1XMJA

Crystal structure of human deltaf508 human nbd1 domain with atp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
246
Chain Sequence
EVVMENVTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFDQFSAERRNSILTETLRRFSLEGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein, hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Impact of the delta-F508 Mutation in First Nucleotide-binding Domain of Human Cystic Fibrosis Transmembrane Conductance Regulator on Domain Folding and Structure
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 246
sequence length 284
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xmjA00
5HKKD 1AS0A 5HZKA 1Q3TA 3SBEA 1SXJA 1HE8B 3H2YA 1QHHA 4PC6A 1T8TA 5HCIA 2ZRPA 5FTNA 4LC1A 2PJZA 4LCBA 4M4SA 4WOPA 5TXGA 3ADBA 2ZJBA 1XCPA 2FN4A 2QAJA 3M1IA 4A6XA 3ZQ6A 4F93B 2QT0A 1KHTA 1KY2A 3LH5A 4Q00A 2ATXA 1UEJA 1W0KD 1Z6AA 4OQXA 4RFSB 2PZGA 1NIJA 1KI3A 4PZYA 2V7QA 2EW1A 3AB3A 2F9MA 3A4MA 1QZXA 5FBQB 5D3MA 1XD8A 1E0KA 4BEJA 1DTSA 4CEHB 1JR6A 4LUCA 3M0EA 4V0LA 2Q9CA 4GFDA 3BERA 2CMKA 4MRPA 4RZ2A 2I1VB 1Z0AA 4XD7D 3QXXA 4LYHA 2RGBA 3QVUA 4EPXA 4TQUS 1SVSA 3R9WA 2XNDD 1KDTA 3ZQJA 5FUXA 4Q1AA 4G5GA 1E1RA 1OHHD 1SXJE 3CRMA 3F0TA 1U81A 3AKEA 3P27A 2R6GA 2C95A 1TPZA 1E3MA 1HQCA 4CF7A 3L8ZA 1XEWX 5CK5A 4D82A 2CCKA 1N5IA 3CPEA 3AVQA 2VO1A 4WZ6A 3ZZ0A 1A5TA 2QM7A 2IYTA 4B3FX 4QBIA 4Q48A 2RGCA 4C0HA 4AG6A 1ESNA 1ZU5A 1KZGB 4JS0A 3AVUA 2ZUBA 2J0VA 4JYCA 2FPMA 2W6JA 3REGA 2WJVA 2WWGA 3LD9A 2J9RA 1XCGB 4Q4JB 3M6AA 4B71A 4US0R 2ZRAA 4B2PA 2V6IA 5CM8B 5GADl 3W6OA 4A8JB 2G1JA 2CHGA 4HUTA 5K8UA 3KZ1E 3L0PA 3SQWA 2BM0A 2QUZA 4O2RA 3QKSB 1YR8A 1W4CA 4KO8A 4M1KA 5CK4A 3NBZC 4OI0A 4IOJA 4G0NA 1E79D 3HR8A 2IXGA 4FINA 1XNJA 3SJAA 5LB4A 4A2QA 4TYWA 3EWSA 5CYOA 4PQRA 4JLMA 2GA8A 1YZQA 3A1TA 4K81B 3GEEA 2NO9A 2DWPA 3TGPA 3RRMA 4FW9A 4UKDA 4A4DA 5G3ZA 3T1QA 2E1RA 1N6OA 2IUTA 521PA 1OYYA 1K6MA 3PEYA 4YMUA 3CNLA 4OQNA 1JPNA 3EARA 2J41A 1XTSA 3CBQA 3LWNA 1Q21A 1LFDB 4IW3B 1IOZA 4UJ3A 3MUFA 3X2SA 2BJWA 1EX7A 1KI6B 2F7SA 4B73A 2C96A 3CZQA 1Z06A 5DO9A 3E1SA 2F1HA 1NLFA 4ZKDA 2GJKA 1L7VC 1YHNA 3B2EA 3N70A 4W7SA 1ODFA 4XH9B 3JVVA 3A37A 3K9GA 1Q1ZA 2R62A 4GDFA 4BRUA 2QTVB 3DOEA 1MV5A 4C0SA 3A4NA 3OIYA 3KFXA 4LX0A 2QROA 2ZRHA 1Q0UA 4M8NE 4P4UA 3V9PA 1Y63A 3WYGA 3D7MA 4U00A 5JRJA 2QP9X 3KQLA 1G3QA 2BJVA 5IDVA 4PO1A 4D0GA 2HDNB 4P4SA 4HI0E 1WBDA 4BRWA 3EZ6A 4AURA 1FPMA 4RY2A 1G1MA 2CK3D 3B82A 3TR0A 1IJEA 2H57A 5EP2A 1DVRA 1M1YE 4Q1CA 2WOOA 4MKFA 3ADKA 2AL7A 3EPLA 3B1ZA 2QPOA 3QF7A 1CR2A 1EGAA 2JJ8A 3BH6A 3GLHA 1DAHA 1Z2CA 3C5CA 1OE0A 3A1VA 3CM0A 3N5CA 4B75A 1Q3HA 1S3GA 5J4KA 4JLJA 1YE8A 1NN3A 2FPLA 4C0JA 1F2UB 2KBEA 2ZPTX 2GRJA 4XVUA 1P9NA 3EXAA 4ZIRA 1R8QA 4D25A 1UM8A 4C2TA 1ZAKA 3BH7A 1IY2A 4I4LA 2OV2A 1J99A 4I1UA 1B0UA 1GKYA 1ZC4A 3TJZA 1U90A 4DHEA 3LXRA 1ZNZA 4N0DA 1KDOA 1KI4A 2OAP1 4DZZA 4BE7B 2BMFA 4D4MA 1MOZA 2CNWA 4IVQA 5KUTA 4LGMA 2ZRJA 1SVLA 1WP9A 4JSYA 3L8YA 3GLFA 2BC9A 4QGFA 4II7A 3GLIA 2ZRKA 2CCGA 3SBDA 3IQXA 5JI2E 1RPZA 1W0KA 2J87A 4CIDA 1KSGA 2IYQA 1U8AA 3WP0A 4DCVA 3CPHA 1VDZA 3PUYA 5JJKA 3NKVA 5JBQA 2Z5FA 4Q4HB 4HB2A 1OH8A 4NMMA 3SS8A 1EFCA 2P3SA 2HLDD 3ZVLA 2F1RA 5DISB 4BFYA 4KLNA 1A2KC 1W4AA 1JNYA 2AX4A 3WMFA 4D0LB 3NXSA 4POAA 1CR0A 2VSFA 3NWJA 5AUNB 2IYVA 5G53C 5KDLA 1KK1A 1HUQA 1E32A 1G5TA 1OHHA 5LDDC 2ZU6A 1Z22A 2FFQA 4GMXA 5P21A 1E9BA 1A1VA 5AJZA 2IF0A 4IFBA 4L8GA 3BBPA 4OHZA 3GLFE 2RGDA 3GLIE 1LVGA 4TTQA 2HV8A 2IUUA 1E98A 3QUSA 4GSYA 1KMHA 1VG0B 3SHFA 5E4FA 1YZUA 1TNDA 3RNLA 5KDDA 4B3GA 2ZRIA 1OFIA 1PLKA 2BBTA 1UBCA 4PX9A 3UK6A 1QBKC 4URYR 121PA 2NO1A 2ZRCA 3CH5A 5DSZA 4DUGA 1Z07A 4DEYA 4NCIA 1VG8A 5DIFA 2JLUA 1DO2A 2GJ9A 3TQCA 721PA 4IEIA 5FPTA 3SYLA 2JAQA 3PFIA 1E9DA 5GJCA 1VTKA 2IL1A 2BVNA 3OIWA 1B23P 2QENA 4A92A 4OK6A 4LBWA 4WIAA 1SXJB 1BMFD 2MMGA 2VIIA 2EWVA 3G0HA 3AF4A 2ZE5A 1PZNA 2VPPA 1R0XA 5JCZA 2WAXA 2Q21A 2RHMA 1Z6YA 2FFBA 3QI2A 2IS4A 3G5UA 5CDFA 5C4MA 2QAGA 3CX7A 4HDQB 1TAGA 4NHOA 3FHTA 2RHDA 4RD1A 4ZDIA 4BLPA 4KFTA 1OW3B 4HDCA 4HZUA 3QNUA 1GSIA 3DKPA 4TLAA 3FPAA 5D3MB 3RAPR 2OCPA 1VCOA 3RHFA 2WJYA 2ZYVX 1W5SA 1R10A 3W3AA 5B2ZA 2QEQA 3BS4A 4WA7A 1U2RA 4JKIA 4O0MA 1NN1A 2N1BA 2YYZA 2WV9A 4DCNA 1WBBA 1W5TA 4PC1A 2HYIC 2FG5A 3FKSD 2V55B 1CULC 4C3ZA 2ZI7A 3RDPA 2QBYA 5CM9C 2NPIA 2RH5A 5KOYA 1M34E 1II8B 2R65A 4UNQA 3OE7A 3U7FB 3AF2A 3ND8A 3AVXA 1XDBA 1TF7A 2P65A 3RWMB 3VR4A 2VH5R 2XTMA 2VP5A 1IONA 1ONBA 3PITA 1WE2A 4TQAA 5CDFE 1RKBA 4RVCA 5BQ5A 3ZS8A 4R2HA 4JKYA 2WJIA 2CK3A 4IDNA 4TMTA 2BKUA 4I1OA 1S1MA 1DS6A 4RZ3A 5BN3A 3AUXA 3CRVA 4W5HA 5K8TA 2B92A 4OK5A 3KB1A 1RW4A 1S4QA 1DOAA 1N0WA 1ZCAA 3D31A 3K0EA 4LYFA 1KSJA 1YZLA 4LHXA 3W34A 3SOPA 4MQBA 4Q9HA 1TF2A 4PZLA 2BKEA 4MA4A 3BB3A 2KSQA 3NHAA 3RS7A 2BMJA 1DARA 2REXB 3NC0C 2H18A 3GJ6A 3CR8A 4KU4A 1OXTA 1NY5A 5F9HA 2DBYA 3B85A 1TQDA 1AQYA 2OXCA 4M1MA 5BXQC 5JEDA 4LJ6A 3BFKA 3GJ4A 3K70D 1YU9A 2O8BB 4V0MA 4EJSC 1FZQA 4RJLA 1CKEA 2QQEA 2ZVQX 2PLRA 1XTKA 3N2IA 5J4LA 221PA 3C5HA 1L4YA 1G8GA 1HH4A 1KJWA 3ZGXA 1XZQA 1ZVQA 3K0SA 4GPTA 4Q4AB 4MGZR 3A8TA 1M2OB 3SHWA 4GOKA 4EQ6A 4OHVA 3ASYA 4LI0A 3B13B 5LBIA 1NRJB 3BOSA 5FTKA 2Y8EA 1U94A 3CB4A 3GD7A 1FP6A 1UEIA 2QA5A 2H5EA 5UKDA 1D2EA 1W36D 2YKGA 2REBA 5TMPA 1Z08A 1LS1A 1Z29A 1Z0IA 1ZNYA 2ZSEA 1NVVR 3EW9A 4V0ME 1G18A 5AUPB 2HLDA 2QI9C 4B35A 5KSZA 3ZD7A 2DWOA 4KITB 3U44B 2XTNA 1II9A 1ETUA 1UBFA 3T06B 4P4SB 3DM9B 3CX6A 4NYIQ 4IDPA 2F3RA 4Q7MB 1MKYA 1XXHA 4NDZA 1LB1B 4N1AA 4OQLA 4TTPA 5AJVB 5AR1A 5HE8A 3C16C 2AKYA 2ZR9A 4FCTA 4RCYA 4Z8YA 1LF5A 1JPJA 1OKKA 1R0YA 2LKCA 4FD2A 1P4SA 3QENA 3DMNA 3EA5A 1UDWA 4TWZA 4ZDWA 2IA5A 3BGWA 4JVNA 4IJMA 4JLAA 4QM6A 2OLKA 4D4JA 3UKDA 2VF8A 3I8SA 4ZIRB 2DFKB 3GJ7A 2C9YA 3AKYA 1X8KA 4WW0A 1YKSA 2PX3A 1XTIA 1G7RA 1N6NA 4AKGA 4M9XA 1TQ6A 2VSXA 3AF1A 4KBGA 2YVUA 1XXHE 1PLJA 3B8HA 4R98A 3QEOA 4L5BA 5L3QB 3B1XA 4BEBA 3IBGA 3PG5A 4B76A 3EG5A 2D7DA 3W8RA 3TKLA 2FEMA 3NG1A 3TR5A 3T5GA 3FOZA 2JEOA 2ZRNA 3C15C 3THYA 3QKSA 1FQKA 4EPRA 2ZJAA 4TZ6A 3GLIB 3Q8XB 4JLOA 5JLJA 3QG1A 3SYNA 3PEWA 2Z43A 4F4CA 1IN7A 4G5OA 4KVGA 3HYTA 2ODBA 4LHVA 1TEVA 4L9SA 1QVAA 4HAVA 1UDXA 2X77A 1XEXA 2O0HA 4GNKA 4BFTA 1NIPA 4AD8A 4YDSA 3KKPA 4TYYA 4CVNA 3H86A 3U4QA 1D6JA 5IK2D 4YXWD 4U7DA 2NO0A 3RS0A 3S1AB 3KQKA 2I4IA 3VR1A 4AYWA 1XX6A 1GFIA 1N5KA 1T9HA 1NVVQ 1R6BX 4TL8A 1X8JA 4I99A 3QVVA 4ESVA 3MLEA 1TU3A 3NEYA 3Q72A 2J45A 1KY3A 3ZDQA 1VECA 1ZP6A 3MGCA 4DLYA 3KTAB 2JATA 4BFXA 1R7RA 2I1QA 1NVUQ 4V02A 4DB4A 4OL0A 3CH4B 4Q7JB 1KMHB 2GAAA 1YZNA 3LDAA 3VR2A 2QP4A 5KNCA 3J81k 4DVGA 3UG6A 3B1WA 5JRZA 4IDHA 3KXKA 1W4RA 5JHHB 5TY0A 5EXPA 4NCNA 2G3YA 4D4KA 4A36A 2KB0A 4TMXA 3SU8A 3SI7A 4Z54A 2ZSBA 3QEJA 3GJ8A 4TL7A 4D26A 2GCOA 1JAHA 1T3SA 4PQYA 3SFZA 4URUR 2W6ID 1OB5A 4A8JC 4M21A 2B8WA 2QQ0A 4MGKR 3T15A 5CJ2A 2FSHA 4M9ZA 3SE0A 2F1IA 3THOA 3BE4A 4JBWA 2VHTA 2XITA 4JL5A 1G4UR 4N0EA 2ZUDA 3OEED 1OF1A 1NLYA 4HAWA 2PT5A 1CJMA 4A1FA 4OQMA 2A3RA 2XSZA 2QAGB 3I72A 3RANA 4DDWA 3LQRA 1CRPA 3RS2A 3SNHA 4CT4B 2XZLA 1MR3F 3DL0A 4PPQA 1Z28A 3OEHD 5C18A 4FN5A 4QBHA 4QHTA 3D6TB 4QOSA 2ZI9A 2OEPA 2OILA 1ZM2A 1T3LA 2W2XA 1NI3A 4PSAA 1OYWA 4QFMA 3GEHA 4OI2A 1PUJA 2QTHA 4PTLA 1G6HA 4C0LA 1JI0A 2JJ1D 5JJLA 4QL3A 2E9SA 2LKDA 5JZVA 4FWIB 4X8MA 3NVAA 3K9NA 2Z6VA 3IILA 1O3YA 1XJ0A 2QT1A 1OV4A 3QF4A 1Z5ZA 1P61B 2G0NA 2FF7A 5FOWA 3ZJYA 5F98A 2IS6A 3K0CC 1ESMA 1FMLA 1QVRA 3IO5A 4MKIA 1CLUA 3JZAA 2H17A 4PHGA 4C0AC 4KBFA 1VG1A 4BLTA 1G7CA 1KNQA 5KPJA 4DXAA 2HUPA 2J7PD 3MJRA 4QJ3A 2IYRA 2GF0A 1ZC3A 5FBLB 4QNMA 4RD0A 3W3ZB 5E7IA 1XTRA 4CEJA 4B6FA 4YMTA 1WCV1 4U5XA 5CLLA 1KI1A 2YC2C 4W5JA 2ONJA 2GBLA 1P75A 3AKCA 3RC8A 4KSCA 4GL2A 3EZ2A 2ZXUA 2YWEA 4LK2A 2AXPA 4HAZA 4F4IA 2OXRA 2ZE7A 3PV0A 4CEIB 4ASUA 4JL6A 1OH5A 3AV0B 1JQJC 2C2HA 1D2NA 4OI1A 2IXEA 2HT1A 4TMKA 4I1SA 4B3CA 2P6RA 1G291 1F3OA 4W9MC 3A4LA 4EKDA 1NG1A 3I5YA 2WVJA 2A9KA 2ZR0A 2PX0A 3K8YA 2YZ2A 2CLCX 1IXRC 3WNBA 4DSTA 4F7WA 1VYUA 2ASEA 1M7BA 3MWKA 2V3CC 1W4BA 2V4ZA 5J5CA 4NH0A 2GHIA 2V9PA 1CIPA 1OFHA 3TIFA 2BEJA 1YZKA 3UANA 2JASA 2FGJA 4EQ6B 1E99A 2GDJA 2EFEB 2MSDB 2JLVA 5FUVA 2ANBA 4DIEA 3MJHA 1KIMA 2NZ8A 3FMPB 4H1VA 5JCPA 1CF4A 2H8KA 2ZRFA 4CW7A 4H9GA 1XJCA 4AG5A 2VF7A 2CVHA 1F2TA 1X8LA 2ZAOA 3NTUA 4LYAA 1E9AA 1KTVA 5JJIA 3BAFA 1PLLA 1SVWA 2FNAA 4P4TA 4US1R 4DCUA 2WKQA 1EG7A 4DIDA 4HUQA 3DOFA 2Z0MA 1JECA 5C46F 5B57C 1XXHB 1R0WA 3AVVA 2LCFA 4BWYA 1G7SA 1DO0A 1W0JD 2FX3A 1M7GA 2ONKA 2GEDA 4S2EA 1JXMA 3FB4A 1T0JB 3WNDA 1JB1A 2OCAA 3Q5DA 3U7HB 5TB5A 1W1WA 1D9ZA 1GDDA 1HA3A 2BIFA 2NPFA 3KB2A 4DDTA 3AKDA 4LJYA 3VKHA 3ZS9A 1II8A 4ARZB 5L3SB 2GXAA 1RRGA 3ZIAA 3QPVA 2UKDA 3WYAA 2G77B 4NZYA 2MSEB 1UKVY 3OAAD 1V43A 2QM8A 1PUIA 4ESHA 2A2ZA 2ZAMA 3P1JA 3UMSA 3CWQA 1F48A 3BXZA 3EIEA 2Z83A 2O5VA 3KUDA 1ZBDA 2D74A 4UNPA 2W6IA 1XPOA 4LJ7A 3VKWA 1E2EA 2J1LA 4BFUA 2OSBA 1CJTC 1JAIA 1JBKA 1Z6TA 1NBMA 1SVOA 2OM2A 2EQBA 2ZSFA 3T35A 1G7TA 3FE2A 4GT1A 4M9SA 4NONA 5CYPA 3THYB 3MWLA 1M74A 3H4MA 5ANRB 3CONA 3IEUA 1I4DD 4Q66C 1G3UA 5GJWC 2G83A 4Q1FA 4YC7A 5L3VA 2OFOA 2O8BA 2A5YB 1R5OA 3I73A 3L0IB 1UJ2A 3DDCA 4RD4A 1U9IA 4TMVA 2FE4A 1QHSA 1XEXB 2OBNA 3AGPA 5FL7A 4DLWA 5KO2A 3ICQB 4RFVA 3UMFA 1BYUA 5DGXA 1D8TA 2R6CA 4QKQA 2FA9A 1ZM4A 3U4QB 2FDCA 2GJSA 3EZFA 1E2FA 1H8ED 3L82B 1IBRA 3OIUA 4Q4AA 2JJ1A 2XB4A 2XEXA 4QGAA 3PIRA 1NBME 1BIFA 3KXIA 3GPLA 2F3TA 3AVYA 2O8DB 3Q7QA 4GP7A 4K8OA 1UF9A 1HV8A 2VHCA 3NH6A 4PSVA 1E6CA 4AI6A 1FQJA 3OFND 4XWOA 3IKJA 2JA1A 2VA8A 1CS4C 1N0VC 1VCMA 2NZJA 4BGDA 1Z47A 2J7PA 2ZI3A 5DI9A 4M1TA 1F60A 3U44A 1XZPA 4MYCA 3DPUA 4FCWA 3KJGA 2J0UA 4HDOB 4IDOA 1WDTA 3TQFA 5GVSA 2V1XA 1GITA 3MWYW 4JIMA 5B64A 1JR3D 1U98A 2WM9B 4DWJA 4P33A 1UAAA 4KFRA 4R2IA 2WAYA 2ZRDA 1ZIOA 2GCOB 2C04A 4NE2A 1J90A 4RSGA 1GL6A 5EE1A 3WMEA 3I62A 3LBNA 5FI0B 2JJ2A 2PZFA 4Q21A 3TLXA 2YWFA 5BWMA 1AM4D 1IM2A 3K70B 1U0LA 1FX0A 4PAMA 4RCZA 1E9SA 4B33A 2HF8A 1X3SA 2R6FA 4PHFA 1GILA 1Z3IX 1E1QD 3KKNA 1S3SA 3BC1A 2WTUA 4Q01A 2BWJA 2FMXA 2JLZA 3MWJA 1ELOA 3LBIA 2D3WA 1CU1A 1XTQA 1SKYB 2H16A 5EE9A 1YR9A 2JCSA 5FOTA 2W00A 3B9PA 2LWIA 5L3QA 2NMVA 5CJPA 5DI3A 1K5GA 5HKKA 2JLRA 3DHWC 3A1SA 3RS5A 4M0LA 3QXSA 1NMXA 2N42A 5CLQA 3AVWA 2A5DA 2O0KA 3Q3JB 4C2UA 1W36B 4PANA 1IAQA 1GRQA 1KI9A 2R6DA 3QF4B 3RC3A 3AQ4A 4G1UC 4V0NA 4D0NA 3ZD6A 2PCJA 3KQUA 1Z6XA 2CEAA 2D7CA 2ZQ5A 5AK0A 2GKSA 5KHOC 5H70A 2ZEJA 3CNNA 3BB1A 4LPSA 1E2LA 1FFHA 1GTVA 4DLTA 1HYQA 2WWXA 3BORA 2W0SA 3H0KA 2VLIA 2ZM5A 4UQOA 3OF5A 1W0JA 2DYKA 4ZCLA 1G3MA 5BYJA 4EAQA 2GXQA 5FBWB 3S1AA 1YRBA 4XD7A 1ZJ6A 4WXRA 4FMBB 4CEJB 2XNDA 5EE5B 1BH2A 4NTZA 4ZV4A 1NNEA 3GFTA 3TH5A 1EWRA 1G4AE 2F9LA 3RABA 4C4PA 3KTAA 4RD2A 421PA 2P5SA 2Q6TA 3K9HA 3F8TA 3H84A 3IHLA 4MH0R 3Q7PA 4XJXA 2CCJA 4JBXA 1VHLA 3IEVA 2HCJB 3NDPA 3RWOA 1ZYUA 5LPNA 2GILA 1NKTA 4PZZA 4LRWA 2QNRA 4JT2A 4DC9A 2XXAA 1I4TD 4ON9A 1Z0KA 2QTFA 1AGRA 3IGFA 1DAGA 2X2FA 1AZSC 4XTRA 1NSTA 1E2HA 3T1OA 1Q1BA 4JLNA 4URZR 2UZ3A 4DLSA 1P6XA 2VEDA 5FPYA 3K0AA 5JWOA 3TAUA 5DN6D 6Q21A 1N25A 1E79A 3BFXA 3BK7A 4V03A 4AK9A 2IYUA 4A15A 1EXMA 5K8LA 1GVNB 4IEEA 2OFWA 4FXPA 4J0QA 2ODEA 5BYKA 2WPDD 1FTNA 1F2TB 2CL0X 2BM1A 5HTKA 1AS3A 3U60B 4WZAE 4X8LA 1IN6A 2QU8A 3NBYC 4DBLC 2XOKD 3TSZA 1R8SA 1H8EA 1LTQA 1CP2A 4HUQB 3LXXA 4MYTA 3FWYA 5FTJA 1Z0DA 1N2CE 1E2JA 1VMAA 4DCSA 1M6NA 4LJ5A 3LAWA 1QRAA 2WMNB 4G5QA 4EPTA 1CRQA 2CLSA 2CHQA 3IBYA 1H65A 3MCAA 1KGDA 2KJQA 5AJWA 1L8QA 3P26A 4LWZA 4ZPXA 3V00A 5DHFA 3VAAA 2BDTA 3AF0A 3OFNA 4FCVA 3IIJA 4Y0AA 3VU9B 1GZSA 3FMFA 1ZIPA 4A0FA 5HR5A 3EPJA 4NYIR 2GTPA 3VMFA 1EESA 5JMTA 1SVKA 2AWOA 1HE1C 1LS6A 2IHBA 4IOKA 3PQCA 1Z2AA 1X1RA 2BBWA 4Z1MD 3QBVA 2WWWA 2BBOA 3T1VA 3R8CA 3E70C 2PMKA 3B5JA 5TARA 5AUOB 2GZAA 5EQTA 3Q9LA 1Q12A 1US8B 4MITA 5SZKB 5KDOA 2HXYA 3WY9A 5TVKA 1SGWA 1BS1A 2OBMA 2WICA 2IYSA 4Q47A 3E5HA 2RCNA 1E2KA 2QSZA 2GZHA 2QPTA 1J8YF 4GOJA 1AKEA 4I81A 2C9OA 3TSOA 1VPLA 1ZU4A 4LV5B 3T61A 1YZGA 3T5DA 1T3HA 2WWYA 2PT7A 1KO1A 1E9EA 2PJRA 2REOA 4NCJA 1UKYA 4B47A 4YMVA 3EC1A 1PV4A 2X1VA 2YNMA 3PVSA 1E1QA 4CEIA 4L16A 4UXJA 3QG5A 4ACAA 5E7JA 3GJ5A 1BO6A 3ZZUA 4BZQA 4ZCIA 1N5LA 3EC2A 1XPUA 4Q7LA 4NYJQ 2ZREA 4B34A 4DRZA 2OESA 2IYYA 1XU4A 1JR3E 3IIMA 1OIXA 3VX4A 1DAFA 2CJWA 3GLGB 4TSFD 2ERXA 2IT1A 3WRXC 5JECA 5FBVB 3CF2A 4BFVA 1VG9B 1JEDA 2C8VA 1GNRA 1GNPA 2FFHA 1X1SA 4PHTA 5HZHA 5FPSA 5LD2C 3CUEF 3WMGA 1KK2A 1XJQA 2ZSAA 3AP3A 3VTKA 4KFUA 1P62B 1XD9A 2RGEA 1MH1A 5F3WB 2Z4SA 5FI1B 4TN1A 2GK6A 1KI2A 4Q1DA 2XJ4A 2WKPA 1TADA 1XTJA 2GXSA 3KDSE 1SHKA 1MRSA 2C9CA 2WJHA 3K09C 5IHPA 1XMVA 2QY9A 1AK2A 2OG2A 1R4AA 1D2MA 1UBGA 2J0UB 3THXA 4ZDJA 1NJFA 1E0AA 1F5NA 2CVFA 3RRZA 4JVSB 4BFWA 4LV6A 3HPRA 3O8BA 1XF9A 2GJAA 3C8UA 1SZPA 1TU4A 2KWIA 1IHUA 1Q1QA 2ORWA 2O8CB 1NY6A 2UVQA 1S8FA 1F6BA 3BWDD 1QHYA 1LF0A 3GJ3A 3PUVA 3TMKA 1D5CA 4TT3D 3RLFA 3GMTA 4M1YA 1M7HA 4ARZA 5L3SA 1FX0B 2CE2X 1XMIA 5GJVC 5FR2A 4YMSA 1E96A 3NBXX 1SKQA 1W7AA 4N3NA 4KXFB 1TMKA 2KE5A 5IRCD 3VNUA 3H1TA 4Q03A 1L4UA 1COWD 1NLZA 4TYPA 5EUMA 5KU1A 2XX3A 3LX5A 2IWHA 4LY6A 4HB0A 3TAHA 3X1WA 2JLWA 2ZS8A 5KSYA 2AXNA 3FVQA 2V54A 1QG4A 1N6IA 1NVXQ 2EFDB 3U5ZB 2PL3A 2AWNA 4CZ2A 1CJVC 1U0JA 4QM7A 2OE2A 1ZW6A 5FR1A 4B2IA 4B74A 5DI3B 3NIBA 5BN4A 1HT2E 4PAQA 1BMFA 2EFHB 1KKLA 1GRRA 2GXUA 1ZMXA 4UNRA 3ICEA 1EWQA 3UIEA 2WWHA 5FL3A 1YVDA 2AK3A 5C4GB 3CRW1 2WPDA 2FOLA 2PH1A 2WSMA 1MO4A 3VR6A 2IXFA 4HLUC 4PAOA 4BFSA 4NYMR 2YOGA 2XTZA 1XCMA 2HCBA 3REFA 2IW3A 3BRWD 1VYVA 4KFSA 5J4YA 4RD3A 2QGZA 2ZIAA 3TE6A 1G21E 3R9XA 4JLVA 4QGGA 4G5SA 2VYFA 5BW8A 2QL6A 1KK3A 1SHZA 1IN5A 1VHTA 4IOMA 2ZS9A 1E4VA 1KAGA 2RGNA 4AYXA 1OIWA 2IK8A 3O8DA 4JMPA 4FMDF 1ZNWA 3GP8A 1FUUA 2JLSA 3IQWA 3FKSA 3AUYA 2H1LA 5KYKA 3RS4A 3L2OB 1BYIA 3LO5A 4G5RA 4DEXA 4RZXA 4P0TA 3TUJC 3R8FA 2O8DA 2ZRGA 4UNNA 5J47A 4YDHB 1I2DA 1T8UA 3K1JA 4QBGB 4Q9KA 4UXIA 4DB2A 2OCYC 2Q3FA 2V7QD 1DAKA 5D3QA 4NL4H 3O8CA 4XWAA 4OK3A 2XXAB 2WKRA 3HJNA 2BHRA 4TYQA 4DKXA 2VTKA 3CR7A 1RC8A 3B60A 3TW8B 3DVLA 2ORIA 3GJXC 3KFVA 5FOSA 1E9FA 1RRFA 2VRWA 2WZQA 3DO6A 5L8VA 1CR1A 2PCLA 4HZIA 5H68A 1E1RD 1TX4B 3P4YA 3X1ZA 4ACBA 2IBMA 1TEXA 3K0AB 2QZ4A 3K0CA 4MRNA 1L2TA 4MRRA 3KKQA 4EDHA 5JI3E 2DR3A 4JL8A 4E07A 1J2JA 3ZZTA 2BV3A 4MUBA 1N6RA 2ZYUX 1EFTA 5FH9A 2VBCA 1LNZA 3A58B 5LB2A 1GL9B 3THWB 2MSCB 3AEZA 4KVAA 1GRNA 1GNQA 1RRCA 4B43A 4R9UC 4LDJA 4URWR 2QP3A 1G3IA 1AA9A 2DCUA 3T34A 2WSSD 1TUEA 2OCBA 4E09A 3SYKA 4AIIA 3EZ7A 1RIFA 4NBSA 4TSFA 5EE0A 1NKSA 4C30A 3RRYA 2QMUA 3CZPA 4A0GA 4CYMA 5FTLA 5DH9A 5CITA 4NYMQ 1GIAA 2ECKA 4WVFA 1EK0A 4Q1BA 3LV8A 4CDGA 4A0RA 3PEUA 1AIPA 2YWGA 1CJKC 1UFQA 4Q02A 4MRSA 3TNFA 3EPKA 2G6BA 1AZTA 1II0A 1ZM7A 1UPTA 2ZETA 3FTQA 4AKEA 3R7WA 1G6OA 4EJSB 4M1WA 2J0SA 1Q1EA 1MO6A 1P2SA 3WP1B 1CXZA 1C1YA 3HR7A 4BUJA 4QBFA 5H8WA 2H7VA 3RS3A 4EIWA 1IN8A 2BMDA 3QPUA 2A7QA 3SQXA 1D9XA 4RKFA 1N3BA 1R5BA 1SKYE 3QOFA 2PLFA 3ADCA 4XWKA 2D2EA 3IHWA 3NH9A 1GKUB 3K53A 1RZ3A 5F2EA 4QJ4A 3CW2A 4OJQA 2ATVA 1P3JA 2K5UA 1GAJA 3KJIA 2ZI4A 1UADA 3R9IA 1YR6A 1RRPA 2ZR7A 2WHXA 3W9YA 2P6UA 2J5XA 5CIQA 4FMDB 4DSUA 2BMEA 3KL4A 1EFRD 3KKOA 4LZZA 1PVOA 2OZEA 2V8OA 2YOFA 1OXUA 3LFUA 1I2MA 4OHYA 2I3BA 1XMSA 3P32A 4KLZA 2PEZA 2J7KA 3PUWA 1OLOA 1X86B 1DAIA 1R0ZA 3LLUA 4O3MA 4ZCMA 4MGIR 4TYNA 3U61B 5SZJA 1OT3A 3BD9A 2MMCA 1R5NA 2FJUA 3SJZA 1GG2A 2ZTSA 3TVDA 3KJEA 2CJWB 2FPKA 3C7KA 1NP6A 1IXZA 3D3QA 3IDQA 4HEJA 2C77A 4ZDKA 4PC7A 1E2GA 1JEEA 4LJ9A 4OI4A 1G8YA 2UZIR 4AKIA 3BFVA 1ZUNB 2HYDA 4QJ5A 2VHJA 3LY5A 4PC3A 5FOVA 1N6KA 4M53A 4Z51A 3C4JA 3UWOA 5DHAA 2VQSA 2ERYA 3NHBA 2R6AA 3L43A 2N46A 1RYHA 2IS1A 1XEWY 2OLJA 1SVIA 1KO4A 1P60A 1S9DA 2KBFA 3VHXA 5B58C 4NKRA 2FWRA 4LC0A 4PFSA 5EP1A 1MRNA 1N6LA 5IK2A 2GK7A 4IXMA 1XWIA 4LJ8A 4YXWA 1P73A 4B3BA 3JVUA 3THXB 3A1WA 3WRYC 3IPXA 2CNWD 4KV9A 1Z0FA 4WBSA 3LRPA 1U8YA 3U6BA 1HT1E 3P20A 4H1UA 3SZRA 5DNYB 5JHGB 1FNMA 1G5RA 1Q44A 4TQ9A 3W90A 2WWIA 2IC5A 5AJYA 3A1UA 1TQ4A 1T6NA 2GBLC 2CDNA 1EX6A 4JYBA 1HQYE 3VU9A 4WAUA 1GL7A 5KSOA 2Q3HA 1X6VA 2IS2A 3MMPA 4JJKA 3EX7C 4BLSA 2Q9BA 3QXHA 4JZKA 1AN0A 1UBEA 2QN6A 2W2TA 2ZI5A 3ETLA 4DJTA 2DPXA 4GP6A 3HWSA 3QBTA 2AFIE 1CBUA 3EPHA 2QE7D 1US8A 2B8TA 2E87A 4U02A 1S9HA 4R71A 3PUZA 5FTMA 3U7EB 1E9RA 1XD2B 4JLKA 3UG7A 2G9NA 1P9RA 2QGNA 3U3OA 1U8ZA 2QRNA 3GFPA 1Z6GA 1NL3A 4JVLA 3ONWA 1SULA 2A5JA 2G1KA 2X8AA 4HLQB 4XSGA 2V6JA 3AP1A 2XAUA 1SXJC 1RYFA 4PQFA 1QF9A 3VQTA 1E2MA 2VP9A 2FSGA 3OEEA 1T5IA 3SC3A 4FWTA 4OKSA 1XP8A 3O8RA 4I1VA 1T4GA 2QMOA 3LLMA 4HYYA 1AKYA 2WSSA 4TMWA 1LY1A 5EZ6B 5HCNA 1S1CA 4ABYA 3ZVRA 4DUGD 4GOXA 1DAMA 1FL9A 2ZI6A 3OEHA 4Q7KA 5DYGA 4A82A 1E2PA 4DT1A 4EPYA 2IX3A 4AC9A 3LBHA 4L4UA 2QMEA 4AY2A 3SR0A 1G8FA 4PXAA 2XZOA 1N0UA 2ZJ8A 1G3RA 3B1YA 3TK1A 3GLGA 2XZPA 1VIAA 1FNNA 1HY3A 2IHYA 2B7BA 2AR7A 1WXQA 1SVMA 2WWFA 2ZUCA 3K0FB 2FH5B 4IKEA 3MSXA 5HE9A 2HT6A 1LV7A 4D81A 3BB4A 3HYRA 1G41A 3DKVA 3U7GA 1OFUX 3M4YA 4WZBE 4A6PA 4KAXA 2CLDX 4R7ZA 1E4YA 3G82C 5JSZB 1JALA 2ZYTX 3HU2A 3B1VA 3GJ0A 4GRAA 4W5WA 1OXVA 2B6HA 1Z63A 3B6EA 5DLQC 5G40A 3OZXA 4BQSA 5FUWA 1V5WA 5J4HA 1YJ5A 1YQTA 3FFAA 3EASA 4PC2A 4A2PA 2GAOA 2PMDA 4EFLA 2F43A 3TVTA 3ZH9B 4PPFA 3KX2A 3GLGE 1P2TA 1CR4A 1ZCBA 3PCRB 3HU3A 4GZLA 2NIPA 1OIVA 2C99A 2O8CA 5GJBA 2O8EA 4BASA 2P67A 3A36A 4QC2A 4URVR 3EIQA 3W6NA 2VHQA 3OE7D 1EFRA 3B78A 1Q22A 4DDUA 2GNOA 3Q5EA 2NTYC 3RVBA 3LX8A 3F3YA 4GBMA 4UXHA 2FFAA 3FMOB 3ADDA 2YC4C 3CF0A 4Q5IA 1U9IC 1GOTA 3KKMA 5CB6A 1CEEA 2DHRA 2F1JA 2ZJZA 1G8HA 2ODWA 2WOJA 4E5UA 5KPDA 2KI5A 3CNOA 2OUKA 3CF6R 4DLUA 1W47A 5TV2A 4DSOA 3SDZA 4EPWA 4D4LA 3FFBA 3V4FA 2ODNA 2XNSA 4B6EA 2EYUA 4LJAA 2IEZA 2ZYWX 2NGRA 2WJJA 2OAQ1 4Z8XA 4HATA 3R7WB 2EFGA 2GCNA 1W2GA 4G01B 5ELXA 4Q9JA 4XOIA 3AGQA 2FU5C 4TLEA 1NSFA 3D8BA 4L9WA 4OHWA 1OB2A 1WRBA 4PHHA 1W48A 4UJ5A 3ZVNA 3ZLJA 3I3SR 2VL7A 2ZSDA 4FMCF 5FPKA 4PPGA 2NOAA 3QXJA 3BIFA 4HSEA 1HEIA 4P31A 3RYTC 4XIGS 3I92A 5KNDA 3GLHE 1TF5A 2D06A 4P32A 4F38A 2DFLA 2ZITA 1GP2A 3MFYA 1KYIA 2FSIA 4BZXA 4IOLA 2HXSA 5CIWA 4M2LA 4LPKA 3QKRA 1PJRA 4PPNA 5EXTA 2G88A 4OHXA 3LW7A 1JJ7A 5EJEA 3QSYA 3HPQA 1QHNA 2FGKA 1OPXA 4QNRA 1QHGA 1R2QA 4KCGA 2ZE6A 2HJGA 1TTTA 3NDBB 3A6PC 4TTRA 3OAAA 4GI7A 4C0QC 4TZ0A 2Z4RA 3OHMA 4LJ4A 1RJ9A 2Q9AA 2QE7A 2QORA 3F5FA 5DYIA 2ZROA 2BOVA 2ZS7A 1T5LA 4IXNA 4F92B 1ZUIA 4FI3C 2WMOB 3AF3A 2WJGA 3IUYA 3B9QA 1ZINA 4XTCS 4C7OB 4AWXA 3U2QA 2XGJA 2GEUA 4MKGA 1E9CA 2L0XA 4ILEA 1RFLA 2BEKA 4ZO4A 3RSOA 2O8FB 2QG6A 5AWFC 3I4LA 2AFHE 2DFTA 2G0TA 4V0OA 3SEAA 4BFZA 1HTWA 1DADA 1OKKD 2CHVA 2PEYA 4Q9LA 4C0BA 5J40A 1GWNA 1RVDA 3SN6A 4NYJR 2EU8A 1OSNA 1E0SA 2J46A 3FGNA 3T12A 3FDIA 3OESA 3QY0A 4D2IA 2GEVA 2C78A 4CRWB 3CX8A 2DFNA 3NC1C 4LBYA 2VP0A 3VKGA 3THWA 1UKZA 3IO3A 3NBFA 3R20A 3SJBA 4YLGA 3EA0A 1W2HA 3WNCA 2JGNA 5B30A 1DEKA 1DG3A 3W5JA 3UMRA 1FW6A 1U99A 1G20E 1N6PA 1CJUC 2PBRA 3MG9A 1KZ7B 1ZD9A 3K9LA 4QHSA 2NO7A 2BBSA 2GVDC 4TL6A 1GUAA 4NCKA 4C9BA 3PUXA 1IJFA 1DG1G 3TBKA 1QHHB 3B7GA 3AH8A 2D62A 3RRNA 1AGPA 1G8PA 5DE3A 4TMZA 4ZI2A 621PA 3TW4A 2NG1A 4X8OA 1BKDR 1W44A 3ZYCA 3EWAA 4DLZA 4X8HA 2DB3A 3AP2A 1CTQA 3BJIC 2JLYA 3E2IA 4KYIB 2YHSA 4D6PA 4EJSA 4LHYA 3FMIA 1H8HD 4OQFA 5JFGA 3AVTA 1TUIA 2ZJYA 2HJVA 4MYUA 3QE0A 1P72A 1S2MA 2GJ8A 4M1SA 4V0KA 3MAAC 2FZ4A 4TLDA 4IVRA 4B44A 5HPYB 2FV8A 3PJRA 1JR3A 2IYWA 3X1XA 1Z8FA 2R2AA 4EFNA 4BPBA 3TUZC 4P3YA 4US2R 4QGHA 1KOFA 2GESA 4MGYR 4O2LA 3NEJA 3N2EA 3W6PA 2A5GA 2RB4A 4FMCB 2JLXA 4B3DA 3L0SA 2F6RA 5FOUA 1IQPA 1P2VA 3ASZA 4LYJA 5E95A 1MO3A 3CRQA 4TLBA 4YONB 2RGXA 2CL7X 2A78A 1MABA 3BH0A 1P2UA 3EIHA 3K09A 5H1YA 4IDQA 4ITRC 2C03A 1KO8A 2C98A 5L3RA 1ZM9A 5KSPA 1Q20A 4HAUA 3AVPA 1IN4A 1XRJA 3I5XA 3GQBA 2YJTD 4IVPA 3VR3A 4O25A 4M22A 1N5JA 1NMZA 1J8MF 2J0QA 2A5FA 4Y0VA 2QAGC 4QXAA 4DT1B 1DE0A 3EZ9A 4LSGA 1P9WA 4ZI3A 8OHMA 4OBEA 2AKAB 1YZTA 2XJ9A 3TUIC 1XPRA 2W58A 3ECCA 1AQUA 1I4LD 4KI0A 5FPHA 2BCGY 5C1BA 5EP3A 3KQNA 5TDHA 2FSFA 4JVMA 1EFHA 4HB3A 2Q3MA 5GVRA 3C14C 2ZRMA 4A2WA 2X19A 4GZMA 2VP6A 1KMQA 4XVQA 1DPFA 1VCNA 1QHXA 2Q0HA 4TLCA 1OXXK 4MUAA 3X1YA 3QXCA 2XSZD 3HP1A 1A82A 2VP2A 3DMDA 3QJYA 2GWHA 2WBLC 1S0UA 1QHIA 2P2LA 1G16A 2OFXA 1IY0A 5KNBA 2B21A 1RE0A 4QHYA 1T91A 3QKTA 2YOHA 4K46A 4A9AA 5JS7A 1OH7A 4CGZA 2IEYA 3DZ8A 3FHOA 4L15A 1K8RA 2AHOA 2F43B 4WXPA 3QPWA 1Z83A 4AKHA 1KSHA 1G5PA 3EAQA 3FHCB 3UWKA 4DSNA 3C41J 4HLUA 1NF3A 1FP7A 2O8EB 2GCPA 2OO7A 3QQ5A 1A7JA 2JIZD 2H92A 1LW7A 4RFSA 4UNSA 1P5ZB 2DY1A 3VHLB 2W0MA 3VNVA 1G19A 2O52A 1W49A 5A0FA 2O0JA 5AUQA 1WB9A 1MT0A 1OJLA 4JBYA 3UXMA 4CEHA 1VKJA 1UKEA 5JWRA 3AM1A 1M8PA 1ZUHA 5JWHA 2WIBA 1KDRA 2IYLD 1KJYA 1XD2A 3L0OA 3GLHB 2ZJ2A 3SJCA 3DZDA 4A0HA 4EUNA 1ZD8A 4DLXA 1J7KA 4GMDA 1OFTA 2XB2A 1A4RA 5DN6A 3QIAA 4LBZA 1DAEA 1NN0A 4LV8B 4MKHA 2SHKA 4PO8A 1XBTA 4E22A 1NJGA 4ASUD 4EFMA 1NN5A 3GFOA 4LBVA 3WBKA 1E94E 1VIYA 3U6KA 1DELA 2JDID 3OIVA 4MRVA 5EP4A 1KK0A 3U3KA 3IIKA 2W2VA 1AJEA 2XOKA 1S96A 1KI7A 2ZRLA 4Q4JA 1NVWQ 1BOFA 2P5TB 3CO5A 4E03A 4A8JA 4B32A 2CE7A 2CL6X 3PENA 1T0HB 4JT4A 3GLFB 1E2DA 4NPHA 3T1TA 3K0FA 1HURA 4HLCA 821PA 1SXJD 3JZMA 3LQQA 3VR5A 4KJZA 1O87A 4KODA 4QG7A 4F4JA 4DDVA 3GCGA 2GF9A 3WBJA 2BCJQ 4D80A 3QKRB 1H8HA 3TSWA 2C5LA 2ZU0C 4YQFA 5JSZA 3U3JA 5IF9A 1DBSA 1FMJA 1SQ5A 2JLQA 5EZ5A 2TMKA 2R44A 4TL9A 3X1DA 4Z1MA 2RKOA 1TQ2A 3HU1A 1K5DA 2QSYA 4HLDA 1RJ9B 2RMKA 1ZNXA 2ANCA 1KI6A 4S35A 5K8IA 1E2QA 4DLRA 2CBZA 1KDPA 2VSOA 2EWWA 5EE3A 5M04A 2J3EA 1E2NA 2WIAA 4BZPA 1WA5A 3MD0A 1J70A 2EFCB 3AVOA 3LVRE 1E2IA 1KO7A 1GKIA 2V1UA 4LOAA 5BN5A 4F91B 2R8RA 2OHFA 1FUKA 3ZVMA 3WYFA 2ORVA 4PO9A 3ZIAD 1GM5A 1JXOA 4Q9IA 5SZHB 1FOEB 3Q85A 2DWQA 4KYUA 2HEIA 4EPVA 1KSFX 2GVZC 4DCTA 5KTYA 2OBLA 3GEIA 4NCHA 1VYTA 1Y3AA 5FOXA 2R9VA 1AS2A 3I32A 3WHLA 4XVRA 1XMJA 5EUQB 2W6JD 2AN9A 1MO5A 3HDTA 3FYHA 1A2BA 1WMSA 1ZD1A 5EXXA 3VFDA 2RGAA 4M1OA 2YWHA 1C9KA 1KJZA 2PZEA 1NBMD 3CWZA 1NG9A 3I1FA 1NMYA 3CKLA 2RGNC 1XFAA 4IFEA 4KHZA 3CLVA 3RSLA 4ERNA 1F2UA 4B48A 1ZRHA 1G17A 2AD5A 4B2LA 5A4JA 2FZLA 3LA6A 2AD1A 2W83A 4G3XA 4AYTA 4KSBA 1KNXA 2P0EA 3CIOA 4NP6A 4RD6A 2NO6A 3U3MA 2HF9A 2IF2A 1Z0JA 4BLRA 1G64A 1G9XA 1KKMA 4HZUB 4QRHA 3IPYA 1W46A 2VHUA 4NU0A 5FL7D 5JS8A 3DEFA 1P7CA 4B3XA 4MDFA 4ZKEA 1FTSA 4JJZA 4OJKA 3TRFA 2FEOA 4JLDA 4RZUA 2ZANA 5EXSA 4M9QA 2IUSA 1VCIA 3SFVA 1IY1A 2ZVPX 3WXMA 1XEFA 2F55A 5G3YA 5E3HA 5LD2B 1U0HC 2J59A 2D4HA 4LHZA 4BECA 3PR1A 3V4RA 4Q4LA 3LNCA 4JLPA 3ND9A 3PEVA 5SZIA 2QBYB 2JIZA 4FIDA 1KO5A 4TT3A 2IYXA 2EYQA 4Q18A 1WQ1R 5JEEA 3W8NA 2ZJOA 1MABB 1ZM3A 2RAPA 4HAYA 4Q4HA 3K70C 2GZDA 2NQ2C 4Q1EA 1XB2A 4URXR 3UPUA 3MRSA 2OT3B 3PXGA 3U3RA 4IRUB 1YRAA 1COWA 5FBRB 5FUYA 4LHWA 1WF3A 2YV5A 1N6HA 4JSTA 2CXXA 3KXLA 3I8XA 1C4OA 3O47A 1ANKA 2QPAA 4Q19A 5AJXA 4C7OA 5G41A 3VX3A 4PSKA 4XSHA 3WHKA 2D2FA 4CT5A 4JLBA 2QRZA 1Q57A 2P6NA 3CRRA 5A5GA 5C2JB 5CB8A 1OH6A 1KI8A 4YMWA 2O8FA 3DM5A 1TL7C 2JJ2D 5E7MA 3P4XA 2AK2A 2ZRBA 4C0KA 4DLVA 4BLOA 3KUCA 4IHQA 5F9FA 2VP4A 4BLQA 3W5IA 4MDEA 4HAXA 2RGGA 1OXSC 1JQLB 1E0JA 1IXSB 3FKQA 4RKEA 1QG2A 3LW8A 1W36C 2JDIA 2A30A 1E69A 2IYZA 5IT5A 3I61A 3KJHA 2B7CA 5FFMA 1JJVA 2QMHA 2YINC 1KAOA 5J4VA 4PR0A 2EVWX 2GETA 2X2EA 2ZJ5A 1QDEA 2ZE8A 1YR7A 4HB4A 1EFUA 3KQHA 3LVQE 2IWRA 3UATA 4MYHA 3CPJB 3QKUA 4OYHA
chains in the Genus database with same CATH superfamily
3AEXA 3AC0A 3K6JA 3TVYA 1AS0A 3ISJA 2BM8A 3EVFA 3QLEA 1HE8B 3O82A 5KX5A 4RMNA 5HCIA 1V6SA 1VMKA 2OG1A 2WJAA 1V5GA 1Z4QA 1CWUA 5EN4A 5JZBA 2PJZA 3VOTA 5A7FA 1YRHA 1GFZA 3TCXB 1XCPA 2FN4A 1FA9A 3M1IA 1CY4A 2PSEA 2F59A 3BHIA 3MGGA 1RPAA 1Z38A 2JHCA 4ZO9A 5FQOA 1KHTA 3ZQ6A 4AUEA 5LMNB 2ATXA 4FSXA 1W0KD 4CKCA 3NT5A 4PZYA 2J5RA 4XYEA 4E21A 1U5BB 5LZ4A 2XKAA 5BSEA 1ZESA 3O9VA 3AB3A 3ND5A 1JTFA 2HPAA 1OFGA 5AI0A 1ECBA 4D9BA 4H17A 3OC0A 5D3MA 3HGMA 3GEDA 1JAXA 3KTFA 5ALSA 3UJBA 3VDRA 3TFQA 3TXXA 2TMDA 5IJWA 2Q9CA 3OA2A 3CGGA 4HLNA 3WIOA 2VSNA 1EQUA 5IJ9B 3Q10A 1I01A 2I1VB 2NQ8A 2PUHA 2Y6UA 3IP8A 2W9XA 3IQIX 4XD7D 1M6HA 2R96A 3QVUA 2WJWA 4TQUS 3PQ2A 5AKLA 1Q17A 5TQJA 3L9WA 3PFBA 2NTEA 4EITA 1SUEA 2VDPB 1KDTA 5IG2A 1WCYA 3X1MA 1M2VA 2BTQA 5E1DA 1K0UA 3AKEA 4OB8A 5EXDA 2QL5A 1P81A 5BNFA 1IAVA 2C95A 1HQCA 3FM9A 1XUOA 3EXG1 5CK5A 5EIAA 4NENB 4D56A 5T57A 3CPEA 3OJFA 4L7QA 5JSUA 4WZ6A 4Q82A 5K0NA 3VKFA 1A5TA 2QM7A 1VFPA 3BDIA 3ZZ0A 2IYTA 3AG6A 4B3FX 3LY7A 4Z99A 4BO7A 1KEPA 2Q3BA 1SRQA 3HR4A 5BORA 4G23A 3AVUA 5E4YA 2H1FA 3MJCA 4IJVA 2WYWA 3W9SA 3EZLA 1QV9A 2O5RA 1GY8A 3WMXA 2WWGA 2EDAA 1JH9A 4HTFB 4US0R 4RGQA 5B53A 1XNGA 5CM8B 5GADl 4WKCA 1U02A 1YVRA 4JJ6A 1GHTA 2XIQA 2G1JA 5JYBA 4ARAA 3R0JA 1FFXB 1JDBB 3ESDA 3KZ1E 4B8ZA 4HUTA 3ZV4A 5K8UA 4EHIA 2P9TA 3OTQA 1W4CA 3V6LA 5LA6A 3NBZC 4OI0A 4IOJA 4YACA 1E79D 2HFJA 2VUHB 1XNJA 1NZDA 2VBGA 3SJAA 4CE6A 4IV8A 2BSAA 5MN4A 2BFFB 5CYOA 4DA0A 4JLMA 5DXFA 4E51A 2FYTA 1QH8A 2GA8A 5ISMA 5BW4A 3O93A 1D8AA 2DWPA 2CDRA 4HDKB 4KH1A 4HWRA 4B84A 4GPZA 3NNNA 3EVDA 5ALFA 1QTRA 4YJHB 1KWGA 3UJ3X 4ZYWA 3GAFA 2Q5EA 1LXCA 1K6MA 1ZD5A 2AVDA 4FQ5A 5J59A 3U31A 1EWYA 2P7IA 3LC2O 1DKPA 4WN9A 2J41A 2W98A 4ER5A 3CBQA 1Q21A 3I12A 1DTEA 1P4AA 4BRZA 5A04A 3ESXA 9ATCA 1Q95A 3S2EA 2R5FA 2JAWA 3KEQA 1EX7A 1O9HA 1O1YA 3CZQA 3DPSA 3ZE0B 4KWHA 1BFUA 1E4EA 2GOYA 2O3TA 3H8WA 1ORVA 4P7JA 5DO9A 5E3JA 1NLFA 2K6GA 2I2CA 5T4HA 4U7TB 4OF4A 3WQRA 2F4VB 3F7NA 4LSWA 2XDWA 3B2EA 3N70A 3N76A 4LOKA 2CSXA 1Y1LA 1ZBQA 3DLBA 1EB9A 3JVVA 5B1EA 1V9LA 1RQGA 2R6R1 9MHTA 5BN5B 4BRUA 3DOEA 3WAGA 2PA0A 1G1AA 3AL2A 1R6AA 2ZRHA 2XCIA 4ZQGA 3T38A 3MIIA 1Y63A 4DCPA 3W1WA 5JPCA 4B6JA 2H5IA 3KQWA 1G3QA 4EAAA 5FNVF 3FCXA 3HU5A 4HVAA 4P4SA 2BEVA 5ECYA 3VPDA 1WBDA 1W5BA 4BRWA 2I3DA 4TRNA 1RI2A 1TM3E 1URPA 3IOYA 1Q7TA 5AK4A 4HXFB 2HW8A 1IJEA 2IE8A 3DD5A 4DCCA 4K9RA 2FW0A 1DVRA 2Z4TA 1BQ3A 3PZRA 4Q1CA 1U9JA 2AL7A 3B1ZA 3MM4A 2WZBA 3L5KA 4GYJA 1BVRA 3DDZX 1DAHA 5TSDA 1OE0A 2YUIA 2GFHA 1JHOA 1S8NA 5ALKA 4B75A 5HJ5A 1PQYA 1WUJS 3H75A 4QEZA 1ZMRA 1U0OC 3FOAA 5J4KA 3FPJA 1ML3A 1W34A 4C0JA 4UHDA 1F2UB 2KBEA 4F97A 1YONA 2ZPTX 1T15A 4NOJA 2IHNA 2X6QA 4BZZA 1V5FA 2BF7A 2XRYA 2C4HA 5E6UB 1LQTA 4X62B 2OSVA 1G6KA 3ZNQA 4ZEOA 2FVYA 4NFLA 3BH7A 3WLAA 2XNCA 3FTPA 4G4IA 4EPXA 3EGDB 4M0MA 1UWVA 4Y2RA 4C7KA 3ZG6A 2FR8A 4HPXB 4A8TA 1GKYA 5KJFA 1U90A 3LXRA 4MV3A 1LRJA 3QV1A 2OAP1 2Z30A 1P6QA 3FNFA 1YUMA 4GC9A 1PZMA 2IPNA 4OMCA 4FYJA 4R2KA 3VZRA 4LGMA 5KUTA 3V8BA 1YACA 1ZA1A 5J9FA 1M2KA 2ZRJA 4C6TA 5J2UA 1WP9A 4A2PA 3GLRA 3PC7A 3SKXA 1X39A 1Z56C 2G4CA 4M37A 4II7A 1YRLA 2Z58A 4QAQA 3GLIA 3B6KA 1KVSA 3KHUA 2VWPA 3CMMA 4Y18A 3IQXA 5DHPA 3W8EA 5CX1A 2I4OA 3VU8A 1OWOA 1W0KA 3KVNA 4WXEA 2RK6A 4FPXA 4DCVA 2PR7A 4TV8F 4C5CA 3WADA 5EJ7A 5F2NA 3H99A 3PQEA 3T5BA 2Z5FA 3BICA 1BDJA 1WCXA 3JQ7B 4QARA 4ZQBA 5F52A 5LXTA 5HMMA 1STOA 2ILTA 3ZVLA 3ETEA 1MJNA 4JC8A 4M99A 4Y2XA 3PD1A 2F1RA 5DISB 4D0LB 2HIAA 3G1UA 2AX4A 4O3MA 1QRRA 1ZGJA 4POAA 1CR0A 3R5SA 3NWJA 3D3WA 5LA6F 5KDLA 2GGSA 2YDYA 5LDDC 3AUKA 4GMXA 4Z53A 4DQ0A 1UT6A 1RMTA 3OTGA 4E12A 3D4PA 3QUAA 4R5HA 4G4JA 4ZYXA 1CHNA 2OGUA 4IZHA 1XGKA 2KX7A 3CF4A 3DF9A 5CGQB 1LVGA 2O2DA 1PZEA 2HV8A 3CHYA 3P71T 4GSYA 2IUUA 1IEQA 4PO3X 1IZZA 1JEQB 2PY6A 2YHBA 1VG0B 2AR0A 4BKPA 3RNLA 4YAGA 1M5UA 2D1SA 5KHOC 2ZRIA 4PX9A 1LK5A 1UBCA 1GD1O 1EFVA 2O7QA 1N3IA 3PGMA 121PA 4F5DA 3NJRA 2ZRCA 3PS9A 4QBTA 5ED0A 2BPOA 4PLCA 4RVNA 2G06A 1O9GA 3R7BA 3VZCA 4DUGA 4ZHSA 4V0SA 3ANTA 3RIEA 2GN6A 2I8LA 1L7EA 2DR0A 2GJ9A 3GP5A 3F90A 4M46A 3GG2A 1M8GA 4UC0A 4ZT4A 3TQCA 2FRXA 2XAAA 3VYTB 3IAUA 1VTKA 1SMKA 1ZOSA 1KIAA 2IL1A 2PS3A 3AI7A 2VCHA 3OIWA 4XCXA 3MNFA 2CUTA 2NZYA 2V0GA 1EUQA 4YRMA 3LL7A 5TPWA 4WIAA 5FA5A 1BMFD 3OJLA 2A92A 2EWVA 3KD3A 2VJCA 3AF4A 1YVPA 1PZNA 3DMRA 1J25A 2J32A 3FJ1A 3L4EA 5FFNA 4EHJA 3VSAA 3I3OA 5JCZA 1QGUB 1ATIA 4F04A 1BZYA 5AKIA 3P8ZA 1E6LA 4OJTA 1Z7BA 4BE9A 5JQGA 3VR6D 2QAGA 2ORYA 2RHDA 4X66B 1Z8NA 1RM3A 1WXFA 3JZIA 4JC4A 4ZDIA 3WNZA 2H2GA 3KQYA 2C8LA 1U2SA 4HDCA 5SICE 3DQQA 2XF8A 2WK1A 4XX1A 5CW1A 1JEYB 4TLAA 3D4BA 4I46A 3D6JA 2BHNA 1LNQA 1ZH2A 2WJYA 1WXEA 4KEAA 4C4RA 3ZXIA 3FSJX 4KQMA 2O7VA 3CUYA 3CB2A 2I2WA 2QNIA 3PR2B 3WLTA 2G63A 4OP3A 4WNAB 3TLEA 3VZBA 3F3KA 1ADFA 1WZUA 4BATA 3OZ7A 1WBBA 3FKSD 1PR2A 2COKA 1CULC 3FZNA 3OHPA 4EECA 3ORSA 3UA3A 4RK1A 4F3RA 1HLGA 4PFJA 1RHQA 2RH5A 3HCPA 3TNLA 3V1LA 5KOYA 5K01A 1AD2A 1N2ZA 4NK4A 2ZXFA 3AF2A 1SC3A 3U7FB 1Y9ZA 4Q16A 2P65A 3RWMB 1JW9B 4K3UA 4B31A 2VH5R 4QDXA 1R4NA 2P2SA 4FFOA 1UBSB 3RYHA 4CCSA 4EY5A 1GUFA 5E1MA 4E3ZA 5A4IS 3ZS8A 1JX6A 1D09A 4IDNA 5CTJA 1Y34E 4I1OA 1HDEA 4I2NA 4R8MA 4DDHA 4QE3A 5BN3A 5J2UF 3WKBA 1SPXA 2HZ7A 4W5HA 2R84A 5ERYA 5TEVA 2B92A 2IPAB 5K8TA 2OZPA 1MJGM 4I5DA 1EJBA 1RW4A 3JD4A 4YBZA 1S4QA 1DOAA 1N0WA 1TMGE 2GK4A 2IGBA 2O50A 1KSJA 3K9QO 4LHXA 1AKWA 3DAHA 4MCAA 1TCVA 1TF2A 3HADA 2QD4A 2BKEA 1NRXA 1AK1A 3NHAA 3VRHA 1DARA 1NI5A 2H18A 1ECLA 4HNUA 4DYDA 3CX3A 5F9HA 3EWNA 1TQDA 2J3MA 3DMYA 1AQYA 5GGXA 4XQ0A 1QK4A 3SIWA 4JP1A 2EF0A 4KMMA 4AXXA 5BXQC 3BFKA 4YPOA 5HZMA 1NXVA 2HF7A 3OOYA 1HMYA 2FQQA 2HNBA 2QUHA 3GJ4A 1DT3A 3K4PA 2ZYGA 5SV2A 2Y1FA 3IURA 2YJZA 3PHHA 4V2IA 4BTVA 2VHXA 1IBMB 4GDMA 1QQTA 2ZYRA 1T2CA 4EHDA 3WDLA 4B5KA 4LRYA 2O05A 1CKEA 3O1IC 3GJYA 2NU6B 2QQEA 2ZVQX 4LRXA 4DQVA 3GGOA 3PE3A 5ADVA 2A0WA 1XTKA 1OA1A 3IQFA 4FFVA 3PP8A 4AF8A 4GNRA 4JT8A 5FXMA 1EWKA 1QOQB 4NJMB 1OBCA 4QTYA 1SC1A 5J2TA 3HFGA 3OD1A 2E37A 3H8VA 1XZQA 3ZGXA 3BEDA 4UMFA 2J5QA 1QZ3A 5JZOA 3A8TA 1M2OB 4H7DA 3HL0A 3SHWA 2D0DA 3LGAA 2Q7DA 1XQ1A 3K8ZA 4P1ZA 2ZTHA 4OHVA 1ZX1A 1JHRA 3VR6H 3D8UA 1H6BA 1ZKDA 3E7XA 1PIWA 1H1LB 3D6AA 5LBIA 2E1PA 3TQSA 1FFWA 1ZJWA 4E2WA 3LKVA 2Y8EA 1XMQB 1FP6A 2GZ1A 2OVBA 1G98A 1BWPA 2QA5A 2VDWA 3N5KA 4LK3A 3HO1A 4R7TA 1JLHA 3D2AA 3DBRB 3UQYS 1CB7A 1Z0IA 1NFQA 1TVKB 2CL5A 4I3FA 3K6KA 1G18A 3WZMA 1RS0A 2HWXA 3KIPA 4KE7A 5IAJA 4B35A 5CFMA 3TECE 1II9A 4CLHA 1W96A 4OBBA 2OGWA 3T06B 3UT5A 4REQA 3C8HA 2DLDA 4BO9A 2E0IA 4D9JA 2HJSA 4W4TA 2F3RA 3PSAA 1A8PA 1XXHA 1TIBA 2X5NA 4NDZA 3Q9SA 4L8YA 4PCUA 3SQOA 4YHBA 3UKOA 4YJKA 2JCGA 4N1AA 3AUSA 4K5QA 5BWCA 2BKXA 4TTPA 2HMVA 3M2PA 5PGMA 1KFKB 2B5WA 1JQDA 5ALWA 3TLCA 2I80A 2VDQB 2X8BA 3DLPX 3HNPA 2ZR9A 1K89A 3P5SA 3PLNA 4RIFA 5HIIA 5I4KA 4RCYA 1ND5A 4Z8YA 1LF5A 5JQGF 2ZWAA 1YQUA 1GZ6A 3PGVA 3S5UA 4KN8A 3B1KA 1FU8A 4RPKA 5LQNA 4IV0A 2MSNA 4QXQA 1UBLS 3BGWA 3NC4A 4UCQA 4JLAA 3WB0A 4E5VA 2RARA 2UUPA 2C59A 2OLKA 4EJFA 4QM6A 2Z9CA 1HDZA 1RJGA 1XFDA 3UKDA 4GKKB 4QOIA 4XWTA 4ZIRB 3WJ7A 3GJ7A 5C1OA 1WHTA 5BSKA 1EA5A 1X8KA 3LFHA 1L1QA 1XTIA 3IP3A 2XB9A 4E0BA 4CKZA 2WLTA 3ZZMA 1JB9A 4GAEA 3WB9A 1N1MA 3J81A 1BKYA 4KBGA 3OMXA 3P9IA 2PTGA 3H2HA 5DX1A 4ZMBA 3HCDA 4NZ9A 4QOFA 4HVTA 2UZ4A 5LM3A 3B1XA 1NF8A 1BJTA 5A9SB 3QWIA 1A9YA 3IJPA 4GMKA 3W4KA 3TR5A 5I7HA 3MT7A 1XV5A 2JEOA 2OENG 3O3MB 5LJLA 4LQDA 3THYA 2LR0A 3BIWA 3QKSA 1YCDA 1FQKA 3IAXA 1JQ5A 3I2GA 4YP9A 3U56A 4TZ6A 2DC1A 5JSFA 2X0KA 3T3OA 1KARA 1D1SA 1V16B 1DIHA 1NQXA 2BF4A 3AB7A 3OT1A 4COOA 2X0RA 3QPCA 4DLAA 1QVAA 2FMHA 2X77A 1XMOB 1EJ2A 1XEXA 4CU2A 3IC5A 4GNKA 2Q4BA 1ZEMA 3L92A 4BGIA 1GO2A 5A9TA 3ZV7A 3S2IA 3H86A 5F51A 5L45A 3QVWA 4AU1A 4YCSA 3U4QA 4ZI7B 1NPDA 4J75A 3ML1A 3VR1A 3ZE9A 3KLNA 3NTQA 2X40A 4ND8A 4FNMA 3ZR4B 1NVVQ 4TL8A 2WIJA 1X8JA 4C04A 4BMSA 3MLEA 2Y1WA 1TU3A 1TEHA 1WKCA 1XZGA 1T2UA 2DG2A 3HKBA 3G17A 3Q72A 5JO0A 1F0YA 1NZJA 3ACDA 4AX4A 1OX4A 2BTOA 5E6SA 3O8OB 2ETVA 4LTDA 2JATA 3IAM6 1J09A 1RU3A 5D87A 5FO0A 3HGQA 5FLEX 3STHA 1M66A 2FPIA 2VHWA 4V02A 3RAEC 1DIBA 1U1EA 3C8MA 2HA4A 3L8HA 2QP4A 4KMRA 3J81k 4AJJA 1HDOA 3HZRA 1J97A 1FK8A 2YXBA 1MN6A 2YZMA 3RUIA 3B1WA 3SX4A 4IDHA 4BNDA 5F7XA 1B8OA 5JD6A 2W6CX 4DY6A 5JRZA 3LDGA 1RYBA 4KO2S 5J2TF 2DKNA 3RIXA 1J2UA 4JHLA 3UC5A 2C92A 2E4AA 4A36A 1QE0A 1VMDA 4QDJA 1YE3A 1XU9A 4TMXA 3SU8A 2VJPA 3AW8A 1PR0A 1SRRA 1XVVA 3JARB 3AESA 4QELA 1LLFA 3GJ8A 3X44A 3ZWQA 2W4IA 1RI5A 1TQHA 4UMEA 1IWPB 4MEBA 5EHQA 4BGUA 1T3SA 3L7MA 4FNOA 3ZKAA 2FHPA 3PX7A 1NX9A 2W6ID 3OMLA 3ETDA 1L6IA 4A8JC 2ALJA 2B8WA 1ZWKA 2QQ0A 3OKAA 1P2BA 4CKYA 2P0YA 2AR9A 4MGKR 4EEZA 2V6BA 2F1IA 3THOA 5JIBA 4MJLA 1OC4A 1U0SY 4JBWA 1KWKA 3L93A 2VHTA 2I4RA 4BZWA 1DDGA 2OXIA 3RNOA 1IQUA 1M34B 1T6ZA 3ZWYA 1KS9A 3G2NA 3OEED 3GVHA 3DHEA 2OHXA 1Z5OA 3TZBA 1NLYA 4HAWA 1CJMA 1D4FA 4A1FA 1RAAA 2WDPA 1XL0A 2A3RA 2XSZA 3GVXA 3I72A 4M76B 4MTCA 3LQRA 1CRPA 1P9OA 2D5IA 4OGWA 2FLWA 2OD7A 1EWTA 3M81A 1XOIA 3WLFA 2XZLA 1HXHA 4J3JA 2HIMA 5C18A 5ITZA 1ZCFA 3C70A 4UOZA 1Z5UA 5LKAA 3CVWA 1FCJA 3D6TB 2B3DA 3MTEA 3WHIA 3WQSB 1RYMA 4F84A 2OEPA 4C4AA 4RTOA 1LSUA 1K8YB 4HX5A 1KH1A 1Q92A 4AB1A 5LR6A 4QFMA 4HGRA 2QTHA 2W93A 3KKLA 1ICEA 3DBLB 4INAA 1YOBA 4X7BA 4ENSA 1JI0A 2JJ1D 5I9LA 5CLHA 3B9BA 5KYTA 3STWA 5JZVA 4BEVA 3EFBA 2BD0A 1NFRA 4G36A 5K0CA 1UJMA 1H5NA 1C8LA 3L0CA 3CLUC 4KAJA 5DK4A 1P61B 5K03A 2OP1A 4R2JA 3TLGB 3K0CC 4FZ5A 3MGAA 3OIGA 4L74A 1ESMA 4L9AA 4MWCA 4TYMA 5IZCC 2CMDA 4NDAA 5DCLA 1CLUA 2GBIA 3JZAA 1OI3A 4DSAA 2JFZA 4KBFA 1KMIY 4K7JA 2VXBA 3IDFA 3IHTA 3TMYA 4DXAA 2BFMA 1N2JA 1U2ZA 4QJ3A 2IYRA 2Y67A 3KOWA 4GWGA 5FBLB 4QNMA 2HN9A 4DRXB 4YRPA 2NU9B 4JI1B 1CYDA 4L5CA 2GH1A 4O4IF 4CEJA 3UCEA 1QKJA 4U5XA 4DJDC 3RB8A 3CURA 1LTHR 4KR0A 3BQMB 4I5FA 4LG1A 4NBTA 4N82A 3T7DA 1J56A 4D3SA 1NRWA 2VRNA 1TYDE 3DVRX 2RSLA 2FKAA 3I9LA 3EZ2A 4KSCA 5KOJA 4FR5A 4FHDA 4MGEA 1F20A 2H2IA 4H6XA 5ES3A 2XV1A 4IEFB 3IOCA 4B4DA 4ID3A 5DOZA 4F6CA 1CUDA 3G5AA 1NC1A 1DDIA 1SU6A 2C4MA 4OI1A 3ZWXA 5AQ1A 4OIMA 4TMKA 3ZD8A 3DDUA 2WYIA 2O2CA 3U0VA 1NNLA 3VJRA 3A4LA 1NG1A 1QYXA 2ZR0A 1SUPA 2A9KA 3F67A 2CHUA 2Q6VA 5AIAA 4A5SA 1U3UA 5AVXA 3K8YA 1Y5RA 2CLCX 3JQBA 3IP9A 4DSTA 1G2PA 5I51A 3AEYA 1YT5A 5G0TA 5HRUA 4RJKA 3HM9A 1T8PA 1CIPA 2FZ5A 4LZNA 1TU0A 4RZQA 4AJ4A 5JADA 4YK7A 5IVPA 1PT6A 2CEKA 3HN6A 4EQ6B 1OXKB 4DUPA 1RQPA 1GGHA 1E99A 2JLVA 3HCAA 4FE3A 1Z88A 1W9HA 4AN0A 4D9HA 3DUWA 4DIEA 2NZ8A 3FR7A 3JYQA 4H1VA 5JCPA 4MUAA 1CF4A 2AS0A 1XJCA 1X8LA 1F4PA 2PYDA 2WPNA 1ODLA 1VSVA 5JJIA 3BAFA 3E58A 1PLLA 1SVWA 3E0QA 3PC8C 3FRHA 3ZU2A 2DZDA 2C2ZA 3GRAA 5T4EA 1BX3A 2C1ZA 1EFDN 3SOZA 4DIDA 5J1TB 2Q28A 2Z0MA 1FLAA 1V8FA 2VDUE 1N34B 3WQBA 4F4UA 2IW1A 1I6WA 4NJEA 2WRZA 1A2QA 1IRIA 2PKQP 1YRWA 1JZQA 4HEQA 4GL4A 1KKUA 4ZP1A 2NSYA 2A9FA 2JGAA 4B3MB 3R6TA 5HIAA 1T0JB 1T4MA 1CQIB 2GZRA 4WBNF 5TB5A 3G7NA 4IP0A 1D9ZA 1GDDA 1VGVA 3JD0A 4FNGA 4L4XA 3KB2A 3N0RA 3PT5A 4Y2PA 1VL8A 2B4QA 4Q4CA 1OI4A 2CFRA 3AKDA 3BHMA 4LXXA 3FPGA 1II8A 1Z4OA 1GUBA 4ARZB 3BGVA 5L3SB 4CF5A 2XCRB 4S12A 1ARZA 2J4FA 4WCFA 4IZIA 3TSCA 2J6IA 1C0IA 1Q0HA 2C00A 2H1SA 4RVGA 5E2BA 1ZJYA 2P4UA 5JO9A 4KPYA 5JALA 3GNTA 4WK0B 2HUNA 2CXOA 3B1FA 3UMSA 3CLRC 2H4HA 3EIEA 1FDTA 1TECE 1U5AA 3D6VA 3KUDA 3NHSA 2W6IA 1H85A 2ZKLA 3DBIA 3NQ41 4LJ7A 3CXUA 1XPOA 4R1QA 5BN4B 2OSBA 3OX2A 1WD5A 1M6YA 1Z6TA 2X1HA 3PPVA 1PZXA 2OM2A 3UHJA 2ZSFA 3T35A 4C20A 2IFTA 1XROA 2CN1A 2Z1NA 3FE2A 3GN1A 4NONA 5EHGA 5CBPA 3IEUA 3SEQA 1OV6A 3WLKX 5B4TA 3CVOA 4Q66C 3IAFA 3IUNA 1N8NA 4UM8B 3SICE 2OFOA 2FW7A 2FUEA 2O9JA 3HJUA 2GYVA 3WWZA 2O8BA 4Y6RA 3AYZB 1F06A 1QDLB 2GN8A 5TT1A 4DMMA 1M2JA 4GEKA 1LSOA 4HRYA 2OBNA 5FL7A 2HIGA 3R6LA 4FT4A 1BA2A 4QDUA 4N5IX 3PJDA 3UMFA 4MLPA 2R6CA 4C03A 4KI7A 3T3IA 3NM5A 2JI9A 4Y8VA 2AZDA 3HGTA 4DQXA 2FDCA 3PRHA 5KTTA 3EZFA 3DE0X 1E2FA 1O0CA 3L82B 2H0RA 1TIPA 4Q4AA 4ZVOA 2JJ1A 1E6KA 2PUEA 4LWPA 2BI8A 3R24A 1EHIA 3ENWA 1Q2XA 2VJQA 4I55A 4URHA 2JHGA 4GBJA 2Z2IA 2JVKA 3Q7QA 4G84A 3PX3A 1F8GA 3HKCA 4N5NA 2YMPA 2A1TR 3ITNA 2Z8YA 1E6CA 1TJ4A 4YRJA 1WNTA 4OUDB 1LI4A 1VPEA 3T5MA 4DLKA 3LWDA 5JFTA 1IPEA 1DV2A 3FW1A 5DM4A 5AW9A 2VA8A 3IXMA 1G0NA 2G7ZA 2NZJA 5IASA 1ZS9A 1Z47A 2AYYA 3USZA 1UT5A 4P4NA 2YW2A 2R8XA 3TPFA 4JR2A 3P0FA 4F5YA 3KD2A 2QYTA 1GGJA 3UJ9A 2Y1LA 3K94A 3NDJA 2WD7B 3EVTA 3TQFA 2Q8QA 1IC6A 3MWYW 2WU8A 2BDUA 1FP2A 3CWCA 3NOQA 4QXOA 4DWJA 3TNYA 2W37A 5JJCA 2W8BB 2WINI 3WOVA 1BD3A 3ZBUA 1D2HA 3KOUA 4EO7A 2WG2A 3P9PA 2I6SA 4TM8A 1GL6A 4X7RA 1CYEA 2A9OA 4QOGA 5FI0B 4Z2AA 2JJ2A 2PZFA 2TYSB 3IE2A 4Q21A 5C5CA 1YK0A 3E3LA 2G40A 2VI5A 5ER9A 3VYSB 4KAFA 1IM2A 4D79A 4MPDA 1GPMA 1MJGA 1FX0A 4R68A 1OLUB 2YNMD 4B33A 2R6FA 4PHFA 1SIOA 3FROA 3F74A 3KKNA 1VI6A 3A2MA 4X90A 4BNYA 2XPCA 3WS7A 4D4HA 5F73A 1JXAA 3LKZA 4LXGA 1LWOA 3VR3D 3VV2A 2JLZA 1ELOA 4E6EA 4D8WA 2C5EA 4K6OA 3F5DA 2I91A 4P53A 3VJMA 1DJLA 1FVOA 1SKYB 1TI7A 1YR9A 2PL9A 3FPSA 3SJUA 5CMLA 4S24A 5LIRA 1UMDB 4RZSA 3T4XA 4ALLA 1NOJA 4BWFB 5HTOA 2XDQB 2NMVA 3S1SA 4RJ2A 3DHWC 3A1SA 3RS5A 4IO0A 2E48A 2QYOA 3PZBA 2N42A 1E5QA 4P84A 3MA0A 3EH2A 4XXHA 5FHQA 3UKJA 3R3XA 1E1KA 3M6MD 1W36B 2C2KA 2CVQA 3QU5A 1WPRA 1SB9A 1IAQA 4QUJA 5K7SA 1K06A 2D5CA 3HKEA 4B83A 1PFUA 3KQUA 2FP4B 4D97A 2RAVA 4KQ6A 3MOIA 3VM6A 2J4CA 2ZEJA 3BB1A 4LPSA 1HKUA 1E2LA 1A50B 1N2IA 4EL5A 4RTRA 1EGVB 2WWXA 2VWGA 1PV2A 1WO8A 2FEAA 2DQSA 2PRYA 2DUWA 4DN6A 1I51A 2R97A 4ZCLA 1IK4A 1KP3A 3F78A 1YRBA 4HFNA 1GZVA 3N07A 5AM1A 1C9MA 3S1AA 3TNDA 2QVXX 3EEOA 4FMBB 3QE4A 3DTVD 4IO1A 2HBRA 3I4FA 4NTZA 1NNEA 1JIXA 1JV2B 4M60A 4B82A 1XYYA 1MRZA 2OV1A 2V7UA 1RP7A 1BHO1 3D3EA 3FWNA 4UE2A 4URFA 4UM9D 3DC7A 1UDBA 5HM6A 3KR1A 3KTAA 1LPMA 2P5SA 2ZZMA 3H84A 5IF3A 1QE5A 3O4JA 5ALJA 5ECDA 3IEVA 1PK8A 3DV0B 1OWMA 1PJCA 3RWOA 5LPNA 2R7NA 2CJXA 1Z73A 3JRWA 2D13A 4JVOA 3IB6A 4DC9A 3HXQA 2XXAA 5FX2A 4MS4A 1Q0QA 3SDBA 1Q11A 2DPGA 2OBBA 3DULA 1L5QA 3O7WA 4JP8A 4UD6A 5A2GA 3FUWA 4NLLA 1LCIA 4OJMX 2VUUA 3EGXB 4GX5A 4TRMA 4GICA 1O95C 2GASA 1E2HA 2Q5IA 4NZNA 2DLNA 4XB2A 3OLXA 2A9JA 4Y9TA 1IE3A 1L8LA 1T3ZA 3ROZA 3T7RA 1P6XA 4G4GA 2JKZA 2VVTA 3L49A 3SHQA 5JWOA 4HQKA 6Q21A 1I3KA 1B15A 1WY5A 3BK7A 2RJOA 3T9CA 4A6EA 4AK9A 3TLZA 1DQZA 3WDKA 2M9MA 4ML3A 1PL6A 4IEEA 2DPLA 2P5UA 2ACWA 2PXHA 3PIIA 2O8VA 3L6OO 1P7YA 2W4QA 1UDCA 2WPDD 2HRRA 3DOIA 4HRAA 1PR6A 4NU8X 3KWMA 3EDCA 3L0ZA 4RIIA 5EIBC 1EH5A 5JD4A 1VP9A 2PZKA 2GUGA 5HTKA 1FMCA 5G0UA 4WZAE 4X8LA 1IN6A 2QU8A 2BGWA 1RLJA 1DIOB 4DBLC 3TSZA 2PUDA 3EBPA 1KTIA 3ZDDA 1LTQA 1WXHA 2B98A 1P4GA 3LU1A 3MTAA 4MYTA 4V0QA 5C5DA 5L51A 2DSTA 5JISA 1VMAA 2CLIB 3SC2B 1Y8RA 3A3NA 4WLUA 4MGHA 1QRAA 1Z7EA 2WMNB 1SCUA 4EPTA 4K87A 1FS6A 3MCAA 4Q39A 1COZA 16PKA 1KGDA 1ZSYA 4HNAB 2O2XA 1UR5A 13PKA 1R50A 2Q3LA 3G2KA 3A6JA 3UJAA 4BL5A 5IFKA 3WK9A 4CG3A 4CG2A 3AF0A 5KZMB 3VU9B 4QQKA 4EW6A 1NHWA 1ZIPA 1SPBS 4CBVA 3LOUA 2GTPA 5JMTA 5IJAA 2AWOA 3PXXA 1CRWG 4QULA 5T4BA 1SKUA 2IKSA 5DDIP 2BBOA 3T1VA 3R8CA 1FRNA 3SNKA 1QIFA 5AXDA 4KUHA 4RSHA 5LXTB 3R4VA 2CC2A 3V3TA 5A1TA 3Q9LA 3ZCXA 2O7NA 3PK0A 4MITA 2C3PA 2JK0A 3OTOB 5KDOA 3WY9A 5TVKA 1SGWA 4H4CA 1HZZA 1X7ZA 3GRPA 5IAOA 3VGPA 2IYSA 4P5EA 4QFBA 2RCNA 1E2KA 1RWKA 2GZHA 1AKQA 3RRFA 2O2HA 4GOJA 1UK9A 3CLKA 5EWLB 1FRVA 5AI5A 1ZU4A 3D43A 3KELA 1YZGA 4CTOA 3QP9A 5JFOA 2PT7A 2WWYA 1KO1A 1BG6A 4MA5A 4WZBB 2REOA 5C81A 1GZ7A 2PJDA 4NCJA 3EC1A 2YNMA 3LPCA 3MTIA 3H5WA 3BYZA 1O03A 4CEIA 5K0BA 1DXQA 4G5YA 3L6RA 4X64B 1IWBB 1W4ZA 1XZNA 3F49S 4ZCIA 1JKJA 1P19A 1XPUA 1PTKA 4QU8A 4Q7LA 4JBHA 4NYJQ 2ZREA 3C74A 4B34A 4DRZA 1J5XA 2JS7A 3KSDO 2IYYA 1Z35A 1BQEA 3OPQA 4AP5A 4P5DA 4D8YA 3L02A 4MCIA 4EUHA 4PICA 1ZH4A 1M3SA 4HQ0A 4MV1A 2CJWA 3OPNA 3N7TA 3UMGA 1I30A 2FR0A 4IDDA 3QLTA 5HDQA 2IT1A 3I5MA 2OP0A 5JAUA 3FCYA 4GC5A 3AR4A 1SBHA 1EBUA 4AM8A 5F5XA 5F5NA 4XFDA 1U1FA 3C0KA 4R9NA 1K6IA 3VO1A 1JEDA 3UW1A 1FJ2A 4ZCPA 2DHEA 3OTIA 3EXHA 1X1SA 3GU3A 4PHTA 3FOWA 5SYAA 5FPSA 3CVJA 3WL6A 5IJXA 1JSXA 1HYBA 2ZSAA 4MW6A 3AP3A 3VTKA 1VE6A 1ENZA 4KFUA 2RGEA 4EGFA 3BGDA 4HWKA 5F3WB 2W6QA 2C5HA 2YWXA 2XUFA 5KQMA 2VK8A 2R48A 5DWVA 1P7ZA 2WKPA 1TADA 2Q99A 4UQPA 3KQMA 4RACA 1SHKA 4ARIA 3K09C 3VC1A 3BIJA 2QY9A 2OG2A 3SXUB 3NUZA 1KR5A 2BGTA 3HVRA 2IELA 5B6PA 2IOHA 2OCIA 2XUAA 1A97A 4IG9A 2PLAA 2Q3CA 4UOQA 4LV6A 1KC1A 1JEAA 3EFHA 4HWOA 5JDCA 2OZVA 1T3TA 1ZMOA 4HQRA 1ECPA 5ERXA 4MQ4A 4OFWA 2JFQA 2O8CB 4DUYB 4B7ZA 1NY6A 4I2VA 4TXLA 1U7WA 3BWDD 1Y1TA 2FW9A 2O54A 1C30B 3EBOA 4PSUA 3PUVA 3F47A 1D5CA 3M6XA 5DPMA 3GH3A 2B69A 3HEBA 1EK2A 4UAVA 1O5OA 2Q4RA 3PPYA 5GJVC 5TRTA 4KOEC 4PAWA 1E96A 1CLEA 1V8PA 1ILWA 2AOTA 2BZSA 4QUBA 4N3NA 1Y8AA 4K6FA 1M8JA 4NV1A 1IM8A 1GQ2A 1NLZA 1V5EA 2SKEA 4TYPA 1VBKA 2XX3A 4ZOLF 3UH1A 1ID1A 3RYCB 4HB0A 2HJRA 4MUJA 1AX9A 3VTZA 5BVGA 5FQNA 1XNHA 4LY0A 3VI3B 1H2BA 2RAUA 5TQ2B 3OJOA 1U0JA 4F2DA 1W87A 5I45A 5LQJA 3RS9A 4J1TA 4O5OA 5DI3B 3OX3A 4IJQA 2WFMA 4YUZA 1KE1A 3BKXA 5IW8A 4BQEA 3LHDA 5DWDA 3JYNA 3QSGA 1UBTS 2WWHA 4EX6A 1I1NA 4KPEC 2DSNA 4PGFA 1NW9B 5KWVA 2I3ZA 3CRW1 7MHTA 2WPDA 2O2YA 5BMOA 4ZRDA 1HNZB 4ED9A 4N41A 1C1DA 3D7KA 2EKZA 3M9WA 5WRFA 3HJAA 3ONEA 1O2DA 5CNMA 1CVIA 2Y0PA 4RTQA 3QHQA 1XRSB 3L4BC 1SCDA 3GD5A 4G41A 4J07A 3BWMA 3REFA 2MWMA 1DC8A 3TE6A 3R9XA 1G21E 5HJ7A 1EINA 2W2QA 4X3CA 1IHYA 4CLOA 4QGGA 4GX0A 2CLFB 5AXCA 1QO9A 3EHDA 4MQEA 2ECPA 4FBMA 3QEMA 5KWJA 2DBQA 1QQAA 4F1JA 3D02A 3HXPA 1SHZA 2Y76A 1O6BA 3RGGA 1Q0ZA 5JCOA 2ZS9A 1KAGA 2QI9F 2QN9A 3M1LA 1MJHA 1L7AA 4QT0A 4A5OA 1OIWA 3OP4A 1KBQA 1CR6A 3O8DA 4MUKA 3T99A 2NYVA 1AB5A 1FUUA 1A3CA 2EHJA 4RXTA 5JBNA 1DT5A 4GWLA 2BLNA 2NSJA 3RS4A 3F3MA 4MUMA 4DEXA 4P0TA 3U7JA 3R8FA 4HGNA 2XWPA 4KPFC 3LC7O 4DL9A 3HHEA 2ZIWB 3FPFA 4UXIA 4DB2A 3QFRA 2PT9A 1H23A 1P18A 2Q3FA 2V7QD 2XVZA 3K0HA 4HGYA 4HSGA 4L9RA 1E20A 3QLVA 2PR2A 4DQUA 1BCRA 3ZJ5A 4HD8A 3P9XA 3O8CA 4XWAA 3HVIA 2W2MA 1X0XA 1ZGGA 2J3KA 3BUSA 4OK3A 4PAGA 5EMHA 3WMWA 4RDIA 4YAIA 2BHRA 1HLPA 3CR7A 3FIUA 4BX9A 1PFWA 5CAEA 3TW8B 2O4UX 3DVLA 4WK4B 1D7OA 1Z0UA 4GYYA 5H81A 3B1JA 4QDZA 1E3EA 1E9FA