1YJXA

Crystal structure of human b type phosphoglycerate mutase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
AAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase, hydrolase
molecule keywords Phosphoglycerate mutase 1
total genus 79
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1yjxA00
3IT2A 1FBTA 3BIFA 3PGMA 1QHFA 2WU0A 4JODA 2GFIA 3FJYA 1BQ3A 3C7TA 2P30A 2OWDA 4MA4A 1DKOA 3O0TA 5CU7A 1C80A 1C7ZA 1QWOA 1H2EA 2P6OA 2P75A 1T8PA 1UJBA 5PGMA 1TIPA 1DKMA 4E3WA 2WNIA 3E9DA 4D4MA 1YFKA 1K6MA 4ARSA 1C81A 3IT3A 4PZ9A 5AJWA 3LNTA 1BQ4A 4PZAA 3E9EA 3QPUA 3K4QA 3KKKA 1ND6A 2F90A 4EO9A 3NFYA 3FDZA 5AK0A 1V37A 2HHJA 5AJZA 5CDHA 1ND5A 1RPTA 2DWPA 2DWOA 2P79A 3K4PA 3LL4A 2YN0A 3QPVA 2P9ZA 2RFLA 4ODIA 1EBBA 3FDZB 1SKBA 3DCYA 2EOAA 3GP3A 1SK8A 5AJVB 3ZHCA 2H0QA 2HIAA 3D8HA 2BIFA 4PGMA 2IKQA 4FDUA 2P9FA 2AXNA 4GPZA 1RPAA 2HPAA 2EKBA 4TSRA 3IT1A 4EMBA 2WNHA 2ENUA 1YJXA 3OI7A 3E9CA 2P9YA 1DKNA 2A9JA 2P2YA 5AJXA 5AJYA 1UJCA 2P78A 4FDTA 1H2FA 3QPWA 1IHPA 3MXOA 1FZTA 3EOZA 2P6MA 3R7AA 1XQ9A 2EKZA 1SK9A 2A6PA 1RIIA 3GP5A 3LG2A 1DKLA 1NT4A 2PA0A 3MBKA 2OWEA 4JOBA 3DB1A 2I1VB 2ENWA 1BIFA 1E59A 1CVIA 2P77A 4IJ5A 4D4LA 1DKPA 3F3KA 4HBZA 4D4KA 5CX4A 2H52A 2QNIA 3IT0A 4AROA 1SKAA 4GPIB 5HTKA 3EZNA 2H4ZA 3F2IA 1E58A 5HR5A 2P2ZA 1QFXA 4D4JA 2YN2A 3HJGA 4QIHA 2H4XA 4JOCA 4IJ6A 3D4IA 1V7QA 4ARUA 3D6AA 3GW8A 3NTLA 4ARVA 1DKQA
chains in the Genus database with same CATH superfamily
5C4GB 1UXIA 2FW6A 2ZIEA 5F12A 5L6MB 1KZ4A 4PTZA 1R8QA 1X87A 1G3MA 4U8HA 3ZR4B 4BB0A 4K05A 4G5HA 2VYVD 4BE9A 2RONA 2JZNA 5CCXA 4X90A 4NC9A 5IYZF 3TEFA 1E6EA 3BOSA 3TZCA 1MH1A 3JARA 1XWWA 2JAUA 4HYQA 4RTSA 2VDRB 3BWMA 3ZWOA 4L78A 1AQUA 1QIIA 1SVLA 5ALFA 1WIWA 1N0UA 3IEXA 1NE2A 3FCSB 5G0UA 3LXXA 2JFGA 4EJ6A 1NHGA 3V7NA 4Z3DA 2POQX 4X41A 3P8ZA 3ZLVA 3BL6A 2C4VA 2PYZA 3L41A 3I23A 3O95A 1IQUA 4QNRA 4HT3B 2NVBA 3OE7D 1MENA 3FKSD 1X1AA 2J0VA 1OA0A 1K9VF 2TRSB 4OMDA 1GAWA 2DVMA 2ZJOA 1YGPA 1CQXA 1T0UA 4MW5A 1KJJA 3RRYA 5KOIA 4XQCA 4KHZA 1ZD5A 2YASA 1MNQA 4K9SA 1NZJA 4AUEA 5JWRA 3D6TB 1GLNA 4YIKA 1GL3A 4R01A 4YJFA 4EFDA 1IM8A 4H77A 2VNJA 3D7MA 4GO1A 1T36A 3AUKA 4YXWA 1RQRA 1I51A 3HPQA 2HUPA 2H0QA 3DT8A 1NY5A 3GDHA 4HLUA 4AJ1A 3FDXA 4JIMA 2G4VA 5B4TA 1TUBA 3EDQA 2G1UA 2Q6VA 3JSAA 3B78A 3N86A 1ZJ5A 5HJ2A 3SQMA 3ZD6A 1N9GA 1J00A 1UXKA 2ZI5A 2D06A 5BMVA 3J81A 1JB1A 2GHRA 1G1MA 1XNGA 4PCLA 1ZI9A 4ALNA 2FK7A 3T8YA 3DCIA 2IBSA 2PBRA 4JHLA 3WRXA 1C7EA 4ND7A 3VDRA 1FRVA 3CWCA 5I3ZA 3MWLA 1I8TA 4CRWB 1EZ1A 2DQ4A 1W75A 3IEMA 5EG5A 1TX4B 1SJ9A 2UUAB 3C8DA 3N2GB 2CVZA 4PQYA 1RMYA 1GN9A 5KU1A 2C31A 3A3NA 1Z8HA 2JHPA 3H8JA 3OM9A 5A2QA 4GMDA 1KPIA 3QBJA 3CX8A 3WIBA 1UBNA 1Y3CE 2QQGA 4M60A 3TQCA 5AW6A 3SM9A 1O57A 1IRIA 1YRYE 2FSPA 1VE1A 5HKAA 2UYOA 4MGHA 1D0VA 2IY9A 2OT3B 4FDAA 2CN1A 3CUYA 4X6YA 4EJSB 1DTWA 4KTVE 2YH2A 2OFXA 2P68A 3ET4A 4GC9A 3VSAA 2Q7XA 4TT3D 1NC3A 1Z2DA 1NMEA 1U2GC 1F9AA 1Z56C 3EA5A 3TSYA 3FOEC 1IN5A 3HBJA 4WW0A 4CMKA 5MFPA 3RSZA 5MF6A 2FZ4A 1P3DA 1GOTA 2WPDA 2OCDA 1G4AE 1X7XB 3E22B 4I3GA 1L2TA 1US8B 4HVTA 4DDMA 5AW3A 4G07A 4YCAA 2AUNA 2XQGA 3OPYI 4DE5A 5JFOA 1TQ2A 3D8UA 4QNMA 2OKCA 1VPWA 2GYUA 2QRNA 1QHEA 4ENUA 5HKLA 2X9VA 2JATA 2P2CA 2GBLA 2H1WA 4UAJA 3NTLA 4RTMA 2V65A 1ZUHA 4WEQA 1LTHR 1SVKA 1XXHE 2X42A 3ONVA 1RLJA 2ACVA 2J9YB 2OCAA 4TMFA 4TLAA 4ETMA 1FFYA 4MQ5A 4DM3A 4NOLA 3JVEA 3O1IC 1LF5A 1H42A 1WCV1 4EG4A 2NNLD 2XZOA 2HHHB 4CMEC 1CQWA 4B7ZA 4H7PA 4MINA 4LKOA 3DEAA 1QFZA 1PFKA 2IPLA 3JQ8A 3ZKWA 4PZUA 3FMGA 1ELOA 3PIIA 1L4FA 3KK0A 1H0KA 2CVQA 4UD6A 1BU5A 2PKWA 4ZHSA 1V16B 1JHDA 4QFMA 4F86A 5TV2A 5L7TA 1GFSA 3GC6A 1LRJA 1UMDA 1VHQA 2PQ2A 4OIMA 3GA5A 4MGYR 3T5AA 1WAMA 3LSTA 4B8ZA 4ZGGA 5I5EA 5FWXA 4DQXA 2Q41A 4O33A 1E18A 1M67A 3UB4A 4PF1A 1AJEA 4Q6WA 1FNMA 2XUGA 4DLNA 2XCRB 1O6CA 2ZWIA 4RY8A 1VI2A 3BTSA 3BXPA 4BKMA 4FSDA 4AMYA 2I29A 4PXAA 3SYTA 4RTRA 5TRTA 421PA 3WL3A 1F0KA 1U90A 5DLYA 4OHPA 5KMGB 4AN0A 3PGJA 2VUIB 3IAAA 3F4LA 4WOCA 3ZHYA 1XYYA 2V0CA 5LNK1 4A5SA 1NW8A 3ABRB 2J3LA 3S8YA 2JIQA 1DDOA 4J7AA 2A1UA 1V8FA 2Z8YA 3VC2A 3CCCA 3B6JA 2NTNA 2VNIA 3AR6A 4K2HA 3ANTA 3HK2A 2J3DA 4MQFA 4CT4B 5LU9A 4F60A 1Q22A 1QFYA 4ZJZA 5GAJA 1K7CA 5FOVA 2IEZA 2VSOA 4JLOA 3ZVKA 4ZI3A 3ZW8A 2O14A 3C3XA 1GPJA 2F6RA 2WE7A 4YFYA 2JLCA 3FNIA 3TLCA 2WJHA 1PN3A 4S1OA 4F46A 4LMPA 4KP7A 1FP2A 1KY4A 2HADA 1JLMA 1JG3A 5ALKA 8ATCA 4K88A 1KRWA 3IDAA 4HWTA 3K9HA 1T3ZA 1Z0AA 1I80A 3O47A 2WTAA 3NC1C 3ZQ4A 1YR6A 1W30A 1N2ZA 1GGJA 3PNPA 3QFCA 4I5IA 4RH3A 1C8LA 1I3OA 3I5AA 2YJTD 3PWKA 1SC4A 3QTBA 3T3PB 5ENDA 1SBZA 2GILA 2X4LA 2OGZA 3T61A 4HX9A 4F1KA 4F4JA 4YMVA 5CYGA 3I5YA 1LZKA 4EB0A 1MDFA 3KZNA 2WIGA 4A0FA 5AM3A 1KP2A 2YWJA 2I3GA 1OWOA 2F8LA 2ZXEA 3GMTA 4DLZA 4WRRA 1K3UB 3L0OA 3CY6A 3ROKA 3GHYA 3WHIA 3UJHA 1QP8A 1U2SA 3X1ZA 4EITA 3GLGB 1ULSA 4N47A 3OD1A 2R7LA 2QG4A 1EDOA 2VZ0A 2NU6A 1ZGHA 1I3NA 2YJNA 3FOCA 3M3PA 3N7UA 4KVZA 4L4RA 2IW1A 3WDKA 4XRGA 1LUAA 2AKEA 3NKVA 1LC3A 1OWMA 2J87A 1QIGA 5ERYA 2JLYA 1T5BA 1QHHA 2QUAA 3WFJA 1WXGA 1SEVA 2Q5IA 3OIGA 3UN1A 3L43A 1PNTA 2ZS9A 3ASYA 5TQ2A 4YRMA 5KMGA 3LHKA 1P1KA 1ZICA 2GFQA 1PJRA 2HB6A 3JZMA 1DRKA 1KQ3A 1RC8A 1NIJA 1SXJA 4Q48A 2Y2UA 3OPQA 1N3BA 1V11A 3QF7A 5CFMA 4KUHA 3PXEA 4YONB 4EEXA 4JODA 3PUJA 1RZUA 1U0GA 1E2JA 3AOEC 3C3PA 3EIOA 3MB5A 3OURA 4MS4A 2HK6A 3ZPXA 2RBGA 4M6WA 3RC1A 3CR8A 5E9WA 4Q3AA 2DHRA 2R7AA 3ONDA 2V5UA 5CG1A 1BHSA 2IHTA 4GZ5A 4NBRA 4ZEVA 1RFLA 4CNQA 5EQFA 5BNFA 1WETA 1YZHA 4LQDA 4OYYA 4L07A 4R1NA 1NW9B 1JKMA 1ZCFA 2B1JA 1AHNA 1J24A 1OH5A 1P7VA 3GI1A 3LC7O 1N6RA 2RGGA 1BXKA 4R0VA 1NKTA 3AB3A 3IXLA 4EO9A 1XDUA 5IASA 4M76B 3ZLUA 1AS0A 4UM8B 2DYKA 2XWJI 3NYRA 3OSUA 1TM7E 3AOGA 2NIPA 3IIJA 2PLWA 3MQ2A 1S96A 1ZCAA 4M83A 2W6PA 4K9DA 4CF4A 2IYNA 2QHXA 2PKYX 4W1SA 2C98A 1G8FA 3NTOA 3C3KA 1G9SA 4EX6A 4IIUA 1ZSVA 2BP7A 3KOMA 5CB0A 2BBTA 2DMRA 3BVPA 2AVDA 1WBDA 4N7BA 4ND1A 2XXAB 4W9RA 3C97A 1AG9A 1GGVA 1VMDA 1Y8RB 1EUDA 1KDZA 4P6VF 4ER3A 5JJKA 5KDLA 5F4BA 3CVYA 3H04A 4KQKA 3U3MA 3W5DA 1UF9A 4LE1A 4P34A 4JUAA 1MUUA 4HDQB 4CFZA 2OY0A 1VE9A 4YX9A 3NHBA 4RJTA 1EINA 4KFCA 2QRVA 3T1NA 3V34A 1XJQA 3H11A 3WMWA 1PFVA 3VOBA 1YOBA 2VJCA 2RGNC 4U5XA 1P45A 2C5HA 4YALA 1RPZA 4P80A 3VPDA 4ZZIA 2WU8A 3IXQA 3PPVA 3FCOA 4WXPA 2AJ8A 2JEYA 1KEEB 4UARA 3WKCA 1VL5A 2ES4A 2MSNA 4FOOA 3D8BA 4MS3A 4XX0B 4RTLA 3DMTC 3MUNA 4ZVUA 3EPKA 2GXSA 3KAQA 4B5LA 2I2XB 4UTXA 4IOKA 2FN3A 1B14A 1C0KA 3ICQB 1W59A 1Z2NX 3H4VA 2GLXA 1GTL1 2WIKA 3FJOA 1TRKA 4DA8A 3UBTA 3I9V6 3V4LA 4MVYA 3R7AA 4RTPA 2PU7A 3E4CA 4Q7JB 2P62A 5C8YB 3WQRA 1GDTA 2PRSA 1XLTA 2CJPA 5B3KA 4DR3B 4CLRA 2E82A 1H9CA 1NKVA 1EFKA 1HV8A 2VL7A 1WMDA 3IALA 4FOPA 4I55B 4DW8A 1A97A 3OQNA 4W5QA 1UFRA 2VUHB 1ADJA 1WHSA 2VCYA 1DIHA 4IW3B 2J0QA 2H00A 4RHTA 2GBGA 5CXXA 3UF0A 4Z2YA 1FFBA 4YDSA 4ZHQA 3TLXA 2XYQA 1KZGB 2WUFA 4EUNA 3CJRA 2B7CA 4GBJA 2VTDA 1MORA 1RHUA 2XGSA 3AHEA 3NBMA 3N07A 2EHJA 2H7YA 3E84A 4Y8VA 3HKCA 1PJLA 4QBGB 1YA8A 4G37A 4Q19A 5C4MA 5JHHB 4AKHA 3GT3A 3NCTA 1PNQA 4HLQB 4M7OA 1WCIB 3HCCA 1YU9A 1YS4A 3EQ2A 4HWGA 1D2HA 3A26A 4HN9A 2OB1A 4UJ3A 1ACJA 1GYPA 1VOTA 3ZGOA 1FF9A 3KEQA 3DDOA 5B64A 1Q3KA 3GQBB 2OTCA 1GQYA 3BIFA 1XA3A 2X7HA 1TLTA 4L8GA 5F2EA 4RUKA 4JBWA 1IY8A 1RPNA 1R9GA 4FFSA 2PX6A 1Z0JA 3UC9A 3CGWA 2HJSA 1Q1GA 4G01B 2V7QA 1YZYA 3SS7X 4EGAA 1C30A 3KWJA 3OEHD 4KR9A 5LOVB 3E27A 3F98A 4EY8A 4FZ5A 2ATIA 4WJLA 2J7KA 4KGVA 1RP7A 2FX2A 1BEEA 3L82B 3U80A 4D5GA 3G8CA 1R66A 3EFBA 5TPWA 3KXPA 3GLHA 4G8BA 5FTMA 2PBZA 1C81A 5IJ9A 4LJKA 5AJWA 1K8YB 2YX1A 4BASA 2BF4A 1X80A 1UBGA 2WG0A 3N2IA 5IUJC 1U8FO 1DBRA 3O6VA 3A2LA 4JU8A 4RL4A 1ZSYA 7MHTA 2BFOA 1QO9A 2AOXA 1UZMA 2IUSA 3INRA 3NEAA 3MWDB 3W4KA 2ZG6A 3WTCA 2M1XA 2IDJA 1H8HA 1DLIA 1M2JA 1P1FA 1BC5A 3G79A 3M89A 1L4LA 4O63O 4W9NC 3UAZA 4BFLA 4PNPA 1OPRA 5AHOA 5EZ5A 3DDSA 1EMDA 2DB3A 1L3IA 2V8BA 1YE3A 3V46A 1CUEA 3NM4A 4YJ3A 2PS3A 4J90A 4RU1A 1J2RA 4S2UA 5DYYA 7MDHA 5K20A 1VA4A 3OPVA 1N25A 3PNQA 2NO7A 1KNXA 3FOAA 1NVXQ 4NCJA 1JLLB 1MC1A 2XB9A 4QUEA 2DU8A 1QIJA 4YP9A 3CKMA 2JVJA 4PZCA 3M6AA 2FP4B 3WL4A 1O0BA 4IDOA 4YRTA 2RAFA 2ZWMA 1JVSA 3V8VA 4U3JA 5LZ4A 4XOIA 4PLZA 3D4OA 1F8FA 4WJZA 2HA2A 1XU7A 4EEKA 1E9AA 4JJ7A 4I4CA 1KHHA 5EIXA 3LRPA 1E6WA 1WUTA 2VRCA 4MR8B 2PMFA 1CVRA 2PSEA 2GYYA 2QQ5A 4S05A 1WOMA 4CBVA 4DIDA 2PANA 2WG1A 1GNQA 4U2BA 2WAAA 2YZ2A 1GTZA 4BRZA 2EKQA 3DNPA 2OFOA 1M1UA 3V1NA 4FC6A 1M2EA 1X15A 1ZW6A 4CMBA 1RIIA 3ASUA 2YDYA 3EXG1 4I2VA 4NX2A 4YR7A 1YR3A 1FLAA 5CITA 3P0EA 3ZDEA 1J9ZA 3LUFA 1Q15A 2DWCA 2FLWA 3WIEA 3ONWA 5JLAA 1N0WA 5CW1A 4YV1A 3PJRA 1S7GA 1RXVA 1N3IA 3UJDA 1MP0A 2XDQA 3DVLA 3JS5A 2DFPA 4BBJA 1CUDA 3MM4A 2NUAA 5DVZA 2VDVE 5BXYA 3I72A 2FY8A 3WRXC 1Z6YA 3F8TA 3MD9A 3OEEA 5CX1A 4R41A 1E0DA 2WKSA 3KHSA 1POXA 1DC6A 1R37A 3LRXA 4LKRA 4ND6A 3T7DA 2WZBA 4LOLA 2MSWA 2GD0A 2G9ZA 4HH4A 2FZKA 1CUSA 1NW7A 2WKPA 3TQQA 1NUQA 5BOSA 2RHGB 4H35A 2HBYA 4CR7A 1UBHS 2IS4A 1TD9A 2CLSA 1RJEA 3NHZA 4DV3B 4IIEA 4CLOA 1EFAA 3IFSA 4ARIA 4LNUA 1QNFA 1GGEA 2ESRA 2H1FA 1LI4A 4CM1A 1PLJA 5C2JB 3IB3A 4FNMA 3ZGVA 5B3LA 4MZXA 1UMCB 4BNFA 5LLDA 1SXJE 1PEDA 4JSTA 2HREA 4BE4A 1WULS 3IKMB 1GSHA 3G3EA 4S35A 4AD8A 3GLFE 3NWJA 4QO7A 1W52X 3KL4A 4TMZA 4Y6LA 4Z0HO 5CFLA 4ZVTA 2ST1A 3A1CA 3ZIDA 3OX2A 4Y67A 3KQWA 5J47A 4MQEB 3MWYW 4E30A 5HRCA 4UNRA 2LDBA 3UMRA 5PGMA 4IIJB 4ON9A 5D3MA 1P5FA 2J30A 4PYKA 1XL0A 3DNMA 4LYFA 1IK4A 1HC7A 5D5HA 2PD3A 4U7DA 1BCRA 1E3LA 4POAA 3T4PA 1XRLA 2AV6A 2UV8A 4NE7A 1VBFA 4ZO4A 5ALRA 5EPEA 2O8DA 1DIBA 3NJ4A 4JMPA 4BN4A 2OHFA 4ZIRB 2H5JA 1EP9A 2AJTA 5BSRA 2X9LA 4KNYA 3R3HA 4LX8A 1JNYA 1WNFA 4MVJD 2HA0A 4N0PA 5FNVF 3ZIUA 5IULC 2F8SA 1CP2A 4M4SA 3EUAA 3ISVA 4N65A 2FRDC 4MLPA 3W4JA 2ZROA 1J70A 2VQEB 4E5NA 4IXWA 3VZDA 1TTHA 1B0AA 1SCJA 2HCJB 2LCQA 4EHLA 1N33B 1G18A 2W2LD 4CLXA 1AE1A 4TKMA 2WZDA 5MGBA 2H1HA 2R6DA 2I6FA 3BE4A 2YWHA 2FPLA 2I8LA 1V0JA 2QYSA 3HKBB 3RK1A 2MWMA 2QNBA 1NX6A 1SCNE 2H2AA 3H6HA 4Y0AA 1ZVJA 2Q6OA 3I9FA 3HM9A 1MJGA 3HU5A 5B2ZA 4ANFA 4EX7A 3TGWA 4D0SA 5D85A 5UKDA 3LLSA 2QN8A 3C2QA 3FRIA 3MXTA 4W7IA 2R4UA 4M7WA 3ZWKA 2DTXA 5K99A 5J1SB 3PFIA 3EDOA 3BEDA 4MVJI 3K6KA 1POWA 1RXSA 1LH0A 3W5IA 4RPKA 2VDPB 4DNOA 2QE6A 4BQFA 1EUYA 7YASA 3KOOA 2GM3A 4X94A 1P0IA 1DJMA 3LX8A 1GL9B 4FFNA 4TKZA 2I2CA 1VHLA 1CDEA 4R4JA 2PKQP 3OO1A 4Q9HA 5IHPA 2QSUA 4NCHA 4A0QA 4BP8A 3JRNA 4A4DA 2O23A 3LKDA 3DFUA 3DOIA 5ECDA 3WLKX 1B42A 2OQIA 2E7ZA 4RD3A 1NSFA 3PFHA 5BSTA 3CNEA 1W94A 3CSUA 5IXJA 3S29A 2HHLA 5EOVA 4Q15A 3EX7C 3WBKA 4BLPA 1O95A 4C07A 1SUPA 1HM5A 1XTZA 2QLMA 4MSUA 4NHOA 2EZ8A 1OOEA 2PL5A 3BC1A 1N0IA 4UZEA 1KK3A 5CLHA 3T1YB 1YZTA 3PEVA 2J0UB 1RI2A 2Z4TA 3AB8A 4NKRA 5TDHA 3SD7A 3UC5A 4ZYYA 2WF8A 2ZB4A 3HN2A 1H2ZA 2HA4A 4LZPA 2FMTA 1ZJYA 1V71A 2BGLA 4MW9A 3SF0A 1USUA 4A03A 3FSGA 3ZBQA 5ALQA 4YRZA 4BXOA 2ZZMA 3GROA 3KYBA 3PUIA 4DV7B 4Z4FA 3E5RA 3FPEA 5DDIP 5JJLA 4TV9B 3OHPA 1FXUA 2FEKA 1GGNA 1FFAA 3RLIA 3UQYS 1U4SA 3K6SA 2BGTA 4R7TA 5AI5A 2EFCB 3R9KA 4F1WA 4EPXA 4U4AA 4FN4A 2PRIA 4F38A 1WB6A 5CFPA 1K8ZB 1TUBB 1XEXB 1PJTA 5EJ9A 4AQYB 5LJLA 4IVQA 1Z37A 5HOEA 2E1RA 2IODA 3HC7A 1H5QA 1Q92A 4XYGA 3VZCA 3NTUA 3DV0A 4M1YA 4PXYA 5ICEA 2VF4X 3A4MA 3FMVA 1N8TA 3FN4A 2GD2A 1JSZA 4Q3KA 2QSZA 4PSAA 2QTWB 4HC4A 4PG4A 4CF6A 1KXJA 3LW8A 2CLLB 1ZW1A 4I81A 2AMJA 3VR0A 4C88A 3CONA 1WD7A 1XCJA 3TMAA 4EJFA 4NU0A 3U09A 1OR8A 3LF2A 3LT0A 4GR4A 5IKXA 4U2FA 4K9PA 4MLDA 4U6QA 5FPTA 3VKUA 2M6SA 2XT6A 2H4HA 3DWGA 5JCZA 4RETA 3SYMA 5DEOA 5ALVA 1E62A 3L7IA 2PEYA 4L2IB 1VCOA 1YB2A 4MIKA 4BFSA 1K7SN 1N0VC 3IBTA 1JDBC 3LMKA 3SM3A 1E6LA 3THSA 3TIXB 7GPBA 3BMOB 4HUJA 4PV7A 3UAOA 3X2FA 3M5PA 3EVGA 4O29A 4YLYA 1V37A 3I0NA 4EDHA 5CLIA 4MNTA 1ZIXA 3BGIA 1WD5A 4RKQA 1ENYA 3FTPA 2Y92A 1T4BA 2YY5A 3AWIA 4S0XA 3QFRA 1SWVA 1PLLA 3EXHC 5I45A 1KMQA 3V42A 1TK2A 1FP4A 2IC5A 4EH1A 2IYPA 1BD3A 4DIUA 2LP4Y 2EFDB 4C2UA 3UH0A 4B6JA 3T94A 2I4LA 4G1FA 1QX3A 4NBVA 1LLCA 2YJZA 4AF6A 1U8CB 4BJ5A 3EFOA 3QLUA 2ORWA 1G20B 4BUJA 3FSRA 3OAAD 1L5OA 1WMBA 1Z15A 4BV3A 1FSGA 4JEHA 2IOFK 4CZ2A 2JFZA 2CNNA 4JEIA 1KC1A 1IEXA 5E8JA 4WNIA 1YR7A 1A8IA 2C94A 3RARA 2KI5A 3DQZA 2IH4A 1QG6A 3GVHA 1Q84A 2XR1A 4MB2A 2GVZC 5DWQA 5J1TB 3WLHA 5DO9A 6REQA 4QGAA 2KE5A 2GUGA 3BB1A 5JYDA 2W42A 1SCKA 3NBAA 4L4SA 4GUAA 5DK4A 4BTVA 4FDTA 2VC2B 4COOA 3HJRA 3VVCA 5K03A 4RGYA 3M3DA 1O5OA 4YHHB 3A27A 3EGEA 4O4JB 1G3RA 4HGRA 4U6SA 5HZHA 2QLJA 5LDHA 4N54A 3H1EA 1ZD2P 1PWHA 4JLKA 4OGLA 4AKTA 4RVUA 4FK8A 4YR9A 3R5KA 3LS2A 1BWQA 1GG5A 4UUBA 3I9MA 3WGTA 1HL7A 5JW6A 1TPYA 2IPAB 2O8EA 1HMYA 3KM0A 4OUDB 2VIIA 2B25A 2J9XB 4DIFA 1U8ZA 1XZJA 2NTYC 4ASUD 4N48A 5CA1B 1RQXA 1AUXA 2HIHA 3F7TA 3WAGA 3ANNA 2VP4A 3SF8A 5K09A 4EA7A 1S2DA 3A8TA 3ETJA 3GARA 3MCWA 3GV0A 1AZLA 2I7CA 3AWDA 5E9JA 2FPKA 3FR8A 1M10A 2RC5A 3ZTWA 2PUAA 3T3IA 1UZUA 1LNZA 4BBZA 3SOZA 5KWJA 4TL9A 5ADUS 3S2YA 1VQ1A 4PLWA 4JA2A 4LZOA 3NC0C 1N4AA 3VDMA 1JFFA 1UBSB 4C4PA 3WO1A 2DFLA 4GBED 2C2KA 4B76A 2ZGVA 4JSYA 4YMUA 2Y0CA 1IOLA 3P71T 3QELB 2WUWE 1HQYE 4L5YA 4XTRA 1CV2A 2V5AA 4WJKB 4UU1A 4EM6A 5B4VA 1VE7A 5FUVA 4ZCPA 1FJGB 2Z2YA 1JG1A 1NRJB 1VIDA 1ZD1A 3IP5A 4RQAA 5HA5A 4DUGD 2XTJA 4D8VA 4MUNA 4GKAA 4QODA 3LUJA 4RHYA 2NWQA 1MO6A 2BFBA 4YI3A 1YS2X 2GPNA 4BXOB 3PD7A 3DLIA 1EHYA 4I6JA 3IEPA 1KXZA 4P38A 4HLNA 3E58A 1I1NA 3RAJA 3JQ9A 3OCYA 4AMGA 1L5LA 2ORYA 4KO4S 4BKUA 4TTSA 1MW8X 2BMVA 2PCJA 3BZBA 3DB2A 1P2VA 1YZLA 3OTHA 4JVNA 2V8OA 3TOCA 5F2NA 1WCXA 2G40A 5KQLA 4DZRA 4MCHA 3T9FA 3E9NA 4RA6A 4UXHA 5E3IA 5I7FA 2V3CC 4FFLA 2GYWA 5BYBA 1TYBE 4JKYA 2FB9A 4GD3Q 2PUGA 4N5HX 2WC1A 2WU4A 3NJRA 1LY1A 3DBIA 1O6BA 1SELA 1SHTX 2NU6B 2YRWA 2SKEA 4YAWA 2Z1NA 5BW8A 1QRUA 3NBQA 1RYHA 1XZEA 3PPIA 3L6BA 4WCFB 1J2YA 4F9TA 3KEGA 2P6PA 4CUKA 1GPDG 5L3QA 4UDYX 3IUEA 2OHIA 3DTVB 3VPGA 3WLTA 5ELXA 3OAAA 1GRNA 1Y8QA 5AXCA 1EGAA 1F2TA 4PFJA 4TWAA 1JAZA 2W6MA 3JATB 1DUIA 1K8QA 2V7QD 2OO5A 3H2KA 2X5OA 4EVQA 1SXJB 3KTAB 4X91A 2AZDA 2DETA 3AH8A 2SKCA 1E1CB 3PHBE 5CVCA 4GVXA 3VR3A 2AOTA 5CYFA 3WL7A 1YD7A 3HWSA 4L74A 4DMMA 4MS4B 4LF8B 3OZCA 5E7JA 3SMQA 3BXOA 3U62A 1R0SA 2V6GA 5HK9A 5H8WA 4G26A 2H17A 3I01A 2Q3HA 3BHJA 2PUWA 4HP8A 4KWCA 2IXDA 3C1TA 1Q57A 1EK2A 1MPXA 2OGSA 3KELA 4W1QA 5DM70 3AUYA 3SLGA 2F3QA 2Y1CA 1AF4A 3CZMA 4R71A 2H06A 3T0GA 1JDTA 4O3FA 1SUIA 1TF2A 2B7BA 2JD0A 3RT7A 1KVQA 1Y1RA 4WWHA 4G3XA 4RJLA 1IM2A 1RLOA 4X1IB 2HKIA 1GUBA 2NYVA 1DE0A 1T9KA 1K3FA 2PXCA 1Z7GA 3SFTA 3P9ZA 2ZPTX 4P93A 1T2EA 4HMOA 1R6UA 2MSCB 1T5LA 4JUDX 1KDTA 3VMMA 3WIUA 1A9OA 1GUFA 3I76A 5DPMA 1SQSA 1NNEA 5BN5B 3IL2A 3WOHA 2JDID 1USKA 4P98A 2VBIA 1OXXK 4DQLA 3GDGA 1UC9A 1XALA 3I2HA 1PCXA 4U39A 2I65A 4KKXB 2IHJA 4IFEA 1RAGA 4WZAE 4PX3A 2IY7A 4Q3CA 1X39A 1XQ1A 2H4ZA 4LFAB 5EPUA 3NR2A 3ZZTA 1VKNA 4Y2QA 1EA5A 5L4LA 2ETVA 2XOKD 4AY5A 4HNUA 2JGNA 3LV8A 4A8PA 4DB2A 3B6IA 3FUTA 4IQ0A 3CVXA 1JEAA 3SXPA 3ZNPA 3KTFA 3H1AA 2J5XA 5LZ7A 3TEJA 1EVKA 1I7LA 1I32A 5J2TF 5CFQA 3TSAA 1NI5A 4JMLA 1NTRA 3C6KA 4LJ4A 4K86A 2OZEA 4N01A 3GGSA 3W8EA 1A9XA 1S2OA 2XRYA 3MS7A 5TEVA 1LS6A 1Q19A 4ZI7F 3Q3HA 1V47A 1U6KA 3M4ZA 1YAJA 2UAGA 2ZXUA 4WX2B 3RQIA 2AR7A 1L6IA 1M1ZA 1WP4A 1QKIA 2GNAA 2N3ZA 2OZKA 1T43A 3NDRA 3D2CA 3R7FA 3RIHA 3TSOA 4OP3A 3GPIA 5K3DA 3ROMA 2WNIA 1K63A 3G9TA 4M8SA 5DNWA 1GILA 4GYWA 2ON6A 3CN7A 3OTOB 2D5CA 1W0CA 3AUJB 2YICA 5AJHA 5BT8A 3CIFA 4FEEA 1L6RA 4RGVA 3AETA 3QLEA 3J81k 4LTDA 4MV9A 3VYWA 3UV6A 1A82A 3LQKA 3UB3A 1P5ZB 1OBOA 4WXYB 5TMDA 1RT9A 3GG9A 2OZLB 4MJLA 3O2NA 3FOZA 5IDQA 3HRKA 3K9CA 5KHAA 4CM5A 5JISA 2RGEA 2R9VA 2VHTA 3ZWXA 4B9AA 1ESDA 2DPLA 2XWSA 1D2NA 1EBBA 1FDVA 1VKJA 2A94A 5HJEA 5IVPA 1A8QA 3ETEA 4Q4AB 5JLJA 4ND2A 4QPZA 2X6TA 1W0JD 4G36A 1IC6A 4PRYA 3S5JA 3EG9B 2IQ5A 5JSQA 4YJ2A 2ANCA 3GXBA 621PA 3EGCA 2RK3A 2BJWA 5DNCA 3HV2A 2NYRA 3EODA 1EQUA 2Z9BA 4PYIA 1M73E 2V9PA 4JI5B 1NR5A 4R1OA 3KTDA 1UXJA 4L3WA 4G0WA 4BFUA 1HEIA 2VPYA 2PPVA 1ZY2A 2W2MA 4RK1A 3ZHQA 4L3VA 1F14A 4H1VA 1NASA 3SEFA 1NONA 3GEMA 4UVDA 4F12A 2VPXA 1AKYA 1Q1NA 1NBMA 1TO2E 3RFTA 4DDVA 5T4BA 3RW9A 2HWWA 3QPAA 3AR3A 1QYVA 1L5KA 1QVVA 2WJWA 4H31A 1R15A 1J7JA 2C2WA 3VH1A 4O4LB 5I4CA 1UIMA 1E94E 2AQIA 2TMKA 4PLPA 1SOAA 4A91A 3GDOA 4B33A 3PEFA 3KCNA 3OFKA 4XJVA 4YC7A 4BZWA 2JI6A 2ASVA 2II6A 4Z9FA 1IOVA 4ETNA 2I8CA 4OBXA 4TLEA 1GADO 3WGZA 1PV4A 4QRDA 3S55A 2FZGA 4Z6KA 5FPYA 3PKZA 1G2OA 2JI8A 4V3BA 2I78A 2XUFA 1UR5A 1NVTA 1YQ9A 3B53X 4JUFA 2IV2X 4L15A 2DRIA 4X60A 4YXWD 2JRCA 1ZUIA 2XE4A 1HZJA 4OI0A 4LVNA 3D6UA 3ROEA 1DAIA 4HZUA 4QEZA 2FLVA 2O8NA 2ZYDA 3F2IA 1S0UA 1QBKC 3IAHA 1SUBA 2VA8A 4ZODA 4E2XA 2B5OA 2JIMA 1FLVA 3KSZO 4EMUA 4HDNA 5L40A 2HBRA 1MQ8B 2JHCA 2A0FA 4IH1A 1DG9A 3NPAA 2YV3A 5F52A 1N4DA 4DRXB 5C32A 3OMLA 5AVOA 5JQGA 3EW7A 4X24A 1YB1A 5IW8A 2B5WA 5BV8A 3B1XA 4MQ6A 4M9RA 2QP3A 4A82A 3M4XA 5FX2A 2QG9A 3IRUA 1IJEA 3QX3A 3NNSA 4JUBA 3WBJA 4DMLA 4EQ6A 2C5FA 4TV8A 3NXSA 1WHTB 4QUAA 3EPJA 4YAOA 1FL9A 1AGNA 1RKXA 2IBMA 4ID3A 3U81A 2QI9F 3ZWMA 2X9QA 4EHKA 5E8RA 4JI0B 1GRQA 2BDUA 2YJ4A 1T8PA 5F98A 1IZ9A 5JG7A 1G55A 3KYIB 3A6DA 1T6YA 5F51A 5AUPB 2A1IA 1MFZA 3E9DA 3IAM6 4RE5A 4BNGA 1YDGA 4OFBA 3FW1A 2E4UA 4Y9DA 2ZE6A 1A9YA 1DJQA 4UREA 1JXQA 4F5DA 2ZANA 4IH9A 3PS9A 2WTNA 2H11A 4EG3A 3VNQA 2ATCA 2QUHA 3I2JA 3ZE2B 4CTMA 4OL9A 2X4GA 2PEZA 3BXZA 2R7MA 4TXJA 5IBRA 1P9OA 3D59A 1O89A 4OK6A 1QRTA 2XITA 3GGPA 3RJ9A 1UAAA 1CXZA 1N6LA 3FGOA 3L0PA 3TZQA 4KHPB 1T5HX 3RFUA 2QLTA 1AXGA 1ZVVA 2RGCA 1WDTA 4J9VA 2J0SA 2C4NA 3PX3A 4UDNA 4UEWA 4A0RA 3UCFA 4CDGA 4G9BA 3R0JA 1ORWA 1ONSA 3QM1A 2RHWA 3DM9B 3W7AA 3NV9A 4Z9BA 1M74A 4NI5A 4BIMA 4ZGWA 5K6AC 1P2BA 3JQQA 2C9MA 4TTIA 2VJLA 1ID1A 5HIMA 3UT5B 1LPSA 2BUAA 4IGEA 2PX3A 4AS3A 4MCIA 5LP6A 5FQNA 3HGMA 3ZV4A 2RGWA 2R8EA 4TZ6A 4CMAA 3LLCA 1EJ2A 1ZHFA 3PNLA 1L1QA 1RR6A 3A9SA 1V7PC 2DKOA 2WICA 1R0RE 4H60A 3TAUA 3FSEA 1CJTC 3ZV3A 4QSMA 1P39A 4UFPA 2WJGA 3JQRA 3HY6A 5AIAA 1JR3A 3AOEA 3BUSA 3VU9A 4B8WA 4DYDA 4ETIA 2BGMA 3IO3A 1EX6A 1I0ZA 3N75A 4CEHB 4M55A 3UWMA 2NPIA 1NNI1 4IIJA 3BA1A 1Z7YA 3MGGA 1IJFA 4BRUA 4UTZA 2DJ5A 3NYIA 5BSVA 3THWA 3H75A 5BQFA 2X0IA 1U5AA 1ABEA 4PHCA 2IWHA 5IDVA 1OASA 2XTMA 2VHJA 1MMFB 4FQ8A 2W90A 5H3CA 4OHXA 1O8BA 4WXEA 1JR3E 1II8A 1Z75A 1YC2A 1NI4B 2AG0A 4KXYA 5ERGB 1WEHA 3SJCA 5JEEA 5D87A 3OZVA 4DMKA 1W19A 3K5PA 5BUQA 4MV8A 4NYMQ 3S2GA 1SCBA 5C3UA 2GN0A 4MQBA 4FNGA 2UYHA 1M8KA 1Q0UA 4LHWA 5KJFA 4Q9LA 1MDBA 2VJMB 4MKFA 2IX3A 1GL6A 5I3CA 1H69A 4D96A 4D9FA 2NT4A 2EFGA 3N9IA 3PQ5A 1JLKA 2PU5A 5ALUA 1TA4A 4MO2A 2JFXA 3F74A 2P2ZA 4NCKA 3VKWA 3W2TA 5KYKA 3N8GA 4XDHA 1EAMA 3H3FA 1Q77A 3VZRA 1WG8A 3BWVA 5M2QA 4UD2A 1R6DA 3VNAA 1GTVA 2HMYB 1QYDA 1GHTA 3OA0A 3HVHA 5TMEA 1E3TA 1L7DA 5THQA 2H9AA 1NN0A 2ZSIA 2WF6A 1GD1O 3BIWA 2A4MA 4QARA 2LUOA 4LHVA 4G89A 1BA3A 2ZTVA 3WNCA 3ND8A 2Z1MA 2QRQA 3BRCA 4UBJA 5DCLA 3LIPA 3D7NA 5HF8A 4ARZA 1TEVA 3E23A 2ILVA 4AZ3B 1FRZA 1G3IA 1NLYA 4QVIA 2P75A 3Q5EA 2H2IA 1CRLA 1JI0A 5B58T 1VHWA 2BDTA 4XWTA 3TUIC 3FVQA 3LK6A 5HDBB 1Y3DE 1Z2PX 2EGGA 1T5DX 2YY6A 4C6RA 3V8BA 2YMQA 2ZUUA 3Q3VA 5KNDD 5EHIA 3VR6A 3SJ7A 1BDHA 2GAFA 1IPEA 1E6KA 4G65A 1Z26A 3GEIA 1M0WA 3T7RA 5A62A 3C6YA 5JC1A 1IWPB 2X9NA 3GJYA 3CIOA 2ZDGA 1OH7A 5KKAA 2FF7A 3NP7A 4LVCA 5BSWA 4ACBA 5EJ8A 1K6JA 1CFJA 1XBTA 3EIFA 1RRFA 4UMFA 5ALOA 3Q8MA 4RS4A 1EKXA 2WHXA 4DILA 3PEWA 4N9QA 2XE7A 4NAVA 1DELA 3HXOA 4B3XA 5BWCA 3FPBA 3QYAA 5I8PA 3MIIA 1Y4AE 1F8GA 3ZK7A 1CUCA 4L72A 1WJGA 4QXOA 1TYCA 3CB4A 1PW7A 4ZK2A 1X77A 4HWRA 1DLJA 1NNLA 2VYNA 2YHIA 5FLKA 4BL5A 2TMDA 1JMKC 4J0FA 5JEDA 4CEJA 4AI6A 3W7VA 4Y6RA 4IMPA 5FTNA 4CU2A 2XMZA 1SZDA 2FPRA 2WD9A 2XIQA 3S2FA 5KJ6A 4N76A 3R6WA 4W8OA 1THTA 1I4DD 2MDTA 3L6OO 4UZSA 3AQIA 3D0OA 4XWKA 1PUJA 5EWMA 4K6GA 2FV8A 2WJZB 3U60B 2QJWA 4LYDA 1U04A 4JB3A 4DCVA 3ZDRA 4F1JA 2WUEA 5JQGF 2C77A 1P72A 1E63A 1YS9A 3NOOA 3M5DA 5ECWA 3C98A 3UIEA 5JSZB 1TZ2A 3WE7A 1DAHA 5CBPA 3QMVA 3RUHA 4GXNA 3AV0B 1TAGA 3FG9A 5IHXA 2FZ5A 3LQ4A 1N5RA 3FF1A 5D5QA 4ZVMA 3VR1A 2BGGA 1DT5A 3DUWA 3MIZA 1J8YF 4KREA 4BVAA 5E1BA 2FPPB 1MPTA 3B3JA 3I28A 5LB4A 2D7DA 3VPXA 2HXGA 1SCQA 4P3YA 5JXIA 3L4SO 2ASEA 2VEOA 3B3QA 5EAIA 5C5DA 2ZYHA 3IOEA 3UHJA 2IYEA 5J40A 4E3ZA 2KJQA 2FZWA 5F64A 3W90A 1QHGA 1WZCA 2JKVA 1UP6A 3VI3B 4EFMA 3PUKA 1L8AA 4WNAB 5COAA 1N0HA 1C9NA 2VHYA 3QVTA 2QF7A 1RKUA 3E9MA 4MV1A 3WISA 3EULA 5K6RA 5A3RA 2QNIA 3NO4A 2R66A 5CP8A 5DSZA 1TZMA 4OHZA 4J4BA 2QQ0A 3STHA 1N3LA 1OBVA 1OFIA 2VDOB 2JJYA 4A10A 2AQHA 4JYZA 3C1OA 3KJIA 1XQVA 2FGKA 2X3YA 4RVNA 4CTOA 4E4YA 4W9MC 1U0SY 3C87A 1PP4A 2FVXA 3A9RA 1A7AA 3CKLA 2E4XA 1EFUA 3MRTA 5I5GA 2OHGA 3MJSA 2I87A 3PHIA 3TX6A 4K26A 4CFSA 5AKXA 2J9RA 2BSAA 3IBCA 4OM7A 3ZCPA 1HZZA 1QH1B 3AIMA 5G4KB 1UDWA 5KTMA 2OSBA 4KAJA 4QUKA 3PR3A 1DP4A 1FDUA 3A32A 3DE2X 4RVOA 4RBNA 3L2OB 3CW8X 1BXZA 3OU7A 1T8SA 4ZAWA 3PYLA 3OT1B 5EKUA 4YCBA 4AKGA 3WRVA 1QWOA 3L0DA 1G60A 1VMEA 3A11A 2O0JA 4GZLA 1S1MA 2OP0A 3E81A 4ZJUA 3MCZA 5G1OA 1VSTA 3MWJA 1QCZA 3VR6D 4YPOA 1J97A 1ORDA 4IFIA 5L7WA 1GZUA 1XK7A 4JC8A 3KKKA 3VO1A 2GPTA 1S1CA 5JPCA 2XY4A 2EAUA 1XELA 3BJRA 4AO8A 4CM8B 1OV4A 1OAKA 1CG6A 4ES6A 1Z2CA 1DL5A 2AL7A 3OQMA 1YB5A 4QU9A 1ZJZA 5KYYA 1NP6A 4D56A 2I3DA 3DEFA 1OVGA 1QKKA 2W2KB 3Q0TA 2R5WA 2VF5X 2VQ6A 1H6DA 4PE5B 1I2MA 4ZICA 3AK4A 4TT3A 3SFZA 1JFLA 2GCIA 3RC8A 4Q47A 7ABPA 2O7QA 3OZFA 4PVCA 4X7RA 5AJVB 3F1LA 1XJ5A 4QU5A 5G2OA 5FAKA 4I50B 5CDFE 2D3WA 1YFJA 3I34X 1GAJA 3UPTA 1JE0A 3OOYA 2LVBA 3NONA 4RIEA 1O96A 3O4VA 2D6FA 4GSKA 2EYUA 2W2QA 4Y9UA 3HM2A 1RI3A 1JHVA 3AT1A 3GEBA 3IERA 4W82A 1KR5A 1Z88A 1RWBA 2HM7A 2RKWA 3TD9A 3OLZA 4R7ZA 2HF2A 4UMVA 4E5MA 5AUQA 4EHAA 5KWEA 1JPNA 5FUBA 3IBFA 2DECA 1MT3A 1T8TA 2YQZA 5ADWA 1SUWA 1H2FA 2O2YA 2ZR7A 3EEFA 2L17A 4P84A 1I7NA 3MXOA 3O2QB 4KDFA 5ITVA 4QUGA 3ZK9A 2V0GA 5IH7A 1U7WA 1A5TA 1DVRA 1SN7A 1O94C 1V3VA 2ZSDA 4EMTA 5JMWA 1NW6A 2R5NA 3PGVA 3FMFA 3QE2A 1KZ1A 4OQQA 1CZUA 3DTTA 3VOTA 4UPVA 3LWZA 1HT2E 3COYA 4JB0A 1NF3A 4R69A 3PCTA 1E2KA 5AQ1A 2WIBA 2B37A 3Q7EA 4UQLA 3UMMA 2HCRA 1UBMS 1VECA 3GWZA 1W29A 1FTYA 2EKPA 1QSGA 3HBLA 3SX0A 3E82A 2H5IA 3RS2A 4EA9A 3M8KA 3U7JA 1SIUA 1O8CA 2RH8A 4NWIA 4Y0NA 3D31A 4HBZA 4HEQA 2VP6A 3NRBA 2B1RA 2HLNA 3CF4A 4GQIA 4DADA 3SLRA 1AHIA 3FAKA 4NBTA 3EISA 1R6TA 4GPBA 1FQOA 1JEYB 2P7HA 4H0CA 4KVGA 3GUYA 2YW9A 2ZLBA 3RHTA 3E03A 2G08A 1S3IA 3PGXA 3V6LA 1XRNA 2H16A 4P4TA 4BMZA 1J1UA 4S1VA 5HVNA 3CX4A 4XJSA 3W2GA 1M34E 4ZYLA 2D1QA 2ZE5A 2ZWVA 1P0PA 4JR2A 2D2VA 3PGMA 5LQDA 4H3SA 4BZPA 4YRGA 5TPZD 3DOJA 3HCPA 4EBBA 3S2ZA 4DUZB 4L0MA 2ZRQA 3OZSA 4UNNA 4CV3A 2R84A 1BCSA 1DO8A 5JMOA 4P5DA 4DR5B 1X8LA 3GLFB 2WM9B 4R8LA 7ADHA 3FMIA 4Q1VA 5G0WA 1KO8A 2E55A 3L6CA 1V11B 4GMXA 3RYIA 3SJZA 3PPYA 1G0OA 2CXTA 3AP2A 3MTIA 1EVJA 2Y27A 1LJ8A 2PXXA 2VPZA 1GRRA 4ISBA 1KBOA 4DXHA 1JHMA 5ALHA 1Z7EA 1BQ4A 1CULC 1R50A 2LCFA 4ALLA 6Q21A 3D5EA 1BKSB 5LXTB 1V1MB 2FWJA 3DBVO 1W6UA 5K0LA 3OCWA 2EKLA 1DXQA 4QFBA 5LDGA 2PUBA 3CH7A 4C9BA 4R98A 3RBAA 1FUUA 3IP7A 2CJWA 2ZI9A 3AIOA 3B1VA 3BCHA 3GPBA 3L4EA 3U7IA 2Q2NA 3UKJA 2HRBA 3CNHA 3JQGB 5CR9A 2CV1A 3WKEA 1PTJC 2JJQA 4U9HS 1AKEA 1X1SA 5A0FA 2NZVG 2H54A 2GCOA 1Y7TA 1BSVA 1ZRNA 2ZRMA 5DCUA 3V33A 3PTLA 4UHEA 2Z1DA 3GJ7A 3UJNA 5AOBA 5K0SA 4Q4JB 2WSSA 1UKEA 1C50A 3NBFA 4PHFA 3FAZA 3SDZA 1JR6A 4ZCSA 1P8AA 1NYRA 3DZDA 1ZN9A 3I9KA 2C95A 2ECFA 1KZ7B 3QJ5A 4DLKA 1I30A 4ECAA 3KQUA 2MR6A 3AINA 3CRVA 1JEEA 3PCXA 3R40A 2W4IA 2V6IA 3JQEA 1W6RA 4IILA 2D0DA 4G09A 3FTNA 2OCBA 3IT1A 2EDAA 3R5JA 1YJXA 1G6HA 1DRJA 3AY0A 1EEXB 1Y1LA 3QVGA 1NZDA 4O0MA 2R5FA 2NQTA 4R6WA 3TCNA 3HYCA 1Z4NA 1YVDA 1PFWA 3ZZ0A 1PUXA 3HU2A 5DIFA 1L4UA 1GCOA 3MHPA 4UUMA 4KWTA 2C88A 3IELA 1NQUA 4EELA 2C84A 3PUYA 3E9YA 4RK7A 5JFGA 3WR5A 3KAPA 3VAAA 5JBIA 2VYCA 3V3TA 1MX9A 4MVJH 3UNXA 1P29A 3KETA 3QA9A 5HP4A 1EXVA 2Y1DA 4D8XA 3PPWA 1QQ7A 3RK4A 2IKSA 4U1RA 3NGMA 5EHGA 2JI9A 1QWSA 4JC5A 1TJ5A 2P4EA 4CTJA 3RTBA 1C3EA 2REQA 3QYFA 4DY4A 4LF4B 3KJEA 1FRQA 3O03A 3U7GA 1UBEA 3CWQA 5BO5A 4XQ9A 4KV7A 1X94A 1ZRSA 5A6SA 4JUIA 2P3QA 3HUUA 4RQBA 5IKMA 3RYCB 4IV8A 4F2WA 2IHZA 3IQFA 5JZSA 5GIPE 2BKUA 1LK7A 5EL0A 4ZAXA 5FKJA 4EUSA 4ZYVA 2AG6A 2IUEA 3KV3O 2FE1A 4NECA 4W7HA 1F0PA 5CT9A 1PR5A 2X0NA 3WB9A 1J39A 5IANA 2I34A 3DGFC 1AS3A 4EDFA 1SKAA 2JGRA 4HDRB 1EDDA 2O4CA 3USES 3NM5A 2FPSA 3LJKA 2MINA 1IWOA 4PGHA 5B2EA 4OSEA 4CM3A 1Z82A 3IA2A 5DTIA 4D9MA 4B2LA 2DFNA 4UCXA 1ZK0A 2PSJA 4Q9IA 1XMPA 3NDBB 2O7RA 4MQFB 9LDBA 4R2XA 3QUAA 4FS8A 3E9ZA 1NXQA 2P2DA 2QXTA 3OPMA 2VUTA 2FKNA 2H48A 3O75A 1TT5A 2IYAA 1L0BA 4G5OA 4JLUA 2GKOA 2AQKA 1BQ3A 1SOWA 3AZOA 4ROSA 2P30A 2F1OA 4TMWA 2ZUWA 2NVOA 1JDZA 3NVMB 3PL5A 3EGDA 3UFXB 2D4HA 2EW2A 3LUHA 4WUVA 5BXQC 3C15C 3R23A 2OR3A 1DINA 3FZGA 1EVQA 1YL5A 4MR9A 1E20A 3PDWA 2VRCD 4B40A 2C2GA 3R3UA 3PQDA 3RLFA 5JDCA 3BTOA 4LJ9A 5AOCA 2FUKA 4G8JA 4EY6A 1KI8A 5BQPA 5AH0A 1PZXA 2AS0A 3KT6A 3ASVA 2ZRLA 2W70A 1BVHA 4O4LA 4RC9A 3S2SA 2CMFA 2AOUB 1GEEA 4ZA2A 4GP7A 4Y1RA 1WS6A 3B48A 2AB0A 1UXOA 3PP8A 4MXDA 4URHA 2WF5A 2CC2A 4NENB 3OBIA 5IAAA 4BO3A 5JCOC 1YRWA 3ZVRA 4FX2A 4D6PA 4ZI7A 5BNIA 1C7IA 1EFVB 4JJFA 3TKAA 1JFRA 5A4JA 3UCEA 2G8LA 2VF8A 2WWHA 4YJGB 3FF4A 4KKVA 4CMEA 4FZRA 3BHMA 5GINE 4FDMA 3DJFA 4EVSA 3DL0A 3F5DA 4KQ1A 4P3PA 4N5NA 4DA7A 2WSSD 3WGIA 4RVSA 4YRKA 2PRJA 4DSUA 3NTQA 5F7XA 1ZGCA 2HLPA 1NDUA 2Q9BA 2RE8A 5A02A 3AFMA 1XIVA 4Q37A 1T8WA 2W6NA 3IPRA 4Y2PA 1P1BA 1NULA 2QVZX 3F0TA 2G8NA 4NZOA 3SQNA 2IW3A 4TWJA 3RSSA 2VSYA 4CPDA 2QRMA 3STUA 4ZMBA 1SHUX 4YDHB 2OGUA 3ECCA 1BOOA 5HGXA 3EVNA 5IAOA 3GCZA 3LUDA 1NF9A 1NN3A 4TSFA 4E6PA 1DX9A 4LXXA 1TUEA 4ZDKA 1BQEA 3CF4G 2ZJFA 1GV0A 3ODGA 1E4OA 1YVEI 2VP5A 4JELA 3VNRA 4LY3A 2DT5A 2EXXA 2FCAA 3L4BC 4LA4A 2R6GA 4FMDF 1T91A 2HNKA 4X8OA 5C34B 2PGNA 1JEQB 1GPYA 1RXIA 3BJIC 3MQ4A 4H15A 2VXCA 3D1VA 4HNQA 4LRTB 4B43A 4Z3OA 1ZD8A 1UP4A 2EJWA 4N3CA 3K09A 4XCXA 3UOGA 1NPYA 3RIYA 4M7PA 3TR5A 3TVYA 2QTLA 5C8DA 3GOHA 2XNKA 3N0XA 4WNYA 5NLLA 2EU8A 1P2TA 1SK9A 3GYGA 1EJ6A 3GZTB 3OJXA 3ZWBA 4DVJA 5K01A 1YS1X 3N39C 4F85A 1Y3IA 2IU6A 1WUIS 1C2TA 1D6MA 1I4EB 2ORIA 3P1JA 1SVSA 1U9CA 2AZMA 3IS3A 4JBIA 4V0SA 1U7HA 3ZXYA 3D5TA 5FTJA 4B81A 3BD8A 3N2NA 4QGGA 1Q7EA 1EFPA 1L7MA 2H1CA 3FUWA 1VGQA 2CNKA 1H9AA 3I6YA 4LWPA 4DWOA 5B3JC 1FNNA 2AEFA 4NFHA 3RFXA 1BJKA 3S5UA 3SOPA 3DP9A 3OO0A 3FCXA 3R5TA 5TSDA 4MV0A 4NBSA 5TT0A 3DMRA 2ZJ4A 4LXIA 2UVDA 4FXPA 4IGFA 5JZBA 4RKYA 2BUBA 2WAMA 1Y34E 3IP6A 2LNDA 1SCDA 3LA8A 2RB4A 4KI7A 1R5NA 3MINA 1KDVA 1I9CA 1W1WA 3HWRA 5GM1A 3WZ2A 4EB6A 1ZQ9A 1DBQA 2H07A 4ZOQI 3EZFA 4JLMA 4KQWA 2D74A 3ONFA 1EHCA 2H57A 3G82C 1VHJA 3HEAA 2ZE7A 5LP6B 1U5BB 2XOXA 2CNDA 3Q88A 1BWRA 2H1RA 3TRJA 4XGRA 4FGUA 4UM9B 5KTPA 4O25A 5IAKA 1I3CA 5CT8A 1MG5A 1OY1A 2X23A 1AB5A 1KI6B 1NGSA 1BE8A 2D2FA 2OWDA 3DR3A 3TTYA 5D6OA 1H6AA 1PE0A 4MA4A 5KQPA 2WM8A 1XZIA 2Q46A 121PA 2QJFA 3IVRA 4CM4A 2G1KA 1DKOA 4NR0A 3CUUA 1AV6A 3VU9B 4RKWA 1KYVA 5BN1A 3TQSA 1WPQA 3ESQA 4YREA 1ABBA 4CEHA 1UH5A 4P1ZA 4RDHA 1SWWA 4ITVA 1VDMA 2QUKA 3ICWA 1DO2A 1Q0PA 1X70A 4ARCA 4CETA 4EHBA 4H08A 3DBLA 1C8VB 1OXUA 1V41E 1RQLA 2Z2ZA 3I53A 1F8UA 1T15A 2GVDC 4I6GA 5CYOA 4F3CA 2F90A 1MO4A 1VG0B 3FDZA 4MWCA 4DIKA 3GX1A 1NJ5A 1G5FA 1OA1A 2ERYA 2HHJA 2RJOA 4MVJP 3QHAA 1Z5WA 4PYRA 5JXWA 3A1NA 2IF2A 4IIYA 3QUBA 3UO8B 4ESHA 1D03A 4D3SA 1Q0SA 1OLSA 2J46A 4KXXA 3T35A 4EARA 3L8ZA 5GY7A 4KYTA 2ZI3A 4BX0A 2RHCA 3W06A 1JNXX 3SDBA 4EVRA 1OB5A 3K8OE 1FQKA 4K6FA 1A77A 5ICFA 3FYSA 2CXPA 2Y1KA 3K0FB 1ZA2A 3OOSA 2IL1A 4XB1A 4Y6OA 4P58A 1EDEA 2JBAB 4HGOA 1KJ8A 4YPFA 1PJBA 1C3LA 3HKCB 4FWIB 4L50A 5J4VA 3RU3A 1QVZA 4DLWA 5FP0A 1DAEA 5M7EA 3O4RA 4IDDA 4P31A 8LDHA 3GJ4A 1H6BA 1ZOLA 3IR7A 4IQFA 3HB1A 4KWIA 1DCKA 4XW2A 3CBQA 1J06A 2DQKA 2HA5A 5DW3A 3WLOA 4UHBA 4BE7B 5A9RA 1DAKA 1XMSA 2JB9A 5FWYB 5HCIA 4PICA 2OESA 2BR4A 1YL7A 4PRKA 2JIPA 5ESDA 2DQSA 4KR7A 1A5ZA 2YVQA 2ZCJA 1LWOA 3OETA 1KQNA 1F5SA 3B7PA 3I3SR 4B3IA 5JMPA 3L4JA 2A9PA 3B1KA 2BGJA 3QUSA 3M82A 1EZZA 4Q1CA 5K51A 4E6EA 3V4PB 1RDFA 1H85A 2O1SA 2Q8NA 4PLFA 1SB8A 4BO4A 1IHPA 4ZRDA 3N3BC 3AKCA 3N0TA 3OU2A 4C06A 4KBYA 2X8JB 4YRRA 4BNUA 4KL8S 1EGQA 1CSEE 3DBHA 4NY1A 3WLQA 4B6RA 1MOPA 5AVYA 2EERA 3WHKA 4Z9YA 2X9GA 4BS9A 1HFWA 3N2LA 3BCRA 5BWBA 5HQTA 4YY3B 3K2EA 3GCWA 3GXOA 1YKSA 4KFUA 4MQMA 4M98A 1ONPA 3H9UA 3NHSA 5EKSA 1YDHA 5CNKA 2NGRA 3JSXA 2H31A 3OZBA 3FMPB 3DONA 5E2AA 2DGDA 5LJIA 4N7JA 3FNBA 3BIOA 4HNAA 1IIRA 1K6XA 5E6RB 3KVOA 5B2FA 3V9AA 1HDGO 2F3SA 1ZIDA 4JLJA 3ROPA 4CVNA 1KO7A 4O4LF 4WY5A 1XZDA 4IJVA 2PWBA 3H0EA 1PNOA 3H9EO 3Q2OA 4D7AA 4ENQA 1UANA 2XMCA 2YXBA 2YHIB 1C4OA 5ETJA 3WA6A 5P21A 3ZHOA 3A6EA 3VYSB 3TLGA 1FYFA 4WFIA 2DP4E 3O9VA 3GUCA 4FLEA 1L5RA 4OP1A 1IDOA 1ZK3A 2AW3A 1OE0A 3DDNA 3UJ9A 2C82A 3S2EA 3KQNA 1YXMA 2XWBF 2I6SA 2YMLA 3SCZA 2SHKA 2BLLA 2C3UA 4CKWA 2JLAA 4RULA 3BJMA 3BA6A 2YYSA 3BL8A 4CDMA 3K7EA 3W3AD 1PZNA 5LUBA 2TECE 4ZI2A 1Q5PA 3CTPA 5JSZA 4FGSA 2PS0A 2PUVA 1GAQA 4RK5A 4BCDA 1A88A 4DCPA 4H1HA 4E2YA 4GHWA 4XVUA 3EYWA 4K8OA 1QORA 2GA9A 5CA1F 4CIAA 4Q4LA 1DOZA 1ZBQA 4LYAA 4Y9RA 3QI7A 4IYJA 4QFCA 5CYPA 1J56A 5I7WA 3EFHA 2AXQA 5REQB 1YKFA 5AXDA 1OSNA 3D8RA 2ODPA 3QNWA 4HSGA 4RVDA 2RIRA 4W5HA 4IV0A 4M89A 1R0WA 4RZQA 5CFZA 1VL1A 1Z5VA 2AJBA 2Q2WA 3O92A 4RMGA 5H83A 1H2RS 5JAIA 5J2UA 5E1OA 3PX7A 4FUQA 2FWIA 3RSQA 1Y0BA 2DTDA 4XWWA 3DOEA 5DHQA 1L7PA 1SC6A 1Y3BE 5IJAA 5LWHA 1Q1AA 1E7MA 3HGTA 3LT5A 5AT1A 2NUAB 1WW2A 4EABA 1U8TA 2BTQB 1K75A 5B12A 4W5JA 2BGNA 5G40A 3HBMA 5KCMA 4EECA 2Z3VA 1M5RA 1L3BA 1LXCA 1YIDA 2XCQA 1JPUA 1QB8A 2R48A 2ZRIA 3PICA 4BO0A 5AM2A 3QIVA 1YL6A 5ILGA 3FTEA 4Z1MD 1O4VA 3O5AA 2ZFUA 4HQOA 4DCCA 4XYBA 3L0CA 4L9RA 4Y6PA 1KZHA 2QTZA 1V45E 4MLCA 3DOHA 4FS3A 4OJMX 3TQRA 5JYBA 5I9SA 3RU9A 1WB4A 3CVJA 2QBYA 2XQVA 4UE3S 1K5HA 2Q0XA 3KEOA 5DM4A 3T9DA 4J4HA 5J59A 4PX2A 1E3IA 5T4EA 4NFYA 4ZO9A 1TECE 1Y82A 3CEAA 4HB3A 2GERA 9MHTA 1UPCA 1MZVA 3CNLA 4AIRA 2NPFA 5HUQA 5IWCA 1TAHA 3RUEA 3CRZA 1YVRA 3YASA 1E9VA 1M2OA 2WJPA 2OHXA 3QKUA 4I4TF 3CG0A 4WLEA 1TM2A 1G2IA 1ECBA 3I3OA 1H6CA 4TWBA 4DAEA 821PA 1NSTA 3PQFA 4L9WA 1NMZA 4B74A 1UEIA 5IXYA 2ZM5A 1W4LA 1ZIOA 4HRXA 3FETA 1BAPA 3JWGA 1G5IA 4DLUA 1P6UA 3JQAA 4K6OA 1PEKE 5E6SB 5ENZA 5BYAA 4JBYA 3CX3A 5KYYB 1IUOA 1RTTA 3A2NA 2G5TA 3TMKA 4DNFA 4EJ0A 1RXUA 5DRTA 3K35A 2P5SA 3IUQA 2CFIA 1W0KA 4TXLA 5IK2A 3KVNA 3OCVA 3W2FA 5BPHA 1AHPA 1CY0A 5AJTA 1T8UA 2C2BA 3DAFA 3VR2D 3D3KA 5JJIA 1E7RA 4YAKA 1E1QD 1HQCA 1F4PA 4C3VA 3IBGA 3LVFO 1ZMTA 3ORRA 1LK0A 1N7HA 1TK9A 3LTEA 2ZAOA 3LZCA 4MUJA 4F5YA 3RHFA 3RIXA 3K70C 1A9QA 5IJZA 5MN6A 2HT1A 1YOVA 4XGNA 3RJMA 1XRMA 1NV8A 1O96B 4F11A 2HWXA 2Z95A 1T4CB 3PKIA 4LJAA 2I3ZA 5ECYA 5LP6C 1ZU4A 3ZS9A 1IBKB 3FSJX 4GZMA 1AQYA 5K3BA 3DVAA 3ZWQA 1YZVA 3B2QA 1SO8A 1YK1A 2GFHA 4ZOCA 1FS6A 4E07A 4MV4A 3KLOA 3QY0A 3AY3A 3WADA 5KVAA 3RF6A 4RPIA 4LSZA 4BNTA 2BFAA 2QIPA 2LE0A 1WF3A 4H17A 1SULA 4HCJA 3L77A 3IT3A 3WI7A 1U0OC 2CNOA 3BFVA 1W48A 3HI4A 5CNMA 2C99A 3R2JA 2BH2A 2D13A 1JL3A 1JQAA 3ID6C 3SSMA 1D04A 2WWWA 1YACA 3QPBA 3UV7A 1Q95A 1RJDA 1FE8A 2B6NA 3G2MA 4HNSA 3UYLA 1WLSA 5DGCA 2WG2A 2P79A 2ZEJA 4FINA 4RGBA 4XJTA 5LB2A 1I3MA 3R6LA 3HHPA 1YDFA 4XVQA 1O87A 1OXMA 1EH5A 1NPTO 1NVVQ 2W9XA 4EP1A 1JEDA 1JBQA 1S5PA 2QTVA 1JBEA 2RHMA 1KI3A 4Z4HA 4CKCB 5KOYA 2OFPA 3PFKA 1D4FA 5JD4A 3IMEA 5A05A 1N5MA 4D8UA 1XQXA 4PTLA 1YI0A 4YAIA 3AYXB 2K7FA 4TV9A 3B6EA 2A9KA 3MT0A 4RA6B 3HKDB 5EWJA 2QLBA 1JEYA 3O2JA 2GR9A 4MVJM 1I3KA 1ZA1A 4J1SA 2Q7DA 2ZYUX 3THRA 1KVRA 1ECGA 1S9DA 4BQOA 2AKYA 4NS1A 3IAM1 5DXJA 4G23A 2JL1A 2VXBA 4P7JA 3BMNB 2V3WA 3M1IA 1KL7A 1ODLA 2V0NA 1E77A 4M0EA 2QUZA 5D01A 3VAZA 1SU8A 5DH9A 4C4XA 3AHFA 2VJBA 1M0SA 1VRCA 5CAEB 3BRQA 3DCNA 1Y8QB 4L73A 5FNVA 1BCSB 3CSDA 3FGPA 3HYRA 4BVKA 3L9XA 1Q21A 3GLFA 3E2PA 1K2WA 1O5TA 3KEMA 3L1KA 1SHZA 2O7SA 1CFZA 2JIBA 2QW1A 3Q7SA 4JLSA 3TE6A 4BJ1A 2H5LA 2BFMA 2HF8A 3EOZA 2FPGA 3M4JA 4KQCA 4LJSA 5D2CA 4ZT4A 2PA3A 3GEPA 5H81A 2AJCA 3E3MA 1PR1A 1EE9A 1QZUA 3MWKA 3Q1KA 3TQHA 4DHWA 5BR4A 1TMGE 1UOPA 1OLUA 4QXPA 4OO3A 1V1MA 2BD0A 3D3WB 3PI7A 4U7TB 4YRQA 5KAMA 4UVHA 1E0KA 2BCJQ 3D6HA 4P32A 3V8NA 2QPOA 5IH3A 2EYQA 3VAYA 4I9UA 5EE3A 4D79A 5LN1A 1GNVA 1J0EA 5D86A 3CUSA 4DA4A 5B6IA 4FR0A 3RGWS 4R2JA 4RKFA 2X7JA 1HO3A 3JWHA 4BLVA 1CUWA 4P4NA 1FP4B 4YUWA 2Q4EA 4JP8A 3UJ7A 4FTWA 2D2XA 3DAYA 5DHFA 5KNDH 5AW8A 3IQGX 4QC2A 1XK6A 4LMAA 4RHEA 4C0XA 5BN5A 4WOPA 1SCIA 1QE0A 2BGIA 5CA0F 2XUAA 1C1XB 4I4NA 1LGYA 1T1EA 3RRFA 1DDGA 1G20A 3V7UA 4WKCA 4TM7A 5EKXA 1LU9A 4E08A 1T3SA 3PUVA 4BX9A 1PQYA 3E22A 5JCJA 3DEJA 3GLKA 1PT8A 4RNCA 2GWRA 2BEKA 4KWEA 2E4YA 4NYJQ 5K8JB 3AJDA 4HD8A 1KDYA 3TDKA 3L7CA 4QUIA 1RZRD 4QYIB 2WYHA 3BRWD 3PV0A 3I9LA 3O82A 1B7GO 5CDFA 1A4IA 3FDIA 4AJPA 1HLPA 3MGAA 5LD2B 4HMPA 4LGYA 3KXIA 3SBXA 1PYGA 4O4HF 3W5UA 5CLLA 2ZYRA 3DXZA 4C6TA 5H3LA 4AM8A 4P0PB 3CZQA 3TZHA 5KIAA 2Y4OA 5JWOA 3ORQA 3QU9A 2D1RA 3TDNA 4DOMA 2AHRA 1DXOA 2Z09A 3F7NA 3PT5A 4KLNA 4BLTA 4EL0A 1KZ6A 1JHPA 2VQ3A 2QMZA 1IOWA 1L3CA 3NBYC 3E5MA 4FMCB 1T9CA 2ACWA 3I62A 1ZEMA 2OC9A 3O8RA 2AF3C 4L22A 4K3VA 1JHUA 1OGIA 1OYOA 1Q6ZA 3RUPA 1JDVA 4QL3A 3RASA 4TRNA 4DPKA 2D1TA 4OP2A 1JLHA 2A67A 3ABZA 1PYDA 4K3UA 1SK8A 2J7PA 2QGZA 5JSHA 1OGYA 2JF0A 3B3FA 4Q66C 2VN8A 2OQVA 1NZFA 1Q3TA 4B45A 4B2PA 1B8UA 1LNQA 1YVPA 3EB9A 4E32A 3JPYA 4YDQA 3UJBA 1U7ZA 2DBRA 1H2HA 3A9UA 3CZ4A 1QZZA 3LH5A 2Q3DA 3NDJA 5CNJA 1B16A 4HAIA 4DARA 2V59A 1KHTA 3EZ7A 4MYRA 4B6SA 5DX0A 3PU6A 2PT5A 5LIRA 3GLHE 1KWGA 2NZXA 2WYWA 3PE6A 3HR7A 2J4DA 3OF3A 3DPSA 3TCXB 4HUQB 3LCCA 1DTEA 5JMTA 5IT9A 3P97A 4BNZA 3MBOA 1UADA 2OAQ1 2OE2A 1Z0IA 3DE0X 1FMTA 3NTVA 1NJGA 4U63A 1ODJA 1Z0ZA 2GWHA 1HT3A 4LZAA 3U4CA 1FYEA 1YQWA 1Z7BA 1JQBA 4NNPA 4D0RA 1OT5A 1UBRS 4M1ZA 4OBEA 4NDZA 4UBNA 2B4KA 3BF8A 1N57A 2NZ2A 3BHNA 3O8NA 4UASA 1RBQA 5JY6A 3DFFA 3LG2A 3OLXA 4GI1A 1EX9A 3HZHA 3DE4X 2A1TR 2VSQA 3JU3A 1NTOA 1W5FA 4RVGA 3RHZA 3TZ6A 1UWLA 1X7GA 1YQGA 4JA0A 2DX7A 3PTZA 3WIOA 2PR2A 5I4BA 4K7JA 5TMBA 2EW1A 3L4KA 1KKLA 1NG9A 1ATIA 2BKLA 3QFSA 1N78A 3GBPA 4PG7A 5LYYA 3U4QB 5HCNA 4X6LA 1NATA 1CERA 2M6RA 4GMFA 1SBHA 4PYLA 1DU4A 3PQ7A 2D7CA 4L6IA 4BP1A 4NBUA 5L3RA 1EFLA 3GUVA 2FN9A 3UHAA 2DFDA 1B41A 4O3MA 3QBDA 4GOLD 1XDZA 3GNLA 5E4FA 2BFEA 3RVNA 2AFIB 1QFXA 4BNDB 3ZWAA 3VOAA 2XXJA 2LD4A 3VR3D 1TAQA 3EZ6A 4LF5B 3I09A 4ITUA 4KQ9A 3L6DA 4CF7A 1ULBA 1NVKA 1NYTA 3CPHA 3ZV7A 5JT1A 1E96A 3A6ZA 2OBYA 4CMCA 4BQIA 2Z30A 2RGDA 3UPDA 2XZDA 5JNSA 2IY8A 4PCAA 5FJJA 1L4GA 1JILA 5KQRA 3T3MB 1K6EA 1X1TA 3BWYA 3KLNA 4P33A 3BXHA 4QOGA 3AUSA 3INGA 3QQ5A 2WM2A 4ZYZA 1ZD4A 2BTOA 1W46A 4JASB 2BOVA 4UNQA 4EJ2A 3LYHA 1Q91A 1U9IC 3A6HA 5HG0A 4PS1A 1L9XA 1T2NA 1PGPA 1B1CA 1XTPA 3ZDFA 3STWA 4X6XA 1YFKA 5CEJA 5HX7A 1E0SA 5GPBA 4RZUA 3GRFA 3DFIA 3HMQA 4PZ9A 1QCCA 4RHUA 4ZV7A 3EGOA 3MT9A 5KNDA 1JHQA 4OVKA 3M3HA 2ZREA 5AKGA 3CCFA 2DR0A 3C8ZA 4ISCA 3FFXA 4IY1A 3W77A 2ZVJA 3CF0A 3KWMA 1Y5LA 2WE8A 3GH3A 3G2IA 4PTYA 1YTUA 3ZHBA 3SYLA 1E79D 1JSLA 3A4NA 2V7TA 5JXHA 4LYYA 4PBSA 2RCNA 2VA9A 3NVAA 1H65A 1VJDA 3OOJA 1FC0A 3QX7A 4FKBA 2E0IA 4RPJA 5TEWA 3SGLA 4UKDA 5MDHA 2P6RA 1P4SA 5TQJA 3UYKA 4AO7A 1XZCA 2RGBA 1KO4A 2WQZA 3AEZA 2J6HA 4GX2A 1QG4A 1SKUA 1YR1A 2J8ZA 3I6QA 4OYRA 3UMJA 4PG8A 4QYXA 1V5GA 4IEIA 5LXTF 5ICCA 3FTFA 2BJHA 1P4AA 3KJHA 3AHHA 4DQVA 3TF5A 4F2GA 5LQSA 2NV6A 1EFRD 4QLAA 2GEFA 4XA8A 1C7RA 4PC2A 1T1JA 4U02A 4A2CA 2PE5A 4MRPA 2OM2A 1GP2A 1KKUA 2HWKA 1X1RA 3ICPA 5F78A 2CKMA 2VQDA 1IFXA 3WA7A 2WMYA 5K8TA 1L1FA 4Q3OA 4JXJA 2BE7A 5JSYA 2W93A 4BLWA 1MAUA 1DGQA 1QH8A 2ZUTA 2DSTA 2ZUBA 5A5VA 2DLNA 4YACA 2P4UA 3B9QA 3WS7A 1B6GA 3GVIA 1TA0A 2RGRA 5AWFC 5EP1A 3ZBTA 1ONOA 3FTCA 4HV4A 5J43A 4FIZA 4GNKA 1HYBA 4MPRA 4XX0A 1CRWG 4HN2A 3O4FA 2BWJA 1MA0A 5AO9A 1YJ5A 2FPIA 2R60A 4GS5A 3ICOA 3BTVA 3HVJA 5G1PA 2PGJA 3PUZA 5I9BA 4WY2A 3BGOS 2WJJA 1WQ4A 2V7EA 1A72A 2A14A 1GA6A 3Q6MA 4QGFA 1E9CA 2VRWA 4U6NA 1Z2OX 2PZEA 1QGUA 2N1MA 2Q3JA 1SD5A 2VJAA 3DZKA 1LDGA 2SICE 4W5RA 1TQ6A 3EIEA 3F3KA 4O2RA 2J4CA 2FX3A 3EGXA 5G53C 2DH6A 1KC3A 4YBRA 3UPUA 2O1EA 1VBNA 1FUEA 2X5JO 3IUYA 1TJYA 3Q40A 3SU8A 1M8JA 1NJFA 3L0SA 4S0ZA 4OMCA 1E58A 1QR2A 4KX3A 1SBTA 1FK8A 4WGGA 3ICVA 1SCAA 5CIWA 2POCA 2OXIA 3A3YA 1M2VB 3X1XA 3U7RA 5B1HA 1YA6A 3GRVA 3LT1A 4HEA1 1ESZA 1B3RA 1DWOA 2DPXA 1M34B 1QP4A 2PGLA 3A1FA 3TINA 2JG3A 2PZJA 4ZEXA 2X13A 4UVGA 4C3UA 2PBFA 2AIRA 5TVGA 1XCGB 1XVAA 4Y7DA 3VTAA 1BROA 1KOLA 4EUHA 1N1GA 1IN6A 1IY9A 3CLVA 2O6HA 3DS8A 1L8XA 4FGKA 2E85A 4IJKA 2PJDA 1D1PA 3SVZA 4HFMA 2VF2A 2KW5A 3TCKA 1Y6RA 3IRVA 3UUGA 4HQ6A 4F3RA 1SBCA 1SXHA 1T2DA 3WWYA 3B1JA 1ORRA 2Z6AA 2G76A 2H7CA 3DVRX 5F5NA 2GPYA 3T3NA 2GQ0A 3JQAD 2FEPA 2J67A 3JWPA 4ARZB 4QJBA 3NTXA 2PMWB 2R6R1 1WCYA 1W4ZA 2WFLB 5F7ZA 5LP1A 2O9JA 1XMVA 3T9CA 1D07A 3DULA 3BREA 3LCMA 4BGIA 5A5DA 1LVHA 1S6YA 1YCGA 5BQOA 3VC1A 5IJ9B 2C8KA 1QQAA 2NP6A 1F3LA 5FO1A 5GOTA 2F1IA 1X92A 1GZVA 3HCNA 2P9ZA 2O2SA 2CL5A 3BORA 4ZCLA 3FYUC 2JAOA 3KSUA 2IHKA 2HJVA 2FW1A 1C9MA 2WSLA 3OJLA 3K0AB 5DBIA 3J7AC 1E2BA 4QOJA 3KVRA 2Y1EA 1JWBB 1Y7LA 3HCBA 4DLSA 4TL7A 4CR6A 3WLPA 3FBGA 3GAMA 4H16A 1CB0A 1EFRA 1BHO1 3OZIA 1U99A 1FFSA 2EP8A 1JG2A 4XVRA 3WGJA 2HH9A 2WP0A 5JRDS 1H4VB 2J41A 1D2RA 1ETUA 4ZEMA 2L2QA 4F91B 3DEYX 2PZBA 3A06A 3FLMA 3V4OA 3LHIA 1JG6A 2H85A 5FUQA 4FFBB 1TU4A 4HNHA 4OA5A 3RUCA 4MR7B 2C0PA 2X19A 5I7UA 2Q0QA 1PF7E 5EZSA 1FMCA 4R1PA 1H8ED 4E46A 2IFTA 2G83A 2CDCA 3CVOA 3PHHA 2QTTA 3ILHA 4M22A 4AW9A 4G4SP 1URPA 3TGLA 1SY7A 3N2KB 2CNBA 2FN4A 3NB0A 5DM2A 5J5VA 2P6MA 5AUOB 1M6EX 1U31A 2RARA 4DREA 4DUGA 1F60A 4REQB 3RAFC 3V1KA 4LZWA 5WRFA 1GTMA 3T0FA 3ZH2A 2V7BA 5TQ0B 4LC1A 3OF5A 1H3EA 2AFRA 4F9EA 4AJHA 2YVAA 1QHNA 3UGJA 4QKQA 5BV2P 1FUYB 4QDTA 3KWFA 2Q3FA 1RYBA 2OZVA 2CF5A 2IQIA 2N9UA 3QBEA 4IDBA 1ZGJA 3Q8XB 4AYTA 5JRZA 4KSBA 1IQRA 3ZZNA 1ZWLA 1E7SA 1JU3A 4RD0A 5FTKA 1IBRA 2I76A 2XUJA 1D8TA 1R5JA 4ZZ1A 1QPBA 3OEED 2VTEA 1YCDA 1WTCA 4ARAA 2F43B 4RZ3A 3FUVA 2WAXA 1G20E 2Q9CA 2WKRA 4IHKA 2IU0A 1PHRA 4BPRA 2ATEA 3OT4A 5J4HA 2C7VA 2QX4A 4UTNA 1ZAYA 5M34A 1SXJD 1PL7A 2DQYA 1QLHA 5CPBA 2I9KA 1V8PA 3T7SA 4M9ZA 1HYHA 4ARVA 3QBVA 2C78A 3IV6A 2ZBDA 1RQ7A 2GARA 2VHXA 2GEKA 3PX2A 3TVDA 3DWIA 1UBLS 3FRJA 1JVBA 1QHSA 3BD7A 3OE4A 2B9VA 3ADDA 1EGMB 1Z4LA 3DYBA 3O90A 1W9HA 1XRQA 1CY8A 1T0HB 4J7CA 4EJMA 3NLLA 1S4QA 2ZTLA 4AT1A 2AI3A 1KEKA 1H2EA 4U2EA 2B5VA 4U2CA 4Q7QA 2GK3A 3B52X 4C5BA 1VLHA 3FHLA 2QGFA 5HWSA 1EVYA 1Q17A 3KQSA 1HT0A 3T5BA 3WGVA 3G02A 2AUMA 1IVYA 3CT6A 3MTQA 4K9MA 4INZA 4NPCA 2BY4A 2R79A 5EUBA 5K0GA 4LZZA 2J3JA 3IQWA 3MOGA 3ZW9A 3WZMA 2ZR8A 3MTGA 3QLVA 4M9UA 4I08A 5CDHA 4GMGA 5FV7A 5TF0A 3ZHUA 1MNAA 4A6DA 2ZYTX 3DBRB 1XQ6A 4EPYA 2L18A 1QJ4A 1FP1D 2YN0A 4QSHA 2FG7C 3CR7A 3KBOA 3WV5A 4C0KA 4D9CA 1VCMA 3M2TA 5L8VA 3THYA 4LGCA 1C0LA 2EX4A 4G81A 2CB0A 2VJMA 4XOUA 3AJRA 3MJ4A 3X2EA 1W88B 2UXBB 1LZLA 2ZRFA 3AF5A 3BQ9A 4FM9A 1GPH1 2ODNA 2R6HA 3LDGA 4XSGA 4C05A 1SAYA 2H65A 1OMOA 5CK5A 2W2KA 1W5BA 4EENA 3AI3A 2RGYA 4RM3A 2VHVA 3EASA 3IMFA 4AQ7A 3EXIB 3WGOA 2OMKA 1KJZA 1UT6A 2ENUA 3DD5A 3H97A 1Q0LA 3AYZB 4UULA 3EC1A 2GJ9A 1C1HA 1F9EA 2WTXA 1JR2A 3GCGA 1M1YA 1YR8A 3KD2A 4KK4A 5DHPA 1XHEA 5I7AA 1U6JA 5ALIA 3R3YA 3T7IA 1SEPA 4EHIA 4YCLA 1P0FA 2ECQA 2C4WA 1L4HA 3QE9Y 2FOIA 2B4QA 2FRVA 4OEHA 3ZXIA 1SKQA 3KPYA 1TLFA 2IOQA 4OKIA 1ADCA 3ZWVA 5BSEA 5I4KA 1NR7A 4UTPA 1CIPA 5HKBA 1GLVA 4OFWA 1WB9A 5A06A 1I6MA 3ZUPA 4IIFA 1KYIA 3FWNA 2GZ1A 1M1YE 2JHAA 3OY2A 3IIIA 2Y1GA 3L5OA 4Z99A 2PUCA 5U1PA 1ZH4A 3WNDA 4TYWA 1ZESA 1W25A 1Z29A 3RJTA 2N42A 1BIFA 3B7GA 2ATXA 3EBLA 3NHFA 4GWLA 4V24A 2XUHA 1VFPA 4L8YA 1D2EA 4F6LA 4NDAA 5M3BA 2YKGA 2DBVO 4YP7A 2J7PD 5FWDA 5K3FA 3OQOA 1MEOA 3R7SA 3T95A 2QX9A 5ED4A 4H9GA 5TR9A 3SJUA 3KPUA 2BM8A 4RH1A 2P69A 2RKOA 4E09A 5IU6A 3N2YA 3I04M 4KVAA 1DBVO 4IRMA 5KWIA 2E5LB 2FQQA 4ZU6X 4XQ0A 1PDWA 2A88A 3HKDA 3I9JA 3KJFA 5T41A 3WQQA 1MRZA 1XLTC 4I8DA 4BWGA 1YS6A 2J0EA 1UAGA 3EF3A 4D45A 3PG5A 3ANYB 3KRTA 1R6BX 1P1CA 1OREA 5BSMA 1PUIA 2V7UA 2JW5A 4AVYA 2A57A 5JO0A 4NEHB 2HIMA 1EIWA 3M2PA 1DWUA 3L0YA 4DLAA 4O4IB 4RANA 3P4XA 4DIOA 4WKPA 1NUUA 3O8LA 3KJNA 5EQDA 4O2BF 2W8BA 5AYVA 1CJBA 1UBFA 1XWFA 2EDCA 4G0OA 1P7PA 5LA6A 3QHPA 1U3VA 3K9QO 3UWOA 5AM5A 1G4UR 1P2SA 2AMVA 5A03A 2Z57A 1R7RA 3UM9A 4ZYWA 1GPLA 1J8QA 1XEFA 3KVVA 2Y77A 1EG7A 4K46A 1L8QA 5EJ2A 2VJDA 1GYQA 2QTBA 1EK1A 4PAWA 1NVBA 5G4LA 2QT0A 3TLAA 3PLNA 2ZJ3A 4AB1A 1RCUA 1ZJ6A 2O0HA 3KSRA 3K96A 1OLUB 4YRDA 5HIJA 2AF4C 3RYFB 1JQKA 1MRSA 1PFUA 3QEOA 4TTAA 1L7EA 1LJLA 1R4MB 2ZRBA 3T5CA 3U13A 4EKDA 4F4CA 1S2MA 1YA4A 2WPDD 1IQPA 2QW8A 4QOEA 1R3DA 1QXSA 3K0KA 2R65A 1VJ5A 2DPMA 4S24A 4A8JA 1JALA 1QHYA 4L2IA 4YT8A 5AESA 4WNAA 4MK4A 2AOVA 4ODIA 4PLGA 1LB1B 4GP9A 3AG5A 5DHRA 3WLNA 2P2LA 1Z63A 4OQEA 4YBZA 5C1OA 5IF9A 2HMAA 3EG5A 1CS0B 3M6IA 3VHQA 3VV2A 4CIBA 3H0KA 1SD2A 3KIPA 3QXCA 2C42A 3S2IA 5E4YA 4HGZA 5F2OA 3UT6A 5B1SA 1MB3A 1OIXA 5SYAA 1CK4A 2LTAA 1YJQA 3VOSA 1Q7RA 4B34A 2PXHA 4E22A 4Q4HB 3Q3EA 4B17A 3V8MA 2E4VA 2JGEA 1NLZA 4LOAA 3RSHA 2BZ1A 4DNXA