2WY2D

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 32
structure length 103
sequence length 103
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wy2D00
4JAVC 4N03A 2YHAA 3CTPA 3H75A 4HNSA 3C6QA 2RDMA 4QYWA 3H1EA 4WT7A 4XFKA 1M2EA 3LUGA 5DGCA 2JCGA 2PL1A 3RVSA 4RY8A 5TQ0A 2IOYA 2H3HA 4PE5B 1PUXA 3CNBA 3DGFC 3HM9A 2HQBA 4Z99A 1ZN2A 4MYRA 1SD5A 1JLKA 1ABFA 3H5TA 4LE2A 2JVKA 1JF8A 4MR8B 4JA2A 1P2FA 5TPZD 1JL3A 1TM2A 4DADA 3MMNA 2Q5CA 4RDCA 4MQEB 2RGYA 1YS7A 1EHCA 2E4VA 3FFWA 1SRRA 2FQYA 4JB0A 5EWMA 5FWYB 2E4WA 4FE7A 1GCGA 4E7OA 1E6MA 2F8SA 3GL9A 3HSYA 2V0NA 1MAVA 3NBMA 3HDGA 4RXUA 3FFXA 3JVIA 2GBPA 1APBA 1DG9A 5EWLB 1MB3A 4LZLA 1DCFA 3LUKA 4EYQA 1SXGA 3VNAA 4HYEA 5JNWA 3GT7A 1DBPA 4RWEA 2O20A 1DP4A 2QSJA 2XDYA 3O1HB 4N41A 3G1WA 1ZH2A 3HO1A 4RV5A 1ZAYA 2PUEA 2FQWA 1A04A 2GWRA 2PAFA 3N0RA 1USIA 3JS5A 3H5VA 2QW1A 2GX6A 1JYFA 1ZHHA 1ZVVA 4F06A 2DRIA 1L5YA 1Z18A 3IPAA 5TQ2B 4ETNA 4KRFA 2B4AA 2FEWB 1NXVA 5T7BA 4EYKA 3RVMA 4Z4HA 2YHBA 1PEAA 1NXOA 5JS2A 4RK0A 4GNRA 1W25A 1CHNA 4LX8A 2L19A 3M9WA 3QLTA 3E61A 1DRJA 4OATA 3F6CA 2FMHA 2QR3A 1U0SY 1VKRA 1CYEA 2PL9A 5IBQA 3H5WA 1P8AA 4JOQA 4OBBA 2A9RA 4ZMSA 2MYPA 2JB9A 2P4UA 1LK0A 2RJOA 3CLKA 4G97A 4KZKA 3N6VA 3T38A 3TD9A 4EUKA 4O1IA 4MS1B 2IKSA 2H0AA 2FVYA 4ZMRA 4EVRA 1BA2A 4LE1A 4F12A 3HVRA 3GV0A 1NTRA 4QPJC 5HM6A 2IYNA 1QPZA 1DC8A 1LJUA 2AYZA 2QZJA 3RH0A 3HK2A 3CRNA 5JS1A 1JHZA 3UKJA 5TPWA 3H5IA 1NY5A 5GOTA 3IP5A 2ZWMA 3H5LA 1D1PA 3GA5A 4KV7A 5FBKA 1PNRA 4ZPJA 3OQNA 1R8JA 3MYYA 3OLYA 3LKVA 4RY0A 4YP9A 2LBPA 4MS1A 4EVSA 4L85A 3KJXA 4NCBA 2HSGA 3CG0A 3QEMB 2LP4Y 1BVHA 4ZYLA 2FMKA 5DTEA 1Z17A 3I42A 5IUKC 3KCNA 5TE9A 1USGA 3OQMA 4G0XA 3HDVA 4MQFB 4YLEA 1KRWA 2QVGA 1EWVA 1YTUA 3JPWA 3N0XA 1QNLA 3QLUC 3C3KA 3OLVA 3EJWA 2WB4A 4KNYA 4YO7A 1E6KA 4HNQA 4MR9B 3EQ2A 2A9OA 3E3MA 3QEMA 3TB6A 1NXPA 1RPJA 1K68A 5B3JC 1YVUA 5IUNC 2FMFA 1E6LA 4XARA 3O1JC 2R47A 1OXKB 2GI4A 1U8TA 3GWGA 2WWVD 1U2QA 3T6KA 3LUFA 1Z26A 1FFGA 3JTEA 3IP7A 1ZGZA 1TLFA 3DZDA 3N53A 1H9CA 4D6YA 1UDRA 2PMCA 4PYRA 4YS6A 1DZ3A 4MGEA 1QP4A 4XASA 1IIBA 4W5OA 4KFCA 4MR9A 4PZ0A 3LUJA 3LOPA 1LJLA 1NXTA 3L49A 1RNLA 4QYMA 3VNBA 3HJFA 1VPWA 1SXHA 1Z12A 2JBAA 2E4ZA 2FEPA 3I5AA 4EGSA 1Z16A 3MF4A 4LDAA 1W9HA 4KVFA 6ABPA 1RZRD 1L5ZA 2JK1A 2QXYA 4LE0A 2LUOA 1DCKA 1LBHA 3GBPA 3Q7RA 4MR7B 4UHKA 2L2QA 5JNTA 1AB6A 4N0PA 4Z4CA 3NHMA 3M6MD 4OLBA 1BAPA 5PNTA 2N9UA 3KS9A 3T8YA 3LUHA 2MSWA 4RS3A 4W5NA 3EAFA 4IMIB 2FLKA 2F8TA 4G0OA 5FWXB 4KREA 4WXEA 7ABPA 2VYCA 4MR8A 3O2QB 5F64A 3LFTA 4WXMA 1K66A 3RVRA 3O2SB 3EODA 4MQEA 2W42A 5JNSA 3T95A 4XAQA 3LTEA 4G0PA 5FWYA 5DCLA 2NZUG 5KC9A 2KYRA 4NCAA 2FLWA 2R25B 3FMVA 3QX9A 5ABPA 5FWXA 2JVJA 3N0WA 1M2FA 1KMIY 3HV2A 3O75A 1MIHA 4RZSA 3F6PA 1A0OA 1LBIA 4O1HA 5EWLA 1URPA 1EAYA 4UHJA 3O21A 3RVLA 1XHEA 3OQOA 1GUBA 2J48A 3N8IA 4N0QA 1ZDMA 1E2BA 3QLVC 5KWSA 4XXHA 1M5UA 1VLZA 2I6FA 2OQRA 2HQOA 4MLDA 4TN5A 3HZHA 4QICA 4EYGA 2TMYA 4YCSA 4D6XA 5CNKA 4YRZA 1WETA 1U04A 3GYBA 2HJ9A 4WUTA 2IPMA 3OMXA 3QLUA 3NNSA 1JWLA 5TQ2A 3TMYA 3LKBA 3H6HA 4Z9BA 2L17A 1FFWA 1D5WA 2MSKA 2PJUA 5B3JA 3B2NA 4NQRA 4H3KB 1ISSA 4S04A 3JPYA 4Q6BA 3P9YA 1YMVA 2QV0A 2NT4A 3IP6A 1YK1A 2A9PA 1ZGGA 3HCWA 4RY9A 2FXIA 2ZAYA 4JP1A 3S99A 2IPLA 1BDJA 3BRSA 3DLBA 3EQZA 1YS6A 3K4HA 2L18A 2FSPA 1FSPA 3RVPA 3IP9A 1ZITA 4Z4IA 4IMJB 1JYEA 5KQMA 4Z4FA 3RVNA 1USKA 1TVMA 3C3WA 3H6GA 4FE4A 3RVOA 2WJWA 1D2AA 4Q6WA 1EFAA 1QQAA 1C0EA 1NATA 5BRJA 2FW0A 2PUGA 3CS3A 3SM9A 2VUHB 3ILHA 3R0JA 3HEBA 3MIZA 1QQBA 4Z4EA 4G0YA 3UUGA 3EGCA 2VK2A 4ZJPA 1NXWA 4RXTA 1Z2DA 4LDZA 3MQ4A 3A3KA 2E4UA 4OG2A 5IULC 4TLLB 4O5AA 1DBWA 2WMYA 3KSMA 3ROFA 3KYJB 1M5TA 9ABPA 4KPYA 1Z15A 1PHRA 1JX6A 1JDPA 1U2PA 3JY6A 3Q15C 4KQ9A 5I4CA 3KHTA 3UK0A 4N76A 4P98A 2E4XA 4MQFA 3OLXA 2NT3A 3F73A 2E4YA 4LRQA 4TMYA 4PICA 3CFYA 2MYNA 3O1IC 3DGEC 3QEKA 4ETMA 2RJNA 1GCAA 4KK3A 2IPNA 3C3MA 1D4ZA 4WZZA 1I3CA 1QMPA 4RK4A 5BQ3A 3IPCA 4RK6A 2WRZA 3QELB 5HKOA 2JVIA 2PLNA 5TQ0B 1TJYA 1DC7A 2PKXA 2R48A 4RU1A 4NICA 3LUCA 5T3YA 1JH9A 4CBVA 4RK1A 1PEYA 2QVCA 2PUFA 4M88A 5JNVA 6CHYA 5HSGA 5KQGA 4HNRA 1YMUA 4Y9TA 1JDNA 4S05A 2MYTA 3FDFA 1JFTA 4P1ZA 1DJMA 3A0RB 3QELA 2LIVA 5IEBA 3D02A 3H1FA 3KLOA 2PE5A 4YR7A 2IPAB 3O74A 5KQLA 2HPHA 5EWMB 1T34A 1GUDA 4KMRA 3MM4A 4DQDA 3W9SA 5C5CA 1Y1LA 3OO0A 5DLEA 4YV7A 2B1JA 4IILA 2BGGA 3OLWA 2MSLA 3Q7SA 5GQSA 5D2CA 4MR7A 1JFVA 4ETIA 1B00A 1Z25A 2FQXA 2IDMA 3QK7A 1Z2EA 4W5TA 4RK5A 4E7PA 3TO5A 5TQJA 2OENG 3BILA 4EY3A 4D74A 2FN8A 3CHYA 2GKGA 2FTKE 5KC8A 1GLGA 3RVQA 3MA0A 3QX8A 3FGZA 3I09A 2HQRA 5HQJA 1JBEA 3HUTA 5IX8A 5CNIA 3NHZA 1AB5A 1ABEA 1QO0A 1FFSA 2NUBA 2NZVG 1DBQA 3K9CA 1Z13A 3SAJA 4MPTA 3H5OA 2ID7A 2CD7A 8ABPA 2PUAA 4Z0NA 2M1ZA 1MB0A 4G0MA 3HXMA 4W5RA 4RSMA 4GPAA 2FN9A 4MRMB 2LPMA 3F7NA 3GRCA 4JB2A 1XWWA 2FKAA 1OXBB 1ZY2A 2WJAA 2PUDA 2A9QA 3OM1A 1QKKA 4ML3A 3KYIB 3URMA 4OLAA 4G0QA 4L4UA 4IRXA 5EWJB 2CWDA 4WWHA 1ZH4A 5IC5A 2PUCA 3FFTA 4DN6A 2FEKA 1QP7A 1P6QA 4MRMA 5CNMA 4F8JA 4RKQA 3OLZA 1PNTA 3I45A 2M98A 4EYOA 3A10A 3LUAA 4B09A 3CU5A 3CG4A 1EWKA 3M9XA 2PUBA 1VRVA 2JRLA 5IEJA 1CEYA 5BR1A 3HUUA 1F51E 3KKEA 3ROTA 5DKFA 1D1QA 3O2JA 4IGAA 1QP0A 3KLNA 5EWJA 1MVOA 5TPWB 5KQPA 3BRQA 3Q7TA 3TX6A 4MS4B 2QU7A 1YIOA 1C4WA 3JVDA 1RZRA 5CHYA 2X7XA 1A2OA 2CHFA 2CHEA 3DBIA 3KG2A 4RKRA 3D8UA 1BDIA 5TPZA 1RXIA 3RQIA 4MS3B 3NNDA 4Q7EA 3BBLA 4OTZA 3Q9SA 1TMYA 3LUDA 1NXSA 4G0ZA 1KRXA 3ILYA 4RK7A 3CZCA 3SG0A 1ZESA 5CNJA 1QO0D 5E3JA 4MS4A 1DCMA 1HEYA 1RXEA 2AYXA 2VUIB 3CKMA 3G85A 3N75A 3RVKA 2MYUA 3BREA 4MAAA 1YK0A 4EVQA 1ISRA 3OM0A 3GBVA 4KQCA 4N47A 4W5QA 2R4QA 1DRKA 3H1GA 5ED4A 3LMKA 3Q41A 1JFSA 3SNKA 4MS3A 5BRAA 3DLHA 2FMIA 4F3TA 1XHFA 5JNUA 3HS3A 1NXXA 4RXMA 5FBHA 1P6UA 4MLCA 3NNNA 4F11A 4H3HB 1FQWA 3A0UA 3IDOA 4JASB 3KTOA 3SQNA 4PEVA 4YWHA 5JNRA 4G86A 4XLTA 1F4VA 1S8NA 1KGSA 3L6UA 2P9HA 4Z4GA 1J56A 3C97A 1SXIA 3OO1A 3RVJA 3EDCA 3CZ5A 4Z9AA 4IF4A 4H60A 4TLMB 5IUJC 3SY8A 2ID9A 5KI6A 3QLVA 4YGXB 5C5EA 2JBAB 3EULA 3OMWA 4KK4A 2WY2D 1BDHA 1EWTA 4NV3A 4FB4A
chains in the Genus database with same CATH superfamily
3EVFA 1ZVKA 9MHTA 5HW0A 4QGSA 1NVDA 1NKTA 1X70A 2HTEA 1E9BA 4D9FA 4F91B 3EXG1 5JVDB 5DGCA 1RQ7A 4IJQA 3MCTA 1JDVA 3DKRA 3R3YA 4LJ6A 3BH0A 4ZYZA 5CMLA 2XEXA 4RD6A 1I0IA 5A02A 4GX5A 2RIRA 2IQ5A 3W4KA 1AQUA 5IMSA 5KU1A 5U4QA 2WD7B 4HN4B 1LBQA 1YS4A 1GZ3A 1N8TA 1C7EA 5JPIA 1N6LA 2KMLA 5ITVA 1EWRA 5FJIA 2IF2A 4DB4A 3GARA 1IXZA 1CDDA 2JGNA 3Q11A 3UJCA 1QWSA 1RPNA 1JL3A 3FNFA 1P1BA 2Q5CA 3UGKA 2JF0A 5IW8A 2P9FA 3EY4A 2Y99A 3S0JA 4UHHA 2C03A 2WHQA 3V8QA 1NW3A 1BG6A 3L7NA 1E6MA 3U81A 4DRYA 1UJBA 1WS6A 1OBOA 1PR3A 3LFUA 1N8NA 5G40A 5U4XA 1D2RA 2AN1A 1H9BA 4K9NA 1H8HD 3MTIA 3JQAD 4IGEA 1LDMA 3WLLA 5AKZA 2H5EA 4BQQA 3HBFA 4LZLA 3OPMA 2UUOA 3INYA 1RMQA 1J8DA 4GMFA 5KCMA 3RIXA 3SE7A 3W90A 4TKVA 5CB6A 5IVPA 1KI2A 1OGJA 3EFBA 3IFSA 1KKMA 2YC2C 4P2GA 3DAPA 5FUXA 1SAYA 3I6YA 2NU8B 3QVOA 4I50A 3R7FA 2Q21A 3CB4A 1DP4A 1FX0B 4PNZA 5GV8A 2TRSB 5DTJA 2EV9A 1LLDA 1W36D 3PNPA 1Q77A 3QVLA 1ZOPA 2O4CA 4Z0PA 4HAIA 1A04A 1JQAA 1OHHD 1ORIA 2PUHA 4DLPA 3GLQA 4M8SA 1VCIA 4ZTZB 3SVTA 1IPHA 1C1YA 3HCBA 1NVGA 4Y2HA 3DXXA 2XMBA 4R0VA 4YA6A 4KIUA 5JMPA 3DO8A 2NU8A 1C1DA 4BFSA 4CTKA 1Z18A 4JUDX 3MTBA 5JU6A 1RRFA 2X6RA 1FX0A 5JZOA 1L7NA 3R44A 3ECAA 3G8YA 4J0IA 2YHBA 1U5CA 4PCLA 3KBOA 2ENWA 2Q5JA 4MUEA 1VIVA 3H84A 4HJRA 5AHXA 4Z2AA 4ZOLF 3ILXA 3OM8A 4LSZA 3TECE 3NGLA 2FUKA 4LUCA 1IJEA 1YR7A 3OOWA 3ONDA 3R3WA 4P53A 4UEWA 4XEUA 3WNVA 5L4LA 3QLTA 2UUAB 4RANA 5FR2A 3E61A 2C20A 4LYAA 1VSBA 4E5KA 2ET6A 3IIIA 3OJXA 1G8GA 5GJCA 3QVWA 2FPMA 1TQ6A 3PPIA 2GGSA 1HZJA 3ND5A 3K8OE 1OGIA 5D6NA 3GNQA 4EPRA 3L4JA 1WNFA 2FN4A 1TO1E 1YFKA 3FFBA 4NHEA 1S3SA 3LRXA 3PCTA 1QIEA 5DTMA 3E22B 5D1HA 1BDBA 2H0AA 2F1JA 3RAJA 1QOZA 1CRZA 1U0TA 2BGUA 2QW8A 3FOBA 3IEVA 1R0KA 3MAGA 1UJCA 5TDHA 1FNDA 2I1VB 2CSUA 1TF2A 2YUIA 2R87A 1JHZA 3QVSA 4MPPA 1WF3A 1HETA 1VIDA 4COOA 2G0AA 1GGNA 2F43B 2XUIA 4IJMA 2NP6A 2PL3A 1L3IA 4NARA 4HQ0A 5J4KA 3O84A 3E22A 2BPOA 1MFZA 3HHEA 4EDFA 2XSZD 3F8TA 2ZKIA 3SWWA 4X8HA 4O4JB 2I4OA 3G8CA 5IYZB 3UMFA 3C3EA 1Z17A 1EJBA 3R6DA 1ZL2A 1DBRA 3I42A 3SEAA 4B7ZA 1QAQA 4PPQA 1JU9A 3EDOA 4I1VA 4RZHA 4OREX 1ZS9A 1KIAA 3G2MA 2W8ZA 1H2XA 2VAPA 1OLOA 2JAPA 2H59A 3GWZA 5IC6A 5EIHA 4FYIA 3SIRA 4TRRA 1OXVA 2W43A 1RPJA 4E08A 2FMFA 1KVSA 5EY5B 4AJPA 5FTJA 2VVTA 4EBBA 4GVLA 3LHSA 2WWVD 4WACA 5B7GA 4Z3KA 1YQQA 1HYBA 1SMKA 1P1JA 2ZRGA 1W2WB 3O8NA 4IJKA 4PCUA 1PLKA 5A5GA 4GGMX 1NASA 1TO2E 2BDTA 2R5WA 1LDNA 4Q9NA 1YBFA 2HADA 4CT5A 1MBZA 2JD0A 1ZHOA 4RKFA 4WJLA 2ZP1A 4WADA 2QVLA 5ALWA 3PFFA 1TQ4A 1SCBA 2QL5A 3DLTA 3H2BA 3OEHD 2IU0A 1UOEA 1E5VA 2W7TA 5AW7A 2G3YA 1CVIA 1OZAA 3ESRA 1T9KA 2JJ1D 4OJTA 1N2CB 1KFCB 2A9VA 4C6HA 1R4NB 4NTZA 1WB5A 3I2KA 2PTHA 3P0RA 5LYJA 5EP2A 2P5UA 1R6TA 2ZATA 4F1WA 3ZZMA 4PLZA 1Z16A 4NYMR 1KSGA 3MOSA 3SJBA 3USCS 3B3FA 3QJYA 5LU8A 4FHCA 2A9FA 4Q03A 2P65A 4MZDA 1K8XB 1UR5A 2G4LA 4UUMA 3GLIB 2EYUA 2QRQA 3VSAA 2CV0A 1W94A 1RM3A 1PN3A 1LQTA 1AGYA 1IY2A 3EAGA 4L3OA 3MRSA 4PR3A 1RXWA 1VHTA 1R4NA 1KEWA 4MWBA 2MSWA 4D0SA 5AI4A 5TC4A 5CFLA 1OBHA 1BEUB 4X84A 4KREA 2OBYA 7ABPA 1XDBA 3S4YA 2ZDGA 3PCXA 3FTNA 2GEKA 4LEIA 5K9ZA 4OLBA 2VSYA 5CP8A 4YAJA 4PZDA 3S68A 4DE5A 5F64A 1P39A 2YJ3A 4ID3A 3RVRA 1KY5A 4GRAA 3T9DA 2Q6IA 3H9JA 2O57A 1J0XO 2F3QA 4BNMA 4A26A 2H6EA 4C0HA 3IP1A 2UYGA 3IC5A 3OQIB 9GPBA 1G8AA 4M99A 3PFGA 1ESZA 5DYGA 1R1DA 3VDQA 1EFDN 3HQ4O 2BJWA 2Z09A 1F2VA 2A7XA 3UAVA 1HC7A 3E5HA 3DDWA 3QVKA 4BNFA 4X0EA 5JISA 2VK8A 4KN8A 4JELA 2OT3B 2WU8A 3UWSA 3TTVA 2WZQA 4QDKA 2IYXA 3BCSA 1VHDA 4HNUA 1RBQA 2DPXA 4X7PA 3RGGA 3WKEA 1DOAA 5KTKA 4ENQA 2UYOA 1UK7A 2WNSA 3TNLA 3A1UA 1G7CA 3Q3EA 3DXYA 3Q8XB 5AFSA 5LJLA 4HR7A 4DYVA 1IM2A 1U9IC 1KIFA 5JC8A 4CN8A 1P61B 3WXBA 3K0AA 4LKOA 3GZJA 3F3YA 3H11B 4QGAA 4HDSB 3HUDA 1RIFA 3OX3A 2WQ6A 1YJ5A 3A4YA 2JA2A 4HB2A 3A6FA 3KEGA 4D6XA 1V8FA 4EI8A 4JJEA 2IPMA 3FCOA 3TPCA 3FCSB 5TMEA 5IDVA 1FTQA 1UJMA 4LRTB 1JWLA 1M34E 3OTQA 3EY9A 3GLFE 1NMXA 2W71A 2ZZKA 2PJUA 4N65A 1WUKS 4L0QA 4GMXA 1ISHA 2PXXA 2QY9A 1E7YA 4ARCA 2E55A 3SEFA 1JH8A 4D2IA 1P72A 5AJWA 3OZXA 4TZKA 3WYAA 5CXQA 3A6DA 5F1YA 2EW1A 1EE2A 5HKKA 3DWIA 1U0GA 2FUCA 4JJFA 5JCJA 3RIYA 3RS0A 4QT0A 2B8WA 1EPUA 3PZBA 3LOUA 1R66A 4OJMX 5K3CA 2N75A 1Z0IA 2G04A 4X3OA 4AZ3B 3EQZA 5J23A 3TCNA 4NMMA 3I64A 3I9KA 1U3CA 2WIGA 4YRPA 1O96A 4CEIB 1EGVB 1ZGBA 4O8CA 3L77A 1COZA 3EF1A 5BWBA 1DKPA 2DFLA 2HNBA 3PRJA 4MGZR 4C06A 4OY3A 2VHWA 4LY9A 4YUVA 1Q74A 4DV2B 1E9DA 3RVOA 2CV1A 3IQEA 3OIGA 2FW0A 1KZ1A 1JLLB 3AB8A 3QKTA 4AZ3A 2AFHB 3JQPA 4OXXA 1F8XA 5KYNA 4ZGWA 4RTOA 1EB9A 1PFVA 4H4EA 3ZGZA 2EWMA 2FAXA 4BVLA 4CEIA 5F77A 2ZI3A 1B74A 2QL6A 3QUQA 4IDOA 1V1RA 2AK2A 1YRYE 2VK4A 1AS0A 3OAAA 3HDYA 1A7UA 2W83A 3M4XA 4IG9A 1CR4A 5DDIP 5AQ1A 3K0SA 4TS4A 2YN4A 1YI0A 4KWHA 1X1SA 1BQEA 3O26A 4O2AA 1RI1A 1G4UR 2QRZA 3MLAA 4KDCA 1O7JA 4WQMA 3VGPA 5J63A 3GU3A 4TLLB 3GJRA 1C7ZA 2JLBA 1DO2A 1TUEA 3L0ZA 1H4QA 2AFHA 2C84A 3PX7A 4RW0A 3I2HA 1C3VA 1MQSA 4R8MA 4S12A 4N76A 2YOGA 4PQYA 3RCBA 1IRXA 2C3OA 3K31A 1JGTA 2EOAA 2GR9A 4X20B 4D3YA 2JJQA 4S1VA 1N5DA 1A5SB 3ZIUA 4TMYA 4PICA 4FCVA 3Q2KA 4TRMA 1KH3A 3D4OA 1P2GA 1MIOA 2RHOA 3AJEA 3W1EA 1ADYA 3EC2A 3PT9A 5H0IA 1FUEA 2O2ZA 3ENNA 3Q9NA 4BLVA 1RCFA 3MGBA 1L5HB 4XD2A 2FW6A 4U6SA 3KEMA 2JVIA 3AF0A 1YJCA 2Y66A 3E70C 4LYDA 2WFLA 3EC7A 4X20A 2OBLA 2JG3A 1OW3B 2QUKA 4N8DA 3RHFA 2EBHX 1CXZA 5JNLA 3WGUA 1FYXA 3SZRA 4URHA 1XD9A 1KBOA 2A30A 4RPIA 4DRXB 1O5OA 1ZC3A 5HSGA 3EPRA 2Q99A 1E3DA 2XWPA 3KEFA 2M32A 1BGVA 4LHVA 4KQGA 1L5HA 3NHLA 3OTIA 2LIVA 4JVSB 5IEBA 1R50A 3MBOA 5I9MA 1VRWA 4YAIA 3GCXA 3GLVA 5KQLA 2X5JO 2PT7A 2QXUA 4DQDA 4YV1A 1SU8A 4GMKA 2JFFA 1XHLA 2B1JA 5I8WA 5CLJA 1ND6A 1O6BA 3KVYA 2P1RA 2CYAA 1M8PA 1XXLA 1RRVA 2PYDA 5EIOA 2E89A 4K9KA 2OENG 4RDHA 3TAUA 4D80A 1W7AA 3NVKI 1YOVB 3CRW1 3B6IA 3CBGA 2EJUA 5FBVB 2OMEA 2ZCVA 2IV2X 4ECAA 4IIHA 2EWVA 3RVQA 1XTUA 3A28A 3L4SO 5LLSA 1WXFA 1K8ZB 3NTRA 1Y3HA 4BKQA 3F9IA 5AI6A 3CNLA 1I3OA 3RC9A 4BAZA 4O2BA 1NBEA 3PEVA 2ZQ5A 3BERA 2PHZA 1SZCA 1XVVA 4MV1A 2R2AA 2WTBA 3LLMA 2PT6A 2VDKB 3UTDA 5KYYB 4E51A 3DW3X 2X1HA 1ZKDA 1FFBA 2GN2A 4XSHA 3C6YA 1YOVA 5AW1A 4WGGA 5MN5A 1SU7A 1EXVA 4B7CA 1C9MA 4MRVA 5CPFA 3QU2A 2NXJA 3FYSA 3T7IA 5AJTA 3EUAA 4H1UA 4Y2RA 4WFIA 4BNZA 3DMFA 1FB5A 2IHVA 2M1ZA 2JGDA 4LHWA 4PO1A 1S01A 1Y33E 4XD7A 3V7FA 4WBNB 2ZOSA 1L5NA 3FPLA 3HXMA 1Z45A 3MHPA 4AKTA 1KOJA 1N8SA 1CUHA 1C2YA 1E63A 1NZDA 2IKQA 2H9YA 2NQTA 2PGLA 2PM8A 3HCDA 3W04A 1G3RA 4RYLA 3WGYA 3SPXA 4ZTBA 3D8RA 1PZGA 2XE6A 3DXZA 4RD2A 4DPLA 1M0EA 1BMFD 3NVDA 2EYQA 1YB5A 2P4QA 1JHVA 1UINA 2WUDA 2PX3A 3LYAA 3KYIB 3C1OA 1NG9A 1EXWA 3QOFA 4LGCA 4CWAA 5AW5A 1CZNA 1OROA 3NDBB 2A35A 3TI7A 4XRRA 4DS3A 4WBNA 2AJLI 1XQ6A 1BGWA 1ZH4A 4KGDA 3GUVA 3WZLA 4PBSA 3NOXA 1QR2A 2FEKA 2RGAA 3TTWA 1QP7A 2EG5A 2G8NA 4PQEA 3GP5A 1NU6A 2M98A 3A10A 3LUAA 4B09A 5CU7A 3M6FA 4W4TA 4P83A 4QVKA 2JRLA 1CEYA 1GR1A 2BKEA 1NIJA 1Z6YA 1N4AA 1TD1A 3LFHA 5JFGA 1UC5B 1LVHA 4NESA 3VZDA 4GBMA 4LN1A 1LLQA 2BBSA 1ZXLA 1MJ5A 3R5SA 4KE6A 3DBLB 4N5MA 4QOIA 4B4KA 4K81B 1C0KA 3BFXA 3DQZA 4PLVA 4X91A 3EYWA 3AP1A 4XB2A 2WZBA 4QQKA 1GGKA 5CLLA 3W6UA 3RQIA 5G0WA 3JASB 4D1YA 3D59A 1MTOA 3PR1A 4POOA 2B0JA 2C29D 2AMLA 2IIBA 4J9VA 2YVUA 1R8SA 3W5BA 1R4AA 3GEIA 3HZOA 1M1UA 3DVQX 5A62A 1CUYA 1PEKE 4FUQA 4OHRA 4TS3A 4B6EA 3RS8A 4ZZ1A 2OV2A 4NENB 2OKGA 1AN0A 2OZLB 1LTQA 4X1YA 1OZFA 3VSCA 2VNIA 1KBQA 4IGIA 3G0OA 3HYRA 3QFFA 4AF6A 3JASA 4BGUA 4F3TA 1KVUA 2J41A 2HBZA 4PYMA 5FBHA 5AK4A 3WLJA 1FP6A 3EGIA 3T1NA 3OCZA 2C3UA 4QT4A 3O73A 1SK8A 3TIVA 5KNDA 1C50A 1DWUA 1YJ8A 1INLA 3KKNA 3LPDA 1PG2A 1TEZA 1QDEA 2E87A 2OZLA 2XZLA 1UP6A 3V00A 4Z4GA 1I80A 4Y2YA 2H4HA 3AHDA 2XA1A 3RVJA 2QLLA 1QGYA 3NKLA 3UK6A 1CNMA 1LQ2A 3FYUC 3B52X 2J67A 1JDTA 5TY0A 4MJ7A 2ID9A 1XZAA 2W2VA 3L7KA 3ZV3A 2GHRA 3TBFA 4CG2A 5C5EA 2YMQA 4P4TA 5JZ9A 3L7AA 4N03A 3M6XA 1A27A 1N3YA 4HNSA 1U28C 1XTKA 3E8XA 3EZ7A 3RIGA 4K9OA 4U9HS 4CIXA 1UMBA 1CUDA 3MS7A 3GN2A 1FTNA 1IUKA 1QHYA 1W2HA 1ZM7A 5COBA 4TV8B 4ARZB 3C3DA 1PJ8A 2OHJA 2Q5HA 2W90A 2YRFA 2MJLA 2ZR8A 3R6TA 4R81A 2YX1A 3U4QB 3K1AB 2F1OA 4DC9A 4Z1MD 1IDN1 4MVJH 4AD8A 1QDLB 2DHDA 2XOXA 3SNHA 1VIMA 3H5TA 2IT1A 2ST1A 3ETNA 5M34A 2Z98A 1P75A 3GFVA 3PPXA 4HKTA 1JA1A 4DJEC 2OKCA 1REQA 1YCFA 1BU5A 3ZUGA 1P2FA 4D9CA 2OWDA 2O2YA 2EX1A 2IE0A 5A3SA 2H54A 5DMHA 5DM0A 3R5FA 3OBBA 3BWXA 1EHCA 3LX5A 2Q7XA 2FQYA 4TV8A 3HKBB 2EARA 5EWMA 5H82A 3HFJA 3KC2A 2QTAA 1U0EA 3FJ1A 4PSVA 3UY4A 4CLRB 4GBJA 2WJJA 2V0NA 2GZ1A 4JCOA 2C5FA 3MT9A 5AKJA 2VT2A 3WL8A 5KOHA 3RS9A 1NVVR 4ZYWA 4D99A 5C7IO 3C7CB 3EZXA 2CKMA 4D4IA 4R7ZA 5SYNA 4CR6A 5EWLB 2FWJA 3KQHA 1MB3A 1QIGA 4JGGA 4H0FA 1DCFA 3GYGA 3H2HA 1EE9A 3FYTA 4UPVA 3RJZA 4RZQA 1T5SA 3HKBA 2G07A 4AXBA 5JNWA 3GT7A 4TLEA 1IHYA 1C0PA 1VJ5A 3K0CC 4CLRA 4IJ6A 4YMWA 1GA4A 2Q6LA 3CPEA 3MUEA 2QD4A 4U1RA 4WLFA 3VU1A 4DMMA 2LCIA 1Y3BE 4COKA 1HORA 2R8RA 1BXGB 4UU0A 3WGJA 1B0AA 1FUYB 1YSCA 2POCA 2Z58A 5MHTA 1KPHA 4LX0A 1ZKMA 3TW4A 4DSOA 4WZAE 1M33A 3DULA 4PBTA 4ETNA 3SJUA 1UDXA 3PQEA 4N54A 2D2VA 2QA5A 4W1QA 1TM7E 3CEAA 3LUPA 4J16A 4A6XA 1NXVA 1KDPA 3ZWCA 3GJYA 5CFZA 1RC1A 2C9MA 1NXOA 1U2DA 3KL2A 4I8DA 1BXGA 2XNKA 3K8ZA 3P45A 1Y1TA 1Z2AA 3OJFA 4GZMA 3P2OA 4LBZA 2NZ8A 3AR4A 3K7EA 4BU0A 2JFOA 3LWDA 3WSTA 3IBGA 3INGA 4IXNA 4R2IA 3SBXA 3WK6A 5H3LA 3AX6A 2JJ8A 3L18A 4CIVA 3BL5A 4JGIA 1UDCA 5EMNA 1TUIA 2F3UA 3AI3A 3N5KA 3NPAA 4R5MA 2BGKA 4J4HA 4JOQA 4GLFA 3W9YA 4CFYA 2ZR0A 3AY3A 3BQNB 2O05A 3FZEA 2QROA 1XZBA 3N6VA 3AHJA 3BWBA 3VPDA 3E4DA 5A71A 4H1HA 1MW8X 3HP7A 3HI4A 2AKYA 2MU1A 5FV7A 2IKSA 3JZMA 4X71A 4PLWA 1OU0A 3MERA 1WETA 3QY0A 1LVGA 1OFUA 3LGXA 4LE1A 2ZRFA 4Q3LA 5TX7A 3K6RA 2AS0A 4K6KA 1Q1EA 1Z3IX 2CLFB 3I04A 3PUJA 3NRCA 4AO6A 1XLTC 4QECA 5KKAA 2FSSA 3AEKB 3WWEA 1G2IA 3KTAA 5DHFA 3SX4A 1XMQB 2P6OA 1UBJS 1Q21A 2AIRA 1E2NA 1T4CB 1SXJB 4IHAA 3K6KA 3OUUA 1P2TA 2H51A 2PS0A 4AICA 3U4MA 5KSYA 1Z4KA 2B35A 2DUMA 3N76A 3FPSA 3G2IA 3W8EA 1C9EA 3BRWD 4HGOA 5EZ6B 5JFOA 2OHXA 1KY2A 4FNGA 4MPJA 3V7NA 1XDGA 3LDGA 5EXPA 1XMOB 4J07A 2WUGA 4CTJA 2C99A 4M87A 3D5EA 3AM1A 1K7YA 4JI6B 3C3KA 5EN4A 4F2DA 1T4CA 4AL4A 7REQA 1EDBA 1QVAA 1FW8A 2G1AA 3EZNA 1XDZA 1ZO8A 2X8BA 4GPBA 5HGXA 1XZHA 1MEEA 4KQXA 3WAJA 4Q4CA 2Z5GA 1CUSA 4QLBA 3QBJA 4X44A 3TW8B 2F48A 1F0NA 2X1MA 4FSDA 3TSYA 4AZ0B 2NXEA 5BQPA 5DYIA 1EDZA 3X1JA 4L5YA 3ZE0B 4G37A 4PPFA 3IA7A 4ZI7A 1C3XA 1PQPA 1T1EA 2CUZA 1GPWB 3LQ4A 3QPCA 3V55A 4J4BA 1UL1X 1NW5A 3BUSA 3KUDA 3O38A 7AT1A 4YJ3F 5JYDA 1ZCAA 2H08A 3LX4A 2ODNA 4H7JA 1RYFA 1TZBA 3W4IA 1PS9A 1AZTA 1NVTA 1PL6A 1TMGE 1QS0B 2JGMA 1U80A 1M8KA 2OUKA 4MCHA 3VHXA 4B87A 5BR7A 1KEVA 1XJQA 3I2IA 5DYYA 1RHQA 1Z56C 4HAOA 1GFWA 3PVZA 1EBBA 5E7MA 3D3WA 1BS1A 3HLTA 4OXIA 4N0PA 3A9UA 1G5HA 4EPXA 3M6MD 4MVXA 3KX2A 3SHFA 5AW4A 2CXXA 4GPEA 4B2LA 1JEJA 3NHBA 3KUXA 4YMSA 2X9NA 1HFJA 4KBYA 1SXJC 3ZVLA 1WMBA 2V7BA 4V39A 1X3LA 1M0WA 2J9ZB 3QV2A 4KQHA 1R6AA 4G5SA 4OHUA 4BCCA 3CPJB 3O2SB 2QJOA 2IYYA 3FETA 3N07A 3I72A 4BZWA 1K5DA 1P29A 1Y6FA 3U3XA 4H7DA 4AIIA 3A1VA 1CLUA 1HTWA 2NZUG 2WJHA 5DCLA 4P2BA 4PHTA 1RSZA 1R00A 3FDXA 4MUMA 4ANFA 4HTFA 3GW8A 3PNYA 4M83A 4XH9B 5FAKA 1CJCA 1M2FA 3MS4A 1JSXA 2R96A 4HGNA 5FORA 4DJ5X 3AQ4A 3DA8A 4RZSA 3PXEA 2C3PA 2G9QA 1IHDA 3VC7A 1HLPA 4YUZA 4PO3X 2ONCA 3DYVA 2H31A 2NZWA 3LKZA 4IDBA 5GP1A 1NVMB 1RWPA 3PX2A 3GGPA 4OIFA 3REQB 3WYEA 4GG1A 3PDIA 3W34A 1GNRA 1GFSA 2V7VA 1A4XA 3CMMA 1FXWF 5HOQA 3L4KA 2BGMA 3HLKA 5LMUB 2H52A 1YQTA 3EZFA 3G9UA 4DLSA 6NULA 2VPQA 2XX3A 2FZCA 1TZJA 3KJNA 2JH8A 3S8EA 2P77A 3HYCA 3F4LA 3FTDA 2BFCA 2QNIA 3CURA 4FOSA 4HAXA 5TQ2A 3REQA 1T0HB 4V0SA 4YJ2A 1L7BA 1T6ZA 1ZIOA 2WJIA 4M46A 3TMYA 4HEA1 4Q1DA 3TD6A 4PHGA 3VR4H 2ZYWX 3EWAA 1LA2A 2JCSA 4X92A 4HWRA 4HWTA 3T06B 3LBAA 4O4LB 1ULAA 2Z8XA 3O83A 1LJ8A 2OM2A 2WWWA 1NAIA 4MNTA 5DTRA 3RSZA 4PHHA 4R1LA 4D98A 2ZQZA 5ARCA 1U9JA 3KXIA 1LPSA 4JP1A 5BOVA 5LDGA 3NEJA 2DWPA 3Q4GA 3RWMB 3WA7A 2R00C 1G63A 3KZVA 2HFJA 3UICA 5C9ZA 4O25A 3NC0C 2HH9A 1FSPA 1DRVA 4B4UA 1R18A 1CJTC 1KZGB 3IRVA 4CGYA 2A14A 4UTZA 4XZ3A 5DNAA 4UOZA 1IJFA 2HMUA 2JIRA 4OJQA 2XUGA 3PA6A 4G2NA 1T3SA 5BSUA 5THQA 5HJEA 4N3CA 5K8CA 3DNFA 5EVJA 2QUZA 2ZRLA 3LY8A 3QHAA 4O4LA 4QUAA 3WIVA 4NAVA 1NOJA 3S40A 1ILWA 1JHRA 1VHWA 3M5WA 2PRYA 4WN9A 5HA5A 4C3ZA 1OA0A 5BPFA 2YFQA 1TJ5A 3PDWA 4I0WB 1PZMA 1E5QA 1G0OA 3AB3A 4P7FA 1WXGA 3Q88A 1UK8A 3ZE6A 4O1MA 4Z4EA 2BTEA 3BM5A 3QTBA 1Z4JA 4JWTA 3W77A 4KODA 2ZT7A 4ONEA 2W6IA 4IWYA 2ZWOA 5ALYA 5IF9A 4I99A 3ED1A 4CL0A 2YY5A 3AZQA 3L3BA 1CHDA 4MI1A 2HWYA 4BTEA 1P19A 3FUTA 3LBYA 3VXKA 3KM0A 3WTCA 4DIKA 3HO8A 2EFYA 1G2QA 5LZ7A 1E98A 1OT5A 1OY1A 2DUNA 2GT1A 3BF7A 4H16A 4J4TA 3DZGA 5DEIA 4QUDA 1SY7A 5ENDA 1X1RA 2NT3A 2Q1UA 8GPBA 3VNQA 1WD5A 1Z7GA 3L8DA 1W5AA 2CZCA 1V5FA 4N8EA 1ZEMA 3RJMA 3LDHA 4WW0A 4DKXA 1ABBA 1ZH0A 3AU8A 1H6DA 3V80A 4R2HA 5J43A 4V0KA 2WQ7A 4JI3B 4I5DA 3IPXA 3VV2A 4EX6A 1E7MA 4BQIA 1NX9A 3PNOA 5C0OE 4B34A 3RUAA 1N5OX 4NXMB 1AQIA 1QFZA 4RU1A 4TYMA 5ALRA 3BB3A 1R5BA 4Z49A 1RM4A 1SO8A 2CNWD 2H07A 4JR0A 2BJHA 2PD6A 4RK1A 3FPKA 5FYQA 1PEYA 1QSGA 5ALHA 4BGEA 4WKBA 4Z4QA 4D9EA 3K15A 1ZUWA 2QDKA 2DY0A 3BMXA 3CLRC 5JXWA 4L4YA 2UZ4A 4DWVA 3H1FA 5E2IA 1O0BA 2ZYAA 1EUQA 4YR7A 3GQBA 1NG1A 3D2CA 1EGMB 4KMRA 1T5IA 4MCAA 4IFTA 1HG0A 2IYPA 4NDAA 2QTZA 1G1MA 5COQA 3F7TA 3R6WA 4HRAA 3Q5DA 3FYCA 5GQSA 1I5EA 1GTL1 1NJ5A 3VU3A 1ECCA 1SCJA 3BBPA 1VG8A 1N6OA 4R69A 1T8RA 4D45A 3I9V6 4N7MA 4ZEVA 2JD2A 5AHWA 5TARA 4RPHA 1GLGA 1NVAA 1P0PA 1P6XA 4MQLA 3DEAA 3Q2OA 5FUYA 3K96A 3MBIA 3QBVA 1G8HA 3AVUA 2R6CA 3RJ9A 3ETDA 2PG3A 5DXJA 4KIWA 1WZNA 5IFLA 3P9ZA 2H2DA 3L79A 4GPTA 1RYHA 5U9CA 4F4CA 1H6CA 1BCRA 1YMQA 3RV4A 3OU6A 3ZCTA 4B43A 4E5MA 5CURA 4BMCA 2WWFA 3KXDA 4BB0A 3SYRA 3CUSA 5IZCC 2VJMB 5CPBA 2IX3A 3JQ7B 3Q8MA 1FNMA 2JI8A 4GSLA 4HAVA 3COJA 1P91A 1OX6A 1JKMA 1E94E 2PH1A 2AN4A 5ENZA 1PUIA 1CRPA 5HTOA 1ID8A 4ARSA 2A92A 1PSWA 2CBGA 2WMNB 3KZ1E 3NDIA 3OKFA 1ZICA 4KI7A 3EJ6A 1G1AA 4XKJA 3NTOA 4AZVA 5DGXA 3T3MB 3P4YA 2WKWA 1SVLA 1ESEA 4IM7A 4QDUA 3JQ7A 4IRUB 4Q9LA 1SXPA 4OLAA 3KYBA 4DR6B 4IIJA 4MJLA 3R74A 4HB0A 3DCIA 3CH5A 3A36A 1KYQA 3FH0A 5IJ9B 5JJLA 1NLYA 1Q7CA 4TMTA 2IF0A 1B8OA 4B79A 4L5JA 1NW9B 1EP1B 8OHMA 1VL5A 3ELYA 2MSEB 4R6WA 4IIFA 1UAAA 4L27A 1SOWA 3SN6A 4YRBA 4J3NA 5BW6B 1NA5A 3HPRA 3DZFA 1KPGA 4CQMB 1SIWA 1FYWA 2GETA 3Q7TA 5TPWB 4F45A 4YECA 4D8WA 2WWRA 1PDVA 2F8MA 4JKYA 4D41A 2OGUA 4JBWA 4BV8A 1UXGA 2XBUA 5DIZA 1T25A 4P3NA 4QGFA 5DBGA 2CHFA 2G7MC 4UASA 2EZUA 3ELWA 4ICIA 4A0SA 4MS3B 3RSQA 2PV7A 5TLSA 3G7NA 4PU0A 3ZK9A 4PLCA 1QGAA 3RKRA 1PV4A 2WF7A 4DV6B 4MWZA 1GJRA 2W2KB 3OU7A 1RWXA 3EIWA 1C8KA 1GQSA 2SHKA 3YASA 5JBNA 1SIBE 3PC4A 3WQSB 1YR1A 4YXFA 4BVGA 2ZIGA 3V4FA 5CVUA 2VTBB 3GFSA 1NOIA 1BSVA 1BW9B 1V96A 1N9GA 2G9UA 3G9QA 2ZI4A 3TNYA 4OOEA 3VZPA 3QG1A 1RJGA 4MS3A 1XPRA 1PI3A 5K3AA 4MW5A 4MH0R 3P20A 1N9KA 2GHQA 1YT5A 4ZDWA 1AU9A 2GM3A 1N57A 3SQNA 2B83A 2WVAA 3IKVA 4H3VA 4I1YA 3TNFA 3C7KA 1U99A 4A5OA 2VTBA 2P9HA 2XJ4A 3TKLA 1JLHA 3GDOA 1N3IA 3D4PA 4LJAA 2A84A 3EMVA 3OECA 4NEGA 1YB6A 3UA3A 4Z9AA 4RUKA 3Q1KA 4X54A 4BJ1A 1GY8A 2VPIA 1UZLA 1F2UB 2WY2D 3K0EA 1JA0A 5JCJD 1FJHA 2DM6A 1KKUA 1W4AA 2VRCA 1FVOA 4QOGA 2BLNA 1A72A 3WBKA 3CTPA 5HK9A 4DLXA 4R9SA 1GZSA 1SBHA 1WKBA 3PEEA 3R3JA 4UXHA 5CCDA 4DUGD 4M1EA 4U00A 3TTTA 1JUDA 2FP3A 4DSAA 1NZJA 3BG5A 5LOVF 3RB8A 1U1DA 2IOYA 5HQTA 4X65B 1W0KD 2BCGY 1USWA 5CAEB 1BWRA 1KS9A 4LSMA 2FR8C 4OQQA 4F38A 3A58B 5GAJA 3E35A 1ZPDA 2O3RA 4JY7A 2HDNB 4TGLA 2Y2UA 2D5AA 3P9XA 1YRBA 2CMDA 4FGLA 3TCKA 4F72A 5ER6A 4FJ0A 4IOJA 1JW9B 1OAOA 1XZNA 2C5BA 4Q3NA 4MGKR 3WGTA 3FOZA 5BVGB 1XMIA 1YGYA 1OA1A 1Z38A 2JIOA 3NJ4A 4M37A 3UHPA 3O3MB 4FIDA 2PMEA 3VJLA 3ABQB 1W0JA 2XT6A 2C2MA 3GF4A 4MX8A 1GCGA 3HFRA 4TMZA 4Y0AA 3RYHB 1SQGA 2VP3A 2F8SA 1X0VA 3BIJA 1JMKC 1MAVA 2Z57A 5DN6D 4W6QA 3P5BA 4KXQA 3MELA 4I3FA 1VLMA 5KDOA 4CF3A 2YWGA 2AEFA 1R0RE 3TXXA 1O97D 1E7SA 2FFAA 4L6AA 5BVGA 2FEOA 2GZ2A 4K8RB 4J0KA 3FWKA 2WU1A 4HYEA 4EO9A 3FTFA 2WAAA 4IQ4A 4KLZA 5CIQA 4FOTA 3IKLA 1LNZA 2FCAA 3H19A 4HGQA 3RYHA 2JLWA 1T9HA 1GL6A 1P7WA 2WWYA 3TFOA 5J4LA 3LUBA 3N2IA 2W22A 2ZWAA 4HEJA 2GWRA 3KPWA 3L6DA 1SUAA 1VJRA 4NFYA 3W1VA 3DD1A 4LMBA 5JHGB 3REFA 1Y1QA 2LDXA 4JEUA 3WISA 3IPAA 1J0EA 3F1LA 1X13A 4KE8A 1Q2XA 4WZ6A 1YCHA 5AVSA 4J0QA 4KCGA 5K3SA 3MTEA 5JS2A 5JD5A 4JENA 4AYXA 3O2NA 3GCWA 3FD8A 1UC4B 1UZAA 2RGWA 3GDHA 2VPPA 3V4ZA 4UBLA 2GTPA 3M3HA 3BTSA 1E9AA 1S2MA 4KU4A 4HRYA 4B9AA 4LVUA 5THXA 2XGMA 1JIJA 5JH7F 1KYZA 4CCYA 3G6KA 2I1WA 4K9QA 5D3ZA 2ONZA 3PGXA 3S27A 1E3SA 1WJGA 4M9CA 1HF3A 1NMQA 1RDFA 1BKDR 2I80A 2XVMA 3Q3HA 3L0DA 3RGWS 3E3AA 4LSWA 2RGUA 4MUBA 4IHKA 5P8WA 3DLIA 1IEQA 1DT3A 3F8SA 5I9NA 3GJ7A 5DWDA 4EUKA 2X7JA 4LCEA 4GFDA 2BFNA 4AECA 1HDEA 2ANCA 2DX7A 3JYHA 2AN3A 4REQA 4BNUA 1XZLA 4AJLA 3ONVA 4WBSA 4HQKA 1LH0A 4PNHA 3Q98A 3RH0A 4RJIA 4GDFA 1RZUA 1LI5A 3SQDA 2ETVA 2CHVA 5K0JA 2Z0MA 2FOIA 3GCGA 1KC1A 4BJHB 5TT0A 2E3JA 2I03A 3ES9A 1YFZA 2WWGA 2ACEA 1J5EB 5D7NA 3ADPA 1VZ3A 3OWXA 4ATNA 2V59A 1D2GA 2A0WA 2GM5A 3FN4A 4MVWA 3BTUA 4WLEA 4HDKA 4EVIA 5DLQC 1DHRA 4UTVA 2ZETA 3NIWA 3HO6A 2A0XA 3BCUA 4XD7D 3SS9X 1E2JA 2XQGA 3KL4A 4G0XA 4MQFB 3MZ0A 3UV7A 5CEFA 2QU8A 1G59A 3T3IA 3ETHA 1MZPA 2F59A 3IX7A 4Q3OA 5B4VA 2G9NA 5J5CA 4N39A 4DCMA 3D0RA 4UTOA 5C8ZA 4TTTS 1Z6QA 1FMTA 2AMVA 3ML1A 4AO8A 4AUNA 4CKEB 2P2CA 3PE6A 3NI2A 5B36A 3PGJA 2PNFA 1U1CA 2GD1O 2ZPTX 2GASA 3CYFA 3ESDA 2CUKA 3CJQA 3I9OA 4K9PA 5DRYA 2YMLA 3FRJA 5B37A 3NANA 5AESA 4H1VA 3EXEB 1TYZA 3JTEA 3GRPA 2DWOA 2ZT8A 4R68A 4F0JA 2PMCA 1E1DA 3OD1A 5E7QA 2WQZA 1ZMOA 3HRKA 4Q4DA 5LIRA 4KPUB 3D6MA 4S35A 4CKEA 3OPYB 2FB9A 5F3WB 4I4TF 3A70A 4Y2UA 3HC7A 1L5LA 1KJNA 3ANXA 1W1UA 4OJKA 3ZDBA 2ZRMA 1T43A 5JJCA 5DHSA 4LF4B 2P75A 2P9JA 4AW9A 3EXEA 5DM2A 1L4UA 2QPLA 1CJBA 2NADA 4Y1RA 3VUFA 2Y9MB 1RM5A 2IW3A 1UP4A 5IBPA 4C29A 2RSLA 5K3OA 4M7RA 4RQUA 4BVEA 2LUOA 3U44B 2COEA 4YXWA 7MHTA 3UYLA 1VPTA 1PKEA 2Y1KA 3OPYA 2CLIB 1KK3A 3QG5A 1XNHA 3RYCB 4N48A 4P7BA 4NS4A 2PRSA 4FEAA 1YQGA 2CMFA 1CUCA 1E9RA 3KB1A 4GP6A 1ST2A 5F4ZA 5PNTA 3ZGVA 3A4LA 4UEJA 1XL0A 3MMPA 2MOKA 1TE2A 3ZGNA 3LE8A 4CXMA 3OURA 4A2WA 2VYCA 1E3QA 3L7JA 2LCFA 5HFAA 3QBTA 2QAGB 3CEJA 4OU4A 1KFBB 3JQQA 3ZUPA 4AG5A 4MR8A 4JL6A 4ERNA 3U44A 2P9GA 3S8YA 5AVJA 1V41E 3IBCA 1ENOA 1SBYA 4MQEA 1X7HA 4JBLA 5GJBA 1UK6A 4DMFA 2QSUA 5J3JA 3IHKA 4G67A 4XIYA 4M9XA 1C3JA 5KC9A 2AE1A 4L75A 1U8XX 1DIAA 5JLJA 4RF5A 3V4PB 4B74A 2ZUUA 1A2QA 1GT91 1GOTA 1TL7C 3G7UA 4MICA 4KMOA 5BV1A 3HJGA 4Z53A 4I50F 4TKMA 1G60A 1O87A 2HM7A 5AD1A 3STHA 1LBIA 1YI8A 4JYMA 5CK4A 3HACA 1YVPA 3EMBA 4C2AA 1VTKA 1AA9A 1JVNA 2P8SA 1GUBA 5AHKA 3SDBA 2J48A 4MV4A 1QJ4A 4XJVA 1QFXA 5TIIA 3ABRB 3HMKA 4IJ5A 3X1YA 1U0OC 1DAHA 2JANA 1M5UA 1UZUA 2BSXA 3KXLA 2EDAA 3LPNA 3EE6A 1MDBA 3KKKA 4CIBA 2OORC 4MI3A 3JD4A 5AVZA 2Q3DA 1DRWA 1V5EA 4Z3OA 4JQCA 1STOA 1YV9A 3FWNA 3PR3A 4NBNA 4P08A 3H4VA 1GPMA 1LDGA 1KI7A 1Z5UA 2UZIR 2WF9A 3NNSA 3RABA 3TRFA 3ORRA 3T3EA 3P7MA 3TUZC 4D44A 1UOPA 2WKQA 5LJIA 5E1BA 1G16A 1F12A 1HEUA 1OWOA 1D5WA 1R5OA 1W19A 3B2QA 3BWYA 3B2NA 3DTNA 3N05A 3HL4A 4LWOA 1JQJC 4NQRA 3QHQA 3NOOA 5B4TA 2D7DA 3C4JA 5EHGA 2XYGA 4V02A 3SBDA 4OYYA 1DLIA 2XB2A 2VOEA 2GPBA 1IHUA 2DH5A 4ER0A 4GEGA 3OZDA 4C6TB 1B8PA 2GAJA 4B6RA 5EJIA 3UKOA 2Q6OA 5BMVF 4JHLA 4BJ3A 1KF0A 2QAGC 1MX9A 1I4DD 2XKAA 2IDJA 4LZOA 4XPZA 4ZVPA 4P0PB 4AMGA 1ZIPA 3DMTA 3WJ1A 1VI2A 2IZ7A 3BGSA 4DR5B 4C4AA 1KS2A 2R7AA 2XBMA 1GTZA 1XEXA 2VSNA 4FZRA 1NUPA 4GWGA 2BTOA 3CX6A 3DTVA 2PWBA 5TEVA 2B69A 1KSFX 3WLAA 3A1CA 3R3SA 1H2YA 1M7HA 5AKYA 1YC5A 4C6TA 3PFWO 1UFOA 2ZBQA 1N0HA 1COWA 2Q2QA 1E6CA 3OUTA 2FPPB 5HKLA 2ZEJA 2BN4A 3NYRA 4OPMA 4TWIA 1GU7A 3TLMA 3AF5A 3I1IA 2I4RA 1T3HA 3KHSA 1GPJA 1V6CA 3R8CA 2A0FA 2IYOA 1H0HA 4M0KA 2ZTVA 1A9SA 4D3DA 4PONA 4GXQA 1QFSA 1ID1A 2BEUB 4LHEA 3TLJA 2I71A 1KI1A 4Y1FA 1O6ZA 1NBHA 2ODAA 4B3GA 2DECA 4M9QA 1QH8A 2I54A 4PRZA 4HPJB 3ZDYB 2WJ4A 2RAPA 5BSGA 3KKMA 4I46A 4ROTA 5I4CA 3ZJVA 4FKZA 3L0IB 5CVVA 1EBUA 2VDNB 3H8JA 5KSWB 1CS0B 3F4KA 5CRIA 3ZZ1A 1MT0A 4G0NA 4M1WA 4FFSA 4TL6A 2QRPA 2IHUA 2BEUA 4HAZA 4M49A 2GAOA 1JLRA 1UFVA 1SB9A 5E4FA 1HFKA 4ZODA 3FOAA 3R09A 1H2AS 2O8BA 2EKDA 2YV4A 4NNJA 3K09C 4CKWA 1KK1A 1SJ9A 1YRWA 1QXSA 1X1QA 5EUQB 3H42B 5AP9A 1QTQA 2PVPA 1CS0A 1QGZA 4L57A 2N0SA 4ZVLA 4BNDB 2FRVA 3B38A 3RR2A 2HRDA 1NUAA 1QG2A 3E9YA 4TKLA 3U3KA 1UAYA 2R84A 4F9TA 1EVKA 1UXHA 1CUXA 1JH9A 3N7TA 5LYJF 3QX7A 4DR1B 3G5UA 2QENA 4FWBA 6CHYA 3EXIA 1IQPA 1BKYA 3QYFA 5FDFA 1BJKA 2H9IA 4IXMA 4ZOCA 5DHPA 5DB4A 2I2XB 1G41A 2JFYA 2ZK7A 3JVEA 4WEOA 4AFNA 4DWOA 1JI0A 2XMQA 1SVNA 4TYNA 1SEPA 2JARA 2ATCA 4DLVA 2IEAA 1GVNB 1TCAA 1PZEA 1WRBA 2XRFA 4YMLA 3WLRA 5DLEA 4B17A 4JLBA 3OZUA 1XOIA 3OCWA 1WY5A 2QLFA 3OE5A 5CLFA 1ISJA 2OPBA 4CCSA 1IK6A 3L7MA 4YUYA 4DV3B 3DO5A 1U8CB 4KLAA 4PAGA 1HQYE 1XI2A 3UJAA 5ELLA 3S2IA 1T0JB 2GA9A 4TYYA 2J6BA 2JGKA 1LW6E 3ASYA 4MULA 3H9EO 3KDSE 3H9QA 1FNCA 1YB4A 3FBWA 4LC0A 1GCIA 3FHLA 1NUHA 1Q1BA 1JAZA 1SXJD 2CE7A 1FNSA 2IEGA 2P5TB 3HP1A 4PGMA 3M5CA 3ZJ5A 2CN1A 4EW1A 5CBPB 5F9FA 4G4IA 1UPTA 1X80B 1TNDA 3CX3A 3FPGA 4F5DA 1LPAB 1XBTA 2V1XA 4BDTA 4XYBA 2GM4A 2O54A 2W6CX 3PHCA 3R9IA 3GLHB 4UU8A 4DZZA 5EE3A 5IAKA 3I5YA 1Z6ZA 2C8VA 3Q0IA 4KFTA 3E3NA 2OCPA 5J2UB 1WBJB 3FCUB 2WIJA 3SKXA 3MD9A 4UBOA 1CU1A 4L5BA 2VHVA 3ZS9A 5H9WA 4FFBA 5KOJA 1BJRE 3KCQA 3JAKB 1FJ2A 2I62A 1X80A 1U0HC 1CT9A 1JHXA 2ZANA 3IQIX 3I9MA 2PS1A 4UQLA 2AFIE 2W2XA 1SKBA 3HJTA 4NP6A 1SQ5A 3GLHA 1I3KA 4OHKA 4Y9SA 4BO2A 2WJAA 2AQHA 5LIPA 2ZBEA 1ZG3A 2EQBA 4DILA 1N2BA 1PSDA 1Y1KE 4MB6A 2NOAA 3M4ZA 4YAOA 3RU3A 3W78A 4F8YA 3F2IA 2NSDA 1K7CA 3JAKA 4KX3A 4WWHA 2DG2A 3ZI0A 8ATCA 4OLFA 1SM4A 1FXUA 1JT9A 2W0SA 1JQBA 2ZU6A 3BTOA 2NZJA 3DG9A 4ZCQA 5A3VA 3U7GA 4YBZA 3AESA 1TF5A 2XTMA 4FZJA 4H6WA 4JI8B 3ODPA 4ZEXA 1V8DA 2XT9A 2HJVA 4L2IB 4NU6A 1F51E 4A2PA 1YA4A 3F3MA 3JQBC 2RK6A 2P2ZA 1R10A 1PVVA 1ZD1A 4JOSA 4CM4A 5KYWB 1NV8A 2DR2A 4M53A 4KGXA 3P97A 3VYUB 5BSMA 3T1HB 5BXQC 1MAWA 1RLUA 1TM4E 1YIOA 5FKJA 3S1AB 2GUWA 3UOWA 5IJZA 3HCOA 1I1HA 4IXWA 4E0BA 2ZSFA 2XF8A 1ZK2A 3HWWA 2OY0A 2X7XA 4IDHA 1KI9A 4RKRA 3F6YA 2QDXA 4HLDA 3C7AA 4GBED 1XR3A 4XOIA 3ICWA 3NNDA 4TQGA 1P4AA 3E9ZA 4ZVOA 4OTZA 3PQCA 4EARA 821PA 2GNPA 2DBQA 4BFTA 1ATZA 2J7PA 1WL8A 3ILYA 3UK1A 3RSHA 5KAMA 3UMCA 2CXUA 1L8OA 1GDHA 1XRQA 1DCMA 1XZEA 3WWCA 4LMAA 5DCUA 5BURA 1RJ9A 1BIFA 3U4IA 1XLUA 1GSAA 2QTLA 5KEIA 4LDJA 1QH9A 2B9EA 3OY2A 3E82A 4IV5A 4XCQA 3RTCA 4B81A 3O82A 4W5QA 2BFDB 3Q41A 1GYPA 3C98A 1G4AE 5CDFE 3HS3A 1H1LA 1G291 4YJFB 1SURA 1WLYA 2YJGA 3ABOB 3AF2A 1E4OA 2IHZA 5FT9A 3WZMA 2Y1XA 2VYNA 4LRUA 3WHIA 3VX3A 2NO0A 3NWEA 1X15A 2ZJ5A 5EESA 1DC3A 5FPSA 1Z35A 1N2HA 1A69A 3HABA 1ZM3A 3DOIA 1EK0A 1IBRA 4S0ZA 2O5RA 1H3NA 3CRVA 4YP5A 4DLUA 1A1VA 4UUAA 1D0SA 4BC1A 1ISPA 3V8BA 3RI3A 2BFDA 3P9RA 3BE6A 2FW7A 2XB4A 5DT2A 4IF4A 4QO8A 3HFGA 2NUTA 1N6NA 3RNLA 1JEQB 4TLDA 2OZEA 4AJKA 1RM0A 1E6UA 2AWOA 1ZNWA 4LJLA 4NV3A 1CZUA 4AN4A 5EEGA 3CPHA 4JUIA 1P45A 3BOSA 4EH1A 4MVJA 1MEJA 2WSSA 3H1EA 3LUGA 3NLLA 3G49A 1F0YA 3D6UA 4BNTA 2A88A 2C97A 1WULS 3MBKA 4FEYA 2FDCA 2JI9A 1JEQA 2ZJ2A 5BWNA 3PDCA 2AJBA 3DMHA 4TKUA 2RH8A 3TLKA 2GYYA 3I30X 3WSWA 2JLUA 3THOA 4RVHA 2WSMA 2YZ2A 3V46A 4GVXA 3TLXA 2YIDA 1V3QE 4NY1A 3UAXA 1BJTA 1O1YA 1DJPA 1NUQA 3OT1B 4P7GA 1GSIA 3L8EA 4BO1A 3FPAA 4CCWA 6AT1A 3NV7A 2BGWA 3M0EA 3JQ9C 4P86A 5IHXA 1L4LA 1Q92A 1D6JA 1T3ZA 2W6ID 3W3AH 2I34A 2NU7A 5CGZA 1TECE 4GC5A 5FTWA 2WOOA 2RONA 3EGVA 3CLVA 2D2EA 2JPDA 3N1UA 1XF1A 1E7WA 3SIPA 1AKRA 1DFHA 1EX9A 1R0BA 3W5IA 2GXSA 2V7PA 2XVAA 4H77A 4TSRA 1F7VA 3BJMA 4RXUA 1DFGA 1KZ9A 3LCMA 3OT1A 1G5PA 4UREA 1ONPA 4EW6A 1P5HA 5GGXA 2BAGA 5KKNB 4KQ6A 4Z2YA 3ZW8A 4EY7A 1OC2A 3KQVA 1NVUQ 5DGDA 1ZK3A 2ZYIA 2NVBA 1ZRMA 1DO8A 3E9EA 4XIJA 3VU8A 4B1FA 1WNTA 3GRFA 4DAEA 4MQ4A 3IH5A 1UQRA 1KJ8A 2ZBUA 3KJQA 3MUFA 3VOBA 3DH0A 4UUQA 4DREA 4Z0TA 4V24A 4KQKA 3WNDA 3W7VA 1XWIA 4WNAA 1ML3A 2ZKLA 4EKEA 4IQ0A 3JS5A 3DBRB 3FNEA 3FR8A 1E32A 3JD0A 2FPUA 1QQTA 1IC6A 1LPPA 1ZRHA 2VDLB 3KZKA 5CCEA 1NSYA 5CDTA 3IV7A 1YI1A 4FDUA 3QEJA 2Y8EA 2DB3A 4EZIA 4QQ8A 1NONA 4P38A 4PYIA 4C01A 4D6PA 1M72A 2ORVA 3QW2A 4LMRA 4PFKA 4YQYA 1HNWB 3PHIA 3M6AA 3W9UA 2O0LA 1PR4A 1Y4AE 1W25A 1YACA 3MSCA 3R40A 4R7GA 1QV9A 2X0FA 3V7WA 2ZYRA 5HGJA 1Z2OX 5DX8A 1XVTA 1RYEA 3E7WA 3K32A 4KR0A 4AC9A 4EK9A 4UNPA 2FWBA 5KUTA 2OZKA 4TZ0A 2IK8A 1ZVJA 4Q9DA 2PL9A 5BUSA 4KUHA 4IX1A 2OFOA 2X2PA 4HDMA 5FOTA 4ZC8A 1CVLA 4BVAA 1VLQA 5JTTA 3FVTA 2D13A 3EASA 2W6QA 4BRUA 1ULBA 5JS7A 2GPJA 2O3TA 3PZRA 2ERCA 1OI3A 4S3MA 3E15A 4ZMBA 2RGEA 1ORVA 1QLJA 3ORYA 3RJTA 3DCNA 5JCXA 2AYZA 1QPZA 4MUXA 4TTPA 3ZJYA 1WD7A 3OBIA 2ZT5A 1WAMA 3L8ZA 5LP6B 4XDGA 5FTNA 3TPFA 3CO5A 2REQA 4UW9A 3E81A 2GTIA 2PR7A 2Q8QA 4LF6B 2AG6A 1QJCA 2QLTA 5FBKA 2UZAA 2YIJA 5B1HA 3OQNA 4F4UA 3AVVA 4RSGA 3WWYA 1MQ9A 1FJXA 1NBMA 1SPBS 3DB1A 4EO7A 1N33B 3AKCA 3WTBA 5BT8A 4M3NA 1XJ5A 2Q4DA 3IXQA 3JQFC 3FBGA 3BMNB 1F48A 3T3NA 3EVGA 3JQGA 3PBKA 4P3OA 1XF9A 2DT5A 3EPKA 4R41A 3TH5A 1U1FA 1YS9A 2MSCB 5A6SA 4WINA 1P80A 5FL7A 1VG9B 4QDXA 1V1JA 2A33A 4BECA 3TB4A 1W8IA 3P2EA 3DE6X 4RWZA 3DAGA 4OYLA 4HUTA 1SUSA 2VKQA 4YO7A 4KNYA 1CF4A 4Z7JA 3TOSA 1OU4A 5LA6F 2AX4A 1EMDA 2HREA 1E2IA 4DJDC 4NZPA 2IXFA 1MVLA 3E3MA 3FW1A 3WNZA 1NXPA 1KFKB 4S1OA 2HSEA 3BMNA 3WKCA 3QE0A 5F2EA 4C6SA 1AMUA 3GWGA 4C05A 4RA6B 4V2IA 1T3LA 3TJZA 1UKCA 1Z73A 3H2KA 4KSCA 3VH1A 2BH2A 1U4OA 3DHYA 4IIXA 2WI8A 3U61B 2VBGA 4RTJA 3VZBA 1R5NA 1KKLA 1U8YA 2P69A 3TR5A 4A9AA 3LLVA 4PGAA 4PRKA 5LPNA 4CEHA 1F06A 1O03A 4R16A 1QRAA 2RHRA 3N0TA 2Z30A 3H17A 3HXKA 1T10A 3N2EA 1UDWA 3FNQA 1GL3A 5DW3A 3BIXA 3MWDB 4OCZA 4CMIB 1PW7A 3ER8A 3T3HA 3PXXA 1V0JA 4RA6A 4QAJA 4ZCMA 4KMSA 1Y9ZA 4GF5A 1L1FA 1AA6A 3NDRA 1MH9A 1MTZA 1EDEA 1TYCA 1Y4ZA 2HR1A 3MF4A 5SZIA 4CU2A 4D9BA 5GINE 1I6WA 2XR1A 4YJGA 1LRKA 4KWTA 4MQ5A 3Q7RA 4O0LA 4B3BA 2FNAA 3DEJA 3USES 1WOYA 3SXUA 3MWDA 4NMWA 1JFLA 1SBQA 2ZRBA 3KSRA 4PLPA 3CRRA 4ZAXA 4ER6A 1TK9A 1GRQA 1WZUA 4CQMD 2P6RA 2JJYA 2OCBA 5EAIA 4W5NA 4XI9A 4OH7A 1BXZA 3L92A 3C3XA 4M54A 5EI5A 2ECKA 3P1JA 4BQEA 3HB7A 4PW0A 1A97A 4DA6A 3GFOA 1X1TA 4WXMA 3SHOA 2XUFA 8LDHA 2P35A 1VMAA 3WA6A 3DT9A 4B71A 1UBNA 1Z0JA 3UH1A 3QGMA 5BQ5A 3T95A 1S3FA 2OGTA 4TV9B 3VSDA 1X9IA 1X74A 1CE8B 3U9LA 1GU0A 4PG7A 3OSUA 1Y7PA 2ZRJA 3E1SA 2FLWA 2R25B 4Y2VA 3PC2A 3HU3A 1PGNA 4L0MA 2REBA 1MX1A 2XBLA 3JTMA 4FI3F 1Q3KA 1HKHA 3LIPA 1UXOA 3E9QA 2PUWA 4IP0A 3U17A 5KS2A 1Y8CA 1ZUNA 4DUYB 1NVBA 1PJSA 3OKAA 4I8IA 1Y8AA 2JLQA 2X2OA 2RHBA 4NBSA 2Z8YM 4TSKA 2X9QA 4YI3A 3JXEA 1CE8A 5CDHA 4GYKA 4N0QA 3R1IA 1E3WA 1OILA 3AR2A 1JXOA 1OSNA 5DJ5A 16PKA 3VR4A 1G8KA 1ZOSA 3WMXA 2XIJA 1YH3A 3NGMA 2XYVA 2ILTA 5DHRA 5FCDA 1EGHA 1SZDA 3E7DA 2EERA 3ETEA 3NYQA 3RRMA 2HJ9A 4IWXA 1J1ZA 2E5FA 4BAUA 3QLUA 3ONWA 1NNLA 4C4OA 4JP5A 2IY9A 4OGFA 3ST7A 4DMUB 2QTCA 4NBVA 1NN0A 3C1AA 1T2FA 4XSGA 1XKQA 1NMZA 2WYVA 5BSEA 3P9NA 1MJGM 4QDZA 3VR1A 4TMFA 2Z4RA 4JA0A 2J9FB 3M2TA 5DOZA 5BQOA 1DPFA 3BFJA 4NKRA 3UYKA 4FJ1A 1ORRA 1SCNE 4IGFA 3ROPA 3J7AC 4MIKA 4E1VA 4DIBA 1K6MA 3K2IA 2O07A 3S99A 2Q5LA 5G0UA 2QRMA 3CW8X 1GQRA 2TS1A 3HA7A 4GS5A 1VL6A 5GTDA 4DF3A 1KQGA 3MEQA 4CQLB 2VSXA 4QOHA 1ZSYA 4E5DA 1H22A 2WIAA 1U9ZA 1YZVA 3L4BC 3ZLVA 4P4UA 1GG9A 3OG9A 3ZPXA 4MHOA 4BMZA 1JKJB 2YWHA 3R75A 5AKXA 3U3MA 1USKA 4FE4A 1YBHA 4KBFA 4B2YA 5IJAA 1J0BA 1Y7HA 4ZCPA 2Q5OA 4M55A 3QE4A 1M0SA 3DL2A 1V26A 4GYJA 3LDAA 4ZXFA 3R5TA 3QPDA 2VUHB 1E3LA 4CQLA 2DPHA 3O4RA 3OEEA 4GUDA 4XR9A 1TQ8A 5BQXA 4O4IA 4RJJA 1W93A 4R9UC 3K6SB 1RYDA 3HPQA 2L69A 5BOSA 1IOLA 3HH8A 5F5LA 2H8GA 3S28A 1JKJA 2QRKA 3VQTA 4RXTA 4I55B 5FPKA 1ZVQA 2VYVA 4J7CA 1HT0A 1I32A 2WABA 3WLMA 2VHJA 5AJZA 4AY5A 4BVKA 4KQWA 2NO6A 5AJYA 1GA6A 3RASA 4RENA 3ROFA 1TAGA 2ZRKA 3VO8A 4GOND 1JX6A 1T4GA 1CFJA 2Q0HA 2O50A 1W48A 3DF9A 3PJGA 4LBYA 3K6SA 5AUOB 4J0JA 3TQSA 5EPEA 3OLXA 1KR2A 3LNCA 4IUYA 4YAEA 5EXTA 2FPSA 2AUNA 2O2GA 3OM9A 5IK2D 4BATA 2O7VA 2HWXA 5FNVB 3GRYA 3B1XA 4X6LA 1CUJA 3V4OA 1E4EB 1WDLA 2ZRQA 2GF2A 1EGQA 4RK4A 5LXTA 2B99A 1J2TA 1OD6A 5HF5A 3LU1A 5JIBA 5A04A 1VYVA 1AURA 3OTGA 1T3GA 4Y6QA 3HVUA 3LYHA 3KHKA 2I4LA 3IVXA 4F6CA 1VPDA 4S24A 1N7HA 2H4YA 1W4CA 2DFKB 3FVQA 4C0SA 2CL5A 3PXUA 1E4EA 4UZFA 1P4RA 5L7YA 5C35A 1LWNA 1O9BA 3G5LA 5CDYA 1RAEA 1RZ3A 5JCOC 1W0CA 3PHJA 1IY1A 1D03A 1JG7A 1M2GA 2XI4A 1U11A 4FD3A 1G21B 3U5TA 2IJGX 2VP6A 2ZULA 2Q07A 1WZ2A 1AF7A 1L5QA 1EXNA 2YV5A 3OHMA 4YALA 5ALKA 4JITA 2BFPA 4K26A 3OLWA 1Z68A 3Q7SA 1PFKA 4ETIA 3AUFA 2FQXA 2IDMA 2QMQA 4ZQEA 5J9FA 3ZWXA 3CVUA 1NN3A 4ND5A 2HL6A 5EQJB 2HW8A 1IY9A 3DCYA 5FBLB 1JHOA 4FNOA 3TZEA 4AKIA 1SPXA 2AQIA 1J20A 4XWGA 1QZTA 3R41A 4MP6A 1G21A 3A1DA 1MC5A 3ICCA 1A5ZA 4AZTA 3BKXA 3F9RA 2ZQYA 4IIGA 1FDTA 1UJ2A 2ZVPX 4YIKA 2YKGA 2B4KA 3E27A 1GKKA 3KE9A 4WA7A 5CA0F 3D4NA 1RXVA 3MRVA 2P2GA 4RKEA 1FFSA 2PA3A 5K6AA 3F9CA 3HJUA 2IEZA 1XDUA 4J0GA 3BDVA 2C5AA 3U7RA 4AT1A 3I1JA 5ESXA 1M2OB 1L8LA 5IRCD 4FVTA 2Y92A 4FZ3A 4IDPA 5ALIA 2VSFA 3ZDFA 5CX1B 2YNMA 4AJNA 4DBZA 4WNCA 3PU6A 4IZOA 1CFZA 4R7TA 1LPNA 1ZMBA 3ZHSA 3FAKA 3FMPB 4EHIA 2QZ4A 5LQRA 3CX7A 4JLUA 1DWPA 2OLKA 2H48A 2O5VA 2WSIA 3L84A 2IITA 3NIFB 4FFRA 5HILA 5CXUA 3BJZA 3IOCA 4WA8A 3ZY6A 2DY1A 1M2OA 3WAKA 2P9QA 3JD2A 3Q6MA 4L5CA 1TVEA 3IR5A 5C4MA 1FQKA 1E2LA 3ZY5A 5J1TB 3ZYCA 2G83A 3RSFA 3FJOA 5CX1A 2JJ2D 2Q1WA 2QG6A 4YR9A 1HM5A 1ZM2A 3HFSA 3K9BA 4ZZ0A 1HE2A 1EH5A 2PUCA 2EKQA 3OP4A 1U2EA 2NN3C 1GGEA 1GQFA 1MGOA 2HA7A 4P80A 1XRLA 1ZNQO 2ZB8A 1XALA 2D0DA 3DOOA 3EIOA 1L7RA 4HGRA 4MEAA 4OI2A 5BN3B 2ZI5A 5BQFA 2PX8A 5IVHA 1V8BA 1XVUA 3NBKA 3WDKA 1R2QA 4ISBA 4E31A 3AKDA 4RE6A 1V39A 3VZRA 1XFDA 1G7RA 3MINB 3P9CA 1GDTA 1H2WA 3GVXA 4BNJA 3HP4A 1IXSB 1RQ2A 2VYQA 3ITEA 4L7QA 3C7DB 3AHGA 3VNRA 1RZRA 3QE3A 4CDGA 4IEFB 3ZW9A 5KMGB 3F5QA 3HE3A 5TPZA 1WXIA 1FE8A 2HCBA 5CDUA 2XW6A 1PF7E 3DZCA 2X58A 3HEAA 3MINA 4AUMA 3VA7A 2WWIA 1M8GA 4AJ2A 2AT1A 5DCWA 5L3VA 1QO0D 3SLRA 1J0DA 1QKIA 2V65A 3FNBA 3I2GA 3KPYA 5D3MB 3D8HA 2XMCA 3EPHA 4FYXA 4ZT6A 1KEEB 1Y7LA 2QM8A 5FI3A 1F4PA 1ARZA 1QIFA 1W52X 1E9CA 2I6QA 3HR8A 3BYZA 4ZYXA 4JC5A 5A6VA 3TRDA 1JFSA 1SWWA 2Q3BA 4A0FA 3VNSA 4YCNA 4Q05A 1A50B 1QQ5A 1C1XB 1TYBE 1A7AA 2IEDA 1IQ0A 1S8OA 2PZGA 3DVLA 4NJEB 4NOKA 2OB2A 3VR0A 5AW0A 3ECSA 3GOHA 1J6UA 3KWJA 5DRTA 2M6LA 3IDAA 1HYHA 5D3MA 3THRA 2A5GA 1KMNA 1PCXA 2O7SA 2VHYA 4E30A 4W9NC 5A9RA 5IXYA 1KEEA 1P7CA 2K6GA 5TNXA 4Z5XA 5I7VA 1U8FO 4Q3AA 5LZ5A 4B45A 2VSOA 1UZNA 4DDWA 5A4FS 2FZEA 2QJWA 3T1YB 1ACMA 4I4NA 4FR2A 5COAA 1PWYE 3RT7A 2JAOA 3I58A 4F2PA 1W1IA 2ZAIA 4GKKB 5LUBA 2D1SA 2N1BA 1QVVA 4MRAA 5IVDA 4C4SA 5J4YA 1BDHA 3EUEA 3L0SA 4QATA 1X7YB 1AQYA 1SKQA 4H9GA 2XUHA 2YHAA 5L6MB 1AKYA 5I9TA 2FZGA 1I9GA 3EX7C 1PT5A 1O94A 1M2EA 2JZOA 4G1BA 4AS3A 5JDCA 2QLMA 2A67A 5FEMA 4R2KA 3WYBA 3EZGA 4M1QA 1X42A 3IESA 4DA9A 4B8WA 2XUQA 1EHIA 1FQOA 1QTIA 2DQYA 2O8FB 1X7YA 4EA8A 1W85B 5INTA 4UFOA 3P71T 3QWHA 4F5ZA 1HWYA 1GR0A 2C7BA 2EQ5A 3KPUA 1TM2A 3OHPA 2VAXA 5K0CA 3CLUD 5BWMA 5T67A 1E1CA 4C2TA 4GWLA 2CDCA 4FU0A 1FVFA 1PU2A 3ORHA 4JLSA 3V9AA 2XUAA 4M0CA 3VR5H 1Z7YA 3WOVA 2WP0A 1KYYA 4MWOA 4M1MA 3IURA 5GM1A 3C5EA 4I1UA 3PXDA 2O8FA 1OOEA 3QVGB 1W85A 4GIBA 5FNZA 4W9MC 1HYGA 1CJUC 2CWWA 2ZAMA 3EEBA 4LNHA 3ZC3A 2FUEA 2RGNC 5LKRA 4IJVA 4B2PA 5ARBA 1NUUA 3KB6A 1NNI1 4CDNA 3BSFA 2X77A 3EVNA 4JC4A 5BUQA 3AF4A 2XWBF 4O3FA 2D1YA 4H4DA 2CZQA 1Z82A 2RHCA 2YIVX 2QXTA 3AV3A 3DVAA 3GR6A 3MWGA 4L8FA 4MA0A 4UFNA 4LXTA 4EG4A 2AG8A 4II7A 5KQRA 3VC2A 1SC9A 5F9MA 1ECBA 1XROA 3QVGA 2CEKA 4RV5A 2XXAB 1I01A 4PHCA 1DQPA 1G5RA 1UQTA 4UARA 1USIA 2R4TA 5M7EA 3EBOA 2HT6A 1OWNA 5DHUA 5HZHA 3T7SA 4IICA 6ADHA 4F06A 4NPCA 1DEXA 2XY4A 2Y1FA 3F4BA 3I05A 3S2YA 2GZHA 4FX5A 2OV4A 1A8IA 4O02B 3HWRA 3FUVA 5H83A 2XXAA 1XZDA 2WHEA 4RK0A 1VBFA 2YW2A 3A04A 2VEDA 4IIJF 5E6RB 5AW9A 2QHXA 1RQPA 3UPUA 2P41A 2F4NA 4CKCA 3SBEA 4OHXA 1U3TA 3TN7A 2X4GA 4OHFA 5MFZA 3F6EX 3OQVA 2VA8A 4CNBA 2XGJA 3GMTA 1ZGHA 4NLLA 1I36A 4QWMA 4H2DA 4N0EA 4QU9A 3GNSA 5KX5B 4NMHA 4Y67A 5BVHA 1ZJJA 4KZKA 3U6KA 2DT8A 3GVIA 4ZK6A 4XVHA 5BW8A 3VR6D 3PF9A 4XW2A 1NP6A 2VJOA 4Q7KA 3S29A 2FVYA 4MKIA 4U7JA 5BN5B 4J1TC 4IDQA 2HEIA 1VL0A 2PZ8A 2IU4A 2HPVA 1I7QB 3R7NA 2D0IA 6REQB 5JS1A 1N5IA 5AKIA 3H5IA 4ND3A 4OUDA 5SICE 3IAHA 3IP5A 4UNNA 3RC2A 5KX5A 2IHYA 4QPDA 4JXJA 1D1PA 1M34B 3FCAA 5DXAA 2AG5A 3V8MA 3W7BA 3SS8A 3MYYA 4XB6B 2HAEA 3GLFB 3FSEA 3SS7X 3H4MA 1JR3A 2WJVA 3PD1A 2Q2VA 2J45A 3C3BA 4G1VA 3PQ3A 4H0CA 2XKKA 4QODA 2B7LA 2LP4Y 1GCOA 4TWRA 2CK3A 4LYEA 3PQ4A 1MX5A 5DPMA 3HVJA 3THSA 5BSTA 5IUKC 1PJ2A 3MILA 1G19A 1IXRC 1KRWA 2Q29A 3O8QA 2IVZA 4H15A 2Z2JA 3WP1B 1RMTA 3PS9A 1M34A 1Q1AA 2C2BA 3QF7A 2V58A 3HUEA 3EJWA 3GLFA 4MW9A 5CTJA 5IKOA 1SCUA 2B20A 4TROA 4ZAYA 5EZYF 3WJ7A 5H02A 4CUZA 1DXOA 2D06A 3GNTA 2Y3IA 2Y9PB 2VRNA 1O54A 2VPWA 3K1TA 3P9SA 2F00A 4O2RA 2PGJA 1V7CA 4KL8S 3T6KA 5JYEA 5IT4A 1KK2A 1XZKA 1M73E 3CZAA 5FWDA 1JEYA 3LUFA 3UBMA 3MJDA 4DIOA 5K2MA 1XMXA 4A0HA 2JHGA 3O4GA 5LR6A 4JSYA 2FPXA 3I8OA 3M70A 4YS6A 2QGFA 2V7EA 2ZVDA 1VG1A 1M10A 3CXUA 3LHFA 4R51A 1C7FA 3IDZA 3UT6A 1EVZA 2B37A 5H8WA 3EEFA 4CQNA 3MWKA 4NWIA 4R05A 3RU7A 1WV0A 4BMNA 5B2FA 5HQ3B 1LS1A 3VNBA 1R0CA 3ANNA 3LO8A 1U7XA 3AW8A 4N3BA 2JBAA 4Y1GA 4Z9YA 1Z0ZA 1YR2A 4BEBA 4NDNE 5AHRA 4CR8A 3ZLUA 3N59A 3O9MA 4G9GA 1LCIA 4R2WA 4KVFA 4CG1A 4FWTA 3A1WA 4UHDA 4BQNA 5DM70 1EUZA 4LWPA 2G8LA 3GBPA 5D8DA 1UBSB 2L2QA 4QPCA 4XA8A 3FVRA 1Z0DA 1H5NA 5DV9A 2V0GA 3HA2A 2J7PD 1K89A 3KR9A 4FNAA 4FMDF 5GVSA 1RBMA 3KKQA 1T4BA 1R64A 2F62A 2SECE 5FWXB 1B76A 2AI1A 3IT0A 1LSOA 4DQXA 4J3JA 3WLHA 5HM8A 3ZLTA 1KTVA 1K66A 1YRLA 5H3CA 2YN0A 3N87A 3HLYA 3N28A 1J39A 4LHYA 4Q3CA 3TUJC 1R0YA 2F17A 3AM4A 2GTHA 4LAFA 3CIOA 3EXHB 4PSCA 3I3SR 4MIYA 3DD5A 1Q12A 4OFZA 5FWXA 2F67A 1Q15A 1KARA 2JVJA 3LBNA 3L8GA 3N0WA 1B43A 1BS2A 1Z3CA 5THKA 3FSJX 3W1WA 4XDHA 5KNBD 3HMQA 1U3DA 5AVOA 1BMQA 1IATA 3A05A 4YP0A 3OZRA 4X7RA 2BF4A 1XHEA 2V4ZA 2ZWIA 4J2OA 4B5KA 4EF4A 3KO8A 3FOWA 2IGBA 3G8DA 3OEYA 3EXHA 2OCLA 4IV0A 3F6BX 3HB4X 2I2FA 4C7OB 1Z22A 1R5JA 3EEIA 2ZDQA 4N0DA 4GH5A 3UT5B 1K7XB 4EMUA 3CRZA 4ZOLB 4DV7B 1ADFA 1K2WA 2OHOA 4OQYA 3KWLA 1RLOA 4G24A 4DNQA 5J59A 4N3NA 2QMHA 2P2YA 5REQB 5HBRA 4Y3UA 4HQOA 5HE8A 2C4NA 4N12A 2FF5A 3W5CA 1XCBA 5C53B 2WF6A 4NMLA 4U7WA 1BEEA 3GEBA 4H1WA 2HLDD 3ACDA 1U0FA 4IIBA 3MJ4A 1JKIA 3QFCA 2VT6A 1A2KC 4HPWA 1JBKA 4NV0A 1YMVA 4UE6A 3UT5A 1JZSA 3IP6A 4LHZA 1DAIA 2YFYA 3GEGA 4ZOLA 4EY8A 3HCWA 2PVSA 4BFXA 5IN5A 4D4KA 2SCUB 2Y1OA 2IPLA 2Z83A 4FLFA 1M1XB 3JD3A 2UUPA 3WQRA 3GAMA 4KFUA 3DLBA 1BE1A 1L7DA 1WABA 4PZUA 4UM7A 4CTOA 3GI1A 1Q0ZA 3ETGA 3TZBA 1ZITA 4RGQA 2OK7A 4E09A 2XNDA