1XNGA

Crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
255
structure length
255
Chain Sequence
KDYQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSVSMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQTKPIDTETLAQLGYDEILVKNITSRIQKNAFKLELPAIAKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal structure of NH3-dependent NAD+ synthetase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 95
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1xngA01
1Q11A 3FIUA 3IMEA 3VU8A 2EL7A 1KQNA 3Q4GA 4MUNA 3CLRD 2DUMA 2J4DA 3P52A 3ZUGA 4EG7A 1MC1A 1QU3A 1G8HA 3S3TA 4ZCQA 4CDNA 2V0GA 3LE8A 1O96B 4JFAA 3A05A 4MW2A 4AQ7A 1N2JA 4MVYA 2G36A 1COZA 1JZQA 1LW7A 3RK0A 4K03A 4NAUA 1X8XA 1MRZA 1VLHA 2E21A 1BS2A 1KAMA 1KP2A 1VL2A 3COZA 3M5WA 4ZT3A 2BTEA 4MW0A 1WY5A 2A7XA 2E89A 3QE4A 1KH3A 3VGJA 1P7PA 1JGTA 2D54A 1MBZA 2CFOA 1G59A 2NSYA 1KAQA 4KPUA 1T6YA 4EG5A 1IVSA 4YP5A 1KH1A 3LCJA 3CVVA 1G8FA 2VTBB 2AKEA 4MQ6A 1N2IA 4BWVA 1B6TA 4RPIA 4DDHA 1F7VA 4UZEA 1NUUA 4Q93A 3D6UA 4UZFA 3UY4A 1MOPA 4L2IB 1WOYA 2X3FA 5DASA 5HG0A 3FETA 3X1JA 3DLAA 4E1AA 4EG6A 2DERA 3TNJA 1U7DA 3RBAA 3TS1A 4ZT7A 2QJTA 1EE1A 2IELA 2CV0A 5BNZA 3G6KA 4S1OA 1I6MA 4G6ZA 3K32A 1D2RA 3Q10A 1GTSA 4L2IA 2NZ2A 3KT6A 3PNBA 4KR9A 1J1ZA 3MLBA 1FFYA 5DB4A 2CT8A 1PFWA 4G5YA 4MWDA 3CLUC 3ND7A 5FO1A 5HUHA 3A04A 3VRHA 4ND7A 2YXNA 1H3FA 3DPIA 1ILEA 5AHWA 2CUZA 3E27A 1OWLA 1MB2A 2GOYA 1O94C 1N1DA 5K0TA 5J58A 1YIDA 3CLTC 5FO0A 1ZH0A 2XRYA 1J1UA 3TZEA 1NUSA 4MWCA 3AFHA 4ZCSA 4CQNA 1NZJA 4EGAA 2QUHA 2YWCA 3CLUD 3NV7A 1VBNA 2WQ7A 4EF6A 2YY5A 1H3EA 3L93A 1M8PA 4U63A 1PFUA 5KCMA 1EFVB 1TYBE 2QJFA 1Q19A 4CT0A 5KWVA 2PG3A 3HV0A 1A8HA 4MAFA 3SZ3A 1QTQA 4QRDA 3UC5A 4EG1A 1QNFA 1G8GA 4R2MA 3H9CA 3AL0C 2JANA 4J75A 4MUHA 1KKUA 2VXOA 1O95D 4MW4A 2D5BA 3C8ZA 3K9WA 3X1MA 2QTRA 1NUQA 2WQ6A 3IODA 2E18A 3G5AA 2A1UB 3N9IA 2JA2A 1OD6A 1O97D 4MVWA 1IRXA 1K97A 3FHJA 5K0SA 2QUIA 3RFFA 1T9GS 1WXFA 3UMVA 2I1LA 4ARCA 1N3LA 3AG6A 1N75A 3L92A 2CV1A 1T6ZA 2PIDA 2A1UA 4R2LA 1WXEA 1IQRA 3TQIA 1XNJA 2PZ8A 1J09A 4HJRA 1GAXA 4FZJA 4YP6A 1Y42X 1ZJWA 3OTWA 3KT3A 1N2EA 1R6UA 3CLSC 2DETA 1EUYA 1O0BA 3ISJA 2X0KA 4RUKA 1SURA 1O96A 4ZCPA 1OWOA 4MUJA 3X1KA 1WZ2A 1Q15A 4MW1A 5DK4A 2CSXA 3P0JA 1GN8A 3HL4A 3FY4A 1YULA 3A4IA 3HZRA 1VBMA 3KFLA 1XNHA 2E0IA 4CDMA 1DNPA 1TYCA 5JBNA 1J20A 3HGMA 1JZSA 3H05A 3IVGA 3HMQA 3Q12A 4OUDB 4ZT6A 5TS2A 4DJAA 4F4HA 1WXIA 4QBTA 1MJHA 2A84A 2DLCX 3DV2A 3IVCA 1O0CA 4HPWA 1WXGA 2VTBA 2QUJA 4NAHA 3RK1A 3PRHA 3AKZA 2CYAA 3H9BA 2AG6A 3SP1A 2V0CA 3ZJTA 1NURA 3DO8A 2QUKA 3IMCA 3GMIA 1FYDA 1ULHA 3MLAA 4QREA 4ZT4A 3AIIA 4MUIA 4ZT5A 3FOCA 4WNYA 1O6BA 4MLPA 1HYBA 2X1LA 4U7JA 4EG4A 2GM3A 3MXTA 3KT8A 1JILA 3N8HA 2XRZA 4GU5A 3FWKA 2IP1A 3RJZA 1T9GR 1K92A 3ZXSA 3LOQA 5LLTA 1T6XA 3A2KA 5LM3A 1PG2A 3N2YA 1IQ0A 2PXHA 4ZCTA 3IOCA 2PZBA 3QTBA 4ZCRA 4MVXA 3SEZA 1VBKA 3U1VA 2RE8A 1NP7A 3FDXA 3INNA 5TGTA 2DR2A 5KHAA 1XJQA 2EJCA 1N2HA 3ND5A 4PY2A 1JIIA 4AS1A 2J5BA 3P0IA 3COVA 1K4MA 1OWPA 1N77A 4EG8A 4G5FA 1O94D 4TS1A 3TZLA 4GRIA 1GPMA 1GTRA 1F4LA 3G59A 3CVUA 1U3DA 3CLTD 1N78A 2D13A 1YUMA 5FNZA 1O5TA 4R0NA 2O8VA 5IHXA 1Q77A 1EFVA 4PBSA 1XNGA 1YIAA 1LI5A 1R6XA 1ZUNA 4NX2A 5IJXA 3CVYA 3PXUA 4DDMA 2QTMA 1WKBA 3ILVA 3PNYA 4WSOA 4ARIA 3FNRA 4MUFA 1J70A 3CA8A 1U0BB 1WJGA 4MWBA 2HMAA 1PFYA 1TQ8A 1OWNA 3FI0A 3ND6A 1WXHA 1OBHA 4HJXA 1NYLA 4EFKA 1YUNA 4MUGA 1N2GA 4PBTA 4XFDA 2B7LA 1JMVA 5J59A 4KR7A 2JAXA 1EFPB 1PG0A 4DDKA 1KP3A 2J07A 1WQ4A 4XFJA 3IVXA 3UK2A 2A1TS 3ZGZA 3P0HA 2Z3VA 4YBRA 5HUJA 4XSVA 2R5WA 5TEWA 4DE5A 3ZJVA 3IOEA 3CVWA 1LI7A 1M8GA 4F3RA 1NUTA 1EFPA 4JZYA 4DNXA 3IUBA 4YMIA 1M8JA 2Z09A 2OQ2A 1QRSA 2HZ7A 4YP7A 2TS1A 3H99A 4DLPA 4PBRA 1IHOA 1TYAE 4HK4A 1IFXA 2X1MA 5DEOA 4X0EA 3ZJUA 4KR6A 2A86A 2ZP1A 4KPUB 5J5AA 1KORA 2GKSA 2PFSA 1JEDA 3NBAA 1EUQA 2CYCA 1ZH6A 2ZUFA 3CLSD 1J21A 5F23A 2WSIA 3SDBA 1V8FA 1GLNA 1TFUA 4MWEA 1S4MA 3IMGA 1H3NA 2O5RA 4NZPA 1OWMA 2OV4A 4J76A 4NDAA 2BYTA 3GUZA 1I6KA 1EJ2A 4JYZA 3JXEA 4OUDA 1M8FA 3MUEA 3ZIUA 2DEUA 4MVCA 4MW9A 3IOBA 1RQGA 3H97A 2CYBA 4I6GA 4MUEA 2IJGX 1CT9A 1KQOA 3SEQA 1X6VA 1KR2A 1R6TA 2C5SA 1TYDE 3UOWA 1MB9A 2H29A 5H7XA 1UFVA 2A88A 4MW7A 4JXXA 2HGZA 4JXZA 1I6LA 2Z08A 2A1TR 3SYTA 1PFVA 3COWA 1IQUA 2H2AA 1V47A 1YI8A 4H3SA 4OJMX 4ZT2A 4NATA 3PNVA 4KKVA 1QJCA 3FG9A 1OBCA 2DPLA 1K4KA 3SZGA 2YWBA 3OP1A 1KH2A 1IH8A 1JEEA 1JHDA 3ELBA 4EG3A 2RD2A 5EKDA 3ZXIA 4Q16A 5H16A 4P2BA 4I6JA 1GZUA 2QJOA 1QRTA 1F9AA 1N2OA 3IDFA 4A91A 1O95C 3F3MA 3RHSA 1TEZA 3NBKA 3CR8A 2CV2A 1NUPA 1WQ3A 3FH0A 1MAWA 2J08A 3MMXA 2ZUEA 2WB2A 3COYA 4K0RA 4MULA 2AZXA 4MUKA 3TQOA 1U7XA 4ND6A 1JIJA 1F7UA 1QQTA 1QU2A 1O97C 3BL5A 1M83A 1KQPA 2A4MA 1H1TA 1N2BA 3I05A 1NSYA 3QTTA 1M8KA 1MAUA 3AG5A 4MW6A 3HFJA 1I2DA 1JECA 1U3CA 3CLRC 4MW5A 1JIKA 4I6EA 4U8HA 5LFAA 3IUEA 1EXDA 1NI5A 3D6VA 5TEVA 2PZAA 3CVXA 2J09A 3KT0A 1M1ZA 2DXIA 3GLVA 3IH5A 1QRUA 3N05A 2QTNA
chains in the Genus database with same CATH superfamily
1KKLA 2C4MA 2YYSA 4N5HX 1P4SA 1Z6AA 4QARA 3SHQA 3AMVA 4JGGA 1U28C 4YI3A 5BURA 1Z0UA 5G40A 3CZ9A 5LP6B 3NV9A 5JVDA 2C7BA 4K6GA 1L8OA 1LQTA 1OAAA 3A2MA 2QTWB 2AZ4A 2FWJA 4BMNA 2JRCA 2JHPA 4GXQA 2BEVB 2XZOA 3TK1A 3TLXA 1SHUX 2AVDA 1V1RA 1LZLA 3H75A 3RWOA 4D0LB 4E5KA 2G1KA 3MOIA 4P33A 1G7RA 1SVUA 2ATVA 3NT2A 2O2EA 4NAUA 3C70A 1B74A 1MRZA 3NJ4A 1YZTA 3QYFA 4KQ9A 4QUBA 5DGCA 3ECCA 2MSNA 3Q7SA 2B1JA 5BY2A 1KH3A 1MKYA 4EKIA 7MDHA 5LA6A 1VKRA 1JG4A 3JAKA 2Q2WA 4BN4A 4LJSA 2ZB7A 2BJVA 3I0MA 3M4NA 4KUEA 4ZTUB 3OH8A 3WLEA 2AHRA 1GITA 2D3WA 4I2VA 3KQNA 3G79A 4RULA 4ESOA 2MU1A 3DP9A 2EKPA 3C0KA 5ALOA 1YA4A 3PQEA 2J3HA 1Y48E 4HFMA 5DXJA 4BWVA 3Q2OA 2OSVA 1Z5NA 2CB0A 2FP4A 1NUUA 2WFAA 3OZWA 4NMXB 4DVGA 2AL7A 2QYOA 2W4IA 3INGA 1KSFX 3BSFA 3C5VA 1WOYA 4V0KA 3W1VA 4D7AA 5K20A 4YO8A 2BF7A 5JTTA 3TG8A 4MGZR 3G5LA 3HR7A 1SUFA 5G41A 3GN2A 1LS6A 2I87A 1P4RA 2OBMA 3FWNA 4ZT7A 1TAUA 4QO7A 3WOHA 1JL3A 1USWA 1KRWA 2LRHA 1WTCA 2PKCA 4RDIA 4DHWA 4F72A 1Z2PX 2O50A 2W0SA 5FD8A 2BKUA 2G80A 1WX1A 3I76A 5BWLA 4W5RA 3A6DA 1QFJA 4EY6A 2ZCJA 3TLBA 1F2UB 1FXWF 3KEQA 5F2KA 5MDHA 3IEIA 4D99A 1MC8A 2WKSA 2R62A 4IHJA 4ZHQB 1TTQB 4RMHA 4GKVA 3BILA 4G5YA 3W5CA 1JB1A 4FOOA 2ZQYA 2ZBUA 3ND7A 4I1RA 4B4DA 3IBFA 4B7CA 2BFEB 3CSUA 4QZVA 3IDQA 1T8TA 1O9HA 1UKEA 1E18A 2IWHA 1YRBA 1ZGJA 3EZGA 1DARA 1H3FA 1TZ2A 1V9SA 3H5WA 3OZIA 2OD7A 4P4UA 4G23A 1KF0A 2WWHA 4F84A 1Z6QA 4PC1A 3C3KA 3S2YA 3UAOA 3WX0A 2UZ1B 1BH2A 4WVFA 4YAIA 4ZIRB 2PBFA 3L7CA 3NWBA 4CIYA 2EHDA 2DCUA 2GPNA 2JIQA 4LDAA 4PTLA 4A0RA 1QH1B 4MYHA 4NCKA 2VRNA 3IQDB 4E51A 3AINA 3HBAA 3IR5A 4DWJA 1VLLA 3MWKA 3CN9A 2WV9A 4PN7A 4OG2A 2Y1GA 2E1RA 4J0KA 1L1RA 2HA0A 1JNXX 4X1KA 1JFFB 5F3RA 1SXJC 3F0TA 5AVOA 1YZLA 2L69A 1UJBA 3AHCA 3IEUA 3B2EA 3UMSA 2X0JA 4DCOA 1IULA 1A98A 3L93A 1Y7IA 3BJRA 3HI4A 3KKKA 4UOQA 2C99A 1GARA 3OFND 4JKYA 4BKUA 3MJRA 4DMUB 6CHYA 2IXTA 2P1RA 3I28A 2GPYA 1B3RA 4Y0NA 5FKJA 1IZZA 3JWPA 4BFZA 5KJFA 2ZT6A 1RRPA 2WYHA 4AJIA 3KAQA 3UIEA 3UB4A 4ZICA 2H92A 1DJOA 4E4YA 4CKWA 4EG1A 1J39A 1XDWA 3U3RA 2I80A 1C1DB 1FS5A 2WMNB 3H2JA 4P4TA 4WLVA 2ZXUA 3F46A 1XCMA 3E58A 4DV6B 3BE6A 2W6JA 3BWDD 1Z0IA 2AIRA 2P9TA 3I9MA 4PVDA 4DV2B 3C8ZA 2J0UB 3BSSA 3PDHA 5G0UA 9GPBA 3RO7A 3W5AA 4KQWA 3OQVA 1O57A 1FJGB 1XEWX 2JI6A 2NTEA 3R5XA 4R8RA 3V3KA 2SCUB 4DIMA 2PTGA 2MMCA 3DXFA 4RQAA 3HFGA 1EK1A 4Z8YA 5KQSA 4UUBA 3OQBA 3KWFA 4KAAA 1NAIA 1TAHA 2B0CA 3B82A 3EQ2A 3G1WA 4JXKA 2JZCA 2GKGA 3KE8A 4D56A 2H1OA 1M34A 1IRXA 3F2VA 3KUUA 4OQQA 3KQYA 2CNNA 2Z95A 3DV0A 2I6TA 3JQAA 4I66A 4FU0A 2HSWA 1VMEA 1AS0A 2AXNA 2JFOA 1I4OA 1ZK3A 2OBYA 1VMKA 3U4CA 4CL3A 4CQMA 1XD8A 2GILA 2O57A 5AW5A 2PR7A 5B4TA 1P5HA 5EIBD 4A3SA 3AESB 1UXKA 4LBVA 3UYKA 1FOEB 3KR1A 5HOQA 2VATA 3IHLA 3P20A 1HFJA 1T8PA 4XKJA 1MRSA 3SVTA 1D2MA 5FAKA 3ZR4B 1QG4A 3LD9A 2ZRPA 1LCIA 1EFDN 1CUGA 3JY6A 3L6RA 1R6UA 4OSOA 3CLSC 3RIGA 3ZGYA 1LV8A 3LT0A 1EUYA 1YQXA 1QYVA 3ZLVA 1UP6A 3UF0A 1SUEA 2X0KA 3T0IA 2C8LA 3HVUA 1SELA 1U7HA 2QWXA 1GRCA 4HQRA 5DI9A 2QQ0A 1F6BA 3AR5A 5LBTA 4PLZA 4Q82A 1XLWA 1DXOA 3GWGA 4GM1A 1NW6A 3TOZA 1AMOA 4CLDA 4IEIA 4KHPB 3ZPXA 2ZZMA 4DIDA 5FPYA 1GN8A 1Y7HA 2H1CA 4IJMA 2NQ8A 1I5OA 3KFXA 4CCYA 1JIVA 2R85A 2VAPA 3TVTA 3ZTYA 2JLUA 5JBNA 4MKZA 1Z5OA 4O33A 3F9RA 1GWNA 2PM8A 4OUDB 1YZYA 4KDFA 4PC3A 1G8JA 3RU3A 3VJLA 5ADHA 4YRBA 1K8YB 3VKGA 4OJNA 1PD0A 4R5HA 1XRNA 4HPWA 4WZBE 3AF1A 3D31A 4GQBA 4X3OA 3RK1A 3ZKWB 4A16A 4JFRA 3NR2A 4L9RA 5DM0A 5A62A 5I4KA 2RMKA 4YAFA 2VNSA 2ETVA 2P0YA 2GEUA 2QROA 4ZOBA 5FWAA 4DSZA 4IRMA 4LN1A 2WU3A 4FDMA 1A5ZA 2OKCA 2XMQA 3HC7A 4Y1RA 4Z7NB 1EFHA 1T2CA 4OQMA 1JG7A 2NU9B 2C1EA 2K5UA 2FUG6 2VLIA 3AQIA 3RR2A 2PUGA 2H65A 1SD5A 1HYBA 3B5JA 3PC2A 4Z3KA 1U7UA 1QR6A 2G76A 4CMEC 2GM3A 5F2NA 3O4IA 2WPNA 1V5FA 4L6IA 1SCBA 4OLJA 5H4GA 1J25A 5EWLA 4I8IA 2Q1XA 1JXMA 2Q8PA 2XEXA 2ZE8A 1JWAB 3A06A 2CFCA 3F7TA 1A96A 4LRQA 1QYXA 4ZYVA 1PR2A 1JYEA 3U09A 1WB9A 1H4QA 2BKXA 4DWVA 1S89A 4IHAA 2AEFA 3LOQA 3B8HA 4NV1A 3ZNNA 3W6OA 4HAIA 4NENB 5HK8A 4B3RB 2PXHA 5JXJA 2PZBA 3HADA 2V45A 1Q0HA 5IF3A 4GYJA 5C1OA 4BNJA 2P3SA 3NYIA 1IMJA 3A4VA 4GNRA 4X60A 3IV6A 1ZJ6A 4F6CA 4URHA 4CR7A 4BQSA 3INNA 1N7IA 4CYMA 1N5LA 5I7OA 3AIOA 1KZGB 4I4TF 4KQ2A 4GW3A 4KL8S 2EJCA 5DYIA 3PBKA 4LQLA 4PX3A 1GNSA 3P0IA 3WY9A 3SYRA 1I51A 5B1YA 5IJ9A 4CMIA 4BE7B 16PKA 1XTJA 5JCPA 2FMIA 2EWWA 2JKYA 1X94A 2PT6A 1NF3A 4KYTA 3SN6A 3TZLA 1AQJA 2DZDA 1CRQA 2RHOA 3E9DA 3SY8A 1DXYA 1YJQA 3CLHA 3CMMA 2HSGA 3EARA 3F8SA 1VHTA 3PT5A 1HG0A 5FYQA 2OQVA 1YBVA 1GCUA 5FNZA 3SS7X 3U7EB 5ENDA 2ZATA 1JKJA 2W2PA 1BNCA 4FYXA 1Q77A 1GPKA 4O4IF 5JRDS 2J3LA 4P86A 1I9GA 1XF9A 4REMA 2Y93A 4HVLA 4E2XA 3WLRA 5DGIA 1BHO1 3ZJYA 1FEZA 2QTMA 3CNBA 1ND5A 1OLXB 3K6JA 3WGUA 2FN3A 3MD9A 4CCSA 2IOFA 2YXEA 2VWHA 1KIMA 3NHRA 1NE2A 1II9A 4EUSA 3SS9X 3LXXA 3DZGA 1PWZA 3KQPA 5CLGA 1M1YE 2QE6A 1PDWA 2PRIA 4DJEC 4J03A 4G3XA 3TQFA 4RE5A 2F55A 2BGKA 3C98A 2ZAGA 2R00A 4TKZA 4B43A 3D3KA 5FUVA 1Y8RA 4C76A 4MO2A 3GT4A 4IMPA 4K6KA 1C4XA 2B69A 3AOEA 1ADBA 5ER6A 1TQHA 4QYIA 1WQ4A 2HIMA 3UXEA 2Y3IA 4TYPA 5B1DA 5LKAA 4LHYA 4Y2TA 2XWSA 3VR3D 3P2YA 5HZKA 1B93A 3BH6A 3EVAA 4MQBA 1MZVA 2W2QA 1NXPA 3D6HA 1CY1A 1AA6A 1ADGA 3A9RA 3IOEA 5AXAA 5D5QA 3L4SO 4ABTA 4OOFA 3F4BA 2DKFA 4JYPA 3N2NA 4DNXA 5KQPA 3EOZA 1JLLA 2DQZA 4JA0A 5LQAA 5LD2C 1JHXA 3AHDA 5DNUA 3KRTA 1V45E 2G67A 3M6WA 4YMHA 1S01A 2ZITA 1TTPB 4MV4A 5HZHA 1XEXB 1W29A 2ZS8A 3NKVA 3CUKA 3HBLA 3M8KA 2CD9A 3EZXA 4NBNA 3ICWA 4AKEA 4K9MA 4C22A 4L4RA 4JLVA 2Y2VA 3DYVA 2PVCA 2PWYA 3P2IA 4QYWA 5EXXA 3W6PA 2GKSA 1KBQA 3OKFA 3BXGA 2ORYA 2Z04A 5J4VA 3L43A 5C1PA 2A67A 3IBYA 3QV1A 5K4GA 3T7AA 2H0AA 4KPEC 4ZOLB 4FGKA 5F7ZA 1RU3A 1PWHA 3NBXX 4GR5A 2LD4A 2Z6AA 5E8JA 5TJHA 5JASA 3OJXA 5BYAA 2X8JB 4O08A 1L7XA 4MQ5A 1OWMA 1NVBA 1UODA 3LDHA 4BCCA 2WC1A 4D26A 2W2LD 5F64A 1T0IA 1KNXA 1VHWA 4EQZA 2ZYUX 3QNWA 1N0WA 4KR3A 4WT7A 1W87A 3QELB 2QDKA 5EHZA 3FVTA 2IBTA 1NUHA 3K96A 4JJ6A 4LOIA 1K3UB 2OC4A 1M0SA 2V7TA 2I8CA 3HJCA 3ROPA 2POCA 2ZUTA 4QUHA 3TLGB 3PDIA 4MV8A 4PO9A 1RXVA 4TN5A 4UU8A 4Y2YA 5DK6A 5GOZA 5BSMA 3NI2A 3UT5B 1QTIA 2IYRA 1UIRA 3TCKA 3O4JA 5B7PA 1SG9A 3TUJC 3ZUPA 4C2AA 1JHPA 1V7PC 1MABA 4NCJA 1CJUC 3BGIA 2D1YA 2V6MA 5FULA 5H7XA 5IYZF 1KE2A 2NU8B 3L0OA 1UFVA 2B8NA 3ZWDA 2GJAA 4RA6A 2JAUA 4BCBA 5EJ7A 4K40A 1MDFA 4WY5A 4G97A 1X0VA 2HGZA 3C87A 5K3DA 1U8YA 3C43A 4JXZA 3D43A 1EHYA 1F5SA 4M37A 2AMJA 2YZKA 1PFVA 1G5PA 3LQ2A 3ZWBA 2D8MA 4RHXA 2GZDA 2GSWA 3L7DA 3BJIC 4P7KA 3VR5H 3WLLA 4P7FA 4AF7A 1V4BA 2XZPA 3DXZA 2QAIA 2V97A 3EQ9A 4IX1A 3A7EA 4UC0A 3X1YA 2JAQA 1IOWA 3FZQA 3RQIA 4KX3A 3V5NA 3PDCA 4AJ4A 3PQ8A 5CLJA 1W49A 5JC1A 3E82A 3HM9A 2P6RA 1PNVA 1OIWA 3OF3A 2K7FA 2CL6X 5EP3A 5K3AA 2NZWA 1V9LA 3HLYA 1F0KA 1XTRA 2NU7B 1AV6A 3I01A 5J4LA 2OYCA 2MINB 1NWHA 5JRJA 3DKPA 1X8JA 2DQSA 2YY6A 1CF4A 1DC6A 3FR8A 1P0IA 5IM4A 4XD7A 4CG2A 3F3MA 1TEZA 1J07A 1E5LA 3FH0A 5D01A 4MI6A 1D6NA 3SYKA 2Q3HA 4D9MA 2ZUEA 3COYA 2QQFA 4B6OA 5BVHA 5A7HA 3IP7A 4KU4A 4YHHB 3NU1A 4MS3A 4TQAA 2VXYA 1YHNA 3GFFA 3QY9A 2WU4A 3CZ4A 5EI5A 4BDTA 2IOHA 3A4TA 3DMYA 3IJEB 4O5AA 5KOJA 3MK31 4R8VA 4XDGA 3IL2A 4WFQA 2F1KA 4PLCA 1RM5A 1XMPA 2JCXA 5P8WA 4OXKA 3NUGA 2F00A 3OEED 2VHQA 2FN8A 3QKTA 1U3CA 2JFQA 5JIBA 4DCTA 4D9EA 1AHPA 5C2JB 4A8HA 3CEAA 2EX1A 3AHGA 1GRVA 2G88A 1NI5A 2HMUA 4ZO4A 1Q0RA 3K2BA 5F9FA 2AE1A 4EAAA 1UR5A 3GPCA 3H2ZA 4LRXA 2C0QA 3OMLA 4RF2A 1R0SA 2O7VA 2XSZA 3VZDA 1KY5A 1COWA 3WGZA 1AOXA 4ZN6A 3O1LA 1L7MA 2VJQA 3RRFA 1A5TA 5D87A 3C3JA 4M0PA 4NPAA 4HB2A 3MEQA 4F93B 3J81k 2GHQA 4JGBA 1ZL2A 3HEAA 5IXYA 4M83A 5TDHA 2OMEA 1JQBA 1MVNA 2CUKA 4K6FA 3UK7A 3R6GA 4M7PA 3GPLA 2O5VA 4G89A 3EWNA 1YASA 5I4IA 1PJBA 1MC4A 4KE8A 4IDPA 3ZBUA 1X8KA 4CKEA 3D64A 2I4LA 2NW6A 3H1TA 4AXBA 1I01A 3A3NA 5A6SB 4CODB 3JW8A 3RW9A 1Y1PA 1U7WA 3DWFA 4P3OA 1K88A 1XDUA 5IMBA 3RK0A 5LP6A 3KYDA 1YRYE 5KYGA 3E9ZA 2HJHA 3M5WA 3KR9A 5BSRA 2QMQA 4BVKA 3O1IC 3TH5A 3RUCA 4F5DA 3OEWA 1E2KA 3ROKA 3TQQA 3RUAA 3ZV5A 2QLNA 1UAYA 5THQA 4X1IB 2I3BA 2CFOA 3AERA 2CKDA 3L77A 4FQ8A 4HLCA 4IJUA 3T94A 5K0ZA 3UT6A 1XO1A 5FPTA 1DWPA 1IVSA 1JDVA 2RGXA 1IN4A 4ZARA 4HBGA 3JRNA 1RWXA 2HF7A 2NTNA 1L5HA 4DUPA 4QUJA 1HY3A 3MQ4A 1H4TA 2J7KA 2XX3A 3KPUA 1H2XA 2W48A 5HRUA 3Q8KA 3R4VA 1ZGAA 5LR6A 3SBXA 2C1ZA 1P7CA 2XCUA 3AX6A 1KFBB 5F5XA 3GLIA 4YECA 1KBZA 2GASA 4DSNA 2RDMA 1EXNA 3Q87B 2H07A 3L7LA 3MSCA 3V2IA 4UAGA 1T8WA 3X2EA 2QE7D 2DU8A 3F7NA 4F4CA 5JJKA 2FUNB 2ORED 3UJCA 1ODCA 3I8OA 4EARA 2GM4A 1SUWA 2P9ZA 3BRWD 2XIQA 4WACA 2WZDA 1RRGA 1XROA 2VHVA 3I3SR 3WC4A 3TS1A 1TUEA 2R7KA 4EKDA 4X91A 4BQQA 2ATIA 1I6MA 5E7JA 1T2AA 1D2RA 1H22A 4LDZA 3V4LA 1W0CA 2B4YA 2PJUA 3QVGA 3KETA 2BMDA 1AZWA 3IO3A 4Q1VA 4W9NA 2C3PA 1VHDA 1OFGA 4YASA 1O54A 1C14A 3QQ5A 4RKYA 1MOQA 5JYEA 1ADFA 3LDAA 3L8YA 4F4FA 3OFSA 4BQFA 1IDN1 2EZTA 4FNMA 5F73A 3WRYC 1E1RA 3L3BA 3O3OB 3UAWA 3PF8A 3D7LA 3JYHA 3V4ZA 3GGCA 4E13A 1JG3A 4O63O 2G06A 3L8ZA 1SKYE 4H2DA 1HXHA 4PZUA 5BNWA 5KPJA 3X43A 1O94C 1SRQA 5D6OA 1A5SB 3B9QA 1AK1A 3B1JA 3WL3A 1JPNA 1Z8FA 2C9BA 2ECKA 4ZHQA 2YJTD 4OXQA 1VJTA 4LWOA 4TXNA 1Q2XA 5KJEA 1D0IA 1ZINA 3GO4A 5K8LA 1VPVA 3SKYA 4LYFA 3C4QA 4YRNA 2D4AA 1YR6A 3SM3A 1Z13A 1E6UA 4DCVA 4B3DA 2VF5X 1LFAA 2QIPA 3FNBA 1GADO 3EYAA 2IDJA 2JJYA 2UZ1A 3FHOA 3FTDA 4R3UC 5CK4A 3UH1A 3U6KA 4YP0A 1RZRA 4DLYA 3N0WA 1KK3A 4LPSA 2IYOA 4MIEA 3LY7A 2BF4A 1USGA 5GONF 3GR6A 4G9BA 4LSMA 2FQWA 2WYOA 5C5EA 1HORA 1OXTA 2HPAA 3CZAA 4U2FA 3WS7A 2QRPA 4A26A 1JLMA 1K63A 4HAZA 2BCEA 4AB1A 3HJGA 1DPFA 3O3NB 3ELYA 5CCEA 2JLZA 1TEVA 4A03A 5LOVA 3PJGA 3BIXA 4G0XA 4EGFA 4UNIA 4PYOA 5C7YA 4A0HA 1IXYA 2WOJA 3LXMA 5JATA 1QHYA 4KIWA 4NYMQ 1KYWA 1E9CA 2G9VA 5D3QA 1U04A 3GOHA 1WEKA 3W2TA 3K09A 2GR9A 1HTBA 1U9IA 3I0ZA 3X1MA 2GTIA 2LDBA 4G25A 2ZW9A 5LJLA 3X2FA 3BFPA 3FUXA 3GVPA 4P92A 4LK2A 1VB5A 3T1VA 4N03A 4U2GA 3F97A 5JO0A 4URFA 1MEOA 1J7KA 1O97D 3C3PA 3EQ6A 4CT5A 3BXZA 1DKRA 2WKQA 1KZ9A 4U9UA 1L8QA 3VSAA 3CISA 1T5DX 2PUBA 1ISRA 3D9QX 4MO9A 9MHTA 1KMIY 3UMVA 4RZQA 3O75A 4GXTA 2I1LA 4FN4A 3TIIA 1N2SA 4BKMA 3HDYA 3THYA 4YQYA 2JIMA 2SCUA 2XXAB 3BK1A 1JDBC 1D0SA 1R27A 2XNDD 1YWGO 1CR1A 3CYFA 3R3ZA 4I4NA 4MAMA 5ALIA 1SUIA 5TPZD 4YQFA 3TQSA 1S0UA 5ISMA 1GAXA 4J2HA 1DWOA 1IY2A 2IYQA 4CU5A 1J6UA 4F3YA 1Y3HA 3LNTA 3JZIA 4IHKA 1E1LA 1IBSA 1QHXA 2QTVA 2WINI 1BDMA 2FZWA 1S4QA 3DOEA 4EDHA 3L04A 3JATB 3AXSA 3K0HA 4I50B 4OI2A 4WL0A 3S2FA 3TB6A 3MB5A 3U0BA 3OE5A 2C7VA 5IHPA 4L4UA 2CN1A 3HCFA 1Q7GA 3F6PA 3CG4A 4GKAA 3DW1X 5K0LA 4BIMA 1QG2A 4WEQA 3DE0X 1KY2A 1MZPA 3WZLA 1YCDA 3QSGA 4JMLA 3PE6A 4Z7OB 2FQXA 3IBGA 2Q4RA 2XCIA 4EECA 2JHFA 3I30X 2QLJA 1Z12A 4FKZA 1PK9A 1BROA 2ST1A 4AECA 1RKBA 4NU8X 1CUVA 4B35A 1P3JA 3RS5A 1HDCA 1KMNA 2JLSA 3C6KA 3FPSA 5CYOA 5DN6A 3IAAA 4QUEA 4Z0TA 4DLWA 4GOKA 4X3CA 3QE2A 2BSXA 3QMMA 2GERA 2IPAB 3WGKA 3RBVA 4DGSA 3IXLA 4OH1A 5FPPA 4OGGA 4EIWA 3UW1A 1ZJ4A 5EYPB 4M1OA 2VP9A 4G4JA 1FFBA 2XBMA 1RAFA 5AM4A 3EVZA 3AR9A 4NL4H 2JARA 1V8OA 1GXSB 4GGPA 3P0EA 2V0CA 3OZXA 3W5IA 3R9WA 3AHEA 4POAA 2JD0A 3DYIA 4GOND 2FCRA 5D85A 3WLNA 2W2OA 3S28A 5CVEA 4MUIA 3DMTC 521PA 5H68A 1HFKA 1Q1EA 1ZSYA 4OP2A 4V39A 4YGYA 5KTSA 3A2LA 3EFHA 3CXUA 4L6CA 5CTJA 4KPGA 2IY9A 4DA7A 2IGTA 1DCFA 2RHMA 4NCBA 3KOXA 3LUBA 3P45A 2X19A 1P2GA 2WSSD 1TTTA 3GFGA 3T4UA 1YB5A 4KE7A 5BVGB 1BSVA 2OLKA 3P26A 5EVCA 3S40A 2HRDA 5TF0A 4P81A 3MFQA 3ZXSA 4V3BA 5A1JA 3D7SA 3OPYI 1WA5A 1G0OA 3GU3A 2JKZA 1WKVA 3B1VA 3C7AA 1ATZA 5B1HA 5IXSA 2FE4A 2WWVD 4R1PA 3ZE7A 4F3CA 3HEMA 3HY6A 1CUBA 3W8FA 3TLJA 4WKGA 3U1VA 5HK9A 1L4MA 4J9VA 4MI3A 5KAMA 4L02A 4DNQA 2ODBA 1NP7A 4H7DA 4KIGA 4AG3A 3LDGA 1OB5A 3QPBA 3D3EA 2IZ7A 3KWLA 3UMJA 2HC9A 1MP0A 4OK5A 5DHAA 4F2PA 4HDKB 1A9QA 3C7TA 3AEKA 4BATA 5A5DA 3BX1A 3C6QA 3DEJA 3KVNA 3RKSA 2ZIFA 3COVA 3NCTA 2O8FB 3ANSA 2PPVA 4JBNA 4F8JA 2WD9A 3U49A 4R69A 2ZSFA 1EQAA 3WGNA 1UBOS 2J45A 2PU7A 4CGYA 3GZTB 1J23A 3W1EA 4PLFA 4AAYA 4INPA 1BRTA 4EZIA 5K09A 1E3TA 1G5TA 3Q8WA 3VU3A 4D4HA 1B42A 2HGSA 1QCYA 2OCIA 4LI3X 5AHOA 2ZU6A 3GEIA 1E32A 2BPOA 4P0PB 4PZLA 4BKRA 1XEFA 2QR2A 3OKAA 2BVNA 3PWKA 5A7GA 3RSLA 4RPGA 3N76A 5HA5A 1UOQA 1F1JA 4PBSA 1J2YA 1PFGA 1Z83A 2YV2A 4RVNA 2PMCA 2R6R1 3EQZA 4RTNA 1DO8A 4WCFC 4FLEA 1YS1X 5IEBA 2D2EA 1FQOA 1GTZA 1P17A 4R2WA 4L78A 4BRZA 3ILVA 1G5RA 2RBEA 4ARIA 1OKKD 1ZXBA 2JVKA 1E0AA 3EC7A 1WJGA 3WFIA 1FJXA 4MTLA 1U0RA 4X6UA 5AOCA 4YRIA 1A72A 1HE5A 1ESMA 3M6XA 3ND6A 4NJOA 3MGKA 4MUGA 4YRAA 5KJ1A 3L0IB 1IZ0A 4KGDA 4I55B 2QM8A 2P7HA 4K46A 3AY3A 2ILVA 4E32A 1EK5A 4FSHA 4IMJB 4EL5A 2VP0A 3VH3A 3EUWA 1Y9JA 2JAXA 1DKQA 4QPZA 1UP7A 1KP3A 1CEEA 4HH3C 3MPOA 1R5BA 1RI1A 3H2BA 4WW0A 2C29D 4JBIA 1PJ8A 2P2ZA 3K0FB 4RD6A 1D1SA 1WXQA 3UK2A 1DIRA 4MWSA 4EB6B 1J56A 3OMXA 4HDMB 3ZGZA 1PJAA 5AHRA 2HCJB 4WZBB 2FZ5A 1CHDA 4YV7A 5E4TA 1TD9A 4P36A 4UKDA 1DQYA 3CM0A 1B6GA 1BYUA 2O2IA 2Z2KA 1IPHA 3CXRA 2WAAA 3DO5A 4N49A 1IEQA 4BO5A 4L4YA 4UQPA 2RAUA 4F6LA 2ZUBA 4IGIA 3RSSA 1JI3A 5FBQB 5L9AA 4LAFA 3EWAA 5ERGB 1YAJA 5AK4A 1TMGE 4AO8A 2WYVA 2HZ7A 1A82A 1UPFA 2AQIA 2HDHA 2L0XA 4MUBA 4RD2A 2EERA 2HCFA 3L1IA 1RHKA 3JD1A 3M33A 3PHJA 3SXUB 4QDJA 3AH8A 3BRQA 1OU4A 5KTTA 5L51A 1R2QA 1R7RA 2ZP1A 4KKXB 4LBZA 1RXIA 1TOAA 2K2QB 1NBIA 1ZPDA 2CMGA 2W2KB 3NBAA 1PHRA 4TKUA 3EULA 2QLLA 1LWNA 1DGQA 3FB4A 3MGBA 3FZNA 4DLNA 1Z17A 1XEXA 2IYSA 3TPFA 5LYJA 3G8AA 2PUTA 1XUOA 4QHTA 4W8GA 3ECSA 1TA4A 3KOMA 3PNPA 4FHCA 4QQFA 4A0GA 2J0SA 5HKKA 1ZHHA 1SH7A 1TM2A 3WE7A 3DW3X 1W75A 3CW9A 3E5RA 5H81A 4E1BA 4MWEA 4RHCA 2P5UA 3HVIA 4J76A 4EJSA 4OHYA 2J59A 1Z5GA 5LXTA 1QUEA 2FN9A 3GGSA 4X8OA 621PA 4HX9A 3KTFA 1SOAA 4K9OA 2P8JA 2WKPA 2VJKA 4LTMA 3UUEA 1Z4KA 1CX9B 5E1MA 5KOYA 1U4NA 2Q27A 2MYTA 4W5QA 3DD5A 2CDRA 3NYRA 1AXRA 1W0KD 3PSHA 3IPLA 1P9WA 3FTNA 5KSPA 3KM0A 4EA6A 4NEQA 4P93A 3Q0EA 4MUEA 3BJMA 3FFAA 4PCLA 5DI3A 3I9OA 3HKEB 1M6YA 4X7BA 2Q6VA 5DYTA 1MIOB 1GAWA 2JIPA 3FNFA 4LJ8A 1YBHA 4TWIA 4B40A 1IDOA 1F38A 2NAFA 3ENKA 2JFYA 1PJRA 4IQ0A 4S1PA 2H29A 2DFKB 3CSSA 3DEYX 2X4IA 1SVOA 4XGRA 3B12A 5IAGA 2JFNA 2VN8A 2WU1A 3MYRA 4O2BB 4CM9A 1BN6A 5FORA 2FU5C 4PQFA 4JUCA 1F14A 1WIWA 1IQUA 3COWA 4KZKA 3UZUA 4B48A 4CV0A 5CB4A 4AURA 4H3SA 4OJMX 1UQUA 2WM9B 3FOEC 1V95A 4R71A 1D4OA 1KTVA 1U0OC 1ULZA 2QVXX 3B5IA 1Y4SA 2NU8A 4EYGA 4F38A 3D2CA 1M1YB 4TUYA 1ZQ9A 5EEGA 1AZTA 1EX9A 1BAPA 2QTAA 4B73A 5HKOA 1HNXB 2H7CA 3ND8A 3FWZA 3AI2A 1G5FA 2AVNA 1IH8A 3FFXA 3GGDA 3GJ6A 3LC7O 3MXOA 4PGMA 3MJVA 4WNAB 5J9FA 5EKDA 3UMYA 3BB1A 1JT2A 1ZJYA 1UJ6A 1X2EA 4QGAA 1CYDA 1WW3A 3FB1A 4HDRB 5HMLA 5L4NA 4BUCA 421PA 1BDJA 1Z56C 3C15C 4CI0B 3DD1A 1C81A 1QRTA 1Z8HA 3BM5A 3ODPA 3QG1A 3QU9A 2R66A 2COUA 3EGDB 6REQB 1ZX1A 5AHKA 3D1VA 2Z56A 3CVOA 1Y8CA 1MAWA 1OTYA 1NX6A 1FNMA 2J0VA 4UFOA 4HAUA 2AZXA 5CH8A 1TIKA 4M0CA 5LVAA 3DONA 4OLFA 3FLAA 1U7XA 2NU7A 3WGOA 3I1FA 2X9GA 3N7UA 4M22A 4C43A 5BV7A 1QQTA 3L8MA 4FFWA 1KQPA 3IYLW 1F6DA 7MHTA 5EWMB 3ROZA 4QJBA 4NAVA 3KNZA 2RHLA 2TMGA 4M1EA 1GGFA 1JQJC 1K98A 3RB8A 2IIPA 1X3LA 5CPFA 4A5SA 1MO6A 4DCMA 4DLBA 2XQJA 1NQAO 2VHXA 2CVOA 5ALWA 2N46A 2XV1A 1DV1A 3WJ1A 3O95A 3FZEA 3TGWA 4LVNA 3DFMA 2VF4X 4UM5A 3OIYA 5AUOB 5HFNA 1CDOA 1FTQA 3AJ9A 1CFZA 3LCCA 4M99A 1M1ZA 1QPBA 1XTBA 2WA1A 3UFXB 2VKTA 3RUIA 4EMBA 4LOHA 3FIJA 3NHYA 4EHBA 1SVMA 2FUCA 2P9HA 5KTOA 1ZN7A 1QGDA 4R7ZA 1KOJA 2DFTA 1JA9A 3F6BX 4WUTA 1N4DA 5FNVB 5DHRA 3TZBA 4AKSA 3OZTA 1SVSA 4LGCA 4KG7A 2C58A 2F4NA 2V98A 3H9JA 1GIAA 2DTEA 2YKGA 1O9BA 1PTKA 3VYVA 3SOPA 3TW4A 3IIJA 3ZUGA 2B35A 2QRVA 5ER9A 2YR0A 4K9QA 1KMQA 1POWA 3K0AB 3WDLA 2UUBB 2NSHA 3OF5A 4LECA 4AZ0A 5AW4A 1T3LA 1XI2A 5LMZA 4ESEA 3LYHA 4DG5A 5KTMA 3LE8A 1OFTA 5K5EA 1QVWA 1SCQA 1VA4A 2CLFB 4HNAB 2NYUA 2BHLA 3D2AA 4DHEA 1N33B 4JQZA 1WWKA 2DRIA 3MJFA 1JTEA 2N3ZA 2CXXA 2QPAA 1T5OA 2HMSA 2KE5A 2ALJA 3E3MA 1ZD8A 3JQFC 2E21A 4Q1BA 3DMFA 5JFGA 3U6BA 5FWDA 4BFWA 1K5HA 1ODIA 2V1XA 2XAUA 4FOTA 1A9RA 4ON9A 2JGDB 3A14A 3JQBA 4JT9A 3ZV4A 4NMWA 3OPQA 4Z4IA 3LUDA 5A6SA 1T6BY 2GA8A 2W83A 4UVGA 4YJDA 4AMZA 1XTQA 2C3UA 4X62B 4GDFA 2IWRA 4KPUA 5T67A 4BC0A 1CIPA 4PRLA 4QOJA 2Q9UA 3R7WB 1P4HA 2Q4EA 3BEOA 2AWOA 1GTL1 2HK9A 3ODGA 3RYCB 5IVKA 3IRVA 1R88A 5JAZA 5H3LA 3ASVA 2YN2A 5MN5A 5IK2A 3Q1LA 1DBSA 4US0R 1GQRA 3GYGA 3HDVA 4M0MA 2XI4A 3KEMA 1C50A 2KLHA 3GRCA 4IMIB 4RH0A 4YNBA 2A0UA 3VR5D 3QX3A 1IL0A 2CXRA 1I7NA 1XXHA 1E60A 2XMDA 2VQFB 2YRXA 1BWPA 4RVOA 3IIMA 1G4AE 2YZ7A 3LWNA 4PFKA 4F85A 3KKZA 3HA7A 1OBVA 1P72A 2O6HA 1OYYA 4I5FA 4YP1A 1UDWA 3EC1A 4ZO6A 5IJZA 3R41A 3CZ5A 1GDHA 5IDVA 4BYMA 5I8ZA 3E7PA 3MFYA 4N0MA 2Y8EA 4BLSA 3DZJA 5LB4A 1C2TA 1SXJE 1RWKA 2Y68A 3TVYA 2NZ2A 5EZYA 4X3PA 3ZWYA 4IF6A 2O06A 1CC1S 2CE7A 2CHQA 3QXHA 2WD7B 1J1ZA 2DWQA 3ZI4A 4CM8B 1I7DA 3HU5A 4ES6A 1W52X 1Y3DE 3EPPA 2GN2A 3RRJA 1A1SA 3TLKA 1TT5B 1ZD1A 3CLUC 1GPUA 2IUYA 4MQUA 2AA3A 4DWWA 1S8NA 1YC5A 5CNJA 1SNYA 2XUOA 4B0OA 3E84A 4BZXA 4JI3B 4QFDA 1GV1A 5FLKA 7AT1A 4G65A 3FPHA 4TMYA 4F0JA 1NPTO 4S3MA 4YRTA 1LBHA 4HGYA 4ISBA 4OPMA 5TNXA 3RC3A 5IZCC 5AHWA 2WJZB 1AGYA 4BXOA 3W8DA 3V46A 1HDRA 2X7HA 2GD1O 4MQ4A 4Z53A 3HCRA 2ZE7A 3IULA 3KLNA 3QX7A 2HDOA 1IXKA 4JBYA 4B1FA 4ERXA 5K0TA 1UXGA 2V7VA 1FTYA 3H04A 3V2GA 4ZD6A 3DXXA 1N6OA 4HLNA 3WKAA 1E2HA 3IB3A 3WQSB 3THWA 4KXYA 3MT8A 1RYDA 3D4OA 5F4ZA 4BMDA 1FJHA 3WWZA 1VMDA 1C4OA 1T2EA 3H7AA 4INJA 4KOAA 3ZCTA 5CEJA 1IN8A 1T5IA 3MCUA 3PUHA 3W2HA 4DRXA 1CZUA 1KYIA 4HLDA 2GBFA 3PC6A 4Z9FA 6AT1A 1C7IA 5FCDA 2QSZA 1WF3A 3EFEA 1ZCZA 2HIAA 2HSDA 3DOIA 5BOSB 3RAPR 1XKXA 1G8GA 1GZ3A 3O92A 2PLFA 3PC3A 5JDCA 1KQ3A 5IABA 5I9IA 2WFLB 4J75A 2CNBA 2ID4A 4L7VA 3U4QA 3M70A 1ZG3A 2VXOA 3PRYA 4FFBB 3EIQA 4H4EA 5JJIA 4D45A 1T1SA 2Z98A 1BA2A 1HRDA 2ZXEA 1P0CA 1XAHA 3B51X 4L74A 4R3NA 3HXPA 4AMVA 2PSFA 2B25A 4BLQA 3GRYA 1DUIA 3NQ41 1T2FA 1BXGB 5ECYA 3AYXB 1P75A 2CZGA 4O4LB 5JAPA 5FX2A 1EFUA 2GBLC 4QHYA 1NY6A 2JA2A 2Q3FA 2XUQA 3K7EA 4XR4A 4UFPA 4LF5B 2R6AA 3AM4A 5DTEA 1KC1A 1R0RE 1A69A 1EWYA 4ZREA 1IM8A 1WMFA 4FYJA 3TDMA 4FYVA 3OEHD 1WXFA 3TQTA 5B57C 5EXDA 1IEWA 5I7RA 3GEPA 2DKOA 5ARBA 2C0PA 3OECA 3H5OA 3HZZA 1N75A 1B43A 1TVKB 3A58B 1EG7A 1FL9A 3LPAA 4NJEA 3KKMA 4BX2A 5DTIA 1WXEA 5B36A 5AOBA 2QP3A 3M9WA 1EDZA 1V8ZA 4RW0A 1JS1X 1IONA 4HH1A 4RVFA 4V0ME 1X77A 2FNAA 3HR8A 4BVFA 5DHQA 1S2LA 1CQJB 2ZQ5A 3ZKAA 4CTKA 5KJ6A 1CZRA 2DLNA 4JQCA 3QKUA 5TRTA 2PANA 3EGXB 2A0YA 1GZ5A 4NYJR 3GPIA 3A6PC 1SUAA 4RUKA 1WUHS 5HM6A 4ZCPA 1UBRS 5AVUA 3GCGA 3HBNA 4FCCA 5IH7A 1JQLB 3ZX4A 2ZUWA 4MYUA 2I91A 5A0TA 2BUBA 1H23A 2AJDA 4MKXA 2F8MA 2HD4A 4CEJA 2QD2A 3P0JA 4B7ZA 1VDZA 1H0KA 2HO5A 2YNMA 4I50A 2RARA 1BEUB 5CEEA 1I2CA 4US2R 3OJOA 5CX1A 1IY9A 2ZBRA 3DOFA 5L7WA 3DBVO 2ONKA 5KWEA 1SKYB 4FFNA 4GX0A 3KYCA 1AT1A 4MB2A 1EBFA 1GPYA 1NW3A 1V5WA 2QENA 1A9TA 3KBOA 1DOZA 3HGMA 1AN9A 3LGAA 4HLUA 4HN4B 4OXXA 3S99A 3VDXA 2WJ4A 4BQNA 4AUEA 1H9AA 3T5PA 2PMBA 4FGJA 2ZVDA 3BFKA 1FDTA 1ZWKA 1RWBA 1U8ZA 4PG8A 5MN6A 3V1YA 4GMGA 1XWFA 2PU5A 3T9EA 1R8YA 1K6IA 3GAFA 4W8OA 2CNWD 1LDBA 3AKZA 3R8FA 1SHTX 2INGX 4DR6B 3ZWVA 5C7OO 1T3SA 3SP1A 2VZLA 4IZOA 1C2YA 4ALIA 4FUQA 2DOKA 3QENA 3IMCA 4WDQA 1JLHA 1GG8A 2BOVA 1X1RA 3AIIA 4O59O 2O7QA 4ZT5A 4QRIA 2GD2A 1HWYA 5FUXA 1ZESA 1E59A 3CKYA 4JELA 4P3NA 1YFJA 1EK2A 4U7JA 3BGVA 4EG4A 4ACBA 4RD4A 4HB0A 1W7AA 5AVWA 4NFHA 3E9RA 5EOVA 1GXSA 4C2UA 1RC1A 2I2CA 3N8HA 4HAOA 4EW6A 2Y0DA 5C32A 1KFEB 1BA3A 1GR0A 1GTJ1 3RODA 1H2EA 3RABA 2IW3A 1YJCA 3TR6A 2YQ4A 3VH4A 4OHWA 2Y1FA 5AKHA 1T6XA 2FUKA 4ITVA 1IZ8A 4TX1A 1P2FA 1XCPA 4MVJI 3CRRA 5AKLA 4WESB 4IUYA 2LXNA 3TRHA 5JHHB 1XN1A 1K2WA 1KDZA 1ESZA 1PUXA 3CKMA 4QPDA 2X2FA 5F9HA 1BFDA 1PSZA 2EBWA 2F9MA 2ZI3A 3KQSA 4LA4A 5HEKA 5J2UB 3UJPA 5BVGA 1U2GA 1PTJA 4TSFD 1AUQA 2A94A 1WPXA 1PZFA 3K2QA 1GCGA 2QYSA 1O89A 2ATCA 2Q6TA 2Q7XA 3AR4A 3BB3A 3KZKA 4JI5B 2RC6A 4QTXA 5HM8A 2M6KA 4AJLA 1MQ9A 3QLEA 4JCCA 4Q3OA 1VLZA 4JR0A 3GD7A 2JLRA 1XPRA 3BK2A 4N6OA 3OJWA 4PCAA 3BA1A 4HQLA 5KYWB 3VDMA 2VJOA 3RVMA 5AIAA 3TDNA 4UU0A 2DT5A 3PZRA 4H7KA 3U3OA 4COKA 3NYWA 1ZVQA 2A0WA 3F47A 3NH6A 4KRYA 4BNIA 4NZMA 1AQLA 1J1IA 2Q9BA 3CN7A 2HHHB 4UE3S 3NHZA 3JYNA 5IDXA 1JEAA 3FSRA 2FDCA 3BORA 4PWYA 4MKIA 2V6JA 4R0NA 3WKBA 1ONPA 1U0GA 5K6RA 5M34A 2HWYA 1UL1X 4WLNA 3TW6A 4BWGA 3KSMA 3CVYA 3MWJA 5HCNA 4FI3F 3RWBA 1MB4A 4C78A 2KX7A 1W1WA 3GRKA 4NS1A 1WXDA 2BMVA 3NHPA 4A23A 2WHXA 4BDSA 4F1WA 2CLHB 4QBFA 4QJ5A 5DBIA 2Q7DA 3QPVA 2H9YA 4X1IA 3MBIA 5CGZA 1YACA 2WJ3A 2QN1A 2B3DA 2FPUA 1A9XB 2EP7A 2KS6A 1C3OB 3HE3A 4C0SA 2X8WA 1OE0A 4FC6A 3K35A 3DDHA 5ITZA 3Q5DA 2OFOA 3HR4A 3CW2A 2CJPA 3M82A 4XFJA 1V16A 1QANA 3SEFA 2X9NA 1UP4A 3DBHA 1B8OA 1OA0A 3RRMA 2MSEB 1NW7A 1FDOA 2YDYA 4PLWA 3VPGA 4W7IA 1WCYA 2WHQA 3H65A 3J81A 5AW9A 1KI6B 5IMSA 3QKSB 1KJQA 2X8BA 2I4NA 5FLYA 2ZDQA 2YFHA 1A9SA 3DZBA 4JROA 1NHGA 3VOTA 4FNOA 4W5JA 3IT2A 1L5LA 3OX4A 3OZRA 4U1RA 4E5UA 4EB6A 1DRJA 4EITA 1YE5A 1C9YA 4HDMA 4IW3B 4J0GA 3OLQA 1JQ3A 2H1SA 3WL8A 5CFMA 5F7XA 5K8CA 5K0BA 1FTSA 4NK4A 1Z4JA 5IJ0B 1LD3A 2DR0A 4PBRA 3ESCA 4QDTA 2B4TO 4JOSA 3DGEC 5DLEA 3AB3A 3QVLA 1ZNWA 4HEQA 4X0EA 1SVLA 3A25A 3FUVA 2P5YA 4MGHA 3SC3A 1S9HA 2NWQA 3DF9A 3HO8A 5J5AA 3TLAA 1PR4A 3W04A 4D0NA 1YFLA 1NYQA 1DAKA 3RFUA 2O5EA 3PXAA 1Y5IA 4QL3A 1SWWA 2Y1EA 1WUYA 1ADYA 4DR7B 2VPXA 1XWIA 5BMVB 3ZGNA 1J0AA 2BFMA 1GLNA 2FW9A 1XFDA 3H18A 3QBEA 1RTTA 4JLBA 3QE9Y 1WLSA 2BM0A 3IMGA 4XJSA 3AFMA 1NQTA 4NZPA 2OV4A 5HQ3A 4GZ5A 4O4JA 5TQJA 3ZGXA 1JEQA 1PEYA 2PGJA 5K0EA 1SG6A 1JF8A 3DE5X 5AXDA 3GL9A 4EI2A 1F8YA 1UBHS 1WHTA 3Q5EA 2DEUA 3V2HA 3IOBA 4WK2B 1FBNA 2JJ1A 3M4JA 1TPZA 1PL6A 5LQJA 2ZROA 3AM5A 3KXLA 2XOEA 4A7PA 3MOSA 2Z2ZA 1X6VA 3CU5A 4M21A 3WGMA 4JGIA 2G77B 1VCOA 4G8DA 1PF7E 5AKYA 1QRAA 4JVOA 5CXXA 4TV8B 1CPYA 2ERCA 2YWEA 3UOWA 3SEAA 4B4UA 1M9NA 2VBGA 2Y9MB 1QIKA 3NRCA 2QV0A 2AHOA 2PZMA 4NMHA 4JOQA 4TMTA 4Y2GA 4YS6A 2X0EA 3H5LA 3SDZA 1OA1A 1PJ3A 3N70A 3HP1A 4EMUA 3CPJB 3HKEA 1UZAA 4J91A 4ZQHA 4AL4A 2DPGA 3I58A 2OP0A 3ACDA 1JX6A 2GK3A 2XY4A 3AYZB 3KR2A 2OO3A 4OOEA 4S1NA 1NJ8A 3G1TA 2A3RA 1N25A 2A8YA 3KKNA 3N58A 5AKIA 2Q21A 5DOZA 1AY0A 2C92A 2Z9CA 4WCVA 3ROEA 3E3OA 5E9WA 4OJTA 4K9NA 1I2AA 3W79A 4JEIA 4O6VA 1E0JA 1OXUA 1Y3IA 5B3KA 1FU4A 2EFHB 5COBA 1L2TA 1XZNA 1G18A 2UYYA 5BV8A 3HXLA 2WTAA 1PX0A 2I5PO 2XTJA 2ON6A 3JS5A 2QTGA 2HPVA 4QU8A 2BEUA 4IUDS 5B6JA 3LT1A 3BTVA 3WQQA 4CKCB 1N9ZA 3HB7A 2M6RA 3BWXA 3WA6A 4EYEA 3E05A 5LP1A 2XNJA 3CVJA 3TF5A 4ZZ0A 2AC4A 1Z4LA 4IRXA 4K26A 1WNTA 6NULA 4MULA 2Z8ZA 3FTQA 1HPLA 1OYVA 1H1LA 4OMCA 2BDTA 1A9OA 1ZNQO 2JKVA 3AUUA 3A37A 4Y2UA 3VC7A 3H8VA 1US8B 1PZHA 4L27A 5C9ZA 1QLJA 1ZJJA 1HLDA 1KPGA 4YK7A 2A4MA 5I48A 4EEXA 3I05A 2QZ9A 3CNNA 3L0PA 3TECE 3UJNA 2D0DA 4OATA 4PYQA 3F5MA 4WBNA 1RPJA 3L8HA 3E0QA 4IGKA 3ZD8A 3EDQA 2ZT8A 3QQPA 5L95A 3GAZA 2AZMA 3JWHA 3STWA 1KA9H 4WFKA 2CXTA 2AFHE 2V74B 4WJLA 4WH0A 3DVLA 4YUXA 3DFZA 4Z7QB 1Y3AA 2JJQA 5L4LA 4RCYA 1TADA 5DW3A 2FPLA 2D2XA 1C9JA 3CUEF 2PKXA 2CK3D 4UM7A 2YHIB 3N0XA 3G23A 3MJHA 5H5JA 3L5OA 4ZZ1A 4G4IA 3O73A 1EP9A 3AY7A 2O2XA 3LUPA 3RTBA 2ZG6A 3OPNA 3HN2A 1KQNA 4E3WA 2G71A 3EMDA 3V48A 2HCTA 2R6CA 4RFLA 2DUNA 1DG1G 1G2OA 4FW8A 4WA7A 5D5HA 1W36B 4YJGA 1VXRA 3GHYA 1JIQA 2FJUA 5IDQA 1XMJA 1ATIA 1MC1A 4JQOA 1OB2A 1NRXA 1DI0A 2AOUB 2C4TA 1RKQA 2FPKA 4FYPA 4KQKA 4RKRA 3FCYA 2KJQA 2H57A 4ZCQA 3KQLA 2V0GA 2GQ0A 3GAMA 3D3QA 5EP2A 3O5AA 3KOYA 3CUWA 5CW1A 4CDGA 1N2JA 3EF1A 3RAFC 1WLYA 2WMOB 4DUZB 1N5MA 1VTKA 3GRPA 1DX6A 1N2CA 2VDVE 4QOFA 1BS2A 1KAMA 2KSQA 2J5RA 2ZIWB 1W85A 3COZA 4ZT3A 1JJAA 1R6BX 4QGGA 3T6KA 4O2AB 3WL6A 4AC9A 2E89A 1HYEA 4ZYYA 2I7VA 1OC2A 4JENA 4KAFA 1C0LA 1MBZA 4WFIA 2ZFUA 1CETA 3VVMA 1JH9A 2DB3A 4W5NA 1B14A 1KRXA 1H0SA 1GNTA 1U2EA 2A9OA 4GRAA 2ADOA 4HNAA 2ID9A 1T6YA 2NU6B 4KNYA 4M89A 4DTIA 4UU1A 2V5AA 4IIJF 3RE1A 4BPRA 5M7EA 3ANLA 3N3BC 4S1VA 4U2CA 2ASEA 4UDNA 3R0ZA 1Z25A 3ZU6A 1DFHA 2JGDA 4X6XA 2O48X 1QOPB 1A76A 3MGCA 4C4AA 1S7CA 4UZFA 4KK4A 2YHUA 3ROMA 1Y1QA 2D5IA 1H2HA 1KE1A 3R20A 2FSPA 4TL7A 4URWR 3ADBA 1XD2A 3R7WA 4FFLA 4FJ1A 1KAHA 1BO6A 3RU2A 1S8FA 4LUCA 5EFOA 3RYCA 1QZXA 2QVZX 1OJLA 2WICA 4JI7B 1JKMA 1VKJA 2AG0A 2H48A 1XQ9A 2FLWA 1LBEA 3NEPX 1R4NB 4P58A 5B2ZA 4LFCB 7REQB 4RXTA 4ZK2A 2QM7A 4H15A 6YASA 4FT4A 1GTSA 3B6JA 1HNNA 1SKBA 2C5BA 3DZKA 2C7QA 5ILQA 2R00C 3TINA 5EJGA 3R6TA 3EEBA 4KJXA 2X5JO 4B6EA 4NTZA 2BT4A 2RG7A 3OVMA 1E7WA 3BF8A 4CTNA 1Z47A 2Y9PB 1PVDA 1J99A 1QIGA 4PPNA 1VL5A 4BX8A 2XRFA 4NHEA 3FF1A 3ZJ5A 4IFTA 4ANFA 4JL6A 4RKWA 4TYQA 1YCFA 2PFKA 3ASZA 3G8YA 4PINA 4C21A 1DIHA 3EIFA 4OLAA 3ICOA 3OICA 5IKXA 1VYHA 2CJYA 1GUYA 1YV9A 2WVHA 1NTOA 1ZY2A 2ZAIA 4DY6A 5IW8A 5KMGA 3CBGA 3PPIA 1EGMB 5ICEA 2FRVA 4U2DA 3GLFE 3ILYA 4MNTA 2FX2A 1DZIA 1M2NA 1H05A 2F48A 3WLIA 3R3JA 1ONNA 2F3UA 3K9FC 3KJXA 4QICA 3GT7A 5D86A 1U8AA 2NUAB 4KWCA 1HLPA 3PNMA 4LISA 3AVVA 2PSDA 3F6CA 1JVBA 1VHLA 3NV7A 2RJNA 4TKVB 1X13A 1QV6A 1VBNA 2OAQ1 3A2NA 1IZ7A 2CDNA 3DAGA 4YA6A 4G56A 3OKCA 1DWUA 1KVUA 2QN7A 2C83A 4DIOA 2PLAA 4RU1A 1EFVB 3LHKA 3KJIA 2Y99A 1NOIA 1YDEA 5AKGA 3I0NA 4YX9A 3UV7A 2ABWA 2E85A 2FSVA 4U9HS 3HV0A 2JD1A 1PT9A 5GM1A 1IHDA 2Y0BA 5IAJA 3VHQA 8ATCA 2YTZA 2YXBA 2PQ2A 4RYLA 4BN0A 1XGKA 1A0OA 4UAJA 3COPA 5LWHA 4RVSA 1Z8NA 5G1OA 4P31A 4H6PA 3SVLA 3B3FA 4P08A 5CIYA 5F1PA 2YJ5A 1SU6A 2BL4A 2X4GA 2E49A 1UWKA 2BUCA 1BD4A 3FTEA 1KOGA 2WQ6A 3HGQA 1A8QA 5T3UA 4B6JA 4JSTA 4LJ7A 4D3XA 5BOSA 4BNHA 1VL0A 4FFVA 3CGWA 3BUSA 4DIKA 3P9SA 3N6VA 5CT6A 1SC1A 3OAAA 4DARA 5TB5A 1V3VA 3UG6A 2QRUA 4C88A 1FVHA 3EAQA 4FFBA 4B3CA 1IZYA 2VT6A 4YJ2B 2QJRA 1ENYA 4TRRA 3A9SA 4TLDA 2C8KA 5ULLA 4YRLA 5EIAA 3LQFA 3VH2A 3TI7A 4QOGA 4DKXA 5HR5A 2Z9BA 3L92A 2AEJA 2VNJA 3DC7A 3WLAA 4CIDA 4JX8A 4XGKA 2VYCA 3IO5A 5CD1A 2AN1A 2VHTA 4HMQA 3A3PA 4FZJA 1PN3A 3DEIA 5KIAA 4F56A 1KS2A 2HQ1A 1Y42X 5AI8A 1BCRB 3IQIX 1THTA 1FFSA 4CRWB 4MWTA 2POQX 5G1NA 2PGDA 1ADJA 3W9UA 3DEHA 1LK5A 1TVKA 4U02A 4MQEB 4F3KA 2I76A 1PS8A 1PU2A 2WB4A 3I04A 4Q4JB 4UMDA 4D80A 4Q7QA 1BVYF 1XZMA 3EPRA 1NVUQ 3OCWA 3B6IA 3DMRA 4NQRA 3K0EA 4JYMA 1CVRA 1CUXA 3GLRA 1MA0A 4HPXB 1J0BA 1EKXA 4OF4A 1Z37A 3BHNA 3FY4A 4NLLA 1JXOA 1OHHA 1R8XA 1X1QA 3IP5A 2Q4DA 4N0PA 2E0IA 1JIXA 1J49A 1V96A 2A58A 3EGXA 4X1YA 4UJ3A 4CDMA 1AMNA 5EIEA 2C2OA 3R9XB 5BWOA 1V39A 4UUPA 4LJ5A 3D4IA 3WJ7A 2B78A 2ZAOA 4QBTA 3ABQB 3KOWA 4MVJE 4NBSA 2RKWA 1ESNA 3PB3A 4C9BA 2ZJ1A 1DO2A 1QCDA 3IUJA 3NHWA 2XBUA 4L76A 1YR9A 3WMWA 2BKVA 1PLJA 3GNTA 2C9ZA 2CYAA 2C78A 4B71A 2FKAA 3UJHA 2XWJI 1RKXA 1KYQA 1LPBB 1QWOA 1VSTA 2QUKA 4ASUD 1HR0B 2ECQA 5BN1A 2GPAA 1TZMA 1HTTA 4C4RA 4F5ZA 4F9GA 3O8QB 5K51A 2NOAA 2M1XA 1B0ZA 3INRA 3BMNA 2J9YB 3I8SA 4Q4HB 3W8EA 2WK1A 2XAAA 1N5KA 1EH5A 2A14A 2XHEA 1BXZA 2OBFA 3CNHA 3UMBA 1DKOA 4JDPA 3RJ5A 3B1WA 4OYYA 2IGBA 4BNWA 3EGWA 3ZBQA 1YVRA 4DPKA 2BI8A 2NIPA 5BV0A 3S1AB 3OOHA 3M2TA 5J2TF 4LXUA 3CZPA 1DOAA 3TIFA 4ZCTA 5EHQA 4N3BA 5JC8A 2EBHX 2XT0A 4WXPA 3WYEA 1JDJA 4GS5A 2IH5A 4UHFA 3WTBA 4EO9A 2B3TA 4PRZA 2QL7A 1L7AA 4I3FA 4QJ3A 3NHMA 5SZIA 4ZEXA 2R3SA 3WK8A 1WVMA 4KVGA 4CNQA 4CLXA 1XJQA 2QXUA 5KOIA 4YJKA 5LP6C 4OMFG 4INOA 3O8DA 3K8ZA 2QI9C 1CJSA 4PXSA 4GC5A 4X45A 4YRGA 3BMXA 5ERXA 2ZT5A 1V3QE 2CVHA 5C5CA 5J2UA 4PZCA 4ER0A 1JWLA 1KO8A 1PV2A 4Z9YA 2LUOA 4B47A 2Q1UA 3W3ZB 1ZW1A 3DZDA 1XRMA 4KB5A 4LWQA 1Y81A 2D13A 5E9JA 1YUMA 3A8TA 4HTAA 3PITA 1E63A 3AI3A 3MG9A 3ELWA 4N7MA 5IAEA 2O2HA 1CNMA 2UV8A 4ENTA 2IYPA 3ZHTA 1E62A 5D51S 5KYWA 1SXJD 4EFDA 2ZBPA 1KQFA 2CWWA 3T7RA 3T7EA 4B6GA 1RJDA 2Q5FA 2Z43A 4Q0MA 3F6EX 4K9KA 2HCBA 8ADHA 1T4DA 4MV0A 1YKSA 1P0FA 1REQA 3LCUA 1FFAA 1FYXA 1G3QA 1GTG1 3G9TA 1W73A 3LWBA 4JT4A 3AVOA 3ZD9A 1Z82A 1I7SB 3GLHE 1TQ8A 1K0UA 2OHVA 2C7RA 1WXHA 5DXAA 4U0JA 4C6RA 1OW3B 5JD6A 4UE2A 4HY3A 3KHTA 5LJIA 4WECA 4MVJH 4QU9A 3KHKA 1ES9A 1P1RA 3VX3A 5BUCA 1RI4A 3K9NA 1SXPA 2BISA 5K8IA 2J3IA 1P81A 1PZXA 1Q57A 1HE2A 2HJVA 3OPYB 3BTOA 4PR0A 3WVNA 4D96A 3NONA 4ARUA 5IT0A 1SBYA 2FPGB 3ITEA 2QKYA 3IVXA 4JC8A 2IZ6A 1KZ4A 1MU0A 4W9NC 4YBRA 2Z1DA 2R1ZA 1Y6GA 2CJXA 5TEWA 1PYGA 5EGSA 1X2BA 1D09A 3PFHA 2PMDA 2FFQA 2VJLA 3K30A 3OTHA 4CIVA 1C3OA 3GCDA 1RYZA 1C9NA 1IATA 1LI7A 2VRBA 3KPJA 4C6TB 3K9CA 5K3CA 2Q45A 2BAGA 3IUBA 4OFXA 4PNPA 4YMIA 5INTA 1RBYA 1T3GA 2BTOA 3LPLA 1WW8A 1Z7BA 4RY8A 4UM9D 4IJQA 5AT1A 3HB0A 3UA3A 5LQRA 3ZD6A 2VQSA 4I9UA 3AJDA 5JAQA 3UK1A 2DY1A 2VJNA 4IS3A 4BMPB 5CFPA 1JP7A 1XMQB 4NPHA 1JSCA 4CMHA 1FYWA 1KI6A 2C5LA 3OE7A 2PX4A 2HHAA 5CVDA 4E46A 3PXBA 3QKSA 4YALA 5AJVB 1TB4A 1IFXA 5DEOA 3COSA 3H7IA 4KR6A 4G0WA 5KYUA 2C84A 2REQA 2PCJA 5DEIA 1OYWA 1C9DB 2BWJA 5C35A 3A4YA 1FFXB 4OUKX 4YJFA 2QMZA 1KOLA 3V00A 5TT0A 1GAQA 4ZA2A 3DT8A 4FOLA 3EPKA 1SKQA 1VIVA 3CLSD 2JGNA 5DOVA 1CZKA 2P40A 4AMUA 4C03A 5FI5A 3DXYA 3PWTA 1GT6A 4V1CB 4NYMR 5LUAA 2RIRA 3NIFB 1L5NA 1JLSA 1PCXA 1XJWA 5CXSA 3ZK9A 1S4MA 1Z9BA 3LDUA 4YMGA 3U62A 4OXNA 3VPCA 3GGPA 4RS4A 1I6KA 4R0MA 3DZIA 2AC2A 1H0HA 5JNWA 3I4CA 2HLNA 3P9QA 4DMLA 1ZN2A 4B34A 1M67A 2H4JA 1DMRA 1Q17A 2P9CA 3GFOA 3HKBA 3H97A 4H35A 4LIPD 4LXGA 3V4PB 1L7RA 3CNQS 1AJEA 3K09C 3BQNB 1U9IC 3SEQA 2PD3A 1Q7RA 1XLTC 1KJNA 3H3JA 4KXUA 1FMLA 3UBMA 4YCBA 1HOTA 1UEJA 2G4CA 5DHUA 3SYNA 3QLUA 1OY1A 1JPUA 1LXCA 4JSYA 3LGXA 4GOLD 1F2VA 1T4MA 1K75A 2AYYA 4M1TA 3V1MA 3IA2A 4N4AA 3U7QA 1ZICA 1HYHA 5E6RA 1U2QA 4CW7A 5GJVC 5LD2B 5EJFA 4IIYA 4AJEA 2GSDA 4GBJA 4MB6A 2VDWB 2FOXA 3N7TA 3LWDA 3RT9A 1V47A 3ZX5A 1MJFA 1TU4A 4FMDF 2XXBA 4B79A 5AVTA 3GY0A 2BP7A 2FHSA 4DM3A 5DNEA 3UH0A 3ICQB 5KYYB 4XOIA 1DAOA 3CNOA 3GMSA 1OAOA 4G85A 3ZS8A 3V55A 1QQBA 2HWUA 4MP8A 1HE8B 3VDRA 1GSOA 2WT9A 1XL0A 3VYUB 3FNEA 3FPFA 4GVPA 1OLUA 3K6KA 2RSLA 4XDZA 1Q84A 4MVJP 1JHDA 4EG3A 2FFHA 5IU6A 4UEJA 2CLMB 4JSRA 4GLFA 2AXEA 3LBNA 3PUJA 2NSJA 1N2XA 3VH1A 3QX8A 2GF9A 4ENUA 2PZJA 1XWWA 3FDFA 1TF2A 1YMQA 4RH1A 4C7VA 1TZCA 5FFMA 3G17A 1CCWA 4G5XA 2VDLB 1SCNE 5FFFA 1FLAA 3VR2D 5A1TA 2NX2A 1HEUA 3ZQKA 1PEKE 1QVAA 2WF8A 2AFVA 4AZTA 1DDOA 3ZWXA 6ADHA 2GD6A 3OZ7A 3Q3JB 4BN5A 2VI5A 1ZBDA 1QIJA 4M1MA 1ZGBA 1HDZA 1K7SN 1U3FA 1N0IA 4MS1A 3TRKA 4BMXA 3A3OA 2CB9A 3P4YA 1UZMA 1IY8A 4GDMA 3C6BA 4WI1A 4RETA 5HKBA 5I9LA 3SYMA 1U94A 3KZVA 3N2KB 2VQEB 2EG5A 1JLRA 1TO6A 5CCXA 4LY6A 3GIDA 4YUYA 4DXAA 1JT9A 1HT1E 4C7MA 2GEJA 3IUEA 4ZQCB 2ODNA 4R84A 1W0JA 4NZNA 4Q02A 1X7GA 4ZGGA 8LDHA 4TYMA 1WDWB 1US8A 5TV2A 3R7FA 2G04A 2C5AA 4BBZA 1VFNA 4RKQA 3DC2A 2BM9A 3LX5A 4KNWA 5DM4A 5AO9A 2E4UA 1GQQA 2E5WA 3HUUA 3JZMA 1BX0A 2C4KA 4PC7A 4RBNA 5FI3A 4YMUA 3QOXA 5F2OA 5AW2A 3FIUA 3THRA 2VRCD 3UBTA 1ML4A 3H0CA 1ABBA 3Q4GA 4PRYA 5KYXA 4RIFA 2PH5A 2J85A 3DE3X 3JPWA 3QLVA 3QVXA 2Q2VA 4GFDA 4ETIA 4PR3A 4S12A 4XQGA 3H2SA 4HDSB 1NBME 5LZ8A 1TE2A 4IQGA 1ZMRA 3SIWA 1K08A 3OLWA 1ARZA 3EA4A 5ECGC 3AM3A 1Y1TA 3VAYA 1BVRA 3KQMA 4FOPA 1RFLA 1KI3A 2QVCA 4GP6A 2CNDA 1S2OA 3I23A 5TQVA 1T4BA 2ZCVA 1U5BA 2DY0A 3BH7A 2FEPA 2VDUE 1JSRA 2O20A 1HSOA 3AF0A 1JA0A 1UT8A 1EGVB 1LDNA 1LRKA 1KOFA 1R8QA 3AUKA 4N0DA 4P3PA 4JB8A 3EXEB 1TJPB 1KP2A 2UDPA 2W71A 2H5IA 3FPKA 2ZSAA 2C4HA 4GICA 3A1SA 4B44A 1PX2A 1T2NA 2AOUA 4P4NA 1CB0A 3QE4A 2NACA 2I4TA 5FPQA 4DA9A 1LNZA 1DCTA 1YBMA 3SJ7A 3ZOKA 3FOAA 2B82A 2NSYA 2XIJA 4ZU3A 3ZQ6A 2AFIE 5D3ZA 4LDJA 1A50B 4EG5A 3OQPA 2R8XA 5DHTA 3T7SA 5LMUB 3GJ7A 5B2EA 1U1DA 2ZIZA 1T36A 5DJ5A 3UA4A 4GP7A 2A30A 1JJVA 1OV4A 1RBQA 4L9SA 1Q1ZA 1XZPA 2JFUA 2RGAA 4JJ8A 3GMTA 4B2PA 1K6XA 4E30A 3HXKA 2PGLA 3HS3A 4ZQBA 1AO3A 5FA8A 2EWMA 2JDID 5JZMA 2HW8A 1YQ9A 3VNSA 5FFNA 4GI5A 5IC5A 3OQIB 4TTAA 2WSBA 4FN5A 4DNOA 4HB4A 2WUWE 1OXSC 1VJ0A 1D2EA 2HLPA 1SQ5A 3TNJA 3GC6A 1UAGA 4PZPA 1O6GA 1QM5A 4F45A 1DBWA 1WUIS 3KVOA 2PSEA 1WMEA 1JR6A 4B4WA 1F4VA 1F8GA 4O5OA 3WL4A 2OSBA 5MFPA 1A4XA 3GAAA 4JD5A 5CDUA 3LU1A 3G7UA 5B30A 3PNBA 1L5QA 1E99A 2EQBA 1NMSA 2FWIA 2ZI4A 4ZVKA 5EIOA 2ANCA 3HUTA 3I73A 1I13A 1UXOA 2CT8A 3EASA 1RPAA 1PFWA 2WPDA 1M2OB 4JLUA 5JUWA 2ZYHA 1FNNA 3DH0A 2GX6A 1JHYA 1CY8A 3ID6C 4IUBS 1C8KA 3EVFA 4PSVA 1U1FA 3O8NA 4MDYA 5FO1A 3V7UA 2JIZD 4ZQEA 3K1AB 1M2KA 4HDAA 5KVAA 3NASA 4MRMA 1VPTA 1EX7A 1GNRA 5AW7A 3AC0A 3I39X 2Q3BA 3K2EA 4X44A 5E6UB 2AFHB 3C3BA 2BGMA 2P5SA 1I3LA 2C42A 3EVEA 4V0SA 4Y2SA 5DRYA 3U0VA 4QULA 3WGHA 5IRCD 4CBVA 3RFXA 3MINA 1EHIA 1Y8QB 2W2LA 4G36A 3ZHUA 4FUTA 1M10A 2GEVA 2BHNA 2LVBA 2XYVA 4L73A 1LS1A 2VDMB 5DE3A 5K8UA 1F6WA 1LV7A 4RE6A 1SU8A 3NNNA 4MHOA 5C8YB 3T34A 4MR8A 1I3MA 1NZJA 2HXGA 2D0PB 3FWHA 2FX5A 1Z62A 1E2FA 1SQFA 1GYQA 3ABRB 3DE1X 4BX0A 2ZT7A 4BP8A 1NVWQ 1U2PA 1EX6A 2FLVA 3ZQ4A 1FSFA 2EX4A 3P2KA 1II8A 3UXHA 3CZCA 3IQZA 3IA7A 1BKDR 3LLVA 1IM2A 1YDWA 1LPAB 3EXAA 5JR3A 3R76A 1OXVA 2FPPA 2IX3A 1ZHFA 2BBWA 2VQ3A 4DJJA 1KZ7B 5FT9A 4N7JA 4TKVA 1XTVA 2P2DA 5H70A 1YSCA 3AB8A 4EJSC 1L5OA 1UJ5A 4MUMA 3HUEA 1EFRD 3PXGA 4G63A 1MQSA 2Y1WA 1RWMA 3D6TB 3N5CA 3QH4A 4J43A 3O84A 4QVGA 3V32A 1CJKC 2PO7A 3EEQA 4CKBA 3RVOA 3BS4A 3Q7PA 5JOQA 3TL6A 2PZGA 3OJ0A 5F4BA 4KI7A 4LCEA 3KV3O 4F5EA 1GLGA 3GVIA 3NEYA 3O7WA 3N8DA 1UOPA 4M0KA 1PVVA 3JQ9C 4HXFB 1VKZA 3C6ZA 5IJAA 4EI9A 2A1UB 3QITA 3FR7A 1GL3A 2PDAA 4AN0A 4AI6A 1M74A 4DFDA 4LHZA 4NOMA 1EAMA 3AU8A 4EWLA 1MF7A 1X8LA 3S1SA 1JUDA 1JDPA 2BLLA 3LQYA 4N3GA 5HF9A 1F1BA 2FFBA 1BXRB 2Y1LA 4IQ4A 4RFSB 5LYYA 4E4RA 1ODFA 4EUFA 2E3JA 4WLEA 2EFGA 2FCAA 3SLRA 2X86A 4AM8A 4V1CA 4OHXA 3E03A 3K71B 3C1OA 3AKCA 1R5JA 4ENWA 2WSLA 4MPPA 3H16A 1NXVA 2F8TA 3GCWA 4JA2A 1U2TA 3MJTA 4EFLA 5DWVA 4KAJA 5ECWA 2J3EA 1XNJA 1E79A 4IVRA 3ISVA 1JXAA 4FFMA 1KHTA 1NQ5A 3LFHA 4OK6A 1S2MA 3JTEA 3OQ6A 1D8TA 2H2WA 4DWOA 1P1CA 2I4OA 1TAQA 5AI5A 1AA9A 3QWIA 4DBZA 2NTJA 1FDSA 3D1LA 3FE2A 3FYUA 1Y34E 4GZMA 2QR5A 2RH8A 1SC4A 4BO3A 1W47A 4HDOB 1SURA 1BDHA 3QE3A 4PC6A 1K6EA 3W5VA 2D5AA 5JCJA 1WDKA 1QS0A 1AV7A 1R4ZA 2IA5A 4MR9B 4MW1A 4N5IX 1V48A 2R6FA 4C06A 5CDFE 1EWRA 1BGWA 1TM4E 1WHSB 1WSDA 2AMVA 3NTUA 4ARAA 4D82A 4Q3EA 4BP9A 4L8YA 4UEWA 1P61B 1NLZA 2E55A 2W11A 4RK6A 5T6MA 2F59A 1XNHA 3EXG1 4MEJA 3K6SA 1IK6A 1GKKA 2R8EA 2YWGA 2PV0A 2HH9A 3EVCA 4OQPA 4Q4JA 2JLXA 1QMPA 4B3TB 4ZDWA 4G84A 3HMQA 4D5EA 4DJAA 3GLFB 4YP9A 3MWDA 3JZFA 2WIFA 1YKGA 1SA0B 4AJKA 4XVCA 4MYTA 2IHVA 4H0FA 4OAPA 3DF7A 3ZWMA 2VTBA 1E7RA 2ZSHA 1R74A 4P4SB 1AIPA 2YVLA 4PZAA 3IBSA 2IOFK 4MTCA 5KNDH 4Z5XA 1MG5A 1P62B 1W93A 1ZM2A 3NJ8A 4LE0A 1DDIA 1EIZA 2J32A 3ZJTA 1EFAA 1NBEA 1QQ6A 3WTCA 1TL7C 2P35A 2IHKA 2VPPA 4XARA 3WSVA 4LJ6A 1RI2A 3K3PA 1Z06A 2H5LA 3B89A 3O9ZA 3CEJA 4LG1A 1YZ3A 1BIFA 1A9YA 1JVNA 5EE5B 3RG8A 1XRRA 2B4AA 3PHCA 4RSRA 1QCZA 5HQTA 3ER9A 3B48A 4JWTA 3EF3A 1NPDA 3D81A 3VISA 4GU5A 2H2DA 4EO4A 4B3GA 4CV1A 1TLTA 4MROA 4DC1A 3PA8A 3N5KA 2O2CA 3O8QA 4PX5A 2CXQA 4G0NA 5IH3A 5EN4A 5ITSA 1R3UA 4J0FA 1P1KA 4J1NA 1FLVA 2J8ZA 4Q4HA 5JWOA 1AQYA 3NJRA 4ZCMA 3EEIA 3R3XA 2DYKA 3SQMA 3SEZA 2LE0A 1I33A 2JCVA 4L9AA 3VTAA 4RLHA 1Z88A 1X19A 1RAAA 3W05A 2RE8A 1PVOA 4H4CA 3T06B 2P5TB 3KJEA 2DFNA 3V97A 1ZIDA 3PFFA 2ZJYA 1W88B 2QE7A 1P39A 2CCGA 4FD2A 2YXDA 3T9FA 4UXJA 1EVQA 2EGHA 3LF1A 3J7TA 3QEMB 5ESXA 2B2NA 2TSYB 2Z3WA 3W4JA 1DEKA 3BRWA 4UTPA 2AOTA 3PI7A 4OXIA 1QU3A 1O03A 3U44A 2Y0PA 1IPEA 2B7BA 3IUSA 3LSYA 2ZYTX 4CIAA 1O94D 2WJAA 3C14C 1EUCA 4RHEA 5FPHA 2VQ6A 2YHSA 3UCXA 2OZVA 2PUCA 1AUVA 1KEEA 3JZDA 4UBOA 2O0MA 1KO5A 4PEVA 1YRAA 1ULSA 1BQEA 2VYFA 3LVFO 4IWNA 2R5NA 1LPPA 3B2QA 1NMXA 4YRDA 1MTOA 1OU0A 1V41E 3CH5A 4I9GA 3WGVA 1KFJB 3GEDA 5A4FS 5BYKA 2VCHA 3VPDA 4HDQB 2J30A 4R5MA 4PVCA 1P74A 3FDJA 4HRYA 3F7MA 4MRNA 5F98A 1H69A 1OH5A 1LI5A 3ETNA 4L57A 2FK8A 2H4YA 2AI2A 1YQQA 1XELA 1V0JA 3JSXA 3M9LA 5FBHA 4BRSA 1RJWA 4BV3A 2HU5A 2R11A 2Z2JA 1NA5A 4XIFA 9ABPA 4KQEA 1QV7A 3AILA 1OH8A 4PONA 1XCJA 1J70A 2YN4A 1HV8A 1I5RA 4EQ6B 2GD0A 3MM4A 4QSMA 4HJXA 4I9NA 1Q1QA 1V6CA 2FOLA 4D3SA 2A0FA 5CVUA 2XMGA 3KTAB 1JPJA 1Z2AA 5J59A 2R47A 2C0CA 2RK4A 2Z8YM 1SUBA 1XDGA 1GYRA 2JL1A 4GL4A 4AZ3A 1TYEB 1ZIPA 2ORIA 3QE0A 1RHMA 5K45A 4ESVA 5IZ4A 1U1IA 3NS7A 3RUEA 1JDUA 4Y2XA 5HKAA 2V3WA 1CJBA 4DLUA 4UE6A 3V1UA 1QWSA 5JMTA 3HO1A 5C81A 3ESAA 1UBMS 2R5WA 2W6ID 5E2IA 4ZAZA 4A0SA 1NWCA 2LBPA 3IDOA 4OGLA 5H9VA 1E2LA 2CHVA 4UVIA 5LB2A 5F51A 3BXXA 1G3UA 1X7WA 4N3CA 3I2YX 4C7KA 2VOJA 2QT9A 3ACCA 4JLPA 5AKJA 1MIHA 3UWKA 2AJTA 4XEHA 5BN5B 4BLUA 1A8IA 2W42A 4YP7A 4PLGA 2V03A 4W1SA 4N41A 2PQMA 4HDNA 4HYTA 2DPXA