1XMJA

Crystal structure of human deltaf508 human nbd1 domain with atp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
246
Chain Sequence
EVVMENVTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFDQFSAERRNSILTETLRRFSLEGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Impact of the delta-F508 Mutation in First Nucleotide-binding Domain of Human Cystic Fibrosis Transmembrane Conductance Regulator on Domain Folding and Structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 83
structure length 246
sequence length 284
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xmjA00
3FMPB 4OHZA 1CTQA 3ADBA 3IUYA 5CB6A 4JYCA 2QPAA 3RHFA 5C4MA 2IF0A 3A4MA 3RLFA 2IS2A 4JVLA 1ZCBA 2W83A 1ZNXA 3LX8A 4OKSA 4ZV4A 1OXTA 3THXA 4DEYA 5JSZA 2CNWA 1Z28A 1E0KA 1T5LA 1W1WA 4HATA 4XH9B 4RVCA 5TDHA 4ASUA 5KOYA 1PVOA 4YC7A 1KGDA 5FTJA 2GAAA 4GMDA 1IJEA 4LHWA 3Q9LA 4V0LA 3SJAA 1G19A 4D4LA 4Q02A 1T0JB 1GG2A 2BJVA 2ZE7A 1L4YA 2CCGA 1AQUA 2BBOA 1MRNA 1KI6B 2C2HA 3K0AA 2BM0A 3T1VA 4LWZA 2R62A 1SQ5A 4Z8YA 2QORA 2WWFA 3RS2A 5DN6A 1QG2A 1U9IA 5FBVB 2XJ4A 4DVGA 1J7KA 1OIVA 4OK6A 1T0HB 2ZI4A 2WJJA 1P62B 1EFUA 1SZPA 4XSGA 3B5JA 3CPEA 1W36D 1X8KA 4R7ZA 1N2CE 4FN5A 4TQUS 3D6TB 4XVQA 2KBFA 4HZIA 1TU4A 3H0KA 4URUR 2LKCA 4TN1A 3UATA 4DRZA 4HUTA 2JATA 4LJ4A 2QRNA 1N6OA 4DDUA 1J70A 4DKXA 2JLZA 2JJ2D 1E0SA 3W5IA 3B7GA 1FTNA 3P4YA 2IYWA 3N5CA 3SJBA 3THXB 1HY3A 1ANKA 1M1YE 3AKCA 3QY0A 1US8B 1R8SA 1OH5A 4XJXA 3MD0A 2VL7A 4PO9A 3TE6A 1BS1A 3PUYA 2XSZD 1HURA 5KHOC 3U5ZB 3IILA 4UNPA 1SXJE 3AVUA 2GK7A 1UBCA 2ZRIA 2WPDD 2BEKA 3O8DA 4M9QA 4NCNA 4ZDIA 4F92B 4XSHA 3CRVA 4JVSB 2EW1A 2OAP1 5JJIA 4P3YA 4LCBA 3CRRA 3TMKA 5IK2A 3FHTA 3VR6A 2XOKD 3SFVA 3VQTA 4E09A 4F4IA 4G5RA 1NSFA 3WHLA 2C9OA 5CITA 3X1ZA 4C0SA 1RRFA 1E2LA 3Q85A 4PX9A 1YKSA 4X8OA 3O8RA 1XXHB 2Q3FA 3IQWA 2VTKA 3QEJA 3PXGA 2HYDA 4EPWA 3QPWA 1CRPA 3EG5A 3QKRA 1XZQA 2FWRA 4QGFA 1DEKA 1MOZA 2ZSEA 1ZJ6A 5TVKA 5F9FA 3ZVLA 1Z47A 3WRXC 3TRFA 4B32A 1OV4A 4PQRA 3VTKA 2O0HA 1WCV1 1F6BA 4YMUA 3VR3A 4BQSA 1KJZA 2F9MA 2FJUA 5AUOB 1G16A 4I99A 1DPFA 2OFWA 4D0GA 2PT5A 1UPTA 5FL7A 3KXLA 1G6HA 5DE3A 4HI0E 2O8FA 1II0A 1QHNA 1JXOA 4WOPA 5KSYA 1Z6YA 3QXCA 2C99A 2C77A 3FKSD 3OAAD 4OJQA 2BOVA 2GVZC 1XP8A 4M1MA 1XTJA 5AWFC 1JI0A 4MRPA 5IK2D 4JVNA 5B30A 3IBGA 2YV5A 1BYIA 1KSGA 3QF4B 3VHXA 3R7WA 4PPGA 2EQBA 2CK3D 3EARA 4HDCA 3V9PA 5BW8A 5L8VA 3KQUA 4NE2A 3VNVA 1X6VA 5AJWA 1P75A 5L3QB 4DC9A 2HDNB 3RWOA 1D2EA 1S1CA 3I72A 2QI9C 3C4JA 3ZZTA 4DCSA 1GILA 1E4YA 3W9YA 4KODA 2EFHB 3MWYW 1CEEA 2A78A 2WWXA 3AGQA 4HAXA 2YWGA 3KZ1E 4LUCA 1UDXA 4BE7B 5C18A 3H84A 3EXAA 4LHZA 1N6PA 3ICEA 5M04A 3P4XA 1FTSA 3AKYA 4C0KA 2ZVPX 2JGNA 1MO4A 1LNZA 3FKQA 1XFAA 1NP6A 2F43A 3CR7A 4FI3C 3DPUA 1XEXB 3TBKA 1LFDB 1I2MA 1IOZA 3B82A 2I1VB 2ZJAA 3DHWC 1U8YA 2DY1A 3LA6A 3K53A 3OEHD 4Z1MD 5FR1A 1E69A 4JKYA 2OAQ1 2WJIA 2B6HA 4KITB 1KK3A 1FX0B 2OFXA 2YINC 4LJ9A 1FP6A 2YHSA 2O8DA 2J1LA 1CR4A 2J3EA 1E2EA 4Q9HA 1BIFA 4NKRA 4MH0R 3SFZA 1QHGA 3B1VA 3MSXA 5JWRA 2XAUA 4FMCB 4LBYA 5JJLA 5FI0B 3AQ4A 1NI3A 3LY5A 1RE0A 2MMCA 4Q19A 4LK2A 1JR3D 4OHYA 1BH2A 4M8NE 4A1FA 1FMLA 5LD2C 4WVFA 4PHHA 4W5JA 5CYPA 4B3BA 5JEEA 3CPHA 4WXPA 1T91A 4Q9JA 2CL7X 3H4MA 1ZNYA 4MYUA 1G21E 3K9HA 4DLTA 3H86A 3CKLA 4M9ZA 4P33A 1TADA 3ZZUA 5CDFE 1ZAKA 4N3NA 4Q7JB 3T35A 2ZR0A 3TH5A 1HQYE 1U8AA 1XEXA 5H8WA 2CLSA 1QHHB 1U90A 3UIEA 2GBLA 4TSFA 3LO5A 4TLDA 3B13B 5DHFA 2G3YA 3HWSA 2GF0A 5EE3A 2ONKA 4A82A 4D82A 1G18A 5ANRB 4QFMA 3KJGA 4KO8A 4BPBA 2ZI7A 4TSFD 4B33A 3WP1B 1I2DA 1AKYA 1E98A 4IXNA 3OFNA 3BH6A 1BKDR 3T61A 4D80A 5CLLA 1W44A 3LNCA 2IUSA 3ZYCA 2YKGA 4OL0A 2ZRHA 2EWWA 3LXRA 1CP2A 2MSDB 5EXXA 3GLGE 1RRCA 4B3XA 2GJ9A 1P9NA 821PA 1T9HA 3G0HA 4GOXA 3P1JA 1GWNA 3U3MA 2HCBA 3L2OB 4GOKA 4FWTA 2ZRKA 3DKPA 4KFSA 1KAOA 3NDPA 3QG5A 2HJVA 1GRNA 1ONBA 2B7BA 1SHKA 2ORVA 4V02A 1NF3A 3QKRB 3K0SA 2BKEA 3HU3A 1ZC4A 1K6MA 1EFHA 2VHCA 1CJUC 3ECCA 1FUKA 2Z6VA 3MG9A 4D26A 4D81A 2ZAOA 1H8ED 2ZUBA 2CBZA 4LHXA 4ASUD 4L15A 3ZQJA 5FUYA 3Q72A 3GLFB 1SKYE 4R9UC 4OQMA 2ODBA 5JRJA 1NIPA 3WYGA 1H8EA 4EJSB 1RJ9A 4EUNA 4ZDJA 2RAPA 2BV3A 1KDOA 1D2MA 3D8BA 4DCVA 3CX6A 2AX4A 3K8YA 4NCHA 4JT2A 4M0LA 1SHZA 4TLBA 1TF2A 1NBME 2QMOA 3EWSA 3W34A 1RRGA 2OCAA 1J8MF 4PSKA 3FVQA 4FMDF 1DG1G 5BXQC 1DTSA 2DFLA 5AUNB 4HB2A 2NPIA 3L0PA 4CRWB 2WM9B 3KDSE 2DWQA 3NIBA 4JL6A 2I4IA 2ZSDA 3QKSB 2XNSA 2DWPA 4CT5A 3R9WA 1KI4A 3G82C 4CYMA 4PAQA 4MRRA 5D3MB 1AK2A 4PC7A 3THWB 2O8BB 2JCSA 2ANCA 2RHDA 3DM9B 2A5FA 2QN6A 3LRPA 2R65A 3WY9A 2J45A 1AGRA 4QBGB 2VLIA 2KB0A 1G8GA 1VCMA 4IEEA 2AKAB 2OM2A 3UANA 5KNCA 1KSJA 4HB3A 5JRZA 1XD9A 2DYKA 2ZRAA 3LQRA 4QOSA 1E1RA 1GNQA 3NWJA 1G5RA 4TYQA 4MGYR 2PT7A 2W6ID 4TL6A 1G3QA 2WIBA 2ZRJA 4O0MA 2AXNA 5BWMA 2F1IA 2BVNA 3IHLA 4X8LA 3NKVA 4ERNA 2D2FA 4CDGA 2C95A 2G1JA 3JVVA 1U98A 1FZQA 8OHMA 3HU2A 1NBMD 3AVOA 2NO0A 2JLUA 1HH4A 1FX0A 4D4KA 2A7QA 1ZBDA 2OCPA 2ZETA 4PO8A 4PSVA 4RCYA 4NCKA 3SQXA 2WHXA 1DVRA 1JALA 2ZE8A 3B8HA 4C0BA 4EFLA 4NPHA 3TKLA 2Q6TA 4G0NA 3EZ7A 3UK6A 4URXR 2IYUA 5HCIA 4A0GA 4G5SA 4ARZA 5D3MA 5DIFA 3BC1A 2P0EA 4XOIA 2X8AA 2IEZA 1LS6A 4LV8B 4DSOA 2FA9A 3GJ8A 1S3SA 1W2HA 1E9DA 1S0UA 2XOKA 5FR2A 5FTKA 1FP7A 1NRJB 3I8SA 1AS0A 3U3JA 4QC2A 1IJFA 2FPLA 2CE2X 5JI3E 3OZXA 3I61A 3FMOB 2AL7A 3R8FA 1P60A 2GCOA 4BRWA 5KUTA 2WSSA 1OFIA 2CCJA 4Q1BA 4TYNA 1UJ2A 2GEVA 3LAWA 1F2UB 1NJGA 3QKTA 1Y63A 2B92A 4UNSA 2B8WA 3FMIA 4DDVA 3GLGB 4MRNA 2OXCA 3AUYA 1DO2A 5TV2A 3LBHA 6Q21A 2WKQA 3C41J 1EFRA 5JCPA 1NN3A 1TUIA 4JLAA 2X1VA 3ZGXA 1E2PA 3U4QB 4P0TA 4MITA 3TUJC 4KYUA 2SHKA 1DARA 3OIVA 1TTTA 3L0IB 4MGIR 1JBKA 3SEAA 2J0VA 3ZD7A 1KKMA 1P2UA 2FF7A 2IX3A 1QDEA 3QKUA 4BLOA 2AK3A 2MMGA 1V43A 1OB2A 4A0FA 4HLDA 1RFLA 4P4TA 3DM5A 4RJLA 1J2JA 1Z2CA 4Q1FA 2RGCA 3UG6A 4E03A 2D4HA 2RGNA 2BCJQ 3GFPA 1OH7A 3S1AB 4NU0A 3LDAA 1N0UA 1YZTA 2GJKA 2QP3A 3B85A 1XCGB 121PA 4DLWA 2QAGA 3AP1A 5L3VA 4LC1A 5AJZA 1QHIA 1Z0KA 2PZGA 1MR3F 3ASYA 5JS7A 1ZYUA 4MQBA 2GCOB 4O2RA 1E79A 4CF7A 4M1TA 1RYHA 3Q7PA 3CH5A 5B58C 2ZI3A 2NIPA 4PQFA 1YVDA 4HB0A 5UKDA 4LBZA 3IO3A 1JAIA 4P31A 4LOAA 2V6JA 2VHTA 1OXUA 1QRAA 5FPKA 5G53C 3GLGA 4HEJA 3O8CA 1ESMA 2KBEA 5FUVA 4BLTA 2XGJA 2GA8A 1NJFA 5JHGB 1RZ3A 2W6JD 4NYMQ 5IF9A 1Z0FA 2ZANA 4C9BA 4TZ0A 5CM9C 3UWKA 3VX3A 3MWKA 2IHBA 3EAQA 4JLPA 3RNLA 3U61B 1E2KA 1GAJA 2FN4A 2N42A 4OHXA 3SN6A 4JLNA 2HCJB 2FZ4A 3BWDD 2NPFA 4B76A 1VG9B 3CWZA 3B1ZA 3K9LA 4HLUC 4PAOA 1U81A 4YMSA 4A0HA 4EDHA 4UJ3A 1P72A 2AFIE 3OIUA 5E95A 2VSXA 2FX3A 4GP7A 4DLRA 3KX2A 1CKEA 2DPXA 1U94A 1R0WA 2ZRNA 2QBYA 1IXZA 4V0ME 2GILA 3EZFA 4OI2A 2ZITA 1G64A 1T8TA 3C5HA 1E96A 4LX0A 4ZDKA 2R6GA 4RD1A 5HTKA 2J0UA 3EIHA 2ZPTX 3SDZA 4LYHA 2GWHA 4US1R 4RD3A 3F3YA 5TY0A 1W7AA 1UADA 2MSCB 3KQNA 1N5KA 2QRZA 3A36A 5JCZA 3M0EA 3OE7A 4M4SA 4KXFB 1LS1A 4QBIA 5FOXA 2C8VA 3VKHA 2FH5B 1OYWA 4BLSA 1Q1QA 2QL6A 2WAYA 2HJGA 1GKYA 4PC1A 2C03A 3RSOA 4A6XA 3ZJYA 4BLRA 3DZDA 3RYTC 3GFTA 2F1RA 3PUVA 1MT0A 4OI4A 3VR1A 4EPVA 2B8TA 1G7RA 2C96A 1VYVA 3CRQA 4A36A 3E5HA 2WJGA 1OJLA 1OHHD 1KK2A 3A4LA 4UNQA 1WBDA 4OK3A 5EXPA 2G77B 1Z07A 2REOA 2BKUA 4NL4H 1M2OB 2CVFA 3VU9A 2JLYA 2G0NA 1T5IA 3CZPA 1ZVQA 3HYTA 4GRAA 3GJ3A 1N5JA 3A1SA 2Q3MA 4FIDA 5EXTA 1Q1ZA 1T3LA 1IY1A 1U8ZA 3JVUA 1G7CA 2WBLC 1MABA 3QPVA 4JLMA 2Q9BA 4R2IA 1N5LA 4V0MA 3RS0A 1IY0A 3AVQA 2O8DB 2EYQA 3U3OA 3TSZA 4L16A 4IFBA 5HZKA 4DUGD 1G1MA 3MMPA 1S3GA 4IRUB 4BUJA 2ZUDA 3QPUA 1KI8A 4M53A 4NMMA 2VP0A 5FUWA 4DB4A 1EFTA 3JZMA 3MJHA 5CJPA 1KJWA 3CR8A 2ZRDA 1RIFA 1K5DA 3TSWA 4LHVA 3IEVA 1G5TA 4U5XA 3CM0A 1ZC3A 2IW3A 5KO2A 3Q8XB 4I1SA 4IOJA 2CCKA 1JPNA 2HV8A 3BD9A 3EPJA 2FDCA 2O8CB 1X8LA 4BASA 3EPLA 4H1UA 5GVSA 3VR5A 1UEIA 1M8PA 2FU5C 5ELXA 4HUQB 2PBRA 4GI7A 3X2SA 4M1SA 1RRPA 1G20E 2ERXA 3B78A 1VDZA 3PR1A 3K09A 4X8MA 2Z83A 3EA5A 1S8FA 4AYWA 1OXVA 2WKRA 3BAFA 3KQHA 2D7DA 4Q48A 4ITRC 4LSGA 4NYMR 1G7TA 4OI0A 2X19A 3KB2A 1KO1A 1G4AE 2Z4RA 421PA 3LWNA 1FQKA 2IWHA 4QJ5A 4B73A 1ZIPA 5EUQB 5TARA 2RHMA 4YLGA 4GPTA 4B3GA 4PHFA 4MUBA 3AVYA 1DAGA 1OXXK 1YZNA 3MWJA 1VCOA 4GSYA 1Z5ZA 5JECA 2ERYA 4XVUA 3TLXA 2CE7A 4FMBB 1D5CA 2JA1A 1AM4D 4FMDB 2ZR9A 5DNYB 1JEDA 3WMEA 3CBQA 1GVNB 1FUUA 3RAPR 1GTVA 4QGAA 3KUDA 1M7BA 3UPUA 4ZIRA 3CF6R 1W48A 1DS6A 3KXKA 1Q12A 2JDIA 3SBEA 1HTWA 5J47A 3ZH9B 3AF4A 2R6DA 1W2GA 3B2EA 1WB9A 2ODNA 2VQSA 2FEMA 4OI1A 3DKVA 2VP6A 3U6BA 3KXIA 5IT5A 2OCYC 2FV8A 3K0EA 1OFHA 2VP4A 1UKYA 5KU1A 4KFRA 3QBTA 2O52A 1G17A 4LI0A 2BC9A 1IN6A 1XMJA 1US8A 1OKKD 1T6NA 5GADl 5H68A 3QG1A 4ACAA 2OFOA 2VEDA 4DCTA 3QKSA 4EIWA 3C7KA 1CJVC 3KTAB 4DT1B 4A8JB 3P20A 4UXIA 3AF2A 3GLIE 4BFWA 3ADDA 2C78A 2ZU0C 4FW9A 3TQFA 2ZRBA 4TMWA 4D0LB 2RGGA 1WMSA 4JLOA 1KOFA 4V0OA 3AKEA 3RDPA 4B35A 3CLVA 1ZM3A 1DAEA 4PZLA 2BMDA 4JLBA 4DLXA 3T1TA 4XWKA 3SYLA 2D7CA 4PANA 4Y0AA 3BH0A 4M9XA 4QRHA 3GJ5A 3U7EB 5BYJA 4EJSA 3MAAC 2OZEA 4BFTA 5FPTA 3TW8B 1IN7A 3FWYA 1T8UA 1GP2A 1EWQA 2REXB 3WBJA 1N0WA 4A92A 3A4NA 4QKQA 1W4CA 3QXHA 2QY9A 3IKJA 5JJKA 3OEED 2F6RA 4W7SA 3U3RA 1NL3A 2ZS9A 1XNJA 4FCVA 1Z29A 1M74A 1FPMA 2IUTA 1K8RA 3LQQA 4C4PA 3K0CA 221PA 2W0MA 2VBCA 3NH6A 4FWIB 4I1VA 5CIQA 5JEDA 5JSZB 4R71A 3K70C 3TSOA 2ZJ2A 4PPFA 1NKSA 1JB1A 4P4SA 2FSGA 4NH0A 2C9YA 5EJEA 4JBXA 3KTAA 1XU4A 2WIAA 3K1JA 2YVUA 4TT3A 5AK0A 1KYIA 2KWIA 1CU1A 4IDOA 1SULA 3W6OA 2QMUA 2IWRA 4LBVA 2IXEA 4AKIA 1M34E 1S9HA 3EPHA 1XTSA 2EVWX 2J41A 1SVSA 1HV8A 2XZPA 2JLVA 5GJBA 4HLCA 1T4GA 1Q57A 4F4JA 2FSFA 5DGXA 4TZ6A 5IHPA 2GXUA 1ZMXA 4AY2A 1YZGA 3KQKA 3UMSA 2VHQA 3GLHE 3ZDQA 4RD0A 2O8CA 4GFDA 1OW3B 1JECA 5HZHA 4IW3B 5FOSA 1GFIA 1P2TA 1U0HC 1FNMA 1TUEA 4GMXA 1F3OA 2J5XA 4Q4AB 2GRJA 2RGEA 1Q21A 3U6KA 4YQFA 4LV6A 1UBGA 1II9A 2Z0MA 1TF7A 3GJ6A 4LC0A 4RZXA 3SOPA 2IF2A 4QJ3A 2QQEA 2QZ4A 3LFUA 3HDTA 4EJSC 4E5UA 5J4VA 3GQBA 5DI3B 4B44A 5LPNA 2NO1A 1WBBA 3SYKA 2OLJA 4WAUA 3BFVA 4AG5A 4TWZA 4LJAA 3B1WA 4L4UA 2PEZA 1E9AA 3L0OA 4TL8A 1NVVQ 3TVTA 1AIPA 5EP4A 2OO7A 5KDDA 2ATXA 4C0AC 4ZDWA 1Q0UA 3TVDA 3O47A 4RZ3A 2GKSA 5EP2A 2OILA 3K0CC 2BWJA 3UXMA 5KSOA 1ZUIA 4L5BA 2FZLA 1GITA 1SKYB 1UBFA 2HUPA 4Q00A 1KTVA 1IXRC 1KMHA 4CIDA 1JJVA 4W5HA 4B48A 3BERA 5JFGA 2IYRA 2AN9A 3GCGA 4JLKA 4RD2A 2ZYTX 2CLDX 2RB4A 1GUAA 2A2ZA 2GDJA 2ZXUA 4C2UA 1SXJC 1TEXA 2RGAA 2P2LA 4NYIR 2QE7D 1M6NA 3THYA 1E3MA 1GIAA 4MRSA 2G88A 2OT3B 1R0YA 3PEYA 1CBUA 2WPDA 4LPKA 4HAWA 4BWYA 2XNDA 4JJZA 4V03A 4LYJA 4DSNA 4XTCS 3ZLJA 2JLQA 1GL7A 3GEHA 3DZ8A 3OIYA 3RRYA 2A5GA 4UNNA 2O8BA 2H17A 2KSQA 1KK1A 1B0UA 1JQJC 1TQ2A 2WJYA 4B74A 2NMVA 2PLFA 1XTKA 4FINA 3BB3A 3W6PA 5IRCD 2GESA 3A6PC 3L8ZA 3C16C 4N0EA 3PUXA 1RW4A 1E0AA 2Q0HA 4TLCA 2AR7A 2CVHA 3KKPA 2ASEA 5HE9A 4AI6A 2H5EA 2ZJOA 3LW7A 4HAZA 1E4VA 2J0SA 3FYHA 2UKDA 3GFOA 3BK7A 2D74A 2ZJZA 3IPXA 3K0FB 3LV8A 3BB4A 1GNRA 1R10A 3M4YA 1O3YA 4HZUA 2NZ8A 3AP2A 4CEIB 3EZ9A 1Q1BA 5L3SB 2BMEA 3BORA 3R8CA 3ETLA 2QMHA 4P32A 3WYFA 4AYTA 2NO6A 2IYTA 3V4RA 1CXZA 3NC0C 1ELOA 1F5NA 2LCFA 4URVR 4IDPA 3THWA 1GOTA 3GLFA 1VYTA 1OSNA 2F43B 1IONA 1XB2A 5A0FA 3AUXA 3W3ZB 1KNQA 3AM1A 1Z6TA 4Q4HA 4B34A 2PEYA 3PG5A 4QM6A 4WW0A 4Z8XA 4CEIA 2QP9X 2GBLC 1EGAA 3FB4A 2V4ZA 2WMOB 4ZO4A 2BMJA 3JZAA 4MKFA 2Q9CA 3I3SR 3T5DA 3TJZA 1QZXA 4RD6A 1YR6A 1QHXA 2JIZA 2E87A 4RFSA 3EIEA 1Z8FA 5BQ5A 1DG3A 2OUKA 1O87A 2IC5A 1E1QD 4QJ4A 1R5BA 3HJNA 1D6JA 1NNEA 5F9HA 1H65A 1ZU5A 2FFBA 1CRQA 1YJ5A 2OG2A 4IFEA 1SKQA 3BBPA 1N3BA 2N1BA 3QXXA 5EP3A 3TQCA 2XX3A 1W36B 3GEIA 1L8QA 1OFTA 3QF4A 4A9AA 1XX6A 4DLZA 3PUZA 2IHYA 1IBRA 5BN4A 2DB3A 4W5WA 2JDID 3WMFA 1KO4A 2F1HA 4UQOA 5DLQC 3SS8A 1XPUA 2QA5A 4KLZA 3AH8A 2FFHA 1NVXQ 3CUEF 4TQAA 1MABB 2R6CA 1ZD9A 2P3SA 3RC3A 3ADKA 2VPPA 3V00A 3NBZC 3IIMA 3NVAA 1OF1A 2D62A 2VP5A 4DBLC 1TL7C 1MKYA 1ZD8A 1YR7A 2ZRGA 3IIKA 2ZSAA 3SHFA 4B2LA 4CGZA 4LV5B 2Z43A 3A8TA 1C1YA 2V7QD 4JLVA 1TNDA 2VHJA 4PR0A 1WDTA 3R9IA 3KQLA 2CJWB 2BIFA 1EXMA 4BZXA 1NSTA 1VIAA 2J87A 2XTZA 2ZE5A 5J40A 1X1RA 4NYIQ 5D3QA 1R2QA 2PJRA 5KPJA 4C30A 4A2PA 4ON9A 3U7HB 4D2IA 1N6IA 1S9DA 2ZTSA 4DCUA 2HF8A 3FE2A 1RPZA 1S1MA 3AVWA 1Z08A 2FE4A 4G5GA 3WXMA 1J8YF 2QPOA 5FUXA 2BEJA 2ZIAA 3TUIC 5DI9A 2A5YB 1TEVA 4JT4A 3QUSA 5E7MA 1JAHA 5CM8B 1D9ZA 2FMXA 4K8OA 1KMHB 3LBNA 2HF9A 3AB3A 2CLCX 4C0HA 3NEYA 3TK1A 4TMXA 1EX7A 5F3WB 4G5QA 1W0JD 2WAXA 3RRNA 1ZP6A 4FMCF 1G4UR 2F3TA 4WIAA 4TYPA 2QNRA 1SXJA 1IM2A 3GD7A 3DDCA 4LBWA 4TMTA 3PUWA 4ZIRB 1P9WA 4ZCIA 3DOFA 3DOEA 4ACBA 1CLUA 2AD1A 1ZM9A 4PPNA 1NN1A 1G3UA 2ATVA 2J59A 5E4FA 4NP6A 3OF5A 5CB8A 3L0SA 1XZPA 4Q4JA 5EUMA 4IVRA 1H8HA 5C2JB 2CXXA 4DXAA 4PTLA 1ZUHA 3RRZA 1IY2A 2IYSA 4YXWA 1AZTA 2X2EA 1MRSA 3KKOA 3SR0A 2BDTA 3AF3A 4RZ2A 3CX8A 2HT1A 3U60B 3OEHA 1HE1C 2GCPA 2FSIA 2W6JA 5H70A 3CF2A 4B6EA 2ZRFA 1NMXA 1SVKA 3K70D 2E1RA 4LDJA 5GVRA 5B64A 1JR6A 3QJYA 2ZM5A 3P26A 1L4UA 1JQLB 3TGPA 3SC3A 1P5ZB 1E79D 1G3RA 5EE9A 2EU8A 3PEVA 3N70A 4JIMA 4TL7A 3FTQA 2GZDA 3LW8A 1VCNA 2ONJA 3E2IA 2IXFA 5K8LA 4A15A 1E99A 4JMPA 2ZAMA 1ZW6A 1YR8A 3VR4A 2GXAA 3Q7QA 1XDBA 4BFVA 2P67A 3WYAA 1VIYA 2R9VA 4Q7LA 3CNLA 1OE0A 4B3CA 1XEWY 1KY2A 5A5GA 4KFTA 4CEHB 1BMFA 4KAXA 3ND8A 4CT4B 2ORIA 4LGMA 3HR8A 3SQWA 1N5IA 2GJ8A 3GJ7A 721PA 2ZEJA 1II8B 4NZYA 3C5CA 4BFSA 3ASZA 3HYRA 1OHHA 3VX4A 4OQNA 4ZI2A 2J0QA 2OBMA 1NG1A 4LYAA 4HAUA 4TTPA 2AXPA 4TTQA 1W46A 3ND9A 4I1UA 2V54A 5K8TA 2RGNC 4ARZB 2IT1A 3NBYC 4Z54A 2ANBA 2YJTD 4IVPA 2VH5R 3EASA 5TXGA 4OQLA 1N6HA 4BFZA 3CX7A 4UXJA 4JLJA 1XJQA 1J99A 2DWOA 1G8YA 3GJ0A 2V9PA 1XBTA 4ZKEA 5FFMA 3KKQA 1A2KC 2E9SA 4O2LA 1JR3E 1EX6A 1TX4B 5E7IA 2RMKA 1ESNA 4HDOB 2VHUA 5E3HA 2CL6X 4WA7A 4O3MA 3T1OA 4CW7A 4WZ6A 2OSBA 2BMFA 3PEUA 1Z0IA 1HYQA 2WMNB 2VRWA 1NMZA 1N0VC 1NY6A 1Q3HA 4ZCMA 2O8EB 2WOJA 1WP9A 2F55A 3IBYA 2EFEB 4GNKA 5K8UA 2G9NA 4IDQA 3A1UA 3GLIA 1NVUQ 2LWIA 5EXSA 4E22A 4ESVA 2CDNA 1R6BX 4A2WA 1XJCA 2BCGY 3ZIAA 2VSOA 2FOLA 1EK0A 1RKBA 4Q7KA 3U4QA 1DELA 3Q5EA 2L0XA 3TAUA 4MYHA 1NVVR 4M1YA 521PA 1KNXA 1MO3A 1XCPA 1IN5A 2Q9AA 2JJ1A 4AWXA 5DYIA 5CK4A 2ZR7A 5E7JA 3THOA 1QVAA 4Q9LA 2GEUA 4HLUA 1E94E 4TMZA 3K9GA 1B23P 1NBMA 1HQCA 1Q22A 2RGDA 3CW2A 1VHTA 5FPYA 1G9XA 4LJYA 4N0DA 3UWOA 3S1AA 3L43A 4DWJA 3K09C 2Q21A 1F2UA 2QAJA 4IHQA 4M1KA 2F1JA 4PSAA 1OYYA 4S35A 1SGWA 1YQTA 3QF7A 4QNRA 5J4KA 2JLXA 4JS0A 4V0KA 1AS3A 1E9EA 4FCWA 4KFUA 4EAQA 3IO5A 4LYFA 1EESA 5TB5A 1KZ7B 3FGNA 1NY5A 1U2RA 1F48A 1HA3A 1QHSA 2F3RA 4PC3A 1SVIA 4QGHA 4H1VA 2QGZA 3BFKA 1D8TA 4W9MC 1TF5A 4PXAA 1XJ0A 4BZQA 1IN4A 2ZSFA 3SBDA 5HKKD 2IYZA 4XVRA 5HE8A 3TAHA 1R0XA 1SVLA 2IYLD 2YWFA 1WF3A 3V4FA 1Z63A 4FCTA 3VU9B 2JJ1D 4UXHA 2WVJA 2QPTA 4YMWA 1ZIOA 2W58A 3CWQA 1VPLA 1NLZA 2QG6A 4K46A 5FBWB 1DOAA 3VNUA 1TPZA 1ZCAA 1VYUA 2ZRMA 4HB4A 2QMEA 2AD5A 1P4SA 4FXPA 3A1VA 4UNRA 4Q5IA 4X8HA 2V7QA 4QHYA 4URZR 2WTUA 4M1OA 2PX0A 4AC9A 1C9KA 3L82B 5EQTA 1Z0JA 1KI2A 1WQ1R 1Z6GA 1PLKA 2ZE6A 4OHWA 5DSZA 3C8UA 4DT1A 2J7PD 2IA5A 1P9RA 5CYOA 2WWIA 4Q7MB 3QVVA 1P2SA 1EFCA 1T3HA 3AP3A 4RKEA 1E2IA 3ZS9A 4QG7A 3RRMA 3OHMA 4F7WA 3GLHB 1RC8A 4QGGA 4MDEA 2A5DA 2J7KA 2QM8A 4MKIA 3Q3JB 1VG1A 4PAMA 2ZRCA 1XMIA 1VECA 5DISB 5JZVA 2QROA 3AV0B 4C0LA 4DEXA 2FGJA 5HKKA 2OBLA 3QSYA 2ECKA 4OYHA 4WZBE 5CDFA 1E9RA 2NQ2C 4IKEA 4O25A 2QP4A 3U3KA 1DADA 2ZSBA 5EZ6B 2RGBA 1AGPA 4LJ5A 2GF9A 4F91B 3VKGA 4P4UA 3SJCA 4AKHA 3G5UA 4CEHA 4QNMA 3NC1C 3THYB 3TR0A 2XXAA 2WWWA 4A8JA 4UJ5A 2YC4C 5FTLA 1A5TA 1CULC 2H18A 3D7MA 3K0FA 2FSHA 2IYVA 3U2QA 3VAAA 3SE0A 1E9CA 1DAMA 3B9QA 1FOEB 2FFQA 1A82A 3TR5A 2GVDC 3FDIA 3BJIC 3X1XA 4PQYA 1W4AA 1BYUA 1LW7A 1JXMA 1SVMA 1MV5A 5J4HA 4CZ2A 2AWOA 3NXSA 1OIXA 1KK0A 3QBVA 5DHAA 2OLKA 2ZI6A 1W36C 2GZHA 4Q4HB 4XWAA 4B6FA 1M7GA 1S2MA 4YXWD 1DAFA 1E9FA 1UKEA 3BFXA 1NN5A 2P6NA 3LH5A 2OEPA 4Q4LA 4R98A 3OEEA 1VMAA 2V55B 2PH1A 1V5WA 2ZJBA 3QQ5A 4A2QA 3B9PA 4J0QA 3TNFA 4I81A 4OBEA 4B47A 1II8A 1P7CA 4JSYA 4LHYA 4Q21A 1VHLA 4DLVA 1RYFA 1ZNZA 1OFUX 4HAYA 1E2HA 1LB1B 1G8PA 3TUZC 3I5YA 2H7VA 3N2IA 4HYYA 2I1QA 1N6KA 5SZHB 2ZU6A 4NTZA 1AA9A 3W8NA 3BRWD 1XEWX 4MYTA 2F7SA 2AWNA 2JLSA 3P32A 2A3RA 5FOTA 4TMVA 4RD4A 2NG1A 4PC2A 1COWA 1ZNWA 3NTUA 3PENA 1AJEA 4KLNA 4AIIA 5KPDA 1S4QA 3FOZA 3C15C 2CJWA 2DFTA 4BECA 4LJ7A 3OE7D 3BIFA 3GPLA 2YC2C 1KMQA 4D0NA 2QTFA 4DLSA 5LD2B 1OH6A 3GP8A 2J46A 3KKNA 4Q1EA 4C7OA 2UZ3A 2VIIA 3ZVNA 3TIFA 1KI6A 4EKDA 3K0AB 2O8EA 2BHRA 3NHBA 1E2DA 4A4DA 4DUGA 2GEDA 1VCIA 1BOFA 3T06B 4XWOA 4LPSA 2MSEB 2JJ8A 1E9SA 4IJMA 4NYJR 3SZRA 2XEXA 5G3YA 2C9CA 2D3WA 1E2GA 3DO6A 3FFAA 4JKIA 4OQFA 3ZVMA 1HUQA 4BEJA 4DJTA 1SVOA 3EC1A 1G8HA 1W49A 4PC6A 3T12A 2WICA 1XTQA 621PA 1KHTA 2LKDA 2IBMA 5G40A 4PZYA 2FEOA 1E9BA 2ZRLA 4LJ8A 5GJVC 1PV4A 1OT3A 4KCGA 5AJVB 2QAGB 1P6XA 3O8BA 1TQ4A 2CHVA 3QVUA 2BBWA 3CPJB 4DSUA 2WWYA 4IOMA 4Q9KA 5LB4A 2O5VA 1KI3A 1I4TD 3HPRA 1KO5A 1YR9A 3MFYA 1SXJB 4BZPA 4DIEA 4GDFA 1P3JA 2QE7A 4C2TA 1TMKA 3ZQ6A 1TAGA 1RVDA 1XPRA 2DFNA 2XTNA 4GP6A 2PLRA 1QHYA 3A37A 4GZMA 4L9WA 1P2VA 3UMFA 4GL2A 1KI7A 3J81k 4RSGA 5BN3A 2HXYA 3CO5A 5J4YA 2KE5A 1G291 3PCRB 3IIJA 2QUZA 2HLDD 3UG7A 1LTQA 2D06A 3LX5A 4H9GA 1L7VC 1KI9A 1QF9A 4OHVA 2O8FB 2IEYA 3SJZA 2WJVA 2G6BA 2PL3A 4M2LA 3PFIA 2W6IA 2GXQA 3BXZA 2N46A 1XD2A 4JBWA 3CONA 2Y8EA 2OESA 4E07A 1FL9A 2Z4SA 2RCNA 3R7WB 3AVVA 1YU9A 2QSYA 4Y0VA 1U0LA 3SYNA 2X2FA 1NKTA 4M21A 1ZM2A 3RSLA 5FBQB 5KSZA 2AFHE 2PZEA 1XEFA 5EE5B 3WNCA 1QBKC 4IOKA 3KKMA 2G0TA 2BJWA 1WXQA 1IQPA 1P61B 4C3ZA 1NIJA 4POAA 1NG9A 2WJHA 1NMYA 4MGKR 3F8TA 4QHSA 4YONB 1CS4C 1PZNA 1DAIA 1Z83A 2J7PA 3IGFA 4MKGA 3W6NA 2H57A 2CL0X 4B3DA 1DBSA 2H8KA 3K9NA 2HT6A 4U7DA 4CEJB 3EZ2A 3REFA 2YOHA 4TLEA 3SU8A 3LVRE 3WP0A 3MLEA 2TMKA 4B43A 2EYUA 1MH1A 1Z6XA 2PZFA 1KI1A 4ESHA 3VKWA 3FKSA 3OAAA 1MO6A 4MA4A 3L8YA 2QM7A 2FGKA 4JBYA 2P6RA 2R2AA 1OXSC 4Q47A 2YOFA 3RS3A 4D4MA 2QQ0A 1CR1A 4BFXA 1LF5A 1JPJA 4TLAA 3CNNA 3RC8A 1YRAA 2GJAA 1Q3TA 3AEZA 4FD2A 1ETUA 1GSIA 2XXAB 4Q1AA 5FTNA 3TW4A 1YHNA 2QTVB 4EFNA 1ZD1A 2NO7A 4NBSA 4DCNA 3CF0A 4MGZR 4C0JA 2J0UB 2GAOA 1UM8A 2FNAA 1KIMA 2H16A 2JJ2A 2ZQ5A 3DVLA 2ZYUX 4Q1DA 5DYGA 1X8JA 5FL7D 4DLUA 3PITA 3PVSA 2KI5A 1G41A 2HEIA 5BYKA 4JLDA 2EFGA 3RWMB 5FH9A 1ZM4A 4K81B 3GEEA 3U44B 1G6OA 5G41A 2DFKB 4JYBA 4LRWA 5JLJA 2W2XA 4G5OA 3W3AA 5CLQA 2QBYB 2O0JA 2GJSA 2WOOA 5SZKB 2R44A 1W5TA 1KSHA 4I4LA 1E1QA 5B2ZA 5SZIA 2Z5FA 1OLOA 4U02A 1VG0B 4AK9A 1W4BA 5A4JA 4B3FX 2REBA 2JLRA 3AGPA 4DIDA 3R9XA 2DR3A 3H2YA 3KJHA 2ORWA 3LLMA 4QL3A 2V3CC 2OE2A 2A9KA 4JL5A 3KJIA 3WNDA 1OPXA 4QBFA 2I3BA 3T15A 4YMVA 1PJRA 1OH8A 5CK5A 3ZS8A 4ZI3A 2NZJA 3WNBA 1G8FA 1E2QA 2RKOA 2W00A 2YOGA 3I8XA 3OESA 1HT1E 5P21A 4DDWA 1W0KD 3KL4A 4IVQA 4XTRA 1KY3A 3BE4A 5C4GB 2YZ2A 2F9LA 1YZQA 1SXJD 2IYQA 2C04A 1F2TA 3EC2A 3EX7C 1GZSA 2GXSA 3WRYC 1FQJA 2CEAA 1E2FA 4A6PA 3UKDA 1JR3A 5L3SA 4Q18A 1GM5A 3LLUA 2YWEA 5FPSA 1PLJA 2K5UA 4I1OA 3HPQA 4NONA 4Z1MA 2ODWA 1K5GA 2GETA 2ZJYA 3F5FA 4M9SA 5FTMA 3X1DA 1CF4A 3QE0A 1ZUNB 4KSCA 4G3XA 4Q66C 1AKEA 2DCUA 2P6UA 3I92A 4F38A 3IPYA 3T34A 2W2TA 2GHIA 3CRW1 3C14C 3E70C 3NEJA 4LY6A 4EPRA 4QXAA 3UMRA 4Q01A 4S2EA 4YDSA 2WWGA 3ZD6A 5GJCA 1E2JA 3A58B 4A0RA 5C46F 5HPYB 5F98A 3D3QA 1W0JA 1H8HD 3H1TA 2W0SA 2BBTA 3ADCA 1XRJA 5L3RA 1KDRA 4KU4A 2JEOA 3NHAA 5KNDA 1R5NA 1DO0A 1VKJA 3DL0A 1GRQA 5KSPA 4NHOA 2P5SA 3AVTA 1X3SA 2X77A 1CJTC 2ZREA 1Q44A 3Q5DA 2YNMA 2DHRA 1XF9A 1Q20A 1Z06A 2GNOA 5G3ZA 4RZUA 2NOAA 2JASA 3ZVRA 4M22A 4GT1A 2WWHA 1R7RA 2XB4A 1COWD 5FPHA 1Z2AA 2ZI9A 3W5JA 4OJKA 4Q4JB 3T1QA 1CR0A 3BH7A 1GDDA 4A8JC 1UKZA 2HXSA 3U7GA 2RH5A 1KJYA 1I4LD 4D4JA 3PEWA 4IDNA 1FW6A 1LV7A 1WRBA 4L8GA 3NH9A 2XZOA 1DAKA 2IYXA 3PIRA 1E32A 3ICQB 3OIWA 4B2PA 4CEJA 1W5SA 4MKHA 3RS5A 1Q1EA 2P65A 2RGXA 2H92A 4ZCLA 4G01B 1CIPA 1QHHA 2GTPA 4MDFA 2V8OA 3T5GA 1Z3IX 4AKGA 1ZINA 4OQXA 2C98A 3AF1A 3OFND 3IEUA 1JNYA 3BB1A 3RVBA 4G1UC 2O0KA 1Z22A 1KZGB 4Q03A 1HT2E 4EQ6B 4AYXA 3F0TA 2J9RA 1G3IA 1TQDA 5JWHA 2QAGC 1YE8A 3RABA 4C0QC 2NGRA 1A2BA 1D9XA 3HP1A 4BEBA 1LVGA 1UDWA 4US2R 4HLQB 5DH9A 4NCIA 2A5JA 2PCLA 1FFHA 3KJEA 3P27A 1LF0A 4KSBA 4R2HA 3QI2A 4D6PA 1AZSC 3MJRA 3U44A 1NN0A 5FOUA 3REGA 3EIQA 1WE2A 4QBHA 2D2EA 4KHZA 4DDTA 2QU8A 3CZQA 1X86B 4XIGS 5JWOA 4TMKA 3DMDA 5FOWA 4DHEA 3QXSA 3BS4A 4F4CA 3EPKA 3D31A 1ZM7A 2WZQA 5AJYA 4GZLA 4IXMA 5DO9A 3AVPA 3GJ4A 5KDLA 3N2EA 5BN5A 4KJZA 1OB5A 3A1TA 2EWVA 2R8RA 3R20A 3I1FA 1G7SA 1P73A 2QT1A 2ZI5A 3AVXA 1BMFD 1AS2A 1Z0AA 1BO6A 3CH4B 2VF8A 2CNWD 1R0ZA 2DBYA 4HZUB 4EPXA 2XSZA 2ZUCA 4RY2A 1GL6A 5TMPA 2XITA 2QT0A 2V6IA 2FFAA 1UAAA 4BGDA 3B6EA 4BFUA 3EW9A 1KDPA 1NLYA 3B60A 3GJXC 3KFXA 4PHGA 4AURA 1YZLA 1CJMA 1KDTA 2ZJ8A 2A30A 3CRMA 4TQ9A 4ZPXA 4DZZA 3QENA 2AHOA 3FPAA 2PJZA 4Q4AA 2QGNA 1HEIA 2ZS7A 5GJWC 2UVQA 5L3QA 1N6RA 1VG8A 3M6AA 4P4SB 3RS4A 1A4RA 3X1WA 4IEIA 3ZIAD 4XD7D 1YZKA 3EWAA 4GOJA 2IS1A 5EE0A 5HR5A 2GCNA 2VYFA 3K70B 1FNNA 2IUUA 2QENA 1YRBA 3FFBA 3FMFA 1T3SA 4U00A 2XZLA 5JS8A 4WZAE 4RKFA 1XWIA 4XD7A 5B57C 1N25A 2Q3HA 3PQCA 2FPKA 4HUQA 5KYKA 5FOVA 2IS4A 2JAQA 1GRRA 2B21A 2ZRPA 1YZUA 1TU3A 3BGWA 3MRSA 3VMFA 2PMKA 2ZJ5A 5LBIA 1F2TB 4KBGA 3HU1A 2YWHA 4ZKDA 4MRVA 5C1BA 3VR2A 1UFQA 3B1YA 5J4LA 3KFVA 1OKKA 1AN0A 4B71A 2JLWA 3E1SA 4L9SA 1XPOA 1KKLA 2V1UA 1TQ6A 3CNOA 2HYIC 1I4DD 5DI3A 1R5OA 5JI2E 1CJKC 4DSTA 4B2IA 1EWRA 1E0JA 5CJ2A 3KB1A 4BLQA 4EPYA 4TTRA 5FL3A 3GLFE 1UBEA 1GKIA 2OV2A 2AK2A 1AQYA 1U0JA 2EFDB 2VSFA 2VP2A 2CK3A 1E1RD 3SNHA 5AUQA 3ZZ0A 4URWR 4BFYA 2ZYVX 4AKEA 2BM1A 2FPMA 5H1YA 4AG6A 1IXSB 2GK6A 2IS6A 2IL1A 1ZU4A 2WV9A 5EZ5A 1PUIA 5KDOA 2IXGA 4TL9A 1W47A 2ZVQX 1WA5A 4NYJQ 1E2NA 5KNBA 3CB4A 1GKUB 2P5TB 1XCMA 1JJ7A 3LD9A 1G3MA 4PZZA 3W90A 1XTRA 1KSFX 2WKPA 5SZJA 3I5XA 2JIZD 3KUCA 2WSSD 5EE1A 3VFDA 4NCJA 3FHCB 1IAQA 4MUAA 1G5PA 3CIOA 3MWLA 3GLIB 5FI1B 1SVWA 1W0KA 4LZZA 5HCNA 1KAGA 2XTMA 3IQXA 2CHGA 4RFVA 3PV0A 1DE0A 3LVQE 5JHHB 1HE8B 4V0NA 1KO8A 3RANA 3VHLB 4PFSA 3EZ6A 1A1VA 3MCAA 4ILEA 1OIWA 4D25A 1XMVA 2R6FA 2IYYA 3NG1A 3WMGA 1J90A 4IOLA 1IN8A 4QHTA 1ODFA 5AR1A 5LDDC 5FBRB 1CR2A 1QG4A 3MGCA 4KI0A 4QM7A 5AJXA 4IDHA 2CHQA 2GZAA 1N6NA 2OCBA 4Q9IA 5F2EA 2IK8A 3GMTA 1U99A 2VF7A 4KVGA 1IHUA 4CVNA 1PLLA 3IHWA 1Z0DA 1VTKA 2ZS8A 2KJQA 2ZROA 3B1XA 5JMTA 2QEQA 3LBIA 4HDQB 4KYIB 2PMDA 1XD2B 1KO7A 1PUJA 5KTYA 4JVMA 5K8IA 3NBXX 3EA0A 5J5CA 4Q1CA 5JBQA 4KV9A 2VO1A 3ONWA 2CMKA 2QTHA 4HSEA 4URYR 2PX3A 1Y3AA 2NTYC 1EFRD 4KBFA 3MUFA 3BOSA 3PJRA 1EG7A 1FMJA 1N6LA 4PO1A 2VP9A 3I4LA 2H1LA 3IDQA 4EQ6A 4TYYA 4JSTA 1UKVY 4EPTA 4WBSA 1XXHA 3AF0A 4JJKA 4EFMA 2PCJA 2QSZA 2WSMA 4Z51A 4DB2A 2BBSA 4NDZA 4BLPA 1RJ9B 1ZRHA 5CIWA 3QXJA 4GBMA 4LJ6A 4WXRA 3HR7A 3SHWA 2G83A 4ABYA 2B7CA 4B75A 4BRUA 1C4OA 1NLFA 1X1SA 1LY1A 3QOFA 3U7FB 5LB2A 5AUPB 1S96A 3SI7A 4F93B 5EP1A 1XTIA 3DMNA 1UF9A 3LXXA 3I32A 4II7A 4AD8A 3QEOA 2ODEA 4HAVA 2XB2A 4C7OB 4N1AA 2R6AA 4YMTA 1U9IC 3X1YA 2OHFA 1DAHA 4JL8A 3GLHA 1M7HA 3NBFA 5FBLB 3AKDA 1F60A 1E2MA 1NVWQ 3I62A 3A1WA 2G1KA 4JZKA 1UEJA 4US0R 1R4AA 3NDBB 2UZIR 3DEFA 2C5LA 2FG5A 4M1WA 4RFSB 1XMSA 4UKDA 1XD8A 2W2VA 4YDHB 4TYWA 3W8RA 4MYCA 1JEEA 1GL9B 4RCZA 2OBNA 3QIAA 3M1IA 4KVAA 4TT3D 3WHKA 1GNPA 2NO9A 2EFCB 2V1XA 2YYZA 1A7JA 1D2NA 1MO5A 1W4RA 2XJ9A 2VA8A 2HLDA 3I73A 5IDVA 3FHOA 1XXHE 5DN6D 3RS7A 1E6CA 1L2TA 2XNDD 4PPQA 3QNUA 1QVRA 4PHTA 4DLYA 4OK5A 1Z6AA 1R8QA 3WBKA 2OXRA 2ZYWX 2AKYA
chains in the Genus database with same CATH superfamily
3PFHA 4B87A 4AS3A 2D0DA 3E9RA 3HDJA 3IUYA 3RVSA 3MA0A 1XHFA 2VAXA 1O0BA 1Z4NA 3KAKA 1MPXA 3VR0A 1I3OA 3RLFA 5JH7F 4EYSA 4OKSA 3UPTA 1G5QA 1PSWA 1YB1A 1ZNXA 3QEMA 2IS2A 2WAAA 1V9CA 2WK1A 1JLMA 4U8GA 3R74A 1BE8A 1VSBA 5DCWA 5FUQA 1XIVA 2WIKA 3DFUA 3SZOA 4D44A 2J9ZB 2EP7A 4RVCA 4XH9B 5TDHA 3ZN2A 4ASUA 1N8TA 4QUEA 1KFBB 4KQIA 2DRIA 4BN5A 5B7PA 5KOYA 1LLFA 2I67A 3GDGA 4NK4A 1JMVA 4OP1A 3RVJA 3WMWA 4CLOA 4ND8B 2PX5A 4D4LA 4PFJA 4Q02A 1G2PA 1GG2A 4YP6A 2CCGA 1JAXA 2FFJA 2NXNA 2GBIA 3E4CA 5AM5A 4DLKA 3A6FA 5EQJB 5BOVA 2BM0A 3DBRA 3K05A 4HGQA 1PZHA 2OGUA 1SQ5A 2AHRA 4JB3A 4JUCA 2QORA 5JY1A 5EQFA 1HSZA 2VF5X 3R44A 2VYQA 1JG4A 4DVGA 4EG4A 5I4IA 3VI3B 3AFNA 1WPRA 2V65A 3COYA 1C0EA 3S2IA 3UJPA 2GVNA 4EUHA 1P62B 3GNLA 3LLSA 4HDMB 4TN5A 1DKUA 3CPEA 1X8KA 2RIPA 3HKCA 1VPTA 3DZCA 3KU1A 2GYUA 4FN5A 2P11A 3U17A 3MF4A 3ESQA 3QXGA 4ZK2A 2IIQA 1AHPA 1T5BA 4B3HA 2KBFA 1GO2A 4MVJH 3S2ZA 3A6DA 1SXIA 2LKCA 4LK3A 3G8BA 3JQCA 3UATA 4D3DA 4HUTA 5B2EA 2XCRB 1N6OA 1QM5A 1A5SB 3JARB 4D8UA 2WHPB 2BSQA 1E0SA 1Q19A 3B7GA 1FTNA 1NMQA 3W5IA 4C7KA 3THXB 4RPLA 2CXOA 5GINE 3AKCA 4UEQA 2OY0A 1UFKA 2A4MA 3GVCA 1BS1A 4KMMA 4P7JA 2B5OA 3TDNA 5KHOC 1B16A 1M2FA 2FXVA 5T3YA 2QRPA 4TLMB 1Z7YA 4UNPA 1FYVA 4QPDA 1BXGB 4BNHA 3GA7A 3JQ6A 1R3DA 1CUJA 1UBCA 2HMVA 2ZRIA 3FWPA 4M9QA 1JVBA 4WFJA 4H59A 4FB5A 1E6KA 1JIQA 3F6YA 2OAP1 1NVGA 3HKEA 3PRYA 3DAYA 4JVSB 8ATCA 4P3YA 2IEIA 1I3MA 4UREA 3FMGA 3W1VA 5IK2A 3JS5A 1OAKA 3VQTA 2QYHA 4E09A 4K9LA 1UIRA 4D57A 3LT4A 3TRHA 2HU8A 3WHLA 1MFPA 1N4AA 3X1ZA 1XZBA 1PJBA 2H3EA 4C0SA 4WECA 1PVDA 1OZFA 3K31A 2V4MA 5CRIA 2VDQB 4TVBA 1V3VA 2JAOA 4ZT3A 1L5RA 4X3CA 1D4AA 2VTKA 3E8SA 3FETA 3LHIA 4B31A 4D9EA 1LBQA 1KH2A 4IVNA 4BPRA 1SR8A 4ZYWA 2FWRA 5TVKA 2IPNA 2ZSEA 5F9FA 1ZJ6A 1DMRA 2QX8A 4ONEA 2V6BA 3ZVLA 3BJEA 2FSUA 5C0OE 4KOEC 1JIUA 3IDOA 4B32A 3BWCA 4YMUA 3R5XA 2YYYA 1QOQB 1YKFA 1KJZA 1C7QA 2FJUA 3G8AA 1WMBA 4HLNA 4BQSA 4BS9A 5AUOB 5CTJA 4I99A 4LOHA 3HGQA 2PZMA 2J8ZA 3GZTB 3MVEA 2PT5A 5FL7A 2CVQA 3M5CA 2IELA 2XUIA 4HI0E 2CF6A 1ZI8A 2H00A 2K7ZA 1QHNA 4E51A 2MR5A 7MDHA 2I4MA 5KSYA 1Z6YA 4GUAA 1CY7A 3DFIA 2P9QA 1RBZA 2HQ1A 1T2CA 4MRPA 3PZBA 3IBGA 2FPGB 2OCXA 4XYEA 1BYIA 1YU6A 2NYUA 4JB0A 1RRVA 4JXXA 1V11A 1KSGA 5DP1A 3LDFA 4F56A 3R7WA 3THSA 4AVYA 4LX8A 2Q4TA 1WCIA 4J2OA 4Q6BA 1KJQA 5D01A 1DTEA 4A6DA 2HRCA 4HDCA 3EE6A 3MOIA 1MIHA 3AB7A 5L3QB 2Z5LA 3RWOA 1TMYA 1MNAA 4RSRA 1UBSB 1Q7EA 4LCEA 1ULSA 5KTSA 3WAJA 4L6CA 3ZZTA 3EGEA 1GILA 2XMQA 5IAKA 1H0SA 3RUEA 1PNOA 3C3EA 1L3BA 4J7XA 1YS7A 3C7TA 3TRKA 4KODA 1XN4A 3FZGA 4GPBA 2P1ZA 2A78A 3K71B 3PLAE 5KREA 4UMVA 3BD8A 1WPQA 3GARA 2C1EA 4L5IA 4LHZA 3IURA 4MAAA 4FSDA 4WOBA 3D0RA 2ZVPX 3OCCA 1PI3A 1O08A 2D5CA 2CXNA 4WLVA 4GKVA 4FZ3A 3KVRA 4LMPA 1LFDB 3UHFA 1S02A 2CXSA 3KELA 3JQGB 3KQWA 4LQLA 2CXQA 5EMHA 3ZCSA 2I1VB 5D1NA 1QHFA 1U8YA 1BS9A 4Z1MD 4U2FA 3OM1A 1E69A 4PCUA 2H07A 1CPYA 1DSSG 1QK5A 3MT7A 2XUAA 3N28A 5KAMA 2OFXA 5CX1A 3I53A 3H11B 3GOQA 4CQLB 2J3EA 1JBQA 3AY6A 3BILA 1BIFA 1VKNA 4AN0A 4MH0R 1QVVA 1MB2A 4PZUA 1JMYA 2C61A 3KQMA 4H18A 3H1EA 1O95A 2XAUA 2QLNA 1XU7A 3CEHA 3PWKA 2BGIA 2VRBA 5BSWA 4WUTA 5FI0B 3LY5A 4YXFA 2IQIA 4D45A 4YCLA 1W52X 5BURA 2O2GA 4Q19A 4L5YA 1AKVA 3TLMA 2DUWA 3ZHSA 4NESA 1SPXA 1FMLA 2BFDB 2FY8A 5LD2C 3QE9Y 4WVFA 4TUYF 3FUCA 3FTPA 3RO7A 5AW2A 2WF9A 4YMIA 4G8BA 1NJ2A 4O0LA 3EMKA 3DZJA 3GAZA 5A4MS 1AC5A 1L5OA 1ZNYA 2D2VA 1LVUA 5EERA 3RJ9A 1SQ0A 1W85B 3HP7A 4C3VA 5B6IA 3GCXA 1JG1A 5K0JA 1XZGA 3CKLA 4IF4A 4B0OA 3O2QB 1Y8AA 1PGOA 3ZZUA 4N3NA 4BNIA 4CM4B 3EOZA 2CHEA 4FQ8A 1L5KA 4GNRA 2C4TA 4DJJA 1K7EB 2YNMD 1U8AA 4M8LA 2QUKA 3QTBA 5ADUS 1O5IA 2CLSA 2DWCA 5F78A 2R751 1V5FA 4TSFA 4NU8X 3F5DA 3P7MA 2PANA 4HGPA 4TLDA 3PQDA 3O9VA 1TUBB 1OX4A 4OHKA 2IU0A 5I7OA 5DHFA 1EIWA 4ODIA 2BFAA 2G3YA 2Q6KA 4A82A 3DBIA 2PFGA 1W85A 3G9ZA 3AJ9A 3WJ7A 2L42A 4FKBA 4KO8A 4OLBA 3WWZA 5JCOA 1B41A 3PQEA 3KOYA 4IXNA 5J58A 1D2HA 3Q87B 4B7AA 3BH6A 5IAEA 2BGMA 1IIRA 5HCUA 4QYIB 1NVEA 1VL1A 4D80A 3UKJA 1BCRB 2YKGA 2H4WA 1CP2A 3R7DA 3GLGE 3TZEA 1IZ8A 4B3XA 3P71T 3DFZA 3SS9X 3S1LA 4LE2A 4MKXA 4ZEWA 2IUYA 5CH8A 2CFIA 1X42A 4C88A 4EGQA 3A4YA 1O7JA 1QZUA 3DKPA 4JHXA 3NDPA 1ZH8A 4KFSA 4QFCA 2B7BA 1ONBA 3MK31 3OF3A 1SHKA 3ZY2A 1WCWA 3R2JA 4LOLA 4V02A 4EQZA 4U5QA 1DJMA 4Y30A 2I2AA 1PGQA 2BKEA 4V3BA 4JQZA 5KVSA 3M9XA 1K6MA 2D0PB 3FR8A 4NSNA 4OXYA 3CIFA 1BTOA 4JMLA 4R1NA 1RTKA 1LSOA 3TLGB 4GD3Q 3ZHOA 4BVFA 4K3UA 1H8ED 2EERA 1R0LA 1ESDA 1KA9H 1U2SA 3DBHA 5EIBD 4L15A 4ASUD 3SMVA 1SZCA 3MOSA 2VBFA 4WADA 3KLOA 4WNIA 1HR0B 3U81A 4R9UC 4GI5A 4L7VA 3DLAA 2G5CA 5LM3A 1ZXBA 1M2HA 2DHQA 1E2BA 1RJ9A 1GQOA 2WNHA 3MYYA 1KDOA 3DLIA 4ID9A 3BMCB 2MYNA 3PD0A 5DT2A 2UYYA 2WTXA 3QK7A 2Q5OA 1ZOSA 4X94A 3G2LA 5CT4A 2MDTA 5ALOA 3WRVA 3HY6A 5A6VA 4LXYA 3GYGA 2WDZA 3X3HA 1SHZA 3ZJVA 1A77A 1P3Y1 1QS0B 1NBME 2QMOA 3W34A 1RRGA 2Q2WA 1D7AA 2PRYA 1EH5A 3IEMA 1I5OA 1PK9A 1DTSA 3JR7A 2JHCA 4DJFC 4CRWB 3ZY4A 3P9RA 2FTKE 3NJ8A 2DWQA 3A6LA 1ZGJA 2IPOA 2PKRA 2ZSDA 3ACDA 3QKSB 3O2NA 4F3NA 1HBJA 2E89A 2WF8A 3PQ2A 1KI4A 1V8FA 3HA5A 4CYMA 1RSZA 1WW3A 4PAQA 3M3DA 5K8VA 1MN6A 4LA4A 2WE8A 2OORA 3DT9A 4KAJA 4YJ3B 1EI9A 3IVMA 2RHDA 1L4KA 5JLAA 5EZQA 5K99A 5DZSA 1SIUA 2A5FA 4ZICA 2MR6A 1L5GB 3WY9A 1AGRA 4GC9A 4U2GA 2D2IA 1ORIA 4QDZA 1IYZA 1TCVA 2SBTA 2OM2A 2VTEA 1H42A 3UANA 3ISTA 5JRZA 5AI5A 1XD9A 1E7SA 3F6EX 3B38A 1TO6A 3H1BA 4BO6A 1SXQA 3LQRA 3D4PA 1VJRA 4P3OA 2A84A 2HWYA 4QOSA 1O9GA 1PFGA 2O19A 3DUWA 4MGYR 4TL6A 4E7OA 1C80A 3E1KA 4GH5A 1ZISA 4O0MA 2ZRJA 2EJVA 1QG6A 2VDMB 2QNIA 2AXNA 4TWIA 3I9NA 3MRVA 1FXUA 4TXLA 1RXWA 2I03A 2OLEA 3OM9A 5FXMA 2CMHA 4C0XA 1KDZA 3LQYA 1RYYA 1Y82A 1U98A 3JVVA 1B6GA 1FZQA 1KAHA 2OENG 2XMCA 3HHEA 3HU2A 4YAFA 3L0YA 5SY4A 3SEFA 4UHKA 2JLUA 3GX1A 5CA1A 4BBPA 1F3LA 1M5RA 3TOSA 1P1RA 1RS0A 1K6JA 3DCIA 3HNPA 4L2IA 1MV8A 4UE6A 2ZETA 3IAAA 4QFBA 1JHQA 2ZJ3A 3SQXA 9GPBA 4C4TA 4ER7A 2PWPA 4YCBA 1JLSA 1XN1A 2Q6TA 2WYHA 3EZ7A 3UK6A 3V46A 3KHSA 3PD1A 5T4HA 5HM6A 4HEHA 2Y6UA 4IQ0A 4ARZA 5D3MA 3AETA 1GN8A 2P0EA 3BC1A 5LZ4A 3WGIA 4AMGA 4UUPA 2X8AA 1PT9A 2IIBA 3OZTA 3AIKA 1LS6A 2AR0A 4WNYA 3INRA 1Y1SA 4DSZA 1OAAA 7REQA 2O1XA 5D6NA 3SZLA 4DA4A 2YCLA 3NHRA 1NRJB 1AS0A 4MS4A 1P0PA 1T2VA 2GN8A 2CE2X 4YWHA 1QOPB 4KO4S 1F4LA 5GOZA 2AL7A 1VIDA 1QFJA 1PS8A 2GCOA 2OWDA 4BRWA 4QLBA 1SUPA 5KUTA 4PSDA 5J2UA 1M0EA 4Q1BA 2Z95A 4G8JA 1UJ2A 4HEQA 4TV8B 4QT0A 4ZQFA 3CEJA 1NJGA 2WWRA 3QMWA 3FX2A 4REQB 1VLHA 1Z2PX 4QXMA 3ZZ1A 1UWVA 4IR7A 1OLUB 5JS2A 4PG8A 5AJHA 1ORHA 4P80A 3UWPA 1E7RA 1O95D 3UK0A 3GLGB 4DWJA 3WO1A 2X5XA 3LBHA 2B1IA 6Q21A 2WKQA 3UCFA 1BJKA 1MO2A 4J7UA 5KYGA 3C41J 4X63A 4HDMA 2EIXA 3OZAA 3Q5GA 1YUMA 3V4VB 4JP1A 3AOEC 5GONA 3U0BA 1GG8A 1ZSYA 4ZVUA 3SEAA 2IVFA 2J0VA 1TCAA 3IP8A 1KKMA 2JRCA 5DM4A 2QM3A 4M88A 5IW8A 5C5EA 4V0SA 1IQUA 1V43A 4BNKA 4A0FA 1L4HA 2IUEA 4IICA 1W581 4PWYA 2QRGA 3DM5A 4Q1FA 3FM9A 3UG6A 1X7ZA 2JI9A 3L7KA 3R6DA 1T25A 2BCJQ 2FW0A 1AO0A 1HRDA 2P68A 1CUEA 1NXWA 4DL9A 1IK6A 3A4TA 3AYXB 4R83A 1Z5NA 1EQAA 4E7PA 3B85A 1XCGB 4DLWA 1NDUA 3FSJX 2QAGA 3AP1A 5IAGA 4B84A 5IDWA 5AJZA 3LWDA 2PZGA 3I64A 2QDXA 1E3JA 5JS7A 4MQBA 4WCFB 4G36A 2PTGA 4O2RA 4RZSA 4YJ2F 5EJIA 4FOSA 1BGVA 2WUWE 4IIGA 1C3JA 1C9JA 2PV7A 4CF7A 4M1TA 3BQMB 1RYHA 4XQ0A 3BZBA 4B82A 3JW8A 1EDDA 4PQFA 1YVUA 1YVDA 4RESA 5LZ8A 1VE1A 4LBZA 3IO3A 3T5TA 4XUCA 1QRAA 3NM5A 4GHWA 4BIMA 3GLGA 4GIBA 2HADA 3O8CA 1DQYA 1N2CB 2J0SA 3M5PA 4Z4CA 5IFKA 3I9KA 3A05A 2GA8A 5ARDA 2XGJA 1NJFA 2V7TA 1ISJA 3GZJA 3T6KA 5DX8A 4UHEA 2W6JD 3G0GA 1UDAA 2ZJ6A 3KRTA 5C1IA 5C3MA 3EQZA 3I76A 3FTEA 4TZ0A 3M4NA 2I4LA 3UWKA 3MWKA 1NBAA 1DKOA 2AYZA 2V7PA 5EJ7A 5AXDA 2V03A 4Q16A 2VZLA 4KWHA 5DGHA 3U61B 2EJCA 1GAJA 2UZAA 4HS4A 3NYRA 4DYDA 4DE5A 4E12A 2I4RA 4PINA 3ZIDA 4B76A 4YRIA 3O7WA 4F3KA 4FSHA 2CVPA 1RM4A 1U81A 2BP7A 2ZW9A 2CXHA 1FC0A 1SQFA 3PF8A 2CBGA 3PK0A 4ND4A 3PNPA 4QUDA 4S1OA 4DANA 5M3BA 1XZLA 4PG5A 1JDPA 2RI1A 2YNMC 1P0IA 3IMEA 1QVZA 4L57A 4GP7A 4JDPA 3JTMA 2H9AA 3GV0A 4MUGA 4NX2A 3BWVA 4DLRA 2DPXA 4K6OA 1U94A 3V33A 1ZIXA 3W5CA 3F8WA 5HQJA 2XUZA 4YIHA 1IXZA 1Q6YA 1Y6QA 1DKQA 2UVPB 2WE7A 3EZFA 4EITA 1DCTA 3C5HA 2BLLA 2YWCA 4K8RB 1F7UA 2R6GA 4RD1A 1QO9A 1Q7TA 2QSJA 1UOQA 4RHTA 4Q34A 4LYHA 3LY7A 1BKYA 4J90A 1FUYB 4MROA 3F3YA 3JSXA 5H80A 4UU1A 1UADA 1IBKB 3KQNA 2QRZA 3M0EA 3OE7A 1UMCA 2YV3A 1AMUA 2P90A 5FOXA 4INJA 2C8VA 2GNPA 2HM7A 4LRQA 4ZTBA 1WXFA 5AXBA 3TCKA 3KG2A 1YFZA 4XCQA 4GLBA 4A6XA 4EI7A 4AL4A 3GFTA 2IOFK 3PUVA 4OI4A 4UUBA 4EPVA 4EBFA 4NXMB 4GEKA 2B8TA 4L9AA 5JCJA 5HWSA 4JAVC 1G7RA 3G8DA 2Y77A 4LOJA 4ENSA 1U2GC 2VJYA 3E5HA 2CJFA 1ZVKA 1OLSB 1VFNA 2FUEA 4H15A 2YZKA 4V1CB 1SKMA 3VPCA 3A4LA 1PJ3A 3TXAA 1Z07A 5LXTA 1V2GA 2BKUA 1O0SA 1M2OB 1AUPA 2JB9A 2M6RA 4ND1A 4NZPA 5F7OA 3MWEA 2N1MA 5CT9A 2V74B 3JWIA 3ZQ4A 1V71A 3A9CA 5E1MA 3VPHA 1LRLA 3GJ3A 3RTGA 1R8XA 1WXEA 4ALJA 4UAVA 4R40A 2JIPA 2IYPA 1KYZA 3L7OA 3DHVA 3WAKA 5KYXA 3JVUA 1TT5A 1G7CA 1V1MA 5D86A 3RS0A 3UQZA 4BNGA 1TYAE 1N5LA 2FN3A 4IAOA 4BBZA 1IY0A 4CQLA 3TMAA 3U3OA 1WD7A 3ODPA 3TSZA 2Q6VA 4HNAB 4IFBA 5IJ0B 3LO8A 3QEBZ 1G1MA 1MORA 1S3GA 1IOVA 3GA5A 3ZR4B 1PQWA 7AT1A 2FEPA 3TQSA 2XMSA 1EFTA 1UUFA 3ITKA 3JZMA 3MJHA 3PCXA 2A9OA 1KJWA 5LP6C 3ZKAA 4RSHA 4TX1A 1MC1A 5DYNA 3GIWA 3W5HA 1O58A 4LHVA 4LMAA 4J4BA 3TOVA 3TZKA 3EVBA 1JU4A 5C5IA 3CM0A 1ZC3A 4YRTA 2BLNA 1KU0A 1S7CA 4IOJA 2CCKA 4XB6B 3EPJA 4MZDA 1X8LA 2Q2QA 1ISMA 2YW2A 4DZRA 3EPLA 3HCWA 1UEIA 2XDQA 1ZUD1 2CDRA 4NEQA 1N92A 1GU0A 2QZSA 3EEBA 4B8WA 3X2SA 5L6LB 4Y1EA 3OMXA 5MDHA 5LQDA 2ERXA 2XMRA 3B9RA 1ZJZA 3EA5A 4N01A 1EB9A 5E2IA 4B7XA 4NBUA 3GGGA 1CVIA 2BTQB 1OXVA 4YASA 4AYWA 5KC9A 3DCJA 3I0NA 4FYXA 2R2GA 4J6EA 3KDAA 3UTCA 1P2FA 1RKVA 1MF7A 3M2PA 5IVPA 2C9DA 1TUBA 3NHWA 3VISA 3NUZA 1G8AA 1KH3A 1D0SA 3HB0A 1R8JA 4RKRA 5BUSA 3LWNA 4HY3A 4A3SA 4OPMA 4YAUA 3LFTA 5CHEA 2I2CA 4B73A 3VUEA 5CH5A 4E2ZA 5BVGA 5EUQB 1CX9B 2RHMA 4YLGA 2DKNA 1JV2B 3AG5A 2ZIFA 4EK9A 4P86A 2ZGVA 2R97A 3MWJA 3UJBA 1BDHA 2JVJA 4XVUA 3T95A 2AZXA 3WDKA 2CE7A 1GKKA 3LXUX 3H9CA 5A4AA 3BJRA 3TDMA 4QYMA 3HK2A 5IC6A 1UT8A 5J59A 2J3HA 1JEDA 1F8FA 1XF1A 3HVHA 4CMBA 1U1CA 2EX1A 3AU9A 1IUKA 3ZY3A 4ZHQB 4QGAA 1MJGA 1CDZA 2PVPA 3KUDA 4Y6QA 3ER6A 3OQIA 2PUHA 1N0HA 3HCNA 4M7WA 3NDRA 4FD3A 4HMPA 3CF6R 3MAJA 4PO3X 3CNQS 4ZIRA 4PLFA 2ZR8A 4KPYA 2JDIA 5KJEA 3X2EA 2R6DA 2Q28A 2X7HA 1A4IA 3Q8WA 4O5AA 2ODNA 1NMEA 1K66A 3WOHA 2YIDA 1L5LA 3DKVA 3DKKA 3U6BA 2DX7A 1BE6A 4AIRA 3VC3A 4RY9A 3C98A 1R64A 1XKQA 1CUGA 3EF1A 3R5KA 2Y99A 5ECGC 1QH8B 4R3NA 5KU1A 4L8FA 4BZZA 3AFHA 2W8BB 1PZFA 2BC9A 4FHCA 1C7ZA 4LI0A 3MWDB 1UXOA 1IN6A 1US8A 1G63A 1VFPA 3OTWA 3PWSA 4GW3A 4RGVA 5HZMA 1H23A 1MC8A 5H68A 3JPWA 1MOSA 2OFOA 4WY5A 4DCTA 1ZH6A 1XLWA 5T7BA 3C7KA 3C74A 1CJVC 3JQEA 3KTAB 4RS4A 1I5RA 2E0IA 4ZXPA 2UXCB 1FVHA 3GLIE 1RAGA 2ZYAA 4M0MA 4RTLA 3ADDA 1L8LA 1H2BA 3DQZA 2ZU0C 4FW9A 3I45A 4TMWA 4OAOA 2RGGA 4Z0TA 3NM4A 1WMSA 2YRWA 3JVEA 1EWKA 2DUMA 3KSZO 3P9SA 3Q15C 2PA3A 4YPOA 1KOFA 2EHDA 1E6MA 4IIDA 3K1YA 4O4IB 1KEEB 2JVIA 4R05A 4R69A 1YDMA 4W63A 4PZLA 3WGYA 5C37A 4I8DA 3RC7A 1K68A 2B5VA 4PANA 4RL4A 4M9XA 4OQQA 2LIPA 1NXSA 2GFIA 2ESRA 3GJ5A 5BYJA 4KR2A 4LSMA 4BFTA 4YQZA 4X95A 1YZYA 3HHPA 2RHRA 1ITZA 3OETA 3TW8B 5ALJA 4B83A 4KL8S 1CFZA 1PWHA 4CGYA 3FPEA 4IXDA 4BIIA 3E8XA 4WZAB 1AV6A 5H9VA 3FCYA 3RYFB 5ADWA 1N0WA 3KPUA 4A92A 4G4JA 2A1TR 3IUNA 4FVTA 1L1FA 4QKQA 1NNSA 3NHMA 3T4XA 5B36A 1I5EA 2IE0A 5CDUA 3VDRA 3IKJA 3ZCUA 5JJKA 3H4VA 3OEED 4EGFA 2F6RA 4JROA 2AGVA 1XNJA 1E89A 1FPMA 1OASA 3I2HA 3KKEA 4PCLA 5K09A 4ZA2A 3K0CA 2J6BA 3ULKA 2VRNA 3NH6A 2QQGA 3QM1A 2O5RA 1KZYC 4QASA 2XNJA 4IG9A 5CIQA 3VSCA 5JEDA 3B48A 2AJ8A 1P0CA 3TX2A 1JB1A 2VNJA 2ZB7A 4MW9A 4NH0A 4BMCA 1M6HA 2X8BA 1ST3A 5I45A 3S3TA 1W88B 4HGYA 3K1JA 1SPBS 4TT3A 4ND8A 1FDTA 1GXSB 1L5MA 4E6PA 3PD7A 4NI5A 5AK0A 4YCDA 4AQYB 2J3LA 2HSGA 2QMUA 5D84A 3DNPA 3ZGZA 4AKIA 1U3VA 1M34E 2DF8A 2W2OA 2Y27A 3FSGA 4RHCA 4LQ4A 2EVWX 4YRGA 5BQFA 1PNTA 2NUTA 1FMTA 3VDXA 2ZT6A 3UUGA 4UMFA 3PHHA 4N5NA 1HV8A 2XZPA 3FUTA 3M3HA 4UHFA 4EYQA 5GJBA 2KHZA 4HLCA 2HWWA 2PJUA 3B6JA 4P7BA 1IPEA 1K0FA 1Q57A 4WNCA 3WKDA 2FSFA 1DRUA 1XELA 4XYGA 5ALIA 4EUKA 5I7VA 4TZ6A 1P33A 2GXUA 3OHSX 3KNZA 5B1HA 3V34A 3D7KA 4AY2A 5TQVA 3BM5A 1NC3A 2IHVA 2VPQA 3ER8A 3H04A 3PNSA 4RD0A 3T5AA 2O8CA 2G72A 2LVBA 4GFDA 3RRXA 1T9GS 1XKTA 4NULA 3QFSA 2P8JA 3A4IA 4DWVA 2NXJA 1WDKA 1NQXA 2PIDA 4IW3B 1GFIA 1TK9A 1CETA 3LF1A 1GA1A 3CRNA 5JDIA 1F3OA 3DEHA 1Q21A 1OXKB 3U6KA 4ES6A 3AHEA 3N6VA 2GO7A 3RSSA 5BR4A 1UBGA 1II9A 3GHHA 1TF7A 4HVAA 4LC0A 4MZXA 3E2PA 2IF2A 2P4EA 4L50A 4EO9A 3SWWA 4UOEA 1HOXA 4J3JA 1FE8A 3NX4A 1P1HA 2X3YA 5F76A 3SYKA 1UIMA 3OM8A 2NQTA 1NE2A 3DV2A 3BFVA 4WAUA 3SSNA 1A9TA 4TWZA 3VU3A 3L4SO 5AOBA 1XNHA 4ZQIA 2OHJA 3R3ZA 1V6SA 1VJTA 3NNNA 3H0CA 4TL8A 1Q0HA 3NUGA 2YH2A 3AM5A 3A04A 2FWMX 4LJLA 4CV3A 5BMVF 1DDOA 1ZI6A 2H2GA 4OJYA 3FRIA 4R41A 4OXQA 2ZTVA 2JL1A 2DUNA 3NPAA 3RIMA 2OGTA 2GKSA 5EP2A 5I6DA 4GKJB 5KSOA 2CNNA 4L0DA 4RXMA 3UXMA 4Q4CA 4DV6B 2X9GA 2ZSHA 1QCYA 3NOOA 2HUPA 4FIDA 3H16A 5FULA 4NJEB 2VJMA 4Q9NA 2R00A 1BRTA 3NXKA 1KMCA 3TB6A 3DVQX 4W5HA 2OQRA 5JJBA 3UGTA 1P0MA 4EI8A 3BERA 3C8ZA 4MA0A 3A9SA 4H08A 2ZBUA 5E9QA 4I50F 4DXDA 5FTWA 2RB4A 4JUDX 2FW7A 2OVFA 5JNRA 4XOUA 5CD9A 2ZXUA 4IV5A 2RKBA 5CFNA 2CSXA 3CVVA 4ENRA 1EA5A 2AA3A 4KDCA 5CM2Z 3OUTA 1M6NA 5HK9A 3EYAA 3I2GA 1QYWA 1U9YA 2XIQA 4M6WA 1WHSB 3L7LA 3QOXA 2ETVA 1DEOA 1XNRB 4O2AB 4WZZA 2WPDA 4C89A 1CLEA 4LPKA 1JHDA 5EXEA 2ZFUA 1W29A 2F8LA 2XNDA 4AZ3B 2FR1A 4DY4A 1UDBA 3WWDA 1YK1A 1GPUA 1KWKA 2BM9A 2XLCA 1DQPA 3ZVKA 4RHYA 1I7QB 1U11A 2V5AA 3GEHA 2WQZA 5FA6A 2H2AA 3ZWKA 3DZ8A 3PFBA 1SC4A 1ZI9A 3RRYA 2A5GA 1FXWA 2KSQA 4RVGA 4B0PA 1KK1A 1B0UA 1TQ2A 2JJYA 3QPAA 3DE1X 1WEKA 3TZBA 4B74A 2K7FA 1KRWA 3K5WA 1XTKA 4FINA 3A6PC 1Z4KA 1H6AA 2B20A 1DT3A 5M29A 4JOQA 1H69A 1U1DA 2BY4A 3MMNA 3GVPA 3C3XA 1BX1A 3HI6A 3PXBA 4B40A 3OUZA 3CLTD 3QPCA 4L4SA 2CVHA 1MOQA 3PYXA 1QKIA 3Q6MA 4MWCA 2WIDA 3MYRA 2ZJOA 3FR7A 1BC5A 1FVXA 3LW7A 3MUOA 4BWFB 1O8CA 4DNOA 1FVFA 2XVAA 3B3JA 2D74A 4F6LA 4Z49A 1G8JA 5FADA 5C7IO 1O3YA 2HJHA 2WB4A 3ISJA 2NZ8A 2AI1A 5LUAA 3EZ9A 1M0WA 1UP4A 4EW6A 1Y9JA 1LUAA 4LDAA 4K5QA 1X80B 4AYTA 3BZUA 2FMIA 2PBLA 2PZLA 3RYFA 3W2GA 5AW7A 3H4IA 4CBVA 1IWPB 2LCFA 4MUXA 5HILA 2C0PA 1KGSA 3IUBA 1GOTA 1FQWA 1VYTA 2F43B 3X2FA 1H2AS 4HH1A 3AM1A 2VF2A 3EUWA 1KAQA 1ENOA 3AHGA 1JJAA 1EXDA 1E61A 2G9QA 4KPGA 3Q3CA 4WLNA 5E38A 3LC2O 4Z8XA 2BFEA 4CEIA 4CCAA 5JALA 4GYKA 1Y34E 1Z56C 5G0UA 1IU9A 3THRA 2V4ZA 4BOYA 3D2CA 4JLSA 2VNAA 2BMJA 4FYHA 3SY8A 1AV7A 1HG0A 4YT5A 1JJBA 1K9SA 1QZXA 3TJZA 3PYLA 1QHXA 3W5AA 2VPXA 3OD5A 4OJTA 4U7TB 1PVVA 3E35A 5AHRA 5FOQA 5BQ5A 1Z8FA 4GXQA 1YCDA 3EFBA 2HK9A 4UATA 3LT5A 1YTUA 2IC5A 2XA9A 3H5IA 1D6JA 1QBGA 2B25A 1V9SA 5FJIA 4YVFA 3DEKA 1O2DA 2HDHA 2N1BA 3SZ3A 3TZQA 4Z0HO 2BZ0A 4B6OA 1H6CA 4B4OA 2Z98A 4P6VF 1AXGA 2IHTA 4A9AA 3DLTA 3HM2A 1KTIA 4ETMA 1U7DA 5HFNA 2XMGA 5DIZA 3S2YA 2GPBA 1T3TA 2JDID 3K2QA 2QTZA 3QYPA 5ECDA 2IU3A 3KQQA 3OZCA 3IA7A 4FUTA 1TM2A 3AH8A 1TM4E 1PWZA 2H2WA 3QELB 1WP4A 1H9BA 3G5AA 2R6CA 4NC9A 3V9AA 3FFTA 2P3SA 1ATIA 2P9FA 1RI5A 3V00A 1E63A 1R6VA 1DCFA 3HDHA 3ENNA 2Q4BA 3DMYA 3O26A 3R3HA 4O4LF 1W34A 2VP5A 1MMFB 4AUEA 4DBLC 1LC3A 1MKYA 1ZD8A 1UMBA 1YR7A 3P0FA 3FPCA 2HLHA 5JTUA 3IIKA 3SHFA 4HGZA 3O21A 1X87A 4DQDA 1E6WA 2PGOA 1C1YA 2FRDC 2C4VA 2DUUA 2W43A 4AUMA 3KQLA 4CL3A 3M7IA 1U8EA 3P9KA 4LQCA 1O4VA 3UBMA 1NSTA 2ZE5A 1J5EB 5D3QA 3BVPA 1R2QA 5KPJA 2HSDA 4EARA 4IRMA 3U1BA 5CEEA 2OBXA 3QLJA 4NZNA 2QD2A 3U7HB 5JCXA 3W8EA 3WADA 2XKJE 1F7VA 1GTG1 1N6IA 4R81A 3VVBA 3ENQA 2C9MA 2OV6A 3WGLA 1RPZA 1Z08A 5JD5A 3N8GA 4G5GA 3DAPA 4HMQA 1D4ZA 2ZIAA 3CZ5A 2B82A 3GGCA 1Q7CA 5DI9A 4FLMA 2QSUA 5CDYA 1QE0A 3OD1A 4BCDA 3KUKA 3OOYA 5BPFA 2HREA 1VKRA 4DIMA 1D9ZA 2B7LA 2FMXA 4F3CA 5DU2A 2Q5IA 2CYBA 3LBNA 3PCTA 4JK3A 3RTBA 4BQQA 5A9RA 1EHCA 3AB3A 1E3EA 2WD9A 2CLCX 5FWAA 3C39A 2Q99A 2O5CA 2WUGA 4RXUA 1YE3A 5KVQA 4WXMA 2DE0X 3GYBA 3KXPA 3B6IA 1YUNA 4JC8A 4G5QA 1FDSA 2WAXA 3ORRA 3LHKA 5CP8A 2BFDA 1ZMOA 2ARKA 4G1VA 3T7JA 1UT6A 5CA1F 1F1JA 4MRAA 1L4BA 2F3TA 2YFKA 1YB5A 4OP2A 4WIAA 1YH3A 5HSGA 1IM2A 5FAKA 1NPTO 1NDQA 3PUWA 1EP9A 1P9WA 3MEQA 5LOVA 2NUPB 1OGIA 2Z2JA 3GHYA 4OUDB 4ZCIA 2XD4A 1SUAA 2BGUA 1Z74A 4UNIA 3LK6A 5K3DA 1YBAA 2Q1UA 1L5ZA 3AJAA 4G1BA 2B34A 3GJQA 1C3VA 5EY5B 3VJKA 1G3UA 5FQOA 3ZJ5A 4JX9A 5CDSA 2FEAA 4J0GA 5EUMA 5A06A 3M89A 1PW7A 1WDMA 3TD2A 1ISGA 4CM6A 4RAQA 3RRZA 1JF8A 2OB1A 1K8XB 1SIOA 3R7AA 3RK0A 3ILSA 5LOVF 1M2VA 2BDTA 4URHA 5KJ1A 2VSQA 1R0BA 2HT1A 5I7HA 3PQFA 1NUSA 2O1SA 5EIXA 2GCPA 4KO3S 2FSIA 3S40A 3G7NA 2Q2NA 4DC1A 5IX8A 3L1JA 2DQZA 4ZOQI 3PR2B 3U40A 1QKKA 1I0LA 1NMXA 1SVKA 1UBKS 2XADA 4TWJA 4LJKA 3JWEA 2BHSA 3QFTA 2E1RA 2A59A 3G0OA 2PAAA 2DULA 1T5OA 5GVRA 3QJYA 2P35A 2HO5A 2ACWA 5DJ5A 3T9DA 2D8MA 4QRIA 1JQLB 3GP3A 3TGPA 1USVA 4MYDA 1P5ZB 3DS8A 1E79D 2PSFA 3WQBA 2FZ5A 4JIMA 4H0FA 5IJAA 4TL7A 4G84A 1R5JA 3DBVO 3UMCA 2ONJA 4M9UA 3GJZA 4BQOA 1E99A 5EUCA 5AI8A 4JMPA 2DUJA 4FKMA 1RWQA 2GXAA 2AE1A 2QX4A 1OFVA 2H08A 2P67A 4BFVA 4AULA 1ECJA 3WYAA 2FQQA 4DM4A 4JSRA 1DC6A 1WXGA 2V96A 5H59A 3G6KA 1OE0A 1UJ6A 4B3CA 2PMCA 1DRJA 1LGYA 1RABA 1XTPA 1PFUA 2OHIA 2R6ZA 3KWJA 3PJFA 4HFJA 5JATA 3MCVA 1WXXA 2BI7A 3EISA 4KFTA 4CEHB 3IBTA 2JCGA 5B3JC 1VC2A 3FD8A 1NUHA 3SQWA 4IGKA 1MW8X 3GJ7A 1XKLA 3IAM6 1FRZA 1HO3A 5LA6B 4BC1A 4UM5A 1I36A 5SY9A 1NBWB 1Z75A 2Z56A 4GPAA 4RPHA 3ESYA 2W22A 4TRJA 5FWNA 2I91A 4P9NA 1WLYA 3OTGA 1CZRA 1C7RA 4Z2YA 5EZYA 3J81A 2J0QA 1MVLA 3EW7A 4G24A 4M8KA 4LYAA 4TTPA 3PX2A 3HWRA 4N82A 4BDSA 1W46A 1VMKA 2XT9A 2YWBA 3PPIA 3FI0A 2R6JA 4L73A 2OP0A 4ARZB 4Z54A 3NBYC 4IVPA 2Y68A 1DIGA 1YOBA 3PJGA 4U4AA 5AD1A 4OQLA 1B14A 1N6HA 4EY5A 1T13A 3CX7A 1OWPA 4JLJA 1Q1NA 4HRXA 3WL7A 4ZT6A 1G8KA 1BSVA 5CT8A 2MINB 3OJOA 5SYMA 4DJAA 1KEEA 4O4HB 4NLLA 1D5WA 1RPTA 1YC2A 4MQMA 1GUZA 2RMKA 1IEQA 2CL6X 1D3AA 1OROA 1XDDA 4WA7A 5EVJA 3JD1A 2IEGA 3R5JA 3BFPA 4YHBA 5CEJA 1ZZEA 3CMMA 4O29A 1J0XO 4YREA 3ZWVA 1U4NA