2QD1A

2.2 angstrom structure of the human ferrochelatase variant e343k with substrate bound
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 142
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd1A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd1A01
1DOZA 2QD2A 3AQIA 2QD4A 2QD5A 2DJ5A 2XVZA 3HCRA 4MK4A 2QD3A 1N0IA 1QGOA 1LD3A 2QD1A 2XWPA 1TJNA 2AC2A 2H1WA 2XWQA 2HK6A 4KLRA 2PO7A 3HCOA 3LYHA 1C9EA 4KLAA 1HRKA 2Q2OA 4KMMA 3GOQA 2Q2NA 2XVYA 3HCNA 4KLCA 1C1HA 2AC4A 2C8JA 2HRCA 2XWSA 4F4DA 2Q3JA 3HCPA 2HREA 2JH3A 2PO5A 4CCSA 3W1WA 1AK1A 1L8XA 2PNJA 2H1VA 3M4ZA 2XVXA 1LBQA
chains in the Genus database with same CATH superfamily
2CLDX 1Y6GA 3PGLA 3ZWNA 5DGHA 3FNEA 3L1KA 3TE6A 4CG2A 3V4SA 5ES4B 5KDOA 1RWQA 1FTSA 3OJWA 3OOYA 1A8QA 2FSUA 3OHSX 3PRYA 1RZUA 2WOOA 4DSZA 5DBOA 1SU6A 2F00A 4WK0B 4L22A 4B81A 2CL0X 2Y67A 5JTUA 3BZBA 3T7RA 3VOSA 5B2EA 4JBGA 4J3FA 5FO1A 1E5LA 1CUSA 4B84A 2NXEA 4J2OA 1UBOS 2JNWA 1QAOA 3ZK9A 2YUTA 4ETMA 3BMCB 1K68A 4XIFA 4UJ5A 1HQDA 2XUZA 5HKKD 2FFQA 3I45A 5JJCA 4Q1BA 2CJXA 3E8SA 1E3MA 2HHHB 1TM2A 1ZH2A 2ERYA 1GG2A 4MR9B 3DBLA 1RYFA 2QG9A 4MW1A 3WDMA 2JK0A 4QKQA 1QKIA 5IEJA 1NI5A 3GEGA 1FE8A 2V7GA 3TECE 3KKNA 2AGVA 1M6YA 2IUUA 3H2SA 3WYAA 5HF6A 1CUEA 3I34X 5GJWC 3L7YA 2MYTA 3WGQA 1FP7A 4ZRNA 2PD4A 2XUIA 5ULLA 1AJEA 4QYIA 5CXUA 2ZRDA 5JXGA 1O8BA 2ZRGA 4IX9A 5EP2A 2CUNA 4EKEA 4W9NC 4R05A 4MR7B 1GCUA 3FGZA 4DR1B 1ZR2A 1H8EA 2HYIC 2CEAA 2H5EA 4YAKA 4FGUA 3KFVA 4N54A 2JS7A 3I73A 5AK6A 1P6UA 4EF5A 3AY7A 1DLJA 3HCNA 2F62A 5G0SA 4ZHQF 1DJPA 2A9FA 2COUA 4EG1A 2DFLA 1MZVA 5CTAA 1YS4A 2ZYAA 2PJDA 1T6ZA 1LVHA 4J2HA 5DWVA 3TR5A 3UCXA 2J6IA 1YB7A 2XAAA 3KVOA 4KQFA 5F98A 3SYNA 5IG2A 2VNAA 1NBHA 3GWGA 4PLFA 1E3IA 2I2XB 1KZGB 4H08A 1C1XB 2QK4A 1QYDA 2BFOA 4UCFA 2HDOA 2LZ0A 1NPDA 2Z0MA 3OT5A 4FNGA 4GZ6A 5FF9A 5C37A 2BR3A 1JKXA 3ILYA 4QBHA 1P4SA 1NL3A 1DI0A 2VR1A 3GVHA 3PPIA 3Q3CA 4GO1A 5CYPA 3UUFA 3N74A 1Z15A 3I8OA 2G1UA 3LP6A 4BWFB 1W5BA 1QP4A 1H8ED 4D9NA 4JJIA 2FRDC 2QZJA 3TXXA 3K1AA 5HMMA 1E1RA 4GD3Q 4AYWA 2XECA 1JDUA 4LC0A 3V32A 4RO0A 1EDDA 5L3RA 5CFPA 4NX2A 4X85A 1T8TA 3GLKA 3LC1O 1VI5A 3CKYA 1FUYB 4JT9A 4NTZA 5DM70 2BSQA 1EUDB 1F2TB 3PSAA 3UAOA 4JR1A 3ZHVA 5DIZA 1FLDA 1JFRA 2DPXA 2QTRA 3HYTA 4TSFD 2IGBA 3V8EA 2BFNA 2ZKIA 1ISMA 2I6FA 3OOWA 3OTIA 3OPYB 1G6OA 3F1KA 4TPKA 4C0KA 1FLVA 3H1EA 2P2LA 4YGYA 4C20A 2DEUA 1MB3A 1P2GA 4KRGA 1XDBA 4KIFA 1P18A 3R8CA 3HPRA 1Y3BE 5AVVA 1H4SA 1ETHA 1RP7A 4R1MA 2Y1WA 3D31A 1E92A 2B20A 1E1DA 3I83A 4X44A 5FOTA 4TZ6A 4XH9B 3GH1A 3BMQA 3U39A 1F1JA 5A0TA 4MKFA 1N5OX 4TMWA 5FWAA 2AG5A 4WOCA 2X2EA 4PX3A 5EVCA 5IVHA 4PZ9A 3D4PA 3TQTA 5DISB 5EWJA 3PC2A 3EGDA 3NYWA 3AEQB 4MA5A 4YRAA 1S2LA 3CRZA 1HG1A 1J5PA 4KR7A 3BCHA 4B3CA 1XAJA 3A32A 5TMPA 2X1HA 3E18A 2CMKA 3I0NA 3IQXA 1JHAA 1W59A 3RYCA 4DLZA 2NACA 3MRXA 4FHFA 3HL4A 5DHRA 5J4KA 3SQWA 3PL5A 4DXAA 1E2PA 2PU7A 3H75A 2XUAA 4MB2A 2R1VA 3HADA 4MWSA 2RC5A 1TNDA 2Z04A 1PR1A 1TLTA 1GPWB 1HEIA 1TLLA 3BKWA 3DEFA 4NCJA 2AZXA 3SIPA 3O26A 1PT7A 1VJGA 3DTNA 2AJCA 4EMSA 2VH1A 2X7XA 4YJDA 5EIBD 4BMOB 1JR6A 3STYA 4A92A 3W5JA 2JGFA 1OFIA 1C9YA 3KOUA 4AW9A 1QG4A 2GF2A 2W71A 5F1OA 1N32B 2VZ9A 3QE9Y 2D1TA 3F3MA 3FLEA 1U80A 2QI9F 5HIKA 5AW8A 2PLFA 3HI6A 4LXUA 1ZEMA 1XKXA 1Y5NA 3BMXA 1NLZA 3SC3A 4YS6A 1YR2A 5H4HA 1NMQA 4L08A 3CNEA 2CWWA 3Q3HA 4DDTA 1W19A 1H2BA 4UU8A 3DE3X 5KHLB 3BL8A 1C8LA 2OD7A 4EHLA 2VAWA 1G63A 3I23A 3KOMA 4XR9A 1F3OA 1LS6A 2ZS9A 1RJFA 3AF3A 2G63A 3EOBI 1IULA 3JQ9A 2VYQA 2REBA 3M1YA 4DC1A 4E2XA 5DX1A 1GEEA 3X1ZA 4HPXB 2XMGA 2X4GA 3H11A 5KJ6A 1VSTA 2QW1A 3BK1A 4G4JA 4QPNA 4RM2A 5G0WA 3IV7A 1YC5A 2WY2D 3GFOA 7MHTA 2J3JA 1ABEA 5FR2A 1YRWA 2YV4A 1GPUA 4AU1A 4S04A 1M10A 4FYWA 1UMCB 1GPJA 2C5BA 3EZ9A 1GPAA 2XYRA 4E22A 1U8FO 5DX8A 2FMFA 3RIGA 5JD3A 1OZAA 3PB3A 1CUVA 2NZ2A 2CE2X 3WJ2A 3WV4A 3ZTTA 4HOYA 1OBOA 3RVPA 4MP8A 5LQDA 4C7VA 1N3BA 4OK3A 1NRIA 2PJUA 2QX9A 1ST2A 3IT2A 5FTMA 2PSEA 4RK0A 3QFTA 1TECE 2AXQA 3G0BA 3M6IA 1H1TA 1GPKA 2XOKA 1U4OA 2KB0A 3BM5A 5DHPA 3KE8A 4HVAA 4KDCA 1OI3A 1ZPDA 2YYSA 1OXTA 3CZ4A 3F98A 2RKWA 4EFNA 1RVV1 2GM3A 3MF4A 3NWEA 2AYXA 2IHVA 2OGUA 5F21A 3VOTA 5AW6A 3PD7A 4ZAFA 2XQVA 1ZM7A 2HADA 2O7RA 1JEQA 1T1EA 3QVWA 4CIXA 2POQX 5HHTA 1JQEA 3FTNA 4HGRA 1J8VA 2FWMX 4D0GA 4G25A 1TVMA 4YXWA 4HWKA 4R6XA 1XNQB 4YB8A 1P91A 1FS5A 4R1SA 4X7BA 3R7BA 3T95A 3WZMA 4BNLA 4BX8A 1XMPA 2I34A 1IQUA 4MITA 1P74A 2KQUA 3I2HA 4XJSA 5CX1A 4Z4QA 3EDOA 3W5VA 1XNHA 3HFJA 4I1PA 4F2GA 3NV9A 4QREA 1R5JA 3DVAA 3P4YA 4PTLA 4BEWA 4FC7A 3IHTA 2DJ5A 4JCCA 1AZLA 1KFKB 1N8NA 3V4VB 1V35A 4WCDA 5HRAA 1X1AA 3UPUA 1J2JA 1S7CA 4WEQA 5HUQA 2ZUFA 2EL7A 3QU4A 4FXOA 3SBEA 3FMVA 1N5LA 1LZKA 1U2DC 2HA6A 3Q8KA 4O5OA 1B8NA 4PAWA 2UYQA 4ARZA 5AVUA 2J3KA 3JASA 4EFDA 1ZRNA 1N1EA 2JK1A 2BM9A 3L0SA 5KNDA 3DKPA 4IIFA 1LBHA 3P5SA 4YXWD 2C7QA 1X80B 4DIFA 3HV0A 4IDNA 5BW5A 2O3JA 1QGAA 1DAFA 4P7KA 4G56A 4WRRA 4BJ5A 4BN0A 2O8CB 2YHSA 2YBDA 1CQZA 5FTJA 5G0TA 5JZOA 1PBTA 1CUXA 4MDYA 5GGXA 4WBNF 3WK6A 2RHJA 4RTOA 1NP6A 3L8HA 3FA2A 4LV6A 4R3NA 1FYWA 3HEBA 3DCIA 3KOOA 2CCGA 1RRPA 4M54A 5JS2A 4CGZA 2DM6A 1NW6A 3W8FA 1GZUA 3GNSA 1L8OA 2QKYA 2BTQA 2F64A 1N6LA 5FEMA 3JQEA 3O2NA 3ADPA 3JXEA 4MYTA 2GBPA 2FKNA 3KCNA 1VPVA 2FK8A 1QSGA 1T9ZA 2P0AA 2ZJ0A 4Y9UA 2X0EA 1RQNA 3OEEA 4BS9A 2BEWA 3ZN2A 1E5XA 4Y6PA 5JH7B 5KINB 1ZJ6A 2P3QA 1HT1E 1E64A 3V7UA 5KYYB 5C8XA 1DDOA 4P6VF 2IU3A 3ENZA 1Y4SA 2W22A 4J8PA 3ZWVA 4YRLA 2OXTA 3BWXA 1J20A 1X8JA 1USUA 3KYBA 1XCMA 1PYOA 4DT1B 1M1NA 3RSGA 2MTBA 1DKMA 3BORA 3VAAA 1PVDA 2CFTA 3EGEA 2HTFA 1AUXA 4GX2A 4WERA 2HO4A 3AHCA 3DTVD 5FPHA 2ISCA 1LLCA 2J5XA 2QUJA 2B7CA 2W6QA 3FPEA 2QM0A 1LI7A 2FX2A 1PJRA 3L8EA 1C4XA 5KSWB 4Z5XA 2PEYA 2WWXA 3B6ZA 3OEED 4W5QA 2X6QA 1M2OA 1RYHA 2WG1A 3B7WA 1E7YA 3KZOA 3T1OA 3FPAA 1ZH4A 4ALMA 4S1TA 1E63A 4XB1A 4OSEA 5FDFA 2GN6A 1TGYA 2FEXA 2NXCA 4Q7LA 2R44A 5AM4A 1JE0A 4C30A 4WIAA 4S0ZA 5EIXA 1KI4A 3LCCA 2F17A 2LUOA 1VLVA 2F6RA 4QAJA 2D3TA 4BBJA 3O8RA 1R6TA 2HIGA 5HE8A 1J0CA 3JQAD 4IV5A 4LY6A 5L4NA 4IHAA 3OA0A 5DJ5A 3E58A 2DERA 5DTEA 5JFGA 1P5RA 3QV1A 3WLIA 2NQ8A 4J90A 3HXQA 5A6SA 2CT8A 4PCVA 3TZCA 1FSZA 4C3OB 1A4IA 1E3QA 1AUOA 1CZLA 1OCEA 2A9KA 3ROEA 1JVSA 1UXIA 1VBMA 1AB6A 2Q07A 3PQ8A 4NP6A 5DLEA 4D3ZA 5M2QA 3SX4A 3F9RA 1ESZA 3T38A 2HNBA 2OT3B 4XOUA 1PF7E 1OI4A 5KI6A 4A0GA 2F59A 3VR3D 3KQTA 4J0JA 1PEKE 3RRFA 3H0KA 5BR8B 1ENZA 4Q4AA 2H51A 3CVUA 4LF6B 1UXGA 2BEUA 4GSLA 3HNPA 1EZ1A 2DECA 2NYVA 1S2GA 2GWHA 2UAGA 3GARA 4H2DA 1T3SA 4K6HA 3QW2A 1HSZA 3WKEA 4EKGA 2UKDA 3SDZA 1TJYA 1EJ6A 1NMZA 2WWTA 4PZ0A 1UQRA 3Q3EA 3VOAA 1PGPA 3R5HA 5A9SB 4N03A 2W93A 4MLDA 2G9NA 2SHKA 2R1TA 1EVLA 2O0MA 2VJPA 1ZXBA 1JQ3A 2PGIA 2WC1A 1NWHA 3R0ZA 1WXWA 1WV0A 4IYRA 4KNYA 2NZ8A 2PLRA 4TV9B 2EP8A 3NALA 5MF6A 2C3UA 4PIMA 4YRCA 3G79A 4F2HA 3EIXA 3MWEA 3SQXA 4XQ9A 5REQB 1N1DA 4K9OA 1PIWA 3ZWKA 2ZWPA 3C41J 5HQ3B 1YNOA 3EQZA 4BLWA 4Q4JA 2JIBA 2ECFA 3KZNA 4B3IA 2ZRPA 5ED0A 5DNAA 1K27A 2FFBA 2OHJA 4CM7A 5HIAA 3CW8X 1IMJA 3MRSA 2VAPA 4Y6SA 3T0GA 1WR8A 4UFOA 2AG1A 4UTPA 4WY8A 3U0BA 1E1CB 1C81A 2PX4A 4UNNA 4I5FA 2Q1UA 4XVHA 5EXXA 3T54A 1RC8A 1WXXA 2OLJA 1RMQA 3PJDA 4JJ4A 4LJ8A 1QLWA 4EKYA 3H4TA 2I4IA 5SZJA 4WFIA 1OYOA 4R9VA 3D0KA 1V5EA 3K1JA 2J5QA 3ROFA 3RFXA 2WPDD 5CT9A 1VJCA 1CRPA 4AKEA 5ALWA 1EVIA 1CF4A 1JBKA 1ULTA 2ZPAA 2A92A 5HQTA 3EUAA 5KMGB 4L8GA 1T6NA 1RPZA 3E9DA 3H5RA 3IAHA 1O54A 5F5NA 4C03A 3O90A 5E6RB 3DAGA 4OHPA 1W1UA 3E05A 4JYMA 4WFJA 2JLYA 3KV1A 2UV8A 1F4LA 1TX4B 2F8TA 1TIPA 1W2WB 2YWGA 4MYDA 1VSVA 1DJOA 1VLMA 2IYVA 3SFTA 5LQJA 2CWDA 1KVRA 2ZITA 4CM4A 2HNAA 5I7RA 1A9PA 3D8NA 1G9SA 3O38A 4N76A 2J9XB 3WB9A 3LCRA 1RAGA 2YJGA 3HL0A 4D0NA 4BB0A 3C3YA 1CF9A 1SBCA 5E6SA 2P9HA 5FWNA 4RD0A 1AXEA 3A0UA 3A8TA 3S99A 1F8UA 2JFBA 2Z8YA 1XLWA 1AX9A 1G1AA 4LHYA 3V6MA 3ZGOA 1HG0A 3T9EA 3DDSA 1E2MA 2IKQA 4XUCA 4MIYA 1CR1A 4EZIA 2C3PA 3DOFA 3ZCPA 4QYSA 4RXMA 2D1YA 1OD6A 2BKLA 1CDZA 1NY6A 4KX5A 1V8DA 3PGKA 4PLGA 4F4CA 4LFBB 1GAEO 1HA3A 2WWRA 3DW3X 3IAM1 2ZPTX 3ILVA 5JJKA 5TMDA 1JWLA 1FSGA 1BU8A 3G85A 5HRUA 1NVWQ 1CP3A 3MXTA 2CHGA 4K9DA 2I6QA 1PWHA 4NABA 4OG2A 1HE3A 4EVRA 1DTWA 2OZPA 1IBSA 1YZFA 2TRSB 3D1LA 4MUAA 1AO0A 1CG6A 3PPYA 3E3MA 4QBIA 1B41A 1RJEA 3BGDA 1J4AA 2XYGA 2R7LA 3IA2A 4YCMA 5ETJA 4YYZA 2ZIZA 2OQRA 1SUPA 3CR8A 2EQBA 1Z6GA 3WO1A 5JS6A 1OZ0A 1U3TA 3OT1A 1E6KA 1G21A 5KNCH 1T0UA 3OPMA 1H2EA 1I3CA 3PITA 4U0JA 3TLCA 2CF6A 4M8IA 2BDUA 3WGJA 3SC4A 2X22A 4LF8B 2QTTA 1RT9A 2RAPA 2Z8XA 4YRDA 1CC1S 1LXCA 2BD0A 1R6XA 2HA7A 4FMPA 3QU9A 4GOKA 1P1KA 3S2YA 4HH4A 3UJBA 5JBNA 1H4TA 3RVQA 2GHIA 4YJ2A 3M81A 2PLWA 1SUBA 4MWBA 3UN1A 5LUAA 2ZM6B 1N77A 3H65A 2JCBA 3GP3A 3OICA 4JC8A 4RHEA 1JHOA 3T7EA 3MUFA 4XSHA 3VHLB 4ZQEA 1Z7YA 4F9TA 1GCGA 3WJAA 2EJVA 4OJTA 3VX4A 1LVGA 4DGSA 4DSTA 3K1TA 5C8VA 3NC0C 1UXKA 5JECA 4YHBA 1SZPA 3ZNOA 4L0DA 2O5VA 5J5CA 2YRXA 5DNCA 1NSYA 1U7OA 2JF0A 3A2MA 3BCUA 3KL4A 3S2UA 4DVJA 4K9QA 3OESA 2V3VA 1MHPA 3RVJA 4RJJA 4OA8A 1Z34A 4OBEA 3DQQA 5ERYA 1K7CA 1O6BA 2GD2A 3II6X 4UHJA 4LJ7A 2ILTA 2A35A 1UDBA 5JMTA 2VBCA 3DKRA 2VN8A 3T4UA 4IG9A 3KTAB 4FYHA 1O89A 4RZSA 1DBPA 2I6GA 2IS6A 3BZUA 1VMDA 4MVJG 1BDBA 1DWQA 3CWCA 5BWCA 2XRMA 4AXBA 1AV7A 1OLXB 3VR6A 2EF0A 4HWRA 3I5AA 1UDAA 3HFRA 4RM3A 3OIWA 2ZE5A 4JQYA 1V45E 3B2QA 1KU6A 3X1XA 5HCNA 1VG8A 1R6VA 1WV1A 3ET5A 3KAKA 2O2YA 4B2PA 4B0OA 1SPBS 4FUQA 4EYKA 3UUGA 2OCIA 1LNSA 5GJCA 5EZYF 5K03A 4UE3S 1IPFA 2A5JA 3NHWA 4FLMA 3WRWA 1U0LA 4IIBA 1VJ5A 5AHRA 3HVUA 2QDKA 4JYAB 3TGPA 3QQ5A 3KJGA 1U98A 3E6AA 3ONDA 1RI4A 4EKDA 1AQLA 2ZYTX 1JDSA 2NLOA 1RWWA 2O7VA 1DAIA 2YWEA 4EH1A 3LF1A 1FF9A 4YHHB 1Q1AA 2GYWA 3Q41A 1IXKA 1N7GA 4FEEA 3V46A 3G5LA 3VR6D 1F1BA 2GCOB 5IU6A 1YQEA 2G1JA 2AQIA 4GOJA 2VYVD 2WIDA 2Y4NA 2CDBA 3ZLJA 2I87A 1S2DA 1WSDA 1MO3A 4YX9A 3U2QA 3KZKA 4G4SO 1UAYA 1NR1A 2QRMA 3MTJA 4C4SA 1WULS 5FOVA 2QRZA 1BOOA 3G2LA 3DFFA 4H6VA 1QIMA 3E5RA 1YRBA 3H8WA 2GMWA 5AJUA 1XVVA 2ABWA 2XDYA 1WW8A 4MRSA 4DWOA 2ATIA 1YACA 5KHOC 2BGMA 4QOFA 3VNUA 3RWOA 1X2EA 3BFJA 1RNLA 1HY3A 4EPXA 4YT4A 4RVUA 2N3ZA 3RYIA 2XGSA 4GSYA 4YJGA 4BAUA 3M6AA 2BBWA 2GCIA 1EB8A 2V7XA 3SI7A 5JXWA 1R5OA 4AX4A 2JLZA 3D3JA 3KR2A 2QUIA 2ANBA 1HWYA 1R9GA 4MLZA 3LYUA 3QXCA 4ZI5A 4KYTA 1NR5A 4QQNA 2NU8B 2PUCA 2HTEA 4RZQA 5B2FA 4XE5A 1V5IA 2BP7B 4DUYB 4ZRMA 1PDOA 1E3WA 5FJIA 1A2BA 4FYJA 2YX1A 3VZPA 2XB4A 1MVLA 2WYIA 3TOSA 3TPZA 1WG8A 1KFEB 1H42A 2WRZA 5T6BA 8ATCA 3WNBA 4URFA 3U1TA 2MDTA 3A1UA 3BHNA 3TLZA 1HBJA 1T0PA 1J1ZA 5C51B 1Y6ZA 1OHHA 3L7KA 3NOOA 4C6SA 3ZQKA 2DTEA 3QXXA 1CX9B 1RI2A 1SIOA 1HLDA 3FNHA 4MS1A 1RXYA 4WK6A 2CZCA 2CNOA 2VG8A 2FFHA 1L1QA 1Z0AA 3WLRA 1EXVA 1J0EA 4ZA2A 2OM2A 1D2HA 1CDOA 2G80A 1W5SA 2GS9A 3L8ZA 4JEHA 4U39A 3SVTA 1GTRA 4IV8A 1WNTA 3O7MA 4RMIA 1SXJD 1CIPA 5KDLA 5CIYA 1ISSA 3N2GB 3EVDA 3KC2A 4EY8A 3C4VA 1YVDA 4J0KA 4IEIA 3BREA 4RL4A 5D5PA 3LYHA 3HDJA 3QFFA 4X6UA 5AJWA 4B3RB 5ITWA 1JKJB 2VF2A 3DXFA 4DV3B 2JARA 4PR0A 1IB0A 4EB3A 3L49A 2DE0X 3PK0A 2XPCA 5KTKA 1E3DA 4EIWA 1NG9A 4OQFA 4UASA 4X1KA 5DB4A 1OV6A 1ITZA 1X9GA 2CY0A 2NWQA 4DLBA 5L8VA 2HWXA 3NFYA 4PANA 1OHHD 5LN1A 2BF7A 1DZIA 1LWNA 3D6MA 3P19A 3K32A 5K0GA 4F3TA 3IMEA 1HYEA 1OX4A 3ZWPA 4EHDA 2IDMA 4HADA 3NORA 4U5QA 3ZCTA 5E4FA 1T2NA 3WL7A 1EWYA 3D5EA 3EBOA 4YUVA 3ZHQA 4AJPA 3H1BA 5JJIA 4XWGA 4R54A 3CKKA 3DBRA 6REQB 3MCZA 1AU9A 2HJWA 1FBTA 2RIPA 2ZYRA 4F72A 2RE8A 4PR3A 1ZESA 3JQBA 1FMTA 4KE8A 1IY9A 3BRCA 4DR6B 2QAGA 5LP6A 3OP1A 5MGBA 3ANTA 5MN4A 2Q3EA 2UVPA 4O4IB 4NF2A 3JRNA 4R3UC 4LF9B 3HM2A 2G36A 2EQ5A 2V6FA 3N07A 2JBAA 1AA6A 4TT8A 1QGDA 3PFFA 3TTUA 4R98A 1I6KA 1ESNA 1ILEA 3SVLA 3TQOA 2VHTA 1K89A 2AI2A 1KMCA 2J6HA 4BV3A 3BXZA 4ZCSA 5FV4A 1IOWA 1W5TA 4K87A 5H82A 2JLUA 2GO7A 1LSJA 2Y93A 4FMCB 4EI8A 5IC4A 2Q5FA 1E6CA 3EMBA 4XD7A 3E1GA 1WPQA 3OZVA 1FZTA 1U1FA 1NV8A 4DQKA 3AUTA 2VHWA 2AZ4A 1U9IA 5CUQA 3AHEA 2K2WA 3QMVA 1JQAA 2DF8A 3MJDA 1ZOOA 1QFMA 3HXOA 2H57A 2RHTA 3LQ2A 2DETA 5DHQA 4JS0A 4PRKA 4HO1X 3SZUA 1K86A 4JL8A 2FP4A 2XD9A 1SHJA 1U7PA 4CIDA 1Z25A 3FYUA 4EHKA 2CGEA 1H9CA 2DFTA 2CXHA 4UD6A 3DFKA 5JLJA 2EX4A 2H9AA 2V45A 3TKAA 4A0HA 5KOHA 1BH2A 3KYCA 2H1OA 5CPFA 3UY4A 3GLHE 4PG8A 1MVNA 1TMYA 3PXCX 1KE1A 4BJ6A 1GVHA 1TZBA 2PANA 1G8PA 4ZZ3A 5A4MS 5IM4A 1KZ4A 1N9ZA 2J08A 1RI3A 3ETEA 3ETDA 3ETHA 1VHWA 3LA6A 4GBMA 3K2BA 5B3JC 4JD5A 3MELA 3CUSA 4XI9A 3PEWA 3HKEA 5WRFA 3UCEA 5JJBA 5AVZA 1XU9A 4DA8A 1F8GA 3I53A 2OBFA 2FPWA 2V5VA 1IG3A 4YQZA 1QP7A 1XMJA 1UKVY 3OA2A 5KWEA 3A3YA 5LA6B 3W2FA 4QNRA 4AP6A 3GLHB 4EATA 2GNOA 3O91A 4PYOA 3ONFA 2Q46A 4COKA 4PQEA 1GGVA 1KGSA 3CB4A 4UHBA 1WS6A 1T8WA 1JGTA 2QPTA 1A5TA 1PR4A 3EXEA 3G9XA 4KZKA 3AJAA 2FG7C 1HDIA 4YMWA 3ORYA 3TBKA 2EZTA 3KQQA 4H7EA 2WNSA 1IOZA 1PW7A 1Z5VA 2WKSA 2C2OA 2XW6A 4XYGA 4DCUA 4NR0A 1EA5A 1XWIA 1LC3A 5K7SA 3EF1A 4N40A 3GLIE 2BHTA 4EG7A 3E3LA 1JR3A 2PKQO 2Y9MB 2P9EA 2VAVA 4TYNA 1S1CA 2VA9A 5JNSA 1RWBA 2F1HA 4ER3A 2CBGA 4Q9KA 2WYVA 3FNBA 1REQB 2V7VA 4UEQA 4PYIA 1ZH8A 2YFYA 1FXWA 1DIRA 3KKKA 4YJ3B 3SKXA 4IIJB 5DHFA 4RTSA 3LO5A 5KTSA 2OCAA 3GLIB 2P3OA 4QELA 3Q10A 2OGSA 4KN9S 5J2UF 1GXSA 3H9UA 1ZI9A 4GUDA 4UDOA 5C0OE 3IAUA 5J4LA 2C1EA 1QV9A 1V1JA 3GFFA 3L5OA 3RU7A 4DRYA 3O95A 4EBFA 1GQSA 3FOCA 4EOGA 4WY2A 2Y2UA 5LR6A 2RH8A 2I65A 3EGWA 4ZODA 2CZQA 2ZB8A 2DR2A 1I3OA 4FFSA 3LVQE 4HNSA 5ALIA 3G5MA 1DQZA 2QIOA 4QQ8A 2IYNA 1XCGB 1LPAB 2HWWA 2BMWA 2VQ3A 1KDPA 2VRCA 2W8BA 3L7LA 4FC6A 4Y2GA 4JI1B 4DRXA 3NEPX 2Q9BA 4L28A 4JVLA 4GI7A 4F3YA 4JVOA 5GPBA 2LR0A 4M1QA 5EPOA 1NVTA 1KC3A 1I1OA 4HZIA 4F5YA 1L5OA 3C3XA 4Z9XA 2YHUA 1VE5A 1DO2A 4BP3A 2GPTA 1PT5A 1VE7A 4WGGA 4UPDA 3LP8A 1M66A 1VBKA 1UK8A 1YULA 1QYIA 2C4NA 2PKCA 4ZU3A 3ZDEA 2NIPA 1KDTA 1QWOA 1UIMA 3KXDA 4PZPA 2RHWA 1G2QA 4Y6LA 4EKIA 1C7IA 1H1LA 3NQ41 4BNZA 3MNFA 2WD7A 3UH1A 3WY9A 4RTNA 3IXQA 4L4YA 5GM2A 2YWDA 5LQSA 3AB7A 5BQ5A 5HF9A 3N28A 1HK7A 1U3FA 4A0RA 4DLVA 2VRCD 4JA2A 5KYVA 5GV8A 4DADA 2GEDA 1K9VF 5BP7A 3RR2A 3EOAI 3KTOA 4DQ0A 5JJLA 2G5TA 2PRYA 1YFZA 2P11A 2QV7A 3I9NA 1KFCB 3NXSA 3AXSA 3OIDA 3QE2A 3KJIA 4GOOD 2RIRA 4DCMA 3INYA 3SYLA 4QM6A 5DNUA 4I50B 1AURA 4BC0A 1YUNA 5H7XA 4HUQB 3UHFA 3GROA 1YR7A 2OGZA 3ZDAA 1A5AB 1PR0A 2X5NA 4CMJA 5HDQA 4EVSA 2ZJZA 1DP4A 4XJTA 3SC2A 2HR1A 2OAP1 3DM5A 4EHAA 1Q3KA 5A7HA 2GBGA 4PCLA 1NAIA 4BWYA 2H0AA 2P65A 1P0CA 2JIZA 1XN1A 3L05A 4FZJA 3CUTA 4N6GA 2DXIA 4I55F 4PRLA 2Q28A 4Q7EA 1E4OA 2YXPX 1JHYA 2JFNA 1YDWA 2YZMA 1OXXK 4EGCB 1ZHHA 1T15A 5IZCC 1FYFA 2VKTA 5EJ6A 3PENA 2AE1A 2JHAA 3PQFA 3T0FA 5M34A 3I3SR 2R6DA 4W1RA 3ZDXB 3A3NA 4XGNA 2GA9A 1E8NA 4OXRA 2NX2A 1EP2B 221PA 4DARA 3TWOA 4E6PA 1IWBB 3D2AA 4BVKA 2R8RA 1T2UA 4RJKA 2RGGA 2XODA 2IW1A 4NS1A 4XTRA 1XL1A 4LY9A 3PE3A 3RV4A 3V8QA 4UFPA 1YOVA 1SCIA 4MI3A 2HPVA 3WHKA 4E21A 4JXXA 3G2OA 1BWPA 5B58C 3QU7A 1SQGA 3JWIA 5DHTA 1B3RA 1NM5A 1CUHA 5IN5A 2KPOA 2ZDHA 3E5MA 3OETA 4FFWA 3CUKA 1NQVA 4L9AA 5EP1A 4BNDA 1C7ZA 3AVTA 3SKYA 4ZT3A 3K8ZA 3EC2A 4KC0A 1RAFA 1TOAA 1GTL1 3IGFA 3TDMA 2H5JA 1SNYA 5E1DA 2ILVA 1XFDA 1N4AA 4G1MB 1Z5GA 1EXNA 1O0BA 2P6OA 1I4TD 5L4SA 4II2A 3KUKA 1Z6XA 2OB1A 2R4QA 3WE7A 1Z12A 1UM8A 2O5RA 1XRSB 4JR2A 2EKQA 4MS4A 1XMQB 1C9JA 5CM8B 4M9QA 2GR9A 5CNKA 2D1QA 1TE2A 5TX7A 2R8YA 3F5FA 3AZPA 1ZD1A 4P08A 2D2VA 3E22B 4WESA 5DHSA 2FZCA 5K3BA 3OQIB 2IDZA 4EJ6A 3KB2A 1CJBA 1XMSA 2IHUA 2PDAA 2E4YA 2P8JA 3ZYZA 1WMBA 2NOAA 4E2FA 2OFWA 4TZTA 3N58A 3V8MA 2JLSA 4X8MA 5CD1A 1QH0A 3KJFA 2V9CA 1ISJA 4MINA 4TYPA 5ALYA 2XJ4A 1KPIA 3K5PA 3RRNA 3IOBA 1XRPA 1YR8A 3SX0A 2B7LA 2ZAIA 4BATA 3OMXA 1ABFA 4LXYA 2ZSKA 1R8JA 1J8DA 5FOUA 2XCUA 3AF4A 4X00A 4KAAA 4ZYYA 4UTOA 3BDVA 2O8FB 4OSPA 1T1IA 2V0NA 3JU3A 1NG1A 4ITRC 3V1UA 3T1HB 1YDGA 1YDFA 4F8YA 4W7HA 2WKQA 3A6HA 3L8DA 3RQIA 5JEEA 2PXXA 3E3AA 3M4NA 1GOTA 1YKSA 3OO1A 4KQJA 2YZKA 3MUOA 1SXIA 4MB6A 1BO6A 2X0FA 4KFSA 4YI5A 2WILA 1SG0A 4ITVA 1OXUA 1Z37A 2QF7A 3KUCA 1QHXA 4AZ0B 4KXWA 2DQ4A 4J9UE 5HX7A 2IDJA 3PXDA 2CYAA 1PR9A 5ALLA 3FNRA 5ALHA 4YRZA 5FXMA 2X40A 1QX3A 1EQ2A 3AL0C 3E15A 2ZRQA 4D57A 1RHKA 3DD1A 4H3SA 6PFKA 2PM8A 2O6HA 1I13A 4C4YA 1KVSA 4PWYA 4L3VA 1ACMA 1XTJA 4D9JA 3ZZTA 1JSXA 3NIDB 1TPYA 4QUGA 3I92A 1WOMA 2FN4A 5KVAA 5ADWA 2OOSA 3WL6A 3G0OA 3CZPA 1QZ3A 1JQDA 1CQWA 1IZ9A 4QYTA 4F3CA 5I7WA 1J2UA 3U4DA 1EQAA 2CHFA 1BZYA 3L01A 5ITVA 1UK9A 3IP3A 1PO7A 1U1IA 3BL5A 1K75A 2UZ1B 1ZC3A 4D56A 1KFJB 2GZAA 1P3DA 5CITA 5I4KA 5JBIA 3H99A 5HZKA 2C88A 1W4RA 4HDKA 2PE5A 2C7BA 4RK6A 2GPNA 3ZIAD 2ZRCA 1NASA 1EWRA 5A04A 3BJZA 2HRRA 3IIEA 2RHRA 2JCYA 2FEMA 3H9QA 2C04A 1T0HB 1E98A 2A9PA 3HDTA 3Q7PA 5DM1A 3S2SA 2XB6A 4CR7A 3VHRA 4DLRA 1AGXA 4IFBA 4LYGA 3C7CB 1KZ6A 2Q3DA 3CX7A 3ENQA 4KMMA 4ZOCA 1T5BA 1FRZA 2D1FA 3L40A 5J1SB 1AZTA 1XDWA 2I67A 2V65A 4B44A 6GPBA 2H4HA 2PX3A 4O2BB 1GLVA 4CG3A 4OHVA 4RY0A 3ESRA 5CCDA 2Z6AA 2C4HA 5HKAA 3KXKA 2YWHA 3UO8B 3ZW9A 6NULA 5KNBH 1EWKA 5DWQA 4RWEA 1TJ5A 2Q1WA 3AHJA 4GBJA 4JU9A 1NUSA 1D03A 1RQGA 1QNFA 1P1FA 4A7PA 4KV7A 4ZYWA 2AYZA 4RIIA 4MVYA 3KOZA 3L46A 1YZQA 3REGA 2RK4A 4D82A 4DS3A 3N0VA 2GPBA 2OGTA 2DFNA 3H2ZA 3PR2B 2J9YB 3G0GA 5TEWA 1IBRA 1NDHA 1OWNA 2B61A 5IARA 1IIBA 1MF7A 1V2HE 2O3TA 4JR0A 1QHSA 4ETNA 3ZDBA 1T5DX 3IUJA 4LYYA 5A3VA 3W9UA 4DRZA 3O8QA 3RC3A 4XZ3A 4QO8A 3N8DA 2AXNA 1EQUA 1O5OA 1Q2UA 2FQ1A 3NDJA 3UWOA 3W9YA 1BD4A 1BKYA 5ALEA 2IU4A 2O1XA 2WJZB 1P60A 2QM8A 5FUVA 3SF8A 5HVNA 3NB0A 3PNVA 1GZ3A 3QYAA 1FSFA 2QTVB 4NWIA 4RH1A 1NONA 1QH8A 2AEEA 4Z1OA 4MQ4A 2RHHA 3BJRA 5BSRA 3SVZA 3HA7A 4HS4A 5KDDA 3H0CA 3OM9A 1W4AA 3UW3A 1ZC4A 2VK4A 2XKBA 3EH1A 3TOVA 1E4YA 1L7RA 3IDAA 4DXHA 3O4IA 2FI1A 2JH9A 5DV9A 4W5OA 4BLSA 1UMDA 1ECFA 1FQWA 3NW9A 4IJUA 1Q7CA 1H65A 4U2BA 4K5QA 1DKOA 3LA8A 4WBXC 3QWBA 3D4LA 3QLVA 3HK2A 3TTWA 3WLJA 4R31A 1E18A 2PZGA 5LZ7A 4IL5A 3B3GA 1H6CA 3DHYA 2JGKA 2XVXA 3O9VA 521PA 3BRWD 2C03A 5EKUA 4M0EA 2HJSA 3OCZA 4A4DA 3FLMA 1MHTA 3AEKB 4FN5A 3FTFA 1OLOA 3L1VA 3ADCA 3DNFA 1TA0A 5SY4A 2WJVA 3CG0A 4A8JC 4DV6B 4F3KA 3DMNA 4TXMA 3ZLUA 4Q24A 2UYHA 1UAGA 1B23P 2Z2ZA 4KN5A 5E1BA 4ZYLA 1J90A 4EI7A 1RLJA 4KVZA 3ABSB 5B2ZA 4LX0A 5JZ9A 4JI2B 3EYAA 1LTKA 2QOEA 4GG1A 1GPLA 4LOHA 2ET6A 4FGSA 3SHWA 3EIWA 3WRXA 3K53A 2C97A 3K4HA 1JRLA 5IHXA 4Q3BA 3V4OA 4UE6A 5ESWA 5C53B 5JALA 3BXHA 4HAZA 2HLHA 4ED9A 2QQGA 1NVVR 2XI4A 3JQ8B 3KUDA 2ZSHA 2EJWA 1EFHA 3AF1A 5ER9A 3OKPA 4LHEA 1MXFA 5G4LA 3QIVA 3T5TA 3ANXA 4FB5A 1VM6A 4TX1A 2NPIA 3GX1A 1C1DA 3WQSB 1RABA 4ZMRA 1P44A 2NO9A 2BGWA 1NYLA 3A9VA 3FSJX 3UV6A 5CEJA 3GV0A 2BGRA 4Q9IA 5BR7A 4NBWA 1MAVA 3FMGA 4TWZA 4MGEA 2WJWA 1VHJA 1XQXA 2X77A 4D4GA 3AHHA 2W0SA 3JTMA 3WK5A 2QL6A 1JQKA 5JHHB 3OY2A 2EWVA 2WWWA 2ZCUA 3FPGA 3KTFA 3UT0A 1XTBA 1FJ2A 1WSBA 2GVDC 4V2UA 5CMLA 5HOQA 1B0PA 2JI7A 4HAUA 4IHKA 4PZYA 5LDHA 1NNUA 3WA7A 4DSNA 2J30A 4RJIA 5AK4A 5FKJA 1ZK0A 2JJQA 1UFVA 1QQ7A 1V37A 5KTRA 1JNYA 3HVKA 3G9ZA 2IEDA 1WXQA 3CE9A 1CDDA 2L0XA 2W6IA 2YBEA 3M49A 3U9TA 1QDLB 4YN3A 1SIUA 4BFYA 2HF8A 5CEFA 4RF4A 3T3MB 2ECPA 5HIJA 1JZSA 2QI9C 3LI2A 3UJ3X 2R6AA 4ZT4A 1ZQ9A 4BMVA 1D4OA 1I7DA 3EJ6A 3G82C 1CQIB 5FTLA 1EFPB 3ZHBA 2BJHA 1QS0B 2PRKA 4RA9A 1D6SA 1TJPB 4YNBA 3R20A 2Y1DA 1XB2A 4PW0A 4C7KA 1UL1X 1MQ9A 2ZDQA 4A0QA 2O8DA 2O3UA 2R25B 4X97A 1U1DA 2PH1A 1BS9A 6LDHA 3PX2A 1U65A 4MIEA 2REOA 1L3BA 3GBVA 1QGED 4ILEA 2PQ2A 4H35A 1P4GA 1SXGA 1U3WA 4HX2A 4J1QA 2P78A 2QRLA 3OTQA 4G9BA 4GHWA 4QDTA 5FADA 4E11A 2W6ID 3SHQA 5AVSA 4RYDA 2C0PA 2QVCA 2V1UA 4Y2RA 2Q3LA 4W5RA 4I46A 1HE1C 2AOUA 2AWOA 1GKUB 2JIOA 2PD3A 3EGCA 3MOGA 4R40A 3S4YA 1F12A 3LXUX 3MJRA 1KO4A 3FDIA 2CMDA 2WHPA 2C8KA 1CVLA 4ARAA 3HUEA 4EJSB 4BC1A 1R0BA 2O8BB 5IAOA 1FZQA 1U2GC 4JWTA 4MHSA 2NTNA 1MFZA 5FL3A 5D84A 5HK8A 3T7KA 2P0YA 5TPZA 2O2GA 3PC8A 1N8TA 3JVEA 5C1BA 4UPEA 3QVKA 4Q3NA 1Z2AA 3MUNA 1AKRA 3ADOA 3H5AA 9LDBA 5JAMA 2AK2A 2HIHA 4CI9A 1D2GA 3AJEA 2EXXA 4HCJA 5EHXA 4KDEA 2CBZA 1I4WA 2AKAB 2VHCA 2XADA 3KEQA 4OI4A 4DLWA 5CXXA 1DAOA 3TQQA 3PDJA 4ZVTA 1ZI8A 3SX2A 3TRHA 2GCEA 3DGFC 5JQGB 3BSFA 4YROA 4UFNA 1EUYA 2BMAA 1FX1A 2OYSA 3KIPA 1RBQA 1W6RA 1SBYA 4NLLA 5L7TA 4FKZA 3QXJA 3AF0A 3K35A 3KHKA 1TEXA 3FSEA 2NXNA 3ENNA 4JLWA 2IWHA 4X9XA 1JIXA 5ICCA 3TGWA 2WTAA 3A3KA 3GRYA 3K9WA 4PC3A 5E1MA 3W2HA 3J80A 2BFBA 3ECAA 2PRSA 3GPDG 3P0IA 2AFRA 4IG4A 1IHOA 3VO9A 4B83A 2VTEA 1V5GA 3FMIA 3QWFA 4IJKA 2X0RA 2XF8A 4XCVA 1N2SA 3HCWA 4QXQA 2PUFA 3NT4A 3ED5A 3ZI4A 1MKYA 2J4DA 3QHAA 3ZWCA 1YAHA 1NNLA 3M89A 4P7FA 2NU6A 3H2KA 5EUBA 1IXSB 1FDTA 2CJPA 2HHAA 2FH5B 2WB4A 1TM3E 4G86A 2JJYA 2IYPA 3IAM6 4DDKA 1OMOA 4GQAA 3GMDA 1E0SA 2FDRA 3FVWA 4G0WA 1BN7A 3LKBA 3QKSA 4QVIA 2WHRA 1IC6A 1XZNA 4AO8A 1QVZA 4I1IA 4ER7A 1QGUB 3NKFA 3R3HA 1XPUA 1ZZGA 4P92A 1UKBA 5C8YA 4DIKA 1RI5A 1Z38A 4GLJA 2Y2VA 4D80A 3TD2A 1KO1A 4IH1A 4CI0B 4ON9A 4Q47A 1NUUA 4FZ3A 3LOPA 1VMKA 3ROPA 3MEQA 1M5TA 3HJCA 3U81A 3JVDA 1XROA 1HL7A 2VSNA 3PC7A 2YWRA 1QQAA 1I5EA 4DBLE 4MVJA 3M9LA 1POWA 4R8SA 3TRJA 2ZQZA 3UWPA 4OMFG 2LDXA 5AJZA 2O8VA 3KKMA 4NRDA 4CFYA 1D0SA 4H7FA 4H1WA 3MWDA 1S4QA 2EYQA 3EB9A 4NCAA 1I2AA 1Y5LA 1N34B 2DPYA 4IMJB 4O0MA 3C8ZA 1VCNA 1CXZA 3RABA 2H2DA 4J4HA 2R97A 3EXHB 3U4MA 3EQ2A 1PNTA 4L6IA 2UUAB 1R6UA 1YQTA 1N4DA 2GCGA 2VQ6A 3SQMA 2QP4A 4UE2A 5L3SB 3OIYA 2YOHA 4LXXA 1P1JA 4DJFC 1YQGA 2R68A 4UDYX 4YP0A 3TEFA 3TIIA 2ZTSA 3M1LA 3ICQB 1G4AE 3IEVA 1ODKA 2XIJA 4JELA 1J9ZA 2UUPA 2CHQA 4DWWA 1O3YA 4MVJD 3P7MA 2OSBA 2FW6A 4CLRB 1PD1A 3GJ7A 4DE5A 4UVIA 1Q1BA 2QMZA 2WLSA 5CB4F 4C06A 4UM8B 1TYBE 4NNPA 1PN3A 4WLUA 2G5GX 4Z49A 5JZBA 4LJKA 1L6IA 1UMKA 4F3NA 4D4KA 1L8XA 2ATEA 2QZZA 4Y2YA 3TAXA 4M6WA 1L5FA 4ZVLA 4XGQA 1FDRA 1VE6A 3S81A 1EG2A 1QBKC 4PAGA 2ZUCA 2YJZA 2WZCA 3ZZMA 2ETXA 1HMPA 1XZLA 3MLBA 2PT7A 4RETA 3DEIA 3VR5A 5CB6A 3DKIA 3MTQA 4XIJA 2X76A 1A7KA 1PR6A 2YW2A 4NOMA 3CKMA 1RRGA 2C99A 1R12A 4C88A 4N7RA 1CFJA 3JALA 3U40A 3CH7A 1CNEA 2ST1A 4HX5A 1AUQA 3H8SA 4E5SA 2OR3A 5BYBA 2QVZX 4KOAA 2WA1A 4B87A 1YTUA 3DZJA 2Q2NA 5BWBA 5L3QA 4NEHB 2HBZA 1JHRA 2PBFA 3LUJA 5KJ1A 2BN4A 3WRYC 1M2FA 5FLXA 2WUDA 4LVCA 1BSVA 1LRJA 1NBWB 4GPBA 4I5DA 4CMGA 1BAPA 3D8TA 1MJHA 3FFTA 1NN3A 5EE9A 1JXOA 2NTVA 1J2YA 1T4CB 2AR0A 3IQFA 2BR5A 5IDQA 2DUMA 2P41A 5E4JA 2LCQA 1V6AA 1XA0A 4LK3A 4X64B 3D3KA 3L0PA 3LRPA 3SHTA 3MOSA 2QW0X 3PUHA 4FJ2A 3Q9LA 1Q6ZA 4EQZA 3F5QA 3NHRA 1D1PA 4DSAA 5BVGA 4TLEA 1CY8A 2E0IA 2Z9DA 1XVTA 3PP8A 4HLDA 3AV3A 4JBXA 5DP2A 3W6ZA 2VWPA 1KY4A 1ZMOA 4EY5A 2ODAA 3H7IA 3HA2A 4MKIA 2KLBA 4TT3D 3KETA 4UU0A 3M6FA 2FETA 1XYYA 1ZDMA 2HDWA 1WPXA 4ZYXA 2ON6A 2C9BA 2XCRB 2BTOA 1DBSA 3OOHA 5KQPA 1YFLA 4PAQA 2X2PA 3CRRA 2WF6A 4ZCQA 3HHEA 2DH5A 4A9AA 3ER9A 1LDGA 3P5BA 1MTOA 2RH9B 1W8IA 3K5WA 3LT0A 3QA3E 1OX5A 4KV9A 1SELA 3TH5A 5C7IO 5B6IA 1I4DD 4ZTBA 3HACA 5CA0A 4ZEXA 1HFEL 2ECQA 1OU0A 2NN3C 2NVOA 3AEXA 3S1AA 3W1EA 5ITSA 4PF1A 5KQLA 1DWUA 1LU9A 1WXFA 3FOFC 5EZ6B 4UATA 3B7PA 2VUSA 2CXPA 1R8QA 1DIGA 3LY7A 3WOHA 2ODEA 4HRAA 2GH1A 1KH2A 2C5GA 3EMVA 3F67A 4ND5A 5FNVA 3ZWXA 2HFKA 1QP8A 4WZBE 2OD9A 1IBMB 5IKOA 3DMHA 3H6HA 4UREA 1LPBB 4C6HA 3NIGB 1OFTA 3IXLA 2W2LD 3R3ZA 4M37A 3SZ3A 4Q93A 4C7BA 1FYVA 1GGJA 2H9IA 3ELBA 1BW9B 2VOEA 5TF0A 2LW7A 2WDZA 4FGZA 1MIOB 1UAAA 1THTA 5DLPA 3IR5A 5HCIA 1VG9B 1XG5A 4YAEA 1TD9A 4Y2UA 1Y3CE 1YVPA 3K9BA 4O02B 4WZBB 1YE3A 1RFLA 2PA3A 2W42A 4WSOA 3ZZ1A 2R2AA 2WKRA 3GD7A 4OP2A 1OIXA 2VPIA 3CTMA 3PVZA 4R2KA 3SNKA 6ABPA 4KQCA 2ORIA 1P2TA 2OBLA 2Z1NA 3MK31 1NAHA 2JFUA 1E1LA 3FNFA 1NULA 2R8OA 4E7PA 4EA7A 1TO1E 1N5MA 2HQBA 3E9YA 2CXSA 3PDIA 2WU0A 3CEJA 1M34E 2GUWA 3EX7C 3KQLA 2VQDA 1QLHA 3RM3A 4DQDA 1ZGHA 2FN3A 1O6ZA 2EVWX 5K4HA 1QVWA 2GN2A 3A2LA 4UXHA 4WHMA 3TL3A 1PWYE 4RPIA 1SKBA 5HS6A 3JQGA 3F6CA 3KSRA 4D9HA 5BRJA 5CP8A 3V7NA 1OLSB 3R2JA 3G5TA 3HY3A 1EE2A 4QVGA 4MWCA 1GKLA 5EIOA 3HUFA 2M2IA 5JZVA 4I4TB 4PG5A 3VYUB 2IVZA 1MC5A 1OGIA 3IUSA 1RHUA 1M34B 1PUJA 4DKXA 4IIEA 1CR6A 4ZT5A 4CQMA 5IT4A 3HY6A 1QYRA 3AMVA 1NXVA 1QFXA 2QJRA 2J9FA 3DBHA 4TLDA 4EITA 2ZIVB 3LY9A 2BTEA 1FP4B 2V5UA 3N7UA 5BXYA 3VDQA 1Z56C 4WZAA 2IIBA 2J45A 4HXGA 1YB2A 3G2JA 2P40A 3RSHA 2DHQA 4ENUA 3C3CA 5LWHA 2P6PA 2R1ZA 5E8RA 3IURA 4L78A 2GESA 1KYIA 2F3QA 3O3NB 3R7SA 2YVLA 2XMPA 1MU0A 5CLHA 3VH2A 3V4FA 3LY8A 3T5BA 4KZPA 5A2GA 3NTOA 3R75A 4C5AA 3S40A 4M0FA 5J2TB 1KF0A 4IOJA 2G1PA 4MV0A 3FWHA 1Y7TA 4B3DA 4CQLA 4F4DA 1NNI1 3EYWA 4TTIA 1KPGA 2NTJA 4TV9F 2JGDA 2QORA 3V8NA 2NVBA 1Q0ZA 3CGGA 3SG0A 5DOZA 4ZVPA 1C2YA 2IZ7A 3ASUA 3GCWA 4CKXA 4EY3A 3G2NA 4KACA 3AQIA 3T06B 4YAGA 5CCBA 3X1DA 1T2EA 2P9CA 3N8KA 3MBIA 2XNSA 2YWJA 4MQUA 2G08A 3SXUB 3ITKA 2VDNB 2VAMA 2FX5A 4PBRA 4TWIA 2G1KA 5ICSA 4BFLA 2G4LA 3D02A 3Q1KA 4H15A 2OO7A 1V6CA 2IOFK 4DG5A 4N8EA 1P77A 1YO6A 3W3AA 5IF3A 2HMWA 4FGWA 1AB5A 1J33A 5FIUA 2OQVA 3ZKWB 5IHPA 3P26A 2OCBA 4II7A 3FBWA 3GFTA 1W76A 1DUVG 3NT5A 3EC7A 3LX6A 4PZUA 3VAYA 4Z7OB 4ALNA 4OI0A 4F60A 3S29A 5ED4A 2EP7A 1AHHA 4EABA 4F5DA 5ICFA 4RIFA 3DCYA 1AV6A 3S5UA 2PUHA 3AQ4A 1MVOA 3HMKA 1B8OA 2ZB2A 3C97A 5KAMA 4MLCA 5C5CA 4OU5A 3MILA 3U7IA 4B17A 1GJRA 2HBYA 1SUAA 1N9GA 3TUJC 3JWPA 5D3KA 3K2EA 4XPZA 1R27A 4PSAA 1S3GA 2RGWA 3T1VA 3WZ2A 3PUZA 1RWMA 3MWKA 2XA2A 3PDUA 5IJXA 3U3MA 3PT5A 4RY2A 5T4EA 3UW1A 4WD3A 1KYVA 2O7NA 3KEOA 3RBAA 3TVYA 4QTXA 4CIYA 3ER6A 4XARA 2NQTA 3PNSA 1SCNE 1O6CA 3KVRA 4FOOA 3WAKA 4K46A 3ZX5A 2J0SA 2ZSEA 4E30A 2WJAA 3RVMA 2H92A 3DFUA 3SSAA 2IY7A 1ZSYA 1F5SA 1R18A 1LS1A 1L7EA 4URHA 3FWYA 4X71A 4JSTA 1C1XA 2IYWA 3N6RA 4KO3S 3H1FA 2F1OA 4DA9A 1RHMA 1M1YA 2QIPA 2VPXA 3I2GA 1E9VA 4NMHA 5JD5A 1Z0SA 5E8JA 2CXTA 1F0KA 1U1CA 2G3YA 4KRFA 3WP0A 3EIHA 3QMPA 3W9SA 2QU8A 3BD8A 3OM0A 3T4XA 4P83A 4DPLA 3OCYA 4AJ1A 3HN6A 1DEKA 3HU5A 4A8HA 4PCUA 2RGRA 4G26A 3O31A 4ODIA 1Z17A 2NU7A 2PUBA 2ZJFA 2HK8A 4BVJA 4C3ZA 4DM3A 2VP9A 5FBLB 2HGSA 2IPXA 1WCXA 3X1KA 3BXXA 2E6UX 1AH2A 3SNHA 2K4MA 1FDSA 1EGMB 1KOFA 1H2WA 1SVIA 2C59A 4TVOA 4C7MA 3O1LA 1VIVA 4KPGA 3NM6B 3B89A 3F6BX 4XDZA 2GZRA 3DONA 3MD9A 3TSAA 2B2XA 5C5DA 2JLVA 2CC2A 5LNK6 4NYJR 5FQOA 4CVNA 1CS4C 3ZUGA 3FMOB 5E9WA 4J2TA 1UF9A 2HCJB 3KWMA 2A2ZA 1XZDA 1AF4A 1GPMA 4Y2QA 1PUXA 4G37A 4YAFA 3Q2KA 2XNHA 4HDRB 4OY3A 2X7JA 3C3AA 5A7FA 5BSFA 2A0XA 1HKHA 1MG5A 4JLOA 4Y1GA 4YK7A 1XPOA 4J07A 3HXPA 3W5DA 3DF9A 5J47A 3FZYA 3QF7A 3I1IA 3DZHA 1KVTA 4OMUA 4WVLA 5LD2C 3LH5A 3BE6A 4PXAA 4UEOA 3E84A 1CRZA 3P0RA 4JDUA 3A31A 3OI7A 1KSGA 4DUGA 2C57A 2C92A 3DOJA 1IH8A 1EGAA 2NZVG 1KY3A 1RXUA 4Z99A 3U9SA 1IEVA 1JI3A 4MMXB 3RTEA 3U7RA 4CCYB 2QVLA 4PNEA 2CFCA 3PEVA 4Z4GA 1C3JA 2LE0A 1U2SA 4ID9A 1R4MB 4CJXA 2H29A 3VJLA 2K2QB 2XVAA 5LJIA 3B1ZA 3BWBA 1RCUA 4ENVA 5M04A 1OA1A 1NVEA 3IQWA 4P5PA 1EE1A 2X9VA 3JAKB 4J75A 4C6TB 1JA1A 3CXUA 3A7EA 4CN8A 4CR6A 3I30X 1LDNA 4WT7A 3TMKA 1ODFA 3QVMA 1ZNYA 3RTAA 5B7QA 2FSSA 1E0KA 3QEBZ 4R4JA 3A3OA 1USKA 5CDYA 1NP7A 1DQNA 1RKVA 2P90A 2ZAOA 1PV1A 1SCKA 1UC9A 1W0JA 2HQOA 3AP2A 3CBGA 3M4YA 3T9DA 4DMLA 5KYTA 5B1SA 4PICA 4DUGD 4GC5A 2B2CA 2WV7A 2FQWA 3PCXA 2FN9A 5IJWA 4AK9A 1JEEA 1OILA 3LUCA 5EIHA 4OQNA 1TZMA 5G53C 1GRNA 3FKSA 4A8PA 3KJXA 4L74A 3UUWA 5BNFA 4YECA 2ESRA 4O4HF 4DV7B 4OKSA 4PHGA 3OTHA 1IWPB 4UXIA 3PI7A 2NO0A 3RS0A 1B16A 1W85A 1KO7A 4J03A 5CHYA 3WV5A 3VKVA 4W8GA 1R0LA 1JKMA 4OI2A 3MW8A 5HDBB 3M6MD 1ECCA 1KMNA 4OB8A 1PGOA 4N5HX 2UYYA 3E8XA 4YIKA 4QBFA 2J0EA 4C05A 2Z6VA 1VP9A 3BOSA 1RKBA 1W0JD 1TCVA 1QKKA 2VH5R 5F52A 3OX1A 2G88A 1DKQA 3RJMA 3VU9A 5EJIA 1NXSA 2RGNC 5A5DA 2RGUA 5G3ZA 3MWJA 4YRFA 2I7TA 121PA 1QC5A 2MIIA 2DH6A 5D1NA 1QF6A 4K6OA 1UFKA 4O3FA 2HMTA 4ZI7B 1WBBA 2X5KO 3CC8A 1D6NA 2CCJA 2GLXA 3FYCA 1JPJA 1KZ9A 2FZ4A 3PICA 4KUEA 4ZIRA 2A8YA 2V54A 3FOEC 2JIPA 1NLFA 4BUZA 3I2IA 1NI4B 2D0OB 5BRAA 2REQA 2EW1A 2BGLA 2LTAA 4YT2A 1XZJA 4PGAA 1TL7C 4TXHA 3UFXB 1NOKA 3HWSA 4NJEB 4DB4A 2OCLA 4YACA 4XM2A 1ZJWA 1N2GA 5I48A 4QQKA 4DBZA 1NUPA 1WNFA 3EXG1 3ORSA 4RTPA 1J8YF 3JZMA 4KGVA 1VTKA 1KY2A 4S1NA 1HT0A 5CTJA 4AKIA 2VPWA 2B4TO 2HUNA 4QRIA 1K5PA 1TVKA 5GADl 1WTCA 3DL4A 4FZRA 5E3JA 3G9QA 2C2YA 3D7MA 1O6FA 1I3LA 3VPSA 1UBLS 2VUTA 4IH4A 4BVLA 1KAMA 2ZS8A 4RPGA 4RELA 3RUCA 5A4JA 5IAAA 2W0MA 4IDCA 3RPEA 4B8ZA 3AERA 1CV2A 1TYEB 4PLHA 2LPMA 4HMQA 1EJBA 2AC4A 4MP6A 1JAYA 4QDZA 3ZG6A 1UJNA 4GI3A 1U0NA 4F4IA 2OD2A 4WASA 1UJMA 3A6FA 3PF9A 4ZVUA 2R85A 3SJCA 3V1NA 1TZ2A 1WQ1R 2V7TA 1QONA 1VBNA 3N8GA 1YXMA 3DHWC 1C30A 2AC7A 1MB2A 2JBWA 1NRWA 2HJGA 1J07A 2LVBA 1GZDA 2NQ2C 3C45A 4IS3A 4LWQA 4XA8A 3ZDRA 5M29A 1ZD9A 3BD9A 5TEVA 4IDHA 1XN4A 4BPRA 1A8SA 4ILKA 2EDAA 4QYIB 2RARA 3ESYA 4RHFA 4UU7A 1I30A 3NEJA 3IPCA 3FB1A 3GMTA 3AR7A 4EYOA 1KMQA 5HCUA 2JFOA 2BJWA 5LFAA 1X80A 4MRNA 2JVKA 4R1PA 2A5GA 1GZ7A 4IUDS 4YRJA 5EHZA 2O8CA 1E5VA 4KH0A 3EARA 2PQ6A 3USES 1L5VA 1XQ1A 1XV5A 2W2OA 1GUYA 1JI0A 1KQNA 4BCDA 3CNQS 3VU8A 3KKZA 3EZ6A 5G3YA 1OB2A 721PA 3KVYA 3GFPA 1EU1A 3NBAA 1P4HA 5K0BA 2HN9A 4WXMA 4R0MA 3PUJA 1G66A 4J7XA 1N2BA 1NXOA 4PHCA 4YT5A 1TJNA 4P35A 3Q3JB 3RAJA 4ABYA 4X65B 4QL3A 1VJ1A 4PNPA 5IMBA 4H1TA 3MPUA 3DOEA 3AESB 4R68A 2CHUA 3QLUC 5JH7A 2ZIAA 1JH8A 3T1TA 1ECJA 1D9ZA 1QMPA 2DX7A 3C4QA 3EE6A 3K09C 1RYBA 3K1AB 4LJ6A 4LPKA 5KYYA 1RHRA 2XF2A 5SY9A 3REOA 4O4IF 1FJHA 3NDRA 1YMQA 1NKTA 3EVFA 1ID1A 4UU1A 3ZGYA 1MOPA 5H4GA 2XR1A 3JQ6A 2QX7A 2ZYSA 3I05A 3WNVA 1JF8A 5EJEA 2R79A 1Q83A 5BV8A 2OHOA 3UMMA 4YH1A 1DC3A 4IICA 2IDKA 3V3TA 3UC5A 3ANLA 5I3CA 1L5QA 1NW3A 1GTVA 4UAGA 4Q3OA 3BRSA 1YKFA 2AQHA 3K05A 3ICOA 1OBVA 4FMCF 4FFBB 4LIPD 1J49A 4XGRA 2HSDA 3U80A 3I3OA 1BE0A 2C7RA 1WETA 3ODGA 3OUUA 3HYLA 1EB9A 3OZBA 2BONA 1ZA2A 2W2VA 2R6ZA 5I7VA 2F4VB 2H07A 2GBFA 1WVMA 3K8YA 3BMQB 3MD0A 2OXRA 3WISA 3W6NA 1A82A 3HG7A 1JSZA 4CCSA 3H9GA 1MJGM 2XDQA 2H2IA 1U02A 3N0TA 3VI3B 4B3BA 2NAPA 2VQEB 3FW1A 5DIFA 2NADA 2E4WA 2FCAA 3DDCA 2AB0A 4QU8A 1XQYA 4D8UA 3HDHA 2GN4A 1JHPA 2FY8A 1D2NA 5DNDA 3DVQX 3BTUA 1BWSA 1BE1A 2W9XA 1G5RA 1PQPA 3BQ9A 3I52A 3EWSA 1H2RS 2AR7A 1NE7A 4DFDA 3L6UA 4Z9FA 5IS2A 4G89A 4LVUA 2R1VB 5KYKA 4ZDKA 1Z3IX 3WLFA 5KTPA 4KE6A 5F2KA 2UU9B 4IM7A 1BHQ1 2ZVJA 2CB0A 4J4BA 3FNGA 3QELA 4O2AA 1QIJA 5LA6F 3UAGA 3TQFA 4Q6BA 2WMYA 3IKLA 3M6UA 3EPLA 4BX9A 2R4UA 1C7FA 1P5JA 1TU4A 2B1QA 2B2NA 5IXYA 3ER8A 2CNNA 2FRXA 2XT9A 1W36D 4MUKA 3F6RA 3IQEA 1M8FA 4N5IX 3JWGA 2EL9A 1RQ7A 4I2NA 3R7FA 4MQBA 1V16A 2XKKA 2JGLA 1UXJA 4DL9A 1Q16A 2A3RA 1H93A 2G09A 3L9WA 1OFVA 3Q9UA 4IMPA 4JJ6A 1AM4D 3T1QA 1ZCBA 4XYMA 1O87A 4YAJA 2EIHA 3TI9A 3NAMA 2HREA 4H17A 4K26A 1DG3A 4MVCA 2Y27A 2PO5A 1TW2A 2VEOA 4LE2A 1IQ0A 3H11B 4IIJF 4G23A 4YJ3F 1E8MA 2PAFA 5IDVA 1YZNA 1SO8A 1U3UA 5REQA 3LMKA 2AS0A 2QSUA 4A23A 1HORA 5JYEA 3TG8A 4FWTA 1D7AA 4M0CA 4B6SA 5HQ3A 5JCOA 2C98A 2XWBF 3T6KA 1Y8RA 3TB4A 1QRUA 2CLEB 3G2IA 3LPMA 3CY6A 4PGGA 5CJJA 3ZE6A 2ES4A 2JZOA 1A9ZA 2ORVA 4HRYA 3ICCA 1ULAA 3O7WA 5DBFA 4RIHA 3C3KA 4UMEA 2QYHA 3RNOA 1JFVA 1XDZA 3DLPX 3A4TA 2NW6A 5KNLA 4REQA 4HBGA 1XVIA 2VJLA 2WKPA 2Y0EA 4KPYA 2I6UA 1C1HA 1E7SA 5GONF 4NE2A 3KXLA 4JLSA 1T4GA 3UHAA 3TM4A 3RTDA 3OX3A 3RT1A 3LHDA 2GI4A 3VO2A 2CV1A 4E2WA 3UPDA 4NYIR 3UA3A 4MPRA 3G23A 4E2ZA 4WBNA 1PP4A 3KPVA 1XZIA 3KK0A 1PJZA 3AUXA 4KP7A 3LKDA 1SVUA 5LXTB 3COZA 2GXUA 4HDMA 1EM6A 1U2RA 2V6IA 3KB8A 9MHTA 3T7SA 4L75A 1JQ5A 4M87A 5JR3A 3ERCA 2VZLA 4WVFA 1TQ6A 5BO5A 4F6LA 3WGIA 2GZ2A 5IBCA 4RPCA 5B55A 2OILA 3SEFA 4PC1A 1VIAA 4JODA 2P4UA 2V5AA 4UW9A 4HB0A 4V39A 1K7FB 4IKOA 4NCHA 5TPWB 3RARA 3P9QA 1C9KA 4DPMA 2XQGA 3HBFA 3H8VA 4H4EA 3T1YB 4ZPXA 3E2MA 1NVUQ 4JAVC 4JKOA 2XVMA 1UC5B 5CX1B 1OH5A 3VSBA 3AV0B 4B5LA 2V9ZA 3DVAB 3RVDA 4AULA 5FYDA 4O3MA 4I50F 4M4SA 1NYTA 1ISHA 2G9UA 1LQTA 2H2AA 3DE4X 3K3PA 4G1UC 4D8TA 4HAXA 4C4XA 5LDDC 4URVR 4JC5A 1Q44A 1U0RA 4FEYA 4P5EA 1AHPA 2ODBA 1UDXA 1PWXA 3BE5A 3T9FA 4EMTA 2ATVA 3UGKA 1PHRA 2IYSA 1P6QA 2PH3A 2NSDA 4V0SA 3IE0A 4ARZB 2R7NA 2D0PB 3JASB 1DXYA 4D0RA 2FWPA 2PGAA 1HNNA 1CUYA 3T41A 2PMKA 5I9IA 1OAOA 1PYGA 1RPJA 2JFYA 4CFSA 2GKOA 2O1EA 1H8HA 4WPGA 4W9MC 1HLGA 1BYUA 1EWTA 2LDBA 2VJYA 2XSZA 5EZSA 3VVLA 5CLFA 1LY1A 3LSYA 2ZJ7A 3CCCA 4JROA 3A1DA 5CG1A 3KRTA 3O92A 5LQMA 5A5GA 3JWJA 3R4CA 5E38A 1G5HA 4OQPA 1NLYA 4ASUA 1L4GA 4HNVA 2D59A 1UBCA 4LECA 1OKKD 1W25A 1ZNZA 4RORA 4YALA 5C4GB 2QRUA 2A86A 3D9QX 1LK5A 1C5KA 2GFIA 1Y3AA 3U1BA 3LAWA 3BXOA 2OHVA 3FR8A 1ZCFA 2E89A 1YR6A 5BR1A 2GZDA 3GYBA 3CA8A 4NE7A 2F8LA 3DTTA 4HAOA 4ZMSA 1LBTA 1K9SA 1QYCA 1XI2A 3NYRA 4HGQA 1A69A 2AJLI 4FI3F 3CF6R 2E7ZA 3WLSA 4C0JA 4LI3X 2GPWA 2Y0DA 4I66A 1HURA 4AQDA 1BXRA 1M1NB 2JFHA 1YFJA 3UWKA 3JQAB 2R5WA 4RD6A 2ZPUA 4U1RA 1W9HA 2ZW9A 1P1HA 2ZWMA 2JFPA 5AKJA 4Q3LA 4RU1A 3QBDA 4AZWA 3L6CA 5FP0A 5CEEA 1JDNA 2DRIA 4D4IA 3W90A 4MV8A 4TKLA 3ZK8A 2EF1A 5HMLA 2GETA 1KQGA 2C8JA 1M2OB 1EUZA 1UJ2A 3LUKA 1YIAA 1SCBA 2Z3WA 5BWOA 3VKHA 1TLFA 1WZNA 4QGBA 4FQ7A 4KHZA 1E9AA 5JNUA 2C3YA 4RH0A 4XEUA 2Y0PA 1VIYA 3R6TA 3GLFA 5DBGA 3U49A 3EGIA 3SLGA 2PA0A 3RSFA 1P2BA 1Y8CA 1U7XA 5B3LA 1DT5A 4BFZA 1CSEE 1V95A 3ESCA 2RDMA 3VR1A 1G4HA 2FPIB 2PJRA 4QODA 5I3ZA 1RKQA 2H1HA 4D3SA 3LPDA 2GEBA 2HMVA 5ALSA 2FZLA 4Z9AA 5JNWA 2OXEA 2VNSA 2VTBB 3STXA 4OK5A 4S1OA 2R5NA 2VP0A 3LHKA 4DJJA 3IV6A 3DDHA 5DYYA 4PX2A 2G40A 5HKLA 1F2UA 1K66A 2FV8A 2N47A 2WJHA 2X9NA 3E9RA 3FB4A 3IHKA 5H3CA 2P5TB 2QTGA 5FUXA 4X95A 4XB2A 3HCCA 2ACWA 1H2XA 3MT7A 1YB5A 4BNGA 1WHSB 2HLDD 3L0CA 4YMHA 4R2HA 1ZUNA 4YUZA 1YDMA 3Q6MA 1QRSA 2P68A 3MJTA 3GT7A 4BIIA 4DJ5X 4C4PA 3CNOA 4UHKA 1KY5A 2GEVA 3KLOA 2P4SA 2X58A 4UHFA 4Q7QA 4TQGA 3U16A 4K9MA 3W5UA 3CVXA 4JHXA 4FT4A 4WN9A 5JFOA 2BEUB 5TS3A 4HC4A 4HYEA 3DPIA 2I99A 4EZEA 3IEUA 1FMJA 3UJ8A 1CR2A 4DF3A 1XX6A 2X4LA 3AWIA 1H05A 1M8KA 2WT8A 3CLSC 5D01A 13PKA 2FDCA 3AVUA 1UJ5A 1E6LA 3LDHA 1A4UA 1U2TA 3HR4A 3J81k 5BQPA 2ONJA 1NMEA 3USZA 3DMPA 2R1TB 3AT1A 2BJVA 3HJAA 3M2PA 3WSVA 4EY4A 4UNPA 2VHUA 4W7IA 4BEJA 2AMJA 1C8VB 4MUFA 4GU5A 1DWOA 1CUBA 1EAMA 3HQ4O 4QXRA 5DZSA 2H4JA 3SBXA 1J7KA 3F9CA 3MWEB 1TB4A 3S8YA 1NBMA 2GBLA 4S05A 4E5DA 1T6XA 4GGMX 1T3LA 1Q0RA 1YBHA 3IDSA 2B9VA 2NU8A 3LCJA 3ZCXA 5AP9A 1ZD4A 4XWAA 1XKQA 3DLIA 1NX9A 4AZ3B 1RM5A 4K1LA 4N47A 2Z98A 3E82A 4G0YA 3PJEA 1L5ZA 1NZDA 4LXQA 4A0SA 3DE1X 1IN4A 1U5BA 4YO8A 3B6MA 1GPNA 1WJGA 3IOCA 3MIIA 4ND1A 4QRHA 1F4PA 2B0CA 2ONKA 4FR2A 4O2BF 5TRTA 5T5QA 3RANA 4J6EA 4HNHA 3ZDYB 4NONA 1VHLA 1WO8A 1VE1A 1AS2A 4LTMA 4ZI2A 5FOXA 3P0HA 1NN5A 4FHCA 2OVFA 4X3CA 2J9RA 3WMGA 2OBXA 2WF9A 4KQ9A 1F5NA 2BZ0A 1ID8A 3QX9A 2VJCA 1RE1A 4M9XA 4QOJA 4QTYA 2XB2A 4BIMA 3CINA 3GNLA 3IVXA 2FMXA 3RLFA 5BUCA 3AVQA 4DTIA 4KX3A 2H0QA 2EFEB 2ZBUA 4WXHA 3F78A 5DVZA 1JKJA 1L9KA 1ZITA 3N6XA 3D6HA 4EHHA 2GTIA 2C2GA 3IOMA 4PO3X 1LK7A 3ND6A 4ZD6A 4ZYVA 4ZV7A 4V3CA 4HDCA 4O4JF 3RKUA 1D2MA 1AKUA 1XD9A 1Z4JA 2A6PA 4G81A 3EPKA 4ZOLA 4CM4B 5CX4A 1MLDA 3SEZA 3DZ8A 2QRQA 3DP9A 1Z18A 2GILA 3NGXA 4CLHA 4F91B 2ZJAA 1Y6FA 1U6IA 3SIWA 1NN0A 1MV5A 2J46A 4BB5A 5IMSA 4R1OA 4X63A 2ORWA 5FAXA 4UAJA 5E6SB 5HBGA 3FETA 4B3JA 1JZQA 3WIBA 5LNK1 1E2FA 4KRYA 1ZIOA 5H9VA 1JLLA 1VGRA 4YGXB 3R3WA 2ZYIA 4QHSA 4QU0A 3LBYA 4ZAVA 4EJSA 2CBXA 3OFVA 1H6BA 1CB7A 2PSDA 4NCKA 2WNIA 3PYLA 3EIQA 2JIRA 3HY4A 3WIOA 2HJVA 4U8HA 3MVEA 1DXOA 4XJXA 4QE3A 1P1BA 3PDHA 4V02A 3RWMB 3IH5A 3JARA 2WJIA 3T3GA 3KQHA 4U7GA 5IPFA 1ZVJA 1GKKA 3ZD6A 1W4BA 4NU5A 3GFVA 4AX8A 1BC5A 3K0SA 1X8XA 3LUGA 4JUIA 5ECGC 3RJ9A 1E79D 1X13A 4G5FA 3K0KA 1DTWB 3DFMA 3KJEA 1OTHA 1SQ6A 1C9MA 3L06A 4EEZA 4UOEA 1WZIA 3GRCA 1NZJA 4LDRA 1BXGA 1ZMBA 3HXLA 3QKRA 3R3XA 3CEAA 2NU9B 1EHIA 1XNGA 4TL9A 1ADFA 5JRDS 2FSVC 2PU5A 1RQ2A 3IBSA 1I2MA 1X7YB 3ZV4A 1MDFA 2XZDA 4L9RA 2WTUA 1KTVA 1XRJA 2DJIA 2ISSD 1BG6A 3OT1B 1IUNA 1G21B 2C2MA 3FYSA 1AO3A 3HFGA 5B30A 3QTTA 4R84A 2WB2A 1Y9JA 1KERA 2ORED 1MH1A 3CRVA 1ODSA 1LPMA 4GAEA 4KQMA 5AXAA 3WXBA 3HNRA 4TWBA 3FHOA 5FULA 4BMNA 3A4MA 2JLQA 2BFEA 4X1YA 1QCYA 1Y98A 3HZOA 2GGSA 4HB3A 4NOJA 1RLOA 3BWCA 4PLWA 4RKQA 4YJ2B 2WSSD 4DZZA 3SQNA 2JFXA 1GARA 4JQCA 2CW5A 3C8MA 4GMXA 1RZVA 4M1MA 2QXUA 3L7OA 2OZVA 4E5UA 2V3CC 2G9VA 5F64A 1FP1D 3K30A 3CF4A 2W6ZA 2X3UA 1PUIA 2IRWA 2DB3A 1E0JA 5FTWA 2GK3A 4BCCA 4ES6A 3VDXA 1EHCA 1T9GR 1QFSA 2XUOA 4OPMA 1F4VA 1XYVA 1A9OA 1GY8A 2M9MA 1H2AS 3NHBA 4OHCA 1OW3B 1QAMA 1WXEA 1L5RA 2XXAB 5F4BA 2C1ZA 4JFRA 5G40A 1ZNWA 4HP8A 1XJ5A 2KBFA 3MPOA 4NY1A 3MJVA 5DGDA 3SZGA 5IW8A 2G5PA 1ATZA 2FMKA 3UB3A 3M1AA 3P9XA 1NVDA 1KHHA 1P7PA 4OM7A 5AQEA 3MCTA 1RJ9A 4M2LA 1F8YA 3NHJA 3X1MA 1MIHA 1WPRA 1Q3TA 5JSHA 2XWQA 5LZ2A 1TDJA 3AP3A 5HGXA 5FO0A 5I7EA 1BKSB 3WAJA 1AKVA 1W1WA 4WCFA 2QL5A 3IRUA 4EI2A 1EFRA 4TUYA 3H6GA 1H4VB 3SHOA 4JYBA 4A2CA 1V7CA 2XCLA 2ZBRA 1URPA 4QQRA 4FPXA 3RRBA 1RBZA 2WR8A 1WABA 2PFSA 3OSUA 4P82A 1RU3A 1NUAA 1YB4A 4LKRA 3GLIA 1LSUA 2OCDA 2E4AA 3D6NB 5EP3A 3KT8A 4G5RA 4LHXA 4RK5A 4P3PA 3CU5A 3CZAA 3NO4A 1BIFA 4QTUB 2WPNA 4NJMA 5D5QA 3Q85A 1ATIA 5HJ2A 4GEKA 4Q7JB 5HIIA 3RE1A 3QSGA 3KKOA 1K2VN 3OH8A 5TJ9A 4HGPA 3Q72A 2I54A 3E0QA 4MJXA 2AW3A 3FMPB 3HJTA 5IT0A 4UZFA 1PFYA 3FUCA 3OIVA 4CMIB 1F14A 1TU0A 4IX1A 4U5XA 3NKVA 1YB1A 1XLTA 3RC7A 4S12A 4IINA 1SXJE 2H08A 4C1BA 1YI0A 4F2PA 2FLVA 2WYOA 1SVKA 2P9FA 2YC4C 1L7PA 1FY2A 2O8NA 3S7TA 3ZI7A 5JATA 4Z0TA 1Z2EA 4J16A 4ZARA 3NBYC 3RASA 4G36A 1AGRA 1DL5A 1XZ8A 5TVKA 2CN1A 4YJGB 3RYIB 2R0QC 1JJFA 1GPDG 3B5JA 4I1SA 4B6OA 5KZMB 2VATA 1JUDA 4B75A 3E9CA 1IM5A 1DRKA 1Y34E 4FINA 4JEIA 4DWVA 3B85A 4I7EA 1M2HA 1N3IA 1TD1A 3PQCA 2IU6A 3AVYA 4GKKB 4FSHA 1EP3B 3GO4A 5D3MA 3WICA 4BKPA 3A37A 4PU0A 4F8EA 5H80A 2Z5GA 2JJ2A 1U8XX 4AJLA 2RAUA 2R8PA 5L51A 1KJNA 4ZALA 3ZV3A 1FNMA 1Z5PA 2QVYX 4JP1A 1H6AA 1YIOA 3IMKA 5EESA 3ROKA 2FMIA 2YCLA 3B1YA 3LLVA 4OJYA 4XTCS 3SGLA 5H9WA 2XA9A 1ESEA 3A27A 4IEEA 3BMNA 3OZFA 1Z6QA 2FR0A 1BS2A 5DYNA 1NF9A 3BIOA 4KQHA 2BKEA 4MS1B 3WFZA 2BLLA 3L1UA 4FZVA 3ZWBA 3FVTA 5LBTA 1Z3CA 4V1CB 3RCBA 5EC8A 3H84A 1TQ4A 2ZTHA 3CJTA 3DBIA 5JU6A 5HM6A 1T4MA 4GR9A 3ENVA 5I8ZA 4MUHA 5K0LA 4PS0A 4HLUA 3W6UA 2LCIA 3NJ8A 1P2UA 1DIOB 5ALNA 5FUWA 4F9FA 5LQAA 4AJEA 5HXAA 4GYJA 5BV1A 1ACLA 3B3QA 3K16A 4DYDA 5JSKA 4NK5A 1HETA 3KQNA 2I2AA 1EUQA 1YFKA 3GAFA 4NS4A 1QQ6A 3HB0A 4HQ6A 1ORRA 4BRZA 2N9UA 5COBA 5EUCA 3D6VA 1N57A 3PQ2A 3LQYA 3V4LA 3KQUA 4KFCA 2YDXA 1OX4B 1IY2A 1S5PA 2A1TR 3KBOA 1E7RA 5CNIA 3GRFA 2VJQA 1NXTA 4JBLA 2IYZA 2JI8A 5I4IA 2PFKA 2GXSA 5BSHA 2HV8A 3DE2X 4L95C 4N5MA 3DBRB 3JQFC 3VU3A 4Q1EA 2RHBA 2FCRA 2D62A 4J0IA 7ABPA 5T8KA 4BNIA 1VJDA 1VL0A 3PJRA 2ODQA 4B0PA 5A1TA 1I32A 1OBHA 4AJ9A 5YASA 2QAGB 1A9RA 3QBJA 5LP6B 3CLRC 1NUTA 2BMVA 4BO4A 1BWRA 2UVPB 2GA8A 3H97A 2YNMA 4YAOA 3QKIA 4R8MA 5LYJA 3L5KA 4IMIB 2JBAB 3K92A 1MABA 4ENQA 4IBOA 1SQSA 3BH0A 3NDPA 3U1VA 4O08A 2ENUA 3IP9A 4HV4A 2KHZA 5IVDA 2X6RA 5CDTA 1CEQA 1DEAA 5CHEA 1E2HA 4RA6B 1VJTA 5K3CA 1NJ6A 4AWXA 2VF4X 1UZAA 3ZTWA 2JEYA 4FFRA 1QK3A 3GA7A 3O82A 4HF7A 4Q37A 2C5HA 3WKDA 1RQRA 3NOXA 4K2AA 1J22A 4PXYA 3ZU6A 1RXEA 1R00A 4MW5A 2JIQA 1O94A 2QM7A 3LQRA 5A9RA 3FHLA 3MYRA 2AG6A 3OOEA 4QT0A 5CVVA 3Q2IA 3SZOA 3TFWA 2ZRNA 1RW4A 2CCKA 4L5JA 4LZOA 4DA7A 3FYUB 1U5CA 2BRUA 4MAFA 1XQ6A 5ALKA 2YIMA 1GCIA 1IY0A 3RS3A 4EA6A 8OHMA 3B9QA 1ZVQA 1PZNA 2H1RA 3V80A 1TT7A 2RHOA 4F12A 3R1IA 4F2DA 4EY7A 2OXFA 3KYCB 1DAHA 4PZEA 1ZGBA 1TK2A 4ZEOA 3RFCA 1EG7A 4E3ZA 4JNKA 2RHDA 4OHZA 4MTCA 3C6YA 1XKTA 2W2KA 4EG3A 1WTAA 2MINB 3AY0A 3JYOA 4G4SP 4MGYR 3SZLA 1OR8A 1WM1A 1TO6A 2QS9A 3TIFA 4A16A 1GDDA 3HKEB 2I9PA 4BJHB 4EUKA 3MN1A 1Y3DE 3IR6A 4CUZA 1RYZA 3E61A 1AGPA 3RVBA 5EN4A 2FR8A 5F3WB 3VGJA 3IP6A 3VDMA 3L6BA 2Q3FA 3MJEA 3M4XA 3V42A 3OEHA 3FGPA 3V6LA 4AS2A 1EZ4A 3EPPA 4DJAA 3O8BA 4R2WA 5FHQA 2YYAA 3HJFA 1Y1QA 2ZJ8A 2G4VA 1CJCA 3OT4A 2JJMA 2YTZA 3AOEC 1X7ZA 3GPBA 3I8SA 4KUGA 3ZX4A 2ODPA 4HQNA 4HQLA 3QUBA 2NO1A 2QLNA 4DMKA 3OTOB 4IDQA 4XWOA 2FPMA 1ENPA 3PFGA 4OQ4A 3W4IA 2EZ8A 1HR0B 2VPPA 1HDCA 1DX9A 3DCJA 4HEQA 3U3JA 3ZVMA 3PDWA 1IBKB 3N2EA 3F96A 2QP3A 3R3JA 4LQCA 1GQYA 4MYCA 1GGFA 3I8XA 3A9UA 3QEJA 1Y89A 3KXPA 4OJKA 3UKDA 2AEMA 1T35A 3QVUA 1YU9A 3F7TA 2UZ1A 3BFXA 5AI9A 3T52A 4YCLA 1KZYC 4WLVA 1S9HA 3OO0A 3VZDA 2RMKA 1UJCA 2A0YA 3FGNA 1U3CA 8ADHA 1S8AA 5JAUA 5U1PA 5LU9A 2PRZA 4LOJA 4MV5A 3WLMA 3BJIC 1N75A 3KZCA 3O03A 4QG3A 4RJLA 2I5PO 3RH0A 3N7AA 1ESDA 2H5IA 3E9ZA 5FA8A 1OJLA 3BBPA 3VMFA 3WB2A 3FX2A 3NUGA 1J00A 1S8NA 3HCOA 4RQTA 4B6EA 4CLEA 4E0BA 4B9AA 1WHTB 1ZKMA 2REXB 3ZU2A 1GAJA 1WCWA 2QJTA 1DAEA 2P3LA 4UC0A 1FMFA 3W5HA 4LJ5A 2HM7A 2W8BB 2PZAA 1QWSA 1X74A 5AJHA 5KTOA 4CT0A 3ZXYA 1GG9A 1V3UA 4BN4A 1L8LA 1OFGA 1JDVA 3RT9A 2AHRA 1QORA 1QPZA 1KJIA 2MHCA 2ZR8A 5D1HA 3QENA 3SFVA 1BDIA 3Q40A 1NQ5A 4C2BA 4YLYA 2B8TA 3UXMA 4MYUA 2CUTA 2EBHX 1KI6A 1KNQA 1SU7A 2BMJA 2G71A 3NM5A 4GQIA 4J0GA 4R81A 2OYCA 4C14A 2N0SA 4ZVVA 2RBGA 2FGJA 3G8YA 3MXOA 1LFAA 1H1LB 1Z4LA 4N0PA 4XR4A 4Y2VA 2AOXA 3D43A 3U3KA 4EHJA 3EPHA 1KGDA 1D9XA 2ERXA 2P2GA 2Q0HA 3CWZA 4M0MA 4V0LA 4UNIA 3Q2OA 4BTLA 4Q1DA 3MMXA 4YT8A 2I7CA 3P0EA 3C24A 2QRVA 4NFSA 5BURA 1YZTA 4W5WA 2HJ9A 4ND7A 1HSOA 4OL0A 3R7DA 1J21A 2QSJA 4CL3A 4KXYA 4TQAA 4U9UA 4EPTA 3DL0A 1HRDA 1T3HA 3SBDA 3QBEA 4HDNA 5F5XA 4G0VA 3D8SA 3W79A 1TF5A 2CD9A 2XY4A 4UEWA 2XNCA 2YV1A 2BE7A 2XLCA 4RZIA <