1XNGA

Crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
255
structure length
255
Chain Sequence
b'KDYQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQTKPIDTETLAQLGYDEILVKNITSRIQKNAFKLELPAIAKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Ligase
total genus 95
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1xngA01
3C8ZA 1LI7A 1NUQA 3QE4A 1WY5A 3IMGA 1EE1A 4MWEA 4ZT3A 4CT0A 1D2RA 2E89A 2GM3A 2QUIA 4QRDA 4J75A 1WXFA 3GLVA 1ZH0A 2AG6A 2VTBB 2O8VA 1WQ3A 3PNBA 3H9CA 1COZA 1KH2A 5DASA 1ZUNA 1TYAE 1M83A 1WJGA 1NZJA 2D5BA 2PG3A 4HPWA 4ND6A 1O97C 3TQOA 5H7XA 4ARCA 3HMQA 1KP3A 2QJOA 5J58A 1F4LA 3IMEA 1I6MA 2E18A 3DV2A 1SURA 4E1AA 3G5AA 3SZGA 2QUHA 1T6YA 1OWOA 3I05A 3N8HA 1YULA 3F3MA 4R0NA 1KKUA 4CDNA 3COYA 4OJMX 1ULHA 4S1OA 4XFJA 1Q15A 3MMXA 1Q11A 3CLSC 2CUZA 1TQ8A 1F7UA 1U7XA 4A91A 1IVSA 1VL2A 1MAWA 1XNGA 4KKVA 4MW2A 1K4MA 3FHJA 3CLUD 3IDFA 3AKZA 2J4DA 1OBCA 3G6KA 1G8HA 4KR6A 4QREA 3MLBA 4EF6A 1IFXA 2QJTA 1QJCA 5H16A 1EUYA 1YIDA 3SDBA 4ZCRA 3ZGZA 2VXOA 4OUDA 3BL5A 4NATA 4KR9A 1EXDA 3L92A 1NYLA 5K0TA 1N3LA 1PFWA 3VGJA 3ELBA 4CQNA 2YXNA 5DK4A 2XRZA 1IQ0A 1WXGA 2CV2A 4Q93A 3U1VA 4R2MA 3X1MA 1GZUA 1IRXA 2AZXA 4PY2A 4NX2A 4NAHA 1YIAA 1JMVA 1N2JA 1A8HA 3FNRA 3H97A 4QBTA 4P2BA 5EKDA 1O94D 5TEVA 1YUNA 1JEDA 4XSVA 1NSYA 1XNJA 3P0HA 5KCMA 3P0JA 4ZT2A 4EG7A 3UOWA 4JFAA 2DETA 1WKBA 3HV0A 2CFOA 3P52A 2WQ7A 2DXIA 1T9GS 4MQ6A 3D6VA 2HGZA 3AG6A 1KR2A 4PBRA 1JIJA 2QJFA 2CYBA 4MWDA 1PFUA 2D54A 4HJRA 5J59A 4DLPA 1N2BA 1VBNA 3COWA 3ILVA 3SEQA 2G36A 1M8FA 2OQ2A 1TYBE 3KT8A 1QU3A 3LCJA 5KHAA 3VRHA 1J20A 3ND6A 1M8KA 1WOYA 4BWVA 1VBKA 1PFYA 1K92A 2YY5A 4RUKA 2YWBA 1KQPA 1JZSA 4YP7A 2DEUA 4ZCPA 2J09A 4EG4A 3HL4A 3IVXA 3ZXSA 3TNJA 1WQ4A 2DUMA 3PXUA 3P0IA 3SZ3A 1PFVA 2D13A 2JANA 1PG0A 3E27A 2DPLA 2O5RA 3A05A 3JXEA 5K0SA 1QRTA 4GU5A 1JZQA 5FO1A 1IQRA 3IVGA 4MVCA 3CLUC 4DJAA 1HYBA 3H05A 3IMCA 3MUEA 4Q16A 3A04A 4HK4A 3RHSA 4MLPA 3OP1A 4MW9A 2WB2A 4L2IA 5FNZA 3FETA 1ZH6A 2OV4A 3QTBA 4ARIA 2JA2A 2JAXA 1G59A 1O5TA 3PNVA 4NZPA 3VU8A 1N1DA 2Z3VA 3CLTD 1FFYA 1M8PA 2QUJA 1TFUA 1J1UA 3H99A 5TEWA 1H3NA 4YP5A 2BYTA 2CSXA 1MOPA 3DO8A 3TS1A 1H3FA 2RE8A 1NURA 2BTEA 3HGMA 1H1TA 3M5WA 3ZJTA 4XFDA 2HZ7A 4ZCSA 3AG5A 2A86A 5LFAA 2PZBA 5HUHA 1NI5A 1KP2A 1QU2A 1R6UA 1O94C 1X8XA 1N2HA 2PZ8A 3RJZA 1I6LA 2CYAA 1WXHA 3IOEA 3CVYA 2A7XA 4ZT4A 1N77A 2YWCA 2PIDA 5DEOA 1GN8A 2E0IA 1KAQA 1LI5A 1J70A 4RPIA 3PRHA 3Q4GA 1G8GA 3TZEA 1O96B 2GKSA 2A84A 1OWLA 4H3SA 4MUKA 1EFVB 1Q77A 4EG6A 4DDKA 3N05A 1QQTA 5FO0A 3TQIA 5KWVA 1OWMA 3CVUA 2HMAA 2EJCA 1F7VA 1EUQA 4G5FA 3FOCA 3MLAA 4ZCQA 1MBZA 4MUGA 3RFFA 1GTRA 1J21A 1T6ZA 4KR7A 1LW7A 1JILA 3IVCA 4YBRA 1N75A 4ZCTA 3IOCA 1NP7A 3X1KA 1U0BB 1H3EA 3G59A 4I6GA 4CDMA 1NUTA 1KH3A 4FZJA 2AKEA 3KT3A 4I6JA 1OD6A 1O97D 4KPUA 2A1UA 2PXHA 2DR2A 1KAMA 1MJHA 1M1ZA 4I6EA 4JXZA 1MAUA 1RQGA 2J08A 2CT8A 1IH8A 3CR8A 5J5AA 1GPMA 1YUMA 3CVVA 4K0RA 2CV0A 4EG8A 4GRIA 3CLTC 3FIUA 1GAXA 4EG5A 1O6BA 4YMIA 1CT9A 4MVWA 4MW4A 4L2IB 3ZJUA 2C5SA 1J1ZA 1MC1A 1JECA 1TEZA 1V47A 1X6VA 3ND5A 1KH1A 4MAFA 2NSYA 5LM3A 1JIKA 1KQOA 4HJXA 4EGAA 1IHOA 4MUJA 2TS1A 5JBNA 4NDAA 3ISJA 1QNFA 1UFVA 2J5BA 5LLTA 4MUIA 3TZLA 2X0KA 1EJ2A 3AL0C 2A1TS 3OTWA 3RK1A 1QRSA 4ZT6A 4JYZA 1N2GA 4EG3A 5TGTA 4MUEA 1VLHA 1M8GA 4MW5A 3LE8A 3IUBA 2ZUEA 3SP1A 4DDHA 4DE5A 1KQNA 3X1JA 4MULA 1JEEA 1KORA 2CV1A 1N78A 2EL7A 3A4IA 4AS1A 4UZEA 3INNA 4MW7A 3H9BA 4MUFA 3FY4A 4U7JA 3RK0A 1JIIA 1BS2A 1R6TA 1U7DA 4MW6A 2RD2A 1O95D 1GLNA 3GUZA 3IODA 3CLRD 4TS1A 1N2IA 1Q19A 4MW0A 1EFPA 2IJGX 3NBKA 4OUDB 2X1MA 3CA8A 3IOBA 3K32A 4F4HA 1ZJWA 4F3RA 2QUKA 4WNYA 1Y42X 4U8HA 4PBSA 3UC5A 3Q12A 1FYDA 4K03A 4MUNA 2A4MA 1GTSA 3SYTA 4EG1A 4WSOA 3UY4A 2GOYA 3IH5A 3N9IA 1F9AA 2QTMA 3COZA 2X3FA 1T9GR 3AFHA 4MUHA 4MWCA 1N2OA 3UMVA 4KPUB 2A1UB 3N2YA 1TYCA 1XJQA 1M8JA 3UK2A 3FWKA 4MVXA 1S4MA 1NUUA 1R6XA 4MVYA 2DERA 1OBHA 1V8FA 2VTBA 3LOQA 1QTQA 1B6TA 3Q10A 4PBTA 1K4KA 3QTTA 4EFKA 1O0CA 3S3TA 4G6ZA 2QTNA 1YI8A 3FDXA 1WZ2A 3CVWA 2V0GA 3FH0A 4MW1A 1U3CA 4G5YA 3L93A 4DNXA 3DLAA 5AHWA 2A1TR 3IUEA 2WQ6A 2A88A 5BNZA 1P7PA 3MXTA 1K97A 1JGTA 3CVXA 3PNYA 1JHDA 2V0CA 1O0BA 1OWNA 3ZJVA 2DLCX 5F23A 4ND7A 3HFJA 2J07A 3GMIA 3AIIA 1T6XA 1WXEA 1I6KA 1XNHA 4DDMA 3A2KA 5HUJA 1G8FA 1PG2A 1O95C 1U3DA 2CYCA 1DNPA 2X1LA 3ZIUA 2I1LA 4ZT5A 1TYDE 3CLRC 1ILEA 4J76A 3CLSD 1O96A 4NAUA 1EFVA 3ZUGA 2Z08A 1NUPA 2PFSA 4JXXA 4MWBA 2Z09A 1IQUA 3SEZA 1MRZA 2PZAA 1J09A 3NV7A 3D6UA 2H29A 2ZUFA 3ZXIA 4U63A 2NZ2A 4UZFA 2B7LA 1EFPB 1N2EA 3KT0A 2E21A 3KFLA 4YP6A 2H2AA 2WSIA 1OWPA 1WXIA 2ZP1A 2QTRA 5TS2A 3KT6A 4R2LA 3DPIA 4ZT7A 3RBAA 5IJXA 2IELA 5HG0A 1MB2A 2IP1A 4AQ7A 1NUSA 3K9WA 3FG9A 4X0EA 5DB4A 2XRYA 3FI0A 1MB9A 1I2DA 1QRUA 4JZYA 2R5WA 3COVA 1VBMA 3NBAA 3HZRA 5IHXA 3ND7A
chains in the Genus database with same CATH superfamily
2GFHA 1UKYA 2ZRIA 4J1TA 4DMCA 3BMQA 3ZXXA 5EVCA 1WY5A 3DVAB 4OYYA 4Q7KA 4J4HA 5AKJA 2Y1DA 3TE7A 1SXIA 4N0QA 3BE8A 3KV3O 1QIJA 3P9RA 5DWQA 3HRHA 3TVYA 3VH2A 4UNPA 1WWKA 1ZEMA 4QXRA 2IQ5A 1WXFA 3R7FA 4IIJA 3PNMA 1P72A 2QTHA 1NV9A 1LVGA 3KAJA 4E03A 5KJEA 2P75A 3WB9A 3VSDA 3OQMA 1LX7A 3DNFA 2G83A 2HCRA 1Q1QA 1V95A 2LE0A 1EGMB 4LCJA 1UBRS 1EP1B 1JF8A 2V6IA 4OX9Y 1MZPA 2FG5A 1MR3F 1BXGB 4K87A 5JYCA 3I8XA 5JDIA 1Q0TA 4ND6A 4MUBA 1TEHA 1GZ3A 3CEPB 2ECKA 1GAQA 2GYVA 4OGWA 3HMKA 4W5WA 4ZVLA 4RQBA 4BNMA 4HNTA 1YFJA 4CKXA 1U31A 3HCPA 4J0IA 4M88A 3SE0A 5AVRA 3LPAA 4A6EA 1GG8A 1VLQA 2WVJA 2XMDA 1M7HA 2WUEA 3DCJA 3MWDB 2EKZA 2I62A 5HE9A 1PGQA 3QY9A 5KTMA 3G0DA 2AEFA 4Z53A 2R9VA 5DIFA 2D7JA 3LU1A 4OHZA 3TOCA 3NBUA 1IBLB 5ESWA 2O8BB 4KVFA 4DQDA 1RWXA 1OX5A 1YZGA 2D5IA 2EP8A 2JJ1A 2WLTA 4BC1A 4EK9A 4Y6QA 1VJ0A 2H5IA 4LWZA 5EUBA 3A4TA 3QMVA 4WA7A 1TQ8A 1GL9B 2AXPA 4JLAA 1F7UA 3IMFA 2JKVA 3L4SO 2B4QA 1QHFA 4FYYA 1YR8A 4CMHA 5A4KA 1KIFA 1NVEA 2OV6A 2B8JA 1SWWA 2YN0A 5H59A 4RJJA 4EF6A 4G26A 2BKUA 3GAFA 4DVGA 3UB3A 2RIRA 3A3OA 1H2FA 3AF0A 3VR3A 4JA0A 1VL0A 5KYWB 2QEQA 3BMCA 4P93A 2A1IA 2ISCA 1L4UA 2WABA 2ZB8A 1ATZA 4LPKA 4M0MA 5G0SA 3STTA 5JCXA 3QQPA 2QGZA 4J7UA 3SXJA 4TQGA 1NRWA 1E3SA 1T8SA 3DAYA 3IAEA 5FFMA 1IEQA 2QRVA 2R1TB 1S3SA 4ND8A 3PEWA 2AKAB 1S3FA 2OENG 1UKZA 4NXNB 3GJXC 3BFXA 1WG8A 3F8TA 1E79D 2R47A 3GRKA 3VR1A 4RPJA 1CY7A 4H7KA 1JBEA 3DEZA 5K8VA 1K68A 1YTLA 3AY3A 3BREA 3IUSA 4PY2A 1JTFA 4MEBA 4D0RA 1A8HA 4YLYA 5EWMB 2P0EA 4QTYA 3DQZA 3D8SA 1LJUA 3MD0A 1O94D 1EXWA 2DHCA 4P4UA 2XXAA 3A11A 3LP6A 4XSVA 4ER3A 1XNJA 3QKRB 4JT4A 5BQPA 5C52B 2CL7X 4AU1A 2CK3A 4JYMA 2DFPA 1FRQA 4NS4A 3UGTA 1ZUWA 5A03A 3U09A 2QAGB 4F86A 1PWHA 4EFLA 5AWFC 1K4YA 2R8YA 1IC6A 3ZWPA 4KGXA 1YOVA 2HHCA 3CZ9A 1JIJA 2VCYA 1DLIA 2CYBA 5AK3A 3STUA 3CG4A 3TI9A 3KZOA 3DDWA 5JADA 1CYDA 3B8EA 5CHEA 4RJ2A 1RMYA 1LBEA 5DI3A 4BO7A 4DLPA 2NU9B 5LNK6 1JA1A 2GJ9A 1H66A 3A58B 3BJEA 5IKPA 4YRRA 4LSWA 1SH7A 3KYBA 1ECCA 1E2FA 4J4BA 5ICFA 1SXJD 1XD9A 4Q66C 3TXXA 3VR5H 1Q3KA 1VKRA 1ZK2A 3JQ6A 1VHJA 2C1ZA 2PWYA 3WWCA 2CXQA 3B1KA 5C32A 4TX1A 4E94A 4MICA 4BP1A 1B6SA 3QJGA 5D3QA 3ZE1B 4V0KA 1F9EA 4DMRA 1YB6A 2QAJA 5JLAA 1NX9A 2IZZA 2BMAA 1FUEA 4ADSG 1NKTA 4F8JA 4ZEMA 3IQGX 5HR5A 3DVLA 4GBJA 2GNAA 2JDID 5K3EA 2Q7XA 3D3NA 3VMMA 3OLQA 3VNQA 2XKAA 1BO6A 2QU7A 4IYRA 4U2GA 3E9RA 1C7JA 5C51B 5EJIA 4OQYA 4PHHA 2AGVA 1ODKA 2N9UA 4HTFB 3L1JA 3PE4A 5KWJA 3I2FA 3OZWA 4OQZA 4EI9A 1S1MA 2H3EA 1ONNA 1OLUB 1RKQA 2GXQA 3EZLA 4MOWA 5EWLA 3K1ZA 4CUKA 5JYDA 3C4VA 1FNNA 4C4XA 1DCTA 1XRRA 3RBZA 4MX8A 3DE2X 2BFEB 3GNTA 3PRKE 3TSZA 3UGQA 3T3NA 3OAAA 3TX6A 3PEYA 1DL5A 1V6AA 3C8DA 4DEXA 5AW7A 1FFXA 1SD5A 1P17A 2B8WA 1F17A 1DEAA 1RAFA 1G2OA 3EXHC 4URWR 1G3QA 4NZPA 4URZR 3UMFA 3PUJA 4B2LA 1I32A 1TK9A 2VWHA 3CZMA 3MZ0A 4TTAA 1N1DA 3VJMA 2J33A 4RD4A 1OAKA 3VZRA 1M8PA 3IR5A 4Y0AA 1TFUA 2G9RA 1FOEB 4Q7EA 4CF5A 4RMJA 4QYSA 1BE8A 1V8DA 2VATA 3ANYB 1W46A 4ER5A 3ABRB 3DO8A 4HL6A 4BNVA 1M6EX 2ZRBA 5KYXA 4TZ6A 2BF7A 5FCDA 1PEAA 4M22A 4L85A 2WIAA 3NT2A 1H1TA 2C4MA 4MS3A 4O08A 8ADHA 1PK9A 4LZZA 2AVDA 3CPEA 2R44A 2XZOA 3ISTA 2HRCA 3AM5A 3GZNB 4DA4A 1AS2A 4AP5A 5FTLA 2A86A 1B14A 2Y1OA 1LGYA 3W2EA 3GUCA 2HBZA 1XZEA 3R7DA 2WEKA 1GTG1 2YMMA 1VZ2A 3UANA 1Y5LA 4HNAA 2LIVA 4F45A 2B1JA 3BQNB 3NTOA 4X7PA 1H0HA 1K88A 4JC5A 1UBHS 4PGGA 1XHFA 2E48A 3FUWA 1Z2OX 2Y1KA 5CVCA 1NFRA 1W0JD 1ZN9A 3UXHA 2R96A 1XQ1A 1DEXA 2JEOA 1XEXB 1DAOA 1F3LA 2A2ZA 2R8OA 3EJ6A 4ZYWA 4X6UA 2EZ8A 1G8GA 4KFSA 4BNIA 3IR7A 5JNLA 5LQDA 3WDSA 2XVMA 3DE4X 2GKOA 1SB8A 1OW3B 3EGDB 4Q1DA 3MVEA 4R3WA 3WTBA 4YRNA 4M21A 1DT5A 1N4DA 1QAQA 3FPGA 1IAQA 3E3AA 4G5OA 4ZOLF 2Q6KA 5EJ2A 1IYZA 1T3ZA 4DDKA 1QQTA 3TQIA 2HMAA 4OB7A 3ZWOA 4RZIA 1NVKA 5AVVA 2FSHA 1I0IA 3RAGA 1YNSA 1MBZA 2EZ4A 1XTPA 3S7ZA 3RE1A 3CJRA 4X92A 2D7CA 4HWTA 3IKLA 1IJBA 3L40A 4HG2A 5E1MA 4CJXA 2OY0A 5EI5A 4JX9A 3NUQA 1PUIA 4YPOA 2BSAA 3F7OA 5ULLA 3HA3A 5IH7A 1Y4UA 4S2EA 4K05A 4LHVA 3NHWA 2F64A 4JEHA 2Z8XA 3FWZA 2BGGA 1QOQB 5A5DA 1L4NA 4LMAA 4MGKR 2FWMX 4TV8A 1FMTA 2Z8ZA 5AVOA 2OILA 4FX2A 4J0EA 4KV9A 5FOTA 3JS5A 1L1QA 3B20A 3VTFA 1TZCA 3AUAA 3BD9A 1V1RB 1QC5B 2B2CA 3DC7A 1WSAA 3OWXA 2OBMA 4G2NA 4GI7A 3HEMA 4L4XA 2PT5A 5EXSA 4BX3A 2FFQA 3HQ4O 4I6EA 1JSRA 1MVLA 2YWHA 4GEKA 5BSWA 2WG1A 3GOQA 2K7FA 5MN4A 2J08A 2CT8A 4KDEA 1FLDA 2V7QD 2XAUA 1EVZA 4D97A 1WHTA 4OJNA 1AZTA 1I13A 1E2EA 1XUOA 3MBIA 5FHQA 4N48A 3MT7A 2P3LA 3WK5A 3CPSA 5G40A 4Y67A 4I0WB 1NT4A 3NDBB 2QJRA 3G0HA 5AKIA 3IJ5A 1LPNA 3KOXA 3L49A 1VMKA 4YCDA 4YMIA 5AW5A 1WR8A 4DT1A 4MQ5A 4ZZ1A 2W8BB 2CC2A 4L2IB 5TT0A 5IF3A 1X7ZB 5ARCA 4J7AA 4HWGA 2FQQA 5HWSA 2ZDHA 3KBOA 3WC4A 3Q7EA 1T24A 1LX6A 1ZXBA 3NLLA 5JJLA 4IDDA 4ALIA 2Y1XA 3ETDA 2BTQA 3ZY4A 1EVQA 2ZJ6A 1EFAA 1KZHA 2QUZA 3MRVA 1TZBA 4NDAA 4Q3EA 2X5KO 2YYZA 4N7MA 4QUBA 3RV3A 2C61A 4RTLA 4OXKA 5KYNA 3KVNA 1GGEA 1IPEA 1IXYA 1QANA 5E6UB 3WYEA 3E6AA 2X0KA 2X1HA 1K7EB 3B5EA 1BNCA 1X42A 1WZNA 4P4TA 3AL0C 4RIHA 3TAHA 5JVDB 1F06A 4JMPA 2WAAA 1AKEA 3PJGA 2FWJA 1NF3A 2BIFA 1FLVA 3LFUA 4LGVA 2PZMA 3VTAA 3RTAA 1U65A 3GDOA 2ANCA 3HHPA 4I4CA 3G9QA 2XTJA 3C85A 3IUBA 4KODA 3RVOA 2JLVA 3FXAA 2AC7A 2VXCA 3BZBA 3NBMA 4Q4LA 1TVMA 3NHSA 3IOYA 4W5JA 1ZONA 1NHGA 2M2IA 3U4GA 4EZBA 3KQSA 4WDRA 2VYVA 2AQ8A 2ZSJA 1P9NA 2REBA 1BX3A 3INNA 4IGEA 4MW7A 1MAVA 4AFNA 1RYDA 4IP0A 1P19A 2HYDA 3TRJA 3DFUA 4P7KA 5ALSA 1QBGA 2R4UA 2WF9A 1D1QA 4DY6A 2W71A 4NE9A 5JZBA 3EZNA 1DX9A 3F7MA 4OXQA 4OFBA 2BGLA 3FYUC 2ZU6A 3V1MA 4L50A 3BHMA 4TSFD 4AICA 1Y6FA 1BHJA 2O1EA 1XTRA 2MYPA 4OUDB 3ZX4A 2PLRA 4HQNA 2WIFA 3EIUA 3E4DA 5E3IA 2Q3LA 3ZE0B 5CDSA 2IP4A 1Y42X 1MO6A 3KYDA 1QH9A 1ST2A 3MJ4A 4CKYA 4N82A 4WJLA 4AJLA 1RZRD 1BCRB 1U2QA 2FN8A 1YA4A 2QV0A 4N6NA 2PH7A 4ZEVA 1UFRA 3ADOA 3K8OE 4Y2UA 1YS7A 2MCFA 1UK6A 4TSRA 4LHXA 5AVYA 1RE1A 5LQRA 3AVWA 2P67A 1QIEA 3NGLA 5HKLA 3FOEC 2W5UA 3UJPA 3UXMA 3LWDA 4E7PA 1TRHA 2YWXA 2JFVA 3OURA 4FOPA 4MV7A 1EQUA 1QFJA 2EJWA 1ADCA 3KTOA 2QROA 4KWTA 5H5JA 1VG1A 4OYLA 3ZHVA 3P9IA 1BVRA 2PSJA 1LSSA 5KYVA 3VVBA 4BUJA 1IXRC 2R25B 5BVGA 1H6CA 3FNIA 3E4CA 1LCIA 4MVJH 4YXFA 2RGWA 4REQA 1MO5A 1YU6A 3F5MA 3VNUA 1RAEA 3H2GA 1PJCA 2J0EA 3D0RA 2RG1A 2V9CA 3AO0B 5CK4A 5EA2A 1R0XA 1MB4A 3FPCA 4QSMA 3WNCA 4MIOA 3LYLA 2X0FA 3IAHA 4AROA 3NHZA 1JQAA 2ZBGA 2FR8C 1KYYA 2WKWA 4Y18A 2CLDX 3GLUA 3MIZA 4TWJA 4M9UA 3UCFA 3MGKA 3FNQA 4HEHA 4Y1GA 4D4HA 3PJRA 2OCBA 3LVFO 1BDMA 5TGDA 2WHYA 1BJKA 3L6RA 4IMRA 5HBRA 3HNRA 3JQGB 1H1DA 2FPLA 4JC8A 5A3RA 1JWBB 1UC8A 3I62A 2NZJA 1FDIA 1C9KA 3ZWCA 1KEUA 1VMDA 4F9TA 4CMAA 2RCYA 2MIIA 4Y2JA 1X74A 1JRLA 3ZWNA 1ODJA 4BZQA 1YA8A 2WIBA 4LYHA 3T34A 3HWSA 2J3HA 5CFPA 1JGTA 3CVXA 3PNYA 1JZTA 2QENA 3FGOA 1E99A 2BW0A 3EDQA 3K9CA 4N40A 3SQXA 5BRJA 1NM5C 521PA 1SCUA 1EVKA 1NP3A 1F38A 3H2ZA 4OHXA 1ZH2A 5H3HA 1NBEA 5T4FA 2IYEA 3A2KA 1MVNA 1S8FA 2GUWA 2WVAA 4U7WA 4BNXA 4WGGA 4XTCS 4B31A 1NYQA 4YR9A 2AOXA 1O4VA 1FS6A 3L7LA 4CRWB 2G08A 4RY0A 5FTJA 1C9MA 1R0BA 3MLEA 1A8SA 4WCFB 4WZ6A 5C7IO 3ROTA 4ZHSA 5C7LO 3GVPA 1RKUA 2W6JD 5HUHA 5AM0A 3GJ5A 5ALMA 3OTIA 4A8JC 2A0YA 2PWPA 1EFVA 5KNDD 4CLXA 4PLZA 3UA4A 1BDJA 1RI5A 3M6VA 2JIDA 2LBPA 4II3A 5EKSA 2VSQA 4FINA 4CG0A 1YBHA 4N5MA 2IHZA 2XUHA 2X14A 4UEOA 5BNFA 2NZXA 3T1HB 2FZ5A 2QN7A 3F3KA 2B25A 1EVYA 4NCNA 1I1HA 5JARA 1Q7BA 1M76A 3LP5A 4BJ6A 1XDDA 4ZYUA 2PM8A 4XH9B 3B9QA 5K51A 5CA1F 1ZHFA 4Q1VA 1P1BA 3U80A 2Q9CA 3MGCA 1EJ6A 16PKA 5PGMA 2VK2A 1N0HA 4ZI2A 4CLHA 4RPHA 3KT0A 3OOSA 3Q0TA 2G06A 3WGIA 4XVUA 2PGDA 3VHRA 2HSEA 3WLAA 1NXQA 4V1CI 4JU8A 1TI7A 2ACKA 1KO1A 2MHCA 4GR4A 1DBRA 5LWHA 1DJPA 2JEYA 3IQIX 4WZBA 3WLEA 4B6SA 8AT1A 1E2PA 1HTWA 2EP5A 2VJMB 3PF9A 3L0IB 4M6WA 1V16B 4IUYA 4QA9A 4R41A 3QVLA 1RDFA 3VR0A 4GMDA 1II8A 1SQFA 5KU7A 2PAAA 3K2EA 4XUDA 2OBLA 2ZRKA 3VVCA 4GHWA 1Z7GA 2NX2A 2Z3WA 1YAHA 5ERGB 3QBJA 5LYJB 4FFDA 1PZEA 1OR8A 1QG0A 1UPUA 3AI1A 5DDIP 2XSZA 3U1BA 4RGQA 2FU5C 2H4JA 4H6VA 4OHCA 5JDCC 4KOEC 1PR1A 2C59A 3NJRA 4X20B 4RZQA 3GDWA 4EQ6A 2FWAA 1NFQA 3L04A 1FQWA 2OCXA 3IAS6 4YDRA 1W5FA 1I10A 2IXEA 4Y2XA 5FOUA 3SHOA 4CGZA 4R9RA 2WJ4A 1AGNA 1LRKA 3CH4B 3KLNA 2O8EB 1D03A 2AG6A 2VPQA 2JBWA 3TQRA 5CX4A 2OHHA 4KITB 1Y34E 1S4QA 4IOJA 4UM8B 4DY4A 1E6LA 1TT7A 1VSUA 4KNVA 4FHDA 3Q9UA 2AI3A 3CX6A 3B1ZA 5BY2A 1VKHA 2VH5R 4I4NA 1Y8QB 5F1OA 2NGRA 2P5UA 3U9TA 4CTMA 4XWOA 4FHGA 1JLLB 3CNBA 2NZWA 5EUCA 4IJVA 4FE7A 2COKA 3CEAA 3R4CA 4L5AA 2D0IA 3WKBA 3HEBA 3IQWA 4WBNA 2GEVA 1JNXX 1GGHA 3I2GA 3LFTA 4N5LA 1AX9A 1C1DB 3QLVC 2ZYDA 3OBBA 1TIPA 2C7GA 3KJGA 1E8DA 3G9TA 4RS4A 3VR4D 4FYVA 3LXXA 3SS9X 1SQ6A 1P61B 3SQMA 1U9IA 3DF7A 3E9QA 1BS1A 1Q15A 1FPMA 5AHOA 3AJDA 3ICCA 1J33A 2FP4B 3D7RA 4CM4B 3TRIA 3QA9A 5ICEA 2V8OA 1ZNQO 3GGCA 1D4FA 1MUUA 1KZGB 3IQZA 1QKIA 5IZCA 5D2CA 1DINA 2YOGA 3IBYA 3RHZA 3TQCA 1QCCA 4GZ5A 2R65A 4I5DA 4ZQBA 3ZWAA 3GY0A 5AXBA 4OHKA 4E33A 1J23A 2FLVA 3KL2A 2O2XA 3NHKA 2VJQA 5CDYA 1ICEA 3H18A 2BEKA 4ZCRA 3BD6A 5LZ2A 2P62A 2GK7A 1AH2A 2WMYA 2R7MA 3LYUA 4KR9A 4GNRA 1ZGHA 1JMKC 5A06A 1XU9A 4LFCB 3KSRA 4L8YA 4YIHA 2JK1A 4P3XA 2QP9X 2JIBA 3P94A 3ZLJA 2OB2A 1JQ3A 3T5GA 1FTNA 1VQ1A 2W9XA 4I3HA 2J3KA 3ZGVA 2B98A 4EHDA 4ZJZA 2HHHB 4JR1A 4JVSB 3DDZX 1PS0A 4JHLA 2H2WA 5EIAA 1IMOA 4QGGA 5KYKA 3LCRA 4D3ZA 4EH1A 2VF8A 4DLWA 1QHGA 4JMLA 4IUDS 2RHHA 1U1CA 3B8HA 1B23P 1Q7EA 1PL0A 2OC9A 2YQZA 1L7DA 1U81A 3UJ7A 1G7CA 2RHCA 3CN9A 5K1ZA 2SKDA 5EKTA 2PVSA 1A8IA 2NLOA 2NQ2C 1Y6RA 1YUNA 3E3MA 1L4LA 3P0HA 4Z9AA 3U3DA 4GLBA 4EQZA 5M34A 2J85A 2QPAA 2XODA 1QQ7A 3P96A 2BONA 2RHJA 3AR6A 3I12A 4UBIA 4CTOA 1MH1A 4EGQA 1UC5B 1YRAA 4HOYA 2NUBA 2DTDA 1WTAA 2FE1A 5F4BA 2QJFA 3Q7PA 2OLKA 5EHQA 4CMEA 5AXAA 3BRWD 2PUEA 1H2YA 2JAHA 2H63A 1FP6A 5JQWA 4W5NA 5ECYA 1RBZA 2ODBA 5C1PA 1L7EA 3J80A 2ZB2A 2CDRA 2GETA 3QQ5A 3VR2A 2G36A 3RYFB 4Z8XA 5LIRA 4AG5A 5FUMA 2YZNA 1F51E 1HFEL 4R6XA 1YL7A 3T5CA 3T9BA 4M0KA 3EMDA 3ND6A 1OYWA 4FX5A 4PCLA 5AUOB 1KTIA 3W06A 3T4PA 3ZLBA 1TT5B 2VJNA 1C7QA 1PDWA 1S2IA 4J0GA 1XQXA 4UHHA 1P7YA 4F2DA 3DTNA 5JJ5A 5KWEA 4E09A 4XM2A 2PZLA 3JALA 2WIKA 3ZE8A 5HM6A 2CDAA 1I4EB 4EG4A 1RWBA 4Z5XA 4EW2A 1BVUA 3ZNQA 3TNJA 3PXUA 4GI5A 4PZEA 4DLSA 3SZ3A 3H75A 2EFJA 4DMMA 1N0UA 1KK1A 4MUYA 2HFJA 5JSFA 1G8YA 2QMYA 2ESRA 3JXEA 4GU5A 4WACA 4OPMA 2RBKA 3F1LA 2QX7A 5G02A 4V0SA 5JY1A 5C53B 3IVGA 1MEJA 1WMEA 4G85A 4WOJA 3F5SA 3UAGA 1HF3A 1Z7WA 1FX0B 3M6FA 3WIEA 1GXSA 1J9EA 3GFVA 3HCWA 1KEEA 3IUYA 3QMWA 2R00C 3RADC 1OTHA 5EFOA 2YY7A 1XWFA 3CLKA 5HUQA 1ML4A 1DWQA 1NPYA 2GAAA 2NVWA 4WVFA 5DGHA 4AZVA 3I73A 1DJMA 4P3KA 3N8DA 4C6HA 3T06B 3BE6A 2IPXA 4B45A 4Y6RA 1LDNA 1VL6A 1GNTA 3H5LA 4OP3A 3RT7A 2I3AA 2AQKA 3OPYI 4CEHA 3HN7A 3DZIA 2RGRA 3TRDA 2VRNA 4CKBA 4P6VF 2DLDA 4XIIA 3SN6A 4A2WA 2R6JA 2F2TA 1IWPB 4NI5A 3RC1A 2TMDA 1YR7A 4IOKA 1EYZA 2AR9A 1I14A 3L06A 4KQKA 3O9VA 4LPSA 5CT8A 4LNAA 1GRRA 4GX0A 3FMGA 1VI2A 1KIMA 4B32A 5BNIA 5J4LA 3TGPA 4HVTA 1J6UA 3OQIA 1E7SA 2IOYA 2V03A 2ZBEA 2EKLA 3DWEX 4QBHA 1LC0A 3ZG6A 1LWOA 4R4JA 5IYZF 3ZGNA 1QP4A 3R9XB 4PSAA 2JCSA 1A9QA 3P2OA 1K2WA 2VKTA 3WYDA 4B6QA 2VCHA 2Q2OA 1E62A 1EM8B 3O2QB 1V4BA 4V0RA 1G64A 2X7XA 3NJ4A 5FHRA 3V32A 4E4YA 4YV2A 1D2MA 5HKBA 2IXTA 5DEOA 1HNWB 4ZEWA 1TZMA 1O08A 2F9MA 4I99A 1BA3A 1KAQA 4DXAA 5AW8A 4DJDC 4MARA 3C87A 1K5HA 3K0SA 3MRXA 4E11A 3FTEA 2GQ0A 4OMFG 1E1RA 3OQHA 1O5OA 3F9CA 1OI4A 1Q77A 1ZUD1 4G9EA 1GV1A 3CNLA 1M1YE 4FFWA 4HGYA 5ENZA 1V35A 3VYSB 1AA9A 1QX3A 1GSOA 2X8BA 4U3JB 3OPQA 1UKVY 2ZZKA 4ZAFA 3UB2A 4IIJF 2L82A 3QU2A 1ICIA 2I6TA 3LGXA 3MLAA 4YXWD 4GMKA 1H1LB 1X1BA 4I50B 1NQWA 2W6ID 4LVCA 4D43A 4KAAA 4UOZA 1SBQA 4X97A 1T4CB 1K6IA 2HA7A 3K6JA 4O4HB 1GG2A 3RH0A 4KPFC 1M2VA 3ZHTA 2IY9A 3TECE 1ZEJA 4XGQA 5ALGA 1RHQA 3TUIC 1QOPB 2P30A 1AURA 5DBFA 1WIWA 4AO7A 2GCOB 3O8OA 3G59A 5HEKA 3OT5A 2HF9A 5ICCA 2PJDA 2XY4A 1QVVA 4ZTUB 3U7IA 5K4GA 3T9AA 5JXGA 2BUAA 2CXOA 2GAJA 1ECBA 5FBZA 2EFCB 2AWNA 4BV3A 5EZQA 3WO0A 3WV4A 1T9KA 1G17A 1Z13A 1JFTA 1ZI8A 3HO8A 3KL4A 5ALRA 1GU7A 3EWNA 4KV7A 3LLUA 1KVTA 4FDLA 1Z16A 4KIGA 4FPXA 1DT3A 4OB8A 5BURA 2UAGA 3D6JA 2LIPA 5JSZA 2NUPA 2DKOA 2ODQA 3S8EA 3FHCB 4R54A 1JDBB 1W48A 2TECE 1T2NA 2GJ8A 2XDWA 3DZDA 1TE2A 5AW9A 3RTGA 1S3GA 3NWPA 4KN6A 1NXVA 1Z33A 4YJGA 2OD7A 2GK3A 4L9WA 3D4NA 5L4SA 2W2KA 5HM8A 1TIKA 2WPDA 4MVWA 1P77A 2PSDA 4Q4DA 2P6NA 2Y3IA 1AU9A 3TPCA 3AXSA 1TM7E 4OH1A 1TEZA 2O8CA 5L9AA 2PFGA 3GGOA 2C3YA 5FOQA 3FCUB 4JL6A 2G0AA 2QG9A 2XB8A 1BMFA 3FFBA 1SXQA 3C7AA 1ZUNB 2Q5FA 2WHRA 4JS0A 4KVAA 4XYMA 1AQ6A 3RUIA 2QTCA 2JIZD 1F8GA 1KI3A 3ZD7A 3IT2A 1CUWA 2JFFA 3ESZA 3P2IA 3SIPA 4LZPA 1O9BA 1R4NB 3NZEA 1ULZA 2PS1A 2OUIA 2XUGA 2PU5A 4CQMD 1VJRA 3LDAA 2OQRA 1D6MA 1OV4A 1Q16A 2Y77A 4GEGA 4WK4B 4BFVA 3QENA 1FDUA 2E4UA 2CB9A 3CZ4A 1VA4A 1L6RA 2AXEA 4A23A 3KLPX 3L1HA 1K89A 1E58A 2HXYA 3F6RA 4MW5A 1X87A 3WGUA 3E9EA 2R6HA 3I6QA 5HFJA 3ILHA 5K9ZA 1CZRA 6AT1A 1H4QA 5I4KA 3EQ9A 1L3BA 4PCVA 3VKUA 1EWKA 4FEYA 1WVIA 2BFPA 2PYIA 3UK6A 2AN1A 1FF9A 1HFKA 4N6GA 5ALJA 1MORA 4G4SO 3G1WA 1CHDA 1KY4A 3ERCA 3DQPA 2NG1A 3HUEA 1YR1A 2Q29A 2GM5A 3L7IA 1I7LA 3O94A 4BWGA 1WHSA 1Y3AA 4AIIA 3UO8B 1KSFX 3ZKWA 2FDXA 2Y1WA 2TMKA 3EQ8A 3P2YA 3E5RA 3PPIA 1PTJA 5LB2A 4C0AC 3VR4H 4HBGA 1BOFA 1EK2A 3C5EA 5I4BA 4EL5A 3DZCA 1PX2A 3DO6A 3F98A 4TLCA 5KTPA 3WQQA 4IPTA 4PLFA 1T3HA 3KV1A 4RTNA 1FFSA 1N7JA 4O2BB 1ZJWA 1XTBA 5BYAA 5CFNA 5FEUA 1G20A 1Z6ZA 2PEYA 1X1CA 3DWGA 3UBMA 2Q6VA 3BDIA 1SUFA 5K0NA 4F5ZA 1YDFA 3G2OA 3LDUA 3QEMA 2BN4A 3CRMA 5BMVA 4YT5A 3RPEA 2JAPA 2NUTA 2PVCA 5E0OA 4DLXA 4L9AA 3AF2A 3Q41A 5I9MA 1LF5A 1YONA 1L4GA 1W96A 1KE1A 4YRKA 5E3JA 4ZMRA 5HMLA 4FLMA 3H0CA 3K70C 3FAKA 3U2QA 3EH2A 1TA4A 4IQ0A 3QUAA 4NV0A 1DHTA 2X0JA 4QDKA 2BFFB 3Q7TA 4WLVA 1TCCA 4B43A 1GGJA 2BM9A 3AFHA 4Q9AA 4MWCA 3AY7A 1ZUIA 2QQ0A 2BI8A 2CFIA 2F55A 3SQNA 3I01A 2QVLA 3RSOA 2L2QA 1VE6A 1YZNA 3IQDB 4ENTA 2V3CC 1ZM4A 1YZTA 4W5QA 2FR1A 2FX2A 3SXUB 4B71A 3DGFC 3L6UA 2OBYA 2ISQA 4B3JA 4Y6SA 5JH7B 5D3MA 1EHIA 2WTMA 4ZQFA 1C3JA 2YS7A 4NZMA 2F9LA 5HNKA 1BKSB 4M86A 1OSNA 4PRKA 4C22A 2B4KA 5KNCH 1Z4MA 1WZ2A 1HETA 3CVWA 3JZDA 4JT9A 2G7MC 1USWA 3WL6A 2J6CA 2EFEB 1SCAA 1SGWA 4XPIA 3RRMA 3GRYA 3HH8A 3LGAA 5FORA 4R0MA 3TVDA 5LZ8A 4RGBA 4BVFA 3DLAA 3NR2A 4Q4HA 6LDHA 1FSZA 1CERA 4OD0A 2Q8PA 1F12A 3CV3A 2B5OA 1UODA 1QVAA 2ZJAA 2FPXA 4Q48A 5D5QA 3THYB 2QI9F 2GZMA 3LW8A 3GRRA 4N9WA 4PPQA 2V0CA 1BJRE 2VF7A 3G5UA 4PX9A 1IZ0A 1ZWLA 2B36A 1HE2A 4ZAVA 4DNFA 4YUZA 1NKSA 5K8JB 3CM0A 4UUAA 3UJDA 3UTDA 2F8MA 4AC9A 2O2ZA 4U02A 3PPXA 4UVDA 4BMNA 5K6AC 4QHSA 5L3QA 1OOEA 3PL5A 4K9SA 1IK6A 3GCDA 4QT0A 1MIHA 3DMHA 2PPVA 4IXMA 4G0ZA 4KSYA 3BZWA 4U0KA 3K5PA 4R40A 3PEVA 3V1TC 4B6JA 4LN1A 1ZINA 4BLRA 5C5CA 5AW0A 2H5JA 1ZAYA 2CWWA 3OLCX 3ZS8A 2ZS7A 1VI5A 2G5GX 2VHYA 4A2PA 1TZKA 4EPYA 1GTMA 3PUVA 1U7WA 1XTJA 4ID3A 1LTKA 3QLUA 4TQUS 3OZXA 3MJDA 3SEZA 4LFAB 3JU3A 4KX5A 1FTSA 1RJGA 1UKAA 3QJYA 2D74A 2QXUA 5DTEA 2LXNA 2ONYA 1TTPB 5FOXA 5EIWA 4UZFA 4BVEA 5L45A 1NVTA 4EA9A 3DKVA 4FK8A 4PZYA 3TLYA 3G13A 4GOJA 1DAGA 3U7EB 3GN2A 4CCYA 1IWOA 2G0TA 2AS0A 4G4GA 4HGNA 1OWPA 1HBJA 4P7GA 5LQMA 1UCFA 1FUYB 3MQ2A 4IAOA 4ZT7A 3FRHA 5HG0A 4LY9A 5FTMA 2OPHA 3U9LA 1NUSA 2FG6C 5HIMA 3TYXA 5CB8A 5L3SA 1XWIA 1A4RA 4TV8F 4UHCA 4A10A 3GIWA 4EA6A 4CKCB 1L7BA 3H84A 1A8UA 1UF9A 3Q9LA 4FMCB 4MQEA 1L5YA 2D8AA 3HCCA 1PNOA 1XQYA 1Q0SA 3M1YA 1U3GA 3AR3A 3RRNA 3WWEA 4QJ3A 1KQFA 1VBMA 2KI5A 2ZXFA 3PPYA 5DHSA 4D74A 5FPPA 2X4LA 5GJWC 1PE0A 2JVIA 2J30A 5JS1A 1JDTA 3U4DA 2BEVA 2VSYA 3DMGA 2VP4A 4J1QA 4QTZA 2OV1A 2WJZB 4G37A 4OCZA 3K05A 2QB5A 2ZRMA 4C0SA 2KQUA 1NJ5A 3NNDA 1G5QA 2GT1A 3B1WA 4QOHA 4QOSA 1D2EA 2ZKLA 4HXFB 1KZ7B 3RS8A 3EA0A 5C5EA 3AH8A 2GZ1A 4QDUA 3WY9A 1DC6A 3O47A 5KJCA 3KAPA 3N7AA 2O6LA 5EHIA 2VJBA 2PZJA 5BNTA 1Z07A 3CEJA 1GKLA 1MHTA 4GWKA 1TL7C 4YRSA 4K6GA 2ZJ2A 5GZ6A 2RAFA 1NAIA 4PLPA 3S2ZA 1O6GA 1ETHA 4X91A 1XB2A 3GJZA 2F1JA 1AZLA 1U0NA 5C1DA 1WNTA 2AG5A 1RW4A 1PJZA 2XBUA 4EX6A 3DKIA 5I01A 4FGLA 4KBYA 4F93B 4R8KA 1YKFA 1XA4A 2UVDA 1CJCA 1RP7A 1V39A 3B2NA 1CS0B 3SZGA 1RYEA 3ZZUA 3IUPA 1HR0B 4FWIB 1E1NA 2DJIA 3MWYW 4EB3A 1ZS9A 4JOCA 4ECAA 1VJ5A 1X7YA 1RSZA 4K9QA 4QUEA 3G2IA 4XFJA 1TXGA 4L4SA 4NS1A 2ROQA 3DEIA 2UZIR 3AU9A 4KLNA 2NSDA 1NF8A 4R9NA 2O4CA 2YHSA 4WXMA 2XRFA 4AX8A 4B4UA 5CB6A 4M36A 2ZCUA 1AHIA 2I1QA 3GLKA 3MMZA 3NQ41 4O5OA 4TT3D 3JAMA 3I58A 4FYJA 4IJUA 3W8NA 2J4DA 3G8DA 4EMUA 4KR6A 3U3KA 2K4MA 2WIJA 3GAAA 5ILQA 3HLKA 2DFKB 1XRPA 1G6Q1 1S0UA 2PX5A 2VTKA 1ZESA 2XVXA 4BNKA 5BSKA 3R20A 3QVJA 3S2SA 4ECEA 1KDVA 1O54A 4D9BA 3PLRA 1E5VA 4R31A 5BO5A 3EGOA 1W36B 2A9PA 5EKXA 3S1AB 1ID8A 4LDPA 5EJ9A 3MWEB 1V9CA 3OPYB 5T3UA 3FPAA 5EEHA 4ESEA 2C5BA 3DOHA 4FOLA 3WAJA 4CQNA 4F4UA 2DFNA 5C8XA 1NLMA 1TVCA 3DMFA 1QP7A 3FDIA 1FRZA 1FTWA 2F1RA 2I5PO 4HAUA 3UQYS 2KMLA 3TR5A 4MR7A 4B33A 2ZSFA 5BV7A 4NCKA 1ISJA 1PQ4A 3HXKA 4P58A 5LQSA 3N74A 4BYGA 4IKPA 3D2BA 3ANMA 5K3AA 1ZL2A 2MWMA 3BFPA 3KB2A 3DZKA 4PHGA 5J5VA 1X7GA 3F74A 4M0PA 3HXQA 4LX0A 4X1IA 4Y0NA 4DCOA 3MJEA 2OLJA 1TO6A 2XCLA 3F3YA 1V4VA 1TCBA 4BVLA 1SM4A 1KMIY 1M1NA 3IV6A 4EZIA 1GPLA 1MAHA 2NNLD 5FQOA 4UKDA 4EG7A 2ZUCA 4P0QB 4MB0A 2GZ3A 2IYSA 2FV8A 4DABA 1CUXA 3INGA 4DIKA 5L53A 3CPHA 1OFVA 5JPIA 2R8RA 3IKJA 3PBKA 5CPFA 4OSPA 1UBFA 3FSJX 5GOZA 2C54A 1NU6A 3RYIB 5LJLA 3KR1A 3C6XA 4IOMA 4Q18A 5ALUA 4EPRA 2IXAA 4HS9A 3ISVA 1X86B 4XCQA 3PD0A 1G38A 2WU8A 2AMFA 3LQ4A 2B5WA 4ZO7A 4EJ2A 1HY3A 3LDHA 3R0QA 5K0LA 3ESRA 1R18A 3T7TA 1N57A 4KHPB 2PA0A 3M9WA 2O2JA 3Q3JB 2FSVA 2J59A 1Q0UA 3ETNA 4NNPA 4JC0A 2WUDA 1TLTA 1GUAA 2MJLA 2VHJA 3OZAA 4PYLA 1NW8A 1TKCA 4Q3CA 4EDFA 3IPLA 3KOMA 2DEUA 4TKUB 4YNBA 1XQVA 1R6AA 2P2NA 3DBLA 1CQJA 1CZHA 3AHGA 5DVZA 3IVXA 4F6RB 2HLHA 5FPTA 3E22B 3UKOA 2EJVA 5B37A 5DHTA 4DLRA 2QE7D 1UBEA 1VHDA 1R27A 3B3FA 3CW8X 4KIUA 4DIFA 5BW5A 5K0SA 1G4HA 4CM3A 3FTPA 1WKVA 4ROSA 5T4HA 1DFGA 3T4UA 4K2AA 4H77A 3GDHA 2IYYA 5EIOA 5IPFA 1LZLA 1VIVA 3WLJA 3A04A 4G0VA 4X7BA 2ZLBA 3OPMA 5HDQA 2Z57A 3RVPA 3QU5A 2KHZA 5JS2A 3T7SA 3Q2KA 4U6NA 4NNOA 2W43A 1RNLA 3IULA 5G1NA 3ES9A 3MWKA 3ZU5A 2H3HA 3FFAA 4V1CA 2GD2A 4HN2A 3IEPA 4E22A 5BOVA 1Q7RA 2XUIA 3CIFA 3L07A 5JIBA 1MX9A 4RJKA 4QT4A 1UMCA 2GD0A 3H99A 4QQFA 4BN0A 2HJGA 4M0UA 3ANLA 4I1UA 2YV2A 3RSGA 2IYAA 3LHDA 1X70A 3TBKA 1VE9A 3HR8A 3FTCA 4FI3C 2WD9A 4L78A 1CIJA 1E9EA 1S02A 4B4OA 1DQPA 4WKCA 5DYTA 4EM6A 5BUQA 4JVMA 4U8GA 2VQDA 1Q84A 2HY7A 1JT2A 3WHIA 3AV0B 3OLYA 1N6RA 4BAGA 2M1XA 1EA5A 1JW9B 2B21A 5LFAA 3W4KA 2ZIFA 1DDGA 4Z1MD 3LXMA 2GXAA 3FLEA 2IZ1A 3IQHX 5TQVA 3HJBA 3NHYA 4QICA 4CEJB 2O7QA 2X2PA 3GPDG 4U39A 2A0XA 2J32A 2ORVA 1H85A 4B3HA 3ENWA 5WRFA 4F6CA 1GRVA 1PV2A 1WULS 1L4HA 2E0IA 3QX9A 1LPOA 1X3SA 3RUFA 2GZHA 3SFTA 2QPLA 3EXEA 1KMNA 1NXOA 1OIWA 2GESA 3OJOA 4MSUA 3KSBC 2IPLA 4N0PA 1PUXA 4BMSA 2ZBUA 2H2DA 1SKQA 3KQVA 3VHXA 3HDHA 4DVJA 3K2IA 3ABSB 1MMFB 3PT9A 1IU9A 4KSBA 2HREA 4YAJA 3KQMA 4C1NA 2FZCA 4I1PA 3CB4A 3DKPA 1H8HD 4MYTA 3BA6A 4X9XA 4EUEA 3LQ2A 3GROA 3RFFA 3ZDDA 1V43A 3C3CA 3OX4A 2PUVA 4YT4A 3HVJA 4BGDA 2X19A 3EVDA 5HJ7A 4YUXA 3DZBA 3OFSA 3QWHA 3HPRA 4ALLA 4I19A 1O2DA 1J8YF 2AZMA 3E9DA 3JVUA 3LIPA 3OSZA 5EIBC 5HOQA 1UZAA 3TXAA 3K5IA 4KXYA 2I7XA 1FDTA 1DKPA 1HZJA 3MQFA 1PD0A 2EOAA 1HRDA 2B4YA 1MEOA 3E9NA 5EJ6A 2ZWMA 5JT1A 1VLLA 5DNUA 1UANA 4ZYLA 2BM0A 3O03A 1QAMA 1QDLB 3E8SA 3DM9B 3ELDA 4GX2A 3F9IA 3T7KA 2QYOA 2NO7A 4ONEA 4C3OB 1EB9A 3K94A 4WZBE 2EGHA 1D1SA 2HWKA 2FZWA 2DWOA 3VV2A 3WYAA 3ZIAA 2Y0EA 4BOYA 2GEBA 4CE6A 4WBNF 1RQGA 3GGSA 2GPNA 2VNAA 3MCZA 2RKWA 3R8XA 4C7XA 2BISA 3PGJA 1XZNA 1P4SA 5DP2A 1B2LA 2WUFA 3NXSA 1LQ2A 4AF7A 3K6SB 2P5TB 1CC1S 1WV0A 4K0RA 1G4AE 1QIGA 2W6NA 3QV2A 5F7JA 4YV0A 2I67A 1EUDB 1R10A 3GFGA 1DB3A 3BGOS 4TKVB 3RU7A 4ABTA 1GAXA 2F3RA 2LP4Y 1O6BA 4NMMA 4DM7A 2G6TA 4MW4A 1BGVA 4WNAA 2D6FA 4G0QA 2OAP1 3U1TA 4G81A 1E60A 1OH7A 1D6NA 3RVQA 2D0PB 3ET5A 4UHFA 3VYTB 1KH1A 3UMMA 4BQQA 2F8TA 3GEPA 4HJXA 2RB4A 1PVDA 2P9ZA 1EP2B 3LLCA 4AI6A 4EJMA 3S81A 2CXTA 1SU6A 1YQEA 3HBAA 4KAFA 4DV1B 1RFGE 4FZVA 2ERYA 5HRUA 2WYIA 1EPUA 2Y4NA 4CWAA 3O4RA 3ANSA 1HSOA 4BMCA 3V8PA 4NBKA 4RD2A 4AUKA 4C7OB 3TLKA 2C8JA 4UE6A 2Y27A 4FB4A 2A1TS 1G6OA 3OIFA 5BUCA 3WLFA 2COEA 2OQIA 4L16A 4L74A 5ER6A 4JNCA 3EVNA 3IP6A 4Z0TA 5LWQA 1P0PA 1ZCJA 4TMXA 4UM9D 1FBTA 3H0KA 4CDRA 4CEIB 1WZEA 3AHCA 4BTLA 5D85A 8GPBA 4OQNA 4HGQA 4TTIA 4BQEA 1YKGA 2CV1A 3U44A 1QTIA 2IHNA 2C29D 1Y81A 3MT8A 1U9ZA 1WEKA 3QX7A 2C94A 4LW8A 5AHRA 3W1WA 4G8JA 3FY4A 2IKQA 1MAAA 2OVFA 4M46A 1WMSA 1XAGA 1Z35A 5CEFA 4TV9B 1BS2A 2XNDA 2PQ6A 2Y1EA 4RW0A 4DMHA 4DDVA 3W9BA 4FWTA 2NWQA 3LBIA 4UNSA 1ZVJA 1TLFA 4MTLA 1DE0A 4M9RA 1V9LA 5AYVA 2I0FA 2DTEA 4FMDB 4N5DA 3HDJA 2FUNB 1JE0A 1UEJA 1L9KA 4M0FA 3MNFA 3I9V6 3WFZA 5B3JC 3ZHUA 2QUBA 5KOIA 4JBWA 1BU5A 3HXOA 1GAEO 1XZQA 3SIRA 2Q6IA 3KETA 1NA5A 3KJXA 2IYQA 3VI3B 2UVQA 3R0IA 4HH0A 3QKTA 1Z6GA 3MT9A 1G8KA 1IIBA 4K03A 1JH9A 2WMNB 3WJ2A 5CDGA 3ESAA 1GSIA 2CEAA 5EZYB 3G8CA 3RSLA 4ZAZA 1ZBDA 4OY3A 3TNDA 1W5AA 4BZXA 1ZHHA 4FGKA 5J3JA 3B13B 5K8TA 1DTSA 2ECFA 2EZUA 4XM0A 1YZKA 4LI3X 4DILA 4BX0A 2XQFA 4NBRA 2LDBA 1L5ZA 4TLAA 2AKYA 5DTRA 4JKIA 1UOPA 2ODWA 2QD2A 2YRFA 2ZAIA 3OJXA 2P41A 4IIHA 2J0QA 1QZZA 2J31A 2B1QA 2GD1O 1AQIA 3OCCA 2VJOA 5BSMA 1GZVA 3RASA 1HK7A 3JX9A 3UAOA 4O4JB 4WQMA 3DSRA 3GWGA 3UMVA 4OXNA 1SXJB 2Z9BA 4YS6A 3EGVA 1L1FA 1MRSA 5CTAA 3R7BA 1TDJA 3AW8A 4PO9A 1C1XB 5CXQA 1KQGA 1EFLA 1M8JA 3AESA 1NVXQ 3HR7A 3D02A 1UAGA 3F5QA 3Q5DA 3CSDA 3PC8A 4B85A 2P35A 1CVLA 4LCEA 4CKEA 4PLVA 1ZZEA 3IHKA 2QN8A 1B3RA 2O3JA 2GM9A 5AXCA 2WJJA 1QTQA 1IM8A 1R5OA 1KS2A 1YMVA 3FRJA 2UZ0A 5IDXA 4MS4A 2ZGVA 4ZVRA 5ESDA 3SJUA 2VH2A 4UNNA 5G0TA 4AUMA 10MHA 1EDEA 4MDHA 4ZOAA 2GF0A 3ABZA 3SU8A 2PH5A 2AYYA 1OXTA 4PC3A 2JFYA 4N7BA 3FROA 4IJMA 2OQVA 5K05A 5JXIA 1J56A 2GJSA 3F49S 1P9WA 4ZARA 3OM0A 2ZT5A 3HVRA 2P6MA 2IDJA 2VN8A 1JVNA 1G9TA 3I2YX 1D2AA 1WF6A 1KTVA 1WMFA 4IKEA 3PNLA 3VPBA 3KD2A 3MAJA 1PT8A 4HLUA 3TQTA 5IKMA 2QDXA 4RMNA 3RC3A 1A9PA 1DKRA 2CHUA 3K53A 4FFOA 1YRLA 1X14A 2NPOA 4I08A 4LSGA 3UATA 3NVDA 4PZAA 2IWRA 2DLCX 4K6HA 2IEZA 5JJCA 3KALA 1AGXA 2WAOA 2VA8A 2ZDQA 1QV9A 3KVRA 3H5WA 3MTAA 1GPAA 5EE1A 1G41A 5EE5B 5A6SB 4CMBA 1RWQA 4LQCA 2XCSB 1EWQA 5IULC 1ODLA 1DAEA 1CQPA 1K7SN 3I39X 2P6OA 3U7QA 1I6KA 5CGZA 4P4SB 4TL9A 3C43A 1JU9A 3IPAA 5C8YA 2CXUA 2XMPA 3D5EA 1SZPA 4PE5B 4PN3A 2F9FA 5TC4A 3HJUA 1EK5A 3GLHA 3BICA 4MWGA 5E6SA 5KTSA 1W5BA 4YJ3A 1N5MA 2V98A 1KYQA 3P2KA 1VKJA 4GSYA 1EJBA 1W1UA 3HA5A 3PL1A 4EJSB 4JI8B 1SUDA 1U4SA 1A95A 1SCQA 4UTZA 4WADA 3QFSA 2P4EA 1KS9A 1YQDA 1Q20A 4TOIA 1PZGA 1P6QA 2Q9AA 2BEJA 4LWOA 4PYNA 4QOFA 4G86A 4DJEC 1FXWA 4C6TB 1EBFA 1MKYA 1COWA 1HDCA 2OOKA 3O26A 4QJIA 4KTVE 4DV7B 1NM5A 1PGOA 1G21B 1SUIA 1RXIA 2H29A 1MFZA 1NQTA 1Z7BA 2W6ZA 3HS3A 2P9QA 2Q5CA 1UDRA 2NVBA 3HNOA 4U63A 4V0QA 1L5NA 3T94A 4P9NA 4F5WA 1C81A 5FAXA 4YAWA 2GN0A 5DGXA 3KZMA 2W93A 4KN5A 4BJ1A 5F76A 2QAGC 1STOA 4YYEA 2VDWA 4TL6A 1RLOA 4BIMA 1GA1A 5EMKA 5FLKA 5FUYA 5TMBA 5BV8A 3GLGA 1G98A 1US8A 1MHPA 3U39A 2D8MA 3RBAA 4KJXA 5BW4A 1B42A 4KNYA 2FZVA 3LT0A 1OJLA 1NASA 4R3UC 3SDSA 2FPWA 5CT4A 3K9WA 1IUKA 1JS1X 5B2FA 4KI7A 1SY7A 2FI1A 4NLLA 3FJ1A 4N8SA 3A1CA 4OIMA 2QD5A 2H0RA 2YVQA 2JLUA 3VU0A 3F9RA 4DN6A 3IP5A 4J03A 4Y2PA 1CP3A 1RQPA 2WHXA 1C9JA 1U94A 3D0KA 2ZSKA 3M0EA 3TD9A 3BFKA 3DTYA 1DIBA 2KX7A 1PKXA 1EE1A 3OFND 3DLPX 3BIOA 1Q0RA 4G1MB 3BPSA 3K7EA 4F3KA 4CT0A 1JPUA 2CJXA 2E89A 3HGTA 3HABA 3LD9A 4QRDA 1K2VN 3QX8A 5E1DA 3DA8A 3ZI0A 3A7DA 3CX8A 1DUSA 3KSMA 4FT2A 2VHXA 2GO7A 1XZMA 4IIYA 2D4AA 5G0VA 1A9XB 2ARKA 1MXHA 3CO0S 1YQWA 3G0CA 3QU9A 1WQ3A 1TAHA 3EZXA 4LXIA 2BKVA 3VO9A 2QS9A 3V8BA 4LRTB 1MJGA 4O6VA 1NFFA 2HK9A 1KO4A 1MDBA 2VS1A 1TYAE 2G25A 4MGIR 4ZAWA 4YAUA 4Q3KA 3E61A 3BGIA 3JATB 2ZITA 5DGCA 5K0ZA 1LRLA 2PKQP 5JSHA 5BQFA 2QJOA 4FKZA 5ALIA 3UM9A 5HKKD 3DAGA 1QORA 1W4BA 4GZ6A 5JQGA 1E3WA 4FOTA 1W19A 2ST1A 3DOJA 4HV4A 2FPPA 3QH4A 4N47A 3S2EA 3UXYA 5HKAA 3J81k 3JQRA 2MSCB 3QXGA 2QUHA 1OC4A 3DT9A 5CNKA 2CVHA 1N3IA 4IS2A 4ZODA 3IKTA 3F3MA 2EQAA 3DXXA 5LUBA 3LKZA 1AMUA 2I22A 2BTOA 3GQBA 4Y9UA 1BMDA 3P9QA 5T4EA 2AK3A 2AVNA 2DULA 3COYA 1K3TA 3DJFA 2ZTVA 5LUAA 2AOTA 3MSCA 1M3SA 2W2PA 3DOCA 1HQDA 3BILA 3LT4A 1U7XA 1E8MA 4MQFB 2BOVA 1Y1TA 4IGKA 4PLHA 3H13A 3KQKA 4IXNA 4ZHQB 1GO2A 2V96A 2WFAA 3I9NA 4P81A 1JIVA 2AYZA 3GT0A 1LDEA 1KI6A 2EHDA 3C2QA 3NWJA 2F3QA 4M38A 4HAVA 2GFIA 4IM7A 4KU4A 4XOUA 4W1QA 3BJMA 2BMDA 3T38A 1DBPA 4B3RB 2NU7B 4KGZA 4PAQA 4G5RA 2VHQA 3DE7X 1HV8A 1VJDA 2P27A 2QRMA 3QUCA 4UW9A 5AJYA 5B7QA 2XCUA 3WISA 1UMBA 1XZDA 3MB8A 3TBHA 4I1IA 2O8FB 4JKOA 2VO1A 1BE6A 3KVVA 2EBHX 4BJHB 3C8MA 5UKDA 2LDXA 2FFBA 3STWA 1P73A 1CRLA 4NYMQ 4OK6A 4IF6A 3ELBA 2H65A 3H83A 2DT5A 3EFOB 1MH9A 2R1VA 2B69A 3R7WA 2YXNA 3WG9A 1C4XA 2IW1A 4BVKA 1PNVA 1XTIA 3IHLA 5FPSA 4EHBA 5JBIA 4IRMA 4IX9A 2I7DA 2XE7A 2IZ6A 2QORA 2RHTA 1QGED 1WSWA 2PQMA 4P83A 1AF4A 5BMVF 3NWBA 4FDUA 1ZMOA 2O05A 1OPRA 1IWBB 4TPKA 2A7QA 3PUZA 1WDWB 2EU8A 1NLZA 1TA9A 3OUTA 4K5QA 1YIAA 2IEDA 3R5XA 4X1KA 3FNRA 4WN9A 3NEAA 3DR3A 4Y2VA 5DM0A 3IMKA 4GP6A 1Z63A 1YL5A 4BLWA 4X66B 1P2BA 4G0UA 1M5TA 2I6SA 4B7CA 3BXOA 1JFFA 1RYMA 1HMYA 2BJWA 4UM7A 4ZT2A 4QNMA 3ZXIA 5HK9A 1LNZA 1WXQA 3WZLA 2HHLA 2BP7A 4BFYA 2EWVA 5JAOA 2WQ7A 1UEXC 5C7OO 2PLFA 3S7TA 1QK5A 1XEAA 2DPMA 2YQ5A 4RPCA 5T8KA 2OHGA 2E4YA 4GLLA 3ZQ4A 4JWKA 4PBRA 2XBLA 2ZQZA 3OWOA 3T7JA 4DEYA 1N3BA 2WOOA 3UT5A 1Q57A 2AB0A 4D3SA 1SA0A 2HMTA 3E1GA 1RIFA 3IL2A 1E5QA 1V9SA 1X8JA 4RVCA 5ETJA 4CM7A 4QVGA 1DFIA 1CDEA 3JYLA 3O38A 3D6FA 1MTOA 1RRGA 3ILVA 3PQDA 4LHEA 4Y2SA 3VH3A 4DF3A 3KKLA 1JKXA 3DE5X 4RH3A 3TLJA 5BVHA 3MWGA 1U2DA 2Q3DA 4NYJQ 4MXDA 4MV3A 2FN3A 5I9LA 5AK5A 5HCIA 3O95A 5LNK1 2JA1A 1G20E 3PIIA 3O1IC 1JEQB 1QIHA 1MCZA 2JGLA 3MS7A 3BMOA 3PGXA 2JGRA 4DCSA 2PUFA 2D06A 5CNJA 1DCMA 5D3KA 3KKEA 4N3NA 5TQ2A 3O3OB 3VSBA 1Z83A 3DP9A 4J0CA 1BJTA 1KFBB 4WZAA 2PX0A 2VWQA 2ZK7A 4KWHA 4AF8A 3ZVMA 2D1QA 1LV8A 1Y89A 1Q0LA 3ITEA 3NTXA 2EKBA 3ICWA 4F1KA 3VR2D 4QPJC 2P0AA 3OEEA 1W76A 2WG0A 3LHKA 3WLQA 1KYTA 5EFZA 1E2DA 2X13A 2EGUA 1HXHA 3EWAA 1HA3A 3MSXA 4Q16A 2Q99A 1EIWA 2G07A 3UAWA 2RDMA 4L07A 1P0CA 3L1KA 3I9MA 3L8HA 3WJ7A 4M76B 1B6GA 3ZOKA 2JAUA 5KOJB 1JU3A 1PJSA 5E4FA 1VIMA 5AK0A 2Q8NA 1V5WA 1T5OA 1QBKC 3AF3A 4R9VA 3C15C 1UFQA 3TLMA 2E4VA 2B4TO 4OHFA 1ISIA 2JLCA 1Y3HA 2QHXA 1JKJB 2YXEA 2YJ6A 4KLCA 3EB9A 1H3FA 1NNUA 3W5CA 3UOWA 2XWBF 1V37A 1NURA 4HB2A 3RU9A 3ZIDA 3ZPXA 1P1CA 4M1OA 1QZUA 3Q5EA 2CHVA 3BD7A 3KOWA 4DC1A 2GHTA 3DT6A 5K09A 1PL8A 3WYGA 3W5DA 1NR7A 3EX7C 2I9PA 1QH8A 2OCLA 3PUXA 3Q40A 1SVSA 4N8EA 4PRZA 4JLNA 5JXHA 4ZVMA 3T5MA 1KJ8A 1RAAA 2HK7A 2PR7A 1FBNA 3ZHQA 4D0SA 1VJGA 4OLJA 3H5AA 2VK8A 3NC0C 5EPOA 3RS5A 3H8WA 3QITA 4DADA 3AF6A 2GCGA 1FC0A 3C1UA 4RK4A 4JBLA 4XYGA 1A1SA 2EJUA 4II2A 1KZ6A 1XG5A 3PQ4A 4Y7DA 5CLFA 4NXMB 2AMLA 1P74A 2YOHA 3LF2A 1SHUX 3SS7X 3VYWA 1U7HA 1M67A 4ALJA 2YINC 1QHYA 2NOAA 2WD8A 1JQBA 4UHKA 1RAHA 5CNMA 4L22A 4NTZA 1CQZA 1EZZA 4RBNA 5KKNB 4RVNA 3GD5A 3IX7A 4LWQA 4QWWA 3QXJA 4F4FA 1KVRA 3ANXA 3EDOA 4C4YA 4IJWA 3JZAA 3X2EA 4JI1B 4YRLA 3CVUA 1UJBA 3NTQA 3GOHA 3U3OA 2EJCA 1F7VA 5IDYA 4RVFA 3I04A 1GWNA 1FZTA 1R4MA 3HDTA 3WKAA 2FN9A 1WW8A 1WUHS 1EP9A 3I5XA 1GTRA 1YWGO 3PR3A 2O57A 3W04A 1FRFS 2ZYSA 1XMXA 1CV2A 1LI4A 3UMRA 1T1EA 3NX4A 3QELA 1DMRA 3GDFA 4HH1A 5JC1A 2YCLA 2ECPA 3X1KA 2X58A 3W3AD 1N6IA 1L5OA 4MQLA 3C7CB 3AUKA 3PB3A 2XKKA 3WLTA 1BFKA 3A14A 3K1TA 3TW8B 3UT6A 1EG2A 3CY6A 3T52A 3HADA 3KPVA 1SBTA 4K88A 5IJ0B 1LA2A 1E63A 2C00A 1KYZA 5ALQA 5CDHA 1ZJ5A 1YV9A 2PXHA 4F3CA 2IL1A 3SMQA 1RXYA 4HUJA 1GKIA 1Y1PA 1F48A 1RI2A 2BFMA 5HOEA 1N0IA 2CJYA 1N1MA 5K8CA 2RFLA 4G0WA 2E1PA 3OPXA 1UAYA 4IGAA 4R9UC 5TIIA 4GOXA 3E1SA 4P98A 4RAQA 4M8SA 2BFCB 1AC5A 3EZFA 4YCBA 1XRJA 2RHMA 2P9TA 2RKBA 3VM6A 2Q62A 3E7DA 1IHXA 3CLTC 5JE8A 3PYLA 1CS4C 1JJ7A 2E4ZA 1L8QA 1DBIA 1PFKA 3R1IA 1F0NA 1R8JA 2JBAA 2RSLA 3B3AA 3DV0B 3EF0A 3ICVA 3M1LA 4G97A 1RHKA 4LDAA 1MC1A 3Q11A 1RWVA 1Z5OA 1EFRD 4O25A 1BIFA 3RG8A 2NSYA 4PAWA 2CKDA 4CG2A 4CV1A 4FFVA 1GUYA 4TZ0A 1J42A 3ITNA 2A33A 1YNOA 1ZD5A 5CVTA 4WCFC 1E2KA 1TMKA 3LHFA 4YB8A 5EJ5A 1JHVA 2CD9A 3AB7A 3BG5A 3ISJA 2VDMB 4Y7CA 1C3OB 4ZOQI 5KNBD 2HDHA 3HEAA 1BWSA 3AEUB 1SKYE 2VRWA 3Q6MA 2B8NA 1WY7A 3ZLTA 4CT4B 2EKQA 4D3XA 1DO8A 2XWJI 1ZKDA 3DOFA 3GEMA 5MFPA 2WPDD 1CZUA 3CX3A 3OTWA 3QFHA 2B3TA 2GS9A 3H8VA 4LV6A 4JYZA 4AMVA 1YHNA 3EGEA 2HU5A 2ZIAA 1XA3A 2XTAA 5AP9A 1Z4QA 2H0QA 1X77A 3L4EA 4QPCA 3UICA 1W5TA 2XVAA 3BORA 3T3OA 1T43A 4DDHA 1LBHA 4DE5A 2I6FA 3E03A 4HDMB 1BMFD 4QVIA 4IF4A 4Y6OA 2Y68A 2CDCA 4X8MA 2WZBA 1Z37A 4OL9A 1PJAA 4CMGA 4US2R 5CH5A 1NRXA 3IAUA 4XCXA 5BSTA 2PL3A 3QGMA 3RYTC 4AKHA 5TPWB 3VZSA 5JATA 3NHFA 4CQLB 1G291 3OY7A 4R1SA 2NPIA 2RD2A 5ITZB 1B8UA 2CL5A 1U5CA 1ES9A 3OOEA 4AO6A 2OP1A 3EZYA 4JLSA 4LYFA 4OXIA 3X1WA 5F9FA 2XUOA 5B12A 4C9BA 5KSOA 1W1IA 1IHDA 4UCXA 1CCWA 1SELA 2IC5A 2PRKA 3PGVA 3PHJA 4MVJM 5EIHA 2VJCA 4BLTA 2GKGA 1Z4PX 2QSJA 1N6PA 3U5ZB 5AH0A 5A62A 2Q4EA 2IW3A 4CL3A 3JD1A 1RR6A 2P9YA 3D3WB 6Q21A 1C8BA 2J6IA 1EFUA 3F5DA 3LUKA 4R8VA 5KSPA 3OKAA 1ZGAA 2GYYA 4AJ1A 4TRNA 5I8WA 1QOZA 3W6ZA 1FYDA 3OT4A 4UTVA 4CM8A 1XJ0A 3M9LA 3TOVA 4E5MA 2VBGA 2LCQA 4AECA 2A4MA 2IXFA 1D1TA 5B1IA 2XX3A 1HT0A 3V6MA 1SCBA 1PK7A 1CFZA 1T36A 2QNRA 2R751 4EG1A 3MIIA 2GOYA 3IDSA 1I2MA 2GX6A 3COSA 5G4KA 4CKZA 2KJQA 2ETVA 4OATA 1EEXB 1KKLA 5DLPA 2IUYA 1MW9X 3EF1A 5AKHA 3OPVA 4KQHA 3EHDA 5TY0A 1FYFA 4OOEA 3OZCA 3LPMA 1ACLA 1T1SA 2MR5A 2OFFA 4BX8A 4YRGA 1RYZA 3FLBA 3PS9A 1DI0A 4IDOA 3HJRA 2RB5A 4HY3A 3TOSA 2FZEA 4DHWA 5K3OA 4HNVA 2C7RA 1HE4A 3PENA 2HA6A 3BGDA 2IS1A 1OUMA 4KXWA 1TAUA 4NONA 1S4MA 1NUUA 1SG9A 1KC1A 3D8TA 3VMFA 1IM5A 3HKEA 4EAAA 1V8FA 5LSAA 3V42A 2AK2A 1SUAA 4H1WA 3X2SA 2NN3C 3CGWA 3S3TA 5C5IA 4RIFA 4URHA 5FDFA 3OG9A 4Y30A 1NBMA 3H3JA 2C07A 4DXDA 1E2BA 3AI3A 2AZ4A 3ORFA 5DIZA 5KPJA 4YRZA 3I6IA 3K71B 4XARA 1OLXB 5E8JA 1XMOB 4G5YA 3OU2A 3FR8A 3DGEC 2V5VA 3K0BA 4MKIA 1K9SA 1V2HE 2WWIA 5I3CA 2RHBA 4DFDA 2A88A 4JLPA 2P2LA 1Z6QA 2ZYUX 3FGNA 3OFJA 4LNHA 3LVRE 2HGSA 2WFLB 4ALNA 1GFZA 3IP7A 3QX3A 4EY3A 3TKLA 1RZUA 1OWNA 2HV8A 1UJ2A 2EX1A 4OA8A 5LA6A 2YNMC 3DMTC 3HWRA 5F23A 1SOUA 1UR5A 3DTVA 3NPAA 5DCYA 1GDDA 1YJQA 4DDMA 2ZYGA 4R51A 4DBVO 3GYBA 4EPTA 3SHTA 4ZYVA 2HU7A 3EIFA 3NXKA 3EVBA 5HIIA 1P3DA 1C4WA 4GYYA 1FP2A 1CSEE 5F7ZA 3ZGXA 2FCAA 3DEHA 4PSDA 4KFUA 5CGQB 3R6DA 5JASA 1F8FA 2AN3A 2VI5A 2VTEA 1GSHA 4QEDA 5FA8A 5FL7A 3ICQB 5A3QA 3VKGA 4HRAA 1K27A 3UB4A 4D3DA 2H00A 2HDOA 1VPWA 3BEDA 1OASA 5CBPA 1EVEA 1YGPA 3MTGA 4FT4A 4CIXA 3AVPA 3BS4A 4V39A 1ZJZA 2P1DA 2JARA 5LL6P 1U8UA 4RY2A 4MR9B 1RWPA 3Q9SA 3M2PA 4JBHA 3ZV3A 3GUVA 2RH9B 4LRQA 1EFPB 3CZQA 3WDKA 3EDMA 2DBZA 4QO7A 1CJBA 2UYGA 4CMIB 1JSLA 4CI9A 3FZEA 4C3ZA 4C5AA 4KFTA 3GJ3A 1TJ4A 3KFVA 1XV5A 5AI0A 5IM5A 3NWEA 4BNDA 4WLEA 3CRRA 3EWIA 2Q0QA 1E3LA 1H2WA 4XDGA 3UA3A 1ZU5A 5AJHA 4BJ3A 2DC1A 5F7XA 5FNVB 1ARZA 4NQRA 2PRYA 4PZDA 3SHVA 1RMTA 5EIBD 1ZH8A 2EG5A 4L02A 2QX6A 5LQAA 1RLUA 2O14A 5HF9A 1K75A 2R5WA 2LD4A 2HT6A 1KMMA 1FY2A 3GJSA 3LL4A 4FKBA 4TMFA 3S1LA 4AN1A 1UAAA 5I5EA 4LZWA 3HU5A 3KUKA 3HZRA 3NBAA 1X9IA 3NDIA 3QEKA 4Q3DA 5E8RA 2GLTA 1R66A 1RWMA 1D2NA 1LI7A 3NP7A 4E13A 2QLMA 5DTQA 1D9XA 3BWEA 1A9RA 2DY1A 5CX1B 4OGFA 4D8XA 4DMKA 1HG1A 1A1VA 1M54A 4LKRA 1D2RA 3BA1A 3L0SA 4YCJA 3KCNA 4GE3A 1YQXA 1VXRA 1XCPA 2A94A 3HP7A 3ESBA 3GNLA 4EKEA 2RH5A 2RJOA 1CUVA 1HDZA 5JBQA 4PC6A 1FMJA 1V11A 2VQSA 2P4UA 3FCOA 4JLDA 4W82A 5DLYA 3CEHA 3IAS1 4KGDA 3TEFA 1KHTA 2MMGA 3O8LA 3PQFA 3CEMA 5LKRA 2BFDA 1LF0A 2GHRA 2VH1A 3EC2A 3GCGA 2IH4A 2OYCA 2IE0A 1M83A 1UOOA 3WP0A 1B26A 4CCSA 4HPWA 4ZI7A 3OCZA 3TG2A 4QGAA 4L5IA 3DW3X 4QUIA 4UE3S 1DQSA 2O1SA 2YYAA 1DCKA 3SC2B 1E4VA 2HMVA 3G2LA 5F5NA 1WB6A 2R8ZA 4DV4B 3EIQA 1UMDA 3MELA 3PEUA 2MT9A 1X19A 2G04A 4KLRA 5H83A 3FM9A 3R5SA 1AQNA 5DSXA 1ZY2A 2NYAA 4F96A 3A6FA 3W6UA 4R0NA 5IVKA 2NZVG 4TUYA 2ZS9A 1C8VB 2PS9A 4RQUA 4OJMX 5CR9A 4HF7A 4LY0A 2AFIA 5JY6A 1Q11A 5L4LA 1JDPA 1YA6A 5JAHA 3KKOA 1DIOB 4K1XA 2QIPA 1DAHA 5FWAA 5TXGA 3ET4A 1Z39A 1Y1SA 3IDFA 4YWJA 3V9AA 4DV2B 1CZKA 4HZIA 1I30A 3FBWA 2OV3A 3OIGA 4N6OA 4OAQA 4PHFA 5AJUA 4H35A 5ENDA 4Y6PA 1L1RA 1QGAA 1XF9A 3M4ZA 2Z4TA 3NUZA 2VSOA 3WGLA 2GHIA 4BQRA 1XOIA 5L6MB 2QJTA 4DJJA 4BKOA 1C50A 2GRJA 1BXRA 3OOJA 5H16A 2XUFA 4XDZA 3WGGA 2XKBA 2C4NA 3HUUA 4PQFA 3SNHA 4XUEA 4KWIA 4FW9A 5DNAA 2HRZA 2LR0A 1NIPA 1JE1A 1SCIA 4RTKA 4BGVA 3G8BA 4V38A 4UTPA 5F9HA 2QRUA 3KUDA 1W0KA 4HRVA 2PLNA 1RKBA 1E64A 3WVNA 2GJAA 2C77A 1VSVA 2EWWA 2EW2A 2OHVA 3MTBA 2FYTA 4WOCA 1CNFA 4BUZA 1X92A 5DO9A 3PNQA 1DAPA 1L5LA 2I4MA 2BKLA 1WXGA 2QYTA 3B6IA 3DM5A 3GRAA 3VNSA 2QVXX 2UYYA 3N0XA 3ADDA 5AOCA 4AO8A 3H2KA 4N8DA 4L8LA 3H6KA 2JPDA 1NBOA 3VPSA 4BNTA 3CJQA 2Z04A 3THWB 2WF5A 1SKBA 5F33A 1V6CA 1W4LA 1JG6A 5A0TA 2W98A 1OMOA 3TL2A 4GGMX 1C0IA 3NKVA 3VOBA 5KNLA 1ENYA 2PBRA 3HI4A 4DZZA 1WUIS 1Z38A 4NU6A 3HN6A 4HAYA 3FZNA 1NSYA 1VRVA 3O3CA 3GLRA 3FOFC 3EG9A 3IT3A 2NTYC 1QHIA 4TRRA 4MYUA 4QUGA 4YJ2F 1QIKA 4DSTA 1Q74A 1XKXA 2QAIA 2XWPA 1KEKA 1R0RE 5LMUB 3D6VA 4K3VA 3WB1A 1G0OA 2P5YA 2E49A 4IWNA 1VB3A 5DM1A 1T91A 4YI5A 1UM9A 3L8EA 3LOPA 2F1IA 3GC6A 4MWDA 2D54A 4PVCA 3CNEA 1KU0A 3AUXA 4B44A 2AYXA 4B82A 1QQAA 4JLKA 2GWRA 1JDBC 1M33A 3QUQA 1F6BA 2FW7A 5EJ4A 5CLLA 2OB1A 3IEIA 2VPZA 4B0PA 2SCUA 3VC2A 5A9RA 4HDRA 3MWJA 5LBIA 3K4HA 4AG3A 1M8KA 2ZETA 1B1CA 3EFBA 1VGQA 1CRPA 3C3BA 1U1GA 4PO3X 4Z54A 4RUKA 2GN4A 5AMXA 2RGNA 3DZ8A 3PGLA 2J1LA 3FF4A 3GWZA 3NO4A 3SJ7A 3O8QA 3SNKA 2ISSD 3NU1A 1NAHA 3HL4A 3WGVA 4NENB 4R5MA 5GJVC 3OZIA 1TJ5A 3ABOB 3PT5A 4V3CA 3TAUA 3TOXA 2JANA 4P5PA 2IODA 4D5EA 1L4KA 3KZVA 1KK0A 4PAGA 2CKMA 4I8XA 1ORIA 1DELA 4ZALA 2RI1A 3SZOA 2I3DA 3OECA 4NC9A 4ITVA 2QTBA 3ELWA 5FBWB 5SZIA 1KVQA 2B99A 1LLCA 4AY6A 2B6HA 2GNOA 3LI2A 5C8YF 5FUBA 3RHSA 3I64A 1YH3A 3NTRA 2D62A 4MLPA 4AVYA 2DF8A 1ADYA 1WOMA 5KVQA 1K5DA 4K6KA 1I6WA 1N9ZA 4X93A 4YJ3F 5D3ZA 1QGUB 2PS3A 3O7WA 3CX7A 1VPDA 3LFHA 1OHHA 4TROA 3PX2A 3HO6A 5BPFA 4Q05A 3PR2B 1DTWB 1MC4A 3FBTA 2R7LA 1JU4A 4LVUA 3T7AA 3WI7A 4EUFA 1FXWF 1U8TA 3IFSA 3S29A 2GA9A 3CF4A 1DUIA 3KJIA 4KYIB 1AO3A 1K6MA 4UFOA 4IIFA 2HSWA 2W2MA 1ZW6A 5FYDA 1TCAA 5H3LA 3ZDCA 1E4EA 5E7QA 3ZU3A 5KYUB 821PA 2ACEA 3JYPA 3JQ8B 4CM9A 2HF7A 4OI0A 4OQDA 1Q1BA 2D0DA 1TF2A 3KQQA 3HY3A 3V55A 4LC9A 4BNFA 1BDIA 3ECCA 4RMHA 2KWIA 2EJTA 1ZSYA 4X1YB 1PJTA 4Q9DA 3H65A 1R6UA 4PR0A 4ZANA 1YQGA 1MGPA 3CVYA 3UMBA 3V2HA 1NBWB 1RACA 1IJEA 1BS9A 4HN9A 4P86A 3ZNPA 2NUAB 2ZRGA 2HU2A 3D3KA 3OX2A 3WXMA 1RZVA 4Q1BA 3CONA 1LI5A 3AHHA 4HUQA 5DRTA 4F1WA 3SVLA 1YI0A 2QN6A 4MTCA 2D2FA 2I4OA 2J6BA 1M1YB 2BGMA 1T3SA 2JS7A 4GM1A 1YB4A 3FW1A 1FP4B 1E7MA 1USGA 1SC6A 4BMYA 5GIOE 1CEYA 2AEJA 3ZGYA 3IAM6 4K7JA 1OAAA 3EXFB 4KRFA 4AG6A 4KMOA 5LMZA 1KI9A 4G5FA 3CYFA 3FOCA 3QKSB 1X39A 1ZOPA 2C2YA 3P2JA 1OZFA 5LZ5A 1Z73A 2FWNA 4M8NE 3KHTA 4XJXA 3A36A 2WMOB 1LW7A 1T8TA 4JJEA 4R2WA 3TWOA 4EABA 1YB2A 2WF7A 4LJAA 4EB6B 1AV6A 1GUZA 1HH4A 4AZTA 4E0BA 5LQKA 2BV3A 4NYIR 3Q6IA 4HCJA 3IOCA 1PGPA 4PM4A 3BXHA 3MPUA 4I3FA 4GXTA 3N7TA 3QBEA 5E9JA 5DXFA 3WLPA 2MINB 4CDMA 1R7RA 1JI0A 5HGXA 5IABA 5IYZB 3HXMA 4HDSA 3GLGE 5TJ9A 3GUYA 3RRXA 4HAWA 3LC0A 1TMGE 5JQGF 3C3DA 3RKSA 3UHAA 4O0MA 4BLQA 1TAQA 1ULTA 2WZDA 1U6IA 4KPUA 2I4IA 2AA3A 1MJHA 2ZR9A 3HY4A 4HDNB 4WERA 3UAVA 4MK4A 4PAMA 3ZJYA 1WU7A 4C3UA 3K9HA 1J25A 3GNSA 4Q4AA 4O63O 3QOWA 1YS4A 4X90A 3JQ7B 4B7AA 4Z4IA 2XYPA 3E9ZA 2FK8A 3I5UA 4PZZA 5K0CA 4MINA 4MKHA 3V8QA 3ICEA 4Y1RA 3AC0A 3IALA 4ZC8A 2XMBA 3BMQB 4JJAA 2GN9A 1A7KA 1YZQA 4FTWA 1Z82A 1PFQA 1U3TA 2DWUA 4F8YA 4LZLA 1HDRA 3F90A 3R5HA 2OV2A 1TO1E 4DYHA 1GAJA 1QGYA 4JLWA 5IRCD 2YUTA 1CT9A 4AY2A 1YDEA 4KQ2A 4EPXA 2HK6A 5EG5A 3VC1A 3OQJA 5A3JA 3DNMA 1UJ5A 1Z0AA 3L41A 5BN4A 2QSYA 1V47A 1S9DA 3L7YA 2POCA 3ZBPA 5FPYA 1C1YA 1CR0A 4R7TA 2HLDA 4H59A 2HDWA 2VLIA 3OA2A 3SLRA 3GGGA 3DJYA 1W30A 3ON5A 4C7VA 2WHQA 1A5TA 1SQ5A 4RKRA 4WXEA 1CNMA 3VPDA 5KTOA 1JPJA 5FBLB 2J5BA 1ACMA 3RQIA 3JWPA 4CHTA 2CMDA 3H5NA 3PIRA 3Q5GA 1FDWA 4L9RA 4OQLA 5JEDA 3WQRA 2VZLA 1H6DA 1EDBA 4GPAA 3ECAA 5CIYA