4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
2HF8A 4ASUA 621PA 1KO1A 2IC5A 1NBMD 4FCWA 4KO8A 4KFTA 1XCPA 2GAOA 4JLDA 4LHXA 4MH0R 4MA4A 2O8BA 1VG1A 3SJZA 5EP3A 5B30A 1LVGA 1H65A 3CUEF 1OXSC 4HAWA 1II0A 1UKZA 2QMOA 3VMFA 4ZI2A 5K8LA 1WE2A 2UZ3A 2IYQA 3CPJB 4IDQA 4YDSA 1W1WA 3OZXA 2WSSA 1RC8A 2PBRA 3OHMA 4H9GA 4G3XA 2QGZA 1ZUIA 3KQKA 1J8MF 1VG9B 3VNVA 1NN3A 5AUNB 3KQLA 1GAJA 1HEIA 3GLGE 1RYFA 4MGZR 4NYMQ 1WDTA 4KFUA 4B35A 3THYB 1O87A 1XNJA 4BECA 3B78A 1OFTA 1G3MA 1L4UA 4M1KA 4UQOA 3UMSA 2F3TA 4U00A 4E5UA 2CCJA 4HATA 4BQSA 4HAYA 1ZCBA 1G1MA 1LNZA 2F43A 4XSHA 4JBYA 1OXUA 4JLMA 3BD9A 1VIYA 2ZYVX 2ZAOA 4M1MA 4HB0A 1KKLA 2NO1A 2CK3A 3AP1A 3ETLA 1WA5A 5KUTA 5DSZA 1XZPA 1T8UA 1DEKA 2HDNB 1M34E 4YMUA 3K53A 4V0LA 1D2EA 2Z83A 3NWJA 5TARA 2QBYB 2P5SA 2FH5B 3R9XA 4WVFA 4HLUC 3DOEA 1Z22A 3BB1A 1MO3A 5BWMA 1XCMA 4Q7KA 3NG1A 5GJCA 1RIFA 1QG2A 3C7KA 1US8B 3KFVA 1N6NA 4B2LA 1K5DA 2C03A 5EE3A 3A4LA 4N1AA 2ZAMA 3A4MA 4RSGA 1WF3A 2JLVA 3PCRB 4NZYA 4PC3A 3RRNA 3BRWD 3MWKA 2OAQ1 4UXJA 3ZVLA 2ZXUA 4TYYA 4NCNA 2C9OA 2GF0A 2GILA 3AKDA 1KI9A 5BQ5A 3KQUA 5B2ZA 4XD7A 4DSNA 4DUGD 2EFCB 3FYHA 4B73A 1G20E 2VO1A 2ZR9A 3CNLA 1HUQA 2WPDD 1UKVY 2PX3A 4QBGB 2AR7A 2JJ2D 4KYIB 3SQXA 3HDTA 4WOPA 3D7MA 1GIAA 1KK2A 1R0ZA 1VYTA 1E2KA 2IF0A 1EXMA 3FMOB 5C46F 1VCMA 3KKPA 3HR7A 4Q66C 3KJGA 1O3YA 1FUUA 2PLRA 4WBSA 3UWKA 3THOA 3GEHA 3VTKA 5JWRA 5DE3A 2KWIA 2C2HA 2XTNA 5JFGA 3LO5A 2JEOA 1LF5A 2Z5FA 1Q1ZA 4M2LA 1IQPA 2D2EA 3GJ4A 2R65A 2P3SA 1JEDA 2CNWD 2NZJA 2PT7A 1KZGB 3AF4A 4Q4JA 2OFWA 1TQ6A 2ZRJA 3FPAA 3X1YA 2GJSA 4DLRA 1KMHB 2OSBA 5FL3A 2PMDA 2OEPA 2C99A 1HT1E 2AHOA 2VSXA 1SVSA 2FGJA 4Q00A 2G0TA 2GEDA 2YNMA 3WY9A 4B74A 4F4CA 4AKIA 1DAGA 2G77B 1E9CA 2A7QA 1XTIA 5IK2A 1JPNA 3H84A 3SHWA 2IHBA 5C2JB 3VHXA 3NC1C 1NL3A 1Z6YA 2WIAA 2DFKB 4GZMA 1SXJA 2BHRA 1QDEA 3ADDA 4NE2A 1E2QA 3AKEA 3FWYA 3PQCA 2JLQA 2OBNA 3I4LA 4KSBA 1Z08A 2VSFA 2DFLA 1TL7C 2YHSA 3GFPA 4HZIA 3SFZA 3UIEA 3QSYA 2J3EA 1D9ZA 2OV2A 3OIVA 4QHTA 4LHYA 4DT1A 1IY0A 2QROA 4TLAA 5JRJA 3LVQE 3P1JA 3SQWA 4P4UA 1QHSA 2IYLD 4LCBA 1BO6A 2RGEA 4YMWA 1JXMA 1R8SA 1IJEA 4LHZA 1WXQA 1UM8A 2WJHA 4MGKR 5KNDA 5DISB 2NO0A 4DHEA 1W4CA 2QTVB 3IQWA 4TMZA 1E94E 3E1SA 3PXGA 1OHHA 4MYCA 4M9XA 4I1UA 3NKVA 4R7ZA 1ZNZA 4DCUA 4UNNA 4PSVA 3GLIE 3EA0A 2ZUDA 4GMDA 2XSZA 4JBWA 4GT1A 2YC2C 3CM0A 1G19A 1QHXA 1FUKA 2KI5A 2XB4A 2XAUA 2O52A 4HI0E 4BLSA 5H8WA 1WRBA 1BKDR 2UKDA 2EW1A 4MYTA 2I1QA 1TUIA 4V0ME 3U3JA 1OH8A 1GL7A 1WBBA 3X1XA 2F43B 1YZGA 1RJ9A 5KOYA 2OXRA 1XTJA 1SHZA 4QM7A 1VIAA 5J40A 4B6FA 3S1AA 3T1QA 3NBXX 5GJVC 4BRWA 2XJ9A 2EYUA 4IVQA 1F2TA 1DAEA 4B48A 1C4OA 1DTSA 1ONBA 1RRFA 3DM9B 2GZAA 4L16A 3ZQJA 4TMKA 5JS8A 4FN5A 4PHFA 3EW9A 5JLJA 1R6BX 3RLFA 3CNOA 1OKKA 4MRVA 1G8PA 2RGGA 2NOAA 3VKWA 4MKHA 1DADA 1G5TA 4OK5A 3K0CC 3NEYA 2ZI3A 2NQ2C 4M8NE 5EXSA 1N0UA 1FZQA 4GMXA 1ODFA 4B3XA 4EQ6A 2JLYA 2J41A 2N42A 2JIZA 4DDVA 2FA9A 1PVOA 3SI7A 1KJWA 3D31A 1GTVA 2LKCA 2FPKA 3DMDA 3TR5A 4D82A 5DYGA 3BE4A 4DB4A 4NBSA 3OAAD 4DLYA 4JIMA 4FINA 1OH7A 1OFUX 2W83A 1XD9A 4ZCIA 3KB2A 3T15A 1BYIA 4XTCS 5L3SA 2GF9A 1XDBA 2A2ZA 2XNDA 4BFWA 4JVLA 1ZYUA 1NLZA 2FFAA 2QQEA 4B3FX 5HPYB 4IDOA 2QRNA 4A0HA 4JVMA 5FUVA 1U98A 1KY2A 4LK2A 1C1YA 3ASYA 2JLSA 2RGXA 2Z4SA 2ZUBA 4UKDA 4A92A 2CVFA 8OHMA 1IOZA 1Q1QA 3EZ2A 4GPTA 1RE0A 4GSYA 4BFUA 5B64A 4DXAA 4K81B 1N5IA 1Z83A 3WYGA 5BXQC 1R8QA 2FSGA 2B7BA 1CR0A 3EG5A 4JS0A 3CX8A 3LA6A 2Q9AA 2IWHA 2GXAA 2WAYA 1BS1A 1EG7A 5J47A 2KB0A 4I1OA 4O0MA 4F4JA 2GBLA 3CR8A 4HLCA 1YZNA 4NCJA 4ESHA 3WRYC 2ERXA 1HV8A 3DM5A 2GDJA 4FMDB 4KV9A 3LQRA 3AM1A 1T91A 4KODA 2AX4A 4KLNA 2P67A 2A5JA 5H68A 4ZCMA 2VHQA 5LB4A 4M9ZA 5FUXA 2FG5A 2W6JD 4A2QA 4EDHA 5GADl 2H1LA 1XPRA 2W6ID 3WNDA 1CJVC 3EZ7A 4QKQA 1WCV1 3NDBB 2H8KA 2ODBA 1EFRA 3X1DA 1NNEA 1SXJB 1FMLA 4JVSB 3C14C 1QVRA 3TUIC 3MWYW 1Q3HA 4DCNA 2C9YA 1NSFA 3OEED 2ODEA 4UNRA 1P9NA 1NBME 1H8HA 3PJRA 4DT1B 3TBKA 3QVVA 1AZSC 1OIXA 2YWHA 2BJWA 4OQFA 3K0EA 5DN6A 1VHLA 2A5FA 3ZVNA 3VNUA 1N6PA 2OCPA 4Z54A 4M1SA 3SN6A 4XVQA 4IOJA 1U0JA 4NP6A 2P6UA 4MGYR 1JBKA 2DR3A 4MRRA 5JS7A 1H8ED 4URYR 2VBCA 3REGA 2KE5A 1J8YF 3PEUA 4D0NA 2ZTSA 1JJVA 3GJ7A 5ANRB 2ZJYA 3EC2A 5KSYA 4Q1BA 4TMVA 2AFIE 2GRJA 3I73A 4II7A 4MYHA 1A5TA 1Q1BA 4U5XA 2ZRNA 3QXJA 1W5SA 4WZ6A 5FI1B 2BKEA 4ZI3A 3NBYC 4NCHA 4M1WA 5JRZA 4KAXA 2WHXA 5D3QA 2YV5A 2ZSDA 4M9SA 1N25A 1F5NA 4PC7A 5JCZA 4QNMA 4PC6A 4HB2A 4Q48A 1GILA 4PSAA 1RJ9B 2QQ0A 4ZDWA 4F93B 1Q44A 2ONKA 4ZV4A 1NRJB 3S1AB 3R20A 4XIGS 2QU8A 3V4RA 1F2TB 3T12A 5DNYB 1N3BA 1X8KA 1PZNA 1W2GA 2QNRA 1FMJA 1RVDA 1EWQA 5P21A 2D74A 4Q7JB 4JLBA 3BBPA 1IHUA 2Q21A 2QP4A 4A2PA 1XEFA 4OJKA 4DCSA 4EPRA 1L7VC 1EX6A 2OFXA 1A2BA 4B33A 3PUWA 3QBTA 1G8YA 4WIAA 3CWQA 4ZPXA 2P6RA 4EQ6B 1ZD9A 2FSIA 3UG7A 2IXFA 3TK1A 2J59A 1Y3AA 3QUSA 4PPGA 3G82C 5GVRA 3OE7D 2O8CA 2WKRA 2YOFA 1NKSA 5F9FA 2ZRFA 1TQ2A 2JLZA 4BLPA 1S2MA 4G1UC 4IJMA 5SZHB 1G3QA 3LWNA 2A78A 1RRPA 4FCTA 2BKUA 4QBIA 5L3SB 5DYIA 4GBMA 2JDIA 4ACAA 3EIQA 3BFVA 3FDIA 3ADCA 3ZD6A 2IYYA 1ZM9A 3L0OA 4EJSC 4Q02A 3KJIA 3K0CA 1ZM7A 3GLFE 2Q3MA 2ZITA 5JHGB 3K0FA 1NVVQ 1VHTA 5FPKA 3SBDA 4FWIB 5E4FA 4D6PA 1SGWA 3FOZA 1E98A 4HB3A 3K1JA 2N46A 3AF0A 4CT4B 5CDFA 5K8TA 3RS4A 1U81A 2VA8A 3HYTA 1NG9A 5JJIA 1D2MA 4LY6A 2CHVA 4IXNA 1N6KA 1OW3B 4WAUA 3EARA 1XU4A 3UANA 2JLRA 4Y0VA 1TNDA 2BBOA 3AKYA 4OHWA 5KTYA 3KQHA 4R98A 2CE2X 4FD2A 2G0NA 1RPZA 3RWMB 3FMIA 1DOAA 3B13B 5FBWB 3RAPR 3U7GA 2JLWA 5KYKA 4OHZA 4DVGA 2RHDA 1ZM2A 3MD0A 1KI7A 3T35A 1YZLA 2QT0A 2OM2A 4FXPA 4GRAA 1W0KA 2IW3A 1HE8B 1XD2A 3BH6A 3LH5A 4KFSA 3ZJYA 1NLYA 3KZ1E 2WJIA 4EUNA 3VR5A 2YOGA 3LFUA 4JL8A 1KO7A 1FW6A 5J5CA 3A6PC 3AB3A 3BK7A 2G9NA 4A36A 1P6XA 2NTYC 2ZUCA 2SHKA 4TT3A 1GOTA 5AK0A 3RS0A 1G5RA 3CF2A 5FTJA 1GG2A 1UDWA 3HP1A 5FOXA 1AK2A 2F3RA 3OFND 1TAGA 3LXXA 3PR1A 2CL6X 2N1BA 1ZP6A 1N0WA 4HDOB 1KI1A 2O0HA 3BIFA 3MWJA 1P62B 5AUPB 3EA5A 3IIKA 4YMVA 4NCKA 4AI6A 1CLUA 4QJ4A 2CLCX 3GPLA 3T1VA 1R5BA 3THYA 1KOFA 4DLWA 4C0JA 3DOFA 4HSEA 1HYQA 2O8FA 2IYTA 2WKQA 3UG6A 2BC9A 2JCSA 4FMBB 5HKKA 2OXCA 3FMPB 1SHKA 2QTFA 2BBWA 3OIYA 2H92A 4NMMA 1P4SA 3IHWA 4DB2A 3IQXA 1E2PA 4BZQA 1IXSB 3LW8A 2XXAA 3FKSA 2ZRPA 1E2DA 3ZGXA 1X1SA 2YWGA 1B0UA 2C5LA 2C9CA 3EIHA 4RD2A 1NBMA 2A30A 4KSCA 3BJIC 1E2MA 2OG2A 4OI0A 4GOKA 3LBNA 3ZS8A 2A9KA 3EC1A 4G5SA 2I4IA 1R10A 2DFTA 5EUQB 5AJWA 4A0FA 5KSOA 3P4YA 1W49A 2IUUA 1Q3TA 1N6IA 3I62A 4Q1DA 3BB3A 3TRFA 1MABA 4BZPA 1OYWA 3QIAA 1AKYA 3QQ5A 1M1YE 1U8AA 1JECA 5CM9C 3K09C 3QPUA 4I4LA 3TGPA 3UMFA 2XB2A 3MRSA 2O8CB 1TU3A 3RANA 4IRUB 3TW8B 3AH8A 1PLKA 4HLQB 3W6NA 4RZ2A 1LY1A 2JATA 2R44A 4B32A 4TYNA 4RVCA 4CF7A 2IWRA 4WA7A 2VHTA 4A2WA 3RRYA 1HE1C 2BEKA 2VPPA 1G7CA 2BMDA 3IIJA 3I5YA 3QXHA 1TF2A 2RGAA 3H2YA 4B3BA 2JLUA 2EFEB 1P2UA 4LYAA 4PQFA 5FBQB 4QGFA 2CL7X 1E3MA 4Q9IA 1VPLA 1MH1A 3GD7A 1KK0A 4ACBA 2HV8A 3K0FB 3EX7C 4MRPA 1S96A 5JJKA 1RRGA 1V5WA 3CRMA 2AKYA 4URVR 2D3WA 5KSZA 1PJRA 3PITA 1TU4A 3F5FA 4QBFA 1UF9A 3K0AA 2D4HA 4A6PA 1NVXQ 3T06B 2WM9B 4KYUA 2IX3A 1S0UA 2J7PD 1KMHA 2GJKA 2WWIA 2WICA 2YINC 1J7KA 1VCNA 1XX6A 1ZJ6A 3AVUA 4TZ0A 1G17A 4ILEA 1DO0A 2YJTD 1TMKA 3L8YA 1E2LA 2VYFA 2ZM5A 3R8FA 5J4KA 3SU8A 1JAIA 1JI0A 1GWNA 2GESA 1Z2AA 2L0XA 4URZR 1C9KA 2IS1A 1E69A 4NPHA 1VCOA 2WV9A 4GP6A 5A0FA 1ZUNB 4J0QA 1NY6A 2UVQA 3FFBA 4XWAA 4BASA 1XD2B 3ADKA 3Q8XB 3TE6A 4DUGA 3CF6R 1G21E 1I2MA 5EJEA 3B1VA 2WPDA 3KL4A 5HTKA 2C77A 3IPXA 3LBIA 1EFCA 1DG1G 3AGQA 1N5KA 2AFHE 2JJ2A 1ZVQA 2V4ZA 4O25A 4LBVA 2GWHA 1F2UA 1QBKC 3VQTA 4M21A 1ZAKA 4RD6A 4I1SA 3GP8A 1G8GA 5TY0A 3NVAA 3AUXA 4A4DA 3GLHE 4DJTA 2ZYUX 2RGNC 3HU3A 5TVKA 1KO8A 4JLKA 3K70C 3TSOA 4DCTA 1E2NA 3GMTA 3PVSA 2NPIA 4ABYA 3A37A 4OYHA 2FV8A 3AVXA 3CRRA 5DIFA 3RABA 2CNWA 4RKEA 3TKLA 1P2SA 3VAAA 5G3ZA 1VDZA 1A1VA 2WVJA 1WB9A 4DZZA 3AVOA 1PV4A 2P6NA 1KDTA 5KNBA 3AVWA 4JZKA 2J46A 3FE2A 2O8FB 1II9A 2R8RA 3C15C 3AVQA 3WRXC 2F7SA 1XPUA 1CR4A 1D8TA 5JBQA 2NO7A 4TLBA 2ZS8A 4KVAA 4IOMA 1KSFX 2ZETA 4NYJQ 1JPJA 1E32A 5G53C 3U4QA 2XXAB 1D9XA 5JEDA 2FEOA 1GNPA 1S1CA 4NCIA 3O8DA 2CJWA 1QRAA 2P5TB 3IIMA 2H18A 2ZRKA 4NONA 4R9UC 1SZPA 2MMCA 3B1XA 2FSHA 2HF9A 1YKSA 1ZU4A 1G9XA 3A1UA 1JB1A 3GJXC 1E79D 3TH5A 5J4VA 5EXTA 5B58C 2ZJBA 2OE2A 4CZ2A 1KAGA 5DHFA 2VLIA 3D8BA 4NKRA 3MGCA 5E7MA 4NYIQ 1MABB 4PO8A 3TAUA 3U3KA 2YWFA 3VKHA 2FZLA 2PH1A 2DWOA 1NSTA 4M9QA 4N0DA 1G4UR 4EPXA 2PJZA 3CRQA 2OBLA 1T3SA 2CLDX 2LKDA 1GVNB 2IUSA 2NZ8A 3C16C 721PA 3CR7A 5JI3E 3QF4A 1G64A 2ZI5A 2HT1A 3WHKA 2HXYA 3TMKA 1G6OA 4N0EA 1JXOA 2OLJA 3G0HA 3SJBA 4O3MA 2BCGY 1Q1EA 3QG5A 5JEEA 2NO6A 2ZRLA 2HCJB 1VYVA 4JSTA 4BEJA 1HQYE 1XBTA 2GXSA 3U2QA 4L5BA 1XXHE 1FPMA 5G3YA 4PAQA 1GSIA 1Z28A 4OBEA 4P33A 4RD4A 5LD2B 2DPXA 2NPFA 1EWRA 1G3UA 5BYKA 1E0AA 4TTRA 1E4YA 4URUR 2XJ4A 2OBMA 3DVLA 5HZHA 3SYLA 2BJVA 2ZI9A 2A5GA 2V7QD 2ZSBA 2ZJ8A 5JZVA 4JL6A 4D4MA 1RFLA 3A1TA 3K0AB 2PCLA 4JJZA 4TWZA 3ZDQA 3DZ8A 3QEJA 1UBEA 4AYTA 3TAHA 3TNFA 2XOKD 2JA1A 3EPKA 1FQJA 1EESA 2BVNA 1E9RA 1W36D 3RSLA 1JEEA 1Z0KA 2AXNA 4MKFA 2JASA 1NVWQ 4CVNA 4NYMR 3HU1A 4GOJA 2RGDA 3T5DA 3ZLJA 3RHFA 3U5ZB 2ASEA 2PL3A 2R6DA 3TJZA 5KPDA 4JLVA 2XNSA 5FL7D 2OILA 4Y0AA 1XTSA 2VSOA 3OAAA 1U9IA 1UEJA 3IILA 3KB1A 5AJZA 4R71A 3AVTA 1Q12A 1AJEA 2FWRA 2ODNA 2QMEA 1VG0B 1COWD 1YRAA 4OI1A 1R7RA 4BFSA 2HJGA 4UXHA 2ZRAA 5FOWA 4M53A 2ANCA 2ORIA 3QKRA 2JLXA 3LQQA 1F2UB 4AIIA 1U90A 4P0TA 1R5OA 2FNAA 4B76A 4AWXA 1QHIA 1YRBA 2YVUA 4KBGA 1G3IA 4M1YA 3U6BA 2MSDB 3AQ4A 5L8VA 2HYIC 2REXB 4OJQA 2Q3HA 4D26A 1UPTA 4KXFB 2ZE6A 2ZS9A 2WOOA 1KNQA 2FX3A 3L0SA 4HUTA 5UKDA 1N6RA 5A4JA 3QJYA 4LJ9A 1QHNA 2ERYA 2QMUA 3KJEA 3EXAA 1KK1A 1E2HA 4ERNA 4NYIR 4TTPA 2GEUA 3THWA 3P27A 3Q85A 4RCZA 1LS1A 3TQFA 1P2TA 4LBYA 2ZQ5A 4IEEA 1YJ5A 3R7WA 2W6JA 2WWGA 3AGPA 2OCYC 1E9DA 2NMVA 2W6IA 5CYOA 5FR2A 2R6GA 4CIDA 3DPUA 1M74A 4LHWA 4US0R 2RGNA 5KSPA 4D4LA 3GJ3A 1AN0A 2TMKA 3U3MA 2QGNA 3U4QB 1F48A 1KGDA 2ZSEA 3R9WA 2ZRMA 3FGNA 3CBQA 4R2IA 2EVWX 1OLOA 2CJWB 2J7KA 3OEEA 3SHFA 4Q18A 1CJKC 2ZR7A 3N5CA 5SZIA 4C0KA 1CEEA 4PPFA 4WZAE 3HPQA 1UJ2A 1W2HA 2QZ4A 3X1ZA 4PC2A 5TMPA 4UNQA 3TLXA 5EE1A 2C96A 2GKSA 3L8ZA 4KCGA 4U7DA 3GLHA 4V0KA 4HAUA 4LJ6A 2EFGA 4ZCLA 1IY1A 5EE0A 2QP3A 2OZEA 4MYUA 1XMSA 3PENA 5IHPA 3U3RA 4L9SA 4URXR 1E6CA 2FFBA 4FCVA 1UDXA 2WJGA 2IYZA 4MDEA 3CX6A 3NBFA 4U02A 1H8EA 1ZW6A 4V03A 2EFDB 2YWEA 4HLDA 1R2QA 2PMKA 3ZZTA 3LX5A 4C0BA 3W90A 2F1IA 4BUJA 1E2FA 2QG6A 4C0AC 3U7EB 3C5HA 2IS2A 4AY2A 3GLGA 3QF4B 5HE9A 3ZQ6A 3BH0A 4CW7A 4W7SA 1E9SA 1Z3IX 4YQFA 4LSGA 4HLUA 3OIUA 4RJLA 3KQNA 4JT2A 1L4YA 4QGGA 1ELOA 3ASZA 3PV0A 3LY5A 1CRQA 1TX4B 4V02A 4IDNA 5J4LA 2FOLA 2FPLA 2IA5A 4LC1A 4MKIA 2BMEA 2WOJA 1IN8A 4OQMA 4DSOA 2CBZA 1P5ZB 1VMAA 3GCGA 3NC0C 4E07A 1CR1A 1CXZA 3B1ZA 3KUDA 1OT3A 4JLJA 1CKEA 3UK6A 4GDFA 3SOPA 5JJLA 2Z6VA 2GJ9A 1AS2A 5H70A 4W9MC 3O47A 1KI3A 1U8YA 2AL7A 3E5HA 3CONA 4BE7B 2ZSAA 1E1QD 1T3LA 4NHOA 4JT4A 3B8HA 4F7WA 1FFHA 4H1VA 5M04A 2JGNA 1Z07A 4QJ5A 1X6VA 4PC1A 3HYRA 4Q1CA 3B82A 4PAMA 1N5LA 3CF0A 3CRW1 4RZ3A 4LC0A 3AUYA 5JSZA 4GP7A 4QHYA 1E9FA 3UXMA 3PUYA 4OQNA 5KDLA 4C2TA 3OE7A 3K70D 4QOSA 2QN6A 2C78A 1KO4A 4KITB 4TSFD 1XTKA 1ZUHA 1G8FA 3RC8A 1QHGA 3U60B 1P72A 2IYVA 1AS0A 2J0QA 3QE0A 3QKRB 2FGKA 3RRZA 2J9RA 2UZIR 3FHCB 3JZMA 1ZNYA 5DLQC 2WJYA 3R9IA 3CO5A 2BMJA 2ZU0C 3KJHA 1XXHA 3EIEA 1B23P 1N6OA 3MLEA 1E9AA 1AM4D 5FOUA 3T61A 5LBIA 4WXRA 2BIFA 2MMGA 3LNCA 4QGHA 3PG5A 3W3ZB 2VHUA 2CLSA 2O8EA 3GEEA 4HZUA 4WZBE 4Q1EA 5KPJA 3BFXA 2BM0A 1S8FA 4PO9A 3ZIAD 1QF9A 1NN0A 3E70C 1KIMA 1ZM3A 1BIFA 3M0EA 4G5OA 3THWB 2FPMA 1XB2A 4POAA 5K8UA 3FKQA 2H17A 2AN9A 3B9QA 4HAZA 3BWDD 2J1LA 4Q7LA 5TB5A 5DI3A 2B8WA 3EZ9A 1KNXA 1W47A 1Z0AA 4XWKA 3R7WB 2OFOA 2O0JA 2B21A 2AWOA 2EU8A 1FOEB 4GI7A 3X2SA 4BFXA 4EKDA 2KBEA 2FZ4A 4UNSA 1KYIA 1GL9B 3I72A 2E1RA 3N2IA 2JJ1D 1M7GA 5C18A 3K70B 2ZREA 2ONJA 3QY0A 4I1VA 1R4AA 3W5JA 3LLUA 1Z06A 1P2VA 1UAAA 1NG1A 4LV6A 2IXEA 3CWZA 2WWHA 1JQJC 4LZZA 1UBCA 2IYXA 3ZZUA 2Q3FA 2R6CA 5F2EA 2RCNA 2IK8A 1HH4A 2VF8A 1NI3A 3GLHB 3IGFA 1GRRA 5CYPA 4OI2A 4OL0A 4TLCA 3ZYCA 3ZVMA 3OFNA 3VR3A 2WMNB 2ZVQX 1MV5A 4AC9A 1QHHA 5FUYA 2HT6A 1SVIA 3RS5A 4EFLA 4LBWA 1X3SA 1E0SA 4O2RA 3SYNA 3ONWA 2BDTA 4A6XA 3GLIA 2ZR0A 2ZRCA 4QHSA 1FQKA 4C7OA 2V6IA 4DEXA 2IXGA 1XMIA 4BLQA 2PEZA 5AR1A 3GLGB 1JR3D 3E2IA 1Q20A 2ZROA 5DHAA 3I3SR 2RGBA 2J5XA 1MO4A 1ZCAA 2BM1A 3LW7A 4IEIA 1SKQA 1DARA 1LV7A 2QPAA 5C4GB 2V1UA 3FHTA 4V0MA 4B2PA 1KKMA 1A7JA 1RW4A 1R5NA 1Y63A 3W8RA 1GRQA 3ADBA 1SVWA 2ORVA 3EWSA 1TF5A 2B7CA 2ZEJA 3QKTA 4ZKDA 3KXIA 1ZNWA 2F1HA 2R62A 1NP6A 4IDHA 4EIWA 3CW2A 2AWNA 3HU2A 4ON9A 1XMJA 5GJBA 2RKOA 4DCVA 5L3RA 4HB4A 3CB4A 5KNCA 4TLDA 1Z6AA 3RDPA 3K9GA 3IBYA 1Q21A 2ZRDA 5FI0B 4Q4HA 2VEDA 3QPWA 3AVYA 4KJZA 3U7HB 4TQ9A 1D6JA 5FBVB 1GKUB 4LJAA 2ZE8A 2IF2A 3BFKA 3TUZC 4FMCB 4TMWA 2BBTA 1KJYA 1N0VC 1DBSA 5JSZB 4BPBA 3L0PA 1DAFA 2VHCA 2X2FA 2Y8EA 4OQLA 2YOHA 4PO1A 3V4FA 3C41J 5AJXA 5TDHA 1GP2A 1IN6A 4ZDIA 1M7HA 1DPFA 1GKYA 1EGAA 2ZJ2A 3FVQA 5FPSA 5TXGA 1ZD8A 4EPYA 2BOVA 4TQAA 1UBGA 1W36C 1A4RA 1IN4A 4S2EA 4YONB 4F92B 3N2EA 2GCPA 2D7DA 3CLVA 2QPOA 2ZSFA 4BLOA 5CK5A 1XXHB 4QM6A 3IEVA 5FPTA 4C0LA 3JVVA 2ZVPX 2RH5A 4LOAA 4CEJB 3PUVA 1UEIA 2WWFA 2X8AA 4RD1A 3BS4A 2D2FA 1VKJA 2XITA 3B9PA 3X1WA 3EZ6A 2O8EB 2IL1A 3TQCA 5GVSA 4HZUB 2W00A 1GKIA 3MAAC 4LRWA 3A36A 3RRMA 4O2LA 4YMSA 1CU1A 3Q72A 1T9HA 2FDCA 4BLTA 4H1UA 3IPYA 4TLEA 4IHQA 2OAP1 2J7PA 4A1FA 4B6EA 5LPNA 3DZDA 1P73A 3M6AA 4CEHA 3CNNA 2GHIA 4HEJA 1U2RA 2ZE5A 2W2VA 2AK3A 2VL7A 4LHVA 1AQYA 2W0MA 3LVRE 5DI3B 1E1RD 1DVRA 3DO6A 4JLNA 4BLRA 2QE7D 2VRWA 4LJ5A 2OESA 1ETUA 1FTSA 1KZ7B 1XP8A 4GOXA 4M0LA 4Z51A 4D0GA 4B3CA 3FTQA 2HUPA 2X2EA 3Q9LA 2CMKA 4US1R 2ZI4A 4DKXA 1EK0A 1IBRA 5EZ6B 5FTLA 2G1JA 3NTUA 4NTZA 4X8LA 4JL5A 2ZPTX 1KSHA 4DBLC 1OYYA 1EFTA 2R2AA 1ZU5A 3VX3A 3P4XA 5BW8A 1NVVR 1X8LA 1G7SA 1MO5A 2DWQA 1SVMA 4TL7A 5HR5A 1IAQA 2OCBA 4LJ8A 4EFMA 4Q9LA 2GJAA 4BFVA 5JWOA 5EXXA 5F98A 3BERA 4DEYA 3KTAA 3LBHA 4JSYA 4OQXA 2Q9CA 2ZYWX 2VP6A 1G6HA 3UPUA 1WMSA 4F91B 3U7FB 5LB2A 2XEXA 4BFYA 1S3GA 4B43A 4QFMA 1QHHB 1E0JA 1D2NA 4W5HA 1YU9A 1E2EA 5DH9A 5AWFC 5FOTA 3GLIB 1SVKA 4C7OB 4DC9A 1OIWA 2ZRIA 3KKNA 2DB3A 1XRJA 4Q9JA 2XZLA 2A5DA 3BC1A 1OXXK 1GFIA 3BGWA 1R0YA 3MJHA 3K9NA 1KI2A 3WXMA 2RB4A 1J2JA 3ZVRA 1BH2A 2FMXA 2BBSA 5IRCD 3O8BA 1M6NA 5E7IA 3VHLB 2HXSA 1EFUA 1DAHA 2HLDD 4N3NA 3HR8A 1OE0A 3B85A 4LWZA 1XZQA 2CDNA 2HCBA 4C4PA 5G40A 5JHHB 3SNHA 2YC4C 2GXQA 4PZYA 4JMPA 4TQUS 1T0JB 4XWOA 1G7RA 3SJAA 3BOSA 1W4RA 1LTQA 5BYJA 4LDJA 4PTLA 1TTTA 1E79A 1Z6TA 2GK7A 4TL9A 4QBHA 4Q4HB 1XTRA 3ZS9A 3LAWA 2G6BA 4Q21A 1LFDB 2B8TA 2FSFA 3EWAA 1E2JA 2D06A 4MGIR 2EYQA 5FTKA 3WP1B 4AG5A 4RD0A 4EJSA 1CS4C 3EAQA 3B5JA 1OIVA 3WBKA 4Q4AA 2QM8A 3BORA 2W2TA 3JVUA 4LJ7A 2WWYA 5BN4A 1FL9A 4BEBA 2D62A 1DE0A 1G4AE 2E9SA 1U94A 5CK4A 1SKYE 1UFQA 3D6TB 3T5GA 1KAOA 3SZRA 3ICEA 3IEUA 1AS3A 2NG1A 3CIOA 2QAJA 3F8TA 4LJYA 4DRZA 3EPJA 1Z2CA 2IBMA 4FI3C 4Q1FA 4LV5B 1OH5A 4CT5A 1CRPA 1IXZA 4C0HA 2QEQA 1BMFD 3A1VA 4GZLA 3VU9A 2DBYA 4DIEA 1II8A 2JAQA 2AD5A 3L43A 3SDZA 3B1YA 5C1BA 4LGMA 4D0LB 3GLFA 1RYHA 1YE8A 1Z6XA 1MT0A 1W44A 2G3YA 5FBRB 4IXMA 4Z1MD 1EFHA 4PQRA 1KSJA 3ND9A 1CJUC 1OF1A 2R6AA 3EPHA 2J0UA 2CCGA 2R9VA 4B44A 4Z8XA 2CVHA 3AP3A 4NL4H 2V7QA 2BCJQ 3LDAA 3T1TA 5DO9A 4QXAA 5EZ5A 3DKVA 2ZJ5A 2WAXA 2GCOA 3B6EA 4TL8A 4K8OA 3K9HA 4Q47A 2XOKA 821PA 4CEHB 3KKOA 4W5WA 4B71A 3AV0B 1K5GA 2REOA 1W0JD 2H7VA 4KVGA 3MG9A 1KI6A 3CPEA 3B2EA 3AF3A 4M4SA 1P3JA 2BEJA 2NIPA 5EP2A 4AKGA 2Q9BA 1WQ1R 5EQTA 5FL7A 2V6JA 2QMHA 1MOZA 1Z47A 3IUYA 4QC2A 5J4HA 3U6KA 4XH9B 4TMXA 2I1VB 4IW3B 4YC7A 1YR8A 3CH5A 2V3CC 2J87A 2FN4A 4MUBA 1I4LD 1COWA 5L3QA 4LUCA 5FTNA 2XTZA 1KDOA 4UJ5A 1W48A 2MSCB 4TL6A 1ZRHA 5EP4A 3UMRA 3OEHA 2CCKA 1CP2A 1I4TD 2CHQA 2IYRA 2F6RA 3EASA 4RKFA 4P3YA 4FMCF 3WYAA 4I99A 1NMZA 4MRSA 1PUJA 4Q9KA 4A8JC 4QJ3A 3WHLA 3CX7A 4RZXA 3K0SA 1T6NA 3KTAB 1K6MA 4RZUA 3AVVA 2C98A 1M2OB 1ZNXA 1T8TA 1XJ0A 1CJMA 4Q9HA 5E7JA 1U99A 3UWOA 1ZIPA 3TSZA 2DYKA 5AJYA 2OLKA 1CBUA 3CKLA 3VR1A 3VR2A 3VR6A 5CB8A 5KHOC 1FP6A 4PZLA 4MRNA 3IO3A 2OT3B 4QL3A 3THXA 4HAXA 1E4VA 2VP9A 4S35A 5DGXA 1JR3E 3EZFA 3QG1A 1F6BA 4DLXA 2B92A 2I3BA 4DSUA 2IYUA 4RFSB 1AGRA 2K5UA 4YXWD 1GL6A 5IT5A 3KXLA 1OJLA 4W5JA 1XMVA 1TADA 1BYUA 1NLFA 1V43A 3WBJA 3IKJA 3TW4A 2QUZA 4AG6A 3NBZC 2ZJAA 5JI2E 4M22A 1IM2A 1YHNA 5AUQA 1OSNA 3ZH9B 4FW9A 4P4SA 1XJQA 1KI8A 2GBLC 5EE5B 1Z8FA 421PA 4KI0A 3V9PA 4ASUD 2P2LA 2WWWA 3K09A 2NGRA 3FFAA 1G3RA 2QORA 4HYYA 3RYTC 3MFYA 5JCPA 1Z5ZA 5HCIA 3B60A 1AQUA 3H0KA 2FJUA 2GXUA 2PZGA 3QPVA 1JR6A 2ZIAA 2IS6A 4BFTA 4LX0A 2CL0X 1G291 1N2CE 2ZE7A 4G01B 1W46A 1P9RA 4EJSB 4IKEA 2F55A 4DLVA 2WSSD 1LW7A 1ZMXA 3MSXA 4Q4AB 4CGZA 2WSMA 1G16A 1NY5A 2AK2A 2X19A 5L3VA 2XZOA 1RZ3A 1A82A 3U44A 1I2DA 4KLZA 4DDUA 121PA 1S9DA 4L9WA 4IOKA 4JVNA 1KI4A 4NYJR 3MCAA 3OEHD 2ATVA 4CDGA 1X1RA 3A1WA 3QI2A 1W7AA 5HCNA 5CM8B 3VU9B 3NH6A 5SZJA 1II8B 1E96A 4FIDA 1AA9A 4JJKA 3GLFB 2FEMA 3C8UA 1Q57A 3KDSE 4YDHB 4RY2A 1SULA 3RS3A 3T1OA 2QAGC 1OV4A 4ZKEA 4P32A 3H4MA 2CK3D 4XSGA 5F9HA 2WKPA 4HDCA 2ODWA 1GRNA 1ZIOA 2J0UB 1YR6A 1F60A 4P4TA 1EX7A 3VR4A 4D80A 4DLTA 2C04A 5G41A 1UKYA 2O8BB 1XD8A 1T3HA 2J0VA 3ZZ0A 4D2IA 5K8IA 1S1MA 2GCOB 1E1QA 4GFDA 3VKGA 1AKEA 3L2OB 4B75A 4Q03A 4TTQA 4BGDA 1W36B 1IY2A 2NO9A 1HY3A 4LYFA 2OUKA 2X77A 2RAPA 3MJRA 4PHGA 1KI6B 1JALA 2W2XA 3M4YA 4HAVA 2V54A 5E95A 4Q4LA 1DAKA 1HT2E 1NVUQ 2E87A 1OXVA 1F3OA 3W8NA 3PFIA 4E03A 4TSFA 1ZD1A 4XD7D 4GNKA 4MQBA 1GDDA 1QVAA 2KBFA 2ZI7A 4AURA 1DAMA 5L3QB 3SS8A 3BB4A 4NDZA 1XJCA 2GCNA 1XPOA 5AUOB 1X8JA 4IFBA 1M7BA 2IHYA 2VF7A 1ESMA 3OF5A 5EP1A 2ZRGA 4HUQA 1T4GA 1KMQA 3DDCA 2AKAB 3DHWC 1NF3A 4CRWB 1DAIA 4G5RA 1YZUA 2PLFA 1CR2A 4ZDJA 3WNBA 4GL2A 3IBGA 2FE4A 3MMPA 4C9BA 2YYZA 1X86B 4MUAA 1D5CA 2R6FA 1WBDA 3W5IA 2WJJA 3AP2A 3QF7A 4ESVA 2DCUA 3NXSA 5CDFE 4JLPA 4L4UA 3ZIAA 4EPTA 2QL6A 4OHVA 3RC3A 2IEZA 1DG3A 1QG4A 1W4BA 3GJ8A 2DWPA 3THXB 1RKBA 2A5YB 1P9WA 2OO7A 3I5XA 2YKGA 4KU4A 3V00A 5FPYA 1AIPA 3W3AA 3QKUA 1YZQA 2J0SA 2G83A 5IK2D 1G5PA 3SYKA 4A8JA 4G5GA 3HJNA 4F38A 5CIQA 1YR9A 3IDQA 1LS6A 1P7CA 1Q22A 1YZTA 2VP0A 2QA5A 3PEVA 3Q7PA 1SXJD 3AF2A 4FWTA 2JJ1A 1FP7A 4Q19A 3KKQA 1TEVA 4P4SB 2O0KA 4A15A 4CEIA 3WYFA 1T5LA 4C0QC 1XEWX 4AK9A 2C8VA 4LPSA 4LBZA 4M1TA 3CPHA 4OI4A 4Q5IA 3SE0A 2MSEB 3W6PA 5JMTA 1NKTA 2WWXA 3QBVA 1VCIA 3A8TA 4XJXA 5B57C 5FUWA 1KHTA 4Q1AA 3QVUA 4TYPA 4L8GA 3GJ6A 3QKSA 3TIFA 1VECA 1YR7A 4XOIA 3RNLA 4AKEA 3M1IA 3LX8A 1K8RA 1A2KC 5C4MA 3GQBA 4ITRC 1OHHD 3LRPA 4UJ3A 1MRSA 1VG8A 4WW0A 4D4JA 2KSQA 2VP4A 1Z0JA 4PSKA 3T34A 4KBFA 2QT1A 2ZYTX 1FX0A 2FFQA 2GNOA 4BZXA 2XTMA 3LLMA 4Q4JB 2XSZD 3Q7QA 1KDPA 3NH9A 1JR3A 3U44B 3PEYA 1L8QA 4L15A 2BWJA 2HYDA 2P65A 3GEIA 1ZC3A 521PA 1PLLA 3OIWA 2B6HA 2GETA 1DELA 4Q01A 2AD1A 1CJTC 2KJQA 4PPNA 3QOFA 5BN5A 3IO5A 3SJCA 3AF1A 1MKYA 1XTQA 4URWR 4ZIRA 1OB2A 2VHJA 1T5IA 2REBA 1UADA 1JNYA 3JZAA 4CEJA 4MDFA 2ORWA 4QG7A 3P26A 2EFHB 3IHLA 2IS4A 4X8HA 4B47A 4EAQA 5BN3A 1KO5A 3Q5DA 1YQTA 1NJGA 1NN1A 2GA8A 1WP9A 2VP5A 2Z0MA 2FF7A 2PX0A 1IN5A 4Z8YA 5FTMA 1Z63A 1XFAA 1Z0FA 3I8SA 5HE8A 1R0XA 4E09A 1OKKD 3ICQB 1NN5A 3QENA 4TZ6A 1UKEA 1NJFA 3P20A 2P0EA 3R8CA 4JYBA 5EUMA 1G18A 1YVDA 2GZHA 1GUAA 1YZKA 2C95A 3G5UA 1NMYA 1S4QA 2RMKA 4TMTA 3WMFA 4B34A 1TF7A 5KO2A 1HA3A 4P31A 2JIZD 1J99A 2GJ8A 4X8MA 2PEYA 3K9LA 3WMEA 4PX9A 4JYCA 2QAGA 1OFHA 1XEXA 4V0OA 2QY9A 5FR1A 1SKYB 1G8HA 1QZXA 2W58A 3BXZA 2J45A 3I8XA 1J90A 4AD8A 2IT1A 2DFNA 2X1VA 2WMOB 2G1KA 2XNDD 3TR0A 4D4KA 4DLSA 1JQLB 4A9AA 2GAAA 3MUFA 4QNRA 4C2UA 4C0SA 2ATXA 3LXRA 3WP0A 1TPZA 4HUQB 2FU5C 1OH6A 2QI9C 1XCGB 1UBFA 2V8OA 2Z43A 2QPTA 3CH4B 3GJ5A 5JWHA 2H16A 1ZC4A 1VTKA 1QHYA 1Z0DA 3QNUA 2WJVA 4XTRA 2HEIA 4CYMA 3GFOA 3DKPA 4A0GA 5ELXA 1S3SA 2F1RA 2GVDC 4X8OA 4OK6A 2IEYA 3WNCA 5E3HA 1IONA 1OFIA 2QRZA 3A58B 4V0NA 3U3OA 1XF9A 3J81k 1JJ7A 5KDDA 2ZS7A 2ZJZA 4G0NA 3AVPA 1CULC 5CLQA 5IDVA 1GITA 3SBEA 2GZDA 4YMTA 3PUXA 3H1TA 5DI9A 1DS6A 1U8ZA 3K8YA 2WZQA 1XWIA 4IFEA 4PHHA 3RS2A 1J70A 4AYXA 4EFNA 1TUEA 3MWLA 5LD2C 1E1RA 1LB1B 1VYUA 2F1JA 4DLUA 1SVOA 2A3RA 4UNPA 2CEAA 2QE7A 3CZPA 2ZRBA 2ANBA 4A8JB 3C5CA 3NHBA 5A5GA 4D25A 2ZU6A 1EFRD 4IVRA 2PCJA 2QSZA 2ZANA 5CLLA 4ZO4A 4PANA 1U0LA 4CEIB 3U61B 5LDDC 1H8HD 4ARZA 1E0KA 5JECA 1CTQA 1I4DD 2O8DA 2D7CA 2QENA 1FNMA 1Q0UA 5DN6D 1FTNA 1G7TA 2W0SA 1ANKA 1KSGA 3QKSB 2VIIA 4KFRA 3AKCA 2V55B 2YZ2A 1KY3A 3EPLA 2RGCA 4LI0A 4MKGA 1MRNA 3RWOA 5D3MA 3VFDA 1IN7A 5FBLB 3SFVA 3FHOA 2QM7A 3ND8A 4E22A 3QXCA 2CXXA 3SC3A 1FX0B 3Q3JB 4UXIA 4OKSA 2DHRA 2F9MA 4EPWA 4PAOA 2QTHA 3BAFA 1CIPA 1T0HB 4DLZA 2JJ8A 4G5QA 4B3DA 4DIDA 1N5JA 2H5EA 1OPXA 3QXXA 1P61B 3NDPA 1OXTA 1GNQA 4IDPA 1MO6A 1TQ4A 4ZIRB 3ECCA 2IYSA 3I92A 2HLDA 1S9HA 2VP2A 2ZI6A 5FFMA 3O8CA 1OB5A 5TV2A 3BH7A 2PZEA 1HURA 4OK3A 2XX3A 3RS7A 3UATA 1ZM4A 2CE7A 5FH9A 3RSOA 2XGJA 3REFA 3W34A 1P75A 2O5VA 3KFXA 1NIPA 3KUCA 1KJZA 2PZFA 5FOSA 3CRVA 1W5TA 3RVBA 4LJ4A 3C4JA 2ECKA 4IVPA 1TEXA 3HPRA 3Q5EA 3PUZA 5EXPA 5FPHA 2WIBA 2HJVA 3L82B 3PIRA 1IJFA 2QAGB 3QEOA 1XEXB 2LWIA 4KHZA 3LV8A 4TYQA 4AKHA 2GVZC 2RHMA 3W6OA 1SQ5A 5AJVB 4XVRA 2GEVA 1ZBDA 2VH5R 4AYWA 2H57A 1IXRC 1XEWY 4C30A 4A82A 1KK3A 4DDTA 4NU0A 3SEAA 1R0WA 2JDID 1U0HC 4RCYA 2QP9X 4K46A 1BMFA 4OHXA 4OHYA 3VX4A 2F9LA 2VTKA 1GNRA 4Q7MB 4EPVA 4F4IA 6Q21A 1E9BA 1Z0IA 4PFSA 1DO2A 2VQSA 3PEWA 1E9EA 4Z1MA 2IYWA 4LPKA 5KDOA 3LD9A 2Q0HA 3FMFA 1KTVA 3HWSA 3O8RA 2LCFA 2XZPA 4LV8B 1PUIA 1TQDA 4DDWA 4YLGA 5CJPA 4FMDF 2QBYA 4PR0A 1E2GA 2FFHA 5KU1A 1N6LA 3P32A 5CIWA 5SZKB 4IOLA 3TUJC 1MR3F 3I61A 3B7GA 2EWVA 1P60A 5J4YA 3CZQA 4RFSA 1AZTA 4JKYA 1US8A 3GFTA 4QGAA 4D81A 3QXSA 2ZJOA 3L0IB 1W0JA 3D3QA 2AXPA 1ESNA 2GTPA 3NIBA 1PLJA 3N70A 4I81A 3H86A 3I32A 4PZZA 4DWJA 4TYWA 1FNNA 2WBLC 1N6HA 1SXJE 1W0KD 4JKIA 3F3YA 1SVLA 4JLAA 3NHAA 4WXPA 4RFVA 5H1YA 3SR0A 4TN1A 3DEFA 2PJRA 3FB4A 2BMFA 4ARZB 4B3GA 3OESA 2V9PA 1Z29A 4JBXA 3B1WA 2O8DB 3I1FA 4JLOA 1E99A 4PQYA 4DSTA 4TT3D 2GK6A 1GM5A 4ZDKA 1JAHA 1AGPA 2EQBA 2V1XA 1HQCA 2Z4RA 4A0RA 4BRUA 5CITA 2WTUA 4LYHA 4HDQB 3TSWA 1NIJA 2G88A 4US2R 1G41A 1SXJC 5EE9A 5HZKA 3DMNA 3KX2A 4M1OA 1Z6GA 2CHGA 1U9IC 4R2HA 3KXKA 5D3MB 4LYJA 3A4NA 2BV3A 4PHTA 1KDRA 4PXAA 4C3ZA 4BWYA 5GJWC 1HTWA 4PPQA 2OHFA 1M8PA 1ZINA 4MITA 3F0TA 2ZRHA 1RRCA 2DY1A 2QSYA 2PT5A 3KKMA 4XVUA 5F3WB 3NEJA 1NMXA 1E2IA 3UKDA 4B2IA 5IF9A 3A1SA 3W9YA 3DL0A 4YXWA 5CB6A 2IUTA 5HKKD 1LF0A 3AEZA 3TVDA 4QRHA 4RD3A 5FOVA 5CJ2A 1GZSA 221PA 3WMGA 3TVTA 1CF4A 2OCAA 1L2TA 3ZD7A 4NH0A 3FKSD 4BFZA 3GJ0A 1BOFA 2EWWA 2Q6TA 1W4AA
chains in the Genus database with same CATH superfamily
621PA 1RM4A 3F71A 1Q2UA 5IUKC 3CSDA 1E5VA 1K6XA 1XCPA 2BLLA 1WL8A 2GAOA 2YHIB 2VDQB 3CPSA 4FBLA 1DKOA 4P7GA 2DUMA 2XYHA 3DEJA 4Y2PA 2C3PA 2NU7B 3UYLA 5I51A 1DV1A 2O5RA 2PGIA 2O8BA 2A0KA 4HRXA 2C1EA 3HCOA 1GLVA 1ECFA 4EF6A 1CFJA 3CUEF 1OXSC 1XZFA 3A05A 3DDSA 4FGSA 2W6QA 4KGZA 1SC4A 3T5BA 3VMFA 3G8BA 4ZI2A 3NWPA 1PW5A 5CT8A 1V8ZA 4OG2A 1ZIDA 2UZ3A 2BTQA 3P2OA 4U6SA 3OKFA 4PICA 1NATA 1PCXA 1W1WA 1CT9A 1W1IA 5E9WA 2WDPA 5KVVA 2FN3A 5M29A 2QUKA 1JG1A 2IP4A 4ZCQA 2PS3A 4QAQA 3HN6A 5KQMA 2HTFA 3I5UA 4YFYA 2WM8A 4C6RA 1R6XA 3D8SA 3PCTA 3L4KA 3EEFA 4MGZR 2CYAA 5FJJA 4BECA 4XYMA 2QRVB 1BCRA 3FMVA 4ZXPA 4UQOA 4B31A 1WUHS 4AXBA 1Q6YA 2F3TA 1L7XA 3VYVA 2CCJA 4DW8A 1V1RA 3AO0B 3U4AA 4J16C 3M33A 1W34A 1ZCBA 3W8DA 4NE7A 4PPYA 1L7BA 4MR9B 4DLKA 3CINA 4MIKA 4AT1A 2O4CA 5DGDA 2ZAOA 1JEQA 3C8MA 4ZVNA 2BGLA 1JHDA 1O96A 4ZC1A 5I9NA 3AP1A 3C8DA 4FFDA 4XUEA 3X0DA 5J2UF 4NS4A 3ZCSA 1AD2A 3FRJA 1DEKA 1FY2A 3AI3A 5E9QA 4YMUA 1IMJA 1GTL1 3K53A 1D2EA 3D5TA 4L6CA 3ZY6A 3R9XA 3ESXA 1T4DA 3UFXA 4M86A 1Z22A 4H7FA 1L8XA 4Q7KA 3DF9A 5GJCA 3LWZA 5AOVA 1JQAA 4AQ7A 1ZJZA 2X6RA 2PE5A 1H85A 1DOZA 1TRKA 1KY4A 1RTTA 2C5SA 3KHTA 4Y18A 4BMYA 1JG7A 1K5DA 1YMVA 4BO5A 2YYSA 1PV1A 1P39A 3A4LA 4JUIA 1ZK1A 2ZAMA 4RSGA 1F12A 4NZYA 3A10A 2ARKA 5K1ZA 3RRNA 3TD6A 5EHGA 2OAQ1 2I7VA 2BUCA 4QGSA 3AKDA 2EF0A 2YZKA 2E4ZA 4XD7A 4DSNA 1O03A 1U2GC 2EFCB 2AUNA 4RK6A 4U7PB 1G20E 2VO1A 1XZGA 2ZR9A 4MW5A 1W96A 3CNLA 4EO7A 4B3JA 1F9AA 2HDWA 4BCDA 1AHIA 2JJ2D 1IL0A 2AR0A 4UEJA 5C37A 3G9UA 3TG2A 1M5UA 4FDLA 4L76A 5CDYA 2IF0A 3FMOB 4X7PA 3EXEB 3KKPA 1OLUB 1DRKA 3C7AA 2V96A 4LS3A 4Q66C 4RO0A 5DBOA 4HHEA 4M60A 1FUUA 5A6SA 5BW4A 4LXYA 2AT1A 2FSVC 3EAGA 3KTDA 1VL2A 4HVAA 3NZEA 1P2GA 1TCVA 2C2HA 4XEHA 4CF7A 3LO5A 5IJZA 1IWPB 1XZJA 2ZGVA 4EI7A 5L7WA 1NP7A 4CN8A 2OTCA 2Y77A 1ZI9A 2VZ8A 4JI2B 2PMFA 3QELB 3PU6A 1ENYA 3UAOA 2P3SA 4PWYA 2CNWD 3T0IA 4N7MA 5EJFA 1TFRA 2NZJA 3BKXA 5H83A 1KZGB 2YBDA 2PWPA 3AF4A 3BTOA 1R0KA 4G67A 3IHKA 2ILTA 3H9UA 1TQ6A 4OHOA 2FE1A 2OV3A 3FPAA 1KMHB 1W5AA 3MMNA 2OSBA 5KNBD 4ZOLB 1GGNA 2OEPA 1RHUA 1USKA 2C99A 2GD2A 3TRKA 1GNSA 1LU9A 3REQB 2VSXA 3OTHA 1XHEA 3WLAA 4UTXA 2G0TA 3WY9A 1DRUA 2YNMA 4KN8A 4F4CA 4AKIA 2G77B 1SPBS 2A7QA 1JPNA 1Y6RA 2X0IA 3H84A 2IHBA 5CAEB 2HO4A 4OGFA 4Q93A 3RKUA 3VHXA 4ETIA 5C2JB 2PO5A 4OCZA 3O3NB 1NL3A 5E9JA 2WIAA 4GZMA 4NEGA 1Z39A 3WL3A 1UPFA 3NAGA 3ADDA 2YN0A 4KKXB 2OBNA 1Z08A 2VSFA 1MU0A 2QU7A 3GFPA 3WLNA 3GFVA 2J3EA 2WSYB 2Q7OE 3QSYA 3MOIA 4QHTA 1T3ZA 4PLWA 1C8KA 2Y1DA 4UTRA 2X7JA 1OMOA 1TJYA 3DUWA 4OFBA 1OGIA 3NATA 5AI8A 2BR4A 2RGEA 3LUGA 1NVTA 2Q29A 2JJYA 5C7IO 4YMWA 1PQ4A 4Z2AA 3IOYA 3SY8A 1IJEA 4EG3A 5JXHA 1TAUA 3GJYA 3A9TA 1C14A 5K9ZA 5DISB 3P52A 3JYQA 8LDHA 1E94E 1LRLA 3TNLA 2BTQB 3E1SA 3M1LA 1OHHA 4KWEA 1HLGA 1K86A 3FF1A 4M9XA 4EY6A 1SUWA 4FYHA 3M70A 1IQUA 1X13A 2QKYA 4DCUA 4EBBA 4HFRA 2TMGA 2ZUDA 4X90A 4AJEA 4JBWA 4GZ6A 4OIMA 1MJNA 3QQPA 1BVHA 4YP7A 1L4LA 4GX5A 1M9NA 4KOAA 1QHXA 2KI5A 1N5DA 2ZB3A 2Q0QA 2IPNA 3LXMA 1V8PA 3A2MA 4QT0A 1XFDA 1SPXA 4PX3A 4KIGA 3MCWA 5FWAA 1HYEA 3NU1A 4FR5A 1BCRB 4IO0A 3K9FC 3WRWA 2P1DA 4R2KA 5EXEA 1WRBA 4EZBA 1V1RB 1DT5A 3ASUA 4H6WA 1K08A 2FEXA 4TKUA 5F7JA 3H4IA 1G8MA 3GMDA 1OH8A 3AHIA 4L02A 4BKMA 1O5OA 1YZGA 5D5HA 1MTOA 3VPFA 4IMJB 4HX5A 3EOBI 1XZAA 1NYTA 3FJOA 1JEQB 4PG5A 4B6FA 2CY0A 3FWHA 1O96B 4Y1GA 2EYUA 4IVQA 4FLFA 4RGBA 2Z95A 4U8HA 4B48A 4BZWA 4YAFA 1N8KA 1ONBA 1P5FA 1W87A 1I14A 1XGKA 2JAWA 2XD9A 3O8NA 4L16A 4LNHA 3PZRA 4QRIA 4LDZA 4TMKA 3VTZA 3ZHOA 4Y9UA 3R9XB 1ND6A 4I36A 1NC1A 3UFXB 2VATA 1WW8A 1U9YA 3CEAA 3O2NA 4DQLA 2SNIE 2VQFB 1CZKA 4BO1A 1JL3A 1XL0A 5CVEA 3VKWA 1CNFA 4MKHA 1G5TA 3Q1LA 3NOVA 4KHPB 2ZI3A 2NQ2C 1AO0A 4ER6A 1PJZA 4H77A 4BNTA 1UDRA 4QTXA 2B8NA 3LVBA 2RIPA 4WKNA 1NV8A 2JLYA 2J41A 1GQOA 2JIZA 2PWBA 2Q41A 5TQ0A 3F8WA 2C4TA 3BWEA 4MKXA 2O8VA 3D31A 1H3EA 1PVOA 2GN4A 3L5KA 4UMFA 3DMDA 5H3LA 5IF3A 5JXWA 3TR5A 1T43A 1UAYA 4DB4A 3BE4A 1EVKA 4I50A 3NANA 2HNBA 3LF1A 1CRLA 3L5OA 4DLYA 1IH8A 4JIMA 3RTBA 1ISGA 2YX1A 1CK4A 5KTPA 2PQ6A 3BMQA 3HBLA 1I80A 4XTCS 3UUWA 4BE9A 2GF9A 3ESDA 2L82A 4BVBA 4JVLA 1YKFA 1IUKA 1XJWA 1T1IA 1VBMA 2I8AA 1WCIA 5ADUS 1PYGA 3N7AA 1DUSA 1NLZA 2FFAA 4KQEA 5BSTA 2YV3A 4M99A 2VWGA 1IHYA 4FCCA 2X0RA 1K9SA 4WKGA 1V3UA 4JVMA 5FUVA 1L4MA 5AOCA 1KY2A 3QBEA 3PFKA 3TIIA 4DZTA 5BPHA 1MPXA 2ZUBA 5A6SB 4A92A 2XMDA 2ZTLA 2X13A 2VK1A 2UZAA 4E08A 1EGHA 4K81B 5BXQC 1E7WA 4M3NA 1QFZA 1R8QA 2FSGA 2L18A 3GNLA 3EG5A 4H1HA 4HBZA 3S68A 3UBTA 2Q9AA 1SD1A 4BUCA 3D3EA 2FKNA 1ISMA 3I37X 4I9NA 2GPTA 4I1OA 1EFDN 2WIKA 4F4JA 1K66A 1LC3A 3FD8A 3VPHA 4RK1A 2P68A 1IOWA 1V7PC 3QSGA 3L3BA 1PRYA 4UPVA 1ZN8A 3HXTA 4NCJA 1LSUA 2C82A 3D7NA 4ESHA 5BSVA 3DLPX 1D2RA 1KORA 2X3FA 1HV8A 1JI3A 1T2NA 1U7TA 4FMDB 1T9DA 4K5QA 1T91A 4G24A 4KV9A 4MB0A 4XQGA 1AG9A 2XYPA 3WGVA 2A5JA 4EG7A 1Q74A 1I6WA 4ZCMA 1RRKA 5L6MB 2W6JD 2FY8A 1UINA 5GADl 3NRBA 4KAJA 3VHXB 5AK5A 4RHEA 3WNDA 3GRFA 2HJHA 3OTOB 3OPNA 4BB6A 3NDBB 2H8KA 2ODBA 3X1DA 2JFYA 5EGSA 1Z5GA 4FXOA 2ZUSA 1QVRA 1BZYA 1OZGA 2YJ5A 3MWYW 2PUJA 2TSYB 3H3JA 3UAVA 4DR1B 2Y6UA 1KJJA 2C9YA 1NSFA 3G8CA 2NUBA 1QCYA 3GLUA 2OORA 3Q7SA 4MUMA 4GXTA 4OIFA 1P9NA 4UZSA 4U2FA 3ZQUA 2Y71A 4HSGA 2HF7A 3AJ9A 2V4MA 2Y9MB 2GAIA 4I19A 1MZPA 2BJWA 3E7WA 4OQFA 1V5FA 4FNAA 3ZI7A 5BXYA 2QMYA 2RBGA 4UHFA 2UZ4A 4KE9A 3COYA 3KXDA 1V26A 1JLLA 3GWGA 1E7QA 4PX5A 4Z54A 2JVJA 4M1SA 2XDYA 4WVLA 3T9CA 2H2FA 1OYVA 3FUVA 1P33A 4QU8A 2FRVA 3RFUA 4DDMA 2BFAA 3QWFA 2P6UA 1JBKA 4B7AA 1VHDA 2I4TA 3LKVA 2VBCA 2Q0SA 2KE5A 2WUGA 1J8YF 3PEUA 2AC2A 1JJVA 4E5DA 2AJCA 2BFPA 2DFPA 4HNSA 5KSYA 1L8LA 4Q1BA 3TDMA 4H7JA 2VHEA 4II7A 2B98A 2G7ZA 1H4VB 4U5XA 4B3SB 3PB3A 3V4LA 2Q1XA 4CL8A 3W9SA 1W5SA 2GMWA 3JQAA 5IJXA 1EGQA 1M83A 3TXYA 5JRZA 5ICMA 2KW5A 1M5TA 2HJ9A 4HWTA 1ICIA 2C4HA 2WHXA 4JUFA 3BXEA 2W70A 3HB5X 2ZSDA 3UBMA 3VO1A 4HLNA 2EP8A 3BGOS 3GLSA 3BF8A 3NHKA 5TMEA 5JCZA 1IUOA 4TKUB 1G6KA 4KGDA 2OP1A 4FGKA 4PFQA 4WLEA 3WQBA 3ORHA 4G4IA 5CB0A 1AE1A 3QV1A 4KMRA 4W82A 2WB2A 4KWCA 5CX4A 1TM2A 2VNHA 3U0VA 1LPMA 4TV9F 4F93B 4F97A 1Q44A 2ONKA 3R40A 1NRJB 2VZEA 4RABA 1RMYA 3TX6A 1IBMB 3R20A 4FPXA 4FB4A 3HLTA 1V2GA 4MS3A 1F8UA 3TLZA 5KX5F 3HJBA 4GEKA 3P9IA 1JG2A 2II6A 5DNYB 1E1DA 1X8KA 2NACA 1UIRA 1RVDA 1JEYA 4N3GA 2D74A 4GQIA 3PHLA 4WY2A 3T7KA 4NC9A 2WJAA 2XGSA 1SBHA 4HDRA 2GYVA 1XEFA 5LXTA 3D54D 4DCSA 1EHYA 3RK1A 4BX0A 1GTZA 4XI9A 3ESAA 1I1QB 4Y1FA 4LF8B 3IBCA 3QBTA 3W2HA 5ER6A 1M8FA 1QQ5A 1WTAA 5CDUA 2FSIA 5TQ0B 2WWVD 3JV7A 3QX8A 3TK1A 4L3WA 4RGQA 5ALLA 4BU0A 1TU0A 1WU8A 2C59A 4PPGA 3SSAA 3G82C 3QLUC 5FHRA 3OE7D 1OBHA 1RWBA 4JGBA 4M89A 3HTXA 2YOFA 3IE2A 2VCYA 3CVXA 2ZRFA 4I50B 3WLKX 5COAA 3UICA 2JLZA 3C3WA 1IPEA 3KELA 4YRGA 4GKVA 3MAJA 4DR2B 2Y92A 1CLEA 2FG7C 3BMQB 3LWNA 3OTGA 4JWKA 4J0FA 4WBXC 4MLDA 3TKYA 5JD3A 4DNXA 3VJKA 5FDFA 4GBMA 5I7AA 4J0IA 2CF5A 1WWKA 2WTNA 1WCIB 1GCGA 1JRLA 4M37A 1RMQA 2IYYA 5AI6A 4DNOA 4GMFA 3L0OA 4QTUB 2DFVA 1EDEA 3ITDA 2XXBA 5LZ7A 4MVJM 2VK4A 4CN9A 1ZM7A 3W79A 4DFDA 4R9SA 3P9RA 4BWFB 4AMZA 2VAPA 2WYWA 3P96A 2XMSA 5KCZA 1SHLA 1SIUA 2V5VA 4GI2A 3SBDA 3JQDA 3OMLA 4KQGA 1GYPA 4D6PA 1YS6A 3FOZA 1GY8A 1IB0A 5KNBH 4N41A 3OZTA 5A4KA 4YMGA 3JZDA 2BI7A 1QS0A 3TQHA 3HYTA 1JHQA 1Y48E 2CVPA 3EEBA 4UDXX 5DT2A 1HRDA 1P7VA 3RT7A 3UHAA 4LY6A 4HNTA 3OICA 5GAJA 3DLTA 4G63A 3SDBA 1OW3B 4UOEA 1XU4A 2JLRA 4C4AA 2EW2A 3IEMA 1ISJA 1PQUA 1P3Y1 4HGPA 4BP8A 5KTYA 2C4VA 1VXOA 2Z9CA 3KBOA 5D5QA 1LLCA 4F5WA 1IHDA 1OCEA 5ERGB 1YQEA 3RWMB 3TZQA 4X64B 3L7YA 3ACBA 1E6EA 3F5QA 3IAHA 4JEHA 2Z8ZA 2QT0A 4BN4A 4JI6B 2OM2A 4FXPA 2TYSB 2QDXA 4GRAA 4C05A 1W0KA 2OC9A 1RYNA 3NHZA 4JFAA 4NVRA 2B1JA 4HV4A 2RAUA 4DV4B 5AICA 3KZ1E 1NBWB 3NTVA 2ZAIA 1BQEA 3PR2B 3RHZA 3COJA 2JLAA 3SS9X 1C7ZA 3LFUA 4HNRA 1FW6A 5J5CA 1PHRA 3A6PC 3IOMA 3ZJTA 3IQZA 1ZXBA 5JAPA 2QTCA 1N78A 2ZUCA 1U6KA 4TT3A 4U9IS 4NARA 5TEVA 3A4IA 5CBKA 1GOTA 3EWIA 4QECA 5AK0A 4RTOA 4N03A 2FMIA 1Z9BA 3IPRA 3PICA 2NYVA 5HFAA 1JLLB 3L79A 1GG2A 1HL7A 3HP1A 5FTJA 4FYPA 5BQPA 3DLCA 3OHSX 3GUCA 4AAYA 2F3RA 3PD1A 1K3UB 3KQTA 1DMSA 2VPYA 1J20A 1JDTA 2CL6X 2J9GA 3ETHA 3ON5A 4KQMA 4WNAB 4LNAA 3W2EA 2XA2A 5KHAA 1P62B 4WEOA 3IIKA 1IK6A 3HH8A 4OL9A 1CEYA 3PHIA 3TTSA 3N58A 1H3FA 3EXIA 3GIDA 4FYMA 2EJWA 2IEAA 4DG9A 1EQUA 1R5BA 3GGPA 1Q14A 3KHSA 4P4NA 4WCFA 4DLWA 5JSFA 1U0OC 4D6XA 1SN7A 3ETCA 4R2XA 5BW6B 3GYGA 5BP7A 2O8FA 2EGUA 2X6QA 4WTOA 1EGMB 3JQAB 4P81A 3UG6A 1LBHA 3FW1A 2FSSA 2BC9A 2J3LA 4BQFA 2Q6VA 3CJQA 1TM7E 1U1EA 1M1NA 2QTFA 3A1CA 3Q3IA 4QXOA 1P4SA 1H1DA 2RKBA 2FWIA 1PR3A 4BNKA 3CVWA 3TQOA 2FZCA 1XVAA 2KX7A 1IXSB 3IELA 4FN4A 2F4VB 1MC4A 1GG8A 4TQGA 5SYMA 2AS0A 5TIIA 2AEMA 3H2KA 2HXGA 3TW6A 2MTBA 3TKAA 2YWGA 4MS3B 2RBKA 1Q50A 3IAFA 4XASA 1APBA 2G82A 4PN3A 3UGJA 1Z36A 2BHTA 2RAVA 4B5LA 2OG2A 1HE5A 1Q1AA 3LBNA 3NFYA 1JEYB 2V7WA 3COZA 3DULA 2A9KA 4MIEA 3WIOA 4V1CA 1XI2A 2I4IA 4F5DA 1EDBA 4HDRB 4TRNA 4Y1RA 5LXTB 2P6MA 5U4XA 4G23A 4D9CA 4X65B 3Q9UA 4MYDA 4F4HA 4C4SA 4BIIA 2VNSA 1KC1A 3BM5A 2DERA 1EA7A 3TRFA 1XN4A 5C5EA 4K2AA 3G8AA 3QQ5A 3H5OA 2ZJ7A 3A06A 1M1YE 1BD3A 2O8CB 4WKBA 3OX4A 4ED9A 3TGPA 4YGYA 2NNWB 2XWQA 3MRSA 4UEKA 3ZHTA 2XB2A 3RANA 2XE4A 4BNJA 2OCLA 1PLKA 1SBQA 2YUTA 1N0HA 2X7HA 3AH8A 3HBAA 4MJLA 4RCVA 2R44A 4RZ2A 1ZK3A 5ER9A 4B32A 1GDHA 2JZOA 3RVJA 3V1KA 3BIWA 2B8JA 3F67A 3I3OA 4RVCA 1H42A 2IV7A 2HR1A 4K0KB 2BZ1A 2RHRA 1ULHA 1HFKA 1U28C 2VPPA 1QH1A 4ZU6X 2WDZA 2BMDA 2CDRA 2HA3A 2GN9A 3QXHA 1U2ZA 4P8RA 3TPZA 1DZ3A 1PT5A 3BXXA 3OZRA 4P83A 1YAJA 4B3BA 4JGGA 2B6NA 3DNFA 3ELWA 2CFSA 1IIRA 1S2IA 1SHTX 2EFEB 1P2UA 3FPEA 4GSKA 3UENA 4PYOA 4EA9A 4QGFA 4YCAA 3SD7A 4Q9IA 2XMCA 4M0UA 4CM4A 1E3MA 3W7AA 3KYCA 4JENA 3LC7O 5EXSA 5JCJD 1GGEA 1GCOA 4JR2A 3IMCA 4UTPA 1GPAA 4BBJA 3EX7C 2FUEA 3UKOA 5LQNA 4YRPA 3OBBA 5JJKA 1I3CA 1H9CA 4KYTA 2WNIA 5CLFA 1KMCA 4CM1A 4Q9DA 1PJRA 3PITA 4QBFA 2P6PA 1QS0B 2JK0A 1MC1A 3F78A 3L46A 1MB0A 2D4HA 3CKMA 2VJQA 4A8PA 1Q2XA 3NTQA 2GFIA 1F1BA 1E5LA 3LCUA 2C7GA 4FSDA 4J7AA 4PS1A 4G9EA 1KZ4A 1ZH6A 1SVNA 3CUVA 4LFAB 1ST2A 1DO0A 2YJTD 4FHCA 1TMKA 2C54A 4C6HA 2OQIA 3DVSX 3HA5A 4Y30A 1JZTA 3ZCTA 2C29D 3SM3A 1E2LA 1B74A 3SC4A 3ORRA 1REQA 1NJSA 2HFJA 2J3JA 3C5VA 3PQEA 4TM7A 5F76A 5A6VA 2L0XA 4CKXA 1NVDA 2I6UA 4YWHA 4NPHA 4ZOQI 1CUGA 1VCOA 3I30X 3FYTA 4XWAA 3Q8XB 1NAIA 3CF6R 1M72A 2HA0A 5EJEA 2ZWPA 3G5AA 1U5CA 3KL4A 4B85A 4IXWA 5HTKA 1I1HA 1QU2A 2GWRA 2BR5A 3AGQA 1N5KA 3R7DA 2JJ2A 3G2PA 5B37A 4LBVA 4WN9A 2O3RA 1IPFA 1DKLA 2XT6A 4J3FA 1Z75A 2FX2A 3SX4A 2B2CA 3K0BA 2Y05A 4EHIA 2QJOA 5BUSA 4KAFA 4I1SA 5TT1A 3SHVA 5DTMA 1G8GA 4QPJC 3EF1A 4MPTA 5L95A 2XQVA 3AUXA 3ZWXA 4CIVA 4PYLA 1XROA 2OQ2A 2ZYUX 4KVZA 5DTEA 3HU3A 4RPIA 1KO8A 2R7AA 2YV1A 4JLKA 4U2DA 4DCTA 1CY4A 2Z9BA 3IT3A 3GVXA 2Z5VA 3E53A 2V4UA 3KB6A 4ABYA 2VHYA 3ABSB 3CRRA 2YQZA 3UWDA 2CNWA 3ELUA 4UMVA 5LDGA 2GTIA 1IQRA 4CLXA 4UU7A 2I4NA 3HKBA 3K8QA 3EXIB 3WIBA 1WNFA 5FA6A 1BH6A 3X44A 2VHVA 1CZHA 5L4LA 1KDTA 4WCFB 3SZLA 1HOXA 1IE3A 1OAOA 5KNBA 2IHTA 1R16A 3GUZA 1JU9A 1WF6A 2J46A 3VC3A 2PZBA 2HPVA 3E1GA 4FHFA 2O8FB 3AVQA 1F0NA 1JDZA 3LUFA 4IZ6A 4V3CA 5EGNA 2M6KA 2WIJA 3WRXC 1XPUA 1F2VA 4WKOA 1M1NB 3B7PA 1NQ5A 2NO7A 3A6EA 3C3AA 3GH1A 3QU5A 4G4JA 1SXHA 2QZPA 4JJFA 4KVAA 5FPQA 4BOYA 4R8KA 4DEVA 2ZETA 4FKMA 2PKXA 2IU3A 3IYLW 4JXJA 5DM0A 5TVGA 1JPJA 3QMVA 5C8YF 1Y4DE 1D9XA 2VYVD 3D4PA 4ND2A 1PR9A 1NW9B 2FEOA 1EU1A 1GNPA 1R6DA 1E8DA 1X94A 4NCIA 3O8DA 2H54A 2QS9A 2CJWA 4E4RA 4EY5A 3IL2A 1TD9A 1Z2OX 3IIMA 4REMA 2H18A 2CT8A 3F47A 5H02A 2JIBA 1DAOA 5JXIA 2HF9A 5JS6A 4A10A 4NR0A 1YKSA 4ZGGA 1JB9A 4ALNA 4M9CA 4DIUA 5BMVF 4V1CB 1G9XA 3V1TC 5J4VA 1AO3A 3SKVA 4DIBA 4KH0A 2P30A 1PJQA 4F21A 4Y1RB 2NZYA 2OE2A 5KJFA 5DHFA 3BMCA 5B5SA 3G5LA 3UJBA 1JFRA 4TMYA 3VGPA 2YWFA 3M9XA 2PH1A 3BTSA 2DWOA 1OLSA 1SBYA 1ZUD1 1Z6PA 4M9QA 1ISRA 4MOWA 1M0TA 4N0DA 2G8NA 3I23A 1QH8A 1WIWA 1Y34E 4JJIA 3L05A 4EH1A 3C16C 3KOZA 1GGVA 3CR7A 5JI3E 1I5EA 1IHXA 1MFPA 3QF4A 1G64A 1TMGE 3TEJA 1XZMA 4BMZA 5LP6A 2ZYRA 3NPAA 3R75A 3TMKA 3WC4A 1SQ0A 3VC1A 4CMBA 1VHWA 4N0EA 1JXOA 4ROSA 4B6OA 2PFGA 3D4NA 1JFLA 1NYRA 1QH1B 2EBFX 2Q1TA 2DFDA 5E4YA 3CLUC 2FPOA 2LP4Y 2C2YA 3EW7A 5REQA 1Q7GA 3DO5A 2B0JA 3O5AA 2VYCA 4YO7A 4IQ0A 3UOGA 2ZYIA 4ND3A 3U2QA 1M1XB 1XXHE 2YZNA 4Y2HA 5IM5A 3IVAA 4OBEA 4CM4B 3WIVA 2O5EA 3KYCB 4CCYA 5B3JA 4YV1A 2OWEA 4AMUA 3OJXA 2DPXA 3TOCA 1DINA 2G9UA 4U3JA 1E0AA 5HS4A 2PUDA 1TM4E 3C6ZA 1E4YA 1H5QA 4URUR 1T15A 2XJ4A 3DVLA 3GV0A 4JC0A 3GCWA 2BJVA 3ZNPA 3IBFA 3DNMA 5HZHA 5IG2A 1IUPA 2V7QD 4KXYA 2UYGA 4DR5B 2ZJ8A 1R9NA 1ZIXA 4CCSA 1XQXA 2W98A 1NMSA 1CF2O 5AHWA 4BIMA 3LY8A 3AF6A 3SEFA 2R6ZA 4YVFA 1D2HA 4DIKA 3DZ8A 3QEJA 1NXOA 5F5LA 7ADHA 4G25A 1JPVA 1ZUWA 3EPKA 1FQJA 1ES9A 2BVNA 2QN9A 1Z5UA 4OQPA 1FMCA 3L4SO 3L7MA 3E7PA 1FC0A 3HCBA 4WJZA 3DA8A 4MKFA 1O95D 1NVWQ 1NW5A 2Z2IA 4OQDA 4BGVA 1UJ5A 3QKWA 4GH5A 1QOQB 1REQB 1V7ZA 3AR9A 3DFMA 3RGWS 1PU2A 2QN3A 1HQKA 4JLVA 4YRQA 4Y0AA 1MAAA 3QE9Y 3SWWA 1U4NA 3EQ2A 4CQJA 1XKTA 4DMGA 4GM1A 1IOVA 7REQA 3DKRA 1J0DA 4ZVUA 3GL9A 4UXHA 2ZRAA 1S8OA 3C3DA 3MBOA 3QKRA 2CUKA 4M53A 1MF7A 1K8XB 1K7EB 5L51A 4WN9B 5D85A 3VDNB 1NSYA 1UMDA 1Q83A 1OBVA 2FNAA 2Z3ZA 4B76A 1KR2A 2YVUA 2NO4A 1BFUA 4KBGA 4Y2TA 3U6BA 4UARA 3MGGA 4YAWA 1ONOA 4MQMA 4OJMX 5LQDA 3AQ4A 1V8FA 3STVA 1D6MA 2IXBA 2X5NA 2X0DA 3H17A 5JIBA 1UPTA 4KXFB 2CB9A 1KAEA 1R18A 1KNQA 3I6MA 3IAS1 3L0SA 3DW1X 4IJ5A 1YQ9A 4RPKA 3QJYA 3W8FA 4ZK6A 4TYMA 2NUAA 2H31A 1A27A 4FP9A 3HKBB 3KJEA 2XRYA 3EXAA 1KK1A 2D0PB 2Q5FA 1R4NA 3VR6D 4TTPA 4ZAGA 1CY1A 4MTCA 4ZAXA 3P27A 3Q85A 4NS1A 4RCZA 4B8ZA 2R1VA 1O8BA 1JG4A 3I76A 3DDWA 4HGOA 2QNBA 1QIJA 3KPWA 4LDNA 1C3XA 4M8KA 2XF2A 1OZHA 2H4JA 2OXFA 3UQZA 5EKXA 2W6JA 3RU2A 4MTLA 1E2UA 3TL3A 4J3NA 4TVSA 2JGAA 3H2BA 3QMWA 4P53A 4RSMA 4ZVMA 1C9DB 1G21A 1L5HA 3KOWA 3ZC3A 3R9WA 1FNBA 1TMOA 2CJWB 1H0HA 1A5AB 2V5AA 3GN1A 3C87A 1KQNA 3SHFA 3OOEA 1VIDA 2H5JA 2G1UA 3PC4A 3EA4A 1A7KA 2Q5HA 3IQIX 4WZAE 1T8PA 3PD0A 5DGCA 3D8HA 2A9VA 2V7VA 4LSMA 3ZX5A 2GEBA 1GXSA 2GKSA 1KETA 4KE7A 4CLRA 4PNPA 3S55A 3BF7A 2YMMA 4RWZA 5IVKA 4YYEA 1TVCA 3W5AA 4C07A 1DJPA 4WI1A 2FPWA 3BMCB 1YDEA 4C1BA 2KPOA 4EY4A 3U3RA 3G89A 1EJ2A 1E6CA 3OECA 4E5PA 4OV6B 2WJGA 4MDEA 3STYA 1B15A 3NBFA 2CKDA 3HV0A 2EBWA 4V03A 1OLSB 1PS9A 3UJAA 2EFDB 5D3KA 1VIMA 1VLHA 2JGDA 1QH8B 3ZV4A 3P71T 2ZIWB 3GT3A 2P77A 4F46A 4U7WA 3GLGA 1TIKA 3QF4B 4OTZA 2JGJA 2XGOA 5LP6B 3BH0A 3F8SA 2P4QA 3WADA 1Z2EA 1NX6A 1F14A 4WOJA 2RGUA 2BGWA 1SQGA 1ULUA 1OWOA 1PG2A 1N8SA 3EGCA 3UNXA 3ZWVA 4F8EA 1QMPA 2Y0PA 1G9SA 2R4QA 3AUFA 5REQB 1TX4B 4EI8A 1NMEA 3G02A 4IDNA 5LMUB 1Z45A 1AUQA 1E1NA 4BXOA 5DOVA 2RIRA 1FPQA 4K8RB 1KMNA 5C1OA 4E13A 1LDNA 4CCYB 1T25A 3LZCA 3PPYA 4FGJA 1FJXA 2X76A 2XNKA 1E4EA 4OEHA 5F35A 4LE2A 3VHRA 3GXOA 3X1JA 1CR1A 1CXZA 3B1ZA 4U3JB 3T94A 1K92A 3KUDA 3UK6A 5C8YA 1LPBB 2DSTA 5H70A 4RY9A 3WLEA 2WAOA 1A9XA 1K3FA 1F0YA 3H1EA 3M6FA 5ETJA 3H3XA 3JSAA 4DRYA 1KI3A 5JMOA 4R1MA 5F12A 2AL7A 3R6LA 3U7QA 3E5HA 4X85A 2ON6A 2ZSAA 3ZY2A 2GUWA 2OP0A 3OY7A 3M4JA 2GUGA 2WT9A 5M04A 3PLAE 1C2YA 4KQKA 4PGAA 4QULA 2GKOA 4PC1A 4Q1CA 3B82A 4PAMA 4YDRA 2GI4A 1C8BA 3AUYA 2BUAA 2HIGA 4R51A 4QHYA 5DM1A 4B4KA 3UXMA 5A9SA 2VK2A 1UJ4A 4M1ZA 5KDLA 3ST7A 4C5CA 3OE7A 2GQ0A 2C7QA 4D8UA 1KO4A 3L8EA 4JI1B 5ISMA 4DL9A 1ONNA 3QVLA 1P72A 3QH4A 4G8JA 2CLKB 2HCTA 4ZZ2A 3ABOB 3D0QA 1CUCA 7REQB 1EXVA 3IVXA 5LOVA 1R9GA 3QKRB 2FGKA 5MF6A 2J9RA 3FHCB 3DG9A 2HWWA 4W6QA 5DBIA 1Q5PA 5DLQC 1UMDB 4WV3A 2WJYA 4UCQA 2G63A 2R6JA 4X60A 4HMOA 4AUKA 3FNHA 3U4IA 4IS2A 2P4HX 5EIBC 1EFLA 3T9BA 2C4NA 3Q2KA 3KEQA 2OWDA 4RTRA 5DNWA 1SZCA 5T5QA 1SUCA 1AHPA 3W3ZB 5BWBA 1TJ3A 2LGJA 4CUZA 2Q50A 4EYSA 3IAM1 2RK4A 3TQRA 4A5OA 4Q1EA 3INRA 4J1TC 1ZXLA 4WMLA 3JZIA 4N49A 3OZCA 3BFXA 3G2NA 2VOJA 5CGZA 3QMPA 4IP0A 4MV8A 2WZCA 3AJRA 3ROKA 2BM0A 5IDWA 2NUAB 2GD6A 4RH3A 1JXAA 5IM4A 1R4NB 3E70C 1ZM3A 4WWHA 4TRMA 3CJTA 3S40A 3UK7A 4DIFA 4W7IA 5F5NA 4CXMA 2V7BA 2R1VB 1HPLA 2X42A 2HU7A 5B4TA 4HAZA 4Q7LA 2J1LA 1GZUA 4RAOA 1RLMA 5TB5A 3UJ8A 4OA5A 3ZBUA 5KTNA 3LDHA 4DV3B 2B8WA 3DOUA 1W47A 1Z0AA 3IBTA 4H08A 2EG5A 3AEQA 3SZUA 5AVUA 4FDMA 3ERCA 3EOZA 4EJ6A 4A91A 1ZVJA 2H48A 3VYSB 2B21A 1I7PA 3HACA 1N57A 4BFXA 4P7KA 4EKDA 2KBEA 1XQ6A 1KYIA 1GL9B 3V32A 3V9AA 3IEXA 1ZJYA 3HI4A 4RHUA 5ALIA 3VXKA 1G21B 1L5HB 1V71A 4H31A 4I1VA 2C57A 1CY6A 1MVOA 1P2VA 4KC0A 1OFVA 4OHPA 4PV7A 5EJGA 3L1HA 2WWHA 1JQJC 1C0IA 4MWOA 3M82A 1I3NA 2Q3FA 2O7NA 3RGGA 4QT4A 3SE0A 4N76A 4QTTB 3K0HA 2R6CA 4N3AA 3FVVA 2GDZA 2VXCA 1GXSB 3M89A 2VF8A 4XGNA 4CLRB 4YRCA 1HBJA 3KWJA 4OI2A 1W2WB 3EHDA 5KYYA 3LWBA 3V55A 3NALA 3VDQA 3GT0A 1DTEA 2O48X 4RBNA 3VO2A 4B84A 3G6WA 4F3TA 2EEPA 3B3GA 2AX3A 2QG4A 3TW8A 3IAEA 4WE3A 1OGJA 2JGDB 4DEXA 1HR0B 1F4VA 1XMIA 2IXGA 3RC7A 2EKDA 1AF7A 1ZY2A 1B14A 1JR3D 1IUNA 3WB2A 3WLTA 3VOSA 3GLGB 5DHAA 2GASA 1X80A 4K2HA 2QDKA 2J5XA 2BM1A 1TEZA 4DNFA 5DTIA 4INOA 3K4PA 5C4GB 3FUUA 3EEYA 3NEPX 3FHTA 4K3UA 4B2PA 3ME5A 4YJ2F 3H16A 1R5NA 3RJ5A 2V9ZA 5CNMA 1Q17A 2IY7A 1M76A 4BXOB 4FFNA 1P8AA 6ABPA 5B7NA 1VMEA 4PR3A 1SVWA 2QZJA 2R8YA 3Q6MA 1TF5A 2B7CA 3QKTA 5KI6A 3TQQA 4H17A 3RSZA 1ZNWA 2AMVA 3B7WA 3L18A 5K4GA 2PUEA 1E4EB 2ZW9A 4ALLA 2F3SA 3SSNA 3WG9A 4ON9A 1Q0RA 2RKOA 5FPPA 3LNTA 5L3RA 5C8YB 1R27A 2V97A 3L7LA 5F7XA 1U65A 3R41A 1A9XB 1A76A 2B35A 4ZOEA 3UXYA 3TN7A 3DXFA 3BHMA 2C2MA 3K9GA 5BR4A 5CG2A 3SXJA 1UBNA 1ZXXA 3U7QB 3EOAI 3WISA 4ETWA 3QW2A 4QXPA 4YRNA 3N76A 3LK7A 4BO8A 4BLWA 5FV4A 4FR2A 3PDHA 4PTYA 4N48A 4LJAA 4EGJA 1SZJG 1Y3BE 2ID7A 3PNMA 4FHEA 2IF2A 2CJXA 3BFKA 4FMCB 4TMWA 3VI4B 4H6XA 4B40A 3CU5A 4D3SA 3IPCA 3ONEA 1DBSA 4RANA 4MUGA 1TZMA 3L40A 4NZOA 2C61A 1W25A 4AMYA 2YOHA 4QRDA 3V4FA 1RABA 4ZTZB 1GP2A 1IN6A 3L1VA 1RJEA 4ZDIA 2FRDA 4UPDA 1JLKA 1XMOB 1XA0A 3N2KA 4WLVA 4EPYA 1H22A 5LOVB 1UBGA 2CLMB 4K9PA 4ZAYA 2M6LA 1KVSA 3INGA 2GCPA 1ZH0A 3RSQA 3BL8A 5U4QA 1HG1A 5LP1A 1WUIS 1U3GA 1WMAA 5CK5A 4E2XA 2UAGA 4QLOA 1P19A 2FW9A 3AY6A 2CLEB