1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
2NO7A 4MYCA 5FBWB 1S2MA 4ESHA 4LOAA 1T8UA 1WDTA 3BS4A 3SQWA 1SXJA 4Q4HB 1RRFA 4DSUA 4NU0A 2XZPA 2P6RA 4EJSB 1DS6A 2WMOB 2LKDA 1ZINA 2UZIR 3BFVA 2J45A 2NZ8A 2ZUDA 5DN6A 3GEHA 1OLOA 1UKYA 2PX0A 3PUZA 4CYMA 1NI3A 2ZE8A 4PAMA 1TNDA 3K9GA 4PX9A 4CT5A 4B76A 3CONA 1X8KA 2QPAA 2ZITA 4KYIB 4E03A 3TK1A 1OSNA 1M1YE 2ZRKA 4DLRA 2GVZC 1JAIA 2QAJA 2G9NA 2IXEA 1W44A 4ARZA 2AD5A 2W58A 5H1YA 2QQEA 3RANA 1A2BA 1WP9A 3OFND 5B64A 4JMPA 1KK0A 2IYXA 2OXCA 2VLIA 3Q7PA 4URXR 4G3XA 3E2IA 4I1UA 3THXA 2FV8A 1Q1EA 4IKEA 3JVUA 1FUUA 2CHVA 4DSTA 1F2UA 1GL9B 1D6JA 1W4BA 4N0EA 3NBYC 5JSZA 5DHAA 4YMUA 1G19A 1E2JA 3T35A 3W5IA 3PVSA 2F1JA 1I4DD 4TL6A 1QHSA 3KJIA 1Z08A 2PEZA 3K0FB 3AP1A 3QIAA 4OL0A 1QHNA 2OT3B 4XWAA 5FTKA 2C8VA 3QKTA 1CR4A 3WP1B 4A0HA 1P9NA 2BCJQ 6Q21A 5HE9A 1EWRA 4JKIA 4M0LA 4M9SA 5BN5A 1AJEA 4JVNA 5KSPA 1E2LA 1D9ZA 1OXVA 1W4AA 3WRYC 2KJQA 2AFIE 1W4CA 2V3CC 1G41A 4LJ8A 2ATXA 2NGRA 2O0JA 4A82A 4NCJA 4B34A 4FW9A 1DO2A 3FOZA 4DUGA 2DB3A 3ZLJA 5SZIA 5D3QA 3ZVLA 2XB4A 4KCGA 4IOMA 1IY0A 4TMWA 5TVKA 3IEUA 3AKDA 2AL7A 3HJNA 4US2R 2R65A 2G0NA 2ZSAA 3A1VA 2OFXA 1CJTC 3UMFA 3THYB 1R5BA 2IL1A 3ICQB 1P9RA 4JL5A 3T1VA 2O8BB 3IHWA 1Q3HA 3AVYA 3CZQA 2FF7A 4Q21A 1CKEA 5DI3B 3UXMA 3ECCA 2QGZA 5JHGB 3L0PA 2FJUA 4LHWA 4AKGA 4M2LA 3ZIAD 3ZVNA 3R9WA 1G5RA 1N5KA 3U7GA 1GNQA 2BIFA 1IXZA 4W5JA 1SULA 1AA9A 1Y3AA 3DKPA 3SBEA 1ZIOA 2CEAA 1W47A 2YYZA 1X1SA 1D2NA 2BMEA 4WW0A 2Y8EA 1NBMD 4XTCS 5A5GA 1ZU4A 1KI3A 4FMDB 2YC4C 1QF9A 1MH1A 2XNDD 5GADl 1OFUX 4XJXA 4M1TA 3T06B 2ZANA 4C0KA 2I1QA 1U2RA 3RS4A 1FFHA 3TLXA 3C16C 1J8YF 2J41A 1AS3A 3DHWC 2F7SA 4YLGA 2DWOA 3TE6A 3D3QA 3ADBA 4MA4A 1P73A 2D74A 1BYIA 3HYRA 3I62A 2PJZA 3CRRA 2D2EA 3QF7A 3LXXA 1AS0A 4CW7A 1U94A 5H70A 2ZUCA 1R8SA 1XTIA 1Z3IX 1VG1A 5HCIA 1EX7A 2IYSA 2K5UA 5CM8B 4PPQA 2QAGC 2ZSFA 2OCPA 3U61B 2B21A 2IWHA 1ZM4A 2QPTA 4XD7A 1F5NA 4FCTA 2OCBA 3QPUA 4MRNA 2Z83A 3BXZA 4RD3A 4WZ6A 1RE0A 3UG7A 1RJ9B 3A4MA 4MUBA 1E79D 1U0HC 1WF3A 1YR9A 5TB5A 1CF4A 2Q3MA 4QRHA 3KTAA 4ACBA 4EFMA 2ZI4A 3I1FA 1TU3A 4EPRA 4UXJA 3IKJA 4URYR 4KHZA 4BFWA 1TEXA 2ZRNA 3BBPA 2QZ4A 2ZI9A 1PVOA 4BECA 1IY2A 4ACAA 4FMCB 4DLWA 3VR4A 2HXYA 3KFXA 1PUJA 5F3WB 1MRSA 2AX4A 5EQTA 2HYIC 5EUMA 2C98A 2D3WA 1OF1A 2FSHA 3J81k 3IIJA 3I73A 1EFUA 2ORIA 3VMFA 421PA 3LH5A 3TGPA 1MO3A 4O2RA 1Z29A 4U00A 2V7QD 2F9MA 4QL3A 5AJVB 1SGWA 2ZS7A 2CK3D 2WICA 1IBRA 3GLIA 4URWR 4P4TA 5EXSA 1XDBA 3QOFA 3WMFA 1E0AA 2IC5A 5KDDA 1TX4B 4TZ6A 5CK4A 4HUTA 4Q00A 2WJHA 5JEEA 3FMIA 4UJ5A 1QZXA 4JVMA 1M2OB 4DC9A 4RFSA 1KK1A 1XWIA 5JRJA 3NBZC 3RHFA 3TR0A 4HI0E 4LPKA 2GJKA 4ZKEA 3QI2A 1P60A 4G0NA 5E95A 4V0LA 2OBNA 4JVSB 2X19A 1FUKA 1R10A 5J4VA 5B58C 4W5HA 2CK3A 2A3RA 3VX4A 2PCJA 4II7A 1ZRHA 2ZRLA 5FL7D 2DFNA 1ZJ6A 3AF0A 5HZKA 3CH5A 1H65A 3GFPA 1NBMA 2ZTSA 3TUIC 1YVDA 4AY2A 1BS1A 4LX0A 1XEXB 2CLCX 3GJ0A 5AK0A 3K09A 4D0NA 1UAAA 1IHUA 1TEVA 1NN3A 4ZDWA 3X2SA 3PENA 1XCGB 4M9ZA 2NZJA 4L8GA 1NN5A 1GRNA 1UEJA 1VDZA 4AG5A 4PSKA 1VIYA 1JEDA 1GITA 4GFDA 4LYJA 3MWJA 4DSOA 821PA 4P33A 4A0GA 3PR1A 2XSZD 4G5RA 5FBLB 3GLGB 4DIDA 4NP6A 2JGNA 5TV2A 3QQ5A 2ZYVX 1ZD9A 1JAHA 4I1SA 3K53A 4AIIA 4CEIB 5BYJA 2JLUA 2J46A 2GZHA 1UJ2A 2EFGA 1TADA 2VSXA 2HT1A 3FKSD 1DEKA 4KJZA 4CRWB 3GLFA 4URUR 1H8EA 1RC8A 1GVNB 3DZ8A 1CRQA 5IK2A 3M4YA 3VAAA 5BW8A 5JCZA 4H1VA 4RCYA 3DKVA 5K8UA 1N3BA 2OBMA 3B1WA 4TYNA 3CO5A 1DARA 4A92A 4Y0AA 3MUFA 1ZIPA 2X2FA 1TQ4A 5F9HA 1KO1A 4HB2A 4M4SA 3TH5A 5CK5A 4NMMA 2C99A 4AYXA 4EPTA 1P3JA 3KB1A 3U3MA 1QHXA 2IYVA 5HKKD 4TMKA 4C0AC 4DLSA 3THYA 2IS2A 2GESA 1G5PA 4EJSC 2ANCA 3PFIA 2CCGA 1IM2A 4TL8A 4TYYA 1NY6A 1CJKC 4C7OB 2LKCA 2ZJ8A 4IXNA 1ZCAA 4JJZA 3THWA 1KYIA 4M1WA 4JBWA 4BFXA 3MWLA 2CCJA 3CH4B 2ZXUA 3AVWA 2G88A 3QXCA 2Q0HA 4FN5A 1EWQA 5KNDA 1IN7A 3AF4A 2VO1A 3MJHA 5DHFA 3ZZUA 5DN6D 1E2KA 1W1WA 3WNCA 4LJ5A 3RABA 2ZRCA 2P3SA 4P3YA 1AM4D 2ZEJA 4RCZA 5IF9A 4JLAA 5DGXA 1X8JA 3B78A 3PIRA 2J87A 1J90A 3TBKA 2ZETA 1E9BA 2W83A 1N6LA 3RAPR 3EWSA 2FSIA 1E99A 1XNJA 4NYJQ 2PMDA 3A8TA 3ZH9B 5KDLA 4M1OA 2BDTA 1XMJA 2D62A 1Z6TA 4BZQA 2WSSA 3OAAA 1MV5A 3QPWA 4DIEA 4DJTA 2ZYUX 1WRBA 2J0QA 1YU9A 3T34A 2AXNA 3TIFA 2C2HA 1WXQA 3FHCB 3BB4A 1CBUA 4M1YA 2Q9AA 2WAYA 3QBVA 4JKYA 5KSOA 4IEEA 1DAKA 3IPXA 3R20A 3Q72A 3WXMA 2O5VA 2QROA 3HWSA 2H92A 1MKYA 3DMDA 1FQKA 2ZR7A 2FDCA 1G3RA 2QTHA 1KI6B 1SVSA 1PJRA 1UKVY 2NO0A 4M1KA 4M53A 2Z4RA 2ONJA 4AKIA 2JLYA 2MSCB 4BFSA 4NL4H 2PT5A 4US1R 2BKUA 4V02A 4AYWA 3A1SA 2B7CA 2VP0A 2JJ2A 4LYAA 1MT0A 2VHCA 2V6JA 4B35A 3EIHA 1JPNA 1YJ5A 1E1RD 4O25A 1AZSC 2OCYC 1BH2A 5DYGA 1SXJE 3B1VA 4PHTA 3ZQ6A 3BFKA 2GXQA 1IXSB 2GETA 4O2LA 4POAA 5EE9A 3W6PA 2JLQA 2O0HA 1ZM7A 4QHYA 2CCKA 4LC0A 4Q19A 1XTKA 3FPAA 3GLHB 5CJPA 1YRAA 5E3HA 4C0HA 3F3YA 4M9QA 5EE5B 2ZI7A 2GEVA 1NSFA 4BFZA 4D6PA 2WKPA 2ZE5A 4DDWA 4TSFD 4ZCIA 3K0AB 4Y0VA 2V1XA 2H1LA 2WKRA 3AF1A 5IT5A 4HATA 4D26A 5GJBA 3U44B 3RLFA 2WAXA 1D8TA 3TQFA 1KMHA 1P2TA 2JJ2D 3HU2A 4C2UA 3WYGA 3M6AA 1TUIA 4JLNA 3OZXA 3CUEF 1HTWA 1N5JA 1ZUNB 4E09A 4NHOA 1LW7A 2IX3A 2IS1A 4XSGA 4OYHA 1OB2A 3U7EB 3S1AB 4AI6A 3RC8A 1YE8A 4JLPA 1FPMA 4P4SA 1EK0A 4IFBA 1P5ZB 2DBYA 5SZHB 2BJVA 4D81A 5KYKA 2FPLA 2J0UA 3EC1A 4IVQA 1T5IA 1G7SA 1XF9A 3ASZA 1Q57A 3AKCA 4ITRC 4WXPA 5M04A 4BLTA 4IW3B 1S1MA 4DEXA 1OW3B 2ORWA 2ZR0A 2AKYA 1DO0A 1K8RA 1BO6A 4A15A 1NJGA 1RIFA 1RVDA 1YZTA 2QE7A 4RD0A 3AH8A 1NVVQ 2BC9A 4CEJA 1XXHE 4LV5B 5EXXA 4I1VA 4NYIQ 3WMEA 2CLSA 1R6BX 2YVUA 3CRW1 3LX5A 5EZ6B 3MFYA 1MO5A 2GEUA 2R2AA 1QHHA 1N6NA 1Z83A 2IEYA 4WZAE 5FOSA 1XEXA 2Q6TA 2QL6A 4KXFB 4R2HA 3W6NA 4KFSA 4QJ3A 2CL7X 4TN1A 1IJFA 1RFLA 4JLVA 1LB1B 4E22A 4BUJA 3CX6A 1TQDA 2QRNA 3V4FA 1F60A 4WVFA 3C15C 2BBOA 4JVLA 4US0R 1UKZA 2F43B 1GILA 8OHMA 5KHOC 1FW6A 4CEHB 2V55B 2YWFA 1W0JA 1E2HA 5EP3A 4O0MA 1KDTA 5CIWA 1VCMA 3L43A 1DAGA 1C9KA 1DOAA 3QXHA 5CDFA 2WPDA 5L3QB 3ZZTA 4CEIA 5FR1A 2YINC 5L3SB 2NPIA 3HR7A 1MO4A 2XOKA 1U0LA 3B8HA 2DFTA 3EPLA 2A7QA 2DHRA 1DBSA 3ZS8A 4HB4A 2G1JA 2QUZA 3A1UA 2NO1A 3IO5A 4JLKA 4TQ9A 3PCRB 1VYTA 4A8JC 2WV9A 3RS0A 4WOPA 3SYKA 4B2LA 2VP4A 4TLAA 4ZI2A 3OEEA 3P1JA 5FOUA 4IOJA 1EGAA 1ESNA 1VECA 1G18A 3EG5A 1JB1A 5EUQB 2CE7A 4PSAA 2QMEA 1Z6YA 1GSIA 3CF0A 4DCVA 4EUNA 1FOEB 4EJSA 2MSEB 1U81A 4TTRA 4R98A 2JASA 3U3JA 4MRVA 3IUYA 1W49A 1VG9B 1QHYA 1VCNA 3EA0A 4GOJA 4BRWA 1R5OA 3BERA 1P62B 3QY0A 1KMQA 2GCOB 3QPVA 2IYTA 1OYYA 1L7VC 4G1UC 5AJXA 3H1TA 3T1OA 2W6ID 3LRPA 3NH6A 1GUAA 3A4NA 3CBQA 4LJ4A 4TLBA 3RS3A 4AURA 1AS2A 5KTYA 4JBYA 2H57A 5B30A 3FHOA 4EKDA 2XJ4A 4PHHA 1WBDA 2GXAA 2FH5B 1II8B 2ZI6A 4BLQA 1FX0A 2GJSA 2FSGA 2PBRA 4OQLA 2CJWB 3R7WA 4JLJA 4OKSA 1XMSA 3I8SA 4B3BA 1F2UB 1XZQA 2ECKA 3FFBA 3FDIA 1DG3A 1Q20A 3ND8A 2F9LA 4QG7A 1VCOA 5DYIA 4TMVA 4HDQB 3LY5A 2VSFA 4TZ0A 4PFSA 4AYTA 4BGDA 2GNOA 3VR3A 4AC9A 4YXWD 3X1YA 5EZ5A 3K0CC 4B3FX 1G3QA 4MUAA 1CULC 2VA8A 3ZDQA 2EVWX 1ZC4A 2XXAB 3WHLA 4EPVA 4PAOA 2O8FA 4H1UA 4V0MA 2QBYB 5TY0A 1GL7A 2RKOA 3ASYA 4D2IA 1E4YA 3MG9A 5KO2A 4A4DA 5GJWC 3U3RA 1W46A 3GEEA 5FOWA 1N25A 1R4AA 3IBYA 4TMXA 3DPUA 5BXQC 4OK5A 2OV2A 3GEIA 4L5BA 121PA 3PEWA 1IN8A 3BB3A 3TKLA 2IT1A 1ZVQA 3KL4A 1J70A 4MGIR 3UIEA 1Z47A 3DVLA 4OK3A 1N0WA 4MYUA 3KXKA 1KZGB 1SVIA 2OO7A 4PPGA 4EFLA 2A30A 4M8NE 4F92B 4JSTA 1WB9A 4QBHA 3V9PA 3O47A 4JL6A 3A58B 221PA 3KB2A 5DH9A 2ZAOA 1K5DA 2CMKA 2ZRMA 1IN4A 1YRBA 1FZQA 5GVRA 2GKSA 3PEVA 1EFRA 1Z22A 3A1WA 5CLQA 4A2QA 3TVTA 4B3XA 4PO9A 2ZRDA 5G40A 2GXSA 3RSLA 3GJXC 4WBSA 3D7MA 2NO9A 2AK3A 2VP9A 4C0LA 4ZCMA 1OH7A 3GJ5A 1E0SA 2GILA 3SC3A 4Q4JB 1GKUB 4BFVA 3S1AA 2VTKA 1R0XA 2R6GA 3HYTA 1I4LD 1OH6A 3I8XA 1YZQA 4K46A 1QDEA 4D4LA 4F91B 1ZBDA 3ZVMA 2HF8A 1CR0A 4D25A 2J0UB 1FMJA 2CVHA 4HLUC 1Z2CA 1DAIA 4NTZA 1WQ1R 1E2MA 3W9YA 4PC1A 1DG1G 2WWGA 4KO8A 3TAHA 3MGCA 2JLXA 2CNWA 4C0JA 3B7GA 5FUYA 4CEJB 1N6IA 4W9MC 4NYIR 1FTSA 2ZRIA 2GJ8A 4FMCF 1M74A 4QNRA 5A4JA 3BOSA 3SE0A 1HT2E 2RCNA 1XEFA 1FNMA 1ZNZA 2D7CA 1G64A 2ZRPA 1AK2A 3NTUA 4FINA 1DVRA 2VEDA 2XAUA 3QG1A 5ELXA 1DPFA 4Z8YA 4B73A 5C2JB 4GL2A 4RZ3A 3K1JA 1OIXA 3WY9A 4B75A 2DYKA 2YOHA 2VHJA 3B6EA 5L3VA 1E98A 2GK7A 4HUQA 4RKFA 3U6KA 3LX8A 3IHLA 5CIQA 2WWYA 4IDQA 4B33A 3KTAB 1Z63A 4U7DA 1KI1A 5JLJA 4B6EA 4D0LB 3CX8A 4JBXA 721PA 1HUQA 1XBTA 1X6VA 3GJ4A 2GZAA 2OFWA 3EZFA 4G5SA 1ETUA 4L4UA 3AVUA 3R8CA 3QVVA 2FWRA 4FWTA 2C96A 1KO8A 1MRNA 3L2OB 1GNRA 2WOJA 5SZJA 2XNSA 4PC6A 3MLEA 521PA 1E9EA 4PQYA 1OH8A 5LD2B 4MITA 1XEWX 3AP3A 4NKRA 2C9CA 3I32A 1OXXK 4E5UA 1Q22A 4GOKA 2VYFA 2BBWA 1E2EA 4DDVA 1UM8A 4PR0A 2XSZA 3CZPA 4BFUA 1NIPA 2EWVA 4BASA 3UATA 3QKSB 2ZQ5A 3B1ZA 5G3ZA 3T1TA 3Q7QA 2FMXA 2QI9C 2QM7A 3NEYA 1KDRA 1VKJA 4C9BA 1XFAA 2XTMA 1FP7A 3L8YA 2O0KA 1YZKA 3T61A 1XX6A 4N1AA 4A8JA 2HT6A 4FWIB 1RZ3A 1XTRA 3OIVA 1TQ2A 2GWHA 1CXZA 4YQFA 1T8TA 4NCHA 1KDOA 2IBMA 1SZPA 1ESMA 2AR7A 4RD2A 4B32A 1N6PA 1IONA 3U5ZB 1CRPA 3B1YA 2YKGA 1WMSA 5H68A 1IAQA 1KK3A 1S4QA 3EX7C 3HU1A 1R2QA 4BRUA 3W90A 4OJKA 3NH9A 1AN0A 2JIZA 2EFDB 1E96A 4TYWA 3TUJC 3AQ4A 1II8A 3WNBA 4TT3D 1E9RA 2E1RA 5J40A 1VMAA 4AD8A 3R7WB 3D31A 1F6BA 1Z6AA 3N5CA 1C4OA 4IFEA 2O8EA 4QNMA 4DLUA 1R5NA 2AFHE 2D2FA 4ASUD 4DLVA 3MJRA 4UNPA 2O8DA 3GJ7A 1T0HB 1Q3TA 4KFRA 4TL7A 3U7HB 4XVUA 1F2TB 4J0QA 3DL0A 3VHXA 1F48A 3MWKA 5AJWA 3WYAA 1XXHA 3VR5A 2QMHA 2ZJAA 3H2YA 1SKYB 3D6TB 3T5GA 2RHDA 4PZZA 4R2IA 1JJ7A 2GBLA 3K70D 1XTJA 1KNXA 1Z6GA 3LLUA 3PUXA 1XD2B 5CITA 1YZUA 1IN5A 3CF6R 1N6OA 4F7WA 2XNDA 2HJVA 2XZOA 3HP1A 1XJ0A 4QJ5A 3T12A 1E4VA 5FBRB 3I5XA 4NH0A 1SXJD 1S9DA 4IXMA 4Q1FA 1E2PA 1R7RA 4TMTA 1NVVR 3FVQA 1ZAKA 1UBGA 1W2GA 4PO8A 1G8PA 3FMFA 1RRPA 4B74A 4DRZA 2OCAA 4ZIRB 1PZNA 2C9YA 4DLXA 5C4GB 4X8MA 1DAHA 1VG8A 2H16A 1W0KA 1LS6A 3M1IA 5JECA 1UADA 1NIJA 4XVQA 1G7RA 4KU4A 4DLTA 1L8QA 5CDFE 1KO7A 2RGXA 5IRCD 3Q85A 2WMNB 1UBFA 3LXRA 1UBCA 3EW9A 2FZ4A 1OXSC 3ZVRA 3HR8A 1OKKA 3THWB 2TMKA 1QVRA 5CLLA 2QA5A 2VL7A 2HV8A 1A1VA 4JL8A 4FMDF 3B13B 2RMKA 4QJ4A 4HYYA 3NWJA 2QTFA 5CB6A 3NBXX 3PEUA 3ADDA 1CS4C 2CXXA 4YMSA 1NF3A 2A5FA 1SKQA 3A1TA 4Q66C 4EQ6B 1SVOA 2F3RA 1YZGA 4UXIA 1KGDA 4B2PA 2J1LA 4P31A 2Q21A 4RZXA 4C0QC 5JCPA 5JI2E 1HURA 2RGDA 1G6HA 3VKWA 1U8YA 4RD6A 1CU1A 4RD1A 3NHAA 4HLQB 3RRZA 3BGWA 4WA7A 1MOZA 4CT4B 5KPJA 3VR1A 5HR5A 1GRRA 2NOAA 4KVGA 1TF2A 5JJKA 2J0SA 1BMFA 1AZTA 2ZUBA 2AD1A 4DLYA 3BH6A 1QBKC 1ELOA 4DCUA 3KQLA 2X1VA 4BWYA 4D0GA 4TYPA 1Z28A 3REFA 2G3YA 4KVAA 3HPRA 3VU9B 4Z51A 3K70B 2W2XA 2FG5A 4Q1DA 2IWRA 4DCTA 4BE7B 1HE8B 4ILEA 5AUPB 4OHWA 1T5LA 1VCIA 3CWZA 4HEJA 2I1VB 1P75A 2G0TA 1Q21A 3KKQA 3WRXC 4AKEA 1HEIA 5FTLA 3KJHA 4HAXA 4M22A 4PZYA 2FX3A 4OHXA 1E0KA 4HUQB 4A6XA 2J9RA 4CF7A 2O52A 4MKIA 3CR7A 1DADA 3QKRB 3H0KA 3AF3A 2HUPA 1H8ED 3QXJA 2YZ2A 3FMPB 5FOVA 3EASA 2QG6A 3P27A 1OYWA 2QSZA 4FD2A 5JS7A 1M8PA 5FUXA 4JLMA 1N5IA 1N2CE 2E9SA 5J4YA 3SNHA 2FEMA 1UEIA 2RGCA 3AVPA 2ZREA 1E2GA 2OILA 2CL6X 2QEQA 3C5CA 2ZSEA 2OLKA 3K9HA 1ZUIA 1KI4A 1ZCBA 1G7CA 4LJAA 1KMHB 2JLZA 3C41J 3FGNA 4PAQA 5J4LA 1IXRC 2IA5A 4TMZA 4MKGA 3X1DA 4Q47A 4C2TA 4M21A 2OESA 3WP0A 1N0VC 3GFOA 1GP2A 5KNBA 3PUYA 3KKPA 3CKLA 4LC1A 4W7SA 4XOIA 3TRFA 1SQ5A 4Q01A 2KE5A 4BQSA 2V8OA 4QBIA 1L4UA 4OHYA 2IYWA 1WE2A 4KI0A 5FI0B 1KY2A 2BHRA 4Q18A 4DZZA 2CDNA 5EE3A 1OXUA 2JLSA 3K0CA 1Z0IA 3OEHD 5CB8A 2P2LA 1J2JA 3QXSA 3O8DA 2FFQA 4B3GA 1KJWA 2CLDX 2BWJA 1ZNWA 5CJ2A 4CGZA 4QGGA 2RGNA 2V7QA 1ZUHA 2JEOA 3R9XA 2Z0MA 1KY3A 4KLZA 1E2NA 4NDZA 4PC7A 2ZRFA 2FE4A 4JLDA 3PQCA 4Q4LA 2CL0X 4YDHB 1TTTA 1II0A 3N2IA 1MABA 2IXFA 2RGGA 3A37A 1J8MF 3UANA 5TDHA 3L0OA 4MYTA 2AWOA 1RYHA 4IEIA 4Q1CA 5IHPA 1DAEA 3E5HA 2ZYWX 4NZYA 1CIPA 4Q02A 4X8OA 1COWD 4ZI3A 2F43A 2ZR9A 1SVLA 1D9XA 2JIZD 5F2EA 1E32A 2Q3FA 2RGEA 4N0DA 3HPQA 1UBEA 2IYQA 2OG2A 4EDHA 1M7HA 2WJJA 1SXJB 3CRVA 4LJ7A 2FGKA 1Z2AA 3SR0A 2W6JA 2ZJBA 1GAJA 1W0KD 3N70A 4MYHA 5DNYB 3TNFA 4TLDA 2WSSD 2W00A 3OAAD 2CE2X 3SFVA 2WSMA 5K8LA 5AJYA 2YWGA 4UXHA 2VF7A 4GBMA 4ERNA 1Z8FA 4BLRA 4URVR 3B1XA 2VP5A 4JS0A 1JI0A 2R44A 2YWHA 4LSGA 3UMRA 2IHBA 2J7PD 5KDOA 3BFXA 4QKQA 3IDQA 4HZUA 2ZRHA 4DVGA 3VHLB 4TQAA 5F9FA 4A2WA 1NG9A 2OZEA 5EXPA 4F38A 2A5YB 1CR1A 1HH4A 2IYZA 5GJCA 2B6HA 3FMOB 4A1FA 3GLFE 3BWDD 3W8RA 5IDVA 4BLOA 3MD0A 3F5FA 3LW7A 3IPYA 2P5TB 3L0SA 4AWXA 4I1OA 4Q1BA 2V54A 4IOLA 4HLUA 1F3OA 1TMKA 3X1ZA 1HY3A 1SKYE 4GP7A 1K6MA 1G3UA 3C5HA 4XVRA 3LBHA 5D3MB 3T5DA 5DI3A 5FUWA 2ZPTX 3NHBA 2OSBA 2BVNA 1U8AA 3ZIAA 2EW1A 5KPDA 3EWAA 4BFYA 1H8HD 4DCSA 1IJEA 1II9A 1G8FA 4HAYA 1E1RA 4GT1A 3B82A 1N5LA 1XCPA 3EPHA 1FX0B 3ZD6A 5DO9A 3GMTA 4WZBE 4R7ZA 2ONKA 2AN9A 4QOSA 4LBYA 3VR2A 5L8VA 3KDSE 3IIKA 4B6FA 3AVTA 3I72A 2P6UA 5ANRB 5J4HA 4NONA 2JJ1A 2ZS9A 1C1YA 4DCNA 2NPFA 3AVQA 2IW3A 4D4KA 4D4JA 4QM7A 2VPPA 1KI9A 5KOYA 3SYLA 4JSYA 2H5EA 4KSBA 1OIVA 3BE4A 4RY2A 2OLJA 4PQFA 1S8FA 2ZU0C 2WJGA 1WBBA 3W3AA 4TLEA 2ERYA 2NIPA 3K9LA 4Q7LA 2CBZA 4BZPA 4ZV4A 1M7BA 3VU9A 1PV4A 2O8FB 3GLHA 4IDNA 4Q7JB 3MRSA 3C4JA 5P21A 2ZM5A 1JR6A 3W34A 1G291 1IOZA 3G0HA 1UF9A 5CYPA 1UFQA 4G5QA 1SVKA 4CDGA 1KSJA 5FH9A 1GZSA 2BMDA 4LPSA 1RJ9A 3NEJA 5G41A 4ZDJA 2IS6A 3CPJB 3LV8A 1B23P 4MGKR 2V9PA 3GLGE 3NDBB 3TR5A 2YOFA 1S1CA 4JLBA 5AUQA 4B3CA 1LF0A 2IYUA 2A5GA 3ND9A 2EFEB 1W5TA 4Q9LA 1KHTA 4Z54A 2P0EA 1OXTA 1LS1A 1V43A 4G5OA 3RRMA 2GTPA 3T15A 3SDZA 2WHXA 3EPJA 4D4MA 4KODA 3IO3A 2P65A 4CIDA 1LV7A 1G8GA 1KSHA 3I92A 1TF5A 3KFVA 5JWOA 2J5XA 3W8NA 1OB5A 1P72A 1EXMA 2B8WA 4EAQA 4CZ2A 3FHTA 3CNOA 3U2QA 3TSZA 3SJZA 5HKKA 2GK6A 3VKHA 5HTKA 1GDDA 1Q1QA 1T3HA 1KOFA 4I99A 4C4PA 2N46A 4A9AA 4P32A 2QY9A 2REXB 3Q3JB 1Z0AA 2JLVA 1T9HA 4OQNA 1G17A 1BOFA 1U90A 1ZU5A 3BH0A 5JS8A 1NJFA 2QNRA 1OIWA 1J99A 2PL3A 1QHHB 1JQLB 1T3SA 1ZD8A 2XOKD 2ZRBA 2OE2A 2F6RA 1O87A 2ZE6A 2V1UA 1NKTA 2ZVQX 3PV0A 1JEEA 1G21E 1OHHD 2DR3A 2WOOA 4HAVA 4DWJA 2NG1A 2HYDA 4LZZA 4MRRA 1FQJA 1PUIA 2C9OA 5KUTA 1W36B 3VQTA 2D7DA 4DB4A 3VNUA 1N6KA 1SVMA 5CM9C 1KK2A 3R8FA 3KUCA 3GFTA 3WNDA 1QG2A 3DZDA 3IGFA 4LHVA 5E7MA 1PLJA 3TSWA 3QXXA 1P2VA 2OAQ1 4HB3A 3LD9A 4JYBA 1R0YA 2H8KA 4BLSA 3U3KA 5GVSA 2QENA 4X8HA 4ZCLA 1E9AA 2RGNC 1N0UA 4A0FA 4DEYA 2XGJA 1ZW6A 2QTVB 1SXJC 4URZR 5KSZA 2DFKB 4Z1MD 3U6BA 1NN0A 1E1QA 4LCBA 1E9SA 4TYQA 3QBTA 1AKEA 2ZI3A 1KIMA 2BV3A 3UKDA 4IHQA 3SU8A 1VYVA 4OQFA 2DPXA 1S0UA 2DY1A 5C18A 3CB4A 5B57C 2ZI5A 3MSXA 4ZO4A 3K8YA 4GSYA 4IDPA 1A4RA 3LLMA 4B47A 2EQBA 2XEXA 2ZYTX 1XMIA 2ZRAA 5FTJA 3NDPA 2UZ3A 3SHFA 3CIOA 4HZUB 1P6XA 3KJEA 3LA6A 5TMPA 3QENA 1EFCA 2JA1A 1KZ7B 2DWQA 4WAUA 3RNLA 2FFHA 2VF8A 2O8CB 4LV6A 4HLCA 4DKXA 3H86A 2KWIA 2RGAA 1N6RA 2UKDA 1W0JD 4B2IA 1E9DA 2ZJ5A 1E6CA 1EX6A 4UQOA 2V4ZA 5FBVB 2IEZA 2ZJYA 1DAMA 5AJZA 5JZVA 3LAWA 1GNPA 1W5SA 2OEPA 1E94E 3CLVA 2EU8A 3LQQA 2HF9A 2I4IA 2XITA 3ADKA 2Z43A 1KJZA 2YHSA 1W48A 3RVBA 2OUKA 1U98A 3A4LA 3EXAA 3LDAA 2BMFA 2A9KA 3L82B 4HAZA 5D3MA 3NC0C 3UWKA 2NQ2C 1WCV1 5BWMA 4O3MA 5JRZA 1Z0KA 1IY1A 4MH0R 1XPOA 4BZXA 3RWMB 1L2TA 4IDHA 3DOFA 2JAQA 1JECA 1CP2A 4QHSA 3KQHA 3G82C 2R8RA 1VIAA 1XEWY 3FKQA 3B85A 4I4LA 3K09C 1NLFA 2XZLA 3NG1A 2JATA 2QU8A 3KZ1E 3ADCA 3V00A 2QE7D 1ZNYA 1VTKA 3WBJA 1A5TA 4FCVA 5FUVA 2GCPA 2O8EB 4KV9A 2QSYA 3EZ7A 4HB0A 2ZAMA 4LHZA 2BBTA 3QE0A 4IDOA 3GLIE 4LV8B 1W7AA 621PA 2ERXA 4TTQA 2OAP1 1G8YA 4NE2A 2QT0A 5DISB 1NVWQ 2JCSA 4Q9IA 2BOVA 2QPOA 3AV0B 2VSOA 2FEOA 1XTSA 2OBLA 3U60B 4GOXA 2RH5A 1JXMA 3PITA 4M1MA 1Z0JA 2A78A 4FIDA 5JBQA 2ASEA 3NC1C 4A0RA 3E1SA 3SJCA 3OEED 4UJ3A 4LYFA 4MRPA 2XTZA 4C0BA 1P2UA 2ZS8A 3CRQA 3ZYCA 5C46F 3SI7A 3U3OA 5EE1A 1HT1E 3Q5EA 5FPTA 2C95A 3ONWA 5JJIA 2PZEA 5A0FA 5LBIA 4ZDKA 1TQ6A 3CNLA 4Q4AB 5SZKB 2EYQA 4Q9JA 1XCMA 2OXRA 2X77A 3IIMA 3DO6A 3GP8A 1UDWA 4A36A 4DB2A 1XP8A 3F0TA 3A6PC 4YDSA 2KBFA 1CJUC 4Q7MB 3VX3A 3VR6A 4H9GA 1LY1A 1HYQA 3LVRE 4LJYA 4PXAA 5BYKA 2HDNB 3JVVA 1XPRA 1OFIA 2F55A 2O8BA 3KJGA 2ZU6A 2HJGA 3OIYA 1R0WA 5AUOB 3LBNA 3BK7A 2GHIA 4N3NA 4YONB 5L3RA 5EJEA 5K8TA 3U44A 5J5CA 2FSFA 2V6IA 2WWFA 3P4XA 3T1QA 4V0OA 3WMGA 2N42A 4LRWA 3RS5A 1Z0DA 3BRWD 2QAGA 2IYLD 3RYTC 3FE2A 1XD9A 2WWIA 3DOEA 4RSGA 3K0SA 3UPUA 2IHYA 4IRUB 2NMVA 3KXLA 4DUGD 4RZUA 5GJVC 1U9IA 2J7KA 1LF5A 4DDUA 3QJYA 1O3YA 3P20A 4P4UA 2FU5C 3NIBA 1ZYUA 1S3GA 3OF5A 2W2TA 2J3EA 1OHHA 4QGHA 5FBQB 4B71A 5FPKA 3RS2A 3PUVA 2XB2A 1Z6XA 3E70C 4L9WA 1E2IA 1J7KA 1UPTA 4QFMA 3QSYA 1EFRD 4JZKA 4B43A 5JHHB 2C77A 2QQ0A 1KKMA 1UKEA 3FWYA 2G1KA 4AG6A 1G7TA 1Q1BA 3QF4B 4X8LA 1TUEA 3SFZA 4AKHA 2ANBA 1S96A 2OFOA 1QHGA 3ZZ0A 2EWWA 1P4SA 1XRJA 4RZ2A 1CJMA 3RSOA 1QHIA 4GMDA 3GCGA 3CRMA 1NL3A 1AKYA 1JNYA 4QC2A 2PJRA 2YC2C 1L4YA 3TAUA 2JDID 4NYJR 1GIAA 1MR3F 1FTNA 5CYOA 2GXUA 2QGNA 1Q44A 1JR3E 2VRWA 4OJQA 1FMLA 3ICEA 5FTNA 5KU1A 2IYRA 4YXWA 3K0EA 5E4FA 4W5WA 4CEHA 2OM2A 3AKYA 1QVAA 2QP4A 4A2PA 1EFHA 2RAPA 4Q4HA 3QKSA 2YOGA 3SS8A 3AM1A 4D80A 4IJMA 1XPUA 3LO5A 1NP6A 3I4LA 5FTMA 3KXIA 1ODFA 2Z5FA 5B2ZA 1KO5A 1G3IA 2YJTD 2BKEA 2FPKA 1KAGA 4CVNA 2J59A 4KBGA 4AK9A 2P67A 2WWWA 1K5GA 1W2HA 2VP6A 4QXAA 2CNWD 2A5JA 1G1MA 2EYUA 3P4YA 2FZLA 1JBKA 2W2VA 2O8CA 1TF7A 4EPWA 1GRQA 4ARZB 4C3ZA 1G20E 3WYFA 1IN6A 1S9HA 5BN3A 1G6OA 1U99A 4NYMQ 3THXB 3OE7D 5IK2D 3NBFA 4OI1A 5JI3E 3PUWA 1E9FA 4MKHA 4ZDIA 1SHZA 1US8A 2HXSA 4L9SA 5JWRA 3L8ZA 4TLCA 2FGJA 2O8DB 2MMGA 4B44A 1KTVA 3GD7A 3CNNA 2J0VA 5E7IA 3RC3A 4P0TA 3CR8A 2FA9A 3I3SR 3W3ZB 2HCJB 1OKKD 1VPLA 5JWHA 2WJVA 2HLDA 3K0FA 3DM9B 4XIGS 1XXHB 3IEVA 1AQUA 1E0JA 2A2ZA 4OI0A 4E07A 5TXGA 4YC7A 4LBZA 1JR3D 2GA8A 4K81B 4Q5IA 3RRYA 1NKSA 1HQCA 2Q9BA 3HU3A 5JEDA 1B0UA 3SJAA 1OH5A 1U8ZA 1XD2A 3CWQA 3GJ8A 4NCIA 1OJLA 2NTYC 4UNQA 1M34E 2WTUA 3B5JA 4PANA 4HZIA 4GDFA 2VHUA 4RVCA 2BM1A 4XWOA 2B7BA 3BIFA 4JLOA 3ZQJA 2I3BA 4QBFA 5FL7A 3REGA 2F1RA 1XB2A 3GLGA 3IQXA 3ZS9A 5BQ5A 2VIIA 3VFDA 3BORA 2KB0A 3KKMA 4UKDA 2PLFA 3SJBA 5AUNB 1W36D 2AK2A 1RW4A 1TAGA 1A2KC 1BYUA 2ODBA 1KDPA 4LGMA 4LYHA 3VTKA 1TU4A 2GJAA 5LD2C 5H8WA 3KQUA 4OQXA 1PLLA 2B92A 2WIAA 3PXGA 3AVOA 3EC2A 4XTRA 5J4KA 2OHFA 2QP9X 5E7JA 1ZC3A 3QG5A 2D06A 4ASUA 4DT1B 2PX3A 3X1XA 2KBEA 4JT4A 1G3MA 1NMZA 2R6DA 1VHTA 4TSFA 2ZIAA 2X2EA 1A82A 3LWNA 4Q1AA 1NLYA 2IUSA 1NG1A 4PO1A 3RS7A 3SQXA 3SZRA 1FP6A 1P61B 1ZM9A 1KAOA 4EQ6A 2VP2A 4LBWA 3UG6A 1E79A 5UKDA 4GPTA 2DCUA 1XTQA 2SHKA 3OESA 2QMUA 4M9XA 3W5JA 5K8IA 3PG5A 1ZM2A 3FYHA 2ATVA 4Q1EA 2R62A 3AF2A 2FOLA 3WHKA 2BM0A 4MGZR 3TW8B 1XMVA 2GEDA 5DE3A 4Q48A 1Z5ZA 3FKSA 4GP6A 4GRAA 2D4HA 2R6FA 2G77B 3BH7A 3K9NA 4V0ME 3TMKA 1U9IC 4YMTA 1X8LA 2ODNA 2N1BA 5BN4A 2QAGB 2CHQA 3AGQA 4Q4JA 1W36C 4UNSA 2EFHB 3ZJYA 3CX7A 2GAAA 2FFBA 5HCNA 3LFUA 2R9VA 2GVDC 5HPYB 1RRGA 2WIBA 3BB1A 4LDJA 3ZD7A 3VNVA 2P6NA 4GI7A 4M1SA 4XD7D 3GJ6A 3CM0A 2JJ1D 1JPJA 1YR8A 2WJIA 5EE0A 3PJRA 3B2EA 4BPBA 3D8BA 1DTSA 5EP4A 4QM6A 2Z6VA 2F1IA 4RKEA 2H7VA 2ODEA 4S35A 4JIMA 4PC3A 1YHNA 4ZPXA 4DLZA 3U7FB 1YR6A 3B60A 3KX2A 1Z0FA 3W6OA 3SBDA 1ZM3A 1KSGA 1M7GA 4OI4A 3P32A 2IXGA 1I4TD 1VHLA 2C5LA 4KFUA 4TQUS 4EIWA 2ZJZA 3L0IB 4WIAA 3EA5A 4MDEA 3KQNA 2HCBA 2C78A 1V5WA 1FNNA 3IILA 4FI3C 1CEEA 3TJZA 3LQRA 1KI6A 2VHTA 4S2EA 4C30A 3R9IA 4LY6A 1OV4A 3JZMA 3TQCA 4LI0A 1RPZA 2AXPA 2P5SA 2HLDD 3BJIC 1T91A 2CHGA 3UWOA 2WPDD 4OI2A 3GJ3A 2WKQA 5C4MA 4LHXA 3THOA 1NVUQ 4OQMA 1R0ZA 1UDXA 2WBLC 1G9XA 2YWEA 3GLIB 5KSYA 3DMNA 5FR2A 3V4RA 2RB4A 2BBSA 1KJYA 4MRSA 4PPNA 4PZLA 1T0JB 2JLWA 1XU4A 2AKAB 2VBCA 3FB4A 5DSZA 2PZGA 1X86B 1DAFA 3M0EA 4LJ9A 3FTQA 2H18A 1LNZA 4RFSB 2WZQA 4BLPA 2B8TA 4Q7KA 2QORA 1JALA 2EFCB 2R6CA 4MDFA 3CW2A 3TSOA 3EZ9A 5FPYA 4EPXA 2QN6A 1XD8A 5G3YA 2YNMA 2F1HA 3GQBA 2PT7A 1E3MA 4PQRA 4LJ6A 1BKDR 4KITB 1GM5A 4JYCA 2AWNA 2Q9CA 2YV5A 1M6NA 4RD4A 2NO6A 3BC1A 1AIPA 1OFHA 2W6IA 4OK6A 3C7KA 1MABB 4D82A 4KBFA 3PEYA 1NN1A 5LB2A 1OPXA 4TL9A 1DELA 1JJVA 5JMTA 2XTNA 4KFTA 3AGPA 1E2QA 1ZMXA 3H4MA 3K70C 1H8HA 1KI2A 1RKBA 3N2EA 3CF2A 3I5YA 2JJ8A 4FCWA 4Q03A 1US8B 1D2EA 2PEYA 1NMXA 1XJQA 3U4QA 1P2SA 1SHKA 2H17A 2RGBA 4MGYR 3FFAA 5LDDC 2IYYA 3TUZC 3EZ6A 2DFLA 4HDCA 1ZD1A 1WA5A 4HDOB 1GKIA 2QMOA 2BEKA 2ZSDA 5JFGA 3SHWA 2ZSBA 1I2DA 2XX3A 1Z06A 2XJ9A 5FL3A 1ANKA 1HE1C 3MAAC 1LTQA 2CVFA 2F3TA 3IBGA 1FL9A 3RRNA 5FPSA 2IS4A 5J47A 1GOTA 1YZNA 2C03A 3AP2A 4U5XA 3GLFB 2E87A 1T4GA 3P26A 4ABYA 2C04A 1VYUA 3O8BA 4TTPA 1AGRA 4DBLC 3OIWA 3GLHE 3LBIA 2LCFA 1GWNA 1KO4A 1R8QA 2BEJA 4NCNA 4BFTA 4KLNA 4OBEA 1F2TA 1P9WA 2WJYA 2ZRJA 3DM5A 4KSCA 2ODWA 5AWFC 1MO6A 2IUTA 5JJLA 2UVQA 1PLKA 2G83A 1N6HA 1BIFA 1NBME 3DDCA 4NYMR 4DSNA 4A8JB 3CPHA 2BJWA 3AKEA 1E69A 2QP3A 2X8AA 4L16A 1LFDB 4JJKA 2W6JD 1OE0A 4V0KA 1OFTA 1G16A 4C7OA 2G6BA 1YR7A 2QRZA 3B9PA 4LHYA 1COWA 4PHFA 4DT1A 1KI7A 1NY5A 1NMYA 2J7PA 4UNRA 1YQTA 2WWHA 1GFIA 2VQSA 4G01B 1G4AE 3RDPA 1T3LA 5FI1B 1HQYE 2PLRA 2ZJOA 5EP2A 5F98A 4Q9HA 1CTQA 1QG4A 4GZMA 3SYNA 2JLRA 4F4JA 4LWZA 5C1BA 3KQKA 2GDJA 4LK2A 3OHMA 3G5UA 3NKVA 2GCOA 3TW4A 1JXOA 1SVWA 1BMFD 2QM8A 1JQJC 3KUDA 3Q5DA 4FMBB 1HA3A 4K8OA 2FPMA 1QRAA 4HAUA 4PPFA 5FPHA 3AUXA 5JSZB 1E2DA 1Q0UA 4ESVA 1EESA 3AB3A 3EZ2A 5HZHA 1EFTA 3DEFA 1ONBA 2IK8A 3ETLA 1D2MA 4FXPA 3VKGA 3LNCA 4I81A 4L15A 4HAWA 1XJCA 3IQWA 4G5GA 3MMPA 4U02A 1Q12A 2MSDB 3OEHA 3OFNA 1TPZA 4DXAA 4V0NA 4Z8XA 3ZGXA 2LWIA 1YZLA 4B48A 1RYFA 2CJWA 2VHQA 3KKNA 2ZJ2A 1GG2A 2W0SA 3EARA 4RFVA 5AR1A 2QT1A 1NVXQ 4XSHA 4QBGB 4Q9KA 3SEAA 4YMWA 4TWZA 1NNEA 3AUYA 1CJVC 4OHVA 4KYUA 1D5CA 5EP1A 2ZROA 1NRJB 2IF2A 1ZP6A 3BAFA 3HDTA 4TT3A 5DIFA 2BMJA 1VG0B 2W0MA 4PTLA 4ZIRA 3AVXA 1AGPA 3QUSA 2AHOA 3KKOA 4MQBA 2WWXA 1S3SA 1KI8A 2GBLC 1E2FA 2XXAA 2JDIA 4IOKA 1P7CA 1XZPA 4R9UC 1RRCA 3O8CA 2MMCA 2VH5R 1Q1ZA 3QKUA 2QBYA 3A36A 4RJLA 4DDTA 4WXRA 4NBSA 1G5TA 3OE7A 4HLDA 2PH1A 4Z1MA 3K0AA 2ZRGA 3LVQE 1U0JA 4GZLA 1ZNXA 4PHGA 4F4CA 2DWPA 1NSTA 4Q4AA 2GRJA 1Z07A 2WVJA 3CPEA 1TL7C 2IF0A 3BD9A 3EIQA 1NLZA 4NPHA 2GAOA 4XH9B 1LVGA 2IUUA 4B3DA 3UMSA 1GL6A 3RWOA 4ZKDA 4UNNA 4IVRA 1CR2A 2Q3HA 1KNQA 1Y63A 2FN4A 3EAQA 4PC2A 4P4SB 3QEJA 3EPKA 4EPYA 3MCAA 2ZE7A 3SN6A 2REBA 1KSFX 4BEBA 1YKSA 2REOA 2FFAA 4BEJA 1CLUA 2WM9B 2GF0A 3GPLA 4QGAA 4EFNA 1X1RA 4XWKA 4A6PA 2FNAA 3H84A 2KI5A 2Z4SA 5LB4A 1G8HA 2A5DA 3WBKA 5DI9A 1A7JA 4HSEA 2R6AA 5HE8A 2KSQA 3C14C 1HV8A 3AEZA 3Q9LA 3SOPA 4PSVA 2GCNA 4QHTA 3MWYW 2PMKA 4YMVA 5G53C 4C0SA 4QGFA 3LW8A 3QNUA 3OIUA 4F93B 1G4UR 2ORVA 2ZVPX 4V03A 1GTVA 2GZDA 1AQYA 3X1WA 1GKYA 3I61A 4OHZA 5KNCA 2GJ9A 4LBVA 2PCLA 3JZAA 4LUCA 4MKFA 3QKRA 1I2MA 1JR3A 3QF4A 5TARA 4JT2A 3U4QB 2GF9A 5FOXA 1X3SA 3EIEA 3C8UA 3QVUA 4DHEA 4NCKA 1DE0A 2PZFA 2BCGY 1KKLA 3TVDA 4R71A 5FFMA 1IQPA 5L3QA 5DLQC 2L0XA 3NXSA 4GMXA 3AVVA 5L3SA 1W4RA 5EXTA 3QEOA 4KAXA 2RHMA 3B9QA 1T6NA 4F4IA 1EG7A 1E1QD 1E9CA 4GNKA 4IVPA 3Q8XB 1OT3A 5FOTA 3O8RA 3NVAA 5LPNA 3F8TA 2HEIA 4ON9A 3UK6A
chains in the Genus database with same CATH superfamily
3GPBA 1C8KA 1EE9A 2NO7A 2GYYA 4HX5A 1AGXA 1LPPA 1NF9A 3KT0A 5FBWB 3KTDA 3N6XA 2OYSA 4KTTE 3V32A 4NARA 3VYWA 5EUBA 4I4TA 3UMCA 1WDTA 3SQWA 4YBZA 3FRIA 4HDMA 4Q4HB 1RRFA 4GWLA 5LQKA 6YASA 2CNBA 4ZO8A 4DRXB 4YAJA 1D2HA 1QPZA 3A4YA 5A06A 4NIMA 2NZ8A 4UQPA 1SUFA 3E7PA 5ES3A 4N5LA 2HO4A 2PX6A 3GEHA 4K88A 1LCIA 1B76A 2PX0A 4V2IA 4CLHA 3DVSX 3LT2A 3WGGA 4EW6A 2ZE8A 3CLKA 4COKA 1RHJA 4CT5A 1GZ4A 2ZITA 4KYIB 4UPDA 1EFDN 4DR4B 3CX4A 4MMYB 4PS0A 1GPBA 1P1RA 1NXXA 4GF5A 1VMEA 2R751 2Y0BA 2LCQA 3H8WA 4BCBA 4DLRA 4K9LA 2QN8A 3DXFA 2QAJA 4GC9A 1JIQA 2G28A 2G9NA 3VR2D 5ENDA 1JDJA 4CG0A 4DMUB 3V4VB 3B2NA 1THMA 5LNK6 2A0XA 4ZOCA 5H1YA 5LA6F 5JXJA 3SEFA 3OFND 5B64A 4YP7A 1LW6E 4OP1A 4LFCB 4E15A 3SM9A 2YUIA 1ECFA 1VLHA 1W8DA 2C2KA 3JYHA 2FUCA 1JEQB 3NHUA 3DE0X 3OO1A 1UK8A 5I7AA 3WK4A 2FV8A 4J8PA 4IKEA 3G0BA 3JVUA 3TF5A 2CHFA 2CHVA 1FUUA 5LQNA 1ISGA 1GL9B 3IJPA 4S1TA 3ZUPA 1N5MA 2WF6A 1M1XB 4E5SA 3H42B 1EX1A 2GN4A 3KEQA 3KKKA 1BCRA 4YMUA 2FX2A 3RAJA 4GO1A 3PVSA 3W5IA 5KWIA 1I4DD 1MORA 1QHSA 3M5WA 4WVLA 1NR5A 4TTJA 4BXOB 3SSNA 5BQ3A 2PEZA 1QPGA 2OT3B 1UOQA 2PQMA 4V0SA 4C4SA 2BCJQ 4MB6A 2FEAA 1K6EA 2DG2A 4JKIA 3K2QA 3S8MA 3VV2A 3H3FA 4JVNA 3DQZA 4HOYA 5IM4A 2AFVA 1OXVA 1O77A 4LKRA 1EUQA 4HPXB 4MPRA 2V3CC 3MOSA 1ULBA 2Z5VA 4C1NA 4ETMA 5MHTA 2NU7A 4A82A 1UK7A 2AJTA 5L95A 2PFKA 4FFBB 3LX4A 1X42A 4DLLA 2EJBA 3BXXA 4DUGA 4E14A 5BY2A 2B8JA 3ZLJA 2R4TA 1M6VB 2OLEA 1YC5A 3ANSA 1FLDA 1OXBB 4YMLA 4G0PA 4P5PA 1DRUA 1E5XA 4HNSA 4KP7A 3RSQA 3V2GA 2BEVB 4N9QA 4JI1B 5LKAA 1K97A 2R8OA 3ELWA 3N05A 4QA9A 3TM4A 3KR1A 4US2R 2G0NA 2V65A 1CJTC 1VSUA 1CQIB 4LY3A 3THYB 1R5BA 2AF4C 2K2QB 3LPNA 5FD8A 3EXIA 4R8KA 4EMTA 2O23A 5BMVA 3T1VA 4DR3B 1ABEA 5K3DA 5C53B 3M5PA 1GTG1 2C97A 3U0VA 2JAOA 4OXRA 4Q21A 4N5MA 3OM9A 5DI3B 3QU5A 3CEAA 3X1KA 3IOMA 2HPAA 2NX2A 1NPTO 4HXGA 5KOJB 3ZI0A 1BDIA 1ZJYA 4LHWA 2P9HA 2Q5IA 4WCVA 4ZA2A 2C82A 5I4KA 4NBLA 5IJWA 4HPJB 4PYRA 3LTEA 1Z8HA 3NAZA 4KX5A 3N76A 2EZ8A 1CD5A 1JN0A 2Q6KA 1Y3AA 2ETXA 5IEJA 2X14A 2YN0A 3CIFA 2CEAA 2YYZA 3EWIA 1D3AA 1TYBE 1X1SA 1CUXA 2AMLA 2BMEA 2R6ZA 4WW0A 1NBMD 5U9CA 4R8SA 3PWTA 3QTBA 2YC4C 1QF9A 5M34A 2GK4A 3FFTA 3WRXA 5JNSA 3WV4A 4M1TA 1SUIA 2ZANA 3T06B 3UJPA 2WU4A 2WV7A 4C0KA 3RS4A 3TLXA 3NFRA 1WQ4A 4B3TB 3EZGA 3T7KA 1V35A 4YCLA 1XROA 1SR8A 2NT3A 2OBYA 2ZWOA 4ZAXA 3TZEA 4PVDA 2RFLA 1B41A 3QF7A 4MVYA 1SUPA 1JHRA 4LF9B 1PSZA 3AUFA 2FCAA 2ZW9A 4FP9A 1XTIA 3NZEA 1Z3IX 4CHTA 4PY2A 4RUKA 3HO1A 1XV5A 4WL0A 1ISPA 2VWPA 3U40A 1CDDA 3U61B 2B21A 1GPLA 1NP3A 3BSSA 2IWHA 5JNRA 1GYQA 3QNWA 4KE7A 1PVVA 4XD7A 2IOHA 3TI9A 3FSGD 5I9BA 1J2UA 1WQ3A 4QECA 5CFZA 4FCTA 4BNDA 1XAJA 3O26A 5LZ4A 4MRNA 5KTTA 4AS1A 4RFLA 2JJYA 3UA3A 4MO2A 1U0HC 1WF3A 5IX8A 3IT1A 16PKA 1CF4A 4TWIA 3C7CB 5JZOA 1GPUA 3B38A 3RSGA 4ZQIA 1J97A 3PRHA 3I1FA 2JEYA 1P2BA 4IWXA 2QTTA 2RI6A 4JCOA 4KHZA 4BFWA 2ZRNA 2WUVA 5A9RA 2AFRA 4UUAA 4HSGA 1UZLA 3EPRA 3BJEA 1O97C 1TGVA 2IZ0A 2HZ7A 5D00A 3TI7A 1KRHA 4BKOA 5H4GA 4F86A 1YDWA 2J6IA 2P0YA 3VR4A 5KREA 3U4IA 2AX4A 2CV2A 5FNVB 3MINB 5T6MA 1VBFA 3KSAC 1V6AA 3IIJA 4PXSA 3EMVA 3I73A 5D5QA 1FVOA 5FWYA 3VMFA 4H60A 4I66A 5FOQA 1Y6GA 3JYNA 5JNTA 4PE5B 1K7SN 3LOQA 1BMDA 1NRWA 3HBFA 5EIWA 4DV0B 2J3IA 2F9MA 2DUMA 2Z3WA 2CK3D 1IBRA 4URWR 4P4TA 4JNKA 5EXSA 1QO0A 1J07A 5ALZA 4M7WA 5KDDA 4DBVO 4HWGA 3RIMA 3T7EA 1WZIA 3TB4A 2CUKA 4P36A 4HUTA 2WJHA 2Y2VA 3CCCA 4RL6A 1BDHA 4MS3B 2REQB 2P6PA 4N49A 1M2OB 4DC9A 4FR2A 3R7FA 3FTEA 3K9FC 3GX1A 4XB2A 2WUWE 2IEBA 1RCTE 3NBZC 2NADA 5BN3B 3Q6MA 3TR0A 5IFLA 4KMSA 2P7IA 3KOXA 3WLRA 4F97A 4ZKEA 4N8EA 3QI2A 3DWIA 5E95A 2XF2A 2OBNA 3OQIB 5BV2P 3H3XA 3GFVA 4FFLA 3ROGA 2CK3A 1M5UA 3D1JA 4L73A 4QFCA 6ABPA 3FTCA 2A3RA 2PUDA 5DCUA 2PCJA 2X9NA 1U7XA 3PFFA 1UT5A 4II7A 2WYUA 3FMVA 2DFNA 1QOPB 3GFPA 1CQJB 3HV2A 2PVPA 3QVGA 1PTJA 1TRKA 5FPPA 3RD5A 3HZOA 2VDVE 1YVDA 4AWBA 3PR2B 1QQAA 3QJ5A 4XDHA 4HQ6A 3GJ0A 3EDOA 1E77A 4MWZA 1IHUA 1TEVA 5K2MA 3RJZA 1NN3A 3Q3EA 4B31A 1UAAA 3ZCQA 5CGQB 2PKEA 3VM6A 4DL9A 3G23A 3WV5A 3IAUA 3DDWA 2RKWA 3NNDA 5LSAA 1UJ4A 3R5JA 4K3VA 4ETNA 4EKYA 1D4AA 1AA6A 1WEKA 3ANXA 3JQPA 3Q4GA 4N6GA 4EI9A 3PGMA 2CXUA 2QL9A 4PSKA 5IXYA 4WH0A 4DIBA 1GITA 2C29D 1K7XB 2BUBA 3PRYA 5ALOA 4G4GA 5REQB 4A0GA 4MUMA 3LRXA 5CTJA 4Y67A 5JPDA 2Z09A 4CI0B 1ABFA 2OHVA 4NP6A 2E4UA 2DFPA 1JAHA 5CDSA 3K53A 3HBAA 4ZO7A 5BYJA 4CEIB 1UJ2A 2EFGA 4BMVA 3AUKA 1ILEA 3FKSD 5CXQA 2VN8A 3B3QA 1D5WA 1NE2A 2WWTA 4KJZA 3G89A 4CRWB 3H19A 3MJVA 4JENA 1U0BB 4TTTS 5AOVA 1OLUA 2BFAA 1FLVA 2FDRA 4EHIA 3DZ8A 2OKGA 3HKBA 3M4YA 5IK2A 4BO6A 5JCZA 4H1VA 4RCYA 4WN3A 5M7EA 1QZTA 4UBIA 1VL2A 1MNQA 4BLUA 1DARA 5IC5A 1YASA 4ND1A 1ZI9A 2MR5A 1M6VA 2KM1A 4BC1A 3FRHA 4DV4B 1TQ4A 4QUAA 3W7VA 4ZJYA 4WPGA 2M98A 2BGKA 1PJAA 4HB2A 2ID7A 4L0QA 1KMNA 4ZGBA 2JGIA 3KB1A 1K9VF 4GM0A 2X1LA 1Z36A 3TB6A 5JSQA 2ZYGA 5HKKD 4TMKA 3THYA 2G36A 2VF4X 2ZKIA 2GESA 4OGGA 1DC7A 2WTEA 3LGSA 3FB1A 1MZVA 3PFIA 1IM2A 2H51A 5B4TA 1NY6A 3MT7A 1CJKC 5I47A 2ZJ8A 3Q10A 1ZCAA 1KYIA 2Q4RA 3F1KA 3MWLA 4N8SA 3DKIA 5KJEA 1L5YA 1Y3BE 2XT6A 3QXCA 4JDPA 9LDBA 4KR0A 1S8NA 1WDMA 2W90A 1I24A 2Q0HA 3NJ8A 4ZT5A 5JZSA 5KNDA 1N2JA 5TQ0A 1EWQA 1IN7A 3AF4A 1ZG3A 3CYFA 3N0TA 1SUSA 1PI3A 3MXOA 3DQPA 2A9VA 3DOJA 3SMVA 3EMDA 4WXMA 2P3SA 1GZDA 1B16A 4ZAWA 5YASA 4P3YA 5BN4B 2Q4DA 2R1TA 3QM1A 1GAWA 1X8JA 3PIRA 4GM1A 2IHJA 2J87A 4X1YA 1P8AA 3MJSA 1YZHA 3MMXA 2RG7A 3RAPR 1GAQA 3OTQA 4PVCA 1DJPA 3VH3A 4NYJQ 4PQEA 4R40A 3CSUA 1NW7A 2FK7A 3A8TA 3ZH9B 1LRLA 3L8MA 4FS3A 3B5EA 3AV3A 4ZOEA 4Q6WA 1O8CA 4UFPA 4P92A 4CV1A 1O94D 5LL6P 1T4DA 3QPWA 5GM1A 4AG3A 2Z8YA 4JMLA 3UM9A 2ZYUX 4PIPA 2AXNA 3TIFA 3AJ8A 1V1RA 3ZV7A 4CR6A 5LNK1 2D8AA 3GFRA 2PVSA 1QGYA 2XNJA 1K2WA 4JNCA 1K6IA 2HMSA 1GPMA 2VUHB 2VQDA 3FI0A 4NZPA 5CJJA 4E5KA 2UZAA 1DAKA 1TUBA 2PKRA 2XH8A 3Q72A 2O5VA 4O4LF 3UB2A 3DO8A 3P7MA 4A26A 2H92A 4BQEA 3C70A 3DMDA 1LLQA 1VB5A 3E9QA 1Y98A 3L6EA 5AVXA 3HFRA 3O0TA 3NWBA 1QK3A 1V9CA 3E9ZA 2OGZA 4N47A 4AQYB 3N2KA 3S5UA 4US1R 5JNUA 3PJDA 2BKUA 4PCUA 4AYWA 4G9BA 1KS9A 3UJ6A 2B7CA 4LYAA 3Q5GA 5HVNA 1KMCA 4R2WA 3WOVA 3BZBA 2NZWA 3VDMA 1RHUA 2QLBA 2X0FA 3I9LA 3Q3CA 3B1VA 4FFMA 4G84A 4WUVA 5DYGA 2FW0A 1DWUA 3I3OA 3A1FA 5EE9A 2XWJI 3P0JA 3WXBA 2JLQA 4ND5A 1KOLA 4CMEC 5C52B 1J39A 2VQ3A 5COQA 3GLHB 4O2BF 2YY7A 4IWYA 5E3HA 4UEKA 2IU0A 2I2AA 2ZI7A 3R74A 1IBMB 1M0WA 3K4HA 3L0BA 3MERA 4YVFA 2NVUB 5LQAA 1T9AA 4BCDA 2QAIA 4EL5A 2UVDA 1YL5A 4Y0VA 2M6KA 1IK4A 1LU9A 5GJBA 1M33A 3U44B 3LKBA 3OFJA 6GPBA 2AJLI 3KUXA 1BCSB 3CNEA 4ZGWA 3P2OA 4WHMA 4BL5A 1P2TA 3HU2A 3LQFA 4INJA 4UHJA 1C1DB 3M6AA 4DPMA 1TUIA 5KHAA 2IHZA 3HUDA 1RMQA 4AULA 3CUEF 1HTWA 1M0TA 5HKBA 4R1OA 4NHOA 4XSGA 1PL8A 3SQOA 1OB2A 1HDOA 1H0RA 4AI6A 5JJBA 2I7DA 4I9HA 4EZIA 4Z7OB 2VJMB 4JLPA 3D3EA 1F8UA 1RAIA 3FDJA 1FPMA 1BA2A 4HYQA 3C3BA 2JFYA 4AU1A 1P5ZB 5K09A 2BTEA 4BO2A 4B3IA 5FLKA 3U48A 3AHHA 4UEOA 3FVTA 5LJIA 3M1YA 4RYLA 4L7VA 2ZBRA 1G7SA 5A1JA 3W5UA 3LYHA 3P2IA 3H4TA 1BDJA 2PH3A 4M0KA 3AKCA 3OT1A 4ITRC 4JB2A 4WXPA 4F5YA 2NWQA 5IMSA 3LL4A 4BLTA 2WU8A 3ROFA 2ZR0A 4R84A 2ZP1A 1K8RA 5E4JA 4A15A 1RVDA 1V8DA 3D0OA 1K4MA 1RHMA 3LHIA 2BC9A 4CEJA 1I14A 3QBDA 2D2VA 4I1VA 5CLIA 1IATA 3WMEA 4IH9A 2H4FA 4Z86A 4AL4A 1ULTA 2P9BA 4BN5A 1AB6A 3ERCA 3OFKA 3DBOB 4PLGA 4YT4A 3T7SA 3LX5A 5EZ6B 3SC6A 4WLVA 4LXGA 3QX3A 3F46A 2GEUA 3WQRA 4YROA 1F0NA 3ONDA 5DZSA 4XM2A 5BV0A 4I5FA 1X0VA 2YJGA 4R2HA 3W6NA 3KSBC 2PE5A 3E8SA 1HYEA 2ZYIA 2PA3A 5EJMA 1ENYA 1RFLA 4FUQA 4JLVA 3CF4G 4WTOA 3VH1A 3CX6A 1C1HA 3VVCA 3WZMA 1T3ZA 4OJNA 1XRQA 3E5MA 2FRDC 3EIUA 2FPXA 3OWOA 2BBOA 3RNOA 1V8OA 4JVLA 2WFLB 1UKZA 2F43B 2Z98A 4US0R 3T4PA 2XQFA 4EGSA 3AOGA 5U4QA 1HNXB 1FW6A 4WK2B 3GZ4A 4P5DA 1I10A 5EP3A 5DKFA 3SCZA 4O0MA 3W79A 3DL7A 2B5VA 5CIWA 1YVPA 5CDFA 3IOBA 1I0ZA 3RVNA 5L3QB 1HEUA 1SHJA 2YINC 5L3SB 4MW0A 2ENWA 5E7QA 4J0HA 4ZOLF 1U0LA 1T9GS 5BO5A 1EH5A 3EPLA 2DHRA 2A7QA 4CUZA 4ZI7A 4FBLA 4UUOA 3ZS8A 4CETA 5CCXA 3IO5A 4IVNA 2ZYRA 1N8SA 4CCYA 4G23A 4QXRA 4A8JC 1HX7A 2WV9A 2G9RA 1MH9A 3EOZA 4WOPA 5JZMA 5FT9A 4FN4A 2P9QA 5D6NA 1T5DX 2VZ0A 4FR5A 3NALA 3EG5A 2DWUA 5JV5A 3EF3A 2EIHA 1GSIA 2ZJ7A 4MR7A 4EUNA 4CLRA 2QOEA 4PCLA 1U81A 4AMUA 2FZVA 2C3UA 3OJ0A 2JASA 5FX2A 4MRVA 4JHXA 3KT6A 3LQ2A 1JU9A 4BRWA 2JGLA 3EA0A 2IPXA 5LC1A 3WL3A 4EELA 2L2QA 5ALFA 4IHJF 4C7XA 2J09A 1WZ2A 1KMQA 3KZCA 2GCOB 1LSJA 5H9VA 3RYFB 4Y9DA 1ZGHA 2Q5HA 1UC5B 3IB3A 1XMPA 4RSRA 1RJWA 3T7AA 1SBNE 3ZG6A 4DXHA 1B7GO 1HSOA 1JHVA 2V4MA 2YV3A 3IPCA 3H4IA 1H3NA 4QTXA 5F33A 3LRPA 5CG2A 1XZEA 4ZFNA 4C76A 1GUAA 2YH2A 3A4NA 3CBQA 3JR7A 1BVHA 5TMDA 1AS2A 5J2UF 3NNNA 1NUQA 1YT5A 2O5RA 5B30A 3GT0A 3FHOA 2ZB8A 2PUWA 3L84A 3JZDA 2X5XA 3ROKA 1WBDA 3H5OA 3BTVA 5EKTA 1T36A 2ZI6A 1HRDA 2XHEA 3B89A 4MZXA 1I3LA 4QRIA 1X7YA 2ZBGA 2FWIA 3G1UA 1C0LA 3TOVA 4E0BA 1XMSA 4ND7A 2B9EA 4B3BA 2EDAA 3ZGZA 4QREA 3WLNA 3ZE0B 3FDIA 4MVJG 1GG5A 4RGVA 1NJ2A 3ND8A 1BCRB 1UFVA 4QQNA 3C24A 1BAPA 4TMVA 2XE4A 1BEZA 4NDNE 3LY5A 3PUKA 4H6VA 2WR8A 4EYGA 4AYTA 5LYJF 3LGAA 4MJXA 3VR3A 1RKUA 3KKEA 3UHFA 5EZ5A 3DMHA 2OB1A 1U8TA 4OYYA 1EWYA 4KQ2A 4UATA 1TIBA 2Q4EA 2QD3A 4UTZA 4CU2A 1TA4A 3AJRA 2XXAB 1ZC4A 3AR2A 2JIOA 5AI8A 4R8RA 2Y1LA 2YUTA 3R3YA 4PAOA 4KNVA 4OVKA 4V0MA 4EBFA 3H3JA 4D2IA 2HQBA 3PQFA 3P2JA 3P0FA 4Z99A 4GI1A 1KAQA 4E2FA 5KTOA 1KKUA 1V4BA 3ZBQA 2R8YA 2H3EA 3B3GA 4G36A 2G9VA 1R4AA 4Y9UA 4DA8A 3HYSA 2A9PA 3DPUA 4YHHB 2OV2A 3GEIA 3OJOA 1Z12A 3RO7A 1E6KA 3KLBA 121PA 4CKXA 1HNWB 3FZNA 3R7SA 2P6MA 5LP6F 1KY5A 1A5BB 1N2BA 3KL4A 4FFRA 4MGIR 5JROA 1KP3A 2P2ZA 3MGKA 4MYUA 1KZGB 1SVIA 3DZBA 4PPGA 2A30A 4M8NE 4CN9A 4F92B 2VDJA 3F4LA 1EDEA 2OB2A 3FPSA 1K8YB 1GCGA 1ZIXA 2D0PB 3E0QA 4DWWA 1T5BA 3IV6A 3O47A 4JJEA 5HIKA 2NU6A 4IJKA 4B4UA 4E5MA 221PA 3I30X 5DFAA 1N2CA 2RAFA 2ZAOA 5AMXA 5HOQA 1L6RA 3PNVA 5A4FS 2GKSA 3QVJA 1AO0A 1EFRA 1CJBA 3OJFA 5ER6A 1CZRA 1QH8A 3LPMA 3TVTA 4A2QA 4MPJA 3OP4A 4IQFA 4PO9A 4U3JB 5T4HA 5U1PA 4M0CA 4WBSA 4BBPA 4C0LA 1BWSA 3T99A 5AI5A 3ZV4A 1ZN2A 4IDDA 3CGWA 2X13A 3A31A 3FUVA 4OL9A 1NVKA 4HNTA 3FHJA 1CUCA 3ZV5A 2O7NA 5ITSA 5KX5B 3E8MA 1CY0A 2JKVA 2LXNA 3HYTA 5LIPA 1I4LD 2XEDA 2VDLB 2CDBA 4TXHA 5BWNA 3OTOB 3O3CA 4HO1X 1YZQA 3DC2A 1DZ3A 2XNKA 4LKOA 1NW5A 1DI0A 1ZBDA 2HF8A 4J1TA 3CZRA 5GONA 1YL6A 4C22A 3PNKA 1SQGA 1GEEA 1E2MA 3OE5A 4HBZA 2WILA 4P82A 4F5WA 1DG1G 2FPWA 3KLNA 4JOCA 2PH5A 3MGCA 1U5BB 3IR7A 1AXEA 5DRTA 3TAHA 3IEVA 2DAPA 1N6IA 5CLHA 3N3AC 4FMCF 4QNRA 2GJ8A 3KM0A 4J2HA 3TO5A 1I5OA 2UXDB 2HJHA 4NENB 1L4HA 3F1LA 3DVAA 1OT5A 3HCCA 3UXHA 1ZNZA 5CXXA 2GI4A 1KOJA 4R68A 1P4RA 4BMDA 3D2BA 1FQOA 1U3DA 3BRCA 1DPFA 2X0EA 4B73A 5ELXA 5EZSA 4GL2A 5L51A 3CE9A 4P4GA 4B75A 5A04A 2YOHA 3I8OA 3HSKA 3D81A 1JX6A 4HUQA 1T4CA 8ATCA 3KJXA 1VB3A 3I1IA 5GM2A 3S8YA 2WWYA 1B8PA 5AHWA 3OU6A 1Z63A 2CDRA 1GN9A 5JLJA 3CX8A 4CF6A 3EVEA 1XBTA 1MJ5A 1N9KA 3GJ4A 4JFRA 4RLHA 5IXJA 1ZICA 1JHOA 3LF1A 4G5SA 4NZNA 1ETUA 1L1RA 4WQMA 3H5IA 3IX7A 4G4IA 2C96A 4EB3A 4L3WA 3T95A 2WTMA 5CX4A 1C4WA 3MINA 4BLWA 2VNSA 3HCBA 4U7FA 3MCVA 1JDTA 3HJRA 4PQYA 1OH8A 5LD2B 3E5NA 1FPQA 3M5DA 3C6QA 4NKRA 4FFPA 3ROEA 3VOTA 4A16A 2OC9A 3E15A 2XF8A 2NUPA 3I32A 5IDXA 4ZTZB 4AZ0A 2A1UA 4LXHA 2ONZA 2EX1A 3GWGA 1E9VA 3L6OO 3OZAA 3DA8A 3C4VA 2XMZA 4DDVA 5M2QA 5C7OO 4BEVA 4WADA 5EMJA 4LW8A 1TTHA 3QKSB 5G3ZA 3T1TA 2REQA 3HDYA 1A5ZA 3I9JA 5JDCC 3O75A 2QI9C 1KWKA 2QM7A 3U9LA 1DQRA 3BMQA 4C9BA 1XFAA 2XTMA 1I2AA 3L8YA 1VRCA 2PD4A 4G8BA 2Z6UA 1XX6A 2H9IA 1RZ3A 3L3BA 2J5RA 3MXTA 5I7RA 4BNIA 2P8JA 2Z5GA 1NJ6A 2QD2A 4LHSA 1ZJ4A 2VUSA 1R15A 4RJ2A 2CSXA 1UWVA 2G17A 2GX6A 3E81A 3AXSA 3IHTA 1I7QB 1OC4A 1V8ZA 1T8TA 1KDOA 1H85A 3HWWA 4RD2A 1S2NA 2FQWA 1N6PA 3RTBA 5BWCA 3M49A 3KDAA 1RE1A 1D2AA 4JVOA 1CRPA 2EOAA 1BKSB 1WMSA 1AOXA 1KK3A 3E9NA 3UQZA 2HMTA 4DV5B 2VFAA 1TFUA 3FCEA 4QOFA 1JFFB 3LHFA 3BHMA 2EFDB 1E96A 4O5AA 1NI4A 3AQ4A 1K88A 1II8A 1P2DA 4LVOA 2E1RA 4KE8A 4XR4A 3U62A 2PTHA 3PQ7A 1F6BA 3N5CA 4KN6A 1C4OA 3R76A 4AAYA 1I7SB 2E5FA 3ODPA 1U3FA 4KN9S 2O8EA 3HXOA 1XP5A 3L7OA 4ZVRA 4UVIA 1U02A 4QYTA 4UNPA 4EHLA 1EI9A 4CDMA 3JXEA 4KFRA 1Y33E 2V7XA 3ETNA 2WY2D 2O06A 3U7HB 4TLLB 2M1ZA 4XVUA 4DJFC 1RZUA 1K63A 3IV9A 3QMWA 4ZOBA 1EUCA 4LYYA 5C35A 1F48A 3CN7A 1JKXA 3T7CA 1LI7A 2NM0A 3NT4A 4HDAA 2QJRA 2PLAA 1SKYB 2R7KA 4A10A 3D6TB 2RGUA 3LQKA 1WL8A 4NFSA 3QH4A 3TQOA 1RT9A 2RHDA 7ADHA 1ZK2A 2O2SA 4MIEA 3VBCA 5JOQA 3UC5A 4O8ZA 4FGUA 3TR6A 1YD7A 2IY9A 1DQYA 1Y0BA 3EGVA 3M3HA 1R12A 3I76A 3I5XA 1A27A 1NVEA 2CLFB 2P9CA 2OAGA 3TBHA 4AZ3B 3GDOA 3C3JA 3S3TA 3FVQA 2PMEA 1CY8A 2GLUA 1RYZA 1I1OA 4PFKA 1ZN8A 1YOVA 4PO8A 4IM7A 4DTIA 4E94A 1JXAA 1KQ3A 2OCAA 4ZIRB 3OQMA 5IH3A 2Y77A 3GRYA 1EVLA 4DLXA 3KL2A 1W96A 4K9QA 3QE3A 1VG8A 2H16A 3B70A 1LS6A 1WMDA 3HNPA 2Z8XA 5C81A 3H9BA 2HQSA 2XKKA 4N3GA 1NIJA 1JLLA 4E70A 4WLOA 2XCIA 1PFYA 1EG2A 2BT4A 3S68A 2VDOB 5B37A 4BIIA 3PU6A 3ZXXA 3THWB 2ZXEA 1PBTA 1B2RA 1QUEA 3ZGOA 1K66A 3DEHA 2Q3CA 2ON6A 3MUOA 1WSDA 1OLSA 1XO1A 3EIXA 2A7XA 3T3GA 2GRUA 2P41A 3HWRA 4HYYA 3NWJA 1WZUA 1G21B 2CN1A 5DHSA 5DVZA 2OENG 3ADDA 1CUBA 2CXXA 4YCSA 3B7WA 4NJMB 1K8ZB 1LDNA 3A1TA 5LOVA 3MWDB 3W2HA 4UULA 5LXTB 2IOYA 4NI5A 1K08A 4P31A 1EBFA 1H5UA 1PQYA 4RA9B 3U1VA 5JCPA 5JI2E 1R0RE 1LWOA 2ATEA 2QMZA 4A8HA 2LIVA 3R1IA 1CU1A 5JADA 5BYAA 3BGWA 2PK3A 3UWPA 1MOZA 2Y27A 5KPJA 5HR5A 1X92A 3JQ9A 3HUEA 3N8KA 2CYAA 2PFSA 1QB8A 3QKIA 3UBTA 2J8ZA 1LBHA 3JRWA 5F9MA 2PAAA 2PPVA 4D98A 4XASA 1AZTA 1HM5A 2AD1A 4F46A 3BH6A 1QBKC 1ELOA 4FEGA 1UXGA 4PHCA 3ZUGA 1JHDA 1ZH0A 4DCUA 4M86A 4YRRA 1MW9X 4MINA 2XQKA 2X1VA 4EUEA 1Z28A 2G3YA 4M7RA 4Z51A 3D8UA 4I5IA 2H0RA 1T2VA 2O8VA 2XOEA 3K70B 3CLHA 1E3EA 4BE7B 2YNMC 3LSTA 1VZ2A 2IZZA 3HJCA 4I6EA 5BOVA 5LQMA 3CWZA 4H2DA 2HRZA 4J7UA 3WRXC 5FTLA 1HEIA 3I39X 3STUA 4U7TB 1KERA 4HUQB 4LF6B 4CF7A 3CR7A 3QKRB 1Z5UA 3OBBA 3LK7A 4Z4IA 1H8ED 1I36A 3PNMA 1J06A 4DAOA 3NHPA 3PICA 4TRMA 2E5LB 1NC1A 1UL1X 3O94A 1JQDA 2QG6A 4WOBA 2WD9A 4FD2A 4TKLA 3FYUC 5FUXA 1N2CE 1T8WA 3SNHA 3UMMA 3Q87B 4FIZA 4JFAA 2VTBA 2ZREA 4ZMSA 3I34X 3F78A 3KFLA 2CL6X 1FTQA 2ZSEA 2NZVG 3ETJA 4YNBA 3HVUA 3HV0A 4DJEC 4X62B 3QFSA 4BYMA 1QVWA 3C41J 4MS4A 2F64A 4L28A 3X1DA 2I3DA 2SECE 3B36A 1TU0A 1MC4A 2OESA 4M7PA 3WP0A 5ER9A 1PEAA 1GP2A 3D8HA 1B0ZA 4BBAA 3QVOA 4BNWA 5IG2A 2C2MA 3X1JA 1SQ5A 4K6GA 3W6ZA 2V8OA 1L4UA 3FWNA 4OHYA 3NP7A 2ODQA 4KI0A 3CEMA 4G1CA 4Q18A 4EITA 3OM8A 4EABA 5EE3A 5ERXA 3PB3A 2A9OA 2XXBA 5L7YA 3TPCA 1Z0IA 2CVPA 3D4IA 1JPVA 3I12A 1SK8A 4UCFA 3TXYA 3GT7A 5K4GA 4AJ9A 1J2JA 4FGZA 4NZMA 4B3GA 1PVDA 1L9KA 1YBMA 1ZNWA 2BWJA 4B9EA 1TK9A 3S1SA 3A10A 4Q05A 3R9XA 4UEWA 5F78A 2FLWA 3ER9A 4KLZA 4NDZA 4EGQA 2P35A 3LRTA 2X86A 4JJGA 4Z9XA 3VPFA 1DWPA 1YRYE 4CR8A 1X7HA 2PG3A 2IHNA 4LWQA 2QZSA 4WGGA 3GJTA 1Q74A 1J5XA 4XE5A 2XECA 4MHTA 2OCDA 3BGSA 3ND5A 3VU0A 1G6Q1 2YY5A 3HCOA 4Y2PA 1J8MF 1JEQA 1NW4A 5JY6A 5FHQA 3HP7A 1E20A 2BFNA 4MR8B 3NDIA 3K35A 3N2YA 3TOSA 1FA9A 1WZEA 4GL4A 1IUKA 2ZYWX 4NZYA 1MD9A 4C89A 1PJBA 2BFBB 1C1XB 4Q02A 1GFSA 2O8NA 2DPHA 4IS2A 3ZV6A 5LMZA 3HPQA 4BP9A 3UJ7A 1WNFA 2OG2A 3F5SA 2I8CA 4KIGA 2I3AA 1SXJB 3CRVA 4NMWA 1GQ2A 1PQPA 1XL1A 4NNJA 1NHGA 3R5KA 4IBOA 4DA7A 4L27A 2A67A 1U3TA 1WHTA 3URMA 5TVGA 3PK0A 2XLCA 3JRXA 1Z4MA 4QFBA 4X7BA 3TNFA 5TIIA 3EZLA 2CE2X 5K8LA 3P9QA 3HA2A 4EF5A 1Z74A 2X41A 4UXHA 1I01A 1USKA 2B25A 1RM0A 2CNNA 3CLRD 4H59A 4X24A 3SX0A 2P9ZA 1N0HA 2VP5A 1PFGA 2IHBA 4F6LA 4QKQA 4KXYA 1F0KA 3GDWA 3IDQA 2FQYA 2XBUA 2FVYA 3K2BA 4Q3KA 4GP9A 3SS7X 4CIYA 2R96A 3IE0A 3R5HA 1KGSA 5E2AA 3VHLB 1BMTA 1U6KA 2ATIA 4Q82A 4AMVA 4A2WA 5HYVA 2BKVA 4D3ZA 3VU8A 3T5AA 3OCJA 3AB7A 3HA5A 1XQ9A 2OGUA 3I6ZA 2IYZA 1NT2A 2PGLA 3PL1A 4KH0A 5GJCA 2B6HA 5I7OA 3H9CA 3COSA 4V3CA 4A1FA 4BO3A 2Z9DA 2CXPA 3BWDD 2KYRA 3W8RA 1YDGA 5CFQA 4O2AF 1D09A 1E1LA 3F5FA 4UU1A 3SE7A 4DR1B 1E64A 2QM0A 2BPOA 3L0SA 4I1OA 2XDQB 2XRMA 2GM3A 3HMQA 2PWBA 2X0KA 4Q1BA 4RMJA 4RLQA 5F1KA 3WQHA 3HN2A 1X1QA 4TSKA 2ALJA 1F9AA 4NNOA 3PPIA 2H3HA 2ZJ1A 1SBYA 2X1HA 4TXNA 1CJCA 4AO6A 5B6IA 1AY0A 3JQBA 4KWIA 5D3MB 4MLZA 1I33A 2G1UA 4F56A 4NAHA 4CM4A 1JWBB 2Q46A 2V7EA 1E5QA 2BVNA 3M6VA 4CMAA 2Y0EA 2X4LA 3IAM6 3LC1O 4HH3C 1IJEA 1QOZA 1F38A 1G8FA 1QZUA 3E05A 4GT1A 2VRNA 4HAYA 3KYCA 5BMOA 7MHTA 5E1MA 3ZD6A 3PS9A 5CB4F 3GMTA 1NDQA 2Y1KA 1YONA 4WZBE 5SY6A 4R7ZA 1XVAA 2OV1A 2PA0A 5L8VA 1J23A 5CPFA 5ECWA 1CUJA 2IHVA 4IXWA 4DJDC 1WY5A 1GHTA 1QMPA 3ZD9A 1PJTA 5GV7A 1R0SA 2QLNA 4OHUA 4W7HA 3CLSD 1W29A 4L50A 5TS3A 7YASA 4M0PA 1M0EA 3AOEA 4XQ9A 3S2GA 1HLGA 3B1FA 2ADMA 1IOVA 1ZH4A 2VPPA 1ZO8A 2ZBVA 5KOYA 2AMVA 3L1KA 1YQXA 2H5EA 3LDFA 1QHFA 2GKGA 1KYTA 1TXGA 5TPWA 1VL5A 1R6XA 2ZU0C 2Y1GA 3PA6A 3W3AA 3LDUA 2GUWA 1PV4A 1LA2A 4HNGA 4E11A 4PYIA 5J5AA 3ZHZA 3GLHA 1ICEA 3WLTA 1FEZA 5G4KA 2HADA 3O2QB 3MRSA 4FYYA 2VJBA 4II2A 4PRYA 2P69A 2O2DA 3CUUA 4IDCA 3TLEA 5J2TB 4XCXA 1IOZA 4XGRA 3ZDZB 5I7HA 5KCMA 1O0BA 2QL7A 4G5QA 3T9DA 3W8DA 1KSJA 4IQ4A 4FE7A 2PAFA 4IV0A 1KDZA 3NEJA 4I19A 5G41A 2IS6A 2PS9A 3SSOA 1IULA 4X41A 3LV8A 1B23P 3FYUA 3WBFA 2V9PA 1J25A 4IJQA 3VTAA 1TLLA 3U81A 3NDBB 1FFGA 4P7BA 5KAPA 3FPKA 2CW5A 5AUQA 1PL6A 4KIFA 1KU0A 3RVQA 5A03A 5FYDA 3ZU3A 2A5GA 2EFEB 2VJDA 2X8WA 1KHTA 3BF8A 3GB9A 4FKZA 1ZK4A 1LS1A 4QYXA 5DTJA 3T15A 1G0NA 5A05A 4YAGA 5IT4A 5KX5F 2WHXA 2GBIA 1BE6A 1AGNA 1COZA 1I94B 3WA6A 2P65A 4OAOA 2A5LA 4I6JA 4IQ0A 1OU4A 2HO5A 1TF5A 2FWJA 2J5XA 5FNVA 5JWOA 1OB5A 1DTWA 2PGOA 2OFPA 1QYWA 2W4IA 3FHTA 4HMQA 1G2OA 3SJZA 3VKHA 2NXEA 4O4LB 2IZ5A 4N48A 1IOWA 1ECLA 2Q3LA 2RIRA 3QUTA 2YZ7A 3WGTA 4UTPA 2MHCA 3LG2A 4MUKA 1TEZA 1Q2UA 4UUQA 4FOPA 1EHCA 4UOQA 2XMSA 2XGGA 1SG9A 1QFJA 2O7VA 1U90A 1ZU5A 3HXKA 3QA3E 1ICIA 4LOHA 4OEHA 3W1VA 1C9YA 5ERYA 4EY7A 2HJ9A 1PTKA 3HB4X 3IQFA 2NZXA 1OI4A 2KLHA 3DP7A 1QHHB 1MAHA 1ZD8A 2ZRBA 3OZIA 4INZA 4DDHA 1X7XA 2F62A 1O87A 1FXWF 1KJIA 2Q6LA 3OPQA 3ZH2A 5EIFA 1QVVA 1JEEA 3EWNA 1R6UA 1L5SA 1OHHD 2DR3A 2ZDQA 1SY7A 2WOOA 5CT8A 4TYMA 1ONOA 4RDHA 3VI4B 5K0EA 4MRRA 5KUTA 1TJ4A 2XUPA 4L2IB 3TL2A 1SZCA 3V4RA 2R5NA 3OZVA