4EAQA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 3'-azido-3'-deoxythymidine-5'-monophosphate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
201
Chain Sequence
FQSNAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with 3'-Azido-3'-Deoxythymidine-5'-Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 201
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4eaqA00
4L15A 2WOJA 2YOFA 4LHXA 2ATXA 1CRQA 4XVUA 1G3RA 1PUIA 1F6BA 4KXFB 5KUTA 2XZOA 1XEXA 1QZXA 5EP2A 2ZRKA 4B6EA 1RKBA 1CJMA 1VMAA 3AF2A 3CWQA 3N5CA 4Q01A 5CJ2A 4DSTA 2WSSD 3T5GA 3VR6A 5L3RA 5CLQA 4ZI3A 1HUQA 2XTNA 4M1YA 4B6FA 1UKYA 1ANKA 1TAGA 3ONWA 2W6JA 1Z47A 3R9WA 3WRYC 1X1SA 4DLWA 4EFMA 1Z0KA 1NN5A 3B82A 1T4GA 2HCBA 4HB3A 1WF3A 1WQ1R 1GKYA 2Z83A 5LPNA 5BW8A 1KDTA 3BS4A 3I1FA 4M9ZA 5P21A 4A8JA 4URUR 4G5RA 1W36B 2WHXA 2A3RA 5CLLA 5BYJA 4TSFA 2FGKA 1E98A 4CF7A 1HT2E 3LDAA 3DMDA 5FUWA 4Q1BA 1E1QD 3GEHA 1BKDR 4MA4A 3CF0A 1M74A 4IOMA 1KI8A 3HR7A 3LH5A 2GVDC 4NH0A 3LX8A 3PJRA 2JA1A 5ELXA 2NIPA 1Q22A 4EJSA 2Z6VA 5C18A 3P26A 3ECCA 2OCAA 3AKEA 4V0OA 2QAGA 1E9SA 4ZDWA 2VIIA 4A0RA 1E9EA 2ZS9A 5EXXA 3KUCA 4QHSA 1VCMA 3CO5A 1SXJA 1ZBDA 1QG2A 4B44A 1KDRA 2OFXA 3QF4A 3GFTA 5KSPA 3W90A 2IA5A 4B76A 2EFGA 2NMVA 2O0JA 5BXQC 3AVXA 4JLBA 5J47A 3GJ6A 5CIQA 2F43B 4XH9B 1OIWA 1W0KD 4B3CA 4GMDA 3UANA 2HDNB 3KXKA 1KI6A 1OF1A 3FPAA 4G5OA 4MKGA 2QAGB 3QF7A 4RVCA 1NIPA 1ZNYA 1Q20A 2IS4A 4B73A 3Q7PA 3B7GA 1P61B 3SJAA 1Z0FA 2J5XA 2ZSEA 1KMHA 2OBLA 2QPOA 2HXYA 2JLUA 2F1IA 1J7KA 1T0JB 2PX0A 4B48A 3P20A 2NOAA 2G83A 4I1UA 3THWA 4XJXA 2BHRA 2JASA 1SXJD 1VTKA 1GOTA 1JAHA 2QSZA 3WNBA 2AK2A 3X1WA 2BM1A 2GJSA 4JLVA 2QMOA 5J4YA 3B1ZA 3AVPA 3U2QA 1QHHB 2JJ1A 4JYBA 4NL4H 4A2WA 4KVGA 4DDVA 3KJIA 4BLOA 4IDPA 2Q3FA 3TR0A 1N5JA 3UATA 4DLTA 3D3QA 4B2PA 3CWZA 3KKQA 4QHTA 3U3RA 3KKPA 1M34E 4LYAA 4EPYA 1W44A 2QZ4A 3B9QA 5JWHA 3W9YA 3WHKA 3SQWA 4AC9A 2QGNA 3T12A 4Q66C 5GJBA 4PC6A 4TL7A 4H9GA 5C1BA 3MLEA 3RHFA 5CDFE 1E4VA 2J87A 1NF3A 2ZJZA 5EUMA 4DIDA 4TMZA 3ZZUA 1KK1A 1G18A 2BDTA 1ZD8A 4LC0A 4LDJA 1T0HB 2YWGA 1N6PA 2QEQA 4AKIA 1KKMA 3ZVNA 1D2MA 2Z4RA 1Z28A 2O8BA 5AJXA 5TDHA 4B3BA 1SKQA 5GVRA 1MO4A 1LTQA 3RRMA 1SXJC 1OW3B 1FX0A 4NYJR 3CLVA 4QRHA 1OXTA 1B0UA 5H1YA 2QBYB 2WMOB 4JZKA 2VHQA 4NE2A 1S3SA 1E6CA 3C4JA 3NBXX 2RMKA 4NCHA 3E1SA 3RRZA 1Q3TA 2GTPA 2AX4A 1Z6YA 4JS0A 1NKSA 3Q9LA 3FKQA 4P0TA 2AWOA 3KDSE 3CRVA 1ELOA 1Z6XA 4GFDA 2RHDA 3I32A 2JLQA 2TMKA 1J2JA 3S1AB 2JATA 5TMPA 1MKYA 1OB5A 3RS4A 3NC1C 1F2UA 3LVQE 1UAAA 2AWNA 3Q5EA 2GHIA 1QRAA 1A7JA 4ZDIA 3MWJA 4ZV4A 1Q1BA 3ZH9B 2GZHA 3VHXA 5KU1A 2Q0HA 4ESVA 2BIFA 5KNCA 4CT5A 4CEJB 3SN6A 1HA3A 1H8HA 1E2IA 3CRW1 4A0GA 2QP9X 1CRPA 1Q0UA 2QI9C 1N6IA 2FGJA 2EWVA 1LF0A 3UPUA 4Q1EA 1P9RA 2C9CA 4CGZA 3WBKA 1M2OB 3NHBA 1JJ7A 1N0WA 2BJVA 2RGAA 1M6NA 1R5NA 2WMNB 3RC3A 1CP2A 2WWXA 3MWKA 2JLRA 2VTKA 4WIAA 1YKSA 1II8A 2OFOA 3K0CA 4R7ZA 1JBKA 4TWZA 6Q21A 3OFNA 4DB2A 3RSLA 4O2RA 5EUQB 5JRJA 4IDOA 2FEOA 3EX7C 3CX6A 1G17A 1U0HC 4Q5IA 5G40A 1UDWA 1FQKA 5FBRB 4PX9A 4QGAA 3CRMA 3SFVA 4IRUB 1E2MA 3EA0A 3GJ4A 3NIBA 5KDOA 3X1YA 1YE8A 4EPRA 1G19A 1G16A 3KB2A 4Q7KA 4IOJA 4FINA 3ZJYA 1XTIA 4G5QA 1D9ZA 3ZVLA 2X2EA 4C0QC 4C3ZA 3EIQA 1II0A 3K9HA 1P75A 2FSIA 3BFVA 1TL7C 1XPUA 1VG0B 2RGDA 2RKOA 2NG1A 3K9NA 3MAAC 2FG5A 2VF7A 1N6LA 1W5TA 2WAYA 3REFA 3GD7A 5L3QA 2CLSA 4QKQA 3LFUA 1ZU4A 3ZVMA 4PTLA 4DZZA 2J0UB 4HLUC 2UVQA 1TPZA 3G0HA 1F48A 3QENA 2OEPA 1T3HA 4BFWA 1F2TB 2F9MA 1P6XA 4LJ7A 1U81A 4Q4JB 1SVSA 1WA5A 1JQJC 3ZZ0A 3A1VA 3C41J 1OFTA 4YQFA 1Q1QA 2GK7A 3RLFA 4OI0A 3O8CA 3W5IA 3C14C 3NH9A 3U7EB 2RGXA 4FCVA 2EFDB 4LSGA 1VCIA 2GXQA 1KHTA 4Q7MB 1G41A 1W48A 2ZVPX 2IF0A 1EX6A 2CE2X 5TARA 2QP4A 2ZRGA 3OF5A 4W7SA 5EE5B 1YZLA 1IAQA 3NHAA 2OM2A 1U98A 2NO9A 4ZIRB 2AFHE 3N2EA 4GRAA 1E9CA 1EGAA 1ZUHA 4JJZA 3FMFA 2WTUA 1NBME 2RGBA 3DOEA 2R6AA 3SEAA 1Z6GA 1GZSA 3RS5A 5CJPA 3VQTA 4MKHA 2BVNA 3R9IA 1DAEA 3CF2A 3W8RA 3N70A 5JS7A 1FNMA 1MH1A 1SHZA 2RGNC 2Q9BA 1XTSA 2CNWD 2AHOA 2ZJYA 1VYVA 4KU4A 2IL1A 3KQNA 5EQTA 721PA 3U6KA 1CXZA 1SVKA 1UFQA 2ZVQX 2BMEA 4Q4JA 4KYUA 3K9GA 5B57C 1E1RA 2W00A 2YJTD 4LY6A 4KFSA 1K6MA 2BEKA 4PC1A 3K70C 3WYGA 4MDEA 3CKLA 4MH0R 3TE6A 3VR5A 1COWA 1T5IA 2KBEA 3UIEA 4ASUD 1W47A 1RYHA 2CVFA 4W5JA 1TF2A 1X6VA 3A8TA 3BOSA 5G53C 3B5JA 1XCPA 4RKFA 1GP2A 2GXSA 2CL0X 4V03A 1BH2A 2AXNA 4P33A 5FOTA 3QPVA 5FPSA 1CULC 3GPLA 1A1VA 2GF0A 3ND9A 2JAQA 3TBKA 3U3MA 3U3JA 4K46A 4QJ3A 4PANA 3OEHA 3T5DA 2FFBA 5J4LA 2J0QA 1GILA 2WAXA 1OT3A 5IF9A 4TLBA 4LHZA 1CF4A 2CXXA 3UK6A 1US8B 4C9BA 1R6BX 2HV8A 3C15C 1NJFA 1H65A 2ZQ5A 1G3QA 2C95A 3AP2A 4RCYA 4JT2A 2BCJQ 1BMFD 2W2TA 1E96A 3QKRB 3B1YA 1RVDA 4QBHA 4UNPA 1YR8A 2O8DB 4A2PA 1E0JA 3I62A 2F9LA 5FPTA 3K0EA 1QHSA 4JVLA 2ZEJA 1GL6A 2DHRA 1NG9A 3RVBA 2IYRA 2R6GA 4LJAA 1E2DA 4GZMA 2GKSA 3K8YA 1E2HA 3DVLA 4PFSA 4RFSA 3VU9A 2FZ4A 4LJ5A 3CM0A 3AV0B 4PHGA 4DLVA 4P3YA 1XWIA 3BH7A 4YONB 2WWIA 4BFVA 4ZCIA 2HXSA 1CKEA 1Z07A 1KY3A 1W0JA 2HLDD 4YDHB 5KSOA 4TMXA 4RD1A 4D81A 2QTVB 4IDHA 2MMGA 3QXJA 1KOFA 4B2LA 1HH4A 4NPHA 1ZUIA 2VP9A 4LYFA 1AJEA 2JIZD 2VP0A 4DXAA 1MABA 5FPHA 4QNRA 4DC9A 2GZAA 1GWNA 1NBMA 4D26A 1C9KA 3TSWA 5CYPA 2EWWA 1S1MA 5AUQA 3BH0A 2ZROA 5CITA 3B9PA 1CTQA 4DHEA 2RGEA 3MSXA 4PPGA 3AF1A 1XCMA 3CPHA 1NSTA 4DBLC 1JI0A 1RFLA 5TV2A 1GTVA 1KO1A 1R2QA 3QXHA 4E5UA 4UJ5A 5FPYA 1U8AA 4JLKA 5A4JA 1CJVC 2XZLA 4BZXA 1FX0B 4PAMA 4YMWA 4HDQB 1IXZA 1Q3HA 4X8HA 3TQCA 5AJZA 2C9YA 2ZU0C 2QAJA 1KJYA 2R62A 2MSDB 4HLCA 5KO2A 3ASYA 4I1OA 1F5NA 1WBDA 2FWRA 1KDPA 1OKKD 3UMSA 4YMTA 1N25A 2XOKA 1OJLA 1RRPA 1WP9A 2F3TA 2MMCA 2R2AA 3DM9B 4JLJA 4C0AC 2NPIA 2OXCA 2Z43A 3R7WA 1NMXA 2CCGA 4WW0A 5FR1A 4JL5A 4MYTA 1OXVA 3K0FB 1QHIA 2HJGA 1IN8A 5JI2E 1NI3A 1PLKA 4I81A 1VPLA 3FFBA 2PBRA 3CR7A 3NBFA 4DUGD 1W2GA 4PAQA 2WM9B 3M4YA 5E3HA 1RZ3A 2ZRLA 2IWHA 4D2IA 1OH7A 2V1UA 3V4RA 2OAQ1 2ZRIA 1ZM4A 2P65A 4HAZA 2ZSFA 2XB4A 2AK3A 4MRSA 5DGXA 3TW4A 1PJRA 1HEIA 3VNVA 3NG1A 2QQ0A 2IYVA 1GG2A 4MGYR 1ZP6A 1KAOA 4DWJA 2HF9A 1G4UR 1W5SA 2DR3A 1YQTA 1ZYUA 4XSHA 3NKVA 4LZZA 4B3FX 1QG4A 1BS1A 1BOFA 2Q3HA 3FMOB 3QUSA 3VKWA 3PEVA 4EJSC 3QI2A 1MV5A 4IXMA 3QG1A 2QAGC 1TF5A 3U7FB 3LBIA 4PO9A 5AWFC 3EASA 2SHKA 2BEJA 4UXHA 3E5HA 2EYQA 2L0XA 4LBWA 3WYAA 1IHUA 4B3XA 3BERA 2G77B 1E4YA 2Q21A 4A6XA 4IEEA 4POAA 5B64A 2ZRAA 3TQFA 3QSYA 1KI1A 3ADKA 1P7CA 1MRNA 2ZSBA 3GLIB 2QENA 3SI7A 2ZITA 1ZCAA 2YNMA 3CPJB 4HZUB 4Q48A 4D4LA 4NKRA 1W0KA 2G1JA 2Z5FA 4M9SA 1IJFA 4M1TA 3RAPR 1NY6A 1OV4A 1XMSA 1FMLA 3NEYA 5E7MA 3W8NA 4EJSB 3WP1B 1WE2A 2IYSA 4Q4HA 4NBSA 4LV8B 2R8RA 4TYPA 3PUXA 5DYGA 2G0TA 2QP3A 4ZPXA 4P4SB 3IIKA 4TLEA 4DDTA 3D31A 4WAUA 2IT1A 4Q19A 1I4LD 1Y63A 5KNBA 2VSOA 1AZTA 4IVRA 2FPKA 2AKAB 4D82A 1K5DA 1E2GA 4LJYA 1P62B 1ZIPA 3CNNA 3GJ0A 4US2R 1ZRHA 1GNPA 1H8HD 3FKSD 4AURA 4HI0E 4YC7A 3J81k 1KO5A 4M2LA 1Q12A 4AG5A 2ZRJA 4JLPA 2ZXUA 1W1WA 1N2CE 2NO1A 2V8OA 4MGZR 1W4BA 3HWSA 1HY3A 1DARA 2FV8A 4AIIA 3ZLJA 1MR3F 1HTWA 2I4IA 2CL6X 4XWKA 2W6JD 4II7A 2ZPTX 1AS0A 3QVUA 4X8OA 1W36D 3B1VA 1QBKC 3TGPA 2BOVA 5H68A 3GFPA 3UMFA 3SS8A 3AGPA 2PZEA 1JPJA 4ZI2A 5C46F 4N1AA 2Q9AA 5TXGA 1KI7A 3D8BA 4FIDA 2HCJB 1OH6A 1FUKA 2VP2A 4PSKA 3QKRA 4MDFA 2ANCA 2OCPA 4EPWA 1G5TA 2Z0MA 1DAHA 2GJKA 4HAXA 4HLDA 2BJWA 4GSYA 1KAGA 3TUZC 2DWPA 3DEFA 2DFNA 5FTKA 1DAMA 2D2FA 5IK2A 1AM4D 5IRCD 4IOLA 1JXMA 3AGQA 3BWDD 3UMRA 2YC2C 1VKJA 4Z8YA 2CCKA 4B34A 1AGRA 4OJQA 1UKZA 4PQFA 3EZ6A 1NNEA 1G8PA 5E95A 3BBPA 2PZGA 4QXAA 521PA 1UJ2A 1NVXQ 3Q3JB 1HURA 1FW6A 2QNRA 2A5JA 3I72A 5EXPA 2WSMA 2GILA 5LB2A 3A58B 4PZLA 2FEMA 4LCBA 3DZDA 1TU3A 4YMVA 5FTNA 3QBVA 2C04A 3Q5DA 4B43A 2YOHA 4Q21A 2H57A 2VQSA 1E0SA 4Q4AA 2LWIA 3NEJA 4QHYA 5JSZA 1IY2A 4Z51A 3R9XA 2C8VA 2DPXA 4N0EA 1XJQA 2XXAA 2OLKA 1IBRA 4YMSA 2QE7D 2CK3D 1U99A 2PEYA 2ORIA 4UKDA 1T9HA 2QU8A 4AKGA 3IGFA 3IILA 5EP3A 1EX7A 3K70B 1LB1B 1R0WA 4G0NA 5JWOA 1WCV1 4CEHB 3SFZA 5EZ6B 3PV0A 4D4MA 5DI3A 1N0UA 2W2VA 1PUJA 2BBSA 3GLFA 3T1QA 1KJZA 1OXUA 2QA5A 2WKRA 4C30A 5F3WB 4B33A 1GL7A 1W7AA 4TT3D 2OILA 1G7SA 1UBGA 2O0KA 4EUNA 1UKVY 3NBZC 4CDGA 1GUAA 1ZNXA 1CJTC 1RYFA 2QM7A 2B92A 4Q47A 2OXRA 3BB3A 2JLYA 4JT4A 3ZD6A 4MUAA 4OQLA 4LYHA 4V0LA 2JLZA 1XMIA 5G41A 5J4HA 3ZS9A 3GLGE 1Z0DA 2GJ9A 3IBGA 3OIUA 3QBTA 1OB2A 3V4FA 2ZAMA 1RRFA 3HYTA 5FL3A 4E03A 2NTYC 4L5BA 2QORA 4M1WA 3H1TA 1H8ED 1F60A 2E9SA 4I1VA 3IQWA 4Q1DA 3LWNA 1OHHA 4Q1CA 1R4AA 4WA7A 4ZKDA 2ZM5A 1TTTA 4OI2A 4BRUA 2IYZA 3UKDA 1OHHD 1E9AA 4Q02A 1NG1A 4DLXA 3A4NA 3U60B 3MMPA 2QE7A 3QKUA 4BPBA 4HAUA 5DHFA 5AJYA 4NMMA 2ZU6A 3SJCA 3ZD7A 2OT3B 2HYIC 1UPTA 2GJ8A 4XSGA 4B32A 1NL3A 2D7DA 3DKVA 3H0KA 5AUNB 1G64A 3SR0A 4A15A 2OV2A 5M04A 2YWFA 3I5YA 3FDIA 2JLWA 2QMEA 3FVQA 2GEUA 4EQ6B 4TMVA 2NO0A 2OE2A 1LVGA 4BFZA 2F7SA 2PMDA 5J40A 2ZE7A 2V3CC 4WVFA 1II8B 4B74A 2CHQA 5KPJA 2IXEA 1Z0AA 2P6NA 4FMCB 4N0DA 5EXSA 2BMDA 2QL6A 3M1IA 1AQUA 2I3BA 3AF4A 4GOXA 4URYR 1EFCA 3CH4B 2GEDA 3KJGA 1KSFX 3IDQA 2ZI7A 3ZVRA 3QG5A 1E0KA 2VP6A 4LJ6A 5UKDA 4EPTA 2HLDA 3RDPA 1SKYE 5JS8A 2WBLC 3REGA 5FBQB 3TW8B 2P6RA 3TJZA 3U61B 2OCYC 5FL7D 2PT7A 1OSNA 1AN0A 1PLLA 1WMSA 3LW8A 4GOJA 4LV6A 4LJ4A 5FTMA 1CR1A 1XJ0A 4OK3A 4XVQA 2ZJ8A 2X1VA 4Q4LA 1YZNA 1FFHA 4R9UC 2EFCB 3DM5A 1T3SA 4ARZB 3PEYA 4IXNA 4NCKA 5SZIA 4ACAA 3CZPA 3LXXA 5AR1A 3KTAA 2LKCA 1DEKA 2W6ID 2ZYWX 1KI9A 4Q00A 1KI6B 4RD2A 421PA 2GCNA 2P5SA 3GEEA 2IBMA 3UXMA 1Q57A 2WJHA 3B8HA 3MWYW 1U9IC 4P4SA 4B2IA 2DFKB 1CEEA 2IHBA 3LX5A 1KMHB 1ZCBA 3GMTA 3AVVA 4TLAA 1E79A 3KXIA 2PX3A 3H84A 5AUOB 3NDBB 3VKGA 4TMWA 1VCOA 2WZQA 2VA8A 1VYTA 3P4XA 4BLPA 3F5FA 1RJ9A 3HU1A 4DCUA 1E2JA 4MITA 2XJ4A 3V9PA 4HZUA 4U00A 2FPMA 4QBGB 2FSHA 1KZGB 1ZU5A 1RJ9B 4WXRA 5K8IA 1P2VA 3EIEA 1Q21A 3R20A 4M22A 2PT5A 3FMPB 1UEJA 4ASUA 3ADCA 4D80A 5EZ5A 2AFIE 3R8FA 3T15A 1R5OA 5EXTA 3RS7A 3KQHA 3FGNA 1I2MA 2OBNA 1XD8A 4BLQA 3QPUA 4TTPA 4WBSA 5JWRA 2W2XA 3PUVA 1G7CA 3AKYA 4IOKA 1P2SA 3ICQB 2K5UA 3PVSA 2JJ8A 3QOFA 1X3SA 2VEDA 1A5TA 1XEWY 4YDSA 2P67A 1AGPA 2WIBA 2CLCX 4GT1A 4JL6A 4IDQA 3K09C 5L3SB 3VAAA 2RGGA 4IJMA 2WKQA 4ARZA 3LVRE 4M4SA 1GAJA 3C8UA 5GVSA 3X2SA 3VR3A 2V6JA 4PPFA 4AYWA 3KJEA 5KNDA 1IY0A 1DPFA 3PIRA 4LHYA 3BGWA 1QVAA 3RS0A 1DELA 5L3SA 2PCJA 1NVVQ 4A1FA 3PITA 4GBMA 4RZ2A 4R2HA 3QEOA 1TX4B 2V7QD 4OI1A 3W3AA 1X8KA 3NXSA 1UADA 2GRJA 4S35A 1N6OA 2UKDA 1JAIA 4ZCLA 1P9NA 2IYLD 3QVVA 1NVUQ 2HF8A 2GA8A 2JJ2A 4G1UC 1Z6AA 2DBYA 4KO8A 2XNDD 3U7HB 3QIAA 3GFOA 2J59A 2JLVA 2O8DA 4QGFA 1OLOA 4QGHA 4D6PA 4DUGA 2ZSAA 1HE1C 1ZC3A 1RE0A 2JIZA 3KUDA 4RFSB 3F0TA 5DISB 1KO8A 3B78A 3I4LA 1XD2B 3IO5A 2UZ3A 1SVIA 4PPNA 4PHTA 1S8FA 1G8HA 4RSGA 2J9RA 1BIFA 2REOA 1OFUX 3I8XA 3K53A 1CR2A 1YZQA 4HDCA 3PUYA 821PA 3A4MA 4NDZA 1ZVQA 3WMEA 4A4DA 2B8WA 2IUSA 3OZXA 3DOFA 1ZINA 3AKCA 3BC1A 3CBQA 5FH9A 4CZ2A 3LW7A 2NZ8A 4KCGA 1MO3A 2FOLA 2V55B 2QSYA 5E7IA 1XPOA 1IOZA 2BWJA 3BIFA 3B85A 1EFTA 1KSGA 3R8CA 1MABB 3T34A 4A2QA 1LV7A 2X19A 4M1MA 4UJ3A 3L8ZA 1IQPA 3HYRA 3FWYA 4FCTA 4G5SA 5DNYB 3IHLA 2QTFA 5GADl 5TVKA 3AVTA 2QN6A 3RWMB 3KL4A 1U94A 4Z8XA 3MGCA 1KKLA 4C0SA 3UWOA 1E94E 1GSIA 1MRSA 3EC2A 5C4GB 2W83A 4G3XA 5F98A 1VG8A 4E09A 4GZLA 1KO4A 2VH5R 4PR0A 2XZPA 4ZO4A 4RKEA 4GP6A 1XMVA 2WKPA 1QVRA 4X8MA 3KFVA 3W34A 2XJ9A 4E07A 2RCNA 1IN5A 1VYUA 3GLFE 3PR1A 1BYIA 3AQ4A 3A37A 4FI3C 4D0NA 4ZIRA 4P4TA 1FTNA 3VTKA 1NJGA 5SZJA 4PPQA 5DH9A 4RD3A 4PZYA 2FFAA 1SKYB 3EG5A 4Q1FA 1S2MA 4V0NA 3VU9B 2B21A 5CB6A 4FMDF 3LO5A 3TUIC 2WJYA 1A2BA 3ZIAD 1NBMD 4OJKA 4DJTA 5HTKA 4Y0VA 1NN0A 2J0SA 1C4OA 1GRNA 2JLXA 4HSEA 1DAIA 3RRNA 2PMKA 4BASA 4C2TA 1L7VC 5EP1A 4NONA 5K8LA 1FQJA 5DLQC 2ZUDA 3OHMA 4DSNA 4CEIB 2JLSA 3PENA 4EFNA 1JPNA 1EFHA 2P2LA 4RJLA 3K0AB 2OLJA 2F55A 2ZIAA 1KIMA 4KI0A 2ZR0A 2DWOA 3FKSA 3IEVA 1CBUA 1GFIA 2C5LA 4LX0A 4D0LB 3CRQA 1KO7A 2DB3A 1N5LA 3SHWA 1ZAKA 2ODBA 3ASZA 4Q4AB 1JEEA 1KJWA 2ZS8A 5DIFA 4UXIA 5KDDA 1KK3A 1KY2A 3FB4A 1QHGA 4HB2A 1E9RA 2FX3A 2Q6TA 1N6RA 1L4YA 2NPFA 1HYQA 4DLSA 4K8OA 2R9VA 4W5HA 4AKEA 2XSZD 2ZETA 3GLHE 3X1DA 2ZRHA 3BK7A 3H4MA 4Q9KA 1DAFA 3MUFA 4C4PA 3QXSA 4I4LA 5L3QB 1E1QA 1GNRA 1XTKA 4AYTA 2BC9A 3BFKA 3TIFA 2BBOA 4A8JC 2R6CA 3THYB 1DADA 2J0VA 3K0CC 5DSZA 1EK0A 1U0JA 3AVOA 1O3YA 4H1UA 5DO9A 4BE7B 2H8KA 2BKEA 2ZI6A 4DCNA 2O52A 4RD0A 4LRWA 4FWTA 1KGDA 5LBIA 2AN9A 2YWEA 3N2IA 2VBCA 4B3GA 4BECA 1OFIA 1YU9A 4PQRA 1DBSA 2X8AA 4NCJA 2ZI9A 3ADBA 2R44A 1FMJA 2FA9A 3T1OA 1NIJA 3WXMA 2IS1A 1E9DA 4M1OA 2WWFA 3PXGA 3I61A 4PXAA 1OYYA 1NMYA 1WRBA 2CJWB 4P4UA 1BYUA 1QDEA 1Z08A 4DLYA 2DFLA 3G82C 2VL7A 5LDDC 2J1LA 4BQSA 3AUYA 1AS3A 3ZYCA 4JLOA 1NVWQ 621PA 4L8GA 2ZR9A 2IYXA 3L0IB 1XNJA 2QBYA 1UF9A 4MQBA 1NKTA 1TQ2A 2WSSA 2G9NA 1F2UB 2ZE6A 3IKJA 4RZ3A 3A6PC 4F93B 2YOGA 3K70D 4JLMA 1YJ5A 1AKYA 1IN4A 1KSJA 3OIVA 1C1YA 3JVVA 1WDTA 3RS3A 4OL0A 3SJBA 3Q72A 2WWYA 1T8TA 3T1TA 2UZIR 3IPXA 1RRGA 3HR8A 3QJYA 4YXWA 2PEZA 2VHJA 2BBWA 3BE4A 1GIAA 4US1R 4LHWA 1G9XA 2R6DA 2VP4A 1OXXK 4RZXA 3RABA 3U3OA 4DDUA 3OE7A 4QFMA 4GL2A 1Z2AA 1W4RA 4UXJA 2PZFA 2F1RA 2WJVA 1SVLA 2C96A 2FPLA 3MFYA 2C77A 5EP4A 4AG6A 3I5XA 1XXHE 1YR9A 4B47A 4URWR 5CK5A 3AM1A 4KHZA 1L2TA 1ZM7A 4NU0A 1G6HA 5JJIA 2RH5A 3PCRB 4PSVA 2XNSA 3Q7QA 3LNCA 2GCOA 2A5DA 1QHYA 2OCBA 4XTRA 2ECKA 1FOEB 1XPRA 4PAOA 2V1XA 4Q9HA 1N6NA 2OZEA 2FF7A 4JL8A 3VR4A 2IX3A 4U02A 5G3YA 4LBVA 4PSAA 1AQYA 1XD9A 3WRXC 1JR6A 4BFUA 5HZKA 3SYKA 2VLIA 1RIFA 4NYMQ 2OESA 4HATA 4LHVA 5KDLA 3LY5A 2ODWA 3DMNA 3NDPA 2GK6A 2XTMA 1SXJE 1JECA 1T5LA 1R8QA 3ZQ6A 3GLHB 5FUYA 5FFMA 4MKFA 3SJZA 1VECA 2N1BA 1BO6A 5GJVC 3BB4A 3C5CA 3QPWA 4JKYA 4U5XA 2IW3A 3B6EA 2EFHB 1Z63A 4OHYA 4HYYA 2HJVA 2N46A 4TL8A 4L16A 2GAAA 2LCFA 1FNNA 2ZYTX 4ESHA 1A4RA 3RNLA 3KKOA 3TKLA 4IHQA 2WJGA 2VF8A 4M53A 1JEDA 4RZUA 4BEJA 1B23P 2DYKA 4B71A 1TEVA 1ZD9A 4FXPA 4MRPA 2O8CB 5IT5A 2ZE8A 3H2YA 2JGNA 4R98A 2OUKA 1M7BA 1P3JA 3P27A 1VIAA 4LBYA 2WICA 4EPXA 4JVSB 3QQ5A 2KE5A 4MYHA 2GBLA 3NC0C 4F4IA 4ZKEA 2FH5B 3SU8A 2ORVA 4OK5A 2FSGA 3FYHA 1XTJA 1D2NA 5L3VA 4ABYA 2QM8A 3M6AA 4HLQB 4NZYA 1LS1A 5FOSA 1TQ6A 1N5IA 3ZQJA 2IC5A 3KQUA 2GVZC 1DAKA 2J46A 2PJZA 1JR3D 4C0BA 3RSOA 4L9WA 2BV3A 3THXB 1KK2A 3OAAD 5FOWA 5CK4A 2FU5C 1A82A 2O8BB 3I73A 4ZDKA 1HV8A 1GKUB 4QG7A 5DI9A 2B8TA 3CX8A 3LLUA 2GESA 3W3ZB 4O3MA 1S3GA 2NZJA 4LC1A 1P2TA 3RS2A 5G3ZA 3OE7D 2CLDX 1XU4A 4TYYA 1N6HA 3KJHA 1UBCA 1R0ZA 2OSBA 4QL3A 4YMUA 4QGGA 1AZSC 4BLTA 1CR0A 2H92A 3WMGA 2QRNA 2J7KA 3SOPA 2ASEA 3KTAB 1XTRA 2ZYUX 5AJWA 4Z1MD 2GXAA 2ZTSA 4RD4A 2FE4A 4TZ0A 1EFRD 1UDXA 4A0HA 1TF7A 2CNWA 2WPDD 1ZUNB 3DPUA 4V0KA 4F38A 5KYKA 5JBQA 1II9A 3LXRA 3TLXA 2AXPA 2BBTA 1GKIA 1UBEA 5DN6A 4URZR 4TQ9A 2J7PA 3VMFA 2HT6A 2BMJA 2CCJA 2O8FB 2ATVA 1E2LA 1W2HA 3CW2A 1NLZA 1VCNA 2F3RA 5FOUA 4OYHA 2IUUA 3L43A 4URVR 1OH5A 4OHXA 1IM2A 2P5TB 2A2ZA 1XF9A 2E87A 4EPVA 4Q9LA 1XRJA 1FUUA 4JBXA 3D6TB 2LKDA 5D3QA 4XIGS 4DLUA 1W49A 2RGCA 2YZ2A 1KZ7B 3RC8A 3FHOA 1W0JD 2ERXA 4R2IA 2G0NA 4FMBB 3THXA 1XMJA 1ZM3A 5D3MB 3PFIA 4NCIA 1EFRA 4BUJA 1U8ZA 3SYNA 3CNOA 2JCSA 2BMFA 4GI7A 4XOIA 2A9KA 1R0YA 4CW7A 4AYXA 3LD9A 2H5EA 5DN6D 2FJUA 2CDNA 3AH8A 3P1JA 4HLUA 4OK6A 3HDTA 4RD6A 4OQFA 1SXJB 5JCZA 4BFXA 1P72A 2C03A 3L8YA 4KAXA 4M21A 1US8A 4JIMA 3CUEF 2CHGA 1UBFA 1TUEA 3MWLA 4W5WA 4MKIA 5L8VA 5HR5A 1XXHB 3A1TA 2WPDA 3QKSB 3B1XA 1WBBA 1E9BA 1G1MA 3BAFA 3EIHA 4L4UA 2VHCA 4TQUS 2HYDA 5J5CA 4BRWA 2ZI3A 3TR5A 4OQNA 2JDIA 4PHHA 1DVRA 4QBIA 4W9MC 5LD2C 2D3WA 3UG7A 2O8EB 5FL7A 1LS6A 3GJ5A 3WNCA 1V5WA 3A1SA 2ZRBA 3F8TA 1E1RD 3HP1A 4ERNA 1N0VC 1TADA 2GF9A 2V4ZA 2ZS7A 3KB1A 4WOPA 1ZW6A 2QT0A 1AKEA 5EE0A 4IFBA 2QY9A 3GQBA 3AVQA 3T06B 3VNUA 1ODFA 3NTUA 1Y3AA 1DG3A 2HEIA 1GRQA 1QHNA 2FFHA 4OQMA 4FMDB 3T35A 4KLZA 3SZRA 2A5YB 3P4YA 4PZZA 1Z3IX 5FI1B 3W6OA 3PEWA 1XP8A 1FPMA 1S4QA 4MGKR 4TL6A 3U3KA 4EIWA 2CL7X 4BFSA 1U2RA 2ZI4A 4JLNA 1Z83A 3AF3A 3A1WA 5DI3B 1JB1A 4FWIB 4V0MA 4AI6A 1E79D 3NBYC 5LB4A 3WNDA 3NWJA 1ZM2A 1TU4A 2ZAOA 4D4KA 4QM7A 5EE9A 2GXUA 3QE0A 1COWD 3KZ1E 4K81B 5TY0A 3I92A 2DY1A 2AKYA 1YHNA 2XOKD 1NMZA 1NY5A 5JHGB 4HEJA 2REXB 1G3UA 3U44A 1OFHA 5H70A 2V7QA 3TVDA 1Z0JA 1VIYA 4C7OA 2XAUA 3HJNA 3PQCA 2WVJA 2I1VB 1E0AA 3PUZA 3QXXA 3BFXA 2A7QA 2J0UA 2AD5A 2V9PA 2WIAA 3AKDA 5KSZA 1VG1A 1U9IA 3EXAA 4DCVA 4DRZA 1Z06A 3G5UA 1KDOA 1TQDA 2GZDA 1X86B 1XEWX 1G291 2IYWA 2V6IA 5H8WA 3LLMA 2ODNA 3B60A 1D6JA 1XCGB 1NN1A 2G3YA 4EFLA 4TSFD 1TMKA 5IHPA 3KQKA 3GCGA 4TYWA 1E2KA 3O8DA 3U4QB 3TSOA 4FN5A 4ON9A 2KSQA 3DZ8A 5JEEA 1K5GA 1GRRA 3BD9A 4HUQA 2MSCB 3DL0A 3TAUA 1L8QA 1X8LA 1YRAA 3TRFA 4OKSA 2KJQA 1UKEA 4XVRA 3ICEA 1E9FA 2DWQA 2YHSA 4A9AA 2BCGY 2Y8EA 2C2HA 1E2PA 2GJAA 3ADDA 1MO6A 5EE3A 2OAP1 1DTSA 4KSCA 2IYQA 3TAHA 1JJVA 4O2LA 3X1XA 1CIPA 2D2EA 4CYMA 5C4MA 4KITB 1OPXA 3GEIA 2YC4C 4Q7JB 4HUTA 3AF0A 4M1KA 3W6NA 1EESA 5CIWA 3OEED 4TN1A 2YYZA 3LV8A 1N6KA 1SVWA 3KKMA 1Z22A 4QC2A 1XTQA 4IFEA 5FR2A 2EW1A 2GEVA 2ZJAA 4CEHA 2ZJOA 5BN3A 3IHWA 2QPAA 4QM6A 1MT0A 1HQYE 4PC3A 2PJRA 2A78A 4I99A 1AK2A 1TUIA 4CEJA 1Z2CA 3CRRA 3IQXA 4NP6A 4JKIA 4N3NA 3GLGB 3THYA 3EZ7A 1W46A 2OO7A 2NO7A 3PG5A 3ZIAA 2X2FA 4MYUA 4M9QA 3A1UA 2PL3A 1YZTA 2C99A 2XXAB 3CR8A 3Q85A 1PLJA 1W4AA 3EPKA 1CJKC 4MRNA 3VR1A 1NP6A 1G7TA 1I4TD 2H1LA 1DO0A 2VSXA 2YV5A 4TMTA 1S0UA 4JVNA 3SYLA 4TYNA 2ZRNA 1RW4A 3V00A 1G5PA 4HUQB 3C16C 4TL9A 2BM0A 2OBMA 4HB0A 2QRZA 5HE9A 2PCLA 3W5JA 2W0SA 1G8YA 4Y0AA 2V54A 3MJRA 2ZANA 2OFWA 1RC8A 2H7VA 4KFTA 1N3BA 4M9XA 3ZZTA 2RHMA 4MRVA 3AEZA 3C7KA 3SE0A 4URXR 1IONA 4OI4A 4HAWA 4BFYA 4HDOB 4M8NE 4P31A 5JJKA 2JJ2D 4DCSA 3IO3A 4DEYA 1SVOA 1GNQA 1Q44A 4D0GA 4F91B 4WZ6A 1WXQA 4A36A 3K0AA 5KTYA 4RCZA 3EPJA 4CEIA 1FZQA 1JQLB 1AIPA 4OQXA 3WP0A 5JLJA 1EXMA 3U44B 1Z8FA 3RYTC 1KNXA 2WWHA 1CS4C 2XSZA 3NH6A 2NQ2C 1VG9B 2ERYA 8OHMA 1SVMA 3LQRA 1AS2A 2VHTA 3QY0A 2HUPA 3PUWA 5F9HA 4D25A 3GJ3A 3HU3A 2D7CA 2O0HA 2JEOA 1GITA 3QEJA 3DDCA 3O47A 5C2JB 1QHHA 5JI3E 4PO8A 3KQLA 2GDJA 3GJ8A 2A5FA 3VKHA 1XJCA 5FI0B 2J3EA 4EAQA 3TH5A 3TUJC 4IVQA 3SHFA 2VP5A 3L82B 2O8EA 3QXCA 4Q9JA 1IXRC 4MUBA 5A0FA 1OKKA 3BXZA 3FHCB 1T6NA 3JZMA 3VX3A 1OH8A 4AKHA 1PVOA 2QMHA 2NO6A 3CONA 5FTLA 4JBWA 4GDFA 4C0LA 3LBHA 2B7CA 2KI5A 3GLIA 3U7GA 4LPSA 2ONJA 1E32A 1KMQA 1XX6A 3AVUA 2F1JA 5HKKA 1FL9A 2H18A 3JVUA 4LUCA 1G21E 4B3DA 2Q9CA 5F9FA 2ORWA 2QG6A 4QNMA 2ZJBA 4Q4HB 5AJVB 3D7MA 4DLZA 1VHLA 1W36C 3QF4B 2IF2A 3EC1A 2ZE5A 2IYTA 4G01B 2P3SA 4JVMA 2ANBA 4R71A 1XXHA 3QKSA 4WZBE 2BKUA 1CU1A 4DB4A 3ZGXA 1PZNA 1G8GA 3X1ZA 2ZRCA 4KFRA 2IUTA 2YVUA 3MD0A 1HE8B 1KI3A 4UNSA 1J99A 3THWB 4ACBA 4RFVA 3THOA 5E4FA 3KKNA 4J0QA 4IEIA 4V0ME 4KFUA 1Z29A 1P2UA 1S96A 2IYUA 5EE1A 4BGDA 1TQ4A 1T8UA 1ONBA 2VSFA 2OHFA 4KODA 1Z5ZA 1LNZA 3WYFA 4S2EA 2EYUA 4CVNA 3TNFA 1XEFA 2WWWA 1HQCA 4HZIA 3KXLA 2FDCA 3L0SA 4A8JB 1JXOA 5B2ZA 2O8FA 2CBZA 4JMPA 1DAGA 3AVYA 4I1SA 2X77A 3IIJA 4IVPA 2F43A 4KLNA 4XTCS 1I2DA 4LJ8A 2D06A 2RB4A 4TT3A 221PA 4LV5B 4FMCF 5DHAA 5A5GA 3GLIE 3H86A 1MOZA 4JBYA 4MRRA 3NVAA 1XB2A 4OHWA 3SDZA 3T1VA 3TVTA 1R10A 1KI4A 1FP6A 1UEIA 3SBDA 3UWKA 4DCTA 2DFTA 4AWXA 4QOSA 1S9DA 1E2EA 2CHVA 2JJ1D 2P6UA 3CZQA 3HPQA 2GAOA 4JLAA 4C0JA 1J8MF 3R7WB 1I4DD 1R5BA 3BORA 3HU2A 5SZHB 1M8PA 3LA6A 4KJZA 5J4KA 3OESA 3K0SA 1OXSC 4TQAA 1KYIA 2G6BA 4YXWD 1P9WA 5CM8B 2VHUA 3AP1A 3OFND 4CIDA 4KBFA 2A30A 2RGNA 3E2IA 1E3MA 4UQOA 1LW7A 1JNYA 3Q8XB 3DKPA 2MSEB 3ETLA 4TLCA 1RPZA 4GMXA 3K0FA 3EZ9A 4AY2A 5HE8A 2J7PD 5LD2B 1VDZA 2ZSDA 4WZAE 1R7RA 2ZRPA 2CEAA 4JLDA 1KK0A 5IK2D 1XD2A 1NRJB 1ZNZA 2Q3MA 2FZLA 4GOKA 4BEBA 3DHWC 4YLGA 2ZYVX 3K09A 2H17A 2W0MA 1FP7A 4Q03A 2W58A 3A4LA 1SHKA 3WMFA 1IY1A 3MCAA 1P73A 3FHTA 1KI2A 1P4SA 2ZUBA 3IBYA 5ANRB 5CB8A 4M0LA 3CIOA 2CK3A 5BWMA 5HCIA 1O87A 2O8CA 1SQ5A 3TSZA 2E1RA 3QNUA 2HT1A 1ZJ6A 3CH5A 1IN7A 4LWZA 1D2EA 1LFDB 1R8SA 2VPPA 4PC2A 1XEXB 3AVWA 1G20E 5JMTA 3KX2A 3OAAA 1G3IA 2QUZA 4GPTA 3BRWD 3RWOA 5TB5A 5GJCA 4DT1B 5CYOA 2AD1A 3U6BA 5SZKB 1H8EA 2GBLC 1S1CA 2XEXA 4P32A 4F7WA 2ODEA 2RAPA 3SNHA 2XB2A 1ZIOA 5CDFA 1LY1A 2IEYA 3L2OB 4C2UA 4M1SA 5KHOC 2FN4A 1ZM9A 3EWAA 1G6OA 4JJKA 1HT1E 3GLHA 5JRZA 3VHLB 2C98A 4TTRA 4HAYA 2FSFA 4Q18A 1S9HA 4QJ4A 3TMKA 4G5GA 1D8TA 2C78A 4NHOA 3GJXC 4TYQA 5KPDA 1J90A 1YZKA 4QJ5A 4ITRC 3BB1A 4ZDJA 1NSFA 1G8FA 4NYIQ 3DO6A 5HZHA 1U0LA 5BN5A 1TNDA 2YWHA 1T3LA 3FE2A 1OYWA 3QKTA 2ZJ5A 3LAWA 4BLSA 3ND8A 2PLRA 1SULA 1XZQA 5KSYA 2XITA 2VYFA 4NYMR 2G1KA 5IDVA 4FW9A 4LBZA 2ONKA 1L4UA 2WJIA 2ZJ2A 1U8YA 4LGMA 2J41A 4MYCA 5DE3A 3P32A 1ZNWA 3UG6A 2YKGA 5K8UA 2IS6A 3VX4A 4XWOA 3VFDA 2F1HA 2KWIA 2IYYA 5FOVA 5GJWC 4B75A 4DDWA 4HB4A 5JCPA 2REBA 5K8TA 5FUXA 4GP7A 3IPYA 1YVDA 2O5VA 3EW9A 4RY2A 5FBLB 4C0HA 1PV4A 4L9SA 4Z1MA 2FFQA 1WB9A 3C5HA 1U90A 1JR3A 5BQ5A 2PLFA 4PHFA 3W6PA 4E22A 1K8RA 4JSTA 4Q9IA 2GCOB 2IEZA 5KOYA 4KBGA 4OHZA 2Z4SA 1YR6A 3K1JA 1NN3A 3OIYA 5FPKA 1AA9A 2D4HA 4KSBA 1KSHA 4LJ9A 2R6FA 3WY9A 2W6IA 2CVHA 3A36A 4LYJA 2OG2A 3B1WA 4BWYA 4DSOA 2NGRA 2IS2A 4PO1A 5FOXA 3FMIA 1G3MA 1LF5A 5JFGA 2P0EA 3GLFB 4DKXA 3L0OA 1Z6TA 3EWSA 4WXPA 3GJ7A 1E2NA 5B58C 4XD7A 1V43A 2QMUA 1EFUA 1M7GA 1XDBA 3I8SA 4OBEA 3VR2A 4BFTA 4LI0A 2EFEB 4JSYA 1XBTA 4V02A 4XD7D 2CJWA 2QT1A 3FTQA 3B13B 4LK2A 4O0MA 3RRYA 5HPYB 3GP8A 1E2QA 2D62A 4U7DA 2JDID 3AUXA 2D74A 4UNQA 5CM9C 5AK0A 1X8JA 4CT4B 1IXSB 1G4AE 2C9OA 2H16A 2R65A 3IEUA 5F2EA 2IXFA 4DVGA 4UNNA 1NLFA 2KB0A 1OE0A 1SGWA 2QGZA 1N5KA 1IN6A 3EPLA 4F4CA 2WWGA 1KTVA 5FBWB 121PA 2ZREA 2ZRDA 4BZPA 4GNKA 4EQ6A 4TLDA 1EWRA 4A92A 2QPTA 4DIEA 1CR4A 5J4VA 2PH1A 2VO1A 2ZUCA 2FMXA 3EZ2A 3WHLA 1VHTA 1M1YE 3SC3A 3EAQA 2AL7A 2B7BA 3EARA 3CNLA 3LRPA 4PC7A 3RANA 4F4JA 2WJJA 5EJEA 3S1AA 4AK9A 1Z0IA 2XTZA 4C0KA 5JZVA 1D9XA 3CB4A 3PEUA 4DSUA 4NYIR 5E7JA 1EG7A 3FOZA 2VRWA 4A0FA 5JECA 3EPHA 3CF6R 4ILEA 3GLGA 1F2TA 4NCNA 5DYIA 1DS6A 4UNRA 1P60A 1ESNA 1G7RA 2YINC 5JEDA 1ZD1A 1ESMA 4F92B 1EWQA 4LOAA 1DOAA 4HAVA 1ZMXA 3ZS8A 2GETA 3KFXA 3AP3A 1FTSA 1KNQA 3L0PA 1OIXA 4A82A 2GNOA 4A6PA 2XX3A 3CX7A 1E2FA 1X1RA 3IIMA 1P5ZB 4OHVA 2GWHA 4AD8A 1YZGA 4IKEA 1SZPA 4NYJQ 2XNDA 2XGJA 1DG1G 4H1VA 4IDNA 2IK8A 2CMKA 3LBNA 1TEXA 1GM5A 1E69A 1G5RA 4EKDA 1Q1ZA 3F3YA 4CRWB 1ETUA 2B6HA 4BLRA 1RRCA 3ZDQA 1GL9B 2I1QA 4O25A 5BN4A 3EZFA 1D5CA 3OEEA 3I3SR 3SQXA 1F3OA 2F6RA 4D4JA 1E99A 4JYCA 2EVWX 4IW3B 1J8YF 1CLUA 2N42A 3OEHD 3FFAA 5FTJA 1YR7A 1GVNB 2EQBA 4KV9A 4NTZA 3EA5A 3MRSA 2AR7A 4KYIB 1W4CA 3TK1A 2WOOA 5BYKA 4FCWA 4TZ6A 3BH6A 4LPKA 3HPRA 5HCNA 1BMFA 1GDDA 2ZI5A 3K9LA 3O8RA 4FD2A 3M0EA 5JSZB 2QQEA 1XZPA 3E70C 4BZQA 4DT1A 3SBEA 3OIWA 1ZC4A 1NVVR 3U4QA 3MG9A 2A5GA 1JR3E 2FNAA 4X8LA 4XWAA 5FUVA 5FBVB 2J45A 4KVAA 2IWRA 3U5ZB 2ZRFA 4ZCMA 3MJHA 2DCUA 4Q7LA 3B2EA 2QROA 5JJLA 2IHYA 2IXGA 3WBJA 1QHXA 3JZAA 3AB3A 1DE0A 4B35A 1A2KC 4US0R 1YRBA 1NLYA 3BJIC 5HKKD 1DO2A 2ZRMA 4QBFA 4DEXA 1CJUC 3LQQA 3IUYA 5B30A 1T91A 2EU8A 4C7OB 1M7HA 1IJEA 3CPEA 1YZUA 3T61A 4TTQA 2G88A 4PQYA 1XFAA 1JALA 1Q1EA 1QF9A 4DLRA 1UM8A 3O8BA 5JHHB 4EDHA 4Q1AA 1OIVA 2QTHA 2ZR7A 1MO5A 5D3MA 2GCPA 5AUPB 2CE7A 2WV9A 4MGIR 4TMKA 1J70A 2KBFA 4Z54A 1R0XA
chains in the Genus database with same CATH superfamily
3I05A 1I6WA 3U39A 2UVPB 1SWVA 3HDYA 2HWKA 1DXHA 4JELA 4LHXA 1H6BA 4BAZA 5L51A 4IXDA 3ZDFA 2QUBA 4BX2A 2KMLA 3W6UA 1AMOA 3VJRA 3RSHA 1AOXA 1QIDA 4P2GA 1VLLA 5K3CA 1EK1A 3RSQA 3ZY6A 2XZOA 3TNJA 3FYUA 3BGDA 1RKBA 1CJMA 4PS1A 3AF2A 3K31A 5NULA 3N5CA 3WSTA 4BWGA 4HLNA 5DCWA 3EUWA 5A05A 2XMPA 2POQX 4UTZA 3T5GA 3EISA 1ZA1A 2XTNA 1QH9A 2Q4RA 4YP6A 1UKYA 3LZCA 4B6FA 4CM9D 5B7PA 2PO7A 3D2AA 1LZKA 2XAAA 2XVYA 4E94A 2JI7A 3WRYC 3GLRA 2PU7A 4DLWA 3EULA 1Z0KA 4G4JA 4RY9A 1WDWB 5AJUA 5ICFA 3EEFA 1J0EA 3O90A 1ZFNA 2FSSA 1J0BA 3KQMA 4QLOA 1GKYA 1YRYE 1MEEA 2XZTA 4W9RA 2NV0A 1EWKA 1KBQA 2XH8A 3BS4A 5DBOA 1LV8A 1D2CA 1SA0B 2X9LA 3CLSC 1X87A 4HEA1 4URUR 3L05A 3T5TA 1HNXB 4TSFA 1I3MA 5AH0A 1WXGA 5HOEA 1QQAA 1EK2A 1Y1SA 2AZDA 3DLAA 4ND8B 2BI7A 2HQRA 3F67A 3HKCA 4BQPA 5FAKA 4LDRA 4R01A 4TV8F 5CVUA 1M5TA 1BKDR 2F48A 4U7FA 3CF0A 3V4ZA 1G66A 3ZR4B 1GGHA 3TNDA 1IPFA 5LP1A 1GGEA 3ESBA 4UDNA 3HR7A 3U7RA 2ZSHA 2D0IA 4NH0A 3L1UA 4GMHA 3ZXXA 3IXLA 5ELXA 3PJRA 1P18A 3BMNB 1FDIA 2LIPA 3ECCA 3AKEA 3KE9A 4H2DA 1E9SA 4Z4FA 3KOXA 1OXKB 4ECAA 4Q12A 2O1SA 1C7ZA 3CE6A 2DKOA 4YRJA 1RAHA 1MC5A 4JOCA 3KHSA 1K0UA 5ICEA 4WACA 4BE4A 2NSJA 2HRZA 2HHJA 3DXYA 3L7LA 1UXGA 1L0BA 1YC5A 2D3TA 2OC9A 3SX2A 4C88A 4YY3B 1KDRA 3O3NB 1EEHA 2VK1A 2B8JA 3ISJA 4RMJA 1GPH1 1UM9A 3LUGA 4ZAVA 1CHNA 3G0OA 3GJ6A 3OX3A 3UT5A 2F43B 4YTEA 1Z39A 2AN5A 1TCUA 2C5SA 3MOGA 3ZZMA 4GMDA 2HL6A 4HAOA 1C7QA 1ZQ1A 5JRDS 2HDNB 4HAIA 3C85A 4DIKA 2QAGB 1CDOA 3IA7A 3KB8A 2OMEA 5K05A 2VDVE 3K6JA 4RU1A 1P61B 3SJAA 1Z7WA 1VZ3A 2XMCA 4REOA 4RF3A 5HDQA 4CCSA 5C8VA 1I94B 1GAXA 5IBRA 1IZ7A 4CKWA 1KMHA 2FP4B 5ENVA 4F0JA 5C8YB 5B1YA 4YYZA 5AK3A 5B1DA 5BQFA 1K8YB 2BKVA 2D2XA 2EBWA 2EW2A 3V1NA 2G80A 3BIOA 4E7OA 2BRUC 1SXJD 3DE6X 4PIMA 4ZYVA 2JPDA 3B8EA 1JAHA 1ISHA 5DYTA 4B85A 3QYPA 4E6PA 2CVZA 3DMGA 1KH2A 4HGOA 3ANMA 2AZ4A 5I6DA 4C0XA 1E2BA 1YI8A 3B1ZA 1L4BA 1B1CA 3R5FA 3SZUA 4CDRA 2A59A 2Y1FA 4A2WA 2QMZA 1V5EA 1M8GA 1A4XA 4KVGA 4DDVA 5CXQA 3KJIA 2VZ8A 3IQIX 3WV5A 3CB2A 1N5JA 2IPMA 3U81A 4YK7A 3UATA 2QM3A 3CWZA 2ZSKA 2P9JA 2XDYA 4QHTA 1MCZA 4JR1A 1M34E 1IG3A 3RSGA 3W9YA 2QZ4A 3SQWA 1D4AA 3IPCA 3T12A 1YQQA 3R4CA 3LUCA 4PC6A 4TL7A 1NNI1 4HDKB 3UJ6A 3WYCA 3CCFA 4BV2A 3MLEA 4ZO8A 1P44A 1E4VA 1ETHA 2J87A 4RM2A 3TDNA 1L4FA 3KJQA 2LVBA 4R9RA 4D99A 2QN3A 1M8KA 4XIIA 3FR8A 2OQ2A 2YWGA 1QG6A 4JNKA 3LF2A 4QAJA 1YS6A 2FMKA 2PX2A 1KKMA 3DFKA 3NTLA 3QTTA 4IUBS 1D2MA 3ZVNA 2UXCB 1VKOA 4FJ2A 5AJXA 3T41A 3WNQA 1I4EB 5E6RB 5TDHA 2PE5A 1P29A 2EP7A 5DM60 2X6TA 1WG8A 3RADC 3RRMA 1SXJC 4B7XA 3PK0A 2IHJA 4J16C 1VL8A 2A1IA 5H1YA 4L8LA 4TKUA 4G07A 1KMCA 4JAVC 1YGYA 2WIJA 1BMQA 1MGOA 4C7XA 2RMKA 3ZE1B 1PZMA 4NCHA 3SIXA 1CS0B 3FCEA 4CQLB 2YWCA 4BATA 1Z6YA 2HA2A 4K6CA 1DKQA 3IIEA 5CA0F 2E82A 3CVVA 1E4EA 3ZGYA 2X0KA 4GSKA 1Z6XA 3R3WA 1U7OA 3CUTA 3I32A 1IDN1 2DJIA 3KU1A 3L4EA 4DMHA 4F8EA 2TMKA 1QGUA 1CUDA 2YJ5A 3MTIA 2B2XA 4ZOEA 4EFDA 2A57A 1TC2A 5TMPA 1ZN7A 1AN9A 4FYVA 3RS4A 3V4SA 1CY6A 4KNYA 4RHCA 1HTBA 3ZE0B 2O2EA 2GN8A 1A7JA 5DHPA 3RRBA 3MWJA 4AY4A 4Z49A 5LA6B 3GMSA 2EJVA 3E22A 4DR1B 2UZ4A 2BIFA 5K3AA 3W7BA 5KNCA 1BFDA 1XC7A 2NXJA 3OZEA 1HA3A 3PPIA 3D6JA 5DBIA 2CV2A 3DUFB 3GGPA 4R9NA 4FC6A 3SHTA 5JBNA 2QQ5A 1EYZA 5FB3A 5DSTA 1Q0UA 3IFSA 3P71T 1PWXA 3UPUA 5ALDA 1XCOA 5EVJA 1SOWA 3R0IA 1MRZA 1XV5A 2A9QA 2WMDA 2BJVA 3NHBA 2CHUA 4ZOLA 4WQMA 3RC3A 4AT1A 5LLDA 3IDAA 2WWXA 4KLCA 1IOLA 4QREA 4A8TA 2QOEA 1YKSA 2OFOA 4R7ZA 3L7CA 1JBKA 1M2FA 1WPRA 6Q21A 2CXQA 1JKJA 2JFUA 3GVXA 1Z5WA 3IT1A 1CJSA 3FYUC 4JU9A 4F6RA 1R12A 3AMVA 4QWMA 1N8SA 1V5IA 2PBLA 1J2EA 3E48A 3IP5A 4H1HA 5G40A 1XA0A 3WGZA 1K08A 1NFRA 2JVIA 3AO0B 1SMKA 2ZDGA 2O48X 4GOND 2HFKA 4UM5A 4P5PA 3SFVA 1E2MA 3EA0A 3NIBA 4OXQA 5KDOA 3X1YA 1YE8A 2VNJA 4EPRA 2V9ZA 4UHJA 1WLYA 3UK0A 1YIAA 2RHHA 3NWPA 3ZWYA 4LI3X 1G16A 2C59A 2W71A 4Q7KA 3ZJYA 3ZCTA 3DULA 2B78A 1AVTA 2GN2A 1TLLA 2IXDA 4QQFA 1BXGB 1Q0QA 4Z86A 1D9ZA 3ELBA 3ZVLA 2I6FA 1LPSA 4LXQA 1PFUA 1PVDA 4BO2A 3RLIA 4QQKA 4YMHA 3RYCA 4OYRA 5F1PA 3TJMA 1MTOA 4NV3A 1A8QA 1P75A 2EKPA 2FOIA 4KYTA 3OU2A 3G8YA 3PGLA 1SB9A 3IEKA 2O6LA 2RG1A 3K9NA 4JJFA 4N18A 1UKAA 1O96A 2FG5A 4INZA 2QUKA 3OU6A 4XQGA 1B3RA 5ERYA 3NYQA 4Z2YA 3DGEC 3CUSA 1BH6A 1ZU4A 3LFUA 5E1OA 3ZNQA 4Z7OB 5LQCA 3ZVMA 3GI1A 1F3LA 1QE5A 2VT3A 3I9OA 3KZCA 3PR3A 4N3GA 4XOUA 3RSFA 1TPZA 2C4WA 5MGBA 3G0HA 3T3MB 1T3HA 4HRYA 4KXUA 4MS4A 5EN4A 4BFWA 1FDRA 4MQ6A 4RZQA 3C6KA 1P6XA 3R3XA 5FHQA 1Z4QA 4M49A 4Q4JB 4YT2A 5BR7A 4MQUA 1SUPA 1ZOOA 5CEEA 2OCGA 4NG4A 4OI0A 3RLFA 1YDFA 4BBZA 1UDAA 5K6AA 3O8CA 4OAOA 1AUXA 1U2ZA 4JU8A 3D7SA 3U7EB 1UJ4A 3T4UA 2EFDB 1T2NA 3CZ5A 4DV6B 1VCIA 1N9ZA 3STYA 1PCXA 4OHPA 3ELYA 1X0XA 1SR8A 2P3OA 4BNDA 4EI2A 2YVLA 3TPFA 1ESCA 4QU0A 5JW6A 1ZO8A 4L76A 3I5MA 2QP4A 1YZLA 3BL6A 1MAHA 2OGZA 3NHAA 2OM2A 4G63A 3AJ9A 4C3UA 4ZIRB 2WU1A 5CEFA 5ISMA 4JA0A 1N0HA 4RBNA 1BNCA 2YHBA 2XQJA 2YNMC 4GRAA 1E9CA 4MAFA 4DAEA 1XTZA 4G5YA 3WQQA 1SPBS 1XDDA 3FMFA 3AOEC 4R1MA 2RGBA 4QDXA 4ITVA 2EIHA 3AJEA 4D3ZA 4NJMA 1NQUA 2VXCA 4DMRA 1NMEA 4L5IA 3R9IA 3EGEA 1HXHA 2XLBA 3N70A 1FNMA 2BI4A 2H29A 1MH1A 3H5NA 4XPIB 5JS7A 2RGNC 1SUAA 4DV2B 1YXMA 3V7FA 2ISQA 2ID9A 2ZJYA 1IJBA 3RJ9A 721PA 5KYXB 4J8PA 4QOFA 2ZCVA 1SG9A 3K9GA 1APBA 1TYCA 1V45E 2W00A 2YJTD 5B57C 4FKMA 4FYHA 4C5CA 1HDCA 3TZ6A 3GZNA 6PFKA 4IILA 4PC1A 3K70C 1P0CA 4X3CA 5TVGA 3VV2A 3GCWA 2NPOA 4P6VF 4TKZA 3VR5A 3WYGA 4LF5B 3GCDA 2G40A 2WV7A 4QGSA 4PINA 4EKNB 1XU7A 1UT8A 3FCUB 4FC7A 1RYHA 4J7AA 3ZCVA 5IAJA 3WB0A 1TF2A 1UH5A 3BOSA 3B5JA 4GH5A 4KQJA 4JUAA 1GP2A 4RKFA 5G53C 3LHDA 4NCAA 2OXIA 1WY5A 4IO0A 1PKEA 2CL0X 4BGIA 2B82A 1FMFA 3QBJA 1NQ5A 3QVTA 1EG2A 4U7PB 1C3XA 3D02A 4MVJE 5FPSA 5C3UA 5C5DA 2CLFB 1FSGA 4XVCA 4H0FA 3U3MA 2HA0A 4BNTA 4QJ3A 3T5DA 1V26A 2FFBA 2QN1A 1B73A 1K7XB 1KARA 1QB7A 3W1WA 1PW5A 4AJ2A 5FRDA 4MWCA 4AZ3A 1EJ0A 4BX9A 4CODB 1VL5A 5HHTA 2OVFA 2FQYA 4HDKA 2CMFA 4MV7A 1QU2A 4J0DA 2HV8A 3C15C 1MX9A 1QK4A 3OT4A 1GPMA 4WXHA 3AP2A 3GDOA 4TZTA 4Y2UA 2COKA 3VO8A 1DZ3A 1DB3A 1BMFD 1SKUA 1QCDA 2W2TA 1E96A 4EG8A 1PS0A 3QKRB 3MYYA 1I2ZA 3ITEA 4OLJA 1A77A 3I2KA 3WLQA 4QLBA 4W6ZA 2IHKA 1LC3A 1XIVA 5JC1A 4E5KA 4U3JA 3IEXA 1W85B 2F9LA 2Y67A 4ARVA 4FVTA 4CKEB 1PX2A 2CYBA 2IE8A 4D9NA 4FZVA 3DBHB 4BZWA 2R8XA 3PXEA 1CUBA 1BWQA 5B1IA 4MRMA 4QWWA 4CG1A 1P7ZA 2FW7A 3V7WA 1N1MA 3OT1B 3FJOA 3ZCPA 4UCFA 4I2VA 5IT0A 3FSRA 4ER0A 4DV1B 5C7LO 3GFBA 3BL8A 3G2HA 4PFSA 3KZXA 1CHDA 1RWPA 5CAEB 3O3CA 3VU9A 5CH3A 3D0OA 2HQSA 3AV0B 3W3AD 3VR6D 1FLNA 4F21A 3QEMA 4G09A 5C8YA 4ZCIA 2AF3C 3FTNA 2HXSA 5EZSA 4U0JA 1CKEA 1N2OA 3H2SA 4R05A 2RGUA 4YDHB 4DF3A 5K6TA 3GFGA 4TMXA 4D81A 5LA6F 5F7ZA 3CTPA 3UW3A 4IDHA 4FLEA 3TN7A 4ZEVA 1DWOA 4NPHA 3HMKA 1E89A 1QFZA 2HMUA 4LYFA 1KVRA 3WFIA 2FRDC 1EWVA 4BZZA 2P2NA 3C7DB 4QNRA 4DC9A 2GWRA 3S1LA 2GFHA 2LR0A 2HPZA 5ALRA 1I51A 1WMBA 1GWNA 4Z9FA 4N6OA 1U8FO 1K66A 1H0HA 4I4IA 3JQDA 1FNSA 3FCCA 1BVUA 5BW5A 1S1MA 4NECA 3AILA 3B9PA 3R1IA 1LRLA 1NV8A 3IDOA 4XQCA 3BDIA 4NNPA 3O94A 1Y8CA 1Z2OX 2FPSA 4PPGA 4FB5A 1TIKA 3HB0A 3V8EA 1L5RA 2I2XB 3JATB 5ALVA 4ZMBA 1EZ4A 4RTLA 4NFLA 2RB5A 1KO1A 4C4YA 1PK8A 3QXHA 1C0IA 2YR0A 3U7IA 3HJCA 1KBZA 3A06A 4REQB 2GHRA 4ZARA 1YDGA 4F46A 3NLLA 4CIBA 3PI6A 3O8OA 1AHPA 3TQCA 4OHKA 3BF7A 5AJZA 3SEFA 1ZD5A 1KJYA 4YRCA 2IDJA 3WHIA 2GZMA 3BK1A 2MSDB 3GEMA 3QVXA 2OGUA 1BA2A 1PNTA 3OWHA 2Z2ZA 1OJLA 2F3TA 1PR4A 3BJEA 1B2RA 3KYDB 4JLJA 4NF2A 3W8EA 5HKLA 2NPIA 1YBVA 1QS0A 1JBQA 2OXCA 4G5XA 1NMXA 2CCGA 4WW0A 2QVBA 4B6SA 4DANA 1KXJA 1C9DB 2YMQA 1ORRA 4RGYA 3KYDA 3H04A 3LPCA 1IN8A 2Q2QA 4GAEA 1PLKA 3AZOA 2YMLA 4YUXA 5C52B 2PBRA 3NBFA 3WMXA 4DUGD 4BTEA 4YRQA 3FHLA 4UVHA 1TW3A 5E3HA 2IEDA 3RUPA 1RZ3A 1T6XA 4FGKA 2ZRLA 3I30X 1EWYA 4D2IA 3H6KA 1FRQA 2VRCD 4FE7A 3WNZA 2GI4A 5KNCH 3B2QA 1DFIA 2PLNA 4YHBA 2JCXA 4EKYA 2OAQ1 4TRRA 3QKIA 2W6ZA 1ZM4A 3EQZA 2HMAA 5TEVA 3VNBA 4F2PA 2QU7A 3MGAA 2QUIA 1W52X 1ZZEA 3ZX4A 2PWYA 4E3WA 4F5EA 1H2FA 4CG3A 2HBZA 1HDGO 1ML4A 1T3GA 1GG2A 3BHIA 3UAOA 4GU5A 2YH2A 1WW2A 2R1TA 3KXPA 1G0OA 1RM4A 2H1CA 2W37A 3HUEA 5CD1A 3Q8LA 2EEPA 1YWGO 3NKVA 3RVDA 4V24A 4O2BF 3EFBA 3JZDA 4M46A 1Z6QA 1BOFA 3C3XA 3FMOB 3Q7RA 4OLAA 2QN7A 4UVGA 4ND7A 1JF8A 4DR3B 4XLLA 4XGRA 3U3XA 2PA3A 3EIOA 4EJSC 1CEXA 4ZQBA 2UZ1A 3L0YA 4IGFA 5HW0A 3BN3A 3LBIA 1C81A 4OHBA 4PO9A 5FT9A 1BGWA 4FHEA 1FFGA 4WOJA 4XAQA 2NTVA 1ODCA 3E5HA 3F9IA 2DLNA 2EYQA 4IJ5A 3UHOA 3VU1A 2CMHA 3Q6NA 4FFDA 4B3XA 1JFRA 1RRMA 1E4YA 4IIYA 1P3Y1 3VISA 3E35A 2RHBA 4RK0A 5CAEA 2W6OA 2ZB7A 1KI1A 4AF8A 4ZVOA 1LQUA 1UXHA 2IX9A 3KOWA 1A9XA 4K9MA 3BDVA 4ARAA 3PVCA 4RIHA 4JEIA 4NKRA 5HYVA 2QJFA 1NVFA 2YL2A 1DBVO 2YNMD 4RAQA 1LK5A 1XMSA 5E4YA 5E7MA 1UPAA 3BMNA 4M1QA 4KXNA 1WE2A 2I4NA 1X74A 4RESA 2IYSA 2Q3BA 1DRKA 3GBSA 3P0EA 2XDWA 4YECA 4N5MA 4TYPA 4BV8A 1XWFA 3PUXA 3DV0B 4DDTA 2G0TA 4ZPXA 4TLEA 1ABBA 1JVBA 1XVIA 1Q16A 5B7QA 2YJGA 5IHXA 5KYYB 2IT1A 2AFRA 4D4HA 1V9CA 3D7KA 4AUKA 4DUPA 1IQ0A 1WXEA 2VSOA 1PWZA 4KEAA 5JDIC 3TQIA 3KKEA 3WK4A 4IF4A 3HXOA 1H2HA 2QPLA 3DCNA 1EWQA 4PWZA 4D3FA 1QP0A 2A9JA 3RJ5A 3QX3A 1P62B 2O59A 4GC9A 1O6BA 4OUKX 4PYLA 1ZRHA 1WB4A 5D87A 4AP9A 1FSZA 2P9EA 3B53X 3P9YA 5EFOA 2V7WA 5HEKA 4CF5A 2JEZA 2E4XA 1VL6A 1W73A 3L06A 1I7SB 4YCNA 1O8BA 1Q12A 3PJDA 2ZXUA 2NO1A 1XKXA 1OWLA 4MGZR 1W4BA 4GWKA 1QLHA 2HMVA 4AIIA 2RBGA 4P3KA 3SHOA 3C7AA 3D81A 4Q7QA 1TJYA 4IPTA 5ALWA 5LQAA 1B76A 1Q19A 1QBKC 1SQ0A 2V98A 2BOVA 1I1QB 5JFOA 1O94D 2BZ1A 5JATA 3TGPA 1DC8A 2PZEA 1JPJA 3NM4A 5C46F 1HMPA 2YY5A 1YKGA 1PE0A 3OX1A 5DV9A 4DG5A 4FIDA 1SC1A 4KQ1A 4L8VA 4YQZA 3UENA 4PSKA 3FXAA 1FYEA 2EJCA 4EZBA 2ANCA 3D8SA 4UM7A 4KL8S 1X1BA 1ZJWA 2Z0MA 4YRBA 3EPPA 3FVRA 5ESDA 4DIBA 4HAXA 2C4TA 3IURA 3KCNA 4HLDA 1OUMA 2BJWA 3PUHA 3R77A 4R2LA 5DLYA 1KAGA 3DMTA 3UV6A 5SY9A 3ULKA 2D2FA 4PRYA 5T4HA 4F3NA 1C8BA 1SBQA 5IRCD 4IOLA 4ZVRA 1PFVA 1PK9A 4KOEC 3GJSA 3DT8A 1G1AA 1FP4A 2CCKA 1RZRA 2BTQA 3LUJA 4P93A 1UKZA 3I6QA 5M34A 3KPJA 3BSFA 3KQQA 3RKSA 4IP0A 3CUYA 4MV0A 3UT5B 2JRCA 4LXUA 1Q0TA 1ND5A 1XT6A 1ZK1A 1ZGHA 3Q3JB 4L3VA 5CB4F 4AJ9A 1VA4A 1IBMB 2DVMA 2A5JA 3OU7A 1DJQA 1AO0A 1E3IA 2VSYA 5EXPA 5F9MA 2G9ZA 1YSCA 3A58B 3L1IA 3PB3A 2O2YA 3GZNB 5ELLA 4LCBA 3DZDA 1TU3A 2ZBEA 2VXOA 5FTNA 1T1IA 3R5KA 4LQCA 2VUHB 3MLBA 3DAPA 4RXTA 3RF6A 4F3RA 2WMYA 5A5EA 1ACLA 1ST2A 1TECE 2YOHA 5DPMA 2LE0A 2X9QA 4BMNA 2LWIA 3CRNA 4UU7A 3NEJA 4Y98A 3VPGA 1FA9A 1T0BA 2WYIA 2E6UX 1UUFA 3F6CA 4D9KA 5BMOA 4YMIA 2DPXA 1M6VA 4N0EA 5CHYA 1XJQA 3A25A 3JSAA 4OP2A 4ZZ2A 1DIHA 4QUEA 2C2ZA 1YK0A 4F9TA 3ENZA 1P4GA 1U99A 1T5BA 2FPPA 4OFWA 4M0PA 2PWPA 2PXCA 1T9HA 2QU8A 4CMEC 4HGQA 3BIXA 5EPEA 3S2YA 2D4AA 4AKGA 1LTKA 4IY1A 4DQVA 2JFXA 3AM5A 5K7SA 1TZCA 2IJGX 4G0NA 2FXIA 4I14A 4RTQA 1YS1X 2GAJA 5IYZA 1SBCA 3G2QA 3SFZA 1WUYA 1QORA 3PV0A 5EPUA 2BBSA 4C4XA 1Q1NA 3MTJA 2QA5A 1K6EA 4P5EA 3A1EA 1CZNA 3GJYA 4TT3D 1UBMS 2OILA 2O0KA 5EUCA 1DTWA 3A3OA 1DGQA 4B7ZA 1ZNXA 1HG0A 2BEVA 2DJ5A 3C8HA 2QM7A 1SZCA 2B92A 3OZRA 1E60A 4D56A 3UGKA 4DYHA 3CSSA 1XLTA 1GD1O 1MG5A 3G79A 4LYHA 2G17A 5AW1A 2ZZKA 5DNEA 3B7WA 4K9RA 5J4HA 3THSA 4BNXA 4M1EA 4X1KA 1DXQA 2P8SA 3IBFA 3E27A 3TGLA 1OB2A 2DH6A 2HQBA 4CMEA 4C6HA 4WKGA 2WTEA 2JJMA 1EVQA 1U2QA 2DLCX 4HGNA 4XA8A 1CY8A 2EJBA 2NTYC 2QORA 5BO5A 9MHTA 2QJTA 1F60A 4IL5A 4JFRA 4X66B 2WUVA 4I1VA 4LRQA 4NWIA 5EJ9A 1NXVA 2IEGA 1G38A 4KTTE 3SJUA 3ZHUA 4G0UA 2FQQA 3JXEA 3R2JA 4GR5A 3UKDA 1OHHD 2DFPA 4XIFA 1OZAA 4Q02A 2JF0A 4JYPA 1HM5A 4NE9A 4DLXA 5BV2P 3HGTA 5DZSA 5KYYA 1IMOA 4OU5A 3TJRA 5DHFA 4P84A 1G5HA 4GIBA 2CFRA 2ZU6A 4NMMA 5CU7A 5IAEA 1XK6A 2AZXA 2W9XA 2HYIC 3ZDAA 2WF8A 1UPTA 5AM3A 1YVPA 4CM7A 1LSUA 2D7DA 2OYCA 2OZVA 4U7TB 4UPDA 1HBJA 2Z2KA 5AUNB 1F1JA 2D5LA 2G4VA 2OV2A 2VJQA 4RHXA 3I5YA 4V2IA 4DFDA 2VJLA 4NEQA 4B8ZA 5I7WA 2PVCA 1DOZA 4WFJA 3ZBQA 5HX7A 2OB2A 5HF6A 1P1JA 4Y2HA 1T1SA 1LVGA 1GU7A 1LDYA 3F1LA 1JH8A 4GLJA 3HVKA 4BFZA 2ZE7A 1CDZA 4WVFA 1II8B 2QD5A 4CMCA 4M8KA 2XVZA 2A14A 1Z0AA 5JADA 1NASA 1VL0A 3JR7A 1I24A 3BGVA 3L8FA 4JXJA 2GYYA 5ALXA 1ZN2A 4UNIA 5A2GA 5KU7A 2BFWA 2QL6A 3M1IA 4W1SA 1EHCA 3AF4A 1JLHA 1GDHA 4FDAA 3KJGA 4E12A 2I6UA 4X7MA 5BNTA 1XLVA 2B37A 2PD6A 3PGMA 4LY9A 1XG5A 1E0KA 2VP6A 4LJ6A 5LU8A 3DLIA 5UKDA 4EPTA 2HLDA 1SKYE 4E08A 2WBLC 4GBJA 5FBQB 3TW8B 2FLWA 5KTTA 2NO4A 2OCYC 3D43A 1IJKA 5FL7D 1W4ZA 2XWBF 3RFTA 1AN0A 3VUFA 4WA8A 4LV6A 3TYXA 2FY8A 1CR1A 1XJ0A 3C5WP 3GX1A 4WNCA 3TEJA 4A6EA 5LJIA 3UUEA 5BT9A 1MDBA 1HRKA 4G65A 1H2BA 3FA2A 1Z62A 2VDJA 5HQ3B 4MS3A 1YZNA 1CRWG 4NV0A 4PCVA 2JBHA 1E4EB 2Y71A 3CEMA 2TRSB 3WFZA 3LXXA 4KXXA 1BVHA 3KTAA 5IAGA 3ESCA 1NT4A 2CV0A 4BP9A 4ZHQA 3ORQA 1TA0A 1VYHA 3N8DA 4JC0A 1TMYA 3U7QA 1JJIA 2ADFA 2GPBA 1YD7A 1Z0ZA 4UOQA 2Q27A 3UXMA 5LDHA 3KYBA 5AP9A 4P4SA 2XWSA 4MAMA 3IE2A 4UEQA 1EA5A 1KMHB 4W1PA 1YJ8A 2I71A 2YCLA 3RVJA 2I6SA 4UEKA 3NDBB 4TMWA 5G1OA 3ZGNA 1A96A 3JAWA 5A71A 1VYTA 4HNQA 1AT1A 1ECFA 3F5FA 4BLPA 1V71A 3HU1A 3QMVA 2O19A 1F51E 3AL3A 1ZAYA 3V9PA 2XGGA 2JH8A 2Z3VA 1JDTA 4QBGB 4XUCA 4ENRA 1QS0B 1EP9A 1KZGB 3OQMA 2G09A 3VR5D 4RE5A 1P2VA 3IESA 1YR2A 5CFZA 2HN9A 1Q21A 2C5GA 4OLBA 4M22A 2PT5A 3O2NA 4ASUA 2OECA 1T5TA 5FO0A 3ZIUA 3R8FA 3I3OA 3T15A 5E1BA 2RJNA 5EIXA 3E4CA 5EXTA 4EF6A 2CUTA 1EGQA 1F4VA 3KQHA 1XD8A 2JFFA 2E5LB 4B3MB 1QO0A 5DK6A 2H2WA 2ZWMA 3NU1A 4HX5A 4TZKA 2J67A 4O6VA 3SYMA 3ZBPA 2JJ8A 4L73A 2O1XA 3OA0A 3QOFA 1A5TA 1YS2X 5BWCA 3EVDA 3HJRA 2IOHA 4PRKA 2ZUSA 4JL6A 3PDUA 5B3AA 4CKYA 1UK8A 1EVZA 4KX5A 3KEGA 2HNKA 4IJMA 4NESA 3WLKX 1WUTA 3OZ7A 4I1PA 3MUNA 1C8KA 3TI9A 5JXGA 1GAJA 3WL4A 2H4XA 5GVSA 1ZRMA 2H1SA 2V6JA 4PLYA 4O4IF 4XSVA 2YASA 3ICWA 3EB9A 3H0EA 3JYOA 1PNOA 4JBHA 4RMGA 5ENZA 4I08A 2PCJA 3I9V6 1SCIA 4QUGA 3K96A 4RZ2A 3LVFO 4YUYA 5AXDA 1FDUA 3U49A 3IL2A 1TX4B 1YTUA 5EYPA 1Y9AA 3W3AA 1QOQB 1X8KA 5LOVF 1NU8A 2GRJA 2YQ4A 4S35A 1P5HA 1N6OA 2UKDA 3KSRA 3WB2A 3NANA 4FOOA 1P9NA 3QVVA 4OX9Y 5DM4A 3BAZA 1K98A 2Z3WA 2DBYA 3HZZA 4HMOA 3RVPA 3ZLUA 2JAOA 1PYDA 3LC2O 2J59A 2H31A 3QIAA 4GMKA 3RK4A 4QGHA 4J0HA 3BREA 5LKRA 1RTTA 3NHWA 4DUGA 1A8IA 1HE1C 1HETA 2E21A 1Y6RA 3LG2A 1LBSA 4C3OB 3D4BA 3O74A 3KUDA 3F0TA 1KO8A 1XELA 1XD2B 3COSA 3IO5A 1M2NA 1X2EA 1DO8A 4PLWA 4PPNA 4JI0B 1N4AA 3KALA 4RSGA 4MPPA 3NOQA 2REOA 3DOHA 3EJ6A 3K53A 1CR2A 3D54D 3ISVA 1VPEA 4JX8A 3FJYA 4LZOA 5D8DA 3TQRA 3BEDA 4RIFA 1PTJA 2WDZA 4AMZA 2I8AA 2ARKA 3FH0A 3LRTA 2B6NA 1BD4A 1BROA 1NZDA 3V2UA 5TE9A 2IUSA 3DOFA 5FH9A 4LQLA 5SYMA 4CZ2A 5EJ6A 3N59A 4KCGA 1MO3A 2V55B 4ZCPA 3S2ZA 1S7CA 2BMVA 1TT5B 2A0YA 1WKVA 2YZ7A 2A3NA 2VZ9A 4FOLA 4LECA 4I3GA 1IOZA 1WZNA 1XPOA 1ZPDA 3BJMA 3QH4A 4K9PA 2JZOA 4LVUA 4U2FA 3URKA 4DAOA 4A8PA 1KSGA 1SKBA 2CF5A 3OCYA 3R8CA 4CCYA 5FX2A 3V48A 3VKVA 2VAMA 3L8ZA 1UWCA 2CXUA 3NJRA 4OU4A 5G0UA 3AIMA 3EEIA 1TM5E 3EXEB 4LWOA 3S99A 3NC4A 4NZNA 1E9VA 2JGJA 4XB1A 5DNYB 4FILA 3R44A 2DR0A 3IHLA 3H6GA 4YRTA 3MMZA 5KQPA 2QTFA 1ZR2A 1T1EA 2GPYA 1XDGA 2IY9A 2WHYA 4K0RA 3GLSA 1NUSA 3QVGB 3ZBUA 3KL4A 3MGCA 1U4OA 1KKLA 1TCAA 3M4NA 3OKPA 1MRSA 3UWOA 1H66A 5I4KA 4DR5B 3EK2A 3HXTA 1ORHA 5IAKA 2PFGA 4G1CA 3TZEA 4GZLA 3WLSA 1YTLA 1W2WB 3BK2A 2NU6B 1OR8A 3LQKA 4XEHA 1UK9A 1L5NA 4PR0A 4ZO4A 2RHTA 4GM4A 4HP8A 5A62A 4ONEA 2IELA 4GO1A 3UQZA 2XJ9A 3KQVA 1EFVA 4FX2A 1VYUA 1FX1A 1HORA 1LW6E 3IQFA 3G2KA 3PR1A 4ZHQF 3A37A 3ZDRA 5JAZA 2VFAA 2H6EA 1N2XA 1IB6A 3VTKA 1NJGA 2ZQZA 4PPQA 5DH9A 2DF8A 1NJ1A 1QV9A 3EY4A 3HN7A 1MVLA 3NRJA 4MQEB 5BSFA 2Q8PA 1S2MA 2XOXA 3KPWA 2PUDA 2ETXA 3NTRA 4U0KA 3E7FA 4NZOA 1U7WA 5DM1A 3ZK7A 4ZAGA 3PCTA 3V4LA 3ZIAD 2ODPA 4OJKA 4EUHA 4DJTA 1NN0A 4AS2A 2J0SA 1C4OA 2VN8A 4HSEA 1P7WA 4BP1A 5IG2A 1L7VC 4NONA 5K8LA 3UHJA 3N05A 4DSNA 1MPXA 4EFNA 2BLLA 2H4JA 2PKYX 4R51A 5DJ5A 4BCBA 2MSNA 1A9RA 1A2QA 2PMWB 4GDMA 4RJLA 1CWUA 3K0AB 4NSNA 4RL4A 2H7CA 2ZIAA 3RC2A 2ZR0A 1XHEA 5IH3A 5DRYA 3GA5A 1CBUA 1HYBA 2C5LA 2DRIA 2W2PA 3QWBA 4LX0A 3CRQA 5AI8A 3UB2A 3W5CA 3GG2A 4MMYB 4XFDA 4C43A 5AI9A 3K9FC 4RTSA 3IQZA 3LXMA 2ODBA 5EJ8A 4Q4AB 5KDDA 2ZWOA 2BTEA 3NHJA 4FD3A 1KY2A 2WWVD 1R5JA 2NACA 1N5MA 5AESA 1WKBA 1T26A 4HB2A 3BJRA 1GR0A 2FX3A 2HU8A 2X2PA 2Z8YA 1N6RA 1TGVA 3D0QA 3Q7IA 4FFSA 4JP3A 1L4YA 4MS4B 4RV5A 4CUZA 2EL7A 1AO3A 1E3WB 1EFKA 1V5GA 1BS2A 2NSDA 2OHJA 2ZETA 2SICE 2B4TO 2C3OA 3GLHE 1SCAA 2HX1A 1G60A 2OC4A 5E0OA 3BK7A 5M5BA 4Q9KA 1RYNA 3UMJA 1T36A 3I2HA 3NAZA 1PJLA 2EBHX 3I09A 2MINB 4B0OA 1XTKA 1O96B 1UBOS 2B94A 1Z12A 1QK3A 4MZDA 1Q0PA 4M83A 3TXAA 4AYTA 3OM8A 3BFKA 1I7PA 3P19A 3TIFA 1IEXA 5LNK6 1RPAA 4JYZA 2VK2A 1AU9A 3K0CC 3FMVA 1EK0A 1U0JA 2OP0A 3AVOA 3EYWA 1SEVA 3K1YA 4JY7A 4LNUB 4LZNA 4QEKA 5DO9A 3TTXA 5K5EA 1Z2EA 3HHPA 3ONVA 1D1SA 2CUKA 1KGDA 3ZDYB 1JR4A 3PNOA 2YWEA 3N2IA 1XRPA 4F5WA 2Y1LA 1YFLA 2VBCA 4IKOA 2H0RA 5JVDA 2VQEB 2XDAA 4OBBA 1W88A 2XUFA 1FMJA 2FA9A 2XV1A 1PJTA 1G2OA 4GI3A 3ZJVA 2YJ3A 1LBTA 1R64A 3SGLA 5B4VA 4IXWA 4KE6A 2OY0A 1WRBA 4Y1RB 3ZKWB 3L0DA 4K86A 5HFAA 3BQNB 1B93A 5JCJD 4BQSA 3CVYA 3B1KA 3GROA 1JKJB 1LRKA 1NVEA 2IZ0A 4L8GA 1DUIA 2AW3A 2Q7DA 1XNJA 4BX8A 1PL7A 3RVSA 2JAUA 3M6LA 4JFAA 1NKTA 1JU3A 4BPRA 1F2UB 1BKSB 3RU3A 4RMNA 4RZ3A 3HCPA 3A6PC 2YOGA 3GEGA 3K70D 2CEKA 3AEQA 1NZJA 3IIIA 4XE5A 3ZHRA 5CCEA 4NBVA 1AKYA 1KSJA 1C1YA 3JVVA 1ZGJA 4C89A 1T9GR 3EQ8A 3SX4A 3F46A 3Q72A 4CNQA 1XZGA 2WWYA 5HTOA 1FY2A 1BFUA 1T8TA 4OA8A 5ICGA 1OMOA 2UZIR 3IPXA 3IAAA 2XUIA 1H22A 3AETB 2X4DA 3HR8A 4IICA 3PNSA 2WSYB 3LL4A 4R1NA 1O4WA 1C4WA 4QPPA 1MAUA 4DZRA 4UUNA 3DMTC 1RAFA 3STUA 3UFXB 1OJ7A 1BZYA 2PZLA 2VHJA 4QBTA 4B7CA 2C94A 5H83A 3OFVA 4N9QA 3U3OA 5TLSA 4RZXA 3QE4A 3HO8A 5C5CA 3GT4A 4L4SA 4QFMA 3ER6A 3T7JA 1ZGGA 2WJVA 2FPLA 1QGUB 3KL2A 2XIQA 4P0PB 3JASA 2VZ0A 2YWBA 4WZBA 3R7NA 5J58A 3ESQA 4IWYA 3D7NA 1NW9B 5CK5A 4BNKA 3W5UA 2Q28A 4YRNA 1PUXA 4WESB 3PCRB 1VE3A 4PSVA 3Q7QA 5F5LA 2GCOA 1UXJA 4I55A 3AFHA 3MUEA 3OLZA 2A5DA 4JZYA 4LXHA 1MB4A 4BIIA 3M6VA 5IULC 5A7GA 2ECKA 2OV1A 2TECE 1WDLA 4NFYA 4JJ8A 2H65A 2Y1XA 3K0KA 2C7RA 1A5AB 2IX3A 2P7HA 2XCQA 5HKBA 4PSAA 4BP8A 1V1MA 4OMCA 3H4TA 5G2OA 3WRXC 4B81A