4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
1B0UA 2L0XA 2VF7A 2HEIA 4JL6A 4PHTA 4QFMA 5IF9A 3QNUA 1Q20A 4AIIA 4Q4JB 1OB5A 3TK1A 1OHHA 3AP3A 1II8A 1C9KA 3NKVA 1ZCBA 1K5GA 2QAGB 4TL8A 5GJWC 4URWR 3PXGA 1GIAA 1KDPA 2NZ8A 1U8AA 1SXJA 5FBLB 1Z0JA 1IN4A 2B7CA 2KE5A 5CLLA 2ZJZA 1QHNA 4C4PA 1S9HA 2DWQA 2F6RA 2WAXA 3KKPA 1XXHA 5LD2B 1NKTA 2QE7A 1Z28A 1JPJA 1Z8FA 2UZIR 2WWWA 5AUQA 4TYPA 4Q03A 4PR0A 3MWJA 2V9PA 4W9MC 3CKLA 3RRNA 5LPNA 2RH5A 1TQDA 3QY0A 2DBYA 2O0KA 1E9SA 3PEUA 2PZEA 1BMFD 4IVQA 2BMJA 1G7CA 2OUKA 4RD3A 4R9UC 5HTKA 3K9NA 4IDPA 4QC2A 5FR1A 5KSOA 4B2LA 4CEIA 5EP2A 2IW3A 1WBDA 2W83A 4RD4A 2XGJA 3RABA 4IDNA 4QJ5A 4V0KA 2GTPA 2QUZA 1MRNA 4PZLA 4DDTA 5JLJA 3PG5A 3GLIA 4NHOA 1W36C 1N6RA 1KNXA 3D8BA 1FPMA 2J46A 5DI3B 3NEYA 4F4JA 4A8JC 2P6RA 1NVWQ 4BPBA 3KJIA 2HXYA 2ZE6A 1Q1EA 4RCYA 2EU8A 2ZUBA 3OEED 1G18A 2H57A 3LY5A 4PPFA 3WYFA 1NLZA 3U7HB 3GLHA 3PV0A 2LWIA 4B3FX 2ZRCA 2FJUA 2OFOA 1JJVA 1LF0A 4LYJA 3CRRA 2O8EA 3A58B 4LJ7A 4DCVA 4CEHB 5KNDA 1XP8A 3ZD6A 2E9SA 5AWFC 1EFCA 1KK1A 2HUPA 3H84A 1JBKA 5DH9A 3THWB 4TL7A 1TUIA 5EXXA 4AC9A 1KZ7B 4ASUA 1XX6A 3GJ8A 2A30A 3HYRA 2Q3FA 3IDQA 4WBSA 2ASEA 3EIHA 3MJRA 1Z0AA 3BS4A 4HEJA 1G17A 1TAGA 2WPDA 3K0AB 3P20A 3ZH9B 1AS3A 2FPLA 2YV5A 1R2QA 2A5YB 1K5DA 3NDBB 1G6HA 3SYLA 3K0EA 2JJ8A 2ZI9A 1MRSA 1ZUHA 4EIWA 2YINC 3MJHA 2IXFA 3GMTA 1L7VC 3EPHA 4JYCA 3RS5A 2A3RA 3GP8A 4URVR 3VHXA 1XEWX 1MH1A 1HTWA 4I1OA 4CGZA 5BYKA 1OT3A 3B1ZA 3BAFA 1LTQA 1D5CA 5DGXA 2D7DA 4LJ8A 3RANA 3CX8A 1CULC 4LV8B 5IT5A 1W4CA 3CWQA 1GKYA 4TQ9A 3K70D 2IBMA 2Q9BA 3B1WA 2PZFA 1YR9A 3LO5A 1DG1G 3NTUA 4G5QA 2FMXA 4M1YA 2DFTA 4WOPA 4FD2A 4OHYA 4H1VA 1E4YA 5AJVB 4M8NE 2QPAA 1L2TA 4PPQA 2AR7A 4KBGA 5LD2C 5JJIA 2ZJ5A 4NL4H 3G5UA 4BLPA 4LC1A 1GL6A 4K81B 3SS8A 1UFQA 1UBGA 1BS1A 1XD9A 4PAQA 3THXB 1C4OA 4F7WA 2ZRGA 5KPDA 1KI6B 4JS0A 4DRZA 4F4IA 3IEUA 1L8QA 2O52A 1N5JA 3UWOA 2HT1A 4TYQA 3R9IA 2TMKA 3NVAA 4YMUA 2Z83A 4DCUA 2BEJA 5L8VA 4DB2A 2W6JA 5KNBA 4QHTA 1Q0UA 4ASUD 4CEJB 1UBCA 1YZLA 1Z0KA 4Z8YA 4IOKA 5DN6D 4O3MA 4B3GA 2VP0A 4GL2A 1VCOA 1CR2A 3RWOA 3DVLA 2DFLA 4U00A 5EXTA 3VMFA 3T5GA 4DJTA 1XD8A 2GEDA 1R0XA 5DISB 3DO6A 3Q7QA 1V5WA 3EWAA 3NBZC 1JEEA 3KJHA 2QZ4A 3LRPA 4WVFA 5LBIA 2YWEA 4N3NA 3NEJA 4IOJA 4Q1EA 4ABYA 1GITA 3LW8A 1GL7A 4IDOA 3AVTA 3HDTA 2FFBA 2DR3A 3I3SR 4B74A 2ZQ5A 2FN4A 2QRNA 1WB9A 5EE1A 2BKUA 2GCOA 4HLDA 4CYMA 3KXIA 4V0MA 5K8TA 1UDWA 3IPYA 3VX3A 4D4MA 3A4NA 1XJ0A 1OH7A 1P72A 1JB1A 1CP2A 1OFTA 5FH9A 4OQFA 4QL3A 1BYIA 1GUAA 1NVVR 4JT4A 3KQUA 3PJRA 3ETLA 1JQLB 1SVKA 4P32A 2J59A 1XMSA 1YVDA 4DDWA 1J8YF 1R5OA 1E2JA 4R7ZA 4GMDA 3LBNA 1NBMD 1T9HA 1OSNA 4A82A 5JEEA 3IBYA 4BZXA 4CEIB 5GADl 1YKSA 3WMGA 1IJEA 3L82B 1J7KA 1VCMA 1KK3A 2WJJA 3UMSA 2V54A 3BB3A 1CJUC 3VR2A 3U4QA 2Z43A 4JJZA 1XCPA 2ZREA 5TXGA 3O47A 1XWIA 3P4YA 1NIJA 4RD1A 2YC2C 2VPPA 5JECA 4TYYA 4QOSA 3RLFA 4PC7A 2JASA 3QKUA 5FUXA 4ESHA 3QKRB 4M2LA 4RZXA 3TAHA 1Z0FA 4M1MA 1UKYA 1W5SA 1TF5A 2FU5C 4NPHA 3CF6R 1KSHA 1AJEA 2RCNA 1KK0A 1BKDR 1UADA 4PPNA 1VTKA 1NVXQ 2QAGA 2XAUA 3HJNA 5H8WA 1KI2A 5JHGB 5TVKA 2O5VA 1ZIPA 4OI0A 1LNZA 3VNVA 3FB4A 1ZC4A 2WOOA 3DMDA 2FH5B 1RRGA 3W6NA 3N2IA 3Q5DA 3HU3A 4HLCA 4HATA 2X2EA 5CITA 4LRWA 5CYOA 1T3SA 2WM9B 2JDIA 3I8SA 5BQ5A 2P6NA 2RGNC 4DEXA 4BRUA 1KO4A 2DFNA 4D0NA 5TV2A 2FSFA 1TEXA 2AHOA 1GAJA 4RY2A 3QKRA 2FX3A 4XTCS 1S0UA 4O0MA 5J4HA 1IY1A 4AKIA 4Z1MD 3TSWA 4HB2A 5AJZA 3ZZTA 3M6AA 3AM1A 2PH1A 1RFLA 3QKSB 1BMFA 1XD2A 4M1KA 2ZETA 2NO0A 4JL5A 2K5UA 2R8RA 221PA 4TZ6A 2VHJA 2Q21A 4PO8A 1KDRA 1R8SA 4PC3A 4A0RA 2WSMA 1G8PA 4N0DA 3K0SA 1US8A 3M4YA 4MRVA 2UKDA 3PUXA 5CM9C 1LS6A 1SXJE 3LD9A 4UNSA 2AK2A 5AR1A 3FYHA 4R71A 2QROA 3K0FB 5JBQA 2V7QD 1XJCA 4GP6A 5FTKA 2D7CA 1HEIA 3GEIA 1KSFX 2XB4A 4PAOA 1RRPA 3X1YA 2BBOA 1ZUIA 4QHYA 1MABA 1P5ZB 4D2IA 2QBYB 3QE0A 2ODWA 1NLFA 2GJ8A 1Z6TA 4JVMA 3JVUA 1KTVA 2MMGA 1DTSA 2AL7A 2CDNA 4N1AA 4BLRA 3KQNA 2YHSA 3QKSA 4LHVA 3BB4A 5EXPA 3KQHA 1A5TA 2OT3B 1E2PA 5IHPA 5FOWA 4GNKA 4IXNA 4LGMA 2GZDA 3E1SA 1X8LA 3K9HA 5FBQB 5CK4A 4KFRA 3BH0A 3C8UA 1N5LA 5CIQA 2I1QA 4ZO4A 1XTSA 5B64A 3WRYC 4LV6A 3AUYA 4B33A 1P9NA 1AN0A 2C9CA 3CONA 3FTQA 2D62A 4Y0VA 2QNRA 4G5SA 3RRMA 4KHZA 3WNDA 1AA9A 1K6MA 2QRZA 4DLWA 4XOIA 2CHGA 4AG5A 2YVUA 4BFXA 1E79D 3CRQA 4NYJQ 5G41A 4HAYA 3SN6A 3QQ5A 4E03A 2FNAA 4KSBA 3AF3A 1S96A 4HLUC 1SXJD 2R6CA 3UG6A 3DOEA 4UXJA 2ATXA 2OHFA 2JIZA 4X8MA 2ORVA 5JSZA 4DSUA 4JLDA 1E94E 1U8ZA 1XB2A 4DIEA 5EP3A 2WWXA 2F43A 5HZHA 4NYJR 1N0WA 2IUUA 1OLOA 1XPUA 3AVQA 4FMBB 3MD0A 1NY5A 1KJWA 1ZM7A 3Q85A 4JKIA 4L9SA 1E2FA 3MLEA 4DLUA 3MRSA 3GLHE 1Z22A 1AQYA 3F8TA 4D4LA 2PX3A 2C78A 2F3RA 2REXB 4C9BA 3FKSD 3VFDA 4OHZA 4TTQA 2CVFA 4TTPA 3FOZA 1XCMA 2P5SA 3A4LA 3GEHA 3KFXA 4RJLA 4B48A 5CB8A 2PT5A 2VHTA 3BXZA 5E7IA 1GM5A 4POAA 1DARA 2CHVA 3AVXA 1SKQA 3AF2A 5FUWA 2ZR7A 3OF5A 1AZSC 1XBTA 3LDAA 4DSTA 1RYFA 1FTNA 3X1ZA 5FPSA 2PJZA 4GOKA 4ACAA 1KO1A 3IGFA 3QI2A 2VHUA 4YMSA 1OXTA 5FTLA 2ZANA 1H65A 2PEZA 1W0JD 2MSEB 4PPGA 3LA6A 2D06A 3LX5A 2KSQA 4W7SA 1TU3A 2ZE5A 1E4VA 5P21A 2IXGA 3B9QA 4LHYA 3THYA 3QPWA 2P67A 1KZGB 4DCTA 1F2TA 2BBSA 1E9BA 4JLBA 3MWYW 4PFSA 3WMEA 4FCWA 4W5JA 1E96A 3H1TA 2PLRA 1XRJA 2B21A 2YYZA 4GZLA 4JLPA 2JLRA 1E9FA 3AGPA 3IO3A 3PEWA 2ZJYA 4P33A 1YZQA 1P4SA 4D81A 1G3IA 2FSGA 3QJYA 2NPIA 4NCKA 4BLQA 1F2TB 4Q1DA 1A2BA 2BBWA 1E32A 2WKQA 1SVSA 1X1SA 3SEAA 5CLQA 4EJSC 3VU9A 3VAAA 4OK5A 3W8NA 2GJAA 4IW3B 3K0CA 5FTNA 4TMTA 3U4QB 3KKQA 1G9XA 3K9LA 3TIFA 1BOFA 1KDTA 3AH8A 3BWDD 2DB3A 3T1QA 4LJ9A 5DN6A 1S3GA 2WVJA 2FZLA 4LCBA 2GBLC 2HDNB 1B23P 2XZPA 3QXHA 4N0EA 3D6TB 1UEJA 3REGA 3TLXA 2O8BB 1KO5A 1KI7A 3I5XA 3PUYA 3F3YA 1P6XA 4P31A 3BC1A 3OESA 2GETA 1SVLA 1SVIA 3PVSA 1G7RA 4M4SA 3F0TA 3LQRA 4WZAE 4Q00A 3CWZA 3K0FA 4XWOA 1WA5A 4IEIA 3FHTA 2XTMA 3T35A 5GJVC 4B73A 3GLGA 1IXSB 1NSTA 1HQCA 3QVVA 3H0KA 5F9HA 1PVOA 3QBTA 1F3OA 1VHTA 4QGAA 1D9ZA 4LJ6A 2RAPA 2ZUCA 4LHXA 5KU1A 3O8CA 2XOKD 1FX0B 4C0KA 3GJ0A 4QBFA 2GEVA 2AD5A 1KAGA 1VMAA 2BMDA 3BD9A 4QGHA 5EE3A 1YR8A 2DFKB 2ERXA 1XXHE 2JAQA 2ZRMA 2VH5R 5EP4A 5EUQB 1WQ1R 3RWMB 1UBEA 1RPZA 1D2EA 2GK6A 2NO9A 1NSFA 1E69A 1QG4A 1KY2A 2Q0HA 4US1R 4BLSA 521PA 5JRZA 1Z2CA 1E99A 2E1RA 4PQYA 3I61A 2GZHA 2PT7A 4JLNA 3SYNA 1Q1QA 3AVUA 2NZJA 3ZYCA 4F93B 2CE2X 4PC2A 1TL7C 4OHWA 2F1IA 4JMPA 4WAUA 3GD7A 2EFDB 4BFUA 4DCNA 4ZDIA 2B8TA 4EUNA 2EFGA 4IKEA 3HU2A 2QAJA 3ZQJA 2J0UB 4C7OB 1NN3A 2ZRKA 1ZJ6A 1ZM2A 1JXOA 2IYQA 5DNYB 3AVVA 5CJ2A 3SBEA 4C0AC 2JGNA 2OCAA 2PX0A 1XTJA 3GJ3A 2AD1A 2IS6A 1E0SA 3OEHA 2F9MA 1E9DA 4IVPA 3BB1A 1R10A 3ZD7A 3CF0A 4BWYA 3MWKA 4RFVA 2OXCA 2IS4A 5KUTA 1JAHA 3VKGA 1E98A 1OYYA 3QG1A 4BFZA 2QMEA 5E3HA 4BFSA 4TSFA 3WRXC 4K46A 2ZRFA 4NYIR 2R65A 3OIUA 1ODFA 1G3UA 1S3SA 5UKDA 4GZMA 5BW8A 4PX9A 5L3QA 2NIPA 4YXWA 1JECA 2QPTA 1S4QA 4Q7KA 1R4AA 1NMYA 1Q1BA 4TLAA 2PJRA 3AB3A 2OBNA 2REOA 2ZR0A 2UZ3A 3SHWA 2CL0X 1XCGB 2XNDD 1IJFA 3CH5A 1HUQA 4D6PA 2AFHE 4TYNA 2H5EA 1JPNA 4C3ZA 2NQ2C 3KX2A 3X1XA 4E22A 4TQUS 2EFCB 3ZVRA 3OFNA 3KUCA 4ERNA 3LQQA 1KSJA 4ACBA 2B7BA 1TF7A 1EFRA 3EA5A 1X3SA 4GDFA 3O8BA 4KBFA 2FPKA 4RFSA 2G3YA 1YRAA 4W5HA 5TB5A 3THOA 2HT6A 4HZIA 4XD7D 4AD8A 4CEHA 1NI3A 4O25A 3R7WA 3QF4A 1RYHA 3B1YA 3CNOA 3DMNA 2UVQA 3WYAA 3QUSA 2C9YA 2J7PD 3AKYA 4XVRA 2PMKA 1U0JA 4QM6A 2GESA 1ELOA 1NRJB 3IEVA 2OXRA 4DC9A 4AI6A 3HYTA 3K53A 1SKYB 2ZRAA 1KHTA 1VECA 2JJ1D 3FHOA 1U98A 3ZIAD 4JBXA 4F91B 4A2WA 3M0EA 1E2HA 4X8OA 4ZCMA 4JVNA 3I32A 2C03A 2Y8EA 5A4JA 2ZJ8A 2BOVA 4HI0E 5LB2A 3X1WA 1RVDA 1MO4A 3EA0A 5GVRA 1WMSA 2GXUA 5AJXA 3LFUA 4DT1B 5C2JB 4HZUA 4IRUB 3G82C 1ZM4A 2F1HA 2CHQA 3SQWA 1OXUA 3QXCA 4G01B 1YU9A 5D3MB 2QENA 5JMTA 1U8YA 1MV5A 5B30A 1G5TA 1X8JA 2VBCA 3U3MA 2W0MA 2CMKA 2BIFA 1ZM9A 2ZRBA 1ZAKA 1ZNZA 2FZ4A 3VX4A 2E87A 3CPHA 4A0GA 2HF9A 1K8RA 4GBMA 3RS3A 2NO6A 3I4LA 3LH5A 2FEMA 1KI3A 421PA 1E0AA 3QVUA 4LYFA 1CTQA 1COWD 1W47A 1YR6A 4FCTA 3IQWA 3GLIE 1DELA 3AF1A 1W0JA 3T1VA 3Q3JB 5K8UA 2IXEA 4B6FA 1ZINA 5EQTA 2WAYA 5FI0B 3KJEA 1JI0A 1N25A 1E2QA 4KAXA 4ZPXA 2YJTD 5IDVA 4XWKA 2BMFA 5EE0A 3MFYA 2C04A 1HT1E 1CJKC 3ZS8A 4D4KA 2I4IA 3PUWA 4DDVA 3KQLA 4KLZA 4GFDA 1II8B 3GPLA 2F9LA 1QHGA 1RJ9B 1CR1A 1VYTA 2IYWA 1RRFA 4PC1A 3D3QA 2FGJA 2IL1A 4LPKA 1RJ9A 3IBGA 5L3SB 4NZYA 3B13B 1D9XA 3RNLA 2CJWB 2RGNA 3WHLA 1P73A 3U3KA 1PLJA 3BOSA 1WE2A 1XJQA 3UK6A 3FFAA 4CT4B 1QVAA 1XZQA 3LW7A 3I73A 2OCPA 4LHWA 1KI8A 3DZ8A 2R9VA 4AKEA 5BN3A 3BH6A 1KMHA 1E2IA 1OV4A 4O2RA 3SI7A 2YKGA 4YMWA 4MQBA 1FP7A 2W2VA 3CUEF 3KZ1E 4TYWA 3SU8A 2V1XA 5IK2D 4MGIR 2ANBA 2J87A 5FPHA 3KUDA 3GLGE 2ZI5A 2XX3A 5AUNB 1ZD9A 3WP0A 4GT1A 1ESMA 4M22A 4Q4LA 2OFWA 2AKAB 1Z63A 1IAQA 1ZUNB 3GJ4A 1IOZA 5M04A 5A5GA 2VP2A 4HDCA 3LNCA 5G3YA 1DAMA 3ADBA 2R62A 1Z6GA 2QORA 4RD0A 4RZUA 3T1TA 4MGKR 4KFTA 1QDEA 1T5IA 1N6IA 2O8DB 4KXFB 3SFVA 4FINA 3UKDA 2CNWD 1R5BA 3E2IA 3EPJA 4TT3D 4LJ5A 1DAIA 2G88A 2FSHA 2ZE8A 4EFNA 1ZU4A 4MKIA 2O8BA 1P2VA 1W0KD 2ZXUA 2JLUA 4NE2A 1U2RA 1GDDA 1IN5A 4WIAA 1KI1A 2GJSA 1CRPA 2C98A 2QM7A 1TUEA 1T8UA 1QHHA 2AXPA 2VIIA 4HB0A 5JS8A 4HB3A 3RVBA 3CZPA 2ZROA 1S8FA 3S1AB 1KJZA 4YDHB 3R9WA 2DWOA 1NN0A 1W2GA 2P65A 2ZSDA 3CRMA 4LBWA 1GSIA 5EP1A 3B8HA 4M1TA 2WWIA 1VDZA 5F9FA 4LJYA 1XEFA 4D25A 3CO5A 2D2EA 2ZRHA 4TMVA 2WJVA 3KJGA 5DHFA 2O0HA 5DO9A 2GK7A 4DLXA 2XJ9A 2X1VA 3DPUA 3EZ6A 1OXXK 4I1VA 1U0LA 2A5DA 2ORWA 3B1XA 4URZR 2Z5FA 3V4FA 4Z51A 4ZI3A 4MYCA 4TMKA 4CDGA 3ECCA 2KJQA 3LV8A 5IRCD 1JALA 4FWIB 5E7MA 1CBUA 5C1BA 3AVOA 3ZVNA 4ARZB 1Z29A 4PANA 3EC1A 1PV4A 1DBSA 2IWRA 4WZBE 4XSGA 1E0KA 4EQ6A 4FMDB 4JSYA 2AK3A 4DXAA 1JR3D 3CM0A 3THYB 4Q1BA 2OFXA 1CR0A 3L8YA 4GOJA 1ZNXA 1OKKA 2FFQA 1LFDB 1G20E 1M7BA 3S1AA 5JRJA 4ZKDA 4HB4A 2WSSD 4TLDA 1NNEA 4C0QC 2GZAA 1GNPA 2LKDA 4EPXA 3W8RA 5JWOA 3P1JA 3SC3A 1AM4D 3ASZA 1FQKA 5JJLA 1KOFA 4C0JA 3GJ6A 3O8DA 3PR1A 1P9RA 1ZCAA 3NHAA 4KYUA 3CR7A 3TUJC 1QZXA 4QNMA 2JJ2A 1Q3TA 1W0KA 3W3AA 3RRYA 3FMOB 2HCBA 1D2NA 3EARA 5JI2E 3ADKA 4M1WA 5JWRA 4DDUA 3OIYA 5GJCA 1X6VA 1F2UB 3L0SA 4JVSB 5J4KA 5KHOC 3KB2A 5FTJA 2FDCA 2OM2A 3SZRA 3BERA 1WBBA 1G8YA 4KVAA 5KNCA 4Q9JA 5GJBA 1E1RD 4JLKA 4M9XA 3UANA 2CE7A 3CBQA 2VYFA 2WTUA 2RMKA 3TMKA 2VTKA 2D2FA 4ZCLA 4A6XA 4GSYA 5B57C 1BYUA 3U6KA 1MO3A 3B85A 4BFTA 3NHBA 4G3XA 2XXAA 3D31A 1E2GA 2MSCB 4YXWD 1HV8A 2BKEA 2W2XA 3OAAA 4ZDWA 4KV9A 1WP9A 1A82A 3KKMA 4B32A 3RC8A 2IUTA 2ZJAA 3SQXA 4UNNA 4AYTA 5LDDC 2WMNB 1GKIA 3DKPA 1JR3E 2ZYUX 4QHSA 3KDSE 1TX4B 1YRBA 2CL7X 4B71A 4NU0A 1N0VC 2GVDC 3SBDA 2Z0MA 4HAZA 2W58A 2OG2A 1YZTA 1HYQA 2OAP1 4I81A 3A8TA 1UBFA 3K0CC 2CJWA 3B82A 4LOAA 4EFLA 5JWHA 1DVRA 2YWFA 3AGQA 3OZXA 1Z08A 1AS2A 4R2HA 4NYIQ 4L8GA 1J2JA 2G1KA 1XEXB 2ZI4A 121PA 5F3WB 1M7HA 2FFHA 3Q5EA 4LK2A 2XB2A 2C95A 5C4GB 4LZZA 3THXA 4EPRA 1ZC3A 2GILA 2V1UA 1U90A 2ZSEA 4RD2A 4PHGA 2RGGA 2YNMA 2A5JA 3CX6A 5EUMA 2AX4A 1ZP6A 4BZPA 1DO2A 3KTAA 3RS4A 1Z07A 1HA3A 2YOFA 4IFEA 4Y0AA 2R6GA 1P9WA 4US0R 3UG7A 3ZZ0A 4QM7A 3R9XA 1MO6A 2IEZA 5JZVA 4FIDA 4YC7A 3DEFA 1VYVA 1XTIA 2VP6A 2W6JD 2R6FA 1JR3A 1RE0A 2R6AA 1S9DA 1Z06A 1R0YA 2XSZA 4LC0A 4NCHA 3TW4A 5DI9A 1IY2A 4L16A 2ANCA 3HPQA 4B35A 2YOGA 4FMCF 4FN5A 4HZUB 4TTRA 2IYVA 1VKJA 2ZE7A 4DLVA 3UATA 3AP2A 3U3RA 1WF3A 3WMFA 2QI9C 3KFVA 3DHWC 2ONKA 3PEVA 4KCGA 4U5XA 1MR3F 1Q44A 3WBJA 4HAVA 1NKSA 3IILA 1EFRD 2RGEA 3SJZA 5FOTA 4NKRA 4A8JA 4PSKA 1G3RA 1VYUA 1C1YA 3HU1A 2QQEA 1E2DA 3K1JA 2C5LA 2G83A 1W36D 2WHXA 1CJMA 4HUQA 2Z4RA 3UIEA 4A9AA 4OHXA 5KSYA 2QMUA 3DL0A 4AG6A 3THWA 1DEKA 1M7GA 4JZKA 4QG7A 4TZ0A 2O8EB 2AN9A 2JLZA 2GWHA 1KI4A 3DOFA 2C96A 2R6DA 1GZSA 2ZAMA 3NXSA 1XDBA 4I99A 2ZAOA 3C5CA 1FNNA 1XPRA 4MRRA 2ODBA 2NMVA 4C30A 4BGDA 1Q21A 5FPYA 2FWRA 5FOSA 1NG1A 4IEEA 1EFHA 1YR7A 2QMOA 3ONWA 3SOPA 4ZDKA 1ZBDA 5FOXA 3U7GA 3BE4A 4OBEA 2ZYVX 1LW7A 1N6HA 4MITA 4Q7JB 5E95A 3K70B 3QPVA 2IUSA 1T0HB 4E07A 4S2EA 5L3VA 1Z0IA 5FBRB 3UPUA 2DYKA 4CIDA 3DZDA 4LUCA 3IHLA 5SZKB 3AVPA 4FW9A 4H9GA 3B60A 3GJXC 2ZRNA 3NG1A 2QP4A 4M1SA 4D80A 1X86B 1GL9B 1ZU5A 2J5XA 3HWSA 4JBYA 5ANRB 1CU1A 4M9SA 4II7A 4CT5A 3T5DA 2NTYC 2JA1A 3NC1C 3TGPA 5FL7A 1Z5ZA 5AUPB 2EFHB 1Q22A 2J41A 4C2UA 2RGBA 4FI3C 1AIPA 1M34E 4KLNA 2ECKA 4FMCB 2BBTA 4YMTA 1KIMA 3I72A 3AKEA 1GNRA 2OBLA 2OEPA 4LX0A 4CZ2A 1OYWA 4PSAA 3NBFA 2QA5A 3QG5A 1AKYA 3B7GA 2XTNA 1VCIA 5G53C 4V02A 3TJZA 2V6JA 2ONJA 4BECA 2DPXA 3H86A 3FMFA 3UMFA 2PCJA 1TU4A 3OFND 4JKYA 1ZNWA 4URYR 2GF9A 1ZM3A 2EWVA 4OK6A 2VQSA 2BHRA 2HYDA 4V0OA 1J99A 2EVWX 3B5JA 1XXHB 4NCJA 4KO8A 1QVRA 4LDJA 3SYKA 4UNPA 1YJ5A 1GKUB 1U9IC 4CW7A 1HE8B 2NO7A 2XJ4A 1NG9A 2ZYTX 1GILA 1I4DD 1FTSA 4K8OA 4U02A 2WPDD 2XSZD 4HUQB 2ZVQX 1NMZA 1R5NA 4KYIB 2SHKA 3L8ZA 4LBZA 1AGPA 2ZRDA 2EWWA 4LHZA 4Q19A 2WWYA 2EW1A 4Q7MB 3KL4A 3AF0A 3DM5A 2JATA 4Q4JA 2GHIA 4D0LB 4C0BA 2CXXA 2W0SA 2CLCX 1Z6AA 5L3SA 2ODEA 5JEDA 2IC5A 2W00A 1L4YA 1XZPA 2ODNA 3L0OA 1ZD1A 5IK2A 3BFKA 3QEJA 3VR3A 1VG1A 1N5KA 3CPJB 2F1RA 3EZ2A 1LS1A 5HR5A 1E79A 3LVQE 2RGCA 2VSXA 3CZQA 1FUKA 3A1TA 3U7EB 4B6EA 4AYXA 3ND9A 3QIAA 4B2IA 4URUR 1XTQA 2LCFA 1KMQA 2Q3MA 2PCLA 4HAWA 1FL9A 4LSGA 2ZUDA 3SJAA 4Q5IA 1ZIOA 3UWKA 4B75A 4MUAA 1FX0A 1OHHD 2WIBA 3ZQ6A 2PLFA 1J90A 1I4TD 4OJKA 5FOUA 1MOZA 1ESNA 2FE4A 2DHRA 4DSOA 1SVWA 3U6BA 3PENA 3B78A 5FBVB 2G1JA 3OE7A 2DCUA 5BN5A 1QG2A 4D0GA 2GXQA 2W6IA 4NYMR 4KJZA 1QHSA 1TQ4A 5G40A 3KKNA 5FUYA 4MRNA 1W1WA 4CRWB 1KO7A 3QENA 2ZRIA 4DUGA 4M21A 5JFGA 1G3QA 1NY6A 4HDOB 3EPKA 3EZ7A 3X2SA 1NBMA 3VNUA 5CM8B 4DT1A 1YE8A 4OI1A 3B2EA 4A4DA 4AY2A 2ZPTX 1W4AA 5B58C 4MYTA 1JAIA 1TQ6A 3EG5A 3IKJA 3TR0A 3TW8B 5EE5B 3LWNA 3ZZUA 2OCBA 2FA9A 5DYIA 3TNFA 3TUZC 4L4UA 5TMPA 2QQ0A 2JLXA 1G7SA 4Q9IA 2ZVPX 4PSVA 1H8EA 1PJRA 2BEKA 3EWSA 1XTRA 5FFMA 3WYGA 2XXAB 4BZQA 2OBMA 5H70A 2O8CA 2AXNA 3NH6A 1AS0A 3EASA 1FFHA 3BK7A 1NLYA 3FKSA 1VIYA 4TMZA 1EX6A 1F48A 2VO1A 3N5CA 4A2QA 3Q72A 3MGCA 4O2LA 1GVNB 3LVRE 4PAMA 3TAUA 4M1OA 1E2NA 1IXRC 1WDTA 1LF5A 1Q3HA 1Y63A 5EXSA 3PCRB 4DLTA 3C15C 1RZ3A 2ERYA 3LLUA 1Z0DA 1EG7A 1N6OA 2ZSFA 4CVNA 4OJQA 2KB0A 2OLJA 2RHMA 4M9QA 4DCSA 2GDJA 1DADA 1G4AE 2FFAA 2PZGA 4QJ4A 3LX8A 4LPSA 4D4JA 4IFBA 3PIRA 5J4LA 1YHNA 5AJYA 3U60B 3CNNA 4P4SB 4LBYA 1PUIA 4YDSA 2VA8A 2JIZD 3EIEA 4MGZR 4QGFA 3SJCA 1CEEA 2IT1A 2WBLC 1E2KA 1P7CA 4QXAA 5JJKA 2BCJQ 4JL8A 4XSHA 3EAQA 4B47A 1NP6A 4KITB 4JLJA 3VR1A 2AWOA 2P6UA 4UQOA 3FE2A 1IN8A 1N2CE 5L3RA 2Q3HA 2BJVA 4KSCA 4B43A 1Z6YA 1R7RA 2OSBA 4Z54A 1KKMA 1W48A 2CL6X 3OEEA 3P26A 3UMRA 5BN4A 4TMXA 1TPZA 1ZYUA 1TNDA 1CF4A 1JEDA 4TLBA 4X8LA 2VSOA 2GKSA 3TVTA 2QM8A 3I62A 4TQAA 1E1QA 1W46A 3SJBA 1TQ2A 2HLDA 4KODA 1N6NA 3U3OA 2CEAA 5EJEA 2QAGC 1G41A 2GXAA 1T91A 3ADDA 3SHFA 2CCJA 2ZITA 3OAAD 5CIWA 3K09C 4C7OA 3BORA 3C5HA 3FVQA 2F1JA 3MAAC 3IPXA 2D3WA 4FWTA 2WWHA 3HR7A 2Q6TA 4A8JB 4A1FA 3AP1A 1P3JA 2J0UA 2OZEA 2VRWA 1UPTA 3LBHA 3A6PC 1W49A 5CK5A 2QGZA 2WKPA 1ETUA 2QU8A 2DY1A 3RRZA 1M6NA 3K9GA 2G9NA 4BASA 4ZIRB 1CLUA 4IHQA 3A37A 4EKDA 4YMVA 821PA 1FOEB 2V3CC 2G0NA 2C2HA 2FSIA 3F5FA 4GOXA 1RC8A 2A78A 3VR6A 1Q1ZA 721PA 5BWMA 1S1CA 3H4MA 1FUUA 3I1FA 4DKXA 4HLUA 5SZHB 2ZEJA 2ZRJA 1LY1A 2ZSBA 4ITRC 1KYIA 4OI4A 4DB4A 1DE0A 4OKSA 4NMMA 4XWAA 3CR8A 2QBYA 1XMIA 1UKZA 4GI7A 2N42A 3GLFA 3ICQB 5FTMA 4B3XA 2ZJBA 4MGYR 4DZZA 2O8FA 4WXPA 3IHWA 5L3QB 1J70A 3MUFA 4S35A 3I92A 1EFUA 2ZS9A 1DAGA 1SHKA 2H1LA 4TN1A 3E5HA 4NTZA 2BM0A 3GLGB 4TLCA 2O0JA 1PZNA 4QBHA 5HCNA 1NVUQ 2CLDX 5JCZA 2VEDA 4LYHA 4Q66C 1WXQA 4JIMA 1N6PA 4UNQA 4KFUA 1IXZA 1KKLA 2ZM5A 2JLSA 3V00A 4B44A 2G6BA 4AYWA 3U5ZB 3WNCA 1X8KA 3C41J 3JVVA 4JLAA 4KI0A 4UNRA 1OJLA 2ZIAA 1AK2A 3CRW1 4RZ2A 5FR2A 2EQBA 4Q4HB 1E9EA 4G0NA 2IS1A 1OXVA 3C4JA 3FWYA 2ZYWX 2WSSA 4L9WA 4RSGA 2EYUA 5F2EA 1HE1C 2YC4C 1KGDA 1VG8A 3WBKA 2H18A 2CLSA 1G6OA 1TADA 2VP4A 1OIXA 3GJ7A 2JDID 4Q47A 3QXJA 4PC6A 3X1DA 2IHYA 3TSZA 3SDZA 4DSNA 4DVGA 1BH2A 3U61B 5ELXA 4A15A 3B9PA 3MSXA 3A1WA 2OCYC 3A1UA 3KKOA 1TTTA 4PHFA 4ARZA 4BQSA 2I3BA 2IA5A 1SQ5A 2QTVB 4W5WA 2QTHA 4PQFA 3C7KA 2OE2A 3LXRA 2ZJOA 3PUVA 1HT2E 4JYBA 4DHEA 4Q02A 4NONA 4AKHA 3FDIA 5KDDA 2BVNA 2J7KA 4MRPA 3AF4A 2CBZA 2GF0A 3W6PA 5GVSA 1G3MA 4AURA 5CB6A 1GWNA 5K8LA 1RRCA 3L2OB 4QRHA 3VKHA 1E1RA 5FUVA 1XEWY 2XNDA 1AZTA 2XNSA 3FKQA 1CIPA 4DBLC 2QPOA 3FPAA 1LV7A 1GRQA 1SVMA 2QSZA 3DDCA 4RFSB 4BEJA 3GLIB 2YOHA 1AQUA 2ZTSA 3CRVA 1EGAA 2J3EA 2DWPA 1OIVA 1G5RA 3QPUA 1XFAA 2H16A 3M1IA 5DI3A 621PA 3KB1A 2BMEA 4KVGA 2NOAA 3NIBA 1M1YE 4G1UC 1R8QA 5DYGA 1U81A 4Q9LA 5A0FA 5TY0A 5B2ZA 4B76A 4EDHA 2WOJA 1Z3IX 1G1MA 5J5CA 1FZQA 3CH4B 2V8OA 1O3YA 1UJ2A 3FGNA 2XEXA 4X8HA 1DPFA 4WA7A 2C9OA 2WJIA 2PBRA 3W5IA 4G5GA 1EK0A 4IDHA 5HKKA 1FMLA 1R0WA 4Z1MA 2IHBA 4IXMA 2P3SA 1EFTA 1QF9A 3N70A 1IONA 1G8GA 4LJAA 4LJ4A 1VG9B 3AUXA 1OFIA 4NCIA 1P60A 3K8YA 4GRAA 3W90A 4IOLA 3ZIAA 5G3ZA 1DG3A 2IEYA 1KY3A 2GCOB 4YLGA 3EIQA 4BFVA 2CVHA 2GAOA 4AKGA 1OIWA 4P3YA 4AK9A 2REBA 4QNRA 2X8AA 5HCIA 3A4MA 1W2HA 2WJHA 3R7WB 4DWJA 5FL7D 1VG0B 2NPFA 3UXMA 2C8VA 2XOKA 3J81k 1V43A 3EW9A 1R6BX 2GVZC 2FV8A 3A36A 3IO5A 2GRJA 2YZ2A 3AV0B 2N1BA 2D4HA 2VHQA 5H1YA 5KOYA 3QSYA 3NH9A 3W6OA 1ONBA 4B34A 1QBKC 4MDEA 1NN1A 2FG5A 3A1SA 2J0QA 1UDXA 3RAPR 2A9KA 4UXHA 3RSLA 2CCGA 3RSOA 4BRWA 3JZAA 3RHFA 2J0VA 1QHIA 4NBSA 1X1RA 1DAFA 1S2MA 4JJKA 5H68A 1GRRA 3QBVA 4MYHA 4NDZA 1IN7A 4I1UA 4LWZA 1R0ZA 4Q4HA 3E70C 1A2KC 4GPTA 2FPMA 4A36A 1E9CA 2GBLA 4WXRA 4AWXA 1Z2AA 2OO7A 3U7FB 2NG1A 1SXJC 3FHCB 1KK2A 1SHZA 1NMXA 4Q48A 2BJWA 2A5FA 4JLMA 5SZJA 3CW2A 3W5JA 3GQBA 1T4GA 1TMKA 3D7MA 3GFOA 4JT2A 5J40A 3KQKA 3U44A 3ZVMA 1GRNA 1W4BA 4TL9A 3B6EA 1UM8A 3OIVA 1G5PA 3FMIA 2BWJA 1JQJC 1W36B 1US8B 3QF7A 4JVLA 5K8IA 5J4YA 2O8FB 1AKEA 1T5LA 1GOTA 1Z6XA 2RKOA 1G8FA 1IBRA 1N6LA 1KSGA 4IJMA 1PUJA 2OLKA 1E2EA 1NJFA 3KTAB 4P4TA 4ZDJA 2HLDD 1I4LD 1IY0A 4OI2A 1YZGA 5FOVA 1G21E 4MKHA 1KO8A 2CNWA 4M53A 4V0ME 3LXXA 2J1LA 4LV5B 4NH0A 1G291 1HY3A 1P75A 2ZS8A 1OXSC 1ZRHA 5BXQC 4WZ6A 1U9IA 2GEUA 4Q9KA 4IOMA 4ZIRA 2PL3A 1NL3A 3K0AA 4V0LA 3TR5A 2RGAA 1A7JA 1ANKA 1QHYA 2B8WA 3CPEA 2AKYA 3IQXA 4I4LA 1RIFA 3WP1B 3TUIC 1TF2A 4TMWA 4MDFA 4FXPA 4BUJA 2IYUA 1IHUA 2RGDA 3W34A 1ZNYA 5FPTA 1W7AA 4URXR 2V7QA 2NGRA 1OW3B 2P5TB 4HSEA 4FCVA 5HPYB 1W5TA 4P4UA 1U94A 3PFIA 3TBKA 2QP3A 4MA4A 4CEJA 4WW0A 2PEYA 1A1VA 4JLOA 4OQMA 2WICA 5DSZA 4OL0A 4RVCA 4OQNA 3TRFA 2ORIA 3ZLJA 4XD7A 3GLHB 3T1OA 1Z83A 1SGWA 3P32A 5SZIA 1P2SA 1VPLA 2IYZA 3RS0A 2W2TA 3P4XA 1IN6A 4QGGA 3O8RA 1EWQA 4ZI2A 2VP9A 4Q01A 3EXAA 1MABB 1N0UA 4M0LA 1MO5A 1KAOA 1DAHA 1UEIA 3DM9B 1W4RA 4EFMA 3GEEA 3CF2A 3BIFA 3WY9A 2QEQA 4A92A 4D26A 2MSDB 2CK3A 3BFXA 5KSZA 4R2IA 4Z8XA 1SZPA 2VF8A 2HJVA 2OAQ1 3MG9A 4HAXA 4ZKEA 1ZD8A 1KDOA 1F2UA 2ZI6A 4DEYA 1DS6A 2QE7D 3ZS9A 4Q1AA 4DLSA 3BH7A 1YZUA 5DE3A 2QT0A 1XNJA 4IDQA 4Q18A 1YZNA 1T6NA 5D3MA 4XTRA 3Q9LA 1YQTA 4V03A 1XU4A 2XTZA 2KBFA 4DLYA 2JJ2D 4HDQB 4P4SA 2JLWA 3NBYC 2Z4SA 4J0QA 4MH0R 4ILEA 3VHLB 3R8FA 1M8PA 1EXMA 1AGRA 4IVRA 1SKYE 1E1QD 4L5BA 3CIOA 1UAAA 1H8HA 2R44A 4PZYA 4XH9B 1UF9A 5HE9A 5J47A 3WXMA 4UJ3A 1CXZA 1WRBA 4EJSB 2HXSA 4BE7B 1DAEA 2F7SA 5KDLA 1T3LA 2GA8A 4OQLA 1NIPA 1FP6A 3QXSA 5DLQC 2QGNA 5JSZB 3TQFA 5DHAA 2QL6A 2JJ1A 3VTKA 1VIAA 3Q8XB 2GCPA 5EE9A 2O8CB 2G0TA 2BCGY 5FI1B 5CJPA 4U7DA 2QTFA 1NJGA 4Q4AA 4A0HA 2WIAA 3OEHD 3NDPA 2IYYA 3JZMA 2XITA 2HYIC 1KNQA 3GFPA 3LAWA 3VR5A 1H8ED 4TLEA 2A7QA 1JJ7A 2Q9AA 2BDTA 2CK3D 4BLTA 5AJWA 1BIFA 1F6BA 4MKFA 3W9YA 4EPYA 2WZQA 1GP2A 4G5RA 1D2MA 5KSPA 4M9ZA 3CB4A 2IYLD 5FPKA 1HH4A 2G77B 2GAAA 2OV2A 4MUBA 4UJ5A 3MCAA 1I2MA 3WHKA 2RB4A 3KXLA 3OHMA 4R98A 4JLVA 1NBME 3OIWA 3PEYA 5JI3E 2R2AA 5EZ5A 4BEBA 1N5IA 4MKGA 3R8CA 2XZOA 4BFYA 4ESVA 2A2ZA 1RW4A 2IF2A 1E0JA 2WJYA 4NYMQ 1MKYA 3QEOA 4RD6A 3FFBA 3G0HA 4PXAA 4HAUA 4JBWA 2IYTA 4A2PA 1J8MF 1U0HC 2IX3A 1E3MA 3DKVA 2O8DA 4PO1A 4RZ3A 1UKEA 1DOAA 4YQFA 1SULA 1XMJA 2C77A 3C14C 1S1MA 2ZJ2A 1D6JA 1OH8A 4GMXA 2F43B 1I2DA 1XF9A 2FF7A 2NO1A 2WKRA 4C2TA 4EPTA 1ZW6A 4EPVA 4ZV4A 2X2FA 4JSTA 3EPLA 1P61B 1P2UA 2AFIE 2H7VA 3MWLA 5CDFA 3LBIA 2QT1A 3WNBA 3U44B 3VKWA 1Z47A 3RS2A 2V4ZA 1GNQA 4C0HA 2HCJB 2BV3A 2WV9A 3RS7A 2LKCA 3V9PA 2Z6VA 1SXJB 1XPOA 4QBGB 3NWJA 1G4UR 2JLQA 4RKFA 1EX7A 1VHLA 3MMPA 4HYYA 4I1SA 3EZFA 3R20A 1W44A 4RKEA 3NC0C 5E4FA 2YWHA 4E09A 4UKDA 1CRQA 1E2LA 4F4CA 3TSOA 2AWNA 1HQYE 2X19A 3K70C 2F55A 1E2MA 2KWIA 1M2OB 3TH5A 3H2YA 2GJKA 1D8TA 5JCPA 1MT0A 3SR0A 3GJ5A 1O87A 2BM1A 3QOFA 2X77A 1KJYA 3I8XA 4Q4AB 3L43A 2FEOA 4GP7A 5HKKD 4RCZA 3ZVLA 4OK3A 1FMJA 2IYSA 1H8HD 1PLLA 3B1VA 4XVUA 3GLFE 4Q1CA 2ZRPA 1JNYA 3AQ4A 5LB4A 1F60A 2ZI3A 3PUZA 3A1VA 2ZU0C 3NBXX 3QKTA 5HZKA 2VP5A 4KU4A 3AKCA 1P2TA 4E5UA 2D74A 3GFTA 2YWGA 3HPRA 1OF1A 2I1VB 4DIDA 2J45A 5JHHB 3T12A 1G16A 3W3ZB 5C46F 3C16C 3CNLA 5AK0A 1CKEA 3U3JA 4A0FA 4HUTA 5CYPA 4DLZA 3AEZA 1OPXA 2QMHA 2IS2A 1BO6A 2BC9A 1E6CA 3PQCA 4EJSA 2ZI7A 2GCNA 1T3HA 4A6PA 2JEOA 1UKVY 3AKDA 3N2EA 1OFUX 2GXSA 2VSFA 2ZRLA 1II0A 1L4UA 1OE0A 1N3BA 3L0PA 1VCNA 4LY6A 4XJXA 3TE6A 3BRWD 3EX7C 4LYAA 1EWRA 4B2PA 1FNMA 2RGXA 2VLIA 4LI0A 3I5YA 2IYRA 1OB2A 4OHVA 5DIFA 3VR4A 3TVDA 4TWZA 2WWGA 4TL6A 4PTLA 3HP1A 4H1UA 4PO9A 1F5NA 5F98A 1NVVQ 1OH6A 2FGKA 1GTVA 4G5OA 2ZU6A 1N6KA 2Q9CA 3Q7PA 3RDPA 1JR6A 2JLYA 1Y3AA 3CLVA 6Q21A 3QXXA 1G8HA 8OHMA 1FW6A 1LVGA 4B3DA 4XIGS 4TSFD 4PQRA 2EYQA 3ZDQA 2QN6A 3GCGA 4XVQA 4BLOA 4EQ6B 4F92B 3HR8A 5D3QA 2P0EA 2V6IA 4NP6A 2IF0A 1G7TA 4L15A 5TDHA 1ZMXA 2HV8A 4OYHA 4HLQB 2CCKA 4MYUA 3RYTC 2QY9A 5J4VA 5E7JA 5C4MA 1GFIA 2RHDA 5AUOB 1IQPA 1CR4A 2IWHA 5FBWB 1RKBA 3FMPB 5KPJA 1QHXA 2IK8A 5HE8A 3CX7A 3IIKA 4D82A 2J0SA 4Q1FA 1COWA 1M74A 3LLMA 3T61A 4EAQA 4F38A 1XTKA 1ZVQA 2OESA 2XZLA 1TEVA 2HF8A 3QF4B 4FMDF 4Q7LA 4PHHA 2H17A 4MRSA 2EFEB 1Q57A 1IM2A 1P62B 2N46A 1T0JB 2B6HA 5BYJA 4QJ3A 3EC2A 1NF3A 3ND8A 5JS7A 2ZSAA 4P0TA 3U2QA 3IIMA 1SVOA 2ZS7A 5FL3A 1A4RA 1QHHB 2QP9X 3PITA 4DLRA 1PLKA 1DAKA 3P27A 2GJ9A 1KI6A 2VHCA 4DUGD 3SNHA 2KI5A 1U99A 3BBPA 3IIJA 4TT3A 5KYKA 3ICEA 1Q12A 3T15A 2J7PA 2QG6A 3RC3A 4B3BA 2H8KA 1G19A 1G64A 1HURA 1T8TA 2F3TA 4ZCIA 3EZ9A 3KXKA 5KTYA 3AVYA 1E9AA 4KFSA 2IYXA 2V55B 4BFWA 2C99A 1II9A 4C0SA 2MMCA 3T06B 5CDFE 5EZ6B 2JLVA 2A5GA 3AVWA 4YONB 5KO2A 3REFA 3ZGXA 2JCSA 2KBEA 1GG2A 3BJIC 1LB1B 2VL7A 2WJGA 3GLFB 1EESA 1CS4C 2ATVA 2FOLA 1WCV1 3ZJYA 2OILA 2WWFA 1DO0A 1FQJA 3IUYA 2PMDA 4QBIA 1XD2B 5TARA 3OE7D 4Q21A 4C0LA 4B3CA 3K09A 1NN5A 1KI9A 1YZKA 2W6ID 5KDOA 4OQXA 3SFZA 3TQCA 3TKLA 4Q9HA 5C18A 2ZR9A 2HJGA 3VQTA 4US2R 1XEXA 2QSYA 1KMHB 2B92A 3L0IB 4NCNA 4V0NA 2J9RA 3V4RA 3T34A 3BFVA 4PZZA 4CF7A 1XMVA 3ASYA 4ON9A 1E9RA 1CJTC 4QKQA 3BGWA 1JXMA 2P2LA 3SE0A 3ADCA 1CJVC 1QRAA 1OKKD 4UXIA 2WMOB 4LBVA 1OFHA 4EPWA 3VU9B 2GNOA 1OH5A 2H92A
chains in the Genus database with same CATH superfamily
1B0UA 1FFGA 2L0XA 3KZKA 5KBYA 2HEIA 1Y3DE 4MAAA 2QX7A 2XUFA 1TVMA 5F1OA 3RRFA 3QW4B 4Q4JB 3L4EA 1C9EA 2IQIA 3IP9A 3TK1A 1MB2A 3AP3A 1DNPA 3FYSA 1QGUA 2Q07A 2P0AA 2QVLA 2BL4A 1GTJ1 2XUQA 3NNNA 4UMDA 4OH1A 3COWA 3ZNOA 4HNUA 5GJWC 4FR2A 4Q3KA 4URWR 2MSKA 2PRKA 3WYNA 3D4OA 2NZ8A 3P2EA 4FIZA 5A7FA 1E5XA 1Z0JA 4ZOBA 1V71A 1Y4UA 5KQRA 4F2WA 2IDJA 2ZJZA 1QHNA 1X7ZB 2Q6IA 2IEGA 1X77A 4I5EA 4DQ0A 3CU5A 2BYTA 5HGJA 3MMZA 4V24A 5B6JA 1XJWA 2CFTA 1JPJA 1NUAA 1UDBA 1Z8FA 3OWOA 3VDRA 2G8NA 4TYPA 2Z5VA 4Q03A 4PR0A 5ITZA 1IWBB 1A9XB 1ONPA 1U02A 3DW1X 2LXNA 3Q7EA 3MWJA 4I0WB 3KNZA 4W9MC 3URKA 3CKLA 3KZNA 3NDRA 3RRNA 2RH5A 3QY0A 2DBYA 4P4NA 1YS7A 4TZKA 5JMPA 1Q0SA 4L75A 5K20A 5JCJA 5D5HA 3FWNA 2A3NA 1SHLA 1G7CA 1MQ8B 5HTKA 2HGZA 1KOGA 4QC2A 5EVJA 4B2LA 3GBPA 3WGVA 2IW3A 3VSBA 2W22A 3ENKA 3HG7A 3MA0A 4JX9A 1WD5A 1I1QB 4HCJA 3AR2A 4QJ5A 4Z4HA 1EXDA 2ETXA 1IBLB 2CNNA 1QCDA 2AR9A 5A0TA 3G1WA 3KCNA 1BQEA 2R60A 1ZXXA 2J6IA 2OYSA 3F5MA 3PDWA 2FG7C 3PDIA 1AE1A 3DYIA 4WOJA 1KNXA 3VDQA 3VU0A 5L9AA 1DRJA 4MWEA 4BNWA 4AJOA 3DOUA 4CM4B 4CKBA 1SRQA 1EM6A 4JEIA 4G2NA 4A8JC 2P6RA 1T2UA 1NVWQ 2X8LA 3STUA 1E3QA 3KQVA 3MUOA 3WYFA 4UBNA 2H57A 1E6UA 7MDHA 3HDQA 4UVDA 3D3JA 3V3KA 3GZ4A 4ZGGA 3WMXA 4DQVA 1Z25A 2CFRA 1NE7A 2LWIA 1Q0HA 1TZKA 4J76A 2O0MA 3EDMA 2ZRCA 4MW4A 1DCTA 4JAVC 4WKNA 4ZEXA 2X6RA 3TLZA 2XXBA 3KOXA 2OQVA 4Y2JA 6ADHA 1FP4B 3QEMA 3WL8A 4I50F 3FYTA 1KVRA 2H4YA 2QXYA 5CX1B 4CEHB 1R1DA 3E9NA 1EK5A 3ZD6A 1AGNA 5DB4A 1YK1A 3IULA 2Q5HA 3U3DA 3ET4A 4GI3A 1EFCA 2A1IA 3ML1A 2FPSA 4RABA 2ZWAA 4CG0A 2BDUA 3QITA 2GS9A 1TUIA 1HE4A 2BW0A 1XX6A 3GJ8A 2A30A 4HDAA 3IDQA 1SQ6A 1SQSA 2DVMA 1Z0AA 5TMBA 3TZEA 3EMDA 1TAGA 3STTA 2J3LA 1DKMA 3QWHA 2EBUA 3GRZA 1PYOA 1EEHA 1R2QA 3PT9A 2A5YB 2NU6A 2OGTA 1BDMA 4OQPA 4GOND 2ATEA 2KX7A 1JS1X 2YYAA 5ALSA 4BY9E 2JJ8A 5HFJA 1T0IA 5ALOA 3U7IA 1ZUHA 3CG0A 5EIFA 4EIWA 2JFFA 3DLPX 4YP5A 4F3KA 2EIHA 2XOXA 3HKBB 3ONEA 4ETIA 2I2WA 3GCZA 3GMTA 1U8TA 3RS5A 5A6SB 4O59O 3EPHA 3PZBA 3VR4D 2PUGA 1FFYA 1Y4DE 2J09A 1BEZA 2VCYA 4PVDA 4XQCA 3OY7A 4IQ4A 5A2GA 1OT3A 2BHLA 2Q7XA 3B1ZA 2C4TA 3BAFA 4FYWA 2D7DA 2BHNA 4LJ8A 3HA2A 3VZRA 1Y37A 1GKYA 4V39A 4AP5A 4MQFA 4UCFA 4IF4A 3S1SA 3K70D 3NUGA 3HWWA 3LO5A 1DG1G 1Q50A 3ZNNA 3RT7A 2FMXA 1R37A 1SELA 3I45A 3V6LA 1JFTA 2DFTA 4WOPA 3R4VA 4H1VA 1IL0A 1E4YA 3F4BA 1NYRA 4ENUA 3KSUA 4O5OA 2X40A 3RFCA 3UXYA 5JJIA 1SU8A 1ZOOA 3RR2A 4KC0A 4LC1A 1N3IA 4K81B 1D1SA 2ZYSA 3DXZA 3E3OA 4J2HA 2QRUA 4GRDA 3FOWA 3THXB 5LU8A 1EBBA 2ZRGA 3OLYA 4DA8A 3UMVA 3QE2A 1FMTA 1X7YA 2O52A 3IEUA 5F33A 5A6SA 4X6UA 2Z8ZA 4GGOA 3JAWA 3UWOA 3ZYZA 1C80A 3WSTA 2Z83A 4L0QA 1RBYA 2HWXA 3D81A 1I7PA 1PSDA 1WMBA 3B9RA 1TI7A 4QHTA 4RA9B 2NUTB 1UBCA 3MCWA 4ASUD 4CEJB 3U39A 4IOKA 4B3GA 1TVEA 3SSMA 1C4KA 2OCXA 1KZ6A 3BL8A 1OAOC 1JFRA 1EUDB 3VMFA 3T5GA 1FP2A 3MD9A 4DJTA 1AB6A 1C8VB 4ZVLA 1Z4LA 2GEDA 1OOEA 3LFHA 4Y30A 1W29A 5DHUA 3DO6A 3Q7QA 4C4XA 5AIBA 2JGDA 2ID9A 2XQJA 3A28A 3NBZC 4QSMA 1JEEA 4MJLA 3UAOA 3LRPA 5JARA 3E84A 3WGUA 1UJ4A 5DTEA 2YWEA 3IMFA 1CC1S 2OD7A 2FR1A 4Q1EA 4R83A 1FLDA 4AMYA 5EIWA 3BD8A 1RXYA 4PTYA 2DR3A 2HDWA 4XPZA 3SZGA 2FN4A 3SF8B 3Q3CA 3DB2A 1XZCA 4EI8A 1VHJA 3WLHA 3R3YA 3OKFA 4PCVA 2G80A 3R74A 3CSDA 1AKNA 3A4NA 4K9SA 2QVZX 1EZ4A 2PSDA 3LE8A 4TS1A 4WACA 4BCBA 1OH7A 1PJSA 4H31A 4A27A 2OO5A 2AMLA 1WSDA 5FH9A 2I5PO 1Q11A 1T1GA 3DONA 4M7RA 4IIFA 4CWAA 3CCFA 1NVVR 4D9NA 3QYPA 1JQLB 3T4XA 1SVKA 3FD8A 5B58T 1XMSA 3D6FA 3T99A 3UW3A 4BO5A 1FSFA 1RCUA 2EFYA 3WLRA 3FUVA 3UAYA 1R5OA 3O3OB 4R7ZA 1XZLA 2XB6A 3LBNA 1NBMD 5DNWA 4UTXA 4A82A 4YRNA 1L9XA 1QIJA 4AZVA 4CEIB 1WWKA 4WEOA 2RHBA 2PUHA 3BTOA 4W9RA 1Z17A 3WDKA 3DNMA 2XCUA 2O4UX 2QX8A 4HEQA 4M0MA 4D9HA 3A11A 1KS2A 3L82B 4FGWA 2ZSIA 1VCMA 4X84A 4F45A 3TIGA 2OBFA 2VUIB 4QTYA 1F8UA 1LFAA 3BB3A 3VR2A 3HSYA 2EFJA 2WU8A 3OE4A 3U4QA 2GBFA 1XSEA 2ZREA 1M6HA 3O47A 1XWIA 1FSZA 2ZSJA 5DW3A 5KOIA 3MB5A 4ZT3A 3ZGOA 4TYYA 1N5DA 2I33A 3WMRA 4CG3A 4K9RA 3IVXA 3RLFA 4EW1A 1N57A 4Z1MD 4MI1A 1L5VA 2EW2A 3QKUA 4JOBA 4RF5A 1ZJ5A 4W1PA 5FUXA 3UH0A 4RZXA 3V4LA 3KJFA 5THKA 3RSQA 1UKYA 1IZZA 1GZHB 1W5SA 1UFKA 3AM3A 1HKUA 3M33A 3HLKA 3QNMA 4LYYA 2DHCA 4YAEA 4YACA 1TK3A 3S81A 2BSQA 1QTQA 3NBAA 2BKXA 1NVXQ 1LUAA 1WPRA 3G49A 2R8XA 4R1OA 4C2AA 4Z3OA 2W5UA 2N0SA 1JH9A 3AFIA 2FPPA 4KN8A 4PG7A 1F0NA 1LNZA 2QRVB 3EXHA 3N3AC 4DNXA 4B6JA 2W2KA 1T43A 4N3AA 4JYMA 1YV9A 1XHLA 3KT3A 5F2OA 4GR9A 5ICSA 1K8QA 3N2IA 4HNAB 1CUJA 4OJMX 4XIYA 2PWAA 2E48A 2YWRA 4UVEA 4W1SA 1FB5A 3HU3A 3BHIA 4KK4A 2IITA 3PD0A 4X7BA 3ZD9A 2PDAA 2WM9B 3E9RA 1P1JA 2FB9A 4A0QA 5IHXA 2EDCA 1GEGA 3BVPA 3MS4A 2JH8A 2PUCA 1KO4A 1CB0A 2V4UA 3K1YA 3ZTWA 5JJ5A 2OL4A 1YJAA 3VPDA 3FW1A 2QUHA 2VDQB 1TEXA 2D00A 2IX9A 2XNKA 3PWSA 4FJ1A 5CW1A 4KVFA 4RY2A 4XTCS 1MC5A 4O0MA 1L7MA 2DKNA 5BRAA 1IBMB 3RGGA 1IOWA 1SXIA 5DNUA 5AVWA 4CMHA 4EJ0A 1USGA 1PF7E 2JAOA 1LVUA 3DE1X 3V1TC 1RFLA 4BB0A 1B3BA 1JHZA 1XD2A 3FPBA 4M1KA 3LWZA 4QUAA 2M6RA 4UARA 1WXDA 3BG5A 2QVBA 3CCBA 3EB9A 2X3FA 2I9KA 5J1TB 1KDRA 2EHDA 5DFAA 1W6RA 1Z6PA 1U3FA 3PGXA 2HCRA 1G8PA 4WJLA 3DPIA 5I5GA 1MENA 4J6FA 4NZ9A 3T7TA 1PDOA 1GGNA 2UKDA 3M4YA 1SXJE 3LD9A 3PRJA 3PCXA 2J9GA 3R6WA 3LDUA 4MCJA 2RONA 1A8UA 4CFSA 3G59A 1D2AA 4E4YA 4EJ2A 5K3EA 5JYEA 1GHTA 1RYNA 5FTKA 4CIBA 4EABA 3GEIA 1KSFX 2XB4A 5HRAA 1RRPA 3WL4A 1ZUIA 3OH8A 1DJOA 3LXMA 4BATA 2H2GA 5D87A 3QE0A 4D8VA 1JSXA 4LZLA 3N53A 2WAAA 2CJFA 3PYMA 4JVMA 1UAGA 4QQRA 1D1PA 1VFPA 3JVUA 4BLRA 1OTHA 3D59A 4IJQA 4N1AA 4ZFNA 1FRFS 3JVEA 1AK1A 2YHSA 4NI5A 3A6JA 2I2AA 5EESA 5FX2A 4YHHB 1A5TA 1BXRB 1B26A 1K1EA 4EYQA 1KVUA 1E2PA 1QQ5A 2VHXA 4CUZA 3EOZA 5IHPA 3LBFA 5H82A 1NATA 2JEZA 4XGQA 3SXUA 2RC6A 4NS1A 3J81A 1U11A 1ZD4A 2DFDA 2HBQA 1X3LA 2GZDA 2PRZA 2NYRA 3N8IA 3O0TA 4FQ5A 4OXIA 5CK4A 4M8LA 1ZOIA 4WZAB 3ZH2A 3C8UA 4AY5A 1ZIDA 4UEKA 4AF7A 1N5LA 2O57A 2GD0A 2I1QA 1Y7PA 2XD4A 3GT3A 3AUYA 4B33A 1P9NA 3FTQA 3LCMA 4Y0VA 5A4AA 2V6FA 3PB3A 4M36A 3KSBC 1ZCZA 3WNDA 1AA9A 3S0JA 3ITNA 4DLWA 5BSFA 1N0HA 4XOIA 4MTLA 2CHGA 3QELA 4BN5A 4BJ3A 2VKQA 1Z36A 3F78A 3M6LA 4J91A 2AB0A 3SN6A 5IVHA 3HJCA 1GRCA 3AR8A 2FNAA 4E03A 1E5LA 1M6VB 4EA6A 5KKAA 2QHXA 3VJKA 1S96A 2NSYA 4ZREA 3UG6A 2SECE 3P8ZA 3A2KA 3DOEA 4I2NA 2OHFA 3FLMA 4X8MA 4N03A 3EE6A 1ND5A 1EM8A 4QDKA 1E94E 4DIEA 1QH1A 1QOZA 2WWXA 5EIEA 1MJNA 1Z74A 3O8OA 1SBHA 2PUFA 2ID4A 3FB1A 4LS3A 2DAPA 3ZCRA 2XT0A 4EHLA 4HPXB 4YJFB 5TSDA 3DTVD 3IBCA 4L9SA 4DGQA 1O58A 3B1JA 3ESYA 3MRSA 4DLUA 4OMCA 4EA7A 1EGVB 3D3WB 3F8TA 1ZH8A 4D4LA 1QRSA 2YV1A 2FSVC 2A88A 2DFVA 4C9BA 3UT5A 4PSDA 3QUQA 2PD6A 2GYWA 1QYWA 3FOZA 1DIBA 3X1MA 3PVZA 4N7RA 2MR5A 3A4LA 5BN1A 3QZUA 2EKLA 2AC2A 1DWPA 2I3DA 2R5FA 4PU0A 2FP4B 5EKUA 4B48A 2PT5A 4AJKA 3E0XA 5E7IA 4MLDA 5JSHA 1GM5A 4POAA 1DARA 2VHWA 3ZWCA 2COUA 2NV6A 2VYVD 3MT8A 5IDQA 1SKQA 5LFAA 4DWOA 1THZA 4YUVA 1XBTA 4AO8A 4ZPJA 3AFOA 4O4HA 4OD0A 2XKJE 2O8NA 2GT1A 3B3QA 1VOTA 2VHVA 3JZFA 2QM0A 3UHPA 5FEUA 4RMHA 1CZNA 5IJAA 3JD1A 4NJEB 1OXTA 4YMSA 3I9V1 5F64A 4CLHA 5FTLA 2PBZA 2PEZA 3EG9B 5C34B 3W2GA 1W0JD 3BD7A 4HO1X 1ULBA 4IFIA 3LX5A 4PPGA 4W7SA 2KSQA 3KEGA 4FZJA 4BPRA 4ROSA 1VL5A 3O83A 3QVSA 2GZ3A 2ZE5A 4R1NA 4X6XA 2IXGA 5KX5F 4LHYA 5CT4A 3EAFA 3VVMA 4BS9A 4G41A 5EHQA 4DJFC 3Q41A 3ROMA 3QMMA 3O4JA 4RS4A 1F2TA 1TXGA 1T0PA 2ZCUA 1E9BA 4JLBA 1U5CA 4PBSA 3UKOA 3V1KA 2XVMA 3OOYA 4XYBA 1RJEA 2C7OA 2PLRA 2B21A 4JLPA 4GZLA 3ZHRA 3IO3A 1JKMA 1Q0RA 4EI9A 1P4SA 1BKSB 4I1RA 5AI9A 3TJRA 4DIMA 3QJYA 4EUEA 5BR7A 5A4MS 4WKPA 2ONYA 1XDDA 1LPAB 3LQ2A 4ZJUA 1A5ZA 1ZUD1 5BUSA 2BH9A 4DCJA 3W5AA 4QNNA 3WAKA 3K9QO 4OH7A 1QYXA 4F2DA 1NULA 2DH5A 3P45A 1I2BA 4Q05A 3I01M 3IKMB 4IAOA 4NMLA 5IYZA 4HP8A 2Y93A 3C1OA 3HA5A 3G3EA 3K0CA 4RSRA 4XCVA 3CFYA 3K30A 4HDKA 5ESDA 3U4QB 1NONA 3TIFA 3PPVA 4DMRA 1KDTA 3AH8A 4DABA 2O59A 3T1QA 3SZMA 3MWEA 4QGBA 3PWKA 3N86A 5DN6A 4U39A 5GM1A 3U7RA 1C4WA 2WVJA 5ECYA 2GBLC 3P5BA 1A72A 1MG0A 1B23P 2P9YA 4N0EA 1T2CA 3WQRA 3OUTA 5AI0A 2O0LA 4XDZA 3FNIA 1KJ9A 2Z4TA 3F71A 3O31A 1UBRS 1OLSA 1A9QA 4P31A 3BC1A 1P7WA 3DC2A 2F2TA 3EISA 2GN2A 5LKAA 1NX6A 5BT9A 1SVIA 3ZZTA 1JKJA 5ESWA 2HC9A 4GI5A 3U19A 3KJZA 3T3PB 5BR4A 2ZBPA 2HD4A 4Q00A 3CWZA 4U1RA 1QG6A 1K7XB 2XTMA 3B9BA 2ZBVA 3T35A 2I4NA 5TX7A 1YC5A 3QLUA 4B73A 3ZHTA 4BAGA 3QVVA 1TFUA 3HVJA 4DRXB 4ZAWA 4AZ0A 3MK31 4E4TA 1VHTA 4P0PB 1Z4QA 3U48A 4AQYB 4WXHA 4MDFA 4LJ6A 4EF4A 2KYRA 2RAPA 2ZUCA 3K96A 4EG0A 2PUTA 5KU1A 3O8CA 1FX0B 1TKBA 9MHTA 1NUUA 4RVHA 1V45E 1S7CA 3KZXA 4I36A 5LOVA 5CEEA 3AOGA 4GX0A 3RHTA 3OLCX 3P2YA 1WQ1R 3OKPA 3GPIA 1UBEA 5BWBA 3OM0A 1E5QA 4QEDA 1D2EA 2ZVDA 4RV9A 5EWJA 5CH3A 2CLEB 1QG4A 4JQZA 4G23A 4BLSA 521PA 1EJ6A 4CQLB 2E1RA 1KPHA 3KQMA 4ZO6A 3BSFA 2EJCA 1QMGA 2WE7A 3OCZA 4GECA 2YS7A 3OFJA 4IM7A 3FSRA 3HZZA 4LYGA 3S2GA 3ROEA 3SYNA 1OX4B 2ZBEA 3MS7A 3LM8A 7GPBA 2CE2X 4PC2A 2VPIA 5AW6A 5B3JA 3L6UA 5DU2A 1S8NA 2P6OA 3IP1A 1MRZA 3NFYA 4JMPA 4K3VA 3HY6A 1OZ0A 4BFUA 1VRVA 3TQHA 1VJCA 4MR9A 3HU2A 4I1PA 1JE1A 3MAJA 2QLNA 4R3WA 1VHWA 1AKVA 2QAJA 4CM5A 3O03A 2RCYA 2J0UB 1X2EA 1ZJ6A 3LT5A 1ORDA 1ABFA 3IPAA 4RJTA 3ORRA 1JKFA 2DM6A 1MX3A 3HABA 2TMGA 1ISHA 1GFWA 2PX0A 5BOSB 1DQNA 1E8MA 2SBTA 1KMIY 2GLXA 2X5KO 2AD1A 1NJ5A 2AGVA 2ST1A 3OEHA 4IVPA 3EIWA 3GXBA 2P4QA 1EJBA 1ONSA 5ALDA 1CSEE 3ZD7A 1EAMA 2WU1A 3D8UA 3MWKA 3VJMA 1GDTA 4RFVA 5JXJA 2GR9A 4FFDA 4ER7A 2IS4A 1JHPA 5FUQA 1OYYA 1XQVA 3OF3A 3WISA 4E5PA 1XWWA 3WKDA 2ZUFA 1Q19A 1QORA 1H2YA 3EQ9A 4PFJA 1CNMA 2O2SA 5F3DA 4GXTA 4CM4A 3H75A 1EU1A 3L07A 3OIUA 5JJBA 4AJ1A 2PL9A 2XKBA 3EEBA 3JSXA 1DCMA 4GZMA 4IDBA 4LOHA 5UKDA 4CM1A 1RZRA 4P3OA 4W5QA 3L1UA 2GHTA 4Y6QA 4RKWA 3UTDA 4Q7KA 2PJRA 1GZ3A 1KEUA 4IFTA 3ZI7A 1OBCA 3MQ2A 5G2OA 4E2YA 2VTBA 4EZBA 2REOA 4GC5A 1JFVA 4MUHA 4CKWA 1XZEA 4MP8A 2BFFB 1HLFA 2CXHA 1XCGB 2NU7A 2VBGA 3P9SA 2OB2A 3SX2A 1D6SA 3VHXB 1C30A 3PNQA 1SCJA 4QXMA 2FXIA 5B3LA 1VLHA 4WCFB 3HCNA 4GEGA 1WW3A 2H5EA 3RPEA 3UENA 1ZJWA 3HKBA 2CB0A 3UPTA 4NNJA 2RBGA 1XAGA 3RYFB 1K0UA 1VIVA 2X5NA 1QONA 1RSZA 4RPLA 3LQQA 3GC6A 5AQEA 3Q7TA 4I6EA 3FPJA 4P58A 4ARVA 3U17A 1MOQA 2KQUA 1TF7A 3ABOB 3H9BA 2JHCA 4R2JA 5AVKA 2HJSA 2HJHA 3DZGA 4D3ZA 4KBFA 2YJNA 5FT9A 3RJ9A 2G3YA 3MEQA 1D7OA 3BXEA 4W5HA 1C7FA 4I4TB 5TB5A 4KN9S 5T8KC 3ROTA 2HT6A 3OTQA 4HZIA 4XD7D 4EGSA 1WDWB 1XNQB 4AD8A 2PUBA 4NS4A 4CEHA 1Z18A 3R7WA 4L3VA 4B0PA 2YJGA 4B85A 2HA7A 4I50A 2O2XA 3ST7A 2UVQA 2BGLA 5G4LA 1U7OA 5EJ7A 3EEFA 3ND6A 4IYRA 1A69A 2AT1A 4ZODA 5A3VA 3S2FA 4A5SA 4I50B 5CB4A 4EELA 1LA2A 2I4MA 3RJ5A 2Y1EA 2GESA 4PIPA 4ZVTA 1ELOA 1RYMA 3KVRA 3NOVA 3PPXA 4RMIA 4YCSA 3OFVA 2XTAA 4NJMB 2OXRA 3C43A 4QYXA 4RQTA 1SKYB 3SIPA 1E2BA 4JB0A 3M1LA 3ZU6A 1FSSA 2RG1A 3WQSB 4E31A 4A2WA 5L4LA 1O94D 3FTNA 3WLLA 3OCWA 1AUVA 4JVNA 1ZSVA 3RV4A 4CTJA 3DO5A 1E7QA 2ZJ8A 3EGXB 2BOVA 1Y8RB 2BFBA 5KYGA 1SWVA 1J8FA 1QC5A 3ANNA 2C2ZA 3AEQB 5CXXA 4OFZA 3I53A 5T3YA 5GVRA 1MO4A 3HJTA 2FFRA 1WMSA 4WKOA 2GXUA 2I8AA 4LHSA 3OZTA 1OX5A 3LFUA 1O96A 2QRJA 3O4FA 5JAZA 2BGWA 4WV3A 4IIJA 1ZM4A 2F1HA 3SQWA 2WV7A 3ZHYA 5ALNA 2VDPB 1XHFA 2LVBA 1N75A 2O2GA 2QU7A 3BMNB 1H1TA 3F9RA 1HE3A 1L7QA 1YT5A 3AC0A 5D3MB 3WLQA 4EY6A 5KOHA 4XLLA 3M82A 1MV5A 1DIRA 2J48A 2XNCA 2W0MA 1NUPA 3MRXA 4K28A 2MR6A 2BIFA 3Q0TA 4Y2RA 4ZALA 4FBGA 1ZNZA 4UC0A 4QU5A 3VX4A 2QJFA 1QFYA 1Y6RA 4P7GA 1K8RA 4GBMA 1AK9A 2XF2A 3ZCVA 3TTXA 3COZA 4FZVA 3I4LA 3LH5A 2FEMA 421PA 1E0AA 3QVUA 9LDTA 3C7DB 1CTQA 1V25A 1YR6A 2AW3A 4RJ2A 1L6RA 1GZ7A 2VOJA 2G36A 4EUFA 3OOSA 5DGIA 5JDCC 2IXEA 3WB9A 4B6FA 2B1JA 2Z6UA 3S2UA 4EQZA 3ZV6A 2V98A 3PFHA 4FFSA 5FCDA 5EQTA 1Q74A 1BEUB 3HLYA 3BJMA 3D7KA 1E2QA 2FDRA 2YZMA 1E6KA 1XA0A 3H17A 4XWKA 3EFHA 1O4WA 2VF2A 1X9HA 4KQ9A 1HT1E 5HP4A 4PN7A 3PUWA 4F5WA 2DTXA 2RSLA 3EZNA 4BNUA 3F7MA 4GFDA 5IDXA 2V6BA 1U5BA 1D03A 1X9GA 4RQUA 3V97A 2AZXA 1C1HA 1RJ9B 1S89A 3DH0A 1VYTA 3FOBA 3H9GA 2JGDB 3OIDA 1M6EX 1RRFA 4OB8A 1YRQA 4HV4A 3D3QA 1G60A 2ETVA 3MT9A 4LPKA 2SCUA 1ZXLA 4K6FA 5L3SB 3B13B 1HZZC 2J9FA 3JWHA 3PA6A 1QV7A 3NPMA 4FYYA 4OSOA 4JGBA 3OQIA 5EWMA 2I2XB 4AXBA 3LGXA 1JDNA 1WUIS 2PAAA 3BOSA 1LTHR 1WE2A 2B4QA 1XJQA 1LXCA 1PL7A 2NUPA 4H0CA 4HADA 4HGPA 4CT4B 1FTGA 1XZQA 4ITVA 3LW7A 2P2SA 1OUMA 3BF7A 4EUSA 3DZ8A 3R7NA 4PF1A 5LJLA 3WR5A 1SHUX 4YPVA 1E2IA 2XCIA 4YUXA 3SI7A 4YMWA 2W2VA 1HO3A 4EJ6A 3TOVA 3EMVA 1DFGA 4HRXA 3ED5A 2APJA 3KB6A 4D8YA 5LXTB 2OYCA 1LQTA 3GMDA 4MGIR 4R3UC 1U7ZA 1L7AA 4OL9A 2R1UA 5IJ9B 2O50A 4RXTA 3ZLVA 2B7LA 2XX3A 3DOCA 2YFKA 1FFEA 4RHTA 5AUNB 2B0CA 4J0HA 1ESMA 3FYDA 4FC6A 4BHTA 1EE2A 5JH7B 3R3WA 4CF4A 1IAQA 1ZUNB 2HI0A 2I3ZA 3KD3A 3NYWA 3U4HA 5BNWA 1TM5E 4AECA 2VP2A 3N9IA 5LWQA 4TS4A 5K0FA 5G3YA 3PXBA 4DV6B 1BWSA 1JHAA 1ZMOA 2VR1A 4KFTA 1QDEA 1T5IA 4YYZA 3GUYA 2VYCA 2BUBA 4L76A 3O4IA 3KOZA 2BR5A 1AXGA 2HSWA 5LZ5A 5IT9A 1Q0PA 2CNWD 2V5UA 1FLAA 5FYQA 2ODAA 2R00C 3INRA 1ZR2A 3HXQA 1GLNA 2FSHA 2OY0A 2QD4A 2VAXA 1O95C 2ZIUB 3ZHVA 4CIVA 2DERA 2O8BA 4RULA 1P2VA 4AO7A 1Z68A 1IN5A 1KI1A 2XDQB 4WXMA 5AK6A 2VIIA 1GCAA 3CSSA 4X94A 4C05A 3NTXA 4EMSA 3II6X 1J2YA 5AH0A 5IX8A 5I7AA 1GKLA 3R0VA 2DF8A 1KJZA 2E2WA 4YDHB 4WI1A 1FYFA 1W2GA 2F00A 3KYIB 1GSIA 3PSHA 4KRXA 5EP1A 4LQDA 3NXKA 1N3LA 5CHEA 3VRHA 1XEFA 4X1YA 4D25A 2CMHA 4TMVA 4RHYA 2LUOA 4OUDB 4RV5A 5DHFA 3J80A 5ALIA 1K8YB 2XJ9A 4Q82A 1CE8A 5KYWB 2JIDA 2ORWA 2VCEA 4URZR 4AJIA 1IRIA 1RXWA 1VKOA 4EKGA 3BXXA 5CG1A 5KYWA 2HPAA 4NFHA 1SKUA 3OCJA 2FXVA 3Q0EA 5E7MA 4RH1A 2V45A 2G06A 3AVOA 3VO2A 4Z7OB 3L0CA 2I66A 1IWPB 1Z29A 4K8RB 2I2FA 4PANA 4D9EA 5KYXA 1PT7A 1IC6A 3D6UA 3IE0A 4FMDB 3V2GA 1MD9A 4EQ6A 4AS2A 5HZGA 1BZYA 1KFJB 5TE9A 2OFXA 1Z4OA 3GG2A 4W5RA 1A98A 4NXNB 2GM4A 1PL8A 5KQPA 1OGJA 3F8WA 3L8YA 3NIWA 3A9SA 3GL9A 3PHGA 4GOJA 4XXHA 2FFQA 3UMYA 2A1TS 5CDTA 2O7SA 3S1AA 4P38A 4LXIA 1KDYA 4HB4A 1L4KA 1C3XA 1DCFA 5MGBA 2LKDA 4EPXA 1ZK1A 5BNTA 3SC3A 5BRNA 4BLUA 2FPXA 3UJ6A 3L0YA 3G2KA 2ZG6A 5IFLA 4NABA 1FQKA 5D00A 4C4AA 2BEWB 5LMZA 3O8DA 3NHAA 1ZCAA 2H8GA 4KYUA 4QNMA 4L27A 4Z3DA 2JJ2A 1MC1A 3AIMA 5IT0A 1AQIA 2P2ZA 3RAEC 3W3AA 3FMOB 3L8DA 1EFVB 1WOMA 4D5GA 1ISRA 1D2NA 5ENDA 1FRNA 2J5KA 1FXUA 4M1WA 3EF0A 2DBQA 2VZLA 3ESZA 3WTCA 4V3CA 2HA0A 3DDHA 4LA4A 3OIYA 1JBEA 5GJCA 4W5TA 1QK5A 1E1NA 2P27A 1P7ZA 2JARA 3OP1A 4JVSB 2FDCA 3L84A 3SZRA 3DOJA 3VAYA 3AERA 3BERA 2IHUA 2GBPA 1I51A 2ZTMA 4G09A 5EZQA 2FYTA 3PE6A 5GJBA 4DCPA 4ZMRA 4O4HF 4B87A 4JLKA 2IY7A 3QTLA 2CE7A 5DTIA 3ZHBA 1TRHA 5EKXA 1R64A 1WCIA 3TMKA 4BN0A 4EP1A 2R7LA 2PM8A 1HOXA 1O7JA 2VTKA 4F2PA 1AURA 4ZCLA 2VJYA 5ENVA 3U6KA 1B15A 3B85A 5DOVA 2XYVA 1B3RA 3TRIA 2XXAA 2I22A 5AK3A 3SE7A 4EOGA 3HZOA 3HCCA 2O2CA 4Y8VA 2YV3A 3U62A 1HV8A 5FAKA 4TS3A 3KYCA 3M4XA 4B4UA 1A82A 1F06A 4R1UA 1PFGA 5IM5A 4DTCA 3AJAA 4PO3X 3RADC 1QGUB 2ZJAA 4I3FA 2XUPA 4PBRA 1NBEA 3TRKA 1HWYA 2C3YA 4WJKB 4AYTA 4QG3A 1WS6A 5LDDC 2XD9A 1U5AA 3DKPA 2ZYUX 3S1LA 1CYEA 2JGJA 1ZKMA 3I05A 3KDSE 5IAJA 1YRBA 2E4AA 2JIMA 4X60A 5CFMA 3UK2A 2Z0MA 3VA7A 4UBJA 2ATCA 2ODPA 2E82A 1JN0A 5ALJA 5AKYA 2CNLA 1V8ZA 2OAP1 2XI4A 3A8TA 3BXOA 1ABBA 2NYUA 2CJWA 3H1BA 3Q98A 3K71B 4NAVA 3I2KA 2Z1MA 4YPOA 4NQRA 2UZ1B 3ZE9A 4R0NA 1LBSA 1ADBA 1U1GA 4B7UA 3HWX1 2SNIE 4NCAA 3L7LA 1U0OC 2QWXA 3C6YA 2O1SA 3CUSA 2FFHA 3L4KA 1EUYA 2DR2A 4JDUA 4RSHA 5C4GB 2XB2A 4B1FA 4EO9A 4TKMA 4F5YA 5DWDA 1YI1A 1W34A 3VOTA 4NULA 5KC9A 4HN4B 4RD2A 4M87A 1UP6A 5EKSA 3V8MA 3FIUA 3HNOA 2FJPA 3LFTA 5IDWA 5ICCA 3DXFA 4Y0AA 1GR1A 4US0R 1P9WA 1GT6A 3C8ZA 3UG7A 4QM7A 1KETA 4WZBA 1MO6A 2IEZA 3ZUGA 3SS7X 4S1WA 5HIAA 3GLQA 4IX1A 2ES4A 1VYVA 5ER9A 2W6JD 4P4GA 5F77A 1RE0A 3PGMA 1E7YA 1VA4A 1S9DA 2J85A 4X44A 2GHRA 1YIOA 1N1GA 5SY6A 1V39A 2G9UA 1XKTA 1K7FB 1Q83A 4KG7A 1ZMRA 5C7YA 1J8VA 3G89A 4KV7A 4O1IA 4MQLA 2C5GA 1KRXA 1F3LA 1VMDA 1ZEMA 3ZX5A 3ND7A 3I1IA 4C01A 1WF3A 4IH4A 2QI9C 1E63A 4L9AA 1QO7A 4H6WA 4ZVRA 1N2GA 4YWJA 4AWBA 1FJXA 1T10A 1B4DA 3FVVA 3WNVA 1NKSA 2IODA 1EFRD 5C8DA 2RGEA 3NVMB 3WVNA 4PSKA 1C1YA 2EIXA 2OECA 5H4GA 1IHDA 3WRYA 1E2DA 5IKEA 3OM8A 3R0XA 2GM3A 2C5LA 2ZCVA 3JASA 4G0PA 4QO8A 3BTVA 3VAZA 1W36D 2Z4RA 5DCLA 2W6CX 1RMQA 1UBJS 1KJNA 3P97A 3O1LA 4LDNA 4A9AA 3T1HB 1WW8A 2GZRA 2QMUA 2KLHA 3DL0A 5DT9A 4AG6A 4Z4EA 3THWA 1DEKA 1M7GA 4FM9A 4Y2VA 1M3SA 1KI4A 2HU2A 3F6CA 2MCFA 1SR8A 2QI9F 1V3VA 3I9MA 2J5RA 3PK0A 4FZ5A 1GZSA 2ZAMA 4PLCA 1XDBA 2ZAOA 4TRJA 1Y0BA 3PFFA 1MAUA 2QTMA 3E6AA 1RLIA 1YL7A 2VPXA 4Y6RA 1E9VA 5CGQB 3G5MA 1WR8A 3OOWA 4I8XA 4XR9A 1NM5A 5LQMA 4U2BA 4DIBA 3V4OA 4FUTA 3U7GA 1KEEA 1IATA 2NVUA 5L6MB 1J9ZA 1LW7A 4MITA 3D7RA 5E95A 1Z2OX 2RIRA 4E07A 2B1QA 2HSJA 3GYGA 1I33A 3N8DA 4OYYA 2GARA 1E1MA 1RM3A 1UM9B 3BEOA 2ID8A 3TZCA 3ZG6A 2XBMA 4H9GA 3B60A 3GJXC 4RHXA 1I2ZA 2QP4A 2WDPA 4WN9A 3MB8A 4D80A 3OZDA 4NG4A 1PZHA 3PHBE 4MMZB 1YTUA 1CV2A 1GL9B 1PJ2A 1S2GA 2J5XA 2V96A 3R44A 4MW2A 2RE8A 2YIMA 2N1MA 2PQMA 3BAZA 3ONVA 3ZWWA 3NHWA 3T5DA 1HYHA 2D13A 3GRUA 3TS1A 4D3FA 1I24A 4RO0A 1Z5ZA 5AUPB 3L7KA 2EFHB 2J41A 1A04A 1GPDG 1U7HA 2JHGA 2RGBA 3ZV7A 1GGJA 2W4IA 1EZZA 3H5LA 2ECKA 1CUYA 4FMCB 1R4ZA 4G5YA 3OQPA 3AKEA 1GNRA 1ULZA 3T7IA 2W6NA 3OPYB 4LX0A 4CZ2A 3NBFA 2O1WA 2XYGA 3A3KA 3L02A 1O8BA 4G5XA 4F6LA 3TJZA 4BFCA 5I9LA 1W2WB 5A4KA 2V6JA 3AJDA 3IUJA 4LQCA 1FQWA 1JLKA 3L7CA 3OZGA 1N92A 2ONJA 2PUEA 3LPCA 4NXMB 3FGPA 3DAYA 3H86A 3UMGA 4HJRA 4KLRA 2Z9DA 1ZNWA 1FY2A 4GS5A 4URYR 5DM0A 3O8OB 4D44A 4OK6A 4OMFG 4DIOA 4HAOA 5HJ5A 1Q0TA 1DIOB 3G5LA 1VGRA 3GN1A 1KPGA 2EVWX 3B5JA 3NOOA 3QLJA 1NHGA 4V0OA 5CB0A 1QVRA 3GOHA 6NULA 1PVOA 3QLVC 4UNPA 1E18A 1YJ5A 3B2NA 1U9IC 1U3GA 2HDOA 1P0CA 2NO7A 2XJ4A 3D6MA 4P84A 2B82A 4V1CA 2H65A 3MGBA 2UV8A 3R5HA 4K8OA 4ENVA 4LF7B 1CZOA 2E4UA 3QEBZ 2E89A 5JROA 3O2SB 4HUQB 4RTMA 2JHFA 2C92A 4KYIB 1RXSA 4E6PA 3BGDA 2OO3A 5A9TA 3IV6A 5HVNA 4IYJA 1EINA 2MSWA 3DM5A 3V2IA 1L4EA 4FFOA 3F7TA 2GHIA 2ENWA 7REQA 3HM9A 1RAAA 2MINA 4WH0A 1TAQA 3COJA 3N0VA 2DUUA 4OLHA 2NU8A 1VSUA 3VYSB 2HZBA 5L3SA 1Z8NA 5JEDA 3OZIA 4C06A 3BTSA 4YAWA 5GZ1A 1VG1A 1JU3A 3EVEA 3EXG1 3RUHA 3SBXA 4AJLA 3UJHA 1KVTA 1N5KA 2QTAA 1YBVA 3GYBA