4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
1NN1A 1VIAA 4QGFA 1XPOA 2GVZC 2GCOA 1GKIA 3FDIA 1G3QA 2OAP1 2XNDA 3SQWA 1CJVC 1P4SA 4PAOA 1R8QA 1KNQA 3LD9A 3LX8A 1CJUC 1YZTA 2F1HA 4XVUA 4KHZA 2ZR7A 4JBWA 4RZ2A 3KKQA 3OIVA 3CX7A 1A4RA 2FSHA 4W5HA 2WV9A 4AKEA 5JJKA 4OQXA 2FWRA 2RHMA 4P32A 4DDVA 2ZS9A 2WSSA 4RZUA 5L3QA 3EPJA 3GCGA 4ZDIA 4C0JA 3UG6A 4PO8A 1H8ED 4L15A 1BH2A 2IYTA 1YZKA 1EG7A 1P75A 3G0HA 4BLSA 2NO9A 5HE8A 1G1MA 5FPTA 4RJLA 2O0JA 3TUJC 3S1AA 3K0SA 2WOOA 1ZM7A 2ZI5A 2RGBA 4GOKA 1W46A 3NBZC 2ZJYA 4Z1MA 2V6IA 3KQUA 2XNSA 3P26A 3E2IA 2QE7D 2Q9AA 3MWYW 1KMQA 2F1RA 3DKPA 4JKIA 4LJ6A 1FZQA 5EXSA 1EWQA 4OHZA 2D3WA 2AXPA 4V03A 1WF3A 2HEIA 4JL5A 2CE2X 4HI0E 3AB3A 4PHFA 3SI7A 3V9PA 2JLUA 2YHSA 3GLFE 4PPFA 3QKUA 1XMSA 2VH5R 3LV8A 4WIAA 5G40A 2IUUA 2EFGA 1ZU4A 3BERA 5FBRB 3TVTA 3LW7A 3VHXA 1FMJA 2XTMA 1YQTA 5AJVB 5ANRB 3FYHA 2GRJA 3EPHA 3LVRE 2EFHB 3L0PA 5UKDA 1ZYUA 4LHWA 2BMDA 4Q02A 4KITB 2X19A 5G53C 3W90A 1L2TA 1JQLB 1TF5A 2ASEA 1D2EA 1II9A 2RGNC 4OI0A 3F3YA 3WHKA 1AS0A 4BPBA 4ZCLA 2ATXA 2OXCA 5F2EA 1Y3AA 3ZYCA 5KTYA 2R65A 2ZI9A 1O3YA 1FNNA 2IK8A 2R44A 2WJIA 4RKFA 1HE8B 1DO2A 3VX4A 2UVQA 3RANA 1CR0A 6Q21A 2DY1A 3LRPA 4G1UC 4ON9A 3X1YA 2ZJAA 3KJIA 3AVUA 4D4JA 4TQ9A 3PQCA 4NYJR 5BWMA 2EFEB 1FUUA 4B32A 2C9CA 2ZIAA 5B57C 2QUZA 1G64A 1N0UA 1QHIA 1E6CA 4RKEA 3QI2A 4E03A 4PC6A 5KNCA 4TYPA 3X1DA 3WMGA 4B3DA 3SFZA 2LCFA 2OHFA 5HZHA 1PZNA 2DWQA 1KMHA 1QDEA 3QXCA 3B8HA 5HR5A 1T4GA 2AXNA 2GBLC 5JI2E 4GOJA 4KODA 2D2EA 3GJ8A 2ATVA 1G7SA 1TQ4A 2CK3A 5ELXA 2JLQA 2QM7A 2IW3A 2QPTA 4V0LA 2ZJZA 2L0XA 1EESA 2Y8EA 2GESA 2WAYA 4Q9IA 4MQBA 4QJ5A 4ACBA 2IS4A 3OZXA 4A0FA 5B30A 2EU8A 3AM1A 3ZDQA 2WWWA 4GNKA 1Q1BA 3B5JA 2HXYA 1JALA 3KXKA 3LBNA 1XMIA 4HLQB 3GMTA 2CVHA 4Q4HB 4M9XA 4OJQA 1GILA 2XTZA 3CPHA 4F4JA 1BIFA 4LC0A 2D4HA 4QHTA 4IDNA 3UATA 1DAMA 4MYHA 3RWMB 4M9QA 1VG0B 5KPJA 4JYCA 3GJ4A 1FUKA 3KZ1E 2C8VA 3B7GA 4PHTA 4PQFA 2KWIA 5DGXA 5JWHA 1DPFA 2VIIA 1Q0UA 2YWHA 4MUAA 4G01B 1EFRA 1UBEA 4G5GA 1YRBA 1SGWA 2QA5A 3KFVA 3L8ZA 4OQFA 3RC3A 2VYFA 4MKHA 2XZLA 5BN5A 4E5UA 1SVKA 4I1VA 4IEIA 5SZHB 3TKLA 3UIEA 5EE3A 1CJMA 2GCPA 2H7VA 1E9RA 1WE2A 3U60B 1E9AA 1ESMA 1Z0JA 5IK2A 4HAVA 4AD8A 3EWSA 2YWFA 4XWOA 2ZJOA 1J8MF 3HPRA 4W7SA 2DHRA 4KYUA 4NDZA 4TMZA 3THXB 4EPXA 4K8OA 3PEUA 3ZIAD 4MRVA 1SVOA 1Z6TA 2F43A 2A2ZA 3PUXA 4Q4HA 2LKCA 3K9LA 5DI3B 4CEJB 4E22A 4MGIR 2ZUBA 1OIXA 1VCOA 3B82A 1G291 1J90A 1VTKA 1E4VA 2DPXA 3KXIA 4JLKA 1T3SA 4F91B 1EX7A 1QHHA 5TMPA 3GJ3A 4QBFA 1OXTA 1E9EA 4NP6A 2O5VA 3C8UA 2PMKA 1E69A 4X8HA 2ZYVX 2OFOA 3GQBA 4E09A 4ZPXA 5CITA 4QBHA 5AK0A 2D06A 1DELA 4LBWA 2YZ2A 4DT1B 3W34A 1P9NA 1PUIA 4BLQA 2VP5A 4OI4A 3RVBA 1G3UA 2XJ9A 3T5GA 1TAGA 1AIPA 2VEDA 1JI0A 1Q57A 1XEXA 2ZRGA 1NVXQ 2WICA 4RD6A 2JLXA 2IWRA 2W6IA 4KFUA 2OBLA 5JWRA 3GJ6A 1RFLA 4GP7A 4B2LA 3OE7D 4AURA 1U9IA 1X1RA 3EZ9A 3BWDD 1R4AA 3OAAD 1DAHA 1E2NA 3KUDA 4OQLA 5CYOA 3U5ZB 4AKGA 1NLFA 2NIPA 3R9WA 3EIHA 4GI7A 4TZ6A 3THXA 3NWJA 4IOLA 1F6BA 5D3QA 4MRRA 2QMOA 4X8LA 3TJZA 3IO5A 2PMDA 4ZDWA 2G77B 4JLAA 3I5XA 3TK1A 2GJ9A 2DFTA 1WDTA 3CF0A 4ASUD 2BBSA 4B73A 1N2CE 1X86B 4LYJA 4MRNA 1W5SA 2EWWA 1MRSA 2YC2C 3CF6R 1IXZA 4NONA 5TARA 2ZU6A 2A7QA 2ZRDA 1F2TB 4Q4AA 1XRJA 1PUJA 4DIDA 1M6NA 1UKEA 2WWIA 2VTKA 1Q1EA 4IVRA 1G18A 4ZO4A 4I81A 3RRYA 1EFHA 3LXRA 2PCLA 1N6NA 4WW0A 3SN6A 1GL9B 3I4LA 3QXHA 4WBSA 4C30A 1BMFD 2ANCA 1XWIA 4HLDA 2QEQA 3DZDA 3W3ZB 4DHEA 2CXXA 1GAJA 2Q0HA 2RGNA 4JT4A 3B1WA 1UDWA 1UFQA 2FJUA 2JLRA 2WKRA 2ONJA 2UZIR 3W6NA 2J0UB 3HU1A 2OO7A 2RGCA 3R8FA 1N5LA 2VF8A 1ZCBA 3ICEA 2AWNA 2OILA 2ZJ5A 1OH5A 1KZGB 1Z07A 4BFWA 1MABA 1SXJD 2E1RA 5JLJA 1R6BX 2D7DA 1U8YA 1D2NA 2R6DA 4Q4LA 1XCPA 1BS1A 2I1QA 2ZITA 3T34A 3GFOA 3SYKA 3WBJA 4PR0A 2QZ4A 1E0SA 1E1RD 1VYTA 4H1VA 2V55B 1B0UA 1M7GA 2HT1A 2CJWB 2BDTA 3BB4A 3MLEA 4KBFA 3O8DA 1HUQA 1JR3A 3U4QB 1DAFA 1IBRA 1YZQA 1U90A 2GBLA 4EDHA 1UADA 1ZNYA 2VRWA 4BE7B 1W7AA 2VHUA 3FHCB 1XB2A 5CDFE 1Z28A 1G3MA 3A6PC 2PZGA 4YMSA 4A0GA 1XNJA 3KL4A 4F4CA 5K8TA 2TMKA 2EYUA 4BGDA 2W0SA 1VECA 1G7RA 4PQYA 1FP7A 4R9UC 4HB4A 1J70A 1YRAA 1XD9A 2AR7A 3TUIC 3VMFA 1LNZA 1E1QA 3GJ5A 4WOPA 3GLHE 4AKIA 1JBKA 5C46F 2WIAA 4P0TA 2FZLA 4HZUB 2BJWA 1CR4A 1GWNA 2GF0A 2QY9A 1TQ2A 5TDHA 1X6VA 1II8B 4RZ3A 4BRUA 2AN9A 2BV3A 3GJXC 4NE2A 2G1KA 1R8SA 3ND8A 2QAGC 3MWKA 5LD2B 4MGZR 1NSTA 1ZM3A 1XTSA 3THWB 3PR1A 4L9WA 3NXSA 1GFIA 3RS2A 5AJYA 3KQKA 2WTUA 2IC5A 4HAYA 3NC0C 2CL0X 4NYMR 3SBDA 2B6HA 4XOIA 3U4QA 4A8JB 2AWOA 1E0AA 1D6JA 2RGXA 1E9FA 3QF4B 2Q9CA 3K0AB 2C78A 5K8UA 2ZRPA 4H9GA 3BJIC 5FL7D 3ZLJA 3PENA 1LS6A 4LDJA 1AJEA 4BASA 3K0EA 2VP2A 2ZI6A 2ZETA 1BKDR 1VYUA 4LRWA 2J59A 4PQRA 4V0MA 2ZYUX 2LKDA 2VO1A 3BH6A 5JECA 1OF1A 3CIOA 4NCNA 5J4LA 1K5GA 4QGHA 1Q44A 4IKEA 2WWHA 4Y0AA 5KNDA 2QMHA 4IW3B 3R8CA 2A5FA 2NO0A 4HZUA 4L8GA 3ZVLA 1WQ1R 3VR3A 4B3GA 3SJAA 4ZV4A 1ZNXA 5F3WB 1EK0A 1II8A 5JS7A 2VP6A 1F2UB 3RS5A 1ZC3A 3CRW1 4NHOA 3OEHD 4V0OA 3RYTC 2ZAOA 4KI0A 1X8KA 3KQNA 1YR9A 3U3RA 3RRNA 4EFMA 1E2KA 2J87A 5C4GB 4XSHA 1IY0A 3AEZA 1GTVA 3KB2A 4MGKR 4P4SB 1R0ZA 1Z0IA 2C95A 4Q9HA 3OIUA 2J1LA 4A8JA 2J46A 4EAQA 4GL2A 4PZZA 2YWGA 1W36C 1XBTA 5JHGB 2F55A 4ACAA 4URZR 3QVVA 4JLPA 3P20A 2CHQA 2ZRLA 3AV0B 1GL7A 5JEDA 1KO8A 2W0MA 2HLDD 1IY1A 3RSLA 3AUYA 1XCMA 2WSMA 4XJXA 1N6OA 3DL0A 4EKDA 4QXAA 3UG7A 2GJKA 1NP6A 4MA4A 3SQXA 4RFSA 4URXR 2V7QA 2ZXUA 2GILA 1HTWA 2WKPA 4A0RA 2A3RA 3CWZA 2WJHA 1KK3A 3A4MA 4I1OA 1P72A 3P27A 3GJ7A 3IPXA 2AKYA 3VU9B 2XOKD 3TUZC 4CEIA 3BBPA 2YINC 2W6JD 4O25A 1E4YA 2YOGA 2WMNB 1HQCA 1OE0A 1U94A 1TUIA 1GP2A 4AYTA 4J0QA 3NC1C 4HYYA 2V1XA 5FOWA 1E2GA 2FX3A 4WXRA 1MKYA 3AVWA 2XNDD 4JYBA 4OHXA 2RHDA 2C77A 3L0SA 3IHWA 1RPZA 3B1ZA 2FN4A 4LY6A 4NCJA 4OHVA 2B21A 3ADCA 4D2IA 1YR7A 3HR7A 4YDSA 4ZKDA 2XX3A 4Q7LA 1OFIA 4LJ4A 4NZYA 2ORIA 1KDRA 1NVWQ 1W49A 2OSBA 2PZEA 3ZVRA 3IIJA 5IDVA 1Z8FA 1AKYA 4URUR 4NCHA 3N2EA 3V4RA 3VR5A 3ZH9B 4RSGA 4PFSA 4B6EA 4ARZA 1EFTA 1GITA 1VPLA 2YNMA 2IWHA 4DLRA 4DVGA 3WYGA 3M4YA 5CJPA 4DSOA 2WWXA 3BOSA 3X1XA 5L3RA 3ND9A 2AKAB 2JLWA 4TYWA 2HYDA 2HV8A 3AKDA 3OF5A 3L82B 2REXB 2GHIA 3D3QA 4UKDA 1JPJA 3NHBA 4BFXA 2D74A 1OYWA 1KTVA 4PHHA 3KUCA 1ZC4A 4F7WA 3WBKA 2Z4RA 1DAIA 3GLFB 5TV2A 2J41A 3D7MA 3CH4B 5C4MA 4L16A 4QBIA 5SZJA 3FHTA 1MRNA 3BH0A 1KY3A 1UKVY 3UWKA 3LO5A 1N6LA 1W0KA 1BO6A 3FGNA 4DUGD 1S96A 3W5IA 4MDFA 1KDOA 1SXJE 3QG1A 2A5GA 4Z54A 4MYTA 2DFLA 1VMAA 1YHNA 5AUPB 4BUJA 3EXAA 3A4NA 3PCRB 4ILEA 4XVRA 4BFTA 2O8FB 2QSYA 3W5JA 2GA8A 4MRPA 1TTTA 5J4YA 1XTIA 2WIBA 1IJEA 4LGMA 1R0YA 3GPLA 1GIAA 4M21A 1ZUHA 2OFWA 4KJZA 4TYYA 3U7FB 2GK6A 5KSZA 4IJMA 1SULA 2IS1A 1KY2A 2A9KA 5FPHA 4JSYA 1Z6AA 5HKKD 2P6RA 3SS8A 1R5NA 4EFNA 2ZJBA 4OI1A 1DTSA 4EFLA 3OFNA 2H1LA 4U7DA 1KJZA 4B33A 1UBFA 2DFKB 4A4DA 4EQ6A 4MKGA 4JBXA 3HDTA 1IY2A 3WMEA 2R6CA 3P4XA 3L0IB 3WXMA 4Q21A 4UXIA 4WZ6A 4DLVA 5CJ2A 3A1SA 3DKVA 3BK7A 3LQQA 3T61A 1K8RA 5HCNA 4C2UA 3K70B 2FEMA 3K1JA 4TLCA 1G8FA 2H92A 1U0HC 4D25A 3SR0A 1OKKA 3DVLA 3UMRA 1UAAA 4TLBA 4AG6A 1NLZA 2YOFA 2XZPA 5DYIA 1ZMXA 3W6PA 4MH0R 5H1YA 1QZXA 3NH9A 1E2EA 3ZZUA 1LW7A 4Q5IA 4IHQA 1DAGA 4KFRA 1VG1A 1W47A 4MYCA 4TYQA 4ZDKA 2O8FA 2C98A 1P2SA 3TQFA 2JATA 1QVAA 3PUYA 4G5SA 2ZRIA 4TLAA 2ODNA 3EPLA 2H17A 4DBLC 2FPMA 4DLZA 1FX0A 1NMZA 1UPTA 2CEAA 1G16A 3B9PA 1LTQA 1US8B 3SNHA 4DLUA 1CU1A 1CR1A 3EA0A 1TADA 4JLOA 2ZI3A 3O8BA 4DLWA 1JJVA 3BFVA 2MMCA 1G5TA 1JB1A 1YKSA 5DN6D 4N3NA 4TSFA 1AS2A 1N0VC 3DMNA 5AWFC 1NN5A 2FF7A 4Y0VA 3UK6A 5LDDC 2MMGA 1OPXA 3LBHA 3BAFA 3M0EA 4TMWA 1IN8A 1DG3A 1G5RA 4TLEA 1VIYA 2OBNA 4IVQA 3VTKA 1WBBA 4WZBE 1U9IC 3LLMA 2OAQ1 2ZRJA 2GAAA 4IXMA 1DOAA 1N5JA 1OSNA 2IHYA 4TT3D 1RRPA 1E0KA 1LF5A 2JDID 3IPYA 5G3ZA 2AK2A 3LNCA 1IN6A 1XD8A 4GRAA 4YDHB 4O3MA 1L4YA 4DJTA 3KJGA 4K81B 1E99A 3FE2A 1IJFA 3T06B 3U3JA 4DB2A 2FG5A 3P1JA 1W44A 3IILA 1I2DA 1M7HA 3PUVA 2ODWA 3TLXA 2W2VA 2JJ2A 4Q9KA 5AJWA 4TL8A 2Z83A 4JSTA 4ABYA 3TVDA 1IHUA 1LB1B 4N1AA 5CYPA 4BFZA 2A78A 3GLGA 2XAUA 4HDQB 2FFAA 3J81k 2CCGA 1RRGA 2ZI4A 1G9XA 2C2HA 5IK2D 2YC4C 1FPMA 1US8A 3KKMA 3TIFA 1EWRA 1OXUA 2BCJQ 1EGAA 2ZE5A 3I8XA 3I72A 5FR1A 3HU3A 3LFUA 4LPKA 1U0LA 1W0JA 3DMDA 3IEUA 5P21A 3AVPA 4AYXA 4GPTA 3I3SR 1ESNA 4KLZA 1E96A 2CCJA 1NIJA 3ZD6A 3QY0A 1XF9A 2A30A 1XCGB 3CRVA 2FFQA 3TNFA 4GT1A 5GVRA 1X3SA 2QORA 4RZXA 3U3MA 4FMCF 3H4MA 3SJCA 4IOJA 3TRFA 2JLSA 4KYIB 5BYKA 2VL7A 3T15A 2BIFA 2IS6A 1G3IA 1ZM4A 1ZIOA 2OEPA 3WMFA 3MMPA 2AHOA 1YZNA 2P3SA 2ZROA 1YZUA 3Q72A 4AKHA 3KKPA 1RYHA 3QIAA 4I1UA 5B2ZA 1KDTA 2W00A 2O52A 5KYKA 2EFCB 4I1SA 2W6ID 2MSDB 3CR7A 3QOFA 3CRQA 4PO1A 1A7JA 1E3MA 4B43A 3C15C 1G4AE 4FMDF 3B78A 3WNDA 1M1YE 3NHAA 1B23P 2JJ1D 2UKDA 1OH7A 5J4VA 2WHXA 1G8PA 1H8HD 3K0FB 1OH8A 5JWOA 2BKUA 3CX6A 2IA5A 4TLDA 5DYGA 2J0VA 3CM0A 1D8TA 2C96A 2YJTD 3CZPA 3EIEA 4QHYA 4RD2A 4KU4A 2QRNA 4ZIRB 3EIQA 3B9QA 1T3LA 4EPYA 2C9OA 2E9SA 4PAQA 3X2SA 1MT0A 4TMVA 4HEJA 2MSEB 3QENA 4QKQA 2ZSBA 2GDJA 3CO5A 4IOMA 1CLUA 3RHFA 1ZU5A 1KI2A 1XPRA 3FKSA 3G82C 2K5UA 2V6JA 4A0HA 1ELOA 5H68A 2GF9A 4AI6A 4R98A 2I4IA 3W8NA 2ZUDA 5BYJA 1VCMA 2IYWA 2PZFA 5DLQC 4BECA 2VBCA 2ZANA 1YVDA 4GDFA 4FCTA 4JLJA 1W4BA 4IDQA 4KBGA 4NKRA 4LWZA 4QJ3A 4N0EA 3KQHA 4PC1A 4B44A 2XB4A 1S3GA 1D5CA 1U81A 1VCIA 2QMUA 3CPJB 4HATA 4XWKA 4LBVA 2IUTA 3SE0A 4XWAA 2FOLA 3NBFA 1S3SA 3Q85A 3K0FA 5E4FA 5EP1A 2GAOA 4NU0A 4A9AA 4DCNA 1GRQA 2NGRA 3B85A 4FIDA 3W8RA 5FTKA 3EPKA 1A2KC 2VF7A 1H8EA 2REBA 4DCTA 3AF2A 3RS4A 2D2FA 2KBEA 3WHLA 2Q3MA 3SYLA 2GWHA 1R10A 1ZCAA 1ZD9A 1ZJ6A 2GVDC 1ANKA 4ZI2A 4M1KA 3GEHA 1WA5A 2NZ8A 3M6AA 5FH9A 4Q7JB 1XEWX 2QE7A 4DZZA 3U7GA 1TUEA 3QQ5A 1JECA 3K9GA 4RD4A 3LDAA 1KGDA 2V3CC 1XTRA 3B13B 1TX4B 2ZU0C 1C9KA 4EPTA 3HYTA 3IO3A 3CNLA 1HT2E 1EFCA 1P3JA 1QHNA 3SHWA 5LD2C 2HF9A 2F3RA 2I1VB 1N25A 3H84A 1DG1G 4DSTA 1P7CA 4NCIA 3U7EB 2VSXA 4Q1FA 3N2IA 4V02A 4KV9A 1YR8A 3ETLA 5DSZA 3GLHB 1NY6A 1SHZA 3CF2A 4TQUS 5FTLA 1IONA 1E2LA 1E2MA 3PV0A 4A8JC 4TZ0A 5H8WA 3CZQA 1XJCA 3MJHA 3KQLA 3SU8A 2PX0A 2X2EA 4W5WA 3CH5A 1S9DA 5DE3A 2IEZA 2P0EA 4WVFA 5FBVB 3D6TB 1KNXA 5KHOC 1GSIA 4FMBB 4QL3A 4X8OA 2O8CB 1N0WA 1LFDB 2QMEA 2QROA 4YLGA 4HLCA 3BFXA 3QF7A 5FTMA 1CR2A 1S1CA 4PC3A 4BZXA 2XSZD 1Q22A 4N0DA 1CTQA 1RRCA 2V8OA 3QBVA 2HYIC 3AF3A 1JQJC 2WKQA 2ZSDA 5EP4A 2VPPA 3BXZA 3LH5A 4AIIA 3QXXA 5FPKA 1T5IA 3MJRA 3RS3A 2W2XA 1NBMA 5DI3A 4CEJA 3VKHA 2QT1A 2FSGA 2ZR9A 2DBYA 2VHJA 5FI0B 3R9IA 4QNRA 3CWQA 4NBSA 2QT0A 2JAQA 4BZQA 4U02A 1WMSA 3PUZA 3DOFA 1SKYB 2O0KA 1AGPA 5GJCA 4XD7D 1OXXK 4JL6A 2ERYA 3FFBA 2FFHA 4B2PA 2G3YA 4JJZA 1DAKA 2CLDX 1KO7A 1CJTC 4JMPA 3GLHA 3V4FA 1E2FA 1FOEB 1KI8A 1TU4A 2C03A 2F6RA 4KXFB 2ZPTX 3UANA 4DT1A 2P6UA 3I92A 2VP0A 1CIPA 1KI3A 2A5YB 4UXJA 4DXAA 5BXQC 4FD2A 5JSZB 4BZPA 1FQKA 1T0JB 2BM0A 3KDSE 5FR2A 1HURA 4IVPA 3ZGXA 2RKOA 4B75A 3ONWA 5SZIA 2IYRA 1AZSC 1GOTA 1Y63A 3QG5A 1TL7C 1ZVQA 1ODFA 1DBSA 2WVJA 3O8RA 4P31A 4LJYA 1E2JA 5KSYA 2VHTA 721PA 1D9XA 1Z22A 2F1IA 3MWJA 4QJ4A 5CB8A 1G41A 2FGKA 1OXVA 3U44B 3WRYC 2X1VA 5L3SB 4C0HA 1KI9A 4BEBA 4ERNA 5JMTA 2V54A 1JXOA 2Z4SA 3T1OA 5EE5B 4JLDA 3NBYC 3C4JA 3KFXA 4LV5B 3VKGA 1KJWA 3I5YA 3LQRA 3C41J 2DWOA 4LI0A 1RJ9B 1JEDA 1F2TA 2FFBA 1XEFA 2FE4A 5KOYA 1T9HA 4OK6A 2WWYA 3BH7A 2OUKA 1N6HA 2C9YA 1SKQA 4HDCA 4R7ZA 2FSFA 1OHHD 4AG5A 4YXWD 4A92A 1J2JA 2V7QD 4UNPA 2NQ2C 1BOFA 1CBUA 3DM9B 1I2MA 5EXXA 1G8HA 2RH5A 5JSZA 5F9FA 3JZMA 4DLSA 1E79A 1Z0KA 2I3BA 1LVGA 4C0SA 1NVVQ 2GTPA 2ZS8A 3I32A 3IHLA 1Q12A 1ZNWA 2J0UA 3R20A 2VA8A 4C7OB 3ADKA 1XDBA 4OK5A 5LB4A 3GLIE 5EZ5A 1P62B 4BRWA 5FPSA 3NDPA 3SYNA 1IN5A 4AY2A 4B74A 4IXNA 3RLFA 3AP2A 2CNWD 1OLOA 2ZRCA 1COWD 3IQWA 2JIZA 4PZLA 2RGDA 3R7WB 3REGA 4EPVA 1UKZA 2RB4A 5EE0A 3AVYA 4EIWA 4P4TA 3NG1A 1OJLA 2XXAB 4LHVA 1F48A 5L8VA 1FTSA 2CJWA 4I4LA 4DIEA 4Q00A 2QBYB 5K8IA 2BCGY 1VHTA 1RJ9A 2ZM5A 2Q21A 4AC9A 2PJZA 5FFMA 3QKSB 1OIVA 2PX3A 1FQJA 1LS1A 4URYR 2NO7A 1MO4A 1PLKA 3NDBB 1CF4A 1DADA 1YZGA 2GZAA 3BFKA 4TL9A 4WA7A 1TF7A 2MSCB 1QHGA 1AZTA 3OE7A 3WNBA 1RIFA 3GP8A 3KB1A 3OAAA 1KK0A 5DHAA 1WBDA 2ERXA 3K53A 1NSFA 4HLUC 1Z06A 4C4PA 1SKYE 4DCUA 4D4LA 2ZAMA 1ETUA 1SXJB 1SQ5A 2WPDA 4JBYA 4PSKA 3ASZA 5TXGA 4RVCA 4HUQB 3RAPR 2V4ZA 3JVUA 3A1UA 1Z2CA 3E1SA 4PX9A 2F1JA 2D62A 4Q1BA 2O8BB 2R62A 1KSJA 1D2MA 1NRJB 2XTNA 4ITRC 3UMFA 2O0HA 3H0KA 2O8DB 1VDZA 4LZZA 2N46A 2VP9A 3K70C 3LX5A 1OIWA 3ZS8A 2OCBA 1KK2A 2G0TA 3OEED 5CM9C 1GM5A 4GMXA 3THWA 2WZQA 3PITA 4RD3A 2XXAA 2QGNA 5GADl 1P2UA 2ZI7A 4KCGA 3Q5EA 2P5SA 4DDUA 4URWR 3C7KA 2GXQA 4I99A 1WP9A 2IYLD 4FMCB 3BC1A 3SFVA 5C18A 1CULC 2EWVA 3EZ2A 1Z2AA 1N5KA 2IYQA 1BMFA 2CDNA 1KI6B 1AKEA 1Z0AA 4W5JA 5FOTA 4EJSB 2GJSA 3B6EA 2FH5B 4D4MA 3N5CA 1GG2A 3QF4A 3K0AA 3N70A 4POAA 3RNLA 1P5ZB 1MO6A 1EX6A 1T0HB 2DCUA 4CZ2A 3U6KA 3B1XA 3DDCA 3JVVA 3OIWA 4H1UA 4OI2A 3FPAA 4OQMA 4EPWA 4HUTA 5FBQB 4JVSB 1VYVA 4AWXA 4S35A 4HZIA 3AVQA 4KLNA 1SXJA 5FUWA 2ZE6A 5IT5A 1OKKD 2NPIA 1JNYA 4TL6A 1XPUA 4FMDB 3CLVA 4US0R 4FWTA 4C0AC 3IIKA 2GXUA 4DLYA 5JBQA 4Q1AA 4OQNA 1HV8A 5J4HA 4B3CA 1JPNA 1P2VA 1E1RA 1IOZA 1P2TA 1VHLA 2N42A 4KFSA 2GEVA 1YZLA 3AF4A 4XVQA 4URVR 2IS2A 1F2UA 4C0LA 3CRMA 1IXSB 1UDXA 4TMKA 3QXJA 5HZKA 2JCSA 3NKVA 4PAMA 3U6BA 3W6OA 5GVSA 1AM4D 4JVMA 521PA 2ZSEA 4NYIQ 1FL9A 1A5TA 4W9MC 3PFIA 3UWOA 2V1UA 2NO6A 2QN6A 1ZUNB 3HPQA 1E9BA 1S9HA 4LJ5A 5D3MB 5E7MA 3A1WA 2F9LA 4P4SA 3EG5A 4LV8B 4WXPA 1QG4A 5GJBA 1NVVR 1I4DD 3QKRB 1KI6A 3B60A 1II0A 2WSSD 1OFHA 3K09A 5E7IA 4B35A 4CDGA 4TYNA 1AA9A 3FB4A 4FN5A 4D4KA 1G7CA 1TF2A 3L43A 2QRZA 3H1TA 4IRUB 1SVLA 1NMXA 2G83A 1CRPA 1E2IA 2X8AA 2QTFA 5JS8A 5EP3A 1FFHA 2YWEA 4QHSA 1Q20A 1XXHB 3CKLA 4LSGA 4UNQA 4Q01A 5AR1A 4RD1A 1FNMA 1ZD8A 2KI5A 2BEKA 4JL8A 4Z1MD 3UKDA 3AKCA 3FWYA 5AUNB 1PJRA 2ECKA 1CKEA 3QXSA 5A0FA 3EW9A 3QJYA 3A36A 3ZZ0A 1JXMA 2P65A 4EUNA 1BYIA 2IYYA 2HJGA 4UJ5A 1R0WA 2FV8A 1G6HA 5SZKB 4BLTA 3T1TA 2H57A 2OM2A 4ZKEA 3VU9A 3I62A 5AUQA 2ZRBA 3I8SA 2W58A 5BW8A 4YMTA 3U3KA 4A6PA 1W36D 4WZAE 3W9YA 4HB0A 2GETA 2HDNB 4Z51A 4HSEA 5KSPA 3THOA 2QQ0A 4CT5A 4LOAA 3ZJYA 2PT5A 4CVNA 2IF0A 3IBGA 3EA5A 2BMFA 4YC7A 3VR1A 3QPVA 1PLJA 4CIDA 3AGPA 3HWSA 3K9NA 5DH9A 5B58C 1SVIA 3TR0A 4BLPA 5BN3A 3EC1A 2QAGB 1N6KA 2RAPA 5KSOA 2OCAA 3WNCA 1E98A 3U61B 1ZW6A 1GRNA 2ZJ8A 1T8TA 4M4SA 1XFAA 5TB5A 4L4UA 2V9PA 1R5OA 3EAQA 4ZCIA 4IFBA 1K6MA 1V5WA 4Q7MB 5FUYA 1U99A 4PTLA 2PL3A 3CW2A 4JT2A 1XX6A 1T5LA 3TH5A 2ANBA 1FP6A 2EQBA 2HCJB 2OV2A 2ZEJA 2BKEA 4A2PA 4A1FA 2SHKA 5IHPA 3OEHA 421PA 4B76A 2GCOB 3P32A 2BHRA 1Z6YA 4M9SA 4C0QC 1KOFA 4KSBA 2GCNA 221PA 3GLFA 4M1OA 2J0SA 5FUXA 1BYUA 3AP3A 1OFUX 1P73A 1Q21A 3KJHA 3VQTA 4Q03A 4DSUA 1UJ2A 1M7BA 1M74A 3BB1A 4LHXA 3BE4A 2OXRA 3VNVA 2YYZA 2GZHA 5FOVA 3PEYA 1XJ0A 1NN3A 3GFPA 4R71A 4Q19A 2H16A 4YMVA 1W5TA 2QI9C 1NI3A 2FMXA 4A36A 4GMDA 4A2QA 2CK3D 2ZE7A 2P5TB 4LBYA 1JAHA 1W48A 2IUSA 5FOUA 1NLYA 5FI1B 3VKWA 3TW4A 4LK2A 1GNRA 3BB3A 4ZCMA 2QQEA 5TVKA 1P9WA 2DR3A 3BORA 4PPGA 5EXTA 1U8ZA 5J5CA 3UPUA 2CLSA 2ODBA 1J8YF 3AH8A 4HLUA 2NO1A 3NVAA 3CPEA 2FZ4A 3IKJA 5EQTA 1XTQA 4DCVA 4UXHA 1X8LA 1RC8A 4Z8XA 1KSHA 1A2BA 1QRAA 2XOKA 4GFDA 1XTJA 1JEEA 1G8GA 1XMVA 2Z0MA 5E3HA 3I73A 1W36B 8OHMA 2OE2A 5FBWB 4BFUA 1TPZA 3TW8B 1KHTA 4Z8YA 4NYIR 2GEUA 4QBGB 1N6IA 1OW3B 2OCYC 4CRWB 4D0NA 2EFDB 2QENA 3REFA 2AX4A 3GJ0A 1ZIPA 4M2LA 3AF1A 4L5BA 3EARA 4P33A 4YMUA 5DIFA 2J9RA 4MRSA 1WRBA 4OK3A 2CVFA 2IF2A 1XXHE 4MDEA 4XH9B 2CLCX 4GSYA 1R2QA 1UBCA 2G6BA 3QNUA 1EFRD 3MG9A 1N3BA 1C1YA 4V0KA 2QTHA 4D80A 1OXSC 4M8NE 1T6NA 1E94E 1SZPA 1KSFX 4PC2A 5L3VA 2DWPA 2J7PA 1OV4A 4TMTA 1WB9A 1W2GA 2OLKA 3RS7A 4NL4H 2OZEA 2ZE8A 5FUVA 5KU1A 2W83A 2ZRAA 2ZVQX 2BEJA 2BVNA 4GZMA 1T91A 4C0BA 5B64A 2HT6A 5AUOB 2PBRA 3HR8A 4G3XA 2ORWA 2HF8A 3R9XA 2QGZA 1J99A 3MD0A 4RD0A 3VR6A 4F92B 2ZTSA 5J47A 3AUXA 2ZREA 1FMLA 3PJRA 5CLLA 2IX3A 4DCSA 1S8FA 5J40A 4AK9A 4D0GA 3L8YA 4GOXA 4RFVA 4XTRA 2Z43A 2QPOA 5LBIA 1XEWY 1M8PA 1OB5A 5CK5A 1KMHB 1NMYA 3VFDA 5E95A 2ZYTX 5HPYB 4QFMA 4DUGA 5K8LA 2GK7A 1EXMA 4JLBA 4Q4JB 3SJBA 1KO4A 1N6PA 1CP2A 2ORVA 5FBLB 3RRMA 4QM7A 2ODEA 1AK2A 1UEIA 4G5RA 2JA1A 5DISB 2C5LA 3DEFA 3GEEA 5FOXA 1W4CA 1NIPA 4YMWA 5FOSA 2QTVB 2BWJA 2ZRNA 1WCV1 2VQSA 3LWNA 4PANA 3X1WA 2JGNA 4M1MA 1Z0FA 4UQOA 2Z5FA 3ZZTA 4LCBA 3T1VA 4JVNA 2HCBA 1ZINA 2FA9A 5HKKA 5CIWA 2G0NA 1TEVA 2OCPA 2PH1A 3FMOB 2WJJA 2OESA 1UEJA 1NY5A 2BBWA 2WJVA 1LF0A 1PVOA 3KX2A 2QP9X 4EPRA 1IQPA 3IBYA 4O2RA 3A1VA 2OLJA 5EUQB 2QL6A 2QSZA 3QPWA 2A5JA 1Z6XA 4QNMA 4RY2A 3ADDA 3TQCA 4M1SA 1NBMD 2NZJA 1DS6A 2X2FA 2YVUA 3DOEA 3SC3A 3QPUA 3C5HA 1TNDA 3MAAC 1U98A 2OFXA 1G19A 4C3ZA 4GP6A 3MFYA 1P6XA 5FPYA 3AP1A 1Q1QA 2ZYWX 4Q4JA 4GZLA 3BD9A 1OFTA 1PLLA 5IRCD 5H70A 2R6FA 1IAQA 2WOJA 5DNYB 4G0NA 1NL3A 4B3BA 1IN7A 5E7JA 3C5CA 5HTKA 1L7VC 4DDTA 4JIMA 2H8KA 3FVQA 3SDZA 4LYHA 4NPHA 4DC9A 5LPNA 3D8BA 3GLGE 4JKYA 3I1FA 4Q48A 2FDCA 3IIMA 2IT1A 4DKXA 1HH4A 1KJYA 2Q6TA 4KVAA 4Q1CA 1QVRA 4NCKA 4A6XA 1KDPA 5DN6A 2P2LA 1X8JA 4M53A 3C16C 2IYZA 1Q1ZA 2F43B 4RCZA 4BWYA 2NMVA 1KI1A 2GJAA 1G7TA 2YV5A 3EWAA 5EXPA 1IM2A 1TU3A 4DLXA 1UKYA 4A2WA 1QHHB 2B7CA 4MKFA 2VSOA 5C2JB 4O0MA 4ZIRA 5DHFA 2FNAA 2IYVA 4TT3A 1XP8A 3DHWC 4IEEA 2JDIA 2Q3FA 5LB2A 3FTQA 5AJZA 5JEEA 4LUCA 2AD5A 2FSIA 2ZRFA 1VG9B 2ZR0A 1ZM2A 1WXQA 2H5EA 3AQ4A 3ZVMA 3QUSA 2PJRA 4Q66C 3CB4A 3TSOA 1KO1A 2CL7X 2C99A 2H18A 4PPQA 2G88A 2FGJA 2GJ8A 1JR3D 3K9HA 1XEXB 1FTNA 1R0XA 3NIBA 4CEHB 4GBMA 4OYHA 1VG8A 1JR6A 4R2IA 3KTAB 1G21E 1YE8A 2WBLC 1HEIA 1E2PA 821PA 1ZRHA 3MSXA 4NH0A 5TY0A 1AQYA 1G5PA 2DYKA 5BN4A 4LPSA 2ZRHA 2CHGA 5KDOA 3THYB 4MKIA 5FTNA 2QPAA 2B7BA 1E79D 1GUAA 4G5QA 5CB6A 2CL6X 1N5IA 5HCIA 3NBXX 3VR4A 2B8WA 5EZ6B 1S4QA 3T5DA 1AN0A 3FMPB 3GLIB 4G5OA 4V0NA 1E1QD 4D81A 1DE0A 3AVOA 3NTUA 4PSAA 3AVTA 4A82A 2WJGA 4JS0A 2EW1A 2Z6VA 3BS4A 1G6OA 3V00A 2RMKA 2J5XA 3OESA 3E70C 2JIZD 4HAWA 3KKNA 1NJGA 4Q4AB 1VCNA 1AS3A 3C14C 4NMMA 3ZD7A 1Z47A 2P67A 1SXJC 1W4AA 3LW8A 2IXEA 3TAHA 2XZOA 4JVLA 4OHWA 3ECCA 2DB3A 1R7RA 1SVMA 4XTCS 2IEYA 2GZDA 2FU5C 3LY5A 4QOSA 1KO5A 2QAJA 2RGGA 4LHZA 2AL7A 4CEHA 3AVXA 4NYMQ 5CDFA 3KTAA 1JAIA 4PO9A 5CK4A 1S1MA 4CW7A 5JRJA 1DEKA 1Z6GA 4C2TA 2JJ1A 2CCKA 4JJKA 4KO8A 3THYA 1H8HA 3CRRA 3TBKA 2FPLA 1L8QA 3TAUA 4E07A 3CR8A 4B6FA 2LWIA 4R2HA 5AJXA 1Z83A 2NTYC 2PLFA 2ZSFA 3QE0A 3A37A 3SHFA 4HAUA 1MABB 1Q3TA 4Q1EA 2CE7A 4DB4A 2WPDD 1RE0A 3GLIA 1G3RA 3JZAA 1IN4A 2P6NA 3K09C 3UXMA 4D26A 4EJSC 2HJVA 2IBMA 1KAGA 5KNBA 4II7A 1A82A 2B8TA 3O47A 4KAXA 2Q3HA 1E32A 2IXGA 3EASA 5EE9A 3T12A 5JJIA 2ZSAA 1TQ6A 3SZRA 2O8CA 2AD1A 1ZP6A 1M34E 2ZRMA 3WRXC 3Q5DA 3TSWA 5A5GA 1W1WA 3PIRA 2BOVA 2HUPA 4M22A 4LHYA 3O8CA 2ZQ5A 2CMKA 3H86A 3QBTA 4FINA 4CT4B 5DO9A 3BIFA 1I4LD 3T1QA 1RRFA 4DEYA 2J0QA 4ESVA 3B1YA 2PCJA 1GL6A 2JJ8A 1KKLA 3PVSA 2PEYA 4F38A 3OIYA 4HB2A 4OKSA 4TMXA 4CF7A 2ZS7A 1GNQA 3AKEA 2KBFA 5G41A 3U3OA 4C0KA 1GVNB 1LY1A 4KSCA 3WY9A 4FCVA 1Q3HA 2KJQA 4LYAA 5FTJA 1SVWA 1NKTA 4F93B 2RCNA 4L9SA 4OHYA 2R2AA 3K0CC 2JLVA 3L0OA 3RS0A 4DDWA 1XD2B 4TTQA 2RGEA 1W2HA 4PC7A 2QU8A 3A58B 5G3YA 4JZKA 1UBGA 4M1WA 2N1BA 3RRZA 1GKYA 3MGCA 4KVGA 4YQFA 1CJKC 4TWZA 3HJNA 4DWJA 4LJ9A 2CHVA 3WP1B 4WAUA 3QEJA 4B3XA 1G8YA 1M2OB 3ZIAA 2FPKA 5EP2A 3Q7PA 1KI7A 2ZJ2A 3E5HA 1KAOA 1NBME 3FOZA 5CM8B 5IF9A 1MR3F 3BGWA 3U44A 5L3SA 4MUBA 3NEYA 4IDPA 4KFTA 4PSVA 2VHCA 2CBZA 4M9ZA 4XIGS 4K46A 4Q9JA 2XGJA 2JASA 5KPDA 1OB2A 3AVVA 1QBKC 3TR5A 3ICQB 1KIMA 2QP3A 2NOAA 3TMKA 3SEAA 1S0UA 4YONB 4AYWA 4LJ8A 2AFIE 1HY3A 1GNPA 1XU4A 2OBMA 3RDPA 4M1YA 3U7HB 1XD2A 4PXAA 1DARA 3KJEA 1IXRC 4LX0A 4U00A 1E2QA 3SOPA 1MOZA 4BQSA 2GXSA 1G4UR 4A15A 2GEDA 2BJVA 3CBQA 3Q8XB 4Q47A 4QM6A 2IL1A 2XJ4A 3A4LA 3MRSA 4BEJA 2IXFA 3AF0A 2QP4A 1J7KA 1NF3A 2IYXA 4LC1A 5CIQA 2XSZA 2F7SA 3LBIA 3I61A 4C9BA 2O8EB 3GEIA 4HB3A 3IUYA 3GFTA 4DEXA 1HYQA 1W0KD 4QGGA 1K5DA 2DFNA 1NKSA 1EFUA 3IGFA 1RVDA 3MCAA 4FW9A 5EJEA 3RC8A 3QSYA 1TMKA 4C7OA 5M04A 1U2RA 4TTPA 1MV5A 4HAZA 1L4UA 2QG6A 2XITA 4ASUA 1MO5A 4Q18A 1PV4A 3F8TA 4ESHA 3AGQA 3G5UA 4XD7A 3LXXA 5GJWC 4OL0A 1T3HA 2XB2A 1QHXA 4O2LA 3WYAA 3R7WA 2G1JA 3DO6A 2Q9BA 2C04A 4IDOA 3A1TA 4UNNA 1P60A 3F5FA 1H65A 1UF9A 2KB0A 1JR3E 4QC2A 4RFSB 1F3OA 1N6RA 2OG2A 3IEVA 5J4KA 3LA6A 2QBYA 3OFND 1U8AA 3RSOA 4LJ7A 3KKOA 3VX3A 3M1IA 3QKSA 1U0JA 4XSGA 4CEIB 3LLUA 1FW6A 2REOA 1E2HA 5BQ5A 2BMEA 4DLTA 1OYYA 4PZYA 4B2IA 2B92A 3TGPA 4D6PA 2KE5A 2R6AA 4NTZA 3ZVNA 3QKTA 1UM8A 3ASYA 4FWIB 4BFSA 621PA 1X1SA 2IYUA 4LBZA 2QNRA 5CLQA 1JJ7A 3T35A 3VNUA 3H2YA 2WWGA 4DRZA 2O8EA 1NG9A 1Z0DA 1C4OA 3MUFA 5JCZA 1HE1C 4BLRA 1V43A 3F0TA 4Q9LA 4OBEA 2BMJA 4LYFA 1KI4A 4HUQA 5EE1A 1TEXA 2HXSA 1E9DA 5DI9A 2JLYA 3PXGA 2G9NA 4DSNA 2GKSA 2OT3B 5A4JA 4P3YA 2O8BA 1KZ7B 3FFAA 3QEOA 1I4TD 2BC9A 3VAAA 1ZM9A 4ARZB 4D0LB 2O8DA 2D7CA 4P4UA 2EYQA 3VR2A 3X1ZA 3WP0A 3LVQE 5KDLA 1T8UA 4IOKA 1RW4A 2IHBA 1XTKA 5EUMA 5JJLA 2ZUCA 2ONKA 1QHYA 2VP4A 1OHHA 3VHLB 4RCYA 4YXWA 5JCPA 1AGRA 1CS4C 4S2EA 5KDDA 3CNOA 1GRRA 4HDOB 3MWLA 1LV7A 1KK1A 1DO0A 3PEVA 4TSFD 3ZQJA 3B2EA 1RZ3A 4LV6A 5F9HA 1Z5ZA 4TTRA 1QHSA 4ZDJA 1GDDA 2PT7A 2UZ3A 1RYFA 2WJYA 2R8RA 3L2OB 3FHOA 4EJSA 1YJ5A 4IDHA 3NH6A 3EZFA 4UNRA 1KYIA 3U2QA 5JHHB 4V0ME 2F3TA 2RGAA 3Q3JB 1QG2A 2EVWX 1KKMA 1OT3A 3QVUA 1CEEA 1P9RA 3K70D 1HT1E 1YR6A 3HP1A 1MO3A 4D82A 3UMSA 4PHGA 3IQXA 3SBEA 1ZUIA 2CNWA 2PLRA 3CX8A 3CNNA 1NJFA 1RKBA 1COWA 2KSQA 5JI3E 1P61B 2NPFA 1ZAKA 3CONA 2JLZA 1SHKA 2W2TA 2JJ2D 2QM8A 3FKQA 2XEXA 3DZ8A 2J7PD 2R9VA 3OHMA 1NG1A 1XZPA 1G20E 2PEZA 3DPUA 1D9ZA 3D31A 4IFEA 3NEJA 1F5NA 4EQ6B 1E9CA 4MITA 5GJVC 2BBTA 4MYUA 1R5BA 4FCWA 2GXAA 4U5XA 1XZQA 1F60A 1OH6A 5D3MA 2J45A 1VKJA 1KSGA 3EZ6A 5FL7A 4MGYR 1W0JD 4UNSA 3K0CA 3BRWD 5HE9A 2AK3A 2AFHE 3QKRA 4CYMA 1CXZA 3GD7A 2A5DA 3IDQA 4FXPA 4F4IA 3PUWA 4TQAA 4US2R 5C1BA 4CGZA 1A1VA 2WAXA 2WWFA 1W4RA 4X8MA 5FL3A 2VLIA 2IYSA 2FEOA 1XXHA 3ZQ6A 2ZVPX 5F98A 3FMIA 1AQUA 4OJKA 1Z3IX 4ZI3A 3AKYA 2J3EA 3PEWA 4JLMA 4B3FX 4JLNA 5KO2A 2WMOB 2BM1A 1MH1A 2YOHA 3TE6A 4TN1A 4B71A 4US1R 4NYJQ 1FX0B 3PG5A 2X77A 4TL7A 4JLVA 4HAXA 3HYRA 3OEEA 121PA 1ZBDA 2F9MA 3FMFA 1ONBA 2JEOA 3DM5A 2NG1A 3B1VA 1G17A 3ZS9A 4BFYA 1S2MA 2VHQA 1O87A 2ZRKA 1DVRA 2WM9B 4UJ3A 4B47A 3Q7QA 4BFVA 1ZNZA 3K8YA 3LAWA 2VSFA 1XMJA 1GZSA 4M0LA 1HA3A 5L3QB 3KXLA 5KUTA 3EC2A 1E9SA 4QGAA 3P4YA 1DAEA 2J7KA 3ADBA 4QRHA 1Z63A 1YU9A 1GKUB 5JFGA 3Q9LA 4LJAA 4FI3C 2R6GA 3S1AB 2HLDA 2QAGA 4PPNA 1Z08A 3W3AA 3RABA 5JRZA 2GNOA 4BLOA 3FKSD 3WYFA 3HU2A 4B48A 1E0JA 1SVSA 1Z29A 1QF9A 4QG7A 3SJZA 1E2DA 3EX7C 3TSZA 4B34A 1HQYE 2YKGA 1CRQA 3RWOA 1ZD1A 3CUEF 1XJQA 3EZ7A 1NN0A 4M1TA 2W6JA 3A8TA 1TQDA 2E87A 1NNEA 1NVUQ 3GLGB 4Q1DA 2BBOA 4Q7KA 5JZVA
chains in the Genus database with same CATH superfamily
1VIAA 1XPOA 4H4CA 3U39A 1QAOA 3F73A 3DZJA 3LCUA 1CJVC 3SQWA 1EJBA 4MMZB 3C48A 4PAOA 3RC7A 1CZUA 3LX8A 3ZBUA 3HSYA 1CJUC 4I6EA 1GG8A 4DG5A 4XVUA 1K9VF 2ACVA 3CISA 3IB6A 4KDEA 5CT6A 4IHJB 4UBIA 3OIVA 1MVOA 5ED4A 3KKLA 5LMZA 3Q3VA 3CVUA 1P7YA 3F71A 2GNPA 2PXHA 3STUA 4P32A 4DDVA 4COKA 1GU0A 3OPNA 3AZPA 3FCUB 3GCGA 5A9TA 5L3QA 1RKXA 1CZKA 1EM8A 1KF0A 3V7YA 1GD1O 4AJ4A 3LWBA 2COUA 1LX7A 1MJGA 3G0HA 1VLJA 3EGEA 4J2HA 5HE8A 4H31A 3S2IA 3TUJC 3K0SA 3LYUA 2ZI5A 4BO5A 2ZJYA 4Z1MA 2V6IA 3PYXA 4X7MA 4WLFA 2O7RA 3JWHA 1JEAA 4BX3A 3RTBA 2OCLA 4LWQA 3W4KA 5BNFA 1OR8A 3DKPA 4LJ6A 1FZQA 2C88A 5JQGB 5TLSA 4CQLA 3CRNA 1YV9A 2G71A 3D54D 3T9FA 5LP6C 1BD4A 1RQPA 2LZ0A 1TLTA 4DWOA 1QM5A 1SUWA 2PUVA 4HI0E 4PHFA 5LA6B 3JAMA 3HVIA 3TW8A 3H8VA 3CXRA 3GMSA 3QKUA 4PPFA 4F2HA 1QQTA 1R6AA 5E9WA 1CRWG 1KQFA 2BEVB 2TYSB 2IUUA 3ORHA 1T26A 2ZBGA 4RQAA 1FMTA 1TMYA 1U8CB 2GM5A 4OJNA 3GNQA 3Q15C 1U2QA 2W22A 3VHXA 4MVJG 5F7XA 1J24A 4Q9NA 1QH8A 1U9CA 1Y82A 2J08A 4X44A 4XCXA 5GIOE 1GKKA 5A02A 3EPHA 2F3UA 1B00A 2AYXA 1IBCA 1VKNA 1ZYUA 2P27A 1YAHA 1LDYA 5G53C 3IAFA 4W5RA 2XQVA 4R9UC 3W90A 2UUPA 1JQLB 1TF5A 2JKYA 5EJ6A 3PUKA 4OHMA 1D2EA 1L6RA 1II9A 2OY0A 2QL9A 2RGNC 3IAEA 3PWTA 4RPIA 5IBCA 3F4BA 1AS0A 4BPBA 5DBFA 1TO1E 5BNZA 1O77A 2ATXA 4RH0A 3G2NA 3R4VA 4GKVA 5I5EA 1QU3A 2FAXA 3ZYCA 2R65A 5CYGA 5C5DA 4YRFA 4N5LA 3VZRA 1BKYA 1FNNA 4FGSA 4P3NA 3QKIA 4FYPA 4G1EB 2BE7A 1Y1TA 2HBQA 3CUTA 4R0NA 3WKBA 5K8CA 6Q21A 4G1UC 1SZCA 4ON9A 1HYEA 3PFGA 2ZJAA 3PQCA 5BWMA 3TD6A 3TEFA 1AKTA 2GGSA 2C9CA 5CVTA 3ORFA 5TEWA 1VLLA 4BO0A 1J8DA 1B8NA 4BQIA 5LXTA 5JTUA 3ZCQA 3ZEAA 2P2YA 2ZW9A 4B7AA 5DWQA 4JJ4A 3QI2A 4H7IA 4IXTA 4Q3CA 4UEJA 4TYPA 2G6TA 3WMGA 3CVVA 3VI3B 5KOIA 2LCFA 5HZHA 1IZYA 4HNVA 1MENA 1LWNA 2DWQA 5KREA 2R48A 2VH1A 3LC0A 4RACA 3B8HA 2AXNA 1Z4JA 4L50A 2GBLC 4UAVA 4AROA 4KODA 8MHTA 5ARBA 1KEEA 1SC3A 3GV0A 1R64A 5KCZA 3GJ8A 1W25A 2Q3JA 3A6LA 1NJ8A 2IVZA 2C8LA 1ZL0A 3EZXA 4JU9A 5FQNA 5EHNA 5IUJC 5L51A 2JLQA 2VFAA 2XOEA 1HDIA 3HACA 3JRNA 3R7FA 2QTVA 3PDJA 2R11A 4KR3A 1N2CB 5FUMA 4PBSA 1XFDA 5BVHA 3H9UA 2PANA 4YAGA 1FNSA 3CJTA 4MAMA 5HMMA 4QJ5A 1RBMA 4UUQA 4ACBA 2IS4A 2V97A 1LRLA 3W4JA 3IS3A 5T41A 4QDXA 4XXHA 5CFNA 1A95A 3RARA 1Y4ZA 4RKRA 4XGKA 5TQ0A 1ES9A 3TW0A 3WIVA 3ZDQA 4GNKA 1CY1A 3LJKA 4K6KA 4AY5A 3KAQA 4MLDA 4J0GA 4R1PA 5KU7A 2CZCA 1YQUA 3GRCA 3KLMX 3KXKA 2GA9A 4XI9A 4F5YA 3F49S 3UMJA 5GGXA 3R6DA 3R3HA 2FSVC 2CT8A 2WABA 4FFNA 1AA6A 4F4JA 3P0FA 2BZ1A 2PH5A 4IDNA 3UATA 4D0SA 3U81A 4MYHA 2BHTA 4YJ2A 1NNLA 2VOEA 3HJAA 4M9QA 5DT9A 3M9WA 4HZGA 1LDBA 4MQEA 4RX1A 5CVJA 4S1VA 3ER9A 3ON5A 2GM4A 1EHIA 3V46A 3A3PA 3O1IC 2J32A 2KWIA 3C4QA 4LDZA 5DGXA 2HADA 3DHYA 1Q0UA 1DEHA 2IELA 3GRRA 1AMNA 3T6KA 4JROA 1HLFA 2Y1FA 4B82A 4B6SA 4TWAA 4F9GA 2XZTA 4RJTA 4I50B 2XZLA 5B12A 5JSHA 1Y3IA 2ETVA 2GT1A 4E5UA 1E3MA 3EQ9A 1B16A 3KYCA 4U00A 2GBFA 2HSJA 3TKLA 4DVJA 1V71A 5EPOA 1K7SN 4X66B 1TK9A 3LUFA 3MEQA 3U60B 1ESMA 3HWWA 5JRDS 4EHLA 4AD8A 3OP4A 3Q7RA 3A05A 4JITA 2NZXA 4Y2PA 1OWOA 4LVCA 2NWQA 1U7WA 1M34A 3AUKA 2PGIA 1Y5RA 1XE3A 1Z6QA 4GQBA 3P9KA 4NDZA 1EGQA 1GAWA 1NPYA 3UPTA 4DJDC 3CVJA 3F5DA 2DJ5A 3ZE9A 3ZIAD 4C1BA 6ADHA 4N76A 1K5HA 4Q4HA 5CT9A 1XL0A 4CKEA 3DF7A 5ICGA 2WTEA 1VCOA 2DEUA 1YFLA 1J90A 1VTKA 2BEWA 5CLHA 3RJ9A 5D1NA 1JI3A 1LK0A 2XRFA 2ZM6B 5JH7B 1MF7A 5TMPA 3HV0A 1UXIA 1E9EA 4XDHA 3ZXYA 1E69A 4X8HA 3RBAA 3UUFA 1SJ9A 2OQIA 3W05A 3ULKA 4ZPXA 5CITA 2NSYA 4CHGA 5L6LB 2NX2A 1VBKA 1RRKA 2AG0A 3OIGA 2AFIB 1TYEB 1I0ZA 4O0LA 3RVBA 1AIPA 4LXTA 4B09A 3O1JC 1A0OA 1GZVA 4AMZA 5JS1A 1DTWA 1W52X 1U02A 1S2LA 3EEFA 1NVXQ 2WICA 2IWRA 1XRRA 3KJFA 2UVPA 1D0IA 3AIIA 1GV1A 1XCBA 2OBLA 5JWRA 1HTTA 1T9ZA 2QRGA 3FJ1A 4GP7A 4MQUA 3H65A 2PGJA 5IW8A 1PFQA 1U9IA 2YMMA 5I01A 1Y6QA 2CFCA 4EI7A 4YT2A 4L1KA 1X0VA 4CLRB 1R0LA 2N9UA 3PJGA 2Y1LA 5HF6A 1P77A 4QO8A 1BFDA 1PEDA 3G2HA 4DRXA 1WUIS 2HGZA 4WESB 5KJEA 2VNHA 5BSUA 1XMQB 4YO8A 4K9LA 5ALYA 4GI7A 1P1HA 4TZ6A 4JQOA 3RVRA 3WX0A 4IOLA 5I7UA 3SG0A 1F6BA 1KFCB 3DZKA 4GLBA 5GQSA 3A11A 3PPYA 1YCHA 2A94A 4ZDWA 3KDAA 4RIFA 4AW9A 3ES9A 1WWKA 2DPLA 4WCFA 3KT8A 3KTFA 4AS1A 4CMEA 2DSNA 3DTTA 2X8JA 2AJ8A 2Y0PA 2W4MA 4L9AA 3CF6R 3W79A 1U2PA 2Q0XA 5TARA 2VTDA 2A7QA 4I7EA 1F2TB 4Q4AA 1F9EA 3D81A 1PUJA 4AZ3A 4JXXA 2Q5QA 4PCLA 4CR7A 4EOGA 4XYBA 1JWBB 2PBLA 4ER3A 3U7RA 1UKEA 4FFOA 3H2IA 1TZKA 5H3HA 2WWIA 2YXEA 4MW1A 3DO8A 3AR9A 4KE8A 4KIUA 3DUFA 3S2SA 5HR5A 4IVRA 1QP7A 2ZWMA 3RRYA 1O8CA 3HKCA 2RHLA 4HK4A 3LXRA 3RGWS 4H1WA 5IMBA 3TTVA 3BIWA 2DFDA 1BMFD 2ANCA 1XWIA 2ID9A 1K6IA 3IQEA 3PNYA 1VPDA 4FTWA 4WV3A 2QTAA 3EXHA 2VSNA 1ARZA 1DV1A 1UDWA 1UFQA 2I3AA 1CUEA 2ZKIA 2D3TA 3B6JA 4BZWA 1YA6A 1DGQA 2UZIR 3S28A 3GHYA 3HU1A 3PNMA 3WLIA 3WWPA 1TKCA 3ZU6A 1N34B 2VDWB 1AHHA 4Q3LA 4RGQA 3IOBA 4HG2A 3HCAA 1KORA 3EDQA 7AT1A 2A5LA 2JZOA 5C53B 4R5MA 1WAMA 1MLDA 4G9BA 1AUXA 3G6KA 1MIHA 1U28C 4IGKA 4OFXA 3U40A 3UT5B 1DRKA 5ALFA 1U0GA 3M5CA 2O8NA 3E35A 2D1QA 4RHTA 4U7HA 5NLLA 3UMVA 5JBNA 2H7CA 2YY6A 5F2OA 2R2GA 3UENA 1SKMA 3QNMA 5IJ9A 3IPAA 2XCUA 3UOAB 4PR0A 1VYTA 3RKRA 3EH1A 4U3JB 1B0UA 1BWPA 1M7GA 1L1QA 5AP9A 4FLEA 4GGMX 1P0PA 4KXXA 4KBFA 1MAVA 4TRJA 1PRYA 1JPVA 3C3XA 3KDPA 3BIXA 1FFYA 1YZQA 3IV9A 3OOYA 1ST3A 2YXDA 3EVCA 2NYRA 4BE7B 1E9VA 1Z26A 2VDJA 1J2RA 3ONDA 1BEEA 4NOJA 3TRDA 5IJ0A 3LOPA 2WG2A 1NF2A 1XB2A 1Z7GA 1NV9A 3C5WP 3GFGA 3A06A 4MW6A 2C5FA 4R69A 4RNCA 5JADA 1XVLA 4MQFB 2E6UX 2FMTA 1A97A 1P74A 3HBFA 3KL4A 4A10A 5K8TA 2TMKA 3OURA 2PBZA 4FR2A 3C6ZA 1FP7A 4EK9A 3FPBA 4CM5A 1YRAA 2DWUA 2UYGA 3E84A 2IUFA 3R6WA 4JODA 1RHMA 3K31A 4RXTA 1NWHA 2CFSA 3OLYA 1E1QA 1KY5A 1VKRA 1PT8A 2GEFA 4AKIA 4RV9A 4J16A 2FZLA 2C3OA 4HZUB 1EVJA 1VL2A 2YZMA 4I5FA 4RVDA 4OJTA 2XUFA 1GWNA 2IYPA 1WL8A 2CXRA 2QY9A 3F46A 2AN9A 2GDZA 2QXYA 4KMMA 4LKOA 4NE2A 4RADA 3TZBA 3DMPA 2NXWA 1G66A 2WMDA 4FZJA 2Q50A 4L0DA 2JFYA 2WLSA 3QVJA 4MB2A 4XVHA 1GFIA 1SCIA 4BNXA 2XDAA 1K8YB 2HLHA 5LQJA 1O96B 3GMIA 2O2HA 3WDSA 1TT5B 3G0IA 1KOGA 5DASA 1RJGA 2CL0X 3BHIA 4ZQFA 3H5TA 3SBDA 2WP8J 1L8OA 1YXMA 4QE3A 4BWFB 3U4QA 1M2OA 2L17A 2HPHA 1D6JA 3BD6A 1E9FA 3SVTA 2O2IA 3R5KA 2PX2A 2GCGA 5K8UA 2W71A 4H9GA 3PNSA 3ZLJA 3LWZA 3SAJA 4AMGA 1OILA 1C8BA 1QDLB 1R6TA 1VE5A 2GKGA 3DE0X 5F1PA 5JPCA 4KR9A 1AJEA 2XB9A 3LHIA 3LU1A 2AZTA 5LQDA 4BCDA 2M1XA 3K0EA 4R1TA 1J09A 2ZWPA 5E1MA 3S70A 2CLEB 1BKDR 1N8KA 2GZ2A 2RGUA 2WQZA 4V0MA 1FRFS 2LKDA 2VO1A 3CYFA 4QELA 2D1SA 4Y6LA 1PZXA 5EIAA 5G1OA 4PRYA 4NAVA 2VTBB 1ZJJA 3P9PA 1CVLA 4RVHA 2Z2IA 5D8DA 1AKNA 1GTRA 2ZJFA 3EOBI 4IUDS 3OMWA 1ODJA 2A5FA 3Q0TA 2I6XA 1MC4A 4L8GA 2HK6A 1Z18A 2FPPA 4X1YA 3VC1A 4OAOA 3ZVLA 4ZV4A 4B3GA 2FW9A 5AVKA 10MHA 5IARA 1EK0A 1II8A 1J0AA 5JS7A 1CFJA 2VP6A 3IUBA 3RS5A 1ZC3A 4LDQA 3ZWNA 2RHWA 4HT3B 3FZYA 4INJA 3KL2A 1NOKA 2I3GA 3VMMA 2ZAOA 3ETEA 5ITWA 1J9EA 2GBGA 4NU8X 1YR9A 3ABZA 3BZBA 4QYIB 2J0EA 1D2RA 3K0KA 4WZAA 3RRNA 3U3RA 4J1SA 4EFMA 1E2KA 2Q7DA 4BN0A 5KOJB 1S4MA 4QRDA 1M67A 4FQ5A 2IITA 3AEZA 4Q9HA 1IJKA 1HXHA 2C95A 2HMWA 1X1BA 2BHLA 4YP5A 5EOVA 5BV0A 3OIUA 2PSFA 4YALA 3TTUA 2HSEA 3RJTA 4A8JA 3CW9A 3KEOA 1LZKA 2J46A 3ZNPA 3PFWO 4FBGA 4D02A 2Q1SA 1C9JA 3DO5A 2YWGA 4PZZA 3WWZA 4CLDA 3AT1A 1W36C 2VJLA 1C14A 4E4YA 1A5SB 2V0CA 1LI4A 5EY5B 4EF5A 1UMBB 4ACAA 1FDOA 1X7WB 4JLPA 2PWBA 4E46A 1NQVA 5JEDA 4GWKA 1NTRA 2HSGA 3WFIA 5TMBA 2D0DA 1CG6A 1JQEA 1SWVA 2GTHA 3DL0A 4B40A 3AQIA 1ZGAA 2GILA 4ZC1A 1R4ZA 2A3RA 4A0RA 2XCSB 1ZDMA 3KYIB 3C3MA 2XPCA 3HUUA 3WLAA 3IPXA 1RHKA 3TQTA 1Y8QB 4CEIA 1D2HA 1BXGA 1TCVA 1PWXA 1V1RA 2B2NA 3NAGA 4RLQA 2YINC 5CD9A 1OA1A 4GH5A 4JP8A 1OE0A 1TUIA 4K0RA 1MO2A 1LPPA 2WD7B 3ZKWA 4AYTA 4J0QA 1SK8A 3T7DA 2ILTA 3TLCA 3EVBA 2CGEA 1M6VB 1MKYA 1TA4A 2C1ZA 4EHFA 2XNDD 4O2BB 3NATA 2UZ4A 4YS6A 2DH5A 1CVRA 2RHDA 4O4HF 3IHWA 3C2QA 1JLHA 3G0OA 3IP8A 5I7EA 4EABA 2HA3A 4WOCA 1ZN7A 1YR7A 2EHJA 4G1VA 4YDSA 8AT1A 5K0SA 2WTBA 2W2NA 4Q7LA 2F1OA 3BM5A 4KFCA 1C3OA 2ORIA 1NVWQ 4G2TA 4WZBB 4A0SA 1AUPA 1IIRA 3ZJUA 4NZOA 1R9MA 2B30A 4X92A 1AKYA 3JYPA 3QVKA 4NCHA 2RD2A 4CGZA 4EY5A 2CJFA 4UOEA 2OAGA 5KWVA 3EW7A 4UEOA 2E37A 4ARZA 1EFTA 4R01A 3W5UA 2YNMA 3NEAA 1C9DB 3T5TA 3WYGA 1S7CA 4CHTA 4P0PB 1DSSG 3HABA 2I5PO 3FDXA 1NYRA 3FVRA 1A7KA 1BVRA 3WVNA 2CWWA 2EKQA 1RM3A 3L82B 5LSAA 2REXB 3H19A 2NV2B 1GSHA 4UKDA 1JPJA 5CW2A 2PUGA 3IEMA 1GA4A 2OO3A 4L76A 2Q07A 1JIJA 1PGQA 3B9RA 3WJ1A 2YS6A 3KUCA 4PHHA 1NWCA 3ZDZB 5JYEA 1ZC4A 3A2NA 1G59A 1SUAA 3FCCA 1DAIA 4N8SA 2OFFA 2DETA 2QUAA 3HCEA 4RY9A 1HFEL 4PG6A 3CH4B 3KU4A 5DXJA 3UYLA 1QORA 3G0GA 1ZZGA 4LXGA 4PICA 5SZJA 5JXIA 3BH0A 5H59A 5KX5F 1KC3A 2FW0A 3STYA 4YIHA 2P4EA 2X7XA 3UWKA 1BO6A 2GPBA 3FGNA 5EIBC 4DUGD 5ADHA 4OF4A 2IP1A 2JIDA 4BMCA 1PKEA 5EXDA 2EKLA 2VF5X 3ROTA 1I9GA 1HR0B 1G6KA 2PFKA 3LKDA 3RR2A 3T7AA 4E5VA 2JKVA 2HLPA 2DFLA 3FOBA 4R8KA 4ZARA 3SY8A 5AUPB 4RJKA 6YASA 3EXAA 1MAHA 4ILEA 4XVRA 3DZCA 3WJ7A 3W5JA 4DQKA 2GA8A 4WNAA 4IGIA 1RLIA 3H5NA 1RT9A 4J6FA 4MRPA 5BW4A 1AGNA 1MZVA 2C2KA 4BVGA 1TMOA 1TTTA 1F2DA 4W7HA 5I45A 1ISHA 2CNDA 3L46A 4TYYA 3QLTA 3KVRA 3C1OA 1U2DA 1Z45A 4XPZA 4IJMA 3AB8A 3BJZA 4KG7A 2R8EA 1I94B 2A9KA 3FBTA 2EX1A 4G07A 1FNCA 3EMBA 3ZCPA 4C20A 4I5GA 3PZRA 2PD4A 5F4ZA 3PEWA 1GTJ1 5EKTA 5I5GA 1KJZA 4B33A 1UBFA 4GBGA 1ZEJA 3PDCA 1V1JA 2QTCA 2P69A 4GU5A 4OUDA 4JBXA 5LUAA 4O4LB 3L0IB 4EGQA 2FSSA 2OZLB 3VJMA 4DMHA 1WDLA 2RHBA 4RMJA 4CNBA 4NICA 5TPWB 4ZT7A 3OJFA 4HD8A 5CPBA 3T61A 1K8RA 3EEYA 3F7NA 5BSEA 2PKXA 4Y2GA 4DFDA 3K70B 3D4PA 3DGEC 5F1YA 3PU6A 4TLCA 2Z98A 1Y7PA 3BD7A 3LPAA 5BNIA 5LU8A 1ZWLA 2OCIA 4R31A 3T8YA 1CUVA 3DVLA 2NU8A 4CM6A 1Z4QA 3AFGA 2FHSA 2ZB2A 3DYIA 4TLBA 5C7OO 5DOZA 1NLZA 2YOFA 2QLTA 2W98A 1K63A 1ZH4A 2CNNA 4N82A 3RYCA 1KBOA 1QZXA 1L8XA 1C0KA 5FLYA 4U2BA 1DAGA 4LGCA 1PQUA 4RM2A 3EMDA 5CM2Z 3AEQB 5BNTA 3EG9A 3G5MA 2O8FA 3WGHA 1QVAA 1OROA 4ATNA 2ZRIA 4WOKA 1JG6A 1T2NA 3ZHBA 2ADFA 3WICA 4GPIB 1X80B 2CEAA 2FEPA 1G16A 1MX5A 1OLSA 1LTQA 2OZKA 1GKLA 4FD3A 1H6DA 4F5WA 1NF9A 4G26A 3SNHA 2VI5A 3DC2A 1R4MB 5IFLA 4JLOA 2ABWA 1FYFA 2HX1A 4HQNA 3CJRA 1JB1A 2HJRA 1N0VC 3VDMA 2R7AA 3E3AA 4Y0VA 2A57A 2CLOB 1JYFA 2HQRA 2MMGA 1D1QA 1SHTX 1IB0A 2IHJA 1KPGA 1S89A 1PT5A 3BAFA 4U7JA 5CHEA 4XRRA 3U9TA 5IBRA 3KFLA 4Z4EA 3CY6A 3NS7A 4J0DA 4M0KA 4Q7QA 3UH1A 1QG6A 4XLZA 6LDHA 3IR7A 2XVAA 4L02A 1DOAA 4TUYF 1OSNA 3FFXA 4I46A 4LKRA 4RKQA 2LRHA 1G8SA 4TT3D 2D1FA 4BP1A 5EIWA 2JDID 4I55F 1VLQA 4W9NA 1LDMA 1IN6A 1M73E 1XD8A 3ANLA 1ML4A 3OMLA 2GFQA 4L8YA 1YJCA 1E99A 2WD9A 3FE2A 3RF7A 5AVTA 4AZVA 2H8GA 3IE1A 3WOVA 1YVUA 5TRTA 3CLKA 1GTZA 2Q2WA 2Q4TA 3GRPA 3O73A 1M7HA 1V9CA 1U0NA 3MS4A 4MWBA 2OO5C 1SRQA 5BT9A 2ZIZA 5AJWA 4YYZA 4H6VA 4I66A 5AM0A 4ABYA 1T8PA 2FCAA 4MP3A 1E7RA 3ZWWA 3F5MA 3DAOA 5ECYA 2B2XA 4AG3A 1O95A 1CS0B 2XAUA 3V9AA 2CCGA 4G1FA 4A5SA 4E30A 4YCJA 5CCEA 1NUHA 3QU2A 4RH3A 1GU7A 1GFZA 2FW7A 3WYCA 2KLHA 3AR6A 5C7IO 1US8A 2YZNA 2VTEA 1ACMA 3KKMA 3VR4D 4JFRA 2BCJQ 2P41A 5LOVA 1UK8A 2JL1A 2ZE5A 4XM2A 1Q14A 4IZOA 1DKPA 4J0EA 3OY7A 5DEIA 4LPKA 3NJ8A 3DMDA 1W0JA 3IEUA 1BVHA 2NXNA 4EW3A 4GPTA 1PNOA 1ESNA 4JD5A 3ZDFA 4YAEA 4DCCA 3TTSA 1XCGB 2MT9A 1IYZA 2GH1A 2FFQA 2WYHA 5DLYA 4OBXA 3TOZA 3TL2A 1FJHA 4B46A 4ZYXA 3VYWA 4P7FA 3GUZA 3HXTA 1OC4A 1X3SA 1NDUA 1GPKA 3GT7A 3I2GA 4OGFA 4RZXA 1TCBA 2SKDA 3ZBTA 5H9WA 5GONB 1PR3A 3JSXA 3JZIA 2EJBA 3SXPA 3T15A 5BYKA 1RHUA 3HCFA 2ZJ1A 2BIFA 4MCAA 4K9KA 2OK8A 3BGOS 2BFBA 5E9AA 2IS6A 3EGXA 3WMFA 1X87A 3VSAA 3TSAA 1VRVA 4KRGA 4ETNA 2AHOA 2RI6A 2ZROA 2GBIA 5HA5A 3Q72A 3V4VB 2P9GA 4I1UA 1KDTA 3AJDA 4HQOA 3RYIB 3L7LA 3OT4A 1IU9A 2XOXA 4GPAA 3GA0A 4YNBA 4W5NA 4PO1A 4I14A 4I4NA 1EJ0A 3UW3A 4B43A 3G1WA 3QMVA 4GVPA 2R1TA 3JAKA 3NHAA 2JJ1D 4IDCA 3R09A 3WMRA 4AT1A 5ARCA 1FJGB 1B23P 1JR4A 1THTA 1WJGA 2R7MA 2X5OA 1Y42X 3L6BA 3R3XA 1I1OA 1LSSA 4I1IA 1G8MA 2QUHA 4E33A 4ZO6A 1EUCA 5C3UA 1F7VA 2R0QC 1E60A 3DAHA 3HHEA 5A6SB 2F8SA 2F2TA 4XWYA 2BFNA 1MB3A 5DYGA 1USGA 4EKIA 3D7RA 5ITVA 1D8TA 4QHYA 3R3YA 1P45A 2O0LA 1U3DA 5DTJA 2QR5A 4PGAA 4ZIRB 2ZDGA 1BWSA 2JI9A 3EIQA 4J4TA 2WY2D 4B79A 4FDMA 1L5VA 2C9OA 2R86A 2E9SA 1AKMA 4H3HB 4IIDA 3ONVA 5E6SB 4EPYA 4TMVA 1JG7A 3RIMA 2I4RA 4QKQA 3L8HA 4F85A 5E4JA 5LM3A 4A3SA 2BSAA 3RHFA 1KI2A 1NV8A 1NYLA 1TMGE 3HNRA 2ZAIA 3RUPA 2WMYA 2DG2A 3SHTA 1KEKA 1V47A 2VZEA 3OLWA 4AI6A 3FNBA 4L4XA 1XXLA 3O0DA 1MRZA 2ZBRA 4GSLA 3W8NA 1YMUA 3EDYA 4L27A 2JARA 1L6IA 3M33A 5KTPA 2VBCA 3ESAA 5HIJA 1DQRA 1KZHA 3KELA 2KM1A 4N03A 2NVUB 4CMIA 4DAOA 4LWZA 1YA4A 1O94D 3OUZA 3KQHA 2PSSA 2FDXA 5BN4B 1P7PA 1QGOA 3DDOA 4PC1A 4X84A 3ZW7A 2VQEB 1UMDA 4FDUA 4FHDA 4MARA 5EGSA 4JLUA 4R0MA 3R7NA 5LQRA 2HSDA 1D5CA 1VCIA 3V8QA 3ZQ4A 3N9IA 3FVWA 4HATA 4HX5A 1LPOA 1W581 2ZTUA 3BCUA 2ZWVA 3IMEA 3NUZA 4QDJA 4EG0A 7YASA 4R8MA 5DLPA 2FOLA 3H1AA 4Z2YA 2NUTB 2Q2OA 3UY4A 5K3CA 5E4FA 4DIUA 4PF1A 3ANSA 1V6SA 2WIGA 3IP6A 1CUUA 1PZHA 3LCMA 1CNEA 1JVNA 2X5JO 4FIDA 5F7ZA 3EPKA 2BJHA 4KSYA 3NFYA 5DV9A 1KRHA 2ZXEA 3I01M 4X20B 4N47A 3JWJA 1VM6A 4MDYA 2KBEA 2Q3MA 1ESEA 4QXQA 1R10A 1ZCAA 2O1EA 5L4NA 1XPJA 3NASA 2J5KA 3M6FA 5TQVA 1A9RA 2QIPA 1SIOA 3ICPA 2A3NA 3M1YA 4QPDA 4Y67A 1T6YA 1QCYA 2OHIA 2NZ8A 2PQ6A 3FIUA 2IQIA 2J6CA 1WB4A 3HJBA 4KQIA 4PONA 1A9TA 4J1TC 4K9OA 3OOWA 4AWAA 2CNLA 2Y3IA 1XEWX 4DZZA 4LK3A 4E3WA 1TUEA 1XRNA 4HDKA 1B43A 2AVDA 2OKGA 4OKNA 5DLEA 4L2IB 3T3MB 3W2TA 4BNYA 2QJWA 1XNQB 2C20A 4F2WA 3AI2A 1TX4B 4CLEA 3HUTA 3D0OA 2REQB 4JQYA 1P3JA 1QHNA 4XQGA 3I2KA 4YAIA 1JIKA 4YRPA 3K8OE 3H84A 4LQCA 4DSTA 4NCIA 4AUEA 3MMZA 3JW8A 2WU4A 2HD4A 2OORA 3U7EB 1NXWA 4R40A 5DP2A 4D6YA 2A9VA 4EGJA 1JP7A 4V02A 3ETLA 3KQTA 2NP6A 1UKCA 1REQA 2XUQA 1NY6A 3GLHB 4DMMA 1QQBA 4EVIA 1VJ0A 3PV0A 4C14A 2CY0A 4AMUA 4TZ0A 1AV6A 1DO8A 2GN4A 3CZQA 1XJCA 4AFNA 2HR1A 1J07A 3KUXA 3SU8A 3AL2A 3KWLA 4GI3A 5LC1A 3RIYA 3FDZB 1QIDA 1TW3A 2IEZA 4CKBA 1TM1E 1UFRA 1OC2A 2JAXA 3C8HA 3I9LA 4F6RB 3GHHA 4IINA 1DC7A 1TEHA 3AEKB 3D6TB 4TTAA 5FBVB 3L7BA 2EKZA 2GASA 1GSIA 1Z62A 4PYKA 2C4UA 4AJHA 4DNOA 2Y6VA 1V25A 3U3XA 3GQVA 3UEOA 1LI5A 1V8FA 1G1AA 2AE2A 3BFXA 3CT4A 4PCVA 1NXOA 1PJBA 3CU5A 1QRRA 1QYIA 4H1HA 4U9UA 1E3DA 1S1CA 2UZAA 3L6UA 2CEKA 5HG0A 4WCVA 1O5OA 5HZMA 1SC6A 1RRCA 4UC0A 2QWXA 5ECGC 4JBHA 3H17A 1YJQA 1P29A 2QTWB 5IH7A 3OJXA 4BEWA 5FPKA 1T5IA 2ZBPA 4QQKA 5E4TA 4ZANA 3E5NA 2ZLBA 1NBMA 4PE5B 4V39A 1W85B 2VHJA 4L0QA 5EG5A 3R9IA 2OV8A 4LDNA 5E8JA 4BE4A 4H35A 2B5VA 1YQDA 3M9XA 5FEMA 3DOFA 1H2HA 3QLJA 4KPFC 4XM0A 3WLHA 4XD7D 5DZSA 1OXXK 1S2GA 3I34X 3FFBA 4MP8A 1ZK2A 1AXRA 4GGPA 4H27A 1CCWA 2B6NA 2G3YA 4U7WA 2CLDX 1WZEA 1J2YA 3P2IA 4YRMA 2PS9A 1OYOA 1LPBB 3LQ4A 4TZTA 4L5YA 2Y1GA 1FOEB 1TCAA 5DHUA 1JAYA 1PS8A 4KO4S 1FFEA 1KOLA 3WFJA 1ORVA 4OP1A 1CIPA 2A5YB 4UPVA 4UXJA 2R751 1QE0A 1KEWA 4DXAA 1BS2A 5JSZB 3G9XA 2Y2UA 3AZQA 1Q50A 3OQIB 4HPXB 4QDKA 4KQ2A 1GFSA 2EX4A 3HVKA 1QMGA 2PZBA 5EIHA 3W9SA 4EY7A 3E5RA 1TVEA 3USZA 1LQUA 4GWGA 2OHHA 3LVFO 3F8WA 4QAQA 1Y63A 5BMVF 4LWOA 1C1XA 2DPHA 2F1KA 4Q4DA 4LJYA 2WLTA 3KZKA 3T5PA 1QR6A 4Q9DA 1EAYA 2HU7A 1LV8A 1WABA 2IYEA 3DNFA 3FRHA 4UUNA 721PA 1Y37A 2OP1A 4BC1A 1FP2A 2OSVA 4QJ4A 1N1DA 1C8VB 3I04A 2BFDA 1YNOA 1YZ3A 1NJ6A 1ZNQO 3HS3A 4JKOA 4Y9DA 1OXVA 1MC8A 1SIWA 3U44B 4A26A 5FKJA 1H3EA 2IEBA 4C0HA 4BEBA 1CY7A 1U3FA 2JBAA 2FPIB 3AUTA 1V3VA 2RJ3A 4WBNF 2Y0EA 3NONA 5IXSA 2R8YA 4AN1A 3RS8A 3KFXA 1QTQA 3C7AA 5IAEA 5JQGF 2FPOA 2RBKA 3UKJA 2I22A 1HDYA 2DWOA 4WY5A 2C2YA 3EQ2A 3IQHX 4FHCA 2WK1A 1JHOA 2WWYA 2HU5A 3SPXA 3A0UA 1KEVA 5TVGA 5K0TA 1OHHD 1U7HA 2OHVA 2V7QD 5BWCA 2VAWA 2NQ2C 4RWEA 6AT1A 1GQQA 4L95C 1AQJA 2PUDA 3DM9B 3F9CA 3UGJA 1CQJB 5EXXA 4P81A 4WDQA 2C2OA 3Q0EA 4V1CA 1QONA 3C1AA 4G8BA 3SKVA 3GZNA 4PGFA 4QVKA 3LKVA 1E79A 3RU7A 1DMSA 3RC1A 3MD9A 4M9RA 1E3TA 2WSLA 3I6YA 3DOOA 2XMBA 2H5JA 1Q12A 1RXYA 1ZNWA 2A0KA 4ARCA 2O5EA 1DAOA 2WFLB 1W4ZA 4C7OB 4V38A 3JQ9C 2PX6A 4B4OA 4BRWA 2GAIA 2P9HA 1JSLA 2NV0A 4MS3B 3SYNA 4AY2A 5CB4B 3R24A 3AP2A 2OHJA 3N2KA 3AHCA 2AOUB 1NXSA 2ZRCA 2MWMA 1LEHA 2CLFB 1KJIA 2HHLA 3AFNA 3GWZA 2X0KA 5ER9A 1E61A 2G70A 2RGDA 4PZLA 2ZIGA 3REGA 1UKZA 3OM1A 1T29A 4NBUA 5EE0A 2XVXA 5MN6A 5TF0A 2Z6QA 2EIHA 3TPCA 1F48A 3B3JA 4DIKA 1FTSA 3PD7A 4JCCA 2R00C 4KPYA 4EGSA 5K8IA 3KC2A 1LLFA 1RYNA 4GSKA 4F9FA 1UWKA 2Q21A 4FLMA 4UE3S 5FFMA 3KQQA 3QKSB 5DBEX 1XZCA 3HN2A 3QVGA 4MV6A 5IXJA 2NO7A 3QFCA 4IJUA 2JFUA 1DADA 1YZGA 1X74A 2ETXA 2GZAA 4LNUB 4TL9A 1BROA 1I9CA 4WLVA 4KYTA 4AXXA 5IM4F 4G8DA 1BFUA 2Z1NA 3CC8A 1IH8A 2F4VB 3J81A 3T41A 1U65A 2QJTA 5HGJA 2V7GA 3G6WA 3RQSA 1KK0A 2K7FA 5DTEA 1BE6A 3RK1A 1JHPA 4HN4B 5IDYA 4YJ3B 2ZTLA 4C4PA 1F7UA 4DCUA 2A1UB 3NCHA 4F56A 1SXJB 1CY0A 1HT3A 4AN0A 1N77A 4PSKA 3CSDA 4YGXB 3ONNA 4HUQB 4N6OA 4KL8S 1H6AA 2I67A 2FW8A 1C7RA 1BJTA 3ESXA 3WGMA 3E15A 2BGJA 2D62A 1PN3A 2O8BB 2L42A 3HXLA 5FLXA 5FYDA 3KQOA 1N5OX 3O8OA 4TWBA 1J20A 5LWQA 1ENOA 2O8DB 4LZZA 1EFPB 1RAEA 2N46A 3E3NA 4XE5A 2FVXA 3HP7A 3K70C 1W8DA 4OLBA 1J0BA 2HSWA 2XMCA 1OIWA 4JNCA 2AYYA 3RUCA 4UVGA 3TL3A 1H94A 2P2CA 3DTNA 3V2HA 1I2CA 4CQJA 2GOYA 1XZJA 1GDHA 3PITA 1KS9A 4GMXA 1HYGA 1M2HA 4UW9A 4RD3A 3OCCA 4CV1A 1KEUA 4IEFB 2R97A 2W2LD 3L6RA 4NH4A 3D7KA 4DDUA 3C7KA 5KNCH 4EM6A 1WP9A 2IYLD 2P62A 4K9NA 2WYIA 4QGSA 1CULC 2Q29A 2EWVA 1PFVA 4IFTA 1N5KA 4C87A 1BMFA 1YC5A 3ME5A 3MJFA 4DJJA 1TZCA 2FH5B 4KLCA 4OCZA 1MGOA 3IYLW 1UMCB 3B53X 3S3TA 3K0AA 2E0IA 4MUNA 4POAA 1P5ZB 4QUGA 4UUOA 4MW5A 2AFHA 1T0HB 4LF9B 4BBZA 4DHWA 2DX7A 3DDCA 3VV2A 4M37A 5EWJB 2PKEA 3OKAA 6REQB 5EPUA 4EPWA 1FP1D 2VWGA 4FCCA 4UTZA 4LOJA 5DEOA 5FBQB 1T4MA 5DHRA 3IP7A 4JVSB 2AOTB 1VYVA 1YRLA 1PQWA 3CW8X 4UPDA 1KMCA 3VTZA 3AVQA 4KE6A 5CDUA 2C3YA 1KP2A 2NNWB 2ZE6A 3M4JA 4PM4A 2MINA 4V0RA 4DJAA 3NM6B 4JR0A 4US0R 5DGDA 3M3PA 3S8EA 4GR5A 3IIKA 2GXUA 1CFZA 3BJMA 5JBQA 3IQIX 4OQNA 4BXOA 1HV8A 3LUKA 4FP9A 5DIZA 1P2TA 1IOZA 2FP4A 5AHKA 2N42A 4KFSA 4BATA 3OT1B 3OTIA 4IG9A 4OGKA 4RTQA 1F8GA 4XVQA 3GGCA 1ULZA 2IS2A 5A6VA 1RI4A 4CDMA 2PYIA 2JCSA 2GNAA 2VJQA 4AAYA 1NXTA 3W6OA 1TD9A 3X3HA 2E6KA 3KZXA 4JVMA 4R54A 4BU1A 3IQGX 3MLAA <