1XMJA

Crystal structure of human deltaf508 human nbd1 domain with atp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
246
Chain Sequence
EVVMENVTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFDQFSAERRNSILTETLRRFSLEGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Impact of the delta-F508 Mutation in First Nucleotide-binding Domain of Human Cystic Fibrosis Transmembrane Conductance Regulator on Domain Folding and Structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, hydrolase
total genus 83
structure length 246
sequence length 284
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xmjA00
1AGRA 2W6JA 1JR3A 1Z08A 4TSFA 2PL3A 1T3HA 4BZPA 3NG1A 2IHYA 4PHHA 3NWJA 2OV2A 2D3WA 3GLIA 3X1WA 2A30A 3ZIAA 2IYVA 1KZGB 1QHYA 2E9SA 4C0HA 1AA9A 4FI3C 2GJSA 1RRFA 2ZSDA 1BMFD 2OM2A 1E0AA 2ZJBA 4MRPA 2RGDA 4KJZA 4HLUC 5EP3A 3WYGA 1EFCA 2D4HA 2KI5A 3B7GA 4RD3A 1SVKA 3VR1A 3CB4A 2CK3A 2ZRAA 2GZDA 5KPJA 1LFDB 2XGJA 1KI9A 2BV3A 1YQTA 5DIFA 4JZKA 2RHMA 1YRBA 2IYRA 1GL7A 5FI1B 3FKQA 4G5GA 4XD7A 3QBVA 1TEXA 1W48A 4DSUA 3GLFB 1A7JA 1HQYE 1YZQA 3RS5A 1NJFA 2FZ4A 4A8JC 2BMEA 4WAUA 3RANA 2WJYA 4RD4A 4DDVA 5GJBA 2D2EA 2ZJ8A 2AXNA 3B13B 4ZDWA 1N6LA 2W6JD 1JR3D 3UATA 3CWZA 2O8EA 3K09A 1KO5A 5IK2A 1JECA 1MRSA 4C7OB 1U8AA 3VKHA 1I2DA 4IVRA 2QAJA 4C0JA 3ZIAD 1CF4A 5KHOC 1Q21A 3F8TA 1E1RA 1AZTA 4ZIRB 4Z8XA 2AK3A 4HUQA 3K0FB 4AYXA 3T1VA 3FHCB 4UXHA 5L3SB 3CPJB 2ZXUA 1S3GA 3EW9A 2GHIA 1CR4A 5D3MB 3AF4A 1NVVQ 1Z0KA 3CIOA 3KJIA 2J5XA 3T1OA 4E03A 1COWD 3KTAB 4Z51A 1HT1E 1XMVA 3LRPA 1FUKA 2VLIA 4XWKA 2Q6TA 1T5LA 3IPXA 1HE8B 3FFBA 4TMTA 1FTNA 2CCJA 3GLHE 5FPYA 1CR0A 2P0EA 4C7OA 4B48A 4YXWD 5EQTA 3GJ0A 5LPNA 1IJEA 1L8QA 4MKGA 4WXRA 1ETUA 1JR3E 3E1SA 2XB2A 4IHQA 4BFXA 2LWIA 4BFZA 5AJWA 1XCPA 1WCV1 4OHZA 4PO8A 5JEDA 2ZS7A 3CRQA 4B3CA 1N6OA 5D3MA 3FMIA 4CDGA 4JLMA 2PCJA 1M7BA 4ESHA 4TTPA 1N0UA 1Q3TA 1TF2A 2GF9A 4XH9B 4TYYA 3PUZA 3IDQA 1ZJ6A 1R0XA 1N6HA 4PX9A 3AF3A 3LBIA 1S96A 1XCMA 2XJ9A 2BC9A 2W58A 3I73A 1HYQA 3Q5DA 4FMCB 2OLKA 3KXIA 1P72A 1SVWA 2WWHA 1PV4A 3A36A 1OB2A 1UF9A 2FFAA 3C8UA 5JECA 2WWFA 1II9A 1J7KA 2NO1A 3ZZUA 2BKEA 4JJZA 3A6PC 3QENA 4RZXA 3QF4A 4DSOA 3KXKA 5LD2C 1P4SA 3SQWA 4BFWA 1KSFX 4JLNA 4PHGA 2W6IA 4EPXA 5KSYA 2BDTA 2WWGA 4A0FA 2GESA 3DDCA 3ZS9A 5KSOA 1Z63A 2XTZA 1E9BA 3DO6A 2CLCX 2WMOB 4MDFA 3P32A 5FTKA 5E95A 2DYKA 3R9IA 4IFBA 3SS8A 4LRWA 4PC1A 3TNFA 4BWYA 3CKLA 4ZO4A 2H17A 4XIGS 5JWRA 3S1AA 2CL7X 4K46A 3PUXA 4Q01A 2ONJA 5CIWA 1OXTA 4NCNA 3B82A 3AVQA 2BWJA 5EE9A 1ZINA 4GMDA 4TL7A 1K8RA 2VP6A 4W7SA 1G8FA 2C2HA 1G3MA 3THXA 3U3OA 4PANA 4AD8A 1GNQA 4IXNA 1E9AA 4DLYA 1OH5A 2R6AA 3B6EA 2REBA 2J0UA 2WHXA 3GEIA 1OT3A 4JLDA 4NONA 5FBLB 4DRZA 3ZD6A 2XITA 1E0KA 4IKEA 4RKFA 4A8JB 3RSOA 3TMKA 2GF0A 3X1XA 4WXPA 2IUUA 1G41A 2A9KA 3MLEA 2FJUA 4GMXA 3GJXC 4CF7A 5KU1A 2O8BB 2J87A 2D7CA 2X77A 1JI0A 1CTQA 1KK3A 2BMFA 2ZRMA 3AEZA 4EFNA 1EX6A 1GKYA 1GRQA 4N3NA 1GFIA 4DC9A 4JVNA 1QHHB 5F98A 3DMDA 1SVLA 2YVUA 4TYWA 3UPUA 1VG8A 2ZUBA 2VHJA 1EWQA 4B33A 1M74A 4Q19A 4EQ6B 2ZRPA 3ND9A 4MUBA 4TMVA 2YZ2A 3F3YA 3D7MA 3L82B 3A37A 1IM2A 4UXIA 3A4MA 2XSZD 2Z43A 3IQXA 4CYMA 1OFIA 5C46F 5FTJA 1R10A 3U44B 3CX7A 4MQBA 4KI0A 3VR5A 4QNMA 5C2JB 2ZI6A 2ZS9A 1UBEA 4EJSA 3SJAA 1TQ4A 1KK0A 1Z6AA 3FYHA 5KTYA 4LJAA 4OHXA 3WBKA 2J0VA 4GOXA 3E2IA 2PEYA 5EXSA 2X2FA 2FSIA 1OE0A 3K9LA 2CDNA 2QMHA 3CLVA 4HB3A 3B8HA 2ZRJA 4DCUA 3UWOA 2G1JA 4MRRA 3IIKA 5BYKA 4KU4A 2G9NA 3WP1B 2FPKA 2QBYB 1KO4A 2GAOA 2RGGA 3TVTA 4NYIQ 4B43A 5K8UA 1TU4A 2XXAB 5JWHA 1OKKA 2ZIAA 1OXUA 4DJTA 2OILA 3T12A 2BBOA 4BGDA 3R7WB 3B1VA 2RGBA 4E22A 2BBWA 2VHQA 3QG5A 4JYCA 2GTPA 3RDPA 1XJQA 5DI3B 4RD6A 5DN6D 5JS8A 3CRMA 2VH5R 3QPWA 1VPLA 3QIAA 4DWJA 3IUYA 3RLFA 3EARA 1XXHB 2Y8EA 1NMZA 2J45A 4XTRA 1GG2A 4NYJQ 2FMXA 4PAOA 3BH6A 4OJKA 4Q4AA 4CRWB 3N70A 3T34A 1NY5A 4US1R 2F6RA 2VRWA 3G0HA 3PIRA 4DCSA 1UKEA 1VIYA 2V7QA 1G7SA 1R4AA 2L0XA 1SHZA 1W2HA 4PPQA 4JSYA 4FINA 2CEAA 3A1WA 2XXAA 3UMSA 3A4NA 2IYUA 3KUDA 421PA 4FCTA 2PJZA 3QKTA 4O3MA 5AR1A 1YR8A 4TLBA 2UZ3A 2PH1A 1OKKD 3CZQA 4R2HA 1U81A 5SZHB 1XTIA 5LD2B 4RZ2A 4OQNA 4OK3A 4Q1FA 3DMNA 1SVMA 4RFSA 4ON9A 4L15A 2HDNB 3CBQA 3LVQE 2QN6A 1FOEB 3GEEA 1MO3A 2CVHA 4KAXA 4PXAA 3AVXA 3KQKA 1E32A 2XNDD 4F38A 1R5BA 3SE0A 5EUMA 3BXZA 3TUJC 4AG6A 4Q00A 1TTTA 3JZMA 4B2IA 4D4JA 1QHGA 2WICA 4AKGA 2IYWA 1XDBA 2P2LA 5TMPA 2O8FA 2FOLA 3B1ZA 4S2EA 1R2QA 4A15A 2ATVA 1IBRA 5HZKA 2DR3A 3CONA 2Z6VA 1E3MA 2GEVA 3AQ4A 4D80A 4Z1MD 5FI0B 4FMBB 3CPHA 4OQXA 5FOTA 3MWYW 3WMEA 1BH2A 4U7DA 3I61A 2ATXA 2OCYC 2ECKA 3TE6A 1N0VC 4KVGA 4PTLA 1HA3A 2A5FA 4ARZA 1U8YA 3EIEA 2YHSA 3H84A 5EZ5A 4DLWA 1KK1A 2O8CA 3E5HA 1G1MA 4BZXA 3QQ5A 4B3DA 3LLUA 4NE2A 2X8AA 4WZBE 2OAQ1 4A0GA 1P3JA 5CJ2A 2FZLA 3HDTA 4DLUA 3FOZA 1LY1A 3U7EB 1YR6A 1TL7C 3LA6A 2QG6A 1E9FA 4JVLA 1EFRA 4QJ4A 3HU1A 4XVUA 4NPHA 5AJYA 3N2EA 4RD1A 3SYKA 4B76A 3C41J 3CH4B 1D9XA 3W9YA 2QRZA 2YOFA 3F5FA 3A1TA 4A6PA 3FMOB 3ZVLA 2JDIA 2GA8A 4M1OA 1DPFA 1ZUNB 3A58B 1R7RA 3KKOA 1HTWA 3RC3A 3MMPA 1E6CA 4G0NA 2VHTA 1KAOA 2JASA 4F91B 2BCGY 4PHTA 4BQSA 4AC9A 2QM7A 1A5TA 4QL3A 2C99A 3AP2A 2WWXA 3IEUA 4DSTA 1XU4A 2GVZC 3BWDD 3QXXA 4L4UA 2AX4A 3NH6A 4LPKA 1CKEA 5IF9A 1D6JA 1IQPA 5EXTA 1A4RA 3IO5A 1E2KA 3B9QA 1JALA 1VHTA 2QPAA 4LY6A 1EFRD 3M6AA 4PPFA 5FOXA 2QORA 3GMTA 3VTKA 2BMDA 2G6BA 4UXJA 1U98A 1ZNXA 1Q3HA 2CHQA 4TQUS 3V4FA 3X2SA 2JDID 3NBZC 3CX8A 4IDNA 5H1YA 4JT4A 2JLUA 1TUIA 1CJTC 2GZAA 1FX0B 1OIWA 4XVQA 4MYUA 1G7RA 2ZS8A 2ERXA 2J1LA 3BD9A 3I4LA 2MSCB 2QL6A 2AD1A 1SVOA 3U3JA 2GXQA 3H1TA 4QBGB 2ANBA 4HZIA 3QY0A 3T5DA 2QY9A 3WHLA 3QF7A 1PVOA 2IYXA 3W5IA 4QFMA 4IJMA 3ZVMA 2P3SA 3LV8A 1KTVA 4WIAA 4TN1A 5F9HA 3SJCA 1AS0A 3WY9A 4OQMA 3SBEA 3OIYA 1L7VC 5JRZA 4LV8B 2GXAA 4WZ6A 3ONWA 4QXAA 4F4IA 1W4AA 4QKQA 3K0SA 3AM1A 3BERA 3U60B 3SR0A 2QQEA 1G5TA 2RGAA 4JIMA 1Q1EA 3PFIA 4YONB 4R9UC 1OPXA 3WYAA 1FX0A 2ASEA 1NN0A 4MA4A 2YWHA 5G3YA 4Q7KA 4LCBA 2N1BA 3BB3A 1W0JD 1E0JA 2D62A 3KB2A 3LXXA 3V00A 1G8YA 2ZSAA 5EE1A 621PA 3QSYA 4TWZA 4RKEA 3MGCA 1FZQA 1KO7A 2QENA 2ZRBA 5FOUA 1M7HA 4XSHA 4BFUA 1LS1A 3I62A 3LBNA 5CB8A 3DKPA 2BVNA 4JBWA 4M1KA 2GRJA 2FPLA 4IOKA 2IW3A 2XTNA 3MD0A 1MABA 4GNKA 2LCFA 2LKDA 2O0JA 2YWFA 2GBLA 3IKJA 2BMJA 4IDQA 3T06B 1JBKA 2H16A 3CNNA 1XEFA 4TZ0A 1WA5A 1N6RA 5E7JA 2EQBA 1KNXA 1T8TA 4JL6A 4QGHA 4FIDA 3SJZA 1ODFA 2DB3A 4C2TA 2QRNA 2V3CC 1Z29A 3OE7D 4DHEA 3BOSA 5CLQA 4LOAA 1US8B 1S4QA 3CPEA 4GFDA 5BW8A 5JCPA 1T8UA 2W2XA 3FMFA 1ZU4A 3TKLA 2V6IA 2V1XA 2HV8A 3AH8A 4F92B 3A1UA 1N3BA 5EXPA 4HEJA 4C30A 3PUWA 2W0SA 3P4XA 5DHFA 2GAAA 1NKSA 3QG1A 4LYHA 4Q4HA 2NMVA 4D0LB 1ZM7A 3K09C 4II7A 4POAA 2OBMA 2HLDA 3QXCA 2E87A 1FPMA 1XF9A 3A1SA 1CIPA 4GSYA 5BN4A 1X8KA 3DHWC 1RRGA 5CB6A 4I99A 2C77A 1O3YA 2IXGA 1XEXA 3I32A 3NVAA 3SHWA 4V02A 3UIEA 1CBUA 2ZE8A 3GJ6A 4FCVA 1US8A 3UKDA 2BEKA 3VFDA 2G1KA 3M1IA 2F43B 1Q0UA 2ZTSA 2FSHA 4I81A 1VECA 4PQYA 1E0SA 2GCOA 3ASYA 3HU2A 5DGXA 5CLLA 5BYJA 1KI6A 4O0MA 2R8RA 3OEED 2F55A 3CX6A 1N6KA 3KJEA 3PEWA 1E2DA 4IDOA 1II0A 1KO1A 2O5VA 3GFTA 2R6GA 2QE7A 2WPDD 2HLDD 2R6FA 4JLVA 4YDHB 2WWWA 3EA0A 5DSZA 2QP3A 3KDSE 4C4PA 2QU8A 2F9LA 1P62B 5JEEA 2P6UA 3L43A 4A2WA 2NZ8A 4NYIR 2NO6A 1TPZA 4ILEA 1AJEA 2GNOA 5BN3A 3T15A 3W3ZB 4Q66C 1QHIA 1UKVY 1OH8A 5GJVC 2FN4A 1VYTA 4AG5A 4UNPA 2GETA 1KMQA 1PLJA 4QRHA 3NH9A 2GK7A 3KKQA 3LY5A 3QEOA 1TMKA 1OJLA 1DAEA 2DCUA 2YOGA 2UVQA 4I1UA 3RABA 4URZR 1P73A 3RRNA 1HEIA 3PENA 2FGJA 3A4LA 1XD2A 3BK7A 1ZUIA 1BIFA 1ZUHA 2WJGA 4YMSA 4JLJA 4PSVA 3WRYC 1KJWA 1M1YE 1I4TD 1J90A 3K0CC 1HY3A 4XTCS 4YDSA 2WJJA 2WKPA 2H7VA 2WVJA 4PPGA 4BLRA 3H2YA 1F2UA 4FCWA 4YC7A 1IN7A 5DLQC 3BH0A 4QGGA 4LYAA 1SXJD 3REFA 1KMHA 1GL6A 1XX6A 2MMCA 3ICQB 1AS2A 3WBJA 1RYHA 4J0QA 3OIVA 4W5JA 1ZC4A 3PUYA 2PEZA 2WOJA 3B5JA 3JZAA 2VIIA 5FR1A 4PC7A 3EG5A 4D26A 2W83A 3ECCA 4HLQB 4B34A 4A9AA 4LJ5A 4KVAA 1U0JA 3Q3JB 4HLCA 1P9NA 2Z83A 2CE2X 2NZJA 1KKMA 2DPXA 1Z0JA 2J3EA 4OL0A 1CLUA 3X1ZA 1RJ9A 2N46A 4GBMA 3KQUA 1W7AA 2J46A 2OBNA 1BMFA 4Q9KA 3ADCA 2PJRA 1ESMA 4TLCA 3GLIB 2JLVA 1L4YA 2EFHB 2PMKA 2A5YB 1FNNA 1XPRA 5TDHA 3AVWA 3HPRA 4EPVA 1AS3A 5BXQC 3PEYA 3HJNA 1N2CE 1QBKC 1SXJE 2HXSA 2QAGA 4KLNA 1OW3B 3DZDA 2FSFA 1GTVA 3EZ2A 4HUTA 2FDCA 3FDIA 4A82A 3GLHA 3FVQA 3K8YA 1Z0AA 4QG7A 1GSIA 3VX3A 1RVDA 3KFVA 2HT6A 4TMWA 1NNEA 1H8HA 3OIWA 2GEDA 1RZ3A 1P9RA 5H68A 4LJ9A 2ZR7A 1W4BA 4XVRA 1P2SA 4KCGA 3QXSA 4BE7B 4EAQA 2O8EB 3IBYA 5FBVB 3FHOA 1ZM9A 1W36D 5E4FA 3C7KA 3MJHA 5ELXA 3AVTA 3EPLA 3TR0A 2DWOA 1Z28A 3L0IB 3Q7QA 3U6BA 1S2MA 3JVVA 4AIIA 3VR6A 4HUQB 1SVSA 1G5RA 1Q12A 2I4IA 5EP2A 2IS6A 1KGDA 1COWA 1TF5A 1N6IA 3HYRA 1CR1A 5CIQA 1NMYA 1E9DA 1M2OB 2VBCA 3RRZA 2EYUA 4M8NE 4C0LA 3U6KA 2IS1A 4Q5IA 4JS0A 1D2MA 3K0AA 1W44A 3K0EA 2WWIA 3AF0A 3P27A 2V54A 3LH5A 4Q9LA 4YXWA 3W3AA 4EJSC 1H8HD 2UKDA 3JVUA 1LVGA 1XBTA 2R65A 1TF7A 2R2AA 2V6JA 1W5SA 5AUQA 2XZLA 1NSFA 5TB5A 2G0TA 2EFGA 4Q1BA 2WIAA 2IYTA 1E2HA 2A5GA 2OFOA 1J2JA 2GJKA 3NBYC 2ZRHA 3OF5A 3QPUA 4P0TA 1CJKC 1Z6TA 2QEQA 2KWIA 4NYMQ 4Q9JA 2H57A 2SHKA 4XWAA 5HCNA 4OBEA 1UADA 2Q3MA 2QROA 2J0QA 3C5CA 5F2EA 5G53C 2A5JA 2FGKA 3FGNA 1CS4C 2X19A 3KJHA 3AB3A 2JLXA 1JXOA 4D2IA 3AVVA 2CCKA 1EXMA 1XWIA 4US0R 5AUNB 3ADDA 2KE5A 2FE4A 4A0RA 4V0LA 1PLKA 3R9WA 3B78A 3RHFA 2BM1A 1NP6A 4C3ZA 5LBIA 1NSTA 3GD7A 4HAVA 4DLTA 4TYNA 4M1SA 4QBIA 4DLXA 3RNLA 1CU1A 2A2ZA 5J47A 1XZPA 3QF4B 1H8ED 4M9SA 1IY1A 2QTHA 1PLLA 5J4KA 4BFSA 4LV5B 4TLEA 1KI3A 4MGKR 2QT0A 1B0UA 3I3SR 3CR8A 5KYKA 4OKSA 3EZ9A 3MWKA 4NL4H 5JCZA 2Z0MA 1XRJA 1DO2A 1L2TA 1YZUA 2D2FA 4FXPA 2JJ8A 3RRYA 4YQFA 4LHXA 4LJ8A 3PR1A 3NDBB 1M34E 1E2MA 3O8DA 4G3XA 3C4JA 4IFEA 4EKDA 3K0CA 4KHZA 3HU3A 3C16C 1KIMA 3K9HA 5FR2A 4Q48A 4QGAA 3EZ6A 5SZJA 2NO9A 2RKOA 4PQFA 3S1AB 5FBRB 3ZQJA 3L0PA 3OESA 1VYVA 721PA 1IJFA 1P61B 2JEOA 1A82A 4MH0R 1LB1B 1ZD9A 3SFZA 4OHWA 2DFKB 2IEYA 1UAAA 2KSQA 3VX4A 2OE2A 2OAP1 1JAIA 3SC3A 1N6NA 2ORIA 1QHXA 1ZIOA 3THXB 3C14C 4M21A 1VMAA 4KSBA 4IOLA 2J0UB 3V4RA 3MRSA 1KJYA 1K6MA 2EFDB 2ERYA 4BFYA 4PC3A 3K70C 3CRRA 5KDOA 4HAYA 3KKNA 2VPPA 2CHVA 5EP4A 2CNWA 3EX7C 2WIBA 1SKYE 5FPHA 3M0EA 1DAFA 4JJKA 2OLJA 4TYQA 1TUEA 2F7SA 2YJTD 4Q1EA 1ZAKA 3GLFE 1F6BA 2CLSA 2EW1A 1XD8A 1Q1ZA 3EASA 3I8SA 3V9PA 1NF3A 1G64A 1XEWY 2XSZA 2F1HA 2VF8A 3GCGA 2I3BA 2BCJQ 1XTSA 1G3QA 2GJAA 4HAUA 2ZSFA 3EWSA 3KQNA 2R6DA 1MR3F 4M4SA 3ZQ6A 2JCSA 4LI0A 1I4DD 3CW2A 3CM0A 3THWA 5AUPB 4OQFA 4EJSB 1E79A 4N0EA 4UNRA 4Q4JA 1Z83A 4HATA 3I92A 2CNWD 5HE8A 4DDUA 5GVSA 5HE9A 2XOKD 1KY2A 1V43A 3AKEA 3AVUA 4Q9HA 2QGNA 1ESNA 4ZCIA 3WRXC 1N6PA 1ZVQA 4A92A 5DHAA 4PAMA 2ZI3A 3ZYCA 2R6CA 1RRPA 4JL5A 5AJZA 4QOSA 5DN6A 5FFMA 3GP8A 1MV5A 2FWRA 5JHHB 2C04A 1KNQA 2IS2A 4M0LA 3W90A 4NU0A 5LDDC 3DOFA 2O8DB 3EIQA 2RB4A 3KFXA 4E07A 1JEDA 3AF1A 4P31A 2WM9B 2OT3B 2FEOA 2VEDA 4BEJA 1NBMA 2ZVPX 1SHKA 2ZVQX 2NPFA 2YKGA 3UANA 1IONA 2OUKA 1HH4A 3B85A 3ICEA 1E79D 2W00A 1FP7A 1P5ZB 4Q4AB 1XTRA 4HLDA 3BB1A 4CEJB 4IOJA 4FMDF 2ZI9A 3HYTA 4QHYA 2KJQA 4L9SA 3FKSD 1TX4B 2C5LA 3H4MA 4A36A 1UKYA 2HYIC 2XB4A 3EA5A 2O8DA 1JPJA 1MO5A 3VU9A 2WAYA 4M22A 2G3YA 1XMSA 3CO5A 1P2UA 4G1UC 5EE0A 4RFSB 1OHHA 4Q4LA 2JLRA 2VTKA 1G6HA 2XNDA 2QZ4A 1AQYA 4YMVA 4Q21A 3CR7A 5KOYA 4JVSB 4RD2A 3TUIC 5J40A 1NBMD 1XEWX 1ZP6A 3SU8A 2OZEA 1NG9A 4CEJA 1KI4A 2GBLC 3PCRB 5FTLA 1KOFA 2OO7A 1G20E 1VG1A 2ZAMA 1RPZA 4LSGA 2IHBA 1JPNA 3BGWA 1JEEA 1UFQA 2O8FB 3LNCA 5JWOA 2OBLA 1DO0A 1TAGA 4Z1MA 4D25A 2IYLD 1ZW6A 3B1YA 5J4VA 3EIHA 1X8LA 1FQJA 1NLFA 3TJZA 1R0ZA 1KKLA 4PSKA 3WNCA 2V1UA 4B3GA 3LXRA 3PVSA 4BLSA 1ZCAA 4G5QA 4JLOA 4HAZA 2AL7A 4C0AC 4ARZB 3WMFA 4DSNA 1OHHD 3U3MA 2B8WA 3NHAA 2EU8A 1I2MA 2O8CB 1JAHA 3ADKA 3GJ8A 2ZJ2A 2GCPA 1AGPA 2OFXA 5BN5A 5A0FA 3QKSA 1AIPA 3K70B 4DLVA 5HZHA 1NBME 3PITA 2KB0A 4LBWA 1IXSB 1HUQA 1RRCA 1MT0A 1X6VA 5TARA 5AJVB 3B1WA 2YWEA 1M7GA 1NRJB 1RFLA 1D8TA 1JNYA 2RAPA 3DM9B 1ZM2A 4IEIA 4A1FA 3VAAA 1DAKA 2XTMA 1OFTA 2IYZA 1KSGA 1WE2A 4HZUB 2C9YA 3AKDA 3QPVA 2AR7A 4LJYA 5KSZA 4US2R 3QE0A 4TTRA 4DB2A 4CGZA 3BE4A 1GRRA 1IOZA 2H8KA 2B21A 4B3FX 1E1QD 1VTKA 1M8PA 4MKIA 2VA8A 4EPWA 2H92A 3VQTA 1LF0A 3TR5A 1UM8A 4DT1B 3WNDA 1QG4A 4LBYA 5B57C 3SZRA 1R5OA 1EG7A 3M4YA 4PQRA 1P9WA 3SNHA 4NHOA 4C0SA 5F3WB 1UEJA 1XD9A 1TQ2A 2CBZA 2REXB 1EESA 4M53A 3F0TA 4HB0A 2GXSA 1W47A 2NIPA 2ZRDA 4LHYA 3SJBA 2GDJA 3FPAA 1M6NA 1ZNZA 2Q21A 3PV0A 1YKSA 1ZIPA 3QXJA 1SXJC 3P20A 4HZUA 1NVVR 2ZU0C 2IA5A 5EE5B 1VG0B 1DAIA 3RSLA 4YMTA 3NTUA 1K5DA 1CJVC 1PUJA 2IK8A 3CF6R 2ZU6A 5DI9A 4ZCLA 3N5CA 3PQCA 2GILA 1Z0FA 4H1VA 1S1MA 2JAQA 2KBEA 3G5UA 4ABYA 1AN0A 2FA9A 2HF9A 4AY2A 2XJ4A 4RZUA 4DT1A 2ZJYA 2PZGA 4GZMA 2CL6X 3SEAA 5DH9A 2YC4C 5AWFC 3GLGE 1G21E 4M2LA 4TT3D 1NVXQ 5F9FA 3MUFA 2Z4RA 5DO9A 3GFPA 1XP8A 2RGEA 2ZUDA 5FTNA 2DFNA 3SYLA 2QA5A 4EDHA 1P6XA 3AUYA 3HR8A 1T4GA 3QVVA 3KKMA 4URYR 2JLZA 2Z5FA 2ZRLA 3R9XA 1OSNA 4DXAA 2ZJAA 5JMTA 2YNMA 4EPYA 1NKTA 1W0JA 5HKKA 1Z47A 3WMGA 1X1SA 5M04A 1XXHE 4RJLA 4CIDA 5G41A 3B1XA 4IXMA 4R7ZA 3DVLA 3IBGA 1GL9B 1Z8FA 4GP6A 3CZPA 2WJHA 4FN5A 1G7TA 3TSZA 4URXR 2F9MA 3KKPA 2PX3A 4CT5A 2C78A 4H1UA 3RS3A 3WNBA 4QBFA 5K8IA 1WP9A 2G0NA 4NKRA 1U90A 2OG2A 4Y0AA 1NLZA 1AK2A 1E96A 1W36C 1S9HA 3R8FA 4HB2A 4URVR 1DADA 1MABB 1Q22A 4BFVA 2ZRKA 3EZFA 4M1TA 4BUJA 1RE0A 1IXRC 1EFTA 2NO7A 3P1JA 3OIUA 1MKYA 1W49A 2PLFA 3REGA 4M9XA 4A6XA 3OE7A 2WJIA 5KSPA 3VHLB 5JFGA 1IAQA 2BKUA 1UEIA 4KLZA 1SGWA 4X8LA 2R62A 5HKKD 1OXSC 4RZ3A 5L8VA 2QAGC 1BS1A 5G3ZA 4CZ2A 3QKRA 2MMGA 2FF7A 2ZYUX 3VR4A 2YINC 2B92A 1G4UR 5JRJA 4MGYR 1WF3A 4M9ZA 1FW6A 2RCNA 4K81B 2HJVA 4AURA 2RGNA 1DTSA 5HCIA 2CVFA 5C1BA 4CEHB 4QC2A 1J99A 3AGQA 2QPTA 1Y3AA 2IF0A 2VP9A 4Q4HB 4AYTA 3TUZC 1OH7A 1GOTA 2JLYA 1XMJA 4DKXA 2HCBA 3OEHD 3RYTC 4DBLC 2PT7A 2GJ9A 4V0OA 3VMFA 3GQBA 1VCMA 1IXZA 3SBDA 4KFSA 4JLKA 1WBBA 4HDCA 4P33A 1XEXB 2IF2A 2GCNA 4B47A 1U0LA 4Q03A 4N1AA 4W9MC 2ONKA 1PZNA 1XZQA 4NMMA 5IDVA 3RC8A 2ZE5A 3CNLA 4JBXA 2ZITA 4L8GA 2GCOB 2IYQA 2QUZA 2YOHA 3OEEA 4DIEA 5J4LA 2WTUA 5IRCD 4CEHA 1G6OA 4Q9IA 2W2TA 1GWNA 1KI6B 3AUXA 3BFKA 4BRUA 4ASUD 1KY3A 2R44A 2ZREA 4L5BA 2WPDA 1PUIA 2QGZA 4C9BA 4QM7A 1LTQA 1OFHA 4PO9A 4Y0VA 2C95A 1V5WA 2EWWA 3N2IA 2ZE7A 3X1DA 5FBWB 3HWSA 2OCAA 1YU9A 2VP4A 5B58C 1X86B 1NMXA 1BYUA 1XTQA 2P67A 2WJVA 3PEVA 4TLAA 2ZR9A 2FFQA 1SXJB 2V4ZA 3R8CA 4BLOA 1AM4D 3ZS8A 1ZU5A 2RGXA 4DDWA 4FMDB 5H70A 3GPLA 2VSOA 1ZRHA 3OAAD 3RVBA 2PX0A 4IVQA 1KDTA 5C4GB 5HTKA 2REOA 2JATA 1ANKA 1Q20A 4F4CA 1R5NA 4PC2A 1S0UA 5J4YA 4A4DA 1DEKA 1QVRA 3IGFA 1MOZA 4D82A 4F93B 4JT2A 1IN6A 2ODNA 4HI0E 1XD2B 1ZNWA 3RRMA 4HSEA 5JZVA 1ZCBA 4LX0A 3OHMA 4HYYA 4CW7A 2VYFA 5CJPA 1Z0IA 2ZR0A 1Q1QA 1J70A 4EPTA 1SULA 1Z2CA 5J4HA 1JR6A 1NJGA 1SXJA 2ZANA 1CRPA 2ZAOA 1KDRA 3AVYA 1F2UB 2B7BA 4V0NA 2ZE6A 5B64A 3B60A 5C4MA 1KMHB 1QG2A 4GRAA 1C4OA 1S8FA 3KUCA 4PPNA 1XTKA 1WBDA 2IS4A 2NQ2C 2IXEA 2CCGA 1SZPA 4MRSA 4BZQA 1OFUX 2CE7A 5K8TA 3CUEF 1N0WA 1W2GA 4NYJR 1DOAA 1JJ7A 5DYIA 3T35A 2GXUA 2WAXA 4B44A 5CDFE 8OHMA 4U02A 2F1IA 1G17A 1KI2A 1K5GA 1N25A 3AP1A 1GNRA 1WB9A 1DG1G 5SZKB 1E9EA 2H18A 3QBTA 3KX2A 1NI3A 3BRWD 3AVPA 4D0NA 5GADl 1RJ9B 3I5YA 2JLSA 2MSEB 3D6TB 1W36B 1QDEA 1F5NA 1E2LA 2JIZD 4NDZA 3NBFA 3QJYA 4Q1CA 4V0ME 2D74A 3L8YA 1KAGA 5EZ6B 1WDTA 1KI7A 4P4SB 1NN5A 2G77B 2ZETA 3LWNA 4GOJA 1ZNYA 2WWYA 2BBTA 2QMOA 2QAGB 1CRQA 3A8TA 1EWRA 1TADA 4B74A 3Q8XB 2ZRIA 1E2IA 1E2NA 5KPDA 3GLHB 2P5TB 4AK9A 2J7PA 2PLRA 3BFVA 4HAXA 4ZKEA 1XJ0A 3ZLJA 2ZM5A 4M1WA 1F3OA 1OXXK 3IQWA 4PSAA 1RYFA 3TAHA 4B71A 2FG5A 4FWTA 1YR9A 2W0MA 2X2EA 4Q1AA 3TK1A 1CXZA 1T91A 3RAPR 1KYIA 1IN8A 4B2PA 1B23P 4P4SA 2I1QA 1U8ZA 3NDPA 1T5IA 4LGMA 3IHWA 2CJWA 2IYYA 3WYFA 3EPHA 2YC2C 4RCYA 4V03A 5FUYA 4LYJA 4Q47A 2ODWA 4DUGA 4Q7JB 3THOA 3OZXA 5JI2E 4C0BA 3MAAC 2B6HA 4Q7MB 4O2RA 4NTZA 1EFUA 4PFSA 3CF2A 3EZ7A 1GP2A 3VNVA 4ZKDA 4P4UA 3PG5A 1UDWA 2JJ1A 3SYNA 1FUUA 2J7PD 1G5PA 3K0AB 2FFBA 4G5SA 4JLAA 4JSTA 1F60A 4NP6A 4B6FA 4H9GA 4ZPXA 2WKRA 4CEIA 2DBYA 4MKHA 3TSOA 3Q9LA 1W4RA 2GZHA 2FX3A 3IPYA 3K9GA 1D9ZA 3ZGXA 5EXXA 2K5UA 3L2OB 3KXLA 3MCAA 3SQXA 2QTVB 4TL6A 4BLPA 3AGPA 4LC0A 3QVUA 821PA 3RS4A 5FUWA 1CR2A 1SKQA 3X1YA 4B6EA 2FV8A 2VP5A 4DUGD 2PBRA 2GVDC 2Q0HA 2X1VA 3UXMA 3T61A 4BASA 4TMKA 2TMKA 3NEYA 1NVWQ 1DG3A 1U9IA 2JJ1D 4AYWA 2HT1A 2BJVA 4XSGA 3OFND 1U94A 5JSZB 1GITA 4G5OA 5FOVA 1G16A 2D06A 1QRAA 4ZI3A 3K9NA 3MG9A 1SKYB 2JGNA 1FTSA 4WZAE 3K1JA 5JJKA 5HPYB 3IIMA 1S3SA 1VYUA 4QJ5A 5GJWC 2AN9A 3ZH9B 1H8EA 1QHSA 3EXAA 4KYIB 5CITA 3U3RA 1RKBA 4LHWA 2ZYVX 3LBHA 1TQDA 4KYUA 4TSFD 3QUSA 2EVWX 1GDDA 4LWZA 3VR3A 2HCJB 4QGFA 1C9KA 1DS6A 5A4JA 1VCOA 5JSZA 1N5JA 1WMSA 3NC1C 3DL0A 5KNBA 4YLGA 3RS7A 1P7CA 4OK6A 3FTQA 3I72A 4V0KA 521PA 5L3QB 4X8OA 4QJ3A 4TMZA 5KUTA 4XWOA 4DVGA 4GI7A 1R0WA 1VHLA 2CK3D 3ZVNA 1GUAA 2O52A 4LYFA 3U61B 1ELOA 1Z06A 4R71A 3GLFA 2IYSA 2OXRA 1W46A 2F3RA 221PA 2ZQ5A 1XFAA 4DCTA 4MRVA 4XD7D 4IDPA 5FBQB 3Q5EA 1VCIA 2ZROA 4B2LA 1MH1A 4MKFA 2C8VA 3UWKA 3U7HB 4OHYA 4GDFA 1II8B 1BOFA 2Z4SA 1X1RA 2B7CA 4C0QC 1E2PA 4D0GA 2CMKA 4ZIRA 5IK2D 1YZTA 4NZYA 1W4CA 3K0FA 2WSSA 5L3QA 1XNJA 2G88A 4IDHA 5L3SA 1E1RD 3GLIE 3D3QA 2OXCA 4TQAA 1GM5A 2DWQA 3U2QA 4LC1A 1OH6A 2ZJ5A 1J8MF 1E4VA 3THYB 4LJ4A 2OCPA 1LW7A 3NHBA 3AKCA 1VKJA 3KTAA 1DAGA 1A2KC 1ZM4A 4ESVA 4HDQB 3PEUA 1G8PA 2IEZA 1DAMA 3KZ1E 1E9CA 2LKCA 5JJIA 1HURA 4Q18A 2QSYA 5E3HA 1II8A 3NIBA 4LK2A 3QKUA 3VKGA 4XJXA 2ZYTX 2JLQA 4UJ5A 5FUVA 2IBMA 2GEUA 3D31A 4NBSA 3EAQA 3EPJA 1NLYA 4ZDIA 2PMDA 2C98A 4MRNA 4KODA 4DLZA 1HE1C 1P60A 2OHFA 4KFRA 3THYA 4R98A 3BORA 2WSSD 1X8JA 4Z54A 5CM8B 1EK0A 1T0HB 1Z6GA 4R2IA 3C15C 4QM6A 2WOOA 4ITRC 5DYGA 2XZPA 2C96A 4NCJA 1OB5A 1OYWA 2VSXA 3KQHA 5JLJA 3BIFA 3THWB 1ZC3A 4I1VA 2AK2A 5A5GA 4IW3B 4EFLA 4DIDA 2J59A 4Q4JB 4HDOB 1KZ7B 2XOKA 4KXFB 4JLBA 2O0KA 4NH0A 3SHFA 3WP0A 1OYYA 3ZJYA 3MJRA 4O25A 1XCGB 2AHOA 3MWLA 2ZRCA 4MITA 4B3XA 1DARA 2BIFA 3GFOA 1WXQA 4N0DA 2KBFA 5CK5A 1TQ6A 4NCIA 1H65A 2UZIR 4RCZA 2CL0X 1OIVA 1T9HA 2AKAB 2MSDB 3LQRA 1Q1BA 1Z0DA 1GNPA 3CWQA 4TLDA 3TLXA 2DY1A 4ZCMA 2HXYA 1DE0A 1IY0A 1E69A 3T1TA 5L3VA 1TEVA 3G82C 1JJVA 1A2BA 3HR7A 4QHTA 4TQ9A 5JBQA 1SVIA 2ZI5A 4L16A 2QPOA 1GVNB 4U5XA 1D5CA 2BBSA 1GILA 3FKSA 3LLMA 1AKEA 3UG6A 2FPMA 5JJLA 2W6ID 5E7MA 2VO1A 1RC8A 1XPUA 1OLOA 1YZLA 1FQKA 1G18A 3GJ7A 5FUXA 5B30A 5AK0A 2V55B 4RY2A 2ZJOA 5AUOB 1NIPA 4DB4A 3E70C 1G3UA 4PZLA 5TXGA 2ORVA 2QMEA 5IT5A 3VU9B 1CULC 4UNSA 4LV6A 3LFUA 1EFHA 4M1YA 5B2ZA 4HLUA 1P2TA 4LDJA 1QF9A 2GJ8A 4WBSA 1U0HC 1R6BX 3P26A 4JL8A 5HR5A 5FTMA 3U5ZB 2IL1A 4WVFA 1EGAA 4NCHA 4BECA 1PJRA 2WZQA 1YZKA 3IIJA 4A8JA 5UKDA 1G8GA 2OCBA 1IN5A 3BC1A 1DELA 3SOPA 1VDZA 3I1FA 2O8BA 1E2FA 1E4YA 5L3RA 2F1JA 4OI1A 5EP1A 2ZUCA 4EPRA 1CJUC 3NBXX 2P5SA 3BS4A 4GOKA 1QHHA 3LX8A 2NG1A 2RGNC 4TL9A 3LW7A 5J5CA 1G3IA 2IC5A 2PZFA 4AKHA 3EPKA 1JB1A 2Q3FA 4EQ6A 2W2VA 4DLRA 4AWXA 4YMUA 4AKEA 3GLGB 1TNDA 3FMPB 4IVPA 1ZYUA 4LHZA 4M9QA 3TVDA 3W6PA 1UBFA 4D4LA 1E94E 4CVNA 1HT2E 1Q44A 3QKSB 2ZEJA 3FFAA 1YVDA 3U44A 2ZYWX 2OEPA 4PZZA 1S1CA 3NEJA 6Q21A 1C1YA 2EYQA 2ANCA 5LB4A 4GL2A 2CXXA 2BHRA 3NXSA 2WBLC 2EWVA 1J8YF 3GJ4A 1JQLB 3EC1A 4I1OA 3QOFA 3UMFA 4EIWA 1VCNA 2A5DA 1OXVA 2HJGA 1W0KA 1YZNA 2ZRFA 1GZSA 4EFMA 1E1QA 3O8RA 2QBYA 2FSGA 2HEIA 1E2EA 4ZI2A 1R8QA 4P4TA 2AD5A 4E5UA 3GLGA 2P6NA 1O87A 4LUCA 2N42A 3R7WA 2IT1A 1FMLA 2OFWA 4EUNA 3DEFA 1VG9B 5DI3A 3ZZ0A 4IOMA 3Q7PA 2QM8A 4KV9A 1NY6A 2WKQA 4OHVA 4PC6A 4PHFA 3UG7A 5EJEA 3RS0A 3Q72A 2QT1A 1D2EA 1XXHA 3NKVA 4Q1DA 4RD0A 1Z5ZA 5ANRB 1BKDR 3U3KA 4B35A 4ZV4A 1DBSA 1ZD8A 2F1RA 3QEJA 4OJQA 4CT4B 2C9OA 4JYBA 1W0KD 5IHPA 5KNDA 1W5TA 2V7QD 4PZYA 2J41A 2RGCA 5BWMA 3SDZA 4I1SA 1KHTA 2NTYC 2CLDX 1G8HA 2FU5C 2HYDA 3GJ3A 4ERNA 1UDXA 4F4JA 3KQLA 1KDPA 2YV5A 2XEXA 1KO8A 1E98A 2DHRA 3ASZA 3VR2A 4TT3A 1Z3IX 3U4QB 1Z07A 3CNOA 1G19A 3O8BA 2AXPA 4OI2A 3H86A 4D4KA 5GJCA 3PUVA 2ZSEA 2NO0A 2NOAA 3RWMB 4LJ6A 5TVKA 5C18A 3FB4A 1CJMA 4NYMR 1FMJA 2AWNA 2IUTA 2QI9C 1F2TB 4URUR 4UKDA 4LBVA 4JKIA 5FPSA 1U99A 3UK6A 3P4YA 1YZGA 1N5IA 1YJ5A 2QMUA 2ODBA 1BO6A 4G5RA 4MYCA 4GP7A 5TV2A 2J9RA 1UBGA 1KK2A 2QP9X 4PAQA 4UJ3A 3U7FB 2NGRA 3AVOA 1ZMXA 1Q57A 2EFCB 3W34A 3SN6A 2BOVA 3U4QA 1X3SA 4B73A 2IWHA 4ACAA 2RHDA 3Q85A 1P75A 3BFXA 1NN3A 2QSZA 1W1WA 1KI1A 2HUPA 2PT5A 1F2TA 1E2GA 2O0HA 3IO3A 3L8ZA 2ODEA 4RSGA 3B2EA 4B32A 4TTQA 1MO4A 5DISB 5FOWA 5KO2A 4BLQA 2V8OA 2A7QA 3BB4A 1UKZA 1IY2A 3NC0C 1T3SA 3IILA 2FFHA 2IWRA 5JS7A 1G9XA 4BLTA 3K70D 4FWIB 1GKUB 2QNRA 4OK5A 1G4AE 3QKRB 4BFTA 3AV0B 4XOIA 3WHKA 2IX3A 3BJIC 4L9WA 3TIFA 2ZRNA 3TW8B 3VHXA 4OI4A 1AKYA 2RMKA 1YE8A 4Q7LA 3SI7A 1T3LA 4PO1A 1KSJA 3OEHA 4U00A 3W6NA 1ZM3A 3TRFA 1G3RA 3TH5A 4X8HA 5FPKA 2I1VB 4YMWA 2D7DA 4G01B 4FD2A 4DCNA 4I4LA 2P65A 1MRNA 2DWPA 3GJ5A 1KI8A 2Q3HA 5LB2A 2XX3A 3UMRA 1P2VA 1T0JB 2BEJA 2FEMA 1XPOA 3LDAA 2GK6A 2ZRGA 4ZDJA 1HV8A 4KSCA 5KDDA 3IEVA 4ASUA 3LVRE 1A1VA 4GPTA 4TZ6A 4KO8A 1QHNA 3CH5A 1GAJA 3PJRA 2ORWA 5FL7A 1U2RA 2EFEB 3ETLA 1FL9A 1CEEA 4JMPA 2IXFA 1N5KA 3HP1A 4WOPA 2GKSA 1ZD1A 3ZZTA 3W6OA 4NCKA 1EX7A 1CP2A 4W5HA 1YRAA 3TAUA 3CRVA 5D3QA 1E99A 3LO5A 4RVCA 3W8RA 5JI3E 1IN4A 4UNNA 1WQ1R 4BRWA 1XJCA 2BJWA 4DEXA 2WMNB 3J81k 2J7KA 5CK4A 3OAAA 5CDFA 3L0OA 5FPTA 3LQQA 4F7WA 1N5LA 4KBFA 1JXMA 2J0SA 4MYTA 4LBZA 2AKYA 1U9IC 3TW4A 3ND8A 3TSWA 1OV4A 3LX5A 2NPIA 4BPBA 2YYZA 3PXGA 2Q9CA 5FL7D 4S35A 4FMCF 3IHLA 3MFYA 4MGZR 4QNRA 3O47A 3GEHA 4V0MA 4P3YA 5CYPA 2VSFA 5G40A 3ZDQA 2B8TA 3WXMA 1XTJA 4KFTA 1LS6A 4DLSA 1LNZA 3FHTA 1KSHA 1E2QA 2OESA 4D6PA 2VP2A 3TQFA 2CHGA 5CYOA 4OI0A 1GIAA 1R8SA 2VP0A 3K53A 4JBYA 4AI6A 1NVUQ 1VIAA 4O2LA 4KBGA 4Z8YA 1HQCA 1Z6XA 2C9CA 4DZZA 3ZD7A 2PZEA 2AWOA 2F3TA 3MWJA 4QHSA 3B9PA 2IUSA 2ZI7A 3DKVA 4ZDKA 1TU3A 1F48A 1Z2AA 2YWGA 4LHVA 3AF2A 3U7GA 4JLPA 4QBHA 1LF5A 1S9DA 1KDOA 3W5JA 4URWR 2GWHA 4GZLA 2H1LA 1OIXA 4FW9A 4W5WA 3CF0A 1XMIA 3DZ8A 2C03A 1FNMA 1T6NA 5BQ5A 5TY0A 2JIZA 4JVMA 5EUQB 2R9VA 4D4MA 3RS2A 4LPSA 5AJXA 1NIJA 3ADBA 5E7IA 2WV9A 3TBKA 1Z22A 5DNYB 3BH7A 3LD9A 2VHCA 2AFIE 1R0YA 4UNQA 1E2JA 4TL8A 3VNUA 1QVAA 1JQJC 3KL4A 4IEEA 4LJ7A 5K8LA 3L0SA 1ONBA 3DPUA 2XZOA 2AFHE 2XAUA 2FNAA 3KB1A 4MUAA 1GRNA 4MYHA 1IHUA 2Q9AA 3AP3A 3ZVRA 4WW0A 3T5GA 3LW8A 1E9SA 3QXHA 4WA7A 5KDLA 2QTFA 1DVRA 2F43A 2DFLA 2QP4A 4A2PA 5KNCA 3EWAA 2JA1A 1FP6A 1SQ5A 1Z6YA 1I4LD 2A3RA 2G83A 5JHGB 3CRW1 3I5XA 2VF7A 3DM5A 2JJ2A 2OSBA 3T1QA 3C5HA 2CJWB 3RWOA 1LV7A 3FWYA 1NN1A 2QQ0A 4B75A 5SZIA 2ZSBA 5EE3A 1RIFA 2QE7D 2ZPTX 1WRBA 3W8NA 4A2QA 4DCVA 1MO6A 2XNSA 2BM0A 3QI2A 4E09A 4Q02A 4C2UA 4IRUB 2RH5A 4LZZA 4RFVA 1E9RA 4ACBA 1AQUA 2VHUA 3TQCA 1D2NA 1DAHA 2WSMA 1QZXA 4JKYA 4P32A 4CEIB 5H8WA 4BEBA 1OF1A 4OYHA 2Q9BA 3TGPA 1L4UA 1AZSC 1UBCA 4GT1A 3D8BA 4KFUA 4A0HA 3FE2A 5FH9A 4OQLA 2HF8A 2JJ2D 4HB4A 1YR7A 2PCLA 1FFHA 1G291 2VQSA 4M1MA 5FL3A 3R20A 1XB2A 3KJGA 3QNUA 1GKIA 1NG1A 3A1VA 3HPQA 4K8OA 4TYPA 121PA 3BBPA 3EC2A 4DEYA 3H0KA 4MGIR 5CM9C 3LAWA 3OFNA 4X8MA 2E1RA 1RW4A 4KITB 1BYIA 2FH5B 3SFVA 3VKWA 2V9PA 3BAFA 5P21A 1ZBDA 2P6RA 3I8XA 5DE3A 4PR0A 4C0KA 3DOEA 4TMXA 2ZJZA 5FOSA 3O8CA 2DFTA 2A78A 2JLWA 1UPTA 1NL3A 1YHNA 2VL7A 4B3BA 2ZI4A 4HAWA 4D81A 4DDTA 1UJ2A 3AKYA 2H5EA 4UQOA 3MSXA 5GVRA 4MDEA 1G7CA 4AKIA 1Y63A 1KJZA
chains in the Genus database with same CATH superfamily
1AGRA 1XA4A 1JRLA 2W6JA 5A9SA 4PS1A 4LZLA 3NG1A 1Y34E 3O31A 4HFNA 2VWPA 1E7YA 3ZGZA 1T3TA 2C2KA 1QHYA 2V74B 2E9SA 2QPLA 1AA9A 1E3TA 2E5FA 3DUFA 1RRFA 4O4HB 3MTGA 5CMLA 5E2BA 5F52A 3RIGA 2IW1A 1Z17A 2KW5A 4WWHA 4ZT6A 4ZC8A 4V1CA 4TWRA 3RODA 3AHCA 1Z7BA 1QZZA 1G8JA 3R40A 4N7MA 5KOHB 3B2QA 4MMZB 3V2GA 4WHMA 4I3FA 3F6RA 1U0OC 1JE1A 1SUSA 1EB8A 2OD7A 4REOA 4N03A 5DRTA 3DCYA 4JZKA 1YRBA 1GL7A 3FKQA 3LWBA 4G5GA 1EK6A 2HTEA 4XD7A 4F2DA 5KMGA 4CMCA 4KFCA 1A7JA 1X1EA 2QD4A 2KX7A 4P7FA 1I5EA 3PPXA 4ZU3A 3VM6A 3RS5A 1BXGB 2A3NA 4LI3X 3WIOA 4A8JC 5JNVA 3HVHA 3N0XA 3NCTA 3M6VA 3RJMA 3RANA 1GKLA 5FFFA 2PUBA 2DQYA 1TC1A 2AXNA 3B13B 4AJLA 1E58A 1RP1A 1T1EA 2HPHA 3UGTA 3WYNA 2PGAA 4K03A 5IK2A 2DF8A 4BVJA 2FW1A 3K9QO 4MUNA 3SCZA 3L05A 4FB4A 1F0NA 1SUWA 3M5DA 3V9AA 4RWZA 4BX3A 4C0JA 5ICMA 1Q21A 4WACA 3EZYA 1ND6A 1FE8A 4U9HS 3JY6A 2ZYGA 4LDRA 4J49A 1ZJ4A 3E84A 1MX3A 4HUQA 3TLKA 5DKFA 3I4CA 5L45A 4KE6A 1PNRA 4MS1B 5DX1A 1YJXA 3AT1A 4R41A 2ZWPA 5L3SB 1ZMBA 3CPJB 1SA0A 4JGBA 1CR4A 1EVJA 2YMLA 3VR6D 3HV2A 4AULA 5KQSA 1IZ7A 3O3CA 1VJGA 1BWQA 1NVVQ 1SBQA 3P19A 4KWTA 1JHOA 3NS7A 3FJOA 1COWD 3KVNA 4E03A 5JVDB 4YT2A 5K0CA 2P78A 4GYWA 4MICA 4V3BA 3CVWA 1U1DA 4JUCA 1FRNA 5DM2A 2X5OA 3ZW9A 3M1YA 1QKIA 4GSLA 1FTGA 2VG8A 1M6WA 1NZJA 1HE8B 4EHHA 3FFBA 1HZJA 3PDJA 3ZLTA 4FUTA 1EM6A 1Z26A 4K9MA 2BGJA 2P0EA 3JRXA 1Z7EA 1NV8A 4BCCA 3NRJA 1WVIA 3OSUA 3V1NA 4YXWD 2PUHA 1LI7A 5LPNA 1IJEA 1NJ8A 3NHZA 3FBWA 1ETUA 3JYQA 4UUAA 4WXRA 4ZT4A 5BSTA 2PD3A 3BK1A 2ABWA 1J33A 2LWIA 4BFXA 1ZDMA 3S1SA 4RVGA 5A03A 1ZH2A 5IMBA 4JOSA 2JGLA 2W6NA 4KB5A 4FSDA 3ND5A 4MAMA 4UMDA 4EZIA 3OCCA 5D3MA 3DCJA 3FMIA 1DJOA 2PCJA 2BMVA 4RBNA 4QUEA 1GUYA 3SMVA 1OC2A 2YWCA 4Z9YA 4KUHA 5EMNA 3L7KA 2HV9A 4N7JA 3AF6A 1TF2A 2VDJA 1E3EA 2RG1A 1CUZA 1LPAB 5I5EA 4TYYA 2FG7C 1MJGA 1T6BY 2GHTA 3G2LA 3QWIA 4P58A 3U37A 1ZJ6A 5JAIA 1ULSA 3QOXA 4N9WA 4FYMA 4U6SA 2J85A 2Y4NA 4E5MA 1OXMA 1XCMA 2XJ9A 2BC9A 3I73A 5KCZA 1JE0A 2OLKA 3DGEC 3KXIA 2CNLA 2QDXA 3FTDA 1XZIA 2Q2WA 4W1RA 5AO9A 2WWHA 3HCEA 4BB5A 2PX5A 3ZDAA 3TCNA 2HQBA 3KJNA 5C5CA 1HO3A 4BVLA 2FFAA 2XLCA 3AOEA 3JALB 4PX3A 3RVPA 1CY1A 4EM6A 2OR3A 1VE5A 3C8UA 4G1EB 5K0FA 4NFLA 1UBTS 5IKMA 5ITZB 2NO1A 1UBJS 4NFSA 3QENA 1N2JA 1ZA2A 2GZ2A 4DSOA 1QGUA 1PEYA 2CMHA 3IB3A 4RJIA 4H6PA 4TM7A 1P4SA 1HWYA 5LD2C 1JFFA 5A0VA 2OL4A 1L5QA 3LVFO 1V96A 2RSLA 3OEYA 4KRYA 5G1PA 5ADWA 3SYRA 2FI1A 2CMFA 1WNFA 3MLAA 4RTNA 2W6IA 4EPXA 4MJXA 2WWGA 4A0FA 2GESA 3DDCA 2VF5X 4UCXA 3ZS9A 1Z63A 5DDIP 4ABTA 4QOIA 2IPMA 3PHCA 4ER7A 4MDFA 5DK4A 4A73A 2D5CA 3P32A 1PDWA 2XWJI 3SS8A 1AO0A 4GHWA 3E9NA 4LRWA 4PC1A 2XYRA 4RIFA 3IP9A 1IATA 3K1YA 2I55A 3CKLA 1V5IA 4NHEA 2HDHA 2GYWA 3JWGA 1WW8A 1T6YA 1Z74A 2H17A 5REQB 1JLHA 1ZD4A 4I7EA 4P54A 2IBSA 3ETEA 3ORQA 1JVBA 3S1AA 3CGWA 1FNCA 3TM4A 1BGVA 1E6UA 1EINA 2PGJA 3PUXA 4K46A 4EY3A 4CMEC 1UR5A 1FMFA 3ZU3A 2JK0A 3T7DA 4ZALA 2RGRA 2BD0A 2R47A 4YRBA 4KN8A 3KSUA 1VKRA 3ABOB 2ZVDA 4GMDA 3U9TA 1K8RA 1JUDA 4DL9A 2VP6A 3ZTWA 4UFPA 1G8FA 4AUKA 1MMFB 4QOGA 4X85A 2DFDA 3D8UA 3OCYA 2I3AA 1GNQA 1TCVA 2B8JA 2WU3A 3HI6A 3W3AH 4FFBA 2ODQA 4H4EA 3UK0A 5EVJA 4UPEA 2REBA 3GEIA 1OT3A 2XTAA 5FBLB 4LF6B 1JJAA 1YB4A 1RMYA 1I2AA 3UUEA 1E0KA 4XB2A 1O0CA 3IODA 2AC4A 4B6PA 3FVTA 1F0KA 3UYLA 1HDGO 1KQOA 3IJ5A 4ZODA 3I9LA 4MYRA 4X1IB 4CWAA 4GXNA 4D6XA 4XFDA 1GQSA 4DY6A 2ZWOA 2FJUA 3DZHA 1KJQA 3HUUA 4CMGA 1A5AB 4IF6A 4P3NA 4RLSA 5FF9A 2J87A 1O0BA 4AS1A 1WWKA 1UDRA 1CTQA 2ZRMA 1GPH1 1GKYA 2GEKA 4UFOA 4DC9A 2A67A 4IIEA 4BO4A 3UPUA 1YUNA 1CFJA 1VG8A 2P79A 2ZUBA 1EWQA 2QI9F 2RK4A 2BELA 2FN3A 4GBGA 1XL1A 3D7MA 3G59A 4RK6A 2F62A 3A4MA 2XSZD 1Z56C 1T5HX 2G0AA 1OFIA 4U2DA 1VPWA 2B4TO 1P0CA 3U44B 3CX7A 5D7NA 2QN8A 4LRXA 4WNAB 2Z3WA 2UZ0A 2H2GA 1ZLYA 5BR7A 3DL2A 4EJSA 5ADVA 4KC0A 4QU9A 3DQQA 1CEXA 1MT3A 3WB9A 4FKMA 4GOXA 4CTOA 3AK4A 1E63A 1J6UA 4ZCSA 1HKHA 4R2JA 1OE0A 1T2AA 4Y1RA 2QW8A 3WRWA 4EW1A 1B43A 5EWLA 3UGKA 4C04A 3OO0A 3SXJA 3V6MA 1D8AA 3LECA 3UWOA 4U7TB 1H0RA 1ZWLA 1OLXA 3A6LA 4KU4A 3ZI4A 2BI8A 4YRNA 4TRJA 2XUHA 4RF3A 1PP4A 3IELA 4B43A 4E5YA 4EUSA 4GPIB 4NWIA 5GV7A 5JWHA 1OKKA 4LNHA 5K8UA 2XXAB 4RA6B 2EATA 1WMDA 3CRZA 1I1QB 2WUEA 1SU6A 3LX4A 4BGDA 5JNLA 2RGBA 3C8ZA 4B81A 5EYPA 1MJFA 1K8QA 3KV1A 2CNOA 2QRMA 4RD6A 2FHPA 1V3QE 2C5AA 3CRMA 5D3ZA 2CUTA 3QPWA 3WWEA 2P2NA 4JCCA 2N0SA 3GJTA 3GBPA 3THSA 5JNWA 5F1OA 4ENVA 1DKNA 3LC2O 1XXHB 2VJLA 3OOWA 4KQ2A 4XASA 4EEKA 1GG2A 5I4KA 4CLDA 4F1WA 1BHO1 2FMXA 3GHHA 4PAOA 1LRLA 3BH6A 4PF1A 1XKTA 2P1ZA 2O2JA 4US1R 3T34A 2F6RA 1DOZA 2EQAA 2HZ7A 2IVZA 1VIYA 1CD5A 4RELA 1G7SA 5AOBA 1R4AA 4Y6PA 1BQ3A 4JITA 2P5YA 4PPQA 2NVWA 4FINA 2CEAA 2R8YA 3A1WA 1THTA 2X40A 1O5IA 4JSYA 5HFAA 3UMSA 3KUDA 5BV0A 5GZ1A 2O5EA 5JH7F 2WQ7A 4PRYA 3CZQA 4QU8A 1U7WA 4UASA 1GGMA 3KQYA 4P36A 3B5EA 1URPA 2H7XA 4RZ2A 4R9VA 2YFHA 4OK3A 3DMNA 2XRFA 1SVMA 4Q1FA 1B15A 2A9FA 5JAUA 3MHTA 4BQIA 1AKRA 1CNEA 3GEEA 4A0QA 2VJYA 3FI9A 3INYA 3AVXA 3MUOA 2PSFA 3F90A 2Q1SA 3HA2A 3DXXA 2XNDD 1SOVA 4I5DA 1R5BA 5IBCA 4XUEA 3H2KA 2JGFA 1IE3A 1KC3A 4AG6A 4LJKA 1Z4NA 1E4OA 5AP9A 3LC1O 4D4JA 2BDEA 2IYWA 5H4HA 5A6SA 1R5JA 5JQGB 2P2LA 1BGWA 2ET6A 5TMPA 3G0IA 3H5RA 4HGQA 4OQQA 1RKVA 4D3SA 4UU1A 3B1ZA 1AUPA 1L7NA 2YJNA 4HNAA 5I3CA 2ATVA 2BM9A 5HZKA 2WJ6A 2DR3A 1HFKA 3VPHA 2Z6VA 2VQFB 4CLHA 3GC6A 1T4CA 4KGDA 4NR0A 4YJFB 5FI0B 3UAZA 4N76A 5ARBA 4U7JA 4I4CA 4G1MB 3GRYA 3CPHA 4FMBB 1TIPA 1BH2A 3R77A 2NU7B 1QYIA 4W1QA 3TE6A 4HDNB 1N0VC 4KVGA 3QV2A 4ARZA 2A5FA 3NAMA 5HYVA 1RWNA 1ZA1A 4I6JA 5CX1B 2EBUA 5G4KA 4TZKA 5EZ5A 5I5GA 4DLWA 1F20A 3QQ5A 4J03A 4PNHA 3LLUA 1WMAA 4A0GA 4ZHQF 3GVPA 2CSUA 1P3JA 2RI1A 1V71A 1XU7A 4DLUA 1LY1A 1TL7C 2XVYA 3LA6A 2H65A 5GMOA 1H1LA 4IBOA 3AW9A 3GGCA 2I8AA 3AWDA 3HU1A 4FYYA 3QX7A 5CPFA 2JBHA 3SHOA 4AP5A 3INTA 3UCEA 5JCXA 1D9XA 2Z8XA 4YJ3A 2YOFA 3PGA1 3F5FA 4G23A 1ADFA 1UH5A 2HNAA 2IQ5A 2VDRB 3KVYA 4I50B 3LHDA 3MRVA 4I66A 4N0MA 3ZVLA 1XAIA 2FWJA 4O33A 2YW2A 2KS6A 2SECE 5HQJA 1DPFA 1KAQA 1G9TA 1R7RA 4EY7A 3CW9A 1O0SA 1G1AA 1W9HA 1MO2A 3PTLA 4FNMA 3DZJA 1V8BA 3MMPA 3RC3A 3TQHA 4NQZA 4CCYA 4G0NA 5C4IA 4OLAA 1KAOA 4LVOA 5A9TA 2R68A 1U7TA 4PHTA 4BQSA 1QCZA 2QVBA 2JL1A 3DDWA 3AP2A 2O2HA 1GEEA 3IUMA 4MRMA 4OGFA 5LLTA 3FPJA 3FWZA 4CIXA 1EVYA 4ZVNA 4L4UA 3MFQA 3A4IA 2PL9A 1PYDA 2WSLA 3K2BA 5JE8A 3UN1A 1EGQA 2INGX 5IF9A 1D6JA 3NTRA 1E3IA 4X6YA 1KMIY 2DPMA 3PFGA 1K9SA 1JALA 4PZEA 5KHLB 2IEGA 1PDOA 4HR7A 4P34A 3GMTA 3SPXA 4UXJA 3S2YA 4HNSA 3L0CA 3ZDCA 1ZVKA 2CHQA 1Q3HA 3BL5A 4KAJA 3U4QA 4YR7A 2W9XA 4B3JA 3K71B 1CYDA 1O94C 2B8NA 3EVZA 3CX8A 3JQ9C 1V37A 3E05A 4W7IA 2WZDA 4GO1A 4U7WA 3ANNA 4ODIA 5BSFA 5JJ5A 3T5BA 2J4DA 1OIWA 3BUSA 1NQTA 4MW4A 2ERXA 1YO6A 3BD9A 4FD3A 3TQIA 1BQ4A 5TE9A 1SUCA 4XEHA 4DNQA 4D7AA 3QY0A 3PCXA 4P5PA 3FLBA 3JWEA 3VA7A 3KALA 2QRKA 5I7OA 1PVOA 4IJMA 4QJIA 4UBOA 3ZU5A 3SDBA 3NOQA 4UZSA 3WY9A 4KSYA 4AZ3B 4HK4A 5FAXA 5T57A 3OJWA 1L7VC 1NW8A 1F1BA 4DMCA 2J9ZB 1UK6A 5IAJA 3EQ8A 3V4LA 3KCQA 1W8IA 2DKOA 3JARB 1UBOS 1IDOA 4M88A 4WZ6A 1XOIA 3LZDA 4IIUA 3UT6A 3K0SA 3VRHA 2E4UA 5BURA 4JIMA 4A8PA 5LC1A 2Z6UA 3HRIA 4L28A 2AEJA 4J2TA 5F21A 3WYAA 3AG6A 4KXNA 4MP3A 1KTIA 2YWHA 1YJCA 3P0RA 3QVLA 2W6MA 4Q7KA 4LCBA 5FADA 1YNOA 4PYKA 2KLHA 1E0JA 2ASVA 3V00A 1AF4A 1L7PA 2AFIA 5EE1A 3ZZNA 5IZ4A 3IB6A 2B4RO 2O3RA 4M7RA 5KSZA 3QSYA 3L1HA 4RKEA 3GRCA 1KO7A 2ZRBA 2C29D 4IJKA 4BFUA 1LS1A 2Q4OA 4LKRA 1SCUA 1X7XB 4CTJA 1AB6A 2BVNA 3FBGA 1ADJA 3PI7A 4PZAA 2AC2A 3SJUA 4A3SA 2FX5A 3K32A 3MD0A 3DMTA 3P9PA 1ZICA 2PBZA 4GNKA 2YWFA 4AVYA 2GBLA 3IKJA 2BMJA 1T5OA 4JB2A 5D6NA 3TSAA 4LTMA 3U3DA 3T06B 2H16A 3V8VA 4FS8A 1JQBA 1J42A 3E7FA 1N6RA 5GP1A 2EQBA 1KNXA 1ZN8A 2DECA 4JL6A 1K0UA 1SC4A 4O4JA 4QGHA 4BTEA 4DIKA 3QTTA 1CYEA 4TTVA 2DB3A 4E5VA 1T3ZA 1C0LA 2F48A 3OE7D 4DHEA 3PNYA 3G1UA 1LXCA 5JZ9A 1T9KA 1US8B 5JISA 4R40A 5DWQA 2VHXA 2X5NA 4RVUA 5BW8A 3A2KA 1T8UA 2Z1NA 5B58T 2W2XA 2VHEA 4UMVA 4AF6A 2WJWA 4HBZA 2HV8A 3AH8A 2W22A 1ZRSA 2F4VB 4F92B 5AI0A 1P8JA 2WJZB 1C1DA 4PINA 5DBHX 5BP7A 1BE1A 1CNFA 4D9NA 2NMVA 3RFCA 3TRIA 1TIBA 3K09C 4II7A 4S24A 3DOCA 5IG2A 8MHTA 3UBMA 4ADSG 3V42A 1CUJA 1FPMA 3NGLA 3A1SA 1B4DA 3RC1A 2ZUFA 1BCRB 5BN4A 4LXQA 3DHWC 4OXYA 4H6WA 1F2DA 3P0HA 3UAYA 5CB6A 1WB4A 3AI7A 5FLYA 5IUNC 2VNAA 5TQVA 1T2FA 2C77A 1O3YA 3BM5A 3I32A 4LE2A 4HFJA 2BONA 3SOZA 2GN1A 4TTTS 1PJLA 3FSEA 4FCVA 4MIKA 1JKFA 2PWYA 3GJRA 1B6TA 3T7RA 3U4GA 4J7CA 4BNNA 4D45A 4NJOA 2ZTSA 3F4LA 2I78A 4FJ1A 4I81A 4M0FA 3EDRA 5BSHA 2HA2A 2Q8NA 3ASYA 4MIEA 4ENTA 2DUWA 4G5XA 1H2ZA 2N47A 1NUQA 1E1CA 2R48A 3P9CA 1LA2A 3UJ7A 1GUDA 1GXSA 3HY3A 3NYQA 2QYHA 4HWSA 4JUAA 1Y81A 5GONA 3CX6A 2HIGA 4HHEA 4HH0A 4IINA 1JLKA 3TQRA 4ZMBA 4B85A 1X77A 3KWMA 4RESA 4Z53A 3C1OA 1WXFA 2NU6B 2P9EA 3LYLA 3Q10A 4BAGA 4WJLA 1XLTA 2FVYA 3GRUA 2YJ5A 2IOFA 2R6GA 2WPDD 3DO5A 2HLDD 3RDPA 5AOCA 2AOTB 1E4EB 3JVIA 3KDSE 5DNWA 2QU8A 4AO6A 3KEGA 1RWWA 2G71A 3EXHA 1JHXA 1B7GO 1Y4AE 2P6UA 3F98A 3M49A 1E6EA 3VI3B 4ZYTA 5LQMA 1L5ZA 4V0SA 2C8LA 1VYHA 2ZJ7A 4ILEA 5I8WA 3QYAA 3IDFA 4BTVA 3A70A 3ZJ5A 1VYTA 2Q4DA 4AG5A 3NP7A 4Y2XA 1PLJA 1GJRA 4B4KA 5L4NA 3NH9A 3LY5A 2FEWB 3QEOA 1UK7A 2DHEA 3RASA 4TKVA 4HS9A 3TBHA 5I7EA 1R4NB 2UVQA 1M1ZA 5BYAA 1Q1NA 1QLJA 3ISTA 4OQYA 3T3IA 2W2PA 4URZR 3Q8LA 5BY2A 1HEIA 2IODA 4M9CA 1XD2A 2NN3C 1JQ5A 4HEQA 2WJGA 4MQ5A 4YT4A 3BJRA 4JLJA 1EQAA 1SXIA 5AVXA 3WDSA 1X0XA 3V46A 4WK2B 3U4AA 4XTCS 2DQKA 1HEYA 2ECFA 4F71A 4RX1A 4BLRA 3H2YA 3CZCA 4OFXA 5JC8A 1AB5A 1ZN9A 3D7LA 4YC7A 2RH9B 2XUOA 3I9V1 3LX6A 4KO3S 4MQ4A 2IEDA 3REFA 1KMHA 3E8MA 5M7EA 1XX6A 3UPDA 3ICQB 3OTQA 1AS2A 2J3LA 5EIFA 1Q11A 3DFUA 2C4KA 4J0QA 4W5JA 4G07A 3TPFA 2ZQYA 1P1IA 2PEZA 2X9VA 3WV5A 4Y8VA 1WDWB 2VIIA 3CKMA 2A84A 1W1IA 2FLVA 5TJHA 1JT9A 3ECCA 4HLQB 4LWPA 4EX6A 5JSHA 2L17A 5DGCA 4YRTA 1U0JA 2GCIA 2X4LA 3Q3JB 3RYFA 1BZYA 5C8VA 4UTNA 2RHCA 2VZ0A 3WLTA 3N6XA 1A9QA 1P9NA 4MTLA 2CE2X 2C2OA 2DPXA 1Z0JA 3MCTA 3OIGA 4II2A 4AQDA 5A9SB 1ESCA 3A26A 4GBMA 4NQRA 3DHNA 2JBAB 3WLSA 3IE1A 4NNJA 3ADCA 1K27A 1YRLA 3H42B 1X1BA 4S0XA 3ZE0B 1GGEA 3ENKA 2VCEA 2JB9A 4NPAA 2YJ6A 2PMKA 4R54A 3RUAA 3ZGVA 3IS3A 3FPBA 3KT8A 2JEYA 1SR8A 1PJ4A 4IGFA 5TDHA 4DW8A 4MLDA 5ERYA 3NM5A 1JA1A 4V1CB 1Y37A 3QTBA 3KHTA 1SXJE 1N75A 2IIQA 2QAGA 3L07A 4EHLA 5IVHA 1GTVA 3EZ2A 5AYVA 4EGJA 1GD1O 3MINA 4HUTA 2ORED 1C9NA 2FRVA 3DVSX 3FDIA 3K8OE 1DPGA 3K8YA 4LSWA 3IDAA 4MUGA 4ZOEA 3PDUA 4Q6BA 1ZGZA 1UBMS 5T4HA 1VLVA 1F6WA 1NNEA 4OU4A 3SX2A 2LW7A 5AKGA 2HFJA 3ZDEA 3ZWXA 3U1BA 1SKMA 5H68A 1IXKA 1O6FA 1W4BA 1ZOLA 2FB9A 4BE7B 3IBYA 4NE9A 4EGSA 3BA1A 5E1DA 3MK31 4JC8A 1R6UA 1W5AA 3MJHA 5CFPA 3EPLA 1RXUA 4XWTA 3WWPA 4N65A 3TFQA 3B36A 3CY6A 3JQ7A 3CUTA 3U6BA 4BP9A 4J3NA 1V3TA 2WB2A 4R2WA 4HUQB 1JJBA 3SC6A 1SVSA 4U2EA 2I2WA 1G5RA 1Q12A 1MRZA 3HCFA 4I9UA 4PLZA 1OA1A 3AL0C 1TF5A 1N6IA 1QO0A 1SA0B 1TMOA 1NMYA 4K2AA 1CY8A 1PVDA 4JBGA 4XYLA 1OWMA 5B2EA 1ZOPA 4AJHA 1GGHA 3I0NA 3T5TA 3VSCA 3WISA 4Q5IA 5IKPA 1O6CA 3EUFA 5LLDA 2YXLA 3IALA 1ZK2A 5A3SA 1J9EA 5IWCA 3WL7A 3GFQA 3I6IA 3SNKA 4CMHA 1VE3A 3DFMA 3K0EA 3HJBA 1G2OA 3W3AA 4GVXA 4OYLA 5LXTA 3H5IA 1W5SA 4G4IA 1NC3A 1WNTA 1PSZA 3IUPA 1NSFA 5DX8A 1JLSA 5ENDA 5TB5A 3V8RA 4RGQA 3DTTA 3CLHA 4I4TF 1JKJA 4BNYA 2GNPA 2EFGA 4BMYA 2C7BA 3WGVA 5HIKA 3WIUA 5K2MA 3PRHA 1E2HA 2DLCX 4WASA 1EBUA 3NBYC 2ZRHA 3BZBA 1XZ8A 1N77A 1KFEB 1Z6TA 2QEQA 3T7TA 2KWIA 1GNVA 1N9KA 1AQLA 2SHKA 5HCNA 3FMVA 3X1MA 1LWOA 4KR7A 1CEYA 1ZK1A 4BDTA 1FEZA 4DA8A 5I47A 4C7KA 3VVMA 4WCFA 1DXQA 3ORYA 4B8WA 5G53C 1FVXA 4K9OA 2A5JA 1ORRA 1I2ZA 1HETA 4KZPA 4LKOA 3ND7A 5AD1A 1CS4C 2X19A 4Q0MA 5B7QA 1JXOA 2GO1A 4PLGA 2VTBA 4N8DA 5EXDA 1TJNA 1WUHS 1GPJA 3D81A 5AUNB 4HGPA 4KXMA 2RIRA 3OCZA 5AH0A 4QUBA 3ADDA 4A0RA 4V0LA 3KT3A 4NBVA 2HPZA 3R9WA 4YO7A 2YZ7A 1Y8AA 1YULA 1NP6A 3IJRA 1TFUA 2X3UA 4ZVUA 4C3ZA 4JROA 3GD7A 1NBOA 1PYGA 4HAVA 4HXEB 4KLRA 3N2ZB 1CU1A 4J90A 1PX0A 4I8XA 3RBXA 4XLZA 4HRAA 3VZBA 1H8ED 2XR1A 3L7BA 4M9SA 3C3MA 1JG6A 2DKNA 3HGQA 2UXDB 1JFFB 2I6TA 4D44A 1Y7LA 3FVVA 3IMGA 2JAHA 3KOWA 3EZ9A 2QN3A 3DNPA 4IZHA 4NL4H 4YIHA 1NW7A 4K9SA 1D6MA 1BEUB 2EJTA 2HA6A 5C8DA 3CXUA 4RVSA 3KFLA 1ZUWA 1L2TA 2D2FA 4YQFA 3ANMA 4HJRA 4LJ8A 2HR1A 2Y71A 3PR1A 3FFTA 4IJ6A 1A50B 2Q5IA 4MKRA 2HOQA 4EKDA 4H08A 2P7HA 4KHZA 5FA5A 3Q9NA 3HU3A 4PYLA 3C16C 2C8JA 3PLAE 3K9HA 3DZIA 2YXPX 4H0CA 3EZ6A 1BHQ1 4UD6A 4AP6A 1GSAA 4ZZ1A 4IJUA 4PQFA 2GB4A 4JC0A 3LCJA 3S1AB 5H4GA 2XB6A 1QH1A 1CJCA 4RHXA 1A82A 4XGRA 4F2HA 3PGKA 4LDZA 3SFZA 3O9ZA 1WVGA 3IV7A 4K0RA 3ZZ1A 4FOPA 2R6R1 3O4RA 2ZKIA 3CFYA 2ORIA 3KUKA 3AERA 4MOWA 4RHCA 2B0CA 2DSTA 2ZUTA 1XELA 1ECFA 1R66A 3V4RA 1TVKA 4BNIA 1K6MA 3IQGX 1MAAA 4AMUA 2CXRA 4GOOD 3A04A 3IFSA 2DQ4A 4TS4A 3K20A 3ZY3A 3EX7C 4YAGA 1V3UA 1SKYE 1SVNA 2ZDGA 3BIOA 3BA6A 3HBFA 4IGIA 5DCLA 3N6VA 5IULC 5EXEA 3ETJA 4JJKA 4ZJZA 4TYQA 4IDGA 1VB3A 1KJ9A 1ZAKA 1PBNA 1F6BA 3DVRX 4B3IA 1WXDA 2EW1A 3UYKA 4YHHB 4Y0NA 3II6X 3HCBA 3V9PA 3DZFA 4MGHA 3V3KA 1V25A 1G64A 3SDSA 5F3RA 5CCXA 3ECAA 4MRAA 1B2RA 1DRJA 1DUIA 2I3BA 1G3QA 2AMFA 5EJGA 2R6DA 4B7UA 5ALNA 2TSYB 3VJKA 3FKJA 1GPBA 1D1TA 4XWYA 5FQNA 4CMBA 3I04M 3UAXA 3M33A 2X4IA 2XOXA 3FPCA 2QOEA 2YZKA 3MGKA 4ZK2A 1Y4DE 4EJSB 3FETA 2J9FA 2IUFA 1D1QA 4O8ZA 4Q4JA 1G8KA 2PRJA 3NFYA 4FOSA 1LBTA 4X92A 2C42A 4DM7A 2RI0A 2B37A 2M6LA 4WKNA 3AXSA 4CDNA 1QIKA 1EM8A 5EWLB 4UZFA 3D2CA 4XUCA 4JWTA 2XGMA 1V43A 2K87A 3ZZMA 3AVUA 1OLXB 1Z2NX 4Q39A 3HA3A 2UXBB 1EQUA 3LVBA 2IQIA 4YFYA 4KQGA 3LE8A 5TT1A 1SOUA 4A92A 3CC8A 5KTTA 1PEAA 3KP1A 4U7FA 3WFIA 1UPXA 3BHMA 1ZX1A 1AZWA 2Q2VA 5K3CA 3WC4A 1EK2A 3HCRA 3W4IA 4N5DA 4DCOA 5JHHB 4OF4A 3KU4A 2IS2A 1EEHA 5EYPB 1LTHR 4IZIA 4GLOA 3DOFA 2Z3ZA 4IJVA 5I7WA 2RB4A 3VBEA 3WGJA 3L8HA 4F6RA 1QX4A 4LNUA 2R97A 4P31A 2WM9B 4XW2A 2OT3B 2W2KA 4OPMA 2XODA 2PWPA 3RT7A 3SMQA 2ZVPX 1YBFA 3CZ5A 1PZEA 3IAXA 1HLDA 3ONEA 4BHTA 5D6OA 5JSQA 3H4TA 4BZWA 1E79D 1MJ5A 4E08A 1C9EA 1P5ZB 3I2FA 4FHDA 2Q4BA 1FB5A 1EYZA 4XPIA 2ZIUB 3EVFA 4FMDF 1EBBA 4PCUA 4QHYA 2KJQA 3OM9A 4LDNA 4YCLA 5AW5A 5HDQA 4ZI7F 1TX4B 5FUBA 3W2EA 2LBPA 2W98A 2VRBA 4EBBA 2FMUA 4KBYA 3NBUA 4EUFA 1N8SA 1ZLXA 2JIPA 1UKYA 1ZK3A 4BVKA 3UB4A 3BQMB 4G36A 4GQIA 2O8DA 4G09A 2ZWAA 3ZVKA 4QDUA 3OKCA 4M7WA 4YHBA 4U7GA 1K7EB 1XMSA 1YS6A 5EIAA 4AY6A 3BXXA 4QZVA 5EE0A 2Q49A 5LN1A 1WIWA 4H4CA 1VL6A 2R1TA 1NJ2A 3MXOA 1K6IA 1QDLB 4RY8A 1X39A 5KOYA 4JVSB 4RD2A 2AA3A 3B48A 3QNMA 3JQ8A 3H9JA 1ZP6A 2PGLA 4YJHA 2OZEA 3FCEA 3SU8A 2I9KA 3D5EA 1KOFA 2NV2B 1I1NA 3DV2A 4GVLA 1NXSA 4M46A 3RVMA 1L9XA 2IHBA 3KWJA 3TOZA 4EJ6A 5BMVF 1UFQA 4QVIA 3A05A 3EDMA 3EBPA 8ABPA 4JLWA 2OBLA 4GOMD 1XDUA 4JQZA 4HQKA 1TAGA 2FZWA 4MV1A 1W2WB 5F7XA 4D25A 3GROA 3C6XA 3VDXA 1W30A 4RGVA 1OI2A 3MS2A 5K0EA 4AS3A 4RS3A 1FQJA 1T4CB 4OVKA 1FFEA 3RM3A 3TJZA 1P29A 4PSKA 3EG9A 2YJ3A 2WW8A 2V1UA 3PVSA 1RP7A 2G08A 5F5XA 5EFZA 1HORA 3BZUA 5KU7A 4ARZB 4HN2A 5FNVF 5G4KB 3U3MA 2NZUG 3M82A 2B8WA 2EU8A 4DYVA 1H9CA 3LC0A 3ADKA 1DEXA 1KVSA 1Q14A 3DFIA 3GJ8A 3RD5A 2WUWE 2ZJ2A 3WKAA 2JS7A 2H9IA 3QKSA 3WGZA 1W29A 1AIPA 2DPGA 3QFRA 4DLVA 1QS0B 2I4RA 3K70B 2YH2A 1IXSB 1HUQA 1VE9A 1H1LB 4K1LA 4MAFA 4PSDA 1FTYA 1MT0A 2HUNA 3DP7A 1AGXA 3LJKA 5B3LA 1NRJB 4YJ3B 5L9AA 1QZUA 4U63A 1IHOA 1IU9A 1DAKA 3NHLA 5D85A 4RDHA 2IYZA 4TRNA 1R8YA 5DGDA 1KSGA 1PG2A 1DAOA 1WE2A 1YVRA 2F3UA 3CLKA 3RF7A 1X7YA 3EXG2 3QE0A 3HDJA 1QHEA 2ES4A 4Q3OA 3BE4A 2W2NA 5CW2A 4CCYB 2HWYA 1FXWF 3V2HA 2E18A 4ZHSA 2PKQP 3G2MA 3TR5A 4OP2A 1EFDN 4K3UA 4E6EA 1UM8A 4MRMB 1K4MA 5B57C 1GRVA 3UM9A 3SZRA 2ISCA 3MCVA 4G1VA 1EG7A 2Y76A 2RARA 3N9IA 3SNHA 1KS9A 2NXNA 1UEJA 1ZD3A 2RHBA 3WYDA 2CBZA 3CKKA 3ZW7A 3W7AA 4YGXB 4L0QA 3F0TA 3CNEA 4OJYA 3NP9A 4LHYA 3CB2A 5J4KA 3G9QA 3PV0A 3V4VB 2OBBA 3AJEA 1QFYA 4E70A 3P20A 1ZXLA 1J0BA 4XAQA 4HZUA 4CU5A 3PQ3A 1DDGA 1THMA 3AINA 3U7QA 3W8FA 3PXBA 3B6IA 4WNCA 2OHJA 1EXVA 5JAOA 2FQYA 3EODA 1AK9A 1Z4JA 3QFSA 1CJVC 1PUJA 2IK8A 4OAOA 2ZU6A 3KYCB 5A3QA 3N5CA 1NXQA 4JDUA 4OKNA 4M54A 5LM3A 1K7SN 1RLOA 3T0FA 2V7XA 4UHFA 1DJQA 1S1MA 3STTA 2XBUA 5DZSA 3VOBA 3E0XA 2HF9A 5FA6A 3UFXA 2TRSB 4DT1A 2YVKA 5AM2A 2CXSA 2PZGA 5IBQA 1DFGA 1XCOA 4EG1A 2YUIA 3B6MA 4F4HA 3SZ3A 3MAJA 3AF5A 2PUAA 4KREA 1R6AA 3PRJA 4JP3A 3SEAA 2YC4C 2FZEA 1F5SA 3OZ7A 4NAHA 4ENPA 1L3BA 3L8EA 3MUFA 1OX6A 5F9FA 1DBIA 1J5EB 1ZQ9A 1X1QA 1U9CA 2AT1A 1U9JA 2KPOA 3DTYA 1NUHA 1XK6A 2NACA 4TVBA 4V24A 2QA5A 3EGDA 3HR8A 3AUYA 4WBXC 2GMWA 3M7IA 3V4SA 3R9XA 2ZRLA 2J0EA 4P2GA 3OA2A 5JMTA 5LU8A 3F47A 4UDOA 5HKKA 1Z47A 2JIRA 3F5QA 1O96A 2H08A 4LRSB 2X0RA 4IXMA 4LRTB 1KFBB 4GMFA 1Z8FA 1GUFA 2BHNA 2YIJA 1S2DA 5K3DA 4FN5A 1G7TA 2AFIB 3CGGA 5H80A 4URXR 1O03A 4FW8A 1JQ3A 3KKPA 3IXMA 1EMDA 5CH8A 1FUEA 4CT5A 1DC7A 1M0SA 4K6FA 6REQA 1YE5A 1PG0A 1SCUB 2OG2A 4Y0AA 1DO8A 4QDXA 3DV0A 1NLZA 3P9ZA 4Z86A 1N1GA 1JMKC 4KQXA 2GKOA 1Q22A 1POXA 1EGVB 5K8CA 2ZRKA 1VBFA 4EVRA 4MIOA 5JCJD 1RE0A 2IVFA 3P1JA 1FFSA 1T9AA 3ZDRA 2PLFA 1ZD5A 2LRHA 1ZMRA 2WILA 3H05A 4MQFA 5JDCC 3GA7A 3HADA 1IAQA 4JQOA 4LGYA 4O4JB 4AJKA 5LZ9A 2AR0A 2YNMD 1QIHA 3UY4A 5JDIC 1Z2DA 2CDRA 1HE2A 1BS1A 3BFPA 4E5SA 5C8YF 2ZIFA 5G3ZA 2WYHA 2MMGA 2ZYUX 5FA8A 4D8TA 2YINC 4KN6A 1KR5A 2CJPA 2HJSA 1WF3A 3R3YA 1HNXB 2BGUA 3IOYA 4BV8A 3AHHA 3HXPA 1HYEA 3PPVA 4K81B 1SXQA 4MZDA 3PT5A 5CM2Z 4GX2A 5C1BA 2HJWA 3LT4A 1C1DB 3AZPA 3OWHA 4BXOA 3AGQA 3U62A 1ULTA 2EAUA 1FYVA 1FJGB 5IC6A 4AYTA 1OH7A 1GOTA 5ADUS 5K6AA 3OLYA 3U7IA 3OEHD 4B40A 4J0JA 1POWA 4V0OA 4NULA 2VBIA 2H31A 5BN4B 3GQBA 3PDCA 3L7YA 3DOUA 4L1KA 2Q7OE 2RHOA 4CBVA 4KFSA 3PDIB 1E1NA 4GMHA 2ZIWB 1ND5A 3KNZA 1F0YA 4WY5A 5EGNA 4YRMA 5FNZA 1U0LA 3QLVA 4Q03A 3T99A 2ISSD 1JDTA 1XNGA 2RBKA 5KYUA 2IEAA 1XZQA 4YLEA 4Z9XA 1D5WA 3T3HA 3TIIA 3FTPA 1U4SA 1MUUA 2WD9A 5IASA 1PD1A 3U3ZA 4L8GA 2IYQA 2QUZA 3OEEA 4DIEA 4ZJUA 5J4LA 1THZA 4FZ3A 3BQ9A 4CEHA 4KXUA 1E1CB 3SHQA 4JSRA 1ISIA 3KQOA 1UC8A 1M1YA 4J0GA 1GXSB 4Q3BA 5GONB 2R44A 3JWHA 2ZREA 3R0VA 3RAGA 5HKBA 2EZTA 2PRSA 4L8YA 3GLUA 3CT4A 1RWMA 1PUIA 5THXA 2C00A 3DV9A 1RM5A 3GARA 2F2TA 1OFHA 3M2PA 1X70A 4MMXB 4MULA 4PNZA 3BFJA 1V11B 2C95A 2ZYRA 2I34A 3CCBA 4ZICA <