1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
2AKYA 3THXB 5KPJA 4L8GA 4HSEA 5BYJA 2RHDA 2A7QA 3CH5A 4B3BA 4KXFB 3ZZTA 4RCYA 4MYHA 5J4HA 4I4LA 3IQXA 5H68A 4BQSA 5IT5A 1G8GA 4DUGD 2XXAA 1N6PA 2QT1A 2J59A 1YZQA 3NG1A 4OI0A 4Q7JB 1G291 3PCRB 4A0GA 3CRW1 1WE2A 3AH8A 2Z4RA 4LJ7A 4LYHA 5FOTA 4DLUA 4W5JA 3ASZA 2R8RA 1KI9A 2CJWB 2SHKA 1KAOA 3FMFA 5FUXA 3ONWA 4PZYA 3BFXA 4ON9A 1E79D 1OXVA 1OXTA 3AF1A 1Q57A 1ZNWA 1NN0A 4JLPA 5EP4A 3FHOA 4EKDA 3KKQA 3RS4A 1UAAA 3GLIB 1P9WA 2JJ1D 3CNOA 3CF0A 5JWOA 2YWFA 1Q1ZA 3U4QA 4BGDA 2WIAA 1H65A 4ZV4A 2GF0A 4IDQA 2W2VA 1KMQA 1OFUX 4MYCA 1BYUA 4OHYA 1Z3IX 4LV6A 2QSYA 5HKKD 1KKLA 1XPOA 3QXSA 2QAGC 1FQKA 4MGYR 4P4TA 1NY6A 2WV9A 1NRJB 3BXZA 2G1JA 3KQLA 2FSFA 2VP6A 5JRZA 3CNLA 2V6IA 4ESHA 2ZJ5A 3LXXA 4QHYA 5CB6A 2CVHA 1FP7A 1D2EA 1S3SA 1DAFA 3B1VA 1COWD 1KMHB 2AX4A 1PUJA 5EXXA 5KPDA 4DEYA 2GNOA 3TK1A 3U7HB 1E32A 2OXRA 1U99A 2C98A 1W5TA 1BKDR 1VIYA 1XWIA 1G41A 4JLDA 3AV0B 2KE5A 1FOEB 4BEBA 1WRBA 1TQ2A 3PEVA 2BMFA 3W6OA 5DISB 1D2NA 3BK7A 4OK3A 2IA5A 2QN6A 4IXNA 3MWLA 2WWYA 3EZ7A 1Z08A 2XNSA 4DEXA 1SULA 1FQJA 1W4CA 2QRNA 4E5UA 4LGMA 3BBPA 3CIOA 5G3YA 2CCJA 3VU9B 3WRYC 4GSYA 4B3GA 2ZU6A 2GVDC 4GRAA 2FEOA 1W4RA 2RGNC 1GRQA 4DCTA 3AF0A 2YINC 5AUQA 2QP9X 4DLVA 1TPZA 3LBHA 2OBMA 4LBVA 1MABB 1T3SA 2GK6A 1WF3A 2VP5A 2W83A 2ZJYA 4OL0A 2ZSEA 4TSFA 4AD8A 4C4PA 2O0JA 1W36D 1G3RA 4MGIR 1JQLB 3D3QA 2V8OA 1E2LA 2XGJA 2P65A 2EFGA 3O8DA 3QKUA 1CTQA 1G16A 4ACAA 4XWOA 5JHHB 2FPMA 1QHHA 221PA 4N1AA 3ZGXA 3UK6A 3EIHA 1ELOA 3LQQA 5E4FA 2KBFA 4Q9IA 3IQWA 3BFKA 4FMCF 1F60A 3U60B 3DEFA 4QNMA 4PFSA 4LRWA 4PQFA 3T5GA 2BOVA 4PC6A 1T8UA 2RGNA 2WJGA 4OJKA 4RKFA 2ZRCA 2W6JD 3B85A 1E99A 4M1SA 5HTKA 2G3YA 4TT3D 1EWQA 4AI6A 1U94A 4XJXA 2IXGA 2HT1A 1E94E 4DLZA 4C0QC 2Z4SA 5B2ZA 5JEDA 3VNVA 2GKSA 1GG2A 3IIMA 3VR2A 5AR1A 2VL7A 3ETLA 4MYUA 3THWA 4Z8YA 4C9BA 1NY5A 1YZKA 3RRMA 3BRWD 2ZITA 2CLSA 4C7OB 3QEOA 4B44A 2PX3A 2B6HA 4C0LA 1E1QD 2NPFA 3VMFA 4L9SA 5KU1A 3CF6R 1GIAA 1OYYA 2QMHA 1OJLA 2ATVA 3FKQA 1FTNA 1J8YF 4KO8A 2NPIA 2C78A 3GLGE 4YMVA 4HUQA 5J5CA 5FBWB 2GJKA 2JIZD 3LBIA 1KYIA 1MOZA 1R5BA 3TUZC 4Q02A 2QG6A 3T5DA 3FDIA 3ZYCA 5FBVB 3NBZC 3NDPA 1SVMA 3GEIA 4ZPXA 3KXKA 2GHIA 2WWXA 3RVBA 1KI2A 2FPLA 1JPNA 2H1LA 1ZCAA 2V6JA 3MMPA 5EP3A 3PEWA 2HJVA 4P4SB 4ZDJA 1XJCA 2ZE7A 3UIEA 4A0FA 4F4IA 5BXQC 3ICEA 1H8HD 3QPWA 1H8ED 2P0EA 2Z5FA 2AFIE 1CULC 3B78A 1W0KD 2F3RA 4BFVA 1RJ9A 2O8FB 3T34A 4IEEA 4M2LA 1X8KA 1ZCBA 4IDNA 2O8EB 2PZGA 1GKUB 4TYWA 1CR4A 3AUYA 3HU3A 2IEYA 1NI3A 3M6AA 3OIVA 4PHHA 3EPKA 4ARZA 1XMVA 4GNKA 3DZDA 2QM8A 4JJKA 4C0HA 2QP3A 2PBRA 4D80A 2Q0HA 5FTLA 3QE0A 4UNSA 2WSMA 4NPHA 4ZO4A 2YC2C 2JIZA 3ZVNA 4JVMA 2O0KA 4II7A 3ZS8A 1X1RA 2FFQA 2ODWA 4KLZA 4B2IA 3PFIA 2ODNA 2J41A 3LV8A 4YXWD 3D7MA 4BFXA 1QDEA 5L3SB 1XTQA 2J0VA 4HZIA 4ITRC 2ZROA 1E0SA 2JA1A 3KFVA 3Q5DA 1II8B 1Z6XA 1F2UA 2GAOA 3O8RA 1CRPA 1DE0A 3WHLA 3EPLA 5KDDA 1UFQA 3SYNA 5JCPA 3FGNA 1I2DA 3DOEA 1AZSC 5AUOB 2BWJA 2H5EA 1PV4A 1XD2B 2IC5A 2OE2A 4PPGA 1W36C 5DYGA 5HPYB 4L5BA 2E87A 2WPDD 1BYIA 3AEZA 1KO1A 4LHXA 1II9A 2GJ9A 4FMCB 1AJEA 1UKEA 3ADBA 2C9OA 4E09A 3FKSD 4P0TA 2FSIA 2QY9A 4RD3A 2F1IA 3BB3A 4H1UA 2CBZA 3CLVA 2H92A 3KUCA 1N6KA 2XTZA 1ETUA 3DKVA 2NO1A 1T3HA 2A3RA 3FKSA 1KI3A 2KI5A 1M74A 1VHLA 4NCNA 4S2EA 1JI0A 4XWAA 5KSPA 1GZSA 3X1XA 3GLFA 4IVRA 2C8VA 1AQYA 2NO7A 4TL6A 3TBKA 4UXHA 2WKQA 2FN4A 4TWZA 2C95A 4LC1A 1R6BX 4KI0A 4Q66C 3DOFA 1NG9A 5LPNA 2F43A 4O2RA 3BB1A 1ZVQA 2FEMA 3C8UA 1VHTA 3CRMA 2NQ2C 3AVWA 4LYFA 4AYWA 1CBUA 2IYTA 4Q4HB 4JYBA 2QORA 4QL3A 2ZVQX 3W8NA 1XPRA 1Z0JA 5KNCA 3Q9LA 2CCKA 1Z0KA 2XNDA 1OB2A 3WMGA 2HLDD 2WM9B 3LX8A 1TAGA 4DRZA 5GVRA 1FNNA 4IOMA 4JT4A 2OUKA 1KDOA 3D6TB 5EZ6B 4I1VA 2H16A 1E2GA 1G3MA 3ZDQA 2B7BA 2QBYA 2RGEA 2VP2A 4LCBA 3SHFA 2GEUA 3LO5A 5JEEA 1G3QA 2NIPA 2AK3A 2CE2X 3ASYA 3VX4A 1F48A 1AKEA 2ZUBA 2FX3A 5J4VA 5TARA 4LSGA 3ZVRA 2IWRA 2HEIA 1N5KA 5LD2C 2GF9A 3EWSA 4AURA 3OE7A 4RY2A 1VPLA 3TKLA 4IDPA 3PIRA 1AIPA 2ZR0A 1AQUA 2B7CA 3QEJA 3TLXA 4CW7A 4Q9HA 3T06B 3U3RA 1KKMA 4EFLA 3CF2A 1GDDA 4JLJA 4NYMR 5EZ5A 4O3MA 2ZAMA 3Q72A 1X1SA 2Q21A 1TF2A 5BW8A 1G1MA 2WVJA 4BASA 3PR1A 2QMOA 4D26A 2WWIA 2WPDA 3B13B 3JZAA 2FFHA 4QFMA 3BORA 4BFZA 1Z83A 4Q4LA 2QU8A 4TQUS 1KSHA 2W2TA 1ZNYA 4L9WA 4A6PA 3K0FA 4WZ6A 1OXXK 4BZXA 1NBME 1E0JA 3ADCA 2AL7A 3GQBA 3CWZA 3VKGA 2VSOA 3EXAA 1IN7A 2YWHA 2B8WA 2UZ3A 3QENA 1SHZA 2FG5A 4Q1DA 4TMVA 3EIQA 2YOGA 2AFHE 3OEHD 4RZ3A 4DB2A 4KODA 2OAP1 3VAAA 3NBXX 1XDBA 3MCAA 4WOPA 3R7WB 1AM4D 2ZSDA 4NDZA 2H18A 4HUTA 2XEXA 4LJAA 3JVVA 4KCGA 1G6HA 4AC9A 1LNZA 5KHOC 4HYYA 1NJFA 4M9ZA 1FP6A 3REFA 1FNMA 1KJYA 5B30A 1R0YA 1NN3A 3DO6A 2AXNA 5CYPA 3UWKA 1KI4A 2B8TA 2VF7A 2IXFA 3IEUA 2J45A 1FUKA 4ASUA 2WMNB 3EC2A 3NBFA 4L4UA 3ZJYA 3CWQA 2FV8A 2J7KA 3C14C 3K9LA 2R6AA 1SGWA 2KBEA 1CR2A 4MUBA 4WW0A 2GJ8A 1VCMA 3P20A 3KJGA 3E1SA 3LWNA 4M9SA 4FCWA 3WHKA 3R20A 2VLIA 4PZZA 5IF9A 1LF0A 2Z83A 3BWDD 1VG8A 5IRCD 4CEHB 1I2MA 3G82C 5FBQB 1OV4A 1JPJA 4F92B 4XH9B 3AVTA 2ORWA 2RCNA 1P9NA 4QGAA 1YU9A 2IXEA 2IEZA 2FPKA 2ONKA 1QVRA 5H1YA 2CHQA 4A82A 2X2EA 1YRBA 2HV8A 2NTYC 4BLQA 1DADA 4JVNA 5L8VA 1W4BA 4BZPA 1CJKC 1TU4A 5G53C 3R9IA 5TDHA 2GAAA 4Q9KA 5L3QB 2HF8A 4URXR 2IK8A 3W3ZB 4PSKA 4Z51A 1UBEA 1ESMA 1TUEA 1VKJA 2AXPA 4BWYA 2IS6A 3SU8A 4M9QA 1CLUA 4LOAA 1W0JA 5IK2A 4BFWA 5C4MA 3GLFB 3TSZA 2R62A 5FFMA 2AN9A 2CHGA 1J7KA 3MFYA 4K46A 4BFUA 1ZMXA 1UKZA 3QG5A 2KSQA 621PA 3RWMB 3NC1C 4U02A 3TUJC 4HZUB 2C9CA 1KO5A 1QG2A 3MG9A 1G7RA 4GMDA 4KU4A 4QHSA 4OI1A 3NVAA 2WTUA 3EASA 1NN5A 4O25A 2ZRHA 4DLRA 2J0UA 4PHTA 2CLDX 4OKSA 4HAYA 4JLOA 3UKDA 2BKUA 4JYCA 1NVVQ 2XSZD 4FINA 1ZC3A 1VTKA 1JR3E 1YKSA 1Z0FA 3BC1A 5UKDA 3WNCA 2P67A 2R6DA 4TQ9A 4DC9A 1NVWQ 4FMBB 4MDEA 1GP2A 1ZU5A 1CR0A 2H7VA 4H9GA 1SVKA 3OEEA 5BN5A 3Q8XB 2RGXA 3EZ6A 3I1FA 3SHWA 2RGCA 5TVKA 4AKEA 4Q7MB 4A0HA 4AKGA 4XVRA 4YC7A 1RIFA 2HCJB 5D3MB 1Q3TA 1LV7A 4KHZA 2X19A 2X8AA 3AP3A 3SFVA 3FHTA 2DBYA 1P7CA 4TL7A 2B21A 3ZQ6A 4Q1FA 2RGBA 2RGDA 1FMJA 2YKGA 1Q1EA 3S1AB 1CRQA 2Q3MA 2ZETA 3HPRA 2Z0MA 4C0AC 5K8LA 4PSVA 2MMGA 2X77A 3BOSA 5E7JA 3I5XA 1SHKA 3L8ZA 3I5YA 1UADA 3V9PA 3AUXA 4PHGA 4CT4B 1SVIA 3KKNA 5GJWC 2OILA 1QHSA 2ZRKA 3I32A 2ZUDA 4A8JC 5CLLA 4LYAA 2FFBA 2FOLA 4A8JB 2RMKA 4GL2A 4GZMA 121PA 4BLOA 5AJWA 4CEJB 4DT1A 3TVDA 4HAZA 4EJSA 2JASA 1K5DA 4Q1AA 3S1AA 3I62A 1NBMD 2GRJA 3RS2A 5DHAA 3VTKA 2J7PD 1UPTA 3T1VA 4JLKA 2YV5A 5DO9A 2OAQ1 4D0GA 5H8WA 4A4DA 4OYHA 3H2YA 4PX9A 3KDSE 3KTAA 3FVQA 4IOJA 2V7QA 2ZAOA 2BCGY 1KNXA 4A2QA 2CLCX 1DVRA 1JAIA 1N5LA 3GP8A 2JLXA 1XMIA 5GVSA 2FU5C 2QAGA 4IVQA 3LQRA 5DN6A 1IN8A 3QKRB 2IYQA 2BCJQ 2XTMA 3PVSA 3OESA 2D7CA 4PC7A 2V7QD 3GCGA 4TYPA 1XD2A 5FBRB 4A8JA 4IHQA 1OPXA 4MKIA 4X8LA 1QHGA 1YJ5A 2ZI3A 2OG2A 4DWJA 5E7IA 5EE3A 2I3BA 4EJSC 3KKMA 3LX5A 3SEAA 4PZLA 3SJBA 3UG7A 1ZC4A 3I73A 1E9DA 1XEFA 1F5NA 3LXRA 1ZM2A 4XD7A 1JNYA 2QZ4A 4O0MA 3TVTA 2EWVA 4IFBA 1XCPA 3VX3A 1EWRA 1E1RA 3MJHA 4KSCA 4WXPA 4N0DA 1F2TB 2ZSAA 3P4YA 4PR0A 3D31A 1ZM3A 3GJ0A 4ARZB 4B47A 4XVUA 5LDDC 3M4YA 2JEOA 2ZRMA 3GLHA 5D3MA 1A82A 4AKHA 1FFHA 1JECA 1EFHA 1KY2A 1QF9A 1L8QA 2ZJZA 4EIWA 2AD5A 4OQMA 2I1QA 2P2LA 3VR6A 2D2FA 4V02A 5KDLA 1W36B 2PX0A 4A9AA 2XX3A 3HU1A 1W46A 2OXCA 4B3FX 3EA5A 2ZRPA 2ERXA 1DAHA 2RGAA 3A36A 4H1VA 4K81B 1ZRHA 4M9XA 2GDJA 3CB4A 3U61B 2NZ8A 3WBJA 1N0WA 3K0FB 2HJGA 2ZRAA 4WZAE 3SJCA 1KSJA 5DN6D 5CJ2A 1RRCA 1EFCA 3LH5A 4LPSA 5HE9A 1CJVC 2CNWA 3U3JA 5JJKA 1FPMA 3CRVA 3JVUA 4JVLA 1NMXA 3SYKA 1T0JB 2QPTA 4ACBA 1XCGB 4B34A 4DCSA 5C46F 3T61A 5FBLB 1DAGA 2FNAA 4MQBA 1AGRA 1LTQA 2A9KA 3I3SR 3CX7A 3DKPA 3KQHA 1VCOA 2UZIR 3IUYA 3IBGA 2JLZA 1KI7A 2RAPA 4CEIB 1ODFA 1NKSA 1XD8A 2IYRA 2CCGA 4E07A 1NLZA 1UEJA 4LX0A 4Y0AA 4ZKDA 5AUNB 4R7ZA 1UBFA 5KO2A 3AVUA 1U98A 1QHXA 1NMZA 3PUWA 1G5RA 3ND9A 3IKJA 4C2TA 3KXIA 3UXMA 1L4UA 2NO6A 1IN6A 1M1YE 2PMKA 1VG0B 2J5XA 3EA0A 1NN1A 3BB4A 3OIUA 3X1YA 2R6GA 2WICA 3HDTA 4P4UA 1JBKA 3E5HA 1C9KA 2EFDB 2V9PA 2OCBA 1KMHA 2CK3A 4OQXA 4GZLA 3BFVA 1CKEA 3NKVA 1IN5A 2WAXA 1ESNA 1HUQA 3OF5A 1V43A 2QAGB 2WZQA 5FTNA 1N6RA 5A0FA 2BM0A 1HE1C 4G01B 3CM0A 4B33A 1W44A 1ZNZA 3IEVA 4IJMA 3DL0A 1US8A 2ZE5A 5CLQA 3V00A 3EPJA 2XJ9A 4CVNA 2PT5A 4D0LB 4HLDA 5EP1A 1JB1A 4G5OA 3G5UA 1YR9A 2GJSA 2P6NA 1D5CA 1GRNA 1JXMA 1M6NA 1S3GA 2W6JA 4HLCA 4TTRA 3SR0A 4NTZA 1E9BA 4Q4HA 1EGAA 5FH9A 1E3MA 4IVPA 4P33A 1XB2A 5J40A 4B2LA 4DJTA 2B92A 1UEIA 3Q7QA 4HATA 4M53A 4DT1B 4EJSB 1RZ3A 1HYQA 3QIAA 2FWRA 5AWFC 3BAFA 2DHRA 3B9PA 5J4LA 1LVGA 1PLJA 1G4AE 3LW7A 1Z2CA 3QKSA 3TE6A 3PJRA 4G1UC 1VCNA 3R8FA 1OXUA 4LYJA 1UM8A 2XTNA 3WXMA 2YHSA 5KUTA 1P73A 4CZ2A 2DFNA 1D8TA 4LDJA 2JCSA 1EFRD 4G5GA 4LPKA 2ORIA 3RABA 3GEHA 3PENA 3B1XA 1R0XA 3OIWA 4PXAA 1ZW6A 3RS5A 2V1UA 1R10A 4JJZA 4RFSB 2OFWA 3P27A 3GLIE 2O52A 4EDHA 3LVRE 2DYKA 2IHBA 3CBQA 1XXHB 4FMDB 4LC0A 3IO3A 1U90A 1O3YA 1KO4A 2FFAA 4MRNA 3QKTA 1NVXQ 1G6OA 3ND8A 5DE3A 2VHUA 1KDPA 5CDFA 4OQFA 1KJWA 2W6ID 4FXPA 4G5SA 3KQNA 4HLQB 4PQYA 2WJVA 3U6BA 1G9XA 3I8XA 5SZIA 1P2VA 4AWXA 4ZDIA 4M1WA 2PJZA 2EYUA 2YZ2A 2ZR7A 4WVFA 4Z1MA 2ZRIA 3IHWA 1W2GA 3OAAD 1A2KC 2FDCA 2AKAB 2N1BA 3TSOA 5DI9A 1IY1A 1OH8A 1COWA 4JL6A 3SBDA 4G5QA 1SXJE 4YLGA 1SVWA 2F1RA 1MT0A 2X2FA 2GVZC 2O8DB 2RH5A 3C5HA 4HDCA 1AZTA 1H8HA 2A5YB 4TMKA 3W9YA 3M0EA 2IYSA 2REXB 4F91B 2ZI6A 3U5ZB 2OBLA 2OLKA 3HWSA 1DG3A 1US8B 4DDVA 1OHHD 4RD2A 4R71A 4ESVA 4OHVA 1WDTA 5FOUA 2YOHA 3CR8A 4D4JA 3OFNA 4LZZA 3G0HA 3LA6A 2D06A 3CRRA 4PC1A 4KBGA 3B1ZA 5GJVC 5JS8A 1Z6AA 3QXHA 4ZIRB 4FD2A 2L0XA 2ZJBA 1NSTA 3SE0A 3AKDA 1NLYA 3SI7A 1GFIA 3SQWA 1WP9A 4D4LA 1OFTA 2XAUA 2ZJ2A 5LBIA 1TF5A 1AS2A 4LI0A 4CYMA 1TF7A 4JLNA 4R2IA 3CNNA 5CIWA 5EXTA 4QJ5A 1S1MA 4ILEA 3UANA 1KZGB 3PUVA 5FR1A 3PXGA 4C0KA 4Q00A 4WXRA 2WHXA 1VMAA 3LLMA 1D2MA 1E2PA 1ZINA 2WSSD 2FMXA 4MKFA 1IY2A 5DSZA 4XSGA 1CF4A 1K5GA 4NYIR 1W49A 1YR8A 3NEYA 4PPNA 3BH0A 4R9UC 3TAHA 1DEKA 1NP6A 3MD0A 3SJZA 1HE8B 1D9XA 4KFUA 2XNDD 2QGZA 2J3EA 2AR7A 2ZRNA 4NZYA 1OSNA 3ZIAD 3A6PC 3MGCA 4DXAA 4G3XA 3I92A 4G5RA 1W7AA 5CJPA 2AD1A 2CEAA 1A7JA 1XCMA 4PAQA 4QG7A 5LB4A 4D4MA 1TMKA 3B1WA 3KL4A 1E9SA 2J0QA 4F4CA 4I1OA 2ZE6A 3WNBA 5BN4A 4X8OA 3THOA 1FMLA 4BFYA 2QENA 1E2DA 2GZDA 2QTFA 3H86A 2ONJA 1RRGA 2BEJA 5TY0A 1JJVA 2DFLA 2EVWX 1T4GA 1OXSC 2DFKB 3CZPA 3LY5A 1ANKA 3ZIAA 4V0NA 1P4SA 1R0ZA 2IYXA 4MDFA 3U6KA 5P21A 2BBOA 3LAWA 3RYTC 1UKVY 3H0KA 1TX4B 2Q3FA 2WKRA 4RKEA 2QUZA 3UMFA 5KNDA 1AA9A 5FTJA 1Q21A 4Q19A 4URYR 4MITA 3W34A 4D6PA 1U81A 3A4NA 1KGDA 1WQ1R 1XF9A 5F98A 1RPZA 2CXXA 4CEJA 3A58B 3CX6A 5JS7A 4CEIA 2H17A 2YWGA 4N0EA 4UJ3A 4GP7A 2XITA 2K5UA 4HAVA 2GTPA 4YDSA 1UF9A 1TL7C 1CR1A 2A30A 4TT3A 4YMUA 4TMXA 2G6BA 3N2IA 4B74A 3GD7A 4KFTA 1SXJD 1X6VA 4PC3A 2WJYA 4KYIB 2BBTA 1PLKA 4C7OA 1RE0A 4DBLC 3OFND 5TB5A 1OH7A 2JLWA 1DAMA 2ZRDA 3HU2A 5J4YA 4IEIA 5HCNA 4M22A 4DSOA 1ZYUA 1TU3A 3FMPB 4TLCA 2RGGA 1XEWX 1XZQA 1OH5A 5JJLA 4OHWA 4Q9LA 4ZCIA 4QGGA 1IXSB 2IYYA 2QEQA 3UWOA 1KI8A 1S96A 1IQPA 2WOJA 4PPQA 3ZZ0A 2HXSA 4IW3B 5JZVA 1Q1QA 1FW6A 3RLFA 3HYTA 4LJYA 2BMJA 2IW3A 3KJIA 3W3AA 5IHPA 1WXQA 4E22A 3MLEA 4ASUD 4AG5A 1T5LA 1Z6GA 3CW2A 2OEPA 2QA5A 2BMEA 2OESA 3L0PA 3GLFE 3EWAA 3KJHA 4XIGS 2WKPA 2BMDA 1CJUC 1LS6A 1W2HA 3KXLA 4C0BA 4UKDA 4K8OA 3IPXA 1I4LD 3WBKA 2R6FA 1PUIA 3QSYA 1IOZA 1AKYA 4MRPA 1CP2A 1XD9A 1RW4A 3HPQA 3SJAA 1QG4A 2V4ZA 3A4LA 1E4YA 2CK3D 2WWHA 2ZYWX 3IO5A 1P5ZB 3AF4A 3NHAA 3BGWA 4QGFA 2X1VA 5IDVA 1E2KA 3VQTA 5LD2B 3IILA 3CONA 5AJYA 3EZ2A 4US0R 2OFOA 4DSTA 4TN1A 3TQFA 2GILA 3LW8A 3PEYA 2NO9A 3KB2A 3AGQA 4ERNA 1S9DA 3TR5A 3GJ4A 1U8ZA 1FTSA 1HV8A 4URWR 1U9IC 3V4FA 4CT5A 4QJ3A 4ZDKA 4ZDWA 4JIMA 1G7CA 4EUNA 1N5IA 1Q12A 3PEUA 4IKEA 5DYIA 1PVOA 3X1ZA 2F7SA 5DH9A 4P3YA 1MRNA 3TH5A 3TRFA 1EFTA 3L0SA 3IHLA 2W00A 2UVQA 5FPKA 1IHUA 4FMDF 1P75A 4TMTA 1EX6A 4W9MC 1E2EA 721PA 2VP0A 2PLFA 4PTLA 1ZBDA 1UDXA 3HP1A 5FOSA 3OEED 2IS4A 1GL9B 2GEDA 3B8HA 3LNCA 4RD0A 4B3XA 4OHZA 1OB5A 1G5TA 2JAQA 2QT0A 4GOJA 4LBZA 4AIIA 2ZS7A 1IN4A 4HAUA 3IIJA 4EAQA 4HDQB 1TEXA 4Y0VA 1XTSA 3RC3A 2JJ2A 4QKQA 1KHTA 2EWWA 2Y8EA 4OK6A 1J8MF 5BQ5A 3T1OA 1NG1A 3HR8A 3T12A 4B75A 4RD4A 5L3SA 4BECA 4F93B 1ZM7A 1IONA 3CH4B 4HAXA 1W0JD 1N0UA 1IAQA 1JR6A 2O0HA 3GLIA 3JZMA 1BIFA 1N25A 2OHFA 3WMFA 2DR3A 1DAKA 2GCOB 5G41A 3UG6A 2QRZA 2ODBA 5CYOA 3RHFA 1GUAA 2A5GA 4GT1A 1R7RA 2VTKA 4C30A 1OF1A 1U2RA 5EE9A 2C96A 2IUSA 1N6NA 1DTSA 1XU4A 4Q4JB 2DCUA 5C1BA 2YJTD 1SXJC 2ZJAA 2JLRA 2O8FA 2J0SA 3CKLA 2IS1A 4JBXA 2ASEA 4BLTA 4KYUA 2JJ2D 3RS7A 4OBEA 1OKKA 3DMNA 2WWFA 4JS0A 1ZIOA 2F3TA 2JGNA 1ZD8A 1E69A 4PO1A 4TTQA 2BJVA 4U7DA 2BV3A 4URUR 2AHOA 4QHTA 2FZLA 4RFSA 5JI2E 3CPEA 1EG7A 1BOFA 2CDNA 2CVFA 2YC4C 3LDAA 2CE7A 3KJEA 1KDRA 2N42A 5JCZA 3FHCB 3U7FB 5TXGA 3LVQE 1QZXA 1A4RA 2N46A 3RS3A 1EX7A 2OO7A 4RSGA 4XSHA 4DHEA 3AKEA 1OIXA 2QE7D 1M2OB 3AVXA 2F9MA 3VHLB 5HZKA 4M0LA 4DDUA 4C2UA 1M8PA 3UMSA 1L4YA 2C5LA 3KB1A 1SQ5A 4QBGB 4W5WA 2HDNB 4XVQA 4AYTA 3GFTA 2QL6A 4TYYA 2G83A 4RJLA 2AK2A 2WSSA 4NCHA 1KK3A 3KZ1E 5K8IA 1TEVA 3SC3A 3SN6A 2JLYA 3A1VA 3AB3A 1Z2AA 3IDQA 4GPTA 4Q7KA 5CK4A 2QM7A 2A5JA 2KB0A 4IXMA 4R98A 2ZRLA 4BRUA 3BS4A 1XNJA 3QXJA 4Q21A 3PUZA 3IGFA 4E03A 2BC9A 2IWHA 3K0SA 1MRSA 2ZREA 4PSAA 1OFIA 5M04A 1GM5A 4OHXA 3BJIC 4LHVA 3K70C 3M1IA 2V1XA 2VP4A 4DVGA 2ZVPX 1NVVR 4Q03A 3CZQA 1MH1A 4W5HA 5JHGB 1P61B 5G40A 4JKIA 5ANRB 1IXZA 3K1JA 4M4SA 3TNFA 1AGPA 4KVGA 4Q47A 4NL4H 2IYLD 1NKTA 1DOAA 4BLSA 4HB4A 1P2UA 4IOLA 3T1QA 4OJQA 3C15C 1E0KA 1PLLA 1VYUA 2GZHA 3ZD7A 1WB9A 1A2BA 3ECCA 2WMOB 1S8FA 2E9SA 2ZI5A 2CNWD 5D3QA 1X8LA 4TLBA 1W5SA 2G88A 3REGA 2JDIA 3X1DA 5SZJA 3VNUA 3E70C 3NBYC 2QNRA 4KLNA 4QBIA 3N2EA 1Z29A 4LJ5A 5C2JB 3KTAB 4A2WA 4A92A 8OHMA 5AJVB 4QBFA 1E9CA 3K70D 2I1VB 1T5IA 4DUGA 1N2CE 1MABA 4XTCS 1UJ2A 1RFLA 1XTJA 1G3UA 4NYJQ 1XTKA 2E1RA 3KFXA 3TW8B 3EZ9A 4GMXA 3EC1A 3RS0A 1E1RD 4P31A 4AY2A 2A5DA 1YRAA 4Q18A 2EQBA 2HYDA 1ZAKA 4ZIRA 3B6EA 1E0AA 2VPPA 2ZIAA 2W2XA 2CHVA 3NHBA 1NJGA 4MGKR 1H8EA 1XRJA 4FN5A 2P6UA 1DELA 2WAYA 5FI0B 5FPTA 3GFOA 1KDTA 2MSEB 1I4DD 1JAHA 4A2PA 2O8DA 1M7HA 1RVDA 3SYLA 4M1OA 3AVPA 3E2IA 2ZI4A 2C04A 2QE7A 3FPAA 1T91A 421PA 2ZEJA 1QHIA 1Q22A 4G0NA 4NKRA 1WA5A 5FPHA 5A5GA 2CMKA 3ZH9B 3WYFA 5GJBA 1Z47A 5CM8B 1WCV1 5CDFE 2DY1A 1A5TA 3W6NA 3CO5A 4GP6A 1U0LA 3I61A 1OHHA 2BM1A 3AP2A 1KO8A 4NH0A 4A0RA 2D4HA 2BKEA 4QOSA 1OT3A 1TUIA 4JL5A 2IT1A 2ZYTX 2A78A 4HEJA 3W5IA 1Y3AA 2OM2A 4EPTA 1KI1A 1ZD1A 5HCIA 2YOFA 4LJ4A 1TADA 2XXAB 3BERA 4LHWA 1CEEA 5EJEA 1RYHA 1XXHA 4B2PA 4NHOA 5IK2D 1W47A 1VG9B 4A36A 1IJFA 3MAAC 2W6IA 4MRRA 4QNRA 3U3MA 4AG6A 4HZUA 2WIBA 3TQCA 1P6XA 1JR3D 1OKKD 3TIFA 2HUPA 1NBMA 1LB1B 4FI3C 1GVNB 4IRUB 3X2SA 5F3WB 3TSWA 2G9NA 1J90A 1Z06A 4BZQA 3QBTA 4TSFD 5KSZA 2BVNA 2QAJA 3TGPA 4B6EA 1G17A 2C9YA 4M1YA 3QJYA 2P5TB 4FIDA 3TJZA 3VKHA 2IS2A 5E7MA 2ZYVX 1SVOA 1OFHA 2H57A 1D9ZA 3D8BA 3VKWA 4QM7A 1E2QA 3IBYA 3OIYA 4Q7LA 1OH6A 5FI1B 3EPHA 4PAMA 1P9RA 1O87A 4UNQA 4HLUC 1JR3A 4JKYA 2YWEA 2GBLA 2VBCA 4KVAA 3N70A 5JSZA 4LWZA 4Q1CA 1Z5ZA 4DDTA 4GOXA 3CPJB 3KQKA 3T1TA 3THWB 2PEZA 4Q01A 2JDID 1XZPA 2QMUA 2ZU0C 4HB2A 3AGPA 4JLMA 1CXZA 1MKYA 3KKPA 3U7EB 4DIEA 4Z8XA 5EQTA 1ONBA 4NP6A 1EK0A 1XPUA 3RRNA 1ZM9A 1XJ0A 1G4UR 3VR4A 3EG5A 5EUMA 1GAJA 1M34E 1NMYA 1MO5A 4YQFA 1LW7A 3K70B 1NIJA 1EESA 2J87A 5FL3A 3ZVMA 3QXXA 4Q1EA 1BMFD 2KWIA 4UNRA 5JECA 3QVVA 1KK1A 4M8NE 3W8RA 3K0CC 2HCBA 2VH5R 4LK2A 1E4VA 1F2UB 1U0HC 2G0NA 2I4IA 2RKOA 3F8TA 1II8A 3FFBA 4LBYA 4BLRA 2XZOA 2ZXUA 4GDFA 4IDHA 3QPVA 2D74A 3UPUA 2ZTSA 4YMWA 1X8JA 5FOWA 4KV9A 3QI2A 4NONA 1M7BA 1AN0A 3GJXC 2P6RA 2P3SA 2DFTA 3VFDA 4TTPA 1XTRA 4JLVA 1DO0A 5FTKA 3MSXA 1BO6A 4V03A 1DPFA 1F6BA 1R5OA 3U4QB 2VHQA 4TYQA 1ZD9A 5L3RA 3GEEA 3ZD6A 3MUFA 4Q5IA 4YDHB 5JRJA 4TZ0A 2CL7X 1OW3B 4TYNA 3QF4A 3QKRA 4LHYA 1E2NA 4ZI2A 1W48A 5KOYA 3V4RA 3TAUA 4MUAA 5JI3E 5HKKA 2RHMA 1LF5A 1R2QA 4UNPA 2XB2A 1AS3A 4UQOA 2EU8A 2VIIA 3ICQB 3I4LA 1SKYB 1ZIPA 1BS1A 1L7VC 3C41J 1JJ7A 1XP8A 3FWYA 3HR7A 3OZXA 3QUSA 1VECA 3AVVA 3LFUA 2BDTA 3C7KA 4C0SA 1CS4C 1BMFA 1TNDA 3MRSA 1P3JA 4LBWA 2ECKA 4NCKA 3FMIA 1A1VA 4CRWB 3GLGB 2O8BB 3LRPA 5JMTA 4FCTA 1I4TD 1XX6A 3THXA 2GXAA 5SZHB 4Z1MD 1XEXA 1KI6B 3L8YA 2WBLC 4FWIB 4PC2A 2F1HA 4D82A 3NDBB 4IDOA 3GPLA 5KSOA 5LB2A 3B82A 5EE0A 4DCVA 3RWOA 3VU9A 2ZSBA 2G1KA 3GLHB 1NNEA 3LBNA 2H8KA 1Z6YA 1Z0IA 1E6CA 5FOVA 2ZRGA 4F38A 1M7GA 2BBSA 2QI9C 1N0VC 3PV0A 1N6HA 4RCZA 3THYA 2O8CA 1N6LA 3TUIC 3KX2A 1VYTA 1SKQA 1QRAA 3K9HA 2NOAA 3P26A 4Q1BA 2EFCB 1E79A 3NH6A 1YZNA 1N6IA 1ZUIA 2ZJOA 5CIQA 1DG1G 2CJWA 4EQ6B 4I1UA 2IF2A 3QG1A 3WY9A 3VHXA 1YR6A 1F3OA 3U2QA 3FB4A 3AQ4A 1FL9A 2VEDA 4M1MA 1QVAA 2QP4A 5DI3A 1QHHB 3TW4A 2DWQA 3K09C 4NYMQ 521PA 2J0UB 3K9NA 3SBEA 1DAEA 2C2HA 3C4JA 4JMPA 1T0HB 3SNHA 5CITA 1GOTA 5JFGA 4KITB 4YMSA 3AKYA 5JBQA 1F2TA 4NU0A 1T9HA 5DHFA 2VHJA 2GXUA 1N6OA 3GJ3A 1GSIA 1GILA 4NCIA 5CK5A 5EXSA 2NGRA 4JT2A 2R6CA 1YR7A 4HB3A 3C5CA 2VP9A 1P2TA 3J81k 3EZFA 4L16A 4TL9A 3F0TA 1IY0A 3BH7A 5HR5A 2AWOA 2ZI9A 1XTIA 3DVLA 2ZJ8A 1OIVA 2WJJA 5G3ZA 4I1SA 4WBSA 2ANCA 1LY1A 3NIBA 2FE4A 3B5JA 3NC0C 1YZGA 2PCJA 2PEYA 5B64A 1FX0A 2EFEB 1XMSA 3WMEA 2ZRJA 3OEHA 2R9VA 5C18A 3F5FA 4BPBA 5FTMA 4NYJR 1S1CA 2OCPA 3K0AA 4Q4AB 5F9FA 5FUYA 4B35A 2PL3A 3PUXA 4MKGA 4NYIQ 1S4QA 2FGJA 4WAUA 4XTRA 3A1UA 1AK2A 4KFRA 3QY0A 3A1SA 1J99A 821PA 2V54A 3ZZUA 5HE8A 1G7SA 4JBWA 2GJAA 1U9IA 1SXJA 1P2SA 4LV5B 5BWMA 5EUQB 4EPXA 1YZUA 3N5CA 4LJ6A 1E1QA 4D25A 4IOKA 5GJCA 3DM9B 1EFRA 4AK9A 5C4GB 1G20E 4EPRA 4JL8A 4BFSA 4B76A 4EFMA 5J4KA 1G8FA 3TMKA 3LD9A 4X8MA 3SQXA 1E96A 5FOXA 3NEJA 2ZRFA 1WBBA 3FYHA 1UKYA 4XWKA 2GCOA 1GWNA 3W90A 4TZ6A 1KNQA 2MSCB 2WWGA 1VIAA 2ZPTX 4US1R 1LS1A 3EIEA 4HB0A 1W0KA 5A4JA 1E2HA 4D2IA 2FH5B 2OZEA 1VYVA 1RRFA 1W1WA 3A8TA 4DB4A 1U8AA 2G0TA 1OE0A 2F55A 1J70A 2QQ0A 1SVLA 1XBTA 3L82B 3Q85A 3EAQA 2ATXA 2ORVA 2C03A 2V3CC 3O8BA 2IL1A 1R5NA 1G64A 2FJUA 4FCVA 2JJ8A 2Z43A 5L3QA 2QBYB 1Z6TA 3SS8A 2D2EA 2DWOA 4KFSA 4M1KA 2IF0A 2PCLA 3RC8A 4DLTA 1E9FA 2DWPA 4QJ4A 1KJZA 3L2OB 4QBHA 3L0OA 3A1WA 3QOFA 3DPUA 5JLJA 2HT6A 4PO8A 4UXJA 4A6XA 4DZZA 4HUQB 1XEWY 2ZI7A 2IX3A 1KTVA 1ZM4A 5BN3A 1HQYE 5DLQC 4QXAA 4PPFA 4CEHA 5FUVA 1SKYE 3T15A 3SFZA 1MV5A 4YXWA 4EPWA 3U7GA 3NWJA 1Z22A 1YQTA 5TMPA 1GITA 1U8YA 4L15A 3ZQJA 2F43B 3R9XA 1JXOA 1U0JA 2BBWA 2ZM5A 4MKHA 2PJRA 1JQJC 3C16C 1Q0UA 3Q3JB 2GXSA 5BYKA 1Q44A 1TTTA 1EXMA 3QBVA 2OBNA 4B43A 1R0WA 1XXHE 4DCUA 2TMKA 1ZUHA 3AM1A 5FL7D 3DM5A 3KQUA 3DMDA 1EFUA 2HYIC 2ZQ5A 3WNDA 2GWHA 2MMCA 2VO1A 1S9HA 3FE2A 4NE2A 4MA4A 5KNBA 5E95A 3U44B 2O5VA 4TL8A 4DLWA 4URVR 1HT1E 1NVUQ 4MH0R 2ZS9A 5GADl 2WJIA 3RDPA 3CX8A 2LKCA 3GFPA 4I99A 3AVOA 2IYVA 3WP1B 2WJHA 1IXRC 4DKXA 3RSOA 2QROA 4F7WA 3O8CA 1Q1BA 4US2R 5KDOA 2J1LA 4MRVA 4QRHA 5AJXA 3R7WA 1Z8FA 3OAAA 1QBKC 1Y63A 1G3IA 3H4MA 1KIMA 4Q9JA 4KAXA 2W0MA 3WYAA 4YONB 1GTVA 1W4AA 4Q4JA 5SZKB 5HZHA 4EPYA 3WRXC 1IM2A 2GETA 3A4MA 4MRSA 4A15A 2ODEA 1WMSA 2GCPA 2XB4A 4KSBA 4EQ6A 1OIWA 2ZE8A 2REOA 4DLSA 2OLJA 2JLSA 2VYFA 1KK2A 3DDCA 3KKOA 1ZNXA 2IYWA 2HLDA 4W7SA 1RC8A 1KK0A 3IIKA 1NL3A 3DHWC 2FSGA 3MJRA 4MYTA 4DSNA 1S0UA 4DDWA 4B3CA 1GL6A 2Z6VA 5JSZB 1VCIA 2LWIA 3RSLA 1TQ6A 1UBCA 2OV2A 2ZANA 3IPYA 5J47A 1S2MA 2BHRA 4I81A 4PAOA 1PZNA 3AP1A 3K8YA 3H1TA 3GJ8A 4WA7A 1C1YA 4GBMA 2VHCA 3MWKA 3I8SA 4D4KA 1UBGA 4DSUA 1YE8A 3FOZA 2QQEA 4YMTA 2IYUA 2GA8A 1OYWA 2XSZA 3F3YA 4NBSA 5TV2A 1XEXB 1GKYA 2VHTA 4BFTA 4JZKA 2F9LA 2JLVA 3VR3A 1HEIA 2HXYA 3RNLA 1IJEA 5KSYA 2IUTA 1E9AA 3OHMA 5K8UA 2FZ4A 4PQRA 4CDGA 4LV8B 2NG1A 1TQDA 3DZ8A 2W58A 6Q21A 1DAIA 3L0IB 3R8CA 1KZ7B 2VQSA 5DI3B 5EP2A 3T35A 2C99A 1G5PA 2OCAA 4GFDA 4BE7B 3MWYW 2Q9CA 1DBSA 2ZUCA 3AF3A 3K0EA 2DPXA 5B57C 4TLDA 5DNYB 4S35A 1B23P 4NMMA 4D0NA 4XOIA 4RVCA 3RRZA 2JLUA 3NXSA 2MSDB 1Q3HA 1G18A 5FL7A 3ZLJA 2P5SA 2FGKA 1KSGA 2KJQA 4BUJA 4V0KA 2GZAA 2QTVB 2QTHA 2R44A 1BH2A 1G19A 5F2EA 1QHNA 3CUEF 3A37A 1T6NA 3GMTA 3LLUA 3PG5A 4CIDA 1P60A 3UATA 1HQCA 1Z28A 3FTQA 4KBFA 3U44A 4TMZA 1FX0B 4TQAA 4B48A 4LJ8A 4ABYA 3ADDA 1GRRA 2ZR9A 3K9GA 2R65A 2VSFA 3U3OA 2YVUA 1E2MA 4B6FA 1J2JA 1GKIA 4AYXA 1E2FA 1E9EA 1E98A 2QPAA 3EW9A 2VSXA 1KOFA 1LFDB 4V0MA 1P72A 4BLPA 1VG1A 1JEEA 1X86B 4P4SA 2YYZA 4V0LA 5AJZA 3B2EA 3EARA 4WIAA 4RZ2A 3NH9A 4AKIA 1SXJB 2ZS8A 1SVSA 3NTUA 1DO2A 1WBDA 2FA9A 3B7GA 2HF9A 1SZPA 2OT3B 4RD6A 4PHFA 2QMEA 1C4OA 2FF7A 2A2ZA 1KAGA 2PZEA 3GJ5A 4PANA 1Z0AA 4B3DA 1HT2E 1II0A 2PZFA 1IBRA 2GXQA 2OSBA 4HDOB 4GI7A 2WOOA 4JSYA 1ZJ6A 3VR1A 3ZVLA 1E9RA 2IHYA 4LY6A 3B1YA 3CR7A 1JEDA 1FUUA 1MR3F 2GK7A 2IYZA 3EX7C 2VF8A 4RZXA 3CPHA 1N5JA 3Q7PA 1G8YA 1MO6A 1T3LA 4R2HA 5FPYA 2FSHA 3U3KA 4EFNA 4CF7A 2NMVA 3A1TA 4C0JA 2XOKD 2D62A 3HJNA 2J46A 3OE7D 2J7PA 2VA8A 4A1FA 2QSZA 1Q20A 2BJWA 2EFHB 3GJ7A 1E2IA 3B60A 1QHYA 2Q6TA 3FFAA 4DLXA 3ZS9A 2J9RA 1HA3A 4TLEA 1YHNA 2XZPA 1CIPA 1R8QA 3CRQA 3W6PA 1ZU4A 2NO0A 4NCJA 4JBYA 2EW1A 4POAA 4WZBE 2PT7A 4JSTA 1PJRA 4TMWA 4ZKEA 1GNQA 3GJ6A 1NF3A 2V55B 4DLYA 1RJ9B 3BD9A 3PITA 2ZYUX 5CB8A 2NZJA 2JLQA 2EYQA 5B58C 1L2TA 4EPVA 4FWTA 2O8EA 1KY3A 4HLUA 4UNNA 2PLRA 3B9QA 2GBLC 4F4JA 5CM9C 1HTWA 4P32A 3PUYA 5FR2A 4D81A 1E2JA 4O2LA 3QF7A 3K53A 2CL0X 3GLGA 2O8BA 5L3VA 2PH1A 2D3WA 4QM6A 4OI2A 1CJMA 1KO7A 1HH4A 1B0UA 2Q9AA 1G7TA 5KYKA 2F6RA 3Q5EA 4OQNA 3THYB 2O8CB 1DARA 3RANA 4XD7D 5ELXA 3I72A 3K0AB 4Q4AA 2XOKA 5EE1A 3QF4B 2GESA 4UJ5A 1Z63A 3WYGA 1JALA 2ZSFA 5JWHA 3X1WA 3K0CA 2AWNA 4M1TA 4Q48A 4M21A 4MGZR 4V0ME 4Z54A 2D7DA 3QVUA 4DIDA 4OI4A 2CL6X 4B32A 3UMRA 2XZLA 1T8TA 2LCFA 3QNUA 4QGHA 4X8HA 3QXCA 1MO3A 2W0SA 2JJ1A 1P62B 1G8PA 3P1JA 5KTYA 1KI6A 4U5XA 3RRYA 2Q3HA 2QPOA 3TR0A 5DGXA 4JLBA 1AS0A 3KUDA 5AUPB 3O47A 1D6JA 3PQCA 3AVQA 1HY3A 2IBMA 1N3BA 2BEKA 3ADKA 4IFEA 1CJTC 1MO4A 3VR5A 3HYRA 3QQ5A 2YNMA 4JVSB 5E3HA 3WP0A 3BIFA 1K6MA 5AK0A 4ZI3A 2OCYC 3R9WA 1YZTA 5EXPA 3SZRA 1CU1A 1TQ4A 1GNRA 1NLFA 1NSFA 2ERYA 2G77B 4RZUA 3W5JA 1YVDA 4V0OA 4C3ZA 4UXIA 4DCNA 4HI0E 3AKCA 1V5WA 2RB4A 4RD1A 4OK5A 1RKBA 3K09A 2A5FA 2PMDA 5EE5B 4J0QA 5DIFA 1FZQA 1XFAA 1XJQA 5FPSA 1Z0DA 2IUUA 4BRWA 2F1JA 3L43A 4TLAA 4URZR 1G8HA 1VDZA 3FMOB 4U00A 4FW9A 1R4AA 1YZLA 2R2AA 4B71A 3RAPR 4CGZA 1GL7A 1ZP6A 2C77A 3AF2A 4BEJA 1NIPA 3H84A 4ZCLA 1RRPA 2JATA 2BIFA 4KJZA 2REBA 1K8RA 3P4XA 4ZCMA 1ZUNB 1DS6A 2Q9BA 3QKSB 5FUWA 4LJ9A 3AVYA 2ZRBA 3GLHE 4RFVA 4QC2A 3MWJA 1OLOA 2GEVA 2QGNA 5JJIA 3QPUA 4N3NA 2LKDA 1KSFX 2VRWA 5F9HA 4JLAA 2GCNA 2ANBA 4HAWA 1GNPA 3SOPA 2WWWA 5JWRA 1UDWA 5H70A 2UKDA 1G21E 1XMJA 5K8TA 4LUCA 1R8SA 1Z07A 1HURA 3BH6A 4PO9A 2DB3A 1X3SA 3P32A 3BE4A 1RYFA 4B73A 2XJ4A 3SDZA 4OQLA 2OFXA 4LHZA 4GOKA
chains in the Genus database with same CATH superfamily
2AKYA 4C7MA 2FYTA 4K1XA 1GQFA 1M2VA 1K06A 3BE5A 5K45A 3F74A 4L8GA 4CG3A 3L7CA 1VPDA 3A2MA 1HYHA 5AW9A 3WL7A 2C42A 1BH6A 1JHDA 2JF0A 3ZZTA 4CMIB 1TVEA 2CFCA 5I7HA 4CLOB 1CS0A 3WXBA 1HX7A 5ADWA 3WV5A 4I4LA 4X00A 1HE3A 3IQXA 1L8XA 4FYJA 5HKAA 2FPPA 4TSKA 1G8GA 1QIMA 1KAQA 4MV6A 4Z86A 3SZOA 3ZK8A 3HK2A 1N6PA 1G1AA 1ORTA 3K5HA 4L4SA 5HP4A 3PCRB 1WSDA 2I6SA 2WV7A 1L8LA 5CXXA 1WE2A 3MMXA 1APBA 1U5BA 1YFLA 1XZ8A 5FOTA 2WFZA 4DLUA 1BXRA 1KAOA 4UU7A 2ONYA 2WT9A 4JGBA 2XXBA 4J16C 4FHFA 5D3KA 5PGMA 3VC2A 4IKOA 4DMCA 1EIWA 1TYZA 2Q6IA 4HY3A 1E79D 3GGDA 5JDIC 2I7DA 1RYMA 1NN0A 1T6XA 5ALWA 2QNBA 2GM4A 1U9YA 4WBNF 3GLIB 1Q1ZA 3U4QA 5C7IO 2WIAA 1H65A 1AV7A 3H2KA 3MCVA 2H2GA 5GONF 4EAAA 2ECOA 4YGYA 1MZVA 2W2VA 4R2MA 1KMQA 4ZEOA 1VKZA 1BYUA 3MYRA 2Q3LA 4QQFA 4BYMA 1THGA 4EA9A 2VPXA 4TROA 1B00A 1L7MA 3QXSA 4FHEA 1LFAA 4MGYR 4LQDA 4WWHA 4XCVA 3UUGA 4WXEA 4BNYA 1BXRB 1D7AA 5JRZA 2VP6A 2ZB4A 1L1RA 4B6OA 3OBIA 3K9QO 5E1DA 5FP0A 1YB2A 2A94A 2IE8A 2GQ0A 5ALDA 4Q3EA 1FP7A 2VQDA 1S3SA 2R85A 3WKBA 4HN9A 3GCWA 2I6QA 1TB4A 3Q2KA 4J7CA 3CVXA 4HH3C 5DM4A 4DEYA 5K0FA 4JJ4A 2PUDA 3TEJA 5JJ5A 2HCFA 3NVDA 2P78A 3OJXA 2BFMA 1W5TA 1BKDR 1VIYA 2NZVG 4E5SA 4ZVLA 1FP2A 4CUJA 1IRIA 2PZMA 3X1JA 2A67A 4BEBA 4I55F 3DEJA 4KAFA 2BMFA 2Q4EA 3W6OA 2AG1A 3Q15C 1OWMA 2CD7A 2OK7A 3QVWA 1NTOA 4OK3A 4K9PA 3VR4H 4DXHA 2R6HA 4JI2B 3TNLA 2DBQA 1U5CA 1W4CA 3RO7A 4G8BA 2IW1A 4LGMA 1OTXA 2ZAIA 3NM6B 5K0NA 3VC3A 4EVQA 3I0ZA 3KHUA 2GYYA 1NDHA 3CNQS 2IDZA 2ZU6A 2GVDC 4FR5A 4X1YB 2H3EA 1W4RA 1XZDA 1RVV1 3VDQA 3K8OE 3WIVA 1FNBA 2BFDB 3DMRA 4DCTA 4JYZA 1M72A 3AF0A 4MMZB 5AUQA 2QP9X 1JJFA 3ZI4A 1PRYA 2OBMA 4TSFA 1RAHA 2NYAA 4AD8A 1TEHA 1BNCA 4C4PA 3M6UA 1IHPA 4F4FA 3A3KA 3WDLA 2VOEA 1SBIA 2DJIA 1G3RA 3G5LA 3KOOA 2C7RA 5LU8A 3C1AA 2POQX 3F6RA 5IJ0B 3F1KA 4EHNA 1E2LA 1FRZA 4MA5A 3H87A 3DOJA 3TB4A 2IH5A 2EFGA 1H2XA 1Z5OA 4BNLA 3O8DA 4HVLA 4FDLA 5I4BA 3FY4A 4XWOA 2JLAA 1HYBA 5JHHB 3OCUA 1W6UA 2FPMA 5C1PA 5BMOA 2CYAA 5CDUA 5KTKA 1D4OA 1SUBA 2OP1A 4N1AA 2Y1WA 3TJMA 4EG0A 2ILVA 2JK0A 1FA9A 4BVBA 1F60A 1FW8A 4PFSA 3N8IA 2GHQA 1LJLA 3AEUB 1WV1A 1XA4A 4OJKA 1OAOC 5JCOA 2HIHA 1EE2A 2YJZA 1KBQA 5JZMA 4R3WA 1ZDMA 3JALA 4UVDA 2BISA 2FZEA 2IXGA 4FOPA 5H59A 4DWWA 2DUWA 4HVAA 4NPAA 4ZQHA 5L7YA 1DUSA 4M3NA 4BGIA 5B7PA 2HRRA 4AF8A 1P7PA 5C5EA 1PO7A 5JEDA 2QMQA 3TQTA 5M7EA 5BQOA 2REQA 4TRJA 1B3BA 2OKGA 3V8NA 1AB6A 1NY5A 2NZUG 2SKEA 3RRMA 2BCEA 4NU8X 5AKIA 1UBJS 2CLSA 3C98A 2HU5A 4ZTZB 2BEVB 4GWKA 4B44A 2B6HA 4XQGA 3ZUGA 3ENVA 3ZCPA 2NPFA 2HHJA 4HGRA 3Q9SA 1HOXA 1SC9A 2XODA 4L9SA 4N4AA 1GIAA 1YCFA 2QMHA 1POXA 1V6SA 3ZDBA 2GHTA 2JGDA 2OO5C 4HS9A 2V9ZA 1SOAA 2A0YA 3FKQA 3DD5A 1BMQA 3ON5A 4KO8A 1Y9DA 3GLGE 2C78A 2Z2IA 4PXSA 3CLSC 1JTVA 1WCIA 1NQTA 2Y92A 4HUQA 3JZFA 1T3TA 2P9BA 4YP0A 3C3KA 3R2JA 3ZLTA 4PZCA 3CN7A 4NYJR 1OV6A 1SUSA 4CM9D 4HWRA 5F1KA 5JAZA 3GDGA 4XQ0A 1R5BA 1PNVA 3GEGA 3U0BA 3QWAA 1NAHA 1YJQA 4TTVA 2GZRA 3NBZC 3NDPA 1SVMA 3D5QA 1QE5A 3GQVA 1PWHA 2GHIA 3NONA 1XZCA 4RMJA 4E11A 4Z4IA 3UHOA 4JXZA 3KUUA 4C78A 1C29B 4ALLA 2H1LA 4REMA 2KYRA 4G25A 2V6JA 4N3AA 4QAQA 1RWPA 2W2QA 4H18A 5EP3A 3VZDA 4YR9A 4D9MA 2VDKB 3WWZA 3ICEA 4D9BA 3ZJ5A 1T35A 1U2EA 1GG9A 4GU5A 4I4CA 4U2FA 5G0TA 3V1TC 4YREA 1JKXA 3EF3A 3V4SA 4F21A 1CR6A 3H75A 3ZWQA 2R7MA 3C5EA 1Y8CA 5EYPA 4BNUA 3HRKA 4XR4A 4CCAA 5EJ5A 1X8KA 4IDNA 4A3SA 4FDUA 2I2WA 4PPYA 1MX5A 3TGLA 3LY9A 3E03A 1CR4A 1HDEA 3K6SA 4PWZA 3AUYA 1UMCA 1YRYE 2CF5A 2WLTA 2X9GA 3B3JA 4LY3A 1B1CA 3HBMA 2QM8A 3JQAA 3VKUA 5A3RA 3RUPA 1G6KA 5AIAA 2A9QA 4UNSA 1DAPA 1L5SA 2WSMA 2G76A 2FXVA 3IVXA 3RYHA 1V96A 4J2TA 4ARBA 2JIZA 5C5IA 5C81A 4NXNB 4CF4A 2O0KA 3INYA 3T3OA 4HMQA 4KLZA 2YN0A 3PFIA 4W9NC 4ZVSA 1K6EA 1JF8A 2ODNA 3ZWMA 3D7MA 3DBHA 4GLBA 4XQCA 4YWJA 1XTQA 1IH8A 3AEUA 2JA1A 3G5AA 1Z6XA 3R6TA 3PWKA 3CB2A 4KP7A 1KMNA 2UYOA 1DE0A 3PRJA 3IQDB 1IK6A 4DN6A 1BEUB 1EVJA 2EAUA 2IIBA 3CVOA 2NNWB 3NGXA 3NWPA 4IJ5A 4KQEA 5ER6A 2R5FA 1XCJA 4QE3A 5K2MA 5JVDB 5TQJA 1SU7A 4O4JB 3ROMA 3L4BA 3ZK9A 1XD2B 3N0TA 5BW4A 5SV2A 4KKVA 1EQ2A 2PL9A 5HPYB 1GA4A 2OBXA 1M73E 1NZFA 3EXFB 3SSAA 3QHQA 2O6HA 4HEA1 3DR5A 4R84A 3N8GA 2VBGA 4Y6LA 3V80A 3QMMA 1WHSB 2OVBA 2JGAA 3C3CA 1XZLA 3IOEA 3HA2A 4G65A 4BVEA 4RD3A 3LZCA 2F1IA 4IXDA 4LGCA 5T3UA 5JXGA 2CBZA 4L4YA 5JNRA 3KUCA 5B1HA 2NO1A 5F4ZA 1JFRA 2R8OA 3UMGA 2V7TA 3IDZA 3CUTA 4MWEA 4KGZA 1KH1A 1M74A 1QZUA 4NCNA 1JI0A 3A28A 4S2EA 4RZQA 5KSPA 2XRFA 5TQ2A 5HDBB 1Q6YA 1QAOA 2C8VA 1AQYA 2R87A 2YHBA 4BV9A 3P45A 3Q7IA 2C7OA 4UXHA 5A71A 3PPWA 2FN4A 3JWHA 1Y9EA 3WQQA 4TLMB 1R6BX 4QICA 1NG9A 3PE4A 1JL3A 1OFUA 1B8OA 1VQ1A 2F43A 3NYIA 1F17A 1R6UA 3OTWA 5FV7A 1QRTA 1DP4A 4MRMA 3CRMA 1YDFA 3BM5A 3EDMA 1E77A 4B8ZA 2ODAA 1W88A 3CE9A 4D92A 1VL8A 3ZBTA 2Q4OA 3S29A 1P1JA 4IHJF 1RXIA 3PU6A 5IXYA 4KK4A 4R7TA 3WNVA 3PBKA 3AHDA 4QL3A 2PPVA 2QW8A 1Z0JA 3L6UA 4PTZA 3IQGX 2YWJA 3ZWVA 4R7GA 5E4JA 3DZIA 4ZZ1A 2UU9B 1ACJA 1Q84A 2XNDA 4MQMA 4J4HA 4BLWA 1OILA 2UZAA 5CUQA 5EGNA 2HREA 1KEUA 5JE8A 4L7QA 4JH0A 3T4XA 4FI3F 2WZBA 4B7ZA 1SXQA 2GN8A 3LUPA 3R41A 4FFRA 4TUYA 2OUKA 5E6RA 1Q1NA 2O07A 2V3VA 4BVLA 4I1VA 4PLHA 2H16A 4O4IB 3R3WA 1UZUA 4HDRB 1X1QA 3CLRC 1AMUA 1VLJA 4QTUB 3UJNA 2QBYA 2RGEA 5JAMA 4LCBA 2R8BA 1B16A 2Y2VA 1PFKA 3PHHA 4PFQA 5JEEA 5AHKA 3VPGA 3DE2X 1G3QA 1QTQA 3ASYA 1KVTA 2MDTA 4W6QA 2M6LA 1AKEA 2EP7A 2ZUBA 5FWDA 1MGPA 3AL3A 4DIFA 5I45A 2ZTMA 4IIYA 5AKYA 4CKYA 3ZVRA 4GX0A 4RHEA 2IWRA 1ZNQO 3EEBA 4NBNA 3ZE1B 3IQIX 2RH4A 1N5KA 2EKQA 4RPKA 4YALA 3EWSA 3TDMA 3OE7A 3YASA 4BU1A 1VPLA 4ZHQF 4P81A 3NB0A 1MDFA 4NWIA 2V6GA 1AQUA 1QGZA 1W96A 2QM3A 1GQOA 4J9VA 4P7JA 4RVOA 4BNMA 3DKIA 1QIGA 4HAIA 2CL5A 4Z9BA 4C3OB 3IL2A 4GR4A 2AYZA 2FKAA 3BZWA 1R50A 3GROA 3KWLA 3EOBI 4C2AA 2H48A 3O94A 4WKPA 4WERA 1Y4SA 4X90A 5EZ5A 4O3MA 4TLLB 1NPTO 2DMRA 2C2KA 2L18A 3Q72A 4JR1A 4YRZA 1C3VA 3OPXA 4TZKA 1K7XB 2V7PA 3ZDZB 4GPEA 1QMGA 4DLNA 4BASA 1O9BA 3RVSA 1N57A 4RO0A 3TLCA 3K2IA 3TW8A 4PNPA 5DB4A 4C3VA 1UC9A 4D26A 4QFMA 1FLDA 2CGEA 2HN9A 3IUBA 2XWPA 4HDMB 2OFFA 3UMMA 2QU8A 1LDGA 4ZYWA 3IRVA 3GAAA 4MOWA 5A5VA 1RC1A 2IIQA 2JFVA 3O9ZA 4L9WA 4KMOA 3K0FA 3HS3A 3K8QA 4RS4A 4WZ6A 4AN4A 1QQ6A 1H2YA 3LL4A 4JJ7A 3KT0A 2R7AA 3LDHA 2AL7A 1YRHA 4EB3A 2YJ4A 3F49S 3A4TA 2D1SA 1ZRMA 2EF0A 4L8WB 3TXAA 4ARSA 1EXVA 4R05A 1P29A 2UZ3A 2FVYA 4ZQCB 1V1RB 4Q1DA 4AQDA 3KYDB 3UHPA 3F5SA 2B94A 4ZT5A 4KODA 4HK4A 2OAP1 5F4BA 1JKJA 1JHXA 2P77A 3VNQA 3GVCA 4KX5A 3DWFA 3NBXX 3QW2A 5DWQA 4WLNA 4I3GA 2O1SA 5IT4A 4W5TA 4NDZA 1WPQA 1O5TA 3L7JA 4MVJE 4Z9YA 1VGQA 3OCZA 4IG9A 1LLDA 5HF9A 4D9GA 1F8YA 5EERA 3EXHA 1B8PA 1G6HA 4ALMA 5EIEA 4AC9A 4DZRA 2R8EA 4RPCA 1FNDA 1W19A 1Z15A 4YI3A 4RJIA 5ALQA 1HDZA 5ALYA 5TT1A 3AFIA 1NJFA 2X76A 5KHOC 1A9RA 2GZSA 1L4LA 1FP6A 1YQQA 2WU8A 2I99A 3UCXA 4BV2A 1FNMA 4KXLA 1NN3A 1N7JA 3MJTA 1H42A 1YIDA 2P9YA 2XOXA 1XCLA 1K8QA 2D2VA 2ALJA 1UBLS 2V3WA 1QRSA 3LCRA 1KI4A 3I12A 2YUIA 3Q40A 1FNCA 4MP6A 4FKZA 4BXOB 2J45A 2HK6A 1BVYF 1WW3A 2WMNB 3EC2A 3NBFA 3WYEA 4D3YA 2BR3A 2QUBA 4GPZA 4CTJA 4I9NA 2XDWA 4CTMA 1NI4A 3G0CA 3OM8A 4Y6PA 3WYBA 3LHDA 1UMCB 1GFZA 1SGWA 1OPRA 2KBEA 1CR2A 4EGCB 1BHSA 5DOVA 1N8KA 4WW0A 8AT1A 3KJGA 4LOJA 4M9SA 4FCWA 4EX6A 3WHKA 3R20A 1CG6A 2VLIA 2KM1A 4PZZA 3H5RA 3FPHA 3C45A 5B5SA 1VG8A 5IRCD 4AX4A 3VOSA 1DXYA 2ZAGA 1TUBB 1TOAA 1NW8A 3ELBA 4F92B 3G2OA 4UUPA 2HDHA 2AW5A 3ZBUA 1DKUA 1OYOA 2RCNA 2IXEA 4WTOA 3WQHA 3OQ6A 3KETA 1NR1A 4XPZA 1UC8A 2HPZA 2XHEA 4CT0A 1YRBA 4J07A 2HV8A 3PQFA 3JQ8A 1Z7WA 4B5KA 4KRYA 4AJIA 1K6XA 2NYUA 4FP9A 3IP6A 1W4BA 1ZL0A 3VBEA 1XCOA 1QX3A 1TU4A 1Q16A 2CLMB 2WI8A 1BXGA 1LU9A 5G53C 3HU5A 5TDHA 3R9IA 5FO0A 4BBJA 5BNTA 5J43A 3SC2A 2IK8A 1YAHA 3M82A 1YMQA 4EB6B 3ER9A 3C6QA 3ECAA 3Q3VA 4ETIA 2H9AA 4HGPA 4XRGA 1YI0A 1VKJA 2AZDA 4YGXB 3CZRA 2P9QA 3NPMA 4JB0A 1RXCA 4MTLA 2ZIVB 4HRXA 1CETA 1F6DA 2PT6A 5EIOA 1IL0A 3EXEB 4RLSA 3GPDG 1J7KA 1SCUA 1Z37A 4L07A 4O08A 4BFUA 2AQ8A 5H5JA 3WV4A 1I51A 3QG5A 4HMOA 1MG5A 2I2DA 1JVSA 3L7YA 3RWMB 5D7NA 5DM70 4MEAA 1U1DA 4U1RA 3HJFA 2C9CA 1HC7A 1KO5A 2IYOA 3OX4A 2A84A 1JG1A 1G7RA 1S89A 1SUPA 2HMSA 4KU4A 4EA6A 4FX2A 5HOQA 2KLBA 3NVAA 2P79A 1Q3KA 3V1LA 1S2GA 2CFSA 2PUHA 1RBMA 1ZMBA 1UAYA 4D96A 4L78A 4DLRA 1C8KA 2CLDX 1HT0A 4GYYA 3IMGA 3AHHA 3OLWA 3ZHUA 4XGIA 4ATNA 1Y1SA 4FINA 1ZC3A 5KYUA 1DTWB 1JR3E 2DBRA 3T38A 2ONZA 3EVGA 1VE7A 2PQMA 4TQ9A 3DAOA 5HQ3B 4FMBB 1KJQA 2AT1A 3CKKA 1GP2A 1PZMA 1QIJA 4RQTA 4X7RA 5IC6A 5AVSA 1XNRB 2H7VA 4AS1A 4H7DA 5C0OE 1FUIA 3ZE9A 1RQLA 1O96B 3Q8XB 2CXPA 4COOA 4A0HA 5ITSA 3VNAA 4AKGA 4FUQA 1TA4A 4URFA 3OQOA 3MOSA 2FPOA 5HDQA 1Y6JA 1F51E 4I9FA 2I33A 5ELLA 3F78A 1L5OA 1WPXA 2DBYA 3BRWA 3ZQ6A 2DHDA 4M0EA 1L3CA 4CM4B 8GPBA 4UHBA 2WZDA 3BJRA 4BVJA 4FK8A 1CRQA 4N8SA 3HPRA 1R27A 2ADOA 4OQYA 1VL5A 2X77A 3F4BA 3MQ2A 3EXEA 1ZO8A 3L8ZA 4PIMA 4D3SA 1T6ZA 2F3UA 4KAJA 1HORA 2PIAA 2VNSA 2G5CA 3QBDA 1SVIA 1T1SA 3FCAA 3KKNA 2XMZA 1QHSA 3PQ5A 4F1KA 2PMFA 4OHBA 4XUCA 3ZTWA 1NVTA 1PZFA 1W1IA 1XVLA 4A8JC 4ZQEA 4EJMA 1SCAA 3QX8A 2FFBA 3SJCA 5BRAA 5BXYA 1FC0A 3C43A 3QK7A 3KU1A 4CEJB 1NBWB 2FZCA 2X7XA 3TVDA 1OBFO 4DT1A 1K5DA 1TLFA 3OPVA 1NBMD 1R6AA 2JFFA 2XKJE 3VR5D 2J7PD 1DZ3A 4JLKA 2YV5A 3DFZA 4LYGA 1PNRA 5BUQA 2OAQ1 3KB6A 3Q2IA 4D0GA 2QVZX 5KSWB 5T4BA 3H2YA 2AV6A 3BKWA 3G0BA 3ASVA 2I62A 1SUWA 3KTAA 1JLSA 3EMBA 3RVOA 5JTUA 3T5PA 3HSSA 2BCGY 1KNXA 3DF9A 4QUDA 4A2QA 4D3XA 1JAIA 3FXAA 1MX1A 3GP8A 2CJYA 1XMIA 2C83A 4GBED 4I14A 4IVQA 1UXGA 2XCUA 5DHSA 5EIBC 2ZJ1A 1T8WA 1SKAA 2BCJQ 4HYTA 4RVSA 2D7CA 4PC7A 4EARA 1QZZA 5J58A 3V6MA 3QU2A 4TYPA 4CHGA 1TDJA 4MKIA 3BSSA 5KHAA 4WN3A 4GG1A 4PU0A 2EJBA 3BILA 2PE5A 3EFEA 4HYEA 4JLUA 1TEZA 4MB6A 4EJSC 4F84A 5LQAA 3RG2A 3OU2A 4E5DA 1T3GA 1THTA 1SQGA 2WSBA 1K86A 1T4MA 3SJBA 2QX8A 1JYSA 4S1PA 5HA5A 4YRIA 1SXIA 5G0VA 2Z04A 3I8OA 1ZM2A 3ZLUA 1QFJA 4FHDA 4MJ3A 4S1TA 2ZJ7A 1P1BA 3EIXA 4FBLA 5AESA 4N0DA 2ZSAA 4MV1A 4PR0A 4F71A 4Q3AA 1ZM3A 1W9HA 4OGKA 2UYQA 3PVZA 4O3FA 1N9GA 1KJ8A 3PQ6A 2ZRMA 4Q7EA 5FBHA 2EBFX 1A82A 4LOKA 4EJ2A 1CUWA 5TJHA 5EWMB 2W43A 1JECA 1EFHA 5KTSA 3KSBC 2JHPA 5DXFA 4EZBA 1L8QA 2X5JO 2ZJZA 2NO4A 1K75A 2VJYA 3HJAA 3L1KA 3ABRB 5DXJA 2BKLA 3H5IA 4D8UA 1O6ZA 1D2HA 1G4HA 4UDXX 5KDLA 4D0SA 1RDFA 1J6UA 1R6VA 1SZJG 2P5YA 2V7UA 1MJGA 1X8XA 1EUCA 5ALZA 1W46A 1PGQA 1FDSA 2BZ0A 4RMHA 4B3FX 4NOLA 3ZY2A 3W5HA 1USWA 4FZ3A 2L42A 2Y66A 3IOYA 2QZPA 1OU4A 3OJEA 1ZD3A 3BD7A 3B70A 3CG0A 2GDJA 3UOAB 4ZJYA 4TUYF 3IEPA 4KXYA 3U61B 4IUYA 5JO9A 3ZTTA 3K0FB 3EG9B 1E61A 1N3IA 3H11A 3Q7SA 2F62A 4QGBA 1WEHA 2A58A 2G4VA 2NQ8A 4IAOA 4WZAE 1EFCA 1IMOA 1DXQA 4PG4A 5CJ2A 2PRJA 4HR7A 3WK9A 4I7EA 4E70A 2UZ1A 1TAQA 3ADOA 3JXEA 1PT6A 3O92A 3P2KA 1FPMA 1E6KA 4NK5A 4JVLA 5DWVA 4REOA 4PLWA 4ACBA 1T0JB 2QPTA 2PWYA 3HDGA 1KJ9A 1XCGB 3MTBA 3CKYA 1V4NA 3UAXA 4DCSA 5C46F 4ZC8A 3T61A 3E9YA 5FBLB 3V7WA 1DAGA 4TKZA 1XR3A 1YOBA 3IXMA 5T8KC 2AA3A 5DLEA 2UZIR 5LP1A 2JLZA 1KI7A 2RAPA 3K94A 4DM3A 2ACWA 3ZWAA 1GUYA 3TR6A 4E07A 1UEJA 1FS4A 4LX0A 4LRQA 1EK5A 3TX6A 2OVFA 4R1MA 2HRDA 3A9TA 3LC0A 5K99A 1ZD4A 2EGGA 2MYTA 5BSRA 4DTCA 4NJMA 3JVDA 1IN6A 3AF5A 5CXQA 2J5XA 3RFXA 3BB4A 3OIUA 5IDXA 4ZMRA 2GN9A 2R6GA 3L41A 4ENQA 4F1WA 3RBVA 5MFZA 1GPNA 1C9EA 3PD7A 3PJEA 4G5XA 3E5HA 1C9KA 4MAAA 5LP6C 2X23A 5FLEX 4YROA 4UFNA 2E5WA 4O29A 3U4DA 4EB0A 4GZLA 4BX3A 2BYTA 2XQGA 1HUQA 4EGFA 2XWBF 1V43A 5A0FA 1WULS 2MYUA 3USES 1LK5A 2MINA 4ENPA 3SZ3A 3CM0A 5JQWA 3GZ4A 1LRLA 1WXEA 3E9MA 3UJCA 1ZNZA 5DYTA 1EKXA 3TIVA 4R81A 2G1PA 4OY3A 5DYWA 2ZE5A 2FP3A 4LZJA 3UKJA 2XJ9A 4RABA 1WB6A 1V41E 4D0LB 4TVSA 4ZTBA 1XL1A 3FPJA 3EIFA 3N2KA 3RVKA 1AHIA 3QLJA 3S99A 2BEWA 4J0HA 4NENA 1W8IA 3SR0A 5IG2A 4NJOA 3PFNA 4TTRA 1E9BA 1TQ8A 1WXFA 4LOHA 1USKA 1V2HE 4GW3A 1EGAA 4RKYA 1EVYA 5KQGA 2ACVA 4OLAA 1E3MA 4YO7A 1NU6A 2XMPA 5J40A 2JRCA 5FULA 1UEIA 4O63O 2ZDQA 4M53A 4GUAA 3KV3O 2OKCA 4C7VA 4K88A 4KKXB 4DT1B 3SVLA 2JZCA 2FWRA 2QVXX 3H6HA 3OD5A 3PDCA 1UBSB 3ROQA 1QYWA 3FPCA 4WGGA 3RV4A 1T8SA 4I5FA 3CT4A 3QKSA 1K89A 1UBRS 2E37A 3HN6A 1G66A 3R8FA 1VCNA 4LYJA 1UM8A 1T9KA 2X9NA 2DVMA 2YHSA 3GR6A 2V58A 5KUTA 5T57A 2I1LA 4S05A 3RODA 1SB9A 2W2OA 3RTDA 2JCSA 3F96A 1IM8A 4HWKA 1EE1A 5AOVA 3B1XA 2YWXA 2PVPA 2V1UA 3RS5A 3GL9A 4JJZA 4KQWA 2XBMA 4HTFA 3P27A 1BE6A 2DUUA 4LECA 4WOKA 5EHGA 2DYKA 3CBQA 2X0FA 4UPDA 2WG2A 4BZZA 3N7AA 4E2WA 1HPLA 1RQ2A 3IO3A 3V8VA 3V1YA 3ICVA 3BULA 1M67A 5B3KA 2WD7A 2C2OA 4RV4A 1VLZA 2JGIA 1KDPA 5CDFA 1U0OC 2W6ID 4CMGA 4BKPA 1DMSA 1NFQA 3J7TA 5B6JA 5ER9A 4JJAA 4N48A 4C6TA 1EM8B 5SZIA 3BBLA 1P1KA 2YZ2A 1L1FA 4Z1MA 3U1TA 4ARIA 3E5NA 5I9TA 5IT9A 1KEKA 3COJA 3HTXA 3FF4A 4GQBA 4YCJA 2BDEA 2N1BA 4F3KA 3PPYA 4AWBA 1W5EA 1IY1A 1ENYA 2YASA 1NGSA 1SA0A 2RARA 3KHTA 4JMLA 5FWYA 1CZUA 1OH8A 3C4VA 1ADGA 3Q3CA 1MT0A 2B4YA 4U2GA 3VPXA 3TJRA 1PFWA 4UPEA 1ZS9A 4FLFA 2FWBA 3HB9A 1D4FA 2HMYB 3W9YA 3FHLA 3M0EA 4FFLA 5BQ3A 3QIVA 3T7RA 2REXB 1QOZA 3U5ZB 3PNVA 4QVGA 2ATCA 1YVEI 1DG3A 3CEMA 3NRJA 5FX2A 1Z5NA 1OHHD 3KSUA 4JUCA 5TNXA 3CF4A 5E2BA 3SC2B 4OHVA 2OFPA 2YOHA 5CA0A 4D4JA 3OFNA 3FPGA 3ZDRA 3D8NA 2D06A 3AOGA 3CRRA 4PC1A 3VBCA 3C6KA 4JXXA 1Z6AA 2CJFA 2CXRA 3KBBA 4UUQA 4PS1A 5MN4A 2CHEA 3SI7A 2DJ5A 2X86A 2HA3A 3SQWA 5B58T 5IARA 1GTRA 2XAUA 1H0RA 1T2EA 3VI4B 3OT4A 4B09A 5ICEA 1ST2A 1VZ2A 3EVNA 4R2IA 4IIBA 4DQUA 2CFTA 1SG0A 2X0IA 1H6BA 3T3MB 3P2MA 5C8YB 3LT1A 3IP3A 4QJ5A 5EPEA 1ZL2A 1CY6A 1Q19A 5BOSB 1UIRA 1AX9A 5KAMA 3W5SA 1T2DA 2OZLA 4ZMSA 2INGX 4WXRA 2WHXA 5LMCA 2A0XA 3GRVA 3X2EA 3GK3A 1U3UA 2WSSD 3B6JA 2ZT7A 2QRQA 4CCYB 4O4HF 2NXCA 3S8EA 1U5AA 4Y2XA 2E0IA 5ALJA 5IBRA 1L7BA 5AIBA 3GGSA 4HP8A 3FTFA 4NYIR 1DIBA 1W49A 1YR8A 2IV7A 3O38A 4AP5A 2AFIB 2I3AA 4G26A 5AI5A 3W6UA 4DPMA 1FRNA 3OHSX 3Q41A 2C1XA 4MWSA 5AJHA 4QEZA 1HE8B 3LPAA 3SJZA 5IZCA 2W6OA 3UJDA 3CLSD 3NJRA 1SIUA 3GNSA 3I2KA 2XYPA 4JELA 1NUQA 4G0ZA 2OV8A 4N6NA 3TTVA 1CUHA 1QNFA 1HYGA 3HP7A 5DBFA 1CDDA 2KS6A 4RTSA 3BDIA 2VPTA 1XZGA 3I92A 2VZ9A 3KKZA 4G5RA 4YP6A 2GM9A 4E3ZA 1NE2A 2OZKA 3EXIA 3IDOA 2CEAA 4L2IB 1YJXA 3KAJA 4PLPA 5CVTA 1JH9A 3Q1LA 5C80A 4IUBS 1E9SA 2J0QA 4F4CA 1TK9A 2GBIA 3FDFA 1X77A 4I1OA 1MJGM 4E0BA 5JO0A 3M6VA 2QENA 1E2DA 2XNKA 3OX3A 5JBIA 2ZBFA 1RRGA 1JKJB 4BL5A 2BE9A 1KP2A 4M7RA 2EVWX 1NVBA 1ZJ5A 3DOIA 1USGA 3KT3A 3OOWA 4TXJA 5KCMA 3T7DA 4BN0A 4E5PA 3SZUA 3ZE8A 4PE5B 1L5VA 2CC2A 3PKIA 3KOZA 2ATEA 4HQ6A 3U6KA 1QH0A 4Y9UA 3LAWA 3C3BA 2X1MA 2R84A 3A0UA 3RG8A 2Q3FA 1KJJA 2WKRA 3MTGA 2B25A 5DK4A 3FZNA 2VWPA 1PJAA 5FTJA 3TG2A 4I08A 3CLUC 3IKMB 4LA4A 4URYR 4Z9FA 1HF3A 4J0KA 2X8WA 1E18A 3W34A 4DNPA 4LRSB 1CUJA 5TRTA 2FOIA 1M0EA 2HQRA 5KYWA 1QGDA 2MSLA 3EDQA 1XF9A 4J0IA 2YY5A 4OXYA 3RSHA 2WIGA 3CX6A 2H17A 2QV0A 5F2KA 3JQGA 3H83A 4QYIA 2ZUUA 1IB0A 2VYVD 3ZPXA 1D1TA 3NEPX 4DGSA 1CW2B 1ODKA 3IMEA 2G6BA 4YAFA 3REQB 1SXJD 3OT1A 5EWJA 2JVJA 4PC3A 3V8PA 1MW8X 1K6IA 5TQVA 4ALIA 4YRSA 1RE0A 3TN7A 1E4EB 4DBLE 1VA4A 2ZRDA 1OA0A 4RMNA 1Z4KA 5J4YA 4IEIA 1DB3A 4M22A 4YJ3A 1HFKA 1ECFA 4DSOA 1SB8A 3BL8A 4DILA 2TRSB 1W0CA 2RGGA 1KZYC 3JARB 4L3WA 5JJLA 3TOZA 4YP9A 1LWNA 5LDHA 3AU9A 2CT8A 3UGJA 4XB2A 3ZZ0A 1N2SA 4NE9A 4B0OA 2L82A 1D09A 4GQAA 1Q1QA 3BZBA 2IUEA 4O4IA 4J03A 2CUKA 3K0HA 4X6XA 4EGJA 4ZGGA 5I9MA 2BMJA 2IW3A 3KJIA 4GICA 5IHPA 4U9IS 4EG7A 1UUFA 2H4XA 3CW2A 3MTIA 3JZIA 2XA9A 2HA6A 1LXCA 2BMEA 2OESA 4BGUA 2WWVD 4G0WA 4ICIA 2Q4BA 3KJHA 3WGZA 3GLTA 4C03A 3GFGA 1LS6A 1W2HA 2ZSUA 4KPFC 1HNZB 2XB9A 1J0DA 3JASA 1W29A 2GBPA 4GZ6A 3L84A 1I4LD 4PVDA 1RQGA 2R6FA 4MLDA 4WNCA 4KE6A 1IOZA 4L2IA 2DXIA 2H7YA 4MRPA 1CP2A 3AX6A 1RW4A 4MVYA 3SJAA 4OLFA 3A4LA 3U17A 2CK3D 2WWHA 2ZYWX 1ZOIA 5EXEA 4RQAA 4X41A 1P5ZB 3NHAA 2YHUA 1G8KA 4QGFA 1XV5A 3VQTA 3K6KA 3N0XA 3HA5A 4RHCA 2EKBA 1QV7A 3B7PA 3GFFA 2GD0A 5TT0A 3EYAA 2OFOA 3W8DA 3JQ6A 3TQFA 4DV1B 2WHRA 3O2QB 4MWBA 1D3AA 4FSHA 2JLYA 3PEYA 2NO9A 3E35A 4IQ0A 4UBKA 4ERNA 1S9DA 3OMLA 5IKMA 1L9KA 3SEZA 3V4FA 2C54A 4DCJA 1G8JA 3OLQA 1ZOLA 3IEIA 4K2AA 1AE1A 1E3EA 1L8AA 3G89A 3TI7A 4OJMX 4OG2A 2VTVA 4EUNA 3S2SA 1N5IA 4YCLA 2QGFA 1V48A 2F7SA 4C4ZA 5DH9A 2UXDB 1W85A 2QTZA 2C1ZA 1U7ZA 5EEGA 1WABA 4GUDA 1JFTA 2G1AA 4YHBA 4ZGWA 3O75A 1FDOA 1UH5A 5GZ1A 4ZALA 3OCWA 1P75A 4XUEA 3FYSA 4GOND 4DMMA 4TMTA 2IE0A 5IYZB 721PA 1A7UA 2VP0A 4HF7A 3FTCA 1JA1A 5ILGA 1DBWA 4ZRNA 5HUHA 2IS4A 5CLIA 2GEDA 3FAKA 4M9UA 3VNBA 2ADFA 3KQYA 3ST7A 3V8RA 4JGIA 4PZEA 2XYRA 1RWWA 3EMKA 3GQBB 3RYCA 2ZS7A 4ZI5A 3IIJA 4HDQB 3DE5X 1TEXA 4YH1A 3ZDCA 4RANA 1XTSA 3RC3A 4XGQA 1PQ4A 2QYSA 4RVNA 4DV7B 4Z6KA 3HL0A 5C35A 1NG1A 2AEEA 2HJWA 3ITKA 3KU4A 1FSPA 4GZ5A 1FDVA 4EJ6A 4XAQA 4ZJZA 1NJSA 4J0EA 5AI8A 5CEEA 3ONEA 1J33A 2I6TA 1XVVA 1H2RS 3IAM6 4MB0A 5BYAA 1WUJS 4RH3A 3HB7A 2R1TA 1M1XB 3UBMA 4F93B 4BE9A 2CB0A 3LWBA 1JT2A 4DW8A 3UHAA 4DV5B 4BGVA 4U5QA 1T4CA 1D2RA 4J7AA 4BN5A 1NJ5A 2G7MC 4NI5A 2CXOA 1OI3A 2VKQA 2G0AA 2C4NA 1G38A 1UAAA 1GZ3A 3WMFA 3ZV5A 1PS0A 4CI9A 2DR3A 1TXGA 5G41A 4RETA 3WNQA 4GT1A 1PE0A 1VE9A 5IC4A 1U2RA 3ZHXA 1KF0A 5BSUA 1KDVA 5I7EA 1NUSA 3KE8A 3STXA 4BTEA 1KXZA 1I9CA 5JD3A 3L0CA 2BMWA 5JFTA 5K03A 2ZQYA 3P52A 4NBTA 3R6WA 4BMVA 2X4LA 4RQBA 2XMDA 3A9SA 2ASEA 3I9V1 3NBKA 2JJ2D 4QQKA 4FW8A 4OBEA 1OKKA 2QQ5A 3RS7A 3DMNA 5ICMA 2BUCA 2WM2A 1ZI8A 4B85A 1N5MA 3D3KA 4JJFA 10MHA 1U0GA 2YXEA 1R4NB 3BCSA 3IUMA 1E69A 2XAAA 3K0KA 1DKMA 4U7DA 3SSNA 2BV3A 4V1CB 3IVAA 1L7XA 4PYKA 3JD1A 2JFXA 2CDNA 2XKBA 4QYSA 2YC4C 3EQ6A 3A32A 4IIUA 3LDAA 1P4HA 3WLLA 1U3VA 4J1NA 2WSLA 4UARA 4MWTA 4X84A 3NASA 5TXGA 3LVQE 1ZUWA 1XVUA 3A1FA 4QFDA 4PCUA 3ICOA 1LK7A 4JB8A 3FVTA 1HK7A 5AVQA 4C04A 3AYXB 1RNLA 3RPEA 2OO7A 4FYWA 4YY3B 4DHEA 3RUDA 1SOMA 5DASA 1BW9A 2WF8A 1E3SA 2E4WA 3JR7A 4KUGA 5EMKA 2CN1A 4N3BA 1OIXA 1DIGA 2QE7D 2YN2A 3MTDA 4OA8A 2P9JA 1GGHA 4AZSA 4BPRA 1WO8A 1M2OB 1ZUNA 2G5GX 2I65A 2O48X 3OOYA 3PFKA 3RHZA 1CUFA 1I2ZA 3RWBA 4HNVA 1J07A 1W5BA 4DQKA 2AE2A 1DKQA 3WK6A 4P5EA 4BCCA 3RRXA 5CYFA 3OO0A 3KB1A 4QBGB 3UMSA 4XVQA 3WKDA 3GFTA 1R8XA 4WZZA 4TYYA 2G83A 2JKYA 3AESB 3MK31 1XJ5A 5I7RA 3HKBB 2O2GA 2YY6A 3KDAA