1YJXA

Crystal structure of human b type phosphoglycerate mutase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
b'AAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycerate mutase 1
publication title Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase, hydrolase
total genus 79
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1yjxA00
2EKZA 2P30A 4MA4A 3E9EA 4GPZA 3BIFA 4PGMA 2EKBA 3QPWA 2H52A 1DKLA 3NFYA 1NT4A 2HPAA 3C7TA 4PZAA 5CDHA 1SKBA 1UJCA 1C81A 2GFIA 2H4ZA 2P6OA 2OWDA 4HBZA 1UJBA 1QHFA 5AJWA 4D4KA 4AROA 2BIFA 1V7QA 3HJGA 3PGMA 1T8PA 2AXNA 4D4JA 5CU7A 2WU0A 4ODIA 2QNIA 1TIPA 4JOBA 1FBTA 4GPIB 1BIFA 2P78A 1FZTA 2ENWA 2HIAA 2P2YA 4FDUA 4D4MA 4EO9A 1C80A 3QPUA 4JOCA 1SK8A 4ARUA 1YJXA 3GP5A 3IT2A 2IKQA 3F3KA 3LL4A 4EMBA 5PGMA 3MXOA 1ND6A 1DKPA 1RPTA 1IHPA 2RFLA 2P9YA 4IJ5A 3KKKA 1BQ4A 4D4LA 3D4IA 1XQ9A 1EBBA 1V37A 3E9DA 2P2ZA 4E3WA 5AK0A 3EOZA 2H4XA 4ARSA 5HR5A 4QIHA 5AJYA 3K4QA 2A9JA 4IJ6A 2P9FA 2WNIA 1QFXA 3FDZB 5AJXA 3F2IA 1RPAA 2P77A 3D6AA 2YN0A 2OWEA 3DB1A 3QPVA 3FJYA 1E59A 3LG2A 1QWOA 2P6MA 1CVIA 3FDZA 4TSRA 2P79A 3K4PA 3ZHCA 2P75A 3IT3A 1K6MA 1E58A 3O0TA 1SKAA 2HHJA 4JODA 3GW8A 1BQ3A 3IT0A 1YFKA 3GP3A 2EOAA 2YN2A 1H2FA 3D8HA 2DWOA 3OI7A 1DKOA 2PA0A 2I1VB 2DWPA 2P9ZA 3DCYA 1DKNA 3R7AA 1ND5A 3IT1A 4PZ9A 1SK9A 1DKQA 5HTKA 4ARVA 1C7ZA 5CX4A 2WNHA 1DKMA 3NTLA 1H2EA 1RIIA 3LNTA 3MBKA 3EZNA 2F90A 5AJVB 3E9CA 5AJZA 2H0QA 2A6PA 4FDTA 2ENUA
chains in the Genus database with same CATH superfamily
1J0BA 3UW1A 3DTNA 3G0OA 2OHXA 1B2RA 1OV6A 1Y1LA 1IJEA 1UKBA 4ER7A 4G0UA 4OATA 4AJ9A 1C2TA 2AA3A 1NJ1A 3GEDA 4PZAA 4EWLA 3EXEA 2FWIA 3JWHA 1DB3A 4F93B 2XCSB 1PQWA 5CW2A 2BKAA 4OI2A 3BSWA 1BH2A 4E33A 4HQ6A 1QORA 4MLCA 3EVBA 2AE1A 2FN7A 4EB6A 4G9GA 1QC5A 1T5DX 3FI0A 4X66B 5CDUA 3KD3A 1NQXA 1BHJA 3TFOA 4PNHA 1T2EA 1K7SN 5ALKA 2WA1A 4DL9A 1NUSA 3KOUA 3GPLA 5CYGA 2CJWA 2ICAA 1E2QA 4RQUA 4FCTA 3PRHA 3EXIB 2OC9A 2EZ9A 2XF8A 2ZSUA 3OZRA 1KK0A 3MT9A 2ZBRA 4R1QA 1VMEA 4UXJA 3QIVA 4J0HA 3O5AA 3L7NA 5TQVA 2GZAA 1KSJA 3ESBA 2YN4A 2E3JA 3OY2A 5A5GA 2XA2A 4TUYF 4GGPA 3FBTA 5IJXA 3ZVRA 3A37A 1K7YA 2IBMA 1Q15A 5LQKA 1R6VA 1Y4DE 4IHAA 1HKHA 5EJMA 3V2HA 2JLBA 3FWYA 4PLWA 3UK7A 5MFZA 3EPPA 1Q3HA 1RI1A 1OFUX 1WXWA 1I6LA 1Z6PA 3ONDA 1GR0A 1YRYE 4TTAA 1EWTA 2AG0A 1XVAA 2JIMA 4KH1A 5TQ0A 3URKA 4MPPA 4Q47A 2J3LA 2J8ZA 4HYTA 1Q57A 4JLPA 1YTUA 2ODWA 5FWXB 1EUDB 2HA2A 4J0GA 4MCIA 1WABA 5CX1B 3UGJA 1Z5OA 3H5NA 1DG9A 1YVUA 4I0WB 3ZZTA 4BZXA 4HNTA 1JUDA 2BUCA 2CYAA 2TECE 3LSYA 1CE8B 2CXNA 4RVCA 5EPEA 1XFAA 3PCRB 3ANSA 2H11A 2NO7A 1ECJA 3AGQA 3KSMA 3NEPX 4K9SA 1MRNA 1ZSVA 3HR8A 3JQ7B 4A6PA 4W5JA 3EWIA 3CUTA 4CV3A 1IUKA 3MTBA 2IHVA 4KQFA 2CW5A 3HA5A 4AURA 2EJVA 3Q0TA 3PXGA 4RABA 1NJ2A 1VMAA 2GD0A 3A25A 3D7NA 3ELYA 4KL8S 4WINA 3GARA 3TVDA 4WCDA 2XKKA 3NCHA 2FSIA 4CEHB 3NMUF 1ZJZA 3M2TA 5BMVF 4EVIA 2UU9B 1IXKA 4TS9A 2O3QA 1W76A 5T67A 3V4PB 4OMDA 1UAAA 5BW5A 1OZAA 3P45A 1WPRA 2RH8A 4MRMB 5EHIA 3B7PA 3HDQA 4GYYA 2Y93A 4J1QA 4JAVC 3NHMA 4JBXA 3PHGA 4PCAA 2IX9A 4AP9A 3WBJA 2BR4A 1EX9A 1TFUA 4S04A 3O3MB 3DR3A 1UJ2A 1WLYA 2XDQA 4R41A 3PGXA 1E2KA 2EX0A 1IOZA 2CLKB 3VU9A 1L3CA 2W2LA 2FPIA 5G3ZA 4Q1DA 3PFNA 2OBXA 4QUGA 4DPMA 1N1GA 4Z4EA 1NBOA 2ZSAA 4PZYA 5AICA 2WWVD 4CM9A 3OQPA 1JFVA 4B6SA 3Q4GA 1TIKA 4ZYXA 3R2JA 1UBEA 2K2WA 2Q2QA 3SZUA 2EEPA 1DRJA 1Q17A 4CM3A 3ZLVA 3OZFA 4KQXA 1BXRA 4W1PA 5ALOA 3SGLA 3BBLA 1K1EA 2WKWA 2Z58A 4RKRA 3SQNA 1YFZA 2ZJYA 4FIZA 3ZHOA 5DHRA 3C3EA 4YP7A 2P68A 3U1BA 2G9RA 2CCJA 5DV9A 1BA2A 3HRKA 4ZMRA 1CF9A 1Z08A 1Z8DA 4XQ0A 2OWDA 3SBOA 1AK1A 2BGUA 4E88A 1R74A 3UV6A 1U65A 1KMHB 5A3JA 1SBYA 3Q0IA 4PQYA 1EVJA 1DRUA 5ALJA 5KOJB 3K0AB 1PJ8A 3FM9A 3BH6A 3U4IA 1Q16A 4UHFA 4WNIA 4D4JA 4QD3A 4EY5A 3CLSC 4UCXA 3B82A 5KOIA 4I9GA 4XPIB 3UPUA 3BJZA 3P97A 4R69A 3QXJA 5LOVA 2GLXA 3D6FA 2F3QA 4Q6WA 3ENQA 2DYKA 4FGLA 5CFNA 2N1MA 2QDXA 4U2DA 1EJ2A 3RHSA 3QEAZ 5A2QA 4HDRA 4OGKA 5H5JA 1SOAA 3FTCA 1ODSA 4R05A 1UXKA 4AY3A 4E30A 1CR6A 2HREA 3VH1A 5H68A 4E0BA 5TSDA 2G7ZA 3D3QA 3L6CA 4Z9XA 4DNQA 2PSSA 3OD5A 5CHEA 4FR2A 4BQSA 5ARDA 5LXTF 1GUFA 4DG9A 2LXNA 3NDJA 4CF4A 1LQ2A 3RVNA 4GECA 1ISFA 4PYRA 2I78A 3R4VA 1NIPA 1YNOA 3BWXA 4H7EA 1XLWA 3B3GA 2PLNA 1B2LA 4FZRA 4WOPA 2HSJA 3EGOA 1Q7CA 1XL0A 3UA3A 4C87A 2PXHA 4D57A 4RTJA 2RB4A 2HA3A 4BWFB 1VOTA 4NLLA 4UKDA 1DDOA 2X5NA 4MS3B 1YI1A 4ZYZA 1G3QA 3GZTB 4JC4A 4HAIA 1VPVA 1TX4B 3VR6H 5GIOE 2QBYA 1IQUA 3G8AA 1USGA 1PDOA 1R6BX 1XVIA 2IHYA 3EWNA 3NI2A 3SYMA 3I1FA 2XUIA 4RY0A 5I9NA 2FSHA 2C7PA 4M0UA 2AOXA 4QYSA 1HE3A 1SHTX 1FU4A 4EHAA 1VHLA 5TF0A 1AH2A 5D84A 3L06A 1FNDA 3V6MA 3ZJYA 1O5OA 1XTTA 1X1SA 3HWRA 2WSLA 5IJAA 3KTFA 3G1TA 4Q00A 2HWYA 2BP7B 4G0OA 4QPCA 3CRQA 2WHQA 1NNI1 5ILGA 4XRRA 1QKJA 4IG9A 1Z22A 2F4NA 5LB2A 1COWD 3VPFA 2WWHA 1S89A 4MTCA 2C82A 5B7NA 1MABA 1NY5A 2PX2A 1Y4AE 5LUAA 2O0JA 2Q9CA 4DA8A 3MZ0A 2DPHA 4ZHSA 1P6UA 4BKOA 3OPYA 4UEQA 3QVTA 2FW6A 2GEBA 5IDVA 2PL1A 3V8VA 5EJ2A 3JPWA 1XAHA 2IIQA 1GOTA 2Y3IA 4G5XA 4J75A 4X3CA 1JQ3A 4XD2A 3S2UA 4YR9A 5E4JA 2DM6A 2EV9A 3O8CA 2PMKA 3TE6A 1ODCA 3VNUA 2XIQA 1PFYA 1S3GA 1MAUA 2OBYA 1RLOA 3Q7QA 4KSBA 3ET4A 4ICIA 5I7SA 2PUHA 3L3BA 3P2KA 4OJQA 3WWPA 5JATA 3WGYA 1K5DA 1U2GC 2H1LA 1KH3A 1WB6A 3VBCA 1T6NA 1Y7PA 1JWLA 1OTXA 2DLDA 3L4BC 2O52A 2HRQA 4H6WA 4YRCA 2IYSA 4HS4A 2FZVA 3IVRA 1M75A 2GRAA 1VHTA 3DEIA 3E58A 3TQTA 3UWKA 4EA7A 5FWYA 1UK7A 3USES 4HUTA 3QKSB 4MVJE 5AT1A 2L17A 3PC7A 4RA9B 3UB2A 4DCVA 3U81A 1Y9AA 3T4UA 2Z8XA 4UDNA 3IRUA 2PUCA 2A0FA 1LQTA 4DZZA 5HK9A 1A9QA 3MYYA 4U2KA 3N2KA 2J46A 2BZSA 5CLFA 1OGYA 1SUSA 3LV8A 3M6LA 1DDIA 4X7PA 3S2SA 3I9JA 4MV7A 1PFKA 3UMGA 4ZJUA 4W5OA 2BMJA 1YB6A 4H4EA 3IURA 3ZI4A 3FUWA 2ENWA 3FWZA 3CZ9A 2ZUVA 3NBXX 1NYTA 2XH8A 2YHAA 3WBFA 4BMPB 1M1UA 2WJ3A 1AM4D 4BN0A 4YAOA 5JE8A 4Z9BA 1GDHA 4MUHA 3BM5A 2RGNC 3FTEA 1M6VB 2WU4A 1XQXA 3O8QB 1EE2A 1KORA 4L73A 3S2FA 5JBQA 5JMTA 3B6JA 4ZC1A 4R7GA 1B8OA 5EJIA 1XC7A 1X74A 2YXLA 5KDDA 1N2GA 1D6MA 3SKYA 1Q84A 1JKFA 3B51X 3G6KA 1GU1A 2X7HA 4NZOA 4NY1A 4BNVA 1TQ8A 5HUQA 3KETA 3CVXA 3FPSA 1SWVA 1UJ4A 3DDNA 3WLMA 1GLNA 5DX0A 4QX6A 3AERB 1NR1A 1T36A 5DTMA 1GUBA 3NO4A 1JSRA 4YRTA 1AF4A 3TLBA 4RANA 4WIAA 3K72B 1CZNA 1ZMBA 1IDN1 1P29A 3TDNA 3VTFA 1CRWG 2XA1A 4LWOA 3SU8A 4KXYA 3PDIB 1JDUA 4YMTA 2VWHA 3GB9A 3GLTA 3KM0A 1KEEA 4I99A 4C22A 2A9JA 2P90A 3I53A 1JIIA 1R6UA 3GLQA 4N5IX 3RV3A 1VLQA 5IHPA 4AJHA 3JTEA 3JQGB 3VU8A 1BS1A 1RPAA 1YCDA 1KR5A 1YNSA 3NBKA 4L3VA 4OV6B 5TQJA 5JJLA 1JR2A 3OCZA 5JC1A 3U31A 3WL8A 2FA9A 3N58A 1TM2A 2AJTA 4FT2A 4M1OA 3CR8A 5F4ZA 3Q3HA 1W581 4LXUA 3NM4A 3U3JA 4LEIA 4M87A 3DAGA 3TDMA 3P8ZA 3ETGA 1KZ1A 5BMVB 4TLDA 3AR2A 4JJ4A 1GGMA 4MS1B 5FDFA 1MO4A 5G2OA 3E27A 2ZFUA 3HEBA 3GT3A 2DRIA 5JJBA 5T6MA 2R3SA 4HXYA 1KWGA 2V9PA 5C7OO 3SQMA 1UCFA 1QOPB 1PWZA 2X9QA 1TKBA 4E94A 1QKKA 3GNTA 3T1TA 4O2BA 1MOQA 3OIGA 1W85A 1XPJA 4OF4A 4BFZA 2ZIVB 4YXWD 3FWHA 1UMCA 2HU5A 4WZ6A 1ZH6A 4FNOA 5F1OA 2E4XA 3DFMA 1DO8A 1IC6A 3AU9A 3N0RA 1N6LA 1UDAA 2H85A 2QRMA 3Q72A 4ND8B 2VTEA 2CF5A 2XJ9A 4UZEA 4XX1A 4KR0A 5KSPA 4C43A 1CY1A 2J3IA 5LJLA 1VG8A 3T38A 3KUUA 4KITB 3CJQA 1NLZA 5B36A 1EGQA 4MQEB 4X1KB 1CQWA 1BYUA 1TLTA 4MWBA 2WWFA 4H3HB 2GZRA 4EJSB 5ECYA 1JPNA 2P65A 3TN7A 3N7AA 1MEOA 3REFA 4AP6A 1QZXA 5JS8A 4DIUA 4JVOA 3V7WA 2ZVJA 4LF8B 4KE6A 2QG9A 3P32A 1KVSA 3EFOA 4DCNA 4ZZ0A 3T1YB 1PL7A 2PCJA 3EH1A 2B92A 4IVNA 3WYDA 4EGQA 4Q93A 1FVOA 4XQGA 1F4LA 5NLLA 3UG7A 3MS7A 3P9RA 1GV0A 1DADA 4B8YA 2BHSA 1BQEA 1ZIXA 2WFLA 1GNRA 1Z7WA 3A1NA 2JARA 3CT6A 3EYWA 4IJUA 2QN6A 5JSKA 4LVCA 4C29A 1OUMA 1SZJG 2YV2A 3U7JA 3A1WA 3BTVA 3QMVA 2G0AA 5IJ0B 3S5JA 4A92A 1N6IA 3KAJA 2FWAA 3C3XA 4W9MC 2FPSA 3QEOA 3GLHE 3NU1A 2GLUA 6YASA 4A2QA 4L22A 4ZO6A 4JEMA 1V16B 5THQA 1WHSB 5C7IO 2FTKE 2YFQA 4XYMA 5B64A 3PUWA 1MMFB 1J5XA 1CQIB 1YQXA 1CUEA 2FEOA 1W34A 1A27A 3LF1A 4UBOA 1RZRA 1IXZA 1R4NA 3CEMA 4MO2A 4QXPA 2IYPA 4RM2A 5JO0A 5LXTB 1AUQA 3AP3A 2WY2D 4LC1A 5K0FA 2B94A 1UC5B 4FFPA 5J1SB 2VN8A 4CLDA 5L4LA 4ZICA 2FCAA 3KLNA 2P27A 3M6UA 4QJ5A 4YRFA 5TMDA 2JASA 3PEYA 5KOHA 4Z99A 4URZR 4MV0A 5DWQA 4AKGA 1NW4A 1V9CA 4B6FA 3PEVA 4B74A 1RC8A 1H1DA 2WYUA 1ISRA 2EWWA 1MOPA 2FR8A 3CH6A 3FX2A 4OD0A 3SFVA 4TM8A 1YB7A 2Y2VA 1GFSA 3LU1A 2Q6LA 1WE2A 4HN2A 2PMWB 1JJVA 1V41E 1QQBA 4R1NA 2ZIUB 2ACKA 3PUHA 3PWSA 1QX3A 1R8SA 1K97A 1Y5MA 1T0UA 3BMNA 3ISTA 3ILYA 3AY0A 2F00A 4KHZA 1KDOA 2GHIA 3IXQA 4YXFA 4H7FA 2OHIA 3C98A 2QZZA 1TQ2A 2PS9A 2GK6A 4X6UA 3W5AA 4EFMA 1N9ZA 2C97A 5C8YA 1E5TA 1DBVO 1X6VA 3PK0A 1E1KA 2HBYA 2JDIA 2W0MA 3HKCA 1HETA 3IRVA 3OZVA 1Y6RA 4MWSA 4EHLA 4F1KA 3KQLA 4EJ2A 2NSDA 1N2HA 3IQFA 4GICA 2PFKA 4PYQA 4ZALA 4YRNA 3KPWA 3NDIA 3JQPA 4K3UA 1Y8QA 4RHTA 4OA8A 2RBGA 2RGGA 3Q9UA 4Y9TA 2CK3D 1JB9A 1VL1A 1OLSB 3VJLA 1KMNA 2RHGB 5CT8A 3FSGD 4BNGA 3X0DA 2XX3A 1B14A 1W93A 3KWLA 3AHCA 1W1IA 2PR7A 2HHAA 3A27A 3EULA 1GILA 3IT0A 4HH1A 1O96B 1JH9A 1L5MA 1XHFA 3OC0A 4DMGA 4GKJB 5LIRA 2ZJ0A 4LYEA 1RR6A 1PTJA 3EIUA 1AG9A 2HSGA 4Y67A 1XKXA 1DEXA 1IB0A 1XTBA 5TVGA 3KXIA 3KUDA 2XVAA 4DZTA 2VSQA 1VRCA 3EGDB 1IOLA 3A26A 5CG2A 4NZMA 2I4OA 1PJBA 4WD3A 4FZ3A 5CDTA 1IY2A 1PG2A 1TAHA 1FEZA 2AMLA 2HFKA 3VNRA 1S5PA 5KTPA 5JNWA 4U02A 2R6AA 2VUSA 1NN3A 1NYLA 4PO8A 4X9XA 2H92A 3SJUA 5DTJA 3B53X 3W5IA 1SBIA 4JJAA 3AL0C 3TAXA 3PT9A 4E14A 1WW2A 3L93A 4I08A 1YQEA 1PHPA 2H8KA 3BCSA 1KP3A 4OBWA 2BY4A 4QTZA 3AF4A 4EGSA 3AF0A 4D43A 5ICEA 2QN9A 4GNKA 3WYEA 4H7HA 2YFHA 1UOQA 2O8VA 3DVSX 2VZ9A 3PNSA 3Q12A 5E7IA 4YMVA 3ORRA 2W6OA 4FFBB 1UIMA 3O91A 1C1YA 1ESMA 1U1EA 1VJDA 2XNKA 1EVEA 2BI8A 3LC0A 3GJZA 4NMHA 5F7XA 5LLDA 1IXYA 4IQGA 4YAEA 5LOVF 1NBMD 1ZU4A 4UBNA 5T57A 1C50A 1DO0A 2ECOA 1C3JA 4HZUA 3BMCB 1YGPA 1E2IA 1RTKA 1VE9A 4FB5A 4JY7A 1U3TA 3T3HA 1DEAA 1SQ0A 2QQ0A 4KZKA 4AWAA 3DOFA 1U3WA 1H05A 2JCXA 3RUIA 2NTJA 5AM5A 5IFLA 3DWFA 3C4JA 1XPOA 1XVUA 4NJMB 4OXYA 4UHBA 3UMCA 5IJWA 3AKZA 3VR5H 2VJMB 4G26A 1JILA 2NV0A 3S2ZA 3TO5A 1RLUA 3RFFA 4BB9A 2YW2A 3U7RA 3RC7A 2XKJE 3V2IA 2O19A 4X97A 1JU3A 4IKOA 5F98A 3TQCA 2UVPA 1JDZA 4ZOQI 4M8IA 3K5IA 4M1SA 5FL7D 2X2PA 4R0VA 3E2MA 1GD1O 4LK2A 4MMZB 4D8YA 1HKUA 1U3VA 1EFTA 1P5HA 1WMAA 3T1HB 2ZR9A 3BFPA 3EIQA 2JFNA 1RHJA 1JIJA 2UZ1B 4QJ3A 1IAQA 2WD7B 4BVLA 3I4FA 3GPCA 1RHKA 1GWNA 4ANFA 4BKQA 1QOZA 3AP2A 5ALUA 1W46A 2F1RA 3GZNA 3JQFC 5AXBA 4UJ3A 2B5VA 5HKAA 1YH3A 4URUR 3F6RA 4MW4A 5IBPA 2YNMD 5IJ9A 4TZ6A 4PFJA 4F97A 3B3QA 1ACJA 3UHFA 2IJGX 3VHQA 3R0QA 1HM5A 2D59A 4H3VA 2UYCA 4ARIA 3TXAA 3ONWA 4TSRA 3VNVA 1GHTA 4WH0A 3HRHA 1VYTA 2G76A 1PR9A 2EBHX 3RRZA 1ZK1A 2ZUDA 1V8BA 2HUPA 4M7WA 3BE4A 3A9CA 3PXCX 2R8BA 4NBKA 8GPBA 5DN6A 1R4ZA 3WJAA 3HB7A 3I2IA 3LX5A 3O4VA 1AZSC 3QEMA 3KHUA 3ASVA 2YN2A 1O03A 4S1NA 4GBED 1US8A 4UE2A 3RC8A 2FGJA 2X8JB 4FYXA 1PNOA 3L05A 2GKOA 4KXMA 1JLSA 4GE0A 4N0MA 5I9SA 2D7DA 3JAMA 5BW6B 1JBKA 5K4AA 1BW9A 2XMZA 3HPRA 3TZBA 2ATXA 4CMEA 5DCWA 3PA6A 5KDLA 2VF7A 5J4KA 3FE2A 5HILA 2A33A 4BNTA 1I14A 2ZWVA 3X1DA 5KEIA 5HCUA 3EXEB 3O26A 2N9UA 4HEHA 4MV4A 3GY0A 4AMUA 1Z8HA 1I0LA 3RFTA 1NVUQ 2Z2IA 3E0XA 1U2PA 2IXBA 4M99A 1IE3A 1SHJA 2OA0A 4DSOA 5EJ8A 4CQJA 2ZYIA 1URPA 1KAHA 4EB6B 1TI7A 2BBOA 3OKAA 5JLAA 1FP1D 1QC5B 1VIYA 3PXAA 5C5EA 2AFRA 4KO3S 4MYCA 4RO0A 4ZP1A 3L6DA 3RIEA 1BGXT 1SY7A 3ANYB 4BQNA 1TM3E 1FFAA 2CJWB 2ONYA 4CG2A 2X0RA 4GPBA 2HF2A 2ODNA 2YVQA 2C98A 5DW3A 4Q34A 2ZU6A 3DMFA 3KFXA 2JJ2A 3R0JA 1DIAA 3D2BA 2J09A 3EFEA 4BUCA 5ARBA 2OVFA 3L5OA 1VYUA 1Z0AA 2Q27A 3PL1A 4JUBA 5DNUA 5LLTA 3KSRA 5DBFA 3U19A 1LWNA 4D9KA 5IWCA 1JXAA 2P4SA 3E1KA 3ASZA 3ESRA 4I3FA 4E5KA 1GT6A 1FNBA 2JK0A 4QGAA 4DIKA 5J4LA 2PUTA 1EGMB 4N3AA 3LHIA 4FNAA 4DDMA 3O2SB 5J43A 2WABA 4C76A 3C0KA 3Q1LA 4D3SA 3ENZA 1UZNA 3HPQA 4B3IA 1GDDA 4KUEA 5GV8A 4BN4A 3AO0B 2PWZA 1O3YA 1QE3A 3HN6A 5TQ0B 3TZEA 1LBSA 4UM8B 4KREA 1Z6YA 4M2LA 4PS0A 5CFZA 4PLHA 4FQ8A 3H04A 3W04A 4BRZA 1EQAA 1P9WA 5HZHA 1BE0A 1Q7BA 1EJ0A 4D8XA 1CUIA 1G9XA 1LXCA 1UDBA 1PZMA 3BWBA 1B26A 1FTWA 4OBXA 1DQPA 3I76A 3LXXA 4C3VA 5LIPA 2I9PA 1OZ0A 2W2KA 3DBOB 3RVMA 1JGTA 4O1MA 5C5IA 4LDRA 4C5AA 1Z7GA 1RKVA 2B34A 1OXUA 4BNUA 3EDCA 1N4DA 4K9KA 4UFPA 3PX2A 3W1EA 4DDUA 1R0XA 2QW0X 5A3SA 3LH5A 1V1JA 1UWVA 4Q12A 4K5QA 4KQ1A 2FSVC 4CTKA 1JVBA 1Y1TA 3RHZA 2PX4A 3GD7A 3PP8A 5CB4A 1OX6A 2FOXA 3MYRA 2P5UA 3AR9A 4GX1A 4IJVA 4ZAGA 5BR4A 5IF3A 3H9GA 4AUNA 1SZPA 1BS2A 2VSNA 1BA3A 3JD4A 4ZAYA 2DY1A 3CT4A 4O2BF 5EJ6A 1Y81A 1G7RA 2XDQB 5BWNA 3H2BA 4BJ1A 2V1XA 3Q3CA 2FZ5A 3S40A 1LCIA 3VU9B 4ETWA 1NZFA 2FPIB 2Q6TA 4BCDA 1RRCA 2X14A 5F5XA 4GPEA 4AKHA 3F97A 4G84A 3ND9A 3FGNA 4NNOA 4FBGA 2AKAB 3PVZA 5EIBC 1VKJA 2NO1A 5JH7A 1GYPA 3CUKA 3MOSA 2XMPA 5KWJA 2H63A 4G1FA 5FPTA 4BVAA 5ARCA 1NJGA 3OQ1A 4DCGA 1BXRB 2BGIA 1C7ZA 3LCVB 4YQYA 1JQBA 3Q8XB 3CH5A 4MUJA 4LY0A 3LNTA 4ND4A 4WSOA 4II2A 1CUBA 3NTUA 4MUAA 3OZTA 4YI3A 1O0SA 2O2DA 1JAXA 1NBMA 3CN7A 3JCZA 3PGLA 4NTZA 1ULZA 1LTKA 2V97A 1QF7A 1R1DA 3GX1A 4TLBA 3ZI0A 2PBFA 2CXQA 3NWEA 2OAP1 3P26A 3BIFA 4LF9B 2J1LA 2RMKA 2JL1A 3I8OA 1PGQA 4QYTA 4ARCA 2NADA 1AXEA 3KOXA 4OAOA 5CFPA 1UJCA 5LYJF 4DDTA 3JRNA 3VO8A 2B8WA 5LOVB 3M33A 1USKA 2ZI4A 4TYNA 4KXVA 3UGQA 2C99A 3BXOA 2FUEA 1ZOLA 1FOEB 3DO8A 3O4HA 4GYJA 1RE1A 1WBJB 3KUXA 1R16A 1RCTE 3V1UA 1VZ3A 1CCWA 2AJLI 2IV2X 1I9CA 4GLBA 2I1LA 3ZV5A 1UUFA 3PEEA 4V0ME 1L0BA 3V9PA 4UNNA 2WKSA 3H2KA 1B7GO 2PGAA 2NGRA 2QL7A 4LHVA 1KOLA 3SQLA 3LLCA 4C30A 4A5OA 3OOSA 4N3NA 4EF4A 3DD1A 2VJQA 3OPYI 4QOGA 3O8BA 1Y1QA 3LYHA 2GCGA 2NLOA 3O4RA 1R6DA 4YP0A 3CNBA 4A1FA 3MG9A 2IUEA 1A9YA 1RPJA 1YDEA 2GBCA 1VL5A 3VO9A 3ZWKA 2OXEA 4YRLA 1AY0A 4AJLA 4FK8A 5PGMA 1MW8X 2J0EA 1ORRA 3FPGA 4I6EA 5DTQA 1A7JA 3GGOA 1BXGA 3AKCA 4ETNA 1RPTA 4MI9A 4EA9A 2X0EA 5ELXA 2QBYB 4PIMA 3RJTA 3PFCA 1VLZA 2JFYA 3UQZA 1FB5A 1EFHA 2GPBA 4HFMA 5FORA 2IEBA 3EOZA 1WNTA 4OYLA 1RCFA 1VP3A 2ORWA 3QLJA 4OQMA 1OGJA 1P2GA 1OWPA 1E1YA 2IF0A 4XPZA 2OB2A 4WCFA 1U8CB 5C8YF 2DUNA 3R6DA 4PLGA 1WZCA 1R0SA 3H6HA 2ARKA 1NDQA 1HT1E 4GIBA 3IO5A 4IOMA 4NL4H 4JGGA 5M3BA 4EKIA 1LVUA 4B0PA 3AC0A 1MABB 4IXWA 3DEZA 1VL2A 4FHCA 1XT6A 4RXTA 4WK6A 2V1UA 4YDRA 3ZYZA 2P6MA 3FCUB 1ATZA 1A9OA 1CRZA 2QN7A 5C8VA 1I3NA 2H2HA 4DNOA 3HXMA 2R7MA 2JGEA 2XCRB 2VF5X 3JAWA 1K6MA 3GG9A 1E5LA 1MQ9A 2CLOB 4O59O 3LRXA 3GRFA 4DCUA 3K5HA 1L4BA 1N7GA 1SCQA 4XM1A 2ZAGA 3SIRA 2BGJA 1H2FA 1X7DA 3FKQA 1QG0A 4OHPA 1L4HA 2WKRA 3I01A 4PF1A 3OI7A 3A2KA 1YU6A 1DC7A 3ZLJA 2VUTA 3SNKA 2DG2A 2CXXA 3U60B 4ZT7A 4OM8A 3IAAA 1E3MA 2FEPA 4YWHA 1HQCA 2XMCA 2ZJ7A 4DR5B 4CKXA 5FA6A 4HS9A 4MR7A 3G17A 3TPZA 3AY6A 4YGYA 3FN4A 5FWYB 3EN0A 1H69A 4FC6A 4UE3S 3W6PA 3W7BA 2BFNA 1V5EA 3WL5A 3NTOA 3KKNA 4UMVA 5BW4A 3I05A 2TS1A 3C15C 2JD0A 3GIDA 2AMFA 3ZS8A 1DTWA 4GXRA 2O8NA 2PN1A 3E9EA 3NBFA 1FXWF 4MEJA 4NPAA 5CFOA 3N2KB 5EIEA 4HNAA 3VPXA 3FF1A 1YDHA 4TKMA 1NBWB 2PY6A 4C7MA 3KAPA 3PDWA 2NNLD 3KQKA 1FYEA 4K9RA 1V7QA 3E82A 1ZXXA 4HNUA 3ZQKA 1DUSA 3LC2O 1R8JA 3O3OB 3FTQA 4OQLA 2ZVDA 2X2OA 5DF1A 5DRYA 3CJTA 2ZRGA 1QX4A 1Y6GA 1XRPA 1BN7A 4LYFA 5A03A 4FYYA 2O2XA 4P7FA 2QAGA 2XADA 1ZUD1 2QJWA 3JATA 4MVJA 4BTLA 4Z54A 4EW3A 1E2MA 3IS3A 2J48A 2JB9A 4Z4HA 1LGYA 2DXIA 4NDAA 5ETJA 2VPYA 5CDSA 1T36B 3EK2A 2C5SA 2PYDA 3QVMA 1H0SA 2ZBDA 4PYNA 4AX4A 3NTXA 5CTAA 1HEIA 3O1LA 5KSYA 1YF3A 5AP9A 2PVSA 4GKVA 4TTQA 2DQYA 5LQNA 2WG2A 3ZV6A 5JCXA 2JLWA 1L5VA 4K8OA 4M7RA 5B12A 2Q8QA 4J6FA 1KEEB 2JAQA 1XTZA 3C3DA 3QXSA 3EG9A 4HG2A 1X1RA 3CCCA 1FDTA 1TUBA 4KGVA 3I9LA 5AJUA 1EXMA 3E7WA 2J6CA 1OFTA 3CLSD 3F49S 3IMKA 1JG2A 3P0EA 4UUAA 4A36A 2XOKD 2P2ZA 2YFYA 4OOEA 1UODA 2X5JO 3HA2A 2OXIA 3N8NA 3IUQA 2HRRA 2Q6IA 4DXHA 1H0KA 1MENA 4W5WA 1Y8ZA 2PU5A 4YPVA 3H4VA 1S8OA 3Q98A 3EDQA 2GHQA 5AI9A 5F23A 1L7EA 2XAAA 3ENVA 4DMRA 4MKHA 1RWWA 5DGIA 2C83A 2BWJA 4QFCA 4FFOA 4DR2B 1M2FA 3QU4A 3GVCA 5CDFA 2GTHA 3ROGA 3AIOA 2VNAA 2YOFA 4O2BB 2LIVA 3QX9A 4PYJA 1W85B 4IUBS 1YE8A 2BUBA 2OCAA 1XBTA 1TJYA 1J9EA 3H5IA 5F64A 2WTNA 3MRXA 2QW1A 4PCUA 4Z1MD 3OZSA 5AIAA 2DC1A 3A2LA 5DYTA 1XKLA 2VHYA 2JFVA 2Y99A 4RF5A 3AI3A 4B0OA 2XIJA 3M6FA 1NMZA 3UO8B 3CEJA 3KG2A 5KTNA 2A5DA 2LP4Y 3AW8A 5CM8B 2EFJA 4RHYA 4NXNB 2O5VA 4A5SA 1LD3A 4QBFA 3EXG2 3OA0A 5KCZA 2ZUFA 4OY3A 1O9HA 2IPXA 4A6XA 2MSDB 2BRUC 3FPBA 3OU6A 5F77A 1FTYA 2W2NA 4FFDA 1Y4SA 3C4VA 1QNLA 1XNJA 3FBWA 3U4HA 1GL3A 2WNHA 1OFIA 4JBNA 2F8LA 3EFOB 4YUAA 2BZGA 3TIIA 1BMQA 3HA7A 4WWHA 5LCXA 3WL3A 3ZY5A 1CQJA 1I8TA 1TCUA 5I5GA 1FFCA 3CONA 4EW6A 2RK4A 4LZAA 2WFLB 4DLWA 4OQQA 1DMSA 5LYJB 4MV1A 1GUYA 3FZGA 1QBKC 3PQ5A 4WTOA 2YBEA 3WL6A 2ZWMA 7GPBA 4EENA 4KE9A 3GCZA 2QYSA 2X13A 1RXUA 4TL6A 2P9CA 2QJTA 2QTMA 3BXZA 2HLPA 3GXBA 5D3QA 3W5CA 3HM2A 3K7EA 2PU7A 3BZWA 4EG4A 3NATA 2GD2A 4BUJA 4EUSA 2Z6VA 3DZKA 3HUFA 3I23A 3ND6A 2F3RA 2CD7A 3OFVA 2XRYA 4UAVA 2I7DA 3GJRA 3EPJA 4LJ5A 2VHCA 5CU7A 1R4NB 3D6UA 4ESOA 1IYZA 1SCDA 5DNYB 2P67A 4DLUA 3T4PA 3L7BA 3DE7X 4LJ9A 1CB7A 2O0MA 2OBNA 2OCXA 4OJMX 2FPRA 4P22A 3R9IA 3TZ6A 3PWTA 4REQA 1YACA 2ZTSA 4A6EA 4YBRA 5KOHB 3LWNA 1UAYA 2JJMA 1GXSB 5DW0A 1UMBA 4JI7B 4HGYA 3PVSA 4UBIA 4A4DA 4DSTA 3MT8A 3L8FA 1UZLA 1QHGA 2JRCA 3B9BA 1KEVA 1Y82A 1PR3A 2VWQA 1T34A 1XD8A 2ZRJA 3BD6A 1P8JA 3TL6A 3SQDA 3UANA 4DILA 1EIZA 4LX8A 3KV1A 3CWCA 4B48A 3RASA 4B8ZA 1C7EA 1E8MA 2ZYAA 4ND5A 4Y2VA 1YT5A 4RFVA 3GLHA 4A8TA 4D9MA 3T5PA 1E2BA 2OYCA 2JFBA 3BMNB 1TA0A 1K5PA 2E55A 1J06A 2XUFA 1P5ZB 5EVCA 4BO2A 4WZBA 4M7OA 3FMFA 1Z6TA 2RJ3A 4CUKA 1HDOA 4P2GA 4FN5A 2EJTA 1Q6ZA 5C8YB 3N2YA 1JIXA 3PHJA 3HKCB 3OFNA 4QUDA 4Z4GA 1JP7A 4G8BA 5EXPA 4N12A 1NW7A 4TMKA 3CGGA 4YO7A 1ENOA 2PKYX 2AX4A 1VP9A 2FSFA 4FB4A 1Y8QB 3U3KA 3DYIA 1RM5A 5EJAA 1SULA 3X2EA 3GP8A 1P2BA 3HN7A 5CB4F 1KQ3A 2H51A 3H86A 3W5SA 3C41J 3ZE0B 2ZSIA 2BFEA 4WW0A 5BWLA 4KN5A 1XR3A 1R0RE 2ZQZA 2WV9A 3AM3A 1Y98A 1O95C 4WECA 2COEA 2WJIA 2QD1A 1FCJA 4LC9A 1O9BA 4HAWA 4IUDS 2AFVA 4R1SA 4HYYA 3PPXA 3ZGNA 4D44A 4N6GA 3IAS6 3WK7A 3B36A 3EPHA 3DE6X 1O0BA 4M0LA 3G5AA 5JSHA 1HYQA 2YVAA 2FPMA 1T9BA 1DC4A 3COZA 3HGTA 3W2IA 3VZCA 2BEUA 4R98A 1VSTA 3VV2A 4ZK2A 2EZUA 1KMQA 2R8XA 4EPRA 5LZ8A 1JDJA 5JH7F 3B1JA 4Q19A 2C77A 4HB4A 4X00A 2GFQA 3ABSB 3MJDA 4X44A 4RXMA 2FWBA 3SY8A 1CVRA 2CBXA 4YRPA 1UEIA 4B80A 3OJWA 2JGJA 4TT3A 5T4HA 2JGRA 2H2DA 3FRHA 4XEUA 4CKBA 2WAOA 1QHEA 5BV2P 4ZCPA 3SC6A 4IH1A 1V9SA 2AOWA 3DR5A 4ZYUA 4I5IA 2O8DA 3GVXA 1J33A 3GDWA 4KIUA 4NOLA 3AUFA 2G5GX 5D01A 2HZBA 4DA9A 3SQWA 4V39A 3R1IA 3ZTYA 5AESA 4ZIRA 4QQ8A 3NWOA 4NCIA 4Y2UA 2OM2A 1UBNA 2C0CA 3P2MA 2YC4C 5FF9A 3U3RA 2FOIA 3VVLA 2SHKA 1EYZA 1KE1A 4OLJA 3NC4A 3V1NA 1YHNA 4KE7A 4YMIA 4L50A 3NYQA 4HZUB 2AD5A 2ZBFA 4PU0A 2AJCA 1X94A 5M5BA 3GEPA 3DEYX 4QYIA 4KDRA 5I3CA 3QFHA 2FSSA 4FDAA 2JLZA 5FX2A 4U0JA 2WYHA 5CFLA 5J47A 3E81A 4KUGA 2BMAA 3E3MA 4ZQEA 1HFEL 3QE9Y 1KJYA 2HL6A 3RK4A 4L8FA 2EXXA 1ZL2A 1CUZA 5EHNA 5LNK6 4QREA 2ID9A 4NS4A 4D3YA 2OV1A 1VJ1A 1KHHA 1NKTA 5TR9A 3RU7A 4JB0A 3TQFA 3F78A 3WGTA 1Q7GA 1IL0A 1GRRA 2P0AA 4H6XA 3KQTA 4FCWA 3V1MA 1YR9A 3ZWQA 4B4UA 4DR6B 2PVCA 1GJRA 3CLUC 4OVKA 2H2AA 4Q4AA 5B58T 3UHOA 4J16C 2PAFA 3TQRA 3ZDEA 3LX8A 3PI7A 1WDWB 2ERYA 3GEIA 4XD7D 3P9CA 4KO1S 5DTEA 3HLYA 1EVKA 3UCFA 1VBFA 3LWDA 3HQ4O 4WFJA 2AOTA 2I3ZA 1C3LA 4Y9SA 5JECA 2PMBA 3ZDZB 1IHPA 1CUSA 4N5NA 4AICA 4ALJA 2FG6C 2PJDA 1YS4A 4G1VA 2X6TA 1PFWA 1JALA 5B3JA 1X9HA 4GKAA 3SFTA 3TX2A 1XTQA 1U7TA 3LY5A 2WJ4A 4HDCA 1ONNA 1R6XA 2WT9A 1C9KA 1FDVA 3GZNB 2Q6KA 3K9QO 4FE3A 4RGBA 4EY6A 1G59A 1U04A 5IJ9B 3JPYA 4AO7A 1GAWA 1SURA 4GPAA 4Q66C 1UANA 5ALMA 3GLIE 4ZAFA 2ATVA 3DXYA 4PRLA 1L5YA 4DQUA 4LI3X 1NHGA 3FR7A 2QOEA 4CETA 1LEHA 1VCHA 4GZ3A 4TQ9A 4EHDA 2W58A 3CNOA 4XLZA 2JA1A 2Z3VA 4YHHB 1BO6A 2NYRA 2XXAA 3N5CA 2GAIA 3JQ8A 3MELA 2BHLA 1US8B 2AZ4A 2LGJA 3FF4A 3WRXC 3ZHCA 4CR6A 5CCXA 1EKXA 5EHZA 4L0DA 1BX0A 2GPWA 2PMFA 3P9XA 2YWHA 3PKZA 4NHOA 4MR9A 3L8DA 3IDFA 4C7JA 3ELDA 1DC8A 3K9GA 3QLVA 4WKNA 1OROA 5JLJA 2OHHA 3I37X 3OFJA 1I0ZA 3ZBTA 1OJLA 2RHRA 1ZUNA 4HYQA 1P9NA 2FN8A 3R6TA 1DKOA 2BFDB 1OD6A 3WDLA 1G21E 4FD3A 4MZDA 1JF8A 3EEFA 3M5CA 1UC4B 4BRUA 4EUEA 3MQ4A 4KX5A 3R0VA 2QM7A 2VJDA 1BX1A 2GVDC 1T1IA 2WV7A 4RL4A 5E9AA 1P7PA 2IDZA 4KMOA 4NBSA 2VK4A 3T6KA 3HBFA 1X15A 3HCBA 1X7ZA 2WI8A 4K8RB 1JYSA 4PYKA 4J1SA 3CU5A 4OHWA 3SJCA 3AUKA 3E23A 1XZHA 2QR2A 2PE5A 1P9RA 2OD9A 5AOBA 4N8DA 3RC9A 1IOWA 3AVOA 4HNRA 3OAAD 4EG5A 3A4IA 1NT4A 3K8ZA 1JR3D 2RBKA 3DCJA 2BONA 1ISSA 1MD9A 2EARA 2O1WA 3BOSA 4MXDA 2LCQA 5CDGA 2E5LB 1RJFA 2OLJA 4WLEA 2GSWA 1ECBA 7ABPA 2WNSA 1LRKA 1ZH2A 4RMJA 1FMFA 3Q9SA 3T5TA 2WM9B 5HFNA 2YYYA 5H16A 3UMYA 5DP2A 2H9IA 4OHMA 4EHFA 1U0NA 1KNQA 1T5HX 3BFXA 1IJFA 4MVJF 1P39A 5EP4A 3O9ZA 3WGQA 1W6RA 5J4YA 2PQ0A 3RBVA 1WXXA 4LY6A 2ZWIA 1KOJA 1CRQA 3RC1A 3RTCA 2IU3A 5BV7A 5C5DA 2CNWA 1ZM3A 3DV0A 4D4MA 1VYHA 1YOVA 4ITVA 3AJ9A 4AJKA 1QG6A 2G71A 4FDLA 4MMYB 4WK2B 4JLDA 5TIIA 1NG1A 1XVTA 5DASA 5BQPA 1JPUA 1N1DA 1ODIA 1Y0BA 3R7DA 3O2JA 3BSFA 4ZGBA 2W2KB 5DM4A 4NCXA 1E6CA 1YJ5A 1G5HA 1QQ5A 2DZDA 1T2FA 3JSXA 4QUKA 4XCXA 5CXXA 4DZRA 3L0YA 4LJSA 3DMHA 3KXKA 3OJOA 2JLQA 1ESEA 4UTNA 1UPCA 1DXOA 4DBLE 3ER8A 2H5LA 3C24A 3UQYS 5CJJA 3NZEA 1L3IA 4U4AA 2EQAA 2P9GA 3NIGB 1K92A 1Z7YA 2HWKA 1ZH8A 3INNA 4KXNA 4Q03A 4AJOA 4D9CA 5KYNA 4ZMSA 5CB4B 1RWVA 2LCIA 3T3IA 3TSCA 3LWBA 1XCLA 1LC0A 1ZH0A 1VYVA 2Y0DA 4UE6A 3G0HA 2QTZA 4MUKA 2JLVA 1FL9A 1GU0A 2WBLC 3QX8A 1C14A 3K6SA 3OX4A 2X23A 4LRSB 3OHPA 4J94A 4F85A 5AVVA 1N5KA 4RW0A 1TVCA 4YRKA 2ZM6B 2CFCA 2W2QA 2HU7A 3E1GA 1IN8A 3VXKA 4LGCA 3THXA 3JVUA 1KO4A 6REQA 1NE7A 3Q7RA 4XTCS 5ALZA 3IAHA 3ZEAA 2Z8ZA 4CKZA 4PINA 4S35A 7MDHA 5AKLA 2OMKA 3G9QA 5C34B 2F3SA 2VSOA 3ABIA 3EVTA 2JK1A 3RAGA 5JH7B 5D6NA 1SUDA 1QAOA 1UXHA 2FU5C 5IT5A 1JDVA 1U7XA 2Q46A 2QT9A 1XWIA 3IPLA 3WWDA 4R1MA 3ZK9A 4D9EA 4WFKA 3BCUA 2VK8A 4IJKA 3HDVA 1G8HA 3DZCA 4LXIA 3ME5A 4DDHA 5KX5A 3VA7A 1P4SA 3EAGA 3OZXA 1RQPA 4FFRA 3I9FA 4INPA 4UEJA 3ZU3A 4PFSA 4BX0A 3U6KA 5HP4A 3BA1A 4RADA 3V2UA 1DBQA 3WYAA 3IT1A 3U48A 4E4YA 4OXQA 1A4XA 2CC2A 3LT4A 4PG7A 2J41A 2YIJA 1L4NA 2GPNA 4IFBA 4R68A 1CETA 4IGEA 4U6NA 5EIWA 4LC0A 3WVNA 1UL1X 4WLFA 1HZZA 3UW3A 3HB0A 1M5RA 3T1OA 2QUIA 1QQ6A 3KR9A 2C00A 1BSVA 3BG5A 5HBRA 2XF2A 2ZTMA 4UTPA 4NG4A 4M1QA 4YAFA 3NYIA 1E1QD 5AXCA 3L0BA 1TQ4A 1GA1A 1V0JA 2P9TA 3EQ6A 3KAQA 4AJ2A 2I7CA 5FOUA 3F6PA 1OU0A 1J00A 3VHLB 3UHAA 1WUTA 2O50A 1X8JA 2VA8A 3A6KA 4KQ9A 3SVTA 1UJBA 4GHWA 3Q1KA 4Y8VA 3SK0A 3SLRA 5ITVA 2IPOA 3PDJA 3R3ZA 4HP8A 4JP1A 5DCLA 4A27A 1GQOA 4E22A 1V25A 3S8MA 4U8HA 1U5AA 1VL6A 5EUCA 3IEMA 1QGYA 4DARA 4TRJA 3W3AH 3K53A 5K0BA 4BJ3A 4DV2B 3B2QA 3IOMA 4CF5A 1E6UA 2WWYA 3FFXA 1UBRS 1XZDA 1GVNB 3ESCA 3OIYA 1QFJA 3TW6A 2IPAB 3OOHA 4IOJA 3RBXA 1XRSB 2VATA 1FPMA 1BXGB 4DWOA 2O3TA 1XSEA 2IHNA 3UXMA 5LN1A 4RCYA 3BULA 2C03A 3OMXA 3V8QA 2X41A 3TSOA 3ESYA 1DIRA 5CYPA 4BV2A 2FP4A 1Y6JA 2X76A 4V0MA 5JWOA 1MXHA 4AQYB 2IZOA 1N2ZA 3HC7A 5JAPA 3O7WA 1VPDA 1IBCA 1Y89A 3UUFA 1WETA 1OF1A 4WCFB 3F9RA 2QUZA 4YMGA 1F5SA 2VHEA 5A9SA 4WNCA 4NJOA 1PFUA 5K0SA 2PX5A 1C29B 2FK7A 3D6VA 3LYAA 4JP5A 5E2IA 2XUAA 3H17A 1AF7A 1S2OA 2JGFA 4MH0R 4MX8A 4RS4A 1C8LA 2PO5A 3KJHA 4MLZA 4BLTA 3HYSA 3SMVA 4NE2A 4EEKA 4X8HA 1P0IA 2B37A 2XQVA 4J3JA 5A9TA 3TNDA 3V8NA 4BLPA 4GWGA 1QDLB 1UKZA 3CX6A 1ZCBA 2W6QA 3TOZA 1TMOA 3AZQA 3F2IA 3I1JA 4Q16A 4HEA1 4NZ9A 4UDOA 1OYYA 1VCIA 3MW8A 2RGDA 1KKMA 3JAWB 2W0SA 1WD7A 4PNPA 3TKAA 3LQ4A 4NABA 2FP3A 3RUDA 3RDPA 1YD7A 2HLNA 3HL4A 1XAGA 1JR4A 2NXEA 1BGVA 5HQJA 1PJAA 1K3FA 5CIWA 2WWTA 1NX9A 2ZIEA 3GRKA 1UP4A 1UXIA 3SKVA 4N76A 2Y0EA 4PNZA 1HO3A 4XOIA 4PAWA 3QM1A 1OMOA 1Q95A 1MC5A 1N3LA 3E4CA 2Q1XA 3RSQA 3RVJA 5IHXA 2J5QA 2NSLA 1RXEA 4GX2A 1A7UA 1AN9A 4I2NA 4R2WA 4EGCB 5M04A 4MVJI 4PGFA 5HDQA 3FTPA 1QGUA 2G83A 4HRVA 4ZZ2A 2AL7A 4GC9A 1MC4A 3WR5A 3BRWD 4ND1A 3L1VA 1NWHA 1U5CA 3K9LA 3L8HA 2ID7A 5BWMA 2Z4SA 3NH9A 1T1EA 1NVKA 2VJYA 4EZIA 4MR7B 1B23P 2ZOSA 4C21A 4KO2S 4GFDA 1RM4A 1OFVA 4NU6A 5IYZA 4F06A 4A8JA 3BJIC 3MXTA 3DHVA 1GFZA 3DLBA 2C9ZA 4CKWA 3DYVA 3HBNA 1K6EA 4LGMA 4UW9A 3LQFA 2KM1A 3SIWA 3ZQ4A 5HRAA 4WA7A 1DTWB 1ZVVA 1EUCA 1PVDA 3G8YA 3KQSA 3MTAA 3VTZA 4K6HA 4HNAB 3CIFA 1WIWA 2P2GA 3I2GA 1QONA 1BFDA 5DNDA 4E11A 4NIMA 5ALXA 3KQVA 3G7SA 1KFKB 1S2IA 1JXOA 4XXHA 3CPSA 5ENDA 2C8VA 3C97A 1KJQA 4JOCA 3QBDA 2P6NA 3PGJA 2YXEA 3QFCA 3QXHA 5KVAA 1Z6QA 4QG7A 1HE8B 1IBLB 4K7JA 1OAOA 1CP3A 1YZHA 4ME6A 4M3NA 3I64A 4ID9A 1F2DA 2F59A 4GMGA 4TYPA 1DJPA 1NLYA 2GF2A 2P6OA 5DTRA 4FEEA 1EX7A 5JSUA 1XEWX 2XGMA 2POCA 1ZAYA 3HXKA 5EIBD 3K2IA 4E08A 1NQOA 2QAGB 3JATB 4BO9A 5A6VA 2ZJOA 1LTHR 3NOVA 1F4VA 1TT5A 3ECCA 4CIXA 2IYFA 5KYTA 2G7MC 821PA 1G2OA 1TK2A 2PH3A 4IXDA 4A0SA 2O8DB 4BLVA 4L7QA 1VIMA 3LUKA 1A4UA 4D6PA 2V4UA 3D6HA 3SD7A 1VI2A 4C4XA 1AB5A 221PA 2XBLA 1NOKA 4C4AA 3ERCA 3Q7TA 2AW3A 4B3XA 3CVOA 4S1VA 4UUBA 3EG9B 1DBPA 2V7VA 4IIGA 2BHNA 3SSAA 4GPD1 1TUBB 3GUCA 4YS6A 2P0EA 5J4VA 4YUWA 5T5QA 4JWKA 1MP0A 3QYAA 5IT0A 2EGGA 2PK3A 3NHRA 1YRHA 4Q3LA 4ZTBA 4E4RA 3DC2A 4ND6A 4DDWA 1KY5A 1T8WA 1H65A 1FVFA 2QJRA 2BTEA 1YK0A 2XRMA 3TE7A 2P1DA 1Z0KA 1KMIY 2GUGA 2OZLA 4R9RA 4OP1A 3ABOB 1GTJ1 1K7CA 4MQ4A 3W8RA 3JD3A 2BFFA 2JD2A 2QLNA 3OTQA 4R8MA 3MBIA 1TCCA 5EKUA 3TOXA 2EP7A 1J23A 3LW8A 3RKUA 2VHVA 1ULUA 2C7VA 1YB2A 1UPUA 1UZMA 2NP6A 5CCEA 1CY4A 1N3BA 2DWQA 3WWOA 5IEJA 1ZI8A 3FNIA 5LR6A 1KDTA 1P74A 3IULA 3QE4A 5M29A 1XA0A 5JDIC 2P5SA 4JVSB 1U98A 5BSFA 1H2HA 1NUPA 3SR3A 5JY6A 1Z0IA 3H5VA 2QX9A 1I7LA 1X39A 1LLQA 3L0DA 4JBYA 4OL9A 1KTVA 4FZJA 3VC7A 2AKEA 3HCOA 4PAQA 4B2IA 5A5VA 5GVRA 3DLAA 2M6LA 3V34A 1ZQ1A 4AIIA 4BX8A 3SYLA 1AS3A 2RHJA 4RETA 2GM4A 2XW6A 2RHLA 3AI1A 4MQUA 2N0SA 1P1CA 4WCVA 5FQNA 3BFJA 4C4YA 5HWSA 3ZHZA 4JJGA 1F20A 2V3WA 2WTEA 2V6MA 3BJEA 1C9MA 3QPBA 4JQOA 1WRBA 4XSGA 1X8XA 4BMYA 4TZKA 2Y6UA 2OYSA 1YE3A 2G1UA 4YV2A 4JP8A 1JL3A 1KY3A 3L7JA 3MWKA 3WB2A 5JJIA 1H5NA 1CQJB 1EEHA 2B2XA 3C3WA 4D99A 4QPDA 3EZ7A 3ET5A 4N5DA 4LVOA 3BILA 4NBTA 4G37A 3WLAA 5JNLA 4LXGA 4MWTA 5ERXA 4B46A 3TXYA 5IT9A 3MK31 1EHYA 2BGWA 3EBLA 2GASA 3PTZA 2VRNA 4QVIA 1HBJA 1H2EA 1XKQA 1UMDA 4YJDA 5BQ5A 4UCQA 2F90A 2GA8A 4AF6A 3HZOA 1T29A 4ALMA 5JZSA 2WM8A 2A6PA 5BMOA 3WGOA 1E89A 5DDIP 4DUGA 3WI7A 5HYVA 4Q1AA 3BHNA 3T1NA 2Q49A 3Q15C 1DI0A 1E9FA 2VHTA 1YQDA 4PLTA 3ZU6A 4BPRA 4P7KA 3ICWA 2J3QA 3AUUA 1K3TA 3TZQA 1PQ4A 4FQ5A 4RYDA 4LFBB 3CY6A 3EMKA 1DXHA 4D2IA 1FLNA 2D6FA 1S2MA 5LJIA 1BMDA 1Z2DA 1L2TA 4LFCB 3UG6A 5JYDA 5ALHA 2GFIA 2RB5A 4HJXA 4TXMA 4RMGA 1QO0A 4D25A 3LY8A 4U2FA 3USZA 4I66A 2NUAA 2PS3A 3KPUA 5AJWA 3H5RA 1EP3B 1VCNA 2QS9A 3BZBA 4OGGA 4HRXA 4KLAA 4REQB 8OHMA 3ANTA 3EODA 3HY6A 2VOJA 3MJRA 2EG9A 2QNIA 3DE5X 4DV3B 4BVKA 4K9QA 2B6NA 4RZ2A 2NV6A 3PKIA 4FHGA 4EJ6A 5FXMA 1WV1A 3UT6A 4KIFA 2EBWA 4NECA 3KYBA 3GLHB 4NOKA 1JSLA 2REQA 1VXOA 2QP4A 4RXUA 3VJMA 1G8JA 1NN1A 4BIMA 1JU4A 2V7BA 2R6DA 3VO2A 4Z2AA 4WZBB 2YYSA 3WNCA 2G9NA 2XGGA 2AI3A 5MHTA 3HE3A 3JZMA 2I4RA 3K35A 2FY8A 4LJAA 1SUPA 4UULA 1LPAB 4RTSA 1LDBA 5EKTA 5A3QA 3PG5A 1F51E 3GL9A 5KSWB 1NTOA 3G9TA 4JL6A 5G41A 4EVSA 4EPTA 4KFUA 1OH5A 8MHTA 3IUPA 4M83A 2BSXA 3RC2A 4JGBA 1H2YA 3VKUA 4KDEA 4AF8A 4DIDA 4EW2A 5C1DA 5HQTA 2RONA 3ZHSA 2ZSDA 2G8NA 2VTDA 1QYIA 2B4YA 4UREA 2BFEB 2ERCA 4HR7A 4EHJA 1Z5GA 5SYMA 5T3YA 2W6JA 4X1OA 3UH1A 3DT6A 1QV9A 4L78A 3W5BA 5GINE 4RC9A 1XP8A 1OBFO 3MJCA 4WV3A 4JI1B 5H1YA 3V33A 3NDBB 3QJYA 3EJ6A 2HIMA 4TVKA 3TAHA 3EGXA 3IMGA 1NQUA 1U7DA 5AW3A 4NCNA 3SLKA 1TKCA 1KSGA 3KT6A 3UJ7A 1UAGA 4GD3Q 4AJNA 4AO8A 2PV7A 3PQ7A 4MIOA 4TMVA 7AT1A 9ABPA 2BGNA 5BWBA 1NM5A 2AZTA 2FMHA 1MVNA 4DR1B 4RX1A 2BEUB 5ADUS 1ECGA 4B34A 2H2GA 2KYRA 2HCRA 2CKMA 2W6NA 4BVBA 1BKSB 4MQFA 3DE0X 3C3PA 4FGJA 2CE2X 2I29A 4L4SA 3F7OA 1U1CA 2Z2JA 1WQ1R 2GHTA 4G8CA 3WL4A 2NO5A 4UHCA 4X5OA 5KX5F 1NXQA 1T9GR 4RD0A 4CKBB 1Z5VA 2A94A 4KWCA 3E7PA 3TMAA 2EZTA 4QVGA 4ZVMA 1ACLA 1LLCA 4U2GA 4MHTA 1Q11A 1ZUHA 1X1BA 5M34A 4OK5A 2O2IA 1CFJA 4QHTA 2GKSA 2BDUA 1BGWA 2BZ1A 3I12A 1A7KA 3TNFA 1I01A 1Z8FA 2Y4NA 4ZEXA 1P0CA 4F60A 3GGDA 1Y37A 2J9RA 1W0CA 3DMRA 1VBMA 1E2PA 2H7CA 3N8GA 3B6KA 5FUBA 5JSYA 3VGPA 1ORTA 1XHEA 2ZAOA 1KPGA 2Z2KA 3IPYA 1KI7A 2CVZA 4RTPA 2H3EA 2BFOA 4WKGA 1VPTA 2H0QA 2GK3A 3B1VA 2ZGVA 4L72A 1IOVA 1T1JA 4J9UE 1TPYA 4OXIA 1BDIA 2Q5LA 1A2KC 4IDHA 4MVJP 3JR3A 4QYIB 1AVTA 4YC7A 1NV8A 4L4RA 3W6ZA 1AO0A 3VR0A 4E5VA 4RTLA 5CK4A 3M9WA 4HNVA 2ZT8A 2VEDA 4US2R 5FPSA 2GD1O 3VPHA 5K6RA 2Y1DA 4KP7A 4LA4A 4IZIA 4PG8A 1U2TA 4UFNA 2Y8EA 3DBRA 4UNPA 4Q9IA 1IZYA 2SKEA 1TLLA 3QVLA 4TVOA 1WA5A 2OCDA 3EARA 3QJ5A 1HYBA 1UEJA 5G4LA 2DT8A 5LQCA 3HJGA 4OSOA 4AZ3A 3GDOA 3LIPA 3PFIA 4EW1A 3MGAA 4G5HA 1UP6A 3S2EA 1O97C 1N5RA 2PUEA 4JELA 4FGSA 4OI4A 2A5FA 4FYPA 4YDSA 4Q4AB 1BWRA 1E79A 1RNLA 4M46A 4XJSA 2JVIA 2DFNA 2IHTA 4JUCA 2AQHA 4GMXA 2IY8A 4FSXA 4TTJA 4Z9FA 3K73O 1MQAA 2LBPA 5JRZA 2AOTB 2F1KA 2BR5A 1CTQA 3AXTA 2OCIA 1T5LA 3CEHA 5ER6A 3QYPA 2J85A 3D1VA 4X3OA 2P0YA 3T7AA 4E5SA 4IDEA 4JXZA 1LFDB 4CDNA 3F3KA 2OCLA 3AJDA 5LKRA 1L4MA 1C2YA 1X0VA 2D13A 5DK6A 3T34A 2XWBF 4V03A 5SYAA 5JZVA 1ZR2A 4S0XA 4FFVA 3U3OA 2VUUA 1AJEA 1KAOA 1AUPA 1F1JA 2HV9A 3GUVA 4TMXA 3ADDA 4X8LA 1S7GA 3DHEA 3AR8A 1YBAA 2Q5OA 4AWXA 1R50A 4F6LA 2J5BA 5KAMA 5I8PA 3JQCA 5CP8A 5A0TA 3F3MA 4LPKA 5GONA 3AWDA 2QSZA 3BBPA 3NR2A 3NKLA 4JC5A 3RWMB 1N2CA 3Q5GA 3KV3O 4BMCA 1VDMA 3VGJA 2IIBA 2ZG6A 2XXAB 1ZSNA 4F38A 5FUYA 2INGX 2Q4OA 1AS2A 3JQ8B 5A4KA 4N0PA 4JXJA 3WMFA 2C2OA 5DHQA 5AVJA 3LVFO 2ZWAA 2C5AA 4CCSA 3MM4A 4MR9B 2AEFA 3JTMA 1ZC3A 3WZLA 5CVCA 3IB3A 1E3WA 2PZ8A 3SBDA 2WJJA 1ZUNB 3R3WA 3OD1A 4F96A 1Y3CE 3BE6A 4WASA 1FXUA 1A9ZA 3GLIA 3NEAA 1QTQA 4RD4A 3NWPA 5IK2D 1RW4A 3CLKA 2VQFB 3N2LA 5IYZF 2P4HX 3AR6A 3CEAA 4LECA 1X7ZB 4F86A 3SVLA 3V32A 3FDFA 1U11A 3C8ZA 1KQPA 621PA 1K7FB 5CJPA 3HCWA 4DIOA 3GWGA 1EWKA 1G41A 3EXG1 4TT8A 1QO7A 1YA8A 1ZY2A 1E6MA 2R1VA 1ADBA 4PAMA 4Q4HA 1B3BA 4YP9A 4E31A 4C6RA 1QGOA 4YCLA 2XDYA 4N7JA 1IUPA 4WGFA 4WDQA 1VJ5A 3MUOA 2NZUG 1O95D 1KAMA 2VYCA 3ILVA 1VSBA 2XBUA 5EPOA 4RZSA 3GBPA 1R7RA 2AI1A 2JVKA 1IQRA 3WLKX 1V6AA 1LJ8A 1G21A 4LSZA 4QWWA 4XGQA 4OHBA 1E61A 2D0DA 3LUFA 4PQEA 2W70A 4YRJA 3AZPA 1WZNA 2C2ZA 1RLIA 2JIZA 2KI5A 3VR6A 3KKMA 4FS3A 4MIEA 3ITEA 1MORA 1ZOPA 1RQ2A 4LFAB 2IXDA 1XF9A 4F5DA 2L18A 4I5GA 2VXBA 3WGZA 2PXXA 4JQSA 4MR8A 1GR1A 3DKPA 2I6FA 4CCWA 1F38A 2CEAA 3DV0B 2G4CA 4YRAA 1YOVB 1XD2A 1GVHA 5G0VA 2ZTLA 3HNRA 4FPXA 5GIPE 4E46A 2GCOA 4MKRA 4CLOA 5JAIA 1DINA 1O5IA 3E8SA 3I5MA 4MCJA 4NE7A 1WG8A 1G3MA 3E4DA 1Y48E 2UV8A 5FJJA 4CBVA 3E9ZA 3IIJA 5IX8A 2Z0MA 4DADA 4EO9A 2B5OA 3BMOA 3K0FA 3RCBA 4EBBA 2FPGB 4ZZIA 3HXOA 1OFGA 4NKRA 3ANLA 1DJLA 1Q12A 1DHRA 1J2UA 1KJIA 1WEKA 3D4OA 3KZXA 4HY3A 4UQPA 3LTNC 4IG4A 2XZTA 4AVYA 2FZWA 3ZJTA 3HJNA 1JLHA 4QBIA 3VYSB 3W90A 2HGZA 1QP0A 1CY0A 2NTEA 4Q7LA 1NU8A 2DKNA 5TGDA 1XCJA 4MGYR 3GA5A 3SX4A 4ENWA 3U4QA 1KK2A 2A9QA 1HGXA 1GUAA 3K6SB 4HHEA 1Y3HA 4INAA 1XIVA 4ZK6A 5K5EA 1Z17A 1KYIA 2JGLA 1E3EA 1RC1A 1GPJA 4OEHA 3CGWA 3RSZA 3AP1A 4P4NA 3VOBA 3PC8A 3THXB 4N0QA 1X1AA 3GF4A 3H18A 1II9A 1ZUWA 2OZKA 1HL7A 1YJAA 3DOEA 2JKZA 4W8OA 5JZBA 1N0UA 2IYQA 3BXHA 3IV9A 4B6RA 1G8YA 1XXLA 2A9KA 4MO9A 3CLUD 4WAUA 1SXJE 1R0WA 3CUWA 3HO6A 5LBUA 1EFAA 2YQZA 3ML1A 9LDTA 3I2FA 2CHQA 2RK6A 4PYLA 3I42A 3DHNA 4YCAA 5B58C 5BN4A 3P0HA 1E94E 4Z7QB 5KX5B 2CFTA 3TJMA 2GN9A 4V0OA 5B4UA 2B1IA 4LYGA 1ZLXA 2KBFA 3RNOA 4D9HA 4MYSA 1KVQA 3S5UA 5JOQA 1EDEA 1KKLA 3OEED 421PA 4A23A 5JUWA 3E3NA 4ZCTA 5DB4A 5DYGA 3WIEA 4GMDA 2V6JA 3AHGA 3GJ6A 3N0TA 2X0JA 1W9MA 4ARZB 5HS6A 2EOAA 3HDGA 3A0UA 1I24A 4R8SA 1XLVA 4Z51A 4XLTA 4LZJA 5K6AA 3EIHA 4GWKA 2I1VB 4P7BA 1TQHA 3ZU2A 4XGIA 2XB6A 3N3AC 5CVVA 3EVDA 3EQ7A 1RWNA 5JALA 3LQQA 1HE1C 2PBZA 3V7YA 2VP0A 1WM1A 1QF9A 3EJWA 4Y2QA 4DMHA 4HEQA 2GD6A 3OQBA 4RVUA 2AHOA 1NP7A 5FL3A 2QAIA 3BH0A 3CR7A 4UAGA 1UH5A 1G1MA 2PMDA 4WADA 2VOEA 3NHSA 1C3OA 1GADO 1VBNA 3WIDA 1LFAA 1N8SA 3GPDG 5COAA 5HW0A 1TAGA 3U7FB 2PZJA 4DYHA 1NKVA 1V5IA 4KAAA 4MI3A 2FMIA 3P4YA 3VR5D 3NAQA 2H52A 1V9LA 4HLUC 3FHLA 3WLNA 4OQXA 5HCNA 1TT7A 3L1HA 3H6GA 4PR3A 3U26A 4TUYA 5IABA 1T2UA 2ORED 1TD1A 1H2XA 4KTTE 5DWDA 5EKXA 4PFKA 2CD9A 4NYIR 3UKJA 2FR0A 4K26A 4F3YA 3KB2A 3BDAA 1JI0A 4N5HX 2G9VA 3VRHA 2YZ7A 5EMKA 1XF1A 3G02A 1M5UA 3GBSA 3R23A 4D6XA 5YASA 2ZRQA 4AJEA 4ZT3A 2FQWA 1W87A 1QV6A 2DFPA 2PQMA 4XCVA 4EPXA 5LU9A 2HIAA 3PHCA 3FMGA 4TLLB 5LZ4A 2FP4B 4IZOA 3EXFA 5HE9A 5IXSA 3FCAA 2P1RA 5ESRA 1G63A 1JVNA 1NF8A 1J1UA 3R74A 4F9FA 4QNRA 4TROA 4YV0A 3PB3A 2YRXA 4CMAA 5A9SB 4HJRA 1HXHA 4X20A 1IHUA 2YASA 3K6RA 2C57A 4CIWA 2YKGA 2XZOA 3WK9A 4EG3A 1SKMA 1E77A 2XYHA 1JFFA 2OCYC 3HYRA 4EKGA 3KELA 1SC4A 4LXQA 4R2LA 5K03A 3LUGA 3OFSA 1YR1A 1FJ2A 1WW3A 3WRYC 3WYFA 3VUEA 1PL0A 4G85A 4HSEA 1UT8A 4P5EA 3SC3A 3W6UA 2G82A 4L1KA 2JLCA 3Q2IA 3HU5A 3PR2B 4MRNA 5EWLA 2C0QA 1Q0RA 1RWOA 1Z37A 2F2TA 2PFGA 3JD1A 1XRRA 4LZNA 1U5BB 1WS6A 3DYBA 2HU2A 5EJ7A 2E5WA 3OM9A 3R6LA 3LTEA 4S1OA 1Z83A 2BJVA 4P3KA 5E1BA 5EJ4A 5L4NA 1WUKS 5LWHA 1W8IA 2NACA 1AZLA 2GXSA 2CL0X 1EQUA 1KYYA 4EUFA 4CODB 1V7ZA 1Z74A 3PENA 1DO2A 4US0R 4BFWA 3K30A 1GPWB 1QGUB 2AG1A 3T4XA 2DU8A 5KYUA 2KWIA 2ZLBA 3CVVA 2AK3A 2VXCA 3ST7A 3KQHA 2YJNA 3AKYA 2HN9A 3DDHA 4CM5A 2NVUA 4XKJA 2P9BA 5IYZB 4A8JB 1YDGA 3IT3A 3ILSA 1WCWA 3ILHA 4GUAA 3DAPA 5TQ2A 4CKWB 5JY1A 3THYA 1GUDA 3ORSA 4F8YA 3T9EA 4Q02A 1K0UA 3L8MA 4IFTA 4JYCA 4HEA6 3LCUA 1EUCB 1EZ1A 4M36A 4A73A 2P9EA 3LCCA 2UYGA 3FHTA 3ODGA 3A11A 5T8KA 1WMFA 1XTRA 3CV3A 4QXQA 3ZJUA 3BS4A 1GU7A 1O94C 3G2IA 4CEJA 1D0SA 4QLBA 4YMSA 2QRUA 3BWYA 4F3TA 1HDEA 4WNYA 3EW7A 2ZRMA 4AG3A 1VIVA 2V7QA 4DV4B 4CIVA 1SK9A 2O2SA 2ZIWB 3C2QA 2FNAA 1Z4OA 3HV2A 1DPGA 4V2IA 1TVMA 2ADMA 2OV4A 4G5GA 4XVRA 5AJHA 3RKRA 1BVHA 1DEHA 3NGXA 3PJEA 3NPMA 1K7XB 3X1ZA 3PV0A 5FTNA 2Q5JA 3PKJA 1C1HA 2G72A 3UK2A 2Z3ZA 3UMVA 3VNSA 5F5LA 3NM6B 4PHCA 1ZRNA 5DOZA 4GX0A 2W2MA 2H1VA 4AUKA 1EFPA 3VNAA 3N2NA 3WQHA 4MB6A 3CF0A 2PA3A 1NQWA 1TT5B 1TF2A 2GVZC 3IPAA 1IN6A 1AXRA 1DU4A 1RYZA 1IEWA 1XTIA 2XGSA 2OZPA 3CIOA 5IN4A 3ISJA 5EP3A 4AKTA 3E1SA 721PA 4C7OB 4DRXA 4YPOA 1EU1A 2R79A 3DE3X 1PS0A 4QU9A 2HPVA 3KCNA 1IG0A 2CWDA 2OGZA 2IU6A 3MJTA 1LWOA 1P75A 1PG0A 2B8NA 2J3MA 4CT0A 5C18A 10MHA 1EE1A 1J8QA 5AKIA 1KO8A 4HWTA 5JR3A 3MINA 1DIGA 4ZTZB 4YT4A 1HQKA 1X80A 1ESDA 2GZDA 3RAPR 1FZTA 2XLCA 1T5IA 1ZD8A 4DJTA 5A5DA 1ZIYA 2QTTA 3DZJA 4UM9B 4WJKB 1KJNA 1CJCA 4OQ4A 4QTXA 1CEQA 2YS7A 1CUWA 1XNGA 2VC2B 4G5QA 3SEAA 2VS1A 1KJWA 1R9NA 2GF0A 4PZZA 4R16A 1EFRA 2FWNA 4R1TA 4RJJA 1HT3A 3BF7A 5BUCA 2QTRA 1SHKA 2BFFB 5AUQA 1AMOA 3DDWA 3MCTA 3PUZA 3U16A 3CUUA 1YZKA 1XZLA 2RIRA 2GPTA 2YY7A 4N7MA 3WO1A 1NMQA 4TMTA 3SS8A 3FYUA 5JZOA 4L5AA 1EDZA 5BWOA 2G77B 3K1JA 1CDDA 1SRRA 4TS1A 3TCXB 5GONF 2VNKA 4N1AA 3B1WA 1U7ZA 9ATCA 1G20E 2A2ZA 2W83A 4ZKEA 4E3WA 3AHEA 5JU6A 2FETA 1B0ZA 1GPAA 2HXGA 3V00A 1OC2A 4R2XA 2EL7A 5L6LB 1Z88A 3MWDA 3OJ0A 2C4HA 1Z4IA 4YRDA 5HX7A 2GF9A 3STXA 2O7QA 1HRKA 5DGXA 3JQ6A 3VR4D 2UUCB 2AJBA 3M89A 3MILA 3PD0A 2I71A 1NI4A 3VJKA 2B61A 1PF7E 2CDNA 3LAWA 1YIOA 2GNOA 3IKLA 3L2OB 4M0FA 4PPYA 1IEVA 1ZX1A 3NHFA 2QZJA 3UJ8A 2GHRA 2PJRA 2B4QA 3ZXUB 2V0NA 4H9GA 4B4DA 3RO7A 1SELA 4JJZA 1H8HD 4XWAA 2YRFA 5COBA 1JG4A 5HDBB 3G1WA 3JZFA 3PF9A 3RS9A 3B6ZA 3QYJA 1RYNA 4DQ0A 3D43A 3L0CA 4KMMA 4A2PA 2P69A 1EAMA 3IC5A 2Z83A 4IP0A 2W98A 4BJ5A 2HQSA 1NV9A 1FTNA 2ASEA 2GMWA 4M9XA 1DIHA 4H0NA 2D06A 1JH8A 4WOKA 3AHHA 1L5FA 2GJAA 4Y6QA 5ICSA 3VPDA 3I2KA 1UMDB 4IFEA 1YBFA 2L0XA 1DS6A 2FHSA 2G9ZA 3EVZA 3PFFA 1T6XA 5C31A 1DBIA 2ZUUA 5K0JA 2VT7A 2JI4A 1MZPA 2G6TA 4BLUA 3LZ6A 1EWYA 4B9AA 4IJQA 1IBRA 2GESA 4D5EA 2Z5LA 1WBBA 2BLNA 2C4WA 2B8TA 3PE4A 2FF7A 4W63A 4WVFA 2QT0A 4B5LA 5FPHA 5AQEA 1PLLA 1UBLS 4FDTA 2YR0A 2NUAB 2ENUA 2MU1A 1Y3AA 4TSFA 1FDSA 2P5YA 1KXJA 3UMRA 2NPIA 1P5RA 1T5SA 3RABA 1L7RA 3I04M 4NXMB 1A2OA 3ECAA 4I3HA 2PZEA 3TRHA 2EGUA 1CR2A 1PJ4A 1U0BB 1SKBA 3Q9LA 1RMYA 3TLZA 4HV4A 5D5HA 3QKRA 4IRMA 3RIGA 5F9FA 1P5JA 3CVJA 1A69A 1N2EA 1NJ6A 3TH5A 3AFGA 5DU2A 4N48A 2XDAA 1PEAA 3RU9A 5IC6A 1T8RA 1I4TD 2IA5A 2REQB 4UFOA 5HM8A 4QGSA 4JCOA 1LVGA 1K4MA 2XCIA 2BI4A 2ZR8A 2QRJA 1FBTA 3JYNA 5EESA 5C4GB 1X70A 2HPZA 1GO2A 3A31A 3SSOA 1ZGAA 1NW3A 4F3NA 3O4FA 3PCTA 1S01A 4BVHA 4LKRA 3M5DA 5DIFA 4OU4A 4OHYA 1CIPA 2RGCA 5JEEA 1CWUA 1H94A 2RH4A 3UATA 2H8GA 4IFIA 1JSXA 3REOA 4AN1A 2W90A 4BJHB 5L9AA 4TX1A 1A2BA 1TM5E 4FUTA 4QPPA 5B57C 1EFVA 5AVXA 3IUBA 4RD1A 2AFIE 2ZVQX 3X2SA 2IZ5A 4ISCA 3PWKA 5H70A 1M0SA 4D45A 4PLFA 2DETA 1HOXA 4E2YA 5B5SA 1GQFA 2FHPA 1F3LA 2JCYA 2O4CA 2O5RA 4JENA 3EGXB 1UJMA 1U7WA 4ZEMA 1WWKA 1EA7A 3FNBA 1TQ6A 4MUIA 3DQPA 4WY8A 2ONJA 4LYAA 3MERA 4P08A 1QGDA 3AR7A 4G6ZA 4MKGA 2WSIA 6NULA 4EI8A 2B20A 4BKMA 4G4SP 4PLCA 1VA5A 3ONNA 2WUFA 3GI1A 4L7VA 2C2XA 3OSUA 3ABZA 3G59A 4L0MA 4U1RA 2P77A 5J2UA 1F8FA 4UUNA 2QRNA 3NHZA 2CF6A 3DWIA 3FRJA 2OWEA 3P9YA 4JC8A 3U49A 4CM6A 5K0ZA 1HYHA 3TPFA 2QRGA 5MGBA 3DL0A 4C9BA 1NNSA 2FN4A 1T0IA 1MT3A 1JNYA 2I2WA 3BJRA 1PFVA 1I3KA 3KVOA 5HMMA 2JFWA 2NZYA 3IQIX 1M2JA 1OXXK 4UUMA 2F1IA 4JQYA 1G2IA 3F9CA 3VSBA 4ZI3A 3P9ZA 4HNHA 1V3QE 2KX7A 2Q5IA 1E1LA 2I7XA 4FWBA 3BB3A 2GUWA 4B81A 3IKVA 4L76A 5K2MA 5K3CA 2F7SA 1II8A 1PSDA 2DFVA 4FHZA 5EVJA 3RT7A 5AWFC 3VOAA 3A1UA 3HR7A 5LDDC 4B09A 1TECE 3IP7A 1IHDA 5JW6A 1YR6A 5IAJA 4B3SB 2CLHB 1X2BA 3MHPA 4LSWA 3PD7A 4N7RA 4RF2A 3A3YA 3KR2A 4G0NA 3TKLA 4IXNA 5HF5A 1IVSA 1FMJA 4G0VA 1I9GA 4RTOA 3RS7A 3H6KA 5J1TB 3VR3D 4CQMD 1YU9A 2XODA 3QFFA 4F1JA 5BN5A 3FKSD 3P20A 1RDFA 3FZNA 1WZEA 2GK7A 4JI6B 3ROEA 3IE0A 3W6NA 3OCXA 5AW8A 4X60A 4CDGA 4KIWA 2YZNA 3DBRB 1LSOA 4LQ4A 2RKOA 1FFEA 1IWPB 1K8YB 3DUFA 2QU7A 2G0NA 4X8MA 4EGFA 1KS9A 2FWPA 1UM9A 1ZM7A 4AZ3B 3BWCA 3BB1A 2ZTVA 3ZK7A 1CUHA 3AOGA 4AU1A 2OFWA 1RLJA 2G25A 3O83A 5CURA 3UJBA 1SBCA 2WKQA 3MCWA 1S3FA 3O8OB 3BGWA 4I4LA 3PL5A 1YCHA 3QUBA 4L28A 3BTUA 1YRAA 2E5FA 1H6BA 3ZY6A 2XMGA 4I9NA 2GAAA 3HSYA 4PSDA 4RKEA 1GZHB 1ZYUA 3H0EA 4LJRA 2XCTB 4K3VA 2JH8A 4KAXA 1KYQA 3WQRA 5T6BA 1KH1A 3EF0A 2Z95A 2QEQA 5JTTA 1LDNA 5CTJA 2Q4RA 3D4LA 4N8EA 1Y7LA 1SU8A 3KAKA 4FMPA 5FUXA 1VMKA 1JEDA 3M9XA 3OZUA 2VO1A 4EFKA 2ZP1A 5AUNB 1D2RA 1CUGA 4QAJA 1RWPA 1U31A 4HFRA 2AXEA 2XEDA 3IQZA 4G0ZA 4CLHA 3WWCA 3EXHC 2Q6OA 4ZVTA 2QPTA 2HD4A 4DGSA 3DM9B 4MA0A 5JVDA 2I55A 4HWRA 5GONB 1NMSA 3LSTA 4IO1A 4FCVA 3A6GA 2FJ0A 3MRVA 4OSPA 2XGOA 3RAJA 3TVTA 1Z63A 1B0AA 2BC9A 3R7BA 2QD5A 1B8PA 1ORIA 3MRTA 2AYXA 1AKRA 3IP5A 4DLLA 5BR1A 2JLXA 3CRW1 2XECA 1DBRA 1XD9A 2A4MA 3RVBA 4D8UA 3RFVA 1R88A 4L9SA 1EFCA 1RYYA 3GEMA 2GCIA 1J56A 1MEJA 1TK3A 4UEKA 5JCJD 4KO8A 3OCWA 3OIWA 4IV8A 1RP1A 4EHKA 1Y6ZA 5I9IA 1SQ5A 5JQGA 4EELA 1E3WB 3NM5A 3LLUA 5EINA 5JBIA 1G5QA 3OLYA 2R4TA 2RG7A 4FKMA 3E22A 3OTGA 4GLOA 2WIJA 4G3XA 4KAFA 2FFHA 1QH1A 5KTMA 3LMKA 3IE2A 3GLIB 5E4TA 2I6XA 1EK5A 1ZGHA 1H2BA 2PX6A 3KWFA 4KRXA 1KXZA 1PUJA 1N6KA 1C4XA 4KN9S 2WVHA 4L95C 1E20A 4BO3A 2B4KA 5KDOA 4RQAA 1DNPA 3T54A 2DP4E 2I8AA 5PNTA 5CAEA 1EK0A 3WMWA 3CWQA 3O38A 1E5VA 4JLJA 2KLHA 3BMXA 4IDGA 5BPFA 4CCYA 1T91A 3KOWA 4H1HA 4ZO8A 4A2CA 5I4KA 4H0FA 3M49A 2KE5A 2R1VB 5DKFA 2LPMA 4Q4HB 1VKRA 3RF6A 3GBVA 4O8CA 4E09A 2RGBA 1QYRA 2M2IA 4RQBA 5EMJA 2ERXA 3GEEA 4HGNA 3T3NA 1KF0A 3AV3A 3RUHA 4L6IA 5KU1A 1ZZEA 1WTCA 3A70A 4FX5A 3K05A 2KW5A 3PNKA 2PTGA 1W1WA 1N7IA 2B0CA 4IOLA 1Q0LA 1U6JA 4BC0A 4BMSA 1VE3A 5FIUA 4KNYA 1G21B 1VHDA 1C0PA 3FMOB 2A3RA 2BLLA 4JEHA 4YASA 1SNYA 5KNBD 3USCS 1V8ZA 1D0IA 1N36B 1IUOA 1LU9A 4NNJA 2JI9A 3IPCA 1YVEI 1Z0DA 4Y0AA 4F4HA 2OL4A 3OT5A 3O1HB 1QVRA 3QWIA 4W7HA 3D7KA 2I9KA 4P0PB 2GGSA 1RJDA 1NVVR 2K4MA 3AHFA 1XCOA 3E9NA 3GFQA 1DAKA 4MR8B 4TTRA 4V0KA 5MF6A 3O21A 2XYVA 5A06A 3KFVA 1X3SA 3RJ5A 5CEEA 1P4GA 5HF6A 3IMFA 2WWGA 1E3LA 4WK0B 3KDAA 2QLMA 1XD2B 2Z8YA 1C81A 1RI4A 3GT0A 3OT1A 4NG5A 4Q7MB 2QE7A 1SM4A 2GCOB 4CLOB 3OY7A 4RSHA 5DCYA 4RPLA 1V26A 3OO0A 4AROA 4ZQHA 3ZGOA 5JT1A 4IDFA 4MVCA 1T8PA 3EBPA 3QY9A 2NSYA 3FWPA 1ISJA 3RVDA 3V1YA 3HFSA 2BKVA 2J0UA 3L0IB 5I9BA 1TU4A 3BMOB 3CUYA 2CLMB 2ETXA 3A1VA 4M38A 4R4JA 4ZRMA 2Q2WA 3V4OA 2JANA 1XQWA 1N75A 2FEXA 4J9VA 2HRDA 2VNIA 3PUYA 1M2NA 1U0LA 2BMDA 4R6WA 3RT9A 3NJ4A 4FMBB 1I5OA 4CKEA 1CJSA 5JAQA 2B9EA 1UFVA 3NVDA 1E4OA 4J76A 3VI3B 1AHPA 3A14A 4JU9A 4G23A 4JLMA 5L45A 5BR8B 3RVLA 2M1ZA 3U4QB 2HA4A 3ROMA 5F51A 2JHPA 4S2EA 4WBXC 1G64A 5FHRA 4POAA 1CRPA 1NF3A 1P4RA 2TMGA 2VHWA 2ZIFA 3DG9A 4J07A 1N32B 4GWLA 4LJKA 1NJ5A 1T0JB 2ODBA 2OO5A 2ODEA 4QQNA 1E8NA 2D1QA 2X15A 3I1YA 4HAXA 4XB6B 1Q1NA 5EI5A 3SHOA 3A3NA 1KWKA 4XOUA 3V8MA 3ETDA 5IS2A 3TJZA 4EYEA 1UBKS 4S1TA 4BNIA 1EG2A 2NTVA 3JQBC 1JKIA 1MDBA 1W88B 2W2VA 4MIYA 2QMUA 4TS4A 4JI3B 1S7CA 5JARA 1O97D 1UBUS 3DTVA 5DMHA 2ZJ2A 1AX9A 5C0OE 4CN8A 5KIAA 2ZUEA 2ZJZA 2RHCA 4JMPA 1F60A 1OH8A 3HBMA 1Z16A 4L0CA 1Y8CA 4A6DA 3LS2A 2ZDHA 4PPQA 4O4JA 5BN4B 1N0HA 4N03A 1U1FA 3UAOA 2NVBA 3W3ZB 5DGDA 1EX6A 5EJGA 2PKRA 5AI8A 3BK2A 2X1HA 3G0IA 2JGNA 4BAGA 3IBTA 2O1EA 3OZ7A 1ZI9A 3LDAA 4UPDA 3CNEA 3DVQX 1E59A 2JEYA 2ILVA 2QUHA 2GAJA 5BT9A 3TKYA 5JMOA 3Q2KA 4OXXA 3FDXA 5HKBA 3LK7A 3G2JA 3F5MA 1JPJA 2O0LA 4GYWA 1FFXA 1B43A 4HX9A 1UQRA 4R2HA 1J99A 2J3HA 2DJ5A 3M9LA 2MSEB