1XMJA

Crystal structure of human deltaf508 human nbd1 domain with atp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
246
Chain Sequence
EVVMENVTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFDQFSAERRNSILTETLRRFSLEGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Impact of the delta-F508 Mutation in First Nucleotide-binding Domain of Human Cystic Fibrosis Transmembrane Conductance Regulator on Domain Folding and Structure
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein, hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 83
structure length 246
sequence length 284
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xmjA00
3SJAA 3VX3A 2XXAA 1F6BA 1W48A 4U02A 1QG2A 2IC5A 3OIVA 2JCSA 3TUZC 4Q9KA 2J9RA 1P61B 2IWHA 3TK1A 1KI6B 3GEHA 3FVQA 3LRPA 3QF4A 4AG5A 2P6UA 1G20E 5UKDA 2ORVA 4XTRA 1I2MA 2OXCA 3F8TA 5B30A 1YZGA 4IDPA 4LGMA 4HZUA 5G40A 4ERNA 4PPGA 2GCOA 4QBIA 5BQ5A 2X19A 3IIMA 2D2FA 2YNMA 1UF9A 2CCJA 2X8AA 2QEQA 3CX7A 4JT2A 3KKOA 5CDFE 2GBLC 2ONJA 2ATVA 1T3SA 3IILA 3MUFA 821PA 4RCZA 3K8YA 2B8TA 2P0EA 4Q02A 4QHSA 1X3SA 1OLOA 1BS1A 4BFYA 4P4SB 2Q3FA 3I4LA 1UKEA 3QXJA 4TLEA 1H8EA 3L8YA 3A1TA 2OILA 4JVNA 2WPDD 1F48A 1H8HD 1O3YA 1OXUA 2W58A 3EZ9A 4JLNA 1CJTC 2BMJA 4KYUA 3PG5A 3AVUA 1LS1A 4NHOA 3KJGA 3B85A 3OEHD 4OHVA 2DWOA 4ZCIA 4KLZA 4B43A 4POAA 1PUJA 3HP1A 4R71A 4ZIRA 3FMOB 1G6OA 3BFKA 1NSTA 2G3YA 4Q7MB 2BIFA 4BECA 5IK2A 4L16A 1ZU5A 3ZZUA 1UBCA 2GTPA 1N0UA 2GKSA 2G1KA 5DO9A 2ZRMA 2GHIA 3GLFE 4PHGA 2B8WA 1UFQA 2R6CA 2ZE7A 1W5TA 4D6PA 2FSGA 3TUIC 4LHWA 5EZ5A 1E94E 1NIPA 5D3MB 2GWHA 4E22A 4HI0E 4S35A 1M7HA 4TSFD 3RHFA 1E2IA 2JAQA 2GILA 2R65A 3B9QA 1W0JA 4Q66C 2H5EA 2IT1A 4ON9A 1NJGA 4BFZA 1FPMA 3NBXX 3NH9A 2J5XA 4I1UA 4EJSC 2YV5A 1E79D 4PAQA 3W6PA 5JS8A 1N3BA 2GJSA 4IJMA 4P0TA 3H4MA 4GNKA 3T5GA 4UKDA 3SOPA 1A2BA 1G18A 1N5JA 4HDOB 4IRUB 3IHLA 1W5SA 3B1YA 4F4IA 1NKSA 2V54A 2ZJ8A 1OHHA 3FWYA 3THXB 1CP2A 1GP2A 4U7DA 1Z08A 3N2IA 3Q85A 4HB2A 3LV8A 2IXEA 4IDNA 4KFSA 3ECCA 4OJQA 4O2LA 4B34A 1LW7A 3TRFA 4JVSB 1GZSA 5KYKA 3JVUA 1VG8A 1OJLA 4QGAA 1XMSA 2VSXA 1FP6A 1G3IA 3RS3A 1E2NA 2IS2A 1KO7A 2OAP1 1ZIPA 2WWWA 4Z1MA 4M0LA 3MRSA 2LCFA 1EFCA 5AJZA 1DAIA 1JI0A 2YOHA 3CB4A 3FKQA 4DB4A 3THYA 2EVWX 4CEHB 1KDRA 2IUSA 5DH9A 1KK0A 3SYNA 1S9HA 2B6HA 5KSOA 2YOFA 1CJUC 1Z47A 4PHHA 2HV8A 4RD1A 4A8JC 4Z8YA 4HAVA 4HLUC 4V0MA 2QROA 4WAUA 1KDOA 3UKDA 2LWIA 5SZIA 2VF8A 3ZS8A 2NMVA 1YRBA 3MWYW 4RZXA 3AF2A 4G01B 1HQCA 3BK7A 4XVQA 4UXJA 3GLIA 1KI8A 1FW6A 3AF0A 2BV3A 2CE7A 4M1SA 1OFHA 3ZS9A 1W4RA 4NU0A 4BRUA 1HYQA 1EK0A 3GQBA 3W9YA 1XMJA 1T8UA 1KZ7B 4IHQA 3KFVA 3REFA 5A4JA 2WOJA 5GJVC 3SFZA 4KAXA 4PC6A 1R8QA 3SI7A 4AD8A 2BKEA 2XOKA 3DM9B 3ZGXA 1NSFA 5FTLA 4Q1AA 1IBRA 3MWJA 5K8TA 1N6RA 3VQTA 2F7SA 2ZS7A 3QY0A 3OEED 1KDTA 4PAMA 2HLDA 1SVWA 3QI2A 5KO2A 5H1YA 2QRNA 1FTSA 1VCOA 2NO6A 3R20A 5JLJA 3EPLA 2WM9B 3KFXA 3ZIAA 4LY6A 5EE9A 2JASA 3R8FA 5FI1B 2QZ4A 4NYMR 2KSQA 5E7JA 2CE2X 2W6IA 2RGCA 2ZVQX 4PO9A 4A8JA 1CS4C 2BMEA 4H9GA 4IDHA 3K09C 4X8MA 1XD9A 1K8RA 2IYLD 3ADBA 2JJ1A 4TT3D 5GVRA 2YWFA 2CK3A 2V8OA 1NF3A 1M34E 2H17A 5FOWA 2XZPA 4D0LB 3AM1A 2ZREA 3A37A 3U7EB 4MGYR 1Q12A 1QRAA 1L7VC 4FCVA 3I1FA 1MO3A 1ZUIA 2O5VA 3C14C 1RE0A 4KLNA 3TR0A 4ZCMA 5KDDA 1DELA 1P60A 2O8EB 1WBDA 1N5IA 4BRWA 2FGKA 4US2R 1WB9A 1GOTA 2CDNA 4OJKA 1IN5A 3TVDA 2F6RA 4E07A 1ESMA 3EZFA 2ZYTX 2OAQ1 2ZETA 4GMXA 2RB4A 4M53A 2GRJA 2NTYC 4JSTA 4MKFA 4B3BA 1HUQA 2IYZA 1GTVA 1ANKA 3LX5A 1ZVQA 3LBIA 3VR4A 2WJGA 2ZJBA 5FUXA 1G21E 2FOLA 1OH7A 1T5LA 1U0LA 2QI9C 3HYRA 1XZQA 2QSYA 3PENA 3ZZ0A 1D9XA 3RSOA 5L3QA 2DHRA 1F60A 1KSHA 3ND8A 5DSZA 3QSYA 2XTZA 3R9IA 3WP0A 4HUTA 2D7DA 4QNMA 3K9NA 5FUVA 3MD0A 4LPKA 3AB3A 3B6EA 4C9BA 4D0GA 4EFMA 2EQBA 4Z54A 1XPRA 4BLSA 3KKMA 3OESA 4KCGA 5TMPA 5EP2A 1JB1A 1N0VC 1UBGA 4CEJB 5HKKD 3T34A 1P3JA 1GNQA 3MWKA 2WWIA 5SZHB 2CLCX 4ABYA 2YC2C 3C4JA 2BKUA 1H8ED 1KKLA 4FN5A 1M8PA 2JLRA 3LQRA 3K0CC 4ASUA 4U5XA 4A0GA 1Z63A 3X1XA 4MH0R 3D31A 1YVDA 4ZKDA 2J41A 3GJ7A 3OIWA 2WKRA 3W3AA 2GBLA 4ARZA 1Z6GA 1MRSA 4NYIQ 1TU3A 2O8BA 4Q4AB 4QJ3A 3ZH9B 4W5HA 5EE1A 2NOAA 5G53C 5FOUA 3OE7D 4GZLA 3UATA 4NCJA 5JRZA 1NN0A 4ESVA 4TMZA 1CJVC 3A58B 4J0QA 2VHUA 4HZUB 1SVIA 2FEMA 1NJFA 1U8YA 1KK2A 3RC3A 4XOIA 3KDSE 3GEEA 1XB2A 2ZU6A 1SHZA 3VMFA 1EWRA 3SHFA 3A1WA 4LBVA 4QM7A 3KKNA 2ZRDA 2ZRGA 4BLPA 5J47A 4A6PA 1VHLA 5EZ6B 2KE5A 2XXAB 221PA 3P1JA 4B74A 3B1WA 4TTPA 4NYJQ 3E70C 2OO7A 4M22A 1SKYE 2J45A 2NIPA 3BGWA 2GNOA 1TUEA 3T1TA 1YHNA 3BORA 1ZMXA 3GJ8A 1CTQA 4PZYA 3ZVMA 4LV6A 2OM2A 1KK3A 2IYUA 3FHTA 4PC3A 5TV2A 4BUJA 2BCJQ 4OYHA 3PEYA 2ZI9A 3OF5A 4LBZA 2C04A 3BB3A 4DSTA 1DARA 3BAFA 5KHOC 1Z29A 3RYTC 1R6BX 1JNYA 1YR8A 5E7IA 1JAHA 5FFMA 1HT2E 1LV7A 3M1IA 3G82C 3V00A 4D0NA 3RAPR 1G7RA 3KJIA 3OFND 4HATA 1SULA 4FMDF 4X8LA 2ZU0C 2DFKB 2N42A 2IUTA 1BKDR 3CWZA 1C9KA 1ZNXA 3VR2A 1UKVY 2BCGY 1EFTA 3HU2A 2VHCA 1KI2A 4MGZR 2A9KA 3R7WB 3CX6A 1JR6A 4UXHA 3TSWA 1P9RA 1J7KA 4ITRC 3RVBA 1SQ5A 4EFLA 3W8RA 4C0AC 4Q18A 3CLVA 3A4MA 3F5FA 2WVJA 3TBKA 2PMDA 1SXJC 4IEIA 4TYYA 1FUUA 2ZJ5A 1KNQA 2CVFA 2XSZD 3QG5A 2IYWA 4ZI2A 1J99A 3NG1A 1YZQA 3EASA 4X8HA 1COWA 1J8YF 1E2DA 2GDJA 3PR1A 1E9DA 1ZD1A 3B5JA 2ZRPA 2DPXA 2GXAA 3DM5A 2I4IA 5KSYA 5FPKA 3FPAA 1W2HA 2RGEA 3UWOA 5TDHA 3L82B 1G7SA 1R10A 4PSKA 1JEEA 1G64A 4KSBA 1DG3A 5EP3A 3FB4A 1EG7A 1VTKA 2ZVPX 1P2SA 2FGJA 1W2GA 2WWXA 4UNSA 1P2VA 3IQWA 3W6NA 4Q1FA 3CRVA 1GUAA 3DDCA 1XTSA 4LV8B 2JLWA 2OLKA 2QSZA 3L0PA 5HZHA 4B35A 3ZDQA 4DCTA 3AVTA 2HF8A 2QTHA 4MA4A 1LS6A 4WZ6A 3KX2A 1R2QA 1WMSA 4LJYA 2IX3A 1VG1A 1C1YA 2VQSA 2XNDD 2R8RA 2X77A 3IQXA 3K0CA 2G9NA 4C0BA 4D2IA 5F98A 2FH5B 2IW3A 2WPDA 3C5CA 3OFNA 3TE6A 2OG2A 2R44A 2UKDA 3WHKA 2DWPA 4BLOA 5E3HA 2AK2A 3ZD6A 2IYVA 4NYJR 1WBBA 4BFTA 3EC2A 2NO9A 2CBZA 5L3VA 1NY5A 4G1UC 1PLJA 4LYAA 4FWIB 2PMKA 1UDWA 4LYHA 4MDFA 2P65A 1FUKA 2B7BA 1XTQA 2AHOA 2JLUA 3EX7C 2FF7A 2W2VA 4HAUA 2VP0A 3ASYA 4PSVA 4XH9B 4YDHB 2V1UA 2FX3A 2QY9A 2GVZC 2WHXA 2ZS9A 3QF4B 5DYIA 1XXHB 3VU9A 4MITA 1E9FA 1G17A 1VG0B 1XEWY 2DYKA 3A4NA 3DOEA 1NBMA 3GJ6A 1G7TA 2VEDA 3L0IB 3ZQJA 2XZLA 2ZRLA 3A36A 2ATXA 1HTWA 1RW4A 4CGZA 1ZD9A 3UWKA 5CITA 4PXAA 3BS4A 3W90A 4JLKA 2RH5A 4LYFA 3GPLA 1K5GA 5F3WB 1G7CA 2XJ4A 3AV0B 3LA6A 3BC1A 3JZAA 4IDOA 2IYRA 2GK7A 4NCNA 3MJHA 1F2TB 4XWOA 5KTYA 1TNDA 2C5LA 2H18A 3B2EA 1A7JA 2DFLA 3PQCA 2N46A 1CR4A 1BIFA 3DOFA 5SZJA 4M1OA 3C5HA 1HE8B 2ORWA 4KHZA 4A2QA 3R9XA 1XNJA 1HV8A 1J2JA 4N3NA 1G4AE 3SZRA 1NG9A 2YINC 2VA8A 4ZV4A 1AS2A 2D2EA 5KNDA 2VYFA 4KJZA 1ZW6A 4FXPA 4HLDA 4NONA 1EFRA 1ODFA 4LDJA 4URXR 4GOKA 4NYIR 3A1SA 1LY1A 1QHNA 3L8ZA 1W4AA 2V6IA 2F1JA 2BM0A 1M2OB 5FI0B 4M9SA 1WRBA 5J4HA 2IYYA 1ZM9A 4L9SA 1JXMA 4G5GA 2A30A 4RKEA 5CB8A 4JKYA 2FPKA 4MYUA 3FDIA 3U4QA 3GLFB 2OESA 1NIJA 1OXTA 2ZUDA 2E1RA 4PZZA 2BOVA 5EUMA 4C0HA 4BGDA 1N5KA 3ICEA 1NRJB 2OV2A 4HLQB 4C0SA 1XJCA 1JJVA 1NKTA 2LKCA 2XB4A 1Z6TA 4BE7B 1XJ0A 2ZEJA 4Q4HA 3WNBA 3E1SA 1AA9A 2ZAOA 4XSGA 3KXIA 5JEEA 1Z0AA 4WW0A 2GK6A 1JAIA 3BBPA 4DT1A 4NMMA 1CR1A 3TQFA 3I5XA 1X8JA 1N6IA 5ANRB 4JKIA 2REXB 2V55B 4JZKA 1G8PA 4IVRA 3WYFA 1XF9A 5LPNA 3ZYCA 1WCV1 2A2ZA 4TSFA 1KSFX 4TWZA 6Q21A 1Y3AA 4FCTA 1G8FA 3GCGA 3LAWA 3WRXC 1E2EA 2G83A 1PLLA 5AJXA 3D7MA 1WA5A 4IEEA 3AF1A 5CM8B 3W5IA 1XWIA 4PHFA 4M1KA 3UG6A 2GAOA 5FTJA 2RMKA 1RRGA 1Z3IX 4BLTA 1DEKA 5CIWA 2YZ2A 2IWRA 2WV9A 4TL7A 1DAMA 5J4KA 5DGXA 1SXJE 2VPPA 3OEHA 3BH0A 4ZDIA 1KJZA 3OZXA 5B57C 4AWXA 4R9UC 5FBQB 1E3MA 1XFAA 4GL2A 2W2TA 3IGFA 4QM6A 3QF7A 3B13B 4Q03A 4TMKA 4JBWA 4UNQA 4Q4JB 5CK4A 4QHYA 2WKPA 2ZRJA 2DWQA 4HB4A 4DT1B 1R5OA 3KTAA 4TYNA 1F2TA 1NP6A 4YC7A 4I1OA 4D4JA 4DCUA 1VCMA 1IOZA 4NKRA 5H8WA 4MKIA 4P4UA 2XJ9A 3ZJYA 1KHTA 4KXFB 4CIDA 5J4VA 4F93B 1Z0IA 1AS3A 2OCBA 3ICQB 1LF5A 2BMDA 2OCYC 1JR3D 1SVMA 5JWOA 3AUXA 1UM8A 5TB5A 1CLUA 5GJCA 1JXOA 2BC9A 4OI1A 4N0DA 4AKEA 2PZEA 621PA 1R7RA 1CXZA 2QU8A 2VP5A 4E09A 2A5JA 1L8QA 2FJUA 2OBMA 3GLHA 4P32A 2FDCA 1Z0DA 1T8TA 1E98A 1EESA 5F9FA 3H86A 1SXJB 1IY0A 4TMWA 4TMXA 2GZDA 3B78A 1TQ4A 2D06A 4Y0VA 2BHRA 2WSMA 3EA0A 4OI4A 4B73A 3WBKA 1QHXA 4GDFA 5JJKA 4MKHA 5DI3B 2ZRAA 3IIKA 1OF1A 3OE7A 3CM0A 1R0ZA 1WDTA 2ZE8A 1R0WA 2GZAA 4DLVA 4B3GA 1AQUA 3TIFA 1F3OA 1EFHA 3DPUA 5KSPA 3VFDA 2OFOA 1W0KA 2Y8EA 3K70B 1KY3A 4US0R 3QPVA 4XWAA 1T9HA 3CPHA 1RIFA 1RVDA 4Q7JB 4V0NA 4C0KA 3VKWA 4MRRA 1XEFA 2DFTA 3VR3A 2XAUA 4MGIR 2WAXA 3VNVA 3W5JA 1E9CA 3GLGB 3Q9LA 1CIPA 4NBSA 3T06B 1P73A 3GLGE 2AKYA 5C4GB 4ILEA 1OHHD 2A5FA 4MRNA 2J3EA 5KDOA 3LO5A 4O2RA 4Q19A 1NL3A 1DAKA 1QZXA 2FFQA 1II8A 3K1JA 4Q48A 2P2LA 4LJ8A 1E79A 5CM9C 4AY2A 3L2OB 3X1WA 2VSFA 3VKHA 5FTKA 2GJ9A 3QXCA 3THWA 4LBWA 4PZLA 3RRYA 1E4YA 5CYOA 1SVLA 2O8EA 2EYUA 1N6OA 1NN3A 3AF4A 4LRWA 1OH5A 1S1MA 2MSCB 3C41J 4LCBA 3VR6A 2QNRA 2A5YB 1A2KC 2OBLA 2WKQA 1DAHA 5AUNB 1GVNB 4PPFA 3P20A 3FMIA 2QTFA 4BFSA 2NPFA 3JVVA 4YLGA 2GF9A 3QKTA 2DY1A 3T1VA 4ZKEA 5CLLA 3DKVA 3I5YA 4NH0A 4OKSA 3KQHA 2Z83A 4UNNA 4GOXA 2UVQA 1ZM3A 1OIVA 5J5CA 3B82A 2WWFA 1IONA 1TF5A 5B2ZA 4JJZA 1KKMA 5H70A 5C18A 4A8JB 721PA 2GJKA 2PLFA 5CDFA 4EPYA 3EC1A 2IYTA 1HE1C 1G41A 2G0NA 5LB4A 4AIIA 4RY2A 2XX3A 2CLDX 1KJYA 2RCNA 2NQ2C 2V7QD 3IIJA 3NHBA 4DZZA 2REOA 4HDCA 1OV4A 1I4LD 2WSSA 5JRJA 3LVRE 1UKZA 4OK3A 4DSOA 3NDPA 4URYR 2OE2A 1C4OA 1YR9A 3N5CA 4URWR 2ZRCA 4TYQA 3WP1B 1WXQA 4Z51A 3TAUA 3O8RA 4LHXA 2NPIA 1R0YA 2X2EA 4O0MA 2FNAA 2PH1A 4ZDKA 2Q6TA 5FL3A 3D8BA 4DLSA 1U8AA 5G3YA 1AIPA 2IL1A 4RFVA 2IYXA 5AUPB 2ZR0A 3QQ5A 1QBKC 2YWGA 1QHYA 1MRNA 4TMTA 1KNXA 1NG1A 4GI7A 3SJCA 1HY3A 5B58C 2XSZA 4HLUA 1ZRHA 3TAHA 3A4LA 1U8ZA 3AF3A 3LDAA 3OAAA 2FSIA 4OI2A 3UMSA 1E99A 1QHIA 2QMEA 4F4CA 1NLZA 4YXWA 1NNEA 3NC0C 1AQYA 5HE9A 2VP9A 4YMUA 1T91A 2RGBA 1MKYA 1OE0A 3S1AA 3QE0A 1KI6A 3EG5A 1JPNA 3SJZA 3OHMA 1LTQA 1T3HA 1XBTA 3UG7A 2O52A 3LNCA 3VR1A 3PFIA 5LD2B 3LQQA 2C9CA 4KBFA 2VP4A 2IHBA 3KQKA 2V1XA 2FZ4A 1RKBA 1GAJA 1U9IC 2W6JD 3T1QA 1MO6A 4QBGB 1KTVA 1SVKA 4X8OA 1UBFA 2ZYVX 1S8FA 3NXSA 2CCGA 4LC0A 2QL6A 4TL6A 2CXXA 2ZSFA 1D2NA 2VBCA 3X1ZA 3WHLA 3GLIB 4Q1BA 5JBQA 4DXAA 1T5IA 2MMCA 2OSBA 3RWMB 5BN3A 3U60B 5J40A 2VIIA 2J46A 3AKYA 3FMPB 4LBYA 4OQNA 2O8DB 2C98A 2QMOA 1D9ZA 4DIDA 4JL5A 1NBMD 2ZUCA 1OB2A 1CRQA 1AGRA 3CF0A 3PJRA 1KO1A 4V0KA 1W36B 3OAAD 5DISB 2PCJA 1Z2CA 3LBNA 4QGGA 3S1AB 1YJ5A 1FFHA 4XSHA 1X1SA 3KL4A 5AR1A 1Z6XA 3CZPA 3HYTA 5FPYA 4DKXA 2Q9CA 3NHAA 4QRHA 4M1TA 4PC2A 3NKVA 2OCAA 4IFEA 4OQLA 5JFGA 4K81B 3B9PA 1E69A 3NEYA 1GKYA 5D3QA 2WMNB 5G41A 2VHJA 1ETUA 2PZFA 3O8BA 1VIYA 1XPUA 3GD7A 1U90A 2PL3A 4EKDA 4A2WA 2VF7A 1BYIA 2XNDA 3RC8A 3THXA 4YMSA 4ASUD 4D4LA 4QBFA 1DS6A 2QAGA 2YVUA 1IN7A 2JEOA 5JHHB 3B7GA 1US8B 1NN5A 4BFWA 1AJEA 2FSHA 2RGNC 1UJ2A 1G8HA 1Q1QA 3PUYA 1YQTA 4ZI3A 2HJGA 2ZYWX 4RKFA 4MUBA 2IYSA 4TQAA 2KBEA 3EW9A 1JECA 1KAOA 3WNCA 3I8SA 3PUXA 3TSOA 1KI9A 2FFAA 2I3BA 4TT3A 1Y63A 5C46F 3CX8A 3IHWA 3P4YA 2PBRA 2YOGA 4TYPA 5IK2D 3CNNA 3ETLA 5FOXA 4I81A 1S1CA 2OLJA 1IAQA 1Z0JA 4Q7LA 1FNMA 2Q9AA 4MUAA 4QC2A 4HDQB 4M1YA 4M1MA 3I3SR 2QORA 1M7GA 3O47A 3PEUA 4L9WA 2UZ3A 3LXRA 4HUQB 1O87A 4KV9A 1E9BA 5DI3A 2QQEA 1T4GA 4JT4A 4CZ2A 2ZR7A 2O8CB 1A5TA 1P6XA 3LLMA 1KSJA 4UJ3A 2RGNA 2WIAA 3DZ8A 4XIGS 1RZ3A 4LHVA 3K53A 3ZVLA 4FD2A 1E32A 4CF7A 2JLYA 3THWB 1ZCAA 3L43A 1TX4B 3O8CA 1E96A 2D4HA 4JMPA 1E2MA 1E9EA 2I1VB 4NCIA 5CLQA 3RDPA 3CBQA 1E2FA 4U00A 2DR3A 3BH6A 5DE3A 3EPHA 3AH8A 2ZXUA 3A1UA 1GL9B 4MYTA 5EJEA 4XVRA 3BB1A 2C77A 2KB0A 2A5DA 1LF0A 2Z4SA 3KXLA 4FINA 4BFXA 4V02A 4F4JA 1VYUA 4O3MA 2ZRKA 2IHYA 4W5JA 1P7CA 2C95A 2OHFA 4DIEA 3Q5DA 3MWLA 4B3DA 5JHGB 521PA 5GJBA 2O0HA 2G0TA 4FIDA 4HAYA 5TARA 2GXSA 3MJRA 3QG1A 3TSZA 4G5OA 4WOPA 2RAPA 2AFHE 4PTLA 3ZIAD 4XVUA 2YYZA 3R8CA 2IBMA 3OIYA 1OYWA 5CIQA 4DLXA 3B1XA 3OEEA 4OK6A 1P9NA 4KODA 3WMFA 4E5UA 5DN6D 4PX9A 4G5SA 3SFVA 3EZ6A 3QKSA 4WBSA 5E4FA 2R9VA 4I1VA 4TYWA 1R0XA 4A0FA 2REBA 2WJHA 4EPTA 2GJ8A 3WMGA 5JCZA 5BYJA 4URVR 3GMTA 2CL0X 2YWEA 1F2UB 3GFTA 2EW1A 1U99A 3GJ0A 1G5RA 1ZNZA 4RVCA 1TADA 1GL7A 4UXIA 1II9A 1RRCA 1FP7A 4PFSA 2P67A 5GJWC 4DVGA 2RHDA 2ODEA 1FQJA 1JR3A 2QG6A 1XZPA 3QXSA 3ZVRA 2WMOB 4JJKA 1VG9B 3F3YA 3EWSA 3TJZA 4DSUA 3AVXA 4LHYA 4B33A 3HPRA 2CVHA 3X1YA 1Z6YA 4B2IA 4KU4A 5C1BA 2ECKA 1FNNA 1ZM2A 2CMKA 1CR0A 3MG9A 4LJ7A 3AUYA 4MGKR 5SZKB 2IEYA 3CPJB 3EPJA 1G8GA 2CL7X 4B44A 1D6JA 5D3MA 2QBYB 3LY5A 1TQ2A 2H8KA 3BXZA 4C7OA 1XXHE 1ONBA 2ZROA 1UEIA 2Q0HA 4L8GA 4QBHA 1TEXA 4A9AA 3U4QB 2D74A 4I4LA 2ZI7A 5FR1A 3GP8A 3ZLJA 4YDSA 2W00A 4UJ5A 2WWYA 2K5UA 2ZPTX 1ZIOA 2Q3MA 3IKJA 2R6FA 1XDBA 5JCPA 2JJ1D 4DCSA 3EXAA 1WP9A 3BRWD 4BZXA 1ZM7A 4TZ0A 1KY2A 1QVAA 2F1RA 2XNSA 3DEFA 4EDHA 4Q7KA 1GIAA 3SQXA 1VECA 1FL9A 4NE2A 1D5CA 4OQXA 4JBYA 4Q01A 3EPKA 4A15A 4PQFA 1DTSA 3NIBA 4PQYA 4CT5A 1CF4A 1W46A 2O0JA 2GAAA 3NTUA 1X8LA 3IPXA 1TUIA 2J87A 1I4DD 2BBWA 3GLHE 2E87A 1UADA 1Z8FA 4A0RA 1Q1ZA 5BWMA 1JBKA 1MR3F 3VTKA 3N70A 1ZYUA 4PO8A 5AJWA 2GCOB 4JL8A 3RWOA 1Z5ZA 1CR2A 5A0FA 4DEXA 2J0QA 3C16C 1I4TD 1T0JB 2ODNA 2HF9A 3LBHA 1E9SA 4AK9A 3MSXA 3P26A 3MFYA 5FBVB 3EAQA 4HB0A 4OBEA 3GLFA 2HYIC 3E5HA 2Q9BA 4QKQA 2J0UB 3NH6A 1ZAKA 1QDEA 1G3UA 1L4YA 2O8DA 3DMNA 2ZITA 3AP3A 1RRPA 1PJRA 4D80A 1K6MA 2J0VA 3K70C 2IXFA 2W6ID 2QE7D 3SQWA 1R5BA 3IDQA 3GLGA 2J0UA 2QGZA 3EIHA 5JI3E 3ZD7A 2DB3A 1YZUA 1EXMA 1OYYA 1YKSA 2C9OA 5HR5A 2EFGA 1FX0B 2YKGA 1A1VA 5FOSA 2RGDA 4XD7D 1DAEA 3NBFA 4I1SA 3AP2A 2KWIA 2AWNA 1J90A 4KO8A 3K0SA 2C9YA 1QHHA 4C2TA 3QBTA 3HJNA 4WIAA 3MAAC 4Q1DA 1XP8A 5K8IA 2V7QA 2V4ZA 3K9LA 3QVUA 1SKQA 2CHGA 1KO4A 4MRVA 1Q44A 4WXPA 5AJYA 3SN6A 1GRRA 1VHTA 3RS7A 2ZE5A 3SU8A 4B6EA 3T12A 2ANCA 2NO0A 5HKKA 3QUSA 1HA3A 1G16A 2WTUA 1E2QA 1MV5A 4QHTA 1TEVA 3SBEA 1ZP6A 1D2EA 4FMBB 3ASZA 1LFDB 3G5UA 5FTMA 4BQSA 1M1YE 5B64A 4IOKA 4BZQA 3Q3JB 4KFUA 1MABB 2VHTA 2VL7A 2B21A 1Z2AA 3TGPA 4ACAA 5IRCD 4B2LA 3WMEA 1AKEA 1G9XA 4RD0A 5AJVB 3M4YA 1Q1BA 5JJLA 5FBLB 3T61A 1TTTA 1XCMA 4QL3A 4IFBA 2GF0A 5IT5A 4AC9A 2RGGA 4XTCS 5KOYA 1YU9A 3TKLA 1OW3B 1E2KA 4G5QA 1OH6A 1E2JA 1FZQA 1GNRA 1P5ZB 2PX3A 1UAAA 2QUZA 3EWAA 1Z22A 1R8SA 3ZVNA 3AKEA 4PHTA 4RD2A 5JWHA 2WOOA 4JYCA 3TH5A 3I32A 3Q8XB 2AWOA 1M74A 1KOFA 1W4CA 1YR6A 1GRNA 5E7MA 4DSNA 2QT1A 1DVRA 2Z5FA 4BFUA 4L5BA 4E03A 1EGAA 3UPUA 5KDLA 1NI3A 2AKAB 2ZUBA 4H1UA 1MABA 3AGPA 1SGWA 5DN6A 1E2LA 2CCKA 1S3GA 5L3RA 3CUEF 4KBGA 2YC4C 1N25A 1COWD 2J1LA 3HU3A 421PA 3GJ3A 1CBUA 2HLDD 5FBWB 5FBRB 1OPXA 3RS2A 1IM2A 3QJYA 2B92A 1DOAA 1AGPA 2IS1A 2OFWA 4L15A 2W0MA 2H16A 4Q47A 2XTNA 1DO2A 2JGNA 5J4LA 3CRMA 3WYAA 4QJ5A 1AZSC 1KYIA 3L0SA 1AK2A 3BH7A 3P4XA 2JLVA 1TU4A 3GFOA 4CRWB 4XWKA 4C30A 4Q1CA 5F2EA 1HEIA 1FTNA 2QA5A 2ZQ5A 3BOSA 4MDEA 1NMYA 2AXNA 1D2MA 2UZIR 1P4SA 2FFHA 2ZSBA 2BMFA 3AVOA 3P27A 4JS0A 3DO6A 3PITA 1QHHB 4BZPA 1R4AA 3GEIA 4BLRA 1CU1A 2HYDA 5KPDA 4Z8XA 1YZTA 4DRZA 1G5TA 4JLOA 3RRZA 3PIRA 5K8LA 1AKYA 1TAGA 1XD2B 2R62A 3AVVA 2IS4A 1NVWQ 3U3KA 4ZDJA 1X1RA 1NVUQ 1YZKA 2A3RA 1OSNA 4V03A 4D4KA 5L3SA 2P5TB 2GZHA 3DMDA 4D82A 1GWNA 2BVNA 4HB3A 1Q57A 3T5DA 4GMDA 3K70D 5JZVA 4AKGA 4O25A 1K5DA 2ASEA 1NLYA 1Z06A 3R9WA 5JJIA 2HDNB 3PEWA 1DPFA 2O8FA 4F91B 2IS6A 1GG2A 4NTZA 2DCUA 1NMZA 1NBME 3LLUA 2J7PA 4DUGD 1G3MA 4URZR 2FV8A 2QRZA 3U61B 4L4UA 1G8YA 2CJWB 4IXMA 2F1HA 1P72A 3KXKA 4EJSB 4LHZA 3K0AB 3ZQ6A 2F55A 2Q21A 4WA7A 3A8TA 2WJYA 2WSSD 1HURA 2QQ0A 2O8BB 4QGHA 1A4RA 3AKDA 4R2IA 1IHUA 5DHFA 1W7AA 5FUWA 5KUTA 5TY0A 1YZLA 1G5PA 2VP2A 2EFDB 1E0KA 4Q1EA 1Z0KA 1QF9A 4QXAA 3ADKA 2H7VA 5CYPA 4B32A 1US8A 4GPTA 1NVVQ 3KQUA 4C0LA 1ZCBA 4LV5B 3CKLA 1OIXA 4A1FA 4QOSA 2X1VA 4TN1A 3SHWA 2HCBA 2IYQA 4ZO4A 1VKJA 1RPZA 3KUDA 4CEJA 4KI0A 1YR7A 1UDXA 2R2AA 2FSFA 2L0XA 2ODBA 2HUPA 3DHWC 4C7OB 3QKRB 4YMTA 1KI1A 2ZAMA 4DCNA 1ZNYA 2F43A 5FL7A 4ZCLA 2QBYA 3SEAA 3X1DA 4BPBA 2JLSA 4GRAA 3T1OA 2P6NA 5FOTA 4NZYA 4M9XA 3NWJA 2AD5A 3TW4A 5HZKA 5L3QB 3THOA 1U98A 4C3ZA 1VPLA 3SE0A 5KPJA 3U44B 3NEJA 3RS4A 4CVNA 3FTQA 3MCAA 1E1RA 4ACBA 3UANA 5F9HA 1IY1A 5DI9A 4OHWA 5EE3A 4KSCA 4RZ3A 3HPQA 4TLCA 1J8MF 2CNWA 2NO1A 3I92A 2ZR9A 3R7WA 4B3CA 1YRAA 4URUR 5KNBA 4UNPA 4H1VA 1U2RA 4GSYA 5G3ZA 3TW8B 1F2UA 3GJXC 5FR2A 3I8XA 4FMDB 4JLPA 1KO5A 4QGFA 3EIEA 1Q1EA 3KKPA 2ZRBA 3SC3A 1E0AA 3FMFA 4NYMQ 2R6AA 4OQMA 3AVWA 2Q3HA 1GNPA 2ZYUX 3NVAA 5BXQC 3FYHA 3KUCA 1OKKD 1EX7A 3U2QA 3KJEA 3LXXA 121PA 1E1QD 5HE8A 4PPNA 2WICA 1OXVA 3QKSB 2F9LA 2PT7A 4FMCB 4GP6A 1PV4A 5HCNA 5EP1A 3PCRB 3FOZA 4LJ6A 1H8HA 3QOFA 2IUUA 1N5LA 5EXSA 4DCVA 3THYB 1IN8A 4MYCA 5JI2E 4AI6A 4RD4A 1ZM4A 2ZE6A 3SNHA 3I61A 1RJ9B 5L8VA 1XMIA 4AKHA 5P21A 3UK6A 3HR7A 4MKGA 5LD2C 4B76A 5BN5A 2BM1A 4M2LA 4BEJA 1IN4A 2G77B 2WBLC 2EWWA 4GFDA 4GOJA 4Q4AA 4TL8A 1Z83A 3O8DA 1CRPA 1XTIA 3QIAA 3AEZA 4TLDA 1Q20A 3SBDA 4DLRA 1CKEA 1T3LA 3BIFA 3QNUA 1XRJA 2GETA 5FOVA 2IK8A 5FUYA 4PSAA 1FOEB 3FHOA 2F9MA 2ZJZA 2EYQA 4M8NE 2XZOA 4GZMA 1HT1E 4EPRA 4JLAA 1XD8A 1E1RD 1LNZA 3U3RA 4NCHA 4HUQA 3CRW1 2XB2A 3U6BA 2GVDC 3RANA 4IVPA 1WE2A 4RZUA 4YONB 2HJVA 1QHGA 5AUQA 2O8CA 4F7WA 3LW7A 4LYJA 1ZUHA 4IOMA 3KB2A 4LI0A 2JATA 4EQ6B 4V0ME 2DFNA 3GJ4A 2P6RA 4IKEA 5HTKA 1BYUA 4NPHA 1GKIA 4OI0A 3C7KA 1IXSB 3ADDA 3L0OA 4HSEA 1S0UA 4Z1MD 2QP3A 4EFNA 4TTRA 5TVKA 3K0FB 3GLIE 1MO4A 5IF9A 1F5NA 2GEVA 2QGNA 2QMUA 2PJRA 1S2MA 3U5ZB 3WY9A 1AN0A 3HR8A 2BDTA 1QVRA 2BJVA 3BD9A 4DJTA 1KSGA 2BJWA 2BEJA 2IXGA 4QJ4A 2CK3D 4K8OA 3CNLA 4EPWA 2MSDB 8OHMA 2C03A 3WXMA 2QENA 2X2FA 3IBGA 4MRSA 4P4SA 2FZLA 2MSEB 3K0AA 3P32A 1XU4A 1Z6AA 2EWVA 3CF6R 2FPLA 1NY6A 1P9WA 1CJKC 1W1WA 1U0JA 4M1WA 1XX6A 4DLYA 4N1AA 4IDQA 2B7CA 2QN6A 2QPAA 1MT0A 4B2PA 1ELOA 2C99A 1SKYB 1QHSA 2JJ8A 5IHPA 2FA9A 1M6NA 1Q0UA 1S4QA 5DYGA 3D6TB 1GFIA 3FFAA 3V4RA 4CDGA 3KZ1E 1FMJA 5DIFA 3QEJA 1XEXB 1X8KA 4RSGA 5TXGA 3BERA 3TMKA 1N0WA 3BE4A 3B8HA 1M7BA 3ONWA 2ZI4A 3QEOA 3FKSA 1IQPA 5DLQC 5LDDC 1EFUA 1OXSC 1EWQA 3RRMA 1P2TA 2IF0A 1II0A 5HPYB 1KDPA 1D8TA 1BMFD 4JYBA 4Q00A 4HZIA 3T15A 4KFTA 4ZPXA 5M04A 1E2PA 1U9IA 2ZI3A 2W6JA 2GCNA 4OL0A 1OT3A 4F38A 4LJ5A 4AYWA 1S9DA 3GLHB 1G3QA 4JLVA 1DBSA 5LBIA 4KITB 1W36C 1G3RA 4TLAA 1A82A 5EP4A 3REGA 4DUGA 2ZJYA 2V9PA 3QXHA 3CR7A 4TL9A 2XTMA 4DLWA 1XEXA 3TNFA 2ZS8A 2ZSAA 1IJEA 1TQ6A 3Q7PA 2PEYA 4M4SA 1B23P 1RYFA 1HQYE 1DADA 4R2HA 2ZRNA 1ZNWA 3W8NA 4HLCA 4TQ9A 3TR5A 1T0HB 4WZAE 4P4TA 4II7A 3V4FA 4LX0A 4C4PA 2XGJA 1TQDA 3EIQA 2ZSDA 1NVXQ 4Q4JA 1LB1B 1SXJA 3VX4A 3NC1C 3IBYA 3KQNA 5FTNA 4CEHA 1CJMA 4P31A 5CJ2A 1J70A 2IEZA 3PVSA 1KI7A 1R5NA 3BFXA 2A5GA 1JQLB 4RJLA 4LOAA 4QG7A 3WBJA 2F43B 4NCKA 4DEYA 2N1BA 2W0SA 5FPTA 5BYKA 1E0JA 3W34A 2WAYA 1JQJC 4Y0AA 4CEIB 2YJTD 1E4VA 2ONKA 2RKOA 3N2EA 2HXYA 4DLUA 1Q21A 2PX0A 1UPTA 1KAGA 2WZQA 1VIAA 2O0KA 4FI3C 4B71A 1E0SA 4DHEA 3AKCA 2AN9A 4EPVA 4LK2A 2P3SA 3BB4A 2ZJOA 3K0FA 1U0HC 3CW2A 4IOJA 4K46A 1GSIA 2QPOA 1X86B 3RS0A 4RFSB 4A4DA 1EX6A 2WWHA 4QFMA 2V6JA 1E9RA 2PCLA 1AM4D 3Q7QA 5FPSA 2AFIE 2IF2A 2FEOA 4B6FA 2WJIA 4JVMA 3FE2A 4PAOA 3SS8A 3ZZTA 3PUZA 4FW9A 1KO8A 2J59A 1U94A 3K0EA 5BW8A 4EQ6A 1ZUNB 3RRNA 3FFBA 2R6GA 4NDZA 5JSZA 3CH4B 3QKRA 4RCYA 5FH9A 2EFHB 4JBXA 4KVGA 1PVOA 1G1MA 4YMVA 2HXSA 3F0TA 2CHQA 2CJWA 1BO6A 2VP6A 1W49A 2AX4A 1W0JD 2ZJ2A 3NBYC 1Z0FA 2CHVA 3MGCA 2FPMA 2EFCB 3LD9A 2RGXA 4MQBA 3RABA 5E95A 1VDZA 2P5SA 5J4YA 2O8FB 4A0HA 4TTQA 3GJ5A 1P2UA 1II8B 4PQRA 1KI4A 3NBZC 1N6LA 2ZM5A 1UEJA 2NZ8A 2D3WA 1E2GA 2W2XA 2QT0A 3U6KA 3VKGA 4US1R 3LWNA 2ZI6A 1UKYA 2GA8A 2JJ2A 1TPZA 4N0EA 3AVQA 1JR3E 2J7PD 2CLSA 3W6OA 4V0OA 4EJSA 2HCJB 3CWQA 5EE5B 4JLMA 2FE4A 4RD6A 4JL6A 4W9MC 2WWGA 1N2CE 1SHKA 4PO1A 4FMCF 4TMVA 2OZEA 4XD7A 2AD1A 3SJBA 4DC9A 2PZGA 2YWHA 1Q22A 1E9AA 4HEJA 1L4UA 4PC1A 3AVYA 2BBSA 4B3XA 4RZ2A 4B75A 4JVLA 2FN4A 1FQKA 3C15C 4G3XA 2GCPA 1ZBDA 4GBMA 2H1LA 1ESNA 2NG1A 2HEIA 1GDDA 1I2DA 4HYYA 1G291 4MRPA 4RD3A 2QM7A 2GEDA 1L2TA 1TF7A 1YE8A 3VR5A 1RRFA 3HU1A 2BEKA 1W36D 3MLEA 3HWSA 4A82A 3KB1A 3U3OA 1XCGB 4Q21A 3UMRA 1MOZA 3IEVA 4S2EA 1QG4A 1XD2A 2C96A 2I1QA 1KMQA 3LX8A 5CK5A 1RC8A 4BLQA 2NGRA 3WYGA 2QAJA 1OH8A 3EZ2A 3U7HB 2OT3B 4LWZA 3TLXA 4JLBA 3H84A 4AYXA 3EARA 2KJQA 3IO5A 3TVTA 1IJFA 2JA1A 2YHSA 3BJIC 1VCIA 1VYTA 2E9SA 2F3TA 4OHYA 2PEZA 3QPUA 4C0QC 3Q5EA 3U7FB 4D25A 3QXXA 2MMGA 2JLQA 4W7SA 4A36A 3EZ7A 1Q3HA 4MYHA 2ZRHA 3C8UA 1Z07A 4OQFA 4B48A 2CNWD 4A92A 3B1ZA 3DL0A 5EXXA 2OCPA 3A6PC 1ZINA 3PEVA 3AP1A 3KTAB 2OBNA 1RJ9A 4PANA 2NO7A 1N6PA 2W83A 5LB2A 1BMFA 1PLKA 3VHXA 3U44A 5C2JB 5GADl 4R98A 4R7ZA 2G1JA 3IUYA 2IA5A 4TQUS 3NDBB 4EIWA 3K09A 3AQ4A 4G5RA 1IN6A 3KJHA 3U3MA 4BFVA 5FL7D 2KBFA 1U81A 4IOLA 2ZRIA 4LZZA 1DAFA 1E1QA 1V43A 1SVSA 2KI5A 5ELXA 2ZIAA 1YZNA 3AVPA 3UIEA 3M6AA 3WRYC 5KSZA 2WIBA 5EQTA 4HAXA 4AG6A 1XPOA 4P3YA 4BEBA 3RLFA 2LKDA 4KYIB 4WVFA 3WNDA 4M9ZA 2AXPA 2VSOA 3PV0A 1WF3A 4Q9IA 4NP6A 4B47A 2JJ2D 1KZGB 1CULC 4D81A 2QP4A 1GILA 3AGQA 2ZTSA 3RSLA 4WXRA 3HDTA 2GJAA 3VHLB 2GXUA 2JLXA 2JDIA 4DLTA 3DKPA 5CB6A 4YMWA 1TMKA 2SHKA 2ZJAA 3W3ZB 4C2UA 1KI3A 2OUKA 4NL4H 3BWDD 4ZDWA 3SYKA 1NVVR 3KKQA 4AURA 4F92B 2J7KA 5JS7A 4LPSA 1KJWA 2ZI5A 4PC7A 1W44A 2CL6X 1WQ1R 2C78A 4ESHA 3PXGA 2VHQA 4D4MA 1DE0A 3CR8A 2PT5A 3KQLA 1KMHB 2Z0MA 1G19A 3RNLA 2F1IA 5EUQB 3VNUA 1H65A 1OIWA 3LVQE 3FGNA 3CPEA 1G6HA 1DG1G 3IO3A 2G88A 1ZC3A 4KVAA 2ERXA 1E2HA 3V9PA 1SXJD 4IVQA 1KK1A 1W4BA 2Z43A 2JLZA 2GEUA 1IXZA 1UBEA 1ZU4A 5CJPA 2EU8A 1IY2A 4LJ9A 1PUIA 4DB2A 2FG5A 1AS0A 1NMXA 4ZIRB 2PJZA 1W0KD 3B60A 5A5GA 2F3RA 1GM5A 2VO1A 1XMVA 2QTVB 4FWTA 1XEWX 3LFUA 1HH4A 1PZNA 3D3QA 5AK0A 1BH2A 1MO5A 1MH1A 2ANBA 5JECA 1SZPA 4BWYA 3H2YA 5GVSA 3CF2A 4LJAA 4TZ6A 2A78A 2CEAA 3LW8A 1N6NA 3FHCB 5JWRA 2OEPA 1XTJA 1TL7C 1JEDA 4A6XA 1JPJA 2J0SA 1OB5A 2QE7A 3T35A 3FKSD 1JJ7A 4CYMA 4FCWA 1P75A 2HT6A 4TLBA 2QAGC 4GP7A 4Q5IA 2VH5R 4V0LA 1P62B 1LVGA 2OFXA 4D26A 3SR0A 2GESA 3VU9B 3J81k 2G6BA 1T6NA 3QVVA 5C4MA 4WZBE 4P33A 1GL6A 2WJJA 5AWFC 2ORIA 4M21A 2ZRFA 3K9HA 4EPXA 4YXWD 2RGAA 3H0KA 2R6DA 2VLIA 4C0JA 4AKIA 3SDZA 2QM8A 1IXRC 2RHMA 5IDVA 1XXHA 3ND9A 3B1VA 5BN4A 5L3SB 5DHAA 3U7GA 3OIUA 2GXQA 1AZTA 2Z6VA 4EAQA 1FMLA 2EFEB 4A2PA 5KNCA 1XCPA 3UMFA 2AL7A 3SYLA 3CNOA 4DDTA 2VRWA 4DLZA 4CT4B 2QP9X 3U3JA 5KU1A 1TF2A 5DNYB 2BBOA 1OKKA 3QPWA 2ERYA 1B0UA 2FMXA 4DDVA 2FWRA 4YQFA 3IPYA 4PR0A 2DBYA 3CZQA 1G4UR 3CRQA 3LH5A 1XJQA 4UQOA 4ARZB 4JSYA 2C8VA 2JIZA 3VAAA 3GFPA 2ZSEA 3X2SA 1GRQA 4CW7A 3BFVA 4JLJA 2FFBA 1VYVA 4DDUA 4G0NA 2QMHA 4OHZA 1XTKA 1XTRA 2NZJA 3CH5A 4LJ4A 3CIOA 1GITA 3Q72A 2D62A 2Z4RA 1GKUB 2QAGB 4Q9JA 3I73A 1N6KA 4Q4HB 4EUNA 3PUVA 5JMTA 4CEIA 1E6CA 2D7CA 3A1VA 1DO0A 1X6VA 3DVLA 2HT1A 3QKUA 4XJXA 3CO5A 3MMPA 4AYTA 4UNRA 2JDID 5EE0A 3UXMA 4Q4LA 3I72A 4M9QA 2XEXA 4I99A 1KMHA 1OFTA 2AR7A 4W5WA 5AUOB 4B3FX 2FU5C 3RS5A 1ZC4A 3E2IA 4OHXA 4Q9LA 3QENA 2BBTA 2PLRA 2A7QA 1VMAA 3TQCA 5FPHA 4JIMA 3H1TA 4QNRA 3DZDA 1S3SA 1S96A 1RYHA 1NN1A 1KGDA 1W47A 4HAZA 5H68A 1Z28A 5JEDA 3ADCA 4HAWA 5JSZB 1RFLA 2OXRA 4JLDA 4OK5A 4DBLC 3I62A 2C2HA 3PUWA 4KFRA 1ZD8A 1V5WA 4IXNA 5EXPA 1OXXK 3K9GA 5EXTA 2XOKD 2XITA 1CEEA 3EA5A 3IEUA 1JALA 1ZJ6A 1NLFA 1EFRD 2ZANA 3CONA 3M0EA 4RFSA 4BASA 1KIMA 4DDWA 1SVOA 4LUCA 1N6HA 2H57A 1OFIA 1VCNA 1FX0A 1BOFA 2AK3A 5K8UA 2JIZD 2H92A 3CRRA 4DWJA 2VTKA 4Q9HA 3TUJC 2QPTA 1Q3TA 2WJVA 2ODWA 4GT1A 4IW3B 2TMKA 2BWJA 4LSGA 1OFUX 3JZMA 1DAGA 3QBVA 3G0HA 4LC1A 5HCIA 2V3CC 4PPQA
chains in the Genus database with same CATH superfamily
3VX3A 1P0FA 1QV9A 3PU6A 3IAAA 1W5AA 1C29B 2P90A 2QJTA 3OIVA 4GPD1 3V1UA 2H11A 3UHPA 2J9RA 3ELBA 3MOIA 3KAPA 1A96A 1DINA 1KI6B 2OV8A 3GEHA 3QF4A 4O2BB 3TK1A 5UKDA 2VAVA 3AMVA 4C88A 3W5DA 3GMDA 4XQ9A 5C52B 3F8TA 5B30A 4LGMA 1FYFA 4EUEA 1V0JA 4JGIA 4HZUA 3UHJA 4LDQA 4QBIA 2BZ0A 2KQUA 2QRLA 5BQ5A 1CS0A 3T7IA 4ESEA 3WOHA 4POOA 1KQFA 3IIMA 2P8JA 2IH5A 4HN2A 2AN3A 1XDGA 1V95A 2X8AA 5CD1A 3EQ9A 4LEIA 4L72A 3KKOA 5B6PA 1AO0A 5DP1A 2HFJA 2R7LA 2W9XA 4NHEA 1T3SA 3ZR4B 4KE6A 3ZOKA 821PA 4RCZA 2P0EA 4HPJB 1X3SA 3A11A 3BKWA 4IUDS 4ZD6A 2O7VA 3LPCA 3ZWPA 1UKEA 1H8EA 3QUTA 3HNPA 1TM3E 1KBQA 3L8YA 4FDVA 2OILA 4JVNA 1F48A 1O3YA 1NUHA 1OXUA 1IIBA 2W58A 3EZ9A 1KDVA 4KYUA 1B73A 4DIKA 3PG5A 5C37A 4RTSA 1CYEA 4DV0B 2BTQB 1JG2A 3KJGA 1Z4MA 3LZCA 4KXVA 4OHVA 4YS6A 2DWOA 5TMEA 2OC9A 3HP1A 1NJ6A 1B16A 2I6TA 3GYBA 1Z4JA 4TVKA 1ZX1A 3BFKA 1JHYA 1JWAB 1NSTA 5TNXA 5FWNA 4IH9A 3FCOA 4G4GA 4P34A 2B1IA 3WISA 1ZU5A 5IT4A 3ZZUA 1KRWA 4H16A 2AF4C 1N0UA 3OX4A 4OSOA 2ZRMA 3KLBA 5K3OA 2WINI 3DR3A 1SQ0A 3CUWA 2ZE7A 4N0PA 1W5TA 4ZMRA 4LHWA 3TPCA 3B7PA 4RW0A 2GWHA 3RC3A 1KP3A 2R65A 3B9QA 2YFHA 1WF6A 4E4YA 2BMWA 3AI3A 2O59A 3SVZA 5H7XA 4ON9A 3HADA 3VRHA 1NJGA 4BBPA 2C7GA 1SC3A 5CH8A 1SCAA 3GR6A 1USVA 3TIVA 1E7RA 1DSSG 1QPGA 1IIRA 2FEWB 2WD7B 7ADHA 2D8AA 1LEHA 2Q3BA 3TZBA 1XA4A 4UKDA 2C3UA 2YV2A 3EE6A 4RKYA 5F4ZA 1Z73A 1A2BA 3PC8A 4IRUB 4F4IA 2AQ8A 2V54A 2VUSA 1QJCA 3AF6A 3QPCA 2GPYA 4ZYLA 3Q85A 4BZWA 1CUSA 1V45E 2E48A 3WVNA 3C6ZA 4K1LA 4BBAA 1LW7A 4UTNA 4KFCA 1PAUA 1Z5PA 4EA7A 4EK9A 1GZSA 4GMKA 1U7DA 2I99A 4YCDA 5JDIA 4RWZA 1FP6A 2JHFA 1EWKA 2AMJA 3AJAA 3T41A 4JC0A 3O82A 2WWWA 3MS7A 3RSCA 4M0LA 4PXYA 5T3YA 3F6CA 3WGOA 5E1DA 1B1AA 2ZQZA 2YOHA 3FKQA 1P19A 1ORWA 3K0KA 4DB4A 3THYA 4CEHB 4I50A 3K1YA 1E20A 1S9HA 2B6HA 4P5EA 1AXRA 4Q3NA 4HXEB 5ALGA 1FU8A 3TNYA 1RAHA 4FT4A 5KOHB 4XARA 1XK7A 3TQSA 3DMFA 2UVPB 4M87A 1NW5A 3GPDG 3EIWA 4CLOB 3UKDA 5KTPA 3PGVA 4YWHA 2XCQA 2XH8A 2C8KA 2PL9A 2YR0A 2D1TA 5CX4A 5CFOA 2OGUA 3IVXA 3AFMA 3HGMA 2PSHA 3H97A 3DAHA 1HQCA 5K3FB 1C9DB 1ZOIA 1Z0SA 2VPTA 1U2ZA 3F6SA 4B87A 4BBJA 2F8SA 5IWCA 3CZCA 5HA5A 1OUMA 1UK9A 3IE1A 2ICAA 4M1SA 1GEEA 1N3YA 4BRUA 3O1IC 1M2EA 1UPUA 1X7GA 4HQKA 1XMJA 1T8UA 5KYWB 4IHQA 3KFVA 3HGTA 3L40A 3CVVA 4LXGA 4YFYA 4BYMA 1JZSA 4CKEA 4X97A 3ZGXA 5KIAA 1YRWA 4Q1AA 1RXCA 3GAFA 3MWJA 1CB0A 4DHWA 2JF0A 3ZUGA 2HA0A 1UOOA 2ZS7A 3VQTA 3F7OA 1BGVA 2P2SA 5B2EA 4UDOA 5JH7A 1JIKA 2JZCA 2RONA 5JLJA 4D7AA 2QM0A 5EE9A 2JASA 3WLSA 3R8FA 3VYWA 3NCHA 4RESA 1SQGA 2BPOA 5SY4A 3NOOA 1GG8A 2ZVQX 3HSSA 3P9ZA 1W76A 2BMEA 3OQIA 1I0IA 5B58T 4BYGA 3FPGA 2QG9A 1PT6A 4H9GA 3K09C 2GZRA 4IDHA 4UMEA 4X8MA 1AU9A 1VB5A 1XD9A 4XIFA 1K8RA 3UAVA 2IYLD 3ADBA 4ZAVA 1SMKA 4AO6A 3F5QA 4L78A 4YRJA 5I48A 1M34E 1J22A 3F71A 1L7PA 3LQYA 4DG5A 4D0LB 4GXQA 1KJ9A 3JD0A 4ISCA 3U7EB 1Q12A 2C20A 2XQVA 4ER5A 2DX7A 3GJSA 2X42A 3TJMA 1MO3A 2FQYA 4N76A 3K1TA 1AGXA 2PAAA 1RE0A 3O4VA 4M9RA 1NQAO 5IDXA 2E21A 2TRSB 3ZGLA 5EY5B 3HYSA 1EP2B 3R5HA 4WUTA 4U7FA 3T9FA 3ZWAA 3K5HA 4CJXA 2WNIA 1HE5A 4FUTA 3TSYA 3VAZA 1SCNE 4C03A 5IVHA 2IFTA 2AMFA 4US2R 1VRVA 4L57A 4MI6A 4DMFA 3P9IA 3FTDA 3C8HA 3F5MA 4PCLA 4QD3A 3ZDBA 2F6RA 3R3UA 4WKGA 1Z2PX 2A9JA 1TC2A 3DE7X 2ZYTX 1EA5A 2JGMA 2OAQ1 5A3QA 4R1LA 4GMXA 2RB4A 3A6KA 3R4CA 4AF8A 2HMAA 4EG0A 4R2KA 1JG3A 1O97C 3WJ2A 3ZY3A 2ZJBA 2GBCA 2AN5A 3A25A 3FNRA 3KQTA 3A0UA 2QI9C 3E15A 3OM0A 1XZQA 5L6LB 2C7OA 2FSVC 3S28A 3EFOA 1HTBA 2VJCA 3WL5A 4L27A 2IQIA 1KSHA 1Y8QB 5F12A 2NU7B 5FBZA 3EK2A 4KR6A 2A1TS 2XTZA 2D7DA 3PGKA 1YTLA 4XPIB 2IBTA 1I0LA 2JIDA 4MS3A 5FUVA 4EFMA 1R4MB 1DEXA 5T64A 1YS9A 4C9BA 3BWBA 1MW8X 3HEMA 4DKJA 2QYTA 1QYVA 2I6XA 4G2TA 5LQRA 1B8OA 3ETGA 3U0BA 3OESA 2YFKA 4AKTA 4BLWA 4J3NA 2XUIA 4W1PA 1YJCA 2B83A 1JB1A 1N0VC 3ICOA 2XWQA 4P5PA 4WK4B 3WG9A 4CEJB 5HKKD 2C5BA 4KE7A 3HM2A 5LDGA 3SXPA 4B5KA 1FB5A 4FFBA 3VKUA 4MPJA 1NYLA 1OTHA 4Q39A 4EF4A 3KZKA 3T4UA 2P2YA 3RKRA 1CUHA 4TTIA 2WU1A 1XZEA 1JT2A 2VJDA 2YC2C 3DDOA 3KLOA 3G88A 1H8ED 1LZKA 2Q5IA 2BTQA 2XIJA 4FN5A 1A7UA 4U5XA 1Z63A 4CCYB 3AB7A 4MH0R 4ZKDA 4DMCA 3GJ7A 2CLIB 5ITSA 2WKRA 3M6XA 1QK4A 2VF5X 4ARZA 1H85A 1FFEA 4AB1A 2GEFA 3CB2A 3PQ2A 5KJ6A 5LLDA 2O8BA 4Y18A 4QJ3A 2ZIGA 2HK6A 1Y5MA 3H2IA 4EY7A 3FNFA 1ODJA 3DZHA 3OE7D 4CIXA 4GZLA 4HNAB 3BWEA 4IQ8A 1NN0A 1LDYA 3R75A 4E6EA 1NQWA 3GP3A 4TMZA 4B17A 3HDYA 2EL9A 5LFAA 1KQPA 1SVIA 3GW8A 3FNQA 3C5WP 4OGLA 5EXDA 1ESDA 1WNFA 2Q4DA 4RELA 3EZNA 4JB2A 3L8HA 1EK6A 1XB2A 3BCSA 2WD8A 4JK3A 5GM1A 3PGA1 3C8DA 3SHFA 1U0GA 2ZRDA 1KXJA 2I03A 3N2ZB 4FDUA 3DDWA 4HNGA 4Y9UA 4TV9B 5EZ6B 3K8OE 5IXYA 1IM5A 2JNWA 2XXAB 4AMYA 4B74A 2PFSA 1MXHA 3GFVA 2RIRA 3IESA 4NYJQ 3S6JA 1SKYE 2J45A 3NYIA 3BGWA 3H5RA 5H3HA 1TUEA 4N0MA 3Q2OA 1U6JA 3BORA 5ALXA 3UWMA 4KMSA 4OXRA 1DUVG 4W8HA 3ZVMA 3O9VA 3FVTA 3T7JA 3D43A 2P41A 2R68A 4DQVA 3OLZA 4E2XA 1JT9A 4ZOBA 2IYUA 4CF6A 1U0RA 5A3RA 3ZE1B 3KUUA 3PQ5A 1U1FA 2BFDA 2PTGA 4HH0A 1G5HA 1XZJA 3BB3A 3BXFA 1E7MA 1T5SA 3D7LA 3ZWNA 2B0CA 2VSQA 5E7IA 5FFMA 4ZREA 1RM5A 4OHCA 1X92A 1LV7A 5KINB 3WDLA 3M1IA 2C7VA 4D0NA 3RAPR 1G7RA 2EATA 2RE8A 2A3NA 1SULA 4X8LA 3QLUA 2C29D 2N42A 3F8SA 5G0UA 2YHBA 3IVMA 3LOPA 3VR2A 1O94D 2F64A 2BCGY 1NDUA 2GYWA 3KAJA 2BRUA 2YIDA 1CUBA 1H4TA 1XNGA 3H2SA 2ZYDA 3T9CA 4C1NA 3TSWA 1G1AA 3BE8A 5BSGA 1P9RA 3HV0A 4ITRC 3N2YA 3RVBA 5C51B 2ZZMA 1PT8A 1UBSB 3W8RA 1HL7A 4Q18A 3A4MA 3IV6A 4C2BA 3TBKA 2VYCA 4FEAA 2Q3LA 5CCBA 3TZQA 5CFMA 1BVYF 2ZJ5A 1KNQA 2XSZD 4WZBA 1M6VA 5EXEA 3DMGA 1T9DA 3PFHA 2OXIA 3UQYS 1DKOA 1COWA 1A2OA 3LBYA 4DILA 2P2DA 2I4TA 2GDJA 3PR1A 5HKLA 2OCXA 1T13A 4NCAA 3SIRA 1FIUA 3BMQB 3F3KA 1E7SA 4RQAA 1VM6A 3DM5A 4FBGA 5KSYA 4WBXC 4Q9DA 4OHBA 1VA5A 2I3ZA 3QU4A 1DQNA 4WA8A 2OUIA 4PV7A 4UHEA 2PKYX 3DNPA 2P1DA 5GONB 4B6RA 1JEEA 1G64A 2DERA 4FOSA 4IG4A 4NJOA 5HGJA 5BOSA 1UOPA 4KSBA 4ZCQA 3M7IA 2Q6LA 4CN9A 3FB4A 5KEIA 1I80A 1VTKA 4WESA 3O8QA 1AO3A 2YV4A 3LT0A 2HXGA 4PCUA 5AKXA 2EP5A 3IQWA 2F3QA 3WDSA 1GUAA 1D6MA 2LTAA 5L4NA 1KZ9A 2OLKA 4D1YA 4RQUA 1PT5A 3L0PA 1PYDA 2P2GA 3GAAA 4DIUA 3O3NB 2QTHA 4I9FA 4MA4A 1TKCA 1M5TA 4RLHA 4LJYA 1T24A 2IX3A 4DR5B 3ETCA 3ZTTA 3FCSB 3GL9A 1JKMA 4REMA 3W7AA 4F84A 2R8RA 3FTFA 4B6SA 4LMRA 2FH5B 1D8AA 1GSAA 2Q1UA 2R44A 3C5CA 3G9ZA 3PICA 2DWPA 3Q12A 3QK7A 4IM7A 3SEZA 5E3HA 4EMSA 2GHQA 3JALB 4FFNA 5BSTA 2Q7XA 5LA6B 5H83A 5BN1A 3EC2A 1VIMA 2CVQA 2O57A 4YGYA 3TLEA 3SQOA 2VDVE 2C7PA 1UPXA 2BISA 1HZZC 2PMKA 1NYTA 3HI4A 2PYDA 3MT7A 4FWIB 2B3DA 4MDFA 2AHOA 5DRYA 2JLUA 1L5GB 2E4VA 3WDKA 4LJLA 4WKNA 3TLAA 4PSVA 4AZ3A 3O4FA 3PFNA 3WNVA 5B4VA 3A9WA 1U9YA 2FB9A 3F97A 4ZTUB 1Q0ZA 2XUDA 2NZXA 3L0DA 4CETA 2ZKLA 2QY9A 1VBFA 2ODQA 2WHXA 1BCRB 4A0QA 3R0JA 2C2ZA 2MU1A 4I4TF 3CLTC 4LJKA 3IA2A 1FDSA 4IFTA 3GXBA 4MITA 4QX6A 3JQ9C 3PVCA 1XEWY 2TSYB 1YDFA 4IZHA 3GJ6A 4L5YA 1U2EA 3STXA 3S7TA 2W8BB 2ZAGA 4P80A 3A36A 2ATXA 4XX1A 4NPAA 1F0YA 4FR0A 4AMUA 4C04A 1QYCA 2QX8A 3BS4A 1XDDA 1ADGA 4OLHA 2RH5A 2A5LA 1V39A 5LQJA 2O6LA 2DVMA 4FYVA 4QEKA 3GPLA 1JDPA 5K51A 3AV0B 2PXHA 3LGXA 4R51A 2H07A 3ZWWA 2WU0A 5EZYB 2GK7A 4HHEA 3DBOB 3I8OA 4CMJA 3GFQA 1VP3A 4XWOA 1SPXA 4YRTA 4XQEA 2C5LA 1T9KA 3H3FA 1TQ8A 4LFCB 2ZUWA 3PQCA 1CR4A 3ZLUA 5SZJA 1X15A 3I09A 1HYHA 3I42A 1RQLA 3QBDA 4M1OA 4MTCA 3EEIA 4P3XA 4A2QA 3QE9Y 9LDBA 3JATB 3TTYA 4D9HA 2QD4A 2VA8A 4MVYA 3GFRA 4ZV4A 3DEIA 2QR5A 1WW3A 5KNDA 1DQYA 2B1QA 2PD4A 3CT4A 4MAAA 4WXHA 3QOXA 1EFRA 1ODFA 3PFFA 1G5QA 5CA1B 5AJTA 2J07A 3A1FA 1N5RA 1L1QA 1CDZA 2NYAA 3FPJA 3LS2A 4H7PA 1ZMTA 5TS2A 1SC4A 4CPDA 4IXDA 3UM9A 3ETEA 2F1JA 5L51A 2BM0A 4GSKA 1WRBA 4OG2A 5C1PA 1J6UA 4I0WB 1VMKA 3NKFA 3C24A 1P31A 4IUYA 4CCAA 2V3VA 4G5GA 4A6EA 1BMQA 2A30A 1H1DA 1PL8A 2Q5CA 5CB8A 5J1SB 2FPKA 3ZIUA 2X0FA 1XVUA 1EZ4A 1Z8HA 4ZOQI 3O21A 1M5UA 3QVKA 1NIJA 2ZUDA 5T4FA 1FJHA 3UJHA 5EUMA 3LFTA 3KWMA 4MWZA 1P18A 1XL0A 1J49A 1Q6ZA 4IDEA 4GU5A 1KVTA 5BVHA 1DQZA 2LKCA 2PUJA 3DD1A 4QPDA 3NZEA 4BE7B 4EJMA 5I7EA 1XJ0A 4RTMA 1JDNA 2XUQA 2ZEJA 3IP1A 2VS1A 4MP6A 3QNWA 5CXQA 2XQJA 1LNQA 2ZAOA 3LMKA 4TSKA 4JYMA 4FDLA 1Q19A 3E81A 3CINA 3ZQUA 2G09A 2GK6A 1JAIA 1MVOA 4FKBA 4DT1A 3AIMA 3PDIA 3I5XA 3ILYA 3RYHA 5B4TA 2PZBA 2DWUA 2AYXA 2FPOA 2HY7A 3E3LA 2V55B 4IVRA 1Z2OX 5JY6A 2O1EA 4DY4A 3GZNB 3I9NA 3JZIA 4DWOA 5LPNA 1NI5A 4TSFA 1KU0A 2O2CA 2D0PB 1Y9ZA 2QTTA 3CTPA 3KOXA 1WOYA 3P9KA 4TWZA 5EIBD 6Q21A 1FMCA 4N7RA 3GCGA 5E9QA 1UQRA 1O89A 2HDOA 4I08A 2IUYA 1WA5A 4A1OA 1RBMA 4JUCA 1VE7A 1M2KA 4AVYA 1XWIA 4PHFA 2SKEA 1DI0A 3Q9NA 4R54A 3D3KA 2GAOA 2EGUA 3OURA 5FTJA 4AQ7A 3CBGA 1IQ0A 1O08A 5CIWA 1ACMA 1TMOA 8ADHA 2E4AA 1L4BA 1RP7A 3ZZNA 4BOYA 5BQFA 2Z6QA 3A4TA 5IFLA 4DV2B 1T0PA 2H51A 3OEHA 3A3OA 1MC8A 1WB6A 4V39A 4ZDIA 4LWQA 3WIDA 3BK2A 4UTRA 3ZCPA 1DC6A 3HN2A 1QH9A 3KQVA 2ZP1A 5EWMB 4TMKA 4UNQA 1SBZA 2Y05A 1WKBA 4Q4JB 3S27A 3UV3A 4BCDA 2B35A 2WKPA 4QHYA 4HNUA 5EGSA 2FG6C 4HB4A 2B9EA 7AT1A 2I7CA 4MKIA 3KLPX 1O5IA 5B3AA 3LPAA 1LPBB 1JE0A 3ZKAA 4LF4B 4F93B 1EDOA 1HEUA 2XXJA 2OCYC 1H66A 2PWBA 3AUXA 1GUYA 2B8JA 3EDYA 2IOYA 1KR5A 4IIYA 5ECGC 4Z2YA 4DA9A 1JXOA 2BC9A 4N0DA 2HEGA 3CE6A 4JIGA 2YRWA 4YV7A 1YFJA 621PA 4QPNA 1CXZA 1FSFA 1M67A 2EG9A 2EZUA 3FM9A 4OAQA 1MNAA 4LC9A 5BRJA 5C5CA 2AFIA 2RJNA 4TRRA 3B8EA 2GPSA 4UHFA 2OBMA 2R00A 3GLHA 1LPPA 4H1TA 3KEQA 4P32A 4ROTA 3V8QA 2H9IA 5F5NA 1PD1A 4BV2A 2NQTA 1EESA 2NZ2A 1W30A 1G60A 1SXJB 2LE0A 2QG4A 4G89A 2R6R1 4TMXA 5BSKA 3EBLA 5AJHA 1I6LA 3E2MA 3HDGA 1TOAA 1CHNA 3DCIA 5LA6F 2BHRA 3PNBA 3DXXA 3EA0A 3MYRA 4G56A 4I5DA 4XQCA 2HIMA 1WPXA 3WBKA 2IIQA 2CVZA 3CRZA 3L93A 3LQ1A 4QDUA 4I9HA 1CNEA 3ZV3A 3V1KA 3OE7A 1CW2B 2B3TA 2FPWA 5M3BA 2I7VA 3GY0A 4FNGA 2ZE8A 4KZKA 1MTOA 2PRIA 1T25A 3N86A 4MVJD 4DLVA 2O2YA 4EHIA 4MUXA 4QQRA 4XX0A 3TIFA 3ZDRA 4BVEA 8ABPA 1B93A 1GNSA 2R5FA 3GNTA 4Y3UA 5B53A 1WM1A 1MB9A 4US0R 1FNSA 2X2OA 3HP7A 1RIFA 5K09A 4V0NA 5KQPA 2V0GA 5HRAA 3C3XA 3VKWA 2QN9A 4RHEA 1XDSA 2D00A 3LYAA 3PPVA 1C9EA 2CZGA 3L7IA 3NLLA 4MRRA 1UXIA 4U0KA 3UT6A 5JJBA 2YUIA 3L92A 3CX4A 2BZGA 1ISPA 3MS2A 2XECA 1C0LA 1HOTA 4L0DA 4TKMA 3HABA 1V3TA 3KJZA 3MERA 2F8TA 1QIKA 4Q6BA 1Y9DA 4AU1A 5JADA 2AKYA 1ZGGA 2ES4A 3COWA 4H77A 4ILEA 2CLEB 2J3EA 3JASA 4BB0A 3LO5A 3SJ7A 5KDOA 1TK2A 3IUMA 3NDIA 1NL3A 1SELA 4IKPA 1QV7A 3K5IA 1DAKA 1OZGA 4M3NA 5H0IA 4CV2A 4JC4A 1DKPA 2RHOA 3WFZA 6LDHA 2B4QA 4Q48A 1ZAYA 4PHCA 4LJ8A 2B2CA 3CEAA 3ZWXA 4DJ5X 4R16A 1GGFA 1YIDA 3OFJA 3X1WA 2DUJA 2H8GA 3BXPA 5CH3A 3T38A 1NW9B 2EOAA 3FLAA 1SVLA 1N5DA 1BG6A 1ZH6A 3LUGA 5CYOA 1BMDA 2OZLA 1E89A 1N6OA 1N78A 4DCJA 1EWTA 4KN8A 1PS0A 3C41J 1W35A 3VR6A 1N0HA 2QNRA 3W1WA 4F97A 1FFGA 1RCFA 2OBLA 5LUBA 3P94A 2NYVA 5A4FS 2I8LA 1DAHA 4HFNA 4D57A 2CJPA 3P20A 2H7YA 3AX6A 4J3FA 1MB0A 4B79A 2ZAYA 3MJDA 2A9RA 3IR6A 2CHUA 4P81A 3V8MA 2RHGB 1RBYA 2YFQA 1TLFA 4DJAA 1A5ZA 2DY1A 4LYGA 5DHRA 4U2EA 1FVOA 1E3QA 2M2IA 3O1JC 4YQZA 4R6WA 3DKVA 1WHSB 3IQFA 4OKSA 4BGVA 3KQHA 5FX2A 2OHIA 1E1NA 1SQFA 3TRDA 5B6JA 1KL7A 2WWFA 1IONA 3B82A 4JJZA 1ISIA 1REQB 5FWYB 4A8JB 1MOPA 4DA0A 2PLFA 5CDFA 2Z2ZA 2IYTA 2DY0A 5EFOA 2WK1A 4PIPA 5FA8A 1BE8A 2VJMB 2FJ0A 3Q11A 2H2FA 2RCNA 2IOFK 3C48A 3NKLA 1YFZA 4IYJA 3NHBA 3JQ7B 4N3AA 3U3DA 2REOA 4HDCA 3VR2D 2Z8YA 4DR3B 4F1KA 4JODA 1V71A 1C4OA 3QU7A 4H7JA 1S2IA 3E58A 4TYQA 2MSLA 3WP1B 1WXQA 5EIWA 4BKMA 1MBZA 3YASA 5MGBA 4EB3A 5B3JA 3N8NA 2P1ZA 5F51A 3PCXA 4O0MA 3WMRA 2FNAA 4ZDKA 2QIOA 2OMKA 3D8BA 4XCXA 5ESDA 1M54A 3UN1A 4DLSA 3UMGA 3QUQA 4MUJA 4OM8A 4XYEA 4KQ9A 4RFVA 3NTOA 5AUPB 4RVOA 1NR1A 1NW4A 1RRMA 2X1LA 3BSYA 2CW5A 1QBKC 1QGAA 2YICA 2YWGA 3AM4A 1MRNA 4TMTA 2JBHA 5B58C 5IYZA 2XSZA 3U37A 2V7WA 3V2UA 1Z2EA 3FMGA 2JGEA 3ECAA 3A4LA 1O0SA 3BD7A 3UMSA 3DW3X 1E99A 1QHIA 1NLZA 2NSDA 4E2FA 1ZSNA 4R40A 3RYCA 2VP9A 4YMUA 3A3KA 1F17A 3OU2A 2I34A 1XRRA 2FMIA 2Q0XA 3Q7TA 2XHZA 1KI6A 5IJ9B 1RXSA 2B37A 4GHWA 3LCVB 4J0DA 2WB4A 5EIFA 5CB4B 5JYCA 1T3HA 1V7PC 1XBTA 1K8ZB 2VH1A 3UB2A 3UG7A 2DBVO 3VR1A 3I6BA 8ATCA 1OGYA 3HCAA 5KNCH 4KBFA 5AI4A 1UPBA 3RU7A 2IHBA 3P0JA 5HHTA 4KTTE 4XFJA 3TL3A 3ZNNA 2HU8A 2FE1A 4J1TC 4BVLA 3RSFA 3AZOA 1K92A 3TX6A 1MO6A 3EGEA 2O23A 5B1DA 2E5FA 1UBFA 1VPTA 4PLPA 4QRDA 3OLYA 2WF8A 4HS9A 5IARA 4YCMA 3OZEA 1FJGB 3H2HA 1R4ZA 3IT3A 4LC0A 2NXCA 2QL6A 3OJFA 2CXXA 2Z3WA 3FUCA 3UPTA 2Z95A 4X9XA 4DXAA 1DG9A 1PT7A 5JBQA 3JWIA 2JGKA 1Y7TA 3D6VA 4XEHA 3DOCA 4FKMA 1N2HA 1DRJA 1PQPA 5CURA 3B2NA 3RWMB 3T7KA 2D59A 5CJJA 4ND4A 4P08A 1VA4A 2JLCA 2GEKA 2C98A 2QMOA 4PCVA 1VGVA 3NNNA 2Q2VA 1NBMD 1PJ4A 2FPSA 4DIDA 2Y0CA 1AURA 1CRQA 1FFBA 3N2LA 2X41A 4OMDA 3PJRA 2VPYA 5CNIA 1KO1A 1W9HA 4WY2A 3SEFA 4PS0A 2I2WA 2B36A 1D6NA 5ALEA 1ZK3A 1WSWA 1YJ5A 1Y5NA 4CTNA 1X1SA 5AR1A 5FRDA 4C05A 4UZEA 1T6XA 3NHAA 4QRHA 2C4UA 1QB7A 2N1MA 2OCAA 1K97A 2OBYA 4IFEA 5C8VA 3FR7A 5JFGA 2WF9A 5F35A 4K81B 1UFOA 3NEYA 1BEZA 1D7OA 2VNIA 5JTUA 1FP4B 1S3IA 2FI1A 3OQ1A 4NI5A 4UBKA 3ZCQA 1B0ZA 4D5GA 3HXOA 3L6UA 1T4MA 4JELA 4RXMA 4ZQIA 2IODA 3AL2A 3MW8A 1RYDA 2EHDA 4B0OA 2HA4A 1RDFA 3R6LA 5TF4A 2XNDA 3UOWA 3QSGA 5GTDA 3JW8A 4AJPA 4FPXA 4D4LA 4YV0A 2RHHA 4IUBS 3FF4A 3KLMX 4QBFA 3RVKA 1PJ2A 5I9MA 2XWPA 1E1DA 1IN7A 1R6UA 1QSGA 3JWPA 1FEZA 2JEOA 5GV8A 5JHHB 3DCNA 4Z4IA 1YUNA 1R9GA 1UJ2A 4JP8A 1YQXA 1G8HA 4UBMA 1AVTA 3PUYA 4ZI3A 3UF0A 4RKFA 2OY0A 2SCUA 3BJEA 4ZALA 2DF8A 3BMNB 1YIOA 1EK1A 2WAAA 4ZO7A 3V8BA 1KAOA 1PUXA 3SP1A 1K1EA 4YRNA 2J67A 1KI9A 2Q5FA 3DXZA 5B1SA 4W9NA 1Y63A 3GVXA 4L8FA 2M6KA 2NN3C 3IHWA 5C46F 3P4YA 2MYTA 2PBRA 3I53A 3TG8A 5AKHA 4TYPA 1DX4A 5J3JA 3RAEC 3ETLA 5FOXA 4I81A 5E38A 3PFBA 1E6UA 4DMGA 1YUMA 4HGZA 1U1DA 5EJIA 4EJ0A 1Z0JA 2V6GA 4Q7LA 4QU0A 2AC4A 2NUAA 5H16A 4QC2A 4MJXA 5ECYA 5FAXA 3TS1A 1TJ3A 1LK7A 3I3SR 3O47A 1WUKS 2CYBA 2Z6UA 4KQWA 4HUQB 5BVGB 1E9BA 1M75A 1HO3A 3ICCA 3K15A 1T4GA 2H31A 2JGIA 3KR9A 4JT4A 4ZT5A 1P5FA 2P9GA 1FNDA 3WKDA 4EGJA 5L7WA 4I66A 2QTBA 4MQ5A 4GPEA 2DBZA 2ZYIA 2BFEB 2FEKA 4JJEA 1H2YA 4TXLA 3UHAA 3N75A 1PYOA 4HBZA 1CZRA 3RW9A 4CF7A 4ZARA 2FR1A 2QVCA 4FBLA 1JDTA 4RK1A 1JA9A 5ITVA 5JRDS 2F1KA 4J6FA 3MUNA 1E2MA 3OSZA 2IH2A 1VGRA 3VDMA 3I23A 4GS5A 5CLQA 5FO1A 3LVBA 4U00A 2DR3A 4DRXB 3NVKI 2VATA 2PRSA 3BH6A 5I4BA 3EPHA 1PQWA 3A1UA 2PUDA 1GL9B 3KYIB 4Y9TA 4WACA 5IVIA 1LLQA 3KSAC 5IZCA 1QF6A 4OY3A 4ZYZA 4QO8A 4QSHA 2FW7A 4HOYA 5H81A 3KXLA 3C87A 4DJFC 1ILEA 2QVYX 2XXBA 1ZMRA 2ZRKA 4RIEA 5DW0A 2C9DA 3JXEA 2FMHA 3R3JA 4IFIA 1PGQA 3T7RA 2OXTA 1L6IA 3KR1A 3SGLA 2AOXA 2NYRA 3NBKA 4DIEA 3I04A 3SIXA 2QD2A 5IJ9A 3D7RA 3G2HA 3MQFA 3SZGA 1XLVA 5B36A 5KWVA 5EI5A 3QG1A 2VWPA 2AFHE 3WQSB 2O3TA 5AMXA 4NZ9A 1KAMA 2IBMA 2YDYA 3HB7A 1MIOA 2GD2A 1OYWA 2SNIE 3GGOA 3GRRA 3H0EA 4WLNA 5IXJA 3KEOA 3R5XA 1P9NA 2IDZA 3WMFA 2FN8A 4G5SA 5GQSA 1H9CA 1AUQA 3WIOA 1KJJA 3AR7A 2R9VA 3DDSA 1LU9A 3U4MA 4LXXA 3V7WA 2PAFA 2W7TA 1VPDA 2REBA 1MW9X 4P84A 1LVHA 4AECA 2LGJA 2GJ8A 3WMGA 5JCZA 2HMSA 5BYJA 4URVR 1EHYA 1I36A 3GMTA 3L4EA 2N9UA 3DD5A 5ER6A 3GFTA 1E64A 2EW1A 5M2QA 2W2LD 4DRXA 4N3BA 2OWEA 2PXCA 1II9A 1RRCA 2B5OA 4K6OA 1J07A 1NI4A 2CV2A 2BJHA 3PQEA 4DVGA 2DULA 3LCMA 1XZPA 3NBQA 4Q05A 3QXSA 4UAVA 4X1KA 1JQ3A 2YIJA 4JJKA 3ZVRA 1I1OA 3BA6A 4DSUA 4XRRA 3AEKB 3C3MA 5K3FA 2ZCVA 1Z6YA 3ET5A 4IZIA 2ZM6B 3W5BA 3HO1A 3COZA 3D6AA 4HAOA 1RMTA 1S5PA 4MS4A 2QKYA 4JP3A 4CG1A 2ECKA 1KVUA 2DH5A 2P4EA 3UWPA 2CMKA 1CR0A 1BJTA 1VL2A 2DEUA 2GBFA 4TMFA 1YTUA 3VNSA 1Q7TA 2Q6VA 4MGKR 1BDMA 1AGNA 1QRDA 1WWKA 3CKKA 1GY8A 3BULA 2NUAB 1BDIA 1M1XB 5JCOC 4NS1A 2PIDA 3JQPA 4WKBA 4ZQBA 1TQ2A 1VLLA 1XXHE 1ZR4A 2PKCA 4X61A 2A92A 2WI8A 4Y7DA 5DBOA 4PPYA 2ZI7A 1P7VA 4YDSA 4UJ5A 1ZK0A 3HZZA 3NTXA 4GP9A 4CT0A 2ZPTX 4IHJF 5REQA 1ZIOA 1ZONA 1QZ3A 2X7XA 3FTCA 4R1TA 1Q2UA 2PZMA 1XDBA 1EB8A 3MF4A 4MS1B 4C1BA 4CUZA 3OSUA 5JCPA 3TB4A 4KNYA 2Y1GA 5JY1A 1C8VB 5JUWA 3BRWD 4OQEA 1NXWA 1ZM7A 3OCCA 4N9QA 5U1PA 3JD1A 3ZHCA 4Q7KA 1FTGA 3IOYA 1FL9A 1IATA 2YMMA 4H0CA 5C9ZA 3EPKA 1MFZA 3HCOA 3P2KA 3PFCA 5T4BA 4I3FA 3W2TA 1T1EA 2EFYA 1GTMA 4JMLA 4MINA 4BX9A 4L51A 5EPEA 1M6WA 1WO8A 2WD7A 1ZH4A 5A2QA 5TPZA 5IM5A 4I4IA 4O4HB 2E87A 4N54A 4QU9A 2WW8A 3KALA 1VL6A 4DC1A 5BSHA 3RNOA 3CLRC 3QLEA 4OA8A 1VPWA 1C80A 2AOTA 3EGXA 2XRMA 4KPUB 2IZOA 2XI4A 3EF1A 1SZCA 3RK4A 1YB5A 3E7WA 1ZYUA 3VVMA 5F1KA 3RWOA 2J0QA 2FZGA 4DEXA 3MJ4A 3TJRA 3LIIA 3MXOA 5C3MA 3ZDDA 1UUFA 5DB4A 4DMHA 3QVGB 2HF9A 1SIWA 1ZRMA 1ZBQA 3IJEB 3HVRA 8LDHA 5FBVB 3MFYA 2WHEA 3EAQA 3WLPA 3JQRA 2RHJA 3MMZA 5A1JA 3UUFA 5AKZA 3W05A 2SECE 1QH0A 2WKWA 1JA0A 1I7NA 1PJ8A 2Q9BA 3FVRA 4PLCA 4YREA 4DSZA 1N1MA 1M2VA 1CPYA 2OCDA 4KQIA 2PU5A 3NH6A 1P8AA 2Y1DA 3K31A 4RVFA 2DT5A 1GUBA 4BNMA 1ZJYA 1Y7LA 3IERA 4FDAA 4I6EA 4D80A 1RZUA 4QUIA 2BGGA 2W6ID 3SQWA 3Q9SA 1R5BA 4JI5B 3PNOA 2JFOA 1FC0A 3UQZA 1L7MA 2WUDA 2N75A 1KMMA 2XKJE 3GCDA 5A9TA 1Z4NA 3ZQ4A 2I2DA 1EXMA 3H6KA 5HQJA 5HR5A 5BP7A 3A4VA 2RGDA 1DAEA 5AM1A 1TE2A 1VKOA 2AWNA 1E4EB 1JX6A 2ATIA 2PL1A 3MTJA 2WYOA 3U26A 4JUAA 2C9YA 5FADA 4LOLA 1SBCA 1KOGA 3L4BA 1TXGA 2R4TA 2XOEA 3MAAC 3SZOA 4EA9A 3ROQA 5K8IA 3W2EA 3W9BA 4RKQA 3QVUA 2W2MA 2X0RA 2O2SA 4YJKA 1CY1A 1KO4A 2QZJA 4H3KB 4RLQA 4MUFA 4WXPA 4JJ4A 4YI5A 3AUFA 2PUGA 2EXXA 4LNAA 1GTSA 4JBGA 1IYZA 1XA0A 4M0PA 4RJTA 1T3ZA 3T12A 1PDOA 1UT6A 2NO0A 2AI1A 1SU4A 3E9MA 1VL8A 3QUSA 3USZA 3EFBA 4QHTA 2ZLBA 1WDWB 1ZP6A 2O7NA 2QW1A 3ASZA 2AW5A 2Q6KA 3IMFA 1B76A 4ER3A 3R6GA 5AT1A 1ENYA 4ZCPA 3ZDCA 3QU9A 5LLSA 2YN2A 4ZEOA 4BZQA 4ZVUA 4UM5A 5IN5A 1YOVB 4TTAA 4KFUA 2H1RA 1FS4A 2VHTA 4CHTA 2BHNA 2QJRA 2XUJA 1MG5A 4OYYA 2B21A 5JPDA 3AG6A 4J0EA 3EGIA 3TGPA 2RSLA 2EAUA 2HQRA 3CRNA 2IV3A 1YAHA 2WPNA 1FFSA 2O5RA 2GH1A 3RR2A 1G9XA 4A23A 5AJVB 3GZJA 3C45A 1QWSA 1D1QA 3UAYA 1IRIA 1ACJA 2CL5A 4QOEA 5KQRA 4B7ZA 2FRDC 1C3EA 4HNQA 5ALSA 1WCIA 1NLMA 5TLSA 1Q0TA 2GB4A 1N5MA 3LNTA 1V4NA 4PYQA 6REQB 2EFJA 4JEIA 2Z9CA 1WCXA 1ORHA 1EDDA 1X7ZA 2O2GA 2VJQA 2XYRA 3ED5A 4K03A 2X9GA 4KXWA 4N5MA 3TKLA 4JI4B 1QX3A 4ABTA 3LTNC 5D00A 1MN6A 3AR8A 3UICA 1FZQA 1UAAA 2ARKA 2QUZA 5HZMA 3KT0A 4E2WA 5I4CA 1ZRSA 5CVUA 1R8SA 4DLAA 3GI1A 1YA6A 1KS2A 4RD2A 4AY4A 5D7BA 1CUZA 4JYCA 4RSMA 3I32A 1K7FB 4YLEA 2AWOA 3A6DA 1W4CA 5LOVF 3M6FA 4O4IF 1FFCA 2XMGA 2F3UA