1YJXA

Crystal structure of human b type phosphoglycerate mutase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
AAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycerate mutase 1
publication title Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase, hydrolase
total genus 79
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2005-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1yjxA00
1SKAA 1IHPA 4ARVA 1C81A 4IJ5A 3DCYA 1ND5A 1UJCA 3F2IA 1CVIA 3EZNA 1V37A 2EOAA 4D4JA 1XQ9A 5AK0A 2H52A 3DB1A 3ZHCA 2WU0A 4MA4A 3F3KA 2AXNA 2P2ZA 1SKBA 5PGMA 4ODIA 1H2FA 3O0TA 3FDZB 5HTKA 5CDHA 4E3WA 1E59A 3GP3A 4FDTA 2HPAA 2P6MA 2I1VB 2PA0A 4PZ9A 3KKKA 2YN2A 1DKLA 2P75A 4ARUA 1ND6A 2HHJA 3E9EA 1EBBA 2IKQA 2QNIA 1YFKA 3EOZA 3OI7A 2WNIA 3BIFA 1NT4A 1H2EA 3IT0A 2EKZA 4JODA 3HJGA 3K4PA 3QPWA 4JOCA 2H4XA 2DWPA 2OWEA 4TSRA 3E9CA 1V7QA 3IT3A 1SK9A 3IT2A 4EO9A 1FZTA 1BIFA 2P6OA 2P78A 3C7TA 1DKPA 4D4KA 4GPIB 2ENUA 3QPVA 2P9YA 3D8HA 2ENWA 1QHFA 1T8PA 2A6PA 3QPUA 4HBZA 2WNHA 5AJYA 5AJZA 2YN0A 2BIFA 3FJYA 1TIPA 4QIHA 4AROA 1SK8A 3K4QA 3MXOA 1RPTA 2RFLA 4JOBA 1RIIA 2P9ZA 2H0QA 1UJBA 3IT1A 3MBKA 3D6AA 1DKQA 5AJXA 5AJVB 4ARSA 1QWOA 1C80A 4GPZA 4PGMA 2DWOA 1BQ4A 1DKOA 1E58A 5CX4A 2P79A 4EMBA 2EKBA 2HIAA 3NTLA 3GW8A 2H4ZA 1QFXA 3GP5A 2P9FA 1DKNA 2P30A 4IJ6A 2P2YA 5HR5A 3LNTA 2P77A 4FDUA 4D4MA 3R7AA 1FBTA 2GFIA 4D4LA 1K6MA 3D4IA 3LG2A 1BQ3A 1YJXA 3LL4A 3FDZA 5CU7A 1DKMA 3PGMA 2F90A 1C7ZA 3NFYA 2A9JA 4PZAA 2OWDA 1RPAA 3E9DA 5AJWA
chains in the Genus database with same CATH superfamily
1X7DA 5HOQA 2PFGA 2Q28A 2ZUUA 2Q4OA 3CTPA 3HFJA 4E2ZA 1GQYA 1Z6AA 2BMEA 3WGMA 2VBFA 3QEOA 5D7NA 1K7CA 3H1TA 4BGVA 2DBYA 2GAFA 1C30B 5F78A 4Z86A 4CFYA 1EIWA 2AG1A 2QR5A 1EFUA 4LXGA 2WTUA 2ZRDA 5FBLB 1QZXA 4TT3D 2GZDA 3AF2A 1GPUA 1H5QA 4BX0A 2CLFB 4BBPA 3MT7A 4Y9UA 1ZI9A 3GOQA 3TO5A 3USES 2FG5A 1ZN7A 2AWNA 3H5VA 4JJAA 1NUSA 4R83A 5EPOA 4JIGA 2XMSA 3TBFA 3H4VA 1N2CA 5JJBA 4JMPA 3DZIA 1TUGA 4HT3B 2IU3A 2O2GA 1NI3A 2QTCA 4P4SA 3HSKA 2BM1A 2AG6A 3R6TA 5HKAA 4AY2A 2YJNA 3JQRA 3WK8A 1UC8A 3SC4A 5CA1F 5CLFA 5J47A 5TJ9A 2G40A 4GKAA 5EP1A 1S3FA 4KE9A 4CRWB 3B60A 5CVTA 4JBXA 5EHZA 5CLQA 3GFRA 3VR3A 2JFYA 1H22A 3QNWA 1QLWA 1EQ2A 5KTOA 1T1GA 3P9IA 1ZRMA 3UJCA 2DYKA 3BA1A 1SHZA 3R77A 5CG1A 1DC3A 5LMCA 5HUJA 1TYCA 3ZTYA 1WXQA 3KVRA 3E9NA 2G06A 2O2XA 1W85A 3ZU4A 3OZTA 2OCGA 3WDLA 1DDOA 3RJZA 3VJMA 4JOCA 4IRUB 2ZCVA 5EWMB 5EERA 4MR7A 3KOMA 4CMIA 1H4QA 2O8EA 1QPBA 2JFUA 2P4HX 2QK4A 4RDXA 1IIRA 1DIGA 3K4HA 2XXAA 3SG0A 3PYMA 2FUKA 3OPMA 1EVLA 5JSZB 5CEFA 4BZPA 1WDWB 1GXSA 2IP4A 4WE3A 2C5AA 5I7FA 3HCAA 2XT6A 2G7ZA 4DDTA 2WUVA 3HJRA 3GJTA 4B4VA 4QUEA 3UB2A 2ERXA 4B5KA 3V7UA 2H1IA 4K46A 1G5RA 2QRHA 1ULZA 4AJ4A 2IPLA 4FOSA 4KNWA 3FNIA 5JXJA 3IV7A 4M87A 4J0GA 4D0LB 1GEGA 1G6KA 1ZRNA 3KXLA 3X1DA 1JDZA 3WLRA 4DN6A 1G1MA 1P0MA 2ZR7A 2PT7A 1RXSA 4TV8A 3V7YA 3T7EA 1X19A 2LE0A 2FN4A 2D4AA 3GEGA 4L9RA 4TKUB 4MTCA 5EJMA 1EX9A 2ZRLA 3RSLA 1AHHA 4NDNE 1KK2A 3RAEC 2ACKA 1GL3A 1I4EB 3G13A 2I65A 3JARA 4RD0A 4E03A 2DJIA 1L8XA 2P2DA 4DCJA 5HBRA 2YICA 3B7PA 3U3ZA 5LFAA 4EKDA 3AQIA 4I1VA 3S1SA 2ZWVA 4B0PA 3KSDO 5BSWA 5A06A 4PR3A 2RJNA 2OOKA 5T67A 3F7TA 3JZIA 3C5CA 1IBKB 1LDNA 1SVLA 3EZ6A 2GM9A 4ZGWA 4AP6A 3AUSA 2XTAA 1SZCA 2WAOA 3HXQA 1AGYA 1S1MA 3ZHSA 3KZVA 4JD5A 1JFSA 1Z8FA 4UTRA 4G4IA 3H11A 3HNPA 1JALA 3MMSA 2REQB 4X6LA 1Y80A 2XQJA 3CEHA 1H2WA 2VPWA 2EGUA 1NQOA 2IDMA 2Q6IA 3MELA 1Q57A 3FYTA 4R2MA 5HRUA 4AS1A 4X60A 5JVDB 4C14A 2WHPB 3EYAA 1QH0A 1Y33E 2IVZA 4LZJA 4KYVA 1S2LA 5JBNA 3TR5A 4U4AA 2L42A 3AUTA 2Q6KA 4WLOA 4US2R 1XMQB 1KP3A 2XUPA 1YZUA 4YT8A 1GRRA 1SZDA 1U81A 3M6MD 5AWFC 3WADA 4JS0A 4C2AA 1FLDA 1IY0A 1YS4A 4GI3A 3WGJA 1WXXA 2BL4A 1YVDA 2RI6A 4EMTA 1O95D 3OQNA 1ACJA 2LIPA 3FDZB 1JDUA 1D2MA 1E3TA 1ESZA 2RGBA 4L5CA 2ISSD 4WA8A 1E59A 5G2OA 3T0FA 1R37A 3WG9A 3ZWDA 1GKKA 3EDCA 4MIYA 3O74A 2HLHA 1L7BA 3NS7A 4M9RA 2IBMA 2IYUA 3UBMA 1ZAYA 4JJZA 4WZ6A 4I4NA 2DH6A 2JIBA 4YMWA 1TK9A 3D4BA 5A4FS 4PO1A 4HDOB 2CL7X 1WXGA 1K4MA 3U40A 4BFWA 2I1QA 3N6VA 3OOYA 3O3CA 2PK3A 2J0UB 3AX6A 1QIKA 1W1IA 2FSIA 3DKRA 4Y6SA 4O1HA 3MCWA 1Z2AA 2GYUA 1LQ2A 3DE3X 5ENZA 3AKDA 1FYDA 1JQAA 5JCJD 3PX3A 3ZEIA 3TS1A 2WP0A 3NDIA 5BURA 3GRFA 5JS8A 3AM3A 4AF8A 2DR3A 4XWAA 4D4HA 2WLSA 3DBHB 1Y82A 3TRFA 2FWAA 1AF4A 1L4YA 4KHZA 3TX2A 5JSHA 4IR7A 4JNCA 3R7BA 3O91A 4Y2RA 3TM5A 5JCZA 1SG9A 1XIVA 3MS4A 4TVOA 1RQXA 1YNOA 2OWEA 3KQYA 2OD9A 4G65A 4Z8XA 1J4AA 4UDOA 3EGDB 4DV5B 3L7MA 3OPVA 2X7HA 1WHTB 4MRMB 1AO0A 1U0OC 2CBZA 2EW8A 5F33A 3AXTA 2H9YA 2ZJ2A 2XMPA 3SX4A 4MQMA 4XWOA 2I3DA 1O08A 3DDNA 4XUEA 4AMUA 4UNRA 5J5VA 3H2KA 1E62A 1FPMA 1RYFA 4BMZA 4AB1A 1GNLA 1L6RA 3NC4A 1MDBA 2Q5JA 4OUDB 2V7VA 4PWYA 5TB5A 4X95A 4KQ1A 4Z1OA 3VDNB 1LGYA 2DKFA 4FM9A 4J4HA 4H7HA 4CLHA 5HE9A 1COZA 5LZ4A 1U0FA 5CDFA 1CZHA 2JARA 3MUOA 2PRIA 1W30A 1OTYA 1WIWA 3IBFA 2ZJ5A 4FIDA 4I55B 5E9AA 2HIHA 5K3EA 4YHHB 5KOJA 4ARSA 2Q2VA 2IEDA 4YS6A 2QORA 1MFZA 4PGMA 1DKOA 3LL7A 1YU6A 2BEUA 1CD5A 2Z0MA 4H3HB 4MUKA 1MO4A 1YBVA 1GITA 5CEJA 3GFBA 3BEOA 4V1CB 2C98A 3PHBE 4IIFA 3PXXA 1KI7A 2Y0BA 4O0MA 4P08A 4Z0TA 1IB0A 2AJBA 4A0HA 1N32B 3KSRA 3T7RA 1BXKA 5KQSA 2XMGA 4Z4FA 4OK5A 1G8JA 4WMLA 4BNJA 5TF0A 5AHXA 4BVJA 3PDCA 1AMNA 1L8QA 3IUSA 4D4LA 3CO5A 4TMXA 2WUFA 4HTFB 3OEEA 1N0UA 1YQQA 2ODAA 4Q3OA 1RE1A 1OX6A 2L18A 1YJXA 3GGCA 1LB1B 4JX9A 3WWYA 3I04A 3M1LA 1T4DA 4E5NA 5K3AA 4O4LA 3I1IA 1IHDA 5AKKA 4E21A 2FDXA 2H5EA 5AH0A 1KMNA 1P73A 2JBHA 4EABA 3T1YB 1J8YF 2C9MA 4U7WA 1BFKA 5E4JA 4LBYA 1U1CA 4L5YA 4A6XA 2CHUA 5CFNA 4LXXA 1XMOB 3V4VB 4BGEA 1DADA 4IIJF 5DYGA 1F48A 3R3VA 3ZHCA 1RSZA 5HW0A 5KOYA 2IEBA 1PDOA 3TDKA 3HSYA 1Z9BA 1UJ2A 3ZWPA 1TEVA 1AK1A 3TQTA 1SB9A 2EKDA 3TJMA 2EWWA 4KOAA 3GFSA 5K6RA 2XTZA 2FW7A 2WINI 1E1YA 1RCTE 2J09A 5FXMA 3ZE6A 3RV4A 5HQ3A 5KNBA 1USGA 1J42A 1WUTA 2Q5OA 5E1OA 4PGGA 1IDOA 5E6RB 3LQKA 1HWYA 2ZB8A 1RKBA 1SXJD 3SBOA 3GRYA 3IB6A 1X1RA 3WJAA 3R9XA 2GEJA 3HU5A 1V11B 1OAOA 3P9SA 4P3OA 4DCCA 1X1BA 1MORA 4EECA 3JQPA 3AEQB 3LIIA 5F73A 3DT6A 1HEUA 3GJSA 1BA3A 2WOJA 2GBFA 4R1SA 2UXCB 4GOMD 2EFYA 4LNUA 5LXTF 2WD7A 1ZN8A 3ASZA 2C7GA 3TUZC 1UWKA 1E98A 1OX4A 2JVIA 3OP1A 5E4TA 3JVDA 1T9BA 2IYYA 3FOZA 2P5YA 1PDWA 4JP3A 3N0XA 5EYPA 1H1LB 2YX1A 1GPYA 1C7FA 1U1FA 1ZFNA 1T3TA 4YJHA 3ZWVA 4CM4A 5BVHA 4KR6A 4NZ9A 1BXRB 4CNBA 4WBNB 1NP3A 2GUWA 1P2TA 3KCNA 1YB4A 1PUJA 4W99A 4UOEA 1ZISA 3FMIA 3OTWA 1PJCA 3OCZA 2P6OA 2QQ5A 3MFYA 1XEAA 2OFXA 3OX1A 1J9EA 4FGSA 4WDQA 3TW6A 3M5DA 1Z5ZA 5D3MB 3EBLA 4BDTA 3SE0A 3BL8A 4TQUS 1JE1A 1P1KA 2IA5A 1Q0PA 3LY9A 3MW8A 3TQQA 3WTCA 1VIVA 1OIWA 1ZJJA 1KIAA 4U1RA 1NI5A 4OXKA 1L6IA 2Y1OA 3GCWA 4DJTA 2D7DA 1LSOA 1EZ4A 1CJMA 3HLKA 4OSOA 3AVUA 1SFRA 4FQ5A 1OE0A 5MN5A 5EAIA 1YB2A 2DPLA 4MW7A 1J5EB 2HJRA 4DUYB 3CRVA 2JGMA 4HCJA 2ID4A 2H2WA 1SCDA 3ZOKA 3PDIB 4OP1A 3CRNA 1EX6A 1GZ4A 1UC5B 1LS6A 1C1HA 2I87A 1UMKA 1JG6A 1L7AA 1MQ9A 1XQWA 2YJ5A 1KDPA 2GTIA 4RKRA 4Y2VA 2R8PA 1C3XA 1I9CA 2IU6A 3LT5A 3DHWC 1ATZA 2AC4A 3IPYA 2RI1A 1IFXA 4YEDA 3WI7A 4KH0A 2E2WA 1N4AA 2PVSA 2ZJ1A 4C30A 2HCRA 2M32A 3I3OA 4PYJA 1JTVA 4NKRA 2WJGA 2Z1MA 3NPMA 3LNTA 4H1VA 2F1RA 4XGNA 1KZ6A 3ZV6A 3R8XA 4B3CA 2FWBA 5J4YA 5EJFA 2R4QA 3G0HA 5HRCA 1N9GA 2VHJA 2YNMA 1C14A 3VDMA 1BX0A 2QG9A 5C3UA 2WWVD 4EIWA 2FW9A 3BGVA 3DCIA 2VH2A 2JDIA 3TR0A 5EWLA 1E79A 3BB4A 3BSYA 1LLUA 3KTOA 3OLWA 4LHXA 3VR4A 3VJLA 4C0AC 1YQWA 2YS7A 3VNAA 2FZKA 3V5NA 3JATB 3GYGA 4HSGA 1T6BY 2H2HA 2CEKA 1QIFA 4OYYA 1QFSA 1SVIA 2PEZA 4PS1A 2PSJA 1C9NA 1I7SB 3C3WA 4DB2A 1A7AA 4PYRA 1E3QA 1EJ6A 1MV5A 2QMEA 3A4NA 3DOUA 4MQEB 2Z9CA 3P27A 5AK0A 1P39A 2P7IA 2QVYX 2JKZA 3VHRA 1C8VB 4NU6A 1Z29A 5L40A 4NBWA 1E2JA 2L17A 4OBEA 1SXHA 1L5SA 2QLLA 5DM2A 1CC1S 1R9GA 4HQNA 3L6RA 4CQMB 1NTOA 3C1OA 1SCUB 5KSYA 4MDHA 2FPIB 2GI4A 3IEUA 1Z73A 3WGHA 1VHTA 2AGVA 4DJJA 3M83A 4P4UA 3AF3A 1R16A 4MV9A 4UBJA 2W83A 3RSSA 1UMDA 1WPQA 1XQ6A 3I2GA 3PYLA 1RAEA 3VR2D 4KE6A 4BNMA 1YCFA 1TNDA 2O7QA 1WKBA 1ND6A 2JAUA 3A6GA 3AV0B 3ET5A 4PG4A 4QGHA 2Y0EA 3I6ZA 2DFKB 5EIWA 1GL6A 4KR3A 2GXUA 3VBCA 1YXMA 2V9CA 5KTYA 1M2WA 2BFMA 2JAHA 1VP9A 2ZPUA 3DOJA 2R5NA 4F5EA 2AFHE 2BE7A 3IH5A 4B7AA 1S5PA 2DKNA 3UC5A 3ZWNA 4A0SA 3D3WB 4V2UA 3ELYA 3U7EB 4DMKA 2PV0A 4GPAA 4PG7A 5B36A 2C8LA 2EHDA 2V1XA 4N4AA 4ZK2A 1WMAA 2FCAA 3P5SA 4ZQEA 3KB2A 3QU2A 3UUGA 1TVKA 5CB0A 1GY8A 2KYRA 3E0XA 2YJGA 1YRQA 3RGGA 2XY4A 4XD2A 3BWEA 4W4TA 4CCYA 2BHTA 4B4OA 1DCKA 3HXKA 3N70A 3NVDA 5KNDD 4DV2B 4IIHA 4QATA 4TL7A 4BP1A 2M6RA 2IGTA 4F11A 5IT5A 1JKJA 4KIJA 5BNZA 1GTL1 4HGYA 3R76A 1O94A 4AW9A 1KVUA 1UKAA 3I5YA 3NHKA 3V4LA 3ZIAD 1DARA 1J9ZA 2ZSFA 1NMXA 2IT1A 1V3QE 1LLQA 2W2QA 2ZB2A 3QVWA 3QYPA 4G6ZA 5H7XA 2NOAA 4R01A 2YV3A 3UJHA 3AUAA 2UXBB 5CLJA 3KYDA 3HCWA 1YA6A 4PN3A 3JQBC 1C1XB 1XNHA 1Q0TA 3R0IA 1RNLA 3HO8A 3VVLA 3WMFA 1ZH6A 2VCHA 1U9IC 1R50A 3N58A 4GEKA 1G4HA 4M6WB 4MOWA 5HFAA 4F4IA 2BJHA 3ZHOA 2GT1A 2CMGA 1MW9X 1U2QA 2HZ7A 3R0JA 1CQWA 4IINA 4P84A 4PQGA 4Q66C 4QRHA 3TAHA 3OJFA 5FORA 4ALIA 4BNUA 4MR9B 1H6AA 4HNHA 3MJFA 4UBKA 4Q3NA 3Q88A 1PX2A 5HCIA 4ZZ3A 2WJJA 1YAJA 6Q21A 3BAFA 4MI9A 4C05A 4ZOQI 4INOA 2W42A 2AN9A 3LE8A 3TH5A 1Z8HA 3G8DA 3I52A 2IX3A 1RXUA 3OJEA 3U5TA 3U3MA 4GAEA 2XNDA 3BAZA 3NIGB 1C1YA 4XJXA 2HRCA 5CVDA 4WDRA 2PZAA 3LVRE 5B3KA 1TJ5A 1HKHA 4L9WA 4QGBA 1DG9A 1Y1LA 2DHDA 3HJNA 4MMZB 4Q4HB 1P9WA 3OJWA 5COQA 2PL3A 5DISB 3W7BA 1Z74A 1W0CA 4UULA 3DM5A 1T10A 2WIDA 4DIDA 3CZRA 3OFVA 1FXWA 5IX8A 2C7BA 2VJOA 1BQ3A 3LG2A 2C7QA 4M53A 5EG5A 2FKAA 1OFIA 3QLEA 1LV8A 3NLLA 4DNOA 5B3JC 4JJFA 4FZVA 4LHWA 3SXUB 2IEIA 1GSHA 2CLDX 2Z2IA 3X1YA 2VP5A 3FA2A 4CR8A 3GRUA 5AVQA 2WEKA 3EY4A 2VWHA 3OSZA 1V7CA 1JW9B 4M21A 3FHJA 2QTRA 3CURA 1K7XB 5CXSA 1ADBA 1Y89A 3DP9A 3OOEA 4BVAA 2PH7A 2PJRA 2H4FA 2JZOA 3BORA 3L4BC 1AN0A 1U80A 1XZMA 2DBQA 3R75A 5H0IA 1E3WB 1O97D 4E13A 4EI8A 5KINB 2ZYUX 1LDGA 1YI1A 4XJVA 4AD8A 1WAMA 3F3KA 3MGBA 5E2BA 1GPLA 4RJKA 1QK3A 2P3QA 4GG1A 4CQJA 1H2FA 3ZXSA 1PT5A 4E4RA 1GRQA 3ZZTA 3ZHVA 2QRZA 4FT2A 3E0QA 5FNVA 3KKMA 4KGDA 5G0VA 3SJCA 5CFLA 4AX4A 2I1VB 4WCDA 5JE8A 3A3YA 5KQPA 4O4IF 3IX7A 2PBRA 4Y6RA 1UP7A 3U7QB 3M82A 3QELB 1G7CA 3QWIA 4TRMA 3KALA 4G3XA 3RJ9A 1EFRA 1G8PA 2ACVA 2MDTA 4QOSA 5JQGF 1YFJA 1SOMA 5BYJA 3W2FA 2W6CX 3SS8A 3NB0A 3PFHA 2RHGB 3KR1A 1JIJA 1GCUA 1PCXA 2FLVA 4CI9A 3WLKX 5ARBA 1UZAA 2VUTA 3U0VA 3TLCA 1RC1A 4PLZA 4FZRA 3ROZA 1X7WB 5TMEA 4BFXA 2VTBA 2H5IA 1EFCA 2ATVA 2IVFA 1PN3A 1PJ2A 4Q6BA 5E9WA 3V1LA 4QFCA 3ZUGA 1DELA 2P9HA 2R62A 2VLIA 4WN3A 5KX5B 1U1DA 2BMWA 2QM7A 4I50B 5K8LA 4ZIRA 3EWAA 4KTVE 1NWCA 4JB8A 2Q5CA 4H3VA 1GQQA 5D1NA 3K0KA 4PY2A 3BK7A 4HGNA 4HRXA 1T8TA 5A04A 3KB6A 3GMIA 3M70A 3AHFA 3GA7A 4MQLA 4AU1A 2VSNA 5DT2A 1D2GA 3DEHA 1R9NA 2E85A 4WCFC 4XUDA 1J7JA 1F0PA 1IVNA 1CR6A 3EIOA 4AC9A 2Z3ZA 3JQ7A 3C3BA 3WL4A 2VDVE 4RQTA 1K0FA 2EBHX 3DVSX 3SC3A 2GZ1A 3GLFE 4OHYA 2VOJA 2WHYA 4WNYA 3ZEAA 4PE5B 2HC9A 3OAAD 4OHXA 1SPXA 1MEJA 2Q5FA 4YLEA 4XIGS 4ZAZA 5CXXA 4KXWA 3B9RA 1KP9A 1XNRB 1MH9A 1PS9A 3LV8A 3DL0A 1LPBB 3F6BX 4F06A 3TDNA 3UJ6A 1ZVKA 2H7XA 3MILA 4G84A 4ZYXA 3BTOA 3OCYA 2E0IA 3W2EA 2NZJA 2VYFA 1EJ2A 1I1OA 1YVUA 2OD7A 2ZIXB 4KU4A 4QDKA 2XKKA 1WD5A 2HJGA 3GJ4A 5FO0A 3FHOA 5FWXA 3PL5A 4RV9A 3LF1A 1SWVA 2XF2A 4N6OA 3ND7A 2C03A 4WZAA 1BDBA 3PE3A 1SCNE 1JI0A 5J9FA 4KLAA 1Y7IA 3N3BC 1TC2A 3ONNA 3PC2A 3T95A 4F71A 4EGSA 4ARBA 3KZCA 4AIRA 4AUNA 3KBOA 4ENQA 2C54A 1J5PA 2P77A 1BEZA 1KDOA 1TCAA 3LWBA 2QTBA 3R7NA 1G60A 4FBMA 3RKRA 3UWPA 2GHTA 2E1RA 3HZRA 2Y93A 3CN7A 4UNNA 2AEEA 1WSDA 4RD4A 1TKRA 1QG2A 3E84A 1NNSA 2Q62A 1YR7A 2ZJ6A 4M9XA 3NCTA 1OBOA 3DG9A 4GP6A 5GVRA 5TPWB 2IH2A 2OZLA 2YL2A 1RWNA 3CRRA 1ZC4A 2ZRHA 1Q44A 1C7QA 2V7QA 3GMDA 3IIJA 1NMYA 1NGSA 3T3OA 1SH7A 2WAYA 3AYXB 3KR9A 4M7RA 3L8GA 4FXOA 4TTPA 1Z6QA 3QWAA 4KO4S 3WSWA 1E66A 3KOOA 4BNWA 4IDAA 1MB4A 4CLEA 4GI2A 4DREA 1PBTA 4N01A 4NENB 3V8EA 4DMMA 1BW9B 3PNVA 1LEHA 3F8SA 3SYMA 4RCZA 3OKCA 4GMGA 4EA9A 3U3KA 4F6RA 1FMTA 4ENVA 1AU9A 1PX0A 3IHTA 1EDOA 4EFKA 3O4VA 3EIUA 3L8HA 1E64A 1UAYA 1JVNA 4WBSA 2FFBA 3TUJC 1ZI6A 1SC6A 2DLDA 4EJ0A 2CLEB 2G71A 1PYDA 2ZRNA 2RD2A 1N7IA 4GC5A 1P45A 3E3AA 3KQVA 4HDAA 3HH8A 1FC0A 1RYDA 4U6SA 4U6QA 1TLTA 4F9EA 1HGXA 3UGJA 2UZ1A 2VCYA 1VGQA 4UUQA 2G9RA 4IZOA 4LHEA 4JI1B 3OFSA 1ZVJA 1LK5A 2J31A 2JAPA 2O2JA 1L3BA 2PSEA 3HGMA 3V48A 3A2KA 3B5EA 3KXDA 3ZHRA 1Y7LA 3F5DA 4JBLA 4JLSA 1I32A 2GJKA 5TVGA 1JHZA 2WKRA 3V2GA 3ICOA 4D3ZA 2BEWA 3VDXA 3UJNA 2VHWA 2GM4A 2MSKA 4Y0VA 1NBWB 1ZJYA 4V38A 1VBMA 1NPTO 2ZEJA 4G37A 4LDJA 3TI7A 4AZSA 4C0QC 4CMEC 1B6SA 1QLJA 2D5CA 2QTGA 3KUXA 2OHVA 4XH9B 3RVSA 3RU2A 3I23A 3BH7A 4LRSB 2A0FA 2NVUB 4YRBA 1CX9B 5BUZA 3B6JA 3HWSA 3WLFA 4ZTUB 3CPJB 3NYIA 3MSXA 1PTJA 3B9PA 4RM2A 3OM9A 2H16A 2I4RA 5JI3E 2XKJE 4LTMA 1CFZA 2GBIA 4L3WA 1PZHA 1SOVA 5CCBA 2CXNA 3BB3A 3WLMA 4YQFA 4RLFA 3QBEA 1KL7A 3IHLA 3ZQJA 4PBRA 1RZUA 3IBSA 2WNHA 1JFVA 4CT4B 5JLAA 3I8OA 4ZQCB 1AKNA 2OC4A 3FJYA 1YHZA 3NIDB 3ADBA 5A5VA 1IY2A 1P6XA 2CKMA 3E23A 4OYRA 4WXPA 2QM8A 2Z5FA 4LVCA 3MCTA 1WV1A 1WZUA 1VA4A 5HUQA 4UU0A 1II9A 1P2BA 4C01A 5JATA 4QXMA 2JPDA 1LLFA 4DA7A 4U2GA 2IPOA 1QDUA 3GW8A 2D6FA 1JLKA 5AOBA 2LXNA 3IDAA 3FYDA 3HS3A 1I6KA 4TRJA 3U3XA 2XNSA 4LPSA 3V6LA 4EITA 6GPBA 3ICQB 3FOCA 5EXPA 2WSYB 3FGOA 1X7XB 2CJXA 2HBZA 2GNAA 3OT1A 2IE0A 4NCKA 3VH4A 4ER6A 4PCVA 5AO9A 1WSAA 3OQ6A 4NAHA 2VPQA 3NHAA 5CM2Z 1YF3A 3WBFA 4A1OA 2WJ6A 3TPFA 2J41A 5KNCD 2ZSBA 4G5SA 1X74A 1WCXA 2V7BA 3EDMA 4Y7DA 2Z43A 4J1QA 3VPFA 3HN2A 4QTXA 3HYRA 4I19A 5KC9A 1V5IA 2QYSA 4G0WA 1MTOA 2DM6A 2H1SA 5FOTA 2VT3A 4BO3A 1PLLA 3W3AD 1NVGA 4JYPA 4P38A 1Z34A 3EVDA 4NS4A 3RG2A 4UEOA 3UOWA 3WV5A 4YRGA 5M04A 3HXTA 2FJ0A 1JVBA 3N5CA 1U8FO 5BQFA 3O9VA 2Y67A 1JECA 5ILGA 1P5RA 1OFGA 2I7VA 3EFBA 4C6TB 3WQQA 2OXRA 4PR0A 5B2ZA 1DRWA 1S8FA 1RWKA 1D2CA 1ZJ4A 2H52A 3IVAA 4RBNA 4ALKA 2YV5A 1GQ2A 1NQ5A 3QMVA 3QVMA 2XZTA 3BE6A 4LQ4A 2X8JB 5CIYA 4YAKA 3O8QB 4A5OA 1XXHE 3U62A 1GPJA 4KN6A 2JG3A 3TGPA 4OLJA 4YJGA 1SB8A 1TT7A 2BLLA 2GVNA 5JAIA 1K7YA 1J0AA 4QYIB 3BHJA 3TZCA 5I9SA 3AJDA 4ML3A 2ZTLA 3NOVA 1NXOA 1ZIDA 2ETVA 1KYZA 4RK6A 4Y30A 3TRJA 3ZKAA 1QB8A 1QYDA 2IDKA 2ZJ0A 3B89A 5K4HA 3DBIA 3AERA 4WFQA 1A4IA 4X44A 5E6SA 4ZU3A 2BJVA 3RHZA 3QOYA 2E5WA 2FUG6 4IJKA 3AESB 3EPPA 1MB9A 4RFSB 1DUSA 3CHYA 4P2BA 1HR0B 2I4IA 1PW5A 2HSZA 4RY8A 2YASA 4G41A 1KY5A 4UAGA 1NBMD 2WFMA 3QPBA 1Z07A 3M5WA 3HBJA 4Q03A 4DMFA 3TTUA 2E7ZA 3UUWA 5E1BA 3LVFO 1XL0A 2WF7A 1HFJA 3DBRA 4ITUA 4UUMA 3OZAA 5K3FA 2CFOA 1MJNA 2ZJAA 2VYND 1DCFA 1FQJA 1YHYA 2ZYTX 4J0IA 4J1TA 4MW4A 1AQYA 2X8WA 4U8GA 1BS9A 4O5OA 2W48A 1ID1A 1KKLA 3PVSA 4Q3DA 4QA9A 4U7GA 2PA3A 4V24A 2EKQA 1IBRA 1JYFA 4X92A 1PD0A 4IQ0A 4QDUA 3C5HA 4I4TB 4IMJB 4YHBA 1JJIA 1FJ2A 1TPYA 4G5YA 3UWMA 3U7HB 3NBAA 8ATCA 2JA1A 3Q2OA 3ZU2A 4J94A 2H1CA 4E31A 1DBWA 4D9IA 2QT0A 3EQ2A 2P9TA 3H2ZA 4HNAB 3MIIA 1E6CA 3H0EA 4PG8A 3MUFA 1MO2A 5E8RA 3GPCA 1WDMA 2ZSDA 1UKYA 1NVWQ 3NXSA 4UZFA 1JEQA 4DIMA 5C52B 1IEVA 1RTTA 1AHNA 1TVMA 3KJQA 3DMPA 3ZI7A 2IS6A 4OTZA 1YBHA 1ZUD1 4C88A 5EJ5A 4BRSA 3ESXA 3DA8A 1U63A 3VPBA 1L4HA 3IAS6 3SHOA 4FN4A 4Z0HO 3V32A 2OXFA 1R8YA 3EMKA 1AHIA 1ESCA 1USVA 2G17A 3HA3A 4GM0A 4ZVPA 1UDRA 3KTAA 2QVCA 3EPKA 1BQ4A 4I66A 4N0DA 5FOXA 2OV1A 1GYRA 4AN1A 4IUCS 1CHDA 1F8XA 3OEHA 2ZBDA 3MTAA 5EZ6B 2FPWA 3MTEA 3CJQA 1Z5VA 1C7IA 2JK1A 3I9FA 4R1NA 4UHDA 4R69A 4YK7A 3T5BA 3X1ZA 5MFPA 1I5EA 1L5RA 1D09A 2R8ZA 4GBGA 1V7PC 2FZ4A 1TRHA 3WGGA 1CETA 1QUFA 3CEMA 4GSYA 2J7PA 5AW0A 5FOWA 2HADA 1XD8A 5JC8A 4X6UA 5FUYA 4IG4A 1LTKA 4Y8VA 4KUGA 3JAWA 3CUWA 4D8UA 5EJIA 4HDMA 3WL7A 4MR8B 3TTWA 3CLSC 3W90A 2OCPA 4MK4A 2D7CA 4WSOA 1X38A 2PS1A 2XMZA 5A7HA 3TKAA 2HO5A 2PZJA 2CL0X 3TIVA 5ICEA 1QGDA 4OQFA 1T8UA 2IYSA 2L0XA 2ECOA 3ZU5A 3DLPX 4UTZA 3TOVA 2BHLA 3ZGLA 1G8MA 1H69A 2VDMB 3BGWA 4DL9A 3ESDA 2AV6A 5AXBA 3FMVA 2I34A 1RI3A 3E22A 5JG7A 1JPNA 1H2HA 3NAMA 4OMCA 2C97A 1T25A 2PZMA 1UK7A 2XYPA 2J0EA 4CQLB 2DEUA 1GTZA 4N82A 4PSKA 3ETDA 2KM1A 3IRUA 3PDUA 4KR7A 3VZBA 1V16A 4W5QA 1YKFA 3QUQA 1E1DA 2ANCA 1EGQA 3G85A 3MC1A 2IH5A 2K7FA 1R5NA 3WYEA 1TAUA 9LDBA 2X4DA 2Y77A 4IVRA 1U0GA 4MV6A 3Q40A 1RAIA 2XUGA 2JRLA 3EH2A 5K45A 3TCXB 1EXNA 1HOXA 1T2AA 3J7AC 3U5ZB 5CPBA 4B3XA 1M1UA 2I4MA 2YS6A 3V4PB 3WX0A 2EJBA 3F9RA 1WUKS 1R7RA 3BGDA 3C3CA 3HZHA 3PEUA 5DN6D 4HRAA 5MN4A 1T6ZA 1GFIA 3L7JA 4HWRA 3WICA 3D4OA 1HE2A 1NVKA 3GWGA 4CKWA 1PE0A 3B2EA 4LOAA 3OJCA 3HBNA 1XKQA 3TL3A 3P8ZA 3UPUA 1T5BA 2QJRA 3H9BA 3W9BA 3GJ3A 1G6Q1 4AUEA 1DQRA 1N2CB 1N7HA 1MJFA 4GXQA 1GNRA 5FA8A 3TLAA 2AXQA 2C3OA 4O5AA 1RJDA 4P4SB 4X0EA 5KYKA 1M2KA 4TV9F 1R4ZA 3OTGA 5ALHA 4WLFA 2G72A 3A9SA 5GONF 4RTOA 1T5DX 2PZEA 3HVRA 1R64A 1AO3A 4A6EA 2Q5QA 3VPSA 3DL7A 4WQMA 1NR5A 5BQ3A 3IVMA 5TV2A 5CK4A 1PNRA 4M83A 4EHDA 1F2VA 2NO6A 4C0LA 3WGQA 1W85B 3UCFA 2H1VA 5DNYB 3PKJA 2BYTA 4NECA 3FF4A 1Y3HA 1AT1A 4MR7B 3ZCPA 1QK4A 1IHUA 5K6AA 2XNHA 2Z2YA 2FWPA 1KIMA 1V5EA 4CMIB 2O8EB 1S7CA 1J1UA 1I1HA 1RRVA 2PUCA 2XXAB 5CLGA 3M1IA 3GPDG 5HZMA 4CEHA 2EL7A 1JHQA 1GXSB 4DEYA 2X0RA 3EMBA 5IXJA 4RD3A 4NCNA 4UTPA 5ESRA 5CBPA 4TMFA 4FOTA 1CUIA 1H05A 2CC2A 4M9UA 2BEJA 3L18A 3JPWA 1YK1A 3QLVC 1SBHA 4UFOA 2VC2B 3ZBPA 1EWTA 2V5VA 4RJJA 4ETMA 5J1TB 4TVKA 2D1FA 2ZWMA 5REQA 4TV8B 4AKGA 1NN0A 2YHIA 1F51E 3C85A 1B73A 2RGNA 3D7RA 4WXHA 1BOFA 2IXDA 2WA1A 1JILA 1QTRA 2EARA 1SKAA 2E1PA 4ECEA 5CA1A 5JYEA 3FXAA 4CMCA 5CW2A 3S28A 1JH8A 3JARB 4B3HA 2LCQA 5L95A 3MWLA 4NH4A 2VUIB 1KTIA 1JEOA 3A9TA 3HU2A 2H2IA 2REBA 4N7RA 4E5YA 2G0TA 2KW5A 2QD2A 2ZRQA 2P2SA 4GF5A 3ED5A 4GEGA 1U0TA 2B8JA 3DZKA 4K6OA 3GL9A 3JALA 4ODIA 3EXHA 4OIMA 3RFVA 2XSZD 1TXGA 3LHKA 1Z2PX 1K2VN 3KETA 1BC5A 2CN1A 2X6TA 1NDHA 2C8VA 5I9MA 4DJ5X 2CW5A 3H11B 3K1JA 3V8BA 2XGJA 4HLQB 3L7AA 1JWAB 1XD9A 3K0CC 2Z98A 3MGGA 1XKLA 3OETA 4QT0A 4MUMA 3LF2A 2IPMA 3CIOA 4TWJA 4CG3A 5A6VA 3L4SO 4AUKA 4MUXA 1S2NA 5EKDA 3AVVA 4K9NA 2A0WA 1WCIA 1YS6A 4YP9A 4BZWA 3T94A 4BQPA 2QRGA 1MNQA 1RWXA 4RO0A 3GGGA 3V1NA 4MWBA 4FMDF 1OR8A 2HREA 2GSDA 3RHSA 4XYGA 1LRLA 4B3DA 1ISFA 3DLCA 2WYWA 3AK4A 4Y6QA 4YECA 4XOIA 1GGMA 4P54A 2OC9A 1F8GA 4Z4HA 4KMSA 3CPSA 1C8BA 3PUIA 5EUQB 3T34A 4LF7B 4RVGA 1XTSA 4QGFA 1NVFA 4NDZA 3NQ41 4G8CA 5JDCC 3BXZA 4OHWA 4PZYA 1NOJA 5JARA 1N7GA 1H5UA 5ALIA 1QU3A 4LNAA 1MCZA 1ZCAA 2I8AA 4OI1A 2NYAA 1FP4A 4DVJA 4F2DA 4YX9A 1W4AA 1P9OA 1SQ5A 2P78A 3NWPA 2DETA 1H2ZA 1XAHA 3HACA 4MS1A 3GVXA 4EJMA 3JXEA 1NKSA 3G6KA 4ZOAA 4RX1A 3GAMA 2I4TA 1ZI8A 1JQBA 2H11A 1B1AA 2FGKA 5E9QA 3NU1A 5CITA 2PR7A 4Y2HA 3B6MA 1DQPA 1ZUHA 3BL5A 2H59A 3ZY6A 1U90A 1UM9A 1LTHR 2PKQP 4YO8A 3LBIA 2GPJA 3WSVA 3EF0A 2OK8A 3G5MA 5F3RA 3NEAA 4KW7A 1H93A 1D8AA 1KEVA 4LRQA 5TRTA 4I5FA 1XCJA 5LQRA 1UEIA 4I8DA 3SQDA 1TZCA 3JQDA 1JAYA 4KV7A 3ZJ4A 4QD3A 2NNWB 1VP3A 4FMCF 4J4TA 3X1JA 2KLHA 2JFNA 1PZXA 2BI8A 4LGVA 5CIWA 1N8TA 3OPQA 5LD2C 1MIHA 3NDPA 1MX9A 1PQWA 1S0UA 3GLUA 3KOYA 5L6MB 4CM9A 3CVVA 1E0SA 3N1UA 3CMMA 2Z83A 1TF7A 3CX4A 3CH7A 4UQOA 5IDWA 2K4MA 2PQ0A 4HD8A 2HA5A 3R7AA 1UPUA 1N2IA 1IQUA 1KO8A 2OCDA 1NBOA 1W96A 3W6NA 4A73A 3HCEA 2ODBA 2ZI9A 3ABZA 2I55A 3OF3A 4FQ8A 4UCXA 1G8YA 3VC3A 4RA9A 4E5VA 2J87A 2CUKA 4JQYA 5FBQB 1U7ZA 2YFHA 3SOPA 4JK3A 4MARA 5KMGA 4G5RA 1NOIA 1WTCA 1F7VA 2Z3VA 5B1DA 3M6IA 2FOXA 5KOJB 4RK0A 5ALOA 4TLDA 3I4FA 5GWXA 2FMHA 4ER3A 8MHTA 3WDMA 5CDUA 4KI0A 4H16A 1XTKA 2BEUB 1FRFS 2D1SA 4KPEC 4PLYA 1JU4A 1T5HX 5C1OA 1WXWA 3U1VA 2PSSA 3EEOA 1N6IA 4KDRA 9LDTA 4BKUA 2XCTB 4CPDA 3N2KA 2V7EA 3T4XA 5TIIA 3W8EA 5CB8A 4L76A 3ESBA 2FQXA 4KXMA 2QL6A 4YFYA 3A1UA 1WDLA 2X14A 3JTMA 5L4LA 3AHHA 3FKJA 2O8CA 1PT9A 1TOAA 4XOUA 4MVJH 2VRBA 1YDGA 2C29D 3C6QA 5CM9C 4KCGA 4W5HA 3RROA 5FWYA 3DF7A 1U7OA 4UQPA 1TJPB 2JGLA 2PO5A 3F3YA 3C7DB 3SP1A 3UJPA 3ZE9A 3DNPA 3QENA 4BBJA 2FFQA 5EXXA 4LJ8A 3E6AA 2DX7A 2JBAA 4FSDA 3LU1A 2O1WA 1QONA 5ANRB 1KFCB 4O8CA 4Z7OB 3BD7A 3UCEA 3G0OA 3M4NA 1BCSA 4FYIA 3I32A 4BCBA 1M6HA 1EFVA 1SOWA 3ZCRA 4M1YA 1MF7A 2Y0CA 3UT5A 3HGTA 1ILEA 2R8EA 4K6GA 4KYTA 4LA4A 2FMXA 2H9IA 3HL0A 2AJ8A 3RVDA 1U0LA 1DC6A 1TO2E 1G2OA 2XYQA 1HLPA 4J0FA 5T64A 3RWMB 4B82A 2VF5X 4NI5A 3F5SA 5HQ3B 4G0UA 3PCRB 3QEBZ 5FBHA 3LFUA 4F2PA 3UPTA 3VU8A 1TD1A 2WRZA 3QTTA 4P32A 4KN8A 3O8DA 4MRVA 4EQZA 1ABBA 3UJ8A 3R9XB 2ZKLA 2M2IA 3ZWWA 2WUGA 4RIHA 4MS3A 2F8MA 1RWOA 2HMSA 3FNEA 4HPWA 3WIOA 1PSZA 2DPHA 2JFPA 1S2GA 1N2HA 4NSNA 4RK4A 1NU8A 5AVYA 5KNDH 5ECWA 2X0KA 4LNUB 1DWQA 1OPRA 2WD7B 2FRDC 4C06A 5AKGA 4FEAA 3IIIA 2PBFA 1AN9A 1OX4B 3MCAA 5A9TA 3ZDDA 2KQUA 5KIAA 4IDNA 3B6IA 1SIBE 2HF8A 1O5OA 5JNVA 3EVGA 2B34A 5EYPB 4DUGD 3L82B 4CM4B 4YJHB 5BVHB 1P77A 2ALJA 2ZJ3A 1CEYA 5GZ1A 2J5QA 4FMBB 4NHEA 3E2MA 3LK6A 4K9KA 3RGWS 4B4KA 3AJ8A 4C4ZA 4ZPXA 1K4YA 2OM6A 5JEDA 2BFPA 4E07A 4RYLA 1EK0A 3QE4A 2XB6A 1TDJA 5KJEA 1JLHA 4P4NA 3U1BA 1SZPA 3OECA 2CMDA 1QMGA 3KEMA 3DDCA 3LWZA 3C4VA 5ARCA 4BLOA 1Q1EA 4IIJA 3BH0A 1EG2A 2AG5A 5BN1A 1DKNA 1Z4PX 1FVOA 2I9PA 5DMXA 2AMLA 4AJ1A 1KC3A 2YMMA 3EPRA 5A0FA 5FQOA 1JG7A 3QUTA 3VC2A 2GZMA 2HQRA 4YAUA 5HIJA 1T35A 4ISCA 1GTG1 1ODTC 2AJLI 3C3XA 3GFTA 5I4IA 1YDHA 2C0QA 3FKSA 4OP3A 1VM6A 4ID9A 1EEHA 4WNIA 1JYSA 3WRWA 3AHCA 4I6GA 3DWIA 5KNLA 2C5GA 2CNNA 1VHWA 2YRXA 2H4HA 2Q3CA 1XX6A 3R0ZA 1Z0SA 2UXDB 2XUFA 1VIMA 1Z16A 2WM9B 4CKZA 4OXYA 5AJUA 1E7MA 4PLVA 5EIXA 5LXTA 1UOOA 4BFTA 3K9LA 4R31A 2AQ8A 2JH3A 3DZFA 1TFUA 1QH9A 5KVQA 3FSEA 3SSAA 3LHSA 2AXNA 5EIAA 4UE3S 1RJ9A 1BEUB 1N9GB 1JR3A 1U8UA 2PX3A 4XD7A 3CE9A 1DCMA 5C9ZA 1ZN2A 1QBKC 4RHEA 2FPGA 4QYSA 2EBWA 1DOZA 1SHJA 4QEZA 5CT4A 1Q2UA 5EWLB 3DAYA 2V54A 3PKIA 3DAFA 3WHLA 1DKLA 1M1NA 2PXAA 5AVTA 3V1TC 5K0BA 4G81A 4A9AA 1P4GA 1Z5WA 1Q0RA 2IKQA 4ZCSA 1L5LA 3ZDXB 1O4VA 4AY3A 4URXR 2VDQB 2XRZA 4LJLA 5K09A 4BNLA 1QX4A 5HF8A 3WK6A 3GFFA 2PY6A 4LMRA 2RE8A 3ZNQA 1WR8A 2ZS8A 1Z6YA 2WNIA 4H31A 3MMPA 2HBQA 3D7SA 2ZBUA 4K0RA 1CB0A 1AZSC 3EOAI 2ZCJA 4AKTA 3LLCA 2HD4A 3OPXA 3KB8A 4PHTA 1DPGA 4O0LA 4V02A 4RZIA 1FDSA 1KJ9A 2FETA 2PZFA 3MWYW 1H3EA 3AJ9A 1UMDB 1G21E 1HDXA 2GO1A 3EA5A 3CC8A 2O8VA 3Q5GA 3UXMA 5TLSA 3KE8A 2IQIA 2OV3A 1CIPA 2DMRA 3Q7TA 1Y7HA 1VJ0A 2I7DA 1N7JA 1FFDA 2EDAA 2WDZA 3EISA 3VHQA 2A0KA 3BF8A 2R48A 5AVJA 5AXCA 3G1UA 4BB5A 2G0AA 2WSSD 1IAVA 4PC1A 4K8RB 2OV8A 3WLTA 4AZWA 1GADO 3O2SB 4ROSA 4COKA 2YMLA 4F6CA 3LCRA 2A6PA 3EVAA 3UYKA 1O5IA 2O0KA 1NUUA 3TSCA 2PMBA 2R8RA 2ZPTX 3Q0EA 4QU5A 1XZJA 3N28A 1CUAA 4RPKA 3TQRA 1SOAA 4EP1A 1E2QA 1TVKB 2J30A 4QXPA 1P1RA 4CCYB 1VXOA 4LF6B 1HZJA 4RZ3A 3QOWA 3SCZA 2O3SA 2P9ZA 3I9V6 3LYAA 1JKJB 1XE3A 1N6HA 2MIIA 2RH9B 1RQGA 3CR8A 2F8SA 2J3LA 3VKUA 1ZEMA 4PANA 3V55A 4KQCA 2EKBA 1ZM2A 3E27A 1PU2A 5LKRA 1ZMXA 1Q3HA 1HE1C 2O48X 3UWDA 1DXYA 3IEMA 2YTZA 2AQKA 2D1RA 2XB9A 3LK7A 3KYDB 2PX4A 4ZK6A 5C1PA 3H9JA 4WACA 4CKYA 3EUFA 1JQ3A 1MOQA 2YZ2A 2N1BA 4Z8YA 1IJFA 3D8SA 2B78A 1P62B 3CBQA 1DLIA 5JNSA 1HDGO 2YJTD 3I42A 4J0JA 1FUKA 3LUBA 3MRXA 1WW8A 3B13B 2F4VB 3TWOA 5C8XA 3HCPA 3H2BA 4WUVA 3KHKA 2EQ5A 3FPJA 4Q1VA 4UKDA 4V2IA 2QOEA 1TD9A 2ERYA 2RHHA 1W48A 1Y3AA 3G9ZA 2OSVA 2BJWA 3ZOZA 2Y3IA 3TOSA 3BFPA 1JG2A 4WJLA 2Z6VA 4F21A 4YP5A 2JFGA 4ALNA 1FUEA 2OBBA 2PSHA 4Z4CA 4RESA 1NPYA 3IP8A 5JT1A 4B81A 2YUTA 3KZOA 1T3ZA 4C3UA 4EO7A 2W2KA 3EC1A 4QC2A 4EZEA 1LSUA 1A69A 1R12A 2FSPA 2XZDA 4GVPA 1ESEA 3KOXA 5AUQA 3PSHA 5JMPA 1G7SA 3GI1A 2I6FA 3ZWMA 4KQ2A 4B48A 1OQAA 4FSXA 2J3MA 2PPLA 5EI5A 2JLUA 4NC9A 1U8XX 4WLVA 1KJJA 2OBXA 2EYUA 5ITZA 3DE5X 4Q24A 2BUCA 3PEFA 5K99A 2FZLA 2WVGA 4JV5B 3GNSA 4JJKA 2HGZA 3PQ5A 4B71A 4IOLA 2YYSA 3BD9A 4TLBA 4D44A 5JW6A 3Q3CA 3A1SA 4XTCS 1JDBC 3SZUA 3OIUA 3ANSA 5EMKA 4RTQA 2QSJA 2B94A 4IZ6A 4ZVTA 3UG6A 5IJZA 4AKHA 1KARA 2OORA 4ZVLA 4GRAA 4MEJA 2QZPA 3CF6R 3RWOA 1Y5LA 4RZUA 3KV3O 3PRYA 1QGOA 1OV6A 5FNVB 3D6JA 2QRNA 4V0SA 4H4CA 3VVMA 1EE1A 1M74A 4EZIA 3RK4A 5ERGB 4V0ME 3GEHA 3GLGA 1HMYA 1EFPA 2GEBA 3AIKA 4IG9A 2W2OA 5IWAB 4DXDA 2OB2A 3ELUA 3UOGA 4RPGA 5HSGA 3U3OA 2NAPA 2BWJA 3EXIA 1XHFA 2QX9A 3HHPA 3M3HA 5KDLA 3VKWA 3PC8C 2NQ2C 4AECA 4A2QA 5JTTA 5K4GA 3DFZA 4PXYA 4OX9Y 5ED4A 1VLJA 4IGIA 4I99A 3HA2A 2VTBB 2XLBA 1SWWA 1FYFA 5FKJA 1P60A 2E4UA 2O05A 4R7GA 2BIFA 1T2VA 5K0LA 6REQA 4YN3A 1IRXA 4A2PA 4NZOA 4EB3A 3CB4A 5EXEA 4FB5A 1EGAA 1RPTA 3QXHA 4L8VA 7ABPA 2DG2A 3K3PA 3N8DA 1BWSA 2O1XA 5BNFA 2PUEA 4C1BA 3WQHA 3SYTA 4MYDA 3C4QA 4CE6A 4QHTA 1OWNA 4Q48A 5BR1A 4ZVVA 5IF3A 3JY6A 4FOPA 5BRAA 1NJGA 5NULA 3JQ7B 3DONA 4CUJA 3DEIA 5LJIA 3BYZA 2PMCA 1H66A 3HPQA 3KOZA 4PW0A 3VTFA 3WGZA 4JT4A 5LYJA 3K0EA 1Y3IA 1MFPA 2BRUA 1H2XA 3PIDA 4HXYA 1T4CA 4UHJA 1PNTA 4LQCA 2XB2A 5F77A 1Q7EA 3QX3A 3ZDRA 1M73E 4LYYA 1M8GA 4F97A 3V3KA 2K5UA 3CCBA 1DFGA 1A0OA 3JW8A 4I8IA 4IQ4A 1WEKA 4M55A 2VSFA 2JJ1D 1W75A 2QRVA 3ETJA 2W4QA 1K5PA 2HLDA 2X8AA 2QVXX 2WM8A 4O4IA 4D9MA 4ZO8A 1QZTA 3L93A 4A6PA 5E2AA 3UMFA 2RB5A 4B6RA 4C5BA 5JQGA 5FWXB 2VXBA 4IL5A 4JELA 1LZLA 3HBMA 3TD2A 1CULC 2VTVA 5KNCH 5CK5A 2FPPA 1NTRA 4WZAB 4WKCA 2VJQA 5GZ6A 5TS3A 3N3AC 1DJLA 1Q3KA 3G89A 3GT4A 2V8OA 1CRLA 4YH1A 1AURA 5F4BA 5D7BA 1E3DA 3BXPA 3JVUA 3WZMA 4FB4A 1OLSA 1CDDA 2F6RA 5HIKA 4Y3UA 1QIJA 1MX3A 2N0SA 1CR2A 1U2PA 2R6FA 2QAIA 3LCJA 3WVNA 1OFVA 5FBKA 3TR6A 3DEFA 4CHTA 2QY9A 1N0IA 3E5NA 2OT3B 3OX2A 4DADA 4R8SA 3BBLA 3WFZA 5JZSA 3EPJA 1E2EA 1VHJA 1Y9DA 3RF6A 1DC8A 1Q1BA 1ZZGA 2FV8A 3L7CA 3PVCA 2QQGA 4KQIA 3H42B 3FTEA 2OZLB 4PHHA 3UB3A 4NG5A 4X1IA 3JRXA 5E1MA 4U5XA 4U3JA 1N6OA 2JEZA 2OSBA 2RHMA 2XTJA 3CLSD 5SZJA 5AR1A 5K8VA 3IQWA 1TA4A 4L1KA 5IKMA 3C87A 1QFYA 1RYEA 1UBKS 5THQA 3KEQA 5FT9A 2J45A 1U3TA 2JGEA 2HH9A 1IHXA 4GICA 1F14A 3TZBA 4HWSA 2COKA 2F1IA 3UGQA 4F6RB 2O3QA 5TPZD 3SZGA 2IUFA 1I0LA 3IOCA 4NG4A 2QYTA 2W37A 3QE9Y 4TZ0A 3N2IA 4R9NA 1KYIA 1YZLA 3EGIA 1IUKA 3H2IA 4WUTA 3BRCA 4WL0A 2O2EA 3OOHA 4AY6A 1LJ8A 1PFYA 4OHRA 2ATIA 3RHFA 2QUHA 2BW0A 4GOLD 5F5XA 2BZ1A 3L7IA 4JP2A 5K51A 5LR6A 3UMMA 4CM6A 3FPHA 2VJBA 2PWPA 4LJ5A 3UC9A 2RBGA 4ABTA 4R7ZA 3F49S 2UZ1B 1QOZA 2OPBA 3PGA1 3LVBA 1U8ZA 1R0KA 1LS1A 3U4IA 1XPOA 2ZQ5A 3TINA 3TGLA 2NUPA 3AR6A 1KMQA 2WT9A 2X15A 4RF5A 3SBDA 1RQ7A 1VCOA 1WKVA 1DCTA 3D59A 3VJRA 2BEWB 2AUNA 4RH1A 1ZLXA 1P72A 4JVMA 4MCHA 2A57A 4EX7A 1YZTA 1GTSA 2OLEA 3NHBA 3L1VA 1PGJA 1G20A 2VZ9A 4OMUA 2IUTA 4HSEA 1EKXA 3DEJA 2Y1WA 3ID6C 1CY0A 1WCYA 4RQBA 5G1PA 2JLXA 3WLNA 3QSYA 4PCAA 1DQNA 1KF0A 5EJ7A 4EFDA 5HPYB 1H65A 3NPAA 5CX4A 3RC1A 1FRQA 3ZLJA 3H5NA 2CYAA 1SD5A 2EG5A 2CB9A 3KFLA 3H8SA 3H9QA 2Q9BA 4RORA 2HJSA 2HSEA 3ZBQA 1P0PA 2HMAA 4M1MA 1JJAA 3MGCA 3KHSA 4WWHA 4W9RA 1S4MA 4KDEA 1H6DA 3B38A 2BY4A 2QN7A 2OCAA 4M89A 2J9YB 1DP4A 1HLDA 1KK0A 2P67A 4IOJA 4JLNA 3VU0A 3WIEA 4BN5A 3NOQA 4IZHA 5LVAA 1X8XA 3VBEA 2ZBGA 1RM0A 3CKMA 4D9GA 3FWPA 1MTZA 2XQIA 4Y6PA 2YXEA 4BJHB 2CMHA 1YQ9A 3EBPA 4BKQA 3LDUA 5BWMA 3C8DA 3K30A 3ILVA 3O3NB 3WL8A 4C29A 3MTGA 4C04A 5IJAA 2JLYA 4LFCB 3IEVA 1RTKA 1PLKA 3NWEA 1Z4JA 3I9LA 3U26A 1YR9A 1OSNA 2VQ3A 3CE6A 3G6WA 2QS9A 2PYIA 3I45A 5DWQA 1K3TA 2P2GA 1Q77A 2W6OA 1XQ9A 3OT1B 3SFTA 1M5TA 2HK6A 3HJTA 3QYAA 2QL9A 4LWOA 4U2BA 3SZMA 2P2ZA 1NA5A 2QG4A 3FCEA 4ZV9A 4NMWA 4EJFA 3DEAA 1E9SA 4K87A 3EAFA 3UTCA 3Q12A 1T3GA 4LF9B 4G0VA 4CIYA 3IEXA 4RH0A 4WINA 3FSGA 1X3LA 2G76A 2J07A 4C20A 3G8BA 1EDZA 4U7JA 2ECPA 1CG6A 2GD1O 4XPZA 3HZOA 2C58A 2IS1A 1M1ZA 4GBED 4IXDA 2V0NA 3AW9A 1JEJA 4L8LA 3BRQA 2XVZA 3N8IA 1GR1A 2C5SA 4K9PA 2CK3D 4CTKA 3ZHBA 1JH9A 2OR3A 4JJ7A 3IP6A 5F52A 3OX3A 5C35A 4DDKA 1W9MA 1LBSA 1XQYA 4W82A 3DO8A 4MLZA 1MT0A 1SHLA 1ZWLA 2RGEA 3LDGA 2B9EA 2PAAA 3TQOA 1L4EA 1H2YA 3OM0A 1RPZA 4E6PA 5I7SA 1JKIA 4ND8A 1FFGA 3E7DA 3IBYA 3EASA 4YJGB 4BHTA 1XPUA 3ZZMA 3GNQA 1BA2A 3RIEA 1E9EA 1UWVA 1TW3A 5IH3A 5EIHA 1N8KA 1V7QA 3AERB 1IC6A 1F6DA 2ZRPA 5E6SB 1MC8A 4YRDA 4XX0A 1Y1SA 2PSDA 1SUWA 1THTA 3OCXA 3PJFA 5CDYA 1E2KA 4YUVA 1X9HA 5AT1A 4DYVA 4U7TB 5KPDA 1T2CA 4KR9A 1Y5IA 3T5GA 1C41A 1ZIOA 3ENNA 1KXJA 1V8PA 3HC7A 5K3FB 3DBRB 4ZYWA 4LBVA 4MJ3A 5KYUB 2A9VA 2GXQA 1TZJA 2D0OB 2YH2A 5AUNB 4PM4A 1M2GA 1WP4A 2ZWIA 4XGQA 5B12A 1VCHA 4D3XA 4KPYA 1FVFA 2ZAMA 5CXQA 2O52A 2W43A 4Y0AA 1OC2A 4JDPA 1J9GA 2PX5A 3BPSA 3GXBA 3JYHA 4E11A 3DAGA 1GA4A 1QHXA 4L95C 4LHZA 5JIBA 3GLQA 5JD4A 1DQZA 2RC6A 4JUAA 2CE2X 4MIKA 4QSHA 3DLBA 1U9ZA 5IT0A 1U2SA 2NXJA 3AOEA 3KKPA 1HF3A 4L07A 4RVOA 1PT6A 3D02A 3OEWA 4ND2A 4ZOEA 3W5VA 2JFVA 4XEHA 4PNHA 1JEQB 2BCJQ 1S1CA 2H1HA 3BTVA 3S70A 2R1UA 1ONBA 1GZSA 4DQDA 3PS9A 4LK2A 4N47A 4ZAWA 4I1SA 4BKRA 3KHUA 1DTWA 4QBGB 4B6QA 1KYXA 3W2TA 4BFLA 5KQGA 2H2FA 4P0PB 1WTAA 3PSAA 1DWUA 1PQUA 4H9GA 4GLJA 3PDJA 3DMDA 2A9JA 4LTNA 4HS9A 3IE0A 3QU4A 2P27A 4LIPD 2WW8A 3C3AA 4LXUA 2VHXA 4M86A 3KTAB 5SZHB 1V39A 3W6ZA 1J2EA 3WYCA 4EHIA 2IW3A 2PLRA 1OVMA 1GCIA 3OLZA 3T9FA 4CODB 1QYVA 2XTMA 3TD9A 4ENPA 5KKCA 1I10A 3PFIA 1U7TA 2WJ3A 1BZYA 3CKKA 5BV7A 3PUKA 3U4DA 2M1ZA 3MG9A 4ZT5A 2VJKA 4C0WA 1UJCA 1VG8A 4FFMA 2V7GA 4FYWA 4G1BA 4LE2A 1XP5A 4MEAA 4US0R 5FIUA 3PFNA 3REGA 3E5MA 2WYOA 4OY3A 4XJSA 4WX2B 1L5KA 1Y81A 3OQ1A 4L4UA 2X9LA 3CW9A 1XRSB 3W7VA 4PZLA 3FDFA 1YR1A 4M8LA 3STXA 2PH1A 5FA6A 5LIPA 2C61A 5EY5B 3U0BA 4D8TA 1ZH2A 4R9RA 2YINC 2DCMA 1PUIA 3Q85A 1QVVA 3JAWB 3U17A 4H1WA 2GDZA 1FL9A 1NATA 4UM5A 4HDMB 3H3JA 1I30A 3C45A 2GPSA 4FJ1A 3F8TA 5HNKA 1OLXA 3SEQA 5AKXA 1XAIA 1F17A 1GG5A 1DBPA 2ZYWX 4DLUA 4QXRA 3S2YA 3L5OA 4ZHQF 5C5EA 3G7SA 3QNMA 3PRHA 2C4NA 4BL5A 3TNFA 4B3SB 1COWD 4CG2A 5CLHA 3D5TA 3I6MA 3OI7A 4D5EA 1H6CA 2I2CA 4HAUA 2O4CA 4QASA 3E22B 5TEVA 3UFXA 2CMFA 2WYUA 1NLMA 4OU5A 4Q7MB 3FMPB 5C34B 4E51A 3F6SA 1SZJG 3T5MA 1U2DC 1XZKA 2VATA 1VJTA 3SHWA 5EZ5A 1NY5A 1Q0UA 3A3OA 1PF7E 2EHJA 3K6JA 3NHRA 2GETA 4MUHA 4U8HA 2QMUA 3QUAA 4FGKA 4YV2A 2PFKA 1Z0AA 1UBFA 4I5EA 4IRMA 1GAWA 4HYYA 1ZKMA 3KLOA 3OTHA 1DG3A 5G53C 4ZMRA 1UBNA 4NBSA 2LWIA 1KMMA 5SY9A 4WZZA 4X93A 5BSHA 1FZTA 4YJ3F 3D8BA 1KQPA 3GLHA 5ERXA 2HWUA 4FYPA 3TLKA 3A3NA 2HWKA 4MCIA 3HUEA 2YY5A 3ZD7A 3LX6A 2NT4A 3CJRA 4CKBA 5BN5A 1FBNA 4LI0A 5CM8B 1J7KA 3K2IA 3C74A 1BX3A 1L4UA 3JX9A 3QLJA 2HYIC 1DUIA 1R0CA 4CKWB 5I5EA 4DQLA 1YS1X 5B4VA 3SJUA 2QP9X 1VDZA 4UD6A 1A5BB 1G3UA 3T5CA 4I6JA 1CS4C 4DE5A 3LC7O 5BW6B 3CUYA 3KJIA 3P4UA 2QTWB 1CB7A 1K98A 2D2EA 2IYXA 3D6AA 3LCMA 4INAA 5CA0F 1DIOB 4OF4A 2HSGA 1MC5A 2I6QA 3DQZA 1TAHA 4C76A 2B36A 4X54A 2P1RA 4U7HA 2A35A 2XCIA 2RMKA 16PKA 1P4JA 4GMXA 3PGJA 4GT1A 2W2PA 4K1LA 3ICPA 1NT2A 1IMOA 1P75A 2J3DA 1JQLB 2IYOA 3GD7A 4LY9A 4EA7A 5EE3A 5GJBA 1OI2A 3PWZA 3O2JA 2VTEA 5HWSA 1R6VA 4QG7A 1HNNA 1XVUA 3D5QA 3PHCA 3D4IA 4YV1A 5HJEA 4RH3A 4YRAA 2WICA 4JUCA 4Y6LA 5LKAA 1NXWA 3J80A 1DVRA 3PP8A 2GZAA 4LJ6A 2J9FA 4TKMA 1Z2OX 4ZICA 4RGQA 4ZARA 3NJ4A 3D1LA 4UUAA 3PQ8A 4I9UA 4M37A 2OZVA 4FFWA 3S2ZA 3AYZB 3JRWA 3SK0A 3TW4A 1O54A 4P53A 3BRSA 4RS4A 3UM9A 5LDDC 4CEHB 3CLUC 3T7DA 2WYHA 5JECA 5KEIA 3WGKA 1WLYA 5BQPA 3P0FA 3UENA 1RWQA 5CBPB 6PFKA 2GNOA 3R6DA 3X1MA 1BH2A 2NXNA 3PQ2A 2OZPA 3GNLA 4NZZA 4DM4A 1NUPA 3EGXA 4FOLA 5DX8A 3NV9A 3O4FA 2IHYA 3K9FC 1JFLA 2ZRIA 1U8CB 3GFVA 1CQXA 3ZV3A 4DHWA 2NM0A 1OKKD 2ZPAA 4PYQA 4BGUA 2OV2A 4C0KA 1D2RA 4UTOA 5REQB 2BKXA 2VNAA 2YHIB 4TV9A 2RK6A 1BEEA 5CA1B 3H5TA 3FOFC 2QE7A 1NRIA 2G9ZA 1EBBA 2QQEA 3I0MA 2CLMB 3NJ8A 1TZBA 4IKOA 2PD6A 4YRSA 1AA6A 3AWIA 2OO5C 5IANA 3ZLVA 2YWJA 3ON5A 4L51A 5ES4B 4IDPA 2P1DA 3A2LA 4GI1A 4BTEA 3A8TA 1W4LA 2WP8J 1B3BA 3TMYA 2ZJ4A 5DBHX 5H3CA 1AK9A 2GGSA 3JALB 5JSUA 3EXHB 2GCNA 2FPXA 4QQRA 4FHFA 4GWKA 1GR0A 2VZLA 3WA7A 3DE6X 3NTQA 1Z7YA 3EA4A 4HUTA 2BZSA 2VO1A 2X9GA 5AOAA 4BE9A 1OU0A 4YCCA 4BX3A 3FVRA 1JFRA 2O07A 3R5HA 1I14A 4PPGA 5IAKA 3GJ6A 2LCFA 1YDFA 1I13A 4WH0A 3AVWA 2CDNA 5IASA 2YHSA 3IXLA 1E92A 1RP7A 3FOBA 1WCIB 4KZPA 4AKSA 2OGZA 3VR4H 4BX2A 4C7BA 3CN9A 2GLXA 5LPNA 4JI3B 2I2XB 2VR1A 4RANA 5KTPA 2HNBA 4UHEA 4KR2A 1NFQA 3IVRA 4MVJF 4Y2GA 4ZJUA 1KRXA 2IODA 3D54D 3GAFA 1PV1A 1CJKC 3BE8A 3IQXA 4G2TA 4K6HA 5GV8A 2H57A 3IFSA 2JD2A 3MF4A 4IY1A 3JD4A 4MINA 3RW9A 1D6JA 1QFZA 2GK4A 4RHYA 2HF2A 3PPXA 4RXUA 5AK3A 4HNVA 3B1VA 3HFGA 3O1JC 3T1NA 1OFHA 4X71A 5BSTA 3ZVNA 2O7VA 3L7NA 3NHFA 3QLUC 1FP4B 5F1PA 2C2WA 3ZYZA 3AKCA 5JASA 1XU9A 5A05A 2FEOA 2P6PA 2DGDA 1I2MA 2V6MA 1HXHA 3N2NA 4MS1B 3EIQA 4RJ2A 4DSNA 5C7LO 1HSOA 3H8WA 1KWKA 1HZZA 1WB6A 4H6PA 2ZBFA 4YCMA 1WS6A 1Y8RB 5AKLA 3WL6A 3A6EA 2C7VA 3GLRA 5C0OE 4FDUA 3HYCA 5EIEA 1UM9B 3LW8A 4BTVA 4RY9A 1W47A 1TUIA 3VVCA 4NFLA 3BK1A 4W5JA 3VPHA 2WK1A 2XQVA 4FFOA 1G5IA 3IP5A 3O8LA 9ABPA 1QAOA 2F90A 3TL6A 1Z2NX 2Z2ZA 3VMFA 2VRCA 4ESEA 4Q1AA 1U7PA 2YV4A 2BPOA 2PS3A 4BUCA 3FYUC 5AD1A 1H8ED 4PQYA 3HVUA 2YDYA 1QLHA 1NV8A 4GH5A 4YAFA 4XM2A 1MBZA 2IV2X 1IBSA 1QHNA 3IOYA 2I9KA 5ER9A 3VNVA 1UJNA 1P33A 3COPA 2WHEA 3DMNA 3K8YA 3IQHX 1YR3A 4JWTA 2XVYA 1JEYA 1SU4A 3QK7A 4Z3DA 5JADA 2Q21A 3TZQA 5JD5A 1E1LA 3COWA 5KCZA 3T7JA 3GARA 4RA9B 3TXAA 4R54A 4OHCA 2XB4A 5DH9A 5HHTA 3PEEA 3K0BA 4KYUA 5FCDA 2P40A 4RHUA 5KMGB 3IP9A 5FOVA 4KNYA 1FU4A 4LW8A 4LOKA 3A37A 1PQPA 2OCYC 4C6RA 4PZEA 5C31A 2XMQA 5TF4A 1JA1A 2VT7A 3O92A 5C8ZA 2RH5A 1T34A 1XA0A 2OCXA 2HDOA 3MNFA 5F35A 1POXA 4Y2QA 2CXTA 2IY8A 2BHRA 2X86A 2UV8A 1C8KA 2OO3A 1W36B 3N2KB 1SQFA 1VLZA 1C3EA 2X8BA 4K2HA 3DT9A 1XVTA 2A9RA 2F8LA 5DTEA 3RC9A 3B48A 4DMCA 5I48A 3IAM6 1T9GR 5B7PA 1XLWA 3PFGA 3D2AA 2R7LA 1BROA 3GGJA 2O8CB 2Q6OA 5K0GA 2FW6A 4UTVA 2AW3A 2I80A 4FNOA 3LFHA 5B55A 1I5OA 3R0XA 5FWYB 3DWEX 1KEZA 2PWYA 3FDJA 4PNZA 1X6VA 2R85A 1ZMOA 3WYDA 4B84A 3KC2A 1I3LA 4NQZA 3Q3GE 4M0LA 1ZIYA 4BN0A 2QD1A 1ESMA 4BMSA 3T1QA 1G38A 2JBAB 4ARIA 4JP1A 2WHQA 3HI4A 1NP7A 1E6KA 1OT5A 1OT3A 4PZZA 1CRQA 2ZZKA 3PRKE 1BCSB 5DTRA 2O0LA 4IS3A 4AJHA 4LYAA 4CLOA 4I9FA 1EFVB 3H84A 4HDRA 4NFSA 2RHOA 2XQFA 1BE0A 4OGWA 1XVIA 2J5BA 3UT5B 2JGRA 3OCCA 4D9BA 1WCV1 4ZO9A 3DKVA 3UZUA 3K9WA 3IUEA 1GUZA 4FKZA 2PHZA 2Q27A 4MKIA 1NXSA 1F2UA 2YWRA 1PUXA 4RPLA 5TNXA 1M8KA 4EF6A 1QO7A 1E5LA 3GUCA 1L1QA 1AX9A 1SCKA 2AFIA 1OYOA 4PC2A 5LLSA 3D6NB 3G02A 4JOBA 4HGZA 1I3CA 1MO6A 2O8NA 4EY7A 3RRMA 2C7PA 1EVJA 2VXYA 1WULS 4XSGA 1W6UA 2PRZA 4MS3B 1TKCA 2J9ZB 3NX4A 5M34A 1U98A 3LOPA 1ZWKA 4W8OA 2MSCB 2VPPA 3R5XA 5ELMA 1Z36A 3E9QA 5FF9A 1O6CA 2BLNA 3HY3A 3ZDZB 4MHSA 5AVRA 4LMBA 2ZI3A 3OZDA 1PHRA 1CLEA 4GDMA 4RTSA 1ISIA 4HY3A 2VJNA 1OZGA 4TSFD 5DPMA 1SHUX 3DMRA 3OZRA 1F0NA 2NZ8A 3B1WA 2EFDB 3GBPA 2DT8A 2PX2A 1KYYA 2B8WA 4JEHA 1A8SA 4W63A 2OILA 5JO0A 2ECFA 1VA5A 2VL7A 3BJRA 3DUWA 3O4IA 1TM1E 4CMGA 2CSUA 5JC1A 4R2HA 4LJ7A 1YUBA 1OI4A 4IHKA 4QE3A 4ZO4A 1BE6A 2WZQA 3CCCA 3KSAC 3S1AA 2GOYA 2GX6A 1XDUA 1Z18A 4IIJB 1MNAA 2ZUBA 4G9EA 3ANTA 2HDHA 4MIEA 3NMUF 3QZUA 3ZD6A 5MFZA 3NTXA 4TVBA 3T12A 3GGSA 2QTNA 3QE0A 2YFYA 4G1MB 1GRVA 4O3FA 1QO0D 4EA6A 5MGBA 4MGEA 4NYMR 1M83A 2GLUA 3C8MA 1Q19A 4LYHA 5FLEX 3AJRA 3THWA 5JALA 2UUOA 3T3NA 1HRKA 3CUEF 3PK0A 3D8NA 2NPFA 1QORA 2Q2QA 4BNTA 4H1HA 1WU8A 1R3DA 2OFPA 3MEQA 2BFNA 4D46A 4DMUB 4F8YA 2BMFA 4J9UE 2R5FA 4IOMA 1H2RS 1BMDA 4F9TA 2VP9A 2H0AA 1ZD4A 2P8SA 5DK4A 3GEIA 2J59A 5B7GA 4TS9A 4ZT3A 3BEDA 4D9CA 5LXTB 4Q1FA 2VLBA 3OMWA 3VR3D 3IR6A 3Q2KA 3KR2A 2IRWA 2FWRA 1GYPA 2R8XA 2ZSJA 4LWZA 1RJ9B 3ETGA 2H63A 4P22A 1JHYA 4L8FA 3UAGA 1NW8A 2WPNA 3O4HA 3R7SA 1MDFA 2Q49A 3PU6A 4WA7A 4QVIA 3QJYA 2FPGB 5D5QA 4NPAA 3ONWA 5JJCA 4LQLA 5JISA 4X62B 4CHGA 2Z8ZA 3Q7RA 1QHIA 1BRMA 1M1NB 3K70B 4WESA 5CPFA 2ZIFA 1YSCA 2QNRA 3A1WA 5BRNA 2GN8A 4ZEXA 4IBOA 1S9DA 2D2VA 4PC6A 4QOEA 2I78A 2X0NA 1CY6A 2CNWA 4QYMA 3O1LA 4QLAA 2A86A 3U4GA 5IEJA 2PMWB 3K2BA 3ORHA 2AK3A 3OHPA 4WERA 3CLVA 2VHYA 3PPYA 1I3KA 3PTZA 4IJQA 2HCTA 4HWOA 4OQMA 2X3YA 3EVFA 3TQFA 2FFHA 3OCUA 3ZD8A 3BX1A 3GGPA 4CLDA 2BBSA 3UJBA 3OVMA 2AOWA 1ZIXA 1CJSA 2NTJA 3OO0A 4EYQA 5JFGA 4B7CA 4P3YA 2KB0A 3OTIA 1ZK4A 4P1ZA 5D3QA 4BNDB 3CPHA 4OSPA 2VHCA 1RIIA 4EBFA 2YYZA 3ACCA 2HA4A 3I3SR 3QTLA 1GNVA 2FUCA 2YWEA 2JLSA 2ERCA 5CVEA 3D0QA 4JI5B 4BLSA 3FPCA 3KVYA 4D3DA 4RSRA 5BR4A 5JRJA 3K0FA 4DDUA 4JU8A 4MEBA 1V25A 3IVCA 3WDKA 1SPBS 2EX1A 3RASA 2P0YA 2WVAA 3IKVA 1RJEA 4AZVA 3TRHA 3TEFA 5AM1A 4UBIA 2VF2A 3ITKA 5EHIA 2XGGA 3ENVA 3Q1LA 1JPVA 3R5JA 5DU2A 5TT0A 4R6XA 3ICCA 1VYVA 1MD9A 3OKPA 4R98A 1E3LA 4ZTZB 5FR2A 2YHUA 3VGPA 5JBIA 3TG8A 3A04A 3NIFB 4WZBA 4F45A 1JS1X 1PNOA 5DLDA 1JQEA 2HKIA 1KVSA 4DBZA 3T52A 3KOWA 4GSKA 4GR5A 3LLMA 4KPGA 3VR6A 4FT4A 2A1TS 5AOCA 1SVKA 1D1SA 4OJKA 3T15A 4ZOBA 3VSCA 1HC7A 1BAPA 1MN6A 1XR3A 1KZ7B 3EBOA 1SBTA 4DA6A 1Y98A 1K2WA 2QPOA 2DFTA 2V5UA 2YIVX 2QRLA 1QPZA 2EEZA 1YS7A 1MQSA 2R96A 2WG2A 3MWDA 5A4DA 1CVIA 4FNAA 4U2DA 1JQKA 1Z38A 2RHTA 3DM9B 1NHWA 1SU8A 4E5SA 3O21A 1QQ5A 3LSYA 1G291 2Y92A 1C8LA 4GYWA 5KYUA 4BFZA 3SSNA 3QEMA 4GL2A 4UCFA 3V4OA 4E5KA 2RBKA 2QI9F 4Q3AA 4IUYA 5FNZA 1AUXA 4LI3X 2BBOA 4JB0A 3S27A 1G4AE 3KB1A 5K1ZA 4MYUA 5M5BA 1G18A 3F67A 4DV7B 2GBPA 1NQVA 4MWDA 1XZGA 1U94A 1TM3E 1CZUA 1VMDA 2F67A 2XKAA 1MU0A 2A0YA 2Q3DA 3AF0A 3CUSA 3EFOA 3QFHA 4GL4A 3O7MA 3AFNA 4A5SA 4FWIB 2QMZA 4QTZA 3UUFA 3GEPA 4I4TF 1XVAA 4HNSA 5BNIA 3DOHA 1VI5A 4XW2A 2PT9A 5BOSA 2CD7A 1A9TA 1T2NA 5ECDA 3BCSA 2PUVA 2OFFA 3R3SA 4ZI2A 2IIQA 1AF7A 1CE8A 1S2DA 2FAXA 2BBTA 2JIZA 2JGDA 2W2KB 3IT0A 4Z51A 1Z0KA 1X1TA 5E38A 3MB5A 3KUKA 1MJ5A 2RG7A 2A9KA 4R8RA 2NO1A 2FSHA 3VO1A 1NUAA 1KWGA 1C0LA 1XA3A 3UHFA 4UMEA 2WBLC 2DECA 4L4ZA 5ABPA 2QQ0A 3LRTA 2YFKA 3NOOA 4YO7A 1P19A 2DQSA 2PS9A 5ITZB 2BBWA 3A6PC 3S8MA 3X1KA 4KO3S 4KXYA 3EJ6A 1WABA 3L40A 1BJKA 4Q9JA 1ZW6A 5I7UA 1AMUA 3EFHA 2FPMA 1C4KA 1GVHA 1VHLA 4TS1A 1QS0A 3VNRA 3GX1A 4QAQA 1XO1A 3RVJA 2GK6A 2R79A 2Q3MA 2OD2A 3KAKA 1RP1A 4HPXB 2DU8A 3QMPA 2QXTA 4OSEA 1ZONA 3TTVA 1D03A 5BR7A 5B58T 3LWNA 1UBUS 3TSOA 3EQ7A 1SD1A 2JGAA 3A70A 1J5XA 1QHHA 3R4CA 3R74A 4PGAA 3HFSA 4QIHA 3WLLA 3LM8A 1WVMA 4X63A 1PG5A 3ONDA 3K4QA 3MFQA 4V0RA 4PO8A 4F4HA 1EHYA 1Y1PA 2FB9A 3CEAA 1CP3A 4LAFA 4N7JA 1EFPB 4LY3A 3V7FA 3IRVA 1BWPA 1XV5A 3BIOA 4GRIA 4PWZA 1C80A 3NAZA 5AJVB 3TRDA 4YPVA 1XZFA 3T3DA 5KC8A 3ME5A 4BCCA 1MMFB 3EXIB 4J0QA 4JU9A 3E61A 4AMGA 1KBQA 5AKJA 1DFIA 2QSZA 2ZQYA 1A5AB 3SJBA 3ZGYA 4F4UA 2PXCA 1XTRA 4J43A 4F60A 3VH3A 1ISSA 3U80A 2ZTVA 1SRQA 5AVOA 3M5PA 221PA 3HCRA 2QTLA 3OUUA 4EY5A 1ULAA 5JXGA 1DO2A 2WHXA 4CU2A 5C18A 5ECGC 2DRIA 1MA0A 4B40A 1BWQA 2R25B 4I3GA 4AQDA 6REQB 1VJCA 1FNCA 4YMGA 3QE2A 3HWX1 1JHPA 4JWKA 1RWBA 2ZVQX 1YHNA 4S2UA 1PEKE 2CDCA 3NEYA 4TRRA 3LPNA 2IY9A 2OWDA 2ESRA 5JNUA 1ZD5A 1V8BA 3BL6A 4LRTB 1WVIA 2FF7A 2P91A 3OIYA 4HB3A 4F86A 5EFZA 2JBWA 2IOQA 3OY2A 4IMPA 2O8FA 4G5QA 3F4KA 2WG0A 1M5RA 4KXVA 3UHJA 3ER6A 2CXUA 2BR4A 1ZOPA 1XRQA 4RCVA 3ZIDA 1D4ZA 5DIFA 3NHYA 3VU3A 2DZDA 5LYJB 1SELA 1PZNA 2GBGA 1T4CB 2Z9DA 4B47A 2WU0A 4J1NA 1IEQA 2OHOA 4KXNA 4RDIA 5E7IA 3ROGA 2PMDA 4AICA 5EE1A 4MDEA 1M2VA 1YB6A 3CR7A 4FP9A 1V35A 1HQDA 1YZHA 5HTKA 1TM4E 1JLLA 2QRVB 4O4IB 5TXGA 2H9AA 2HUPA 1EQAA 1G8SA 4FCWA 1SCBA 1QCZA 4ZRNA 5FAKA 5KTTA 4H7EA 4M0UA 1DC5A 2EGHA 5JQGB 3GO4A 1XFAA 2P75A 4R9SA 3SQLA 4EUSA 1YK0A 5FA5A 3JAMA 1AV6A 1U3WA 4G1EB 1IU9A 1Y3CE 1JNYA 2P9CA 2FPPB 3GCXA 4NBUA 2J9GA 1ZIPA 4R5HA 3KQUA 1VRCA 4A8PA 1K5DA 1V96A 2P8JA 3C16C 2I7CA 1LNQA 1MRNA 3W5JA 1OLSB 3HJUA 3RSHA 5A1JA 4YRKA 3O73A 2QKYA 4JUFA 1E77A 1E7SA 2XDYA 3DFIA 5HXAA 1GTRA 3ZDQA 2FK7A 3KQPA 3BQNB 3ZX4A 5KTRA 1BS1A 2O7SA 4HB0A 4YMIA 3EEFA 1CWUA 3K9QO 3TLGA 5I4BA 2PUDA 3W0LB 4RULA 5C3MA 1TA0A 2C2XA 2PKXA 3HDQA 2R7KA 4OLFA 1T3HA 1YTUA 3IUPA 2WQ6A 1TKAA 2QROA 4Q93A 3ZU3A 3GIWA 4DZZA 5SYMA 4RDHA 3FOEC 3H05A 4H4EA 4BVKA 3E35A 3BWDD 4X1IB 1C7RA 3INRA 2W22A 5JXIA 4B3GA 4U3JB 1UFKA 3D6FA 2AI1A 2XUDA 3KO8A 3PCXA 3J7TA 3PEWA 1Q7BA 2HK8A 2J3HA 3CT4A 4V1CI 4ZO7A 3U7JA 5HGJA 1CJCA 1T5LA 2BGKA 4JQZA 1RVDA 1A8PA 2C94A 2EJUA 3HPRA 1NJ1A 3JVVA 1ISPA 2J08A 4IKPA 4V03A 1GILA 4IWNA 4F5ZA 1SBQA 3D43A 3KSUA 1SXQA 3ORFA 3QJ5A 1SO8A 1Z6GA 5EQDA 4DV3B 2QRKA 2GZSA 1QANA 2I6SA 2X76A 3QEKA 4UAJA 4HWKA 2CXHA 4LOHA 5CFOA 1NL3A 3OSUA 4Z7QB 1NVXQ 1VKJA 2HX1A 3GV0A 2GARA 2XIQA 5AVVA 3C8ZA 1M8JA 2JAOA 1ONOA 1GZ7A 2C1ZA 4UM8B 1Z83A 3RYFA 3FVQA 3PXEA 3DKPA 3RAFC 4FILA 4JLOA 1EK5A 2D1QA 2V4MA 4WN9A 2K2WA 3M8KA 4ZCIA 2WILA 3VOBA 4BC1A 5IXSA 2NUPB 2P9FA 3DV9A 1RBZA 1TJNA 3AHGA 3G1TA 4JT2A 3ZU6A 2A3NA 1G8HA 1GG2A 4N03A 4AWXA 2YQ4A 3EIHA 4M4SA 4F7DA 3RT9A 1L4GA 1PJ3A 4JGBA 4LFAB 5B1SA 1Y6GA 1G20B 1QM5A 4WK0B 4DDHA 1Z25A 4ID3A 4QSMA 4KACA 3HMQA 3L02A 1X9GA 2JDID 3AZQA 4FR0A 1RLTA 4W1SA 4WLNA 4EY4A 2VQEB 2DKOA 2FUEA 2VDRB 3MERA 3KYBA 3OIGA 2HJ9A 3C3MA 1V7ZA 2C0CA 3NG1A 1JE0A 4Q19A 1UWCA 4R3NA 3RTDA 1POWA 4R1TA 2FUG1 1LW7A 5AM2A 1HBJA 3P2EA 2POCA 4JB2A 3BMCA 2AW5A 2VRNA 1Z7EA 2GESA 3F9IA 1RI1A 1G9XA 3Q8XB 4DVGA 4Z1MD 2AE1A 2JHAA 3F4LA 1W5AA 3MBIA 4J03A 3AXSA 1AH2A 2GA8A 3AB8A 4UE6A 2Z8YA 3PHGA 4P8RA 3MLEA 1KMIY 4LE1A 4XDHA 1J2TA 1G5HA 4JVLA 1E1RA 1V47A 2WDPA 5CDHA 4KUEA 4E3WA 3KOUA 1PGNA 1FDVA 2OBLA 2JJYA 2KE5A 5HQJA 2C2MA 3QVTA 3UFBA 3WKDA 2FPRA 1DIBA 1JHOA 1PI3A 1UCFA 2CHVA 1RT9A 4H77A 1FLAA 3OA2A 4WBXC 1FS4A 4B7XA 4X3CA 1P5FA 5T41A 3B82A 3IOMA 4WIAA 4RPJA 3O95A 4MGKR 1HDRA 5DF1A 5A5GA 4AAYA 3NBKA 3EA0A 3KQKA 2FWIA 3CRMA 1XYGA 2Q4BA 3HE3A 2A5DA 5U4XA 1WKCA 2ORIA 4B3FX 4QT4A 2QVZX 4YAEA 3CLUD 1JFFA 5K8IA 4GQBA 2O0MA 3B3FA 3OCVA 3Q11A 3QQPA 4C78A 3NGLA 2IU4A 3U3DA 4TT3A 1OBFO 3M6VA 4FR2A 1CW2B 2CCGA 2A5LA 4A2WA 1MA3A 3IAS1