1N5JA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine diphosphate (tdp) and thymidine triphosphate (ttp) at ph 5.4 (1.85 a resolution)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5jA00
4IW3B 1N25A 3MRSA 3MFYA 4MKIA 2PEZA 3R8CA 1NLYA 3N5CA 1AIPA 1NRJB 1EESA 3QVVA 1W4BA 1DO2A 1KO8A 2X2EA 4IEIA 3T15A 1TQ6A 4LY6A 3JVVA 2O0KA 2XOKD 1Z0DA 2IF2A 1GKYA 2JASA 3A1VA 1K8RA 5K8UA 1KI2A 4NYMR 3WP0A 1JJVA 1QHXA 2VTKA 2ZRKA 1DADA 4B3XA 2G0NA 2OCBA 1VG9B 2ZS8A 1P60A 1WMSA 5EQTA 1OHHD 2D3WA 2FF7A 1NKTA 2F3RA 4LX0A 1XJ0A 3CONA 3PEUA 2BKUA 3ADCA 3MWLA 3EPKA 1F6BA 1P6XA 3TQCA 4BGDA 1OH5A 1P73A 4LV8B 1GIAA 2FEOA 2G83A 3IO5A 3ONWA 3OE7A 2ZS7A 1AKEA 2OLJA 4JKIA 3ZGXA 1C1YA 1DS6A 4YMTA 1JB1A 3ZIAD 1TEVA 3THXB 5LBIA 2RGXA 2ZE7A 1Z6YA 2BEKA 4IDPA 2OBLA 3SBDA 2KBEA 3QY0A 4NONA 5L3SA 3AVQA 4BLTA 3QF7A 5FPKA 2GVDC 3TVDA 5JCZA 4BUJA 2PCJA 1U9IA 3SS8A 3FDIA 4FCTA 3CUEF 4GDFA 1GITA 4D2IA 3RC3A 3PQCA 2GA8A 3IBYA 4TLEA 2D7DA 3CPEA 2VF7A 4G1UC 4CW7A 2WICA 3SHFA 1R2QA 2X8AA 2P6NA 4NCKA 1UEIA 4BZXA 4XD7A 1IXRC 1AN0A 2GK7A 2V1UA 3EZ9A 1OXSC 3LH5A 1G7TA 3OAAD 2WVJA 4KHZA 4AKIA 1Q1ZA 4MRNA 2XNDD 1OW3B 3A37A 5E7JA 2QE7A 1DG1G 5KU1A 2OM2A 2P2LA 1IM2A 4KV9A 1JR6A 4WZ6A 4YQFA 1SQ5A 1AZSC 4KFUA 4I1VA 4E03A 1OXUA 1IN7A 2HYDA 4PFSA 2OLKA 1UM8A 1ZM3A 1H8EA 4RSGA 4TL7A 2FFHA 4U5XA 3T5DA 2GEDA 3ND8A 2ZM5A 3K0SA 3PUVA 1QHIA 1DAIA 2EW1A 2J7PA 5KDLA 1ELOA 3RRMA 1ZNZA 2IYZA 2H17A 1GRRA 4LYFA 1YR6A 2FSGA 1NJFA 5AJYA 2A5GA 3VR6A 2O8EB 3QKRB 3FMOB 1RJ9B 1ZIOA 4A82A 1TTTA 5AUPB 3G0HA 5D3MA 2ZJ2A 4M1YA 1BYIA 1SKYB 2F9MA 3KKMA 2WIAA 1PLKA 5CK5A 3EIQA 5EXSA 2ZUDA 3QKUA 1IOZA 3T1VA 3PUZA 1DAEA 1E2HA 2UZ3A 2XEXA 2GETA 1OB5A 1SGWA 3LA6A 2RHDA 3SYNA 1MRNA 1S1MA 4QHTA 3CPJB 4DCTA 5FBVB 3PJRA 4JT2A 3TE6A 3TR5A 3UKDA 4A2PA 2H8KA 5G41A 3U4QB 2AR7A 2P6UA 1RPZA 2HF9A 1N6PA 1VIYA 4J0QA 2EU8A 1NVVR 2ZRMA 2G9NA 5CDFE 3MG9A 3L8ZA 3PVSA 4MH0R 1XZQA 3MJRA 1II8B 3VHXA 4TN1A 2CL7X 2CHQA 4OBEA 1W0KD 2G1JA 4TTRA 5KNCA 1YHNA 2ZRCA 1I4TD 1BMFD 1VHLA 3K0EA 3CX7A 3EARA 4QG7A 5JWOA 3WNDA 4B3GA 1OFIA 2HCBA 2AXPA 4IHQA 4LBZA 4MYUA 2BDTA 4Q4HA 3ZS9A 1WE2A 5J4HA 3CRQA 4ZDJA 1NIJA 1ZM9A 2ANCA 3VKGA 2D4HA 4M4SA 1PZNA 3EPLA 2OG2A 3GMTA 3U3RA 2LWIA 3IBGA 3BORA 2ERXA 1HV8A 3KFXA 1IN4A 3LO5A 3GJ4A 3UWKA 2H18A 4M9XA 4CDGA 4OI2A 1CJTC 3QQ5A 2ZI3A 2NO1A 4EFLA 2YOGA 4IVRA 1E69A 1PLLA 1K5DA 1FQJA 1Z0IA 5LD2C 2XJ4A 4HLCA 2R6FA 1COWA 2CLDX 3WRXC 2E1RA 3RHFA 4BFWA 5EZ6B 1G5TA 3CR7A 4JLMA 2WOOA 3HWSA 1AZTA 1J7KA 3FMPB 4KFTA 1M7GA 5EP3A 4ZDWA 3LXXA 4PAQA 3U6BA 4DWJA 1KJWA 3SJCA 1Q1BA 4BASA 5HPYB 4QNRA 3B82A 2I1VB 1XJQA 5DYIA 2NG1A 2WJJA 2NPFA 2J59A 1KO4A 2V7QA 1KJZA 3AGPA 4GPTA 2CBZA 3FHOA 2ZU6A 2FPLA 4JVNA 4PAMA 3ZVRA 2BM0A 2LCFA 1D9XA 3P32A 2RGNA 4HZUA 4LHVA 3SE0A 2IEZA 3LLUA 4XVUA 3IQXA 1NN1A 5K8TA 3KZ1E 5E7IA 1QHYA 4HAVA 4A8JC 1E1RA 4Q1DA 1DARA 2OT3B 2J1LA 1XD2B 3SEAA 4LCBA 2B6HA 4UXIA 4QM6A 3SQWA 5EJEA 1Z2CA 2REOA 2OXRA 4TMTA 4ZPXA 1KI1A 3AGQA 4F93B 1LTQA 3M0EA 4HZUB 1G8FA 5CYPA 2G1KA 1Z0FA 4LK2A 1S3GA 1NY6A 2IYUA 1JALA 2CJWB 3B7GA 4B6EA 5A4JA 3WYGA 2CVFA 2XXAA 4RD3A 3R20A 4C0BA 2YVUA 2YOHA 3LW7A 3LVRE 3NVAA 3VNUA 3PR1A 2XTMA 1EFRA 1Q12A 4LBVA 1AA9A 2BMFA 3U7EB 4ZI3A 3QKSB 2AK2A 5SZHB 3L82B 3T61A 3K70C 2BV3A 4OJKA 2R8RA 1CEEA 1J90A 2P5SA 2HLDD 4QBIA 4E09A 1T4GA 2VSXA 1VG0B 2WOJA 3I1FA 4PHFA 5TXGA 4RD2A 2Q21A 2C03A 3CRVA 1NSFA 4TLBA 1G18A 3FWYA 1J8MF 2P3SA 2GXUA 3E2IA 3BXZA 2PBRA 3CW2A 3C5HA 4L8GA 4RFSB 4RD6A 4DCUA 2KWIA 5FUYA 5CIQA 4WOPA 5H68A 1XTSA 3QF4B 3I72A 4DLWA 4PAOA 4PSVA 4WW0A 3CKLA 3KL4A 4QGGA 3TK1A 3W3ZB 4YONB 1II9A 1KNXA 1E4VA 2A5FA 2W6JD 4PHGA 2FX3A 5KTYA 4QM7A 4HEJA 3MWKA 1G7RA 2IWHA 4TYPA 3R7WB 4BEBA 1WQ1R 2HF8A 4DC9A 5E7MA 3VTKA 4QOSA 3L0IB 1EGAA 2QU8A 4EPTA 1NVWQ 4JLVA 2MSCB 4A92A 3JZMA 1ZD9A 1GL6A 4X8OA 5K8LA 3WMGA 1NBMA 2XSZD 1JPNA 1CR0A 4BFTA 3SFVA 2W2VA 5KNDA 3CPHA 1G7SA 4R2HA 5G3YA 4HAXA 3K70B 2GVZC 1TMKA 5FOVA 2EYUA 1F2TB 3GLGE 2BBOA 3CNOA 1E9DA 5DYGA 1HQCA 3NKVA 3LY5A 5EP4A 4FXPA 2ZSAA 2XZOA 2JIZD 4TQ9A 2R6DA 1E79D 2ZSBA 4FCWA 3TIFA 2OESA 2WJHA 3CF0A 2QM8A 3NHAA 3TLXA 4Z1MD 2JLZA 3UXMA 4EJSC 1PJRA 3UMFA 2ZRBA 1SZPA 4HAYA 1D8TA 1ZVQA 2C9YA 1GG2A 1KNQA 1M7HA 1QZXA 4M2LA 2DFLA 1FP7A 2IYLD 3FFBA 4P0TA 1Q44A 4EPRA 4TTPA 4V0LA 1NLFA 1IY2A 4E22A 2VSFA 5TY0A 4D0GA 1Q1EA 4Q9LA 1E32A 4C4PA 2GJ8A 2VP5A 4JZKA 1UADA 3ZJYA 2N1BA 2OCPA 4IOLA 3KXKA 3GFTA 3BB1A 4PHTA 1EG7A 3W34A 1ZNYA 4TL6A 3K8YA 1T8TA 3ZVMA 4BLPA 1GNQA 4EUNA 1CRPA 4WIAA 3OF5A 1EFRD 2EFGA 1X86B 2ZE5A 4PX9A 4UQOA 1FX0A 2ASEA 1VMAA 4L5BA 3TW4A 5IDVA 2C9OA 4ILEA 1L4YA 1NKSA 1SVIA 2Z5FA 4QGHA 3NH6A 2HCJB 4PQYA 5BYKA 4NP6A 2VO1A 3EPJA 3D6TB 2PEYA 4OHWA 2R2AA 2YKGA 5JS8A 3PUYA 4LUCA 5FI0B 5CB6A 2IF0A 1NF3A 4Q7JB 1W36C 3ADDA 2CE2X 4CIDA 4Q00A 3SJZA 1ZM2A 2J5XA 4AKHA 4JBYA 1ZM7A 2WJVA 4LYAA 3VU9A 1KSFX 3A36A 1MABA 1OIVA 2WMOB 3W8RA 4BFYA 4YDHB 4URZR 4DVGA 3AKCA 1VTKA 4XSGA 1XEFA 4HLQB 5FL7D 2FG5A 1GFIA 1TQDA 4FMDB 2BJVA 4TWZA 4DIDA 3L43A 4US2R 3LBIA 2PLFA 4II7A 4D4LA 2QTVB 4A1FA 1KY2A 2GDJA 2FE4A 3TNFA 1G4AE 2GJSA 1XZPA 4NMMA 4F91B 3A1WA 2JLUA 2JLWA 3KX2A 1FUKA 4XSHA 1OHHA 4RKEA 4AK9A 1KI4A 1L8QA 3UMRA 1ZUIA 2BJWA 1MABB 4M22A 1E4YA 4OK5A 2R6CA 1FMJA 1OKKD 1QDEA 5DI3B 5KYKA 4JLNA 3T35A 2C8VA 4W5WA 3SJAA 4IDNA 3T34A 1CS4C 2P67A 1O87A 3BH7A 2XNDA 2ZYTX 4R98A 1QF9A 5EE9A 4C0SA 1MO6A 5C4MA 4PANA 1FX0B 4Y0VA 5GVSA 4RD4A 1CTQA 1G3RA 3K0CA 1OYYA 3DHWC 1GWNA 1QG2A 1TNDA 1R0WA 2A3RA 5FTNA 4D82A 1QHNA 5UKDA 2DPXA 1ZIPA 3K9LA 5KNBA 2QI9C 2JLYA 4MQBA 4H9GA 4CEJB 5DN6A 3WXMA 2QPTA 3I8SA 4CEHA 1GVNB 1F2TA 2XAUA 2FZLA 5FOWA 1GM5A 2XZPA 3GJXC 2IHYA 3QG1A 5HE9A 1UKYA 3AVPA 4LV6A 2C95A 4DCVA 1CULC 1EXMA 3B5JA 4AKGA 4HLUA 4EIWA 2IXEA 5C18A 1Z5ZA 4K46A 5P21A 3AVYA 1E0SA 1YZUA 4DB4A 3IO3A 2Z83A 2PZGA 2HXYA 4Q48A 1LF0A 5J5CA 2CCKA 1R6BX 2VP0A 3RRYA 2HT6A 1RYHA 1Z28A 4U00A 1U94A 3I61A 1G3MA 2ZEJA 2Z6VA 4AG6A 5IK2D 4MGYR 4EJSB 1KDTA 3F3YA 1D2NA 2FSIA 1M6NA 3PIRA 1VDZA 4JLKA 3RC8A 3LVQE 2A5JA 2J3EA 1AJEA 4NCNA 2WMNB 4DUGA 1NNEA 2AXNA 3AVTA 4Z1MA 4CVNA 1FW6A 3LV8A 2QSYA 1P62B 2JGNA 2ZJAA 2BWJA 2ZAMA 3HPQA 3EIHA 3K0CC 3PITA 2XOKA 1CJVC 3FMFA 2GCOB 1RE0A 3BB4A 4PO8A 1H8ED 1E2QA 4Z51A 3GLHA 3X1DA 4Q7MB 3EPHA 2C96A 1HTWA 4YC7A 3VFDA 5IK2A 2F1RA 2HV8A 4TMXA 2V9PA 4HUQA 2OCYC 4TT3A 3IIKA 3L2OB 4FIDA 3UG6A 3L8YA 4BRWA 3HP1A 3QE0A 2FN4A 1LS1A 4DSUA 1KY3A 3DZ8A 4DUGD 3U6KA 4XD7D 3ZZUA 2ODEA 1XP8A 1P4SA 5C1BA 3SYKA 1ZUHA 1M34E 2XX3A 1YVDA 1XPRA 3TUJC 2VHCA 3I4LA 2GF9A 2QGZA 2QPOA 3N70A 2HT1A 2QM7A 2YWGA 1GTVA 4YMUA 3ZVNA 4MITA 3ASYA 4HSEA 1U0LA 2A78A 3SI7A 2WTUA 2F55A 2CCJA 2VHTA 1XTQA 5H1YA 1E99A 3Q5EA 4NH0A 4AI6A 1N0VC 2FV8A 3A1SA 3I73A 1DAFA 1XD2A 3GP8A 1G17A 2NZ8A 3GEHA 3HJNA 2QGNA 3AH8A 1NVVQ 2PX3A 4ZCLA 1ZU4A 3W5JA 4MDEA 4F92B 5DISB 4OJQA 1EFTA 4QJ5A 1LB1B 2MSEB 2F1IA 3A8TA 4ZO4A 5FH9A 4LJ6A 4PSKA 2F9LA 1JQJC 3OE7D 1Z63A 2GCOA 2EFEB 5GVRA 5CJ2A 4ESHA 2NGRA 3EC2A 4PPNA 3RWOA 2NIPA 2ATVA 3QXXA 2QN6A 4PZYA 2ZYVX 1OFHA 1T5IA 2ZU0C 4O0MA 2RGBA 5IRCD 3MSXA 2XB4A 1T3LA 4GNKA 1S9DA 4ESVA 3U3MA 2IWRA 1E1RD 3AP1A 1P2TA 4Y0AA 2IEYA 1ZD1A 1OXXK 721PA 1LNZA 4JLOA 4OQNA 3KQNA 3GLIA 4MGIR 1FTSA 4RZ3A 1JEEA 2CLCX 4PSAA 3L0OA 3O8BA 3TSZA 1A1VA 2P6RA 2YWFA 4Q19A 3OEHD 1DAGA 1DBSA 1VHTA 1GL9B 4CEIA 1G41A 4JSTA 4LV5B 1G64A 1ZC4A 4XOIA 4ABYA 3RS2A 3PENA 4HDCA 1BYUA 4PPQA 2J41A 3THWA 3THXA 2OXCA 4RZXA 4A8JB 3GJ5A 1KDOA 4P4SB 4L4UA 3WHKA 1OV4A 2CCGA 2ZJOA 2IS2A 2F7SA 2R6AA 3FHCB 2GAAA 3CZQA 3VR4A 1RRFA 3TUIC 4N3NA 4M1OA 3VKHA 1JAIA 2V6JA 2WWYA 4Q18A 3AVOA 3D31A 1WB9A 1WRBA 3LQRA 4B2PA 1Z8FA 3D7MA 3H84A 2PZFA 1V43A 5KSPA 3BBPA 2J9RA 4TMKA 1NG9A 1TU4A 4A0FA 3AVVA 4Q66C 1E96A 4M9ZA 4QJ4A 2GILA 3SC3A 1E2JA 3B1VA 5A0FA 821PA 1RKBA 2F6RA 3K1JA 2VBCA 1W1WA 1II0A 5EE3A 3THWB 2IUUA 3ZQJA 3OEEA 1W0JD 4W5HA 2WKQA 4DLTA 4RD1A 3K0AB 4ACBA 4P31A 5BXQC 3UPUA 1W47A 1G21E 1AGPA 4EPYA 5GJWC 5JSZA 2BBTA 4IFBA 2RMKA 1LVGA 2ZTSA 4Q7KA 1W2HA 2KB0A 3SNHA 1FNMA 2BKEA 4ZIRA 1SVLA 1W5TA 2W2XA 3P4YA 1ZP6A 4B35A 4JVSB 2OILA 2IS4A 1IXSB 2WAXA 4LC0A 1II8A 3DMNA 1J70A 3KFVA 3W6NA 2A9KA 1K5GA 2BC9A 2QY9A 3GLIB 3KQUA 3MLEA 3TMKA 3H0KA 1OT3A 1XEXA 3TH5A 3VQTA 3IPXA 4Q9KA 3FVQA 4GI7A 4GOKA 2B92A 1OLOA 1H65A 1XB2A 1GOTA 2DYKA 3GEEA 1GDDA 1ZD8A 3IUYA 2YNMA 3AF1A 3HPRA 3LBNA 3VX4A 1WDTA 3OIWA 1U8AA 2EWVA 4PC1A 4ZKDA 4TLCA 4DT1B 2HJGA 2I1QA 1GSIA 1A2KC 1VG1A 3IQWA 3K09A 4LJ8A 1GNPA 3TRFA 4I81A 4D6PA 4DHEA 3LRPA 1ZU5A 1Q3HA 3LWNA 4NYMQ 4US0R 2QPAA 4YXWA 3LDAA 221PA 1G1MA 5AUQA 3RABA 3TKLA 2CVHA 1XEXB 3B8HA 4LJ5A 3TQFA 2ZREA 4OQLA 5JHHB 4EDHA 3SZRA 2ZJ8A 2QP3A 1AK2A 1X8KA 2JLSA 2CE7A 2G0TA 3QEOA 3CNLA 4NE2A 1FQKA 4WAUA 2WJGA 4OHVA 1XRJA 5EUQB 1XFAA 2B7BA 2J87A 1E6CA 5BQ5A 1OFTA 4NYIR 2OBMA 5TB5A 5HZKA 2AL7A 5JI2E 5FI1B 2WZQA 3RLFA 5L3SB 1E9EA 1DOAA 1TADA 2QMUA 4QGFA 3LLMA 4EFNA 1US8B 2QZ4A 3NEJA 4MRPA 5KO2A 4MUBA 1A4RA 4F7WA 4R9UC 1KI8A 5JS7A 1G291 2VP4A 3THOA 2VP6A 1YR7A 1D2EA 2H92A 1W36B 2ZITA 4TTQA 1EWQA 1R0YA 2C99A 4A9AA 1TF2A 2JEOA 2ZE8A 3KXIA 3OFND 2FA9A 3EA5A 3GJ3A 2ZSFA 1GP2A 1BH2A 4GZLA 4G0NA 3HR8A 2QP4A 1KI7A 4BEJA 5LDDC 4PC2A 4DT1A 2Z0MA 4RKFA 2QRNA 1KDPA 3FKQA 1IQPA 3MMPA 3PEYA 1KYIA 3DDCA 1W36D 1Z22A 4EFMA 1N6KA 5AJWA 1GKIA 4TQAA 2ORWA 2FGKA 3R8FA 2GRJA 1W44A 2C78A 3I32A 5G3ZA 2PCLA 3GLFA 2FPMA 4RFVA 3FKSA 4LBWA 5JFGA 3AVWA 1LV7A 3U61B 2GAOA 2WWWA 3P20A 1XTIA 2ZR7A 4PQFA 4U02A 3WNCA 4GZMA 2ZRFA 4TSFA 1YRAA 1IHUA 3SR0A 2Z4SA 1Z83A 2F3TA 3HYRA 1GNRA 3ZLJA 4G5SA 2J46A 4KBFA 4TL9A 4D0NA 4CEIB 4C3ZA 2ZJBA 4HLUC 3ADBA 4UXHA 3NTUA 3BB3A 5EE1A 4TZ6A 3G82C 5HCNA 1M1YE 2CNWA 1A82A 3F8TA 5FPYA 5DHAA 3PEVA 3RS3A 2RGDA 2IYQA 1UF9A 4M0LA 5JLJA 1WP9A 4IVPA 4DCNA 1FFHA 2FJUA 3VR5A 3LX5A 4BFSA 3BWDD 1U9IC 4POAA 1LY1A 5JECA 2F1JA 1VCMA 3AF3A 4I4LA 2GXSA 3OIYA 3SDZA 4V02A 1N6NA 5JRZA 4WXPA 3EX7C 4BLSA 3AP2A 2QTHA 1E2DA 2VLIA 4QJ3A 3A1UA 2VA8A 2LKDA 1OH8A 2QMEA 3GD7A 1U8ZA 2HUPA 1MO5A 1E9AA 4PO1A 4AWXA 2W0SA 4IRUB 4JMPA 4HI0E 2IHBA 4B73A 1F2UB 2CNWD 5KUTA 5JJLA 4GMDA 4UKDA 1EFUA 1E94E 3ETLA 5KDDA 1UKEA 4HZIA 2WSSD 1XEWY 3C16C 3ZZ0A 5FPHA 2V1XA 2KE5A 4C0HA 2VP9A 1OJLA 3QIAA 1HURA 1SVMA 5CIWA 1IBRA 2VHUA 4K81B 5DO9A 5DIFA 3QVUA 3EWAA 3B1WA 3KB2A 4F38A 1ANKA 2RGCA 4CRWB 3RYTC 2ZPTX 3RSLA 3X1WA 1JXOA 3PFIA 4RD0A 2HDNB 5HTKA 3R9XA 3KDSE 3U2QA 1OIXA 1FPMA 1IONA 2QMOA 5CLQA 1W0KA 3V4FA 4BFUA 1NBME 5CDFA 2MMGA 2JIZA 4WBSA 1OFUX 1XCMA 1YZQA 2JJ2D 4Q7LA 4BRUA 2X77A 1EK0A 3C41J 1NVUQ 5EP2A 3FKSD 2RKOA 1G19A 3IEUA 5FFMA 5G53C 3BOSA 4A2QA 2JLVA 2ZYUX 4B3CA 3SOPA 1ZBDA 1HH4A 3MGCA 1JQLB 3WRYC 5M04A 4LJ9A 1E3MA 2W6IA 1QG4A 2GBLA 4AURA 3C4JA 1UPTA 5FUWA 4Q4AB 2IL1A 3H4MA 3PCRB 4M9QA 2G3YA 4Z54A 4TMZA 1OXVA 1O3YA 1ESMA 2IT1A 2NZJA 2YHSA 2HJVA 3EW9A 2IA5A 1I4LD 3KQLA 5IHPA 1EWRA 2W6JA 3BS4A 4JLDA 3CIOA 3CH4B 3ECCA 1N5LA 2MSDB 3W90A 1M2OB 2R6GA 3CR8A 4ASUD 2K5UA 1U98A 4ERNA 4PQRA 2CXXA 3P26A 1CJUC 4GT1A 1FUUA 1PVOA 4S2EA 1Z0AA 1Q1QA 4LSGA 3WNBA 2FSFA 1KK0A 1NMZA 4Q9HA 3E70C 2E9SA 3AQ4A 2R62A 3L0SA 3SJBA 4DLXA 1P3JA 5JI3E 2GNOA 1OIWA 4M9SA 5E3HA 5KOYA 1XCGB 4E07A 4C2UA 1KOFA 2OV2A 2ZETA 4GL2A 3FHTA 2I4IA 3AF4A 3H86A 1CBUA 2GESA 2YC2C 3QKSA 5FR1A 5LB4A 3A4MA 1OE0A 1NBMD 2XSZA 2OUKA 3GCGA 121PA 1SXJB 2WWIA 1MRSA 3NC0C 4F4CA 3FE2A 3LX8A 4DLUA 2QL6A 4C0AC 4DCSA 3GJ6A 4P33A 2CK3D 3CX6A 3O8DA 2LKCA 1IJFA 2UVQA 4GP7A 3F5FA 2BCGY 1X6VA 2XTNA 2YYZA 2ZQ5A 3RVBA 4UNSA 3RNLA 2D62A 4WXRA 3THYA 3TUZC 1KGDA 4B6FA 1N6OA 4CEHB 3QSYA 3QNUA 1EX6A 3IKJA 3Q9LA 4HATA 4M53A 4P4SA 1BKDR 1CU1A 1GILA 2WWHA 4RZ2A 4EPXA 4LHYA 2IX3A 2REBA 1F5NA 4A0RA 5JWRA 2ODBA 4Q5IA 3AKYA 2AN9A 4URVR 1E0KA 2E87A 5C2JB 1TUEA 2IYRA 4L9SA 2O8BA 3OEED 2PT7A 1NN3A 2KSQA 3HU2A 3AV0B 5CM8B 1JJ7A 1ZM4A 5DI3A 4DDTA 1KZGB 3REFA 1LF5A 2CLSA 5KSYA 4DZZA 2Q9AA 1IJEA 1T6NA 4MKHA 1KZ7B 4A6PA 1N3BA 2YJTD 3VHLB 4LGMA 2V7QD 4MRVA 2BOVA 4I1SA 2WSSA 5FTLA 2WJIA 3DOEA 5JZVA 4ON9A 1OSNA 3AM1A 3EASA 2PX0A 3SYLA 3W6PA 4EQ6B 4OI4A 3A1TA 4TYQA 1QBKC 5KSOA 2IK8A 3QXCA 4MYHA 2OFWA 2ZAOA 2DY1A 1QHHB 3ZQ6A 3KKNA 4YDSA 1E2GA 5J4VA 1GKUB 1KO5A 3HYTA 3EZFA 2W58A 2WIBA 4B32A 3LXRA 2IUSA 4Q1FA 2O8BB 1HT1E 3U7HB 1RRCA 1Q20A 2CMKA 1BMFA 1UKVY 3MD0A 4Z8YA 1AQYA 3KUDA 3WY9A 3GEIA 5L8VA 2OE2A 1Z07A 4G5QA 4C0LA 2V4ZA 3OZXA 4L9WA 3JVUA 4TYNA 3T1TA 5ELXA 3AEZA 5A5GA 2R9VA 4FCVA 3VMFA 2O8CA 3U3KA 1XBTA 4NYJQ 4HAZA 5CB8A 2OZEA 5JRJA 1ZRHA 5F9HA 3ICQB 5EXXA 4IDQA 5FBQB 4Q9JA 4LZZA 2RGEA 4BZQA 3PUWA 2C77A 2O8DB 3TVTA 1P7CA 1S0UA 4HYYA 4HDOB 3PV0A 4DIEA 1XX6A 1YQTA 1Z6XA 3WMFA 4C0QC 1R7RA 3ND9A 1E9SA 5KPJA 3K09C 2B21A 4QRHA 4LYHA 4QBHA 2OSBA 4A0GA 3S1AB 2QSZA 5E4FA 4Q4AA 2Z4RA 1BS1A 3DPUA 3KJGA 1JECA 2Q3MA 3B2EA 5BN3A 2KBFA 4LHXA 2WV9A 2PL3A 2AFIE 4K8OA 4CGZA 3M6AA 1SXJE 3RRZA 1XWIA 1XXHB 3TAUA 2ZIAA 2ONJA 2A2ZA 5JMTA 1W5SA 4Q1AA 3RS4A 3QPVA 1CRQA 1TUIA 1N6HA 1Z47A 3VX3A 1G4UR 4A0HA 4JLAA 1T0JB 1TL7C 1R10A 2AFHE 3EZ7A 5KPDA 2AD5A 4XVQA 1IAQA 3DMDA 4GBMA 3R7WA 2J7KA 4DJTA 3TW8B 2WKPA 2IBMA 3B6EA 1NL3A 4LJYA 4XVRA 4XTCS 5C4GB 2WKRA 1PLJA 1ZINA 1Z6TA 1XD8A 3JZAA 2J0UA 1CR2A 4LC1A 1MKYA 2IC5A 3IIMA 3T1OA 1XXHA 4OI1A 4ACAA 2ZRJA 5CITA 1YZNA 2CHGA 2ZRGA 1X1SA 2ATXA 4P4TA 1XCPA 4NCHA 5K8IA 4ZV4A 1PUJA 4HB0A 3LFUA 1AGRA 5F3WB 2W2TA 2AKAB 2BVNA 2Q9CA 3QKTA 1CF4A 3C14C 1DG3A 4FWTA 2RCNA 4OK3A 2QAJA 2HLDA 2PT5A 3QKRA 1ZYUA 3T5GA 2V3CC 4BPBA 5B64A 1ZNXA 1ZC3A 3GQBA 4N0DA 1KSGA 3I62A 5JJIA 3R9WA 4TT3D 1P2UA 3HU3A 2F1HA 3F0TA 3N2EA 2GJ9A 4NYIQ 3O47A 1VCOA 1NY5A 1GUAA 1KMHA 1Q57A 5FPTA 3AUYA 2RH5A 4OHYA 5DI9A 2VHQA 2QTFA 1BO6A 3UK6A 2BBWA 3ICEA 1T0HB 3RSOA 2NOAA 3CM0A 1JBKA 2PLRA 3ZDQA 4C2TA 1F3OA 2EQBA 3NWJA 1J8YF 1EFCA 3QI2A 4KFSA 4W7SA 3DM9B 4HAUA 5F9FA 1RW4A 3QF4A 4DSTA 3IHWA 1JEDA 1ZCBA 3QEJA 1XPUA 1F48A 5SZIA 1P9RA 3NEYA 2CJWA 4DKXA 2XXAB 1R4AA 4ZIRB 1NN0A 2BHRA 2RHMA 1YZKA 2JJ2A 4AYTA 4KSCA 4DLYA 3T06B 1IY0A 2N46A 1IN8A 4HDQB 2D2FA 2NO6A 5JSZB 1YZGA 2IW3A 2GCPA 4B71A 4UNRA 2A7QA 4IEEA 2PJZA 4QXAA 3ZYCA 1N6IA 2RGGA 4TYWA 1W4CA 4ARZA 2H57A 3EIEA 3EA0A 2GWHA 3CF6R 1S96A 3VU9B 4U7DA 2HYIC 1VCIA 2AWNA 1VYUA 4KO8A 4B76A 3V9PA 3AKEA 2R65A 3L0PA 3DM5A 2VSOA 4JIMA 2ZI4A 4KLNA 1Z3IX 1GRNA 4BZPA 8OHMA 1JI0A 3AB3A 5SZKB 1Z2AA 1YZLA 5DLQC 4G5OA 4CT5A 1H8HA 4GOJA 1DO0A 1KIMA 4ZKEA 1S2MA 4Q02A 4KXFB 1HE8B 4NDZA 5EZ5A 5KSZA 1E9CA 1KDRA 3X1XA 1NVXQ 3QJYA 3K9HA 3GLFB 3GLGA 1VYTA 4MRSA 4B3DA 1UFQA 1QVRA 5FL7A 1JXMA 1DTSA 3EXAA 3QXJA 3QXSA 5DE3A 421PA 1U0HC 2ECKA 3ADKA 4B43A 1UBGA 4DB2A 3LQQA 4IOJA 2GEUA 2J0QA 2O8FA 4XIGS 4YMSA 3I5YA 3SN6A 1RRPA 2B7CA 2BEJA 4TSFD 4QKQA 4V0OA 1D6JA 1L2TA 2ZI7A 1CR1A 3K0FA 4JYBA 1OYWA 3MJHA 1Q0UA 2CK3A 4NCIA 4Q4JA 4EKDA 5EE5B 3AVUA 3CZPA 4G3XA 2GEVA 1I2MA 3KJIA 5TV2A 4Q4HB 5SZJA 3A4NA 4WVFA 4KFRA 3VR3A 3C15C 4RCYA 4TLAA 3SFZA 3TSWA 3V4RA 5EE0A 3CRMA 2DHRA 2QAGC 1NLZA 3KB1A 2FFQA 1XJCA 2EFCB 5CJPA 3BE4A 3TR0A 4BQSA 2QEQA 1JPJA 4PC7A 2WWXA 3U4QA 3KTAB 1ZNWA 1SVOA 4V0NA 4GRAA 2ZRHA 3X1ZA 3HDTA 4D80A 1MH1A 1S9HA 1YJ5A 3CF2A 1M7BA 5EP1A 4NTZA 3U44B 4JYCA 2BCJQ 1KJYA 1NN5A 4R7ZA 4RJLA 3BGWA 3A4LA 4ASUA 2AKYA 1CJKC 2YINC 1E2LA 3CH5A 2QP9X 1MO3A 1RFLA 5D3MB 4S35A 2G77B 4P4UA 1GZSA 2C2HA 4M1TA 4M8NE 4WZAE 1YE8A 3BERA 4URWR 4B3BA 3OFNA 1WA5A 5GJCA 1BIFA 2CDNA 2NTYC 3BAFA 4IDHA 1WF3A 4N1AA 1TU3A 4D4MA 5JBQA 1JAHA 3LBHA 2QBYB 1RJ9A 4V0KA 1G3IA 2NO7A 4Q47A 3AKDA 1FP6A 3KXLA 4M1WA 2CL6X 3ZS8A 1LW7A 3DKVA 2RB4A 1AQUA 5HCIA 1UDWA 4A6XA 1FZQA 1NI3A 3NIBA 1X3SA 2ZRLA 4US1R 2ZRPA 1OB2A 2DR3A 2DBYA 1FTNA 2ZXUA 2D74A 1VKJA 3DOFA 3GJ0A 2ZSEA 1J99A 4G01B 3PEWA 4O25A 1FNNA 2ZVQX 5C46F 1T3HA 3QPUA 4PPGA 2IXFA 4BECA 2ANBA 4UXJA 2H1LA 4TMWA 2AWOA 3QXHA 2FSHA 3SBEA 2FWRA 3BFVA 1DELA 1AS2A 1KHTA 1RRGA 1XMSA 4A36A 1TEXA 1AKYA 3HU1A 3RDPA 3AF2A 4OQXA 4KYIB 3IEVA 3FYHA 3GLIE 4MKGA 2NQ2C 1P5ZB 3GLHE 3QOFA 5H70A 3RRNA 4EPVA 2EFDB 2IXGA 5DN6D 3K0FB 4LDJA 2ZUCA 2JAQA 4QBGB 2J7PD 4LPKA 2ZI9A 5DH9A 3OHMA 4JLJA 1T5LA 4Q1CA 3IDQA 1JR3D 1S3SA 3KUCA 5AJXA 2X19A 1WCV1 1G8YA 1TAGA 3Q3JB 1R0XA 4KODA 3GLFE 4ZDKA 2A5YB 1AS0A 1TQ4A 5L3QA 4IFEA 1R8QA 1KMQA 2VQSA 3I3SR 5L3RA 3RANA 5JWHA 4C30A 2ZE6A 2WPDA 4Q4LA 4DLSA 1P72A 2ONKA 2RAPA 1KK1A 1AS3A 4KJZA 4GMXA 2ERYA 4NHOA 1DVRA 1M8PA 4DDWA 2NMVA 5HR5A 3KQKA 1Z29A 1U90A 2CHVA 1G9XA 3A58B 4XH9B 2ZJYA 2OAP1 4DEYA 1X8LA 4R71A 5IT5A 5FBLB 4FWIB 2OHFA 1Q3TA 1G7CA 3NBYC 2QRZA 1KI3A 3CNNA 4JLPA 2FOLA 2WAYA 3SHWA 4BLOA 1KI9A 2R44A 2YWHA 5BN4A 2PJRA 2DWPA 3BRWD 4JT4A 5TARA 2DWOA 2ZRIA 1HY3A 2ZANA 3U7GA 2AK3A 3UATA 3ZD7A 1E0JA 5B30A 2DB3A 4ZCMA 1ODFA 4A4DA 3VNVA 5BWMA 1EFHA 4D4JA 5KHOC 2YV5A 1QHGA 2NPIA 1NG1A 1TX4B 1P75A 4C0KA 4NPHA 5DGXA 3GLGB 5JCPA 4QNMA 4M1SA 3DVLA 1A5TA 3OIVA 1JR3A 1N5JA 4QBFA 3QENA 5CYOA 4BFZA 4B48A 3Q7QA 1S1CA 1XXHE 3CWQA 1G6OA 1QVAA 5FL3A 2ORIA 3CO5A 4OYHA 5AUOB 1L4UA 1E0AA 1FOEB 5FOUA 2UZIR 1WBDA 1E2FA 1R0ZA 4HUTA 2B8WA 2X1VA 3D3QA 4RY2A 4FW9A 4IKEA 2TMKA 5FPSA 4YMVA 3BH0A 2JLQA 2I3BA 4JJZA 4BLRA 1DEKA 2D7CA 2OBNA 3NDPA 4AY2A 3GJ8A 4PZZA 3QG5A 3VR1A 5J40A 2WJYA 2REXB 1UKZA 4UJ5A 3I5XA 2VP2A 5F98A 1E79A 4XTRA 1Z6AA 1KAGA 3FB4A 1KMHB 2PH1A 4CZ2A 1SULA 3DO6A 2QMHA 4I1OA 4JSYA 4IJMA 2IS1A 4LWZA 4D26A 1DPFA 5TMPA 3WBKA 4DSOA 2MMCA 1E2NA 4QL3A 5GADl 1XF9A 1U2RA 2C98A 4JVMA 4OL0A 1U99A 3UIEA 1N0UA 1RVDA 1SXJD 2VEDA 1IY1A 2QENA 3LNCA 1CJMA 3U7FB 1YU9A 4URUR 4DSNA 1KTVA 3AF0A 3WYAA 4C7OB 2V54A 5FUVA 2F43A 5J4LA 5FR2A 3GLHB 2C5LA 5CK4A 3WP1B 2ZS9A 4AD8A 2FFAA 3Q85A 4CF7A 4LHWA 1W4RA 5IF9A 1S8FA 4V0ME 4XJXA 4UNPA 3UMSA 3V00A 1D5CA 2DWQA 1VG8A 1P9NA 2H5EA 2QORA 4JKYA 1HUQA 5DHFA 1NJGA 3HR7A 4HAWA 2YC4C 4BFXA 1UBCA 4YXWD 3I8XA 3FMIA 4FMCF 3EZ2A 3T1QA 3QBVA 2XITA 2OO7A 2WWGA 4HB4A 3K0AA 3OEHA 2JLRA 1XPOA 2ZYWX 4ZI2A 4B34A 2B8TA 3K53A 1KI6A 4JL8A 2QROA 4B33A 1OH7A 4V0MA 1YR9A 5JEEA 1C9KA 4BLQA 1YR8A 4MYCA 4CEJA 1OPXA 1VIAA 1CP2A 2GCNA 3CWZA 3GJ7A 1V5WA 3CBQA 1XMJA 1ZW6A 3CRW1 1E98A 1P61B 3DKPA 2O8FB 1U0JA 3W9YA 3UG7A 2C04A 3B13B 3BC1A 1GRQA 3B9PA 2N42A 2O8DA 2DCUA 1VCNA 3RWMB 5JJKA 4JBXA 1EX7A 4EQ6A 5CM9C 2JCSA 4GP6A 4IXMA 1ONBA 2RGNC 3S1AA 4W5JA 2GJAA 2GXQA 3I92A 5ANRB 1N2CE 2BBSA 2BM1A 1B0UA 2GTPA 3NC1C 1HYQA 4A8JA 1VYVA 4OHXA 1H8HD 3FOZA 5B57C 1E2KA 2A30A 3FPAA 2WBLC 2W00A 1XNJA 3DZDA 2QAGB 2O8CB 3BH6A 1W7AA 1P9WA 4B74A 3GFPA 4AG5A 1E2MA 2VYFA 5FOXA 1UBFA 4IXNA 1Z06A 1NIPA 2O52A 2SHKA 4QHYA 3GPLA 5AR1A 2DFNA 1W48A 3CRRA 4B2IA 2ZI6A 5B2ZA 4DLRA 4UNNA 1Q22A 1K6MA 5HKKA 1T9HA 2A5DA 2DFTA 3QBTA 4A2WA 3C7KA 2QT1A 2ZR9A 3BIFA 1OH6A 2IYTA 2YZ2A 4MRRA 2W83A 2QQEA 1ZJ6A 4JL5A 4FMDF 3DEFA 2RGAA 2KI5A 4MGZR 4M1MA 1QRAA 4LBYA 5F2EA 3P4XA 3W8NA 4LYJA 2IYXA 4LI0A 3W3AA 4XWAA 5LB2A 1SXJC 1ZCAA 1SVSA 1YZTA 5HZHA 3PG5A 3FTQA 2QAGA 1Q21A 2HXSA 4Q21A 4B75A 4FMBB 1MO4A 3LAWA 4NBSA 2FDCA 3FGNA 4YLGA 5FUXA 1M74A 2AHOA 1U81A 3TSOA 5D3QA 4XWOA 2IYSA 2J45A 1JR3E 4NL4H 4DXAA 4M21A 1SKYE 3TBKA 3N2IA 5FOTA 3CLVA 1RYFA 1ESNA 4BFVA 3VAAA 4OHZA 4QFMA 4JS0A 4L15A 4Q9IA 5J4YA 3BFXA 4TQUS 5B58C 1CLUA 2GZDA 4AYXA 3MWYW 3O8RA 1G3QA 2IUTA 1MV5A 4TLDA 3IILA 5HE8A 1HA3A 1SVKA 1E2EA 1E1QD 2Q0HA 3R9IA 2VIIA 1E9FA 4V03A 2EWWA 1TQ2A 1G16A 3WBJA 4LRWA 1CIPA 5EXTA 5BYJA 4HUQB 3W5IA 4P32A 1IN5A 3B1XA 4G5GA 1KI6B 4N0EA 5GJVC 4IDOA 3QUSA 3IHLA 4I1UA 4MYTA 1N6RA 4KLZA 3OAAA 1SXJA 3O8CA 4B3FX 3B1YA 4YMWA 2Y8EA 3RS0A 1E1QA 1N6LA 2JATA 1E2IA 3B78A 4TL8A 3K9NA 4LJAA 3AUXA 1KSJA 1N5IA 5FBRB 3ZH9B 2FFBA 2GHIA 4LJ7A 5DNYB 1S4QA 3ZVLA 1N5KA 4OK6A 1B23P 2QA5A 3H2YA 1XEWX 2V8OA 1KSHA 1TPZA 2ZRDA 4DDVA 3RS5A 1W2GA 4NYJR 1MT0A 2PZEA 3KKOA 4AYWA 4O2LA 3SU8A 3OIUA 1LFDB 4F4JA 2ORVA 1MR3F 2J0UB 1XTJA 5J47A 2ZROA 3E5HA 5E95A 4Q03A 3AVXA 1YRBA 4OKSA 3VR2A 2L0XA 1SKQA 621PA 3B60A 1CKEA 2KJQA 3ZD6A 1DE0A 4PPFA 5JHGB 4QC2A 4QGAA 4WZBE 3Q8XB 4IOMA 4NKRA 2YWEA 1P2SA 4PXAA 2P65A 1KK3A 1PUIA 2XJ9A 1ETUA 3EWSA 4G5RA 1KKMA 1XMIA 2ZSDA 4PR0A 4URXR 1QHHA 3X2SA 1I4DD 3DL0A 4KVAA 2BMJA 3MAAC 1NP6A 4EAQA 4A15A 4OQMA 4JL6A 5KDOA 1FL9A 1RC8A 5DSZA 2QUZA 2P5TB 3W6OA 5EXPA 1C4OA 3MWJA 4D81A 4KSBA 4L16A 2O8EA 1R5BA 5JEDA 4JJKA 2BIFA 4RVCA 4E5UA 5EUMA 1E9BA 2JJ1D 4I99A 2XZLA 3AP3A 1RZ3A 4FI3C 4MA4A 1VPLA 2DFKB 1XD9A 3BD9A 2Q3HA 1A2BA 2NO9A 2WM9B 4RZUA 5AJZA 3RS7A 2OAQ1 2PMDA 1NSTA 1KAOA 1X1RA 3P27A 2QNRA 4HB2A 4AC9A 4RCZA 4DLVA 3EC1A 1Z0JA 2ZR0A 2O0HA 4Z8XA 1FMLA 3B85A 3P1JA 2FEMA 1A7JA 2EFHB 1G8GA 2GJKA 1XU4A 2H7VA 2NO0A 2V6IA 1F2UA 2VPPA 4H1VA 4NU0A 5FTKA 3REGA 1BOFA 4BE7B 4D4KA 2GKSA 2FNAA 3WHLA 3KQHA 2QQ0A 2C9CA 2FU5C 1OKKA 1XTKA 4GSYA 2QG6A 4W9MC 2FMXA 1Z0KA 1G5RA 4PHHA 2GZHA 5H8WA 3NBXX 4KI0A 2WWFA 3NBZC 1Z08A 4X8MA 3THYB 2O5VA 1G8HA 2IS6A 2XB2A 4ZCIA 2VF8A 3T12A 6Q21A 4Q01A 1KK2A 1PV4A 4H1UA 1W46A 2VRWA 2X2FA 2FPKA 4B47A 4FMCB 3KJHA 4WA7A 2WSMA 1MOZA 2IYYA 1NMXA 1WBBA 4CT4B 2PMKA 1ZUNB 4NCJA 1G3UA 1CXZA 1XMVA 2VHJA 4MKFA 1X8JA 3TAHA 2IYVA 5FTJA 4B44A 1E2PA 3BFKA 5AJVB 5HKKD 3GFOA 2FGJA 3VKWA 1LS6A 1JNYA 1TF5A 5TDHA 4GFDA 3EAQA 3UANA 3U5ZB 1P2VA 2Q6TA 3ZZTA 1R8SA 4GOXA 1UDXA 2CEAA 4D0LB 4AKEA 3B1ZA 2ZJZA 3IGFA 2D06A 1HQYE 4C0JA 1YKSA 2GZAA 3G5UA 3U3JA 4OI0A 3BJIC 3X1YA 1SHZA 1G20E 2JDID 2AX4A 5CLLA 1OXTA 2FZ4A 3RAPR 1GL7A 4LHZA 5BW8A 2V55B 3MUFA 1IN6A 4JBWA 2EYQA 4JLBA 4Q1EA 5AWFC 2OFOA 5AUNB 5J4KA 3BK7A 2FH5B 2OCAA 1COWD 1HT2E 5L3VA 3EZ6A 4ARZB 3H1TA 4DDUA 4CYMA 2BMDA 2UKDA 3C8UA 2HEIA 5L3QB 3UWOA 5LD2B 3OESA 3K70D 4DLZA 1DAKA 1SHKA 2YOFA 2W0MA 2JJ1A 2GK6A 2J0VA 1G8PA 3M4YA 4URYR 4DRZA 3PXGA 3QPWA 1VECA 5G40A 3FFAA 3KJEA 4F4IA 4RFSA 1UAAA 1Y3AA 1RIFA 3WMEA 2OEPA 4KYUA 4LOAA 3EG5A 3U3OA 1T3SA 4B2LA 2GXAA 1D2MA 1CR4A 1HEIA 2OFXA 1T91A 3CX8A 3A6PC 3LW8A 4UNQA 4KVGA 2JLXA 4X8LA 2XNSA 2VH5R 5AK0A 3K9GA 4O3MA 2QT0A 4XWKA 2D2EA 4PC6A 4EPWA 5GJBA 1L7VC 2QBYA 3D8BA 2BMEA 2ZRNA 5TVKA 1QHSA 2ZUBA 1XTRA 1NMYA 2Z43A 4FINA 1SVWA 4C7OA 1Y63A 2ZJ5A 3C5CA 4KBGA 1G6HA 3PUXA 2ZVPX 4KU4A 1R5OA 4D25A 2ODNA 1ZMXA 3CB4A 3E1SA 3Q5DA 4LJ4A 3J81k 3KTAA 2G88A 4KCGA 4PO9A 4PZLA 1DAMA 3MCAA 3NXSA 4OQFA 2JJ8A 4JVLA 1D9ZA 1U8YA 4M1KA 1XDBA 3SQXA 3NHBA 1WXQA 1OF1A 5LPNA 2F43B 4IOKA 2AD1A 2GF0A 1W49A 1UJ2A 4MDFA 3KKQA 4HB3A 4PTLA 4C9BA 4KITB 1G5PA 4PC3A 3IPYA 4QHSA 1F60A 2O0JA 2Q3FA 3ASZA 4Q4JB 1DAHA 4TMVA 4AIIA 1US8A 521PA 2ODWA 4X8HA 3U44A 1W0JA 3U60B 3M1IA 3LD9A 4FN5A 4HLDA 5FTMA 1J2JA 1HE1C 1R5NA 2EVWX 2QE7D 1TF7A 2VL7A 4FD2A 4IVQA 2XTZA 4MUAA 4LPSA 3Q72A 1KO1A 3NDBB 3NH9A 2CL0X 2GBLC 1E9RA 4ZDIA 3TJZA 3WYFA 2JA1A 3B9QA 4Q1BA 2JDIA 3IIJA 2XGJA 2ZI5A 1GAJA 3NBFA 4ITRC 4MGKR 5FOSA 1Z6GA 4TYYA 5BN5A 4EJSA 4BWYA 2WHXA 4O2RA 1KO7A 2IYWA 1AM4D 1KKLA 1UEJA 2WPDD 2P0EA 1W4AA 5FBWB 3NG1A 2G6BA 4UJ3A 4DEXA 4R2IA 4DBLC 4P3YA 3KKPA 1I2DA 2W6ID 2H16A 2ZRAA 3TGPA 3Q7PA 1N0WA 1UBEA 1ZAKA 4KAXA 2J0SA 4TZ0A 1T8UA 3ZIAA 2Q9BA 4NZYA 1IXZA
chains in the Genus database with same CATH superfamily
4KGVA 1C2YA 3EFBA 4FFNA 4IW3B 4RVNA 2CDBA 2PEZA 1NLYA 3R8CA 1EUYA 4I9GA 3P2OA 3K2IA 1R0CA 4LY6A 1PFQA 3T15A 1C30A 4MWBA 2I7TA 2O0KA 4TSRA 3WOHA 1MGOA 2IF2A 1D2CA 1GKYA 3BSYA 4HP8A 5FDFA 2Q7XA 5AW4A 1PHPA 1K8RA 1Q91A 3AHJA 1EP3B 4MVJI 4E2YA 1OD6A 1DADA 4B3XA 2G0NA 4UTPA 1QIHA 5EQTA 1OHHD 5C1OA 1Y8AA 2FR8A 2PA0A 2MOKA 4O33A 2JD1A 1N7HA 3PEUA 2DF8A 4K05A 1QGYA 2PBLA 4UDYX 5D5HA 3R77A 3X2EA 4A3SA 4RHCA 3N05A 1XKTA 4BGDA 2CEKA 2CWDA 2FEOA 4HCJA 2GS9A 3N76A 4TN5A 4C7JA 3PUIA 3L49A 1JVBA 2E4WA 4JKIA 2OLJA 3EFOB 2O23A 3RRXA 3TTTA 3RTAA 5CA1F 2W2OA 1QUEA 2CKMA 3THXB 1QIMA 2J31A 1ZXLA 1X14A 1Z6YA 2BEKA 8ATCA 2KBEA 3QY0A 4NONA 1HC7A 3TI9A 2O1SA 5GM2A 4ZI7F 1BDIA 4ML3A 3KHUA 1JG4A 4LNUB 3FW1A 3HCBA 1V1JA 2XE6A 3EXG1 4HEQA 1NJ6A 4BUJA 1RI1A 2PX2A 1YS2X 2BFDA 1Q7BA 2IZ1A 1SCNE 1XSEA 3JQQA 3DL4A 4IO0A 5K3BA 4IQ0A 4JU8A 2YCLA 3IBYA 1XQ9A 4TLEA 1W5EA 3DMHA 4ZVUA 4D4IA 4ER7A 2OHVA 1CQJB 2WICA 4NV3A 4OJTA 1QMGA 3HFSA 1A8QA 1E5QA 2EJBA 1WXDA 2P2NA 2QMQA 1IXRC 4BZXA 4EGQA 4BKRA 3EVCA 1OXSC 2YWXA 1G7TA 2B25A 3LH5A 1MX3A 2GFQA 3GP3A 2FYTA 1YB2A 2QNBA 4HWSA 4MUGA 4QELA 4RKWA 5D7BA 4YUXA 2XNDD 3CX4A 2XCTB 3AZPA 1MO2A 2HR1A 1VGQA 4PS0A 2QE7A 3BWYA 2DWUA 4RO0A 4ZQCB 1IM2A 4S1NA 1R6VA 1V6SA 2V3VA 4F5EA 4CMAA 3R5KA 2XDWA 4I1VA 3PFFA 1HE3A 2RD2A 2HYDA 2WY2D 3STWA 4EW3A 4YDQA 3DV9A 3E2PA 5B3JC 4IJWA 2GEDA 4RY9A 1EWYA 3T5DA 1QHIA 1DAIA 2B30A 3HE3A 1D2GA 1WULS 1T8WA 2IYZA 5CA0F 2B69A 4FOPA 4LYFA 1YR6A 1XN1A 2FEWB 1BD3A 1NJFA 3GNSA 3LFTA 4EM6A 3TL2A 2QTAA 4EHHA 3ERCA 2O8EB 3QKRB 4KGXA 2O4UX 3QPAA 1IJKA 2EW2A 3G0HA 2BFEA 1BYIA 3AOGA 4INAA 3ZGVA 1E5TA 1TYZA 3UGQA 4AN4A 1M10A 2FWMX 3H1EA 2VQDA 2WVAA 3UA4A 9GPBA 4DXDA 3SVLA 3QKUA 1LRJA 4KL8S 1FSPA 3BGVA 1DAEA 1QYCA 3OHSX 2WF5A 5ALPA 1X7WA 2RHDA 3B6JA 3TIIA 4JUFA 3CPJB 3V3TA 3G1WA 3ZWMA 3TE6A 4LZJA 4C43A 3KOUA 3ESXA 4MQFB 2H65A 2OB2A 2SKDA 3QUQA 1LPOA 1PDVA 1YL6A 5G41A 1P19A 1K75A 1M2VA 2APJA 4JT8A 1VIYA 1FA9A 2C9DA 2FPPA 2EU8A 1GXSB 2XWJI 4J0QA 5IUNC 4HGZA 5FNZA 2IHJA 1L7BA 3IEXA 1VI5A 1U3UA 3C70A 4MH0R 4GL4A 2CJYA 3MJRA 4NBWA 2F2TA 2JFHA 1Z8DA 1DOZA 3JPWA 4L9RA 4KKVA 2QMYA 4OBEA 5H5JA 4QIHA 4DABA 1FP4B 2Q6IA 1A0OA 1EFPA 2KW5A 5DMXA 5B4VA 2ZRCA 4Q9DA 1T9BA 2VCHA 1HXHA 1VDMA 1VHLA 3CX7A 3K0EA 4IS2A 4QG7A 4BNZA 2XR1A 1DRVA 2FN3A 2VK1A 3UAVA 3PVCA 3WNDA 4LBZA 4DR4B 3ZWBA 5J4HA 4J90A 1NIJA 2HM7A 3IJEB 2GLTA 2D4HA 3CNBA 3CCFA 3D8RA 1NPTO 3F49S 4KGDA 3SJUA 2YIMA 3R3XA 3RJ9A 3GBSA 4Z5XA 4IICA 2O2EA 3IBGA 1ARZA 5DULA 2NU6B 3UUGA 4JB0A 1AGNA 1IY9A 2YN2A 3IX7A 1IN4A 3BVPA 3AYXB 3QP9A 4P80A 1DXYA 4OU5A 1U04A 3L7DA 4OQZA 5DLYA 5L4SA 1EIZA 1EK6A 2CSUA 2PJDA 2VDWB 3A7DA 3QQ5A 5ALEA 3A25A 4RFLA 3SYRA 5KNCH 3MMNA 4L4ZA 1XRNA 1NVTA 4BUCA 2NTVA 3MS7A 4P3PA 1E69A 2C57A 2EP7A 2YUTA 3GQVA 4YEDA 3AFMA 4TV8F 4DG5A 2QKYA 2ESRA 1G5TA 4M8IA 5AVWA 3HWSA 2BEVA 3FMPB 1RU3A 5EP3A 4J1SA 3HCAA 3LXXA 3JYOA 3N2GA 1SUAA 2PUJA 2ET6A 2P8SA 3ZE0B 1J8DA 1AQJA 4CUJA 2JGLA 3ZE8A 2X0IA 4L8VA 3SQDA 2NPFA 4RJ2A 1PR1A 2OQ2A 1WEKA 3KZVA 1YL7A 1JH9A 1KJZA 1PJZA 2D1FA 1PR0A 3FA2A 3NGMA 4JCOA 4RZSA 3AGPA 4GPTA 3IT2A 9LDTA 1GPJA 4ND4A 5M3BA 1CFJA 4ZVTA 3AB8A 5FUMA 1TQ8A 4IF6A 3ZHSA 4LHVA 4XEHA 3B7PA 4XVUA 3IQXA 5K8TA 1P4HA 4JASB 1NAIA 2EG9A 1QHYA 4HAVA 2AFHA 4J16C 1SIUA 3RJTA 3IJ5A 4QODA 4D3DA 2J4FA 4KOAA 4UXIA 2FKAA 4QM6A 1ULHA 2JKYA 4IL5A 3RRFA 1F20A 1J56A 4F93B 3G3EA 1KI1A 2NXCA 1YQUA 3BRWA 1G8FA 2H1CA 4HVAA 3ND7A 4KDEA 2WD8A 4MS3B 4Q34A 5A4JA 4PYJA 2C0PA 4UE6A 5KX5A 3HDYA 2XBMA 5FF9A 1GUDA 1X70A 1M76A 1VKOA 1SOUA 3LVRE 5C8XA 4BNKA 3C1OA 1RP1A 2IPLA 5KJ1A 3I30X 3MGBA 4HVLA 1PZGA 1S3IA 2XTMA 2AN1A 2KM1A 4QNNA 4YY3B 1Z68A 1YI1A 3BE6A 2W6MA 4F9FA 3EXHB 2VWGA 4Z9BA 1WZIA 2Y1DA 4D9GA 2BMFA 1AXRA 1X38A 1UCFA 1MB9A 2ZUTA 2AK2A 1Y3CE 3A1FA 3BF7A 3JAWB 3L82B 3WR5A 4RZHA 3PNPA 2YMLA 2HLDD 3E8SA 3P97A 4U63A 1DC3A 1WPRA 2WOJA 4J94A 4PHFA 4Q37A 4JNCA 3Q1KA 1HLFA 4UCQA 2C03A 2C2OA 1NSFA 3GGDA 3LO8A 3M6FA 4JWTA 3FWYA 4URHA 1IVYA 2V5UA 2GXUA 1I51A 1ESDA 3E2IA 2UUAB 3K96A 4L8GA 4ZI5A 4AF7A 4FHDA 5JQGB 4CWAA 5K8CA 4FOOA 4E14A 4MP6A 1WVMA 4Z6KA 2C58A 1XQXA 5FUYA 2Z57A 4HRAA 4WOPA 5CP8A 2A35A 1Y89A 5H68A 4DC1A 1JBEA 4DLLA 5A04A 4B0OA 5JUWA 1CUJA 4PSVA 2VKQA 2R1ZA 3TK1A 1IHYA 5CNIA 3WSWA 5T4FA 2FZKA 4PXSA 5K9ZA 3NS7A 2NLOA 3FTPA 1OX4B 2VAXA 1S2LA 2FX3A 5CTAA 2YS6A 3G79A 3OJXA 4HEJA 3HABA 5COBA 4E5KA 4KEAA 5FB3A 3OQHA 4WZBB 3I1IA 4BEBA 1KAEA 3TGLA 4NCAA 1LPPA 3EGCA 5JQWA 1EGAA 2WJPA 3DXFA 1FNBA 2RONA 3G7NA 3H04A 3LPMA 4C7MA 1O7JA 2ZYRA 3SP1A 3JZMA 3JD2A 1GL6A 4I3FA 4DY6A 5IH7A 1NBMA 5K03A 5BV8A 1JPNA 2JH3A 2C5BA 2KPOA 2W2VA 1NE2A 1UBRS 1UQUA 3CPHA 3K8OE 1G7SA 4N5MA 2RHWA 4HAXA 4KPUA 5G3YA 1H4TA 4OQEA 1ZOSA 2AB0A 3NBAA 1FY2A 1TMKA 2JEZA 4GOOD 3RS9A 4CI0B 2BLNA 2UU9B 1W4ZA 2EYUA 2Z8YA 4CKZA 2H48A 4N5HX 3OTIA 1C8VB 5CDSA 1E6LA 2BBOA 1E9DA 2Q41A 4OM7A 2PSEA 5H02A 4AMVA 4QTYA 1CF9A 1HQCA 2R0QC 3L7JA 1F0PA 1EX9A 3K6KA 4ZTZB 4Z0PA 1LPNA 3B3GA 3FFWA 4FCWA 2OESA 3I09A 2Q5QA 5FLYA 3MRVA 3NHAA 2JLZA 3EIXA 3UXMA 2H4WA 1ISSA 2QUBA 3DV0B 1PJRA 1NBIA 1Z6PA 3CEJA 4WNYA 4CXMA 3T4XA 2A94A 1D8TA 4HAYA 4PG8A 4RX1A 1AHHA 1QZXA 3DJYA 2FWAA 4M2LA 5A7GA 3JQBA 1A77A 5BYBA 2A86A 2WFLB 3GDOA 2GB4A 5EJGA 3NVDA 1IY2A 5LP6B 3AETA 4MNTA 2E18A 2E49A 4R2MA 5TY0A 2D2VA 1TYEB 1B8NA 1NYQA 2YY7A 2ST1A 4JZKA 5COAA 4R68A 4MAAA 1HX7A 3PFCA 1K0UA 2RFLA 3VDNB 4BX0A 5EPUA 4PHTA 4X45A 3LCVB 1RKUA 3L41A 4RHTA 3JQGB 4K9NA 1ZNYA 4TL6A 4Z9FA 5C8YF 4QGBA 4B3JA 3F3SA 2FPSA 1E4OA 3UJ9A 5JYCA 1GNQA 1KQOA 5FPPA 1QX4A 4GYKA 2R4UA 4JP1A 4F8EA 2XF8A 3K6SB 1CRPA 1EFRD 2UYGA 2EFGA 1X86B 3GJQA 3QX9A 1WY7A 1CZKA 1VMAA 1YL5A 5KTMA 4RIHA 5K3FA 5LOVB 1L4YA 2Z5FA 3HLKA 3DPIA 2XHZA 2HCJB 1GGHA 3NH6A 3RU2A 2XYQA 3NO4A 2RHRA 4O4HA 4DHWA 1H5QA 2VO1A 3EPJA 1T8RA 5JS8A 3PUYA 1J1UA 5CB6A 4IJQA 3KJXA 2YZGA 5JSUA 4K7JA 4EP1A 1W36C 4HJRA 1JIVA 2I66A 2CE2X 3C8DA 3SJZA 2ACVA 1ZM7A 2WJVA 3VU9A 1QV9A 2P9EA 2QVXX 1BMDA 3USCS 2WMOB 1WF6A 4MW4A 3R0QA 1C0KA 4URZR 4YDHB 4EF4A 1QWOA 3EXHC 1XEFA 2C1EA 2I99A 5EIBD 5IBPA 5FL7D 1YFJA 4FBGA 2BJVA 3A6KA 2YJ6A 2A0UA 1SJ9A 4II7A 1N2GA 3RSGA 2GDJA 3UT6A 2F00A 2FE4A 1G4AE 3D6AA 2HTEA 4CV1A 1IHDA 4F91B 3VJRA 1DCKA 3OY2A 2JLUA 4FJ2A 1JKMA 1FUKA 4XSHA 1XRMA 3GT4A 1LDGA 2P90A 4Q3BA 5C5IA 3U39A 1WXXA 4DV6B 3ENZA 4KNYA 1KRXA 4Y8VA 3RNOA 4HRXA 3KXPA 1R1DA 3IP3A 4C08A 1CZNA 5TNXA 3RJMA 3ENNA 4ZYTA 4OK5A 1KL7A 1QDEA 4DV4B 4JLNA 4Y18A 4W5WA 3SJAA 4TWBA 3WADA 1ULAA 4HY3A 1HBJA 3AFOA 4DCCA 3SD7A 4ER6A 4V38A 1SWVA 1K3TA 4R98A 4ZO6A 1Y6ZA 1QNFA 2CDAA 1K7SN 3R0JA 4C0SA 5LLTA 4D0RA 2CZGA 3R0VA 1DX9A 1MDFA 2IYFA 3K0CA 1QG2A 1B15A 2A3RA 3CFYA 4ZVNA 5IUKC 4G2TA 5D84A 4IEFB 2YFYA 1TPYA 4IWXA 4D82A 4LW8A 2I6FA 4YJ3F 4LFAB 1I32A 1N7GA 1ZIPA 5KNBA 4UPVA 5F4BA 2GAFA 2PSFA 2XUPA 4CEJB 2QPTA 3DKKA 2EF0A 2VDPB 1WEHA 1Z17A 2CN1A 3LWDA 1O9HA 1GAWA 1QK4A 3GJXC 2IHYA 3TXAA 3C6YA 2C95A 4MUKA 1R0SA 4DCVA 1EXMA 1RLJA 3B5JA 4P92A 2HMYB 4HLUA 4OA5A 4EIWA 4PBTA 3BTUA 4W9NA 5C18A 5AXCA 3LHKA 1I6MA 3R0XA 3KWJA 1E0SA 2BKXA 4M55A 4N03A 5AOAA 4QUHA 1VRWA 1LF0A 3RIXA 3BM5A 2C59A 1TO6A 1R6BX 2CCKA 1O5IA 2BI4A 2Q5IA 3AWDA 4ZARA 2PWZA 1M2OA 4BQIA 3A2NA 5ILQA 3GBVA 1T2FA 1BJRE 1KP3A 1LI4A 2X7XA 4HGQA 1OX4A 4Y2JA 1T13A 3VGPA 1K08A 1NURA 1GLNA 1M6NA 1RI5A 1JSRA 3B8EA 3PIRA 1B3BA 4I5FA 2A5JA 2XZDA 1QH9A 1YMVA 2PS0A 3C1AA 2VWHA 4FGJA 4MINA 3RO7A 4C2AA 3BDVA 4Y2RA 1SBQA 1ZEMA 5TQVA 1DKLA 5HTOA 5TVGA 3WAGA 4Z4EA 4KK3A 3BDIA 3D5QA 3GFVA 1FBTA 2ECPA 1OC2A 2XDYA 3LV8A 4EY7A 3HPQA 5JATA 5KQGA 5CHEA 4LMRA 3OZAA 4OXQA 4UARA 3AFNA 3OM1A 1D04A 4ZI7A 5EEGA 2JIBA 4PO8A 1FNCA 5JIBA 1PZEA 2NT4A 3HEAA 4Z51A 3X1DA 2YW2A 5DNVA 5HKLA 5A2QA 3CKMA 3EPHA 4D41A 1LD3A 1HTWA 1UPAA 1Z36A 3QPBA 1LPBB 3W5UA 2VBGA 4ECAA 3B3QA 3FNFA 2X2OA 4TMXA 2V9PA 2OP1A 2OCLA 1V7PC 3MOSA 2PE5A 2IODA 2OCYC 1ZK1A 3L1JA 3OOWA 4G1CA 4BNWA 1WBJB 3L8YA 3LBAA 1M2HA 5JO9A 2VHXA 4BRWA 2FN4A 2VZ0A 3PYLA 4DSUA 1VHWA 1KY3A 2O3UA 4YDRA 1PDOA 1X3LA 1EE2A 2ODEA 5C1BA 1ZUHA 1M34E 3D4BA 1FS5A 3BQMB 1I9CA 1YVDA 2REQB 3V8PA 3P71T 2EIXA 1TKAA 1YZFA 4AJJA 4E5NA 3TZLA 1AO0A 1GG8A 1M66A 3KUXA 1EUCA 1BD4A 1ULBA 5FBKA 4EB6B 3Q8KA 1NP7A 2YHBA 3SI7A 2WTUA 2HWXA 2D1YA 2O1XA 3B3JA 2QV7A 3AEQB 1E99A 3NT5A 3Q3EA 4AI6A 1N0VC 2CNKA 4RQUA 3R9XB 3GDHA 1EG2A 4TKMA 5MFPA 4RKRA 3JALA 2EKQA 2QGNA 3MEQA 4YROA 1Y9ZA 2HUNA 5EJ6A 4FLMA 2BELA 1NVVQ 4E94A 5K6AA 3W5JA 2UVPA 3RUPA 1DFGA 1X2BA 3GVIA 5C32A 3ILHA 2BI7A 2RI0A 5BORA 1DL5A 1XLVA 2WYOA 5ALIA 5GVRA 1LDNA 1WMAA 4OQPA 1M2KA 1NI4A 3PPVA 2NZWA 5DLDA 2ZVJA 4P35A 3S6JA 4BP9A 4DF3A 2NGRA 1DTEA 5BPFA 1OU4A 1M5RA 4PPNA 3OMWA 1TD9A 2NIPA 2ATVA 5FT9A 2QN6A 3S8EA 5ALTA 1QH8B 3S28A 2QX4A 5FFNA 5JZMA 2RGBA 2FX2A 3L7NA 3MSXA 2F9FA 2VQ3A 1CFZA 4XI9A 4B7XA 3RVQA 5A0TA 4I08A 4AN1A 1PI3A 5EJ8A 4DYDA 4BRZA 3DE6X 4UBNA 1UJ4A 2IEYA 3IAS6 1JA0A 1ZD1A 2C3MA 2JI9A 2HQOA 3V80A 4JLOA 4Y2XA 5KB3A 3GLIA 1ZCJA 4MGIR 4RZ3A 2QRMA 1L7XA 5HX7A 2BY4A 3HKDB 2JAOA 4PSAA 4REQB 3NOVA 1J1ZA 4LVCA 3USZA 2JBAB 1U7HA 2YWFA 1A8IA 1MRZA 4Z4IA 1T24A 3DF7A 3EZYA 5EHIA 1HO3A 3COJA 1DBSA 1K8XB 3H2KA 1ORWA 3RSCA 4YTEA 3DTYA 1GLGA 2QW8A 1VE6A 1FW8A 2LV8A 3HYNA 2XVYA 4M83A 4HDCA 3HJBA 2QE6A 1BYUA 2EGUA 3LKBA 4QREA 3PDJA 4R8KA 4MHOA 5EGNA 4FLEA 1KDOA 3CURA 2A88A 1A50B 3VOBA 1ONNA 1RWMA 3WHKA 4Y98A 5C37A 5G0TA 1SFRA 2IY7A 3DNPA 4P0PB 2DHEA 4YT8A 1P33A 1WMBA 4Y3UA 4DILA 4P93A 3AU9A 5K0BA 2FQQA 1RRFA 4N3NA 4M1OA 4YX9A 1FYDA 3VKHA 3OJLA 3VNSA 4BVEA 1WB9A 3VPHA 3LQRA 1MJFA 3FIJA 3K5HA 2D00A 1ZGHA 2ZIVB 3Q98A 2BFBA 4RTLA 4CV3A 3C7CB 3I5UA 3OQIA 4E2FA 2CVZA 2ODPA 2E2WA 2O0LA 2P7HA 4C78A 3HFRA 3GB9A 1NG9A 2PZKA 1TU4A 4A0FA 1ILEA 2PAFA 1E96A 1MT3A 3OMXA 5C53B 3L1VA 2Y76A 3MCVA 2A58A 3OI7A 821PA 2GLUA 2NTNA 3UPDA 4NU6A 2OYSA 3BKWA 2Q8QA 4RNCA 1SVNA 1W0JD 1QP0A 1JE0A 1BWRA 2JFPA 2XKBA 3AHCA 2Q7OE 3OOHA 2CY0A 3SGLA 4EHFA 4W5TA 5BXQC 4RA9A 5EC8A 5JG7A 3UPUA 3TWOA 1AGPA 4IFBA 2RMKA 3KKZA 2GN6A 3H5OA 4F5ZA 3TIXB 1O54A 4H6VA 2ZTMA 4J2TA 3TBHA 3CG4A 3AHFA 5LZ5A 1MA3A 4PNEA 3VYSB 5IAGA 3M5WA 2PRIA 1ZJJA 3LY8A 1KZ1A 1A8PA 1W5TA 1W88A 2QTWB 2R8OA 2W2XA 4Q3OA 4M8SA 5HDBB 4B35A 5KWJA 1DFHA 4MV0A 3GLSA 2HHLA 4HGPA 4QYSA 2IS4A 2SICE 2PRZA 2WAXA 3VTAA 4LC0A 3DMNA 4TX1A 4B6OA 1J70A 4LF7B 3QZUA 4HRVA 4C06A 1Z6QA 2BC9A 2EIHA 5DVZA 3GLIB 1BU5A 4DCGA 2XDQA 1DJNA 3VSEA 1NXSA 4PS1A 4BU1A 5JSHA 3H0KA 1E2BA 4UAVA 4NENA 3ZBTA 4B46A 1D7AA 1HZJA 2WJZB 2K7FA 3VKFA 4H77A 4CGYA 3VZRA 5FFFA 5DM1A 3FVQA 4GI7A 1SD1A 4EI7A 3DT8A 1QVZA 1BG6A 2GKGA 2G67A 1MVNA 1M1NB 3RRJA 2DYKA 3AW8A 1GDDA 3LBNA 3HPRA 1KMMA 2H2AA 1VOTA 3F98A 3OIWA 1NNI1 3EODA 2E1PA 4KVZA 4MWDA 4WTOA 2ODAA 4Z4FA 2FMKA 1GSIA 1I3LA 1X94A 3IQWA 4FYHA 4ZQBA 3UJ6A 4D6PA 3FCOA 4UUNA 3O3CA 1CUVA 1YSCA 2GEKA 4US0R 2JHFA 4UVDA 3O3MB 4YXWA 4QUJA 4MJ7A 2PKQP 1G1MA 3TD6A 3RABA 3TKLA 1U4SA 5ALQA 3L06A 3CGGA 4CM9D 3GT7A 3JWEA 3ESCA 4U9IS 5JHHB 3F6SA 3SZRA 3U4GA 2ZJ8A 1I2ZA 3OURA 2HZ7A 4D9EA 1X8KA 3BGDA 4PAGA 4F4FA 2JLSA 5F5XA 2W2PA 2ID7A 3I9LA 1F8XA 8ABPA 3DE1X 4FEEA 3NANA 4NE2A 4QJIA 5KVQA 4XLZA 1VLZA 1XRJA 4JP8A 1XFAA 1YK0A 3RFTA 4AZWA 2J87A 1D4FA 3BMQB 2IPMA 3IPRA 3KXDA 4IHJA 4KXXA 1ZRSA 5HZKA 4K9SA 3PTAA 1FS4A 3C2QA 2OGZA 1K4MA 3E23A 1XV5A 4QU5A 1B16A 3W1WA 3ESDA 2OQIA 1E9EA 2QV0A 4NFYA 1F1JA 5K51A 3TOXA 4QGFA 4BX8A 5HUHA 3ORYA 3RK0A 5KO2A 2QZ4A 4MRPA 3LGXA 3E9CA 5CW1A 3ZCSA 1BHJA 2PUFA 1G291 1NE7A 2V7PA 2VP6A 2WF7A 3EOBI 1NZJA 1YR7A 3IDZA 1HRKA 2XQKA 2ZITA 3ACCA 1P0FA 3QVLA 4I2VA 2OL4A 4I50F 4PCLA 4PSDA 3VSBA 1EB8A 5KWSA 2F4VB 1XA3A 1NPYA 2JEOA 2ZE8A 4E4TA 3OFND 3QVSA 4ARBA 3EA5A 3ZCQA 3GJ3A 5EIOA 4X6LA 5JVDF 1GP2A 3Q8WA 1IUKA 1FQOA 2RDMA 1ZW1A 1OXKB 2DBVO 2EJCA 2PMFA 3B1KA 4JGBA 3MHPA 1M1YA 3GFBA 4RMGA 3ZR4B 2YUIA 1ZRNA 1MB3A 2Z0MA 3C98A 5IJ0A 3NPAA 1OA0A 1KDPA 4HNRA 1IQPA 1RJGA 2QB5A 1Z75A 2YFHA 4RA6A 5I51A 1RAIA 1Z22A 3DPSA 4EFMA 4RPHA 3SKVA 2ZYIA 2ACEA 4YPOA 2O5EA 3QMMA 1ULTA 1GKIA 2HOQA 3H5VA 1CP3A 4MP8A 1YNOA 4CIAA 5KTRA 2JFYA 1L5RA 4UUPA 3VH4A 2FGKA 1NT4A 2GRJA 5LQSA 4R54A 1C3VA 3UQZA 1XQ6A 1HNXB 2FPMA 3FNBA 1ZZGA 3AINA 3DOCA 4RFVA 1GCOA 2O57A 5I6DA 3DC2A 1IY8A 3MT9A 1OXMA 3LP8A 2GAOA 3TX6A 3W8DA 1TRKA 3P20A 4U02A 5I4IA 4ENTA 1QLHA 3S1SA 2VPYA 2ZB8A 3U13A 5ADVA 3LTEA 3VPBA 3TIVA 1BX1A 1N1MA 4JFAA 4IGKA 2F3TA 4UM7A 2NU7A 3E61A 3ZDAA 1P80A 1GNRA 5A5DA 4NHEA 3ELDA 2ZJBA 3IRVA 2O5CA 1RIIA 1WSBA 4UD2A 1LZKA 2D1SA 3UAOA 3NTUA 1S7GA 2RHOA 3BB3A 1J0AA 3PT9A 4J6EA 3VVCA 5K8JB 2QN1A 1JDPA 2WKWA 2D0PB 3QLTA 1HTTA 1VFPA 3TZCA 3UAYA 3OWHA 2QNIA 4GRDA 3ZWXA 1FC0A 3HXOA 1M1YE 2G7ZA 3GU3A 4JJ6A 2G63A 1UF9A 3FWPA 3FWZA 2ZJ6A 3GO4A 3VVLA 2Q50A 4BFSA 4POAA 1U9IC 1CE8A 1UPXA 1KARA 3JRNA 3ZWDA 9ATCA 4HDSB 3P2YA 3HJUA 4BLSA 3LT1A 4R8VA 3HP7A 1KMCA 3AESA 1E2DA 3IAEA 5DGCA 5BOSA 5I4CA 4FQ5A 3ICOA 3L7CA 1O95A 3A1UA 2O14A 2VA8A 1E6MA 2ARKA 3N8GA 1FDTA 13PKA 1SUPA 1U8ZA 2VA9A 2HUPA 3GD7A 3QMWA 3V7FA 3U19A 1QIJA 3R3ZA 4MYDA 4KWTA 4CM4A 2JFGA 1E9AA 2B37A 2CF5A 4IRUB 4O4LB 4E12A 4JMPA 4MR9A 3UV7A 4L5YA 3IV9A 4D92A 1WWKA 2WF8A 2IHBA 3UN1A 1MUUA 5JJLA 2FQYA 3C7TA 3L9XA 4AU1A 4DPLA 3K6JA 2B35A 4UKDA 3C3AA 3RHTA 1EINA 4D42A 3I23A 1I13A 5TQJA 4HR7A 2BGJA 3EGXA 2WSSD 3GCDA 5AXAA 3C16C 2QHXA 2HU2A 1ZJZA 4FQ7A 4TZTA 5BSUA 5HYVA 2XYVA 2FUG6 1QLJA 2BD0A 3H8JA 3CJQA 3VI3B 2KE5A 3MNFA 4Q82A 5CR9A 1IDN1 1SVMA 5L3ZA 3ZUGA 2R2GA 2NYUA 4BU0A 2CV2A 4TM7A 3NCTA 2DBZA 3K16A 4LJLA 4XIIA 3R0ZA 3OWOA 2XNHA 5EMMA 2AHRA 3WLIA 2WQZA 1X15A 2IGTA 4LE2A 4XYGA 3TTSA 3MYRA 1UC8A 4D8XA 2Q4RA 4R6XA 4ZQEA 4EHNA 2Z9CA 4TWRA 3VZBA 3FUTA 2I1LA 1RQRA 2ZK7A 2C4MA 3JQ8B 3ZU4A 4MJXA 1D2HA 2E85A 3H5WA 2HMSA 1OIXA 1FPMA 1Y48E 3PVZA 5CDUA 1A96A 2CWWA 4BB9A 3ZGZA 1VL2A 3TW0A 5CDFA 1V8ZA 4J6FA 3TTVA 1ZITA 1G5HA 1XELA 2MMGA 3NHMA 2JIZA 4YAOA 5CVVA 1IWOA 3KQQA 4Q7LA 4WBSA 4CQLB 4OB6A 1E3EA 3A7EA 4KQKA 1B43A 1Y9JA 2X77A 1EK0A 2FEPA 1NJ1A 3FKSD 5EP2A 4BO9A 2RKOA 1B3RA 1ZDMA 4ZVLA 4ZO9A 5FFMA 1PGPA 1U2DA 2C3PA 4EG4A 3JRXA 3Q6IA 1JFFB 2C00A 5L8VA 3LTNC 1NVMB 4M38A 1QHEA 2HB6A 4F2HA 3B5IA 1KR2A 2B5OA 2DWCA 5SYNA 2QUAA 2EHDA 2XUAA 2A0WA 4XM0A 4B3CA 3G23A 3C3MA 1ZGAA 2LR0A 1SQFA 3RROA 2ZBUA 1JQLB 3M5DA 2YTZA 5J59A 4LJ9A 1E3MA 5KOIA 4ZP1A 3PQ2A 1QG4A 4MIEA 4PGMA 3CW9A 4N9WA 2GBLA 5T4BA 4P81A 3UMCA 3ETJA 3LIPA 4CKYA 1HK7A 2HTFA 2IZ7A 4GLOA 2IL1A 1O6BA 3KWLA 1VL0A 5D2CA 2HSJA 2YHSA 3FCAA 4MRAA 4ILKA 4BIIA 4HZGA 2IA5A 3DBLA 1EBUA 2IDKA 5LP6A 2UZ0A 4FR2A 4JP2A 2W22A 4JLDA 4UBLA 2Q3CA 3CH4B 1ZGZA 1N5LA 2OVFA 2VAVA 3LUCA 2IJGX 4A10A 3BJEA 4MI1A 4D9MA 3WQRA 5B6PA 3JAKA 4BQPA 3ELYA 3GRAA 1C5KA 1PD0A 4RC9A 1B93A 4AW9A 1CJUC 5JD3A 1FUUA 3FTEA 1O6ZA 2YY5A 3T7DA 3WNBA 4B8WA 4DLAA 5ULLA 3IPLA 3R23A 4HNSA 4QICA 1M2WA 2BTQA 2ZSIA 3JSAA 3P8ZA 1ZJWA 4B7CA 4UHHA 5MGNA 3FPFA 1T4DA 1TMYA 2X9LA 3SJBA 1OIWA 1J09A 3EYWA 3OPQA 2C8JA 1P5JA 2CDRA 2YWBA 4HKTA 4BLWA 5KOYA 5AVZA 1PTKA 2V5VA 1FCJA 4E07A 3RH0A 4C2UA 2DVMA 2ZETA 4YUAA 3TE7A 4KBYA 4GL2A 3X43A 3FHTA 3S2SA 5LUAA 2YC2C 1R0KA 4KPUB 5AHOA 3A4MA 1VE1A 2JK0A 2I6GA 1IOLA 4DL9A 1DUSA 2XSZA 2Z5GA 3DXYA 121PA 5JCJA 2HADA 1DSSG 3IYLW 4F4CA 1YI8A 4A8HA 3FE2A 4X1KB 2QL6A 1XUOA 1T6ZA 3A9CA 3GJ6A 4RHEA 4DCSA 1CJCA 5AKHA 5K3EA 3O8DA 1Q50A 4DQUA 1IJFA 2UVQA 3PXAA 1WXGA 1ADGA 1K3FA 3F5FA 4G1BA 2PGIA 1NJ8A 1X6VA 1DIBA 2ZQYA 4ZQFA 4UNSA 3RNLA 1IQ0A 2D62A 2QJFA 3PX3A 3VXKA 4E30A 1N6OA 2CLFB 4BLUA 1LBHA 5GOTA 5BNZA 2C7PA 3PNSA 4HDKA 3QNUA 3IKJA 3OZTA 4HATA 4MW5A 1GILA 1G63A 2REBA 3WGKA 1FFDA 5LA6A 3PNKA 5FA5A 1FSZA 3MTIA 3WAJA 2E87A 2E4VA 1IL0A 1L1QA 1YBAA 3KPYA 4HPWA 4CMJA 2XADA 5HF6A 4Y6OA 3IOEA 2PT7A 3OEED 4N5NA 1NN3A 4FUTA 1SZDA 3FSEA 3HU2A 3QVGB 4S1VA 3IQDB 5CM8B 3V8MA 1WB6A 4DDTA 2XA9A 5JS6A 2L2QA 2G28A 3BMXA 3PS9A 3REFA 1LF5A 3WKEA 1SUIA 2KHZA 2Q9AA 5KNBD 4MKHA 3GUVA 1N1GA 3OMLA 1SK9A 2AR9A 3R3UA 4ZU3A 3O82A 3VHLB 4Z0HO 2O9JA 4MRVA 1GQFA 4A8PA 4RCVA 2W48A 2LGJA 1PJAA 3FHLA 2CB9A 5TPZA 3PKJA 4EMSA 3SYLA 4L4YA 2NZXA 2XTAA 3T7IA 4YRCA 4QUEA 1THTA 2OOSA 1OBCA 1NQ5A 3QXCA 4GI1A 1VPEA 1ISRA 2QLTA 1FDVA 2ZAOA 1QHHB 2IYAA 2OBYA 5DX0A 4YDSA 1PCXA 2YNMC 1GKUB 3C0KA 2JAUA 3EZFA 3LX4A 4RJKA 3DAFA 2IUSA 4Q1FA 2Y9PB 2NTJA 1J5EB 3A1NA 4Z8YA 4RK7A 5FAKA 3CUUA 2FY8A 4OATA 3R6WA 3NJ8A 4LQCA 4IUYA 4UEQA 6CHYA 4C0LA 2QZZA 3QSGA 3OZXA 4K3UA 2VUIB 3B9RA 2A9JA 3T1TA 1W4LA 4BVHA 2O8CA 3OQBA 3VMFA 3TZBA 3U3KA 2Z5LA 1BROA 4BVAA 5EIAA 3OX4A 2CKDA 2DKFA 4HAZA 2JIOA 2R1TA 4G8CA 1ZCFA 3E18A 1RAHA 4OBWA 4X1KA 4XQCA 4KB5A 2PWBA 5B1HA 4UM9B 3F1KA 3ICQB 3KEOA 1JXQA 5EXXA 2VNAA 2FPOA 3GY0A 2RGEA 1CLEA 4L5CA 4Q9JA 1BXKA 2YHAA 3BRSA 1P7CA 4Y1GA 3TVTA 3JY6A 4RTSA 4HYYA 3COPA 2QXYA 3UAGA 1R7RA 3ND9A 4MPDA 1R8JA 3K09C 2GPTA 2AG5A 3H97A 4LYHA 2OKCA 3E5MA 5LUBA 4QT4A 3TG8A 4QBHA 4DYVA 4C3OB 1ZXXA 1G8JA 1T1SA 4RZIA 1E1LA 4BGVA 5H7XA 5E4FA 5CB4F 4Q4AA 2Z4RA 3ZV3A 4LF4B 5A05A 1JT2A 1JECA 1JQ5A 2Q3MA 2WUWE 2P2ZA 1ORDA 3MT0A 1XNRB 2PNJA 5A4IS 1Q3KA 2AFIE 2I4TA 3HNRA 5E9JA 4U7TB 3STYA 2Q6KA 2KMLA 4Z86A 5EHQA 1SXJE 3AHEA 4P3XA 2BKAA 2ZIAA 4CLRB 1UBSB 1CUGA 1USVA 3LWBA 1GADO 3GUHA 4LG1A 1APBA 4OVKA 4I50B 3SIRA 2QX8A 3UHFA 1CRQA 5J1SB 3BZUA 1N6HA 1Z47A 3QWHA 4GUAA 5JNLA 5KYWA 4BO2A 1T9ZA 2LBPA 3S2IA 5KNDH 1BFDA 1WZEA 4YBZA 4ZEVA 2EAUA 2AFHE 5IW8A 1UXGA 3OZVA 4BE9A 3MGKA 4CL3A 1D6NA 2ONCA 1QTQA 3DMDA 1N5OX 4YJGA 4LNHA 2AV6A 2IBMA 4LQLA 2FMUA 5C4GB 1EE1A 1EU1A 2ODTX 3H2SA 2Q28A 4ZYXA 3HCPA 2GK3A 2IC5A 3P0JA 4WFKA 3RUCA 3T1OA 1I0IA 4LOKA 2ZRJA 1I2AA 3F9RA 2NX2A 2MSWA 4AX8A 3BMQA 1UIMA 2NV6A 4IHJB 5BSRA 5A1JA 2JFNA 1NONA 4PBSA 2XMZA 4P4TA 3JV7A 1TLTA 1Z88A 4QWMA 4KQMA 4ZV4A 5DTRA 1H85A 3NX4A 1T2EA 4D9BA 1SR8A 2W2TA 5E38A 3RYFB 2AKAB 3BXXA 1FU7A 4Z4QA 2Q9CA 2GNPA 3IAUA 5IDXA 3QA3E 3ZHQA 2BF4A 2NZYA 1MP0A 1KVRA 4GM0A 3HRIA 4JEHA 3T5GA 1ZNXA 5H3LA 1PJ4A 1T6XA 1KSGA 1DXQA 3H6GA 4PRZA 3I62A 5I9LA 3R9WA 1LDBA 3U31A 2CBGA 1NHWA 4JCCA 5IVPA 1WXIA 5JH7B 4JJFA 5FPTA 3QTLA 1KMHA 1QYVA 4M99A 4UPDA 1KBZA 3PDHA 5MHTA 1OPRA 1ULUA 1OA1A 5DXAA 2WZDA 4EKEA 2EP8A