1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
3TKLA 2AD1A 4OYHA 5KUTA 3GJ3A 4L4UA 1FP7A 4LV5B 1ZD1A 1QHGA 4XD7A 3Q7PA 2WJVA 1I4DD 3SHFA 2J41A 1E2JA 3MJRA 3ND9A 3X1DA 4GZLA 4C0BA 1KZ7B 3DPUA 4UKDA 2WWXA 4I1OA 5CB6A 3UXMA 3KB1A 4IW3B 4R9UC 3JVUA 1P9NA 4Z1MA 2Z43A 3B1VA 1ESNA 5DHFA 2FGKA 2C99A 2QT0A 4LDJA 3TNFA 2FSGA 4JBWA 1CR2A 5EP4A 5KDLA 2ODNA 4FMDB 3AVXA 4A2QA 3TQFA 2JIZA 4CRWB 2QUZA 5DLQC 1N2CE 3CR8A 3K0AB 1E32A 4A82A 1KO7A 4HUTA 5JRJA 2OG2A 3SYLA 1AIPA 2G83A 1CIPA 1XPOA 4EPYA 1E4VA 2L0XA 4DSUA 2GBLC 5FI1B 1V43A 4KSCA 3NTUA 1LB1B 3OIYA 1E69A 3HR7A 5EZ6B 1F5NA 2FN4A 4DCTA 1FX0B 2VHUA 1N6RA 4BLRA 4DWJA 3GD7A 2EFEB 3SHWA 2VTKA 1GL7A 3QXSA 3OE7A 3W3ZB 3EC2A 4LV8B 2BKEA 5JEEA 5HCIA 1U2RA 2IX3A 2F1JA 2OBNA 4DDWA 4RZ2A 2QT1A 3MGCA 1S1MA 1SVLA 4LJYA 1IY2A 3QPVA 4YDSA 1YR9A 4GI7A 4MUBA 4BLTA 1SHKA 3K70B 4OQNA 1NIJA 1R0XA 2J45A 1MV5A 2GEVA 3FGNA 1K6MA 4P4UA 3A8TA 3BERA 4OQFA 3RC3A 5L3QB 4EJSB 1KI9A 4NKRA 2IS4A 2ODBA 1TU4A 2REBA 1EWQA 3MLEA 5AJYA 5AK0A 3PITA 4PSAA 1U8YA 5BN3A 1SQ5A 2MSEB 4LHZA 621PA 4W9MC 1Z0FA 1A2KC 3MCAA 2ZJ5A 2FPMA 1COWA 1DARA 2QSZA 1ZCBA 2V1UA 2AXNA 2KBEA 4RD6A 1AGRA 4A8JA 4G5RA 2LKDA 4Q00A 4KODA 1Z0DA 1W2HA 4GZMA 1CJVC 5AJXA 3HU1A 4XSHA 3TW8B 1E2LA 1N6PA 3O47A 2VP2A 3IO5A 3AKDA 4P32A 2W2XA 1JI0A 1VKJA 3L0SA 4PZLA 5HKKD 2NOAA 1XEXB 2AL7A 2PL3A 3M4YA 2R6CA 2GETA 1XF9A 1QG2A 1PUJA 4TYQA 2C2HA 1M74A 5FPHA 4BZXA 5JI3E 1SVIA 3HPRA 5CIWA 2CLDX 3ZQJA 2Z4RA 4P31A 4F92B 5JS7A 2F1HA 1EESA 5FL7D 3GLFE 4PC7A 3CZQA 2D3WA 1N0UA 3X1XA 1F6BA 3EZ7A 2E9SA 4LSGA 3CF0A 3KUCA 4MYHA 2QGZA 1K5GA 3GLFA 4DLZA 4D0GA 1KO4A 1OHHA 3GJXC 1Q57A 4BFXA 1UKYA 2G88A 1QHNA 4GFDA 3WRXC 1OH8A 1YE8A 2D06A 1SKYE 3DEFA 2H57A 1OYYA 2Q9AA 3TJZA 2OCPA 4FCVA 4RCZA 3R8FA 4XWKA 3WXMA 2J7PD 3RS2A 2CE7A 2J1LA 3QKSA 4ON9A 4NU0A 1KI1A 1W2GA 1P73A 3SJAA 2IYWA 3BOSA 3SFVA 4ZI2A 1W7AA 3B1ZA 3LH5A 2XGJA 2ONKA 3CR7A 2IF2A 3FHTA 3DMNA 2J9RA 3F0TA 3N2EA 4ZIRB 1S96A 3B7GA 5EE5B 2EFCB 3ZZUA 1FZQA 3M1IA 1XWIA 4IOJA 3SJCA 2O8CA 1WMSA 1KI4A 4TT3D 1A5TA 1XJCA 1DAFA 4RD4A 3U3RA 2GZAA 2ONJA 4DIEA 4JLOA 2R2AA 4A9AA 4A4DA 1XEWY 4ARZA 3FOZA 2W58A 5J4HA 4Q18A 1XCMA 3WRYC 1SZPA 1S0UA 4XVRA 5BYKA 1W48A 4AKIA 4A0HA 4PQYA 1KY2A 1ZNZA 4KBFA 2C96A 3H86A 1VYTA 1CJMA 1Z28A 4WAUA 5F3WB 1GKUB 3LBNA 2GZHA 4WVFA 3RS0A 1FNMA 3GLIE 3GEIA 1D2MA 1L4YA 1P75A 3EC1A 3MAAC 4QL3A 2GXAA 4YXWD 4HYYA 4IJMA 3TVTA 5J4LA 1EGAA 4FWTA 5JWRA 1G5TA 1Z0JA 4G5QA 5DISB 4C7OB 3GLIA 2C78A 2IK8A 4HATA 3O8CA 4PPFA 1HT2E 2IEYA 4LPKA 4G1UC 3KXKA 2OLKA 1S4QA 4AY2A 4Q01A 2HJVA 3ZQ6A 2QM8A 1YZLA 3E5HA 3PR1A 5EP3A 4G5OA 3KTAA 1ZNYA 4A2PA 5TDHA 2MSCB 1M7BA 1IXZA 2F43A 4B3DA 2D4HA 1P62B 4OHXA 1RRPA 1GNQA 5JRZA 3GQBA 3ND8A 1PV4A 1KDRA 5HTKA 1FTNA 2BV3A 4HLDA 2W6JD 3IIJA 4NYJR 3NC0C 4URZR 2PEYA 1NSFA 1FW6A 5A0FA 4E09A 3K0FA 3T5DA 2IHBA 1CS4C 3K09C 1P9RA 3QENA 4HAUA 3B2EA 3QKRA 4L8GA 4PC1A 3SU8A 5E3HA 2JAQA 4JLBA 3RVBA 1VYUA 5G40A 3BH0A 1S8FA 2G3YA 1VHTA 4CW7A 2XTZA 1JR6A 2AXPA 2Q21A 4NTZA 1DS6A 521PA 4BZPA 1D9XA 5HE9A 1CXZA 2ZVPX 1VMAA 2FPLA 2ZI7A 3HYTA 3RWOA 2HXSA 2ZUDA 2FEMA 3EAQA 4KV9A 4PC6A 1A1VA 2ZRIA 1HA3A 3FDIA 4FMDF 4XH9B 4TL8A 2AHOA 3UMRA 4ZDJA 2G77B 1KSHA 4MYUA 1U8AA 4TSFA 3PJRA 3TR5A 4B6FA 5F98A 1M7HA 2HT1A 4IDOA 1OXUA 1DAHA 1NF3A 2WSSA 3H84A 4PAOA 5E7IA 4QJ3A 3WMEA 2WWHA 1OB2A 3BB3A 4RKEA 1UEJA 4NCNA 5KTYA 1MO4A 4JLPA 1TAGA 5CJPA 5KYKA 1UM8A 1QHSA 1ZU5A 4IXMA 4JVSB 2OE2A 2XZLA 2ZYTX 4QM7A 3LW8A 1R0YA 3LRPA 1MH1A 2ECKA 1OPXA 3VR4A 4QFMA 4W5HA 4DLWA 2J87A 3V4RA 1BYIA 2BMFA 4IXNA 3P32A 4C0SA 2YWHA 2A3RA 3C5HA 3DZ8A 1UFQA 2VSOA 5FBVB 2ZRHA 1CR4A 2OBLA 5HE8A 3FPAA 5AUQA 4IHQA 5J4YA 1RW4A 4RFSA 1KK3A 2VSXA 1IN5A 1ZU4A 5FTMA 4JLNA 1JAIA 2CNWA 2IYYA 2BKUA 4LGMA 4A8JB 4LI0A 3CRQA 2FX3A 2IUUA 4V0KA 1NLZA 4KFRA 3AKCA 3H4MA 2ZJOA 2ZR9A 2JJ1A 2DY1A 3IGFA 5FR1A 4JKIA 4YXWA 2OILA 4Q5IA 5TMPA 1WE2A 2WOJA 1KNQA 4HUQA 1YR7A 2GK7A 4QHSA 1QHIA 3N70A 3OEHA 2DWOA 2OLJA 1YHNA 2GTPA 2ZAOA 2VH5R 4LYFA 4URWR 1GM5A 2D74A 1XJQA 3TRFA 2JLZA 1VECA 1G8YA 2RGNC 1RE0A 4DUGD 3OAAA 4PPGA 1NBMA 2WOOA 1NMXA 3HPQA 3SZRA 1KDPA 3P4YA 1OFUX 3IQXA 3QXXA 5JCZA 3O8RA 5FTKA 2C98A 1FL9A 2OESA 3IIKA 1NN0A 3CNOA 5K8UA 1Q21A 4IDHA 1KYIA 1W46A 1XEFA 2IHYA 2IUSA 2BOVA 3LX8A 1XXHE 4FW9A 5DN6A 1KJYA 1DOAA 1ZP6A 2QQEA 1G3MA 2OCYC 3NH9A 2XSZD 4QHYA 4GOKA 4B35A 4F4CA 4X8LA 2Z5FA 4GRAA 2P65A 3CRVA 1Z08A 4I81A 3TLXA 1XXHA 4AWXA 1JPJA 2I1QA 4TL6A 1G1MA 1Z3IX 1GDDA 3PIRA 2CHGA 3NBYC 4EFMA 5C46F 1ZUHA 2EQBA 1N5KA 2NPFA 1RYHA 1XTIA 2EVWX 4CEIA 4LBWA 1HE1C 2N42A 1NN3A 1ZINA 2WIAA 1DAKA 3W5IA 4OI2A 1NP6A 2R65A 3QKSB 4LJ4A 5EE1A 4DLSA 4MDFA 4ZCMA 5SZKB 2D7DA 5KPDA 5IK2A 1OFTA 5IDVA 3KFXA 3PEVA 4DCNA 4YMVA 2JDIA 4B44A 1R7RA 3QBTA 1GSIA 3LQRA 4HAVA 2VHCA 4M4SA 1IHUA 1Z0KA 2CVHA 5LBIA 5JFGA 2ZAMA 2YC2C 1TEXA 1VG1A 4A6XA 1AJEA 1OXSC 1DAIA 4LJ5A 1X3SA 2HYDA 4LOAA 5DO9A 3FWYA 5A5GA 2O8CB 1EFRA 2XNDA 2VBCA 2CVFA 3QXJA 4TLDA 1G6OA 3A1WA 3K0AA 4S35A 4GOJA 2EFHB 3TAUA 4ZDKA 4ZO4A 4LPSA 4TWZA 4DCUA 1CTQA 1F3OA 3SOPA 4MRVA 1E1QD 4ARZB 2WJJA 3UK6A 5KOYA 4Q9IA 1OKKA 3REGA 4X8HA 1BOFA 4L9WA 4D4MA 1OW3B 1AZSC 1Z0IA 1FX0A 4U7DA 2BEJA 4Q03A 4MRSA 4TQAA 1PUIA 4F4IA 2PZGA 3VR1A 2CMKA 3U60B 3AVYA 3RHFA 1G7SA 5JHGB 3W8RA 4EPWA 2WVJA 2DYKA 3KFVA 2PJZA 5C4MA 4HLQB 2RGAA 3QG1A 2BJWA 2GF0A 5JEDA 1FQKA 1NVUQ 4HZIA 4Q9LA 2WKQA 1GRNA 2R9VA 1G8FA 2EW1A 2V3CC 4KITB 4CEJB 4A6PA 3TSWA 2C95A 2ZEJA 2ZRPA 3B6EA 3BFVA 4YC7A 4PAMA 5BN5A 4L9SA 1E9SA 5L3QA 3EIEA 1FNNA 4EJSA 1EFUA 4UXJA 5K8IA 2JJ8A 3G0HA 3ZZTA 4ZI3A 1VG9B 1CP2A 2W6ID 4M1OA 4NYJQ 1KDTA 2GEUA 2REXB 4TYYA 4H1UA 3CKLA 4AYTA 4KSBA 5TB5A 1U98A 2IYQA 1OB5A 2Q3FA 4DDTA 2CK3A 4KLNA 3BORA 3TVDA 5DE3A 2EWWA 4DUGA 3U5ZB 4KAXA 2OHFA 3DOFA 3THOA 2HF9A 2HXYA 1ETUA 3A58B 2ZIAA 1ZAKA 2GA8A 2B92A 3QKRB 2OFXA 1XFAA 3RDPA 3KQKA 3AGQA 4CT5A 4IDPA 1XJ0A 3VMFA 5C18A 4LJ8A 4LYJA 4B3FX 1CRQA 2FSIA 4TMVA 4IOMA 4D4KA 3EZFA 4FMBB 3RWMB 1NJFA 3HU3A 1GZSA 3X1ZA 3PUXA 1E2NA 3PEWA 2IYUA 2ZVQX 4DJTA 3TUJC 4US0R 3WHLA 2WV9A 3R8CA 2HLDD 4ZCLA 3JZMA 2WJYA 2ZXUA 2QBYB 4OJQA 1YZKA 2ZE7A 4JL6A 3BB4A 2WWGA 3MWJA 4BFWA 2XZPA 2Q0HA 3ZD6A 2IUTA 5H70A 4AG5A 5EP2A 1XCGB 1Z5ZA 1XTKA 4P4TA 4EQ6B 2YOGA 3UG6A 2VSFA 1ZM4A 3A6PC 4PHFA 1YZTA 3EASA 3ZDQA 2Q9BA 4JLVA 3P4XA 5JS8A 1KGDA 3VR3A 5C4GB 2RGDA 4I1UA 1VIAA 2GF9A 4DCVA 5KNBA 2QTHA 3T61A 5TARA 3CRW1 4DDVA 3JVVA 5KSZA 3GEHA 3I8SA 1PZNA 1B23P 4TTRA 1F48A 3H2YA 1GWNA 4P4SA 1TNDA 1U90A 1E9BA 1XDBA 2WMOB 2PBRA 2HT6A 3GJ0A 1DAMA 3VAAA 4BE7B 2ZRJA 2GAOA 2RKOA 2YOHA 3SEAA 5FOWA 4E5UA 5FFMA 3RS5A 4AC9A 4ZIRA 4ZKDA 1FUUA 4Y0AA 2BBWA 3VKHA 3CH5A 2QG6A 3TIFA 1E2FA 1WQ1R 2X1VA 1H8EA 4ZDWA 3U44A 4Q4JB 1TADA 4MGYR 4D82A 2P3SA 1P7CA 1Q12A 4FN5A 1Q1BA 1QHYA 3LLMA 4QG7A 2OAP1 2AFIE 2GBLA 4IDNA 3WMFA 1LY1A 1HT1E 2ZYWX 3GFTA 4DSTA 1CLUA 2F1RA 4TL9A 2NZ8A 1OJLA 3QOFA 1TTTA 2Z6VA 4C0AC 3P26A 3HWSA 2QU8A 2XJ4A 4XSGA 1NI3A 4RCYA 1E2MA 3ASYA 1GRQA 4BZQA 4C0LA 2DWPA 4PQFA 3TH5A 4AD8A 1XEWX 5M04A 1OT3A 2CXXA 4LBVA 3GFPA 4HAWA 3BC1A 4HB4A 1G19A 3EXAA 3LVRE 2XB2A 1FUKA 1KSFX 4Q66C 4C7OA 3G82C 1LTQA 3L82B 3A4NA 2A78A 3DZDA 4B48A 3U3KA 3ZLJA 4C30A 3C7KA 1II8B 1W4AA 2WMNB 1D8TA 1XU4A 2IYRA 3EZ2A 4H1VA 4KJZA 1X8LA 4TTPA 4U02A 1D9ZA 1KK1A 3QIAA 5EE0A 2GAAA 1ZM7A 3QG5A 2OAQ1 4M9ZA 4BASA 3CONA 1M34E 4B34A 3KQNA 3FTQA 4CEIB 1NJGA 2O0KA 4ASUA 3GJ7A 2OV2A 2X77A 1PVOA 1N6KA 4AKGA 4KFUA 1MRNA 3SR0A 3CLVA 2C03A 3EPJA 4DRZA 4Q21A 5CK5A 4BQSA 1XB2A 4C0JA 3L2OB 3QNUA 3T12A 2BM0A 3ZVNA 2NMVA 3FKSA 4DLYA 1IN4A 3A37A 1QZXA 2ZU0C 1BH2A 4QBFA 2YKGA 1MOZA 1VTKA 1O87A 1LNZA 1G3QA 3A1TA 4WZAE 2IYTA 4CT4B 1JALA 4D25A 2AX4A 1ONBA 3EPHA 3EPKA 3QVUA 2HF8A 2QP4A 1UBEA 2HJGA 2WAYA 1H8HA 1QRAA 3ONWA 4QXAA 5KPJA 1T6NA 3AVVA 1GOTA 2O52A 1JR3E 4RY2A 5GJBA 3IEVA 3IPYA 1ZMXA 1XTRA 4JBXA 1G4UR 1EK0A 1AKEA 2QNRA 4GSYA 4EDHA 4B71A 1U94A 4V03A 3UWKA 1N6HA 2FU5C 1JR3A 1ZIOA 3BBPA 1RRCA 3ETLA 4O3MA 2AK2A 4NCJA 2W0SA 3UIEA 4HB3A 1TUEA 3BRWD 4RD3A 1DG1G 3E2IA 2WPDD 2GVDC 4LV6A 4MGIR 5HCNA 1EFHA 4F91B 3IQWA 1KKLA 1ZVQA 5JWOA 1HY3A 1RJ9B 4ESHA 1TF5A 1FP6A 2VF8A 3W8NA 1Z47A 4KO8A 2R6GA 3KDSE 4PFSA 1E2GA 4BECA 4MA4A 3SQWA 1X8KA 4F93B 1R2QA 1E2EA 3GLHB 4PC2A 1B0UA 5FPYA 5CITA 3CPHA 3B8HA 3QEJA 1IN7A 4ZPXA 1KK0A 1XD2B 4Q1DA 2ODWA 2GJKA 3C8UA 4XVUA 2QRZA 2KSQA 1NVXQ 2QAJA 2QROA 1BO6A 2REOA 2BIFA 3QF4B 5SZJA 4JVMA 2PZEA 3QPWA 4LYHA 2AD5A 5AUNB 1RRFA 1YVDA 1HQYE 3VQTA 1CBUA 3K8YA 1IN8A 4LHWA 2GDJA 3BWDD 5TY0A 4Q7JB 1E0AA 2CLCX 1DAEA 4FXPA 2P67A 1AK2A 1JAHA 5KSOA 4J0QA 4LHYA 2JLUA 4IEEA 3AF0A 3NH6A 2PMDA 2ZSAA 4K81B 2V8OA 3RS3A 4DB2A 3UANA 3I5XA 1AGPA 4PO1A 5DYIA 4DDUA 2JJ2D 4JYBA 5CM8B 2AWOA 3WBKA 3I61A 4U5XA 2XOKD 1P5ZB 3UWOA 5GVSA 1ZCAA 3F3YA 4B47A 5GJVC 3I4LA 1EFTA 1OXTA 1W0KD 2VO1A 2WWIA 3PG5A 3ZS8A 1TX4B 4QC2A 5FOSA 3S1AA 4C0KA 2VEDA 3IUYA 4URYR 3GEEA 5HZHA 3U61B 3CNNA 4AURA 1DTSA 4DZZA 1M2OB 4DSNA 4URUR 2DBYA 3MWLA 1S9DA 2OCAA 2FFBA 3KKPA 3N5CA 2ZTSA 5CK4A 1CEEA 2YVUA 1NVVR 2FZLA 5AUPB 3BK7A 4PZYA 1P72A 2QMEA 1TF7A 4FCTA 2QE7D 1HURA 4N0EA 2BMDA 2YYZA 2HYIC 3KJIA 1KI3A 2FV8A 3OFND 1DBSA 1NG1A 5UKDA 2IYXA 1YRBA 1KKMA 1Z83A 5J4KA 2IL1A 3SYKA 2ZI6A 3VR6A 5JLJA 2UZIR 4P4SB 1G8HA 4RD1A 2BMEA 3FMPB 1SVKA 3K09A 1J90A 4HLCA 4O2LA 4JL5A 5BYJA 2H8KA 2PZFA 3N2IA 1ZM9A 1KHTA 3EZ6A 6Q21A 1Z07A 4O0MA 4LRWA 3K53A 4RFVA 4D6PA 4DHEA 4BWYA 3NVAA 1G5RA 2P6UA 4KI0A 5FTNA 2XAUA 5EXTA 1FOEB 3I32A 2D2EA 4D81A 1N5JA 4UNRA 2AKAB 3U44B 1UBGA 2CCGA 5TXGA 5JECA 2GJ9A 2CLSA 2KE5A 4HDQB 4LZZA 3U2QA 4NYIR 4U00A 1MO3A 1WBDA 3IDQA 3QBVA 3RC8A 1R5NA 2ZS8A 1FTSA 3K0SA 2VYFA 3T06B 2X2FA 3AP2A 3VKGA 1AS2A 1ZD9A 2VHQA 3SC3A 1T3SA 4M1YA 4QM6A 2ZSBA 5FH9A 3UG7A 1US8B 4G3XA 4AYWA 2A5JA 1CR0A 1RZ3A 4KXFB 3DM9B 4BLSA 4G0NA 2G9NA 4A2WA 1NKSA 5E95A 3P1JA 2RCNA 1KMQA 1GIAA 3QEOA 3QXCA 2PT7A 1Z2CA 3T1QA 2CHQA 1O3YA 3DMDA 4HDCA 4JMPA 1W49A 3ADDA 4TLBA 3CF2A 1M7GA 4Q48A 5FI0B 1P6XA 3NBZC 4PSKA 4HAYA 4CEJA 3H0KA 4TQ9A 1AQUA 1DG3A 4P0TA 5JMTA 1BIFA 4LWZA 2FEOA 3TK1A 1KMHB 2O0JA 3U3MA 3CF6R 2B8WA 2CCKA 2XB4A 2QENA 5FOUA 2O5VA 4RZ3A 1E0SA 2VLIA 3D6TB 1XBTA 1LF0A 2J7KA 4HZUB 3F8TA 1C9KA 4FMCB 2DFNA 1YRAA 2V1XA 3B1YA 5HKKA 2J0SA 3RS7A 3PUVA 4MH0R 1JBKA 1I4LD 4MUAA 1KZGB 1FQJA 4I1SA 4RZUA 5AWFC 4OBEA 2Y8EA 3LW7A 5IT5A 2I1VB 4XWOA 4A36A 4M0LA 1T5LA 2YWFA 5CIQA 4BRUA 3W90A 3B1WA 1TPZA 2B8TA 2ANCA 3CH4B 5FL7A 1QHXA 1KAGA 1P61B 2AFHE 2SHKA 5AJWA 4I4LA 1W5TA 2RGEA 2G0NA 4KU4A 5LDDC 2RGNA 2J46A 5P21A 4C0QC 4WZ6A 5CJ2A 2F9LA 3HP1A 2CL0X 4NYMR 2IYLD 1BMFD 3CPJB 1OE0A 1SXJD 1VHLA 1SVSA 2F9MA 4PC3A 4QOSA 5EE9A 5JSZB 4C2TA 1WRBA 4V0OA 1W4BA 3Q85A 2QBYA 2NGRA 4M9XA 1JQJC 3ZVLA 2G0TA 1F2UB 5JJIA 4MKGA 3B9PA 2J7PA 2PJRA 1P3JA 2XZOA 3IKJA 1IJFA 5KDOA 3U7HB 3AGPA 4M1WA 1GNRA 2FFAA 4EQ6A 3SN6A 2YHSA 3AM1A 4M21A 1IN6A 4OI1A 4C0HA 3AVWA 1OIVA 3K0CC 5JCPA 1P2SA 3RANA 4TLAA 3SNHA 2O8BB 2JA1A 2VA8A 3BAFA 1E2QA 3HU2A 3PUYA 4TMZA 3CZPA 3L0OA 3F5FA 2EFGA 2ZRDA 4TT3A 2GJAA 4YMUA 5KSYA 5LPNA 1KO5A 3HJNA 3ZS9A 1ZC3A 3Q5DA 2J5XA 2K5UA 1PLLA 4JSTA 4QNMA 1E9DA 1VG8A 3NHBA 5EP1A 1RVDA 3L8ZA 4P33A 4PX9A 1CF4A 1J99A 4YLGA 3AVTA 3EZ9A 4XOIA 2PCJA 2DB3A 4TZ0A 1ZUIA 3OEED 3R9XA 4UXIA 2RH5A 3MWKA 3KXLA 1PLKA 2VHJA 3KQHA 1VDZA 2JLQA 4DLVA 4Q4JA 4I99A 2VL7A 2EWVA 4XTRA 4NCKA 2HEIA 4JLAA 4GMXA 4GPTA 5DNYB 4A0GA 5BN4A 2PX3A 3BD9A 3GCGA 1TEVA 4MYCA 4S2EA 3VFDA 4LBYA 1OFHA 1U99A 1GL9B 1I2DA 4QGFA 1Z29A 2O8EB 2IXEA 4NBSA 2FF7A 1GNPA 1KSJA 3PEYA 2GXUA 2QSYA 3TGPA 2ZI9A 1P2UA 2WICA 5DH9A 1N6NA 3WMGA 2NG1A 3S1AB 2PX0A 4E03A 3B78A 1XPUA 4JKYA 3VR5A 2QP9X 1IAQA 2FSHA 1DO0A 2FPKA 4EPRA 3D8BA 1II8A 1NVVQ 2Q3HA 2W6JA 4ILEA 4M22A 4LYAA 2YV5A 4IOLA 4LX0A 2DCUA 4AKEA 1N0VC 2WIBA 3VHLB 3LBHA 4XJXA 3LY5A 2WWYA 1OXXK 2Q9CA 1R6BX 1IONA 1V5WA 3CPEA 4JL8A 5FUYA 2EFDB 5BWMA 1QVRA 3H1TA 3IEUA 2ZRNA 1YZQA 3X1WA 3HR8A 4Z8YA 2ZYVX 5FPSA 3BXZA 4M1SA 3IBGA 2F1IA 2V7QD 1XMJA 3W3AA 5CYPA 2QN6A 3MWYW 4V0LA 1SXJE 2DR3A 2GCPA 2W83A 2CL6X 3I72A 1PJRA 4NL4H 1YZGA 2MMCA 3FVQA 3M6AA 1XMVA 4YMWA 3T1TA 4HAZA 5FTLA 3AVPA 4B2PA 1Y63A 1K8RA 3KB2A 4TN1A 1L4UA 3K9HA 4G5SA 1K5DA 3IBYA 4JS0A 2W00A 3Q9LA 4IVQA 3RRZA 1E79D 1QG4A 4W5JA 5TVKA 4NYIQ 1AZTA 3ZJYA 1Q1QA 2F7SA 4JYCA 4D0LB 4FCWA 1LS6A 1ZBDA 2CEAA 4OK3A 2F3TA 1G7CA 3VNVA 4NDZA 1Z63A 1GKYA 4LBZA 221PA 4LHVA 4M8NE 3VNUA 1IY0A 2HCBA 3I8XA 1NL3A 2OZEA 4M1TA 1AN0A 2ZU6A 3AP3A 3EG5A 1PLJA 2QA5A 4YONB 5JJLA 1OH7A 1E1RD 3CB4A 1U0HC 2KWIA 5K8TA 2UVQA 4MRRA 2HV8A 3UATA 1ESMA 4QBIA 5B64A 5DHAA 2PH1A 4JVLA 2YJTD 5J4VA 2QMHA 3NBFA 4TMXA 4KLZA 4ACBA 3PEUA 3P27A 1JEDA 1ZNXA 1T3LA 121PA 2QGNA 3ADKA 4MYTA 3CWZA 2IWHA 1CR1A 1YJ5A 2V4ZA 1UKZA 3W9YA 1RJ9A 4D2IA 4DC9A 1WCV1 3EIHA 3GLHE 3MSXA 4IFBA 3EARA 3EW9A 2ZJBA 3BFXA 3AF4A 3AKYA 4JT4A 5GJWC 4QBHA 1YZUA 2GKSA 1M1YE 1XD9A 3OEEA 4MKFA 4Y0VA 4LJ9A 5ELXA 3MFYA 4Q7MB 2IS6A 3GLHA 4Q4AA 3RLFA 1VG0B 3FMIA 4A15A 4RD0A 1MABA 2OUKA 2W2VA 2OEPA 4B73A 3Q5EA 1W0JD 1XD2A 2FMXA 3BIFA 1DVRA 4UQOA 4BRWA 3U4QB 1T8TA 3QF4A 2UKDA 1XRJA 2B7CA 5SZIA 1Q0UA 5IHPA 1EX7A 3KXIA 4KYIB 3TAHA 3R9IA 4JSYA 5JI2E 3U3OA 1G5PA 4FMCF 1MRSA 2V6IA 4BFUA 1NMZA 3UMFA 5F2EA 4ZCIA 1E9FA 1S1CA 4JZKA 1SXJC 3Q72A 1NVWQ 5AUOB 4R98A 4TZ6A 4UJ5A 4D80A 1TQDA 3TUIC 2WJIA 2A5YB 3AVOA 4DLXA 1R8QA 1LVGA 1VCNA 2GRJA 1NG9A 4HSEA 4NYMQ 1ZW6A 3T5GA 2P5TB 3U3JA 4OJKA 1XTQA 1KJWA 4AI6A 3LD9A 2XSZA 1EG7A 3B85A 1OSNA 4NMMA 3P20A 2GNOA 1TF2A 1Z6TA 3AEZA 5FPKA 4Z8XA 4EPXA 2JATA 2N1BA 4PPQA 1E9AA 1XTSA 3DM5A 2WJHA 3WYGA 1X1RA 4XD7D 1E0JA 4M2LA 4NONA 2QM7A 3AQ4A 1U9IC 2NO7A 2V55B 2ZR7A 3RYTC 2ZJYA 3QPUA 1ZM3A 3EA5A 1A2BA 1P9WA 4CDGA 3I1FA 4R2IA 2IYSA 2IS1A 1E3MA 1T4GA 5FOXA 5ANRB 4YQFA 5AJZA 1Q1EA 2WSMA 2I4IA 1YU9A 3AH8A 4Z1MD 5JZVA 1ZJ6A 4HEJA 2QY9A 3D31A 1OYWA 2EYUA 2LCFA 3B5JA 1D2NA 4B2IA 1I2MA 4CIDA 5GJCA 1DAGA 1KO1A 3WY9A 5FBLB 1GL6A 5L3RA 1MT0A 2JIZD 4IVRA 3GJ4A 2JEOA 3WNBA 1GFIA 4PR0A 5L3SA 4B3XA 3TW4A 1TU3A 5B58C 2A30A 3I5YA 3SBEA 1HYQA 1Z8FA 1E1QA 1E2IA 2CCJA 2YWGA 821PA 1JECA 3SDZA 4ABYA 4TMKA 2P6RA 2ZITA 4Q4LA 3K0EA 4PHHA 3ADBA 1ELOA 1KI6B 3RABA 3RRMA 4DT1B 4N1AA 1XD8A 2Q3MA 3I3SR 1WF3A 3MD0A 3OE7D 2JASA 3KKMA 3KJHA 4JIMA 4YDHB 2ORIA 3CUEF 3Q3JB 3BH7A 2C8VA 1KDOA 1QBKC 2C04A 3CIOA 2FGJA 1H65A 3QY0A 3LVQE 1NLFA 1G3UA 2R6FA 3PUWA 4TYNA 3TSZA 2AK3A 1I4TD 2A2ZA 1KI7A 1E9EA 3SJBA 1US8A 1JNYA 1WA5A 1SGWA 2BMJA 2IA5A 2ZS9A 5GVRA 3ZVMA 2RB4A 4Q1EA 3GJ5A 3MRSA 2JLVA 2R6DA 1JPNA 3DKVA 3X2SA 2RAPA 1L2TA 2H92A 2PMKA 1NY5A 3R20A 1E96A 2ZR0A 4N3NA 4PO9A 1W36D 3MMPA 1W0JA 2ZSEA 4QGAA 1GAJA 2W6IA 4BUJA 4X8MA 1N6LA 2RGGA 1F2TA 5JHHB 3VTKA 2CJWB 2YWEA 1COWD 1KO8A 5CLLA 1UJ2A 4UNSA 2NIPA 1LF5A 4Q1CA 1ZNWA 2GWHA 1J70A 4QGGA 2ZRBA 4C9BA 1U8ZA 2ZS7A 1G291 1KMHA 1P2VA 3C14C 4EFLA 2RGCA 1OXVA 4KCGA 2IT1A 4NP6A 2V9PA 4IVPA 3WYFA 1X86B 4QJ5A 4HZUA 3EWSA 5EXXA 4I1VA 4OK5A 2CE2X 1R5BA 1ZIPA 4FIDA 1M6NA 3SFZA 3Q7QA 3V9PA 3RSOA 2G6BA 3MJHA 2ZE8A 5KHOC 5JJKA 4JT2A 3LAWA 2O8DB 1SXJB 1W44A 1N6IA 4O25A 2NO9A 2QEQA 2XNSA 2O8FB 2QTVB 1G64A 1LS1A 1RRGA 1XNJA 5F9HA 2HLDA 4TMWA 1ZM2A 1QVAA 2WHXA 1N6OA 3GP8A 1ANKA 2WM9B 1IQPA 2GHIA 1E2PA 2FA9A 3IHLA 5K8LA 5D3MB 1UPTA 3ZZ0A 2ZRKA 2OM2A 2C77A 4B32A 8OHMA 4US2R 1ODFA 1MR3F 1Q20A 5FBRB 2A9KA 4LJAA 4DXAA 1RC8A 1OHHD 4JJZA 3DHWC 4TL7A 5JSZA 1C1YA 2VP4A 2CHVA 1X1SA 4XIGS 4TTQA 1YZNA 3AVUA 721PA 5LD2C 3KQLA 1J7KA 4M9SA 1KI2A 1F2UA 5CM9C 2JLSA 2QORA 1E6CA 2ZANA 4TQUS 5EQTA 2DHRA 2QMOA 1LV7A 2C9CA 3W6OA 5E7JA 1QF9A 2QPOA 3VR2A 3UPUA 3WBJA 2JLRA 3WNDA 2A5GA 4BLOA 2BHRA 3FFAA 1G3IA 2OCBA 2BJVA 3ZD7A 1E9RA 1G4AE 3KKNA 2RGBA 2QAGC 2X2EA 3ZH9B 3LXXA 2ZI4A 4MQBA 5L3VA 2JLYA 3LX5A 4NPHA 2ZPTX 2ZROA 1ZYUA 2O8BA 1EX6A 1OF1A 4NZYA 4P3YA 4RJLA 1G9XA 4LJ6A 4Q4AB 4HLUC 2ZRCA 4JBYA 3V00A 2BC9A 3IILA 1MABB 1TQ2A 5CB8A 4XWAA 1S2MA 2FOLA 1QDEA 3PENA 4CZ2A 2FG5A 5LB2A 4MGKR 1RFLA 4MGZR 3DO6A 3LLUA 3WHKA 4UNQA 1EWRA 4B6EA 3SBDA 1L7VC 2JCSA 2R44A 3U7EB 4QKQA 3THWB 2FZ4A 4HDOB 4UJ3A 4LUCA 2MSDB 2Z0MA 3THXB 4QBGB 2OXRA 1E9CA 1GKIA 4WW0A 2VP6A 3NHAA 2P6NA 4R7ZA 5HPYB 5EE3A 1R4AA 3QQ5A 3OIUA 1SVWA 4XVQA 1KI8A 2FSFA 2WJGA 1G18A 2RHMA 4TYPA 3DKPA 3G5UA 4AG6A 1T8UA 4EPTA 2ZRMA 4Q4HB 4M1MA 1OH6A 3IHWA 5FBQB 3PXGA 2ASEA 5B30A 3SQXA 2QTFA 2PT5A 2ZQ5A 2O8EA 2J0UA 4LHXA 2W0MA 2GXSA 2D7CA 3CWQA 4RZXA 2NTYC 2CBZA 5FOVA 3VU9A 1G8GA 4URXR 4CVNA 2D62A 3K9GA 1G20E 2KJQA 1VYVA 4Q1FA 1J8MF 1Z0AA 2H18A 2OXCA 2IBMA 1XZPA 4L16A 3LXRA 5A4JA 2BWJA 2BVNA 1D5CA 1HE8B 2IEZA 2VRWA 4E07A 2XTMA 1E94E 2XITA 3AUYA 3NG1A 4D0NA 3I73A 4WBSA 4UXHA 4PPNA 3GLGE 2JLXA 2ZJZA 4KFTA 1XCPA 3IPXA 2ZI3A 1SULA 4A0RA 5J5CA 2FH5B 4B33A 3KJGA 3AKEA 4CF7A 4JLKA 3FHCB 2W2TA 3ADCA 1NLYA 1XTJA 4JLDA 4Q7LA 3GLGA 3U7GA 2P5SA 1E2DA 4JLMA 1LFDB 4Q1BA 2A5DA 3KQUA 5L3SB 5FUXA 5DYGA 3CO5A 2PLFA 3SYNA 1CRPA 3PV0A 1AS3A 4UNPA 3C16C 3GFOA 5DI9A 3UKDA 1NY6A 5DI3B 1G8PA 1HEIA 2UZ3A 4IEIA 4MKIA 4V0NA 1OH5A 1S3GA 1OIWA 3IO3A 4TSFD 5FTJA 4NH0A 1CULC 2YC4C 2OSBA 2ORVA 1OFIA 2ZUCA 2ATXA 4MKHA 5TV2A 5C1BA 4OKSA 2WSSD 4WOPA 3C5CA 2DWQA 3LBIA 4BFZA 2Z83A 4ESVA 2WPDA 1GP2A 2QPAA 2GCOA 2IS2A 2E1RA 4CEHB 1II0A 1P60A 1YQTA 1W36C 1RKBA 2WKPA 2XJ9A 1J8YF 3B60A 5LD2B 1JXOA 2XEXA 5GADl 4PAQA 3RRYA 1HUQA 1XX6A 2OFOA 3W6NA 1NIPA 3T35A 2XXAA 4DEYA 4HI0E 3CM0A 1P2TA 4A8JC 1SHZA 4AIIA 1RPZA 3THYB 2J59A 4BEJA 2F3RA 2VP5A 2ORWA 3CNLA 2GVZC 2TMKA 3DOEA 1SVMA 3KUDA 1UKEA 3L8YA 4FWIB 3TBKA 3O8BA 1Q44A 3AP1A 5HR5A 4PANA 1OLOA 2GZDA 3K0CA 2PLRA 3RRNA 2QAGB 1F2TB 4R2HA 3CBQA 2ERXA 2FWRA 4MITA 3LO5A 2H16A 4PQRA 4DLTA 4URVR 4Q9HA 5DGXA 1DE0A 1KNXA 2CNWD 4V02A 1D6JA 2ZRFA 3T1VA 4EAQA 2A5FA 2IYZA 3VX3A 3DL0A 2NZJA 2J3EA 5BXQC 2GXQA 4O2RA 2BM1A 3BFKA 1YR8A 2JJ1D 4NHOA 1KY3A 3I92A 3ZYCA 1CKEA 2BBOA 1U0LA 1XPRA 2ZSDA 3U4QA 2Z4SA 4W5WA 4H9GA 3OEHD 5KNCA 1NMYA 2HDNB 4DKXA 3KX2A 4RD2A 2JJ2A 5G41A 1QHHA 5EJEA 4B2LA 2IXGA 1U81A 3MG9A 2J0QA 1R0WA 2ZJ8A 1E4YA 1IXRC 2XOKA 4B43A 3OAAD 1NBMD 1VIYA 1CJTC 3AB3A 3V4FA 2C5LA 2QPTA 4B3CA 1A7JA 4KFSA 4K8OA 1G21E 1GITA 1UBCA 1W0KA 4PTLA 1N25A 4DLUA 3VHXA 1MKYA 2IF0A 1Q22A 1VCIA 1T3HA 4ITRC 4GBMA 4RVCA 2ZSFA 3CX8A 4TMTA 4CYMA 2PCLA 5DN6D 1GILA 2IXFA 3AV0B 1TL7C 5L8VA 1J2JA 2KI5A 2H17A 1YKSA 3AF3A 1NRJB 1N5LA 2ZYUX 2CDNA 4PXAA 1DO2A 5EXPA 5LB4A 3TQCA 5CYOA 2AWNA 3KL4A 5KNDA 3CRMA 2QMUA 2QE7A 2A7QA 4FINA 3QKTA 3DDCA 1JJVA 4TLEA 3U6BA 3FKQA 5CDFE 3OFNA 1GVNB 4EFNA 4GT1A 4NCHA 2ODEA 3NC1C 4WXRA 2V54A 2KB0A 3CW2A 1KOFA 3LA6A 4QGHA 3NEJA 4R71A 1XMIA 5CDFA 1NN5A 2FFQA 3SE0A 2BDTA 2QRNA 1AS0A 3CX7A 5IK2D 3A1SA 2JDID 4RKFA 1RYFA 3EIQA 4QHTA 3FMOB 1G7RA 4CGZA 2MMGA 4EKDA 4Q19A 1HV8A 1G41A 2HCJB 4UNNA 2JLWA 2JGNA 2ZRLA 4B76A 2WAXA 4B3BA 1MO5A 2R62A 4GOXA 3PQCA 4MRPA 3NKVA 1G17A 4TLCA 2ZE5A 3WNCA 4JLJA 1JJ7A 1WXQA 2NO1A 3T34A 4Q7KA 1EXMA 3VKWA 2GJSA 1EFRD 2XNDD 3BGWA 2G1KA 5B57C 1IM2A 4DLRA 3LV8A 4HB0A 4B74A 3C41J 4LC1A 4M53A 4A1FA 2LWIA 2F6RA 4DBLC 3PVSA 5H8WA 3A1UA 3R9WA 4AKHA 4X8OA 2NO0A 1OKKD 1E2KA 4LC0A 2NO6A 4DEXA 1WB9A 1OIXA 1NN1A 1T0JB 5JWHA 4DVGA 4BFSA 3ASZA 1F60A 1KI6A 1Z2AA 2H5EA 3QXHA 1WDTA 4DT1A 1IJEA 1TQ4A 5FL3A 1IOZA 1R5OA 1DADA 2FDCA 4OHVA 4BEBA 5FBWB 3FB4A 3B9QA 1W36B 2QP3A 1Z6GA 3HDTA 2GCNA 3RAPR 4L5BA 3IIMA 4GDFA 4ERNA 3L0IB 5KO2A 1L8QA 2B21A 1FFHA 4OI0A 3HYRA 1G6HA 4LJ7A 5BW8A 4GL2A 3K70D 2V6JA 2EYQA 4E22A 4OQXA 2J0UB 4FI3C 1A82A 2AN9A 2O0HA 5G3YA 3MUFA 3VU9B 4B3GA 4JVNA 1UDXA 1FMLA 2I3BA 4ACAA 1LW7A 4C2UA 4KVAA 2VP9A 2CL7X 2BEKA 3QE0A 3R7WA 4C3ZA 4PSVA 1NBME 2R8RA 2CJWA 3LFUA 2VQSA 2WKRA 2CK3D 3B82A 4DSOA 1IY1A 3AF1A 1UAAA 5IRCD 2KBFA 2OO7A 4DIDA 2J0VA 2WWFA 3FYHA 1E99A 4ZV4A 2ZE6A 1Z6YA 3U6KA 4OI4A 2B6HA 4KYUA 2XX3A 5J40A 3QF7A 4JJKA 4PHGA 1ZD8A 2IC5A 1OV4A 3GLGB 3LDAA 2ZM5A 2YZ2A 2P0EA 4MRNA 2ZJ2A 3T1OA 3GLFB 3LQQA 2O8DA 3K9LA 5BQ5A 5J47A 1A4RA 1BMFA 1W4RA 2R6AA 3VX4A 1SXJA 1GUAA 3A36A 2O8FA 4ZKEA 1W47A 4WZBE 421PA 1CJKC 4D26A 2GILA 4BLPA 1AM4D 5D3MA 1VCOA 1NKTA 5FUVA 1SKYB 4F38A 3FMFA 4US1R 4PHTA 2GCOB 5EZ5A 3GJ6A 1CJUC 1XMSA 1Z06A 3Q8XB 2FFHA 4RSGA 3T15A 4N0DA 3LNCA 4OL0A 5JBQA 1U9IA 5KSPA 1T9HA 4NCIA 1R10A 3CRRA 5E4FA 2XXAB 3D7MA 3QUSA 1T5IA 2WTUA 1N0WA 1ZRHA 3SI7A 3NDBB 3PUZA 3KKQA 1S3SA 2EU8A 3M0EA 5FPTA 3B13B 1ZUNB 1GG2A 5AR1A 1AA9A 4WA7A 4G5GA 4OQLA 5F9FA 2H1LA 4HAXA 1R8SA 1P4SA 3TE6A 4PZZA 1M8PA 3NWJA 4D4JA 3X1YA 2VIIA 4F7WA 3I62A 4EIWA 4WIAA 2BBSA 3GJ8A 2GK6A 1II9A 4II7A 1DELA 4BFYA 1T0HB 1W5SA 1MO6A 3C4JA 4LCBA 1TUIA 3EX7C 1Z6AA 3TMKA 3ZVRA 1H8ED 4QNRA 4XTCS 2Q6TA 1UADA 1YR6A 1UF9A 2LKCA 5H1YA 1KK2A 4Z51A 4OHYA 3B1XA 1S9HA 2ZI5A 3NIBA 4M1KA 1UKVY 3ZIAD 1N3BA 3E70C 2GESA 3CX6A 2DFKB 3SJZA 3GLIB 2N46A 1Q1ZA 2IYVA 4IFEA 4AK9A 1QHHB 1HTWA 1N5IA 2H7VA 2DFLA 4LY6A 4K46A 2ZREA 3THWA 1E0KA 4D4LA 2D2FA 5SZHB 3THXA 3QJYA 4DCSA 3OHMA 4EPVA 2QL6A 2WBLC 1UEIA 1DEKA 3KTAB 4IKEA 1DPFA 3NEYA 4BLQA 2F43B 2GJ8A 3NXSA 1EFCA 4TYWA 5IF9A 5CLQA 4C4PA 5EXSA 3W34A 2F55A 4YMTA 1AKYA 2QI9C 2VF7A 4Q4HA 2GEDA 4WXPA 1GTVA 2E87A 2RMKA 4KBGA 2XTNA 3WP0A 4Q02A 1JXMA 3K0FB 2OBMA 3GMTA 1TQ6A 1X8JA 3TSOA 3WP1B 5EUQB 3J81k 3BS4A 4EUNA 5KU1A 1IXSB 2P2LA 1RIFA 2AR7A 3OIWA 1BKDR 3EA0A 4OHWA 4QRHA 4BGDA 1KAOA 4BFTA 1FPMA 3ICQB 1Y3AA 2BCGY 3OIVA 1HQCA 1SKQA 3KKOA 4ASUD 2YOFA 2ZETA 4V0ME 1XZQA 2G1JA 2OT3B 2V7QA 3OF5A 2ERYA 4ZDIA 1AQYA 3K9NA 2B7BA 3L0PA 1BS1A 1XEXA 3RNLA 4OK6A 3GPLA 1HH4A 3UMSA 1G7TA 2NPIA 1CU1A 4V0MA 2VP0A 4L15A 2C9YA 3FKSD 2X19A 4Q9KA 3D3QA 4HB2A 3BH6A 4IRUB 1G3RA 3C15C 4GNKA 2DFTA 4YMSA 1UDWA 4BPBA 1UBFA 2ATVA 1E79A 4AYXA 1E98A 4POAA 2OFWA 4M9QA 3AF2A 3WYAA 1W4CA 3K1JA 3NBXX 4DB4A 1XP8A 3TUZC 1H8HD 1JQLB 1W1WA 4KVGA 2ZRAA 1VPLA 3QSYA 5DI3A 2HUPA 1Q3HA 4A92A 2C9OA 1JEEA 3QI2A 4B75A 1IBRA 2ZUBA 4NE2A 3U7FB 2QQ0A 3NDPA 3A4MA 5H68A 2AKYA 3DVLA 2FJUA 2FNAA 1BYUA 1VCMA 1E1RA 1ZC4A 1KSGA 1JR3D 5DSZA 4IOKA 3BE4A 2IWRA 3E1SA 3AVQA 3PFIA 2DPXA 3KJEA 3RSLA 3K70C 1KTVA 2BBTA 1Q3TA 3QKUA 4PO8A 2VHTA 5G53C 4KHZA 4Z54A 4EJSC 1Z6XA 4CEHA 3JZAA 3KZ1E 2YINC 2QZ4A 3BJIC 2YNMA 4QJ4A 4IDQA 1WBBA 1JB1A 1WP9A 4Q1AA 4RFSB 1E2HA 5HZKA 5AJVB 1FMJA 3OZXA 3O8DA 2WWWA 4Q9JA 2NQ2C 3BB1A 3LWNA 4MDEA 3ICEA 3THYA 3EWAA 1U0JA 3QVVA 1G16A 1C4OA 5FOTA 1GRRA 1TMKA 5E7MA 4GMDA 4GP6A 1SVOA 4HUQB 3ZIAA 3R7WB 1NNEA 4OQMA 2FE4A 2QAGA 2PEZA 3A4LA 4LK2A 4FD2A 5FUWA 1D2EA 2X8AA 3TR0A 3L43A 3W6PA 4Q47A 4HLUA 5FR2A 3A1VA 3PCRB 2WZQA 4GP7A 4F4JA 3REFA 5G3ZA 5KDDA 1NSTA 2IW3A 5B2ZA 3OESA 4A0FA 3FFBA 3ECCA 3FHOA 3FE2A 1KJZA 1R0ZA 2ANBA 2BCJQ 2ZJAA 3SS8A 4BFVA 4OHZA 1Z22A 3EPLA 3W5JA 3RS4A 3AUXA 2ZRGA 5D3QA 4G01B 1X6VA 5C2JB 1T91A 5DIFA 3ZGXA 1KIMA 2RGXA 4W7SA 2VPPA 2RHDA 1XXHB 5EUMA
chains in the Genus database with same CATH superfamily
4L4XA 2Z3VA 3HRIA 3WLRA 3EXG1 1E66A 3L06A 1OZAA 1V5FA 2OL4A 5IT4A 3RU7A 4XD7A 1QHGA 3NOXA 1PK7A 1POWA 4GKVA 1U1EA 2WJVA 1I4DD 2NVOA 2J41A 3AJAA 3DONA 1E2JA 3PBKA 5CR9A 4AULA 4ANFA 4CKBA 4QPCA 4CLRB 1OAKA 3DFUA 4GZLA 4AUNA 1Z4JA 1C2YA 1JEYB 3UXEA 4QDUA 5K2OA 4LZLA 2NV0A 5JNSA 1VBNA 1NQXA 2ZDHA 3JYHA 4IW3B 4R9UC 3L7IA 1I36A 3E7PA 2WE8A 4MWCA 1L5VA 2BM9A 4KRFA 1JLSA 4N65A 4X84A 2DSTA 4EP1A 2P1ZA 2R1ZA 3KYDB 3V7FA 2ZQYA 2NUAA 1ESNA 4MDHA 4N7JA 2FGKA 2C99A 3IJEB 1E9VA 4MP8A 4JBWA 1CR2A 5BOSA 1UEXC 3VR6D 3Q2IA 3TQFA 5HIKA 4YK7A 1EBUA 2QUZA 1X1CA 3TXXA 1N2CE 1FB5A 2ORED 3B5EA 4PS1A 5D2CA 1U0GA 3R3WA 5JRJA 2HU2A 3EOAI 1E4VA 4JZYA 4UPDA 2L0XA 2BFBA 3GLRA 5E9AA 2XMSA 2NTJA 3NTUA 3AHJA 2CJPA 3NBAA 5JR3A 1AO0A 3HA3A 4DV3B 1XUOA 5U1PA 3OZTA 1SOAA 2VHUA 1N6RA 1ENZA 1LRJA 5BORA 3DYIA 3SSOA 1OD6A 1GL7A 4BKUA 2P2DA 1LDMA 4I1RA 3ZZMA 3AIMA 4LF9B 3ANNA 2P7HA 3ULKA 1DEHA 5JEEA 5EJ2A 5HCIA 3ZY2A 1SG0A 4F2DA 5DEOA 2VTDA 2F1JA 3L7NA 4DDWA 1GR0A 4C1BA 3MGCA 3ZEIA 4Q6WA 1S1MA 5JFTA 1AMOA 1SVLA 1PZFA 3QPVA 4BXOB 4CTKA 2YY5A 1YR9A 4BLTA 4JHLA 3H2KA 4JUIA 3MZ0A 1NIJA 1V35A 2WF6A 2R60A 3DE5X 3IH5A 1MV5A 2GEVA 4PYMA 3WFZA 3A8TA 3RC3A 4MCIA 4S3MA 1KI9A 1EWQA 2REBA 4TKUA 1HXHA 4KO1S 4PY2A 4AY4A 3TPZA 2XVMA 4BMYA 4F3YA 1SQ5A 3CJQA 3THSA 2WLTA 3ZCXA 1RTKA 4I08A 3KT6A 3UJ6A 3C8MA 1TJYA 3EF1A 4W9MC 1A2KC 3MCAA 4UCXA 3CEPB 4J7AA 1COWA 3KVYA 1RLIA 1ZCBA 2QW0X 2AXNA 3BXXA 4IXTA 4RD6A 3T9FA 3L8HA 3UB3A 3W7VA 1TAUA 4BNUA 3OPMA 3F7TA 2R4UA 3NOVA 4FD3A 1P6UA 3X1KA 4BNZA 2DXIA 1EJ2A 1Y7PA 2DQKA 4GZMA 1K63A 5AW8A 4E14A 4R40A 3GP5A 3M8KA 2C5FA 4HLNA 3EUAA 4FFVA 3DAPA 3U9LA 4HNAA 4C01A 5HTOA 2H2AA 3AKDA 3UAOA 3UK7A 2W2XA 3AW8A 2VTBA 4FGWA 1VKJA 1TKCA 4MS1B 4PZLA 3M1AA 3KUKA 4X62B 4BGVA 1NF9A 2F90A 2BFNA 5JSQA 1LX6A 1XF9A 1AUPA 1NHWA 1PUJA 1QG2A 3PHJA 4EUEA 5FPHA 2DOKA 4RF3A 4RMHA 4D9MA 4LYDA 3V4PB 5FDFA 3NEAA 2NUPB 4MOWA 5DWDA 3ZQJA 2BYTA 1BNCA 2F1HA 1T0BA 1OAAA 2V9ZA 1CEQA 1CUGA 3PNSA 2CW5A 4KQXA 3HDYA 4LYGA 4PC7A 1K7SN 5HUQA 4OOEA 1RQ7A 3LWDA 4NJEB 1C7IA 1C3OA 1JR2A 1QVZA 2EBHX 2I0FA 3EH1A 3X1XA 2E9SA 3RTDA 5K8JB 4E1AA 4ZYZA 2JBWA 1I4EB 2X13A 1T9GR 2FZ5A 2NN3C 2PL5A 3ISTA 6PFKA 5J4LA 3JAMA 2H2WA 2DUJA 1NUQA 1FZTA 4IY1A 1OHHA 1G42A 1UKYA 2G88A 5AXCA 3RLIA 3WRXC 3DDUA 2GBPA 3DEFA 4UVDA 1FIUA 2H57A 2QYSA 4HS9A 2Q9AA 3UJ9A 4Q4DA 2B2NA 1IIBA 2OCPA 4RCZA 3OQIA 2GLTA 4S24A 3T95A 1F17A 2ECOA 3IALA 1AX9A 2F1KA 1PJZA 2CE7A 2J1LA 3QKSA 3R0XA 4HEHA 3UA3A 4CIVA 2I2DA 1IBLB 3S99A 3BOSA 3ZW9A 1RQRA 3HLYA 1IEWA 3TSAA 1TT5A 4CMBA 2JH9A 4JGGA 2BKAA 3CR7A 2IF2A 4CUZA 2JFZA 2ZSKA 3LZDA 4DG5A 4CMGA 5LQJA 2EQ5A 2ZZKA 4LJRA 3ZE1B 1I2AA 3PNOA 4NHEA 1V1MB 3B7GA 1D4AA 4MYDA 2EFCB 2FWMX 4MJXA 4WNAA 4YRRA 3M1IA 1XWIA 2B8EA 3MEQA 3D4PA 5F52A 1BE0A 1WDKA 4M89A 3UJAA 2ZYSA 1EIWA 1O2DA 1IUNA 3FRHA 4QATA 1D07A 4TT3D 2E4ZA 1A5TA 3Q88A 3C8HA 4Y9SA 3UWSA 1UMBA 4NARA 2CSUA 2R97A 4TV9F 4JI6B 3AL0C 1KBOA 4DIEA 4H31A 4JLOA 4OB7A 1R9MA 1M2VB 3D02A 3KP1A 1XAIA 2W70A 1P5HA 4A4DA 2V5AA 3FOZA 3EB9A 4LFBB 4GI2A 4Y2HA 4CMAA 2YN4A 1QCCA 4OLHA 2G1UA 2C8KA 3FHJA 3N2NA 3OICA 3QUCA 2YWDA 1S0UA 4N8EA 4AKIA 1W48A 4KQ1A 4A1OA 4BO1A 3BGSA 4CFZA 3LBNA 3R0ZA 5H3LA 3GLIE 4EL0A 1J1ZA 1P4HA 3GGOA 1BQEA 1HORA 1Q6YA 1K6IA 2GXAA 1EFAA 3E4CA 2I3AA 2NTVA 1TM7E 2PBLA 2Y0CA 2J3IA 4OKNA 4RA9B 2A0YA 1JSXA 3STWA 2O1EA 1PGQA 1X15A 1Z0JA 3KSMA 3VR4H 3L4BC 2IK8A 3QPDA 3V97A 3K4HA 1KYTA 2WFMA 5IJAA 5A4KA 4RKQA 2BPOA 4BU0A 4XUDA 1HT2E 2IEYA 2IXDA 4IWYA 4LPKA 3KXKA 4IIXA 4MPJA 4Q01A 3ZQ6A 1KPIA 1DKPA 1ZWKA 4FX5A 4ZOLB 5K4HA 2F48A 1A4IA 4ERXA 5T4BA 2JGMA 3KTAA 1ZNYA 3DFFA 3R5KA 4A2PA 1TYZA 4R69A 2F43A 2HWXA 4Z2AA 2V9CA 3SD7A 5DT2A 1RHMA 4OHXA 4G9EA 1JMVA 1RRPA 1VHWA 1GNQA 2HLPA 2BGJA 4FT2A 3GQBA 5JRZA 3O4RA 3ISVA 3ND8A 1DTEA 2DP4E 3U17A 1AGYA 2VWPA 3BRSA 2GI4A 4HLDA 5AM4A 4L2IA 1E1DA 3IIJA 3PUKA 3OT5A 1NSFA 1M34B 2AS0A 2BTQA 1UDAA 2QRVA 1KVQA 2QRPA 4X1IA 4E09A 5LQRA 5FQOA 1CS4C 3QHPA 4WCFA 2ZUWA 3GZJA 5C3UA 3VHRA 3D6AA 2AXEA 4N7RA 4EMBA 4KDCA 3B2EA 2I6SA 2AYZA 3JV7A 1QKJA 2QTMA 3BWMA 4L8GA 2AN1A 4PC1A 5CH5A 5E3HA 5T64A 4UHBA 4XLZA 1VYUA 1XWWA 5G40A 5GWXA 1NX6A 1JYFA 3NAQA 3LLSA 5AW1A 5EGSA 4H77A 2BUBA 1BOOA 1UBUS 4FYKA 3D7NA 5BWOA 1CXZA 2BGKA 4QXMA 2ZI7A 3HYTA 4OHCA 1SOWA 1P1FA 2YFYA 3A0UA 3P52A 5K2MA 2ZRIA 4TXMA 1YFJA 2DQ4A 5DLEA 2XWSA 4ZDJA 2OBBA 1EUCB 1KORA 1BMQA 2HA4A 3ZWCA 3N6XA 1POXA 3CYFA 3PFWO 1PL0A 1MVOA 2V7XA 3PDWA 3WI7A 4B6FA 4EA7A 5F98A 5CLIA 3AYZB 4G4GA 4BCCA 1DAHA 1R0BA 2R7LA 2VUUA 1SELA 1AQLA 1P6QA 3W2FA 5KC9A 3H84A 4PAOA 4IZHA 4ZHQB 5GINE 3GFRA 3A9VA 2CN1A 1GQFA 2GN2A 3CVJA 1NURA 4IS2A 3SX2A 2BGGA 1ULSA 2H3HA 3QVMA 2ZIFA 1MTZA 2E4UA 1BS9A 1U9YA 3FTDA 3QELB 4JLPA 3KQSA 4K9SA 4MS4B 4W8OA 5CJPA 4YT5A 5FEUA 1RKUA 1QHSA 5KYKA 1P0QA 4IIJB 1KF0A 1JXAA 1VJ1A 3MTIA 1M73E 2OE2A 4IXMA 4N5NA 4XR4A 5FWAA 1GJRA 4WK0B 5IJWA 4MV0A 4QM7A 3LW8A 1NQWA 1LW6E 1V0JA 2EW8A 3M34A 4IG9A 4EMUA 3H16A 5E2IA 2ECKA 1OPXA 1MC4A 1EVQA 1DXQA 4CU2A 2UUOA 3V4RA 1BYIA 1EZ4A 4IXNA 5ESDA 3RSCA 2C3YA 4D9CA 2A3RA 2PRYA 4WVLA 2EBFX 4JI2B 3VVCA 5E6UA 2K4MA 5JD3A 1EFVA 1XJ5A 4MJ7A 4B4DA 3TMAA 2R79A 3HHPA 5K6AA 1KK3A 1CZNA 2DWUA 1OBOA 2VSXA 3M49A 1JAIA 2OAGA 2BKUA 2JG3A 3JW8A 1QOZA 1Y3DE 1E3WA 3G1TA 3N86A 1LDGA 4KGDA 4AP6A 4GNRA 3WLQA 1UXKA 5KYWB 4P0QB 3AKCA 3EYAA 2ZR9A 4ECEA 1ZR4A 2WP8J 2FVXA 3D3KA 5CFQA 4F8JA 2PE5A 4P92A 1M2GA 4DARA 4DREA 1KNQA 4LHSA 2JRCA 1XO1A 3H1GA 4QHSA 3WLMA 1F8XA 4KRXA 5A1JA 2R0QC 1Y3IA 4FSXA 2OLJA 3GU3A 2WNSA 5TQ0A 3LPAA 3T7IA 4JXXA 2IEBA 2GERA 2D74A 3DGEC 1XJQA 3M3HA 4TRRA 3IV7A 5G1NA 2OFFA 3OQMA 5KWEA 4DY6A 1G8YA 2HM7A 2PKWA 2RGNC 3VNQA 3IAM6 1A5BB 2Z9BA 1S2IA 2WHEA 4CKEB 1JW9B 1KDPA 2HBQA 3N7UA 5B3AA 3QXXA 5CBKA 1ODIA 5JCZA 1VZ3A 1HMYA 5L3ZA 1SXPA 4MUFA 5FTKA 1JKIA 1JDUA 2C98A 1UFRA 3IIKA 1L6RA 1NN0A 1MOQA 3CNOA 2ZJ7A 4LAFA 3UWPA 5K8UA 3H8WA 4DV1B 5FD8A 2VJMA 1XEFA 4LWQA 1EXNA 3ZE9A 5JO9A 1CR6A 1DJQA 2Q2OA 1ZP6A 4CG3A 4DNXA 2XSZD 4B35A 1O96B 1QC5A 3P2IA 1PX0A 4GRAA 4Y6RA 4QPNA 3CRVA 3HACA 3AETA 1DKRA 2D5IA 5KTNA 5LXTA 3V48A 1RDFA 3K5WA 3G2JA 2OVBA 2WUVA 1NW6A 4WBNB 4LY3A 1CVIA 1Z3IX 1C9NA 2EV9A 3GIWA 2CHGA 4UTOA 1N5KA 4U6QA 2EVWX 5K3CA 1NXTA 4LBWA 1GCUA 2Z8XA 4PXSA 3T3PB 1I94B 1GNTA 1PKXA 1QCDA 1ORWA 1ZI9A 3SIXA 4OI2A 4IGFA 1NP6A 2R65A 4A16A 4MDFA 3GMIA 4ZCMA 4CLRA 4DNPA 4IQFA 3KFXA 2SKEA 4AJPA 4KTTE 3M4ZA 1HFWA 3J7TA 1BDJA 1GSIA 1W52X 1V45E 2F3UA 2GEBA 2J6BA 2VJYA 4GUAA 4ZVKA 2EKQA 4M4SA 4P8RA 4TKZA 1RQXA 3N8GA 4D9IA 2YC2C 1VG1A 2J9GA 2I7VA 3LCJA 4JB2A 4A6XA 3L7JA 4QDJA 2BM8A 3BXGA 3BTSA 4KK3A 5LZ7A 4Z9FA 3VMMA 4ENTA 1X3SA 3OCVA 4UOQA 4BO5A 2CJYA 3IAUA 4JNCA 4LOAA 5DO9A 4H3HB 1T9ZA 1W29A 1EP3B 2VBCA 3MQ4A 4FBLA 4HDRB 4PSUA 4UUAA 3NR2A 1PJTA 2O4UX 4IRXA 3I04A 3RO7A 4QO7A 4C87A 5KQRA 3DEJA 5JNUA 2EFHB 4RACA 5IAAA 1G66A 4ZO4A 3DWGA 5TSDA 4BYGA 1NC1A 4RFLA 5EMHA 1JWAB 3IP5A 3FR7A 3SOPA 4QD3A 1EI9A 2G06A 2WJJA 1L5GB 3IL2A 5AVUA 4Q9IA 3REGA 3KTOA 3JWIA 2IHZA 1Z8NA 1BOFA 4X8HA 4BQOA 3OWOA 4DR4B 1LA2A 4B9EA 5JAIA 4LDPA 1E59A 1YTLA 5B6IA 2I55A 1KQNA 3CJRA 1FS5A 4OV6B 2UVPA 4MRSA 5HHTA 4U7DA 3TRDA 5DNWA 4ITVA 1MX9A 2OFPA 3GLSA 2UUBB 4KR2A 3RFFA 5TMEA 1KDZA 1V95A 4NU8X 4K0RA 3VUFA 1AKQA 1Q0ZA 1NR7A 3W8RA 1H2AS 2WVJA 3FGZA 3KFVA 5E7QA 1XI2A 2AOTB 4CMIB 2HSZA 2FP3A 3IP9A 4W8GA 3RTEA 4QYSA 2BJWA 4UEOA 1A8HA 1B8VA 4ZT7A 4ISCA 2OHVA 2E85A 3D0KA 9LDTA 2VDOB 4BXOA 3KHUA 4LQCA 3SQLA 4QU0A 1BEZA 3O31A 4PNEA 2CB9A 2C5HA 1N2EA 3OLCX 5BN5A 3LZ6A 2ZRPA 1C3EA 3BFVA 4DV6B 1JHDA 5EUCA 3NHYA 4OXQA 1Z4LA 1FNNA 3EIEA 4RPLA 3H8JA 3LC0A 4RMGA 3FCEA 4C29A 5K1ZA 4RTQA 1PSDA 5JAMA 3G0HA 4X94A 4ZI3A 1DDIA 4YV1A 2OSVA 1UK8A 1MW9X 2YYAA 4M1OA 5ALLA 3NGMA 2G36A 1WL8A 1GUFA 2YY7A 3CKLA 4OB8A 1K7XB 4I36A 4BNLA 5C5IA 2PUGA 5TB5A 4J07A 5IC6A 1JJFA 2I54A 2QHXA 4DDTA 2FRDC 3OWXA 5KCMA 4MI3A 5DE3A 2OCXA 3QTBA 1D2GA 4MYRA 4KAXA 4KC0A 4E2YA 2EKBA 2HXYA 4JR0A 2ZIAA 1O9HA 1CUBA 2GA8A 3QKRB 4RNDB 3PXBA 2IHKA 2EQAA 3G02A 4PZCA 1UQUA 3L41A 1YUNA 4LMRA 4MW5A 3SC4A 5EOVA 4CT5A 3B9RA 1XJ0A 4IDPA 4BO2A 4LJ8A 4XRGA 1EEHA 4LYJA 4UDOA 5E0OA 3CZCA 2PQMA 2OOSA 1XMXA 3LWZA 3OO0A 3EZFA 4FMBB 4IOMA 4RV4A 1Z2EA 4UEJA 3NV7A 1KL7A 3GL9A 3RWMB 3LTNC 3IRUA 2AFHB 4ISBA 4Q39A 3OQBA 2IYUA 3T7JA 4S0ZA 3D4NA 2XIQA 1XYVA 3ESDA 4US0R 5T5QA 5CG1A 2NUPA 4QPZA 4ZD6A 3BQMB 2HLDD 4UCFA 4AW9A 3R3XA 4PCVA 3SHVA 1K4YA 2F8LA 3PQ5A 4JL6A 4MCJA 5DW3A 5DM70 2WWGA 3F71A 3MWJA 4NJEA 2XZPA 5JG7A 4C88A 1YJAA 2Q0HA 3OOSA 3ZWNA 3KWJA 3W5SA 4P7KA 3ZD6A 1L7PA 3IQHX 3I5AA 1E3IA 1HYGA 2IUFA 3NIDB 4WH0A 5EP2A 1P5RA 4ONEA 1TPYA 3KRTA 1XTKA 3UG6A 5CLFA 2AJLI 5G0WA 2JFUA 1ODTC 1Z7BA 4JLVA 4CHGA 5GIOE 4P7JA 3FN4A 1QPGA 3I34X 3P4XA 2ZBFA 3VR3A 5DGCA 1QRRA 2X0KA 3P0EA 1WW3A 3RROA 5KNBA 1U5CA 1LBSA 3KLMX 1K6JA 2I4MA 3E48A 4MVJP 3T8YA 3ETHA 3CLRD 5F76A 3FHLA 3H2YA 1GWNA 4RSHA 1U90A 4MMZB 4LJSA 2D54A 3BMQB 4XM2A 2KM1A 4HGYA 5AKXA 1QIHA 2H1RA 2O9JA 2WD7A 2YWXA 3OLYA 1L9XA 2WILA 1PW7A 3PQ3A 2WQ6A 5GGXA 1JIQA 3JWEA 4NV1A 1HNWB 2RKOA 2LBPA 3MXOA 2GX6A 4FQ5A 2O8NA 1ZOOA 3FWHA 5YASA 5FFMA 4DUYB 4LX8A 4AC9A 3C5EA 6ABPA 1FUUA 4Y0AA 1B2LA 5FA8A 1L5ZA 1P0CA 3DVAA 5H5JA 1AO3A 1EHCA 4AZSA 4AJOA 3S1SA 1FS4A 5DTQA 1QRUA 1C9JA 4MGYR 1ZXLA 2E89A 1P7CA 5B1SA 2I2BA 3NATA 1CFZA 3HDHA 4WDQA 5FWNA 1XCLA 4L3WA 2Q46A 2X0EA 1YQXA 1GFWA 1KVUA 3KYCB 3LLMA 3CMMA 4QG7A 4WE3A 3RFVA 3ZE8A 4E7OA 1P2GA 4X71A 2YWBA 1V7ZA 1H5UA 4YROA 1HT1E 2ZYWX 3GFTA 1CLUA 1N2SA 3VJMA 3SZOA 2NZ8A 3QOFA 4MAAA 4D4GA 2IYAA 3P26A 3ZDEA 5JD4A 1Z5UA 3QU5A 2YZ7A 4JT9A 2P9CA 4M0MA 1RQLA 4CHTA 5LMCA 5M7EA 2DZDA 1NI3A 4RCYA 4EHBA 3AESB 4HYEA 1QHFA 3OY2A 3HBLA 3H99A 1J2EA 4MCHA 3DP7A 3TH5A 1U5BA 2J4DA 3WGKA 1J2UA 1UT6A 3GFPA 4RA9A 3BC1A 4G5XA 1WO8A 3LVRE 2XB2A 3AI2A 1QZZA 1WB6A 3INNA 4ZMSA 3BWYA 3G82C 2VBIA 1BEUB 3C3KA 4FVTA 3R3UA 1N5MA 3H1EA 1SZCA 3IERA 4KWHA 2I6XA 4R9SA 1I5EA 4AWBA 3GNSA 4MUJA 3SQDA 1TYEB 3RIEA 3FVRA 2G25A 3ENNA 4QAQA 4ZOLA 3Q9SA 4B1FA 1X8LA 2ONZA 2DHCA 2YZGA 1UJ6A 4U02A 2YH2A 1KK1A 3MJEA 1O6BA 5AW5A 3V46A 3EGVA 3TZEA 1V4VA 1JIVA 3FZQA 2FRVA 1E58A 2OAQ1 2K87A 3JQBA 3L7AA 4NRDA 3KEMA 3F6PA 4M9ZA 1T29A 5ALSA 5FI5A 1U3VA 2RI1A 4BASA 1NJGA 3F9IA 3TIFA 1Z5NA 1X2EA 4PYKA 1P1CA 1S2OA 2JBAB 2R68A 1IPFA 2OV2A 4RE6A 3K72B 4GQBA 1N6KA 3C24A 3R40A 3UJPA 4FZRA 4I5FA 1M34A 1F51E 2R1VA 2XYHA 4FGLA 4JX8A 2E5FA 4DMHA 4DRZA 4BQSA 5FNZA 4UEKA 5EJ7A 3L40A 1DXOA 3WR5A 3T12A 2ZJ4A 4XGRA 3FKSA 4RKRA 1QZXA 2QY6A 4OX9Y 1WXXA 1VTKA 2HNAA 4DWWA 3KHKA 5C1PA 1DV2A 3NHMA 3A1TA 1O9GA 3DBVO 1IHYA 2AF3C 1YZHA 2FZEA 3IPCA 1PJLA 1EAYA 2QUAA 4RVFA 3A14A 4W5OA 4YLYA 2SKDA 2X86A 5I48A 1MW8X 5AQEA 1ZOLA 3QVUA 4EG8A 2HF8A 2IYPA 5IYZA 2PD3A 1VIVA 4WD3A 4JENA 5E3JA 2HJGA 2WAYA 4FP9A 1H8HA 5FO0A 4ZGGA 3CGGA 1CDDA 4M86A 1C81A 3J7AC 4EYKA 2DTXA 4S1VA 1EUCA 1ZMXA 1G8AA 3D3WB 5KWIA 3VVLA 1JU9A 2Q4BA 1U94A 4HZGA 2DBQA 4V03A 1N6HA 4RL4A 1ZIOA 2RIRA 2OXIA 1TW2A 4GVPA 4CBVA 2AK2A 4NCJA 4HB3A 5KVCA 2Z30A 3PS9A 4ZHQA 4DZTA 3CLHA 5C37A 2GVDC 4HSGA 4FWTA 4MGIR 3ROTA 4NESA 4CTOA 1X1EA 1IXKA 2FQYA 5B58T 4QT4A 2P9EA 2X9GA 1UFVA 3QELA 4YO8A 1YS4A 3A3YA 3D4BA 5DNVA 3FPCA 5JWOA 3FOFC 3D7KA 1TMOA 4IIJA 4WDRA 1NM5C 4M0KA 3FCSB 5A4FS 2H7XA 3A4YA 4MWTA 5PNTA 4ZMBA 2VF8A 3WLTA 4RK1A 1ACLA 2XXBA 2YIJA 2HH9A 1WP4A 4PFSA 3C7CB 2HK6A 1NJ2A 1VMEA 1JDTA 4XJVA 4C4XA 2EZ8A 1X8KA 2FWIA 1WHSB 1G63A 5IJ0A 1AY0A 3QHAA 3ZNPA 3AEYA 3CPHA 3G0BA 1Q1NA 1VRCA 1Y42X 3LRXA 3M6XA 2KQUA 2VK8A 3H6GA 3UBMA 4ESOA 3QVSA 1QUFA 1H9AA 1L8AA 4Q1DA 4BNKA 5CG2A 2KSQA 3ONNA 5DPMA 2REOA 2FF5A 3QF4B 1BO6A 4FONA 1LBQA 4H7JA 4M76B 4UHEA 3G85A 1RRFA 4J43A 1Q1GA 1YVDA 1IULA 2MT9A 3K8YA 2GDJA 2JCBA 4XD2A 4O8ZA 5G0SA 5JH7F 2CLCX 2HU5A 5KYWA 1I6MA 1TYBE 2MWMA 1KZYC 3H2BA 3RVJA 4EITA 4HH0A 1Y3CE 2ESRA 1JAHA 5KSOA 1PR4A 2E2WA 5ER6A 3WB2A 4ENVA 1Q3KA 3DZJA 2WU1A 3GO4A 5L53A 4IEEA 2YQ5A 3AF0A 2PMDA 2C9MA 2ZSAA 2V8OA 3C3JA 4QASA 4EQZA 4D6XA 2I91A 1N7GA 1AGPA 1VE7A 1S2NA 3FVTA 1BU5A 2JGJA 2PNFA 2Y1EA 3AOEC 1M76A 4HRAA 4ZAXA 5KQSA 1A2QA 1ACMA 4HGZA 4JI7B 2W2KA 2CLKB 2X42A 2HQRA 3DQZA 4U5XA 1URPA 3MT9A 5GVSA 3HXMA 1ZCAA 1A9QA 4CKEA 1PFGA 2C2XA 2IEAA 3GUVA 3LDFA 4D9GA 1QE3A 1MJFA 4UAUA 3I4LA 3RVSA 4KPEC 2AC7A 1NYTA 2DCMA 2IKSA 2P11A 2VO1A 3PG5A 3VPSA 3WJ2A 3FVVA 3ZS8A 3ZTYA 1LCIA 2I78A 1E5DA 4DG8A 3F4KA 4C0KA 5A02A 5BW4A 3Q0EA 3NJRA 4U2KA 4BNXA 4EX6A 2VEDA 2MU1A 5HMLA 2HX1A 4OUDB 1Q5PA 5ECDA 5GGYA 4EY7A 3CNNA 4M7OA 5COBA 4YPVA 3NTLA 4D8TA 4DZZA 3TFQA 1R0SA 4AMZA 2DBYA 1CEEA 1S9DA 1O5TA 1O96A 1RD4A 2OCAA 3OQVA 4FFPA 1XDZA 2YVUA 2LD4A 2LUOA 4NAHA 4OUKX 5AXAA 1YQ9A 3LP6A 2QMEA 5GIPE 1X7WB 3S7TA 3Q8MA 1UP6A 2QE7D 4FE3A 5H9WA 1HURA 1GYQA 1BCSA 4L4ZA 4MPTA 3VI4B 5K3OA 4ZZ3A 1KI3A 4FJ1A 5I8WA 4REQB 4JH0A 1MGOA 4HNQA 2CZGA 3OPYB 2IYXA 5ABPA 3IB3A 5CT4A 2HCTA 3L4KA 3D43A 3WLPA 1KU0A 4PWZA 4M9RA 4GGMX 2XVAA 3OKPA 3I0ZA 2GLXA 1C2TA 3BL6A 4MUEA 2J5BA 2X7JA 1WM1A 2H8KA 2XB9A 3CEJA 1JT2A 3CRZA 1CY7A 1UWVA 1EX1A 1UK7A 3EHDA 3QVTA 3WGZA 2CY0A 3ND7A 4GX2A 2NP7A 1H94A 4DA4A 3K53A 1Y3BE 1JSCA 4LVCA 3R7AA 3IVAA 1L5YA 1PK8A 4A7PA 2CJXA 1ONNA 2GZRA 3WL8A 1KFBB 2P6UA 4QSHA 1NWHA 2XAUA 5IAEA 5EXTA 1KMCA 3TJMA 4UNRA 1GUBA 2AKAB 2F3PA 3ADPA 4HDRA 4N5HX 5DTIA 4ZHSA 2Y1XA 1YFLA 4KSYA 5TXGA 2CLLB 2OLEA 4LZZA 5GM2A 2WWVD 3MCZA 1PWXA 4R1OA 2PGLA 4UZFA 3IDQA 3E22B 4WJLA 3OCYA 1XK6A 2ZS8A 3KZVA 2I66A 5JASA 3T06B 1JXQA 2X2FA 4DIMA 1AS2A 1TZKA 2QRQA 5EWLB 2F2TA 1TTHA 1CNFA 2YFQA 2YICA 5BPFA 2ZSBA 2ZB8A 5FORA 5FH9A 3RYIB 4NBUA 3QE3A 2NQTA 3D6UA 4G3XA 4KR0A 4XLTA 4AYWA 2A5JA 1RZ3A 1XLVA 4D43A 3VDNB 3UAYA 3COPA 1EJ0A 1ZICA 5AOBA 4ZOQI 1S5PA 3A06A 3E5MA 3IBFA 3KSDO 4MQ5A 1GGJA 4J3JA 4CMIA 3HDGA 1P7PA 3QXCA 2VCEA 3UC5A 4MR7B 1MJNA 3DMDA 3ER9A 5T4FA 2EZ9A 3BJMA 2ZSHA 2YXNA 5BSRA 3RYCB 3SBXA 1RXWA 1M7GA 4KIWA 3D1LA 4PZ9A 1GXSB 4RKYA 2IP2A 2XQIA 3F7OA 1CY2A 4LWZA 3E2PA 2H6EA 2FEOA 1NVMB 3TK1A 4QQNA 2ZIGA 5TF0A 1GGNA 3ZNNA 4G89A 1FMCA 4ZVSA 1FRVA 2B3TA 3I9MA 2VLIA 5D6OA 2PSDA 5SYMA 3PFFA 1XBTA 1LF0A 4RJIA 4HZUB 3ABIA 3TXAA 1ESDA 4BMXA 3MJFA 1YRAA 3OIFA 4Y18A 3UF0A 1M75A 1UJMA 1NHGA 2H0RA 3BXHA 2IP1A 2I2XB 4N0PA 3NT2A 2AQIA 4MH0R 2IDKA 1I4LD 2FEKA 3V8MA 4KZKA 1Y6FA 1RR6A 4MVCA 3E7WA 4YO7A 1K7FB 3NMUF 1XZJA 1Y4DE 5AM1A 3CN7A 2J8ZA 4N18A 3A6FA 4HADA 1T5LA 2BE9A 2WV7A 4YQYA 2OXEA 3W90A 1J0AA 3B1WA 2PL9A 3D64A 5FL7A 1QHXA 1SU6A 1IZ7A 2WUDA 3EQ8A 2SHKA 4ARSA 4NOLA 2Z6QA 2QZJA 3E9EA 2D59A 1W5TA 2KW5A 1KR5A 2RGEA 2FDXA 3PF9A 1T9GS 3I6YA 3OKAA 5KNLA 5P21A 1B6SA 1IZYA 5DXJA 4BVGA 5CXUA 4C0QC 5CJ2A 2AFHA 4NYMR 2CL0X 3IXMA 2JANA 1B74A 1BMFD 2IYLD 4UUOA 3F9CA 1SXJD 1O5IA 1MNQA 1YB7A 4CCSA 2PSEA 1T6BY 2WYOA 1SRQA 4PC3A 4C2TA 3V8RA 1BA2A 3BAZA 3EXEB 2V6GA 4FYVA 1ECJA 3LI2A 2ONCA 4KQ9A 2PT9A 4MKZA 4MI9A 4M9XA 4F6CA 3WNQA 4YPFA 1F2UB 2JGDB 4MK4A 5AKKA 4MKGA 3B9PA 2LPMA 3O5AA 1PFUA 1DX6A 2B2CA 1T2NA 2HMVA 5FQNA 2H4XA 3IKJA 3N5KA 5DNCA 1I7SB 5ERGB 1IJFA 3HR4A 1WDWB 4FILA 2V7TA 4PICA 2F3QA 3AGPA 4U5QA 1GNRA 4C7JA 4QTXA 3JRWA 5G0UA 3TECE 3MOGA 2P2SA 3AVWA 1O95A 1P0MA 1IQ0A 2JAWA 1OIVA 1HFEL 2IVZA 3ZG6A 4QLBA 4F4UA 1KIFA 2HJ9A 3ADOA 3DE1X 4U7PB 3U3XA 3T9BA 3H2SA 3HNOA 3SF0A 5JCOC 2JA1A 3BAFA 1NWCA 2IIVA 4WOCA 1XROA 3OPXA 4MV4A 7AT1A 3NM4A 4EYEA 2VDNB 2ZRDA 3L7LA 5LPNA 2G40A 3BMQA 3IAM1 4N6GA 3ZS9A 1SBHA 3COWA 1Y89A 3EVGA 1PLLA 2P8JA 5J5VA 3FWZA 1GCAA 4AUKA 1IZ8A 5EERA 1UMKA 1RVDA 3L8ZA 4BLSA 2HRDA 4MUXA 5EA2A 4PX9A 1BE1A 1J99A 1EWVA 4BBZA 1BSVA 2FPRA 2PCJA 4XA8A 4RQUA 4DQDA 2DB3A 3C1UA 2PG3A 1FVXA 1Z2PX 2CJFA 3KIPA 1Y8QB 3FRJA 3R0JA 4GU5A 2C2ZA 4U2FA 3FY4A 3MWKA 1E2BA 2JFQA 3IDFA 4J7CA 4DLVA 1QNLA 2X4IA 4GHWA 2PV0A 1M8JA 3GT7A 2XT9A 1HNNA 5AVRA 1ZFNA 1D09A 1EPUA 1GNSA 1D6SA 2HEIA 5ALIA 4UHKA 4AJKA 1O94C 3MIIA 5DNYB 4A0GA 1OLUB 2F59A 4GDMA 2IYFA 1V48A 2OO5C 2PX3A 3BD9A 1E7YA 4HQRA 4R41A 1RC1A 4JWKA 3I76A 4DDMA 4FMPA 1VJRA 3L04A 5AKIA 2FTKE 3AESA 4HFJA 4U8GA 3C6BA 2G9RA 1RXVA 1X94A 4MLZA 3OE4A 1SCKA 2QAIA 3NWEA 3OP1A 4NZ9A 4J6FA 3G8CA 1SD2A 3IKVA 3IVMA 3WGQA 3EZYA 4ENUA 2V98A 4QOEA 4Y2YA 1E20A 1UBHS 2B4YA 3WMGA 1ZR2A 1BU8A 5B4UA 1EFPB 1QLJA 4J3FA 4FU0A 3S2ZA 3B78A 3EEYA 1F9AA 1UH5A 1ZMBA 1X0VA 3VR5A 3X0DA 1TA4A 2FSHA 4EPRA 2A92A 4S12A 2W6JA 4LYAA 5F21A 3FWPA 2JAXA 2PUCA 5C80A 2WIBA 1RLOA 3KKEA 1NT4A 2O23A 2V7PA 3CLSD 3PIDA 5LBTA 1OXXK 2Q9CA 5K0LA 4IKPA 3CPEA 3T5CA 2A1UA 1VMDA 5EINA 2AZDA 2EFDB 3HBNA 5CBPB 4UVEA 2Y71A 2AW3A 1Y1QA 2IZ6A 4GR5A 4FR0A 3HCAA 2ZYVX 3SS9X 3UH1A 1VXOA 3URKA 1KTIA 4U7JA 1PJ8A 3BXZA 1P1JA 4U2DA 5KS2A 2JBAA 3HB9A 3K6JA 1IHPA 2Z5LA 4HH1A 2OZVA 2V7QD 5IWAB 4QO8A 4TWAA 5CYPA 3MWYW 1GAEO 2GCPA 1VQ1A 2CL6X 3NUGA 2YV2A 4ZGWA 1K9VF 4UM5A 5EKDA 3KSUA 1JQ5A 3M6AA 3BM5A 1XMVA 5C5CA 3WNZA 5E4YA 5FTLA 3AVPA 1X70A 2EERA 3H7AA 1Y63A 1K8RA 2VJPA 5HRAA 4EO9A 5JCXA 6YASA 1L4UA 3TOCA 1UPAA 2PKCA 2QD5A 3GAFA 4PCUA 3AEQB 5L7WA 4G5SA 3SKVA 4F6RA 2WFAA 2ZAYA 5JCJA 1M2EA 1WF6A 4N5DA 1H9BA 5A03A 5TVKA 1KRXA 2C1ZA 2VUSA 4NYIQ 3ZJYA 3DLCA 3G0IA 1IH8A 1Q1QA 4ZOAA 3V5NA 4FCWA 1LS6A 1JLHA 3QEMB 4XR9A 2DT8A 3LT0A 1N92A 1THMA 4L9RA 1JNXX 5JD5A 1GKYA 4JP2A 1N9GB 1IY0A 3IUNA 2OZEA 2P9FA 2XF8A 3E7DA 2XWPA 2QA5A 1H66A 4JSRA 3QFTA 1E1RD 3SDSA 4CM8B 3CB4A 1U0HC 3H3JA 5K8TA 1OH7A 2DJ5A 2WZCA 1ESMA 2CFSA 3UATA 4HDAA 5DHAA 4BO4A 2I4NA 2BTEA 2BP7A 4E21A 5EFOA 5KVSA 3R3HA 4JVLA 4ZEWA 4KDRA 5J4VA 3H1FA 1IWPB 1ZN2A 3N2GA 3HN2A 3ZX4A 1IE3A 2B2XA 4R1LA 4TMXA 4KLZA 5KC8A 5L6LB 4M46A 3CNEA 5KNBH 4DC1A 3GD5A 5DHPA 1T3LA 121PA 2HRQA 1T1JA 1ML4A 3R0VA 4MYTA 3W9YA 5H4HA 1RWOA 4UPEA 3FPFA 5HGJA 3TD6A 1PZEA 1YFKA 2XMGA 3HSYA 2VK1A 3TIGA 4IFBA 3BXFA 2JFVA 3AT1A 1N8KA 2ZJBA 1BTOA 1C7EA 2OB2A 3AF4A 4JT4A 4QBHA 4MKFA 4YJKA 1XD9A 3R3YA 1OFVA 5ELXA 3BHIA 3QYAA 1WHSA 3MFYA 3OH8A 2A1TR 4M55A 3RLFA 1PHPA 1VG0B 4RD0A 1J9ZA 3TM5A 1MABA 3D1VA 3KJFA 3UMBA 5HF9A 4ENRA 4YACA 2WD9A 3CLUD 1HETA 3DNMA 1SVNA 4RHCA 1SA0B 4Y9RA 2P4QA 2HRBA 5I9IA 4KPGA 3QF4A 3CTPA 1NDHA 4XCVA 4MAFA 4WKGA 1DBQA 2WLSA 1OT5A 2B7CA 4G1MB