1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
2QE7A 2EFGA 1E4YA 2IYWA 3BB3A 3VNVA 2WWGA 5FR2A 2CHQA 2HLDA 4D80A 1X3SA 2GNOA 2P0EA 1OXTA 4Q9IA 1XJQA 2XAUA 4QXAA 1SHKA 1UKEA 1KMQA 4KBGA 1W36C 2O8FA 4I1VA 2CCGA 1SXJB 4HUQA 1X1SA 2YWGA 3RABA 3LVRE 2ZRAA 5DHAA 3AKEA 3T1TA 2W0MA 3UANA 5TB5A 4C0JA 4PO8A 5G3ZA 4ZKEA 5JWOA 1IY2A 2ORWA 4TT3D 4NPHA 2ZSEA 2ZJBA 4B43A 1G4UR 2Z0MA 1NLYA 2QPAA 4OHXA 3ASZA 4YONB 4FINA 3TBKA 3UATA 5ELXA 2VSFA 3SR0A 4OI1A 2F1IA 3I4LA 2WWIA 4WBSA 5CJ2A 3KKQA 1J7KA 2DB3A 3ZGXA 1E0SA 1RW4A 1JAIA 4Q1BA 5HR5A 3I61A 4N1AA 4Q9HA 1J70A 1G20E 3K0CC 2ZS8A 2FG5A 1J99A 3KTAA 4QJ4A 2FMXA 2WWFA 5A5GA 5FPHA 3CBQA 4W5JA 4Z8XA 5J47A 3WYGA 5JJLA 3I3SR 3VR5A 2GK7A 4Y0AA 1KI2A 3MWYW 3GLGA 3H1TA 3RS0A 1F5NA 4QBFA 2ZYTX 1NJGA 1AQYA 2GILA 2IUSA 3CNLA 4FMDF 4F7WA 2ZJOA 4XTRA 4Q7MB 3VR3A 1KO5A 1OXXK 4S35A 4GOJA 5IDVA 2RGEA 3LNCA 1W0KD 5FPKA 3K1JA 3GJ0A 1MV5A 3EAQA 2QTFA 3SC3A 5C4MA 2IUTA 1RJ9B 2X77A 1FFHA 2RGCA 1Q21A 3B13B 3RS3A 2QP9X 2BCJQ 3V4RA 2ODEA 4GT1A 1ZYUA 2XB2A 2GEUA 4A8JC 5E4FA 3ZJYA 2QBYB 2VHUA 2R6DA 1XPUA 4D4MA 2GJSA 1N6NA 2FH5B 2GVDC 3CZQA 2IWHA 1GVNB 3VR1A 4LJ6A 3I5YA 5FTKA 4EPVA 2J0VA 3DPUA 4P0TA 5G53C 2R6FA 4QGHA 1QG2A 1L4YA 2AWOA 3IILA 2QAGA 4WVFA 5D3MB 1XEFA 4URXR 5HZHA 1OFTA 4MITA 2D74A 1FW6A 4U02A 4B35A 2OG2A 2ZUCA 1G8YA 2NZ8A 4A2PA 3TSOA 5CM8B 4HLCA 3SYNA 2O0HA 3UPUA 4PC6A 3IKJA 5IF9A 3A4NA 2DWQA 4Q19A 1KJWA 2QTHA 4KSBA 3Q5DA 3BFXA 1COWA 1JAHA 4Y0VA 1VHLA 1QHNA 1W0JD 2F7SA 2XNDA 3IUYA 3EZ6A 3CNOA 3NBZC 1UDWA 1SXJE 4OQFA 1QVRA 3LRPA 3PEWA 1NVVQ 2TMKA 2GF9A 1Z22A 5DH9A 1XTRA 3JVVA 1F2UB 3BGWA 5KOYA 4GOXA 2AX4A 2EFHB 2FPLA 4Q4LA 3VU9B 1D6JA 1GRRA 3B2EA 4M1KA 3LDAA 5FOUA 3TR5A 4KVGA 1I4TD 4YMVA 3NEYA 4MKFA 1N6HA 4OL0A 4A92A 3C8UA 3N2IA 3PXGA 3FFAA 1S8FA 3PUWA 2A9KA 2XJ4A 1HURA 1T8TA 4L4UA 1BKDR 1ZRHA 4QGFA 3VKGA 2PJRA 3K70C 1K5GA 1N5JA 1YQTA 3I92A 2N42A 2A30A 5KNDA 1N5KA 2ODBA 2W58A 5EXSA 3RC3A 3VHLB 2GJ8A 2RGDA 3S1AA 5FH9A 1BOFA 4Q00A 4H1VA 4P4SA 4JKIA 5FOXA 5HKKD 2WIBA 2QEQA 2LCFA 2FSGA 2FV8A 3OIUA 2GAOA 3GLFA 1AA9A 4LGMA 2ATXA 1GUAA 2QPOA 2FSIA 4MRVA 1DELA 3C5CA 3NBFA 4N0DA 4A2QA 1S0UA 2Q6TA 1R0XA 1P2VA 2AWNA 2XJ9A 3CR8A 4JZKA 3L2OB 1GM5A 2A5YB 1T91A 4Q7JB 2H17A 1Z0KA 4NHOA 3V4FA 1SVSA 4FD2A 2UZIR 1T6NA 4JKYA 3M4YA 1QDEA 1P5ZB 4AD8A 3QEOA 5J4HA 4PAOA 5JJKA 3N2EA 5TVKA 3QF7A 4OBEA 1CS4C 3OEHA 1PUJA 2OCBA 2ZI3A 3CM0A 5JCZA 5IK2D 3X1ZA 4K46A 4NCKA 4QFMA 4DDVA 5A4JA 1KHTA 4L9SA 4E09A 1S9DA 2IYSA 3EG5A 2KSQA 2ZROA 1Z29A 1GKIA 2XOKA 5SZKB 1Q1QA 1P61B 3JZMA 4A36A 1JB1A 1IONA 1TL7C 1TMKA 4BEJA 1RFLA 3RS4A 4IOLA 1XEXA 5EZ5A 2AN9A 3ND8A 2QAGC 3LV8A 3LX8A 4OI2A 2Z43A 2A5FA 3IHWA 3LW8A 1KI7A 1S4QA 3AF3A 4IDOA 1D8TA 1N6IA 2CK3A 3NC1C 1AN0A 1E2JA 3KJEA 3FOZA 3AVPA 1JR3D 4EDHA 4BRUA 3AVWA 2E9SA 1EFCA 2GAAA 2R62A 2ZRMA 4LSGA 4Q66C 1FNNA 1T4GA 3QG5A 2PCJA 3ZD7A 3LA6A 4LBZA 3CIOA 1OH7A 2IUUA 1N2CE 1R8QA 1IY0A 1P2TA 2BKUA 3WYAA 1VTKA 2ECKA 1RYHA 4YXWD 4CT4B 1JPJA 1AIPA 3A4LA 1Q57A 3U4QB 4B3CA 1QRAA 2WOOA 5C18A 1W4BA 3QPWA 4P31A 1R0WA 2YWHA 1MR3F 1NN3A 3DMNA 4LY6A 2AR7A 3TSZA 5AK0A 1OB2A 4LC1A 2VP4A 4XD7A 2ZR7A 4TN1A 2OBNA 4B3BA 4BUJA 4FXPA 1H8EA 4M1WA 2IXGA 1SKYE 1OXSC 4ACAA 4G5OA 1GNQA 2GJAA 1Y3AA 3HDTA 5AJZA 5TV2A 3ZH9B 3D7MA 4YMTA 1D2NA 5CITA 1H65A 3KL4A 2QM7A 5EJEA 1NL3A 2N1BA 5HTKA 4QHYA 1XEWY 2I3BA 3K0EA 3RRNA 3GEHA 1E2DA 3CRMA 4TLDA 1E9CA 4BGDA 2ZM5A 3MG9A 2V7QA 1KY2A 4BFVA 4MRRA 4Q9KA 2VA8A 2CCKA 1NMYA 2A2ZA 4M1SA 2AXPA 3A37A 5F3WB 4LOAA 1EFRD 3Q7PA 2KB0A 1UPTA 4RCYA 5CYPA 1KI8A 3CH5A 3MJRA 1KMHB 2REBA 2GTPA 3DDCA 4GOKA 4C0HA 5K8UA 4YMWA 1KOFA 3KQLA 1W2HA 4WAUA 3REFA 2FNAA 2C99A 3MGCA 3LLMA 1XD2A 3HP1A 4HI0E 3LXRA 2OLKA 4URZR 1JXMA 2PH1A 1M2OB 4PZZA 2GXAA 5AJVB 1H8HA 3EASA 1AQUA 3ZZ0A 2J5XA 2JLXA 1Z63A 4TZ0A 2O5VA 2ZE7A 1QF9A 2QP4A 3M0EA 1IN6A 3T5DA 2F43A 3C7KA 2MSEB 1C4OA 1GG2A 1CJKC 2FA9A 3T1VA 4BLQA 3AVYA 2QT0A 2QT1A 3SHFA 4RJLA 1E9EA 2LKCA 4V0NA 2VQSA 4IFBA 5LD2B 5DGXA 5DN6D 2CCJA 1F48A 4LCBA 3KKNA 2DR3A 2YV5A 3HYTA 4BFUA 1A2BA 4DUGA 2BBOA 2EVWX 3A1WA 5JZVA 2IS4A 2WICA 1IBRA 1FUKA 2QL6A 1G3QA 3SNHA 3ZVNA 3WY9A 3SYKA 1EWQA 1OXUA 2WKPA 2GWHA 1KKMA 2YJTD 3EPKA 3NDBB 4PHGA 3JZAA 1GILA 3AQ4A 2BOVA 4UNRA 2IS1A 1U98A 1UJ2A 1A1VA 3EWAA 4HAXA 2C8VA 3N70A 2ZPTX 2JLSA 5DI3B 2ZYVX 1R7RA 3K0AA 4V0OA 4D4KA 4JLNA 4URUR 1SGWA 1U9IC 1QG4A 1E2GA 4RZUA 1F2TA 3Q85A 4DCUA 3THWB 3X1DA 4DDUA 3QF4B 3CX8A 4NYMR 1KI9A 4QOSA 1ZU4A 4GPTA 2HJGA 2J0UB 2ONKA 3T34A 2V55B 3A6PC 4LJ9A 3RNLA 3AF4A 3PIRA 3BORA 4PC7A 1PJRA 3UIEA 2ZXUA 1PLKA 2JDIA 3SJAA 4E07A 4EQ6B 1FX0B 3ADCA 1KYIA 2H92A 4LDJA 3QNUA 1XU4A 4HAUA 5EE5B 4V02A 2DFKB 1ZNYA 1ZM3A 2R6GA 3QG1A 1FTSA 3QOFA 1TEVA 2AFIE 2HF8A 2EQBA 4B76A 4HZIA 3NIBA 2CNWD 2WJJA 3QIAA 2G1KA 4QC2A 3RHFA 1G8HA 3HR7A 2GCNA 4IDHA 1J8YF 3B9QA 5FR1A 2BMJA 2IYQA 3T1QA 4KXFB 5JLJA 1D9XA 4B71A 2Z5FA 2ZETA 1Q1BA 4LHVA 5FUWA 1VG0B 2KBFA 2JJ1D 2ZSBA 3P27A 4PO1A 4XWAA 2RB4A 2R8RA 5FTNA 4E5UA 1NLFA 1NP6A 1KNQA 1GOTA 1NN5A 4MH0R 1WBBA 3HU2A 3UKDA 4RD4A 4QBHA 2F9MA 4DDTA 5JECA 5CJPA 1S1CA 1DTSA 1OKKA 5BYKA 1VG8A 4DZZA 3WP0A 1MOZA 2QE7D 2NPIA 2IEYA 3QPUA 4BECA 5TXGA 1FPMA 4ZCMA 3ICQB 2HLDD 1HH4A 3BERA 3F8TA 4R7ZA 4XVUA 3PUYA 4DCSA 1NSTA 3T5GA 2GETA 3VNUA 2AD5A 2IYVA 5JCPA 4PPNA 3VKWA 4JLKA 2F3RA 1NY5A 3LX5A 1XCPA 4TTQA 1CLUA 1IQPA 2OILA 1VCMA 4RKFA 4JVLA 4UKDA 2P65A 5SZJA 1AKYA 1MO5A 5EP4A 2QZ4A 1T0JB 3LLUA 1MABB 4P3YA 1XMSA 2O8BB 1Q22A 3H84A 3O8RA 1N6PA 1FP6A 3FPAA 5FOTA 3DM5A 2JATA 2KI5A 2YOGA 2J7PA 1RPZA 2XB4A 4DT1B 4F91B 2C95A 3BE4A 3VFDA 3QSYA 2DWOA 3LFUA 2J0QA 2LWIA 5FBWB 1N0UA 3C4JA 2XTZA 3IO3A 4DEXA 1GWNA 4FIDA 2VHQA 1II8A 2WMNB 4IOJA 2REOA 2OUKA 4C0BA 3GJ5A 4C7OB 3K0FA 4Q4AB 1SVWA 2QMOA 4WA7A 3CWZA 3BH7A 4NONA 4C3ZA 3T12A 3RANA 1MO3A 5FBRB 1NBMA 2FN4A 2WVJA 4IJMA 2Z4RA 3R7WA 3MAAC 2V6JA 4FWTA 1LS1A 4MKIA 3VQTA 1US8B 2CJWA 2DY1A 5DYIA 4N0EA 4AIIA 1HA3A 4DCNA 1DG3A 3LBHA 4JSTA 1E98A 2BHRA 1G6OA 4LJ7A 4BLOA 1Q12A 3F3YA 3ZVLA 2PJZA 3NG1A 4Q48A 3VX4A 4DLSA 3KUDA 1UM8A 2VIIA 3CRVA 4PPFA 1YZUA 1ZD9A 2XXAA 1E2HA 3J81k 1DADA 2JLUA 3OE7A 5KTYA 4JVSB 3THYB 3ZQJA 1YRBA 1XXHB 4XWOA 5K8LA 4GP6A 3DO6A 4BFXA 5L3QA 3GLIB 1NVUQ 2VF7A 4Z54A 1ZNXA 2W6JA 5HCIA 2GBLC 3UMFA 4BPBA 2ZVPX 2ZANA 3BXZA 3K9NA 2OZEA 3SJZA 1B23P 2PZFA 1QHHA 2NOAA 4Q4HA 1OV4A 1VCNA 4A0RA 2Q0HA 1U0LA 2VF8A 2GCOB 2O0KA 4CEHB 4DHEA 4PTLA 1XDBA 2BKEA 1YVDA 1Z6TA 4XVRA 1OLOA 5G41A 4FWIB 1CJMA 2L0XA 2N46A 3MD0A 2HXSA 2VP0A 4UNSA 4OHZA 2JIZA 1VCIA 2WAXA 1M8PA 2EFEB 2BEJA 1WCV1 4URVR 1OE0A 4AKIA 1R5BA 4JLOA 2J3EA 1COWD 1NIJA 5EUMA 2ORVA 2XNDD 1KO4A 621PA 1N0VC 3B85A 4X8OA 4F4IA 4DC9A 3EZ2A 3K0CA 3BIFA 1ZUNB 3R8CA 3L8ZA 3B5JA 3LQRA 2CDNA 2I1VB 2PZGA 4HB2A 2WJYA 1UBGA 3TQCA 3EX7C 5JRZA 1G9XA 4ZI2A 1KAOA 5AJXA 4LV8B 1R0YA 1GIAA 1GL6A 1XCMA 2ORIA 3KJIA 4ARZA 2YOHA 3FFBA 1CR1A 2H18A 3F5FA 4Q1AA 2PMDA 4WXRA 2C96A 3MWJA 2ZTSA 3PCRB 2HF9A 4CDGA 2IWRA 1A5TA 1GNPA 3W9YA 1DAMA 3CKLA 4NCNA 4M9ZA 3C41J 4IEIA 3DM9B 4I1UA 3QKRA 2ZI5A 1GP2A 4IKEA 4NCJA 1YR9A 1GRNA 2GEDA 3ZS9A 4RFVA 3U60B 1U81A 4A8JA 5EXTA 2C04A 1YR7A 3CRQA 3OIYA 3QI2A 3RRMA 1N3BA 4RD3A 3GFPA 2IS6A 3MWLA 1G7SA 1GTVA 1NMXA 4WW0A 4F93B 4TYNA 1CR0A 4HB4A 2B8WA 3FYHA 4GDFA 4UXIA 3SBEA 5J5CA 1MRSA 4M22A 1XXHE 2IL1A 4ZIRB 3GLHB 2ERYA 2D2FA 3DMDA 4LHZA 3GLIE 4FCTA 2JCSA 1OPXA 4YDSA 2YNMA 5JI3E 1DVRA 3OEHD 2IYRA 3W34A 5KPJA 4YLGA 4DSUA 2PX0A 4BFZA 1N6OA 4Q7KA 3AKCA 1CXZA 4JVMA 3R8FA 4QNMA 5EXXA 2GZHA 3X2SA 2QMHA 1I4DD 2XOKD 3P1JA 2A7QA 1SZPA 5L3SA 1CP2A 4XIGS 1L4UA 3U2QA 4KAXA 4DCTA 1VCOA 2CMKA 4CVNA 1A2KC 5M04A 4BRWA 1T3LA 2A5GA 2VBCA 3FDIA 2VSOA 4KU4A 4NMMA 2ZUBA 2CK3D 1XPOA 2OXCA 3H4MA 4PAQA 2XSZA 5CIWA 4Z1MA 1XRJA 1PV4A 2ZE8A 2QMUA 3WP1B 2C98A 4HB3A 4LWZA 2ZUDA 4A9AA 1AKEA 2JLYA 1N0WA 3CH4B 2BBSA 2BM0A 1RKBA 2ONJA 4DWJA 1ONBA 1E9FA 2VYFA 3O8BA 1E2LA 1E2EA 4ZO4A 4KJZA 1RIFA 3D8BA 5GJWC 1WRBA 2EYUA 1A4RA 1LFDB 3SN6A 2WV9A 4G01B 4LYFA 2WJHA 1IOZA 1RRPA 1XTJA 2WZQA 3L43A 4DIDA 4CEJA 2VP6A 2FOLA 3AP2A 4HUQB 2MMCA 2QRNA 3QJYA 3SI7A 4LHWA 4JT4A 4NBSA 5JBQA 5CYOA 3KQKA 2ZAOA 3GJ4A 3A4MA 1EX6A 5E7MA 1R6BX 1VG1A 5FTJA 4XD7D 4BQSA 1H8ED 1U0JA 4MGIR 4FCWA 2VHCA 2XGJA 3OEEA 4AYWA 4MQBA 1RRGA 2Q21A 5AUOB 2BEKA 3FB4A 5F9FA 5AUQA 4G5RA 2X1VA 2XTMA 3EPHA 1IXSB 4TYQA 3B9PA 4TYPA 3K0SA 4H9GA 4TZ6A 3LVQE 2ZITA 2JEOA 1XD9A 3ZIAA 1HT1E 1KZ7B 3A1VA 2ODWA 3KTAB 5LDDC 4AYTA 4UXHA 4JLDA 2QBYA 2VP9A 1AZTA 2V7QD 4C2TA 3W5IA 2J46A 1JECA 2ODNA 4Q1CA 4B44A 3GLGB 1S3GA 1C1YA 1HQYE 2O52A 4PZLA 3PV0A 4ITRC 2WKQA 2J7KA 3SE0A 1FMJA 5LB2A 3TLXA 1E1RA 2IF2A 4TMVA 5KDDA 4LHXA 1E2NA 3UWOA 5JS8A 3GLHE 4HAWA 5C1BA 3GJ7A 1VG9B 4NKRA 3MFYA 4WXPA 1G6HA 2H16A 2QROA 3CLVA 3P20A 3KFXA 4KFUA 2P6RA 2J87A 4LJ4A 2IS2A 1H8HD 3EZ9A 4I4LA 1WQ1R 1OIVA 1E94E 1HEIA 1NVVR 2WPDA 3EC2A 1U90A 4HAZA 3BFVA 3VR6A 4KYIB 4XOIA 1XEWX 1Y63A 4QM7A 1VKJA 1XMIA 5BQ5A 3CW2A 1J8MF 2P2LA 1G7RA 1SXJC 2PX3A 1SHZA 2PEYA 4JVNA 4R9UC 4U7DA 2R6AA 2ZYWX 3WRXC 2D3WA 2OO7A 1XB2A 3HJNA 4PAMA 4DUGD 4O0MA 1JR6A 2G0NA 5DNYB 5GJBA 1O3YA 1ZM9A 3RSLA 2D62A 4A4DA 1FZQA 1Z6XA 3CRRA 1E3MA 2W6IA 1TTTA 4KBFA 2C2HA 4LPKA 4UNNA 2AFHE 2ASEA 1AGPA 4DB4A 4B2IA 4BFTA 1IJFA 4NE2A 5CK4A 3W90A 1E0AA 3U7EB 4IW3B 1C9KA 3AVUA 2PEZA 3PUVA 5EE9A 3D6TB 4EFNA 5FL7A 4C0SA 2IYTA 4JBWA 4A6PA 1P62B 1E1QA 2V4ZA 1XP8A 4XTCS 1DAGA 4D26A 1NF3A 2KJQA 3AUXA 4F38A 2CEAA 1FL9A 1KSJA 2BV3A 3OF5A 3QXSA 5JMTA 3PUXA 1UBCA 1SQ5A 3SFVA 4GBMA 2OBMA 1QZXA 2GVZC 3FHCB 3SS8A 5B30A 5KNCA 1QHSA 3PG5A 3NBYC 3ZS8A 1NSFA 2GESA 3T1OA 1JQLB 4Q4JB 4RZ2A 4D4LA 2DFTA 1II9A 2IYLD 2JDID 1G18A 1T5IA 5K8TA 4L5BA 3SZRA 2WKRA 4P4SB 2F1JA 4AG5A 4M8NE 2W2VA 5IHPA 2GF0A 3IPXA 1FNMA 1IXZA 1G3MA 5B58C 5KSPA 3BC1A 2C03A 2NPFA 2IC5A 3TIFA 2OAQ1 1X8KA 3GLGE 2A5DA 4OHYA 1MRNA 2GZDA 2G77B 4PC3A 2BC9A 2HJVA 4DRZA 1TQ4A 4WZBE 1XBTA 2ZIAA 5BN4A 2CLCX 1KJZA 1E79A 4I1OA 3KX2A 1OHHA 4D0LB 1KSFX 3MJHA 2PT7A 2V3CC 1Q3HA 1NJFA 2FFHA 3G82C 3ZLJA 5K8IA 2R6CA 4IHQA 2ZU0C 5LBIA 5KO2A 4D25A 1KTVA 5FI0B 4DEYA 2CVHA 2NTYC 1AS3A 2ZJYA 4F92B 3SJCA 4TLBA 1OKKD 1TQ6A 3I8XA 4XH9B 1XCGB 4QRHA 4QJ5A 2P6UA 2VPPA 4DCVA 4IEEA 3I1FA 5CK5A 3TW8B 3BOSA 4CZ2A 2P3SA 1YJ5A 1DO0A 3PQCA 1JEEA 1UBEA 4HDOB 1WE2A 2CHVA 4PC1A 1E9BA 2H8KA 2D2EA 2K5UA 3IIKA 4XSHA 4C0QC 5E7IA 5GJVC 1AS0A 1XEXB 4OHVA 5BN3A 4Q01A 4C30A 1P72A 3FKSA 1N6RA 1U9IA 5H68A 3RRYA 1JQJC 1XX6A 2ZI9A 1FQJA 4C2UA 1ZM4A 2WSSA 3KFVA 2VTKA 2HV8A 2DWPA 3BBPA 1VECA 2BDTA 2OBLA 2X2EA 2QNRA 2ZU6A 5FPTA 4B6EA 4M4SA 1VDZA 3HR8A 4B3DA 2EU8A 1Z0IA 1HQCA 1IY1A 1HE1C 2AXNA 3CX6A 3DHWC 2J7PD 2YYZA 3GD7A 1X6VA 1GZSA 1VIYA 4G5SA 4BFWA 3TSWA 2Q9CA 3KB1A 4AURA 4KVAA 5J4YA 1U2RA 1ZM7A 1G5PA 1SVIA 1OH5A 1SKQA 2RKOA 4U5XA 1EFHA 3K09C 3KQHA 3ADBA 4WZAE 3OESA 1KK2A 2SHKA 5KSOA 4AYXA 3BRWD 2W2XA 2QGNA 2NO1A 3ICEA 4R2IA 1FMLA 4JJZA 4BFYA 3KXKA 5GVRA 1NBMD 4QKQA 1KIMA 1XZQA 2RCNA 4MGKR 1XD8A 1E9SA 1N5LA 3H0KA 5C2JB 3AKYA 1DAIA 1DS6A 1Q1EA 2VRWA 5SZIA 3BWDD 5KYKA 1OFUX 4TQ9A 2CL0X 3R9XA 1S9HA 1ETUA 1G8GA 4C0KA 3AEZA 4HZUA 1IM2A 1ZCBA 4PR0A 4Q1EA 4YC7A 1XWIA 3QE0A 3U7HB 2JASA 2EYQA 1DARA 4ESHA 1ANKA 1CBUA 2QUZA 3OE7D 3GCGA 1CR4A 4MYHA 4NYIQ 1KSGA 5CLLA 4EJSB 1XTSA 3B1WA 3NBXX 1W4CA 3EWSA 4B48A 1D5CA 3K9GA 2JJ8A 1KAGA 2W6JD 4A0GA 1NVXQ 4MRSA 5EQTA 3KJGA 5JSZB 4MYCA 2W0SA 1W36D 1QHYA 1VYTA 2V1UA 4L9WA 1SVLA 4Q9LA 4HATA 1Z08A 4EPRA 4TMTA 1TUIA 4TTPA 2UKDA 4BZXA 3HWSA 4PHFA 5G40A 1U8ZA 1BO6A 1ZUIA 3ZVMA 3B1YA 2ZYUX 5DYGA 3ZZUA 3TH5A 821PA 2JA1A 4HUTA 2ZI7A 4Q9JA 1BS1A 4I1SA 2RGGA 4NDZA 5DLQC 2JLQA 2JIZD 5EP1A 2BM1A 4CT5A 4ERNA 1W0JA 3IHLA 3QKUA 1NY6A 2F43B 3I5XA 3E2IA 1TF5A 3SJBA 2AK3A 2CE2X 4NYJR 5AR1A 3HPQA 1U0HC 1RYFA 4US0R 2OFXA 1KI3A 1ZU5A 2RAPA 4KI0A 5DI3A 4DLXA 1OYYA 4ZCLA 3EPJA 2VP5A 2QORA 3R20A 1IJEA 1LW7A 4V0LA 4PSAA 4V0MA 4GZLA 4IOKA 2C9YA 3LD9A 1XZPA 3U3OA 2OHFA 3TW4A 4NCIA 4GMXA 2FGKA 1HTWA 4GZMA 4JIMA 4P4TA 2O8DA 3TNFA 2YZ2A 2YHSA 2F9LA 3KUCA 4POAA 1TF2A 4G3XA 4A15A 4EFLA 4RD0A 4KO8A 1JBKA 1IN4A 1IAQA 3CF2A 5BYJA 3GEEA 1ZNZA 2G3YA 3PEVA 1HY3A 1LF5A 2GA8A 3O47A 2NO6A 3K0AB 2J9RA 2GXUA 2ZE6A 1E2PA 2RMKA 3TGPA 3W3AA 4Q7LA 1TAGA 2HUPA 1CJUC 2GBLA 1G17A 2ZJ2A 1UEIA 1Z07A 5BWMA 1QHGA 3BS4A 4GRAA 4DB2A 4URWR 1ZVQA 2ZRPA 5DSZA 3PEYA 1DAKA 1NIPA 2OLJA 521PA 1R5OA 3IDQA 421PA 1W44A 2I4IA 4Q21A 2CL6X 3DZDA 2JAQA 5TY0A 2F3TA 1K6MA 1YZNA 4K81B 1DO2A 3LBIA 1GKUB 4O3MA 4JJKA 5EP2A 2O8EB 5AWFC 1BIFA 4EJSC 1LS6A 3GQBA 4PPGA 1JXOA 2WWYA 2IW3A 2D4HA 3WMEA 4D2IA 2YINC 3OIVA 3UMSA 3LQQA 4IVPA 2X8AA 1JPNA 1UKZA 2MSDB 3A36A 2OAP1 1JI0A 4LV6A 1XMVA 4TSFA 3CF6R 2GCPA 5LD2C 4LI0A 1OFHA 4RD6A 3DL0A 5KPDA 3BH0A 3WHKA 2GEVA 2IX3A 4B33A 3B7GA 1P73A 1UBFA 1XJ0A 3NH6A 2H7VA 2XSZD 5AUPB 1L8QA 3DVLA 4PFSA 4Z1MD 4HB0A 3WNDA 5TMPA 1G41A 4KYUA 3THXB 1W4RA 1I2DA 2R44A 3VHXA 2XZOA 3X1XA 3K70D 4DT1A 2CXXA 4EIWA 4LX0A 2NIPA 1KI6A 1FP7A 4TQAA 1AS2A 4QGAA 3T35A 2FF7A 3Q3JB 3CZPA 1U94A 3WNBA 4LJ5A 4TL6A 3OFNA 4C7OA 1GRQA 3ZYCA 2Y8EA 4CRWB 5C46F 1N25A 1D2MA 1S3SA 2O8CA 1DPFA 5H1YA 2HCBA 4X8MA 5DISB 3RDPA 4ACBA 4CEIB 4BZPA 3GFOA 1YZTA 4KSCA 2JJ2A 4IXNA 4QL3A 4MGYR 2FZ4A 1N6KA 3OEED 4WZ6A 5GADl 4PHHA 1J2JA 3NTUA 5CDFE 4OYHA 8OHMA 5SZHB 3TMKA 1ZUHA 3TVTA 3THYA 1P60A 3E1SA 3IPYA 3ZIAD 5F2EA 1XXHA 1ELOA 4I99A 4QM6A 3K0FB 3B1XA 1GFIA 2O0JA 3WYFA 3O8CA 4RZ3A 3GMTA 1EFRA 1P9RA 1PZNA 1E9DA 2Q3MA 3KB2A 1P4SA 3R7WB 4L8GA 1HUQA 1VIAA 4LBWA 5KNBA 2UZ3A 2J41A 2E87A 2WOJA 2QENA 4IXMA 1E1RD 2GCOA 4CEHA 4TMWA 2GXSA 1U99A 1AZSC 1LVGA 4M53A 1EFTA 2IK8A 2RGXA 3V00A 3B6EA 2IF0A 2W00A 3TVDA 4IDPA 4Z8YA 1W47A 4RFSA 4UJ3A 2ZRFA 4MKHA 2YWEA 1IN7A 2IBMA 4ASUA 1E32A 3CF0A 4DLTA 1NG1A 5L3QB 2WPDD 2B21A 5J40A 5LB4A 2GXQA 5KU1A 3CX7A 1KNXA 2QAJA 5J4LA 2QY9A 5KUTA 4PC2A 1TEXA 3MSXA 2OCPA 1W5SA 4GSYA 1KGDA 4DDWA 4DLVA 1Z0AA 3QXHA 5JJIA 4N3NA 4LC0A 1CRQA 4M1YA 1W36B 1NI3A 1QHHB 1TQ2A 3K9HA 4BEBA 1OB5A 3OAAA 3GEIA 1Q20A 1YE8A 3RVBA 3LW7A 1M7GA 5TDHA 4D4JA 2PCLA 3IEUA 4OI4A 1JR3E 2G1JA 3ONWA 2V54A 2CLDX 4NU0A 1JJVA 2V9PA 3TR0A 4V0KA 3RS5A 1XFAA 3G5UA 4O2RA 1T3SA 1WB9A 1U8YA 1RZ3A 1KK3A 3H86A 4O2LA 1MO6A 4F4JA 4MDFA 1IN8A 4WOPA 1JNYA 2BMFA 3QKSA 2QTVB 2W6ID 4DIEA 3Q8XB 2NQ2C 3NDPA 2QSZA 2JLRA 5EXPA 1TADA 6Q21A 2ZQ5A 4TMXA 3HPRA 3VTKA 3PUZA 1NNEA 1ZP6A 1WF3A 2LKDA 2QM8A 3Q5EA 1XTQA 3OHMA 1EFUA 4LYHA 5EZ6B 5FL7D 1E99A 4DKXA 3SFZA 1W4AA 1E1QD 3A1TA 3C14C 1Z0DA 3W8NA 4AG6A 2WTUA 2B6HA 3ZDQA 2REXB 1ESMA 1PLLA 3I73A 1KO1A 2VEDA 2ANBA 2QRZA 2NZJA 4RD1A 3AP3A 1KO7A 3DOFA 4G0NA 4ARZB 1L7VC 3QKTA 4OKSA 5D3QA 3U44B 5CB6A 2XZPA 2PL3A 3ZZTA 3AM1A 5B2ZA 5FTMA 3WMGA 1E9AA 1V43A 3I8SA 3CWQA 1EWRA 3GLHA 3IBGA 2OM2A 1R0ZA 4DXAA 4JL6A 4QHSA 3QBVA 4AKGA 4Q1DA 4WIAA 4MA4A 2NO7A 2OV2A 4RD2A 1NBME 3EC1A 3PENA 2GHIA 3CONA 1GAJA 2B92A 3DOEA 4MDEA 1W5TA 3ZQ6A 3X1WA 2EWVA 1OT3A 3ADDA 1A82A 2Q9BA 1WA5A 2CVFA 2QQEA 5JRJA 1HV8A 1Z8FA 4W9MC 1TX4B 4NCHA 3B78A 1E79D 2DYKA 4OQNA 1Z2CA 2ZSFA 3EW9A 1SXJA 4TQUS 3IEVA 1G291 3BFKA 2QI9C 1DAEA 2IXFA 1RRCA 1CEEA 1KJYA 2OFOA 1UDXA 1ZC4A 4FCVA 4FI3C 4EUNA 1K5DA 2RGAA 4B2PA 3RYTC 1G7CA 4NZYA 1CRPA 3SU8A 2RHMA 2YWFA 4F4CA 1G8FA 2CBZA 2ZRLA 4A1FA 4LUCA 4ZV4A 4IOMA 1X8JA 1Q1ZA 2DFLA 2O8CB 2HT6A 2C5LA 3I72A 1WBDA 3NVAA 3WHLA 4B3XA 2BMEA 1GNRA 4TTRA 4LV5B 1CTQA 4URYR 5FBQB 2ZI6A 2HXYA 2WJVA 3FHTA 2QSYA 5FPSA 5L3SB 3GJ6A 4TWZA 3H2YA 5DI9A 2O8FB 4TMZA 3TJZA 4JMPA 3L0SA 4BLRA 3FKSD 3P4YA 3RWOA 4JYBA 5HCNA 5JI2E 1R8SA 1QHIA 3SQXA 4Q02A 1G5RA 3QXXA 1F60A 2WSSD 2IHYA 5G3YA 4US1R 1ZJ6A 4KFRA 2EFDB 4GMDA 5KSYA 1M1YE 2NGRA 4LYAA 3KQUA 3QENA 3SOPA 4GI7A 2XTNA 4YDHB 4JLMA 3RWMB 1EG7A 3K70B 4AKEA 3A1UA 3U3KA 1ODFA 1SULA 1HT2E 2FFQA 1E4VA 2VSXA 2WSMA 2ZRGA 2OESA 1EK0A 2DFNA 1HE8B 1QHXA 2NO9A 4XJXA 4PXAA 5FTLA 2J1LA 2WJGA 5HE8A 1T0HB 4CEJB 1RJ9A 1KDOA 2HYIC 4BWYA 1DG1G 1P7CA 5JWHA 2HT1A 4B6FA 2Z4SA 5J4VA 2G0TA 1NKSA 2ERXA 2XZLA 2ANCA 2G6BA 2GDJA 3SDZA 1G1MA 3CO5A 3CR7A 4YMSA 3NEJA 1IN5A 5FPYA 1G16A 2WWXA 4CW7A 3IO5A 5D3MA 4OI0A 1XJCA 1Z5ZA 1LF0A 4ZDIA 5J4KA 3AGQA 2QA5A 3TRFA 1G7TA 4HLDA 2ZE5A 3UMRA 3U7GA 2HCJB 3FHOA 2ZS7A 2XNSA 3QUSA 4DVGA 1ZBDA 4UNQA 2J0SA 3EA5A 1ZCAA 1LTQA 4HSEA 5KHOC 5DIFA 4HAYA 1X86B 4C4PA 1CF4A 4LBYA 4LJYA 4QBIA 4DLWA 4JL5A 2DCUA 5A0FA 1YZGA 2IEZA 3RRZA 4BZQA 1TNDA 1KSHA 2A3RA 4G1UC 1OH6A 3VR4A 2ZEJA 1B0UA 5KDLA 1F2UA 1P2UA 2WWWA 2QAGB 1O87A 4OQMA 3L8YA 2ZSAA 1WDTA 2ZREA 3O8DA 3VU9A 4ZDWA 1UEJA 2IYYA 2OFWA 4DLUA 2RGNC 3AF1A 3K9LA 3L0OA 4MKGA 2H1LA 4IDNA 1W46A 4PSKA 2NO0A 2FZLA 3DEFA 2QN6A 1IXRC 3K53A 3E5HA 3M6AA 1PVOA 5IRCD 2WJIA 1ZNWA 3T61A 3EIQA 2X19A 3BB4A 2B8TA 1TUEA 1MH1A 1AGRA 3SBDA 2P5TB 4B47A 4PQFA 4MUBA 3SHWA 1RC8A 1M7BA 4A0FA 5B64A 2G88A 1G4AE 4PQRA 5H70A 1Z0FA 2FE4A 3HU1A 3CNNA 4LPSA 3K09A 1UAAA 1BMFA 1SVOA 4AWXA 1GITA 4B34A 2NMVA 3KKOA 2YC4C 2BVNA 2CE7A 4W5WA 2ZSDA 3OIWA 4HDQB 4M0LA 4CIDA 4RVCA 4RCZA 4TYYA 2FDCA 2MSCB 4IFEA 1G21E 4ABYA 4UXJA 1G64A 3AF0A 1U8AA 1RRFA 1YR6A 1DEKA 1SKYB 1R4AA 1E2QA 4TLAA 5UKDA 3EXAA 1E2MA 2IA5A 4Q4JA 3RS2A 1SVMA 1YU9A 1NMZA 2WBLC 4JL8A 3GJ8A 1TPZA 4AKHA 1D2EA 3ND9A 4TLEA 3RC8A 3S1AB 1CJTC 1GL7A 2VHJA 2XITA 1Z6GA 1CJVC 3WMFA 2OCAA 4D6PA 3BD9A 4FMBB 721PA 1V5WA 1X1RA 3GLFB 5JEEA 2DPXA 3U3MA 5HPYB 4DLYA 2IT1A 2BBTA 4B75A 1YHNA 2ZRCA 3KXLA 3L0PA 2R2AA 2V8OA 2IYZA 4MYUA 4BLTA 1G3RA 2FX3A 4G5QA 5AJYA 2YVUA 2ATVA 1AM4D 2HDNB 1YR8A 3ETLA 1ZD8A 2V6IA 1E69A 3W6PA 2GRJA 5DE3A 4M2LA 1T3HA 3ECCA 1R2QA 1VYVA 3RLFA 1Z3IX 1MT0A 4IVQA 4JYCA 3BJIC 3IIMA 3L0IB 5JWRA 5DHFA 2QU8A 4XSGA 3RS7A 2C78A 4O25A 4ZPXA 1G3UA 3P4XA 3U3JA 4A6XA 4HAVA 1M34E 4M21A 4MYTA 1ZM2A 4CGZA 1NN0A 1AJEA 4P32A 5E95A 2PLRA 3FKQA 4IRUB 1YZLA 2I1QA 3AVQA 1T9HA 3UWKA 4FW9A 1XF9A 2B7CA 4TSFD 3U4QA 3K8YA 4HEJA 1P75A 1WP9A 3MUFA 4XVQA 2DBYA 4LBVA 2VL7A 4TT3A 1W7AA 1EESA 1K8RA 4EPWA 4KV9A 3WRYC 1NN1A 4M9XA 4QHTA 3MMPA 3W6NA 3PITA 1GDDA 3DKPA 5HZKA 4OK3A 3MCAA 4GP7A 3AP1A 2OCYC 4JLPA 3FMPB 4ZI3A 1T8UA 3FMOB 3HYRA 2IYUA 1A7JA 3T06B 1T5LA 4IVRA 3U5ZB 3Q72A 3AKDA 3W8RA 3ZVRA 3I62A 2JGNA 4L15A 2OEPA 3RAPR 3OFND 2Q3FA 3U7FB 2FSFA 3FMFA 1UFQA 3HU3A 4B73A 5ANRB 4V03A 1OW3B 3EIEA 1TU3A 3FWYA 3N5CA 3NWJA 4JLBA 3LH5A 2FWRA 3VR2A 2C77A 3BH6A 3KKPA 3LBNA 4E22A 3D3QA 1ZW6A 4NTZA 1KMHA 2JJ2D 4NH0A 3EZFA 5JHHB 4QJ3A 3W5JA 1GKYA 1M74A 4K8OA 4BLPA 4OQXA 1CIPA 1Z0JA 2JLVA 4NYIR 1W0KA 4UNPA 3VAAA 4OHWA 4X8HA 2Z83A 1JJ7A 1TU4A 1XTIA 1FOEB 1Z2AA 1Z83A 4LRWA 2KE5A 4D81A 5DO9A 2OT3B 2VH5R 3GLFE 1KDRA 1Z6YA 1ZAKA 4EJSA 1VHTA 2FFAA 4ZDJA 3B60A 4S2EA 4DLZA 4KCGA 2QQ0A 3KKMA 5JSZA 2BJVA 1YZKA 2GK6A 1PUIA 4CYMA 5FUXA 1ZC3A 5EUQB 4L16A 2IYXA 3BAFA 3QPVA 3KDSE 1G3IA 4TL8A 5EE3A 4AY2A 1P2SA 5FBVB 4FMCB 1LY1A 1W48A 1QVAA 1ZIPA 2FU5C 4HZUB 5EE1A 1KK1A 4JT2A 1XD2B 1CULC 2D7CA 4PQYA 1TQDA 2F1RA 3PEUA 5E7JA 1CKEA 4PSVA 3M1IA 4H1UA 1FQKA 1UF9A 1NRJB 4ASUD 2PT5A 3C5HA 4PX9A 2ZJAA 2GJKA 2VLIA 3R9WA 4Q18A 1P3JA 3GJ3A 3TAUA 4BFSA 4LYJA 5CB8A 3FMIA 4MRPA 2NG1A 3T15A 1KZGB 4HLQB 4X8LA 3GFTA 5F9HA 3ADKA 1RVDA 3GJXC 1OFIA 3OAAD 1KDPA 2ZRJA 3AB3A 2F55A 3EA0A 1Q0UA 3DKVA 1N6LA 3AUYA 3IGFA 5BW8A 2WWHA 4LJ8A 4US2R 3AVTA 3THWA 3VMFA 1DBSA 4R71A 2J59A 4NL4H 1KKLA 1CU1A 3QF4A 3F0TA 4EPXA 2WIAA 2ZRBA 2VP2A 2J0UA 3IQXA 4TL9A 4BE7B 3DZ8A 3REGA 1Z06A 3IBYA 2OSBA 4LHYA 4HLUA 5LPNA 5EE0A 4D0GA 1OSNA 4I81A 4KHZA 4LZZA 4B3FX 4YMUA 2FJUA 4EQ6A 1FX0A 1DAFA 5HKKA 3NHBA 4KFSA 5CDFA 4NYJQ 4ZKDA 2WHXA 2FEOA 3L82B 4DSNA 4C0LA 1JALA 4QG7A 1OH8A 1RE0A 3KJHA 1F3OA 2AHOA 4JBXA 1OF1A 4OJQA 1II0A 3B1ZA 1F2TB 1VYUA 4JLAA 4DSTA 1KI1A 3U61B 5GVSA 5FOWA 2MMGA 1PLJA 2D06A 3Q7QA 2XEXA 221PA 2O8DB 5FFMA 4JS0A 1UKYA 2FFBA 3WXMA 3KQNA 1SVKA 1M7HA 2PBRA 4M1OA 1NLZA 3MWKA 4KITB 4NYMQ 4CF7A 2PLFA 3QY0A 1P6XA 2OE2A 2RGBA 4OK5A 4PHTA 1Z6AA 2UVQA 3LXXA 2IXEA 2ZS9A 4KODA 4TMKA 3R9IA 3D31A 1YZQA 3TUZC 2O8EA 1KK0A 2G83A 5CLQA 4MRNA 1LV7A 1OXVA 3AF2A 5IK2A 4M1MA 3WNCA 3GPLA 3V9PA 2RH5A 3AGPA 1G8PA 1AK2A 1MO4A 4ZCIA 5HE9A 1QBKC 3C16C 4E03A 1E0JA 1EGAA 4GNKA 5FL3A 3UG7A 4LK2A 4NP6A 4BLSA 3OZXA 2Q9AA 3U3RA 3QEJA 3UK6A 2ZJ5A 1F6BA 4FN5A 3PFIA 1XTKA 1SXJD 3LO5A 1W49A 3B82A 4QBGB 4AK9A 2JLZA 2JLWA 1EXMA 5B57C 1DE0A 3Q9LA 5EP3A 4EFMA 1X8LA 3GP8A 1M6NA 3IIJA 4B32A 1E9RA 1NG9A 1P9WA 4D0NA 4M9SA 1JR3A 3SYLA 3W6OA 3LWNA 4DJTA 3P26A 5FBLB 4ZDKA 1MABA 3THXA 2ZJZA 2F6RA 4C0AC 2O8BA 2ZR9A 2C9OA 2BWJA 1NKTA 2YOFA 4AC9A 5H8WA 3AVVA 3VKHA 2H5EA 3QQ5A 2AD1A 1IHUA 3A8TA 3WBKA 4YXWA 3BK7A 1Q44A 4OK6A 1KDTA 2YKGA 4QGGA 5AUNB 2F1HA 4D82A 3NKVA 4JLJA 4Q4AA 5GJCA 4B2LA 1G5TA 1XPRA 4CEIA 121PA 4A82A 3CPHA 3KZ1E 1LB1B 2IHBA 4IDQA 4M1TA 3IQWA 1US8A 2VO1A 1DOAA 1E96A 1VPLA 4TL7A 1W2GA 3A58B 4PO9A 3AV0B 3TKLA 3C15C 1KI4A 1EX7A 4EPYA 2D7DA 2QMEA 4XWKA 3PR1A 4R98A 1KI6B 2R65A 3FE2A 4HLUC 3TQFA 4V0ME 2AKYA 3KXIA 1WMSA 1S96A 1S1MA 1TF7A 2A78A 3FTQA 2EWWA 1II8B 5P21A 4II7A 4OJKA 1HYQA 2PMKA 4EPTA 3NXSA 3AVOA 3LY5A 1G19A 2QGZA 4Q1FA 3TAHA 3WBJA 4BASA 3GLIA 2BJWA 1Z28A 2ZVQX 3AH8A 5JS7A 3A1SA 2YC2C 3TE6A 1P9NA 4TLCA 3QXJA 2VHTA 1MKYA 4FMCF 1J90A 1YKSA 2AL7A 2FPMA 4RY2A 3PJRA 2CJWB 3NH9A 3B8HA 4R2HA 4FMDB 3QVUA 3EZ7A 3UXMA 4A0HA 4Q47A 3VX3A 4OQLA 2GKSA 2ZR0A 1OJLA 2GJ9A 3FVQA 2FPKA 4ON9A 2ZRKA 1XMJA 2FEMA 1VMAA 4PPQA 5L3VA 2H57A 2J45A 2XXAB 2P6NA 3EARA 1BYIA 3QXCA 5FI1B 1JEDA 4A2WA 2AK2A 3U6KA 2V1XA 2ZRDA 1OIXA 1S2MA 2DHRA 4ESVA 5AJWA 1YRAA 5FUYA 1LNZA 4KLZA 1GSIA 1WXQA 3TUJC 5CIQA 5JHGB 3SEAA 3SQWA 2G9NA 1E6CA 2WAYA 3MRSA 4Q4HB 5DN6A 4JSYA 5F98A 1E2KA 3P32A 2HEIA 2OXRA 5L8VA 1FTNA 1ZMXA 1BH2A 4Z51A 4W7SA 5JFGA 1OYWA 4RFSB 2W2TA 3FGNA 4PANA 4RSGA 4YQFA 2X2FA 3NC0C 2W83A 2ZRHA 4B3GA 2FGJA 4GL2A 4KLNA 3TUIC 2P5SA 2ZJ8A 2CHGA 4P33A 4DBLC 1GL9B 3ASYA 3B1VA 5KSZA 2GZAA 2C9CA 4RZXA 4U00A 2QG6A 4AI6A 2FSHA 1E0KA 2CL7X 2KBEA 3ZD6A 3EIHA 2QPTA 3JVUA 3TK1A 3E70C 2QP3A 3CUEF 3U6BA 1Q3TA 4B74A 4HYYA 2ZAMA 1ESNA 2BCGY 1L2TA 3QVVA 4EAQA 1BMFD 3I32A 5L3RA 3CPEA 2ZRNA 1E2FA 1R5NA 3CB4A 3U44A 2KWIA 4ILEA 5FUVA 2BMDA 4KFTA 4Q03A 5KDOA 2ZI4A 3QKSB 1KY3A 2EFCB 1DAHA 1Z47A 3AVXA 1KO8A 1I4LD 3CPJB 2BBWA 3EPLA 4J0QA 2AKAB 3CRW1 4Q5IA 4ZIRA 3QKRB 2EW1A 2RHDA 5CM9C 3BB1A 2Z6VA 3PVSA 3G0HA 2A5JA 4G5GA 5JEDA 5E3HA 2ZRIA 4QNRA 4W5HA 1CR2A 1XNJA 5FOSA 2Q3HA 4DSOA 4UJ5A 4UQOA 4A8JB 1I2MA 2WMOB 5BXQC 3THOA 1UADA 2XX3A 3LAWA 3NHAA 4M9QA 2CNWA 2B7BA 2PZEA 4RKEA 2E1RA 4LJAA 4HDCA 1E2IA 4EKDA 2CLSA 5FOVA 3UG6A 3RSOA 1R10A 1BYUA 3QBTA 1UKVY 2BIFA 1OHHD 2P67A 4P4UA 1OIWA 2JJ1A 4C9BA 3MLEA 5IT5A 3W3ZB 4MGZR 1D9ZA 4DLRA 4GFDA 1ZINA 2RGNA 2WM9B 4MUAA 3X1YA 1ZD1A 2HYDA 1N5IA 2R9VA 4JBYA 4PZYA 5TARA 5BN5A 1FUUA 4TYWA 1ZIOA 1NVWQ 1W1WA 4JLVA 5C4GB
chains in the Genus database with same CATH superfamily
1E4YA 3ELDA 1IN1A 1ULHA 5LXTF 2ZB2A 3GNLA 2CXTA 4LTMA 2HLDA 1ONPA 4ZI7B 5DXJA 3EXIA 2VUUA 1N2SA 2I7DA 1LX6A 1YB4A 2W22A 2V9ZA 2AFHA 2XAUA 4Y1RB 3WGYA 1V1JA 4KBGA 1GV0A 3SY8A 4JOCA 4I1VA 1GO2A 2CCGA 3N2GA 4L8LA 4PV7A 4RQTA 2AFRA 1EK5A 1Q1GA 4F6LA 2YWGA 1RNLA 3JZIA 3COJA 1DBPA 2EHJA 3C3WA 3NJ8A 3EE6A 2W0MA 3SOZA 4C0JA 4PO8A 4R5MA 3REOA 1UMCA 4R31A 2ORWA 1BWRA 4UCXA 1FBNA 4TWRA 4L85A 4NPAA 1G4UR 2BM9A 3E58A 4ALKA 3ASZA 1EE1A 3FUTA 3E3MA 4CG2A 2DHDA 2GPAA 3LI2A 3ID6C 4OI1A 1DIGA 1F3LA 4UUNA 4CKEB 5CFRA 1HOTA 2IOFA 4G85A 4YRAA 3PPVA 4I6JA 3FMVA 3PGKA 4OHRA 1E0SA 3JQAD 1L8LA 3ZGVA 2J9GA 3ISJA 5HR5A 1ZW1A 5IM4F 1XI2A 5C81A 2B35A 1XALA 3KU4A 3PEFA 3NOQA 2WLTA 4KSYA 2QLBA 5EMHA 1BFUA 2ZS8A 3C4QA 5JXJA 1I14A 5FA6A 4OKNA 4ENQA 2GLTA 2FMXA 1PEAA 2JIOA 3KKEA 4ICIA 4NX2A 2JIMA 1CRWG 4FFBA 4LW8A 1GA4A 1AURA 3WYGA 4QT4A 6PFKA 5FV7A 5ICCA 3VR5A 4RIHA 1GU7A 2GK7A 2W4MA 2HL6A 2XF8A 3KB8A 1KI2A 1RRVA 3MWYW 3H1TA 5EPOA 1J0AA 1UP7A 3CQ9A 3CNLA 2IUSA 3FNIA 3NOVA 3NUGA 4QBFA 4REQB 4F7WA 2OM6A 3PHLA 2OG1A 2G8LA 3DD5A 1FTQA 1ZH2A 4Q7MB 2ODTX 1FTYA 3A9RA 1OXXK 3EGEA 3WLJA 1R12A 3KOXA 1ABBA 2B1IA 4XUCA 3PC8C 4OH1A 2Q5HA 4YRGA 1KFJB 3FKJA 1CZKA 5DK6A 2BMAA 3WWZA 4DMUB 1O6FA 4OXKA 2Q0XA 2QTFA 1CY4A 3F3KA 4N5DA 4CF4A 1RJ9B 2X77A 1FFHA 4KE9A 3IAAA 5IARA 1MQSA 1NQWA 2ASVA 3F97A 3RS3A 2BCJQ 3F2VA 5J63A 2BZGA 3LYAA 4QTUB 3RYFB 5FULA 4R2JA 2QBYB 3WOVA 4MS1B 4UD2A 5M29A 1Q2XA 2P9HA 5CLIA 3Q87B 2JFQA 4HNGA 2IWHA 1GVNB 2IYNA 2P11A 2ZUWA 4S1PA 1U31A 4FZJA 5KQLA 4DYDA 1KXJA 2FFRA 2HSWA 2J0VA 4P0TA 3SMVA 2BGRA 2R6FA 4COOA 2HRBA 4QGHA 1QG2A 1L4YA 4WVFA 1BEZA 1RQ2A 2Q4OA 3VDRA 1XEFA 1H9AA 1MNQA 2FR0A 4RJ2A 1WEKA 4BNWA 3H0EA 5AM4A 4E51A 3SQNA 2JGDB 1KJ8A 2XRMA 1MGOA 2Q0QA 1G6KA 1NQXA 2CHEA 4DWVA 1S2GA 3OLVA 4P54A 1G8YA 2PQMA 3SE7A 1BMDA 4A2PA 3TSOA 1JLHA 3TFOA 3GJYA 4OP2A 3BFJA 3DQQA 4Z2YA 2X86A 3GHHA 1UWLA 3CE9A 2FZEA 3TLCA 5A9RA 1P3DA 4I9FA 2A0FA 1LDGA 1G9TA 2Q3DA 3M89A 2VDLB 4QUAA 3OOJA 1COWA 1JAHA 4Y0VA 4Z1OA 1QHNA 2F7SA 4LQLA 3R3UA 5ALTA 2OP0A 2YWBA 3KSDO 1UDWA 2DPLA 3NFYA 4QFBA 2NU9B 4BLUA 4EUSA 1S5PA 3IIIA 4K6KA 5K0BA 1JFFA 2O2YA 4IR7A 1NVVQ 1XXLA 1KP3A 5DH9A 4KVFA 1X80B 2E5WA 3NGLA 1T3GA 1F2UB 1JIVA 3BGWA 5BVGB 4GOXA 1IPHA 2IPAB 2VHZA 4GMKA 1NNEA 3GP3A 2EFHB 4KQ1A 4D97A 3VU9B 3ZDXB 5FOUA 3QPCA 3LDAA 3BE6A 3TR5A 2IOYA 3MD9A 1SG6A 2Y27A 4JUBA 4MKFA 4NJOA 4OL0A 3PXXA 3F6BX 4WZAA 1T9GR 5BSHA 5LVAA 4WKBA 2AHRA 3FFAA 4FGJA 3VPXA 1XO1A 1T5HX 4X1YB 1AUOA 1SELA 2XJ4A 1O1YA 5H3LA 1T8TA 4GF5A 3CUTA 1BKDR 4QGFA 2NZVG 1I10A 1RQGA 4CHTA 2OHIA 4RPKA 1Z18A 1CHNA 1LDYA 1N5JA 1YQTA 2GZ2A 3AWIA 3I92A 4YAJA 4EEZA 4M0CA 1N5KA 2ODBA 2QDKA 3HHPA 1XCJA 4F71A 3SVLA 1YCDA 1IIBA 3VHLB 1BOFA 3EFOB 4P4NA 1TRKA 1ST2A 4X20B 4GH5A 2IP4A 3FDJA 4N7BA 5IVDA 3UMJA 1XN4A 1YQWA 5EJAA 2A92A 1TVEA 2QEQA 2YRWA 3IPCA 4AF6A 3NIFB 2HBRA 3JU3A 2FV8A 1PNTA 2DQSA 2WKWA 3K8QA 1VB5A 3PZRA 2GAOA 4HRVA 4IUDS 4FKMA 2Y0CA 4G1EB 2ATXA 3ZWMA 4DJJA 1U2ZA 1D0IA 1CQIA 4V0RA 5KVQA 3LSYA 1R5JA 4A2QA 3JQPA 1S0UA 2ETXA 3NP7A 1R0XA 2BEVB 1XYVA 2XJ9A 3CR8A 2JZCA 1HRDA 1D8AA 1VJCA 4OQEA 1GM5A 2A5YB 4S1NA 1KDVA 5I3CA 2VT2A 4E15A 3RBXA 1Z0KA 2XMSA 2NW6A 2O3UA 4NHOA 1JFVA 3JATA 2HU8A 2P4HX 2UZIR 2YHUA 3LBYA 4JKYA 1JKJB 2XTAA 4XR4A 3ZWXA 1POWA 1TVKA 1DX4A 4AD8A 2XF2A 5J4HA 5CA1F 2Q4EA 3BWVA 2V6MA 2WM3A 1E89A 1Z9BA 3LT4A 3N2EA 3R77A 3QF7A 4QXRA 5TVKA 3KVVA 3DTVB 5A1TA 4C4OA 3V4LA 1CS4C 3ZXYA 3CM0A 1PJAA 3NJRA 5CVCA 4N5MA 2AYYA 2W48A 3CZ9A 3LT0A 3DF9A 4CBVA 2X5NA 1KIAA 4TXLA 5B37A 2GN4A 3WA6A 5A4JA 2E55A 4E09A 2ENWA 3N0TA 1JAYA 3B5IA 3Q10A 1W6UA 4ZO7A 2WTBA 5ALFA 2YQ4A 4MWOA 1ESCA 1O9GA 4J0DA 3QXGA 4QEKA 4NNOA 3RS4A 4IHAA 1XEXA 4AX8A 2BISA 2QAGC 2PL1A 3IOEA 3LV8A 2C5BA 3LJKA 1KI7A 3D3WA 3KXDA 3P2OA 1E3JA 3SYTA 2NVWA 4OKIA 1YFJA 1AN0A 1O95A 2FVYA 2XMPA 4H3KB 3RGGA 1FDRA 2VI5A 2XVMA 3LQYA 4BBZA 1NP7A 1QOQB 2IHJA 4UEKA 1EDEA 1B6RA 2K7ZA 1EFCA 4LSGA 2R62A 4TUYA 4UULA 3W77A 1R4MB 2YZGA 1ZLXA 3D0KA 3TSYA 2H7CA 3DCIA 3QG5A 2QZ9A 1ZVMA 2EKPA 4Q12A 4YRJA 1M2FA 3MMXA 2VRCA 4DYVA 5C7OO 3ZD7A 3R0QA 5KVCA 1G4HA 3CIOA 3GCZA 3ZZ1A 3DONA 5I51A 1E1NA 1P2TA 2BKUA 1JHRA 1MFZA 2ZR8A 1JT9A 3CT4A 2ECKA 2QR2A 4DR5B 3EGCA 1A97A 4YXWD 4KACA 4CT4B 5DX0A 2AEMA 4HQFA 4DJAA 4GYWA 1Q57A 3U4QB 4I1YA 4LX8A 4R8VA 5BSEA 4V2IA 1NW4A 3CG0A 1WR8A 2R00C 4RZIA 2F3UA 1NN3A 3U7IA 3TSZA 1IHXA 3R6LA 3GLKA 4LC1A 3RT7A 3T5TA 4TN1A 4DV0B 5TQ2B 2WNIA 1QK4A 1SKYE 1OXSC 4ACAA 1CF2O 1PNVA 3QVTA 3F5SA 1I5RA 1GNQA 3HDTA 5JVDA 2BUCA 2ZLBA 4LG1A 5TV2A 3ZH9B 2G9QA 3GVIA 4NBVA 1WIWA 1IRIA 4XLTA 3UOGA 3F67A 2B2XA 2QL7A 3BJRA 2VSYA 3DWGA 4B6RA 4RA9A 4QHYA 4TZKA 1V1MB 3GEHA 3TNJA 5JD4A 1E2DA 2BGTA 2DLNA 3EJ6A 1ZPDA 4P7FA 4UQPA 2AFVA 3C3BA 1UP6A 3DZFA 3O82A 3W9UA 1T5SA 1W5FA 4IDCA 2ZM5A 2DR2A 2J5QA 1SZCA 3UWPA 3C4VA 1BHJA 3UMCA 3GA5A 4BFVA 3WRWA 3K6RA 4LQCA 1DBWA 2G9ZA 3L77A 3HB0A 4NK4A 3RKSA 3V1UA 4RSRA 4BVFA 1BMTA 3NI2A 4LF5B 1RWXA 3OWOA 5HM6A 3A37A 3JY6A 3HEBA 3DWFA 4J3NA 1TAHA 2VDMB 5CYPA 2ZIZA 3CH5A 2REBA 4YWHA 2GTPA 1L5MA 4GOKA 1V7QA 1F8YA 3FCOA 3HSYA 4GZ5A 4D74A 2CXRA 3KQLA 4WAUA 3AOEA 3REFA 1SXGA 1XQYA 2I3AA 3VYVA 5L45A 3FZEA 4R2WA 1C9JA 4HI0E 4Q3EA 2OLKA 1TZ2A 1GD1O 1QP8A 1WU7A 1LK5A 2HMUA 2X7JA 3GIDA 3IXQA 3DFMA 2GXAA 5AJVB 1H8HA 1AKMA 3IDOA 4BN5A 2J5XA 3LKBA 4KXUA 4XW2A 5FWDA 3VPCA 4IIDA 4D9CA 2I22A 3H7AA 4G4SO 4EBBA 4WDRA 1N1MA 2ZUUA 3I9MA 2Q3LA 1WDWB 3DE2X 2XQFA 3I1YA 3OPNA 3WMRA 4EFKA 1AZLA 2MSEB 1GG2A 3C3DA 3CH7A 3I2KA 4F6RA 4HADA 4J9UE 2HRCA 4NXNB 1TCAA 2HPAA 2YN2A 2I3ZA 5HK8A 2QT1A 4FHCA 2QTCA 1QVWA 1KQ3A 2VQ3A 4RJLA 1E9EA 1WZCA 2LKCA 2VJMB 3ETHA 3RROA 1TYZA 1JU9A 4IFBA 4PNZA 5DGXA 2ZXEA 4IJ6A 3KKNA 1SWWA 2DR3A 3D2LA 2OSVA 1J33A 3CYFA 2V7PA 4PCUA 5MN5A 4BNZA 1VJRA 2VPYA 3UGJA 2QTWB 1SC9A 2BRUA 4J7XA 1XLVA 3SNHA 3MAGA 1NURA 3SYKA 1VL0A 1IULA 4GGOA 4J43A 4WRRA 3KQPA 6ABPA 1UM9B 3G8AA 1AY0A 1NAHA 2Q6VA 4QPZA 2FZWA 1TKRA 2QRLA 1XZMA 3JZAA 5LCXA 1LDBA 4AXXA 1XKLA 4NMLA 4HQOA 1N2JA 1QPGA 1C9NA 1DKPA 4X7MA 4E1AA 1OZHA 4FYYA 5IKOA 3EWAA 2MIIA 1CVRA 3PGA1 4QECA 2I6GA 4EW1A 1VP9A 4YJGA 3L4BC 3K0AA 4ERXA 5K8JB 2C8KA 2QLNA 1EUCB 3CS3A 4RXMA 4YP1A 5HBGA 1YXMA 1SD1A 1IQ0A 2G40A 4C7BA 3VPDA 4CM8B 2X5XA 4D9GA 1GTJ1 1QG4A 1P8AA 1QPBA 2WIJA 3ASUA 3DBHB 1F2TA 3QIVA 3QI7A 2YIVX 4RZUA 2JLCA 4QRIA 4WEQA 3CX8A 2C3PA 1X13A 4NYMR 5JAQA 3IP8A 2H4FA 4E08A 2PWBA 1W75A 2PDAA 2ONKA 5AXDA 2C8LA 4ZTUB 4JKOA 4PLWA 3BMOA 4YCJA 2CJPA 4QYXA 3NOOA 2IZ0A 1UBJS 3UAOA 4GPD1 1P1HA 3G7NA 1T15A 1J39A 3EEQA 3SJAA 1EWTA 4NESA 2VDWA 4EQ6B 1USUA 1E5DA 1Q91A 3M3HA 3GPBA 3ONFA 3QNUA 4HAUA 4LDJA 4O4IA 4AO8A 3UJNA 1N0HA 1XTVA 3FDZA 4RIGA 2Q0SA 5CYGA 3ROXA 3JQ7B 1JILA 4K05A 3WWCA 4W1QA 2V98A 3EOZA 3QG1A 4JC5A 5AW4A 2G5CA 1I7SB 2QTGA 5B4UA 3ER8A 3QOFA 1QC5A 2HDOA 3BHMA 3FRIA 4F1KA 2CV2A 3LQ2A 1YUNA 3OJWA 3GC6A 1WXFA 3NIBA 1E3IA 5KTNA 1HE3A 4HHEA 3MGBA 3RYHB 4L5JA 3IMKA 3WFZA 5LBTA 4JASB 1P4HA 2VBFA 2BMJA 2FG7C 4K03A 3MJDA 2DQYA 2ONCA 2RBKA 3MINB 4NAUA 4B71A 4ENSA 1NYQA 1O03A 4LHVA 4OM7A 1VLVA 1PV2A 1VG0B 3MIIA 1Q5PA 5FUWA 2WYOA 4ENVA 5FWXB 1YV9A 4UUBA 1U2DA 5FJJA 3TF5A 1WBBA 3UKDA 1NJ8A 4HWKA 4BO1A 4U2GA 3ZY3A 5CJPA 4FE3A 1S1CA 5HSGA 2PRIA 3FF4A 1ADFA 3JVDA 4M0EA 4BV3A 3L6DA 2LZ0A 3TBHA 4RVSA 3UAZA 5IH7A 2NPIA 5A6SB 3OCYA 1TM5E 5EWMA 3QPUA 3ICQB 8MHTA 1NI4A 4ZCMA 1E59A 3Q3HA 3G5TA 4L78A 2GSDA 3PUYA 4O02B 1EFPA 1NSTA 1FNCA 2I2WA 2FW6A 3DLCA 1WHSB 2WIKA 4MB2A 3ZE9A 2AD5A 2DVMA 3DTNA 1EG2A 3ROQA 3FCSB 4ESOA 2FPGB 1FDUA 4YJDA 2A7XA 2W6ZA 1TAQA 4GC5A 2OGZA 3QU9A 3ND7A 3HB5X 3WA7A 2DUMA 1T9GS 1KYZA 1WXIA 5CEEA 1AF7A 4W5OA 3FPJA 4RKFA 5A3SA 3GFGA 4J0KA 5EI5A 3JWGA 4WTOA 1TZMA 1HXHA 2DMRA 4QPCA 3T3MB 3TLAA 4BKMA 4LXGA 2QYOA 2QZ4A 1T0JB 3COPA 3LLUA 3CMCO 1MABB 1XMSA 3BIXA 1G9SA 3TDKA 1RWNA 2I3GA 1IUPA 4FPXA 5E9AA 2O8BB 2WSYB 2P7HA 4QYTA 3DM5A 2KI5A 1GZVA 1X2BA 1VHDA 1JDSA 3QJGA 2C95A 5IXYA 1WZUA 2RBEA 3LFUA 5FBWB 4EI7A 2FK7A 1UBRS 3V1MA 3FXAA 3EGWA 1E62A 1NAIA 4YV7A 2HB6A 4L02A 3IOYA 1H85A 2XCUA 3GVCA 4FIDA 2VHQA 5TEWA 3WYEA 5F77A 4JEHA 4GEGA 1EFAA 1LPSA 2GT1A 1SXHA 1QH9A 3PTLA 5JBIA 1VKOA 1SVWA 3KFLA 5CH8A 4WA7A 3KLOA 1GXSB 2I2CA 3C1AA 4C3ZA 4AJJA 3RANA 1QO0D 5FBRB 4YAGA 5A62A 1YKFA 2WVJA 4JODA 2Z4RA 4Y7CA 4RKRA 5ALVA 1M1NA 3G2IA 4GLOA 4MKIA 3A6LA 3TQSA 3OQNA 4Q82A 5ICGA 3HKDB 2QUIA 3CGGA 5EMNA 3RTEA 1HA3A 3BULA 4BWVA 1CB0A 3A11A 4CKWA 3VR3D 3DBIA 4GM4A 3O8LA 5H80A 3ZVLA 2DE0X 4BQOA 2BSXA 1NKVA 1K5PA 2P9GA 4MI1A 1PQYA 4J1NA 2YJ5A 1U2GC 1YZUA 3SLGA 9LDBA 4V39A 1YOBA 3V8EA 1ZL2A 4F45A 3AESA 3OE7A 5K4GA 5A4KA 4JVSB 5LFAA 3T3DA 1FNSA 2HPVA 3ZQJA 3OA0A 4JT9A 2PBZA 2Q9UA 3KO8A 2NUAA 1E6EA 2DRIA 4GP6A 4GYYA 2VT7A 5BXYA 5JDCA 5K8LA 3EVBA 3GLIB 4LZNA 3HY3A 2VF7A 1PFGA 4Z54A 3ESBA 4E94A 4BPBA 5BW5A 3FSRA 2O8VA 1AGYA 2ZANA 1WCIA 2ZVPX 3BXZA 2C97A 3S0JA 2VUHB 3ZX5A 3U5TA 3KHSA 5JTTA 3PD1A 2OZEA 1YKGA 3E0XA 4JBHA 1M2JA 4Q4HA 4QPDA 1JHMA 3DT8A 2IV7A 2Q0HA 1U63A 3UF0A 3D2AA 5DULA 4FDAA 3IMEA 2JBHA 2NO5A 2HQBA 4DHEA 4CEHB 3QWFA 1GPNA 2I4LA 3GT3A 1XDBA 3HBNA 2SCUA 1PN3A 1E7RA 5AM1A 4N40A 4GU5A 5G41A 5KWSA 3HCCA 3QLVC 2N46A 5GONA 1OVGA 3MD0A 5LJLA 2HXSA 2VP0A 4OHZA 1PGNA 4F6CA 3EYAA 3LVFO 1TO2E 1M8PA 3R6WA 4F9TA 5JSHA 3IPLA 4MGEA 2C7QA 4G0OA 1QX3A 4G23A 4HH3C 4AKIA 3O2SB 1R5BA 1BOOA 5J9FA 2J3EA 2PSSA 2HY7A 1WL8A 4RMJA 3MLBA 3RTDA 3ZW7A 2JIBA 2W2LD 4G0YA 4BN0A 3B85A 4X8OA 3QTLA 5B1EA 1LRLA 2NTEA 4ADSG 1L5OA 4MQMA 4DC9A 5D1HA 3UUFA 4IZHA 4P98A 5MGBA 4TWJA 5LZ7A 1HG0A 5LNK6 3ETDA 4HB2A 1QORA 4I8IA 4IQ8A 4IIVA 1OZ0A 4LOKA 4A8TA 1AMUA 2VHEA 2A59A 3CKKA 1KAOA 5AJXA 2AW3A 4CTNA 5T6MA 1Y6ZA 1R0YA 3A14A 5K0ZA 4AX4A 4ED9A 3B36A 3QPBA 1Y9AA 1XCMA 4RF5A 2ORIA 4C87A 2A1UA 2PS9A 2YOHA 4K9MA 1Z15A 2VDUE 3P2JA 4EYQA 4AJ9A 3ICVA 2ZTSA 4UU7A 1X7ZB 4DBZA 3GH3A 4NQRA 3AY3A 3WIVA 1RFGE 1UK8A 2VBGA 3RTBA 1DAMA 1WX1A 2CXNA 3CKLA 1MC5A 2RHLA 5KNDD 4ZARA 4FFWA 3C41J 1LVUA 5JYDA 2Z6UA 1AH2A 3FR8A 1NUQA 1UKCA 2PX8A 3NP9A 4IKEA 2MCFA 3WB0A 4EW3A 4RTPA 1GRNA 4ENTA 5A5VA 5A2GA 2CZGA 1TI7A 1WXHA 3U60B 1U81A 3ANSA 3AU8A 3B2NA 3QFRA 3LYLA 4CKCA 4V1CI 3RRMA 4D9KA 5A2QA 4ARCA 5ALIA 2Y1WA 4PQEA 2XWPA 1N3BA 4JLWA 3ZK7A 4KC0A 3GFPA 1PV4A 2BHNA 3AR3A 3GH1A 1FJGB 4BVJA 4AECA 1A8IA 1XQ6A 1W4ZA 2O5RA 5DCWA 3WGHA 1L4FA 3U0BA 3I6IA 3OQOA 1W5EA 4OOEA 3CNEA 3GFSA 4UXIA 3L6RA 5AHOA 5SYAA 4H7FA 3QU5A 1T6ZA 4EEKA 1NZJA 3NT2A 4C0WA 2NSJA 4C21A 3AF5A 3HYSA 1RM5A 2DHQA 2IL1A 3W0LB 2UYYA 1WSDA 2A86A 4GYJA 4MQ6A 2D2FA 3DMDA 2EDCA 4LHZA 5GY7A 2PUAA 3ZW8A 3G2NA 2V7BA 4N3BA 1NVFA 1B3RA 2YN4A 4TS9A 3IQHX 5E7QA 3PNYA 3UGKA 8LDHA 3TG8A 4IIYA 2WQ7A 4RDXA 2PBLA 1R8YA 4PGHA 1UC9A 4YLGA 1LI7A 2XRFA 4JR1A 1DJLA 1JNXX 1CXZA 2QRVA 4QNMA 1CQWA 5G1OA 5JNLA 1TFRA 2FUKA 4Y1RA 1P44A 3P1JA 3GUZA 3B48A 1SZPA 1IMOA 2FWIA 1CP2A 1W0CA 1QE3A 1L4UA 3UXEA 1ISIA 1O08A 1R0RE 1VCOA 3WC4A 1KJ9A 3RW9A 2GD0A 4Z7NB 1ZL0A 4EGAA 5M04A 3PF9A 4FX5A 4A8PA 5HJEA 2QN2A 3N87A 3SQDA 2VSOA 3JQFA 3CX3A 4NMMA 4AU1A 4JP8A 3MJVA 3L4KA 4CKEA 1H5NA 1KEPA 2JVJA 4G5HA 4HB3A 4X6XA 1KWKA 2YYYA 3DEJA 1O94D 3LY7A 4NENB 1E3DA 3LXMA 1FFSA 3CH4B 3GX1A 4WPGA 4DWJA 2ORED 1G21A 2VYFA 3JTEA 4EHJA 3UJ9A 1E2EA 1OAAA 3EG9B 1RIFA 1EE9A 4R8RA 5GJWC 4HJXA 3IC5A 3IAM6 1TJYA 3GGPA 5JATA 3SN6A 5AVZA 1KAMA 2WV9A 3PD7A 3UMVA 4CIVA 1E8DA 1NR1A 3L43A 3OFVA 1XTJA 2YFKA 1WB5A 1PDOA 2UZ0A 3KD3A 2H1RA 4DCPA 2DTDA 4Y6GB 3QJYA 2VJNA 1F17A 5JBQA 1TJ5A 1EWVA 5F3RA 1LDEA 1J97A 3A4MA 1TB4A 1NNUA 3HO8A 5E7MA 2P27A 1U6IA 4XD7D 1RXCA 4U6NA 3DZHA 3X43A 3ORYA 2R6JA 3MHPA 2DPYA 1H8ED 1JWLA 3UJ6A 3I6QA 2XGJA 1IUKA 2PGOA 1RRGA 3THRA 4E1BA 3FB4A 5AUQA 4EA8A 4UW9A 3EPHA 1IJBA 3DNMA 4RTKA 1WDMA 4XCXA 4MARA 4ZOEA 2XDQB 2C84A 4LF7B 3L8FA 4NCAA 3LVQE 1X38A 3ZR4B 4Q7EA 5KNDA 5LL6P 1LQ2A 1XD9A 1LPAB 3T5BA 2Z04A 1KZ7B 1W88A 3ELUA 4MB6A 2Y6VA 4E5YA 5LDDC 3W2IA 4UXHA 1J0CA 3ZEAA 5F76A 1PDWA 4RELA 2VP9A 3R7AA 2QBYA 2V7QD 2FZ5A 3LUAA 1C81A 4MS1A 4CLDA 4D57A 4YRNA 2A0YA 4KIWA 1ZH6A 3B52X 1QTQA 3UC9A 2ODNA 1A9ZA 2X0IA 4FJ1A 4Q1CA 1N7HA 1FFWA 4TTTS 4KQXA 1JKIA 4B44A 5AIBA 4LFBB 2O52A 3GDGA 1CUCA 1T6XA 2DBQA 1VE7A 2QI9F 1Y5LA 1BHO1 2FP4B 4FVTA 4JITA 3L8HA 4ZA2A 3UAXA 2IF2A 4Z0TA 3VH3A 1E2NA 3FYDA 5JLAA 5JS8A 4CMBA 1V96A 4IL5A 2BJHA 3WNQA 3HFGA 5C1BA 1FE8A 2PUJA 3OUZA 5D5PA 1ZVVA 2DHCA 3GJ7A 2IIVA 1TFUA 1SUWA 3U80A 4D92A 1I2ZA 4RW0A 4TWAA 3VO9A 1SPBS 1DKRA 3HJRA 3M33A 4KFUA 4RTNA 1G38A 4C20A 4V3CA 4G8CA 4UEJA 1DJOA 3WIEA 2ISQA 2GHRA 1C0EA 1T24A 3F46A 1WQ1R 1OIVA 3HJTA 5ILGA 3ZNOA 3GUHA 4F3YA 1ZI9A 4XB6B 3KQMA 4QT0A 3G13A 8AT1A 2WPDA 4OXNA 3EC2A 4Y67A 1BA3A 1TA9A 4HAZA 3DL4A 3OA2A 3L7LA 2GKGA 4OFWA 4XOIA 3DE4X 1XEWX 4B80A 1F8UA 4PLHA 3WSVA 4N47A 1RWOA 1J8MF 3I34X 3L93A 4KLRA 2EAUA 4MNTA 4XGRA 4CLOB 1MJGA 2O20A 2ODAA 4GLLA 2ZM6B 2GN9A 2H31A 2PEYA 2CXQA 2R6AA 1SUEA 3IUSA 1VPWA 4FLFA 1XROA 2B30A 4B40A 4P2GA 1E3LA 2ZWOA 2OA0A 1A2OA 1XB2A 3HJNA 5AKLA 2CLHB 2VP3A 5LA6F 2QN3A 3R5XA 2G0NA 3W2GA 4YR9A 5GJBA 1ZM9A 3EBPA 4H0CA 3NTRA 3KZOA 7YASA 3RSLA 3OY7A 3WLFA 4DPKA 3WDKA 2J6HA 3N07A 1BQEA 2POCA 1Z6XA 3Q9UA 3WK8A 2RSLA 2NX2A 4KL8S 1Z7YA 3OZFA 2P77A 1P5HA 3OZSA 4LPKA 3GWZA 2AFHE 3ZC3A 4BP8A 4P6VF 1AGPA 5A3QA 4B2IA 1R4NB 4H59A 1IJFA 1KPHA 5K99A 3W79A 1KE1A 3K1ZA 4PYLA 1J0DA 1H2AS 2B4QA 4MWCA 3AVUA 2PS1A 1YF3A 1HLFA 3DEKA 4RS4A 4EKYA 2ZSUA 2QTRA 5ITSA 1W5AA 4HCJA 4UZFA 2IYTA 4ZD6A 1KU6A 1PS0A 3BFPA 4MPPA 2IELA 3KOWA 3RSGA 4D26A 4UBIA 3B9RA 3L9WA 3AUXA 1OI3A 3A3YA 3C0KA 4RK0A 1E5QA 1YIOA 3K72B 1ZRMA 2C42A 2BEVA 2XVAA 1HL7A 1P5RA 1SC6A 3PUXA 3EVDA 4JJAA 1UBCA 5ELMA 3SFVA 3KYDB 2WU0A 4GBMA 4ME6A 3WLIA 2GVZC 3KJXA 4FC7A 1MNAA 3GDFA 1IZ0A 4YLYA 2GNPA 2PWZA 3LYUA 1Y1KE 4TM8A 4Q4DA 1EUYA 3ZY4A 2GESA 2DXIA 1TEZA 1JQLB 5HRUA 4JGBA 4Q4JB 3MUNA 4KXQA 1E3QA 2DFTA 5KMGB 1G18A 1QYVA 1T5IA 3SZRA 3L06A 3N9IA 1JVNA 3DTVA 3PFCA 4AG5A 5JROA 1LLUA 4LJSA 5IHPA 3KWLA 4MIEA 4OGGA 1IXZA 4CV1A 5B58C 1S3IA 2GARA 1YASA 2I0FA 3L7NA 3SGLA 2O4CA 4OHYA 1A0OA 2OZKA 3KTDA 4ZRMA 1FU4A 2FWMX 4BNFA 4DL9A 6REQA 5A9SB 1ZMRA 3RYIB 5FYDA 1XBTA 2ZPUA 3OZEA 4L0QA 4P9NA 4DLLA 5IU6A 1N8TA 5TQJA 3ZJUA 3N2LA 4MHSA 4I1OA 3KX2A 3MJHA 1LPOA 3AU9A 4PX5A 2EARA 4JP3A 5EVJA 3EW7A 1U7TA 2V3CC 1NQ5A 5ALEA 1HO3A 4Q3LA 5BQFA 2ZYRA 5B4TA 4KMSA 4MKXA 1SUFA 4HDKA 3IP3A 5IM5A 3ROMA 3ZTTA 5IZCA 2ACKA 5FI0B 4DEYA 1THZA 2CVHA 5EFZA 3BXHA 1DC8A 4DLNA 1AS3A 3MHTA 3RVJA 2CFOA 3QV1A 3PF8A 1KC3A 3JZDA 1Y4UA 4RKWA 2MDTA 5EZYA 1UKBA 2R84A 1U3GA 3PI7A 1DRUA 4XH9B 2MU1A 4YRQA 1C3JA 4CETA 4DCVA 3DB1A 3TW8B 4ZEMA 5CK5A 3MBKA 4CZ2A 2B4YA 1DO0A 1LPBB 2PKCA 4TMFA 4I4TF 5AW1A 3KQWA 3SX4A 1JDBB 2FWAA 5I4BA 4W8HA 5F4BA 2ICAA 3H9JA 1Z0UA 4GEKA 5DOVA 3U3XA 4PYKA 1JIJA 1MU0A 4C30A 1JE1A 3DZJA 1U9IA 4XQGA 4RAQA 1RYMA 2JA2A 1Q1NA 4JJIA 3IT3A 4ZOLF 2ACVA 4CL3A 5TQ2A 1ZM4A 1GPKA 3S1LA 4TXHA 2HV8A 1HMYA 4DGQA 2DWPA 4GQIA 5CW1A 2OBLA 2X2EA 3E03A 1BVYF 1XDSA 1P6UA 5FPTA 4B6EA 1RZRA 3HR8A 5K7SA 1Q3KA 1JG2A 4K0KB 4LN1A 1QU3A 1KIFA 2Z2JA 5K6RA 2AXNA 2CJXA 4NFHA 5REQB 3O9VA 1ZK1A 2I3DA 3NNNA 4L07A 4R69A 4CG1A 2A67A 2H85A 4AURA 4ND5A 1U2RA 3FPFA 1U4SA 4ZT5A 3T4PA 1REQB 5AKHA 4U5XA 2C54A 1PK7A 3K09C 3KQHA 1JJAA 2RFLA 2WZDA 4KN5A 4YAIA 1VRWA 1M73E 3I1JA 4WZAE 4LXHA 1KK2A 1OFVA 3E5NA 4XASA 3MTGA 4AYXA 4BYMA 1YACA 5KSOA 4ALJA 2NO1A 3BSFA 3JALB 4RENA 1WSAA 1GTZA 2QT9A 1V47A 2LVBA 3PSHA 3H1FA 1XD8A 4IXWA 4TSKA 1K7XB 5MGNA 2I6SA 3KOMA 4MRMA 1DS6A 1RHRA 2V4UA 3QBJA 4HP8A 1ESDA 3FPEA 4QTXA 3BJZA 4JXKA 3BWEA 2YYSA 5CGQB 1BXRA 1U02A 2XYHA 2G28A 4WNYA 4YRMA 3LFHA 3TQHA 1ETUA 1G8GA 2ID7A 2WG2A 2M6KA 4LK3A 3QFHA 2L19A 1GN9A 3F78A 4Q1EA 2FEKA 3TMAA 4KK3A 4D9FA 4TKUB 1H2BA 3CW9A 1IEWA 4YI3A 3ANYB 3KPWA 2QUZA 3BXPA 1C7QA 4MYHA 3DOJA 2CDCA 3PRYA 4M8IA 5HGXA 1QP0A 1VGQA 4EJSB 5F35A 4HVTA 1D09A 1JMYA 5IEBA 1D5CA 1NF9A 1OLSB 1P7ZA 1YSCA 3N58A 2JJ8A 2H2HA 2COKA 2W6JD 4A0GA 3IMGA 3HN2A 4MI9A 3T7EA 2AOTA 2GN6A 3B6IA 4C05A 4ENWA 5HRAA 1OZAA 4PLTA 1T36B 2GX6A 3DBVO 1GQQA 1Z08A 4I5GA 2BF7A 2OQRA 1Z2EA 2YDYA 4TMTA 3WMWA 2VNHA 1MENA 1TUIA 4GUDA 4EPRA 2VNJA 2UKDA 4BZXA 3HWSA 1TLLA 4PHFA 5G40A 1YRYE 3RHTA 1X1EA 1ZUIA 3ZVMA 3ZZUA 2ZYUX 1GAXA 821PA 1VJTA 4GZ6A 2ZI7A 3ZZMA 3JAWB 2I2FA 2CFSA 4D8XA 1TGVA 4H3HB 5CH3A 5DLQC 3V48A 3WGGA 4P82A 5EP1A 4FFOA 5JAIA 2RAVA 1G2QA 3GLTA 4ZV9A 4EG8A 1NY6A 4UEOA 2XYGA 2F43B 3Q7TA 3R7BA 4BUZA 2Y67A 3QMVA 4C6HA 2P9JA 3MELA 3MMSA 3PDUA 4AICA 5BW4A 3RVDA 5CX4A 1U0HC 2IYFA 2TMDA 3H18A 1OV6A 1RYFA 3PSAA 5HGJA 1VMEA 4BAZA 4C04A 1ZU5A 1U7OA 1USVA 2ID9A 2O7VA 2Q5EA 4IRMA 3KHTA 1YBHA 1T35A 3V9AA 1RXSA 4EDFA 1B2RA 4JMLA 3DB2A 3B1JA 1PZMA 1QGZA 1GPDG 4PSAA 4QOFA 3VC1A 4PAWA 2RIPA 1RC8A 4MV7A 1MAUA 3TZCA 3VNBA 1YQDA 3VOAA 3LD9A 3SR3A 4QTYA 4GZMA 4P4TA 2VXOA 4LGCA 1QBGA 1DKOA 1SM4A 2YZ2A 1PSWA 4OYLA 3TNFA 5EQFA 4B45A 5DHQA 4MHTA 2F9LA 3K5HA 2WM8A 4UZSA 4A15A 2TMGA 4EFLA 3M6MD 3CF2A 4N54A 1BA2A 2E48A 4BCCA 4BXOA 4K5QA 1KJJA 3RG2A 5KYUB 4B7ZA 1E0DA 1LF5A 2GA8A 1YE5A 4UVDA 3CEJA 3O47A 4RYLA 2NO6A 5FP0A 1FFXB 1E2PA 4G9GA 5I7VA 1HTTA 2RMKA 3ZI7A 5KCMA 3CHYA 4F60A 3KJFA 3EXFB 3CV3A 3INTA 3IXLA 4S04A 2IOFK 3ETJA 2Q1WA 1CJUC 2XH8A 2GBLA 2SKDA 4EF6A 3U39A 1K0UA 2B6NA 1QZUA 1WY5A 1Z07A 3F9RA 1OBCA 3RYHA 1OC4A 2YYAA 4Y2PA 4F8YA 4QXOA 3PEYA 521PA 3MINA 1VE3A 3OFSA 2WHPB 3ZCRA 3OM1A 1SA0B 2F17A 1EXDA 3MWFA 4MS3A 4X94A 1J8QA 3IDQA 2YIDA 3DNPA 3I1IA 421PA 3ZU4A 5IDXA 5JJCA 5G4KA 2CL6X 2HSDA 3HXTA 4QIHA 4NG4A 5HFNA 3QPAA 5TY0A 4K81B 1QGED 5FXMA 2WRZA 2YV1A 3TZEA 1N9GB 4ZEWA 1F9AA 4DSZA 4B9EA 2IBTA 4WKGA 5KTTA 2RJOA 2FPIA 2V7UA 4CCWA 4PPGA 4UPDA 5A6SA 3T9FA 1TLTA 1T8YA 5I9SA 1X7YB 2P78A 3BBLA 4MWEA 4WL0A 3WMEA 2J09A 2QTMA 3OBIA 4P5DA 5EJFA 1JG7A 5IH3A 1N8SA 2VUTA 2YINC 5TE9A 3UAYA 3LQQA 1JPNA 1WHSA 2MSDB 3A36A 3IDFA 4CMGA 3E9CA 2OR3A 3Q3GE 5MDHA 4Z4GA 5CVUA 1DKNA 3S2FA 4OREX 4TSFA 3RRJA 1W87A 4ETMA 1ZWLA 1E6LA 4RD6A 2BI8A 2FQWA 4EF4A 5HIKA 5KPDA 5D86A 2ZT6A 1JBEA 2FTKE 2I7TA 2IPLA 1P9OA 3TVYA 5KYWB 1PZGA 2D5IA 1PIWA 2PWPA 3J80A 1RAHA 2VG8A