3K9LA 4RD0A 5KSPA 3GFTA 4JL5A 5EXTA 5CDFA 4AD8A 1AQYA 4X8HA 3NBYC 4HUQB 2RGCA 5KTYA 1E0KA 2OXCA 2CDNA 1H8HD 3IO5A 1N6KA 5EXXA 3LQQA 1CRPA 5K8IA 3FMFA 3B8HA 3KXKA 5C4MA 3RDPA 1PUIA 1L8QA 4J0QA 4ACAA 4HUTA 1QF9A 2IYXA 4PC6A 4AKEA 4CEHA 4D25A 2C5LA 1DAGA 3Q5DA 5GADl 2RGEA 5FBLB 2QTHA 4KFRA 2O52A 1UJ2A 1XB2A 3NEYA 3W3AA 4TMXA 2F3TA 2Z5FA 4KBGA 2JGNA 4TLEA 4MRPA 621PA 2VP0A 2JJ2A 4Q9HA 2ZRPA 4H9GA 5DIFA 3SFZA 4ON9A 2O8DB 1XJ0A 1QZXA 5JJKA 4P4TA 4KJZA 2JIZA 3SQWA 4C2UA 3VKGA 3GJ7A 4XSGA 3MMPA 2IXFA 1D6JA 3ASZA 1QHHB 2Q9AA 2ZVQX 4DHEA 3PFIA 2HF8A 1SKYB 4MGYR 4HDOB 2P2LA 3U7EB 4YMSA 5FOVA 3AVXA 4TTRA 1E9AA 1FX0B 1U2RA 2ZYVX 4V0LA 4MKHA 1IJFA 2WWYA 3QF7A 3AKDA 2CJWB 1E0JA 3TGPA 1TUIA 4L16A 3AVYA 1A7JA 1IXSB 1OHHD 3GJXC 4D80A 5JWRA 2J9RA 1NIJA 4WW0A 3TW4A 1VMAA 2H16A 2IW3A 3IKJA 1WBBA 1ZU5A 2OFWA 5AUQA 1NY6A 3TKLA 2P6NA 1AQUA 1HURA 4UNPA 3PENA 1TNDA 2AX4A 2DFTA 5EXSA 2IWHA 3TH5A 5E7MA 1E9RA 1T9HA 4DWJA 3GP8A 1ESNA 1N6OA 5EZ6B 3SEAA 4M8NE 4US1R 1FPMA 4PC1A 1N0UA 3TVDA 1YR9A 2XSZD 2DWOA 1HTWA 3VU9B 3ZZUA 3LAWA 3SHWA 2QAJA 4X8OA 3QI2A 4HI0E 3VR2A 5H68A 1ZNWA 2OT3B 4PX9A 3W6OA 4JVSB 2EFDB 2OFXA 3PR1A 3LQRA 2RHMA 3X2SA 3RHFA 3QJYA 3SE0A 2OLJA 4NCIA 4HAZA 4A1FA 2DBYA 3C7KA 4DT1A 4HZUA 2R62A 5HR5A 4JS0A 1II8B 1R0ZA 1NVVR 4NYMR 3R9WA 2YC2C 3TQCA 5D3MB 3LLUA 5GJCA 1CR2A 3E1SA 4A0RA 2N42A 4DRZA 3B1WA 4BRUA 1Y3AA 1JEDA 5KNCA 4B6EA 3REFA 3T5DA 2O8CB 2IEYA 4WZBE 4D0GA 4MRNA 1UADA 2R6CA 2XTMA 4Z8YA 1ZNYA 2DB3A 4Z8XA 1OXVA 3P1JA 1UBEA 2Q3FA 1COWA 2V8OA 4GSYA 1W47A 3TBKA 3ZS8A 2ZQ5A 2VEDA 1OFTA 3JZMA 4ESHA 4CF7A 3HYRA 5CIQA 2ODEA 3MAAC 1TU4A 4JKIA 1IHUA 4OL0A 4DLVA 3OFNA 4LYHA 3W5JA 3KQNA 4CEJB 3W5IA 2ZSFA 3KJIA 4LBVA 4B74A 5ELXA 4E5UA 3GCGA 1GAJA 5G3ZA 4BEBA 3FHOA 2KWIA 2CK3D 3W8RA 4IEIA 3ECCA 2GJ9A 2V4ZA 3LXRA 1O87A 4KYUA 4OQFA 1JNYA 2F43A 3NEJA 2IHBA 4KLNA 4AY2A 2WWFA 1CJVC 1E0SA 3B9PA 2DR3A 1IY1A 3L0SA 4IDQA 4QGFA 4PPNA 1Q20A 2QN6A 4CYMA 3ONWA 1YE8A 2OAQ1 3RC8A 1OXXK 3ZIAA 2Y8EA 1Z0KA 4AK9A 1N6LA 1HV8A 4PANA 1DE0A 3M0EA 1E2LA 1U8AA 4TSFD 3GLHE 1Z8FA 3JZAA 3KKOA 1DARA 1W36C 1WBDA 3KKPA 3TR0A 5FTLA 3TAHA 4KVGA 4ZDIA 1RFLA 3KTAA 4R9UC 3SI7A 4P0TA 2PH1A 4DSUA 1M2OB 3ND8A 1WP9A 2VSOA 3RSOA 5AUPB 2OCBA 1U9IC 1M7GA 1U0LA 3OE7A 5DI9A 2IA5A 2JLZA 1A5TA 4RVCA 1G8HA 1IN7A 1SVIA 1XPOA 3K8YA 4D4LA 4N0DA 4RZ3A 5TY0A 1EX6A 1XMVA 2PEYA 3NBXX 4P4UA 3L43A 4L5BA 4XH9B 5AWFC 4HB0A 2DFNA 3NWJA 4OHWA 3K9HA 2YZ2A 5DYIA 2JASA 3ZH9B 4B33A 1KO8A 2BKEA 4W5HA 3HDTA 4B73A 3D31A 4Y0VA 2JJ1A 3FVQA 3B13B 5DSZA 3SYNA 1RPZA 2V3CC 1JJ7A 5BQ5A 2VF7A 1S9HA 3DZDA 1E79D 2W83A 1ZM3A 4I4LA 3T34A 1SKYE 4BE7B 1HQCA 1PLLA 4LJ7A 1XTSA 3VHLB 2RGNA 4HZUB 2ORVA 3EG5A 2P5TB 3TJZA 1XWIA 5CK5A 4A92A 1Z6AA 4YQFA 5KU1A 3P4YA 3SHFA 3TQFA 2IYLD 2GAOA 5FUVA 4N0EA 1BH2A 4DLYA 1D2MA 5L3QA 1EK0A 2CL6X 2B7BA 2QAGB 1BO6A 4PC3A 4C0QC 3BAFA 2B8TA 2O8BB 2ZRNA 4WAUA 3N70A 2PX0A 1OIWA 1AZTA 2F9MA 2ZRIA 1NBMD 1CJUC 1DAMA 3EZ6A 2A3RA 3H0KA 4ZDWA 3BH6A 3C5HA 1TUEA 2CLCX 2IXEA 1YZKA 2EWVA 3I92A 3GMTA 2AD1A 4PHTA 2GA8A 2AN9A 2R6AA 3AP2A 4B47A 3GLIE 5GJVC 3RLFA 5DHFA 4D0NA 2ZUDA 4B34A 2ZSEA 3LX8A 5ANRB 4OHVA 1E99A 1Z3IX 4M1WA 4A4DA 3B1XA 4BFVA 4BLPA 2IF0A 1KK1A 2CJWA 3L8YA 2WAXA 3U61B 1GG2A 2ZETA 3CX6A 4YONB 1S1CA 5F9HA 4RZXA 3RRMA 2MSDB 5BN4A 2KI5A 4PAQA 2FZLA 4G5QA 1NI3A 4M9SA 3KX2A 4A2WA 2O8FB 1TMKA 3AQ4A 4B6FA 2FJUA 5HE8A 4TLCA 3TUZC 4BASA 4D0LB 3UG7A 3LBNA 2ZIAA 3MJHA 1N0WA 2MSEB 1CS4C 4QBGB 1NKTA 4RJLA 2HT1A 4L9SA 1QHNA 3DM9B 3U3RA 2OG2A 3K9NA 1RIFA 4LPKA 2L0XA 2QAGA 3C14C 3EIHA 3ZYCA 4TLDA 2QORA 1GDDA 5GJBA 1P62B 2FFHA 2JCSA 4IDOA 4O25A 1P2VA 5DN6A 5CJ2A 4XIGS 2J7PA 2IYZA 3KFVA 4OI1A 3OIYA 4EPWA 1TAGA 1EFTA 2CL7X 1VCMA 3Q7QA 4TMVA 2WMNB 4ARZB 2BBOA 4Q7JB 3SJZA 1VYUA 3EWSA 3TAUA 3THWA 1Q21A 1S1MA 1N25A 4B75A 4NPHA 4EFNA 3FDIA 3CB4A 3BXZA 5TVKA 4LYFA 1QBKC 2ZYUX 2PX3A 3OAAD 3VU9A 3EIEA 4FMBB 4JYBA 2ZRHA 4FCTA 4KBFA 2QG6A 4C3ZA 2F1HA 2GRJA 1U8YA 1P6XA 3H4MA 5EE0A 1G7TA 2G88A 4FD2A 3U3OA 4EPVA 1CULC 4BLOA 3TNFA 5KOYA 2FSIA 3U4QB 4NU0A 4AYTA 1ZC3A 4XVQA 1XEWY 1ZAKA 2MMCA 2QPAA 4TT3D 2H7VA 3OIWA 5EJEA 1NJGA 2ORWA 4LJYA 1OH6A 2OCYC 5G3YA 4PC2A 2HJVA 3U5ZB 2AXNA 3UK6A 2C2HA 1W2GA 2EYQA 2OFOA 2ANBA 2VP9A 3IPXA 4Q18A 4ARZA 4P4SA 5BYJA 1KMHA 1Z5ZA 2GJSA 2REXB 3U6KA 3W90A 1M34E 1N6PA 2TMKA 2GBLA 2WVJA 2WPDA 2WWGA 2VH5R 1JXOA 5JEDA 1G3QA 4OQMA 4DSTA 1LTQA 1E2NA 1SVKA 3QEOA 3QG1A 4EFLA 1DADA 1L2TA 3UPUA 2QMOA 4WZAE 3CF2A 1GRRA 1LB1B 1YZLA 3TMKA 1NG1A 1Z06A 1Z83A 1V5WA 1G7CA 2ATXA 3AB3A 1R7RA 3AF4A 3QEJA 2AWNA 3RAPR 3TRFA 3A58B 2DWQA 2ZR7A 3ADKA 4IHQA 5HTKA 4DT1B 5L8VA 1VCIA 3I5YA 1E4YA 3DHWC 1FQKA 3PEVA 5G41A 4RFVA 4IVRA 3CONA 1LW7A 4LC1A 4PSAA 4I99A 3VAAA 1KDTA 2GK6A 4QKQA 2VHUA 3ZGXA 1UDWA 4DUGD 3X1YA 4OQNA 1Q57A 2GXAA 4PO8A 4QM7A 2G3YA 4HLUA 4JLPA 4QBIA 2IT1A 4DXAA 1Z29A 2WJVA 5B30A 1D2NA 1DOAA 4DUGA 1W5SA 4MQBA 4XD7D 4NDZA 2ZTSA 3DEFA 4PHGA 1W0KD 4ZCIA 3RC3A 1SVLA 1S8FA 2ZJBA 1NLFA 3CRVA 4IXMA 2QZ4A 5GVRA 1SULA 1P2SA 4GMDA 1JPJA 2FFAA 1IOZA 1ZD9A 2GEDA 4V0KA 4V0MA 3K0AA 5IRCD 2ZSDA 3CX8A 3MWJA 4W9MC 2VHTA 1ZU4A 5FUWA 4KO8A 5JBQA 2ZR9A 2D62A 4QM6A 2XITA 1DBSA 5JJLA 1V43A 4GZLA 1NMYA 2EFHB 4CT5A 3UXMA 1Z0JA 1S2MA 2ANCA 2RHDA 4KAXA 4DLSA 4ZCMA 5B58C 4KITB 5A0FA 2QT0A 1DVRA 4LY6A 4Q9LA 1ZNXA 4CT4B 2ZRLA 2IC5A 3HU2A 4MKGA 2KSQA 5FOSA 3TIFA 2E9SA 2IYUA 2GILA 1ONBA 3KKNA 1G291 1IM2A 3OESA 1GKUB 1J2JA 3C41J 4NONA 3ZIAD 1SVMA 4G5RA 3CR8A 4KCGA 3W6NA 3R9IA 2O8BA 1E9CA 4PFSA 4Q4HA 5EP2A 1O3YA 1S3SA 3NC1C 3EPJA 3TSZA 4YDSA 3AUXA 1KNXA 4PZZA 1NN5A 1NL3A 2GCPA 5CK4A 1G9XA 5J5CA 5B2ZA 5DH9A 1G5RA 1KAOA 2FV8A 2IUTA 4LCBA 1ELOA 4NYJR 4URVR 3VMFA 4TT3A 2CL0X 3AVWA 1B23P 3BH0A 3QF4A 1JAHA 4Q7KA 1R2QA 2ZJYA 1E9SA 1SHZA 3GJ4A 2H18A 5IDVA 2QBYA 2J7PD 3RSLA 4GT1A 1Q1ZA 3LD9A 3TR5A 4KI0A 3LVRE 3PUYA 3OHMA 4GP7A 4MH0R 2Z83A 3LBIA 1KI6B 2I4IA 3H86A 1F60A 4TQAA 5JRJA 5TDHA 3M1IA 1KNQA 1IN5A 1M6NA 2KBEA 1E0AA 2J46A 1G20E 3T06B 4IVPA 3A1UA 1CJTC 1E2HA 4DZZA 4TWZA 1W2HA 2ZJ8A 2X1VA 5HCNA 1XCGB 2R65A 2QRNA 2XJ9A 3HPQA 4RKFA 1XJCA 4JSYA 2ONKA 1G41A 4PAOA 1P61B 3RS4A 4QJ3A 2LKDA 1HY3A 4BWYA 3O47A 1YU9A 3MSXA 121PA 4Q4LA 1CR1A 4M1MA 5GJWC 5EE9A 3RS3A 4DVGA 1P60A 4IDPA 1WCV1 1GSIA 3ZLJA 2AL7A 1OE0A 2FH5B 3HP1A 3PUZA 2DCUA 3Q8XB 4PR0A 3FHCB 1G8PA 4X8LA 1F3OA 4WVFA 1M8PA 1YJ5A 5KPDA 1TADA 2X77A 4ZI2A 2H17A 5FR1A 3RRZA 2X2EA 3T1VA 4BLSA 3EIQA 4GP6A 4HDCA 1N5IA 4C0HA 3CUEF 4TMWA 2RCNA 2PT7A 4CEHB 2KB0A 4DDVA 4UKDA 4U5XA 4CDGA 2GJKA 3R8FA 1Q1QA 1SKQA 2VF8A 1E2IA 2GK7A 4DLRA 1UKVY 3B1VA 2C96A 1TX4B 3RNLA 1H65A 2C77A 2IX3A 1HUQA 3BC1A 2XNSA 1W0KA 3RABA 4EJSC 2ZS7A 3F5FA 4LZZA 3VQTA 1E96A 3PIRA 3LDAA 2IK8A 2CVHA 5F98A 1JECA 1SXJB 3LNCA 3WMGA 2Q21A 4GRAA 2ZJZA 2P65A 1CTQA 4Q03A 3NDPA 1W46A 4ZO4A 2ZRGA 4D2IA 3I61A 4NL4H 4C30A 4DDTA 3GJ8A 4DCVA 2QMEA 4U02A 1OPXA 4TL9A 2QA5A 1UBGA 5B57C 2EFGA 1G19A 3KJGA 2YNMA 4XWAA 1ZBDA 2ZAMA 3IHLA 3CO5A 1AKEA 4AG5A 2VTKA 4QHSA 4AKGA 4YMTA 3IBYA 4Q19A 3MRSA 5K8LA 5FI1B 2JIZD 4XJXA 3QXHA 2ERXA 1Z08A 1E1RD 1LVGA 4AKHA 3QXJA 4N3NA 4MYUA 3ADDA 2XOKA 3L2OB 1ZD1A 2WICA 5UKDA 4RCYA 1JALA 5A4JA 3ZVRA 1EG7A 4XVUA 2WAYA 1RE0A 1VG8A 2IS1A 2YWGA 1EXMA 1JI0A 4Q1FA 4TL8A 5JI3E 2J45A 4TYYA 1GOTA 2RGGA 3CRRA 3DKPA 4B3XA 3AKCA 1QHXA 1OYYA 5TV2A 4EAQA 4UXIA 3ZDQA 2XZLA 3BIFA 4K46A 721PA 1ZM9A 1MRNA 3KB1A 1EWRA 1GNPA 3LW8A 2Q6TA 3VR3A 3BOSA 1Z07A 1N5KA 5LD2C 4NTZA 1KIMA 2BIFA 2QGZA 2D06A 4G0NA 1KSFX 1YZTA 4JJKA 2ODBA 3K09A 2ZYWX 2KE5A 3HU3A 3LW7A 2IYTA 3DOEA 2EQBA 4D4MA 5K8TA 3I72A 1UEJA 4GOXA 2C8VA 1HYQA 1ZUIA 3B1YA 4MYTA 3WP0A 2CE2X 4X8MA 1FUKA 2NQ2C 1W49A 1JPNA 2WMOB 1OJLA 2QSZA 1J8MF 3X1ZA 4E09A 4ZKDA 3W3ZB 2HCBA 3OEED 4OYHA 4Q47A 5CYOA 2RGDA 4AG6A 3GLGB 1PJRA 1XEXA 5JS8A 2J0SA 1E2GA 1JQJC 1LF5A 1W36B 4TL6A 3EW9A 4V0ME 2CBZA 5LBIA 1DPFA 3QF4B 1GNRA 1D9ZA 4KHZA 4B2IA 1ZM4A 2WKPA 2AKYA 3U7GA 5EUMA 5KSZA 3GEIA 2W6IA 2LWIA 4UQOA 1E9EA 5JI2E 1X8JA 1T5IA 2Z43A 4JBWA 3KJEA 1G16A 1C4OA 2YOHA 4LBZA 1KYIA 4ZIRB 1QHGA 2XZOA 3SNHA 1E2JA 3QE0A 5E7IA 1OKKA 4JYCA 1NMZA 1KJWA 2BCGY 4Q4HB 4LBYA 3CF0A 3I3SR 1P9NA 3PUXA 4LV8B 5SZKB 4QRHA 3TSWA 4JLKA 1BMFA 1P75A 3REGA 3LXXA 3WRXC 3CNLA 1KK2A 1A4RA 2EWWA 5HPYB 1FQJA 1AGRA 1HT1E 3THXA 5J4VA 2Q9CA 1OIVA 4I1SA 3TUJC 3VTKA 4C7OA 1CBUA 2VSXA 4UNRA 2WIBA 2DPXA 2JATA 3RWOA 3GLIB 4HLQB 2XX3A 2ZRBA 1T8TA 1A1VA 1CR4A 1KSHA 4AI6A 2GESA 4HB3A 1XPRA 4TMTA 4DLZA 4OK5A 3PV0A 3QKRA 1K8RA 2RAPA 2W0MA 2F9LA 4O0MA 2IYVA 3BH7A 4OHXA 3TSOA 5JLJA 1A2BA 3PVSA 3QNUA 2PZGA 3BB1A 1G4UR 4V0NA 2W00A 1DAIA 5EE3A 5IF9A 3SU8A 4B3CA 3GLGE 1H8EA 1X6VA 1Z6XA
chains in the Genus database with same CATH superfamily
3IRUA 3NHKA 4BLWA 2GB4A 2Q46A 2Y2VA 5CVDA 2GXUA 3ZHCA 3JALB 1ZIPA 5DEOA 1R5NA 2QVXX 1ZWLA 3ZY3A 1I10A 2ODAA 2VLBA 1XHLA 3BPSA 4JQZA 1CUBA 1TA9A 1L5QA 2V7VA 1H69A 1B41A 4WJZA 4XD7A 4M1KA 5HMLA 3W9YA 3WL6A 1E8MA 1L5RA 4Y1FA 1FP2A 2Z57A 3ILSA 4M8KA 4YRRA 1LX7A 2CLKB 3DJYA 2ISCA 4XWWA 3ETLA 4DCOA 1YQTA 3GPIA 2XMSA 3B82A 3H2JA 4UMFA 1WKVA 4CM4B 2XCTB 4URFA 1QO0A 5DI3A 4BTLA 1K3UB 5DJ5A 4V03A 4ONEA 4XCQA 3TFQA 1JG6A 1ZM2A 1KYYA 4NK4A 3VYTB 4YGYA 4MR9B 3ABRB 1CFZA 1EWKA 1J49A 3DE2X 3A32A 3HR7A 3ROKA 3T3IA 1YSCA 3UA4A 5C4GB 2WYIA 3GLKA 4MUJA 3JZDA 2WKWA 3I28A 3PT5A 4I55B 2E3JA 4CMEA 3UT5A 4UHFA 3CNEA 4AS3A 3QVUA 1MVNA 4HTFB 1O8BA 4YRFA 4HATA 2RAFA 2X8JB 5AM1A 3UMSA 2W43A 4JT2A 4C0AC 1BKDR 1A72A 1HT2E 2VNIA 2WD9A 3LQKA 3KZKA 4L07A 4S2EA 1NVUQ 3CZRA 2FXIA 3IKMB 1RYDA 3OCUA 5EQTA 1G17A 2J0SA 1ZOLA 1Z6GA 4L0DA 2V6FA 3OCXA 5KU7A 4HEJA 3PVZA 2AG6A 2HA5A 4DA9A 2ZUCA 2EKLA 1DRKA 2EJBA 3ZU3A 2QENA 3OFJA 2ZBFA 1P1IA 1JQEA 1P39A 1W5BA 2AMVA 3FWYA 5EQJB 2ZTHA 5FAXA 3ZWOA 3I42A 1UBTS 5DNAA 1DO2A 1VE6A 3MJ4A 1RJ9A 3TD2A 4AJ9A 4IG4A 2E2WA 2K4MA 2O1WA 4LZOA 3ABSB 2O19A 2FEPA 3S2GA 1ETUA 4RZQA 4I6GA 5REQA 4FGUA 4LYAA 3W1VA 3H1GA 4RY2A 4KVZA 1E3JA 3IQWA 1LNZA 1JQ5A 3TS1A 1AURA 1RIIA 3F7OA 1KQNA 3WGIA 5BN4B 1SN7A 2YWRA 1WS6A 3SS9X 3SQXA 1UBLS 5IC6A 2C2YA 1MVOA 2D1FA 4X97A 1ZH8A 4NLLA 3ZE7A 2BFOA 2GEUA 2AYYA 3N2YA 4KLCA 4Q1VA 4PNEA 1ZJ6A 5FO1A 2G7ZA 2K5UA 4KR0A 2OGWA 2XQJA 2VS1A 2HRZA 4ZAVA 1TVCA 1QH8B 4AYXA 2FN9A 3H9CA 1BVRA 1XZDA 1XZNA 3BZUA 4ZKEA 3GLIA 4WOJA 2C82A 2OBXA 5AK5A 2HB6A 1TIBA 1W76A 1QPGA 2DH5A 2PGXA 5K6TA 4C7OB 3RBVA 1U0JA 3PQEA 2ABWA 4KDCA 4IRMA 3GD7A 1MN6A 4HDSA 8ADHA 3UGJA 4D46A 3N39C 5AXDA 5B1IA 4D8TA 4EAQA 5M2QA 4ZOLF 1GTMA 2R2GA 2AKAB 4KZPA 4XRGA 2WUVA 1LBIA 4QUKA 5JRZA 1W29A 4Q6WA 4YJ2F 2O07A 1PJZA 4AMZA 5F3WB 3BAZA 1X7ZA 4P3OA 1XTTA 2JNWA 1KFCB 1E8NA 2C5GA 2EJVA 1CU1A 4OQDA 3ADPA 3RGGA 3BS4A 1DEKA 4FUTA 1X1EA 2UZ3A 2IE0A 2HJWA 2VCHA 4RL6A 4F38A 3UANA 2O8FA 4Q7QA 1NN3A 3BFPA 4HAWA 4ZI7F 1JDBB 5CFMA 3J81A 1N3YA 3GELA 4B83A 4NV1A 1W6UA 3HRKA 2GD1O 4YRLA 5CX1A 3P9XA 4XWTA 1E94E 5TMDA 4GXRA 3RUCA 5ICCA 2BSXA 4NPCA 1TCUA 1L5VA 2O0LA 3AP1A 3NBZC 4UNQA 2DUMA 5CW2A 4L8GA 3VKHA 3HWSA 3LPMA 2HJGA 2IYFA 2OBLA 4MUFA 5CLQA 5H59A 4MARA 4C9BA 4I46A 5LKAA 1BTOA 1YS2X 3TPZA 2RHOA 4F2WA 2UZ1A 2WOOA 4HNUA 5C8YF 1H2ZA 3G9QA 4NU8X 4RLSA 1USKA 1GADO 5CP8A 4E5KA 5AM4A 2OKGA 1K08A 4NECA 5BN3A 1PP4A 3C8UA 1RKBA 3IP1A 4F93B 3FB4A 2PCJA 3PQ2A 1P3JA 5J4KA 3ZWNA 4JQYA 3ND7A 1V7QA 5L95A 1GSAA 3PGLA 4NCHA 3VR1A 5IXSA 2WZBA 2GM5A 2FMHA 3TIGA 3BB4A 1I4OA 5BOSB 4DV1B 3GFOA 5EPEA 1CXZA 1MT0A 3KOMA 4L22A 5H83A 4TYNA 4IFEA 4LRXA 4ZK6A 2HLDA 2AK2A 2O3QA 5CEFA 5CB8A 1PD1A 1RPJA 3E81A 3E8MA 4O4HF 3BWMA 3TE7A 3UEOA 1NYLA 5FKJA 3ZZ0A 4D0RA 3CSDA 1APBA 2VRBA 3IV7A 1E7YA 3PC8A 4KKVA 3T3HA 4WE3A 4B3DA 1LRLA 2R8XA 5DEIA 1ZZGA 5I7SA 1F2UB 3FROA 4K0KB 1Y5IA 4PLVA 3VA7A 3EMBA 3TZHA 4DYDA 2JK0A 1PFGA 1JMYA 2CXUA 3FWKA 4MUGA 2NZ2A 2ZUBA 3RYHB 2O6HA 3INYA 4RZUA 4R5HA 3EXEA 3AEZA 1QFYA 4QDJA 2QJTA 1OGYA 3K6SB 1NYTA 4V2IA 4LI3X 3JY6A 2C1EA 1ULAA 3FKSD 5FPKA 1H2BA 4GOJA 5DYYA 4KNVA 1JVNA 4P5EA 1UOEA 2QZZA 1XN1A 3FTCA 5E7JA 1DIAA 2X4LA 1I2AA 4B6SA 2VYNA 1T3TA 3R6WA 5JALA 2CCKA 3UT6A 1KVRA 3BL5A 4RK7A 3ILHA 4GWLA 1OBFO 3QKSA 2AD5A 1BWPA 3OLCX 5E6RB 1ZYUA 5CCBA 1VI5A 1IMOA 3G2JA 3PJDA 4CKBA 1E2FA 1RYZA 3OX3A 4EEXA 2Q9UA 3S1SA 2ATIA 3CLUC 3IX7A 2GTPA 3EISA 3RF6A 1FFWA 1J2UA 3OZXA 5EIHA 4ZAYA 4DSZA 5C80A 1XD2A 3NHRA 4LYGA 4NDAA 4X71A 1M2FA 2W7TA 1YK1A 4INOA 5I8PA 3S8EA 1TTTA 2B4TO 2WWRA 4KAAA 3KTFA 3M6XA 5F7JA 1QGZA 1RJFA 1BXRB 3RVOA 4DLXA 5LIRA 4D4GA 1XQXA 2YINC 4MV7A 4MVYA 5A4IS 4LS3A 1X0XA 1EUQA 4V1CA 3ZY4A 1J07A 2W2NA 3P0FA 1UKZA 2GLTA 4WBNF 4QGAA 3AHGA 3PNVA 2BHRA 3IILA 1E20A 1PV2A 2BGIA 2JKVA 2I6GA 2ZI9A 4ZVUA 3VPXA 4Z51A 2I66A 1ZRMA 2R47A 4E1AA 1YBMA 2A9PA 2V55B 1IBRA 3BWDD 2PU5A 3AM1A 1M1ZA 4OQYA 1JA9A 4RGQA 4F4HA 2IPAB 4ZCTA 1JJFA 1QHIA 1V16A 3TBFA 5BSGA 1GU7A 3ZE0B 5AICA 1QWSA 2FR1A 3HVUA 3R5SA 1KPIA 2NZJA 3PEWA 4PHHA 1E3WA 3RU7A 1B0AA 3CPHA 4BNDB 1Z22A 1VECA 2RJOA 1GVHA 2BGUA 2AG1A 3PXUA 5B6JA 2FN8A 2JJ8A 3K5WA 2OCLA 2X42A 3O1IC 2FWRA 2YVKA 4OQPA 1ZQ1A 3C5WP 4JJZA 5CBKA 1W0JD 4L5IA 1Z75A 4PG5A 4D02A 4XGIA 1S8OA 3G8CA 3IQEA 5KOJB 2RKWA 1PJBA 3FFTA 4OIFA 1PSDA 3GLRA 5KAPA 3ESBA 2FPGA 3FCSB 4IINA 2ADOA 4G9EA 1VPEA 2XR1A 3LWDA 1I3LA 3B7GA 5JUWA 4XWYA 1QIMA 2HDHA 5COQA 3JD4A 3LBHA 3S2IA 4AAYA 4ARIA 2IVZA 4HAOA 4CKEB 3VOBA 4BNMA 1VLLA 4ZYVA 3ADCA 3D3EA 4E5DA 3HJAA 3LUAA 3EZFA 4FFLA 4ER6A 1NKVA 2HX1A 1KQPA 1CK4A 4IL5A 5IDYA 3GFPA 3S29A 2J0UB 1N6RA 1P8AA 3EUWA 4TX1A 5H02A 4KTTE 5K2MA 4QUIA 3UMCA 2HSDA 4MNTA 4RDHA 3NBQA 2R25B 3T1TA 2I6SA 2WJAA 4JUIA 5BVGA 1V3UA 2GKGA 4RD6A 3FYUB 4ALMA 2I3GA 3SLGA 3FNBA 1XWWA 2OHFA 3LKDA 3QXXA 3GJZA 3J80A 3T7JA 3VDMA 1QX3A 1OVMA 4G8JA 5CLIA 2C2MA 1E1MA 2IOFK 3EC2A 3DL7A 1OOEA 1US8B 5LP6A 1U7ZA 4EX6A 1OX6A 1PI3A 2NSJA 4GI2A 5ERYA 1X7DA 2DBVO 3B2QA 3I9NA 5FTMA 3SFVA 3T4XA 1KOJA 4OJNA 1FDUA 1WF6A 1INLA 2YMMA 2FUKA 3EAGA 3KV1A 3R6LA 4MEAA 3B5EA 5GM2A 1NQWA 3JWJA 3U7JA 3A9RA 4PYJA 8GPBA 1RSZA 2JLXA 1WSBA 1WNTA 3H9BA 5L6MB 3N8KA 3FG9A 4KMSA 1AQLA 5B3JA 5E95A 2D2EA 4MO9A 3DYIA 3OJOA 1V11A 2XVAA 3OPYI 3RUFA 3QELB 4QNRA 2PSDA 3LPAA 5IUKC 4FYKA 1X2EA 3M6MD 4YV2A 4JXZA 1RHUA 2W4QA 1LPSA 1C1YA 5DHPA 5LMUB 1TUBB 3KSDO 5F21A 3ER6A 1F8UA 2R1TB 4Z7OB 1KBZA 4DNFA 2XDQB 5IAEA 1BDMA 5LDDC 4F9FA 4MKRA 1OILA 2P41A 1RWNA 2EKQA 4ZV9A 3GARA 5KYGA 3QV2A 1U0HC 4IOKA 2BBWA 3MUNA 4IYJA 3A1WA 3LWZA 4CGZA 2C83A 3PHBE 3W4IA 4BQOA 5KSWB 4GQBA 5ALIA 5A06A 3FMIA 4FMCB 5DU2A 5TJ9A 1GU0A 4M1QA 2H3EA 2X3YA 2FMUA 1BYIA 1J70A 3VBEA 4D9FA 1SUWA 5KZMB 4YS6A 4WCDA 1YS1X 1XTQA 3ROGA 2ZUSA 2HDNB 4LC0A 4D9JA 2A9RA 1MNQA 2HBYA 2P0YA 4DB4A 1CY6A 4LHWA 5KKAA 3CLTC 3S2UA 4NFYA 3DA8A 5KREA 1RWOA 4BKRA 1N7JA 2PX8A 3BXGA 1EESA 2H08A 1ATIA 3OAAA 3K70B 4YDHB 3EAFA 5JO9A 1KJZA 4D3XA 4R31A 2ZYRA 1M7BA 4I7EA 2EP8A 4B4WA 2A7XA 2D1TA 3U7QA 1G60A 3IUQA 4O5OA 3PT9A 2O2DA 4LKRA 3A28A 1A0OA 3BK2A 2VI5A 3ZHBA 3VPSA 3ZI0A 4INPA 2IZ5A 2NPFA 3TTUA 3EY4A 2Q5HA 4TKMA 4LG1A 1XMOB 1GG8A 3FGNA 5LB2A 3N8IA 1IXKA 4ATNA 2B5WA 4FZRA 1SU4A 1DTSA 4QVKA 4EW1A 4N49A 1C81A 2RB5A 3T7EA 3H16A 2NSLA 1XXHA 4LGMA 4MGKR 4FW9A 1CEEA 3FI9A 4L5AA 3RYHA 1E1DA 1QP7A 5EIEA 5SZJA 3F0TA 2NU6A 2CHQA 2NO6A 3I8OA 2GCEA 5DGCA 3PPXA 1TPZA 2O7QA 1O95D 5A5VA 1OI7A 3NIBA 4RQTA 4UBLA 1R88A 1XR3A 2GZAA 1SJ9A 2CNDA 7AT1A 1ZJ4A 1JHXA 3KVRA 3ZG6A 3CGWA 4BVKA 5I8ZA 4AMVA 3CBQA 5CTAA 2DU8A 4G97A 4EQ6B 5BYKA 1DRUA 1OIXA 4JC4A 5LBUA 1E18A 2HK7A 3E84A 4YAEA 2VWQA 5CT6A 4D97A 1J5EB 4Z1MA 4CNBA 5GMOA 2WTBA 1MRZA 3ZDCA 1JR6A 2E4XA 4DM4A 4YAGA 3NONA 1Y5RA 1K97A 3ENVA 4COKA 3JQEA 2AUTA 1XRJA 1RHRA 3O4FA 1GR0A 4GOKA 1K6JA 4PVCA 4DUPA 4G0XA 1FNSA 1UC5B 4CCSA 1MQAA 3DFMA 3A6PC 2NZ8A 4CR6A 2CDBA 4JLNA 2WAOA 1JDNA 1P73A 2BTEA 1X14A 3NMUF 1ORIA 1JIKA 2F1OA 4P84A 3R7WB 3R40A 5T3UA 2E82A 3QFSA 3F7NA 2FHSA 3LOUA 3Q15C 4CL8A 3HV2A 2DVMA 1L8OA 1JNXX 2CJFA 4MRSA 2Q2QA 3PS9A 3RRJA 5JZSA 5L6LB 3C3JA 4TZ6A 3I0MA 1IVYA 3GVHA 1KH2A 4HNAA 1C3LA 1N36B 4DLLA 1PL7A 4M55A 1ZFNA 4UHKA 2F8MA 2A5LA 3K20A 1NQXA 5U4XA 2XAUA 2QTNA 1ULSA 1K3TA 3C0KA 4WCFC 3T4PA 5K8VA 4K5QA 1UT5A 2I1VB 2BE7A 3U7HB 1AB6A 1JFFB 4JX9A 3I9V6 4ALKA 3THYA 4JR0A 1GYQA 3EBOA 2H4WA 3ROEA 3R3UA 5BWMA 2PD4A 1CUJA 2V58A 1YGPA 2FFQA 3C4JA 5C8YA 1ZN7A 4RHXA 1CDDA 3E2PA 4WCVA 1PYOA 4DUZB 1L4KA 3PICA 3GUZA 3ELBA 2WWVD 4ZQGA 4PX5A 5INTA 4LE0A 3HCEA 5T8KC 4P22A 3NKLA 2CYBA 1QK3A 4RLQA 4TTPA 2OORC 1T9GR 4KXFB 1L4BA 4MHSA 3VR6H 4EWLA 5C5CA 4W5JA 1T3GA 2Z3WA 3CTMA 4EBBA 1AZWA 1JBEA 3PQ8A 4XJTA 1O5TA 1L7MA 2H4YA 2OOSA 5EXPA 4YBZA 3ETNA 5ADVA 2BTQB 5FBQB 4ETWA 4F06A 3MLEA 1QKKA 1TZBA 1IIRA 3OOYA 1Q44A 4RM2A 5CM9C 2DJ5A 2MYUA 3SN6A 1W6RA 2IF2A 4J91A 2ZITA 2DETA 2NAFA 2NU9B 1CW2B 1JHAA 1CEXA 1TW3A 2FZCA 2CCGA 2QL7A 2JAPA 4LHVA 4MVJE 5EUCA 1VMEA 2QX6A 4O4LB 1LC3A 5IDXA 3MJDA 1OT3A 4ER7A 3JZIA 3HKEA 1RJDA 4BVBA 2G80A 4OK6A 3KSRA 4YMIA 3FDZB 3FJOA 5BORA 5C7IO 3UWPA 2P2DA 4AWAA 3RUAA 1AS2A 4YV1A 5B64A 4C7JA 2QVLA 4CKEA 3T7KA 6LDHA 1OA0A 3PJRA 3E53A 1AJEA 3ML1A 5DYWA 1IJBA 4B09A 1C1XB 1N7HA 1KEPA 1XZIA 1TB4A 2JEOA 4FKZA 1U9ZA 5BN1A 1DB3A 2ZVDA 4FPXA 5LU9A 4QELA 3IMKA 4EDFA 4TZ0A 1L5YA 4EKIA 5IZCA 2VJMB 4UQPA 2GD0A 2FSFA 1UWCA 1OW3B 1ZH6A 3JQCA 3HSSA 2HTEA 1E61A 2EW8A 2VSNA 3LLMA 2AKEA 1ITZA 2WE8A 1DWPA 2QLBA 5ALRA 3EH1A 1DL5A 5DDIP 3SXUB 3ITEA 2HREA 2Z08A 3JX9A 2IS6A 1CY8A 1GAXA 2Q62A 2NN3C 4Q02A 3PGMA 4BATA 2N0SA 3GA7A 3Q7RA 1I36A 2G4CA 1P18A 1DC5A 2EGUA 2QVYX 3BGWA 3QW4B 4FN5A 4X62B 2OP1A 2XVZA 3PL1A 1P7WA 4CG2A 4DUYB 1EK6A 4IICA 1IEQA 3B9RA 4OI2A 1DQRA 4NV0A 3UWKA 1GLNA 3N8HA 3MTBA 5E1MA 1ORHA 1A95A 2XKAA 1WHSB 3Q6MA 1VMKA 5L53A 3PHIA 1E7RA 1I80A 3OT4A 4FHEA 4JLVA 2QSYA 2BBSA 3K6RA 1Y3DE 3QHAA 4HDRA 1I6KA 4Y9SA 2IWRA 1R6XA 5EWJA 4EYOA 1NUSA 2DHQA 2B21A 2PMCA 1P2TA 1L5HB 5IN4A 1P2UA 4L8YA 2J7KA 1IEVA 1X13A 1MXHA 1H1LA 2R66A 1T43A 3IE2A 1PDOA 4V3CA 1H9CA 2OXRA 5U9CA 3A06A 4K9QA 3R76A 1NE2A 3UMYA 3UK0A 3UNXA 4XOUA 3U62A 1ACMA 1ZUNA 3IIJA 3PCXA 2AFHB 5FNVA 2RC5A 2OYCA 3Q1LA 4LTMA 2OD2A 4TYQA 3IAAA 4ENSA 2XOEA 1RAAA 2MIIA 4FI3F 5J59A 3RS9A 3UHPA 1YGYA 2JGEA 1RAHA 2NW6A 1KVTA 3WBBA 3O95A 4B2LA 1J9ZA 3JALA 5I9BA 3L9WA 4CDMA 4Z7JA 4JLDA 5JQGF 4AJ4A 4OYRA 5K99A 2XH8A 1W88A 2BUAA 4LY9A 5FFMA 1A7AA 4B4OA 4ARVA 3GJ3A 3FOCA 3DV2A 3PHCA 3UWDA 3EGVA 1G7SA 1ZM7A 3U4HA 3BJMA 2GTHA 2Z6QA 3RK0A 1NPYA 1DG1G 3HB4X 3R7BA 1MO3A 2C5FA 2RK6A 5AW0A 3PC8C 1ZXBA 2MR5A 3N0WA 4U0KA 5JVDF 3OCZA 5C31A 4IH9A 1E3QA 5IBRA 4EJ6A 3VUEA 2XF8A 2ZATA 3B6KA 3FNQA 4Y2HA 2VC2B 4ZVSA 4BBZA 4F9TA 2PVSA 2PZAA 1PR0A 2PGDA 2BL4A 4TV9F 4NYMQ 1K9VF 4QIHA 4K03A 4C5BA 3R23A 2GYYA 5FDFA 4UTNA 1C4WA 4HSGA 2VDQB 3DMFA 1G3UA 4BGEA 5IAAA 4ZO6A 4FQ8A 1JG3A 4HX5A 2J5XA 3D02A 2W58A 4PTZA 3OFVA 4WKGA 3FCOA 3O7MA 1E89A 1E5TA 1HA3A 1SCNE 4URZR 5EKUA 5B4VA 1XE3A 4WBNB 3AF6A 4DIBA 3S2YA 4A36A 4U7DA 4O4JA 3H84A 1ORDA 1TLTA 1YRLA 3QVSA 4J0DA 4OGFA 2CY0A 3BK7A 1R4NA 3EWAA 3AKYA 1IM8A 3FYDA 3T35A 1PVOA 3PDJA 4CG3A 4R8VA 5IJ9B 3TZEA 2XTJA 3ROXA 4J7XA 2AGVA 2EW1A 2CDRA 3IC5A 4JB2A 5H7XA 2IZOA 4R1OA 5IW8A 1DMSA 3T3PB 4X41A 1NXPA 1TUBA 4NBTA 3AI7A 3H0CA 1T25A 3ON5A 2P3QA 2XA1A 4QHYA 2YZGA 5BOVA 3S0JA 4B6GA 4YRQA 5FPHA 1L0BA 3HJTA 2ENWA 2RBGA 1RAFA 3HKDA 3JR7A 1NUHA 4N39A 4PQEA 5HKOA 2O5VA 1K4KA 2DQZA 4KUEA 4IQ4A 4YP5A 4JI8B 1O9GA 2DRIA 2IL1A 1P7VA 2DF8A 1SXJC 5KYWB 1G21E 3OEHD 1WU8A 2PVPA 2BEVA 2Q6KA 5TARA 3GZNA 2Y4OA 1T5TA 3CIFA 1OZGA 3NJ8A 4PYNA 4QU8A 4QREA 4U8GA 1Q2XA 3PUVA 2FN4A 4G5SA 3I34X 3GLGA 1JT9A 3A7DA 3RHTA 1ZI6A 3PFCA 3OQIB 4U1RA 4MHTA 1Z5OA 2JANA 2LRHA 4Q7LA 2P4QA 1ZH4A 3K1YA 2ZREA 4F91B 2P8SA 2IPOA 4KQGA 4OHYA 1Z15A 4I81A 4UUOA 3WK5A 1NX6A 1PFWA 1FQWA 1H6AA 4L4ZA 4BIMA 4MLZA 3K0BA 2VHVA 1XMPA 3EPPA 3HQ4O 2W8ZA 1NP6A 1SIUA 1XELA 4H35A 4NE2A 1G7RA 1XZFA 2R7NA 4MITA 1EB9A 4N82A 4EI7A 5C34B 3WY9A 3O8CA 5IJAA 3M3PA 3VBCA 4TVOA 3CLTD 4IO0A 1OYVA 1L5OA 1XF1A 3MYYA 1RKUA 3L7JA 4IEEA 2EF0A 3JQAA 3FPHA 1NR5A 4YYEA 5DNUA 3QELA 2B0JA 2AR7A 9LDTA 1CZHA 1BHO1 1GZ4A 3G2OA 1V5FA 1ZK3A 2V3VA 3PX2A 3HXQA 2C3PA 4CZ2A 1GPAA 1ZDMA 2WAAA 1FDOA 1FTYA 1I0ZA 2Y99A 4XARA 5JY6A 4G67A 3MFYA 2ZOSA 1ODKA 2H3HA 5KHOC 2XGOA 3K35A 1Z2AA 1KS2A 3N3BC 4JHLA 4ZU1X 1RQNA 4JJ8A 4YAUA 1G20A 2SCUB 5JDCA 5JZMA 3ECSA 4CMIB 5L4SA 2XUKA 1KE1A 4JELA 3U3ZA 4R7ZA 5FBVB 2VTBA 2UVQA 3RVSA 4HLCA 1O6BA 4TTSA 1CQIB 3GCXA 3MJTA 4Z54A 3JQFA 5HTOA 3WOHA 1ARZA 2CXSA 3F3YA 3HBFA 3Q7PA 1JHPA 2C3UA 3I0NA 4E07A 1O95A 2GZ3A 1WXXA 3NPAA 4Q6BA 3PWSA 2GN8A 1RYHA 3BM5A 3EG9A 3ZCRA 3UYKA 5M34A 3VV2A 2UXBB 1PG2A 5JO0A 1E5LA 5KTTA 2YZNA 1ECJA 4NCNA 5EJEA 1E98A 1MIHA 3F5DA 2NXJA 2ZXFA 3A1VA 3HZZA 5HOEA 3IEMA 4F86A 1P7CA 1I2ZA 2X14A 1CP2A 3OIUA 4GZ3A 1IWPB 4KK3A 1AF4A 3B1KA 4JOBA 3W8FA 2Z2IA 4A8JC 4YRZA 2X7HA 1I1OA 3WGOA 4QPPA 3ZLTA 3I01A 1XTRA 2P77A 4BX0A 2CE7A 2WJ4A 2JCVA 2A5DA 2Q6VA 3KJHA 4QWMA 8ABPA 3A1TA 1IONA 4YRPA 3QPWA 1GGHA 5TPZD 3AB7A 2XDWA 1Z4NA 2BM9A 2X22A 3C6ZA 5JCJA 3RTDA 2PY6A 5HKAA 2MMGA 1XFAA 4I55A 3K0SA 1HYHA 2EX0A 1NRXA 1E6UA 1CT9A 1M76A 1YFZA 2P9BA 1HDGO 2X7JA 2YASA 3C1UA 3Q6NA 2PSEA 2YMLA 3TZBA 1RHJA 4MUEA 3MN1A 4KL8S 3PDIB 1ECLA 4UMVA 2JLYA 5FOSA 2WSSD 4UDXX 5ALPA 5C5DA 2J48A 2EG5A 2C5EA 2CLIB 2P35A 4BO2A 4F9GA 1D4ZA 4KB5A 4DJTA 4J43A 1P0MA 5IJWA 1GN9A 3FVWA 1NNEA 4PYQA 4MW7A 2C9YA 3GPDG 2AI3A 2IODA 1ECBA 4TRMA 3LVQE 2R60A 1RWQA 2FU5C 3LYLA 4JLMA 5MGNA 5YASA 5HMMA 1QRDA 1L4MA 1DG3A 4PONA 1P80A 2N46A 5AQEA 4FGWA 1ZIOA 1P9WA 2CNLA 1W1WA 3H5IA 3I53A 3N0RA 4R2IA 3SX0A 5L4NA 2HTFA 3I58A 4OYYA 1H2RS 1T4GA 5KS2A 4H16A 3D0OA 1YR6A 1GQRA 3LUFA 1X9GA 3MT8A 4PAMA 3VKUA 3GK3A 4YY3B 3CKYA 1OYWA 5CIWA 1OXBB 3TM5A 1M2NA 3EUEA 2HWYA 5GZ3A 1PFKA 4AC9A 1G6OA 1HH4A 5I7RA 1AQIA 2HXSA 4QTZA 5KNCH 3BEDA 3BVPA 3GRAA 2GNPA 4P8RA 3IH5A 4IIJF 1EWQA 3O38A 5BNZA 2V9PA 1IBSA 1XKTA 2XUZA 3DEKA 2HJRA 1WXWA 3VVBA 3KQPA 5EUQB 3E3MA 4MKFA 1GYRA 1Q1EA 4KYIB 5MN5A 2RGAA 2ECPA 3DR5A 3QY9A 3S7TA 5DIZA 3C3XA 5EKTA 1N6NA 1VE7A 1Y80A 1G9TA 1JR3D 1RWVA 2RAVA 1JG7A 4L5JA 3DBHB 4ZHSA 3AF3A 4WXYB 2VHZA 3P0JA 3ZW8A 3C39A 1U7WA 3EDQA 2PZMA 2ZDGA 1XZPA 5CNJA 3HJNA 3ZQJA 3BXOA 2YIJA 4RYLA 2NVBA 2P9TA 2W6PA 4KPFC 1KOFA 2GR9A 4BU0A 1PW7A 3QBTA 3W5BA 3HVJA 1ZAYA 5CT9A 2DZDA 8OHMA 4GX2A 4S1TA 2H9IA 3O4HA 3C7TA 1JIJA 2RE8A 3ICEA 3IOYA 1WVGA 1XCLA 2ZZMA 1KF0A 1W25A 1RLUA 3JD1A 3DBOB 3L84A 1FEZA 2J33A 4XB1A 4HRVA 1IXRC 1L1RA 4XLLA 3EFHA 3O21A 2HD4A 1LC0A 3SIPA 5JMTA 5KOHB 1JHUA 1JG1A 1DAEA 2I2WA 1TCCA 1EZ1A 1UT6A 3O8BA 4NDNE 3WFIA 1Q0ZA 3OWOA 1K5HA 1VG0B 1Y8RA 3AF5A 3OCCA 2YC4C 4CTKA 5FP0A 5C51B 3F5SA 3G0DA 2A30A 3QLTA 3UIEA 3WGNA 4LRUA 2Q07A 1U3UA 2HMVA 4XSHA 1XEAA 4K81B 3AOEC 7REQA 1AKQA 2DKNA 2ECKA 2TRSB 3UJ8A 2GASA 2FY8A 2JDIA 3PXEA 1KBQA 2PO5A 3CH5A 4WBSA 4MUNA 4PC7A 4ZT4A 3CJTA 3HUFA 5TMEA 4A7PA 1OPRA 2Y92A 4Q9JA 2PH5A 1M1YE 3QUSA 4A8JB 3AI3A 3QPUA 4OP3A 5EYPB 3OZSA 3TLKA 4FYVA 4WNIA 2O3RA 2C2ZA 3HO6A 3NYIA 1MB2A 4XI9A 1MOPA 2JFQA 2EW2A 5KWIA 2GAAA 4EFMA 1L4YA 4ZVRA 5JEEA 1NW8A 4F4CA 2B8JA 3VXKA 1ZLXA 4ZEWA 3N8NA 3NTUA 5BPHA 1QR6A 4GU5A 2GFHA 1KO5A 5AT1A 3WNZA 1NUUA 1RS0A 5HRCA 1D9XA 1YI1A 5A4FS 1JLLB 4NYIR 5L3RA 2A9OA 4HNVA 3R6GA 3WRVA 2AOTB 2GPAA 3DXXA 4M49A 4CLOA 1SEVA 1UMCA 1EDZA 5HE9A 1YQ9A 3FLMA 4AJ2A 2XJ4A 3DHVA 5JVDB 3K0FA 2YCBA 5K3BA 2HUNA 1JAXA 4C06A 5CGZA 2ZIFA 1HMPA 1RVDA 2BVNA 3HNRA 4UHDA 2UXCB 3ZGLA 4C4PA 1W581 1BKSB 1PS0A 4G0QA 2PQ6A 5F2NA 3DFUA 3DO6A 1BWRA 3N5KA 5C7YA 1YV9A 1MOSA 3SFTA 2FQWA 1ZICA 3K0CC 4I2NA 4LF6B 2C31A 4DQVA 5KNDA 2D13A 4G86A 3AUYA 3CT6A 3SF8A 1NMSA 1E7MA 1TOAA 2V7QD 4MA4A 3SSAA 4YRBA 2I2BA 1D0SA 1WU7A 2I2DA 3BBPA 3AILA 5HP4A 1HYEA 1NLUA 1CUHA 1AVTA 2OEPA 2YJ4A 3PJFA 4KRXA 1P8JA 2QD5A 4AJEA 5JXJA 4EPTA 3QFRA 1Q92A 1V3TA 2H4HA 2NUAB 4AY4A 3U17A 3UH0A 3NWOA 1E2MA 3B1FA 3LUPA 4JB8A 1L7VC 4BX8A 4FE4A 1AHHA 2M32A 2ODQA 3NYRA 1JLKA 2YTZA 3Q3GE 5DHUA 1O4VA 1IAQA 2VDWB 4ZAXA 2UUCB 3FNFA 2OLKA 2GEFA 3OQ6A 4CM4A 4OL9A 4AQDA 4BBAA 5AQ1A 1IWBB 1IZ0A 5FPTA 2IHTA 3J7AC 1DIOB 2HQRA 2OZEA 1FYEA 3UM9A 3GFBA 3FOZA 2PD6A 3AIKA 1G5FA 4RADA 3M82A 1KS9A 1U2GA 3PFBA 2C2XA 1BVUA 1IHPA 3RYIA 1TM1E 1J8DA 3KZVA 5EZSA 3TW8B 3ZE6A 3MAJA 3UJCA 3IAM6 4Q34A 2BMVA 3CRQA 4NBLA 5H4GA 3TX6A 1KI1A 2IY9A 2ZJ2A 2O2XA 3UMRA 3V4ZA 1EVYA 3IO3A 2I9KA 2O8CA 3QKWA 1UKCA 4EG5A 3K9QO 3PCRB 1FA9A 4PHFA 1FB5A 2PL9A 1T0JB 4H31A 4FYHA 1X3SA 4E46A 2AEFA 3W0LB 2Q8NA 3MCZA 1UH5A 4KUGA 3RJTA 2E4ZA 1SCAA 2PWBA 4LJ5A 4K3UA 3FMOB 3VR6D 2G5GX 2I0FA 3N05A 4K6CA 3VAZA 3THWB 1CX9B 5EQFA 4RK4A 1E2UA 3UWOA 1V7ZA 1HL7A 2BKLA 3HR8A 2BM1A 2NUBA 1QG4A 3OLQA 4WN9B 2PKEA 3N6XA 5EAIA 2XB9A 3QVVA 4TVKA 2AFVA 3R3SA 1ZGZA 1C9NA 3NFRA 1IY2A 1K75A 3SQMA 5D1NA 3HEBA 5ISMA 1G8FA 3GR6A 4TV8F 3VNUA 4JJ6A 3S1LA 1MX1A 3VTAA 1TJNA 4G1MB 2XLBA 3U16A 1BRMA 1RCFA 4C0JA 2GN2A 4FJ1A 2O59A 2ZYSA 2GJ4A 2VRWA 3B9QA 2NSYA 2W4IA 4FNAA 4TTIA 3L8EA 4WIAA 2OHXA 4GI5A 4S0XA 2X3FA 1DC8A 4WOBA 5A4MS 1XA4A 1F8FA 2FGKA 2QN9A 1KI3A 3NUGA 1XTKA 3I9V1 5D3QA 1FC0A 3G0OA 3DDOA 1XXHB 1U0GA 3W7VA 4AZ3A 2EKDA 1DUVG 2HMTA 3I9LA 3CVUA 1JU3A 3D8SA 2JLVA 1GQ2A 2VFAA 4WESB 4A8TA 2X2PA 4ND2A 4HQNA 2JCBA 4QL3A 2D3WA 1W4AA 4G26A 3M6WA 4NZZA 4IIYA 3ELYA 4RMJA 1WXFA 3C3BA 4RY0A 3K0KA 4NJMB 2AS0A 4MI6A 4ZMBA 1RZ3A 3FR8A 2JFGA 1YZUA 2IU6A 2XAAA 1U3FA 5KX5F 2XB4A 2VLIA 4JBGA 1W35A 1MFPA 4ZYTA 4UQLA 3AF1A 2QY9A 1E1QA 4XTRA 1G2IA 4ND6A 3DR3A 4GRDA 4JQCA 4O2BF 5CJJA 4RLHA 2SECE 2Y1EA 5L51A 3PG5A 4FIZA 1W87A 1CY2A 5JXGA 2L17A 4N5DA 2NO7A 1GEEA 1W0JA 3CGGA 2DY0A 4I1OA 4NAHA 4REOA 5I4KA 1Y8CA 1MZVA 2GN4A 3GZ4A 3ROPA 5K9ZA 1OB2A 5BMOA 1R27A 4JL8A 2AFRA 4H0FA 1FFBA 3NIGB 4GG1A 3SC6A 1UZAA 2JIPA 2LKCA 4AZWA 1AHPA 1NU6A 1NNUA 2VHWA 4DZRA 1IULA 3G7SA 4IDHA 3LJKA 4FR5A 4WD3A 5KWSA 1KEKA 3IAHA 3PQDA 1QYWA 2BY4A 4GKAA 5F2OA 4UTZA 2FA9A 4W1QA 1XZHA 4I19A 3ADBA 1DS6A 3EVDA 1C1DB 2G0TA 4BP3A 1CIPA 2DWUA 4KQKA 2QTCA 1N7IA 3GNTA 3GRRA 3ZE2B 4KPYA 1H3EA 1BW9B 1E7QA 4A0FA 2R48A 2W70A 5I7VA 4FGKA 4U5QA 4IOMA 5EMJA 1RRCA 4P83A 3H6HA 4OHMA 4DNOA 3H04A 3GPLA 1I24A 2B1GA 4D4JA 2G1AA 3ANLA 1QE0A 3QJGA 4JA0A 4Z6KA 1EX7A 2ZBDA 4GIBA 5ENZA 4ZIRA 4GL2A 3ZCQA 2L19A 3ENZA 4OLBA 3O75A 3TPCA 3E4DA 5AM0A 4XDZA 4FNGA 1RJEA 4U2EA 5IYZF 2ZWIA 4HRYA 2QIOA 2CEAA 2I6UA 5IKXA 1KI8A 2VA9A 3EDMA 4L75A 3V33A 1GDTA 3H1EA 1GCOA 2UZ0A 3NG1A 1MV5A 3I0ZA 5EJMA 2QTBA 1KO4A 1YB5A 2Z30A 2CSXA 1PUJA 2CB9A 5HILA 1KRWA 4URWR 4EI9A 4HH4A 1N5JA 1QZTA 1LBQA 1X77A 1Z2PX 2IP1A 1G9SA 2I8CA 3G6WA 4QNMA 3WL5A 5EZYF 3IJPA 4NS4A 1TDJA 1XZQA 3ZWDA 4P3NA 4JI5B 2EXXA 3P0RA 4ILKA 1JEOA 1WDKA 5DBEX 5F3DA 4BP1A 3K1JA 4Z2AA 3HGQA 4PICA 1XNQB 1ZD8A 4IHJB 1C3XA 4I4TA 3L7YA 1P4AA 1REQA 2IUSA 1XYVA 1X9HA 3H2YA 5FWNA 3QOYA 2AHRA 5L3VA 1ODLA 1M1UA 2R8BA 3QIAA 1DX9A 4FWTA 1CJMA 3MSCA 5TRTA 3FTQA 4TL7A 1L3BA 1NYRA 2J9XB 4BMCA 2AQKA 2O20A 1MB9A 1V1MA 5CJPA