4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
2VHQA 2QQ0A 1GNQA 1OIXA 4LPSA 4LRWA 4DEYA 1G5PA 2ZE6A 3LWNA 4DUGA 2BBSA 1OV4A 3K0CA 2OCAA 1IONA 1F6BA 3WP0A 4A8JB 4QC2A 4PPNA 4P4SA 1Z6TA 3BFVA 1IXZA 3B2EA 4IEEA 1VKJA 1WF3A 2J7KA 2V54A 2IYTA 2ZSEA 1KOFA 2KSQA 4HEJA 1ZNWA 1R0WA 3EC2A 5AJYA 4DHEA 2Q0HA 1GSIA 4PQYA 3ZGXA 4LV8B 2C5LA 3PVSA 2IYQA 3GEHA 1I4TD 3E2IA 3HR7A 4G0NA 4NPHA 3TW4A 1WXQA 3B1YA 1EXMA 3BH7A 4GI7A 4RFSA 4GMXA 4LOAA 3DEFA 2IL1A 1ESMA 3IPYA 1QG2A 2G1JA 3IBGA 5DIFA 4QBGB 5EQTA 3QUSA 1JQLB 3RABA 2ODBA 2ZRCA 5FOUA 5FTNA 4TMTA 3ZH9B 4D80A 1P9NA 5L3QA 3P4XA 3R7WA 4WXPA 4X8MA 4MYCA 4ZO4A 4QG7A 1FZQA 4ESVA 2W0MA 4TYQA 1F3OA 1NSTA 3F3YA 4O0MA 4U02A 5SZHB 4Q01A 2JCSA 1ZCBA 2YOGA 2GA8A 3RAPR 1VCOA 4AWXA 2WV9A 4HDQB 2IXGA 2GCOB 4FCVA 2HT6A 3EWSA 1VG8A 3L0IB 3QKSB 2F7SA 3Q5DA 1W0JD 5KSOA 3JVVA 2FFBA 3A58B 4JL8A 1CR2A 1JQJC 4TSFA 3EARA 4AKGA 1P61B 1G7CA 4URXR 4BFYA 2VBCA 2RHDA 4UNPA 1TAGA 1KDPA 3KTAB 3O8RA 1ZC4A 2GKSA 1YE8A 3OAAD 3DOFA 1Q1QA 3QKRB 3UXMA 2BMFA 4JLPA 4O2LA 2XOKA 5K8UA 1JJVA 1N6KA 3QBTA 2AHOA 4LJYA 4Q4AA 3UK6A 2AR7A 1E9SA 2WPDD 2ZAMA 3DMDA 2FG5A 1XZPA 1W2GA 2Z43A 1LV7A 1G19A 3F8TA 3N2IA 4PC3A 5KSPA 3VFDA 4XWKA 3AVYA 4LWZA 3WNCA 3QXSA 1G17A 1GIAA 2ZRLA 5HZHA 5B57C 5FPSA 4PC1A 4AYWA 1HT2E 3Q7QA 4XVUA 4M1OA 5BYJA 3RNLA 4FMCB 3IIKA 4TMKA 2WJJA 4JVLA 5A0FA 4BFVA 2HV8A 3ADCA 4B3DA 1N5JA 1QDEA 2I1VB 4PSKA 4HUQB 4C2TA 1VTKA 4C9BA 1HUQA 1P6XA 4YDSA 3CNOA 1D8TA 1ELOA 1GNPA 4KBGA 2GESA 4IDOA 4TT3A 5EE3A 1F48A 4ZDJA 1EWRA 1GL7A 3P27A 1RFLA 3OZXA 1U8ZA 4NYIR 3LLUA 2IS2A 1KZ7B 3NHAA 1RJ9A 1SXJB 4JLJA 4R98A 1XPRA 4LJ4A 2CK3D 3BC1A 3NBXX 1N2CE 2ATVA 4QGAA 1Q1BA 4NYJQ 2JJ2D 2FA9A 2VL7A 4LY6A 4GNKA 4ACBA 1ZUNB 2ANBA 1OXXK 2ZRJA 1S9DA 1VDZA 1N5KA 3AP2A 3TUIC 5J4LA 2YKGA 2A7QA 2BJVA 3EZFA 1AQYA 4URYR 3KQUA 2H8KA 2IX3A 4B6FA 2GJSA 3A8TA 1Q0UA 5CITA 3LVRE 1U98A 2DFLA 1IM2A 4HATA 3MJRA 1LNZA 4AYXA 2JDIA 1GAJA 1E2DA 1KI9A 5FL7A 3WBJA 4UXHA 2RB4A 2DBYA 1ZM3A 3LLMA 2ZI9A 4Q4HB 3KL4A 4HLUC 3FVQA 3IUYA 4DLXA 1YZUA 1U94A 3MGCA 2I1QA 2RGDA 2RGBA 1BOFA 3WY9A 4MYTA 1M34E 2WBLC 1W49A 4PHHA 3WRXC 1E99A 1XEXA 3J81k 1WA5A 2F9LA 3NH6A 3K9HA 3AM1A 2QM8A 1DG1G 2P6NA 2J1LA 4B3BA 2VHUA 4XH9B 1G8GA 3TK1A 1XCMA 2WM9B 1QZXA 2J3EA 3B13B 3ZVNA 4WXRA 1O3YA 4KLZA 1XMIA 2YWEA 4LJ5A 5D3MA 4HB4A 2XX3A 3I5XA 2O8CA 4IFBA 4XTRA 4LBYA 1NIJA 2CXXA 2IF2A 1ZMXA 2ZI5A 4JJZA 4TQ9A 2QGZA 4HLDA 4U5XA 2HXSA 521PA 1UM8A 2ZJBA 3H0KA 1NMYA 2OFWA 2XB4A 2GXAA 3KXIA 4DLSA 5LPNA 4LHXA 4Y0AA 1TQ2A 3MFYA 4QGFA 1F2TB 1TADA 2IF0A 4B43A 1Z8FA 5FBQB 3B7GA 1OT3A 3U7GA 1TEVA 4V0LA 1RC8A 1Z2AA 5EP1A 3I32A 3EIQA 3KJIA 3RWOA 3VHXA 1BO6A 3CX7A 4DLRA 1U8YA 4MQBA 2AD1A 2J45A 4P4SB 2V4ZA 3QBVA 3SE0A 5DYIA 3GLFE 3GJ0A 3MJHA 3OEHA 4PZZA 3AUXA 3U5ZB 4MYHA 4KFRA 1A2KC 1IJFA 2DWOA 2ZYTX 4P31A 4URZR 4QFMA 3QPUA 3GLGE 2D4HA 3K09A 5CM8B 2XOKD 3AF1A 3AKDA 1AGRA 2VP5A 2BWJA 3O8DA 3T1VA 2DY1A 3KKNA 1QHGA 3DM5A 1T5LA 2IEZA 4JYBA 4KXFB 3UWOA 2D62A 1J2JA 1U99A 3MG9A 4BLPA 1OYWA 3H86A 4KFUA 2DR3A 2XITA 4E07A 1KK2A 3GJXC 1UEJA 5L3QB 1FQKA 1E2MA 3FMIA 2VP9A 2B8WA 2A5GA 2QEQA 3R7WB 4CT4B 1CJVC 3N70A 2B7BA 5FI0B 2A5FA 4IFEA 2ERYA 721PA 3C5HA 2F9MA 4HB2A 5GVRA 1XZQA 3A1VA 4L4UA 5KDLA 1GFIA 4KVGA 1KK1A 4AG5A 1WDTA 1X1SA 3KQHA 3FFAA 1FQJA 2IYZA 3QKUA 2PX0A 3HWSA 5J4VA 1KJWA 1U90A 1OPXA 2C9YA 4O2RA 4UNSA 5JLJA 3QXJA 3IEUA 2DFTA 4KU4A 3QPVA 2QUZA 1TMKA 5DE3A 4DDTA 2F1IA 1AKEA 2CLDX 1IJEA 3OIUA 4US0R 2GAOA 1SVWA 1XTSA 2O8DA 1TQ6A 4PPQA 2Z83A 1XTQA 1YKSA 2ZS7A 4OK5A 1RIFA 5AK0A 3Q85A 2RGEA 1N5LA 1NVXQ 3X1YA 4AYTA 3EG5A 1LTQA 1ZU5A 1KI6A 5GJWC 4Q4AB 3K0FB 2XNSA 2QY9A 3BB1A 3R9WA 3NKVA 1G1MA 1TPZA 1W36C 3R9XA 2OCYC 3EZ7A 4PZLA 5A4JA 1KNXA 4LV6A 4TLAA 5BQ5A 3GMTA 3MWJA 1E79D 2GDJA 2OESA 2QN6A 4HYYA 3FDIA 4RD6A 2JDID 4I1UA 1XB2A 4QBFA 4X8LA 3L0SA 2WICA 2WSSD 1E94E 2N1BA 4X8OA 1EGAA 3DMNA 3K70B 1YZNA 1NIPA 1YZGA 2ZRDA 4GOXA 4Q7MB 3THXA 1RRCA 2NOAA 2BMJA 3IQXA 4RVCA 3NEJA 4JLVA 4TMVA 4C30A 2O52A 3TR0A 1VHLA 2XJ4A 3TSOA 3VR6A 3WMFA 1MOZA 3DHWC 1P9RA 1E96A 4DLTA 1RJ9B 1NN0A 4CW7A 5AWFC 2VLIA 4AD8A 1G21E 5DN6A 3THWA 1Z83A 1KMHA 4M1TA 5IF9A 1UBCA 4MUAA 4EFNA 4LHZA 1E3MA 5HCNA 4JJKA 3SR0A 1FUKA 4ZDKA 1D2MA 4A4DA 3KDSE 2KWIA 3DPUA 5HE8A 3VTKA 1KO8A 5E3HA 1E1QD 2J41A 1GOTA 2ZPTX 1RE0A 2YOFA 4MH0R 1Z47A 1Z28A 4FMBB 1E2LA 2BV3A 3LX8A 2GJAA 1IAQA 3PJRA 2J0SA 4IDNA 4V03A 3THYA 1U9IC 4MUBA 3DVLA 3P26A 4YMUA 4CDGA 2OBLA 2JJ1D 2AKAB 1QVAA 4ACAA 1AN0A 1XD9A 2ZAOA 4OHZA 5FPHA 4GP6A 2WHXA 2B8TA 1OW3B 2QT1A 2L0XA 3LQQA 4DDUA 1QRAA 1XEXB 3W5JA 3NBZC 3K0EA 4GZLA 1Z5ZA 1AJEA 3LDAA 5G3ZA 4DWJA 2O8EA 1CLUA 5FTLA 4CVNA 2FEOA 1DAKA 4XSGA 3PXGA 3TVTA 2W83A 2XJ9A 4DLVA 1W4BA 3ZLJA 3IKJA 2OAP1 1EX7A 2NMVA 1U0JA 2OBNA 1P60A 3BJIC 2JLXA 3U4QA 2KBEA 3HU3A 2J5XA 3QXXA 5D3MB 4AC9A 1UBGA 3AQ4A 2X2FA 3EAQA 1VPLA 2JA1A 1W46A 4IKEA 3KKOA 4ZPXA 1UFQA 1I2DA 1E9AA 2W00A 1J8MF 3CZPA 2HF8A 3EZ6A 5FI1B 3W3ZB 3QEOA 2QSZA 2ZUDA 3X1XA 1EG7A 2ZI7A 4OBEA 4QM6A 1I4LD 2NZ8A 4P32A 4BFXA 4XVQA 1VIYA 5JI2E 1KKMA 5EE0A 3ZZUA 3FE2A 1XXHA 3WNBA 2Q9CA 2CBZA 3U3KA 1GRQA 1MO3A 5C18A 4UNRA 3PR1A 3PENA 1Z63A 4B73A 2HLDA 3ASZA 1J90A 3CPEA 5JECA 2J0VA 4TYNA 4KLNA 5LD2C 5F98A 2QGNA 3EA5A 3PEYA 2FN4A 4DSNA 4IHQA 1XX6A 2O8FB 1Q1ZA 3U3OA 1S3SA 2AFHE 4NHOA 3VNUA 1G8PA 2I3BA 2KI5A 2RGAA 3I92A 1OSNA 4Q9IA 3VHLB 5AJWA 4CT5A 3LQRA 3H1TA 1G6OA 2BJWA 4BFWA 1PZNA 1ZD8A 1CF4A 3OIWA 4M2LA 4LBVA 4HDOB 1GKYA 2FZLA 1E0SA 4PTLA 3W8NA 4K8OA 1S1MA 1J7KA 5CYOA 1Q44A 4PSVA 2G88A 5AUQA 4QNRA 2R6FA 2VQSA 1SHKA 2VSOA 3IGFA 1FP7A 3U6BA 1KSHA 4TQUS 3C41J 4IOJA 1JPNA 2CL0X 1Q21A 1NNEA 1QHXA 1ZW6A 4B6EA 3OIVA 1N0UA 1LW7A 3AGQA 5DI3A 1XMJA 2CEAA 1M8PA 3CBQA 3UPUA 3CF2A 1CJMA 4A6PA 1DE0A 2FGJA 4A15A 2IA5A 1X8JA 3KUDA 3RWMB 4JKYA 1E0AA 1BMFD 2GZAA 3TBKA 2Q3HA 2V3CC 5LB4A 5E7IA 3SHFA 2BOVA 1TQDA 2Q9BA 5IK2D 1KNQA 1LF5A 2O8DB 1KTVA 1RW4A 4HZUA 2R6CA 2XZOA 3TUJC 3T5GA 4PPGA 1G16A 3B82A 3NEYA 4OQXA 3TR5A 1W36D 1KI6B 4IW3B 1L2TA 3WBKA 1T91A 1AKYA 2GVZC 3N5CA 3FMOB 2QAGA 2W6ID 1NL3A 2OT3B 2Q6TA 4LHWA 4B48A 2HF9A 4ILEA 1SXJC 2JATA 1VG9B 4FCWA 5E7MA 3VKHA 2EYQA 3R20A 4DLUA 1I2MA 1IBRA 2CVHA 4IEIA 3KX2A 1G3IA 4MKHA 3QJYA 2H18A 3P4YA 1W0JA 4Q9KA 1L4YA 2QBYA 1GTVA 2RGNA 1HEIA 2OCPA 4Q03A 5K8IA 4KYIB 5H8WA 5F2EA 3RHFA 1Q22A 1LVGA 1LF0A 2WJVA 4OQMA 4V0ME 1GM5A 1XEFA 3OAAA 3RC8A 2A3RA 3TSWA 4Q18A 3LBHA 4B71A 3AVXA 1NY6A 2MMGA 2WPDA 1MR3F 2P67A 4RD0A 3THWB 1KMHB 821PA 3EZ2A 1OFHA 4LJ7A 4ABYA 2D74A 3UMFA 3K9GA 1RYHA 2WJGA 3A4LA 4RD1A 2ZREA 5B64A 2IUUA 5JEDA 3QEJA 5JJKA 2NZJA 2XTZA 4L15A 2ZE7A 4EJSB 2BIFA 2DFKB 4FMCF 1G291 4DBLC 4QXAA 3SJBA 1H8ED 2QTHA 4CEIA 1D9XA 2KBFA 3BWDD 3GFTA 5IRCD 2IYWA 2WMOB 4DDVA 1G4AE 1XMSA 5CJ2A 2WMNB 1UDXA 3GLFA 1IQPA 1SKQA 3ADKA 2A5JA 2QP9X 3R8FA 1X8KA 2WIAA 1U8AA 2ZI3A 3GLGA 2HJGA 1E9EA 3U7EB 1SULA 2R6DA 3RSLA 4DKXA 2GBLC 2OLKA 2GETA 2J46A 3BERA 4NYJR 2IWHA 2CK3A 2H17A 1G7RA 1Z0AA 3WXMA 1R4AA 2VP6A 4ARZA 2JJ2A 4UXIA 1XPUA 2OO7A 2C8VA 4KO8A 4KV9A 3QF7A 5JMTA 4OI4A 4OHWA 1ZM7A 1G7SA 3ZIAA 2W6JA 3U4QB 1XFAA 3LVQE 3QKTA 2G9NA 4RZ2A 5J40A 3RDPA 3HU1A 1YR9A 1UKEA 2FGKA 4XIGS 1AA9A 1WCV1 4DEXA 4I1OA 5TMPA 5GJBA 2J7PD 4B2IA 4DLZA 1S96A 3CRW1 1SGWA 3IBYA 1P9WA 5GVSA 2A30A 2IHYA 5FBWB 1JI0A 3GJ8A 3UMSA 3QENA 4IDPA 1QHIA 3VX4A 1J8YF 3MD0A 4KBFA 3BORA 1HH4A 2EQBA 1EFTA 1KIMA 3FMFA 1T0HB 1E2GA 3H2YA 1R0ZA 3L0PA 3A1SA 3MAAC 4TQAA 1QG4A 2ZR0A 4IDQA 4LJAA 4Q9LA 4JLNA 4QKQA 3SQWA 4OI0A 1OB2A 4PO8A 4F93B 4YLGA 2ANCA 2PJZA 1NG1A 1II8B 1FX0A 2GCNA 1SVIA 3W8RA 4JVMA 4QGGA 4V0KA 2IUTA 1EWQA 1YHNA 2J9RA 3CZQA 3ZD6A 4Q7KA 1T9HA 3HU2A 1DAEA 4RFVA 4TL8A 2IUSA 3SHWA 2FSIA 1GG2A 4LV5B 2DCUA 1M7BA 5K8LA 1FW6A 4TTPA 3C15C 2VH5R 3LFUA 3PUWA 5JRJA 2IK8A 4TYPA 3ONWA 3TH5A 2ODNA 2VYFA 2QSYA 4C0AC 1KGDA 3KJHA 4MRVA 3X1DA 4U00A 2LKDA 2GF9A 5FUVA 4W5JA 3NDBB 2RCNA 3NVAA 2ZU6A 1E1RD 2R8RA 3B85A 4NBSA 4UJ5A 3VR4A 4BFUA 1PVOA 4F7WA 1RPZA 1AS3A 4Q7LA 4BEJA 3UMRA 3GLHB 2DWPA 2RMKA 3CPHA 1JB1A 3T12A 2P0EA 3R8CA 1MH1A 4EFMA 3AVOA 1T3HA 1KMQA 1T3LA 2RH5A 4FD2A 4YMWA 1GVNB 1XXHE 3GQBA 4K81B 3PUXA 4A0GA 4D0NA 5EE5B 5FTKA 2C96A 3KB1A 2OG2A 4CEJA 2B92A 1G18A 1E98A 4JSYA 4Q47A 1VCMA 2OXCA 5P21A 1E2FA 1G3MA 1LY1A 3C14C 3BE4A 3PUVA 3DO6A 1A1VA 2XTNA 2ZVPX 3QY0A 3BK7A 2IC5A 2FPLA 4XOIA 2VF7A 4LYJA 1PJRA 3WYAA 1RZ3A 5G3YA 2QAGB 2QPOA 1KI4A 1SXJD 4ESHA 1JXMA 2JEOA 2JIZA 2ZRHA 1G8YA 2I4IA 3BRWD 4M9QA 1ZBDA 2DWQA 3AV0B 1FMLA 5EXSA 3D7MA 5EZ6B 3KJEA 3UG6A 2ZJAA 2GZDA 1A2BA 2ZQ5A 1JEDA 1VMAA 4LC0A 1ODFA 2REOA 3QIAA 3VAAA 2F55A 2JAQA 2QBYB 3E1SA 4DSUA 2CHVA 4PAQA 2G6BA 4M9XA 1X8LA 3W6OA 4D82A 1I4DD 3HPRA 1E2EA 1S3GA 2C99A 4JLMA 1JEEA 4D4MA 2WZQA 3C16C 2ZE8A 3CH4B 4XD7A 3TGPA 3QG5A 2ZSAA 2W0SA 1P62B 2NTYC 2HUPA 4Q1CA 1GL6A 2IHBA 1TTTA 4GBMA 4LYHA 4C0SA 1ZNZA 4WZBE 2OXRA 1IY0A 1BYIA 1WP9A 4EPTA 2J0UA 2YC2C 4KYUA 2QMEA 3ZIAD 4H1UA 2W6JD 5CK5A 2CHGA 1JAHA 2Z4RA 4TMXA 4N3NA 2JLUA 4D26A 2VPPA 1YJ5A 3TAUA 4F4CA 2Z4SA 4PSAA 4U7DA 3ZQJA 1R6BX 1E79A 3BOSA 1QHHB 3FYHA 5FTMA 1YR8A 4C2UA 1ZJ6A 3AKCA 3EPKA 2OHFA 4LYAA 4F92B 5JCPA 4ZKEA 5DYGA 3CF6R 2WSSA 1Z2CA 4TMWA 5FH9A 1G8FA 1MV5A 3PEWA 3VR2A 3FHTA 2D7CA 2JLRA 4R71A 4NZYA 4V0NA 3GLFB 3QNUA 4I1VA 5FOVA 1MABA 3PUZA 5FBVB 1A4RA 3L43A 4MGKR 2QM7A 4EUNA 2X8AA 2GEUA 3GLGB 1OHHD 1E6CA 1P2TA 2ZRIA 5FR1A 4AKHA 2GCPA 1GITA 2VHJA 2WWFA 3AF3A 1P75A 3RS2A 4ERNA 1PV4A 2HCBA 1W4CA 3T1QA 3LBIA 2VSXA 4WOPA 4PR0A 2FOLA 1FL9A 2ODEA 1R5BA 4ARZB 4WW0A 1UBFA 2AX4A 4LYFA 4BZXA 1KDTA 3PEVA 5DHFA 1JXOA 4R9UC 3MSXA 4LJ6A 1ZUHA 1XPOA 4URWR 3RSOA 1R8SA 1XEWX 5JEEA 1UBEA 4QBIA 2WTUA 1KKLA 1ZP6A 1E1QA 4W5HA 1R10A 1KSGA 3U44A 1YVDA 2BBTA 3GLIB 2XGJA 5C2JB 1T3SA 2C78A 1II9A 3RS3A 3PIRA 3D31A 4TN1A 1GZSA 1NKSA 1SXJE 4HLUA 4GPTA 3ND8A 3WHLA 2ZXUA 1DVRA 2ODWA 1VIAA 2NO0A 1R8QA 1DAIA 3F0TA 3GEIA 1S2MA 4G3XA 4GSYA 1SKYE 2JJ1A 3BGWA 1M7HA 4V02A 3N2EA 4OHYA 3FB4A 1G5TA 1LS6A 4JSTA 1L7VC 1KI8A 621PA 4JYCA 1Z0JA 4LI0A 1CIPA 4US2R 4KHZA 1DPFA 4DCVA 4UJ3A 1UKYA 3LXRA 5CLLA 5JHGB 1E0JA 5JWOA 1Z6GA 2BMDA 2QMUA 3U3MA 2REXB 3Q5EA 1P7CA 3IPXA 5E7JA 3TJZA 4A0FA 1VCIA 2F3TA 2PZEA 4C0KA 4OJKA 2DB3A 2QORA 4RFSB 5IDVA 1FPMA 2C2HA 3CPJB 1CKEA 5KUTA 2QTFA 4QGHA 3CRMA 1TU4A 1NMXA 3KKPA 2R6GA 1HT1E 1FOEB 2ZTSA 2ZIAA 3P20A 4C0LA 4TZ6A 1ZM9A 1Q1EA 3CNLA 3CUEF 2JJ8A 1CEEA 2CLCX 4GL2A 2Q21A 3AKYA 1NN5A 4MA4A 3DM9B 2JIZD 4GP7A 1R0YA 2V55B 3VR3A 121PA 1EFCA 2D7DA 4GRAA 1T4GA 1J70A 4CYMA 2CNWD 2AN9A 3SS8A 3HDTA 2P2LA 3K9LA 2CL6X 4FWIB 3PITA 1XWIA 5C46F 4V0MA 3BB4A 3MLEA 4JKIA 1X1RA 1FUUA 2F1JA 4P0TA 1AK2A 4D0GA 3ICEA 3MRSA 4ZV4A 1AS0A 4BASA 3X1WA 4Q4LA 3ZYCA 2R65A 3THOA 1ZNYA 5EUMA 3SBEA 1E9FA 1BS1A 3L0OA 4J0QA 4JIMA 4XD7D 3SYKA 2ZYVX 4R2IA 4BECA 3REFA 5AJXA 2OE2A 2V7QD 3RS0A 2IEYA 2LCFA 4EQ6A 1KO4A 1Z0FA 1WBDA 3SJCA 4KAXA 2ZRAA 1WBBA 3KZ1E 3IEVA 2BEKA 2QTVB 1NSFA 4M0LA 3CLVA 4M21A 4NCKA 4D4LA 3SI7A 4ASUD 3T1OA 2JLZA 3I62A 5J4HA 3M1IA 3QF4A 3TQCA 3U7HB 4HAVA 1CR4A 1HURA 1F2UA 2G3YA 2QROA 1CRQA 2X1VA 4CZ2A 3B9QA 2XB2A 3IO5A 2NO7A 3ECCA 3UWKA 2PT5A 2G1KA 4OI2A 3T15A 2CMKA 3GPLA 4MRRA 3EPJA 1Y63A 3IILA 4NCIA 3ND9A 2Y8EA 5FUYA 4F38A 5FPYA 1E2IA 3VR1A 2AFIE 3TUZC 1KO5A 3CX6A 1EESA 3OEED 3O8CA 2HCJB 4JMPA 1M2OB 2IYRA 4G1UC 2GJKA 4GT1A 4US1R 1BMFA 5B58C 2NO9A 1EFRA 1US8A 1DAMA 3NC0C 4JT4A 4PXAA 2YC4C 4DLWA 4EJSC 1NLZA 4JBYA 2ZANA 4MRNA 3NG1A 5IK2A 5JRZA 1Q3HA 1GKUB 3SFVA 3SQXA 1Z0IA 1IXSB 4URUR 2GK7A 4LUCA 4YXWD 1YU9A 4A2WA 2ZYUX 2OM2A 4NYMQ 4B3CA 1MKYA 1HTWA 4PHTA 1P2VA 2WWWA 3B1VA 4TTRA 1C9KA 3FTQA 4II7A 3SFZA 1NJGA 2W6IA 1XCGB 3REGA 1TL7C 3VKWA 1XF9A 2WKRA 2EFHB 1W5SA 1VECA 3B60A 4HDCA 2H16A 2DPXA 3BXZA 1KSFX 1XRJA 3QI2A 4M9SA 4ZI3A 3GJ7A 1PUIA 1X6VA 2V1UA 2OBMA 4D25A 3TVDA 5H70A 1ZU4A 2O8BA 3LY5A 1L4UA 3KKMA 4B2PA 4Q1FA 1J99A 2K5UA 2ECKA 4C0JA 2H7VA 3NHBA 4UKDA 5SZJA 3W6PA 3WP1B 4DT1A 1CS4C 2B21A 4L5BA 4ZCMA 1AS2A 1BIFA 4MKGA 4CEHA 1NVWQ 1OB5A 4H9GA 2EWWA 2JASA 3EASA 3RLFA 4TZ0A 2JGNA 4YQFA 4RY2A 5HKKD 4LJ9A 2WOJA 5DH9A 4BGDA 4ZI2A 3FWYA 4K46A 3W34A 1W1WA 2FH5B 3C5CA 4OQLA 5TXGA 5KDDA 1ONBA 3IO3A 3SU8A 3CO5A 4A8JC 2AD5A 4RCZA 3T35A 2QNRA 1KSJA 3IIJA 3TQFA 4BFTA 4G5OA 2CE7A 2F3RA 2VIIA 1K6MA 1E32A 1XMVA 2FPMA 3IDQA 4PO1A 3AH8A 1GP2A 4KFSA 5FUXA 3TAHA 3I72A 3RC3A 2O8CB 1W4RA 2J59A 2VP2A 1PLLA 3BH0A 3JZMA 3OESA 4LCBA 4TLCA 1KAOA 4EPWA 2ZU0C 4G5QA 5KYKA 4BLQA 3EA0A 4ZCLA 1GL9B 1HE8B 3U44B 5JJIA 3AP1A 3NBFA 4B3GA 1H8EA 1G5RA 1U9IA 1M74A 3KJGA 4WZAE 1RRGA 5JCZA 5JHHB 2FU5C 1UKVY 4DSTA 1E2NA 4DB2A 1KYIA 2JLVA 4NONA 2Z6VA 1JR3A 4B75A 4NL4H 5EP4A 4D2IA 1E2JA 1OXVA 1NP6A 1KI7A 2CJWA 4HUTA 1FTNA 3BFKA 2Q3MA 2PX3A 1IY2A 1XTRA 3T06B 2XNDA 4NU0A 2WWGA 2VF8A 3RS4A 2P5TB 2WKQA 4JVSB 3QXHA 3I8SA 5FBLB 4BRUA 3C4JA 3BIFA 4DIDA 2R6AA 4EAQA 3BFXA 4POAA 5D3QA 4YMTA 5L8VA 5KPJA 3Q9LA 3WYGA 4WA7A 2FSGA 5FOWA 5EJEA 1AIPA 4AKIA 2E9SA 2WJYA 3LA6A 4HAZA 4B33A 4JLBA 4Q4JA 4RCYA 2EVWX 1MO6A 1P5ZB 1ZM2A 2QU8A 4JVNA 4DCSA 8OHMA 2XAUA 1IN7A 2PMDA 5E95A 4Q48A 5FFMA 2J7PA 4DRZA 1CP2A 3LBNA 5L3VA 1E2PA 4M1YA 2QENA 5HR5A 5FBRB 1P72A 2ZSDA 3GJ4A 5G41A 1XD2A 3AVUA 4R7ZA 3AVVA 3FHOA 3HR8A 1JECA 5DGXA 4PAOA 3OHMA 1NMZA 3T61A 1CRPA 4RD4A 1JJ7A 3CWQA 4JL6A 2PMKA 3IHLA 2ZRKA 3RVBA 5TDHA 3W6NA 2CCKA 1X86B 2BKEA 4M8NE 4C4PA 3TNFA 3ICQB 2FMXA 1M7GA 4CIDA 3W5IA 4OK3A 1UADA 1EFRD 1OFTA 2GK6A 1CR0A 5KNCA 2PEZA 4GOKA 3AVPA 3NXSA 3FPAA 5JSZA 3I4LA 4HB3A 3SYNA 4G5RA 5IT5A 2AK2A 2EW1A 4JBWA 2P5SA 3UATA 3ZDQA 4EKDA 1NBMD 4EQ6B 1UEIA 1G4UR 4G01B 1N25A 2QI9C 2SHKA 3FGNA 3A1UA 3DKVA 4G5GA 1T5IA 1MO5A 2H1LA 1W0KD 3DKPA 5ANRB 3SN6A 4NP6A 4XTCS 1OXSC 1X3SA 3PFIA 5AUNB 1D2EA 1OLOA 3TIFA 3QG1A 1NN3A 1YZLA 5C4GB 2P6UA 4F4IA 4MKIA 1R7RA 1QHYA 1F2UB 5JS8A 2J0QA 1TUEA 1Z6YA 1CTQA 3FMPB 1E1RA 5FOSA 1DTSA 1HY3A 1NY5A 4LSGA 5KNBA 2RKOA 3OIYA 3AF4A 3SYLA 1IHUA 2R44A 3THXB 2GRJA 3KB2A 3UKDA 3K8YA 4BEBA 2PZFA 1TU3A 1OH5A 1XDBA 2WVJA 1KDRA 4JLDA 5BXQC 3SJZA 3CF0A 1US8B 2PEYA 2UKDA 3L82B 1XTIA 3RRMA 4D81A 3GEEA 4UNQA 3ETLA 2RGCA 2ZRMA 1P73A 4G5SA 2IS4A 3D6TB 3W3AA 1EK0A 4BLTA 3OFND 5EXTA 1R0XA 2Z5FA 2J87A 4Q1DA 1U0HC 1FP6A 1DBSA 1SVOA 4N0DA 3B5JA 4LPKA 2IYUA 3NBYC 3EIHA 3EWAA 1MRSA 2FNAA 4PQFA 3WMEA 4HSEA 1SXJA 2OILA 2EU8A 1ZYUA 3NC1C 4BQSA 2PH1A 4XWAA 5SZIA 1XJCA 3RRZA 1N0WA 1WE2A 3ZD7A 1ZUIA 3B1WA 3FFBA 1G3QA 2W2XA 1U2RA 2WAXA 3AVQA 3KXKA 4M1KA 2N42A 3B6EA 1Q57A 4MDEA 2Q9AA 4FW9A 5KTYA 3THYB 5CIQA 1G3UA 2O8BB 1II0A 1JR3D 2CVFA 2B6HA 4A2PA 2JLSA 3KFVA 4CEHB 1TX4B 1S9HA 1D6JA 2XNDD 4HB0A 4OQFA 2QMOA 5BN3A 3VR5A 3A1WA 5CB8A 2ZE5A 1YR7A 2WSMA 4EFLA 5E4FA 2O8EB 1YZTA 3PUYA 1S8FA 3JZAA 4FXPA 1M1YE 4FN5A 1ZD1A 2IW3A 4AKEA 2NPIA 2FEMA 1KO7A 3K0CC 4KITB 1DO2A 2PZGA 4OL0A 4M53A 1OXTA 3VNVA 4M1MA 1KJYA 5DNYB 5DSZA 2IS1A 1OE0A 2BKUA 1NBME 2QP4A 4JLAA 4YMVA 3AF2A 2OAQ1 2BM1A 2H57A 4TLEA 3IHWA 4OHVA 4MDFA 2QE7D 2YHSA 5GJCA 2QPTA 5FL3A 2ERXA 4DCNA 4PC6A 5K8TA 3LX5A 3VKGA 5JZVA 2W2VA 3K9NA 1N5IA 4MGYR 1JR6A 1E4VA 3CIOA 2XXAA 4H1VA 1DAFA 3WYFA 3KUCA 1KO1A 2BHRA 3A37A 4EDHA 1WMSA 1M6NA 2GVDC 1FTSA 1N6RA 5FOXA 4QL3A 1NLFA 2C9CA 1XXHB 4AY2A 1YRAA 1MO4A 2GBLA 2AL7A 1F2TA 2MSEB 2CJWB 4Q7JB 5KNDA 1N6OA 4QOSA 1IN5A 1OHHA 1Q12A 2VEDA 4I81A 2QRNA 1MRNA 1ZNXA 1GILA 2DYKA 2PBRA 3BBPA 4OQNA 4KFTA 4AIIA 4A36A 3U6KA 4ZDIA 1JPJA 5FTJA 4Z1MD 2V6JA 3SDZA 2YJTD 5EXXA 4Z54A 4DDWA 3SC3A 2OEPA 2ZSBA 2NO1A 3QQ5A 5AJZA 3P1JA 1ZD9A 2QRZA 4IVRA 3GFPA 4Q4JB 2IXFA 4B2LA 4DSOA 1IXRC 1Q3TA 5IHPA 1ZIPA 1G64A 4EPYA 2RGGA 5H1YA 1U0LA 4I99A 4TTQA 1FMJA 4Q1EA 3DZ8A 3LW7A 4P3YA 1IN8A 1XD2B 2X2EA 1W2HA 2VHTA 2ZYWX 1SHZA 4OKSA 5TV2A 4FIDA 3D8BA 3LRPA 4NDZA 2XZLA 2HJVA 5DI3B 2OZEA 5JJLA 3FKSD 2OFOA 4A2QA 2G0NA 3MMPA 5CM9C 4N0EA 5GADl 2BBOA 1JR3E 5AUPB 1NVVQ 2B7CA 4FINA 4LX0A 4RD3A 2R9VA 4L16A 1R5NA 3CKLA 2D3WA 1KI2A 4JLOA 2H92A 5TB5A 2AK3A 5LD2B 3CR8A 2KJQA 3QVUA 1FNMA 5JSZB 3K70C 3AKEA 4HZUB 3HJNA 1Z6XA 1JAIA 3B1ZA 3P32A 2ZSFA 3WHKA 5M04A 5C4MA 1Y3AA 4WAUA 2QL6A 1YR6A 4Q02A 1HA3A 1K5GA 4DLYA 5JFGA 5JS7A 5EE9A 3RRYA 1KI1A 1RYFA 4N1AA 1S0UA 2PLFA 3KQLA 4KSCA 2FSFA 2RHMA 2CNWA 1OKKD 2ZR7A 3K0FA 2IWRA 5BN5A 3EX7C 3T1TA 3FKQA 3S1AA 5KPDA 1QHNA 4CGZA 4V0OA 1ZRHA 1ANKA 2HYDA 4KSBA 1XCPA 3ZS8A 1B23P 3CRRA 1GWNA 1G3RA 4ZIRA 1QHSA 2FX3A 2FSHA 3TKLA 1IN4A 2WWXA 1YRBA 3WRYC 2C04A 2C03A 2QA5A 3UIEA 5F9FA 4B34A 1HV8A 5ELXA 4LJ8A 5C1BA 2V7QA 3CH5A 5HCIA 2PCJA 4DC9A 4YDHB 4MGZR 4PX9A 3X2SA 1Z6AA 3SEAA 1GRNA 4C0QC 5CYPA 4B32A 3QVVA 2IXEA 4KODA 5G53C 2ZI4A 4Q1BA 4ASUA 2REBA 3KKQA 2MSCB 4QJ3A 5KO2A 3AP3A 2AWOA 1UJ2A 3GLHE 1TQ4A 3BD9A 4AK9A 1BYUA 3LO5A 4WIAA 3RYTC 1JALA 2G77B 4FMDB 1PLKA 2ZM5A 1GUAA 4NTZA 1GDDA 4FWTA 3Q7PA 4NMMA 4WVFA 5AR1A 1KK0A 3CX8A 5CLQA 3K0AA 4QHSA 3TSZA 1SKYB 4A82A 2BBWA 2QPAA 2R2AA 2N46A 4CEIB 1P2UA 3OEEA 2CHQA 4P4TA 3T34A 1G41A 1BKDR 3TE6A 4W5WA 5CK4A 4AI6A 3C7KA 3K53A 3EPLA 1SZPA 1OIVA 2JLYA 1GKIA 4Z8XA 1A7JA 4D6PA 2GAAA 2ZRNA 4A92A 3AVWA 1PUJA 3I8XA 3SNHA 4JBXA 2HXYA 4TL6A 2CLSA 3TMKA 3VX3A 1H65A 2YWFA 2FJUA 1B0UA 1E0KA 5BN4A 1R2QA 2AKYA 4IOLA 4DUGD 2GZHA 4JZKA 5DHAA 1OH7A 4NYMR 2E87A 1Z0DA 1GRRA 4YXWA 2C77A 2FZ4A 4UQOA 4Z51A 1XEWY 1TNDA 3MUFA 4QBHA 4LC1A 4DB4A 1TF7A 1SVKA 3D3QA 5JWRA 4QNMA 4GDFA 5EZ5A 2OLJA 2C9OA 4EPVA 2VP0A 4HAYA 2XZPA 4HLCA 4A0HA 1NJFA 4F91B 5FPKA 5J47A 1A5TA 1L8QA 3CRVA 3A1TA 2D2FA 2YNMA 1DEKA 4LBWA 4GFDA 1KAGA 4IXMA 2ZI6A 4JL5A 2O0KA 1P3JA 5L3RA 2ZJYA 4B44A 2ZRBA 3M0EA 2EWVA 5H68A 2GXQA 1RKBA 3K09C 3BH6A 1DS6A 3L8ZA 4PANA 3PQCA 3HYRA 4MYUA 3VU9A 1E4YA 4MGIR 1OH6A 4RZUA 2FE4A 1WQ1R 3LAWA 1C1YA 2XXAB 4F4JA 3LNCA 4UNNA 4MKFA 5LDDC 4M1WA 5BYKA 3KQNA 2QP3A 1KY3A 2FPKA 2MSDB 2OFXA 3RANA 2HEIA 3G82C 1E9RA 4JS0A 1UPTA 3LD9A 5HKKA 3G0HA 1CULC 1FX0B 2ZETA 3MWYW 3Q8XB 5FUWA 1HQCA 1OIWA 1ZINA 3A36A 1EFUA 1S1CA 3CM0A 3PEUA 2GWHA 3Q3JB 5DO9A 4D4JA 3F5FA 5HPYB 1Z08A 2LKCA 2VA8A 4CRWB 3VMFA 4DJTA 2X77A 2O0HA 2WJIA 2ZVQX 3B78A 4XJXA 4E22A 1CR1A 5JI3E 2BCGY 1VYUA 1VYVA 4MITA 2A2ZA 4MRSA 4TSFD 2R62A 2YV5A 2G83A 1V5WA 3A4MA 3M6AA 2FV8A 2QAJA 2VO1A 1EFHA 4JT2A 5TY0A 2IBMA 2IYVA 4RZ3A 4BWYA 2O8FA 1XNJA 3MWKA 1ZCAA 2V6IA 1PLJA 3NDPA 1NVUQ 1DO0A 1N6PA 2AXPA 3ADBA 2NG1A 2ZS8A 1CJUC 4IOMA 2ONJA 3A4NA 1Z07A 2KE5A 4Q5IA 2YVUA 3V00A 1UKZA 3TLXA 3QPWA 4WZ6A 4W7SA 3EXAA 5FR2A 2ZROA 2QQEA 4M4SA 5AUOB 1Z06A 2QMHA 1LB1B 2HDNB 2MMCA 2ZEJA 4A6XA 3ZZ0A 4URVR 3HP1A 5CDFE 5J5CA 1BH2A 1CJKC 2ZUBA 3I5YA 3GLIE 4LDJA 2YZ2A 3WNDA 3A6PC 4B3FX 2G0TA 4B74A 1SVMA 3K70D 4AG6A 1T0JB 3FHCB 4CEJB 3L8YA 2ZRFA 4C7OA 5DISB 2YWHA 3UANA 4MRPA 2ZJOA 3T5DA 2ORVA 5FOTA 2D2EA 1KDOA 2ZR9A 2VTKA 1YZQA 3OF5A 4TL9A 4TT3D 2PL3A 3MWLA 4PPFA 3L2OB 2LWIA 3ZQ6A 4IJMA 4EIWA 2F1HA 2VSFA 2ZJZA 4NYIQ 2BCJQ 4PC2A 2BDTA 221PA 4XWOA 3OE7A 1XJQA 2Z0MA 3MCAA 2C95A 2OV2A 2PCLA 5CIWA 3KXLA 1VG0B 1RVDA 5EUQB 2IS6A 4BZPA 1T8UA 4ZDWA 2FWRA 1DADA 2GTPA 2WKPA 4RKEA 3S1AB 3GJ3A 4P33A 4L8GA 1E2KA 4OYHA 3QSYA 2UZ3A 2JLQA 2H5EA 3GP8A 1CBUA 1DOAA 4UXJA 4ZIRB 3ZVRA 2A78A 4QHTA 1CU1A 4DZZA 3H4MA 4FI3C 2ZRPA 5FL7D 4A9AA 1AM4D 1D5CA 4IDHA 2FF7A 5HE9A 1NBMA 1XTKA 2QZ4A 1FNNA 4E03A 3ZVLA 1A82A 1XP8A 4Q9JA 2J0UB 4TMZA 1W0KA 2ASEA 2W2TA 1T6NA 2D06A 1G6HA 3ASYA 2E1RA 3GJ5A 4DIEA 4HAWA 4BFZA 3AF0A 1AQUA 3JVUA 1TF2A 4RKFA 4S2EA 1SQ5A 2DFNA 1AGPA 4BE7B 2ORWA 2VRWA 4KCGA 5TVKA 4DCTA 4ZCIA 5HZKA 1NF3A 4L9SA 5DI9A 3K0AB 2GHIA 4IVQA 4TYWA 2GJ9A 2KB0A 3U3RA 4HAXA 1XU4A 1O87A 1TF5A 1ZVQA 2C98A 2QG6A 2F43A 1H8HA 2IT1A 3KFXA 2ZJ8A 3CONA 3DL0A 4PAMA 1NI3A 2V8OA 4D0LB 2F6RA 1UDWA 4YONB 2XSZA 4LHVA 1D9ZA 5GJVC 3TRFA 4QM7A 1MABB 2GXUA 2RAPA 1G20E 5KOYA 1QVRA 4E5UA 4EJSA 5F9HA 3W9YA 2FFQA 4Y0VA 4YC7A 3U61B 1XBTA 1W7AA 4BRWA 1LS1A 3CW2A 3R9IA 3CNNA 2WWYA 5F3WB 1ZIOA 4LBZA 4BLSA 3PG5A 1JBKA 1N6HA 1E69A 2BC9A 1U81A 3SJAA 4EPRA 1Z0KA 2WWHA 3SOPA 3OFNA 1E9BA 4RSGA 1AZSC 5J4YA 4EPXA 2XEXA 2TMKA 4NCHA 2PJRA 4AURA 4NCNA 3EC1A 4GOJA 4LZZA 2P6RA 5KHOC 2QT0A 4RZXA 2X19A 3M4YA 2EFDB 3OEHD 4LK2A 1E9CA 4HAUA 1Z22A 4Z8YA 4E09A 1COWA 5FPTA 4HZIA 3V4RA 2WJHA 3QXCA 4X8HA 4PQRA 4B3XA 3BS4A 4ZKDA 3EIEA 4IOKA 5L3SA 1HE1C 4ITRC 4A0RA 5LB2A 1WRBA 2FFHA 3CR7A 5J4KA 4OHXA 3VU9B 1NKTA 3HPQA 1E2QA 2A5YB 3C8UA 3IQWA 3GCGA 2YWGA 2OCBA 1W4AA 3RS5A 1GNRA 3CWZA 1ESNA 2BM0A 2UZIR 2ZJ5A 4R2HA 4JLKA 1N6NA 3ZZTA 2GEVA 5B2ZA 3O47A 1ZC3A 2V9PA 2ZUCA 2P3SA 4IXNA 1P2SA 2EFGA 2IYSA 2VHCA 4CF7A 2FDCA 1DELA 1KI3A 4A8JA 5KU1A 4Q1AA 1UF9A 5KDOA 2WAYA 2EFCB 2ORIA 4Q19A 2YYZA 2VP4A 3TW8B 1II8A 4TWZA 4ON9A 3UG7A 2GNOA 5LBIA 3ZVMA 4L9WA 4BUJA 3LH5A 4PZYA 1CXZA 1TUIA 2Q3FA 4P4UA 4C3ZA 2QE7A 3BAFA 2NO6A 1E9DA 1NG9A 3AGPA 1OFUX 2CCGA 2BEJA 3B8HA 4XVRA 2ZS9A 4OJQA 1OXUA 4M9ZA 1DAGA 3OE7D 1OJLA 2CDNA 1VHTA 5B30A 2FFAA 4NCJA 2HYIC 1VG1A 2O0JA 1ETUA 3SBDA 2WOOA 3LXXA 1Z3IX 4BZQA 5EP2A 3K0SA 3EPHA 2IYXA 1DARA 3AEZA 2GF0A 4NH0A 3U2QA 4W9MC 4BLRA 3DOEA 3QE0A 2QAGC 1R5OA 3EW9A 1D2NA 2GCOA 4PFSA 5EE1A 2AXNA 5EXPA 5A5GA 2O5VA 3DZDA 1FFHA 4I1SA 3QKSA 4Z1MA 3SZRA 4RD2A 1QBKC 1Z29A 2ONKA 3GFOA 4IRUB 1DG3A 2CCJA 1XD8A 3GLHA 4Q66C 4A1FA 2CL7X 1IY1A 4FCTA 4TL7A 4TYYA 2NQ2C 2EFEB 2RGNC 2F1RA 5AJVB 1VYTA 4C7OB 3KTAA 4PHFA 4Q00A 2P65A 4BFSA 2WWIA 3W90A 3QKRA 4BLOA 1KJZA 1CJTC 2NGRA 3QF4B 3V9PA 4B47A 2HT1A 1N6LA 1G7TA 1SVLA 3RS7A 1HQYE 4IVPA 4KVAA 4TLBA 4KJZA 2YOHA 5JWHA 5DN6D 3ZJYA 1F60A 3CB4A 4HLQB 4PO9A 1EX6A 4WBSA 3QOFA 1V43A 1N6IA 3NIBA 3ZS9A 1H8HD 1NRJB 3U3JA 1LFDB 1NVVR 3FKSA 1G9XA 2XSZD 4OK6A 1RRFA 5HTKA 2IYYA 2OSBA 5BWMA 3CRQA 3U60B 4I4LA 5SZKB 1NLYA 1OFIA 1W44A 1IOZA 5G40A 4GZMA 1XTJA 1ZAKA 3O8BA 1N0VC 2A9KA 4QJ4A 2V1XA 1UAAA 4M22A 4DCUA 5BW8A 4HUQA 2GEDA 3Q72A 3ADDA 4B35A 3X1ZA 3BB3A 1AZTA 1YQTA 5CB6A 3AB3A 3I61A 2A5DA 1VCNA 1ZM4A 1W36B 2JLWA 1P4SA 2XTMA 2DHRA 4M1SA 1W47A 2PT7A 3E70C 4LHYA 3LV8A 3I73A 2ZRGA 1COWD 5DLQC 4DVGA 3NH9A 1OF1A 4DXAA 1IN6A 2GXSA 3I3SR 4C0BA 1N3BA 6Q21A 5JBQA 3E5HA 1C4OA 1MT0A 1XJ0A 1OKKA 5TARA 4NKRA 4OI1A 4QRHA 2GILA 3HYTA 4Q9HA 4XSHA 4QHYA 3NTUA 1WB9A 3AUYA 1K8RA 1KK3A 1S4QA 5KSYA 2BMEA 2F43B 1T8TA 4DT1B 4B76A 2ZJ2A 1QF9A 2UVQA 1QHHA 4QJ5A 4YMSA 2BVNA 3VQTA 1JNYA 3H84A 4HI0E 4RJLA 4C0HA 4TLDA 4Q4HA 1YZKA 2EYUA 2WIBA 4KI0A 1KY2A 3RRNA 3DDCA 3PV0A 3U7FB 4BPBA 4NE2A 1RRPA 1G8HA 3K1JA 4O3MA 2W58A 3GJ6A 4PHGA 1F5NA 4GMDA 3WMGA 2OUKA 4LGMA 2AWNA 2IYLD 1OYYA 2PLRA 1Q20A 3LW8A 2GJ8A 2CE2X 5KSZA 2NPFA 3NWJA 4PC7A 1TEXA 4FMDF 2HLDD 1KHTA 1W5TA 3FOZA 4S35A 3I1FA 1NN1A 3PCRB 4O25A 1OH8A 2NIPA 1DAHA 3AVTA 5EP3A 4Q21A 4D4KA 3EZ9A 5L3SB 421PA 2RGXA 3B9PA 2YINC 3IIMA 3G5UA 1W48A 5CJPA 5CDFA 3KQKA 1K5DA 1HYQA 3GD7A 1KZGB 3B1XA 5UKDA 3GLIA 2ATXA 2ZITA 1SVSA 3V4FA 1E2HA
chains in the Genus database with same CATH superfamily
2JJQA 2QQ0A 1JRLA 3R74A 3R7FA 2XVZA 1A0OA 2P62A 3NKLA 4N01A 3ZD9A 2EEPA 8ABPA 1M1XB 4YT8A 1XYYA 2ZE6A 1SOMA 3LWNA 1NRWA 3PPVA 4HMQA 4F21A 1V7PC 2BBSA 3SQLA 3AFMA 2ZIGA 2IY7A 4K6HA 3EBLA 3CISA 2OCAA 1A8QA 3LDHA 3WP0A 1X19A 5B7GA 4NLLA 4PPNA 3TTTA 5HSGA 4C3VA 1U5AA 3WLMA 3VGPA 2GQ0A 2PJDA 4FOOA 3OPMA 4UM9B 1WVGA 4R1MA 1R6VA 4YJKA 2AYXA 4KIFA 1R1DA 2B4TO 2PR2A 3O31A 3PC2A 4N3AA 1QIJA 4FKMA 4NICA 2NVBA 5FUQA 2Q0HA 2QRQA 3N87A 1SBCA 3PSHA 2ECFA 4LV8B 4LWQA 2V7PA 3GEHA 3PVSA 3TLBA 3E2IA 3JQEA 2Z30A 3TW4A 4NPHA 5LSAA 5TE9A 4V0RA 1IULA 1SIOA 3LUAA 1EXMA 1BD3A 2X76A 3BH7A 4B6RA 1QLJA 5EXDA 2IL1A 5B7PA 2I1LA 5KVSA 5CFNA 3IBGA 2FLVA 4U7JA 4AZ3A 4UBNA 2FVXA 3V8VA 2D7JA 3VU3A 3R7BA 2DUJA 2IX9A 3ZH9B 4BKRA 4YHHB 2CNLA 3HEBA 5L3QA 4K9OA 3KOUA 2YDXA 3R7WA 3CLSC 4MYCA 5JSQA 4C7MA 4LMBA 2NZ2A 4WXEA 5K0CA 5EVCA 2SECE 2C54A 4JBHA 4NMHA 4O0MA 1QDLB 3CSDA 3KQMA 3ZBPA 1ZCBA 5JSKA 3X3HA 2D0DA 2GA8A 2YMPA 1JTFA 4YRAA 3URKA 5BSVA 4LF9B 3QVGA 3OJLA 2GCOB 1NQUA 2PS0A 3RAFC 4ID3A 3EWSA 1T35A 5LOVA 2R1VB 4KXLA 1YFKA 5KSOA 1GXSA 1FVXA 2C00A 2QKYA 3DL4A 4XE5A 1B4DA 4ZVKA 5P8WA 1CR2A 1NOIA 2C58A 2VF5X 2XCOA 4YT4A 2KS6A 4TSFA 1YBMA 3OZGA 4MS4A 5TJHA 3W5SA 2H29A 4I50A 4AKGA 1BDIA 1J1ZA 4QPPA 3BA1A 3NIWA 4MEBA 1NI4A 1KRXA 2HV9A 3S70A 1ZXLA 4ZT4A 4MIEA 3KTAB 1JJAA 3BD8A 4QT4A 3O8RA 2DBZA 1ZC4A 3M33A 5FNZA 4TQAA 1V9CA 1XQ9A 4JLPA 4HDNB 4O2LA 5LA6A 3ZDZB 3R7AA 3QBTA 2AHOA 1YDFA 2P41A 3FNFA 4KGZA 2FPPA 1JA9A 1N1GA 3N75A 4LJYA 4RV9A 3VC7A 3DPIA 3VR6H 1V71A 2BN4A 2ZAMA 1UJBA 2FG5A 3DMDA 1RPNA 1DWQA 2PSJA 2IUFA 2WYOA 3N2IA 1G19A 3F8TA 4WH0A 1TMGE 4MV9A 5KSPA 4EW6A 4XWKA 1YVRA 5KPJA 2HHCA 4JY7A 4L0CA 1A69A 1G17A 3DFIA 4PC1A 5DYYA 2FMUA 3WGJA 4X0EA 3I0NA 1RPJA 3Q7QA 5BYJA 1GEGA 4XVUA 4DBZA 3MUNA 4Q3NA 3IIKA 1KRWA 2ZQYA 5K6AC 2IU0A 2RBGA 1O96A 2DZDA 2F2TA 3JQGA 1J2TA 3OPVA 3H65A 2NP7A 1KQFA 1AZWA 2PD4A 4R2KA 3WO0A 2PSEA 5KYGA 3AJEA 3TCXB 4C3OB 1QDEA 3GLQA 1HXHA 2IDJA 1Q1GA 4HUQB 5K0BA 1VTKA 2EQAA 4C9BA 3EXIB 1P6XA 4M8LA 1MHPA 4XW2A 4KXVA 5ALTA 2XBLA 1GNPA 4P8RA 1EWRA 1GL7A 1BDJA 1U8ZA 2FDRA 4ZJYA 5JCOA 3NHAA 1RJ9A 1SXJB 3PTZA 4R98A 3WK5A 1CUUA 4WFKA 3VSEA 4JP5A 4LF7B 3AB7A 1OU4A 2FR1A 4NZPA 1Q1BA 4XB1A 1WMFA 1CR6A 3ZHVA 2VL7A 3FCXA 6ABPA 4UARA 3RRXA 1ZUNB 1Z18A 1WMEA 3VDMA 2CD9A 2J5QA 2ZRJA 5D51S 5FI3A 3JYNA 2HF2A 5F5NA 3TUIC 4D8UA 3A14A 1HLDA 5DOZA 1AKMA 4MVJF 3VAYA 2AOXA 3WBBA 1TAQA 3F47A 1EP9A 1RWPA 2H8KA 4B6FA 3KQUA 3PI7A 2OPBA 3LVRE 1L6RA 4L5YA 1L8OA 5SYMA 3KJQA 3HKEB 2C3OA 2WUEA 1PEKE 1PWHA 3LPCA 3EJ6A 3ZV5A 1QP0A 5BN3B 1GAJA 1KI9A 4U6SA 5DCYA 5FL7A 4DADA 3D8TA 4Z2AA 4Q4HB 4DY6A 4E5YA 1VJDA 3GBPA 3L5KA 4HLUC 1ZONA 3FVQA 3KP1A 4OUDA 3VH1A 5JCJD 3T3OA 3HY6A 4IHJB 4TV8B 5IDWA 4B0OA 4B4DA 1LEHA 4ZVLA 3WY9A 2Q3JA 1RMYA 1W49A 3J81k 1E99A 1JZSA 1XEXA 1NZDA 3F9CA 3NH6A 2BONA 2PX4A 3AM1A 2QM8A 4O4LA 3L6EA 3RF6A 2P6NA 1G9TA 5HK8A 2LRHA 3LT0A 2VHUA 4XH9B 4C2BA 3TK1A 2IZ6A 1CEQA 1NLMA 4CI9A 3BMOA 2J3EA 3HA2A 4AN4A 2QIOA 1DBRA 1QCZA 1XTBA 4KLZA 2GAIA 1GGJA 4R8RA 2PQ0A 3ZG6A 2EF0A 3I30X 1WSDA 2JCBA 3OX1A 2OYCA 4F1JA 3LX6A 1CY4A 2W8ZA 3NX4A 3IT1A 4J1NA 4C06A 2PTHA 4GBGA 1OLUB 2QJFA 2PGOA 2RHWA 4NOJA 3PB3A 4NJMA 4TQ9A 2EWMA 521PA 1T5OA 1W4LA 5BV2P 4HQ0A 4MVWA 3C3KA 4K28A 4OIMA 3INYA 8OHMA 1MB9A 3HA3A 3K72B 2GXAA 3TQTA 3OZVA 4LHXA 4REOA 3NWBA 4LY0A 2VPYA 5DSXA 2G4LA 3K9QO 1EUCA 1Z8FA 1T6YA 4J03A 5FBQB 4C14A 3FOEC 4BMOB 1GA4A 2ZWOA 4V0LA 4RVGA 5TQ2B 4NECA 2WF9A 1TM4E 3RWOA 3KJIA 3G9XA 1OWLA 4I6GA 5COBA 2CN1A 1WD5A 4HQRA 1O95A 3VHXA 1H3FA 4AIRA 4HV4A 4ZYUA 4M8SA 2EHJA 2V6GA 4MQBA 4P4SB 2GEJA 5G0TA 2HZ7A 3FCUB 2I99A 1CUVA 2V03A 4OHKA 1HE2A 3MRXA 1PQPA 5DYIA 2AC7A 2GBFA 1ID8A 3PX2A 4PZZA 1E2BA 3TQOA 4BVLA 5K01A 3U5ZB 3GFBA 1A2KC 3L04A 2H51A 3LLVA 1ZI8A 4X61A 2DWOA 2B1JA 1Q7BA 5JD5A 1EZ1A 2DVMA 3AF1A 4H35A 5IBQA 3ZX4A 2BWJA 2VBGA 3O8DA 2DY1A 4KE8A 1QHGA 4KXFB 5BT8A 2IEZA 3OC6A 4R54A 2RHRA 1UBSB 4N82A 2FN8A 3WIUA 1WQ4A 4L4RA 4R9RA 1U3GA 3OTHA 5GV8A 4L6AA 4D3ZA 2DR3A 3CLSD 3O5AA 2P9HA 3SF8A 2F3SA 4E07A 3IA2A 3LUBA 2QB5A 1EFPB 5E2BA 1M54A 3LG2A 4KR9A 3DSRA 2QEQA 3CUWA 2FW8A 3O75A 4D96A 5DWDA 3IL2A 1CJVC 4M76B 1IM8A 1C2TA 2Y67A 3N70A 2YXNA 3MEQA 5FI0B 2A5FA 4JENA 1RZUA 2PIAA 4F2GA 4MW5A 3IEKA 5AK6A 4ND3A 2IEGA 5DMXA 5E2IA 5L6MB 1MB2A 1XZQA 2XUOA 1YS7A 5CFMA 4EKGA 2HHLA 2AG6A 1XAGA 2DQZA 2QN8A 3CNQS 4EUKA 3RGWS 1KK1A 2P11A 2X8JA 4CIBA 1MZVA 2JG3A 3ABQB 3NOQA 3RSGA 1ODCA 1WDTA 2ECOA 4LC9A 4MWOA 5AP9A 4H1TA 1JYSA 3FFAA 5B1SA 1FQJA 1ZIYA 3HO8A 2H31A 2PX0A 3ELDA 2PXHA 4QXQA 2I55A 2UZAA 3AR8A 1ZOSA 1U90A 1OPXA 2H9IA 3L8EA 4O2RA 3QXJA 3IEUA 4KU4A 3QM1A 3QPVA 1ZK3A 3ZX5A 5IVPA 4I19A 5DE3A 3O7WA 3ROXA 2ZULA 5K8JB 1J0BA 3WOHA 1K3FA 2R7NA 3KQWA 3OIUA 1K98A 3AERB 2OSVA 1NNEA 1UDBA 2PMFA 2J9XB 2O8DA 3K4QA 4QEZA 1Y1KE 1OI3A 2ZS7A 5AK5A 5AK0A 5FJJA 1DQYA 2Z9DA 1PJCA 5JZMA 3ZY3A 1EYZA 4WLOA 1NUAA 1Q7CA 1QKKA 3EG5A 1ZU5A 4M55A 2A84A 1T8RA 3F78A 4Q4AB 4OSEA 4LFCB 4PR3A 4EJ2A 3R9WA 3NKVA 1G1MA 1TPZA 4MRMB 4P5PA 4JYZA 1G20B 3EZ7A 4C4XA 5KWJA 1M2WA 3LCCA 3LVBA 1HZJA 4JYMA 5G1PA 4IG4A 1JWLA 2WFZA 3CHYA 1ZW1A 4YAJA 3GMTA 4F45A 4Z7QB 1SB8A 3N86A 3DNFA 1FLNA 2LNDA 2O19A 3E3MA 5KJEA 4RD6A 2VDVE 3UT0A 5LIRA 1XB2A 3MIIA 4X8LA 4H08A 1NU8A 2WICA 4X8OA 3IA7A 4OHOA 1DX6A 5I7AA 3OOHA 4Q82A 4PS1A 1YZGA 5JTTA 4Q7MB 4QGBA 4WINA 4S1OA 4E2XA 3GMSA 5HQTA 2I3AA 3IQXA 3QPBA 4XWGA 1G8SA 4KDEA 4JLVA 5K5EA 3PQDA 3NUQA 3SMQA 3K1ZA 4XIJA 1JF8A 1WXWA 2VK8A 1ZA2A 4G5FA 5J59A 1CUBA 3OQMA 3V1UA 2PH3A 2FY8A 3AO0B 1I94B 1LLDA 2BGUA 5FJIA 5CIYA 1RD4A 3DEAA 4DG8A 5B3KA 3Q8MA 1VHLA 3WJ7A 4QQFA 4R2JA 3I2GA 3M82A 4YX9A 1P9RA 1E96A 5KX5A 3JWGA 3IP1A 1G21E 1KMHA 1JG7A 4IMIB 3PXXA 4BV2A 5G4KB 5LMCA 3I9OA 2VJMA 4EFNA 3RYFA 2LW7A 4PNHA 2BCEA 1IB0A 4DM7A 5KMGA 1G5IA 4RVSA 5BQXA 5HCNA 1UAGA 4KBYA 1D2MA 1T8WA 3IJRA 4GM0A 1L5HA 3E3NA 2CFRA 2YJZA 3O90A 5HE8A 3VTKA 3L05A 3KO8A 3WKBA 5C5DA 4B3MB 1VXOA 1J22A 3AYXB 2XMPA 3MJ4A 2JGAA 3MERA 2YOFA 3MUOA 4G0XA 4MH0R 5JT1A 1FDIA 1Z28A 2EL7A 10MHA 1KU6A 1FXWA 1MJGM 4BWVA 1ISGA 2XI4A 4IDNA 4V03A 3SZUA 3UFXA 3A6LA 2BRUA 4X91A 2DLNA 5IKPA 3QLVC 4RMIA 1R4NA 2VZ8A 2AJCA 2AKAB 1QVAA 2GRAA 1AN0A 4YP7A 4OHZA 3QKIA 2OV3A 3OECA 2JLBA 3TM5A 3HEAA 4JLSA 1FS6A 4TWAA 2QT1A 4YASA 3VU1A 2CXTA 2VATA 3FF4A 3L7JA 2VDRB 2PGDA 5JSFA 3K0EA 3N7AA 5CLHA 1GPNA 1EGQA 1G63A 2XVAA 4UBOA 3SY8A 1KZ6A 5H02A 1VHWA 4LMPA 3UKJA 1CLUA 1CY2A 2G1AA 1L5OA 5E4TA 4D8WA 1FF9A 4YR7A 4PSDA 5HKBA 3SC6A 2XJ9A 1QFZA 3U4IA 4UHBA 4KQKA 3N2ZB 1U0JA 3DCYA 4S12A 5D87A 5A3QA 3PC6A 4MMYB 3BJIC 1RWOA 2JLXA 3LQ1A 1VE7A 3U4QA 2HA5A 3QXXA 1P8JA 2G09A 2K7ZA 3N8NA 4Q24A 5D3MB 5B3JC 1V5IA 2C5FA 2R66A 3GROA 4I55B 4AXBA 3FCYA 1OAOA 1EE2A 2V65A 3EAQA 1VPLA 5A06A 1UFQA 1I2DA 1CUIA 5DXJA 1J42A 3CZPA 1DZIA 1LSJA 2VPXA 4Q9NA 5DHUA 1WSWA 2ZT6A 3QEOA 4BO5A 4H15A 1X3LA 2HA0A 4YWHA 4Q16A 4XVCA 5LQRA 1I4LD 4ISBA 2QM3A 5GQSA 2NZ8A 2ZSJA 1U0RA 2HMTA 4H59A 3NBKA 4P32A 2NM0A 4MQ5A 4BFXA 4IIJF 2AC4A 3ANSA 3HBLA 2PRKA 3W5HA 5A7FA 5BR7A 1YNOA 3EVNA 2F17A 2X5XA 4IM7A 5EE0A 3LJKA 4LAFA 4FHFA 4ZOLB 3UCXA 3H6GA 3U3KA 3WDLA 1X7WB 2WM3A 3WRVA 1W5EA 1XK7A 3OO1A 4UNRA 4CKEB 4IDCA 4MQLA 1TCCA 1V2GA 4H6XA 1Z63A 3BHIA 1P7ZA 5BT9A 5I9MA 1MTOA 1Z8HA 2AN1A 3QNMA 4PBTA 2C7OA 4E4YA 4UDYX 4LXHA 1DBVO 2C7RA 1I51A 2QMZA 3PBKA 2B83A 2O8FB 1Q1ZA 2MJLA 1S3SA 4NHOA 4R8KA 4BMSA 2B6NA 4C29A 2RGAA 1C3XA 2GPAA 3B8EA 3I92A 1RT9A 3H1TA 2BJWA 1CF4A 4FKZA 4XOUA 4C4TA 4EARA 4EG3A 4ENPA 4G0WA 5G1NA 2EIHA 4PV7A 3WLHA 5JMWA 3P9PA 4QOHA 3LBFA 4B8YA 4PSVA 1W6RA 1P5FA 3WGNA 4EF5A 4G07A 2VQSA 4C5BA 4WOKA 3OE4A 4DQLA 3AEXA 4NBTA 1XL0A 3DC2A 5HZMA 2H3EA 5HF9A 1H2RS 4D8VA 1JPNA 2I9KA 4C01A 4OD0A 1E3SA 2QY6A 3JQPA 1C3OB 4P7KA 5E3IA 4C08A 6REQB 3D4BA 5KTKA 4PZ9A 4X3OA 4GOOD 5AM3A 3KV3O 4EMTA 4J07A 4YRFA 3CBQA 5GGYA 4A6PA 1YB6A 1DE0A 2FGJA 4MVJH 5BOSB 1NWCA 5LP6F 3G2JA 1BMFD 4NENA 1NUUA 2Q8NA 3DTYA 1XCLA 4R8VA 2Q3HA 3OJ0A 1MQAA 2EIXA 5LB4A 4Z9YA 2W70A 3R5TA 4Y7CA 3D6MA 2H1VA 3ENKA 2WIJA 2HSZA 1KNQA 2WZBA 2Y93A 4N18A 1RW4A 3SMVA 3CMCO 5ED0A 3WL5A 1L8AA 2SCUB 4ILKA 5DZSA 3JALB 2XHEA 3AK4A 5SYAA 4PPGA 2Y4OA 1V9LA 1VI6A 2WP8J 3AL3A 3BGSA 3BMCA 3AIKA 4OQXA 3TR5A 1KI6B 3MWDA 1YI1A 1T91A 4FGZA 5ENVA 2CXQA 4RIIA 5T4FA 2C4VA 5EQDA 4RZHA 5C37A 4MEAA 4YJGB 4F85A 3AL2A 1X1TA 2Q6TA 1ZVKA 4LHWA 4B48A 1L7OA 2PPVA 3BIOA 3UUGA 2HC9A 1UK8A 2YN0A 2Q5JA 2EYQA 3IQIX 5IBPA 1MW8X 2CVHA 4IEIA 3KX2A 4L4ZA 4A8PA 5BSWA 1G3IA 3UGTA 5IVDA 2CF6A 1M34A 2ZTHA 2PUDA 4ZAFA 4RTKA 3T5AA 5CGQB 3P8ZA 3TMAA 5JISA 4OLHA 1XNHA 1ZH4A 3M5CA 1I5EA 3ZDXB 4Z4QA 1IK4A 2RGNA 6NULA 2OCPA 1KEEB 4U9UA 1WZUA 1N9GA 4WV3A 4Y2RA 5JSYA 3EXG1 3PFKA 5FWYA 4ZT5A 2WWVD 3MJCA 5F2EA 5FIUA 4ZD6A 3FMVA 3TQRA 3L1HA 1Q22A 5JS6A 5F7ZA 2WJVA 1EK5A 3GNLA 2CLIB 4MKRA 4V0ME 1GM5A 1WXHA 1XEFA 3U3ZA 3DGEC 2QXTA 4B40A 4Q18A 2HFJA 1AA6A 3UMGA 3C6QA 2DT5A 3R3ZA 1I10A 3KQOA 3TEJA 3ML1A 2ODTX 2I03A 3PDHA 1NHWA 1GG5A 4KN8A 2JH3A 2O2ZA 1O94C 2WPDA 3EMVA 1ZPDA 1KOJA 5ELLA 2LXNA 3DBVO 4B4OA 1DRVA 4WCFA 2W6QA 4Y6SA 5FHRA 4F2WA 5C1DA 4FGSA 4LJ7A 2GN9A 3KELA 2D74A 4QBKA 1ETHA 1X38A 1YQXA 4UU8A 3ECAA 3K9GA 3DE4X 1RYHA 2NO4A 4UFNA 4UTPA 1QRTA 3A4LA 3B53X 1XZLA 5TSDA 2ZREA 2R751 5EC8A 1JZQA 2ODPA 3JQ9A 4CG1A 5B64A 5JEDA 1M76A 1XZNA 1MPTA 1SCIA 4O4HB 2XTZA 3RU3A 3SCZA 4EBFA 7MDHA 1Y4DE 2DFKB 3GDGA 3HUDA 3LUDA 3SJBA 2DR0A 2EKDA 4S24A 2M6LA 4G0OA 3BWDD 3GFTA 1ZSNA 2IYWA 4E1VA 1T0BA 2WMOB 5KTRA 5K0ZA 3QJ5A 4DDVA 4NXNB 1G4AE 5JNWA 5GY7A 1GTZA 1UDXA 1M6WA 3FZNA 4XQGA 3TR6A 1ESCA 3W2GA 2VR1A 2YS7A 4BKQA 1NW9B 2XA2A 2QTNA 4RKWA 4AX4A 1R0RE 2W22A 4I2VA 2EG9A 1NLUA 4K6OA 3NWPA 3FZEA 5BQ3A 3RSLA 4EHDA 4E7OA 2GBLC 3IT3A 2J46A 3TJRA 3BERA 5L9AA 3GAMA 3HUUA 2R84A 4DA7A 4KTTE 4E1BA 1YKGA 2FXIA 4IIGA 1SQGA 1Z0AA 2CXSA 3EFEA 4DLKA 4X20A 3K1AB 4ENSA 1DO8A 4UXIA 1FDVA 4ZAVA 2C8VA 3BXOA 3UMVA 4KO8A 4O1IA 3FTPA 3QF7A 1O2DA 4G1BA 2PHZA 5AM0A 3SLGA 3MINA 5JMTA 1G9SA 3C24A 1XEAA 3OQBA 4HD8A 2BZ0A 2VT2A 3PE4A 3LVQE 4RNDB 3DTNA 4NAUA 3RDPA 4OUKX 3PNBA 4ZTBA 3YASA 2FGKA 4RDCA 4BNTA 4BVEA 3CKYA 4R6WA 3QFTA 4I3HA 3Q0TA 5EHGA 3DQPA 2L18A 2FG7C 3IV9A 4OHCA 3H5AA 3ZU3A 2PO7A 1OQAA 3I6YA 2BFDA 3IBYA 3OQHA 3WGUA 2IHYA 5GVSA 1JI0A 4KQ2A 3U19A 3K9BA 3VX4A 2EW2A 1L5SA 4BZZA 4F9FA 3HACA 3BORA 3CG0A 2EQBA 3L8HA 4AMYA 4K9QA 3DONA 3WWCA 3QLJA 1K8QA 2AN4A 4MV7A 5EZYF 3HCPA 3UBMA 1R0ZA 2YXPX 2ZPAA 3L0PA 4LJAA 4QKQA 2IOFK 1LQ2A 1NMQA 4YLGA 1II8B 3GEDA 3NHZA 3PL1A 3BTSA 3KQVA 4KAAA 4PYIA 4DXHA 1A9QA 2QZZA 4XWTA 3MLAA 4JVMA 3LX4A 2H1HA 1FMFA 2I4NA 2HNBA 4GBED 3PLAE 1PS9A 1Z38A 4OYLA 2C31A 2IVFA 2Y2VA 1S2LA 3KXPA 4ZYYA 1R8XA 4F9EA 1A77A 3B3GA 1DKQA 1VE1A 2MSNA 4H27A 4NJOA 2AG0A 1DAEA 3SHWA 2FJ0A 1DBIA 2IUSA 3BJEA 5I8PA 5ICGA 4LV5B 4MR7A 4TZKA 3E7XA 1A7UA 3RROA 3GVCA 4KR7A 2VH5R 5B1EA 3WLLA 5JRJA 2QD3A 3NLLA 3QVWA 1JKXA 3TH5A 2PX2A 4M83A 5HMLA 4K40A 4M38A 1VLQA 3ZTYA 3MQFA 5JNRA 2WT9A 1AKUA 1KGDA 3O9MA 4V24A 1JSRA 3M5DA 3KJHA 3OCUA 1NPDA 4MRVA 3TB4A 3KYDB 4RY0A 4U00A 2LKDA 3TD2A 1M2GA 1C7EA 2IQIA 2RCNA 2YHIA 1K08A 1Q17A 3B85A 2EKQA 3WQBA 1DKUA 1YDMA 3D1VA 2BT4A 3LZ6A 3OZRA 1E6WA 3GOHA 1SBIA 3ORQA 4GZ6A 1FQOA 5J5VA 5B6JA 3P2KA 4EW2A 2GN8A 5BMVA 1MH1A 4GC5A 3RBAA 4DV4B 1WUIS 3TQQA 1KMQA 4WL0A 1UM9A 2NVOA 3NHMA 2RH5A 3GUVA 5CM2Z 1GGKA 3JASB 1YB2A 3GQBA 4LTDA 5HGXA 5FTKA 1K6EA 2GR9A 2OG2A 4BVBA 3MXTA 5BORA 3LYLA 4UATA 4E5PA 4G89A 2F1KA 1E2FA 4B7AA 2ZSUA 1NFQA 3ZHZA 4EY8A 1G5FA 3G9TA 3CR3C 3PUVA 4PAWA 1A1VA 1WL8A 3FI0A 4Q9DA 2P9FA 3N2KA 1CE8B 3ND6A 3QY0A 3I2KA 1L9KA 1NBEA 3SAJA 3UOWA 4DIUA 3LIPA 2OZLB 3AUAA 1Z2DA 4ZA2A 1ZOLA 3WYAA 4KVZA 1EEXB 3D5TA 5IJXA 1U8FO 3K73O 1RMTA 4UM7A 1JXMA 2IV7A 2JEOA 2JIZA 2D5BA 3GCZA 4K87A 2DWQA 4AUMA 1FMLA 3D7MA 1NJ5A 1UEXC 1VB5A 3KJEA 4ND2A 5DHRA 3U0BA 2ZJAA 1L7XA 2OHXA 3TLZA 1A2BA 2BMAA 1YF3A 1GUZA 3PNSA 3H8VA 5ALSA 3SICE 4EG0A 1EE1A 4HSGA 2X22A 4L27A 2RGYA 1QRSA 3WGGA 1HDRA 4LC0A 5LOVF 1NVKA 4L85A 4Z3DA 3UAZA 2UXDB 2D1RA 3LY9A 4KZPA 4BQOA 3WLFA 3QTBA 2YCBA 3UKOA 2FN7A 3SS7X 3HPRA 5EWMB 1UK7A 2DPHA 1E2EA 2WF8A 4JLMA 3C16C 4BO6A 4I50F 2ZE8A 4UOEA 3CH4B 1FEZA 2HSWA 2ZCUA 4PZUA 4XD7A 3ZDFA 3QG5A 4I1PA 2ZSAA 1P62B 1U2GA 2VUSA 5K8CA 5G1OA 4A8HA 4DDKA 2VHVA 1ZX1A 4RA9B 1TTTA 1O94D 3FWPA 1ZNZA 2HX1A 1IY0A 1BYIA 5JE8A 5LA6F 4TV9B 5B1HA 2Q1SA 4BE4A 3G0OA 1E20A 4KYUA 5IPFA 3JZFA 4YXFA 5CDGA 1FYEA 3INTA 1BX0A 1JAHA 1RYNA 4I0WB 5L4LA 1XZKA 4D26A 3KSRA 4UE3S 3ZY5A 3A2LA 3GN2A 3MHPA 5DBOA 2YFHA 3PSAA 4PINA 1E79A 3BOSA 1R50A 1TA9A 7ABPA 2I6GA 3T3NA 3L4BC 2JF0A 3AKCA 3IAXA 3I83A 4K6MA 2VQDA 5JVDA 2OHFA 3WA7A 3EPKA 3ORYA 1AX9A 4ZEVA 5IUNC 2ZXFA 3DDSA 4N3BA 2ATEA 1MV5A 5AVRA 1GPH1 3FHTA 2VK4A 1ARZA 2D7CA 2JLRA 3FDZA 3FOWA 1WD7A 3ANLA 3L6UA 4NZYA 5KVAA 1Z62A 4BP1A 3JRWA 1XA4A 1GT6A 4MVJI 5FOVA 4CCAA 4C4AA 5FBVB 3EF1A 1CSEE 3KZXA 2HCRA 3L43A 4S1TA 3G68A 2QN7A 2IZ0A 4RF3A 4MGKR 2V0GA 3U09A 1G6KA 1MGOA 3W8EA 3EA4A 4HWSA 2C83A 1P2TA 1RYYA 2AFHA 2B9VA 3NBQA 2Q5IA 3OCJA 3DZCA 3PE6A 2JZCA 4NK4A 2KLBA 1PWZA 2WWFA 2WIGA 1JFFA 1QGUA 3JQ8B 3LBIA 1DJPA 3A25A 5M2QA 2YZGA 4NU5A 1ODJA 4WW0A 4LVOA 1BXRA 1X0VA 2NAPA 3KOWA 2DHDA 1AY0A 4CNQA 4G8JA 1NULA 3MPUA 3C43A 3MSXA 4LJ6A 1ULBA 2CVQA 1VP9A 2ONCA 1N77A 4BNMA 3D6HA 4YP0A 1UBEA 1GZHB 2WTUA 4WK0B 4W5HA 4FDAA 3A1FA 1NT2A 1R10A 1Y8RA 4GP9A 1KSGA 2Z3ZA 2BBTA 3VH3A 3B2QA 4F6LA 5BV1A 5JANA 3AFHA 1U6JA 1OBCA 3HKDA 2L17A 4BAUA 3JQFC 3EK2A 1QQBA 3PIRA 3D31A 5TEWA 4TN1A 2C9DA 1SELA 4KIJA 3ND8A 3ZCQA 5JZOA 1N8NA 4KR2A 2IVZA 2NO0A 1DAIA 1NP7A 2RKWA 1S2MA 3WADA 1RBMA 4ECEA 4E33A 1DFIA 2E5FA 3PNQA 4LSZA 4OJTA 4V02A 3I2YX 3W5DA 4NH4A 5GTDA 1L7VC 4J76A 1YONA 4LI0A 3H9UA 1JILA 1SK8A 1DPFA 3CS3A 3NIGB 4ZQFA 4DCVA 3GOQA 2FEWB 4UJ3A 1UKYA 5JHGB 4FSXA 4QDJA 5JWOA 1U7DA 2BH9A 4QVKA 1Z6GA 2ADMA 2BMDA 1H9BA 2QMUA 1KVUA 1X9GA 2REXB 3ABIA 2UV8A 3IPXA 3L7YA 1PR9A 3MMNA 4FGLA 1VCIA 1Q2UA 2O6HA 3CKKA 4RZIA 5A7HA 3S7TA 4OJKA 4ARBA 4LYEA 4BP8A 5KNCH 5IDVA 4NIMA 3H5NA 2IHVA 4JJ4A 3LPDA 4HGNA 5DSTA 2C2HA 5THKA 3RVKA 5KUTA 1CKEA 1N5RA 1EM8A 3M8KA 3PNLA 4JJAA 1RC1A 3HCOA 4G0UA 1ECLA 4AECA 1SU8A 1TZJA 1XDSA 1K7CA 2PQ2A 1VXRA 2ZIAA 2ZTSA 3OE5A 3CVOA 4Z9FA 1Q1EA 4KRYA 2M9MA 1H4QA 1G2PA 3CUEF 2CLCX 3HXPA 3R0XA 2Q21A 4I7EA 4U7FA 5AVWA 2UUAB 1E8MA 2AT1A 1D4FA 1RRKA 2JIZD 1B76A 3DF7A 121PA 3B3FA 1EFCA 4N5LA 4ROTA 5AI9A 5AKIA 3RTCA 6YASA 1Z4PX 4FBLA 5TQJA 3EUWA 3K5HA 3QVGB 3N8DA 3PGJA 2Q6VA 2X1LA 2CNWD 2MSWA 2AN9A 4JUAA 1R6AA 3TDKA 4ARAA 2P2LA 3RADC 4OU5A 2VDLB 3K7EA 2QF7A 1OWOA 4RORA 5FXMA 3PLNA 1I30A 4I2NA 5DT2A 3R7LA 5BSTA 4NHEA 1FUUA 1FU8A 3QE2A 4YV7A 5KU7A 5LDGA 3EUFA 4D0GA 3ICEA 3DTTA 1SU6A 4MS4B 3I09A 5K51A 1LVHA 3RIHA 3THRA 2DXIA 1ZNYA 5EUMA 1AURA 3GH3A 1VSQA 3SBEA 4RIEA 4DYDA 3FTNA 2Z98A 4MJXA 1R4ZA 1BS1A 3R4VA 4J0QA 1G21B 4JIMA 4LXGA 2ZYVX 4QXPA 2NTJA 4R2IA 3ABZA 3REFA 4BECA 1DWPA 1F12A 5AJXA 4BX0A 2Q0QA 1JE0A 2J3IA 2V7QD 4MEJA 2ZBEA 5A3RA 4EQ6A 2GMWA 1KO4A 1WBDA 2GTIA 4PW0A 1U2ZA 2ZJ3A 2FUNB 2ZRAA 3A6HA 3P9YA 2FW6A 2QRKA 4Z0HO 2BEKA 3H5TA 4N39A 5D6OA 3CLVA 3L1VA 3A6GA 4PX5A 4D41A 3L4JA 1HYGA 4EG6A 3FFWA 2LD4A 2X2OA 2DSTA 3N3BC 3T1OA 1YUBA 3REOA 3WL7A 2X8BA 2M6KA 3AKZA 3G2OA 3HKBB 2CT8A 3I62A 1P81A 2PD6A 3HUEA 3QF4A 3U7HB 1IATA 4EY3A 1F2UA 1NZJA 2X1VA 5BSGA 3F7TA 3RUCA 3UJHA 3A6JA 3IO5A 2NO7A 3T9AA 3PWZA 3OPYB 3SS9X 2PBFA 3TXXA 1QU3A 5I7VA 4AU1A 1Y63A 4NCIA 5JH7F 3GWZA 3ND9A 1ZIXA 4D8YA 1SB9A 1RQXA 3A0RB 4ZXPA 2GOYA 1E2IA 1QIIA 1SBHA 4MUJA 4M98A 3TUZC 1KO5A 4ZEOA 3JWJA 1DEOA 1E62A 2AV6A 3IOYA 1ZR2A 2DETA 3PQ6A 4IQFA 4Z9BA 1Y4UA 3WTBA 4JMPA 4XDGA 1J09A 1M2OB 1TC2A 4I36A 1EXNA 3NOVA 5ALUA 2P9BA 3V8EA 4XM1A 1X7GA 3CV3A 1EQAA 3DV9A 4G8DA 3UJ8A 3I2FA 3UJCA 5B58C 3NC0C 4PXAA 5E6RB 5IU6A 1GZ6A 5CX1A 5JARA 2YC4C 2E4VA 2ID7A 2B35A 1EWVA 3IMFA 4JBYA 1SD2A 4LXYA 4MCIA 1JVSA 3T3EA 4ZZ1A 3A9RA 1SBYA 1Q3HA 1RE1A 4ZRNA 1GKUB 1R9MA 2YUIA 5HRCA 3WKEA 1C7IA 3VR5H 2H65A 4PYJA 3TL6A 3COZA 4P34A 1UBUS 4LUCA 3JSAA 3IMEA 5CT8A 2QM0A 2OYSA 4B3CA 4LZPA 2H9AA 5FWAA 3AY0A 3L7NA 1OA1A 4KQHA 4TXJA 1PYDA 4TTRA 1XVVA 3RUFA 3RW9A 2BUAA 1GQYA 2OECA 1DKRA 1YASA 3H5VA 1OI4A 2CFOA 3LF1A 5A6SA 1K6XA 1XF9A 3AW8A 3GHYA 4WOBA 3BCSA 1WWKA 5EHNA 1LTHR 2E49A 4U2CA 1ABBA 2FI1A 2H16A 3P0FA 1KSFX 3GARA 3H1AA 1TCBA 1ZGCA 4M9SA 1XLTA 1TVEA 3WB0A 5CB0A 3HUTA 1CZOA 4X94A 3PZBA 4D25A 3VTFA 1MBZA 2ECQA 4B2PA 1L4UA 3IVGA 2YN2A 2GCIA 3EXFA 1X9HA 3HG7A 1WHTB 2K5UA 4L3WA 4OUDB 3KPYA 3NHBA 4UKDA 1NX6A 1XMXA 4L5BA 1MPXA 1AS2A 3TOZA 1BIFA 2GN1A 2BJHA 3HBFA 4R40A 4RHCA 4WCDA 1P6UA 5IXSA 2TRSB 4II3A 5HBRA 3EASA 1TYDE 2C9ZA 4TZ0A 4O4LB 1EJ6A 4FTWA 4N5NA 1LBQA 5E6UA 1MTZA 4C5AA 4BGDA 2X7XA 3NPMA 3GAFA 3ZQKA 5TXGA 3C5CA 3FH0A 5LQMA 5KDDA 1U9CA 1W34A 1PNVA 2HK8A 3KT8A 1KYTA 4R01A 4Y2PA 6AT1A 3KLMX 2PWBA 1S3IA 3T7TA 4F2DA 4NG4A 1Y6FA 2VIIA 2PFKA 1XMVA 1E32A 3GRPA 4KQ9A 1SWWA 3ITNA 3I76A 2HBRA 5SZHB 4QICA 1GP2A 5FUXA 4U3JA 3RRBA 3ZWKA 1JH8A 2GZ1A 3BH0A 4J16C 4CF5A 4CJXA 1A71A 3SSMA 2RHHA 1KAOA 4EPWA 2ZU0C 5CDUA 5KYKA 2HR1A 4WJZA 1PG2A 4HH0A 4M1EA 3C3JA 4ZCLA 3TFWA 5K3OA 1VL2A 3B6MA 4HT3B 1M8JA 4HDSA 3AP1A 2AJ8A 5DNVA 3DVSX 5BVHA 5TC4A 2CBXA 4MR8A 4WZAE 2B99A 4CTOA 3WWOA 3B52X 3O94A 3NNNA 5DGTA 4BMZA 1B6SA 1GYRA 2MSKA 1KYIA 1Q74A 4UOZA 1VGQA 1ISJA 1JR3A 3E7WA 3NVMB 3VHXB 5ALVA 1A9OA 1OBHA 4L74A 5JIBA 4KV7A 5EP4A 3ZJ4A 3BK2A 4M6WA 4M46A 2C2XA 4JB2A 1Z4JA 3C98A 1QTNA 1FTNA 3BFKA 4Q3KA 2TSYB 3BREA 3MAGA 2PX3A 1B8OA 5KWVA 2TMYA 3O4FA 4EJMA 2P75A 4OAPA 2BFPA 3USES 4CCYA 2DQYA 1UPBA 4M7WA 2CB0A 1SURA 4L75A 3I8SA 2YFQA 4JJ6A 3DJYA 1OTHA 3C4JA 3CGWA 1XWWA 3BIFA 2R6AA 1X74A 3PX7A 3VBCA 3RHSA 4NCBA 2VXYA 4TLMB 2VEOA 3UAYA 2MINB 1K88A 4IH9A 2IKSA 1N1MA 3BD6A 4WA7A 1QONA 2F48A 4NZOA 3TLYA 3O8OA 2WJYA 1D2HA 3HYCA 4GVPA 3W4JA 5AXAA 2C42A 3NOXA 4RYLA 4CG2A 4NJEA 3SF8B 4YRSA 1XTZA 1YNSA 4MW9A 3D6AA 4JJEA 2PMDA 4FEYA 2XKKA 1CZLA 2QZJA 3D8SA 2I33A 3LBNA 1Y9ZA 4M49A 4RDHA 4KX5A 4YJDA 1D1TA 4IJQA 5HR5A 1KP2A 5FBRB 5GM2A 3AC0A 2OCLA 3H8WA