4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
2YVUA 1GP2A 3GJ0A 1RVDA 3BERA 2BWJA 5EQTA 4CIDA 4BFYA 4NYJR 1FW6A 1Z6GA 2XZPA 1AKEA 2JLVA 1E6CA 3QPUA 1XCPA 2WIBA 1OYWA 1EXMA 3L0IB 3ZJYA 3DKPA 2PX0A 4EFLA 1KYIA 3QF4B 3U44B 4NCHA 2HF9A 3A1UA 1E2KA 3C7KA 4BFVA 1E2FA 1XEXA 2OESA 3CH4B 1KSJA 2CE7A 2OSBA 2CVFA 2VHUA 3IO5A 1XD9A 2D4HA 3Q5EA 1HYQA 4OHWA 4D2IA 3VR5A 1Z07A 3NXSA 2HLDD 3KXIA 3U3KA 3W6OA 5IDVA 3RWOA 3WRXC 2YWGA 3E70C 2FEOA 4OBEA 2BBSA 4HATA 1US8B 2QTVB 1PV4A 2A30A 1JPNA 4OL0A 2ZEJA 3TW4A 1GIAA 1BO6A 4OK3A 1ZYUA 2DFLA 2V6JA 3U7HB 3K0AB 5JWOA 2CCKA 3NBZC 2BEKA 3C14C 4NCJA 4F93B 5KUTA 4H9GA 4BUJA 3C4JA 1GOTA 1E1RA 1N6PA 1RKBA 2GKSA 1ZRHA 4HLQB 5ELXA 3CWZA 1DAFA 4YQFA 1SKYE 2QU8A 1QG2A 4JLDA 1KOFA 1R10A 1QVAA 4QHYA 1GKUB 4TQUS 1Q3TA 2CCGA 5DN6A 3WYGA 4DLTA 3HPRA 3VU9A 2OFOA 3LBNA 1IXRC 1ZM3A 4A8JB 3Q8XB 2WVJA 1YR8A 3CNNA 3PITA 1EFHA 4CT4B 2F6RA 1E94E 1KO1A 3IGFA 4UXIA 3HR7A 4RD4A 4R71A 3I8SA 1P9NA 3L2OB 3QE0A 3QXCA 4LBWA 4OQXA 3L0SA 3QJYA 4RFVA 2IL1A 1XP8A 3DM9B 4XSGA 5SZKB 3OFND 1E32A 1PUJA 4PC6A 2XB4A 2RB4A 5DLQC 1Z6XA 4ARZB 3MWJA 3V4FA 1BYIA 1TL7C 3IPXA 4BFWA 2Z83A 1CJVC 3RRNA 1MT0A 1HA3A 2G3YA 4HAVA 4LV6A 3L8YA 4LX0A 2GDJA 4Q00A 3B1WA 4R98A 3RYTC 3K09C 1NLYA 4O25A 2IWRA 3A1VA 3T5GA 1ZD8A 1N25A 3LXRA 3I5XA 2GCOA 1LTQA 2BIFA 4TMTA 3TNFA 2VPPA 3TSOA 4ESHA 2QMHA 3SYKA 3LQQA 3REFA 1GDDA 1SXJE 3P4YA 2ZYVX 1ZNXA 4MDEA 1QG4A 2A5YB 2H7VA 2ZXUA 2VP5A 1KDTA 2XJ9A 1OJLA 2YWHA 3KQLA 1CKEA 1MO5A 4Z8XA 5JRZA 4B3CA 5DISB 4KITB 3UMFA 2V7QA 4EPYA 1N6KA 3P26A 3UWOA 1Q57A 2BBOA 4LGMA 1WCV1 3CPEA 2EW1A 4URXR 4QBHA 5CM8B 2ZR0A 4EJSA 1VG0B 3QKTA 4ESVA 3L8ZA 2DHRA 4I4LA 1W4BA 1A7JA 2RGXA 3QF7A 4D4JA 3THYB 3N70A 3GLGB 2PZEA 4B71A 1AQUA 4CVNA 2CL6X 2B21A 5KSOA 2YKGA 1XRJA 3PXGA 2PEYA 1UFQA 5EZ5A 3GLIA 5G40A 3AVQA 4MDFA 5DE3A 1YRBA 3C41J 4LHWA 5BQ5A 1GRQA 3ZD7A 4QJ5A 1VIYA 3D7MA 1ZNWA 1A1VA 2QZ4A 1LS1A 1D5CA 3EC1A 5E7IA 5AK0A 1D8TA 1FUKA 2QENA 3UANA 4WIAA 2WJGA 4B33A 4ZI3A 2N1BA 2BBWA 2QY9A 1N6OA 2PZGA 4HUQB 3SQWA 4ZV4A 2NGRA 2V1UA 3OEEA 1RPZA 2ORWA 3AKEA 3Q7PA 3I32A 4S2EA 1XTKA 3AVXA 3FE2A 1J90A 3X2SA 4Y0AA 3QPWA 4DIEA 3Q9LA 2ZRJA 4C0HA 3LWNA 3BRWD 1HE1C 1Z06A 3BB1A 3R8CA 2RGDA 4UXHA 3TLXA 3R9IA 2J0VA 1YKSA 2YHSA 4KO8A 3NEYA 2I3BA 1P2TA 1DG1G 3RS5A 2O8FA 1E79D 4CYMA 5KDDA 2IS4A 2A5GA 1KO7A 5E7MA 3K0FA 3RC3A 4JLVA 3WRYC 5BXQC 3GFTA 1OW3B 2A7QA 2ZRKA 4HZIA 5KOYA 4HB4A 1OV4A 4DVGA 1OSNA 2HUPA 3PR1A 3UMRA 2V55B 2F7SA 3GLFA 1CJTC 3KJGA 1G7RA 1F48A 4Q19A 1ZBDA 1ZD9A 4GZMA 1OF1A 2R6GA 1D9ZA 3PCRB 3WP0A 2ZE5A 1NMYA 2OCYC 3IIMA 1LW7A 3IKJA 5B58C 3ICEA 1GNRA 3MJRA 3U44A 1KI1A 1LFDB 1XZPA 3SFVA 2X2FA 1G9XA 2ZRGA 2ZRNA 1II8B 3EXAA 4LCBA 1W44A 4LOAA 2BC9A 1XTSA 2P5TB 2GAAA 3QBTA 2P2LA 5HKKD 3UK6A 4RY2A 1NIPA 2XTZA 1YZTA 2FGJA 4G5GA 2ODBA 3PUVA 4V0KA 2FPMA 4DCNA 5EUMA 1QVRA 4Z54A 5DHFA 2VL7A 5L8VA 4PHHA 4JS0A 4U7DA 4GSYA 4QRHA 1Z0IA 4ZO4A 1E2HA 3PQCA 3VKGA 1RRPA 2ERXA 3OFNA 4G0NA 1BMFD 1Q22A 1N5JA 2N42A 4Q4LA 5AJWA 1ZMXA 3Q72A 3RSOA 1A2BA 3UXMA 5JRJA 3QG1A 4JLKA 2NTYC 4PQRA 3NHAA 2PLRA 2JJ2D 4P4SB 3QOFA 1W2HA 1X8LA 3CRQA 4URZR 2H57A 1IJFA 3B78A 1KGDA 4TTRA 2PMDA 3JZAA 3W90A 3HU1A 3H84A 3EAQA 2GZDA 1I2DA 1CRPA 1KI2A 5DN6D 1DARA 1XD2B 2ZI6A 4FINA 1MO4A 4WZBE 4H1UA 3K70D 1G8YA 1Y3AA 5GJVC 1JALA 2C77A 3PG5A 4OQNA 5EE0A 2ERYA 1D9XA 3GFOA 2QL6A 1KO5A 3EIHA 1DAGA 4OYHA 4R2HA 4KODA 1E2MA 4BECA 5DIFA 3T1TA 3KJHA 2RGBA 4ACBA 1NVXQ 5HCIA 1RJ9B 421PA 1PVOA 2GZAA 3WMEA 3EA5A 2D62A 1MRNA 1NMZA 4Q4HA 2ZRBA 1U8AA 2BCGY 1BS1A 2BJWA 3ZIAA 2H8KA 2ZSAA 3O47A 4YMVA 1XD8A 4KXFB 4UNRA 4B47A 3LAWA 1H8ED 1U94A 3OE7A 5A5GA 3I61A 2P5SA 4AG6A 5H70A 4M1TA 1FQKA 3HDTA 2HLDA 4DB2A 2SHKA 2AN9A 5F9HA 1GRNA 3B6EA 2BKEA 1KKMA 2IYSA 3VQTA 4U00A 1W48A 1AN0A 1JECA 2IX3A 5JJIA 1A2KC 1K5DA 1U9IA 4Q01A 3GLHB 3U7EB 5C2JB 4EJSC 3KQHA 1E2JA 2Z43A 3W5JA 1GWNA 1D2EA 3TIFA 1OIXA 2OHFA 4LYAA 2DCUA 4YMUA 1R5OA 1SVWA 2HEIA 1TADA 5FFMA 5KTYA 4HLCA 3F5FA 1R8QA 4GOJA 5DO9A 2DWOA 2CLDX 4IOKA 3DOEA 3AKYA 2FA9A 5FOWA 1HQCA 4XOIA 1Q21A 4HAXA 1QDEA 1CXZA 1VHLA 4RVCA 1A5TA 1OIVA 1Z6TA 2BEJA 3AUXA 5LDDC 4IEIA 2R2AA 4BZQA 2RAPA 2PCJA 1ZP6A 3CONA 1T6NA 1OE0A 1J2JA 1SXJA 5KDOA 1P72A 1OH5A 4QXAA 1MKYA 2XTMA 5FPHA 4RD2A 4Q9LA 4DCSA 2RGNA 3K9HA 3IO3A 1C1YA 1KY2A 2H5EA 3W5IA 1CEEA 3IEVA 1OB5A 2ODWA 1DOAA 2BVNA 2WSMA 1J7KA 5LPNA 3AM1A 1XWIA 5J4VA 2BOVA 1T4GA 1IN4A 2JDID 3LVQE 4P32A 2QG6A 2DB3A 4LK2A 4QL3A 2GJSA 3SZRA 2J1LA 4LPKA 4OI1A 2ZRDA 3KB2A 3QSYA 2CHVA 3PEYA 3HR8A 2ORIA 4TL6A 4U5XA 3FHTA 2GNOA 2DFKB 1DPFA 2H18A 2KSQA 4Q47A 5JWRA 2AFIE 5EUQB 4YC7A 3A58B 2VSFA 1VHTA 4N1AA 1E2PA 4TTPA 1AGPA 2ZUCA 1JR3D 2CLSA 2F1RA 3HU2A 3SNHA 4P31A 2ZAMA 1G64A 2ZYTX 1UM8A 4JVLA 2EYUA 4TSFD 1I4TD 1R7RA 1Z83A 3K8YA 4FMCB 1S3GA 2ZIAA 4NBSA 3TUZC 1Z6AA 2JASA 3KL4A 4IOMA 4O2RA 1XX6A 4B73A 4S35A 4BRUA 4ABYA 4D0NA 4AKGA 2EU8A 1G5PA 1JR3E 1PZNA 4N3NA 2DR3A 3IIKA 1W36B 3SYLA 3SS8A 3T61A 1SVOA 1JEDA 4YMTA 1G18A 4ON9A 2ZUBA 4IW3B 2OXCA 2WSSA 1J8MF 2JLSA 5FBLB 4GMDA 4CEHA 4O0MA 3QPVA 4DXAA 3PIRA 4TLCA 2A5FA 4I1VA 4I81A 3K0SA 1VG8A 3GLHA 1YZUA 2IEYA 3L0OA 4BFZA 2C04A 2GCOB 1S2MA 1Z08A 2GF0A 2ONKA 1XXHB 2PT5A 2QPOA 3FKQA 4B2LA 3O8RA 2A78A 1FL9A 1OXVA 4B32A 4Q7LA 1FZQA 2BMJA 4RZ3A 4LYJA 3NDPA 4CGZA 5JMTA 4XTRA 2WWHA 2RHMA 2W2VA 2OG2A 1G19A 4JYBA 4M1WA 4LHVA 5B30A 8OHMA 3OIVA 1EX6A 2XNDD 4A1FA 1U0LA 1FMLA 4WW0A 2ZJYA 2IYVA 3ONWA 4OQLA 4D6PA 1E2LA 1UBEA 4BLRA 1TU4A 4P3YA 3THOA 2RGAA 1KTVA 2E87A 1KJYA 3FHCB 5BYKA 5AWFC 3FMFA 1OFIA 2NPFA 2NPIA 1XPRA 4XTCS 3REGA 4TMKA 1O87A 1NRJB 4A8JA 2H92A 5FH9A 2GJKA 2J3EA 1Q20A 5JJKA 4DIDA 1YZLA 1CIPA 4WVFA 3AUYA 4RZXA 4I1SA 2QROA 1ZUHA 1E9EA 4MYUA 5F2EA 2ZRCA 3RRZA 4CF7A 3AEZA 3EPKA 3KX2A 3VX4A 2ZREA 5BWMA 3TAHA 5L3SB 2FV8A 5EXPA 3CPHA 4LJ8A 5HZHA 1NN0A 4B43A 2JJ1D 2CE2X 2WTUA 1C4OA 4Q4JA 4BFTA 4BASA 2XSZA 4B76A 2ZI5A 4FWIB 4G01B 1TQ4A 3EIQA 5BN5A 4Z1MA 2DYKA 4L15A 1B0UA 1B23P 2ZRLA 1XJ0A 4UNNA 5E3HA 2AK3A 3EWAA 1JJVA 1KI4A 2ANCA 3TW8B 4M9XA 2ZSBA 3LA6A 2HDNB 2DWQA 3LY5A 2VHTA 2CDNA 5C46F 2F43A 4HLDA 2NZJA 4C3ZA 1Z28A 4D4KA 3B1ZA 4ZCLA 1E96A 4DLYA 3U61B 1BIFA 1X1RA 2Z6VA 3OEHA 3FYHA 1CF4A 2P67A 1XEXB 5K8LA 1CULC 3W9YA 4FMDB 3GCGA 2V54A 4XVUA 4DUGA 3CX8A 4CT5A 3Q5DA 1P9RA 4PANA 3D6TB 4US1R 1KIMA 4C9BA 4Q7JB 2FSIA 4L4UA 1NN5A 4FCVA 4RKFA 2XITA 1SXJC 2ATVA 3LH5A 2FSGA 1GITA 2XNSA 3A4LA 4US0R 3ZVMA 2ZANA 2J9RA 1II9A 1AJEA 3KXKA 4IOLA 1OLOA 1G5RA 1G8PA 4BLOA 2BCJQ 5FL3A 2OLJA 3SN6A 1GKYA 4PPFA 3KKQA 3B9QA 4IXNA 3U6KA 5K8IA 3H86A 3JVUA 3VFDA 1IOZA 2Y8EA 4BGDA 4JLBA 1IXSB 1XD2A 2FFQA 4YONB 4DSTA 1GVNB 3P1JA 1P9WA 2XX3A 2IXGA 3K0FB 4IDPA 1XPUA 2IYRA 4WZAE 5GJWC 1UBFA 2XZOA 4MRNA 4RZ2A 4GT1A 5TVKA 2IYUA 1E0JA 4OHVA 4FIDA 4LYFA 1KZGB 3GEHA 4V0OA 5AUQA 4US2R 2NQ2C 3AVYA 5LD2C 3U3RA 2FOLA 2X77A 2QAGB 3RNLA 1KZ7B 3CPJB 2Q9CA 1T91A 1N5LA 1KMQA 4QGHA 1XEFA 1N5IA 3SJAA 4JLMA 2A9KA 3CUEF 4A0FA 1GTVA 1I4DD 2QORA 4HB2A 5CJ2A 2QBYB 4L16A 3LVRE 5LB4A 1IXZA 1KK0A 1SVMA 3ZZUA 2OBNA 2YWEA 2AKAB 4PC3A 1EWRA 3ASZA 3KXLA 4HLUA 3WNDA 2A2ZA 2H16A 3QF4A 5AUPB 2QRNA 4TLEA 2IW3A 3ZH9B 2ZS8A 4Z1MD 5E95A 5FOSA 5EE5B 4B34A 1NY5A 2ZS7A 4WBSA 2EFHB 1W36C 2BDTA 3B85A 2O8CB 4JJZA 1GL9B 4TMVA 1CR1A 2GA8A 2GXSA 3TGPA 3CF0A 1WRBA 5FTJA 2VH5R 1E9DA 5LBIA 1GL7A 2O8EA 4AYWA 3H4MA 5M04A 1JQLB 4A4DA 3NC0C 2GJAA 4P4TA 3BK7A 1ZVQA 3MAAC 2WIAA 5BN3A 2QA5A 3OIYA 3RS7A 2WJHA 1JPJA 2BMFA 5FR2A 1G3RA 1GILA 1M7BA 4BZPA 1NSTA 2YNMA 5H68A 2D7CA 2QSYA 4A2QA 4A0HA 4IFEA 4C0QC 4EQ6B 1JB1A 2KBEA 2HCBA 1F5NA 2ZPTX 2X2EA 1G7SA 4HEJA 4Q1BA 4CEIB 2AR7A 3SJCA 1T3HA 4PC1A 2ZI3A 1S96A 1N2CE 2ASEA 1KK2A 1E69A 1NJGA 2C99A 4OQFA 1CJUC 3AVWA 1MOZA 2JLWA 1ZU4A 1OXSC 4LV5B 5FOTA 1U0JA 2ZJ5A 4A92A 3N2IA 1SQ5A 3R7WB 3LO5A 4D4LA 1TU3A 1XCMA 3X1YA 3EZFA 2D2FA 4DEXA 5C4GB 1E0KA 5IRCD 4W5JA 3CF6R 2XSZD 3MG9A 5KSZA 3LBIA 3DEFA 3OESA 2OZEA 2CEAA 2R65A 1NVWQ 1NLFA 2OUKA 2XTNA 5GVSA 4QGGA 1ZUNB 3GLHE 4JL6A 2F9MA 5BW8A 1HH4A 2G83A 4KSCA 3TUJC 4GRAA 2W6IA 5FUWA 1MH1A 1UJ2A 4GMXA 2NOAA 4PAQA 1EFRD 2Q0HA 5JI2E 2G0NA 4AC9A 2C98A 3S1AB 3U4QA 1W5TA 3LNCA 5CDFA 3W3ZB 3AVUA 2AL7A 1Z5ZA 4BLPA 4EJSB 1QHSA 2NO9A 3WYFA 2MMCA 4TT3A 3UKDA 5JZVA 2J5XA 3KKNA 2J87A 3GJ3A 3R7WA 3T06B 3BB3A 3AVTA 4PTLA 1NMXA 4HAUA 2QP3A 5GADl 1G3IA 1Z0DA 3FMPB 4K46A 4TMXA 3ND9A 4PO1A 2GF9A 3PFIA 5L3RA 1AS3A 1NVVQ 1SULA 2W6ID 3QKRA 2ODNA 4TL9A 1II0A 4V02A 3L0PA 4MKHA 1R4AA 1OXTA 4ZKEA 3J81k 1WA5A 2QMEA 4DSUA 4JT4A 2D74A 3B82A 3FDIA 3MCAA 4V0LA 1NY6A 5KPDA 2J0SA 1E9BA 1KO4A 5DH9A 4JL5A 3FHOA 4G5QA 2DPXA 4URYR 3BOSA 2KE5A 4Q7KA 1E0SA 4DLWA 1ZIPA 4DLUA 4Q21A 4ASUD 4M4SA 1WF3A 5TB5A 3VHXA 3KUDA 2WSSD 1H65A 3CIOA 1KHTA 4JSTA 4GBMA 3SYNA 3AGQA 2BM0A 2R6DA 1ZNYA 3NG1A 3QENA 5DGXA 4F92B 1GUAA 3CNOA 3IHWA 2O8CA 4PHFA 2B8WA 1VMAA 3U7FB 1T0HB 1Z6YA 1J70A 4Q4AA 5G41A 1KDRA 1ANKA 1Z2AA 1PUIA 4AY2A 1OIWA 4NKRA 2YV5A 2JATA 2QPAA 4EAQA 1IQPA 1JR3A 1XXHA 4QHTA 2CCJA 2BKUA 4TYNA 3ADBA 2WKPA 4N0DA 4XIGS 1VCOA 3VX3A 4F7WA 1EFRA 3MMPA 4OHZA 2RMKA 3IUYA 1TMKA 2BM1A 2FFBA 1YHNA 3GJXC 3A8TA 4PO9A 2ZVPX 2EYQA 2ZITA 3T35A 2O0JA 5K8TA 5DNYB 3T15A 1T8UA 2FZLA 2PZFA 1P60A 3GFPA 4PPQA 4B3XA 2O8DA 5HE9A 4Q18A 2EQBA 2OFWA 1U2RA 2IK8A 4GPTA 4MKGA 1V5WA 3LFUA 4FWTA 3I8XA 3KDSE 1FUUA 2XGJA 1RYHA 4GP6A 1I4LD 5J4KA 5EP1A 3FOZA 5JSZA 2JLUA 2HT1A 4LJ7A 3P27A 4M22A 4FCTA 2ZAOA 1WMSA 4MQBA 2EVWX 1KJZA 1W4RA 4DSOA 5HE8A 2AXNA 3QKSA 1DTSA 1G8GA 1G6HA 4BFSA 4PSKA 4ITRC 2VTKA 4L8GA 1OFHA 4IVQA 2R6AA 3RC8A 1DAKA 4ACAA 4LJYA 4PHGA 4QBGB 3CZPA 2HYDA 1QHIA 5FPKA 1G20E 1EGAA 3AF4A 5AUOB 2IWHA 4KFRA 1NBMD 1XPOA 3EZ7A 3QEJA 5FOVA 1OKKD 3LV8A 1ZC4A 2AK2A 3PENA 4P0TA 3QKUA 3IQXA 1DAHA 5JCPA 3GLGA 4GZLA 2WJVA 2R8RA 3D3QA 2PL3A 4Q1DA 1SVKA 1U99A 2F1HA 2ZTSA 1NBME 1CR4A 4TYQA 5KNBA 1TF5A 3VR1A 1EFCA 3TAUA 4LHZA 2GK7A 3N2EA 2AFHE 3EIEA 3DM5A 2PLFA 2QAGC 3TVDA 1QHHB 4PPNA 221PA 3TJZA 1RYFA 1KDPA 2UZIR 1ZUIA 3OE7D 2IHYA 2NO6A 2OCAA 2CNWD 5J4LA 4TZ0A 1W0KD 5JJLA 4PC7A 3ZIAD 2GHIA 4Q03A 1W47A 4MGYR 4B2PA 3V4RA 2VHQA 4RSGA 3VR3A 5EXTA 3CRRA 4N0EA 1KMHA 3MSXA 4LJ5A 4PPGA 4OI0A 3AV0B 3PUXA 4QOSA 4DDVA 2HJGA 2R6FA 2ZJ8A 2W6JA 4JIMA 2C03A 2GXAA 3OEHD 3QXHA 4LBZA 3VKWA 4PHTA 4C7OA 1YRAA 3K0CC 4HAZA 1QHHA 4DEYA 1JR6A 3QI2A 1R8SA 2X19A 3WHLA 1MABA 4UNSA 4I1UA 2AWOA 3LQRA 3W8RA 4TZ6A 2VIIA 2FZ4A 4ILEA 4MH0R 2Q9BA 1IHUA 2IXEA 4LV8B 1OHHA 3TRFA 4DCUA 3U4QB 3EARA 4ZI2A 1XXHE 1AZSC 5FBRB 5F3WB 1HY3A 4Q5IA 3NDBB 2WOOA 4ZDKA 3KKMA 1E2GA 4RD1A 1OFUX 1UDWA 2W00A 2JA1A 1Z3IX 4LWZA 3N5CA 1XEWY 1E4YA 2V4ZA 2EFEB 1E79A 2FWRA 4P33A 3TSZA 4OK5A 4LJAA 4JJKA 1Q1BA 1EFTA 1TUEA 2ZETA 1M1YE 3ZVRA 5KHOC 5CLQA 1MABB 2J7PA 1IN5A 4AWXA 2G6BA 3KTAB 5FTMA 2WPDA 4C0BA 3CX7A 4D4MA 1NN3A 4JYCA 4WZ6A 3H0KA 1YZKA 3BFKA 4W5WA 2QRZA 4IJMA 4IRUB 1DEKA 5DI3B 2JLXA 4B35A 1SKQA 1F2UB 3RRMA 3OEED 2IYQA 4ZIRB 1T5IA 3L43A 4MRRA 2QEQA 3NTUA 3R8FA 1E1QD 3I1FA 3RS3A 1KNQA 4KJZA 4QKQA 4LC1A 1G17A 3B1YA 2IXFA 1ESNA 2GJ9A 1ODFA 2ATXA 1JEEA 2O52A 4P4SA 3RLFA 3UATA 1WE2A 1IONA 2GCNA 2RKOA 1KK3A 3DDCA 4YXWA 2EWVA 1ONBA 1M34E 1Z22A 2O8DB 1NF3A 4W7SA 1MRSA 1P2SA 3MGCA 1RRGA 2YC4C 2WWIA 3VTKA 4KV9A 4YMSA 4URVR 5DI9A 4ARZA 3LDAA 3GQBA 4CZ2A 1WQ1R 5AR1A 3AGPA 3OHMA 4KBGA 4BRWA 2TMKA 3DHWC 3DZ8A 2Q21A 4JL8A 3NC1C 2FDCA 1M74A 1HT2E 1N6NA 2CVHA 2UVQA 2ZI9A 3K09A 4MYHA 3ZLJA 1P61B 2DFTA 2QE7D 2GAOA 2OAQ1 3F0TA 4KVGA 2V1XA 4QNRA 2GEVA 2IF2A 2R6CA 3BJIC 3KB1A 3RABA 1FTNA 3MWYW 1DADA 3VU9B 1N0UA 3FB4A 4GI7A 4LJ4A 4PAOA 4DRZA 4C0JA 1D2MA 4RJLA 1KI7A 2IT1A 3B1XA 4F4JA 5F9FA 1COWA 1KDOA 2E9SA 1COWD 4URUR 2V8OA 3RWMB 2JAQA 3B2EA 3SHFA 2IS6A 2XOKA 3CNLA 4B3FX 5KYKA 2F43B 2FGKA 3THWA 1Q44A 2Q3FA 1TF7A 4RD3A 4IEEA 1Q0UA 1R0YA 4KAXA 1Z0AA 3QEOA 4PQFA 1KSFX 3QXSA 1F2TA 2KJQA 2XNDA 3GMTA 3K9LA 1PJRA 3E5HA 5JFGA 4L9WA 1FQJA 3RS0A 3A37A 3BWDD 4G1UC 2P0EA 4UJ5A 4BEBA 4BWYA 2NMVA 2BMEA 4LI0A 2VP4A 2ZJBA 4G5RA 5FUVA 1XTIA 3HWSA 1OH6A 4BZXA 1KY3A 3QBVA 3TUIC 2CHGA 4EFMA 1IJEA 3LD9A 4AIIA 1G21E 3FFBA 1Q1EA 5IK2A 1S8FA 1RC8A 4NHOA 1OFTA 2A3RA 4E03A 3JVVA 4IFBA 4ZCMA 4DSNA 2FH5B 3DZDA 3SOPA 2CJWA 3VAAA 3I92A 1BYUA 4XWKA 3B5JA 2C9OA 3MJHA 3GJ4A 4A0GA 2J0UB 2CHQA 2QT0A 4PXAA 1CTQA 1SXJD 4UJ3A 1LF5A 2NO0A 2X1VA 4QJ3A 4U02A 1TX4B 1N3BA 4X8HA 4NL4H 3B7GA 4EPWA 5J4HA 1RRCA 1D2NA 1E1RD 4NYMQ 2PX3A 4Q9HA 4PFSA 1AIPA 1XMIA 2GBLC 3ICQB 3CR7A 5C18A 5FBVB 2OXRA 3LW7A 3PJRA 1UEJA 2WJYA 3ADKA 2MSDB 3K0EA 3TR0A 3WMFA 3U7GA 2J7PD 2WWWA 5IHPA 4OJKA 4FMCF 2VSOA 3K70B 1BH2A 4A6PA 2V3CC 1DELA 4RKEA 3NIBA 1RJ9A 2QSZA 2ONJA 1XCGB 4RFSB 2WICA 5EP2A 4KVAA 4C7OB 4Q48A 1D6JA 2P6NA 2ZUDA 5DYGA 1EFUA 3W34A 2X8AA 3T1QA 3UWKA 5A0FA 4QC2A 1DVRA 4KLNA 3W8NA 2UZ3A 2Z0MA 1G41A 1R5NA 2I4IA 3OZXA 3BFXA 4IKEA 3O8CA 3ZD6A 3A6PC 1KO8A 5TARA 1HE8B 3U3OA 4UNQA 2QGZA 1U8YA 3AP1A 4XSHA 3KKOA 5FOUA 1H8EA 2C9YA 2CK3A 2C95A 4JT2A 4Q9IA 5FUYA 4A2PA 3U3JA 3VKHA 4M21A 2Z5FA 4R7ZA 1AA9A 4CW7A 3T1VA 2VEDA 1R0ZA 2QTFA 2W2TA 1RW4A 3SE0A 2P3SA 1KI6B 1XF9A 1N0VC 1NI3A 1E9AA 1G6OA 2F3RA 2W58A 3AF0A 3EPHA 3FMIA 1X8JA 3EASA 4EKDA 1G16A 1UBCA 2BV3A 1UEIA 3K0CA 1XFAA 1YJ5A 3PEWA 4TYWA 5CK5A 1NJFA 4MRSA 1VIAA 4PC2A 4PO8A 2JLZA 5EP3A 4Q9JA 1S0UA 1W2GA 1JQJC 3V00A 1UKEA 1W0KA 3CR8A 4YDSA 4CEJB 1JJ7A 5EE1A 1G4UR 5CM9C 4UXJA 4X8OA 1IN6A 2WMNB 4HAYA 1KI3A 2MSEB 1J99A 1CR2A 3CO5A 1Z0JA 4K8OA 2NO7A 1MR3F 4NCIA 3PVSA 1XTQA 4R2IA 5KO2A 2PEZA 1W49A 4MYCA 4TLAA 1KI9A 1IY1A 2F3TA 4AD8A 4KFSA 3WBJA 1W1WA 2QGNA 2ZU6A 5CLLA 4QBIA 5D3QA 2FPKA 5B57C 3THXA 4A36A 1S3SA 3BB4A 1LB1B 1NBMA 3EPJA 1AZTA 4Y0VA 3ZS8A 3UPUA 2YYZA 3BH0A 4CEIA 2NO1A 4XH9B 3LW8A 1EWQA 4TQ9A 4A8JC 1UKZA 4PAMA 4TMWA 4AKIA 1HQYE 3GEIA 1AK2A 1ZJ6A 3MRSA 2WMOB 4HB3A 4JLJA 821PA 3NEJA 2REXB 2QNRA 3AKDA 4PQYA 3SC3A 4LBYA 5IT5A 2ZJOA 3L82B 1UF9A 2WJJA 2RHDA 1Z8FA 2VA8A 3CLVA 2XJ4A 3CM0A 4EPVA 2WZQA 3BGWA 3AF2A 3EWSA 2O8EB 3NH6A 3GLGE 2XXAB 2QPTA 2F9LA 4URWR 5SZJA 3I3SR 1ZIOA 3QQ5A 5CB6A 3NHBA 2CLCX 4M1YA 1E2DA 3EZ6A 2VYFA 1TEVA 2NZ8A 2ZR9A 1HV8A 1YE8A 2FX3A 2ZI4A 3IILA 3TH5A 1P5ZB 2WJIA 4RCYA 2DBYA 3TKLA 2GWHA 1SHZA 2JJ2A 1FMJA 4EPTA 4YLGA 1WBBA 3DPUA 2IA5A 4XWOA 2ZE7A 2V6IA 4B6FA 3KQUA 4V0NA 4G3XA 2QN6A 1U9IC 2Q9AA 5J4YA 4IOJA 3AVPA 3B60A 2QUZA 4DC9A 1X3SA 4MUAA 5FTNA 4Z51A 4DCTA 4M1MA 4C30A 1IBRA 1YR9A 4DKXA 3THYA 1G3UA 4NH0A 1U90A 2Z4RA 2VP2A 1S1CA 4JLNA 5CJPA 5AUNB 2IYXA 2EFGA 2PBRA 1M7HA 2YINC 4PX9A 1TF2A 3MUFA 2MMGA 3VR6A 4EPXA 1G291 5HKKA 1R0WA 3JZMA 4B48A 3RDPA 4B74A 3SQXA 2J46A 3FPAA 5H1YA 3ZS9A 4B3DA 1P62B 3QVVA 1FTSA 1TUIA 3EA0A 1ESMA 4OI4A 4J0QA 2ZRMA 3B8HA 3I62A 4TLBA 1OXXK 3ZQJA 4DLRA 3PV0A 4NTZA 2BMDA 2GTPA 2QE7A 4M1OA 5C1BA 5BN4A 5FPYA 3EPLA 2AX4A 4LDJA 4HSEA 1ETUA 4G5SA 2QP9X 2I1VB 5HZKA 3C5HA 5SZHB 2OBLA 5FI1B 4M9QA 5EZ6B 5JBQA 1NVUQ 4Q4AB 1VKJA 1S1MA 1R2QA 2W83A 3SJZA 1QRAA 1SHKA 1S9DA 3DOFA 1F60A 1DBSA 2JEOA 1A82A 2V7QD 1M2OB 1K6MA 1X6VA 3TE6A 5FBWB 2RGCA 1LVGA 4GNKA 3LXXA 2IHBA 1TAGA 1EX7A 1LV7A 5FTLA 2FMXA 4JMPA 2ORVA 1GNPA 3LX5A 2CBZA 5CIWA 1JBKA 3WNBA 3PUWA 3H2YA 4FXPA 5HPYB 3B1VA 3OIWA 1NN1A 1HT1E 3M6AA 3SHWA 4DLVA 4MGKR 5FBQB 1E2NA 3OAAD 3SR0A 1F6BA 121PA 3ECCA 4TYPA 4HDQB 5HTKA 2QMUA 1KKLA 3CW2A 4LJ9A 5KNCA 1VCIA 1ZC3A 4TQAA 1GM5A 2OLKA 2ZVQX 1S4QA 4OK6A 4GL2A 4HLUC 1KMHB 1DO0A 2WWFA 4MKFA 2WWXA 2NIPA 3EG5A 3GLIE 3G82C 1QF9A 4GOXA 5EXSA 5FTKA 1T3LA 5JS7A 4CEHB 3X1ZA 2QM7A 5KU1A 4XVRA 3SJBA 4LBVA 5JHGB 2G1KA 1E98A 1IN7A 3HYTA 4DLXA 4FD2A 5H8WA 1CJMA 4M1SA 1FNNA 2G77B 3I4LA 5D3MB 5FUXA 2GESA 2WWYA 4PZZA 1R6BX 2GJ8A 1W5SA 5AJVB 1JXMA 2FF7A 3LBHA 1IY0A 4B2IA 4RCZA 1YZGA 1YVDA 4QGFA 3IQWA 3KKPA 2RH5A 1U81A 1WXQA 3D8BA 3T5DA 4B6EA 5J5CA 3O8DA 2A5DA 2W2XA 1H8HD 1W46A 3NBFA 5BYJA 2R62A 3GP8A 1L4UA 2D7DA 1P4SA 4JVMA 4A0RA 2ZYWX 3THXB 2GETA 1E9CA 3THWB 2IYZA 3AF1A 4IDNA 3WBKA 1TNDA 3IEUA 2ZRPA 5EP4A 2ZJ2A 1Y63A 1E4VA 4CRWB 4OI2A 1OXUA 1GZSA 3IBGA 3KJIA 4HUQA 3UG7A 3I5YA 4V0MA 4BFUA 2YOGA 5JWHA 4K81B 4DLSA 4DT1A 1VECA 1RRFA 2R44A 2ZSFA 2QT1A 3Q85A 3IPYA 3QXXA 5CITA 2HCJB 4P4UA 5CIQA 5J47A 2VO1A 1QHXA 1ZM9A 3CWQA 4ERNA 1RFLA 1WP9A 1ZM2A 3CH5A 4UKDA 1XTJA 2QAJA 1JI0A 3BIFA 3ND8A 2GK6A 5FI0B 4NDZA 3Q3JB 4MA4A 1VG1A 5AJXA 5FPTA 5FR1A 3PUYA 5SZIA 5E7JA 2CXXA 1N6RA 2OT3B 1T5LA 3SI7A 2O8BA 4LYHA 2AHOA 1E9RA 3GJ7A 4DDTA 4NONA 1DG3A 1DO2A 5EJEA 1NG9A 2REBA 4LUCA 2FNAA 1Z0KA 3EW9A 4MGZR 4NYIR 3A36A 5HCNA 1XMSA 1M8PA 1XU4A 4Q66C 1KSGA 2WBLC 3F8TA 4V03A 2VRWA 4M9SA 4W9MC 1FP7A 1VPLA 4M8NE 1NKTA 2KBFA 2GCPA 2GVZC 2HXYA 2OAP1 4QNMA 5TV2A 4QG7A 2VHJA 2FFHA 2GVDC 1Z29A 4XVQA 3IIJA 4KSBA 1GFIA 1N0WA 1VCNA 4OHXA 3UG6A 4Q1AA 4B44A 4LY6A 4MGIR 3C8UA 4KU4A 4M0LA 3R9XA 4GOKA 4O2LA 1G8FA 2W6JD 4O3MA 2C78A 4NP6A 3NVAA 4FMDF 4A15A 2C9CA 1XB2A 2D06A 2LWIA 2D3WA 1ZAKA 2ZR7A 3LLMA 4QFMA 3TQFA 1ZW6A 4D81A 3OF5A 2FFAA 4JKYA 5FL7D 2G0TA 1K5GA 1NSFA 5HR5A 3RSLA 3SU8A 3PUZA 3NBXX 2CL0X 2CK3D 2PJZA 2CNWA 2ZU0C 3W3AA 4CEJA 4I1OA 3GPLA 4NPHA 5CK4A 1L8QA 3X1DA 2VHCA 4QJ4A 1IN8A 3M1IA 2EFCB 4QM6A 4GDFA 2QP4A 1AQYA 4C2UA 5P21A 3W6PA 2J7KA 4EFNA 3G5UA 1TQ6A 1SXJB 1YZQA 4HYYA 2V9PA 3MD0A 4L5BA 4M2LA 2CL7X 4NE2A 5CB8A 2YOHA 2CJWB 1E0AA 3TMKA 1ZNZA 2VP9A 5KSYA 1XDBA 2O0HA 4DUGD 4MYTA 1VTKA 2B6HA 3BH6A 2ZJAA 1UBGA 4JBYA 4TTQA 3KJEA 3GD7A 2QI9C 5AJYA 4JLOA 3SFZA 2ZYUX 1X1SA 2YJTD 1UPTA 2IYYA 1CR0A 4BLSA 3IHLA 2IUUA 1XBTA 2ZM5A 4QHSA 4PSVA 1N6HA 2O0KA 1E3MA 1G5TA 1FX0A 4X8LA 5B64A 4F91B 2ODEA 3F3YA 2J0QA 1QBKC 2FEMA 3AP3A 4LJ6A 3B13B 4C0SA 4WAUA 2GEDA 5GJCA 4WXPA 1NVVR 1OB2A 2XEXA 1CP2A 2OEPA 4XD7A 2PJRA 2FG5A 2NG1A 5L3VA 1O3YA 2D2EA 3VR4A 3FGNA 2J59A 5B2ZA 2RGNC 4ASUA 3I73A 4Q1EA 1QHNA 2W0MA 4HZUB 5TDHA 5IK2D 3KQNA 3U5ZB 2CMKA 3AQ4A 1SVSA 4ZCIA 2C5LA 5JS8A 4FW9A 3BORA 2B8TA 5CYOA 5LD2B 2HF8A 2GEUA 3KFVA 4Q1FA 2LKCA 3I72A 3QXJA 3QG5A 521PA 5JHHB 3QUSA 1EK0A 1G3MA 1YZNA 1T8TA 1Z0FA 1IY2A 3HYRA 1GNQA 2P65A 4RZUA 2XXAA 4C2TA 4DWJA 3K1JA 3AVOA 3AH8A 4D0GA 4ZDIA 1QHYA 1YQTA 3K9GA 4IDHA 1KK1A 4A6XA 2OV2A 2XOKD 3HPQA 2OO7A 4JLAA 1RIFA 4BQSA 4B3GA 3EZ9A 2OFXA 4G5OA 3KQKA 1YR6A 4EQ6A 2IUTA 1XMJA 721PA 5JSZB 4M53A 1C9KA 2OBMA 4Q4JB 2BJVA 2JGNA 2FJUA 2GILA 2IS1A 2ZSDA 3GJ5A 1U98A 1PLJA 4OHYA 1VG9B 2JLRA 4QM7A 3TVTA 1TEXA 2OM2A 3CKLA 1XNJA 3BFVA 2JCSA 1US8A 1M7GA 2WV9A 3ZYCA 4AI6A 2GBLA 2VP0A 4LHYA 4EUNA 2IYLD 2VBCA 4DCVA 2VQSA 2ZRHA 4Q7MB 1ELOA 4JKIA 2AWNA 5A4JA 2PCLA 2QQ0A 1CRQA 1AGRA 3DMDA 2QTHA 4Q9KA 4XD7D 2B92A 4PZYA 1L7VC 2ZQ5A 4Q1CA 4EIWA 1W36D 2GZHA 4F4CA 1CJKC 1P75A 4FMBB 4DJTA 2DWPA 4F4IA 5IF9A 1ZINA 4AK9A 1EESA 5DYIA 1NIJA 4YXWD 4KI0A 3T34A 4C0KA 2QBYA 3A4NA 4TSFA 2VLIA 2WOJA 2KI5A 2DY1A 1E1QA 2UKDA 4ZKDA 1HEIA 2PH1A 4TT3D 3PEVA 4TWZA 1HTWA 2QM8A 4BE7B 4JSYA 4NYMR 3TR5A 1T0JB 1G8HA 2JJ8A 4TLDA 2LCFA 1Q1ZA 1P2UA 1SVLA 4V0ME 3GLFB 1L4YA 2ZROA 1MV5A 1G1MA 1KI6A 3C15C 4MUBA 2ZI7A 1TQ2A 2B7CA 2WPDD 4DHEA 1ZM7A 3Q7QA 3FMOB 2VF7A 4FI3C 1JAHA 3TSWA 2Q6TA 4POAA 4LRWA 2OE2A 1G7TA 3AF3A 3P32A 4OKSA 2ZE6A 4MRVA 1W0JA 3VNVA 4H1VA 4TYYA 3ETLA 3U6BA 4JBXA 1AS0A 1FFHA 4UNPA 1GRRA 2ZJZA 1OT3A 4M9ZA 1JXOA 1MO3A 4HI0E 5K8UA 5DHAA 1N5KA 3FKSD 5DI3A 1G4AE 2IUSA 5C4MA 3QNUA 4ZDWA 2OILA 3WYAA 4QBFA 4DDWA 2HJVA 1OHHD 4E5UA 3KTAA 4ZPXA 2FE4A 3X1XA 1BOFA 2C2HA 3UMSA 4HDOB 2VP6A 4PR0A 5G3ZA 2YC2C 1VDZA 4AKEA 1OH8A 1FPMA 3AVVA 3S1AA 6Q21A 3BC1A 2WM9B 4NCNA 1HURA 3AP2A 4BLTA 4HB0A 5L3QA 5JLJA 3AKCA 1GG2A 3CBQA 3DVLA 3HU3A 4YDHB 3RHFA 4IVRA 4C4PA 2FN4A 4PSAA 3A1TA 4AYTA 5TMPA 5G53C 3BS4A 1GKIA 5EE9A 2ZSEA 4LZZA 3KFXA 1V43A 2JIZA 4WOPA 3W6NA 3NBYC 3G0HA 1FX0B 4BFXA 1NNEA 1KSHA 3VNUA 1WBDA 5UKDA 2VF8A 1E2EA 1JAIA 4KFTA 3SBDA 5CYPA 1KI8A 3O8BA 2JIZD 1SGWA 5D3MA 2YZ2A 4JVNA 4FCWA 2O5VA 4KBFA 1GAJA 2Q3HA 4D0LB 3E2IA 3VMFA 3FWYA 2HV8A 4OJQA 5FL7A 4IDOA 3V9PA 3LRPA 3GJ6A 1CU1A 3RS4A 4DDUA 3BAFA 1OKKA 5G3YA 1N6LA 1XZQA 5CDFE 1N6IA 5L3SA 2IBMA 1X86B 1F2TB 1Z2CA 2RCNA 1XJCA 1DS6A 3PEUA 4XJXA 2P6RA 4DLZA 3HJNA 4RD0A 3C16C 1TTTA 1P7CA 2AD5A 3K9NA 621PA 4QGAA 1NLZA 2BHRA 3UIEA 1KJWA 1SVIA 4Q02A 1CLUA 1VCMA 2YWFA 3NWJA 4HDCA 3ZZTA 4PZLA 2OCPA 5E4FA 5TY0A 2HT6A 3H1TA 4KLZA 4MKIA 3QY0A 4HUTA 3E1SA 2WAYA 1FP6A 1HUQA 3FKSA 5JEEA 2F55A 4A9AA 5EE3A 5J40A 3K70C 4TMZA 3NH9A 4JVSB 1WB9A 3BH7A 4LHXA 4Q4HB 3WMGA 3T12A 1ZCBA 2VSXA 4IDQA 2WKQA 1NP6A 5JEDA 5KPJA 3C5CA 1UKVY 2F1JA 1BMFA 3FTQA 2J0UA 3BD9A 1R0XA 3IDQA 4BEJA 2PT7A 4X8MA 3ADDA 1LNZA 4TL8A 3RRYA 2ZS9A 1I2MA 2DFNA 3B9PA 1Z47A 3BBPA 1KNXA 3K53A 4EPRA 1L2TA 2ZRAA 1NG1A 1XTRA 2W0SA 4D25A 3P20A 4IVPA 1DAIA 2ZE8A 3RVBA 1KAOA 4FN5A 4LSGA 1FOEB 1NKSA 3ASYA 1UDXA 2GXQA 2QAGA 3K0AA 1G7CA 1ZD1A 4TN1A 4WA7A 2JLYA 4AKHA 1RZ3A 3X1WA 2I1QA 1U8ZA 1KAGA 2YOFA 3ZVLA 3RAPR 1XEWX 1DE0A 4AYXA 5LB2A 5FPSA 3QKRB 5ANRB 3CF2A 1LS6A 2AKYA 1SKYB 4ZIRA 5GJBA 1NL3A 4WXRA 2ZRIA 4JLPA 4JZKA 2J41A 2O8BB 2IYTA 2FSFA 2AXPA 2ECKA 3RS2A 1H8HA 5JI3E 2IS2A 2P6UA 1ZU5A 3CRMA 2ANBA 5JCZA 2KB0A 1VYTA 2EWWA 2GRJA 4M1KA 3ZQ6A 1Z63A 4A82A 1OYYA 4GP7A 1J8YF 1W0JD 2G88A 3NKVA 1II8A 4DT1B 2JJ1A 4I99A 3SDZA 1IAQA 1AM4D 3BE4A 4XWAA 3VHLB 4OQMA 2XB2A 1K8RA 3SBEA 1W7AA 2HYIC 1Q1QA 1EG7A 2WWGA 2QMOA 3CRVA 2F1IA 1UKYA 4KCGA 2G9NA 2IEZA 4HZUA 3OAAA 3KUCA 3GEEA 4KHZA 5AJZA 4DB4A 4NMMA 2XAUA 4LPSA 4NYIQ 3ZZ0A 4Z8YA 1CS4C 2QQEA 1R5BA 2J45A 1PLLA 2L0XA 3R20A 3TQCA 4NYJQ 3EC2A 2K5UA 3QVUA 3P4XA 3WHKA 1VYUA 1VYVA 1U0HC 5KSPA 1OPXA 1Q12A 2O8FB 3MWKA 2PMKA 3KZ1E 4W5HA 4DBLC 1X8KA 4KYUA 4NZYA 5KNDA 1QHGA 3LX8A 2RGEA 4L9SA 3WP1B 4AURA 1S9HA 3RANA 1OH7A 1M6NA 2OCBA 4D82A 1F2UA 2H17A 3TBKA 3ZDQA 4HAWA 1DAEA 1W4AA 2IF0A 2JDIA 3MFYA 4D26A 1AKYA 1P73A 3OIUA 4RD6A 1GL6A 4B75A 2H1LA 4AG5A 2FU5C 3TK1A 1TQDA 4MITA 2ZRFA 2C8VA 4E07A 3ZGXA 2FPLA 1E2QA 1LY1A 3U3MA 4F38A 2JLQA 2LKDA 1DAMA 3U60B 1GSIA 3BXZA 5KDLA 4D80A 1E2IA 1JNYA 1T9HA 1T3SA 2IYWA 3DMNA 3MLEA 1ZCAA 4II7A 4C0LA 4LC0A 2G1JA 3R9WA 2WKRA 4IHQA 4CDGA 1ZM4A 2A5JA 1P3JA 4KYIB 4IXMA 1QZXA 3GLIB 1UAAA 3T1OA 5L3QB 3CZQA 1E9SA 3CB4A 4B3BA 4KFUA 3FVQA 4R9UC 3A1SA 5DSZA 3CRW1 1F3OA 2MSCB 1YR7A 3HP1A 4JBWA 1MO6A 3MWLA 1WDTA 4BPBA 4YMWA 3EX7C 2BBTA 3A1WA 4A2WA 5FOXA 3QIAA 2Q3MA 3QKSB 4NU0A 3M4YA 3M0EA 3A4MA 1CBUA 1SZPA 5JECA 2FSHA 1PLKA 3DKVA 1E99A 1P2VA 1P6XA 4GFDA 3U2QA 3IBYA 4DZZA 2C96A 2E1RA 2IC5A 4UQOA 1XMVA 2RGGA 3GLFE 2EFDB 1E9FA 1FNMA 1YU9A 1UADA 2Z4SA 3WNCA 1W4CA 2KWIA 4E22A 4ZDJA 4NCKA 1RE0A 2AD1A 3ADCA 3ZVNA 1LF0A 1A4RA 3VR2A 4E09A 1G3QA 3LLUA 1Q3HA 4EDHA 3D31A 4MRPA 5F98A 2GXUA 3FFAA 2REOA 3WY9A 1TPZA 4RFSA 2WHXA 2HXSA 5GVRA 3DL0A 3WXMA 1IM2A 4TL7A 3AB3A 2B7BA 2WAXA 3GJ8A 5EXXA 4BLQA 3CX6A 4C0AC 3DO6A 5TXGA 3SEAA 3EZ2A 1AS2A 2N46A 2XZLA 1BKDR 2R9VA 1XJQA
chains in the Genus database with same CATH superfamily
2YVUA 1ZSNA 5FJJA 1B1AA 1NVAA 1WQ3A 5ALEA 3BERA 4BFYA 3TLGA 1V8PA 1ZFNA 2WD8A 2YZMA 3FVTA 3G8CA 3HA3A 5NLLA 5HXAA 4TN5A 3MPUA 1R16A 1XCPA 4HQNA 2GLTA 4MMZB 3W5UA 1EXMA 2OECA 5KS2A 3DKPA 3IH5A 3P2JA 3QF4B 3O8QA 4NCHA 2EZTA 1R6AA 3DFMA 3C7KA 1XEXA 3ROFA 5CA1A 2PMCA 2CVFA 2VHUA 1GA1A 2GK3A 2JIRA 2QUBA 3H1FA 4UBKA 4YT5A 1J1IA 3IO5A 3U7RA 3OP1A 1W581 3GLKA 2D4HA 3AL2A 4D2IA 1M2FA 1PFWA 4I55B 3VR5A 3WAJA 3NXSA 1J8FA 2Q28A 2AJDA 3KXIA 1MXFA 1RAFA 3JCZA 5C3MA 3ECAA 2A7XA 3E70C 5D5HA 3KUKA 2O2SA 3AFHA 4QUBA 1MG0A 1BXRA 2BBSA 3I83A 2QTVB 4HATA 4FKMA 1D1QA 2A30A 1JPNA 1LBQA 2PBFA 4H4EA 3RS9A 3TW4A 1ZRNA 1RFGE 2V7VA 1BO6A 2P5UA 4RX1A 2HMSA 5A3RA 2ZTHA 1ZYUA 2GBCA 3K8OE 2FCRA 4ENVA 1AUVA 3UHFA 3IEIA 1HORA 3D7RA 3FYSA 2FZEA 2P2SA 5JWOA 5I6DA 1UBMS 4HNAA 1Z2OX 2FEAA 4NCJA 4ZOCA 1X3LA 2WSBA 3UAVA 4HEA6 1J5PA 2FZWA 1GOTA 1E1RA 3QWFA 4PN7A 3MCVA 4WEQA 5LA6F 2FB9A 3N2ZB 1QKKA 4CLDA 4TKVB 2D0DA 5CX1B 5K3FA 1DAFA 3UHOA 1A4XA 3HWX1 2QU8A 3CLSC 3GWZA 3GARA 4R2MA 1CNMA 5HZGA 3G6KA 1ETHA 2XT0A 1SC4A 1R10A 1EP2B 3CLHA 2ZUTA 3WJ2A 1PHRA 2CFTA 2ZGVA 5U1PA 4YJFB 3AL0C 1XMQB 1E18A 5EQJB 4A8JB 2XUJA 1T3GA 1KYVA 3M83A 3IDZA 2JGAA 1ACMA 2GARA 2R5WA 3B51X 2D2XA 2CMDA 3OMXA 1XI2A 2Q50A 1OILA 3QXCA 3QE0A 5A5FA 2P1DA 3IUJA 2AQHA 1ZL0A 3BUSA 2PUCA 5TX7A 1NF9A 3PRYA 3DOIA 1AHPA 1KFKB 2I4NA 3VJMA 5SZKB 3G17A 4RFLA 3REOA 3DLHA 1PUJA 5DLQC 4UEQA 1M1UA 1U0SY 4OIFA 5LP6B 3MWJA 4YRTA 5EJMA 5BRAA 2DKNA 5EJAA 1GFZA 1GQSA 2V6GA 3F90A 4R98A 3R6TA 1XELA 1D1PA 2BR5A 3H8WA 1ZW1A 2NNWB 4WT7A 1UR5A 1UP7A 1W93A 3L1UA 1MB4A 3LXRA 4UTOA 3OQHA 5CCBA 1P1CA 2V7TA 2A9JA 4TMTA 1NPTO 1FNCA 2FZKA 2WTMA 2JZNA 3LXUX 3PIIA 3SYKA 1Z5PA 1K27A 3AERB 3AETA 5DOZA 1I2BA 3UV7A 1SXJE 1EM8B 2Z2ZA 1XMXA 1L5MA 2ZYVX 3P4YA 3Q2OA 3NANA 2Z04A 3FYUA 4KUGA 4H7HA 2A5YB 4P54A 1TIPA 3FDXA 1NVDA 4KKXB 1M72A 4X20A 1MQ8B 2Y9MB 4EB6B 1Q74A 2QTZA 3BF7A 3W7BA 3FX2A 1IM8A 1OJLA 4QA9A 1WVGA 3IBSA 1Z4KA 3G2OA 4MV1A 4Z8XA 1DKLA 4KITB 2OC4A 3UMFA 3X2FA 2R6ZA 3P26A 5EZYA 4TTVA 1WCV1 4DBZA 4URXR 5G1NA 4QBHA 1L5ZA 1VG0B 3QKTA 1UIRA 2QGFA 4X44A 2JHAA 4J6FA 2IE8A 3DAGA 3FPSA 2IIPA 3CF4A 5CXSA 5JARA 3THYB 1NGSA 3N70A 4BQNA 2AKEA 4CVNA 2CL6X 5D00A 2YKGA 3VNRA 1XRJA 3DMTC 3NIFB 3MQ2A 1UFQA 1UT8A 2BE9A 3BWXA 4MW0A 3R6LA 2ZBVA 5ITSA 3UOWA 1NFRA 1U8TA 2J3HA 4EUSA 3A9WA 5AM4A 4GKKB 1K66A 3C41J 1UXKA 1DEAA 1C7QA 2R1ZA 3TKYA 1VIYA 3ZW9A 4QG3A 3O92A 1A72A 1E0DA 1Z8DA 2V03A 5TJ9A 3EC1A 3OTIA 3HM9A 1AF7A 3G9TA 2LV8A 1X1CA 4GBGA 4WIAA 3V1LA 5A9SB 3DXZA 2LTAA 3O3MB 3V4VB 2QY9A 1N6OA 4D8TA 4LE1A 3KV3O 4HUQB 2I6FA 2NGRA 4U2KA 5CX1A 2V1UA 3TZ6A 2P11A 2ACEA 4BNFA 4IHJA 4BU1A 1RPZA 4K5QA 4U7JA 4FX2A 3ZK8A 2NVWA 3OZWA 3WK4A 4J90A 3E48A 4KR0A 4U7GA 5JZBA 5EOVA 1E7YA 1F1BA 4DR6B 1RI5A 1Z06A 3BB1A 5I5GA 4H3KB 1KQ3A 2CLKB 4TVSA 4RUKA 3WDLA 4RLFA 1M10A 2WF8A 4HGZA 2YWBA 2ZULA 4GX1A 2Q29A 2QMZA 3LZCA 4JODA 1E66A 3NEYA 2VF5X 1P2TA 1DG1G 2YQZA 3D8UA 1E79D 4YK7A 3SD7A 5HP4A 3G3EA 2VWQA 5KDDA 4LXXA 2IS4A 2A5GA 3H9GA 1KO7A 3OHSX 3GUHA 4JBNA 2UUOA 5E7MA 3RC3A 3S4YA 2NQTA 3WRYC 4D9IA 2Z56A 1OBVA 4X3PA 4JI0B 3EOZA 5T67A 2XEDA 5GM1A 1A95A 5LZ2A 1TTHA 4HZIA 4I4IA 1ZGGA 2WJAA 4OL9A 3IQGX 2BAGA 1OSNA 3FH0A 2ZIEA 2ETXA 3UMRA 1ZXXA 1K0UA 3L77A 4CBVA 4AXXA 2JLBA 3KJGA 1F48A 2X0FA 1UWVA 1ZBDA 3L7NA 3HCRA 3ZJ4A 1D9ZA 4OJMX 2NT3A 3PCRB 1BKYA 4IX9A 2VPZA 4BNDB 2HFJA 4ZVOA 2HPAA 3I9NA 5CR9A 4CMGA 1SVNA 1KXZA 4I6EA 3ICEA 1ECLA 4IRMA 1KI1A 2PBLA 1YDFA 1XZPA 1RZVA 1J0XO 2X2FA 4M9CA 3SFVA 6GPBA 4HNTA 1M3SA 2ZRNA 4X6YA 1OA0A 4QYMA 3UH1A 1ZL2A 3ZW7A 2UYGA 3NB0A 2BC9A 1P6QA 1BXGA 3CMCO 4Y2TA 2I65A 2VUSA 4RBNA 4JJGA 4F1WA 2PGLA 4QPNA 4ZZ2A 3QH4A 5I7OA 3A1EA 3UAXA 4G5GA 3F67A 3RTGA 5L8VA 5EUMA 1HK7A 4BXOB 1N5OX 4G0WA 1SD1A 3EVEA 4JS0A 4BP9A 3HADA 4X1IB 3SQOA 2XMRA 4G89A 4AN4A 1IVYA 1N36B 5ICEA 4G9GA 1HRDA 3H5VA 3T7EA 1E2HA 4CMBA 2CNKA 2ZKIA 4AO6A 2ECPA 1Q22A 3GUUA 1UFVA 3HLTA 4Q4LA 4H7EA 2XB9A 1A2BA 1TAUA 3UCXA 2DETA 4ZREA 3JQEA 2NTYC 3BDAA 1P0CA 4PQRA 3AYZB 2QOEA 5FWXA 1GTL1 2J5KA 1W2HA 3L6CA 4YCBA 4AS1A 3PHCA 5IXSA 4KNYA 1IJFA 4FEAA 4ZYXA 2H2AA 5EGNA 1C7EA 5LA6A 1EBUA 5BN5B 1XAIA 4XZ3A 3MTIA 1L5KA 1KGDA 4TTRA 4CV1A 5K6AA 3JZAA 4W5QA 2PKWA 3EAQA 4GMKA 4L5JA 2GZDA 2C29D 4MPTA 3CUSA 5IUJC 3H1BA 2O1XA 4UREA 1XD2B 2EZUA 2WHEA 4FINA 4WZBE 3SHTA 4H1UA 1MAUA 3K70D 1QYXA 1BRTA 1GGJA 2B83A 2JAHA 3AU8A 3N28A 3OKPA 2C9BA 4FFVA 1QCCA 4NESA 4FYJA 4JCCA 2ERYA 4K7JA 4JELA 4LSZA 1D9XA 1YGPA 2HA6A 2QL6A 3GFOA 4RA9B 2OD2A 5CFNA 1KO5A 5K0SA 1DAGA 4R2HA 1E2MA 4LKOA 1C4XA 1U3WA 2GMWA 4BECA 4I4NA 1U9YA 3KJHA 5E9QA 1PGNA 1B00A 421PA 4YAGA 1PVOA 4JAVC 1ZGAA 5KYYB 2BGLA 3HSKA 1EK6A 5ADWA 3DDUA 3VR3D 2IYFA 1MRNA 1NMZA 5EHQA 2OHHA 3H2JA 4ZOLF 2C3MA 4Q4HA 4RK7A 5ECGC 4AIRA 4OGLA 1WZNA 2FPIA 2J09A 2BJWA 3ZIAA 1X7XA 1ZEMA 1EIWA 4D3FA 2VDWA 4IQ8A 3LAWA 3C2QA 1H8ED 4L3VA 1IHYA 4OLFA 4QXPA 5A5GA 5CA1F 1RWPA 4XIYA 4D6YA 2QWXA 2EKBA 4S24A 1TIBA 3QU2A 2J30A 4YCMA 2D7JA 3HEAA 3HDTA 3QVKA 2BMVA 4F21A 4CLOB 1I24A 2VFAA 2QRMA 2Y4OA 3U7IA 1V6AA 3UT5B 4CM4A 2BKEA 5I4KA 1J1UA 2W43A 2X8JA 1VBMA 3LC1O 3LYUA 3MTAA 5EHZA 1FCJA 5LLDA 2D3TA 2QX4A 5JDCC 3TWOA 3UUGA 5FDFA 4J0FA 1JECA 4BNDA 3ECSA 4NABA 2IX3A 1A2KC 1OVGA 1K5DA 2OBXA 3LQ1A 3UMGA 3GLHB 1HDOA 1X74A 2X40A 2QUIA 2FWMX 4WY8A 2Z43A 2JAPA 1D2EA 1CQZA 1OIXA 1PQUA 2OHFA 2DCUA 4IIVA 4M98A 4LYAA 1VI6A 2HEIA 1OD6A 2INGX 2RHBA 5JH7B 2DERA 2QXTA 4I2NA 1W35A 4GOJA 5B55A 2WT9A 3NYIA 5B1SA 1LPMA 4KWCA 5F12A 1YS2X 1JW9B 3WIVA 2RCYA 2X0IA 2GHQA 2X76A 3BRSA 3LZ6A 1CXZA 4RVCA 2JIBA 1AUPA 3BREA 4LQCA 2FPXA 3IULA 2Q6LA 3I76A 4IEIA 5TNXA 2R2AA 4JJ8A 2CLFB 4KIGA 5A4FS 5K2MA 4WERA 1N4AA 4BZQA 4HXYA 2JI9A 1J4AA 3QKWA 3LP5A 5JD6A 4EW1A 3N0WA 2QJWA 4YRSA 5KDOA 1P72A 4QXAA 5FPHA 3S27A 3L1VA 1HGXA 4ILKA 1T9BA 4L5YA 1P2DA 2RGNA 5JVDF 5H80A 1V7PC 4FEYA 2Q27A 4TT8A 4C22A 3ZE7A 2B78A 1DOAA 3GFGA 2OXTA 5LPNA 1KORA 3B2QA 3BG5A 3P0RA 3TXXA 5YASA 3LVQE 4P32A 1F8GA 3PDJA 3LQYA 5EIWA 4OPMA 1NJ6A 3K30A 4BP3A 1QRSA 1P7VA 4RE5A 4JP3A 4C04A 3DDZX 1QO0D 1F14A 3ZTYA 4F3KA 1G8KA 3QSYA 4MA5A 4FUQA 3PEYA 4F6CA 3FFXA 3HR8A 2GLXA 2VDOB 3EFBA 4TL6A 4YJ3B 5EEGA 3JYHA 2F9FA 2DFKB 2KSQA 5ADUS 5JWRA 3TLGB 4LWOA 1AKWA 1ZIDA 2AFIE 4ENPA 2WWTA 1RZUA 1HQKA 2V74B 4L1KA 4YMIA 1VHTA 4N1AA 3A3NA 4TVBA 5WRFA 1QH9A 1SC1A 2ZUCA 2IZ5A 1DKPA 3HU2A 4KGVA 3LE8A 2BRUA 2ZAMA 4L0DA 4P31A 4F2HA 1UXJA 1GLNA 3Q6MA 5IAOA 4TSFD 2EYUA 3PPVA 1I4TD 5E38A 1FW8A 1R7RA 3EDRA 3DEKA 3K8YA 4AZ3A 2E89A 2GHTA 4L0MA 4BKOA 3WLJA 1PI3A 5LXTB 3TUZC 1Z6AA 3CE9A 4B8ZA 1NE7A 3TEJA 2B4RO 4IOMA 3AUJB 4YCJA 4B73A 3BMCB 4BRUA 1XTUA 4ABYA 2EU8A 2YHBA 1G5PA 2Z98A 2RAVA 4CKWB 1ZBQA 2DR3A 1UJCA 5FKJA 4NV3A 4P86A 4DJDC 1U3GA 3HGQA 4WX2B 3CLRD 1N2OA 3M6MD 3G2NA 1JEDA 3WR5A 3O3OB 4YMTA 3L4BC 2OXCA 4J7AA 2C9MA 2PLAA 2Q6IA 2WSSA 3FETA 4CEHA 2YFKA 5CDSA 3QPVA 1CUIA 2OCKA 3AETB 4PG8A 1KA9H 3PDUA 5AW1A 3PIRA 2I0FA 4KR3A 4DMCA 1GU1A 1VG8A 3GLHA 1A5ZA 4MGHA 2AC2A 2VYQA 4ZCPA 1Z08A 1ACJA 1LX6A 3I05A 4L7VA 3O8RA 2CNDA 3VZBA 4Q9AA 1OXVA 4E11A 1EWVA 4Q7LA 1FZQA 4UD2A 4HKTA 3NDPA 1WQ4A 4JZYA 2VTBB 3BDVA 4XTRA 2ZIVB 1BQ3A 1FVOA 1I6MA 5AJHA 5L40A 2OG2A 1Z4NA 1C9DB 4M1WA 5BWOA 4LHVA 4DV7B 1L4EA 1BDHA 3OIVA 1OC4A 1S3FA 1EX6A 1OXMA 1V9LA 5K51A 3UCEA 4A1FA 1U0LA 2H1FA 3S2GA 4CTNA 1RPNA 3RQIA 2AQ8A 4HDKB 5LC1A 1QYVA 4E6EA 1U65A 2YV1A 2HA7A 2VSYA 4E0BA 1YL7A 1HPLA 1SKBA 2CN1A 1KJYA 2E87A 1Z2EA 5DJ5A 2LIVA 4EOGA 4QQKA 1WPRA 3HBAA 2NPFA 3JQ9C 4NH4A 2NPIA 1I2ZA 2OMEA 4PWYA 4Y67A 2ZAIA 5SICE 4M1ZA 3REGA 3BCRA 1JQDA 1U0RA 3WLPA 1SR8A 3HN2A 4HP8A 1GRCA 4A8JA 4RTRA 2J3EA 3HJRA 1Q20A 1I4WA 2OQVA 5JJKA 1NVTA 1YZLA 2O9JA 1CIPA 4NMHA 1JQ5A 4PPYA 3UM9A 1PFVA 1E9EA 1VIMA 2ZRCA 1K4KA 1QXSA 2O2YA 3EHEA 1Z2NX 4I5EA 3VX4A 2ZREA 4RIFA 4DL9A 4LOIA 1FDUA 2OR3A 4L5CA 4UU0A 3UTCA 5HYVA 5JYCA 2RG1A 3GJSA 2FV8A 2PUAA 3I1JA 1A7UA 5TQ2B 1IHDA 3MJSA 2FAXA 1SA0A 4BFTA 1Y6JA 1EP3B 3CURA 3SPXA 3PU6A 4JEHA 5DXJA 4BASA 2GD6A 1QWSA 3A2NA 3PL5A 1HLDA 1W25A 1XV5A 1HDGO 4L5IA 4G01B 1U2GC 1TZMA 1TQ4A 3FYUB 4G0YA 2C59A 3EIQA 3W4JA 4QTTB 4YFVA 4DDKA 5DCWA 4Z1MA 2NTNA 4R01A 4DYVA 1A8IA 5T3YA 3DVQX 1B0UA 3PA8A 4L15A 1B23P 3ZHSA 3FCSB 3ER9A 1MTOA 3R0ZA 4ENRA 3KEFA 1KI4A 5FPQA 3SVZA 1NBEA 1ZVMA 1NJSA 1LEHA 2PGJA 2RHOA 2V4UA 3T1NA 2HDNB 3MRXA 1HX7A 3L6RA 3ZQ4A 5ITZA 5C46F 5DBHX 2VCHA 2F43A 4X93A 4IMJB 1AKMA 1EMDA 4WOKA 1XZLA 2NZJA 3E3OA 3HUUA 4AUEA 1TRHA 3ZHQA 2V59A 5JCJA 1K75A 4C3ZA 1HZZC 3JD0A 1XA0A 4PONA 5DULA 2CDCA 4CCWA 4ZCLA 4RTQA 1YT5A 1E96A 2CNNA 3SVTA 1JZSA 3OEHA 1SCIA 2EL7A 3FYHA 2AI2A 3CNQS 3HY3A 3JQAA 1AY0A 1K4YA 2BTQB 1KZ1A 2BGNA 3IQHX 4IWXA 2V7EA 2VHWA 3TS1A 3GCGA 5FWAA 1RLIA 1SIWA 4C4TA 1C0LA 3HL4A 3KKZA 4NR0A 3VYTB 1TM5E 4U2EA 1P9RA 3AJEA 2B9VA 1V8DA 3A06A 4KNVA 3EWNA 4EKIA 1LUAA 2FWBA 3M1YA 3QSGA 4PTYA 1XVTA 1RYMA 5DV9A 4YP9A 1DKOA 5ITZB 3P9YA 3HHPA 2Q5IA 2GZMA 4KXMA 3TSAA 2ATVA 4RA6B 2QTNA 5C8XA 5CDTA 5IHXA 4ID9A 4IINA 1CF2O 1V6CA 3EBOA 3NEPX 1FTGA 4LZJA 5G0TA 3MT0A 4IILA 3LGXA 4IOLA 1OLOA 2IEBA 1G5RA 1U4OA 2QN3A 4LVNA 1Z13A 4MLCA 1UP4A 5CBPB 2XMPA 5KAMA 2E5FA 2P6OA 4LVCA 4PPFA 4PU0A 3GJRA 4ND6A 3T3GA 4BMNA 3VFDA 4XIIA 2Q5FA 4BGDA 3H65A 5JAUA 3KXDA 1AH2A 2PAFA 1P9WA 1VPTA 3PGMA 1JWLA 4OHOA 3H9JA 2P4QA 4U7TB 1XPUA 1X77A 2D5LA 4Q3DA 1IZ9A 4AJPA 3G9XA 4LGVA 1UWCA 1Y4ZA 2PX4A 3DQZA 3KTFA 2QRGA 4FIDA 4LYFA 4ZTZB 5KVAA 2ZDGA 5LXTA 1ITZA 1DRKA 2R96A 1PL7A 4II3A 1KXJA 3C1OA 3U3RA 3Q6NA 4C4SA 4IWYA 4KH0A 3AI1A 3ZGVA 1N5LA 1LXCA 2CGEA 3ZI7A 2PWZA 5KMGA 4ITUA 1RLTA 3SJAA 4JLMA 5E9AA 4N5LA 3CUEF 1WHTA 3L02A 5GONF 4ISBA 1QTQA 2QORA 4HB2A 5CJ2A 4N7JA 1K97A 3TGWA 1DZ3A 1NQVA 2VDMB 3LVRE 1IXZA 1KK0A 1K4MA 1SVMA 1EDZA 3ZZUA 2JAUA 1GEEA 1TM4E 2AKAB 2QTLA 5JE8A 1U5CA 3RRXA 1C50A 5AUPB 3GLSA 1KJ8A 1BE8A 1F17A 3PGKA 4F3CA 4Z1MD 5I3ZA 5E95A 3I12A 4WBSA 1XQXA 3I2YX 1W36C 1VE6A 4HDRB 4JJZA 3TW6A 1GKKA 4CQMD 5KNBD 3WZ2A 3BSYA 2AXQA 3KTOA 1GTZA 3V2HA 5LBIA 4RULA 1GL7A 2O8EA 3RI3A 3ZNPA 4AYWA 4EMBA 5M04A 1JQLB 4OHKA 3NC0C 3UJBA 2KX7A 2VDQB 3BK7A 2JGRA 3A6GA 1T5BA 3MS4A 4DWOA 5I7SA 2HQ1A 4ZYLA 2LW7A 3GJYA 1SOVA 5F7OA 1E7SA 3TLAA 1UOPA 3T5MA 4D9FA 2F62A 1WW2A 3RS7A 1JDNA 1M6HA 2WJHA 5I8PA 4EG3A 2G71A 3W9SA 1L5YA 1NSTA 4DUYB 2JAXA 1E2BA 4A2QA 1YDMA 3FHJA 5B3KA 3QX9A 1KOLA 3H8VA 2A1UA 5I51A 4JCOA 3E22A 4J1NA 2X2EA 1G7SA 4BNTA 1QHEA 1TZJA 1FS6A 2J9GA 1TLTA 5E6RB 4CEIB 2EG9A 2GEBA 2VQ3A 5ED0A 5K0JA 5C52B 3OUTA 1N2CE 2ASEA 1KK2A 1FDSA 2O3RA 1NJGA 3PNQA 1MVOA 4MW4A 3H05A 1IATA 4OQFA 5BT9A 4I0WB 5KYXB 1V8ZA 3AVWA 4MS4A 1QK3A 1GZ4A 1OXSC 1J0BA 4LV5B 4X5OA 5DK6A 1POWA 5IDYA 3VNQA 3LSYA 1VL0A 3N2IA 5C51B 1AA6A 3LO5A 3HZHA 1TU3A 2W8ZA 5EQFA 4DADA 2I4MA 5JU6A 2D2FA 1O03A 1C7IA 3KOMA 1TKAA 5EPEA 5MF6A 1QH1B 5C4GB 4MQMA 3IB6A 3PNBA 4ETMA 3GXOA 5IRCD 3CF6R 4QJIA 4IF4A 1ZUWA 2FSSA 2FR8C 3ZD8A 4ZQFA 3OESA 1F8YA 4BRSA 3H2BA 2WW8A 4PSDA 1E1CA 3MGBA 1ZUNB 2JFYA 2WVHA 3CJTA 2QYSA 3S2IA 4F2PA 1HH4A 1YO6A 5FI5A 3SF8A 5BW8A 2AV6A 3CCBA 2JBAA 4MWBA 4GRAA 5SV2A 4GNRA 4BRZA 1CV2A 3WO0A 1GEGA 4IHAA 5AVUA 4PAQA 3S2EA 3AJDA 1SXQA 3EXG2 3O5AA 1GYPA 5JR3A 1G0NA 2Q0HA 2QN9A 3E8XA 4AC9A 2C98A 2VT3A 5JI2E 3TM5A 3WWOA 5CDFA 3DGEC 5HRAA 5TMBA 4FPXA 1JRLA 4BLPA 4EJSB 4LZLA 3USZA 3LT2A 1X1BA 3ILYA 3TPCA 4PG5A 1CUYA 1YK0A 3PNMA 2YCBA 5CFZA 5HJ2A 3R7WA 2OORC 2DFVA 1AE1A 2Q1XA 2VYNA 1NMXA 2GBFA 3DPSA 3L49A 4XE5A 3D3NA 2VVTA 2BFNA 1G3IA 4WBXC 3FMPB 3R5SA 1V41E 4HNAB 4HGOA 3SQDA 4MA0A 1UOOA 2GF9A 3FPHA 4OQEA 5JH7A 1XVVA 4JI7B 1LNSA 3SEQA 1AS3A 2Y1EA 2IITA 4TL9A 1ZICA 3L0PA 1Y3HA 4ZKEA 3J81k 2YW9A 4PSUA 2QMEA 3DTYA 1V2HE 3HHEA 4DSUA 4MPDA 3B82A 4N12A 4OB8A 3MCAA 5KKCA 1NY6A 1QBGA 1NC3A 1E9BA 5K4AA 3O4FA 1GPWB 3LT1A 3FHOA 5DH9A 4G5QA 5F1PA 1NBHA 5FBKA 2NU8B 1FJHA 1UMBB 2H8GA 3LVBA 4ZOLB 4BKMA 4Q7KA 4DV6B 1WXDA 4FNOA 2XDAA 3R5TA 1JVSA 4Q21A 3K6KA 1C1DA 3DZCA 3KUDA 2VLBA 4MI3A 4ZVVA 5B3JA 5JAQA 4GVXA 4EHFA 1UH5A 3G0CA 2W4IA 3B1KA 3SYNA 1UMCA 1VGQA 3TLZA 1ZNYA 2I6TA 1OX6A 3QENA 2ZLBA 3GT3A 3PQFA 4J75A 4JP1A 2FPIB 4PHFA 2QTTA 3JPYA 3ONVA 1O8CA 3SXPA 1AQLA 3H1PA 5LJLA 5EA2A 1J70A 2F3QA 3GFSA 3E18A 1ESCA 4O8CA 2JIDA 2MSWA 2X4DA 4X92A 1T9CA 3R9KA 2JH8A 3CW9A 4BO2A 2GN9A 1OIWA 2Z09A 4C88A 2JATA 4YUZA 2NXNA 3OMLA 1IHPA 1NI5A 2Z4TA 3Q0TA 3FWNA 3MRVA 5TGZA 2CCJA 2WKPA 3FPFA 4UOZA 5SY6A 1UBRS 4RM3A 1NM5C 4BQPA 5DW3A 5IT9A 4E3WA 2YVLA 2BM1A 2FFBA 2QVGA 2V5UA 3A8TA 4JA2A 2ZVPX 2FP4A 3T35A 5B57C 2O0JA 5DNYB 1J42A 3EIOA 1LBEA 2M9MA 1YL6A 2QE6A 2XADA 1T8UA 2PZFA 4IDAA 4KLAA 3RG2A 2V9ZA 3P2EA 1P60A 4ETIA 4FDLA 4B7UA 3T99A 1XTZA 2PRYA 1ZGJA 3NWBA 4MTCA 2J3MA 3G8DA 1T2CA 4XUCA 1HE2A 5LMZA 1EVYA 3E9CA 1XPJA 1S8OA 4GPTA 1FFSA 1JVBA 1Z68A 4TS3A 4X7PA 3SSNA 4G36A 4PINA 4X6LA 4YRJA 4FWTA 1SIBE 3KDSE 1FUUA 4RVUA 1WHSB 3P9XA 4PZPA 1PL8A 2QD2A 4AAYA 1H4TA 4YUAA 5AICA 4X54A 3N8DA 4LQ4A 3QVLA 4G23A 2Z2YA 3LCJA 1P1BA 2VPQA 3GJTA 3P27A 4M22A 3I6YA 2ZYHA 3VVCA 2WFAA 4ZQCB 4XPIA 3NOQA 3OQ1A 4D9HA 1N2ZA 1KJZA 3CH7A 3F6EX 2PFGA 1ENZA 2M1XA 6CHYA 3HKCA 4LEIA 5HE8A 3WL4A 3UOGA 1G8GA 1HEYA 3PGJA 4RLHA 1DKRA 4QSHA 1ZESA 4ZEMA 5JYDA 2C0QA 2I9KA 4ITRC 2XDWA 4O08A 3DNFA 3ESCA 3LXMA 2J3LA 4HQFA 2IYEA 4KO4S 4L8GA 4U2BA 1E5LA 2NVUB 4ACAA 4F8EA 2HWUA 1KVRA 1EGHA 3CZPA 3HABA 4BNVA 1DJNA 1MEOA 4D74A 3MJFA 4WDQA 4KFRA 1TUBB 1PFYA 1PR3A 4EGQA 1OKKD 1JKXA 2EKQA 3LV8A 1SUPA 2XE8A 2Y92A 3A70A 4P5DA 1EUCA 3PENA 3UT0A 4RJJA 3BSFA 1R66A 4L4SA 5JCPA 3GLGA 4GZLA 5JXGA 3QFRA 4KIUA 1JQEA 2EHJA 3PXXA 3ZCPA 4Q1DA 3KE9A 3BVPA 4ENTA 1NBME 5KNBA 5CYFA 4GKVA 3BSSA 2Z6UA 1RMYA 4YRDA 4G1MB 3TVDA 2A3NA 5LZ9A 3O91A 5F2OA 4PPNA 3MT9A 2AOXA 3H9EO 4OEHA 5F76A 3TJZA 2B61A 3WRXA 1M66A 1ZUIA 8ABPA 2OCAA 1W0KD 2FQWA 2PO5A 1ZHFA 4I2VA 5AI4A 5I7EA 2YDYA 2J9ZB 4IG4A 2FZ5A 2GHIA 4JU9A 4Q03A 5AESA 3MRTA 4MGYR 1ZMRA 4EP1A 4WFQA 1IOVA 2PDAA 2YY5A 1W52X 3ZKWA 2PZJA 5ULLA 4B7AA 2PXAA 5EXTA 4N0EA 4RS3A 4KQIA 4LJ5A 1MN6A 4OI0A 1W88B 4QOSA 1OZGA 4JIMA 4M7PA 1RCFA 4UVEA 3WHPA 4EY8A 4AQ7A 5HILA 5K6RA 1GQOA 1QHHA 4S3MA 3TZHA 4I4TF 3WGKA 3WHLA 2X19A 1M83A 4Y7CA 1MABA 4UNSA 4I1UA 5TQ0A 3VYVA 3LQRA 3W8RA 1KZ6A 2W22A 3N53A 4P35A 4OKIA 1ID1A 2Q9BA 5F4BA 1OHHA 1CUZA 3TRFA 3UPTA 4PYNA 2R66A 4OX9Y 4KXUA 3H87A 3KSBC 4BLVA 3E9ZA 5BQ3A 4XUEA 1IL0A 2J6HA 1HY3A 5ITVA 5J1SB 3P9ZA 1JKJB 1R6XA 1WDMA 3KKMA 4ZDKA 1E2GA 2VXYA 2K6GA 3ZYZA 1UDWA 3LKBA 3Q3HA 3NTLA 1W1UA 1ZS9A 2FEPA 1SU6A 2Y1FA 3EYAA 3FA2A 3KWLA 4P7GA 2P90A 3L7IA 1REQB 5GOTA 2JA1A 4FFWA 4LWZA 1LK7A 3PGLA 4P0PB 1E4YA 4R8SA 2EFEB 1YQUA 3TSZA 1JIXA 4DPKA 5CUQA 1YF3A 4XLZA 1H6AA 1EFTA 1TUEA 2EZ8A 1RXYA 4OP2A 2ZETA 4E13A 3R75A 2H2DA 2BI7A 3ICVA 3N7AA 5CG1A 1QJ4A 3PX3A 3V8BA 3HKCB 4EG4A 3NTVA 4X61A 1ZPDA 3AINA 4Y2YA 5J5AA 3VDRA 4BNHA 3H0KA 2Q8PA 2DY0A 4IRUB 3DXYA 4ND8B 1A9PA 5DI3B 5EINA 4EGCB 3IELA 4Z4GA 5AIBA 1A69A 5ALHA 4B7XA 4UM9D 4CTJA 1FMCA 2IYQA 3NM6B 1P7PA 1T5IA 4E4TA 3Q9NA 4MEAA 3DF7A 2QEQA 3RFUA 4M9UA 3OD1A 3RB8A 5DM1A 2FUKA 4CMIA 1AXEA 3V2GA 1U3CA 4PCLA 3ETNA 4MOWA 2QRJA 2GJ9A 3RLFA 1U1CA 2FPOA 2I22A 1FFCA 2GPWA 2OZPA 4U39A 5EKTA 4YXWA 2SKDA 4RIGA 1K0FA 2WVAA 2BISA 2EP5A 1Z22A 3KSMA 4W7SA 1MRSA 1P2SA 4PYKA 4WOJA 3QLUC 4H2DA 4D7AA 5U9CA 1V1JA 3WWPA 1PZXA 4YMSA 1TVKA 2D0PB 3UWSA 4URVR 3S5JA 3TMYA 2UUAB 1BEZA 4RZIA 5F1KA 4UHBA 3EG9B 2B2NA 2OOSA 2G63A 1H2WA 5AQ1A 4FE7A 1YQXA 1YA6A 5C35A 4CQNA 2EX0A 4BRWA 4QVGA 5J2UF 1ENYA 1NXTA 2UVQA 3K09A 1PO7A 3OU6A 2BJHA 2NXCA 3QVJA 1P61B 2W2OA 4YRNA 1KGSA 1U8EA 2PUVA 2B8NA 3UJHA 4RTKA 4N41A 1Q3KA 3QHPA 1IE3A 2H31A 1QGAA 4NK4A 3O3NB 4LTNA 4DIKA 3LPLA 3BRWA 4UAGA 3OY2A 3RABA 3MWYW 4CCYB 3PFKA 4LXQA 4HVTA 4IICA 4MGEA 1UJ6A 2RC6A 4GYJA 1MTZA 1WZCA 4LJ4A 5ALLA 4JGIA 4OOEA 3IVGA 1U7PA 3PC6A 4DTCA 4WXMA 2IT1A 2WUFA 1H6BA 5CVJA 3V1NA 4R1PA 4LZOA 1AGXA 4QU0A 4BLWA 1USWA 4URUR 4NAHA 3EXIA 1ESDA 3VPSA 4B3FX 2FGKA 4B5LA 3FWZA 3M5PA 3KD3A 2CVQA 4UHEA 1SHUX 3HNOA 5KCZA 5REQB 1AMUA 4CHTA 4OAQA 4HDMB 2P41A 4I6JA 4RD3A 3RUIA 3JWEA 1PQYA 4MV6A 3BE6A 5CBPA 4KAXA 4LDRA 2IIBA 3JQGA 3HLYA 2KJQA 2QL7A 2XNDA 4FJ1A 4DCOA 4N47A 3IKLA 4I50B 5CB4F 4NCXA 5EJ7A 3T5AA 2Q49A 1CD5A 1C14A 1PV1A 4AMUA 3CZAA 3BWDD 4YEDA 4BEBA 4E5VA 4HMOA 5EJ8A 3FJOA 4BWYA 2E4XA 4KTVE 2TS1A 2NMVA 4X71A 4YVFA 4MR8B 1T43A 1DKNA 2JIOA 4BZXA 1KY3A 2O6LA 5DXFA 3A3OA 4QUJA 4M8SA 4AIIA 4MIKA 4ZZ3A 1N2GA 1WZIA 5IK2A 4EI9A 2DBZA 5IFLA 4ZU3A 1CC1S 2A3RA 3BILA 2QY6A 3I4FA 3JVVA 5IU6A 3CTMA 4DSNA 3CT6A 3F5SA 1BYUA 3DYBA 1YTLA 5LWHA 4IIJF 2WUGA 2FYTA 4FZVA 4IDFA 2FR1A 4PTZA 4PXAA 2POCA 2ARKA 3FN4A 4WLFA 1SXJD 1PD1A 4UJ3A 5GPBA 3COJA 1RHJA 1YL5A 2DBRA 4EY7A 5INTA 3PVCA 2I03A 1YBAA 3HP7A 4CT0A 2B4TO 1TX4B 1MJNA 1EP1B 3B7GA 4NL4H 3VJKA 1YRWA 1YCGA 2ZUVA 1E1RD 2WIDA 3LOQA 4HSGA 4NYMQ 3UK1A 4J4BA 5JC8A 1RRCA 1YIAA 7MDHA 4FE3A 2GBLC 3CR7A 5C18A 2XQFA 3ETJA 3LUDA 1Z35A 3I9JA 1NVFA 4IUCS 2WJYA 2HMVA 1EWTA 3TG8A 3K0EA 2X0RA 4R1QA 3TR0A 2WT8A 2ZIFA 3HI6A 3F5MA 4LSMA 4W5TA 2EATA 2PIDA 4P22A 3L4JA 1OGJA 5JZSA 3IP3A 4OH7A 2BF4A 1VJCA 5CH5A 3ZWMA 1C5KA 2IZOA 2WICA 3HUDA 4DW8A 1O0SA 1HBJA 1WDLA 2H0QA 4G97A 4JWKA 4KVAA 1DC7A 4JYMA 1F1JA 3OJCA 4OM7A 4Q48A 5FT9A 3IV7A 1QLWA 4INJA 2XNHA 1Z4QA 1JDUA 1U04A 1KMNA 2PR7A 2H4HA 4QC2A 1S2NA 3OCJA 4KLNA 1XN1A 1O5TA 1G41A 3G2PA 5JQGB 3KG2A 2BN4A 1W96A 2NU7A 1OOEA 3OZXA 1JUDA 1T8RA 3BFXA 5K09A 3O8CA 1F0YA 3PBKA 3ZD6A 2EKDA 2P0AA 3A6PC 2Y77A 2IHKA 5IWAB 3GVXA 3U3OA 2OZLB 1U8YA 1N1GA 3TX2A 3DBRB 3KKOA 2DM6A 1RPJA 1YB6A 5DWDA 3U3JA 2GA9A 1RNLA 2CWWA 3W8FA 1HNZB 3KSAC 1JVNA 3PI7A 1PJ8A 5LOVA 4H0CA 2CHEA 5MDHA 3KELA 1M6WA 3SKVA 1RW4A 3SE0A 4CQMB 3F9CA 1CY6A 2RJOA 1NI3A 1E9AA 2F3RA 3QA3E 4JJ6A 4MAAA 3EPHA 1WZ2A 3FMIA 2RI1A 1X8JA 2JFNA 3DBOB 3EASA 4ARVA 4JEIA 4YJ2A 2JA2A 4MVJF 4NVRA 2XT6A 2NXWA 3U0VA 4DMGA 3PHJA 1P5HA 5JAOA 4TYWA 1L7PA 1NJFA 2GEJA 4JI8B 2P2NA 1ISMA 1N8NA 2ORYA 3D1JA 5K2OA 1T9ZA 2Y1CA 4U5QA 5AVZA 2GF2A 1S0UA 3E4DA 4M8LA 1JQJC 4ZOBA 1UKEA 4JNKA 1DCFA 3CR8A 1ECPA 1JJ7A 1ZJ4A 4J0HA 2GRUA 5EE1A 2QNBA 4X8OA 3CXRA 1OZFA 2R86A 5DNAA