1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
1KZ7B 4RCYA 1R5BA 1ODFA 2MSEB 3QQ5A 3BORA 3TNFA 2CL6X 2RHDA 4M53A 3TSZA 4F91B 4R98A 5LBIA 3ADDA 3OHMA 1XZQA 2WJHA 3AP1A 1WE2A 1KKLA 1R0XA 2ZI6A 5M04A 2YINC 4QJ5A 3RWOA 3SQWA 2PLRA 1Z08A 2BJWA 3B1XA 3V9PA 3DM5A 4TYPA 1CULC 2ZS9A 4JS0A 2CXXA 2EFGA 4PX9A 5FBLB 2ZSAA 4HUTA 2O0JA 1M34E 4YONB 121PA 2IF2A 1YZLA 1HE1C 1HEIA 5CJ2A 4JLJA 3CIOA 4WA7A 1P2UA 1KO1A 3X1XA 5BW8A 1Z6XA 4EPXA 2PMKA 4CEHA 1SXJB 4NBSA 2Q3MA 3DZDA 4PAQA 2HJVA 3VHLB 4DKXA 4L9SA 1COWD 5IK2D 2ZRGA 4Q02A 3RABA 3SFVA 2ZJ8A 3LLMA 1NJFA 1EXMA 1VG9B 1T8TA 1T91A 2H92A 2H16A 5KNCA 1DPFA 4Q7MB 3AEZA 4QHYA 2GAAA 4M1TA 5A0FA 3NDPA 3ZH9B 4E22A 3KB2A 3MAAC 1P5ZB 1L4UA 2X1VA 4PO1A 3OEEA 2QA5A 4P4TA 1G7SA 3QBVA 4WZBE 2QT1A 2ZJ5A 2E1RA 5DHFA 5FFMA 1CLUA 3CWQA 3PITA 4D4JA 4Q7LA 3FKQA 4HAVA 3LA6A 3VNUA 4JLNA 2AXNA 4B3XA 3MRSA 3QKUA 4MDFA 1FTSA 1H8HD 1E99A 3FHOA 2HYDA 1KSJA 2QI9C 2OG2A 1NN5A 2NIPA 4MRSA 4ZI2A 4QJ3A 4HUQB 5FI0B 3AKYA 4U00A 3LBHA 1E69A 1KO5A 1KSFX 1G5PA 2JDIA 4KYIB 2XSZD 3NDBB 4IDHA 1OH8A 4AI6A 2EFHB 4MA4A 4A0HA 1LB1B 3A4NA 4JLDA 2W6JD 2A5GA 3SBDA 3WP1B 2FZLA 2KWIA 2BKUA 1GKIA 5FUWA 2EU8A 3U3MA 4JLBA 2FSGA 5JS7A 2QGZA 1JR3A 3LVQE 3ADBA 5JFGA 1TU3A 4FN5A 4EAQA 5FPKA 5BN3A 4RD1A 1AK2A 5KSPA 1C9KA 4PC3A 1KDRA 1AQUA 2E9SA 3RS0A 2GJ8A 1S8FA 2JJ2D 3LQQA 2NGRA 4M4SA 4LV5B 1WRBA 2A30A 3BH7A 3LAWA 5KYKA 1YRAA 3C16C 1EFTA 5DO9A 2PZEA 4P33A 4H1VA 1C1YA 3RLFA 1NSFA 3I4LA 8OHMA 3ZIAD 3C41J 1YJ5A 2FGJA 3GEIA 4V0MA 1DAEA 5H1YA 1LF0A 3LBNA 4EPRA 1KKMA 1KO8A 1VG0B 4A8JC 5C46F 4CEJB 1TEVA 4X8MA 2VP5A 2QL6A 1E1QA 2HDNB 3KDSE 4Q1CA 2ZRAA 4QHSA 2F3TA 4JLVA 4W9MC 2PX0A 4C0JA 4LHWA 3CW2A 4JSTA 2F9LA 3RS2A 4XOIA 1E3MA 4D80A 1XRJA 3I62A 3EZ9A 1DAFA 4G5QA 2VYFA 4JMPA 1GITA 2A7QA 4BLTA 2VEDA 3BB3A 3I61A 2XNSA 1EG7A 3WRYC 2IC5A 1IN4A 1GVNB 1PV4A 1VIYA 1CJKC 1CBUA 2QAGA 1E4VA 3HP1A 3R8CA 3L0OA 2R6GA 3SE0A 2FFQA 1GRNA 4CZ2A 1XJQA 2RGNA 3ZVRA 1U8AA 2X2FA 4EKDA 2OCAA 5ELXA 2IUTA 2G0TA 5TV2A 4Z54A 5KHOC 1Z22A 3EPHA 1G19A 3MCAA 1VYUA 1W1WA 3UXMA 3UWKA 1EFRA 4B32A 2PT5A 2QORA 5JRZA 2FPKA 5DN6A 1TNDA 3MMPA 1CIPA 1DAMA 2GBLC 2CBZA 1NVVR 2BMJA 4OHYA 1KAOA 3AH8A 3AF4A 2ZEJA 5L3RA 5TB5A 4ASUA 2HT1A 3BAFA 2RB4A 4KU4A 1JECA 2XXAA 3W5JA 3PUYA 4A2WA 4GP6A 2WKRA 1SXJE 3QF4A 4DDUA 1NY5A 2YYZA 4DSNA 2ORWA 1ZBDA 2GA8A 1CRQA 1ZW6A 3HU2A 1G3MA 1XDBA 2I3BA 3CRQA 1FTNA 4OK6A 3FHCB 4PC1A 1KI8A 4PHGA 3G5UA 2ZE7A 2BHRA 3UIEA 4UXHA 3I3SR 4ON9A 1S0UA 3SU8A 1R4AA 3MGCA 2XZLA 4XSHA 3SOPA 1BKDR 1Q1QA 5FBWB 2XB2A 1O87A 1DAHA 1E2GA 1NBME 4LJ5A 4Q1DA 2EYUA 1U0LA 2HJGA 1NI3A 1XU4A 3D31A 3SC3A 4MKIA 1E0AA 1S9DA 1R6BX 1OT3A 2VQSA 2GJSA 2PZFA 4HLQB 1NKTA 3NEYA 1I4TD 4PHTA 4XVRA 1E9DA 5FTNA 2B7CA 3ICQB 4YC7A 3THOA 4DUGA 2O8EA 1KNXA 3LFUA 4RFSB 1M1YE 2NO1A 3C15C 3N2IA 4GPTA 1QG2A 4URXR 4MITA 4NCIA 1DE0A 3SZRA 2Q3HA 1EFHA 4LBVA 1PLJA 4MDEA 5E7JA 4NL4H 1JR3E 5EP4A 2XZPA 3EWSA 1TUEA 5JCPA 3K53A 1W4AA 4NZYA 3SHWA 4GOKA 1T8UA 1J2JA 2IYUA 2ZTSA 4PZLA 1UFQA 4L5BA 1XTRA 2FSHA 2GCOB 1OFIA 5JWOA 3NIBA 1VCIA 1DARA 2DWOA 1G6HA 1KYIA 1DVRA 2QE7D 3KQLA 3EPKA 1NLFA 2WZQA 2H1LA 1W48A 2Z0MA 2ZE8A 3KQKA 4TL7A 1W7AA 2W83A 2Q0HA 5DHAA 5IK2A 1SVSA 4NKRA 4PPFA 5FPTA 5FH9A 3K8YA 3THXA 1RC8A 1RRGA 3QPUA 4IFBA 3GLIA 2OCPA 3I8SA 1GKYA 1GL6A 4DLRA 1N6IA 1Q1ZA 2WSSD 2G3YA 2WWGA 1NNEA 3O8CA 1P62B 1AKEA 1YR7A 4G1UC 5C2JB 3KX2A 2QPTA 3Q7QA 5JLJA 1BMFD 2J7PA 3TRFA 5FOSA 4XD7A 2ZYTX 2BM0A 3A6PC 2O8FA 4IW3B 2CHGA 3AUXA 4TMKA 3F5FA 2PLFA 1KI6B 2VSFA 4IXMA 1D9XA 3LWNA 2UVQA 1W4CA 2ZRBA 3EZ2A 1E9RA 3U61B 1Z5ZA 2XJ9A 1ZC3A 3OE7D 3ZJYA 2P6UA 1X8JA 2ODNA 2F9MA 3ZVMA 3OZXA 1HQCA 3B7GA 2AK2A 1HT1E 1W2GA 3QKSA 2O0HA 1VIAA 1JAIA 1NY6A 2FE4A 2GEVA 2JASA 2QEQA 1ZNYA 3WXMA 1E79A 5FTJA 1Z28A 1FNNA 1VDZA 1XEWX 2YWFA 3WY9A 1KI6A 1R5OA 2VTKA 1A5TA 2ZUDA 5DYGA 1OH7A 1OIWA 1ZUIA 5BYKA 4FMDB 2RGGA 2WIBA 1ZMXA 2RGAA 1G7CA 1AA9A 4UJ5A 3I5XA 3CPHA 3NHBA 1YU9A 1KZGB 2QP4A 2Q3FA 2J5XA 5HPYB 3BC1A 3B82A 4Q18A 5J4HA 1E98A 4A2QA 3KKQA 2AK3A 1IBRA 2FNAA 5HE8A 4BFZA 3QVVA 2ZSDA 4BWYA 4GSYA 5H8WA 5LB4A 4NTZA 2ZSFA 1E2NA 1A2BA 4A0RA 3B9PA 2OSBA 4P3YA 2ZJZA 4A36A 2DFKB 1NIJA 2GXSA 1FQKA 1CRPA 1JJ7A 2MSDB 1OW3B 2IXGA 4ZCIA 3U3KA 3A4LA 2QT0A 3U44B 3PG5A 1OFTA 2ZE6A 4ZCLA 3TVDA 1P6XA 1KK3A 1GUAA 1GKUB 2R65A 3VX4A 4Y0VA 1KDOA 4E03A 1E9BA 4HB3A 1ZUNB 2V1XA 2W2VA 1NP6A 5H70A 4CVNA 2QQEA 4FINA 1U9IC 3B1YA 3NBZC 4FWTA 2Q9CA 2F7SA 3FFAA 4MKHA 1MABA 1G64A 1QDEA 3TE6A 1FNMA 3QUSA 2WSMA 3ZZ0A 3QVUA 1N6NA 4O2LA 4A4DA 3NVAA 4LJ6A 4TMTA 821PA 3M1IA 4E07A 3AUYA 4WXRA 2ANCA 5E7IA 5KU1A 1TQ6A 4M1WA 3RS4A 3TR0A 1E2EA 3CM0A 3DVLA 4XVQA 3FPAA 4CIDA 4KITB 1E94E 1W5TA 5JSZB 4HB0A 1P2VA 4C0HA 3IDQA 1YR8A 1CS4C 4Z1MD 1XPUA 2GWHA 4A8JA 1G5TA 3EAQA 1P3JA 2V55B 5ANRB 3UK6A 3GLIE 1Z6AA 1DOAA 2CE2X 4A92A 1Z63A 3KTAB 2R2AA 2D62A 4X8LA 2ODWA 2DPXA 3AF1A 4Q9IA 2O8CB 1AQYA 2HT6A 1QBKC 3LRPA 4JBXA 3GFOA 2KE5A 3W3ZB 3ND9A 1R2QA 1J8MF 3IIJA 3HDTA 1FP6A 3KFVA 2OFXA 5G3YA 5JSZA 3I1FA 4OK3A 3ASYA 2Z43A 1FX0B 1WBDA 4PTLA 2BBWA 2ODEA 3U3JA 5FOXA 3EX7C 1IM2A 4QJ4A 2RGCA 2C78A 1N5LA 1GM5A 1KSHA 1Z6YA 2KBFA 5HE9A 1G4AE 1XP8A 2WJIA 4URUR 3AF0A 1TADA 1TQDA 4B43A 4RZ3A 4URZR 1EX7A 1M7HA 2DY1A 2D2EA 3TKLA 3BBPA 4NCKA 2GBLA 2IK8A 1SXJC 3TIFA 1T5IA 1G6OA 1YRBA 1YE8A 4Q4HB 421PA 2QAJA 3SN6A 4II7A 4DLZA 1ONBA 2HEIA 3P26A 1P2TA 3Q8XB 1G5RA 2UZ3A 3AKEA 4LPKA 1V5WA 1WA5A 4HEJA 5L3QA 4JVNA 4URYR 1RVDA 4B3GA 2GK6A 4LBYA 4P0TA 2NPFA 4EDHA 4GDFA 3MG9A 5DI3B 1OXVA 4CYMA 2QMOA 2VA8A 1YZGA 4PANA 1P7CA 1RYFA 2X8AA 3AGQA 3AVVA 3EASA 3A1TA 2J9RA 4KVAA 4NMMA 4D25A 1E9FA 2CDNA 4ZI3A 4DB4A 4DT1B 1PUJA 3HPRA 4BLOA 1MKYA 2BBOA 2RMKA 3L8ZA 5CDFE 5F9FA 1Z0FA 1FUUA 1P61B 3GMTA 4JIMA 4W5HA 2WIAA 1DO2A 3FMIA 1RIFA 2N46A 3E70C 3GCGA 3NBXX 2H17A 1LTQA 3EZ6A 1KMHB 2ANBA 2FOLA 3OFNA 4Z8XA 4L15A 1QHHA 4RD6A 3OEHA 3OEED 2IYQA 3WMEA 2A3RA 2BC9A 1OPXA 4S2EA 1E1RA 2XNDA 4DVGA 4DT1A 1KJZA 4W5JA 4NYJR 1WCV1 3WYGA 5G40A 3RC8A 2WJJA 4G5SA 5JWRA 3PFIA 4LBWA 3RVBA 3AF3A 3KXKA 3IQWA 5IF9A 2WTUA 3AV0B 4AWXA 3AP3A 5CLQA 3W6NA 2ODBA 4KBGA 1E9EA 2YWGA 1NRJB 3JVUA 3OE7A 5E4FA 1AS2A 4WZ6A 4LJ7A 1L2TA 2CL0X 2JDID 2WWHA 1YR9A 2Q9BA 2RGEA 2PCJA 4H9GA 1SGWA 3L2OB 3VR6A 2FX3A 1BIFA 3A4MA 1M6NA 2G9NA 3EA0A 4ZIRB 1UBFA 3NKVA 2DFNA 5A5GA 1JR3D 1SVLA 4DEYA 3EIQA 3GP8A 3W6OA 4BZQA 1IY1A 3VR1A 1CJTC 2G0NA 1HTWA 1Z0DA 5DH9A 2I1QA 1W36D 4U02A 4Q01A 5SZIA 4TL9A 3RRYA 2R6FA 4DHEA 4BASA 2GILA 1P9WA 1IN6A 2FDCA 1G8HA 1GRQA 1CR0A 1K5DA 4FW9A 2R8RA 2JLRA 3R8FA 1DADA 2FFHA 2IHYA 3NXSA 4I1SA 1QHNA 1F48A 1RKBA 2NMVA 3I8XA 1R0WA 1CJMA 4GMXA 3L0SA 4HLUC 1KI4A 1Z06A 4DXAA 3IBYA 4NCNA 4C0SA 1OKKA 1DBSA 4OI2A 4UXJA 2IS2A 3SJAA 1E1QD 3QG1A 4DDVA 4UNQA 2ZJOA 2REBA 1R10A 1JR6A 3GJ7A 1P9RA 4GMDA 4JBWA 3V4RA 2JJ8A 4DLXA 2J0UB 4WZAE 4KSCA 4MRNA 2WJVA 3EPJA 3EXAA 4BFVA 1N3BA 1JPNA 4W7SA 3NH6A 3IIMA 2OBNA 4LYJA 1QHSA 2ECKA 4EJSB 1SKYB 3K70C 1NG1A 5KPDA 3BH0A 4B6FA 1IN7A 2NZJA 3QBTA 2Q21A 5HCNA 2HCJB 4M1YA 5LPNA 3CONA 2IS6A 2DYKA 3G82C 5JEDA 2CVHA 3FKSA 2J0UA 3K9NA 4LYFA 2A9KA 4OHZA 1GDDA 1N6OA 4XIGS 5GVSA 5DN6D 1G3IA 1MR3F 2ZR9A 3KKMA 4Q4JB 2FH5B 1MT0A 4YMVA 3O8DA 4DSUA 4NH0A 4ASUD 1FW6A 3K09C 3WHKA 1TX4B 4P4SB 5E3HA 4ARZB 2KSQA 2IYXA 1G291 4F4JA 2O8BA 3RNLA 1UKVY 2OLJA 4LZZA 4HDCA 4D0GA 5LB2A 4BFYA 1Z0AA 4DLVA 4TZ6A 4A6XA 2V3CC 3A37A 4Q4AB 1I4DD 2CHVA 2C99A 3VTKA 4A0FA 3K70D 1GWNA 2C03A 4DWJA 3QPVA 4OBEA 4A6PA 1U9IA 1ZIOA 4A15A 1NL3A 4NP6A 1XD9A 3BFVA 1Z2AA 4ITRC 1F2UB 3CO5A 4QGAA 4C2TA 4KI0A 1KTVA 1CP2A 3UMSA 5KDOA 5H68A 2BMEA 2IUUA 2C5LA 4FCWA 2F55A 3REGA 5JEEA 4RCZA 2CCJA 4HDQB 5B58C 4OQFA 4TYQA 2R44A 4R71A 2BWJA 221PA 4BPBA 1NKSA 2J87A 1KO4A 4NCHA 1HE8B 4DUGD 3RDPA 4RD2A 1NVUQ 3MFYA 4ZKDA 4MUBA 3KKOA 2O8DB 4J0QA 3L0PA 4WVFA 3U4QA 4QC2A 2VF8A 1F2UA 4B47A 3QE0A 4QFMA 4BUJA 4GFDA 4LI0A 4JLPA 1E9SA 2V4ZA 4XH9B 5CIQA 4W5WA 1Z3IX 2P67A 3T12A 4HLCA 3AKDA 4X8OA 5TDHA 1D6JA 3IPYA 2GDJA 1RW4A 2GNOA 3SJBA 3VKWA 2D74A 3Q85A 4BLPA 1W47A 4RFVA 1SQ5A 4AYTA 2ZJAA 2O8DA 1XMSA 2IUSA 3CF6R 2ZXUA 5FPYA 3Q9LA 5J47A 5AK0A 4N1AA 1U0JA 2C2HA 1Y3AA 3WBJA 4IEIA 4TT3A 1EFUA 4D6PA 2YOHA 1OXUA 4Q4LA 1Z47A 5JJIA 3X1YA 4XWOA 4AG5A 5D3MB 2CK3A 1IXSB 1ZYUA 5B64A 5KDDA 3NC0C 4LHVA 4MYTA 2MMGA 4Q48A 1Z0IA 2JCSA 3L8YA 2VP6A 5FL3A 2EFCB 1A82A 1XB2A 2B8WA 3H86A 1CTQA 1IOZA 1SXJA 3L0IB 2J7PD 1JEEA 4XD7D 1MRNA 1MOZA 2JLVA 3KQHA 1PJRA 3BS4A 1JJVA 4MKFA 3PEYA 3GJ3A 4HAZA 3QXSA 3V00A 1S4QA 5AJZA 2RGDA 2WBLC 4LJYA 4AYXA 1HA3A 1Z0KA 2XEXA 4IVRA 4XTCS 1NBMA 2WV9A 4YQFA 3TUJC 5SZJA 1R8QA 1CR4A 1SKYE 2A5DA 1DG1G 2RGXA 1E79D 3QPWA 4CRWB 3TAUA 2PCLA 1NLYA 3FFBA 2JATA 2CE7A 3BXZA 3CH4B 5DIFA 4QNRA 1XJ0A 1G4UR 3B60A 1N6HA 4ZV4A 2G1JA 4HLDA 4EQ6B 3CPEA 3GEHA 1BO6A 1OXXK 4PZZA 5JECA 4ESVA 2Z4SA 5FPSA 4OI4A 3MWJA 3P20A 1KI7A 4TN1A 2H18A 3PVSA 4LBZA 3WNBA 5DISB 1VCMA 2WM9B 4HUQA 2EW1A 4IOMA 3ZZUA 1ZM2A 4HZUB 1IXZA 4MRVA 2XTNA 1R8SA 2OO7A 1XCMA 3N2EA 3QSYA 4N0EA 1U0HC 4HAUA 1E6CA 5JCZA 4OYHA 5E95A 2ZETA 1KDPA 1LF5A 4BRWA 1AGPA 2YWEA 3EWAA 2CLSA 2PMDA 2REXB 5HZKA 3AVOA 3UG6A 1NN1A 2ONKA 3K0AB 4D26A 2JLSA 1F60A 2ZPTX 4NONA 2XGJA 3A58B 4CDGA 2YKGA 3CLVA 1WXQA 2EFDB 4MGZR 1G17A 3JVVA 1WDTA 3NTUA 1UJ2A 3U3OA 2J7KA 4RD3A 2WAYA 3H2YA 3RS7A 2ZRDA 3EG5A 4D2IA 3AKCA 4TL6A 5SZKB 1E0JA 1W49A 4Q7KA 1PUIA 3RWMB 4F7WA 5FOWA 3QI2A 1LNZA 2J0QA 3MWYW 4CEJA 5TY0A 4OKSA 1JXOA 4L4UA 2QSZA 3NG1A 4ACBA 1TAGA 4X8HA 1XCGB 2LKDA 5K8TA 1KK0A 2VHUA 3VAAA 1RPZA 3FVQA 3WNCA 3IHLA 2VP4A 3QJYA 4LK2A 2X77A 2VHJA 3JZAA 5JRJA 5EE1A 2ZRIA 4B33A 4Z8YA 2WJGA 4B48A 4D4LA 3CPJB 4HZIA 4TWZA 3D8BA 3MD0A 3SJZA 4HLUA 5CITA 4GOJA 2IW3A 1ZD8A 5C4GB 2L0XA 2WWFA 1ZNXA 4Q66C 3OIVA 4Q9JA 2YWHA 3CRW1 3V4FA 1WBBA 5G53C 2F43B 4LHZA 1WB9A 3DM9B 1OFUX 3HR7A 5GVRA 4BGDA 5HCIA 1DAIA 2K5UA 3CRRA 2OHFA 2OFWA 3TW8B 2WOOA 4FMDF 4DLSA 4Q47A 1E2MA 1Z0JA 1RE0A 1VG8A 1QVAA 4IOJA 3CRVA 5J4KA 1P2SA 2ATVA 5BWMA 3GJ5A 2OE2A 3BB1A 1RRFA 2V7QA 4HAXA 2B7BA 2GXQA 1K6MA 3SR0A 1H8EA 1IAQA 2VL7A 2QENA 2ZM5A 1NMZA 4BQSA 3VHXA 1KI9A 1U94A 4MYUA 3A1UA 5SZHB 4RZXA 4RVCA 3Q3JB 1FPMA 5JZVA 1XEXB 1UKZA 4NYJQ 4MQBA 4OK5A 1OB5A 1ZC4A 2OESA 1Z2CA 2IL1A 2QMEA 3PEUA 1XCPA 3K09A 4ILEA 3BRWD 2IX3A 3FWYA 3E5HA 4I4LA 3QIAA 3CKLA 3PENA 5J40A 4IEEA 3DEFA 1G8YA 1N0VC 4ERNA 1XPOA 1ZM7A 1XTSA 3LDAA 3AVWA 5HKKA 4Q21A 4DDWA 2IEYA 3U60B 3GJ0A 1IQPA 1XMVA 3HU3A 4QM7A 2HYIC 4JJKA 5B57C 1B0UA 4RY2A 2GETA 1KK1A 4PSAA 5EP1A 2IYLD 3RANA 4HB2A 1U8ZA 2V8OA 4RFSA 3GLHB 3AB3A 1T0JB 2PJRA 3VR2A 5FOVA 1T6NA 2PH1A 4RZUA 2RH5A 1XXHB 2B6HA 1D5CA 2AXPA 2ZRMA 1RYHA 3CF0A 1U2RA 4UNPA 2WVJA 5IHPA 5FTKA 1S3GA 1ELOA 4AKEA 5C18A 1II8B 3OFND 4PHFA 5FTMA 1DTSA 5HZHA 3A8TA 3O47A 4JL8A 3OEHD 3HPQA 4CF7A 1UPTA 2ZRJA 1E1RD 1MV5A 2GCOA 2XNDD 1R5NA 1ZCAA 3B5JA 4GOXA 4AKIA 3BGWA 4MGIR 3ZS9A 1GNPA 1ESMA 1G7TA 2ATXA 1L7VC 3LV8A 2J41A 4WW0A 2J45A 4AY2A 1KDTA 3EIHA 2ZU6A 4Q03A 3MJRA 3KKPA 1JPJA 2DWQA 2QM7A 2GAOA 2D7DA 1XMJA 2IS4A 3THYB 3ZDQA 1F2TB 3ZD7A 2AFHE 2N42A 2GVDC 5E7MA 3N5CA 4C9BA 4LC1A 4R2IA 1TEXA 1Z07A 4PFSA 2F1HA 3T1TA 1GIAA 3TH5A 4IDOA 4ESHA 2WKQA 5TXGA 1VECA 2ZU0C 2D3WA 3IEUA 4TQAA 1E2KA 2WWYA 3ZQ6A 2O52A 1VG1A 1U99A 2AKYA 2W2XA 4BE7B 2Z5FA 1O3YA 2OV2A 2IHBA 3KJHA 4V0KA 4URVR 4KXFB 1E2DA 1UDXA 1LS6A 3K9GA 3LY5A 3SS8A 3SQXA 3IKJA 1WF3A 5LDDC 5LD2B 2Z6VA 3IHWA 2VRWA 4TMZA 1NVXQ 2F1IA 3QXXA 2FMXA 2RAPA 3WHLA 4G3XA 4DZZA 4O3MA 4EJSC 3CWZA 5CDFA 3I92A 3R9WA 1OKKD 2ZYVX 5FI1B 2ORVA 1IHUA 2QMHA 3CNLA 1S2MA 2C96A 2OAP1 3R7WB 2SHKA 2GXAA 2HXSA 4Q1BA 4B3FX 4KAXA 1AGRA 1OH5A 2BV3A 1XNJA 2Y8EA 2AFIE 2GESA 2PZGA 4F4CA 3BJIC 5EUQB 2ZJYA 4MYCA 1OV4A 3Q7PA 1VYVA 1DELA 4B71A 2CJWB 3A1VA 3Q5EA 4Q00A 3U3RA 4PXAA 3Q5DA 4Q19A 4KCGA 4TMXA 3S1AB 3FKSD 1IJFA 4TLDA 4JLKA 1GZSA 2OXRA 4KSBA 3REFA 4UNSA 4IHQA 3KKNA 1IJEA 3U44A 4EFMA 4QBFA 1KJWA 4EPVA 3AVQA 4O25A 2ZI9A 2RKOA 1HY3A 2QROA 3CH5A 4G0NA 4I1VA 3AVTA 2ZR0A 2EVWX 1UBEA 1HURA 4PZYA 3VFDA 4KFRA 1EWRA 2IXFA 4Q1AA 4MGKR 5DYIA 3B85A 3I5YA 3DZ8A 4AIIA 4ZDKA 2N1BA 1J7KA 1GFIA 1SHKA 2BEKA 2P0EA 1KI1A 3C5CA 4AK9A 5L3SB 3GLHE 3P32A 2YOGA 1GNRA 1G3QA 1GTVA 4B3CA 1AJEA 2IF0A 1NMYA 2A5JA 4IOLA 4NDZA 1ZINA 2O8FB 3QEJA 1FFHA 3RYTC 2VP0A 3PUWA 3EC1A 4DSOA 4TSFA 3W3AA 1S1CA 3SYKA 1OB2A 2PX3A 1MO5A 1EWQA 3KTAA 5IRCD 3ECCA 2OAQ1 5EZ6B 5CM9C 1X8KA 2O8CA 3ETLA 4A0GA 1CU1A 2FFBA 5KSYA 2XTZA 2JLXA 3IUYA 1WMSA 3D3QA 3EW9A 5GJWC 3TJZA 3B1WA 4K46A 2ZUBA 2XAUA 3T1OA 4B74A 3IQXA 2LWIA 2BEJA 2QUZA 1E0SA 1CJUC 3E1SA 1FX0A 1W2HA 1D2NA 4LRWA 3K0CC 3T61A 3TR5A 5TMPA 1FMJA 1OYYA 3B9QA 4RD4A 1KIMA 2IYTA 3MSXA 1M7BA 3UMRA 4B44A 3LVRE 2FPMA 5EE9A 1XTQA 3BK7A 4QNMA 4F93B 2VH5R 2WWWA 1MRSA 3KUDA 1UADA 2XJ4A 2BBSA 1N6PA 1XTKA 1E32A 3X2SA 4PR0A 1IXRC 4Q4HA 4QHTA 3HJNA 4HDOB 4TT3D 2J0SA 1SZPA 4ZDJA 3IO3A 4LJ4A 1CXZA 1BS1A 1PZNA 1UF9A 1NN0A 1YHNA 4HATA 5CYOA 2A5FA 4OQXA 2CK3D 5UKDA 1I4LD 1FP7A 3BFXA 1G18A 1SVOA 3CNNA 1WP9A 3NEJA 5DI3A 5L3VA 1EX6A 3PUXA 4D82A 2GVZC 1SXJD 1T4GA 4ZKEA 1Q3TA 3AP2A 4JVMA 4JVSB 2R6CA 4FD2A 3QF7A 4IKEA 4I81A 1KI2A 1D2MA 5EXPA 1CEEA 2GRJA 1HV8A 2PEYA 3PUZA 4EPWA 1Q57A 4DRZA 2BCJQ 2IYYA 1E9CA 1ZM4A 1G41A 2BKEA 2QGNA 2VSOA 3GLFB 3DL0A 2EQBA 1NBMD 4JLMA 3TLXA 1YKSA 4HYYA 2OILA 1KMHA 2ZR7A 1A4RA 4HAYA 5DLQC 4A9AA 1XD8A 4B3DA 3PIRA 5BN4A 4KV9A 4DCSA 1OIXA 3QY0A 5EUMA 3FDIA 3ZQJA 2W2TA 4QGHA 4EFLA 4QGFA 4M0LA 2ORIA 4Y0AA 4FXPA 2FGKA 3C5HA 3VU9B 3PCRB 3RAPR 4FMBB 3SFZA 5EXTA 4RD0A 5K8IA 3H1TA 1M74A 2W00A 5CM8B 2IWRA 4BECA 4CW7A 4YMWA 2KJQA 4JLAA 5FUVA 1PVOA 1A7JA 5EJEA 4UJ3A 2WHXA 4XWAA 1M7GA 4V0LA 2ZQ5A 2AKAB 1NJGA 2JLQA 2KB0A 1AM4D 2HUPA 3QKRB 1S96A 4ZIRA 4B75A 1P9NA 3RRZA 5D3QA 1J70A 2QRZA 1E2PA 2OCBA 3KFXA 3MUFA 1L8QA 5KNBA 1RRPA 2QPOA 2RCNA 4BFWA 4DBLC 3W9YA 1AZSC 1EFCA 4DCVA 1Q0UA 3TAHA 3SBEA 1AS3A 2VF7A 4PC7A 3KXIA 4K8OA 4RKFA 1XD2B 3D7MA 3K0FB 4B2PA 1LY1A 1RZ3A 1NF3A 2G88A 5FOUA 1GG2A 3ADCA 1JQJC 3H0KA 2GJAA 3U6KA 3WRXC 1Q20A 1KY2A 4F92B 1ZD1A 1KNQA 1EESA 2B21A 1Q1BA 5P21A 1DO0A 4B35A 4TLCA 1W0KA 4I1UA 1GSIA 4G01B 4XSGA 3P4YA 2H8KA 1CF4A 1RJ9B 3QOFA 1AN0A 1X3SA 3EPLA 1DAGA 4IDQA 4NYMQ 4NPHA 1SVKA 2ZAMA 4YLGA 3R20A 4TLBA 1F5NA 2IYWA 5A4JA 5CYPA 4BFSA 3QXHA 5AUNB 4V0OA 4JJZA 4EJSA 1ZVQA 2GF0A 2YVUA 2ZREA 4AKGA 1FUKA 3WP0A 4PC6A 1KK2A 3PUVA 1QHYA 3WBKA 3WYFA 4C7OB 1P73A 2FG5A 3C4JA 2IEZA 3FB4A 1OFHA 1W46A 3F0TA 1VKJA 2BOVA 1ZNWA 2QSYA 3BE4A 5JWHA 3IPXA 2OM2A 2OBLA 1G1MA 4V03A 4US0R 3BIFA 3FYHA 2KI5A 3B2EA 2WAXA 4KBFA 3FHTA 2H7VA 2EYQA 2FFAA 2NG1A 3HU1A 4Q4JA 2A78A 2V7QD 3K1JA 2NO7A 4P4SA 1H8ED 4ARZA 4UQOA 2PJZA 3UKDA 4NCJA 3SDZA 3ZVNA 4UNRA 3DOFA 3VR3A 5JMTA 4D0NA 3QNUA 1BH2A 1US8B 3SYLA 3U7GA 2EFEB 4Q4AA 4FMCB 2C98A 1B23P 2AD5A 1E2JA 2ZUCA 5DI9A 1ETUA 1T3LA 1VYTA 1Z6GA 5FR2A 4M8NE 2D06A 2MMCA 2QMUA 4RSGA 1OF1A 3M6AA 4OHWA 4XJXA 3OAAA 3J81k 1R0ZA 2CCKA 2GJ9A 5HKKD 3OIUA 1A2KC 4M1MA 5DE3A 4AC9A 1FQJA 4I1OA 4M1SA 1VCNA 1NMXA 5G3ZA 2X19A 3KJGA 2IWHA 2FV8A 2J0VA 3EIEA 1MO6A 4JT2A 1ZRHA 2FF7A 1TU4A 4DSTA 1EK0A 4IOKA 1E0KA 2C8VA 2NTYC 2QRNA 4CEHB 1XEFA 2J1LA 3PQCA 3SI7A 4U5XA 1OSNA 3K9LA 2JLZA 2C77A 3DKPA 1G3UA 1TF5A 2CEAA 4KLZA 1A1VA 3IGFA 3EC2A 3ONWA 4XWKA 4OI0A 1Z83A 4LSGA 2IBMA 4UNNA 2OBMA 2ZRLA 4KODA 3PEWA 1KAGA 1QZXA 3AF2A 4JBYA 3TUIC 5CIWA 4EPTA 3F8TA 3B6EA 4KFUA 4B6EA 5FL7A 4KVGA 1M2OB 1UBGA 3TUZC 3K0CA 3LW7A 4YDSA 621PA 3LQRA 2W6IA 3THWB 2DFTA 2QN6A 5D3MA 3UANA 5JBQA 5F9HA 4C0KA 4PPQA 1AIPA 3T15A 1I2DA 3P27A 4V02A 3LLUA 2DR3A 3CX7A 4JKYA 4A2PA 2F3RA 5LD2C 3ZLJA 1W0JA 1ZJ6A 1JEDA 2IYVA 4LJ8A 4RJLA 4QXAA 4D4KA 1W4BA 1G8PA 1MO4A 2DWPA 1Z6TA 4M21A 3T34A 4B2IA 3THWA 1PLKA 2JAQA 1U8YA 3KXLA 1T3SA 3VMFA 1JALA 1UM8A 2G1KA 2OFOA 4P4UA 3EZ7A 2B92A 5GJBA 3GJ4A 4LWZA 2VBCA 2AHOA 4M2LA 4MH0R 4NE2A 3QKTA 4Q1EA 4URWR 1W36B 1Q21A 5KUTA 2YJTD 4LJAA 1RRCA 2JJ1D 2OCYC 2HXYA 5AJYA 1H65A 2R9VA 2WMOB 3D6TB 3MWLA 3UMFA 2P6NA 2Z83A 1G8FA 1QRAA 3WNDA 3KUCA 1J99A 2NPIA 3PEVA 3WMFA 4EQ6A 6Q21A 3QXCA 3KZ1E 4E09A 1S9HA 1UAAA 3ICEA 3HWSA 1P75A 5J4YA 1NN3A 1ZD9A 2XX3A 1F6BA 3IEVA 3K9HA 1HQYE 4IXNA 2JA1A 1YZNA 3EA5A 4FCTA 4HZUA 3LH5A 1OXTA 1P4SA 2QP9X 1WQ1R 4O2RA 5JHGB 2ZITA 1EGAA 1V43A 5EP2A 4YXWA 1GOTA 1NSTA 5AWFC 3UWOA 3P4XA 4TMVA 2QP3A 4ZDIA 4DIDA 1FL9A 2WOJA 4GRAA 5FOTA 2PL3A 1JBKA 2YNMA 4IDPA 3CNOA 4PQYA 2HLDA 521PA 2X2EA 2R62A 4PAOA 2XOKA 4G5GA 4ACAA 2W58A 4UXIA 1KOFA 3F3YA 3K0AA 2YHSA 4GNKA 4O0MA 2C04A 2QAGB 4GI7A 4WIAA 3FMFA 1XFAA 5EZ5A 4AKHA 2F1RA 2YC4C 5JI3E 2CMKA 4JL5A 5AJVB 4BZXA 2DFLA 3GFPA 4IFEA 3U2QA 4Q9KA 3A1SA 3B1VA 4QBGB 4CT5A 2W0SA 3DHWC 4TMWA 1Q12A 4EFNA 2DHRA 5C4MA 5JJKA 2HF9A 2P5SA 2F1JA 2WJYA 4NYIQ 2GZHA 2O5VA 3CX8A 4KHZA 4TYWA 1KI3A 1BYUA 3VNVA 3VKGA 2FU5C 3DPUA 4GZLA 2V54A 5IT5A 2QPAA 5FR1A 1SVWA 1E2IA 2C9YA 2VLIA 4JSYA 1OHHA 1Q3HA 2ZSBA 1E2LA 2XXAB 5K8LA 2VO1A 1KGDA 3QF4B 3IBGA 4F4IA 2ZRHA 2XITA 4TSFD 2QG6A 5F98A 3K70B 2VHTA 2WPDA 1W44A 2C9OA 3RSLA 4HAWA 4PQRA 4BEJA 3QEOA 4OQNA 5JHHB 2CNWA 2ZS7A 1BYIA 2YV5A 4GT1A 4DDTA 3LW8A 3DKVA 1HYQA 2GHIA 2F43A 2P5TB 1JQLB 4LHYA 1GAJA 1S1MA 5JI2E 1J90A 5KPJA 4OQMA 2V6IA 1SULA 4N0DA 1VCOA 1GL9B 3LBIA 4KFSA 3TGPA 2JIZA 3NHAA 1R0YA 2XZOA 1FMLA 4NYMR 4DIEA 2O8EB 2JLUA 2VHCA 1X6VA 1LVGA 2ZIAA 1Z29A 5KO2A 4LJ9A 1ZCBA 3FMPB 4LHXA 4BLRA 1ZU4A 1IN5A 1OYWA 1UEJA 2QM8A 1VHTA 1N0WA 2JLYA 5CK5A 4QGGA 3ZZTA 2ZRNA 1E9AA 3UG7A 3AVXA 2ERYA 4GZMA 4U7DA 2YZ2A 4L9WA 1GP2A 5KNDA 4DCTA 2ZVPX 2KBEA 4RZ2A 5KDLA 3RC3A 3U5ZB 3W90A 1XEXA 2ZYUX 3C8UA 2EWVA 2LKCA 4MGYR 3U7FB 4AD8A 2JGNA 4M1OA 4KO8A 3VQTA 2QTVB 4QG7A 4LX0A 2GZAA 3FOZA 2NQ2C 2XB4A 4FCVA 1CR1A 3W5IA 3HYTA 1XF9A 1CR2A 1K8RA 3EARA 1AS0A 2R6DA 4H1UA 2ZROA 3BFKA 4E5UA 3L43A 2HV8A 1PLLA 1DAKA 3FMOB 1QHGA 1W5SA 4NU0A 5AUQA 4NHOA 4ZO4A 4C3ZA 3SNHA 5B30A 2FSFA 3CZQA 2P65A 4N3NA 3THXB 4QM6A 3GLIB 3AVUA 4TZ0A 3C14C 3AM1A 2BMDA 4QRHA 3GLHA 4OJQA 2CHQA 3PJRA 4PQFA 5BXQC 3VKHA 4BFXA 3B1ZA 3DO6A 4JL6A 2C9CA 5TARA 5BN5A 3A1WA 2QNRA 3RHFA 1XXHA 2BDTA 4V0ME 5FBQB 4GBMA 1D2EA 3W8NA 2P2LA 1XTIA 4M9XA 4EIWA 1COWA 4C0QC 3K0EA 5BQ5A 1II8A 2GEDA 1IY2A 3TQFA 3QXJA 2ZANA 3NBYC 3PR1A 5EQTA 4M9SA 4V0NA 4WAUA 5EP3A 4B76A 4TTQA 5JJLA 4PHHA 4D4MA 5G41A 2VPPA 5EE3A 4BLQA 4BZPA 4B3BA 1SKQA 4FI3C 1XZPA 4R7ZA 2OLKA 1I2MA 3PV0A 4L8GA 3QKSB 2BBTA 3O8BA 1UDWA 3H4MA 5KSOA 1GNQA 4MYHA 3WYAA 1T9HA 3UPUA 2BCGY 4M22A 1XWIA 5GJCA 3TBKA 4DLWA 1Q22A 3IIKA 3U6BA 2ZYWX 4HI0E 4DLTA 2AR7A 3B78A 4DB2A 3THYA 4C2UA 2VP2A 1F2TA 1UKYA 4XTRA 3TSWA 2I1VB 3X1ZA 1IONA 3M4YA 1N6RA 2ZS8A 4QKQA 2RGBA 2EWWA 5AUOB 1H8HA 5FUYA 2VP9A 4ZDWA 3GLGB 2ZI7A 4PSVA 4EUNA 3BD9A 4US2R 1E2QA 1IY0A 3TQCA 2CLCX 5F2EA 1KY3A 2JJ1A 4WBSA 4GL2A 2XSZA 4US1R 5EXSA 2GCPA 2GF9A 4PPGA 3G0HA 2E87A 2YOFA 4TYNA 1N5KA 4LYHA 3CB4A 2FZ4A 5GADl 1N2CE 1IN8A 2W6JA 3NBFA 3LX5A 2PBRA 4MUAA 2AN9A 1ESNA 1OLOA 3BH6A 4LYAA 2GXUA 4LY6A 3GLGA 4WOPA 1GILA 2MSCB 3CUEF 3OESA 2PT7A 1Q1EA 2P3SA 3CR8A 2P6RA 2CCGA 1DG3A 1HH4A 4BLSA 2JJ2A 3NWJA 5AJXA 1E4YA 4P31A 2WWIA 1FOEB 2ZRCA 4YMSA 1TTTA 1QG4A 1ZM3A 1W0KD 4DLUA 4KJZA 3W34A 3SYNA 1MABB 3GEEA 1TF2A 2IYZA 4B2LA 4DLYA 3ZIAA 2AWOA 3R7WA 1TQ2A 2IT1A 4TQUS 2PEZA 1XMIA 4M9ZA 1XX6A 2FWRA 3I72A 1AKYA 3KJEA 1G16A 1U90A 4PPNA 4YMUA 1VPLA 1DEKA 4Q9HA 4IRUB 3IILA 5BYJA 4C0BA 4KLNA 3GPLA 1XPRA 2CJWA 4Q5IA 5L8VA 2I4IA 1KJYA 1LW7A 4M9QA 2QU8A 3R9IA 3S1AA 1G3RA 5EE5B 1J8YF 4OQLA 4A8JB 1NIPA 3DOEA 2FSIA 5TVKA 2HF8A 1ZAKA 1ANKA 1JB1A 3C7KA 1T3HA 3RRMA 1TUIA 4LCBA 2FEOA 2GTPA 4IJMA 4KFTA 2WWXA 1OIVA 1ZUHA 5DSZA 1JXMA 1L4YA 4B34A 1XXHE 1ZP6A 1U98A 3VX3A 3GQBA 2G6BA 5DNYB 4OHVA 4OHXA 1AZTA 5AUPB 4LPSA 3WMGA 5K8UA 2NOAA 3O8RA 2BJVA 1UEIA 3CX6A 4A82A 1UBCA 3LD9A 2CL7X 2FN4A 4AURA 5CB8A 2QBYB 4TLAA 4JVLA 3E2IA 2D2FA 4PO9A 2ZJ2A 2ZVQX 1Y63A 3DMNA 5L3SA 4B73A 1HT2E 3JZMA 4TLEA 1YQTA 4C30A 5FBRB 1UKEA 3P1JA 1XTJA 3ADKA 4TQ9A 4R2HA 3AGPA 1YVDA 1TL7C 2IS1A 4OJKA 3OAAD 3T5GA 4S35A 5FTLA 1LV7A 2OEPA 2FPLA 1K5GA 4IDNA 3H84A 3DDCA 3AVPA 2G83A 3LO5A 2QBYA 3SJCA 1N25A 4WXPA 4NYIR 2NZ8A 3GFTA 4TTRA 1P72A 3MLEA 5L3QB 5JS8A 3LXXA 3ZGXA 2VIIA 1G7RA 3GD7A 3OIWA 4ZPXA 4EPYA 5FBVB 3CRMA 3T06B 3RS3A 1P60A 2J46A 3ND8A 5J5CA 1TQ4A 3BB4A 1E2HA 1TPZA 1II9A 2IYRA 4KYUA 4PC2A 4Q1FA 4UKDA 5AJWA 1NLZA 4RKEA 2REOA 2ZRFA 4QBIA 4A1FA 1LFDB 5C1BA 2C95A 3W6PA 4QL3A 2QTFA 2BMFA 3T1VA 1G9XA 4BEBA 3MJHA 4GP7A 3GLGE 2V1UA 3SEAA 3U7EB 3UATA 3EZFA 3FTQA 3OIYA 3AVYA 4DEXA 5FL7D 3TVTA 5CJPA 1S3SA 2V9PA 1QHHB 2ASEA 1LS1A 5J4VA 2OT3B 3HYRA 4JKIA 1ZNZA 5FUXA 2ZRPA 1DS6A 3LX8A 2W6ID 4YMTA 2VSXA 4DCUA 4LV8B 2QE7A 721PA 5KSZA 2ZSEA 1NG9A 1HUQA 4OI1A 1G20E 1N0UA 1CKEA 3R9XA 2GEUA 3RRNA 3VR4A 3KJIA 1T0HB 1M8PA 2J59A 2ONJA 2WKPA 1JAHA 1JI0A 2CVFA 4QOSA 1W0JD 4ABYA 3IO5A 2LCFA 3ZYCA 3BOSA 2WSSA 4DJTA 3FGNA 1W36C 1YZUA 4FMCF 4LDJA 2ZE5A 2BVNA 2CLDX 1N6LA 5FPHA 3ZVLA 4TYYA 2BIFA 3Q72A 1GL7A 2RHMA 1BMFA 4Q7JB 4BRUA 3KL4A 1VMAA 3GLFA 4D81A 2FJUA 1G21E 1F3OA 2UKDA 3RS5A 1OH6A 1XBTA 1E96A 2OUKA 1R7RA 1C4OA 2ZJBA 2GKSA 1N5IA 4XVUA 3I32A 1QF9A 1X1RA 4CGZA 3DMDA 1ZM9A 2WMNB 4MRPA 5HTKA 2FA9A 4HB4A 1D8TA 4LUCA 1JNYA 4BFTA 4CT4B 4F38A 3I73A 3QG5A 2IYSA 3M0EA 2D7CA 1N6KA 3VU9A 2NO9A 1U81A 4JT4A 3CZPA 2ZI3A 4D0LB 2NO6A 1QVRA 3K0SA 4C4PA 2GK7A 2R6AA 1QHXA 1X8LA 2H5EA 3ASZA 3VR5A 1D9ZA 2G77B 5DGXA 2QAGC 3N70A 2JLWA 4YXWD 4ZCMA 4JLOA 4TL8A 1YZKA 2QY9A 3ZS8A 2RGNC 2XTMA 4LC0A 1NVVQ 2HCBA 4Z51A 1KSGA 3QKRA 2HLDD 3SHFA 3W8RA 1YZTA 2JEOA 2O0KA 5KOYA 1Z8FA 2XOKD 2UZIR 1MH1A 2BM1A 3HR8A 1ZU5A 4LGMA 3QENA 2Q6TA 2ZAOA 4L16A 5IDVA 1NVWQ 3FE2A 3CR7A 3GJXC 3GJ6A 1N5JA 1W4RA 1II0A 1XD2A 2DCUA 3X1WA 1YR6A 3K0FA 4M1KA 4C0LA 3A36A 4CEIB 2A5YB 4PSKA 1OXSC 5J4LA 3X1DA 3KQNA 2AL7A 3BWDD 4JYCA 3RSOA 3T1QA 4AYWA 3U7HB 1BOFA 1X86B 3ZD6A 3BERA 4AG6A 1X1SA 1SVMA 2W0MA 3GJ8A 4G5OA 3T35A 5KTYA 4FIDA 1VHLA 4K81B 1VTKA 4R9UC 2YC2C 2OXCA 2QTHA 4I99A 1OHHD 4JYBA 4DC9A 5GJVC 2O8BB 1RJ9A 3PXGA 1KO7A 2D4HA 4MKGA 5HR5A 5AR1A 2FEMA 3B13B 3B8HA 3KB1A 4MRRA 4G5RA 4CEIA 3LXRA 4JZKA 5F3WB 2J3EA 1EFRD 2WPDD 2DBYA 5CLLA 2A2ZA 4YDHB 2ZRKA 1E2FA 4LOAA 1YZQA 2CNWD 2ERXA 2B8TA 2V6JA 4C7OA 2IXEA 2NO0A 4PO8A 1G8GA 2ZI4A 1TMKA 3CF2A 4PAMA 1MO3A 4FWIB 1QHIA 3NC1C 2H57A 2WICA 2GJKA 4OL0A 2GZDA 4Z1MA 2AD1A 3CBQA 1XJCA 3OF5A 4POAA 5EXXA 1ZIPA 1SHZA 4LV6A 1OE0A 2QQ0A 1RFLA 2JIZD 3L82B 1GRRA 2F6RA 3TMKA 2TMKA 3LNCA 5B2ZA 2QZ4A 1FZQA 3TW4A 1CJVC 5CK4A 2OZEA 3U4QB 2VHQA 4IVPA 4Q9LA 4P32A 2DB3A 2AWNA 3T5DA 4BFUA 4C0AC 2Q9AA 2ZI5A 2GCNA 3GLFE 1OJLA 1Q44A 2IA5A 4DCNA 3NH9A 2AX4A 4HSEA 4IVQA 2Z4RA 1KMQA 1XEWY 3TK1A 3AQ4A 4TTPA 3MWKA 5CB6A 1TF7A 1US8A 1KHTA 4QBHA 3KQUA 5EE0A 3TSOA 1T5LA 1SVIA
chains in the Genus database with same CATH superfamily
1KZ7B 4IF4A 4LTMA 3LQKA 4CR7A 3LNTA 1ODFA 3QQ5A 3R6GA 1QUEA 1BJTA 3TNFA 3FOEC 4EEZA 4YJKA 3NUZA 2RHDA 4R98A 5KYNA 1EZ1A 4P36A 3PE6A 3AP1A 4Q9NA 1ZL0A 2ZI6A 2W90A 4J6EA 4RQAA 1A9QA 5FADA 4KMOA 4C04A 2BJWA 4CCAA 4ZYVA 2BFMA 4TYPA 4RA9A 2OSVA 5C8XA 1ADCA 5FBLB 2DETA 1WY7A 2C2YA 3I2FA 4OGLA 3QNMA 1HDXA 1UZAA 4W8OA 5FA5A 2IF2A 4BNHA 1JFTA 2WHPB 1P31A 2X3UA 3CJQA 5LQKA 1IMJA 1IOVA 1Z6XA 4LIPD 3UV7A 4YRFA 4DA0A 1GGVA 1UZLA 1BDMA 4WOJA 1EFVB 4M46A 3DZDA 4Z0HO 2YY6A 4FUTA 1Q7BA 3D8NA 5JSYA 3VHLB 1V7CA 1LU9A 4L9SA 3Q40A 1T9AA 4Q02A 4TXJA 2OVFA 3RABA 5HM6A 3SFVA 1DKNA 2PGIA 1KJ8A 1KARA 2ORYA 4N7RA 1U8TA 2AE1A 2HLNA 4EG7A 2QLMA 2R6JA 5DLDA 2MT9A 2NU6B 3RC9A 4FD3A 4EF6A 1MB0A 3ZGVA 5D84A 1YBFA 4F3KA 1NJ1A 2WIDA 3CUVA 3QI7A 3NDPA 1IWOA 3MMXA 1KAEA 4ZAGA 4DV7B 4K88A 1LPNA 1M2OA 1CY8A 5AM5A 2QA5A 5LJLA 5KJFA 2NX2A 5CG1A 2QT1A 5COBA 5ECWA 1PWXA 2E1RA 2ZWIA 3I04M 4Q7LA 3UOGA 4K6CA 5BP7A 1K4YA 1SY7A 1GU1A 1ZY2A 4BO4A 5DXJA 1MPXA 1JVSA 1KPGA 4L8VA 3QKUA 2NUAB 4C14A 5K20A 1VCHA 1FJGB 2VHZA 2OZKA 4HX2A 3RR2A 4CR6A 3LYUA 1XQ1A 2OG2A 5LXTF 1NN5A 1SAYA 2NIPA 3FPGA 4MRSA 1YVPA 4ZI2A 4QJ3A 3O4GA 4RGBA 4U00A 4YECA 4HOYA 1U28C 1KO5A 1DBQA 1G5FA 1HZJA 1VL8A 3PRJA 4JJ8A 1KMMA 1GAEO 4J1SA 2JDIA 1EH5A 1WTCA 1YTUA 2WRZA 3NOOA 1ZN2A 4TTTS 3WLSA 5KTPA 1QR6A 3PVCA 1Q7GA 2IIVA 4MA4A 1YRYE 3O4RA 3C8MA 4TV8A 5JNRA 1LB1B 3JQAA 4N39A 2ACWA 4D57A 3FB1A 3PC2A 2O8NA 2F00A 3OMWA 2FZLA 3QVWA 1GKIA 1THGA 1U02A 3P45A 1BA2A 2A33A 2EU8A 3SYMA 3U3MA 2FSGA 1MQSA 2IHZA 3GLVA 1RI4A 1DP4A 4C3UA 3ADBA 2PX5A 4LGYA 3VR4H 1EK2A 3DPSA 3SQNA 3EFBA 4FN5A 1ZRNA 4C1BA 1C7JA 5BN3A 4RD1A 1AK2A 1C9KA 3HJRA 4PC3A 4HXYA 4H60A 1ISJA 1AQUA 5ADHA 3ZWCA 3HJAA 3LUCA 2JJ2D 3R41A 4ZVTA 2DPMA 2ID4A 3HJHA 3HLKA 1TD9A 5U4XA 1XZDA 3LL7A 5BQ3A 1PNVA 3LAWA 2UYCA 2Y92A 5FB3A 4R1PA 1RTTA 2OK7A 3I4LA 2VDLB 1YJ5A 1LK7A 3RW9A 1IHXA 5HRUA 1U1CA 5A4IS 4NXNB 1KO8A 5CXQA 1WLYA 5C5DA 1CE8A 3LPMA 3PGMA 4ETNA 3OQOA 5HS6A 2HBYA 2Q4BA 1Q95A 3EXFB 1SN7A 3NIGB 4QHSA 5HFNA 4D96A 2EAUA 2JCBA 3EG9A 2PX0A 1W5FA 3KSBC 4TS1A 4C0JA 3GD5A 4H2DA 3S70A 4LHWA 4EJ0A 1L5RA 2H1SA 1NP7A 3BM5A 4RTLA 3DLPX 4XD2A 4PZAA 5A1TA 1XRJA 1DAFA 1EUZA 2ZAGA 1ITZA 1Y9ZA 4RORA 4MS4A 2O3JA 3M82A 1EG7A 3AV3A 2IC5A 1IN4A 1GVNB 2PIDA 1NUQA 1VIYA 4G4JA 4YRDA 2VQ3A 5FHRA 2PS9A 1PV4A 3MMNA 1CBUA 2QAGA 3HXLA 2XE6A 3L0OA 1YSCA 3F98A 4QYTA 1L8OA 1QYIA 1VZ3A 5GWXA 1J5EB 1V9LA 1A9ZA 1C0KA 1X1QA 1XJQA 2RI6A 2V97A 2X2FA 5GONF 3SPXA 4E5PA 1N33B 1CQXA 2OCAA 2IUTA 2G0TA 3NLLA 4INZA 1UDBA 3KDPA 3RYHA 1MQ9A 3ENWA 3UY4A 1VYUA 1OU0A 1W1WA 5CNJA 4MQ5A 2Q46A 5NULA 3CBGA 3UWKA 2QORA 3TECE 2R11A 1VPWA 1BXGA 3MMPA 2J3QA 1BOOA 1CIPA 3FDXA 3O8OB 1QXSA 4CHTA 2CBZA 1NVVR 2WFLB 3JSXA 4URHA 4F2GA 1C81A 3IAS6 1Z12A 2FZGA 5BYAA 2ZEJA 2HT1A 3HVUA 1JVBA 3IAS1 3S2GA 5I6DA 2FXIA 3VHXB 3H04A 3E35A 1KEVA 3BL6A 3SKYA 3W5JA 3PUYA 3SDSA 2BUCA 2FEKA 2XQGA 4FTWA 2XXAA 2GF2A 2WKRA 3QF4A 2ZYDA 4DDUA 3ABRB 1ACLA 3E7DA 3CA8A 3H8WA 4OD0A 4RTJA 1L7QA 1IVSA 2EHJA 2ORWA 2B61A 1A7AA 1CRZA 2G9UA 3R1IA 1ZW6A 3EEYA 1G3MA 2I3BA 1HORA 4J03A 3OO1A 2VLBA 4OK6A 4PHGA 2ZE7A 3L49A 3WTCA 3KELA 3A1EA 4ON9A 1S0UA 5DMHA 3K8QA 1AMOA 3IERA 4YCLA 3X0DA 2I03A 4DMMA 3QLVC 2PLAA 3U3DA 5JASA 4IP0A 2OCGA 4AMUA 2DU8A 2L2QA 3WQRA 4H0CA 4LJ5A 1IYZA 2EYUA 3D31A 2HJGA 2C7QA 2BFEA 1E0AA 4MKIA 1IU9A 1S9DA 1OT3A 2PRIA 1NKTA 1SOWA 2H2DA 4ADSG 3JAKB 3PDIB 5FTNA 2B7CA 5L3ZA 3THOA 4IDFA 2V45A 3AIMA 4DUGA 1XN4A 3GYGA 3LFUA 4WUVA 3L6RA 3ZDZB 1M1YE 4H35A 5FPPA 2ZIUB 1O1YA 4URXR 4KQMA 4MITA 3QSGA 16PKA 1DE0A 4MPDA 3P2OA 1EFHA 3P0IA 3NM4A 5IKOA 3AX6A 3NV7A 3LK6A 3S40A 1RXYA 4D1YA 1W35A 5LXTA 2IYAA 1COZA 3GJSA 4H7HA 5E7JA 3EWSA 2II6A 3EQ8A 1SD1A 1TUEA 5A3RA 5C7YA 3MBIA 4ZZ3A 3SHWA 2D59A 4GOKA 2ZTSA 1P4AA 3D3NA 3E3LA 2G1AA 4PZLA 3W7AA 4Z0NA 3P96A 4K9PA 3N0XA 4J75A 2IJGX 2VAMA 1WHTB 5DSTA 1XTRA 3IX7A 4U63A 3STYA 1QRSA 2GCOB 2GHRA 1QQ6A 2QDXA 2JRCA 1VB3A 1OFVA 5EIAA 3OURA 4MVYA 4JD5A 2DWOA 1WP4A 1G6HA 5FBKA 4IRXA 3RSZA 1TCCA 4B45A 2QE7D 3AMVA 4JENA 4TWRA 3IUEA 2ZULA 2AV6A 1H0KA 3EPKA 1Q91A 3NWPA 1W48A 3SBXA 2WD7B 1FBTA 1OWOA 1TO2E 2I4OA 2W83A 2VCYA 5AI6A 2H54A 1NTOA 4HN9A 4OXRA 2ZIZA 1SVSA 3OX1A 1XALA 3GVHA 5FPTA 3RIGA 1CFJA 4UULA 1EINA 2CZQA 1BFUA 4IFBA 3GLIA 4KPUA 3S1SA 2CNNA 4GMHA 2MYUA 2OBBA 3OC6A 1GL6A 4KQJA 4LYYA 1N6IA 4MJLA 3UV3A 4CG0A 5D3KA 4P84A 5LQUA 1NNEA 3RLIA 3F2VA 5CAEA 1P62B 3KEQA 1IZ7A 4WK2B 5EAIA 1NQAO 1RZRD 3KL2A 4L5CA 2J7PA 1N36B 1DWPA 2ZYTX 3A6PC 5KJ6A 4TS9A 1T9DA 1VHQA 3AUXA 3D6JA 3WYNA 4EVIA 5K8CA 2QX7A 4LF8B 4YAJA 5KVSA 1W4CA 3OCCA 3E9DA 4QEKA 3U61B 3RUIA 3HDJA 1ZC3A 3OE7D 3ZJYA 3ZEAA 1Y81A 1X8JA 2ODNA 2J3KA 2D1FA 4W1QA 2Y99A 2A9JA 3BXXA 3OZXA 1I5OA 1K63A 3R4CA 4JR2A 1NR7A 2QNBA 5AM1A 1KYZA 3V8QA 3RG2A 3WK7A 3WLLA 3HB9A 2DG2A 2I6SA 4FZRA 4ALLA 3DYBA 3M9WA 4UDYX 1T1GA 3T94A 1Z28A 4UDNA 1FNNA 1MX1A 4HN4B 4EHIA 4F9TA 5U1PA 1XEWX 4ZOEA 2HK6A 2YWFA 3WY9A 3ZI7A 10MHA 1UBTS 1A5TA 2VTKA 2ZUDA 3DUFA 3NYWA 4JGIA 4TROA 5GONA 1UODA 3AHFA 1OH7A 3G8BA 5HKLA 2RGGA 2FOXA 2WIBA 3C8HA 4BO5A 2NYVA 4HNGA 3ESQA 4F46A 1AH2A 2GCGA 1YU9A 1BX3A 3NKLA 3PYMA 4J1QA 3TW0A 4RXTA 3VZCA 2Q3FA 2J5XA 4IQFA 2HLHA 4QUGA 4YJHA 1UJ4A 3P19A 2PRJA 3BC1A 1HQKA 4Q18A 3HVJA 4EATA 1ZZGA 1E98A 2FRXA 3HFGA 2WINI 3KKQA 4IJUA 5HWSA 1YOVB 5JSFA 3MRTA 2BKAA 5HE8A 3CLUC 4IWYA 3QVVA 3E9NA 1G5QA 4F06A 2FMKA 1V3VA 3R74A 5JCOA 5E1OA 4DA6A 1W2WB 4S1OA 1PL8A 2EKPA 4NEGA 3BXGA 5I7RA 4A36A 1CRPA 1FQKA 1JMYA 1KU6A 2MSDB 2EBFX 4JODA 2ZAYA 4JQYA 2IXGA 3B2QA 2XMCA 4YRCA 3VO9A 4ZCIA 4LOLA 4L3WA 1OFTA 4ZCLA 1MAVA 2IKQA 4IIFA 4N7JA 2FZCA 4KKXB 2ETXA 2XCQA 4LVNA 3VX4A 1ML4A 5ITWA 2C3MA 1F4VA 1KRHA 2JJQA 2I7VA 2IZZA 2W2VA 1Z0SA 4RX1A 3E22A 4U5QA 4CVNA 4E5MA 1U9IC 3B1YA 1EDEA 1SXPA 2D0PB 2QX9A 1Y98A 3CE6A 3OP4A 3E05A 4PWYA 1G64A 1L1EA 4Y2GA 3IIIA 3RVQA 1V4VA 3MWDB 2WFAA 1HT0A 4JUAA 4YO8A 5EFZA 4BCBA 1YFJA 2C1EA 2I33A 2CY0A 1Z5VA 4RA6B 4ZV7A 1VMIA 5DNDA 4BN5A 1RZUA 2PXCA 3B2NA 5KJ1A 4EVQA 1DX9A 3L6BA 3M89A 2VQDA 4G5HA 3NVAA 5D2CA 3T5CA 3USES 5CA0B 3M1IA 2I3GA 3F5MA 1R6AA 2NVBA 4AIRA 4F9EA 4YP5A 2ANCA 2A58A 4GS5A 5E7IA 1I1NA 3B38A 1TQ6A 2WD9A 2YZGA 4ZT4A 2ZUWA 4O8CA 2COKA 3RS4A 1KJJA 2XQFA 3TR0A 3QBDA 3DVLA 4E2FA 4BV8A 2H9AA 5ALJA 2DWCA 3KLMX 3VU0A 2JD1A 2V3WA 3BTSA 3JWEA 5FHQA 1MOPA 3LYAA 1MRZA 3IDQA 1YR8A 4KL8S 4C0HA 4EY7A 2GWHA 3D3KA 3H2GA 1LSSA 3E03A 1F38A 1PR0A 3BHMA 2PKRA 3H13A 5CGQB 4N6OA 2VWGA 4Y9RA 1XTUA 1B1AA 3KTAB 5ALMA 1CK4A 2QJFA 4KP7A 2YUIA 5CW1A 1BNCA 1OMOA 4WMLA 4IIDA 4Q9IA 3S2UA 2BDEA 4OKNA 1QBKC 1PR1A 1Y1PA 1F51E 1OWMA 1ND6A 3CVUA 2LNDA 1WNTA 3NYQA 1YACA 2VPQA 1WW3A 3H97A 3I1FA 1QZTA 1WOYA 4R8RA 1CIJA 4UCFA 5ILGA 1PAUA 5ALTA 2VBFA 6LDHA 3EMKA 1DRWA 2BM8A 2A0XA 1BD3A 1XLUA 2NXCA 1GM5A 1KDZA 5REQB 1N5LA 4M0FA 2XUPA 5HE9A 2KBFA 3WGJA 3VPBA 1J07A 3WL3A 3EMDA 3WWYA 4YASA 3TJRA 4GBGA 2WJIA 1TADA 1TQDA 2Q3EA 2YJ4A 4URZR 3VVBA 3RU2A 3HBMA 4KN6A 3NTVA 2BZGA 1NVDA 4BYGA 2Z1DA 3DFZA 5A5FA 2HHAA 3BBPA 4NCKA 3TZQA 2ASVA 3IODA 1SXJC 2EEPA 1T5IA 1G6OA 2B0JA 2LV8A 1YRBA 3ELBA 3HYSA 3QVSA 4FJ1A 4OA8A 2QAJA 4UUMA 3B70A 2HEIA 1SUFA 2V5VA 2WUVA 1P2TA 3P26A 2F3UA 4I8DA 3WVNA 2HSDA 2DSTA 3AKEA 3ICVA 1T8YA 2IEBA 1WA5A 5JCXA 3QOWA 2WTAA 1TE2A 4WJZA 2PU5A 5K0ZA 4P0TA 5L6MB 8LDHA 3MG9A 2IZ5A 2QMOA 4PANA 1YZGA 3OEWA 1P7CA 2V98A 3PT5A 1B8VA 1RYFA 3AGQA 3ET4A 1D09A 4DADA 2YFHA 3A1TA 1VLZA 1T24A 1SHJA 1GFSA 1YC5A 4NMMA 3RM3A 2JHCA 3SC2A 5JD5A 2WK1A 3L40A 1E9FA 1WSWA 3IV7A 5I9SA 1MKYA 5F9FA 2W2MA 4AT1A 1AO0A 4AICA 1R4NB 4ZGBA 2HHJA 2HQ1A 4ODIA 1ND5A 1Y82A 1B3BA 2H2IA 3GMTA 4W5HA 1CY4A 3FMIA 1EP3B 1OA1A 5LQNA 2QLLA 1J9EA 3G0OA 5AK3A 3H1EA 5JBIA 1G9TA 3V4PB 1XLWA 1DJLA 4O5OA 2F59A 2P7HA 5CDSA 4KK3A 3NMUF 3B36A 1UMCB 5G0TA 1GZUA 5IC6A 2ANBA 1H3NA 2FOLA 1GNTA 4NJEA 1BX0A 4TUYB 3DMTC 2JA2A 3OEED 2R68A 1OPXA 4OLHA 1E1RA 1Y8RB 2PH3A 1KJZA 3I0MA 3ME5A 3F6PA 4I5FA 4QDJA 3AHDA 2XXBA 5SYMA 3WYGA 4DIOA 4EITA 3HLTA 2OBYA 5EJ8A 5KYUB 3RC8A 3AY6A 3DHEA 2CLMB 5AHRA 4YXFA 3ROZA 3GUHA 3D2CA 2O23A 3UFBA 2PM8A 3TGLA 1YI1A 4PLTA 4AWXA 4G1BA 5FWDA 1M1XB 1IK6A 3IP8A 1VKZA 4GPZA 5CLQA 4GLFA 4CLRA 3WGVA 2NP7A 4KBGA 2ILVA 4OXIA 4AJ4A 2WJ6A 3W2EA 1KJQA 2QUAA 3JQGA 1NURA 2ZJ0A 4LJ7A 4WZ6A 5JIBA 2HMVA 5G0VA 3KXPA 2VDQB 4ZRNA 3STTA 1NBHA 1V95A 5KYUA 1SGWA 4RUKA 4V3CA 5FAXA 1BW9A 3ELYA 3RG8A 5IM4F 4D02A 1I6WA 2Z95A 4E11A 4FHCA 3X1KA 2ZYGA 1GRCA 2HTEA 4ZIRB 3IAFA 3CWCA 4Z9FA 2GN2A 2XYQA 1T9KA 1NJ8A 3W9BA 3D7NA 3EDOA 621PA 1CEYA 1JR3D 1SVLA 1Z4KA 3EULA 3SMVA 2DHEA 1RXVA 1IY1A 5ALUA 1RXSA 3S3TA 4F2WA 1HTWA 2FPWA 4NX2A 2C0CA 1W36D 4BNXA 1M0SA 4U02A 3HJGA 2ONCA 4LWOA 4TL9A 3RADC 1J56A 4RGYA 4GM0A 4DHEA 5B3LA 3OMXA 2GILA 4AO6A 5ES3A 3TRJA 2RIRA 1OWPA 3BJRA 1K5DA 3ZIUA 3K0BA 4F1KA 4FW9A 3E8XA 4YS6A 3K6SB 4RLHA 3R8FA 1XZAA 2B69A 4QUAA 3I58A 1F48A 1RKBA 3EXEA 1ZO8A 2NMVA 4B7XA 1R0WA 1CJMA 1EX9A 3L0SA 1KI4A 1WB6A 4HJXA 4HLUC 1MT3A 2RH8A 4NCNA 2XTAA 4OI2A 5AH0A 2IS2A 3TLZA 1NNLA 3ZWMA 4CV0A 1EBFA 4DDVA 2ZJOA 4MKZA 2REBA 3O21A 3GJ7A 3FPBA 4W8GA 3V4RA 1QNFA 3WIBA 3R44A 4Z99A 1USWA 1A8IA 4WZAE 1X8XA 3IJEB 4AY3A 1ZH6A 2XQKA 1N3BA 2ISQA 1ZGZA 3JD2A 4ZYYA 4ZVKA 3IIMA 1MO2A 4EJSB 5KQGA 1UDCA 3X3HA 4M8LA 4R2WA 1VA4A 4OFBA 3C2QA 4OF4A 3DKKA 3ZHSA 2WAMA 4PNEA 4E2XA 2PFSA 1SR8A 5KPDA 3TIGA 3UTDA 4DLNA 2HWWA 1IN7A 1CJBA 1E20A 3GBVA 4B0OA 2Q21A 5HCNA 2QN9A 5TPWA 4B4UA 3WFIA 2PUGA 4M1YA 1U2EA 2OHXA 2IS6A 2DYKA 4UHEA 1U7XA 2J9FB 3WDMA 1ADJA 2RHJA 2UUCB 5M34A 4KEAA 4LYFA 3QUAA 4TM7A 3CVJA 1AQIA 3VXKA 2C88A 2IP2A 5EZQA 1V35A 1GDDA 1N6OA 2AMFA 3HCEA 4TN5A 1G8SA 1MR3F 1O94C 3DJFA 2V3VA 1WDWB 3MGAA 5LU9A 4G0VA 2BGGA 1N3LA 1FW6A 1IDOA 2HWYA 1TX4B 1W5BA 2W4IA 3K09C 4HPWA 3IDSA 4YVFA 4ARZB 4CR8A 5LOVA 2FQYA 3FPHA 4F4JA 3HMQA 4IJ5A 3KXDA 1ZJ4A 2IE8A 3G13A 2XZTA 2ZGVA 5CEJA 5LQCA 3KU1A 3BF7A 4Z0PA 1CB0A 5K2MA 1IM5A 3BL5A 5C52B 2ZTLA 2XNJA 1HRKA 3HNOA 4JITA 1RJGA 4Q4AB 4XX0B 5CVCA 3LGSA 3K70D 4I08A 1OAOA 5CMLA 3VTKA 1UQRA 4TTVA 2Q3DA 4A0FA 5CDTA 2C03A 4DWJA 4PBRA 3RTGA 4A15A 1MJGA 1Q1AA 1UM9A 1Z6QA 4EA6A 4IV8A 5BWNA 3BFVA 5EIWA 5K0EA 1Z2AA 1F2UB 3CO5A 1V16B 1LQTA 3PA8A 5B7PA 3H1BA 4KI0A 2OHJA 2OPBA 4Z7QB 1R12A 2XWQA 3CLTC 4U2KA 1XSEA 3H5IA 2X1HA 3REGA 3NCTA 1EVJA 1DXOA 3MN1A 4RCZA 3C7AA 4DV2B 4OQFA 4Z3DA 3LECA 2BWJA 1JX6A 1N75A 1GT6A 3UXYA 1FMFA 2J87A 3H2SA 5IVIA 1O94D 1ZXXA 3F7NA 3G0IA 4NCHA 3WMXA 2IEAA 1UPFA 4RD2A 1QS0B 3MFYA 4RH1A 2JBWA 3FYUC 3Q7TA 3WLEA 2GOYA 4DSZA 3U4QA 1N4AA 1HE3A 4WN9A 1WMBA 4X1YB 1XCOA 1F2UA 1PR2A 2CB9A 1IK4A 3AW8A 3PJFA 4G5XA 4RKRA 3VISA 4B47A 1J23A 3M6MD 3QE0A 3EHEA 3BTOA 1LDMA 1TTQB 2OZPA 3N28A 5FQNA 3JYPA 4XH9B 2O2JA 1XZMA 4F8YA 2V7XA 3AKDA 1VJTA 4JI5B 3UVEA 4DNPA 1D6JA 4HG2A 4OHKA 1KEWA 3SAJA 1S7CA 4ENUA 3TMYA 1DEXA 2GNOA 2BEVA 3GN1A 3L46A 2D74A 4FKMA 3OZUA 2FPGA 5IM4A 1N77A 4YWHA 5E6UB 2V03A 4AYTA 2Q6OA 2BHSA 4JUCA 1XUOA 4H3VA 2QD4A 4PSCA 4X1YA 3OOEA 5C51B 2ZXUA 1XFDA 4K2HA 4RTRA 2Y0EA 3E6AA 1NW5A 1WXIA 4ZJUA 1IEQA 2ZUUA 4N1AA 3IJ5A 3UC5A 3AUTA 3EF1A 2EWMA 2FN9A 1N0IA 3LSTA 3V6MA 1W75A 2NXWA 4NMHA 4UTXA 2QVYX 3PUKA 1Z47A 3TB4A 5JJIA 5CNMA 4GNRA 4BNKA 5JR3A 3FWNA 3OX4A 5B64A 5I47A 3GT4A 4LHVA 5K7SA 2Q07A 2MMGA 1Z0IA 2JCSA 5B4TA 3PWKA 1YBMA 3O73A 4K2AA 3JYQA 1A82A 3WXBA 3ZCUA 1DRJA 3T5PA 3FR7A 4NAHA 2QQGA 4PLYA 3Q8LA 4YUAA 4XD7D 4YCSA 3EQ9A 4MHSA 4E5NA 3SLKA 4ZMBA 4CKWB 2UZ1B 3GT7A 4JCOA 5I9MA 1I1QB 3GV0A 4KR2A 3PEYA 4CNQA 1E3DA 5IBPA 1CY2A 1OU4A 4X20A 1RWOA 1LDGA 5AJZA 3BMOB 3WNVA 2O07A 3RO7A 1P0FA 3PHLA 1VIMA 5A03A 1WEKA 2AMLA 4FZ5A 3ZV5A 4S1TA 3LWZA 1TYDE 4O3FA 1U2GC 1SKYE 2RGXA 4ZCTA 2FZ5A 3IRVA 1QF6A 3BIOA 3TAUA 1EK1A 1NLYA 1UWLA 3FFBA 3N2GB 3OJFA 2CHEA 4UAUA 1I0IA 4QNRA 1VE6A 2JGJA 1VE7A 2Z4TA 1M1YA 4HDAA 1G4UR 4NRDA 3QGMA 1M6HA 1SC9A 3BXFA 3GEHA 1BO6A 1WMAA 1JLMA 4OI4A 3WGLA 1HSOA 4FQ5A 3P20A 4M3NA 1FE8A 1NMSA 1SQ0A 3TCNA 5P8WA 3VTZA 5JAQA 4O6VA 2HMSA 3O7MA 1KEEB 1P80A 2A94A 3N2GA 3OPVA 2C94A 2OO7A 3UGQA 3N2EA 3ZLBA 4RTSA 1GQOA 1IPHA 2GARA 3MUNA 3EGDB 1T10A 1QCCA 4KR3A 1F06A 4DQKA 4MHTA 1CUJA 5JCZA 2QVXX 5JRDS 2BFDB 4KUGA 4QU5A 5E95A 1KDPA 1LF5A 3KOWA 3RIMA 4M99A 2CLSA 3T7KA 3QFHA 5LQAA 2PUBA 1P4GA 2OZLB 3AVOA 1I80A 3R7BA 3UG6A 3ZGYA 3K0AB 1M72A 1CNMA 2JLSA 2ZPTX 2FHSA 4EI2A 3CLVA 3MIZA 1NFFA 1WXQA 4IZHA 5BORA 3GJYA 2P8SA 2OQ2A 2C9ZA 3JVVA 4ZAZA 1DUIA 4A5OA 4JB8A 4BO9A 1CDDA 4B6QA 5CCXA 1C0IA 2M2IA 1J97A 3U3OA 4OHRA 3KOZA 1QE0A 1YKGA 2WAYA 3FJOA 2AZ4A 3H2YA 3IFSA 3IULA 3RS7A 1C0LA 3W4KA 5AVUA 3OIDA 4CIAA 5ICMA 3AKCA 2D4AA 4TXNA 4OX9B 4INAA 1V96A 1E0JA 1X3LA 2WF5A 2G7MC 4QPDA 4F7WA 3RWMB 5C8VA 3QI2A 2ECOA 3W1WA 2J0QA 1QTNA 1L9XA 5TY0A 3VYSB 1EB8A 1U0GA 1UOPA 1CY1A 1JILA 3PD1A 1L6RA 1LPSA 3NG1A 3PPVA 4HQ6A 2GBPA 1TAGA 4QWWA 1XCGB 1SUPA 4C08A 4F4UA 5K8TA 4KE8A 1L5VA 4UARA 3VVMA 3ZDEA 4UEOA 2XMRA 4YMHA 1RPZA 4IZIA 4BQRA 3QJYA 2C83A 3CCBA 2HWXA 2X77A 2GQ0A 1U6JA 3E9EA 3OLXA 4L4XA 4CCSA 3T3IA 3FHLA 4B17A 4YV1A 5JVDA 2WJGA 4BL5A 3AEUB 4D4LA 1X1EA 3UJHA 4C89A 1MHTA 2GM4A 2C2GA 2CHFA 1FTWA 4GOJA 5C4GB 2L0XA 2NT4A 3K4PA 4KQ1A 2WWFA 3RYCA 1CZUA 2BAGA 4Q66C 3OIVA 4Q9JA 4DIFA 2YWHA 4Y6GB 3VSAA 3V4FA 1HGXA 2F43B 3OT1B 4LHZA 2ZUTA 3D7LA 3DM9B 1BDIA 1QPZA 2FAXA 3A4TA 4AQ7A 4Q12A 2OHFA 2OFWA 4M36A 3TW8B 3K72B 3CRNA 4CKCA 4F1WA 1Z0JA 3E5MA 4M1ZA 1RE0A 2QN7A 2YXPX 3VPHA 2ZUFA 2IU3A 3LC7O 3CRVA 2PD3A 2HA3A 3F74A 3R3VA 4ER0A 5BWMA 5I7OA 5IVHA 2X8LA 3EDQA 3KHKA 1GZ3A 4J0CA 2BR4A 1ISIA 1JA1A 2COEA 2BISA 2WFMA 3MJ4A 2QENA 3ZOKA 2P30A 1NMZA 1USIA 4R41A 2Z5LA 1KI9A 3LU1A 1WXFA 1Q92A 4MYUA 4RZXA 5FI5A 5SZHB 1RRMA 2F8TA 1UH5A 4RVCA 3Q3JB 3PXAA 5IWCA 2C9DA 4IMJB 4NYJQ 5H4GA 4AJLA 4UHKA 2CL5A 5LFAA 1ZC4A 3VU1A 3LHFA 4TT8A 5DCLA 1WXHA 4LTDA 2QMEA 2PYIA 1M2EA 4JT8A 5I01A 1F9EA 5FFFA 3NORA 2WT9A 3QIAA 3T8YA 4FE7A 1FB5A 5J40A 4IEEA 2JH8A 1XJWA 1LI5A 3CEJA 1S2IA 1UCFA 3E7PA 3Q3EA 3R5SA 1Z4PX 3A2LA 3AVWA 4HGZA 2ZVDA 1O95D 1LD3A 1D04A 2KMLA 3B7WA 2EKDA 2J3HA 5I7VA 1GKKA 1Y1KE 4FNAA 1CZOA 2E6UX 1ES9A 3HB7A 3U60B 3PQDA 3CVVA 5HIAA 1OILA 4RY2A 3DVRX 3H9JA 2VI5A 4R9SA 3L02A 4XM2A 4QXMA 2I6XA 4GDMA 5EP1A 3GG2A 4BGIA 1U8ZA 4RFSA 4J0HA 1RQGA 4P9NA 4KH1A 3WNQA 3C85A 5HIMA 4FNGA 3AB3A 4BMZA 1HL3A 4RY9A 3EBOA 1LLDA 4RVGA 3C6MA 4FGLA 2PH1A 2RH5A 4IGFA 1IUOA 4QXQA 4V3BA 2AXPA 4RESA 4CG2A 1RYHA 4E2WA 1QRUA 4LZJA 4U9IS 4EZEA 2KLHA 5IHPA 2IHJA 4AKEA 1MP0A 1W6UA 3R5XA 1QP7A 2DFPA 3GRKA 3E1GA 4CDNA 3OFND 4PHFA 5FTMA 1ZKMA 3OQJA 2HA6A 2AFRA 4M1EA 5G1OA 2ZB8A 2EF1A 3A8TA 3KD3A 4IIJF 4JL8A 5E9QA 3ELWA 5IDQA 3HPQA 4CF7A 2ZRJA 3U31A 3WKDA 4AKIA 3L8GA 4L02A 1WQ4A 4A23A 2ZWVA 2ATXA 1L7VC 5CG2A 4AY2A 3CLKA 4WW0A 4D99A 4ARIA 2FI1A 3EIHA 2QXYA 1NXWA 4E6EA 4OXKA 1N2SA 3VOBA 1WZCA 3E15A 4CM4B 3ZNNA 2QJWA 4EF5A 4LDAA 1RYMA 3LPLA 2C57A 3MB8A 2WJPA 3LQ2A 4U7TB 4IHAA 2D7DA 1D8AA 2RG1A 3ENZA 1UPXA 1ZL2A 1F2TB 1FRNA 2EF0A 4X61A 3ZDQA 1W7AA 3ZD7A 2W2PA 4LK3A 1E7MA 3R7LA 1WF6A 4FHZA 3VI3B 1TEXA 2VDNB 3A4VA 2CMHA 3VR6D 4H31A 1VIDA 1Z07A 3ZJTA 3WSVA 1F12A 5I45A 1AQNA 3T1TA 3IELA 3WWCA 4DBLE 4OFWA 4J9UE 4CM4A 2C5FA 2XUJA 1MIOB 3FCCA 4I8IA 1H94A 1E2KA 2UVPA 1U2DA 1JHAA 3FLAA 2O52A 2PJUA 2AR0A 1E3EA 3PFKA 4XQ0A 3KZOA 5MFPA 4BE7B 4CUKA 2PYDA 5LZ4A 1EE2A 1XIVA 4RAQA 2H51A 2MSKA 3JWIA 2PKYX 4V0KA 4URVR 4RHEA 5A4KA 1B0PA 2HUNA 4RHFA 4FDLA 2JIMA 4L2IB 1TO1E 4NMXB 3IKJA 3SQXA 1WF3A 2P9CA 1Q17A 2Z6VA 3NVMB 1UOQA 2XDWA 2OO5C 1NR5A 2Q4OA 3AONB 4KVZA 4KNWA 4D9BA 5JAPA 5TMPA 1HFEL 3KQVA 1P5JA 2IYFA 2E3JA 2H2AA 4G3XA 1CUHA 1RAEA 2CNDA 4HH1A 4NNJA 4WHMA 3AF5A 5DHUA 1ZXBA 2QPLA 4KRFA 2GD6A 3I92A 2IY7A 2OK8A 3R0XA 2J9ZB 3UUGA 2GNAA 3I6MA 4KGXA 1QOPB 1U9CA 2RHLA 3KV3O 3CNLA 2Q2OA 3R5KA 1S2MA 1JLLA 2OAP1 3EXHC 2QW0X 4G1CA 5J2UF 1B42A 2GXAA 1J2TA 2HXSA 1F5SA 4N8EA 4AP6A 1SBQA 2BKXA 3IHTA 4HXEB 4LXHA 2V7EA 3AQIA 4NBWA 3CTPA 2QUBA 3HV0A 4LMPA 4WNAA 1W29A 4E2YA 2AFIE 1A50B 4F4CA 1N8KA 2BGJA 3PGKA 4PLVA 1AXEA 2ZJYA 4QNNA 4PCAA 4ENPA 3ZDFA 3A2NA 3JASA 1ONOA 3HXTA 4CUJA 1A9PA 1DELA 1VYVA 1K9VF 2RHTA 2A1UA 3AZOA 4AWBA 4B71A 2CJWB 3A1VA 4ZU1X 3UMMA 2D6FA 3U3RA 4PXAA 1GTJ1 3G2PA 4NATA 3S1AB 3PX3A 4KCGA 2DQ4A 3GA7A 3O75A 4OQ4A 5AXCA 1GZSA 2OXRA 5KYWB 3REFA 1XLTC 4LHSA 3RIXA 1M2NA 3C3YA 1ZGHA 3GEDA 3KKNA 4M83A 1KJWA 2OBXA 3MT8A 1GNVA 3AVQA 4O25A 4C3VA 4RSRA 4P22A 4NF2A 3LDGA 4CETA 4I1VA 3AVTA 1A71A 4IVNA 1MF7A 1UBEA 1ZUNA 4WK0B 4HKTA 3EMBA 3ZHBA 3ZWYA 5E3IA 2IXFA 2XDQA 1V4BA 2X9VA 3HA3A 4LRUA 1V37A 2VJBA 2ZUVA 4IIJB 4WY8A 5CD1A 2XHEA 5M29A 4CFSA 2WTXA 2XT9A 1CQZA 1SHKA 4AK9A 2BEKA 2P0EA 5EMKA 4ZK2A 1P7WA 3TLAA 1GV0A 2GAIA 2YOGA 3OZ7A 4K9RA 5B3AA 4BTLA 2IF0A 1AO3A 2A5JA 3QK7A 2O8FB 1K89A 3CEAA 3RYTC 3UHJA 1FX1A 2IY9A 2I8AA 5C1IA 3LBYA 5WRFA 3RKSA 3F47A 4CHGA 1Z5WA 4A0GA 4CMHA 5JI2E 2PFKA 1DTWA 4CTJA 4IIJA 2QX6A 3V80A 2O2CA 2Q1UA 4Q7EA 3PKIA 4W9NA 5CDGA 4XGQA 4K40A 2NADA 3F4LA 4W6QA 2BFAA 1MO5A 2Y2VA 3KAJA 3RTAA 3ZE0B 5A04A 2VAWA 4E7PA 1NF2A 4FONA 3WRVA 3F6BX 4DDMA 2JGLA 5KSYA 4JUIA 5AKZA 3V7UA 2JLXA 4J0JA 4KB5A 4YV0A 1MBZA 3TGPA 2O8FA 4K46A 2ZUBA 3T1OA 3B6IA 3DF9A 1I3LA 4ZO6A 3L1JA 2WILA 4HK4A 3VPXA 5HUHA 3D6VA 1F0YA 5CPFA 3F97A 1BQ4A 5B53A 1Z5UA 2QLTA 4MW5A 4R0NA 3S2FA 2P9TA 1W2HA 2DULA 2VJMB 3VH1A 3KCQA 4DR6B 1ZOOA 4KAFA 3T61A 3TR5A 3GAZA 3B9QA 5JC8A 3KETA 4ETIA 3FUVA 4RD4A 1CYDA 2IYTA 3W1EA 3ID6C 5I8PA 2FMHA 4XOUA 4DA7A 3EWIA 2FPMA 5EE9A 4LRQA 3E82A 3Q0EA 5LKAA 1NW3A 1HLFA 5FUMA 2VH5R 3RJMA 2XB2A 3P0EA 3VAZA 2JAWA 3LRXA 2I6UA 4O4IF 1NHGA 1OLSA 1UEXC 4N6GA 4R83A 4TLMB 5FBHA 4AP5A 2I4NA 1XTKA 4YI3A 3THSA 3W5UA 3X2SA 1ZGCA 1A9OA 1KH1A 2A0WA 5I5GA 2OQRA 2VPYA 2J0SA 4Q3AA 3GP5A 5CFLA 2WJWA 4LJ4A 1JDNA 5CVJA 1DU4A 4HATA 4ZOLF 1V8ZA 1C9MA 1WD7A 2CN1A 2I54A 4RJKA 4UVDA 5K0NA 4A3SA 1D2AA 4Z5XA 1I4LD 3GZTB 2XRZA 1SIOA 4OJMX 4JI7B 1SVOA 1VLVA 4GZ3A 3NEJA 2ZBPA 3OE5A 4UMDA 3SYTA 2P5UA 1EX6A 2MHCA 3PUXA 1GVHA 3TZEA 3ESBA 4CLDA 4LY3A 1T4GA 1ZWKA 1Q3TA 4ZVRA 4KSYA 1U2TA 4IKEA 1YF3A 2YY5A 2PUEA 1O03A 4P0QB 4AZ0A 1GCGA 3NHLA 4GAEA 4DWVA 4EPWA 3CH7A