2WY2D

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 103
sequence length 103
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wy2D00
1GUDA 1NTRA 5E3JA 4D6YA 2BGGA 4LDZA 3LUFA 1DRJA 1Z26A 3H5IA 4H3KB 5IUKC 3T6KA 4TLLB 6CHYA 1BDIA 1VLZA 4KVFA 4ML3A 4Z4HA 4JASB 1JHZA 2FN9A 3CFYA 5TE9A 3HO1A 3JPYA 4RK0A 4HYEA 4MR8B 1D1PA 4MS1A 2CWDA 5JNUA 3GWGA 1NXVA 2LIVA 3KS9A 3URMA 1APBA 1S8NA 2V0NA 3KG2A 1EWKA 3O74A 5JNRA 1EFAA 2FKAA 3EODA 1E6MA 3CHYA 3L49A 4G0XA 2R47A 4KFCA 3H5VA 2CHFA 4KRFA 3QLVC 3N0RA 2QR3A 2PUAA 1PEYA 4WXMA 3SAJA 3A0UA 3VNAA 3KLOA 1JF8A 2L2QA 1U0SY 3G85A 3GT7A 1M2EA 4XFKA 4RY0A 3H5TA 5EWLA 2NT3A 1KRWA 1DRKA 2JVJA 1U2PA 2HQOA 4S05A 2R48A 3C97A 5B3JA 2H0AA 2FEPA 3CLKA 3HVRA 3Q7RA 3GA5A 1BA2A 3MM4A 3KCNA 4IGAA 4XASA 3QLTA 5TPWB 3RH0A 1NXPA 4IF4A 4G97A 2WJWA 4F11A 1DC7A 2PMCA 3GBVA 4TMYA 5TQ2A 5JS2A 4L4UA 4E7OA 1FFWA 2VUIB 3HV2A 3LUDA 1JH9A 4YP9A 2B1JA 1GCGA 8ABPA 4MS3B 2WWVD 3H6GA 3T95A 4G0ZA 2RJNA 1NATA 1TVMA 1NXTA 5IX8A 4H60A 1JYFA 5GOTA 4ZYLA 1P2FA 4EGSA 2B4AA 1P6UA 2LP4Y 5JNVA 5ABPA 3LFTA 4NQRA 1Z13A 3QEKA 3HUTA 1DBPA 1LJUA 4Q6BA 5D2CA 2MSWA 1VKRA 3SNKA 2PLNA 4E7PA 1EAYA 3KKEA 3OMWA 3P9YA 2IDMA 1D5WA 4MS4B 3GV0A 1Z25A 3QK7A 4LE2A 3B2NA 2A9OA 4DQDA 4JA2A 3BRSA 4JAVC 2RGYA 1YS7A 1FFGA 1MIHA 1W9HA 1JYEA 4YO7A 5FBHA 3CU5A 5KWSA 2VYCA 3SG0A 4PYRA 1PNTA 4RK1A 3Q7SA 1KMIY 3M9XA 5IUNC 5KQPA 1U8TA 4D74A 2FW0A 2FMIA 3JVDA 1EWVA 3F6PA 4MQEB 4W5OA 2AYZA 1TM2A 3LTEA 3LOPA 4Z0NA 3LUHA 1Z12A 4RDCA 4Z4CA 1OXKB 1DCFA 2QVCA 4OATA 4RXUA 1A2OA 1DG9A 3OQMA 2QV0A 1P8AA 2FQYA 1AB6A 3IP7A 3FDFA 3VNBA 3A3KA 3BREA 5DTEA 2VUHB 3N8IA 1MAVA 1USGA 4P1ZA 3ROFA 1DCKA 3RVMA 3QEMA 5BRAA 4MS1B 1MB3A 4IMIB 4LDAA 3RVNA 1ZGGA 1DZ3A 3M6MD 3LUJA 2QW1A 5CHYA 1KRXA 2MSKA 3BBLA 3IPCA 1ZDMA 2E4XA 4JB2A 3SM9A 3EAFA 3QLVA 4NCAA 3O1IC 3UUGA 4LRQA 1PEAA 2I6FA 1JFTA 2JK1A 5IBQA 2RJOA 4Z4EA 3QLUC 4F12A 1RZRA 3LUAA 1ZGZA 3CNBA 2X7XA 5CNIA 3F6CA 5EWLB 1XHEA 3EULA 3O2QB 4PE5B 1YK0A 4EYGA 1PHRA 5KC9A 5HQJA 4YRZA 3MYYA 3KYJB 4KZKA 1DCMA 3OO0A 3O21A 1Z18A 2ID7A 1D1QA 1URPA 1BDJA 2FVYA 4N0QA 1SXIA 2PKXA 4EYQA 5TPZD 4YCSA 4MR9A 2QVGA 3LUKA 3NHZA 4RXMA 4TN5A 3HEBA 2WY2D 3FFTA 4G0PA 3RVOA 4EVQA 5TQ2B 5JS1A 3EGCA 2HPHA 1ZY2A 4ZPJA 3OLZA 3TMYA 2IOYA 4W5RA 4G86A 4QICA 3S99A 5KQLA 1E6KA 2FLKA 2FEWB 6ABPA 2LUOA 3BRQA 3OM0A 4FE4A 1BDHA 2MYUA 4CBVA 1ABFA 1RPJA 5DLEA 3HCWA 1U2QA 3DLHA 4UHKA 1L5YA 1SD5A 2FEKA 2QU7A 1TMYA 1XWWA 4L85A 3G1WA 4RY9A 5HM6A 1W25A 3HZHA 3HSYA 4LE1A 4RK5A 4WUTA 1WETA 5T7BA 1R8JA 5DCLA 2PUCA 4S04A 2QSJA 1QO0D 2QXYA 4B09A 1QP7A 1JDNA 3W9SA 3ILYA 4G0MA 3HK2A 1A0OA 4GPAA 4XLTA 1KGSA 1QP4A 3H5LA 2GI4A 3HS3A 1D4ZA 5BQ3A 2E4VA 3JTEA 3LUCA 3OLWA 3FGZA 1JFVA 4XAQA 1M5TA 2PJUA 4MRMA 1NXOA 2L19A 4LZLA 5F64A 5KQGA 9ABPA 3C6QA 3RVLA 4NCBA 3CG4A 4JP1A 1JWLA 3DBIA 3H5WA 2LPMA 3O2SB 2L17A 4RU1A 2MYTA 4KQCA 1QKKA 3H6HA 2E4ZA 3QELB 3JPWA 4OLBA 1QP0A 1VRVA 2PL1A 2NZVG 3N0WA 2JBAB 3EJWA 1YMVA 4OG2A 3GYBA 1NXSA 4PZ0A 1TLFA 2MYPA 3HDVA 3OLXA 4KNYA 3I42A 4HNSA 1DJMA 4EVSA 4YLEA 2MSLA 2A9QA 5TPZA 1D2AA 2XDYA 4EVRA 4F8JA 4JB0A 2JVKA 2IPMA 4DN6A 3GL9A 4RZSA 3GRCA 2M1ZA 3HM9A 3EQ2A 4RY8A 1QMPA 3BILA 1LJLA 3RVQA 3QEMB 1YTUA 4N41A 2E4YA 1ZH4A 3LKBA 1SXHA 2PUBA 5BR1A 3N0XA 2JB9A 3DGFC 4P98A 3T8YA 3KLNA 1L5ZA 4OBBA 1ISSA 3KJXA 3QELA 4RV5A 1RXIA 1Z15A 3L6UA 4N03A 1AB5A 1YVUA 4TLMB 4QYWA 3CZ5A 3QLUA 5CNKA 2TMYA 3TX6A 3UKJA 2JBAA 3C3WA 4RS3A 1DBWA 4ETIA 4WWHA 1USIA 1QO0A 4RKQA 1FSPA 3H5OA 2E4UA 3F73A 2PUFA 3N75A 4ZJPA 2PUEA 3FMVA 3RVKA 3TO5A 5IEJA 2PUGA 2IPNA 2F8SA 3OLVA 2CD7A 5TQJA 3KTOA 1FQWA 4RK7A 4MR9B 4WXEA 3R0JA 4KREA 3E61A 2FSPA 2PE5A 3JS5A 3ILHA 1UDRA 1GLGA 1JDPA 3NNNA 2IPLA 4Q7EA 2FN8A 1K68A 2ID9A 4NICA 3UK0A 3IP5A 4MLDA 4W5TA 4KPYA 1NXXA 2FQWA 2PUDA 1MB0A 1USKA 3LUGA 4NV3A 2NT4A 2PL9A 2HQBA 4Y9TA 4YGXB 5EWMA 1CYEA 2PAFA 1JLKA 2WB4A 4RWEA 3N6VA 1QQBA 2P4UA 5JNTA 2VK2A 1ZAYA 3MA0A 3OQOA 3CZCA 3O2JA 4F06A 1QQAA 5ED4A 3QX9A 3Q41A 3D8UA 3CS3A 1E6LA 1ISRA 2OENG 2WRZA 3KHTA 5EWJA 2FXIA 3OO1A 3Q7TA 4Z9BA 4QYMA 3Q15C 4UHJA 3CKMA 5FWXA 3HXMA 2ZAYA 4H3HB 3T38A 5JNWA 2A9RA 1YK1A 4MRMB 3RVPA 1ZHHA 1CEYA 3H75A 4N47A 2HQRA 3LMKA 2FMKA 4MPTA 5DGCA 3MF4A 3TB6A 4EYKA 3CTPA 4EYOA 4MR7A 4Q6WA 4Z9AA 4YS6A 2GKGA 3NNDA 5T3YA 1PUXA 3EDCA 4W5QA 4G0QA 1K66A 1U04A 4O1IA 2HSGA 1NXWA 2DRIA 4IMJB 3MMNA 4RK4A 2FQXA 4LE0A 3K9CA 4IRXA 1SXGA 4FB4A 4MGEA 4MQFA 4G0OA 4MAAA 1F51E 5C5EA 1E2BA 4EUKA 2KYRA 2CHEA 3LKVA 2IKSA 2GWRA 1VPWA 1NY5A 1DC8A 4MLCA 4M88A 7ABPA 1PNRA 4ZMRA 3NHMA 2QZJA 2M98A 3OMXA 5TQ0A 1A04A 1HEYA 4GNRA 3TD9A 5FWYA 1OXBB 2N9UA 2W42A 3OLYA 4ETMA 1ZH2A 2GBPA 4Z4IA 3IP9A 1SRRA 3I45A 1YMUA 2O20A 1BAPA 4KK4A 1I3CA 1MVOA 4KK3A 3HJFA 4PEVA 3JVIA 3MQ4A 1ZESA 5KC8A 1LBHA 5CNMA 3SQNA 2IPAB 3D02A 5JNSA 4YR7A 4F3TA 4MR8A 5HKOA 1YS6A 2WMYA 1FFSA 1Y1LA 5IC5A 3I5AA 3DGEC 4EY3A 1JFSA 4G0YA 1GUBA 2FMHA 3C3MA 3CRNA 1EHCA 4YV7A 1JL3A 1XHFA 4OTZA 1JBEA 1RNLA 2A9PA 3DLBA 4N0PA 3O75A 1GCAA 4ETNA 4Z4FA 1LK0A 3C3KA 2FLWA 4PICA 3GBPA 1Z16A 1ABEA 3KYIB 4KV7A 4W5NA 4O5AA 1ZVVA 1J56A 1RZRD 5IEBA 1C4WA 2YHAA 2J48A 3A0RB 1TJYA 5C5CA 1M2FA 5EWMB 2RDMA 2AYXA 3JY6A 5B3JC 1LBIA 5TPWA 2H3HA 3EQZA 4ZMSA 1P6QA 4XARA 5IULC 4FE7A 4QPJC 5CNJA 1CHNA 2YHBA 3FFWA 2LBPA 1M5UA 3KSMA 3RQIA 2Q5CA 2JCGA 3SY8A 2IYNA 5EWJB 4MS3A 3MIZA 4Z4GA 5FBKA 5FWXB 4Z99A 3RVJA 1JX6A 2OQRA 3HUUA 1DP4A 1F4VA 3HDGA 3H1FA 3RVRA 4LX8A 2E4WA 3N53A 4RK6A 5I4CA 1EWTA 2FTKE 2L18A 4XXHA 4RSMA 1ZITA 2JVIA 4MYRA 5GQSA 4MR7B 5KI6A 1T34A 4RKRA 1QPZA 2HJ9A 4HNQA 1RXEA 5HSGA 3ROTA 5DKFA 1YIOA 5BRJA 4OLAA 2R4QA 3A10A 3H1EA 1Z17A 4MS4A 1Z2EA 4RXTA 3K4HA 3IP6A 3F7NA 2FMFA 4D6XA 4MQFB 1H9CA 4KMRA 3OQNA 2F8TA 2P9HA 1ZN2A 3IPAA 1DBQA 2NZUG 3CG0A 1B00A 4KQ9A 3E3MA 3DZDA 2GX6A 3Q9SA 5KQMA 2MYNA 1Z2DA 3I09A 1QNLA 4N76A 3H1GA 2WJAA 2NUBA 3M9WA 3O1JC 4DADA 4WT7A 3OM1A 4HNRA 3IDOA 2R25B 3QX8A 4MQEA 5TQ0B 3FFXA 5IUJC 1BVHA 4YWHA 1IIBA 2ZWMA 4WZZA 4IILA 4JOQA 5PNTA 3O1HB 2JRLA 4O1HA 5FWYB 3NNSA 3RVSA 1C0EA 3NBMA
chains in the Genus database with same CATH superfamily
4HVLA 1BYUA 3RSLA 4CMCA 4TMZA 1M2VA 5BWNA 1Z7EA 2IPOA 1KZ1A 1ZS9A 2CK3D 4OU4A 4S35A 1TM5E 1DEAA 4ZU6X 5F7OA 4DJEC 4HNTA 3A6JA 4YJGB 1JMYA 2FG7C 4NHEA 4IDBA 4A26A 1U28C 1RM0A 1JJBA 3A14A 1YVRA 3SZGA 2H5JA 4WESB 1TYZA 1VRCA 4I55A 3VVBA 4C0XA 2XUGA 3IURA 3CEPB 2Z5LA 3KJZA 5LVAA 2A5GA 3RFTA 1AZWA 5I8PA 3KQHA 4DF3A 5EWMA 4B2YA 4MICA 3QWAA 1C1HA 2B9VA 3GROA 4TMTA 1Z2NX 2E85A 5AK5A 3IDAA 3NTOA 3DAPA 4KO4S 4L0CA 1RYYA 4LXGA 1VE1A 2QN7A 2ZIXA 3H87A 4EB6B 4BO5A 3KKMA 5ILQA 2FDXA 1L5VA 4I19A 3M4JA 5JCJA 2Z98A 1DHRA 2HQSA 3PGMA 1P2TA 1M2EA 3TINA 1FUUA 1E3DA 2R44A 2VDPB 2YL2A 4HSEA 2BI7A 4S12A 3MTAA 1C8LA 5IT5A 5K0GA 5C8XA 1LI4A 3LQQA 2H4FA 3UGKA 1WKVA 1I36A 3TQIA 3HM9A 4EQZA 2EIXA 1N5IA 1Q3KA 2WIDA 4MP8A 2V8BA 4AJPA 4JR1A 1YTLA 3U4MA 4N5DA 4NAUA 3DBLA 1A88A 2AZTA 1BVUA 2IXAA 2O0LA 2W11A 1GPKA 3O8NA 4ZRMA 1OFIA 3ZW9A 3D9QX 4ZYYA 5K8UA 2FXVA 1UAGA 1PW5A 2VUIB 3LUDA 4MEJA 2IXDA 3ZHUA 2GGSA 4YLGA 1GCGA 3G9ZA 5KNCD 4G0VA 1BC5A 2XUKA 3EYAA 2RJNA 1KP2A 1M10A 3KYBA 1D8AA 1TVMA 1UCFA 3RRBA 4OI2A 5JXIA 2WD7A 7REQB 4EGSA 4EMSA 2VTBB 3ZR4B 3LBHA 3FOWA 3RWMB 1FRFS 4QQFA 5DN6A 5BPFA 4Y2HA 4QEDA 3HBFA 2XRZA 5IW8A 3PPWA 2VBIA 4I9UA 1TA4A 4U7TB 1X87A 2R5FA 4Q3DA 2BFMA 5KYKA 1C9YA 1GUFA 3SVZA 1GRNA 1U0LA 1U65A 3BDVA 1CLUA 1VKRA 2G67A 2QAJA 5BSMA 5K20A 2B99A 2UYCA 3M4YA 1G8JA 2HPZA 3K5HA 4UTZA 4PSDA 3RC2A 3WSVA 3K0EA 2D1TA 1E2FA 1VKOA 3G1TA 1TVEA 1WCYA 3MINB 4MWZA 4ER6A 2A9OA 4BC1A 3GB9A 2FJUA 1W59A 5MDHA 3IL2A 3F1KA 1QHSA 3LZDA 3ES9A 1A5AB 4P38A 1JI0A 4YO7A 1JIXA 3SU8A 3V00A 2RH9B 1NHGA 1O96B 4U8GA 1FFCA 3GX1A 2D4AA 1R5OA 4IJVA 2DUUA 4ND5A 5HUJA 3HP7A 3PZBA 1H4SA 3CURA 4B46A 1NQAO 3JQ7B 3ZZ0A 4PG5A 3OEEA 1Z0UA 4IUYA 5G4KA 3RTBA 4RL4A 1JAXA 2VCYA 3FCAA 4HB2A 1FTWA 4GOND 4GP6A 3VC7A 3ZEAA 4F3CA 5GONA 5BSVA 4RDCA 2ZRBA 4ZQIA 1OXKB 5HUHA 5K0ZA 3VSEA 1JG4A 3KVRA 3WL5A 1VKNA 4JEHA 4URVR 3IBFA 2PUWA 3H1BA 5AJUA 3T52A 4HQOA 1FNNA 2FQYA 1AB6A 3HRKA 4JEMA 3E5RA 4L3OA 4I5EA 4AUMA 2WT4A 3NVDA 3CF4A 3EVZA 3A05A 4JP5A 1VC2A 1YRQA 2IU6A 2YBEA 1HTTA 1MAVA 4MB2A 2BFNA 3KVNA 1YOVB 3AY6A 2B6NA 1G66A 2DY0A 3OTIA 4IMIB 1WIWA 4BQRA 1C7EA 1U0HC 5HKKD 1NBWB 2H00A 5G4LA 3CTMA 3AWDA 3KXPA 5AKGA 2BEVA 3K20A 3PD0A 3FOFC 1N9GA 1RM5A 1I1QB 2LCFA 2NX2A 1KI1A 2ZBVA 4N39A 3ZUGA 1AH2A 3AUYA 2CZCA 3HKCA 1WPGA 3E35A 4Z4EA 3QPUA 3O1LA 4C06A 3FDZB 5K0SA 1ZGZA 1Z0IA 2QRQA 3G2OA 3HBNA 1N8KA 2M6LA 3LQ2A 2BTEA 2G17A 2RHMA 2VF5X 5EJEA 2EQBA 4X92A 3OCCA 5AW1A 1MVNA 3HCEA 3MWDA 5FOTA 1DO2A 2YDXA 1NVDA 5KC9A 1IOZA 1MCZA 1ZD5A 13PKA 1NOKA 2GM5A 1GCIA 4HXEB 4PC6A 4D9JA 1G5RA 1G5FA 1VLQA 3SGLA 421PA 2W4IA 2BMAA 1ENPA 3NDIA 4XGNA 2ATEA 3K6JA 4YCSA 1V6CA 2QVGA 4HP8A 5CM8B 1T2UA 4LJSA 3FFTA 4AJKA 4D42A 3AR4A 4DLPA 4B7XA 3ZXYA 2CXOA 2Q4OA 2Z0MA 3EIWA 2A1UA 2OC9A 2Q4TA 5L40A 1SK8A 1RHQA 1IEWA 2BJVA 4WAUA 2HWWA 4MITA 4MVCA 2BHTA 1KOJA 2FWBA 4YT5A 3EH2A 5DP1A 1U0GA 4NJMA 2BKLA 3BH0A 1QM5A 3ASYA 4QU9A 2VL7A 1ABFA 4ZCSA 4AJLA 2I34A 3GUHA 1KL7A 1GV1A 3PPVA 3G1WA 2WM2A 2DJ5A 1W25A 2WM3A 3JAMA 2JGNA 4O3MA 4JMLA 1MGPA 1X19A 4JBHA 3M2TA 2ZUEA 3PNLA 2VHVA 4S04A 2QSJA 3MMPA 1SO8A 3WK7A 4RSGA 2J41A 2RI0A 4G4SO 1T0UA 4OL9A 1E7WA 4FX2A 5LLSA 2X9QA 4B34A 5B53A 3NATA 3TQTA 3SQWA 1NP6A 2OXCA 2CVQA 4TVKA 1L4NA 5TT1A 4DLSA 3AKDA 2I78A 1BCSB 2QVBA 2E6UX 4Z53A 1PCXA 2IUFA 1OX5A 2IY7A 4QVGA 1PJSA 2Q07A 4LZLA 1IJEA 2PUTA 2SECE 3HKDA 5JD3A 3GELA 1JWLA 3TW6A 4R0MA 1KZ4A 3AOEA 5DIZA 4B48A 2WA2A 1ZNZA 5AHWA 4DIUA 3PHGA 1BCRB 2IT1A 2C4MA 2FPRA 2V74B 1PI3A 5IPFA 2N3ZA 1ST3A 3DD5A 1CT9A 3PC3A 1E3SA 4BL5A 1P81A 3V8PA 3ZNOA 3AONB 1EDDA 1QTRA 4OG2A 1CUGA 3HDVA 2D1SA 3LNCA 3LU1A 3P0HA 1L1EA 3I8XA 4R8KA 5IC4A 4US0R 4DR6B 1NVAA 4EVSA 4PG6A 4BRZA 2DBZA 1QOZA 4CJXA 1M6NA 2VNHA 2O2YA 1WXEA 1J2UA 3DXYA 5F1YA 4EVRA 5BUCA 3L2OB 4CL2A 4YYEA 2IXFA 4M1SA 2PS1A 5T8KC 4ZOAA 2RGAA 2ZYUX 3E0QA 1QC5B 2KLBA 1YJ8A 4M60A 4QXMA 3V6MA 5K01A 1E2DA 3UHOA 3OZIA 2AFHA 2R3SA 4UM5A 3VSBA 4X41A 2Q5OA 2Q0HA 2QYSA 1QAOA 1NIPA 4HDOB 2XUPA 2ZDQA 3ETDA 2JB9A 4P98A 4DUGA 2NN3C 1H2AS 1UANA 2JPDA 4HNAB 1U94A 3HM2A 1RXIA 3OLQA 4LK3A 2FDRA 2GB4A 4TLMB 1T3LA 2F17A 3V32A 3AHFA 2C2KA 5CA1A 2DHQA 1ZONA 3IIIA 4L4RA 3WNVA 2VSFA 1DKPA 2PJDA 1RI4A 1X0XA 1E3QA 1EIWA 3NRCA 3B12A 3GC6A 3NH9A 1RFGE 2BEJA 3QGMA 1FYEA 5SYNA 2EFEB 2V4UA 1UPAA 3MCWA 2B4QA 3E15A 1AGXA 4ZVRA 5LBIA 2OXIA 3U7EB 3IHTA 2WIBA 1Q91A 5A05A 5BSRA 4D41A 2ZKLA 3STWA 4BJHB 4A0QA 1NI4A 2P5YA 4LY0A 3RYCA 5JS6A 1CP3A 1OI4A 1PN3A 4RMIA 3R0JA 2YWRA 3DNMA 3DFZA 5CU7A 2Z2ZA 5FOXA 3VNSA 1HYQA 5KTTA 1D2CA 4Q1VA 1J5PA 1U0NA 2AQHA 1GLGA 1KDTA 4TUYF 1QHNA 3NT5A 4KR7A 4N3AA 1KF0A 4C20A 1YDGA 4YXWA 3TTVA 1QXSA 2Y27A 2AJCA 3EDOA 4CG0A 4E33A 1AUVA 5F2EA 4U5QA 1ZEMA 3LS2A 1EWQA 1Q77A 4PONA 3FOZA 1LDMA 3QOYA 3TD2A 1WQ1R 4JWKA 5CR9A 5BWLA 4P3KA 1JR2A 4WNAB 5K6AA 1PZNA 1SHUX 1ZP6A 2WFLA 2YC4C 4UZSA 3KQTA 5ED4A 1TKRA 2Z2IA 4PNEA 4BQIA 1RI3A 2QL7A 4ZAWA 5HK9A 1IY8A 2B2XA 3F4BA 1Y1PA 3IAXA 3ZIDA 2RAPA 1ACLA 3DEKA 5A5GA 1SCBA 2VPZA 4H35A 3DLCA 3WRYA 1GAWA 1MH9A 1ZYUA 4AG6A 3HCFA 2VXYA 2HHJA 5KX5A 2FF5A 4H3HB 4BZWA 1K7CA 4W99A 5JLJA 4B7AA 5JCZA 2VBCA 3KSDO 1AN9A 4PQGA 3AETA 2FMKA 1CQWA 3OT4A 1O03A 2GF2A 1MABA 4XIFA 2NYVA 3GAZA 2EWMA 3MJEA 5EQJB 5BRNA 1JHOA 1Q22A 4YV2A 3I9LA 4OVKA 3CPSA 1MQAA 4PO1A 2HW8A 3F67A 1ESDA 5LZ4A 5I7UA 1ZD9A 1DC3A 1GGFA 1KWKA 2YZGA 3NUQA 1XLTA 1KKLA 3SHVA 5JDIC 2AG1A 4PPGA 4MPDA 4QECA 2ATVA 2ZSIA 4Y0NA 4D9BA 3GD7A 4MQFA 4YUAA 2BI4A 2ACVA 3GJXC 4HZUB 1US8B 3FUVA 4TWRA 3SX2A 1V9LA 2XOXA 3MGBA 5DX8A 1R0BA 4OHXA 1M1UA 3SC3A 5CEFA 4Z9YA 4MV7A 1EHIA 1D7AA 5K1ZA 4FCTA 3PVZA 5EE5B 1MX3A 2HH9A 3SF0A 3FWZA 1JDZA 1OI7A 2GQ0A 2WHEA 2VP0A 1MDBA 2QX7A 1KPIA 4UMEA 3OT5A 3OUTA 4LGYA 4EVIA 2QA5A 4LJ8A 4I6EA 3L7KA 3FUUA 3ZXIA 5K51A 3KJEA 3UMCA 1MF7A 3UT6A 3J7AC 2BGMA 4R8MA 5DBOA 4EG1A 4JELA 2OBFA 1BS1A 2GBPA 4WACA 1KZ9A 2Z6QA 3IQXA 2ZAOA 3R76A 2WJIA 5AI6A 1KZ7B 1L7RA 3IH5A 3PSAA 5L95A 3FX2A 3TSAA 4CPDA 4ESOA 3SOZA 4XVUA 3V7WA 3JQ8B 2G9VA 3CE6A 2FH5B 1XZEA 1KVUA 1IQ0A 1KK3A 2Z57A 3GGGA 4JJAA 1P74A 3SIWA 4FN5A 3N2GB 1GEGA 5CVJA 1IY9A 1T6XA 3AY7A 1IULA 1GUBA 4G0YA 3HSKA 2F2TA 4NTZA 1AHNA 4DJJA 1XROA 1XTUA 1Z08A 3GLUA 3QFRA 3Q7IA 3T94A 4BOYA 4JUBA 4BNTA 4YREA 5DWVA 3BZWA 4IVNA 3L46A 2WE8A 5C37A 1WUYA 2R9VA 2OLEA 1Y63A 1A8QA 3TS1A 3DFMA 1E63A 1Z3CA 4QBGB 2QU8A 1Z16A 3PR1A 4CKBB 3AFHA 4RKFA 3VKVA 2WR8A 3AKCA 3FCEA 3GFOA 3OQ1A 5DHUA 1GAQA 3RIMA 4MUBA 1G20E 1TJYA 2NSJA 1FP4A 6YASA 3EPRA 4LDRA 2O2ZA 1VJRA 5B64A 1NE7A 5KVSA 3G0CA 3T9BA 2JZCA 1NJGA 4G85A 5TPWA 1HTWA 1KU0A 4JYBA 3ZHOA 2BCJQ 4KXWA 1N6NA 4ZRDA 2WTUA 2H1IA 1GEEA 4UBIA 1P7YA 4UNSA 1QTQA 4DV6B 3UXHA 1GZ5A 5B1YA 1XCJA 3A1VA 1WA5A 1OZFA 3VUFA 2CUKA 3CC8A 4JUAA 4CV0A 4ZDJA 3NC1C 1Y6RA 5FWXB 2VK1A 2IYUA 4YJFB 5EFOA 2C8JA 4OBWA 3TLGB 2D1YA 3RHTA 3CVYA 3AXTA 4H6VA 1PX2A 2WZBA 5LA6B 1YL6A 2W2LD 4WMLA 3NAMA 3A6FA 2A59A 2EFCB 3GRUA 2HMVA 4IDCA 4LTDA 4OM8A 5ALUA 5IJ9A 3WGZA 5IF3A 4EEXA 5JD5A 3THYA 2GCNA 4IMRA 4WA8A 1J07A 1SGWA 5DMHA 4BO1A 2BFBA 1JSXA 1T5SA 2AZMA 3MBKA 4KI7A 4NCNA 5CLFA 1C9DB 1CQJB 1OYYA 2H0QA 3GI1A 3L5KA 1RJFA 3MOGA 1IL0A 1DAFA 1RE0A 1J8DA 1IHDA 3FPEA 4BP1A 3KV3O 5EJ9A 2G8LA 2FPLA 3FUXA 2R2GA 4KMRA 2WLTA 4L5YA 5AJHA 4KPEC 4QNRA 4X8MA 2ADMA 3D54D 2ARKA 3ILVA 3NTVA 3IQGX 1ZI9A 1P9NA 3AI2A 3E3MA 1L7EA 1CUZA 3TLZA 1I0ZA 4DHEA 1IU9A 2J09A 4NBRA 3IXLA 1CVIA 3RUEA 3ANTA 1IK4A 3BCHA 1P44A 1Z68A 2VQEB 1CJMA 1T4CA 1KFJB 1YQXA 1SOWA 3TLXA 1KZYC 3AUUA 3E3NA 2IYQA 2YJZA 4PYOA 5EXSA 1NTRA 4DA6A 5JAQA 5E3JA 4ZI7B 2BGGA 1JEDA 4RLHA 5E6UA 1KPGA 1J8MF 1GIAA 3M83A 2VNSA 4K87A 2VI5A 4JX9A 3TXXA 3UYLA 1BDIA 1CDOA 1AZTA 2ONZA 5ALYA 4QOSA 4AMUA 4ALNA 4DIBA 1OY1A 4CL0A 5C81A 5LP6F 3PT5A 3K0CA 4N5IX 1G5TA 1NSYA 1BH6A 2Q27A 2AEFA 5FPKA 2EQAA 2HJVA 3O5AA 4RGYA 1JT2A 2POQX 4IH4A 3G6KA 1QCDA 3FG9A 2J46A 5KYNA 4U6NA 2BUBA 4EITA 4BMOB 3KG2A 4DYHA 4KUHA 4DLRA 3VPDA 3OOHA 3R6TA 3CMCO 4QBIA 1J90A 4OIFA 3OIDA 3AESB 4FLFA 3QLVC 3SICE 4COOA 1VCIA 4EAQA 3K53A 3GJ3A 3IQZA 1N6PA 3CPEA 2JGEA 3GGPA 1VSBA 5GJBA 3DXZA 1JHDA 4KLNA 4DR4B 4GGPA 3GAMA 2V98A 2JK0A 1E6UA 5FP0A 3T4EA 3R0QA 3H9CA 1RJGA 3O8OB 4XFKA 3LDAA 3C1TA 4BLWA 4I5GA 4RPLA 2R8XA 1UH5A 3C85A 4Q7QA 1VYHA 2C2WA 2WIKA 3ND9A 1R8QA 4NYJR 3VH2A 4IGAA 1L4HA 1A96A 1RCTE 4V38A 4BP3A 2QVXX 3K8OE 3ZWYA 2FWNA 1KDYA 1E0KA 1F06A 1X0VA 3IT0A 3QA3E 4O08A 4ZO8A 1JP7A 3A1UA 1OFGA 3VR3A 1U0TA 4TWZA 3VZPA 1M6VA 5C1PA 3FPBA 4G5QA 1CIJA 4NCKA 3K5IA 3VVLA 1EDEA 3A6EA 3SXPA 1IVSA 4KGXA 3OPYA 1VI5A 1NATA 3KZXA 4G1MB 3WJAA 4O2AF 3GWZA 2CYBA 4JBIA 1PJRA 2F62A 2ZYWX 3PLRA 4FCVA 4UEWA 4XIGS 1MKYA 3GQBA 3EPJA 3REGA 3RU2A 1VI6A 1EXNA 3DO5A 4FD3A 1E5DA 3G9XA 4IUDS 4R1UA 4FOOA 2OFXA 2A3NA 2HT1A 2CK3A 1BFDA 2D00A 1RJ9B 2YJTD 4GF5A 4GSLA 1TA0A 2IP2A 3IUNA 4Q3LA 5HGXA 5EMLA 1ZOLA 4RTRA 4TZ6A 2I67A 2Z1NA 2PWBA 2BFOA 1B8UA 2GDZA 3EMBA 4DVGA 1YS4A 5CVDA 1Z5VA 4B45A 2CE7A 3LX6A 2IC5A 3QK7A 4M76B 3KKZA 2C3MA 3G2QA 3D8HA 4NMMA 4M0FA 3GCWA 4LY6A 3BL5A 2YV4A 4FWTA 3R3JA 5EJGA 1P1BA 4Y1RA 3S8MA 2DT5A 3ADPA 4EI8A 3DNPA 1KR2A 4GWKA 1LZKA 1JDBC 2G83A 1IFXA 4ER7A 3BKXA 4D74A 4U1RA 1LNZA 4U7WA 1OZ0A 3SBOA 3STVA 3SC4A 4AY5A 4DLXA 3OWHA 2ONYA 3L5OA 4P7GA 2ZPUA 3LC7O 5CXUA 2YWEA 2AYZA 2GUGA 3LW7A 3TR5A 4YJ2A 2HDOA 2CJWA 3AMVA 3E7PA 1IH8A 2J3QA 4KHZA 2HGSA 4JLJA 2FPIB 4W8OA 3H11B 1ARZA 1B8NA 4CUZA 4DDWA 2FPWA 1FLVA 4HB3A 2W2PA 1U9ZA 3H19A 5CFPA 1KQ3A 5I48A 2C9DA 3HA7A 5A5EA 2EGGA 4CCSA 2Y92A 4L9WA 5KNCA 3NXKA 5JJCA 3VR4H 4TXNA 3VMFA 2RE8A 1JQBA 5FFMA 2IHKA 1RWBA 2XXAB 2WU0A 2P69A 1NR5A 4CKZA 3K6SB 3IPCA 2CF6A 3DE0X 4TSRA 3S2SA 2D1RA 4TMVA 2A33A 2PCJA 1P7VA 5KYGA 2OD2A 1CB7A 3VNRA 1DFIA 1KEEB 4WKGA 4OSEA 3TQRA 2I2XB 4XX0B 4YONB 1E9AA 5AKZA 4EZBA 5I4BA 1F0YA 1UOEA 2YWGA 2NNLD 3CISA 4PLCA 2GM4A 3AVTA 5EWLB 3QHAA 3GJRA 3QPVA 1YGYA 3KEFA 3NI2A 4JIGA 4LYYA 4PE5B 3SS9X 5JPDA 4LDNA 1OX4B 1ZC4A 3QKIA 4GLFA 4RD0A 3MYYA 1SULA 3LL4A 3OO0A 1NLUA 2B8TA 3KC2A 4BAGA 2A8YA 1REQB 5TIIA 5BW8A 2GD2A 3QH4A 3BGOS 1XAHA 2G0NA 1ONSA 2QQEA 3ZV3A 1Y0BA 3T3MB 3AFGA 1NG9A 4G0PA 5TQ2B 1JECA 1I4OA 2D8MA 2G1AA 2QNBA 4N4AA 1NR1A 2HPHA 5KJEA 2PGIA 1NASA 3N70A 5JY1A 3PE3A 5C8YB 1ODLA 2Q5LA 3LCMA 4I55F 1OH6A 3U60B 5CGQB 3UC9A 3A9UA 2R86A 4I1IA 3TCKA 4Q37A 3UENA 3U3ZA 3V4SA 4FC6A 4KPFC 3DE3X 1F2VA 1I80A 1I5OA 1XRMA 2UZIR 1PJ8A 1U2QA 2OG2A 2Y0CA 4ND2A 3VHQA 3W7BA 4G1UC 4L85A 1CY1A 4LVUA 1IIRA 4ZO6A 5DHTA 1Z83A 1RJEA 1ZLXA 3HWX1 1ABBA 1FQOA 2Y99A 4ENRA 1R8JA 1E9CA 3EXIA 1MU0A 3K92A 1XRLA 1H5QA 3LVFO 5DCLA 1LGYA 1SIUA 2E49A 3KKKA 5IASA 5KMGA 1Z37A 1XTJA 2GEFA 3ILYA 1A8IA 2P2NA 3QXJA 2HNBA 4G0MA 4Q4AA 5LU9A 1UBNA 1GNQA 4XLTA 2E1RA 4C5AA 1SIWA 4ZVMA 2E48A 2AHRA 1UT8A 3FF1A 4X3OA 4LY3A 4H18A 4ZQEA 3EPHA 2D13A 4RFVA 1AGNA 2HPVA 2QT0A 2Y0BA 4XAQA 5HKKA 2V9PA 2YJNA 3IERA 4WKNA 2ZJAA 3NBFA 1YXMA 1EFKA 2JJYA 3BGWA 3D8NA 4WGFA 3RVLA 1JEOA 3MIIA 5D5QA 2E82A 1MV8A 5DBEX 3KOYA 3OZBA 1I51A 2IVZA 3LK6A 5DW3A 2PMEA 1BFUA 3QKWA 2WUGA 2WKWA 4RHFA 5LXTA 4DV4B 4WXHA 1I7PA 2GWHA 1RVV1 2XT9A 4GC9A 2JH9A 3PUKA 1GQQA 2C4WA 4FVTA 1NU8A 4HAVA 1R0LA 1EDOA 1UXJA 1MEEA 2PQMA 3EJWA 1XMPA 2PR2A 4TYNA 1R5BA 4IQ0A 2GN6A 5CVTA 1AMOA 4ZQBA 4FNMA 1VE9A 1YL7A 1KS9A 5CEJA 3PE4A 2FW6A 4BNLA 2BOVA 3L93A 2DR2A 5DCYA 5IN5A 3ZCQA 4JJGA 3HBAA 4Y6OA 5J1TB 1G0OA 2CDBA 2PH7A 1N5JA 2YW2A 3LPNA 5ARCA 5IG2A 3H1TA 2ZYVX 2C0QA 3FNBA 3C15C 4JGGA 4MAFA 4CTJA 1Q6YA 3NGMA 1YD7A 4L9SA 3GNLA 5C9ZA 2V7QD 1YTUA 3LKBA 4EY4A 1HSZA 4R2WA 3BGSA 4BMDA 2GN2A 2Z04A 3DGFC 3LC1O 4I08A 2DPGA 4CT0A 1FFHA 2YTZA 3PEVA 4IIJB 3K32A 5GP1A 1DX4A 2I7DA 3AO0B 4OAQA 4CF5A 4TTJA 1HE8B 3C6KA 4L02A 3IT3A 1KJWA 3H8VA 5J4LA 2UYYA 5KOYA 3PR2B 2YXEA 4DCUA 1PFWA 2MDTA 2EJVA 3BZUA 2C8VA 3DF9A 3EIUA 1NNI1 3NDPA 4IIFA 1JVBA 4UPDA 1A77A 1YO6A 2ZSFA 3R0IA 5J4KA 2PWZA 1U11A 2QDKA 2P9BA 2PMFA 3RVKA 1I94B 4AY2A 1SXJD 2X2OA 1KMNA 2HRQA 3U4IA 2HTFA 3EIOA 3L0CA 4BMXA 1Y8RA 4FUQA 3TRIA 1PZGA 4L4ZA 4MR9B 1C3LA 1XPOA 3BMCB 2FSPA 4RO0A 5IF9A 1NX6A 3QOFA 3ZHZA 2QZSA 1FDSA 2CCGA 1P60A 1YZKA 2ETXA 3F9CA 3B3FA 4U2FA 2OFFA 2VNAA 4D5EA 1W76A 1IWBB 1R37A 2C78A 1M0TA 1WKBA 2FX3A 2XQGA 1JLMA 2V6IA 3EBPA 3OU7A 5I9BA 3SJZA 3WL4A 5J4YA 3Q3VA 1B6RA 4BNXA 5AUNB 5L4LA 4CG1A 1VE3A 2HQBA 1Z4LA 3L7OA 1R4MA 2DAPA 1F4LA 1ULZA 2PR7A 1EK5A 3S55A 4MDEA 1OFUX 2P4UA 2YW9A 2XDAA 4XSHA 4J16A 3MNFA 3PX2A 1AUPA 4YRCA 3UJCA 1M8FA 4D8XA 3WGHA 4AJ2A 4P58A 4U2BA 2HBYA 1AKUA 2GZRA 1Y4ZA 1ODKA 4JI8B 4WY8A 2OCGA 4LZNA 3T1QA 4MCIA 2IP4A 4Q15A 1KQPA 2JH8A 1LLCA 5ADVA 4E11A 2E4AA 3VISA 2IDZA 2UYGA 4XUDA 4D9HA 1DAMA 5DHQA 2OKGA 4KQXA 3QI2A 3TNYA 5CYGA 6LDHA 4LDJA 1E2LA 1O4WA 3RVPA 1O57A 4B17A 3P20A 1OREA 3M89A 1HKUA 1UZLA 4YRDA 5GGYA 3AVWA 3FHLA 3TNFA 2Y4NA 4YN3A 1M6YA 2CLDX 1FUIA 1K8ZB 3QWHA 5DI3A 3WMGA 4F1JA 1UR5A 4J94A 3OQPA 4O4IB 5A7HA 4B8ZA 5C3UA 4D9MA 1MQ8B 2YV1A 4G0QA 2I6TA 3I4FA 4L3VA 2YRXA 4QX6A 5AVJA 5HNKA 3P8ZA 2HSGA 1SHLA 1UMCB 1L3BA 4FUTA 3ER9A 1EDZA 2C2GA 2QHXA 3G2MA 4IMJB 5CTAA 1LBSA 3AJDA 3EG9B 4IV8A 3RSHA 4LOAA 1SU7A 2JHGA 1C8BA 2PYIA 3DOFA 1JSZA 3CVVA 1I13A 3T7AA 3LFUA 1Z8NA 2C7GA 2AVNA 1E4OA 3A58B 4KQHA 5B4UA 1ZUD1 5EJIA 1Z38A 3PYXA 1KQFA 1O08A 4OUDB 1N5RA 1U80A 4DZZA 5KYXB 1T5OA 2REQB 3I9KA 4LFBB 4LDPA 3QJ5A 3R5HA 2JGKA 4NYIR 3MG9A 5AKYA 1R9NA 4M88A 1JIIA 2OZLB 5FL7D 1SUFA 3CVXA 3WIEA 4HEQA 3ZC3A 2ZTLA 3ZPXA 3MOIA 1SOVA 4B9EA 1P0CA 4RD3A 3HYNA 3IS3A 4BWVA 3QFHA 4TS9A 3A4IA 2GN8A 3OJOA 4ODIA 1VL2A 1ZH2A 4QJIA 4LC0A 1TEZA 2WINI 3FCYA 3JQ9A 1OA1A 2E89A 1Y8QB 2WM8A 3IQIX 4JROA 4G8JA 3V9PA 5J58A 4S1NA 1IONA 5LP6C 1E7SA 2A88A 3CLUD 2I3AA 3PI7A 3R5JA 3ZWDA 4E5VA 3KHSA 2FPPB 2VP9A 4NENB 2X8WA 1NSFA 3PC7A 2ZE6A 3M4XA 1YS6A 4MQBA 4WZAA 4QFBA 1KWGA 3OZGA 1U2GC 3JWIA 4MWCA 4DJ5X 2A3RA 4EY3A 3K05A 3I1IA 2QI9C 1SD1A 3GCZA 4G1EB 2NACA 3O6VA 5D8DA 4JJKA 1DIAA 1L3IA 3PLNA 3PUYA 1JFFB 1XTPA 5DBIA 2NVWA 1RNLA 1UBSB 3V80A 3BHJA 3PL1A 3WS7A 5B5SA 1XZPA 3CVUA 3SXJA 4CMGA 3SE7A 3MWLA 3PXEA 4HAOA 1GADO 5LLTA 4M8SA 2F55A 4FFLA 2YIJA 3DV0B 4MDHA 2P2DA 4IKEA 5IEBA 4GQBA 1T5TA 1P5FA 4D8UA 5BMOA 2XUZA 4WFQA 5THQA 3B5EA 4PLGA 3U1TA 3X1ZA 2C57A 4DWJA 4D80A 1DJLA 3G9UA 2OV1A 4KQGA 5EESA 3CNOA 4MJ7A 5B7GA 1VMEA 1VIMA 3QKSA 4ZOLF 4BPBA 1TAHA 1PNQA 2YHBA 4WZBB 1QHEA 2Z6VA 1VFPA 3HNPA 1T3SA 2O7NA 1GQOA 2AI1A 3AR5A 1BWRA 3MIZA 4YBZA 3W2TA 5BVHA 6NULA 4OA8A 1SXPA 5BURA 1DG1G 2BKVA 4K6MA 2GTHA 4MK4A 2CXTA 3H4TA 4X63A 2EHDA 3KT6A 3ZCRA 3QUAA 4ZGWA 1AO0A 1RAIA 2C9CA 3C6YA 5AHOA 2HV8A 1IQPA 3I5MA 3A2KA 1WLYA 1TTQB 3SZMA 3PGKA 5BT8A 2OESA 3V6LA 1G5HA 1OLUB 3I3OA 1YCDA 3DM9B 2ZTSA 4P3PA 4RJ2A 5KYUA 4EPTA 4A10A 3ZX5A 2FUEA 2R8ZA 1ECCA 4OYYA 2A0YA 1A9ZA 2JJ1D 2JIPA 2BLLA 2WJHA 3H1PA 4UDOA 3AHJA 1QYRA 2V65A 1YIOA 3JQGB 4HG2A 4F7DA 1ID8A 2R4QA 3U80A 3SS8A 5LOVF 1OU0A 4DWOA 2ZZNA 5A1TA 4C43A 3V4FA 4NBTA 2OM2A 2XF8A 3G8CA 4S1VA 4ZIRB 3ZJTA 5A0FA 1ZJZA 2XY4A 3NVMB 5K0JA 4EHJA 3TE7A 1QIGA 4IDPA 2AJ8A 1SKYE 2HEIA 4FDLA 5E1BA 5C0OE 1KDZA 1FNDA 3GARA 4DIMA 4Z7QB 5K09A 1JSCA 5K3AA 1JG1A 1W581 1NC3A 3GJ0A 5JXJA 1UPTA 4EH1A 2IXTA 3ULKA 1JG3A 2P78A 1TM4E 3NT2A 3GLHE 3O1JC 5CYPA 3THOA 4YRAA 1TZJA 3OCYA 2SKCA 3GUZA 4K1LA 2D0DA 1IBRA 3DMGA 2RHCA 4MQEA 5DK6A 1IAQA 1F0PA 2KX7A 4D4KA 4DFDA 2FG5A 2O8DA 1G7TA 3HPRA 3HMQA 3PXAA 1NE2A 1GSIA 4JUCA 3CLSC 4PLHA 2CL6X 2Y0PA 5H0IA 4YX9A 4ZO9A 3O9ZA 1F0NA 4EB3A 4D6YA 4B6OA 4C9BA 1IY0A 3HJAA 1E69A 6CHYA 2OTCA 3TLBA 4TV8A 5AHKA 3GJ4A 2K7ZA 2Z08A 4D9EA 1V8FA 4U7GA 1J42A 2XDQA 4LYJA 4R69A 4I3GA 4QGGA 5EMHA 4QUDA 5AJWA 1V8DA 3TW8A 2UZAA 4JNCA 1C5KA 1YU6A 3K0HA 4HV4A 5JNUA 3FFBA 3RT7A 3O31A 3ANXA 3L7BA 3FROA 1G2IA 2HK7A 2NV6A 2NUAB 3WWOA 3B6JA 2GN0A 4RTJA 4UBOA 2JFNA 5DULA 2GJSA 2XWJI 3FZYA 2PGJA 3N0RA 4UTRA 1DKMA 4H7KA 1TJ5A 1IUNA 1CR2A 1NRIA 2I6SA 4O4JB 3OESA 1VL1A 4DM3A 4PINA 3GT7A 3IULA 4CW7A 4RNCA 3M70A 4LXIA 4HX9A 1FXUA 4J6EA 4RD6A 3AEUA 2NP7A 3GZTB 2IHUA 1Q0LA 4F2GA 3NDBB 2R48A 4LRTB 3HGMA 4E2FA 3OZEA 4NNPA 3G2PA 5WRFA 3V8QA 1J0CA 2AC4A 2VPIA 3WIUA 5ALEA 1NXPA 5LDHA 5DN9A 2PKWA 4JYMA 4F4CA 2RHHA 1Y5IA 2YR0A 3MILA 4Q1DA 3GA7A 4MYCA 2C9ZA 4RKYA 5ERYA 1VCHA 2FSSA 1H66A 3H6GA 1TLTA 3TR6A 3UIEA 3UV6A 2UUBB 5DOZA 3GZNA 1GLVA 4HGYA 5IX8A 3B9PA 4ZQFA 4RQUA 2X15A 1JEEA 1MAAA 5GOTA 4UARA 5CA0A 1X80A 2QM0A 1T9GS 1DQZA 3TXAA 2JAWA 3O9VA 2QUHA 4UQOA 2JLZA 1W36B 2GVDC 3MJDA 3WWZA 3ZQ6A 4GXRA 1P1FA 4Y6LA 4RD1A 4K3VA 3VO9A 1VHDA 1M73E 2PD4A 2VS1A 3CN7A 1ND5A 1IATA 1Q0QA 2B7CA 3EMDA 2G5GX 1DAOA 3ZLUA 1WHTB 4ND6A 3KUXA 4B0OA 4E7PA 5JARA 1R8SA 5GM1A 5J5AA 4B5KA 1IHUA 2D2XA 1T15A 3F0TA 3PC8C 3PXDA 4BBAA 3LWBA 2GCGA 3GFPA 1GOTA 1YDWA 1YB2A 2CXQA 3DVAA 3FSEA 4MJ3A 4QC2A 4EBBA 3B3AA 2AZ4A 3BRSA 5FF9A 4RPGA 2D0OB 3C45A 3GLVA 3DMRA 4RTPA 2DYKA 3DEHA 1XA3A 2OFWA 2VT3A 2GJ4A 2XITA 3SYNA 4G26A 1C1DA 4OSPA 4LZOA 4IJQA 4OD0A 3JCZA 1HYGA 1RCUA 4LECA 5DM1A 1EE2A 5B6PA 1R6DA 2JI8A 2RKBA 3BXHA 4XUGB 2ECKA 3F5QA 3GUCA 5KQSA 1FDUA 1T0PA 1AXRA 3SFZA 4O2BB 1II8B 1UP7A 3PXCX 4V1CA 4KN5A 4A0RA 8AT1A 4J6FA 5DBFA 1YS1X 3DMNA 4PLYA 4DUYB 3MTQA 3QYAA 1P4JA 4ZAXA 1RJWA 2IHJA 4N5HX 5FBWB 3VPAA 3VKGA 3TZKA 1FF9A 5C1DA 1JMVA 5B1IA 1UODA 4ZHQB 3ENKA 3SIPA 5GZ3A 3WGQA 2NIPA 2RAUA 5KOHA 2GEJA 1H1LA 3T7TA 1NP3A 1CQXA 1LS1A 3RVBA 4ENPA 2IQIA 2FEAA 4GI1A 3N58A 1Z6YA 3U31A 1VBFA 2QNRA 1HG1A 3QMPA 5BRAA 2PX2A 2JL1A 2JLQA 4RAQA 2NWQA 1I33A 2KWIA 3QBDA 3SM9A 3U7GA 3CZPA 2AQ8A 3IIMA 1E7MA 3AL3A 3LXMA 1KK1A 4JVMA 3W8DA 4RV9A 5BMVF 4R68A 3IODA 4F3NA 2ZVJA 3B9BA 4IHJB 1DMRA 5DLDA 4BX0A 3U4GA 2P11A 1TZMA 3MXOA 4YNBA 5H9WA 2CEKA 2ZJ1A 1JHXA 1XQXA 1TK3A 2WJGA 3N8GA 4YFYA 2F9LA 2X7XA 3CUKA 3MYRA 3AFOA 3EIEA 1E18A 1F7UA 2HSJA 3V8EA 4P3XA 4BP9A 2UYOA 4LHEA 4EZEA 1TCUA 1GSHA 3HJRA 1QFJA 2P6UA 3NIDB 3ZTWA 2D74A 3LDHA 3ZWBA 3NDRA 3NJ8A 3KZVA 5ALSA 1BDJA 2OBMA 2Z8XA 1SXIA 3ETHA 4TT3D 1VGVA 3LVBA 4RQBA 3V1KA 1U31A 4CU5A 1EXMA 1HT0A 2QP4A 2OILA 2WG1A 1H69A 3LFHA 3PDCA 4PSAA 4RXMA 3LY7A 2B1RA 2HXGA 3KSUA 2WY2D 5A5FA 4CIBA 1FFYA 1OC4A 3H3JA 5JS1A 4DT1B 4QUEA 2FUG6 4MQMA 2CVFA 2DFPA 1X13A 4CTKA 1E20A 1QCZA 4FYJA 1LSOA 5F7ZA 4K6HA 4QWWA 4ZYWA 4RVHA 1HLPA 3P7MA 2ZVQX 3KEOA 1V5WA 3BSYA 1COZA 1P77A 4NF2A 1GXSB 4BNHA 4EAAA 1QPZA 2FEKA 5HM6A 3K5WA 1V37A 5G0SA 4BAUA 3NTUA 2XW6A 1SVKA 2AMVA 3UXEA 1BKSB 4LE1A 5CDFE 3UGJA 4FSDA 2RKWA 3WL3A 2WHPB 3CUYA 3UMYA 3MMSA 3H4VA 5IMSA 4DLNA 4EG8A 1H65A 5I4KA 2TRSB 3GMDA 1JDNA 1BFKA 1N5OX 2YBDA 3JYNA 4JT2A 4EGQA 2O3RA 4NWIA 5IAAA 4XPZA 1I4EB 2A5JA 2H4JA 3H5LA 1ORRA 3RDPA 4CI9A 3HS3A 2C00A 3QUSA 1CX9B 2QTVA 3CGGA 3DVQX 1FFEA 4IFTA 4LRWA 3IQDB 4F6RB 2M1XA 4I5IA 4WCDA 5K0EA 3I2IA 1J9GA 2PJUA 2Q6LA 1O94D 1IXZA 2ZTVA 3QNMA 1CEQA 1CUFA 4WLFA 5F64A 2IIVA 1CRPA 5ALFA 4JJFA 3CVWA 2VUTA 1A2QA 2I66A 1I6LA 1NURA 3MK31 3E7FA 1NYRA 2ZEJA 3C70A 3CO5A 3HZOA 4JITA 5EUBA 4ROTA 3ZD6A 7AT1A 4P84A 3LBNA 2I7XA 2JBAB 5DNWA 1B43A 3ZCTA 1ZD3A 1GR1A 1LI7A 3GLFA 2ZJ4A 4G4JA 1BDBA 2TSYB 2X0FA 1N6KA 3ZXXA 5SYMA 4AXBA 1CRLA 1ZN8A 1WXFA 3IBSA 5GJVC 1XF9A 5EJ4A 2XUFA 5INTA 2MSLA 1RRKA 3PA6A 4NARA 3QYJA 2XDYA 3JQQA 3TOCA 2IOFK 3P2MA 3MJSA 2AJTA 3I2KA 5HJEA 1N3IA 3IPLA 4A6PA 5CBPB 1QTIA 5L4NA 1U3GA 5BXYA 1KSGA 5CD9A 4AKGA 2FQQA 4NOKA 1KIAA 3X1XA 1Z4PX 5CIWA 3UK2A 5JADA 3U56A 2PX5A 4YRGA 5K3EA 1ZH4A 3AJ9A 2O8FB 6REQA 1CD5A 4R83A 1KXJA 5CCEA 2CFSA 1K89A 4NL4H 3OOWA 2VRNA 3H2JA 3KJXA 2Y1FA 4YP0A 4H27A 2JFBA 1Z2OX 2AMYA 2O0HA 4F45A 1I5EA 1H2YA 2TMYA 2FETA 3GLGA 1U02A 2QWXA 3W3AA 5FWNA 4UAUA 5EAIA 3W8EA 4NP6A 3WDMA 4PAOA 1CWUA 1PNVA 2ZRKA 4URUR 4AJ1A 2IS1A 2AFIA 4GKAA 2BJHA 4E22A 3JR3A 2P79A 1X3SA 1HDEA 3EXG2 4YJ2F 2PUFA 2RD2A 1NNEA 3FMVA 2B25A 3ZHQA 5A4IS 2V4MA 4OHZA 1GYRA 2B36A 2QUZA 4JT4A 3SN6A 2CVHA 3B5JA 1LWOA 3DYVA 3GGSA 2ZZKA 4K46A 4RK7A 1UPFA 3JQBA 2PE5A 3TI7A 2XTAA 5HG0A 2P9ZA 1UFQA 1UDRA 2CZGA 4GD3Q 3DFUA 3DE5X 5E8JA 2FN8A 2OSVA 2XYHA 2ID9A 4XIJA 2QRKA 3IJEB 3C6ZA 1WMFA 4EW2A 2CNWA 4CMKA 1DVRA 4AU1A 1QONA 1EG7A 1QH1A 4HVCA 3F8WA 3LUGA 1FJGB 1PV1A 2NT4A 4L8VA 4GI5A 1UC5B 1CIPA 2PAFA 1C9MA 1VYUA 2CBZA 3E70C 2XMCA 3ELWA 2J5XA 2LRHA 2O3JA 3BUSA 3HU3A 4MYUA 4QG7A 4XGRA 5D7NA 3IELA 1PG5A 3P96A 4W1PA 5DPMA 4ZYXA 3ED1A 3LXXA 3L7JA 4PIPA 2BONA 3UTDA 5JSFA 1SUWA 5A3SA 3VGJA 4TQAA 5EOVA 1E5TA 1MHPA 1XDBA 2FRVA 3COVA 2Y1LA 5ELMA 4WUVA 2DLCX 2ZYAA 3L0OA 3HXMA 2JA1A 4MUKA 2HLDA 4QPNA 4UASA 4KVZA 2CHGA 3OU2A 3ZDDA 1W6RA 1HFKA 1Y1QA 1O5TA 4G56A 5A71A 3OKAA 4R3NA 1NVVQ 4XD7A 3F6RA 3GAFA 4BMSA 1GQYA 2YHIB 5C51B 2IXEA 1M75A 3DTVB 5F9MA 4O4LA 2XRMA 3ZOZA 1CUBA 4EYOA 1IBCA 5FEUA 2YFHA 3ON5A 4LJRA 2R6CA 2DUJA 5AH0A 3DJYA 4TRJA 2GKGA 4TN1A 3T4XA 3WLJA 4TYYA 2QJWA 1BNCA 1E2HA 4HAIA 2I4NA 1E6WA 3FA2A 2WU4A 1VG9B 2OXEA 1K66A 4R1TA 1I2ZA 5J2UA 3HJCA 3EQ8A 2WF9A 4CT5A 1U0BB 1Z5GA 2ET6A 3UMBA 1SKMA 4C2UA 3K09A 1G8AA 4BECA 3HEMA 2MR5A 3K9CA 1SXGA 2HUPA 2CL0X 2PWAA 4G0OA 4JLAA 3RFUA 1SXJA 3KWJA 5COAA 4ZI5A 3IRVA 1TU4A 1ZMBA 2YVQA 1DIRA 2UVPA 4G2TA 4DBZA 4EUKA 4YPOA 1JE0A 4AI6A 1II9A 1KU6A 1P5ZB 3ER6A 1LPMA 2IF0A 3L02A 5H7XA 4NG4A 2IDKA 3D3WA 3EPPA 3T3PB 2QN8A 1UKEA 1UBOS 2A4KA 2EG9A 3LYLA 4EHFA 2VHYA 3AVUA 1W85B 3CH6A 1KA9H 3MMXA 1GA6A 7ABPA 3N7TA 1INLA 2HKIA 2J0EA 2AC7A 4LMBA 1SM4A 4LMAA 1WSAA 4K5QA 1XP8A 4ZFNA 2O8EB 2BDTA 2D5LA 3Q0IA 1OB5A 1LQ2A 1PWXA 2DSTA 2GRJA 3WNZA 1TB4A 2CJPA 3OPNA 1NBHA 1EFHA 2XGSA 4A0GA 5KDDA 2I54A 2Z3VA 4XQCA 2Y93A 2MTBA 3KPWA 4CKYA 4OJNA 3S3TA 3JALB 4U7PB 3S1AB 5TNXA 1QP8A 1XFAA 5I7EA 4M7WA 5FFFA 4TKUA 4DIFA 5F9FA 2Y1EA 4ZANA 3QPAA 3SYKA 1AXEA 3NJ4A 1LBHA 4QRIA 1KVSA 1SC3A 1RWKA 2AI2A 1TUBB 1B0ZA 3H04A 3FIJA 4BB9A 4ATNA 1WZ2A 4DLKA 2G08A 5BWMA 1NDUA 1A9PA 4MB0A 4EKDA 4RHYA 3K1AB 3SDSA 2FV8A 4BNUA 1PV4A 5KYYA 1I30A 2R62A 1O4VA 3H2IA 5ENDA 2J87A 5EP4A 1PTJA 2R5NA 4QSMA 2WBLC 3HO6A 5DM2A 3T1NA 3KM0A 1XQYA 3COPA 3I3SR 4UAJA 4JNKA 1WR8A 3MZ0A 3PF8A 3NTQA 3TSOA 3DFFA 2O8BA 4F86A 1Y5RA 1GDDA 4BLUA 4ESHA 1BHO1 2I1WA 1XMXA 3RF6A 1UWCA 5HR5A 4TKLA 1PGPA 1UP6A 1ZA2A 4OMCA 2UXCB 3GJTA 4AF8A 3N07A 4LBZA 4B6PA 5AO9A 4RDIA 5JCXA 4QLBA 1XZMA 5B3JC 4RVUA 1GY8A 4O6VA 2IYEA 2VJMB 3WMXA 3BTSA 4K28A 1H6CA 1YT5A 2IEDA 1NC1A 2XUQA 2YOHA 1UOQA 1AQNA 2VF7A 4Q3KA 2VDLB 4KE8A 4U7FA 2IUYA 3T1VA 2YWFA 5IJWA 4JT9A 1FTGA 2I8CA 4JLOA 4M6WA 1L9XA 4Q3OA 5FL7A 3WHIA 4LHVA 5LQSA 4FGWA 5JAMA 1UM9B 2B98A 2BFEA 1B15A 4C88A 1E4EA 1JDVA 3KK0A 3LUPA 1DJOA 4JXKA 5LR6A 5J2TA 1DWPA 4XXHA 1X7XA 1XGKA 2OHHA 3G0GA 1ZITA 1E4YA 2I3BA 3M9LA 4PHTA 1MUUA 2ORYA 3R3YA 5EZ6B 1YBVA 4GBGA 2AWOA 3E23A 3OTGA 3V2GA 4H7DA 5A3JA 5DP2A 5K0TA 2ZATA 1DAKA 1WOMA 2FPKA 2JJ2D 3JASA 3KSAC 1HURA 1E89A 1H9AA 4YECA 4HS4A 4X1YB 3I4LA 1NUHA 5AW4A 4LVCA 5AJYA 1EVLA 1V8PA 1GTL1 2Z8ZA 2WOJA 4NFYA 3BCRA 4E09A 4XW2A 4MNTA 3QXCA 5L3SA 1ZN2A 1UBEA 1CUIA 3KQMA 1I0IA 1MA3A 1DBQA 3GHYA 4BNJA 1JV2B 2ZR8A 5DYNA 3NORA 1NI5A 3QMWA 4HADA 2G0AA 2UZ4A 1QYVA 4NEGA 3WK6A 8ADHA 1Q0UA 1SQGA 1RRMA 4G1BA 5FUWA 1L4BA 4IJ5A 4R2JA 4WRRA 3PNOA 2ZIXB 3QX8A 2D62A 4MV8A 5EJ7A 2V7PA 2W2KA 4EGAA 3AUJB 3S5UA 5LQNA 3LCCA 3NEPX 3RQSA 2RGGA 2XUOA 4JOQA 4NCIA 2JRLA 2A58A 2WW8A 3BWVA 4KOAA 4WZAE 5FWYB 4DMHA 2JGDA 4QQNA 4D44A 1JPJA 1LRLA 1FUYB 1NW8A 3N2YA 3NOQA 4QULA 1KYXA 4LDZA 5EKTA 4W7HA 2OBLA 3A26A 3RLFA 2YXDA 3UGTA 4TLLB 2FP4B 1FVOA 4KVFA 2EV9A 1JKJA 1VG8A 4FYVA 3AR9A 1B2LA 3HYRA 3LCVB 3Q3GE 5IHXA 2AEMA 5AW9A 3A70A 3W6NA 4AKEA 4HGOA 4EHDA 1NM5A 2RC5A 2O19A 1E6MA 4XWYA 3AX6A 4WK0B 3SPXA 3MJCA 4B1FA 4XZ3A 4ZT7A 3TIGA 1HORA 3IXMA 3MQFA 1AUOA 2XOEA 4WY5A 1FDRA 1P4SA 1VSQA 2MJLA 3VNAA 1PW7A 4C78A 3PRHA 4FU0A 1T9BA 2AOUB 2J3JA 2OAQ1 3CT4A 2ZI7A 3C5CA 1Q6ZA 3VU8A 2OGTA 1DRKA 1U2PA 4FB5A 1PR4A 1BSVA 1P9RA 2OV3A 3A3OA 1Y6JA 5CDHA 2FEPA 4OI4A 2C7QA 1UJCA 2ANCA 3AB8A 3QKRB 2NUTA 3D2AA 2R84A 1EBBA 3BTUA 2UKDA 4TPKA 3IEUA 2ZWPA 2ZUVA 1EXVA 3PJRA 4V39A 3UMMA 1PQ4A 3UMGA 1CY7A 5JS2A 2JGLA 3EQ9A 3FYTA 3EE6A 1FLDA 2VDUE 2H65A 2IY9A 3HMKA 3UJNA 1CR1A 1FFBA 2H2AA 3D4OA 1G3QA 1XQWA 2CYCA 3O0DA 3R7AA 3C0KA 2HSZA 3GAAA 4XB6B 4LV8B 3ILXA 3RYFA 4BCDA 4PC2A 1JLLB 2ZAMA 2ECFA 3R0XA 4HLUA 3H8JA 1R64A 3I2JA 2P7HA 2Z9DA 3MS7A 1W1WA 1UPUA 2I22A 3KKLA 3OURA 5EKXA 2DU8A 1FW6A 1PZFA 1V0JA 2F67A 2R79A 2IJGX 4NPHA 5IXYA 3JD3A 5MGNA 3TPFA 4C0LA 1XTRA 2H4WA 3QE2A 5GONB 3HUTA 3ZU4A 1E2KA 1E2NA 4RGQA 2ZE7A 3K8QA 3ACDA 1MBZA 4IV0A 1T9DA 1X1CA 1E1MA 1O9BA 3A7EA 1NMQA 3PWKA 4M7RA 3TLYA 2EF0A 4D4GA 3GCDA 2H1VA 3FLMA 3OMWA 5TRTA 1W6UA 2ACKA 2MINA 1N6IA 1NKSA 2J59A 4C0KA 1ML4A 4WX2B 1EFRA 4ZCLA 4M49A 3VO1A 1RWNA 3TGLA 3M1IA 4DV2B 1H22A 5KSWB 3KSRA 1XX6A 1XTSA 3FNEA 4UBNA 3IBYA 1ZL0A 1P75A 2A67A 2OHJA 2HO4A 2VG8A 1LBTA 2KBEA 5FTLA 4QHTA 1JEAA 1E4VA 2XQJA 4RZ3A 5T4BA 2QVLA 5TVGA 4DVJA 1Y3IA 1BJKA 3Q10A 4F7WA 1PDOA 3A7DA 1W4BA 3L0SA 3BXFA 1NN5A 1BEEA 2C42A 3AF6A 1EKXA 1JAIA 2PAAA 4QVIA 4PGAA 2CFCA 5H4HA 4HN4B 2P0EA 4K81B 2IHBA 1PFKA 2B0JA 2QG6A 1TM2A 2HU5A 2K6GA 2R8RA 2W2OA 3ELBA 3HBJA 2IRWA 2E7ZA 2OCBA 3LTEA 1CRQA 3BERA 4JT8A 1KI7A 1C9JA 5JZVA 4Q9AA 4K6KA 3LGXA 5CAEB 1KH1A 3MWDB 3IPRA 1QVAA 2QV0A 4LRSB 4BO7A 5KTKA 1C1XB 3HKEB 3ENQA 4HVTA 2IYYA 3KTAB 3L6EA 1A9XB 2ZUUA 1U1EA 3MWEB 3QF4B 1I3LA 2R2AA 1Z5ZA 4X9XA 1OUMA 5CXXA 2VF2A 1PV2A 2AJBA 2NUPB 1DCKA 3V2UA 1DOHA 2V7GA 4MKRA 2W2TA 1GYQA 5B58C 4EQ6B 2ODEA 4LDAA 2A1UB 4P08A 3VA7A 4KUEA 3D81A 3PQDA 2AUMA 3M6VA 5REQB 2VPQA 1A7UA 3O91A 2JF0A 4C07A 3NTXA 1WOYA 2W22A 1RRCA 2RJOA 2ZP1A 3DKKA 5AM4A 2RHRA 5JAUA 3ZWWA 1V8OA 1USVA 1Q16A 2BEUA 3OAAD 4OQ4A 4DABA 3UY4A 2F43A 2YCLA 2QYOA 1T2CA 1XB2A 1GZ3A 3ZLJA 4RM2A 2FUKA 2PKQP 4KX3A 5C1IA 1PHRA 3CEJA 5U1PA 1V11B 4FONA 3DMFA 1GFWA 4AN4A 5EJ8A 2O6HA 3HLYA 3KYJB 5IJAA 3IHWA 3VDQA 1WBDA 4Q1BA 3LHKA 1URPA 4BASA 1MRZA 5ADHA 2ZBQA 1NVBA 2P40A 1IQRA 1WO8A 1SKUA 1A2KC 1JG6A 4QG3A 2I5PO 3RVOA 4OQYA 2I87A 4TV8F 5EJAA 1UMKA 1MO6A 2DTDA 4CMIA 3AK4A 3HKDB 1EJ2A 3RK4A 3TTYA 5BQOA 1M3SA 2FEWB 1IG0A 1X77A 2I99A 3DDZX 1JALA 3PWZA 4I5DA 5EHNA 2JLXA 1EUCA 3KB6A 1P2BA 1XZGA 2E5WA 2MYUA 1W30A 2XRYA 4FZRA 1CEXA 3GPBA 2ZSHA 1UBTS 2CDNA 2JIZD 3L7AA 3E9QA 3TPZA 4NRDA 2Q5FA 2IBMA 3JZFA 5ALNA 1EUDB 3DOHA 2FN4A 1L7XA 1EGAA 4CXMA 2XMGA 2ZIVB 4UATA 4IDEA 4TVSA 1OBHA 1GL6A 3DQPA 4WE3A 3O9MA 5M3BA 4B3DA 4HBGA 3KTFA 5LNK1 1VJTA 4QDKA 4X7BA 4B3TB 1RPTA 5EI5A 3CH7A 4DHWA 3T7JA 3E3OA 3HXPA 5BQ3A 1F60A 2ZIUB 3E84A 4IDFA 3QBTA 3DVSX 3H9EO 3PUJA 3U3OA 1W4CA 5BSTA 1DKUA 1YRAA 4TKMA 2ADOA 4I9HA 4FGSA 5E4YA 4NBWA 4D81A 4KQ2A 3D0KA 3D5QA 3WKDA 2CW5A 1S02A 4WL0A 4ZT6A 5KKAA 4FEEA 5B3AA 3RTCA 5CLIA 2H4XA 3QNUA 4M3NA 2VWHA 1SKQA 1U7ZA 3P19A 4RFSB 1UKVY 2IGBA 4JLKA 5CA1B 1F8GA 1BIFA 1NRJB 2ZT7A 3BTVA 4JENA 1NVUQ 1G8MA 4NG5A 2OHVA 5EEHA 3GYBA 3M4ZA 3X1KA 5LKRA 3OLXA 4YRLA 5CA0F 5K4GA 1W4LA 4QT0A 3EWAA 1CUJA 2VRBA 1SIBE 2J9RA 3S68A 2C5AA 4ZGBA 2A9VA 3GRKA 3OPXA 2BD0A 2GN9A 3R3UA 4TT3A 2YIMA 2Q4BA 3ZDZB 2ORIA 1XL1A 1NF2A 4YAKA 5HIAA 2IPMA 4MGKR 1YR8A 4IKPA 1FX0A 3G68A 1DAHA 1DINA 2IDJA 2M1ZA 4BGUA 4WXYB 1ZZGA 4NIMA 2QZ4A 3INNA 1KYVA 1Q50A 1XBTA 3BILA 2J9YB 4RY8A 5I7AA 5BY2A 5I6DA 4ILKA 1YQGA 3KQSA 4QPCA 4JJ4A 4YP1A 5LYJB 4WKOA 2WNIA 4I50A 1VMIA 1RLMA 3FYCA 1D03A 1DGQA 2B8JA 2RB4A 4PGMA 2Q3DA 1KYWA 3BRWD 4LXHA 5AW6A 4UVDA 4R6WA 2AMFA 4UCFA 2IWRA 1XELA 4ND7A 5KOIA 2LIPA 3A25A 4AVYA 2EP8A 2WICA 3SQMA 4B3RB 1V16A 3GRAA 1FBTA 1NQOA 1P7CA 3SSAA 1T2NA 4A0SA 5EHIA 3FVQA 5KUTA 3C3WA 3PFHA 4PO8A 4LNHA 4EUSA 5G41A 4QTYA 2HHCA 1RI1A 3ZW7A 2OGWA 3H5OA 4ME6A 3A1CA 3PKZA 4D99A 3LY8A 2IYLD 2NTEA 2OQIA 3TW0A 3K2EA 1HE1C 1SJ9A 1UL1X 2XIQA 2WWXA 3E27A 3WK5A 4B4DA 4BFXA 1GPUA 1PL8A 2XCQA 3N2ZB 2ALJA 4PHHA 1O95D 1YKFA 4HAYA 2XWSA 3CRVA 4B3MB 1DQRA 2EKZA 4EF6A 4MUFA 4AKSA 1W4ZA 3IDSA 3PQ7A 4BUJA 3O4JA 1DXHA 1MAHA 1RAEA 5DB4A 4EFMA 1F1BA 4I2NA 5LYYA 4EZIA 3OQVA 1P39A 2JIQA 4N9QA 5CGZA 4D92A 2V58A 3L6DA 4LISA 2K2QB 2X0DA 2WU3A 3KQWA 3UK0A 2PFKA 4BMZA 2ZRDA 4W5TA 3S40A 2JLSA 2XCOA 1E61A 4UULA 4PS0A 4YMLA 5ALQA 4FW9A 1H2WA 1XMQB 2PL9A 4EJFA 4ESVA 4EO7A 1JLKA 4ND8A 2MR6A 1N2CA 4TLEA 2GFIA 4X60A 1E66A 5AKXA 2X86A 1AQJA 3QHPA 4AF7A 1B41A 4Y2QA 3OPMA 3G2KA 3Q41A 5DJ5A 1XHLA 5E2IA 4H4CA 4PFSA 4E0BA 4ZHSA 4M87A 2J5BA 3EXFA 3KB1A 1XVLA 1Z2AA 5EWJA 4IPTA 1KMHA 3ZY4A 1O8BA 5SZHB 3VO8A 1DWQA 1T4BA 2FZCA 2GLXA 2HHAA 3FKJA 3W6OA 4RTMA 1JHAA 4LQLA 4R41A 3MWFA 4EGFA 2RG7A 1OIWA 3NIGB 2DY1A 2J3DA 3GLFE 4GH5A 2WPDD 4WY2A 5E4FA 4U4AA 3S7ZA 5JAPA 3R9XA 3QWIA 4GFDA 2O6LA 3LW8A 1X74A 4MPTA 4J9UE 5TEVA 1F6BA 5HMLA 3TJRA 3RBXA 2NSDA 4RZHA 3OEHA 3A2LA 4KE7A 1O97C 3PPYA 3SYTA 4OMFG 4UHCA 2Q8QA 1PJQA 1BDMA 2QW8A 2UAGA 4UTXA 2XQIA 4HATA 1NNUA 2P9YA 1YZGA 2VZEA 4QJ4A 1BX3A 2DRIA 2J85A 3RFCA 4CMBA 4BZQA 2B83A 1OIXA 4DWVA 4KR3A 2ZSJA 4QODA 5FPQA 3ZUPA 4NCBA 1K98A 1K63A 3ROZA 3BWBA 1ATZA 4L28A 1ZVJA 4WGGA 2W48A 2IEGA 2R6R1 3G9QA 4XWKA 3P1JA 4H9GA 4IJ6A 4Y6RA 1VIVA 3SDZA 4EJ6A 1FYDA 3SZOA 4WOPA 4J75A 4KBYA 5FBVB 1XVIA 3AKZA 4RZUA 2QD4A 2MOKA 2GBLA 3GLGE 4AZ0B 4YJ2B 4ZZ1A 2P77A 4HYTA 1QKJA 3F7OA 3LGAA 1A04A 1JPUA 2FSGA 3DXFA 2AFIE 3LQ4A 4PYKA 4ER3A 3M8KA 2JLRA 2OBNA 4AO6A 1YONA 3MCTA 3OLYA 1XZQA 2PZJA 3U1BA 1TE2A 3WIBA 4IWNA 5JZSA 2AXEA 3TLJA 1UC4B 5U4QA 5DWQA 4BFSA 2X4GA 4PEVA 4PHCA 4XIIA 3BKWA 3VVMA 4ARVA 2ZIZA 4WESA 1MH1A 3UMJA 3OJEA 4KKVA 1QWSA 4AZSA 2UUPA 1UXGA 3H3XA 1DAIA 3R3VA 4YR7A 5JI3E 1B23P 1ITZA 5AOCA 1FFSA 1YS2X 3P0FA 4IW3B 2M6KA 3DONA 2C5GA 4EM6A 4PZDA 3C1UA 4C0WA 4CR6A 3VV3A 2FMHA 4ZCIA 2FX5A 5AVWA 1QF6A 3ZDBA 5K4AA 2PFSA 5IHPA 5F4BA 2X6RA 1H23A 3PC4A 3OPVA 1XMOB 4Z9XA 3V7UA 2PGDA 2YN0A 2FFJA 4EB6A 4F5YA 5J4HA 5LQJA 2PGXA 4Q4LA 1SU6A 2XUAA 5CXSA 1U8YA 1K0UA 2WP0A 1QV7A 4W5NA 2IITA 5IJ9B 1QIFA 1Y9DA 3UHPA 4OA5A 4UTPA 4KAFA 3BQ9A 3A0RB 4FC7A 1TYCA 4YRRA 3ITKA 3RI3A 3ZW8A 4AULA 3K5PA 1VGQA 2A5FA 3KQVA 4BO6A 4B47A 1VA5A 1GKIA 5F12A 4CL8A 2QLFA 3CF6R 3GPCA 4U02A 4FYXA 3WP0A 3NCTA 2FYTA 1N7JA 3T3IA 3HI6A 5D6NA 2LBPA 5HCUA 1M5UA 1J7JA 1S9HA 5AM5A 2E21A 1E2MA 1ND6A 1QVRA 1RYZA 1N0UA 1RU3A 2X5NA 4BPRA 4FJ1A 1S4QA 2Y1KA 2WYHA 3D3JA 2I1VB 3DBOB 5GJWC 4E07A 4S0ZA 3U4DA 3ZNNA 2EFDB 4DPKA 2BZSA 1WXXA 1TCCA 5CDUA 5LM3A 4MQ6A 3TZCA 3IAEA 1QNFA 4LK2A 1DP4A 1NJSA 2ISSD 2C7PA 1Y7LA 3ZYCA 1JAYA 1A72A 4QFMA 3OQ6A 5EL0A 7REQA 4K9DA 1FSZA 2Q6OA 3Q3EA 4RTKA 2VTBA 4M1ZA 1T4CB 3F5MA 1IE3A 1O3YA 1RCFA 1SXJE 3GRFA 5DNVA 5IAEA 3V42A 3I9NA 5IFKA 2IZ5A 5FTWA 3QOWA 4ZVPA 2IZOA 4HDNB 5B6IA 1Y7IA 1U9IA 1A7JA 3DL4A 1L5KA 1CUUA 4CCYB 5JR3A 1W5SA 4BNNA 5DKFA 5DGDA 3SEFA 1ZGAA 1S2MA 3TVYA 3ZDRA 1SVNA 3C2QA 4CM4B 1NN3A 5JJKA 4MW4A 4KIWA 4KWCA 3VZCA 3MINA 3DBVO 1I6WA 1KK0A 4NZ9A 2LE0A 1QUFA 3K70C 3IPAA 1GPBA 2BDUA 4JBLA 1KKUA 2XB8A 5FHRA 3RARA 2J0VA 5JMOA 4QYSA 5HX7A 2DBYA 3AG6A 4MINA 4YDHB 3TQOA 3GFTA 4G01B 4R01A 1O96A 1TF5A 3FLEA 3OTHA 4L5AA 4IXMA 5FOUA 5LB4A 1ZGBA 4INZA 3RANA 2CUZA 4XJTA 3DLAA 1XLWA 2WJAA 2RH5A 3OETA 5L7TA 1QRTA 1J1ZA 3JQ7A 4PBRA 4GL4A 4XCQA 4BVLA 3U7JA 1JKIA 5AUPB 1FUEA 3ZHRA 3F6EX 4L76A 4QGHA 3A6HA 2HA0A 5LQCA 2PZEA 3S2UA 2VDWB 2WWRA 5HKBA 5FBQB 2QGNA 4UCWA 3ZVMA 3H05A 2TECE 3QBVA 2QE6A 4C4SA 2H57A 1IRXA 4RY2A 4RVOA 3WLRA 1YU9A 4EA9A 3WLHA 4D9GA 3EW7A 4P93A 5HA5A 2XKBA 3BGIA 2H9IA 2C29D 4LSZA 5J2UF 4V0ME 5ALHA 1E7YA 5IDWA 5TE9A 3MCUA 4Q0MA 1YOVA 3CYFA 4C4TA 2J31A 4BO0A 1BQEA 3LYUA 3SC2A 3F78A 1X1DA 1GU7A 3F9IA 2P91A 3T9CA 2YWBA 5DSXA 3LPAA 5E1OA 4F9EA 3L77A 1EFAA 2FKAA 4HHEA 1G291 1IHPA 1T4MA 2ASVA 4KEAA 4Q47A 3H83A 2ZTUA 2FUCA 1GUYA 4M9SA 3CZ9A 3LG2A 5COQA 3PHBE 3ABQB 4IY1A 5EKUA 1ONNA 5J23A 4QTUB 4IUCS 1JF8A 1PX0A 4OYLA 4NMXB 2ZUSA 5B36A 1UBCA 1JI3A 1OSNA 2JJ2A 4XD2A 2DB3A 4WLNA 4GPEA 2AOXA 4LDQA 1UQUA 3HA2A 2JVJA 2WF7A 3ABRB 1OYVA 3G88A 4NOMA 3UOAB 3ONDA 4B33A 4N3BA 5IM4A 1RYNA 1C4KA 1MORA 4BLOA 3GA5A 1B76A 3MM4A 4HX2A 2DT8A 1SQ6A 3OA0A 3QLTA 3FW1A 4B32A 5FFNA 3ASVA 1JQEA 2WJWA 3EEFA 3V5NA 4E5UA 3LVRE 3W3AH 2P6RA 2HBQA 4OH1A 2HTEA 4E7OA 3T1YB 4TRRA 1ZZEA 4JL5A 1Q7BA 3L0YA 4ALJA 4HC4A 1GNRA 3FM9A 4GO1A 1J0XO 3E58A 3L9XA 2WWVD 1CJVC 1R3UA 2XIJA 4KYVA 4ZYVA 5K3FA 5KWEA 1SIOA 3H9QA 4YAEA 5EC8A 4CLDA 1Z62A 2XGJA 1HRKA 2AXNA 1ZJWA 1JYFA 2IK8A 3W9YA 4JEIA 5AXAA 4A6EA 1OZGA 3LY5A 3S2EA 3OCWA 3RRNA 2NAPA 3MAGA 2XYPA 2GR9A 3MMZA 3ESQA 4HWOA 3ZCVA 1L4UA 4C87A 1IWOA 3Q6IA 1R8YA 2ZW9A 4JKYA 4XEHA 1NWCA 3MTIA 3S5JA 1PDWA 2WJ3A 3DP9A 2Y1WA 3LT4A 1M2GA 3NWPA 1FTSA 3O0TA 1D3AA 1X15A 4MO2A 4S1WA 3KKPA 2VJAA 4V02A 3T5AA 2BGTA 2LVBA 1MX1A 3HCOA 5ECYA 4X90A 2JCSA 1PU2A 2G80A 3GLSA 4IQ4A 3VI4B 1W4RA 2BFDA 1N5MA 3UPDA 1BCSA 4RTNA 1Q0PA 2PXAA 1C8KA 1G5IA 3RC3A 3R4VA 2HUNA 4H0NA 4JAVC 2F3QA 1QIMA 5G3ZA 2QOEA 3RRJA 1E5VA 1HYEA 1YHNA 2R00C 2I6QA 3BQMB 2MSEB 5E3HA 2G6TA 1EX1A 2IZZA 2W71A 1PNTA 2R5WA 4O59O 4QHYA 3SZRA 3EXHA 3ZZTA 2XQKA 3I8OA 4S2EA 4EA8A 5IUNC 3KT0A 3WRVA 4UNIA 1SQFA 5LMUB 5EZYF 5K0NA 2PANA 2OCDA 1WP9A 3L8HA 2ZI4A 1QG6A 2OBBA 4IJMA 1YHZA 3IC5A 1GL3A 2BGJA 3KVVA 2OLKA 7YASA 3IR6A 3V48A 4AT1A 1XRSB 1IG3A 4DILA 1NQTA 1Z12A 2C5LA 3JYHA 4DRXB 2Y1GA 5DM60 5ECDA 5HW0A 1U1IA 1YJXA 1SWWA 1RD4A 2RMKA 2ZYDA 3HU2A 4J2HA 4L7QA 1D9ZA 1BZYA 1ODSA 1WE2A 4PM4A 4RXUA 5TT0A 5BXQC 1MB4A 3LK7A 4KI0A 1ORIA 4CTOA 4GC5A 3TSZA 2GXSA 1ZIOA 3G7NA 3VNBA 4BKMA 4ZA2A 3VR6A 2AUTA 3NEAA 2NZ2A 3AGPA 3ROFA 1PSWA 4G5RA 4IVPA 3U0BA 4AUEA 1IDN1 1OAKA 5F4ZA 3VPCA 2BRUA 5DISB 3Q9LA 3LBAA 2KMLA 5IMBA 1E9BA 3I92A 4RVGA 3LUJA 2QW1A 1ENOA 4LA4A 4QUHA 4ZVSA 3BBLA 4CR8A 1ESEA 4JB2A 4HNAA 1HYHA 1XD2A 1OCEA 1JPNA 1JU4A 2GEVA 3DZKA 4UU8A 3PKIA 4DJAA 5L4SA 3TM4A 3OZVA 2GYUA 3OZRA 1VM6A 3L84A 2G7MC 5F2KA 1G6KA 1NYTA 5A4FS 5B6JA 4EY7A 1YBAA 3EF0A 2JA2A 2Q6IA 1GDTA 3GO4A 2JFPA 4OK5A 2X8JB 3RUDA 4BVBA 3PUWA 3QZUA 3T35A 5AOBA 1C4OA 2EW8A 4OX9B 3EULA 3OC6A 1XJQA 1T3TA 3WGOA 1PVOA 4M9ZA 4F6CA 5FA8A 4G67A 1YZTA 1Q5PA 1ZM4A 1K5HA 3I9OA 3N5KA 5L3ZA 4Q4AB 2NXCA 1CC1S 2XVZA 5TPZD 1LBEA 3LUKA 3ND6A 1Z07A 4KX5A 3HEBA 4UBJA 4ZAZA 3L0PA 3Q8LA 2BFFB 2DHEA 3OHPA 4N6GA 4JSYA 2IHVA 2FGJA 4UUNA 4JS0A 4YB8A 4Z5XA 4YAGA 4WA7A 4G86A 1PYDA 3B1JA 1RR6A 2GN1A 2P67A 1OWOA 3W2FA 4BEVA 2DFLA 5JBIA 2ZR9A 5T4FA 1LKZA 2W9XA 1Y89A 2OCPA 4EG5A 1YR2A 1VHQA 4A73A 1GCUA 5LXTB 2DOKA 1EJ6A 2OHGA 1TC1A 3OM0A 4DSNA 1TU0A 4DQXA 3NETA 5JNLA 3ZS8A 2P8SA 2KW5A 1QHFA 4CQJA 1EIZA 4OK3A 3HZHA 3PICA 4RZ2A 1F8UA 4GMHA 1A50B 1BS9A 4LWZA 1U1FA 1UJ4A 4M55A 3F5SA 4W6ZA 5EIBC 5D7BA 1DUSA 2IXGA 5D3MB 5JS7A 3ETLA 1E2IA 3GCXA 4FMCB 3W9SA 1BXGB 3I6QA 4FKBA 2HBRA 1Y6FA 1LTQA 4UNPA 2GHTA 2E5LB 1E8DA 1P80A 4X6XA 5EHGA 2J1LA 3NFYA 1VHLA 3DBRB 4LW8A 4H4EA 4NH0A 4PVDA 3X43A 4YUZA 1M8PA 1OAOA 3VTAA 4WBNA 5CPBA 1S3IA 4JP1A 1AU9A 5AW0A 1WPQA 3IMFA 3O2SB 4G1FA 4LBYA 2K7FA 3GU3A 3JWJA 2MYTA 5J5VA 1OT5A 1TOAA 1JQLB 2OZVA 4RMHA 3ZGLA 2FR0A 3MTJA 4OLBA 2Q3MA 4YQZA 3AVXA 3EGVA 4DM4A 3TAXA 3N0WA 2R97A 2UZ1B 4E08A 1K8RA 3SX4A 2RSLA 3VAAA 3BS4A 2ZJ8A 4KNYA 4HZUA